2CCRA

Structure of beta-1,4-galactanase
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
386
structure length
386
Chain Sequence
GLYVEKVSGLRKDFIKGVDVSSIIALEESGVAFYNESGKKQDIFKTLKEAGVNYVRVRIWNDPYDANGNGYGGGNNDLEKAIQIGKRATANGMKLLADFHYSDFWADPAKQKAPKAWANLNFEDKKTALYQYTKQSLKAMKAAGIDIGMVQVGNETNGGLAGETDWAKMSQLFNAGSQAVRETDSNILVALHFTNPETSGRYAWIAETLHRHHVDYDVFASSYYPFWHGTLKNLTSVLTSVADTYGKKVMVAETSYTYTAEDGDGHGNTAPKNGQTLNNPVTVQGQANAVRDVIQAVSDVGEAGIGVFYWEPAWIPVGPAHRLEKNKALWETYGSGWATSYAAEYDPEDAGKWFGGSAVDNQALFDFKGRPLPSLHVFQYVDTGTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Investigating the Binding of Beta-1,4-Galactan to Bacillus Licheniformis Beta-1,4-Galactanase by Crystallography and Computational Modeling.
pubmed doi rcsb
source organism Bacillus licheniformis
molecule tags Hydrolase
molecule keywords YVFO
total genus 143
structure length 386
sequence length 386
chains with identical sequence B
ec nomenclature ec 3.2.1.89: Arabinogalactan endo-beta-1,4-galactanase.
pdb deposition date 2006-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07745 Glyco_hydro_53 Glycosyl hydrolase family 53
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2ccrA00
5BRQA 5EMYA 4D6JA 3F5LA 1M53A 5M3WA 3VGHA 3WQ5A 2XM1A 4JZ5A 3W4RA 2JEQA 1UZ4A 2VT0A 1DWIM 3DHPA 3SUTA 4UFMA 3VINA 1IV8A 1OWQA 2W4XA 1QW9A 1GJUA 4HOZA 1HP5A 1PEZA 3ALGA 3W53A 1E5JA 2E3ZA 3PTMA 4Q7NA 1LQ0A 3AMCA 4JL1A 4MPKA 1GCYA 1OGGA 1TMQA 3BAWA 3BAYA 3I3BA 4JIEA 3HJEA 2OWWA 5A2BA 2VMFA 1E56A 2GJPA 1J12A 1BF2A 1FH7A 1NM9A 3RILA 1UD5A 3IJ8A 3MKKA 2XHYA 4TUFA 1GORA 3UR7A 1SMAA 1NWRA 4FLRA 4CU7A 5I77A 1E15A 3FAXA 2J79A 3M7SA 4UFHA 4J3TA 1UR1A 2J62A 5FD0A 1TCMA 4MADA 2NW0A 1VRXA 4H8VA 1ITCA 1UHVA 1XD1A 4RE2A 3W37A 1WDPA 4JKMA 4MNKA 2Q8XA 1KXTA 4CD6A 1V3IA 4AIUA 1EXPA 5AYBA 2CEQA 2Y8VA 2ZICA 4UOZA 1R7OA 4HA1A 1E4MM 3T0BA 4UFKA 3AOFA 5D9PA 1WDSA 4XV0A 2XFRA 4J3WA 1K9TA 3ARZA 2DH3A 1JDCA 4DUWA 3IAPA 1HVXA 3DECA 3MMWA 1NWUA 4L4OA 2BHZA 1M04A 1KGWA 3WNMA 1IZJA 1GQIA 5CPSA 2ESCA 2QMKA 3RCNA 3SCPA 3UCQA 1VFOA 4B16A 1OIFA 1XSJA 2QV4A 3FY1A 3BC9A 1LL4A 2O92A 1BHGA 4AXNA 4Z2JA 2YDQA 3GH7A 4C7DA 2NT0A 2ZUMA 2WHJA 1NP0A 4UQEA 3WQ4A 5BXTA 2OYMA 2VUYA 3ARXA 4NI3A 1V6YA 4M29A 1ZB5A 2Y5EA 5FIPA 3CHCA 3B9EA 2G8ZA 4B15A 4W7UA 1BSIA 1VBUA 2JF7A 3RMEA 1UR0A 3IJ9A 1UWUA 1CYGA 1V0KA 1E55A 2PBOA 2OYKA 3EMZA 5F7UA 4ZFMA 4B9YA 1LL6A 1JI2A 1ECEA 1B3VA 2WVUA 5M5DA 1FHLA 4PRWA 4F8XA 3WF1A 4P7QA 1GOQA 5D9MA 4HOXA 1CGVA 2ZX6A 4WKFA 5E09A 2O9TA 2G4FA 5A69A 1GOIA 4LYPA 3VPLA 2VCAA 3WDPP 2XGIA 2JFEX 4MDOA 3AXHA 2BVYA 1UQYA 2XGBA 3NYDA 3L4ZA 3WKZA 3T2QA 3MUY1 5AY7A 5CLWA 2DT1A 1E43A 3FHAA 3ARQA 4PTXA 1B3XA 1DWHM 2O9RA 4ZE4A 4M81A 4N0RA 1QI2A 4KGLA 2DT0A 1PZ3A 2E8YA 1CECA 4HU8A 3FHQA 1HJSA 4ZEPA 4AEEA 2ZX9A 1E4LA 4C7GA 1RH9A 1CNVA 4CD8A 4F9DA 2BHYA 2DPEA 5DT5A 3RO8A 3BLPX 5A6JA 3OLIA 3EMCA 4WKAA 7CGTA 4JCMA 1BGGA 4OZOA 6CGTA 4LPCA 2CBUA 1AQHA 2HISA 3B8SA 4UQCA 4HZ8A 1CENA 2NSXA 1VFFA 4JL2A 5EFDA 1C8YA 4PMOA 4B9ZA 1KXVA 3BCFA 5HBFA 1EO5A 1QHOA 1M03A 1UWRA 1GW1A 1V6XA 3GBDA 4JAWA 3SCVA 1UKSA 2V38A 3A47A 1E6PA 3AIWA 3WD2A 1X6NA 2CERA 4CVWA 3VU2A 1GONA 3CUIA 3CH9A 2W91A 3AHTA 3SIMA 1E3ZA 3A6OA 1FP9A 4EAMA 2YL6A 4J3SA 1V3LA 1LWHA 2CHNA 1GQLA 1W9VA 3VOCA 2YL9A 1WDRA 1GOOA 3PBGA 1LLOA 4PMZA 1QI0A 3MMUA 1E71M 1B1YA 3T09A 4UTFA 3AYSA 3ZIZA 4Q22A 4CCEA 2WAGA 1JYWA 3I3EA 4BS0A 1C93A 4PTMA 5AC4A 2FHBA 5A8MA 4ATLA 3WUGA 3T08A 3IJ7A 1B90A 3HN3A 1W2VA 1J0ZA 3W25A 3UR8A 1K9EA 4FLSA 3VM7A 1V0MA 5IXEA 1R85A 4AD0A 1OCQA 2XVGA 1CLVA 5BXPA 3PTKA 5GNYA 3SCOA 2OSYA 4PMDA 1JFXA 3WL0A 1F4HA 4CCCA 1M01A 3UESA 1JXJA 3ZJ8A 2D2OA 3W24A 1FP8A 2WMHA 3AXIA 3BSGA 4LYQA 1VFUA 3TTQA 1TUXA 1W9DM 3AISA 2FDMA 1JFHA 2VC9A 1E1EA 3NSNA 3WH6A 3OGRA 5IHRA 2WW5A 2IUZA 1MQQA 4W88A 2J7BA 1C7SA 5BCAA 3A3HA 3AHYA 4OUEA 1DHKA 4AZHA 5CGMA 4CN1A 1GOMA 1TVNA 3GH5A 3WQVA 1PJ9A 1UR2A 1QNQA 1H1NA 3N17A 2GSJA 4ACZA 1CXFA 5C71A 1HKMA 4MB5A 2WPGA 3PZ9A 2JF6A 1V6UA 2J7DA 1GOWA 5HPOA 2GUYA 1ZS2A 4CUCA 3L4UA 5GNXA 3M6DA 3TONA 4OOZA 3GXMA 4N42A 3ARWA 1JZ8A 1C91A 3BAIA 4P8UA 1US2A 4AMCA 2FHCA 3SUWA 3UG5A 4XB3A 1E6XM 1KBKA 1Z32X 2J7EA 4F9JA 3GBEA 4HPHA 2BXZA 3VGFA 1HNYA 1ODZA 3WD4A 2DQXA 4OJYA 1VF8A 5BXSA 2J7FA 3ARSA 1E6NA 3CTTA 1K9FA 1BVNP 1FH8A 2ZOXA 3QOMA 4PCTA 4XUYA 3WD0A 4W8AA 4HMEA 2UY4A 2VZOA 2GJXA 2VR5A 2G3MA 3EDKA 2CESA 1GVIA 1V3JA 2W66A 3AS3A 2VX5A 3BSHA 4E4PA 2O9PA 1JF6A 1BFNA 1UD4A 3ZJ6A 1HX0A 4J28A 1DWFM 1WPCA 1J18A 2JALA 1UR4A 1HIZA 2PB1A 4P7RA 3OLGA 3ARYA 4X9YA 4ATDA 5IDIA 3MSGA 2AMGA 1UKQA 2BY2A 3VIOA 1WZMA 3CIVA 2PWFA 1J0KA 1NOFA 1B2YA 4OIFA 1GHSA 2D22A 3GYCA 1EHAA 2D0HA 3ZJ7A 1QHPA 2ZXQA 1WO2A 1QBAA 3AIBA 4PMQA 3O6AA 2E9BA 3D5HA 3RM9A 2EO7A 3AIEA 2VZUA 1SFSA 2AOSA 3WUEA 1VAHA 1P6WA 2X0YA 2VRKA 3GXIA 5ABHA 1DTUA 4PTVA 2XFFA 3TP4A 1L0PA 4BCEA 1KQZA 3HU7A 8CGTA 5CPQA 5A6LA 4P8WA 2DSKA 1VB9A 2XPKA 4JKKA 4KMQA 4MNMA 4W5UA 3PZTA 5CG0A 2J47A 2ZUTA 2D24A 1ZBCA 3TOPA 1JGIA 4U2ZA 4IUGA 2F61A 1WKYA 4BQ5A 1AMYA 1HKKA 4LX4A 4PUEA 4PSRA 4WK9A 2WBGA 3VGBA 4QLKA 1FA2A 4TVDA 1GHRA 1C92A 5JUVA 4GINA 8A3HA 4MB3A 1H5VA 3GNPA 1JZ2A 3ZR6A 4BQ2A 1CTNA 4PMUA 3AJ7A 3CLWA 3OGVA 1EDTA 4PEEA 2Y24A 1CXHA 3QGVA 1GOKA 3MV11 3K8MA 1LG2A 2E40A 3AROA 3WH5A 3CO4A 3CZLA 4M82A 1CGXA 3QOKA 2W67A 4MB1A 3LPGA 2OWXA 3UG4A 1GQJA 1E4IA 1U30A 2GDUA 3AHXA 4F66A 2CBVA 2ZXDA 2XIIA 3VIPA 1IZKA 1D3CA 4TTUA 2V3FA 1EIBA 2ZIDA 3VDBA 3GXFA 4TTGA 3GH4A 3VX0A 2YBTA 4UCFA 2WMJA 4LYRA 1PIGA 2CIPA 2Y8KA 1JDDA 3WF4A 1W2PA 4DUXA 1EDQA 1I1WA 4MNJA 1I1XA 4A3YA 4FF5A 4MAZA 5I6SA 3WFLA 3VIHA 2BVDA 2ZXAA 1KXQA 2WC4A 1A3HA 1R86A 1OB0A 2ZWYA 4V2XA 1CXIA 4M56A 4UFJA 7A3HA 1US3A 1B31A 4E2OA 2WZHA 1EQPA 3BCDA 1JAKA 3WQ6A 3AZTA 1NARA 4LQ1A 9CGTA 2WZIA 4GZJA 2J25A 3WEOA 5FL1A 2YA2A 4H8HA 1HL8A 1W9PA 3WUFA 1GNXA 1GZJA 3CHFA 4OOUA 2V5CA 1NWSA 3VIMA 1R7AA 1HJVA 3CZ8A 1W3HA 3AYRA 2WVTA 3WEZA 2ZUSA 4AD5A 3MU7A 1QW8A 2W62A 1H3GA 3AIQA 3FNDA 4QLLA 5A6AA 1VEPA 3W28A 2VVNA 3ARUA 4DM2A 1BYAA 1D7FA 1J10A 3L4VA 1N82A 4W7WA 3GTNA 5I79A 3DC0A 4NRRA 1WP6A 1E72M 1UZ1A 3SCRA 4AW7A 4MJ4A 2EPMX 1CDGA 1JD9A 4FLQA 1WE5A 4ML4A 1BYCA 5A95A 3T0AA 3KL0A 2BVTA 4D1JA 3VO0A 3WELA 2CBIA 4AZ6A 1V02E 4R5EA 4M8UA 4UQBA 4GZIA 1EH9A 4IPLA 1AVAA 4UQDA 1XD0A 3AIRA 5FL0A 1KQYA 3AZRA 4NZCA 4M80A 4MAVA 3VUPA 4MB4A 2X8RA 4WSKA 2JE8A 4U5KA 1CEOA 3QR3A 5LA2A 4AZ7A 2PBGA 3MUAA 3ZOAA 3WN6A 4HTYA 3MSDA 2EBNA 1H49A 4HZ6A 1XCWA 1JDAA 1PPIA 5D9NA 5CZKA 3VMOA 1K6AA 3A4XA 2DEPA 5JBFA 2UY5A 4W86A 1OGBA 1VBRA 3NJ3A 4CD7A 1H41A 4QP0A 5I23A 2A3CA 3SEPA 3VD4A 5BRPA 1CGUA 3L2MA 2EPOA 1MW2A 3JUGA 5I3DA 4M24A 4KWUA 3VIGA 3NDZA 5BXRA 1H4PA 1O7AA 3TTYA 4D6HA 1KFWA 1NQ6A 1XYZA 3DYOA 2X0HA 5A1AA 4AD2A 2W92A 3VD5A 3RM8A 2PWHA 1MXGA 1F4AA 1UUQA 3CMGA 1E0VA 1ISXA 1CXLA 1S46A 1ISZA 3U57A 3W6MA 3SCNA 1G01A 2E9LA 5EFFA 1VIWA 1XC6A 2VRQA 4JHOA 3OLDA 3N15A 4UOJA 1UA3A 3SCUA 2BNJA 4PMNA 4AYSA 3K8LA 3PZQA 2BXYA 4CD4A 3VDHA 1XHGA 3OGSA 1EDGA 2VI0A 2JEPA 2CBJA 2BY0A 2VZSA 4Y7EA 2XJ7A 2YJQA 2YKKA 5A8PA 4HOWA 3ZQ9A 3WY1A 4OBRA 2Z1SA 4ATWA 1IT0A 1ZL1A 2V3GA 4AZCB 1MQPA 1UH2A 1E3XA 3ECQA 2A3EA 3BMWA 3LPPA 5CGTA 2GK1B 1BG9A 5E9AA 2W63A 1J9YA 1JIBA 1M7XA 6A3HA 2RGLA 2AAAA 4ZENA 1FOBA 2CPUA 1OGSA 1HKIA 1KGUA 7TAAA 3AS0A 2XVNA 4EANA 2PF0A 4D72A 3GNRA 3BGAA 3MUIA 3ARPA 2VNCA 1PX4A 4JFSA 2XSAA 1OD0A 3OLEA 3VILA 2PWGA 3FXYA 2WC3A 1PX3A 1UWQA 3ZSSA 3PZIA 4IPNB 4GIAA 1ODUA 3VGEA 4Z2KA 4AY1A 1VEMA 3WH7A 3CUGA 3WMCA 2G3JA 5ECUA 1KB3A 2OWCA 5GPRA 1J0IA 5A8OA 3SCSA 4YHEA 3GXDA 3WFZA 5DEZA 1XYFA 3KL5A 4U33A 3ZO9A 1D2KA 1CGYA 3WBAA 3EYPA 2NT1A 4PMXA 1FFQA 3KEHA 3PZVA 1JI1A 2J74A 3WBEA 5A6BD 3WNKA 1LJYA 3W6LA 3MUZ1 3WSUA 3WNNA 3EDDA 1BQCA 2ZX5A 3ZR5A 1JD7A 4XX6A 1QNSA 4DWSA 3AHZA 4KRUA 2WLYA 2ZX7A 1QBBA 1CBGA 3TTSA 3OG2A 3N11A 1UD8A 2WKLA 3FAWA 3WUBA 5FOOA 4HZ7A 4JKLA 4UOQA 5A8NA 3N18A 4UQ9A 2EPNA 3FW6A 4DM1A 3OZPA 2BY1A 2YIHA 3WH8A 3L4XA 1X6LA 5KEZA 1V6WA 5D8WA 1V3KA 1G5AA 3K8KA 3AIUA 1B9ZA 1W3LA 1MFVA 1C7TA 1JZ4A 1DWAM 3WIJA 2BS9A 1MQRA 1V08A 3F5KA 1SR0A 1EO7A 1JF5A 5A94A 2D3NA 1KR0A 4MJ2A 2WMFA 1ZJAA 1TE1A 4X0VA 1HT6A 1BTCA 1MWOA 1JG9A 1W9UA 5GNZA 1UOKA 4ACYA 2EJ1A 3WH9A 1XH1A 2EEXA 5LYRA 5M03A 1UWSA 2FGLA 2WVVB 4R27A 2V3EA 1BYDA 1HKJA 1C8QA 3AMDA 1PIFA 4FMVA 4PUDA 5FKYA 1CXEA 2VR4A 2ZUNA 3MANA 1E0WA 2CHOA 2YBUA 4GI9A 4IISA 4MTVA 4TX8A 1Q6EA 2V5DA 1Q6DA 2XUCA 5E70A 3UEQA 4EKJA 4GKLA 4GI6A 2J75A 3PZUA 3APGA 2WSKA 3WD3A 1B3WA 2J4GA 1BGAA 1DP0A 3EDEA 1Q6FA 1MW3A 2DIJA 4QCEA 2GK1A 2PC8A 5E0CA 4GQQA 3N1AA 1HJQA 3OBAA 1RD6A 3T2PA 2ZUUA 3NDYA 2DSWA 2A3HA 3D3AA 2WC7A 3BAJA 2WK2A 2WANA 1H0IA 1K9DA 1W9XA 1PX8A 3N12A 1KCLA 2FGZA 3UETA 2XSBA 2VL4A 4HMDA 1H2JA 2XM2A 4UFLA 2CNCA 2XWDA 4HPGA 4YHGA 1TA3A 3PN8A 2EQDA 2DT2A 2IXVA 5DFAA 1RP8A 3ZT6A 4QAWA 1XV8A 2F8QA 3TTOA 3WDJA 2WBKA 1PBGA 5LA0A 5M17A 2JIWA 4D6EA 4JFVA 3K46A 5ABFA 4Z2LA 3VNYA 4D6GA 1JZ6A 3LMYA 5CJ5A 4H8UA 3AZSA 1E6QM 4HA3A 4QFUA 3WL1A 1QVBA 2PWDA 3WDHA 3BLKA 4DWSD 2A3AA 4YN5A 3POHA 2VQUA 2VX7A 3AS1A 1B3ZA 3NSMA 3MMDA 2ZX8A 4HA4A 5D4YA 4D71A 1Q4NX 1HVQA 3CUFA 5DT7A 1WB0A 4CGTA 2J7GA 4D6DA 5I78A 4AZGA 1V02A 1UR8A 3NIYA 3SURA 3LPFA 2WCAA 1A47A 2ZE0A 3VMNA 3W82A 3S2CA 1G1YA 2C7FA 3EDFA 2WWDA 1KWKA 1WDQA 3EMQA 5A2CA 1MVYA 1W91A 3RIKA 1KCKA 1Y7VA 1J0JA 1MW1A 4PCSA 4ZXLA 2WYSA 2WCGA 5TD4A 1J11A 3SUVA 3FN9A 2J8FA 4KH2A 3WQWA 2DDXA 4JFTA 4S3JA 1EGZA 5CQ1A 1NOUA 4LXFA 1JYXA 4MNLA 4S3KA 3NUKA 4BA0A 1UH4A 5IHSA 3F5JA 1UQZA 1TR1A 2CKRA 3WQ8A 2BFGA 1QI3A 1H11A 4WF7A 4KGJA 3GNOA 4PBGA 5LA1A 1LWJA 2EPLX 2WHMA 3TA9A 2D0FA 2YLLA 5GQBA 2YA0A 4FK9A 2PI6A 3BH4A 2Y2WA 3LPOA 2OSWA 1JZ5A 4PTWA 4HP5A 1MXDA 4CU6A 2FH8A 1J0HA 4NSBA 4W84A 2FHFA 2CKSA 3GDBA 2XFYA 3BAKA 3E1F1 4Z2GA 5BWFA 1L8NA 3WF2A 1FHDA 1R8LA 3PTQA 1NH6A 3PHAA 1E1FA 4J27A 1BYBA 3N13A 4W8BA 3GM8A 3N04A 3M46A 4CCDA 1R87A 1ISVA 3CUHA 2MANA 2O9OA 4AD3A 1OM0A 2X05A 1C90A 1CPUA 5D8ZA 3VNZA 3RJXA 3CZKA 1G0CA 2WKGA 4J7RA 1UD3A 2WB5A 4CU8A 3VVGA 1E5NA 3ZT7A 3CPUA 4DUVA 2QPUA 1AQMA 1JXKA 2JIEA 2XIBA 5CXPA 1JAEA 1DWJM 1WNOA 4GI8A 4UZUA 4PSPA 3ARRA 4UNIA 1EOKA 4E8DA 1E6RA 1DWGM 2ZXBA 1MYRA 4W85A 1ZBKA 1E6SM 1WAWA 4AZCA 1QI5A 5E6YA 5DMYA 2RGMA 1TG7A 4WLCA 2XTKA 4XZWA 3RPMA 1LF1A 1E40A 1WCGA 1HJXA 4AC1X 3KWXA 4JCLA 3IANA 2DIEA 3VIIA 1HF6A 1UKPA 2XG9A 3SUUA 3S6TA 2XVKA 2IXUA 3AMGA 2D20A 1UWTA 1CZ1A 4RL3A 2QLYA 1ZBWA 2PWEA 1BG4A 1GVYA 3WMSA 4W87A 1XSIA 1W1VA 2E0PA 3CHDA 3AMKA 1O6IA 1OBAA 4P7NA 4BF7A 5A8QA 2VCCA 5C70A 2VQTA 1PZ2A 2Y4SA 1GUVA 2DSUA 1OINA 1DEDA 1CLXA 3QHMA 2VJXA 1JZ3A 1ESWA 1C8XA 2UWFA 4ZE5A 4D6CA 2C8NA 1NWTA 4AZIA 5I2UA 4L4PA 3CZEA 3IK2A 3PZOA 2BV9A 1UR9A 3RDKA 4CVUA 5JBEA 1E70M 1U33A 1RPKA 4JFWA 3MV01 3WNLA 4U31A 4J3UA 1HP4A 5E6ZA 3L4YA 2UY3A 1E6ZA 4AIOA 1KR1A 4WSJA 5HNNA 3AHVA 1UH3A 2WMKA 1V3MA 3MS8A 5D9OA 5IFTA 3BMVA 2WMIA 3CZGA 3UG3A 3WEMA 1OSEA 1ISWA 3OB8A 4EE9A 5AC5A 3CZJA 2DSVA 2YDRA 2W5FA 3PZMA 4GPNA 1MW0A 1EA9C 2YA1A 2J77A 5BYWA 1NOWA 4HMCA 5IFPA 3AMLA 2GJXB 2DT3A 3W26A 1J01A 4TVUA 3VD3A 2G41A 1CGWA 3DHUA 4U2YA 1W1TA 5CSYA 4GXPA 3WNPA 1NP2A 3AFBA 5DF0A 1QPKA 4CKQA 3SCTA 4D6IA 2G3NA 2ZWZA 3T2OA 3WD1A 4K68A 5ABFB 5HDRA 4UZSA 1Q6GA 4JFUA 1OD8A 4A4AA 4CD5A 3KL3A 3O2LA 2CCRA 5A2AA 4PYSA 1B30A 1Q6CA 3W81A 1JZ7A 3VD7A 2WVSA 4F79A 1W1YA 2C0HA 3CHEA 4UR9A 2DH2A 3BXWA 3WNOA 3KZSA 3WMBA 2J78A 1J0YA 3VIFA 5HOSA 1JYVA 3WDIA 3N9KA 3DYMA 2UY2A 3I3DA 1KBBA 3WF3A 4W7VA 1EHNA 3A4AA 4TXEA 1H09A 1KGXA 2WHLA 1LG1A 4WIWA 3U7VA 5CLTA 2WCSA 5A6MA 1B0IA 3WF0A 5KZ6A 1QOXA 3IAQA 1QHZA 3CBWA 1WZLA 2VCBA 2VRJA 1HXJA 1V3HA 2VO5A 2YLAA 2VX4A 4URIA 3RM4A 1V0NA 3RJYA 2VTFA 2D1ZA 4IM4A 1XRVA 2WM0A 1QNOA 3MO4A 4NF7A 1X1NA 3VDAA 4U3CA 4E8CA 2EXOA 1VFMA 1V6VA 2B31A 1E9LA 1ZU8A 1UYQA 2DGAA 4U5IA 2WHKA 1TZ7A 3F4VA 3UERA 2A3BA 1YQ2A 3VD9A 1OT1A 3L4TA 3T0DA 1TVPA 1GPFA 1WZAA 2D23A 1VJZA 4AWEA 4H2CA 1U2YA 2YDSA 2J7HA 4H04A 3VM5A 1HN1A 1CWYA 1PAMA 3CMJA 1XH0A 1EQCA 1W9BM 2W61A 3L2LA 4H7VA 2XWEA 3ARVA 1V03A 3OA5A 1UA7A 4RE3A 1QNPA 2J7CA 3BAXA 4AZ5A 2WWCA 1TFVA 1W1PA 3ARTA 1JNEA 2X09A 2CXGA 2WNWA 3ALFA 4D1IA 1JNDA 4AZBA 2HVMA 5E0FA 4GO9A 4A3HA 2XVPA 4WJXA 2WMGA 3WENA 3W0KA 1I75A 4UQAA 1UD6A 1W3JA 1E0XA 1SMDA 5HXMA 2YL5A 3EBVA 3O9NA 3WDRA 4DWSB 2BHUA 3AXXA 1B3YA 1VJSA 3AS2A 2J8GA 2VOTA 4BQ3A 4ACZB 3AQUA 4NRSA 2EPKX 1E4NA 5ABEA 1VENA 4QDMA 3K1DA 4YPJA 5JIPA 3G6MA 5A3HA 2QHAA 3VGDA 4GQRA 3WDQA 5JBDA 1HJWA 5A6SA 2GJRA 4DWSC 1GJWA 3ZJKA 3NSXA 4J3VA 2QF8A 3VKKA 4AD4A 1FFRA 1KXHA 4GO8A 6TAAA 2VZVA 2F2HA 3K4DA 3II1A 5FCZA 2ZUWA 3DYPA 4ZXOA 1CGTA 1OT2A 3HMCA 3AI0A 2TAAA 1JL8A 1VEOA 4W8LA 1SYTA 1UWIA 4J3XA 2E4TA 3W38A 4GZEA 2ZUVA 4WKHA 4LGXA 4OBSA 4AEFA 1UKOA 2YL8A 5BROA 3SUSA 4MDPA 4UFIA 4C7FA 2WLZA 3B9DA 3U5YA 4Z2IA 4TOQA 4B3LA 4BZYA 1ZJBA 1XH2A 3QHOA 4PN2A 1UKTA 4B3KA 2WXDM 2BY3A 4HU0A 1KWGA 3K4AA 2VVSA 4U3AA 1QI4A 1XGZA 3B9AA 2QPSA 2D3LA 3SCQA 2G3IA 2VURA 4CN4A 1C3FA 1XCXA 2VZTA 1ZBVA 3VIJA 3CGTA 4P8XA 3GZAA 4H41A 5A6BA 3OIHA 2D0GA 2VX6A 1CIUA 4P8VA 4OKDA 4V28A 2WMIB 4RE4A 5C8BB 3PZNA 3W27A 1UD2A 2Z1KA 1W3KA 4P7LA 1HL9A 3ZMRA 1TA3B 1WZKA 4QLJA 3KE0A 4BQ4A 4M1RA 2V3DA 1G94A 1BVZA 4AD1A 4P7OA 4AISA 1XSKA 3U7BA 3VMPA 2E9MA 3THDA 5A6KA 3VIKA 2CETA 2GDVA 4Z2HA 2WSPA 3CUJA 3J7HA 3G6LA 1EOMA 4KRTA 4TX6A 5CPTA 5EB8A 3ZSTA 4V27A 3A4WA 2XYLA 4FLOA 3VDCA 2OSXA 2YOCA 1FH9A 2QMJA 5ABGA 4PMRA 5EBAA 2X1IA 4CN6A 3QHNA 3ZT5A 3SCWA 3PZGA 3VX1A 2X2YA 2FH6A 4EK7A 5I0DA 3AIVA 1YHTA 4X0NA 1AQ0A 2GVYA 1BLIA 4W5ZA 4W93A 2DSZA 1JYNA 1CXKA 5AYIA 5DO8A 1HJUA 2OLHA 2GFTA 2E8ZA 1ISYA 2CYGA 1V0LA 1UG6A 3POCA 4W89A 1E73M 4D6FA 4TVCA 5JIWA 2CITA 4JHZA 1MFUA 1ITXA 4QCFA 1BAGA 1LL7A 1QNRA 2WVVA 3M07A 1RP9A 5I5RA 1OIMA 4PMVA 4XZBA 3VGGA 1W32A 3EDJA 3ZM8A 3U5UA 1G9HA 3W29A 2OYLA 5CSUA 2WZEA 5I24A 3VTRA 3NCOA 4PMYA 2XVLA 1H0GA 4AIEA 5HPCA 1GQKA 3L4WA 1BPLB 3THCA 3OZOA 3AICA
chains in the Genus database with same CATH superfamily
2P1FA 3DIPA 1X98A 3F5LA 1M53A 1R38A 3WQ5A 4BI7A 2XIQA 4GX8A 4Q8PA 3E38A 1P7TB 3E9AA 3MP4A 3DHPA 3RCYA 2PDBA 4FO4A 5AHNA 3SUTA 5DQPA 4Q8QA 2QAFA 4MUPA 1OF8A 3PTDA 4GD0A 1Z89A 3H2FA 3PTMA 3V5FA 3OYXA 1GCYA 4ZQNA 1OGGA 1TMQA 3BAWA 3FV9A 3BAYA 2D2JA 3HJEA 2VMFA 1RJRA 4NP7A 4RJEA 6REQB 4XO7A 1QO5A 2R91A 1GORA 3UR7A 1SMAA 3B0PA 3FKKA 1RBOB 3M7SA 1XYAA 3ITVA 2I5GA 4MADA 3G1SA 4S3EA 4IIDA 1ITCA 1UHVA 4UWMA 3PBVA 4RE2A 4Q7BA 2VC6A 1TWIA 1C29A 3S83A 6ENLA 3ZLHA 5C9WA 3GD6A 3FJLA 3DERA 2HCVA 1EXPA 4EPDC 4PTNA 4UOZA 1O1ZA 3GZ3A 4C6JA 2Z2AA 4Q8MA 5EPDA 1XGDA 2RDWA 1JDCA 3PR2A 1YIXA 3A5VA 1HVXA 1LORA 3MMWA 1OFEA 1M04A 3CYVA 4DJDD 3WNMA 3PS7A 3HA1A 4GQGA 1BWKA 2C13A 3BW2A 2ZRZA 2ESCA 5D33A 3RCNA 5JQ9A 3NZGA 2NQHA 3N9RA 1VFOA 5I3KA 4B16A 1XSJA 4NT0A 1LWIA 5DBUA 4LF2A 2YDQA 3UBPC 4LANA 4IFKA 3O0FA 1J79A 1BWVA 3R13A 3E0IA 4C5YA 4EF8A 1VR6A 3ARXA 4M29A 3HGJA 2GQ9A 1ZB5A 3WLNA 2R24A 3GNNA 4GFSA 3DFHA 1SW0A 1GJPA 2G8ZA 1VBUA 1UR0A 1UUOA 1VFHA 3K1GA 1E55A 4ADSA 3MKVA 2PBOA 3N73A 5F7UA 3MJYA 5G1YA 2FIQA 1JI2A 1RLCL 2FZBA 1ECEA 1B3VA 2Y0FA 1IF2A 5AYYA 1TJ2A 4PRWA 5HULA 1RQHA 4HOXA 4QAIA 3LNPA 1PWLA 5E09A 2Z7KA 2G4FA 5A69A 4LYPA 1WA3A 2JFEX 1EEXA 4PR4A 1UQYA 4ERGA 2XGBA 4LNYA 3TEVA 2ODOA 3WKZA 3W70A 1DQWA 3FHAA 1ME8A 4PTXA 3LG3A 4KCWA 3DHDA 3TNOA 4HKPA 3NQGA 1KM1A 3GAYA 4C7GA 2VFHA 2FTYA 4F9DA 2PDIA 5DT5A 3RO8A 3BLPX 5A6JA 3NDOA 3OLIA 1L6YA 4C6DA 3M41A 2VEIA 4FIRA 1VFFA 1O94A 4UTMA 2E6DA 5EFDA 2R8WA 2ZE3A 3IRSA 3LI0A 2Q8LA 5D38A 2X1RA 1EO5A 3FEMA 4LAUA 4QIUA 4O54A 3KVKA 4HK5A 2B7PA 4DLMA 3VKAA 3HURA 2AQWA 4HU3A 5AVNA 2OG9A 2YZRA 3F2BA 3C2FA 2OTDA 1E3ZA 3GUGA 1FP9A 1OZQA 2TPSA 1Z48A 3V75A 4IPJA 5DELA 5E93A 3THQA 3U4AA 1GQLA 1W9VA 1H1ZA 3VOCA 3GKAA 5CCZA 4UTWC 1WDRA 1OCJA 1X7IA 3PBGA 6TIMA 1LYXA 3PJUA 2DZBA 3LGEA 1E71M 2WM1A 1B1YA 3ZIZA 2J9ZA 3SRDA 1Z41A 4O1FA 1BTMA 4Y6GA 1UMYA 5AC4A 1BVWA 1W5PA 1O1HA 2DVUA 4KPLA 3NM1A 3QH2A 4GWEA 1W2VA 5IBXC 1J0ZA 4FLSA 1YBQA 5IXEA 2EG8A 1R85A 1O5KA 3CAQA 4AD0A 1OCQA 3MB9A 3W9ZA 5GNYA 3SCOA 4L1GA 3WL0A 1J2BA 3DG3A 1F4HA 1M01A 3UESA 1HQTA 3GU2A 4ICMA 3EWXA 3EAUA 2WMHA 5C9XA 1TYGA 3AXIA 1M1BA 1VFUA 4YVPA 3TTQA 1TUXA 4JTTA 3NSNA 4XISA 3WH6A 1TCDA 1WXYA 1TTQA 1TTIA 1C7SA 4RV8A 4WXZA 2OZ3A 4KT2A 5CGMA 2UBPC 3EOUA 3I6RA 3W74A 5JH1A 4IGSA 4DNMA 1AUSL 2WOQA 4O12A 1XDLA 3N17A 3UR2A 2XISA 1Q6QA 2WPGA 3S9YA 1M65A 3L4UA 1KKRA 4XAZA 3LHZA 4GXMA 3LV6A 2H3BA 2BGNE 4P8UA 5HK4A 2C19A 3MYOA 3G22A 3EB4A 1Z32X 2J7EA 4LB4A 4HPHA 4LUIA 3AO0A 4QNWA 1FCQA 2ACRA 1R2RA 3E74A 5HAOA 1E6NA 3CAKA 4XBKA 2ZOXA 4PCTA 2PF8A 3WZ0E 2OU4A 4W8AA 2UY4A 4LFYA 2VZOA 2GJXA 3VCNA 4Y90A 5IRPA 4AWTA 3P60A 4IP7A 1GVIA 1P0BA 3T4WA 2WKJA 2B81A 3TYCA 1FWAC 5BU6A 1HX0A 4OTKA 1DWFM 1WPCA 2ATSA 1WKEA 2JALA 1HIZA 3HOJA 2IPFA 2I5QA 3UW6A 3S47A 3MSGA 1OFOA 3KOFA 1Q8JA 5GJPA 1UKQA 2BY2A 3IIOA 1WZMA 4ZBCA 3ABOA 3GKFA 1B2YA 5C6MA 2QIIA 3GYCA 1EHAA 4HB7A 4XK2A 5CJMA 1WO2A 4H2HA 2KX9A 3AIBA 3O6AA 3HM7A 1UW9A 3AIEA 1J2WA 4Y9PA 1B54A 1GYMA 2X0YA 2VRKA 5D2VA 1DTUA 1P48A 1Q6OA 1DJYA 1PCKA 1QOQA 1XQLA 1L0PA 1KQZA 4MKSA 8CGTA 1R3YA 2TMDA 2DSKA 3CU2A 1VB9A 2XPKA 3A9BA 2FQIA 2ZUTA 1KM3A 2D24A 3GVRA 1LBLA 4U2ZA 4BY3A 2Z1WA 2F61A 4BQ5A 4LX4A 4PSRA 4QJ1A 1DL3A 4FI4A 1D3GA 4QLKA 4DF1A 1FA2A 2XZ9A 1TX0A 4IGNA 4NNCA 1ZCCA 4C6FA 3TQPA 1H5VA 4RZ5A 1JZ2A 3ZR6A 4K1GA 3CLWA 2Y24A 1CXHA 3QGVA 1GOKA 1VKFA 3K8MA 3VOIA 1LG2A 2E40A 1OK4A 3MHUA 5CJNA 3QOKA 1SZFA 4MB1A 3DOPA 3SRHA 3OHMB 3IWPA 4UC5A 2PP3A 4TTUA 4NAFA 2V3FA 3GIYA 4TTGA 2IKIA 3LGGA 3BV7A 4CLMA 4Y8EA 5TNVA 3ERPA 1FWSA 4C5ZA 1CT5A 1JQXA 1JJKA 1UP2A 3M7WA 3OU8A 4DUXA 1NEYA 3G3MA 1EDQA 2GUUA 4L4LA 5HA7A 1I1XA 2XIJA 1W6TA 1Q4WA 1R2SA 4FF5A 3WFLA 1RA5A 1RQBA 1A3HA 1OB0A 3R5EA 4LBSA 1B31A 2ABAA 2PU1A 4IZGA 4AWSA 4V1YA 2J25A 3WEOA 5FL1A 4H8HA 4FP1A 2H9AB 1N2VA 3W1AA 4OOUA 2ISWA 1PIIA 3AYVA 3QBUA 3AYRA 5CH9A 3KBMA 3HQNA 3MU7A 4AD5A 2Z26A 4G2DA 3FGCB 2W62A 2E1DA 5H6HA 4OHQA 3W28A 3WQEA 4DM2A 2C91A 1BYAA 3FXGA 2FMOA 3KWSA 4HNNA 1WP6A 4MJMA 4MJ4A 3ZR4A 4LCRA 4FLQA 4JTSA 1RK6A 3COTA 4ZMGA 4ML4A 1M3UA 2BVTA 4D1JA 2VGBA 4N9DA 3DFSA 1X7FA 1PHWA 4ZB0A 1BD0A 1GVSA 5K7JA 1EH9A 3BW4A 4IPLA 1AVAA 1ZHAA 3BOFA 4L9XA 4MB4A 2X8RA 4AZ7A 3H26A 2OCZA 3E6EA 1S5NA 4I8DA 1NJJA 1EKOA 1K8ZA 5FF0A 1N7KA 2DEPA 3G1XA 4I7VA 3W86A 4WSHA 4QP0A 5I23A 5MHBA 3SEPA 1NDZA 3UVAA 2EPOA 3JUGA 4ZO8A 4ADTA 1LUCA 3UJRA 1O7AA 1KFWA 1S2VA 3ZFHA 2X0HA 5A1AA 4LVDA 3DEQA 1MXGA 1UUQA 1ISXA 1CXLA 3KVJA 3U57A 3SCNA 2XSXA 1ZUAX 5EFFA 2QULA 1XC6A 4I9JA 5FAGA 4GFIA 4UOJA 1UA3A 1ENUA 3KP1A 4JIRA 3UNDA 2XN0A 1UB3A 3R2GA 2BXYA 1BRLA 1A5UA 4GYPA 3LCIA 2JEPA 2CBJA 1JRBA 4Y7EA 1I2QA 5A8PA 4C91A 1FTXA 3WY1A 1W5OA 1ZL1A 3MKCA 1MQPA 4Q8WA 3INPA 3B8VA 3BMWA 3LPPA 5CGTA 3NL2A 3NURA 2GK1B 4MLRA 1BG9A 3G8EA 3WQFA 4B5NA 1M7XA 2RGLA 4YL2A 1FOBA 2PP0A 1R0MA 2VR2A 4QM1A 3M5ZA 1XGEA 3IVSA 3UFYA 4GJIA 3W7KA 5BMXA 2RFGA 3ARPA 3VNLA 3OLEA 4DVOA 2PWGA 1AQFA 3MBDA 1ODUA 1CI1A 4NX0A 3H6OA 1VEMA 2O56A 3WH7A 3G77A 1XC4A 1TREA 3ONBA 4M5PA 1YDYA 2Z0IA 4XAYA 2OFJA 1Z69A 4LVGA 2G3JA 2OWCA 5GPRA 1J0IA 3SCSA 4NAEB 3ZS4A 5AOUA 3DXIA 5AYZA 3GXDA 3W1QA 1IR1A 4U33A 3ZO9A 1D2KA 1CGYA 3L7RA 4K6AA 1TV4A 4PMXA 5LXXA 1FFQA 2DUXA 3WBEA 1I45A 4LCQA 4MUZA 3M43A 1LJYA 1A80A 2ZX5A 1K77A 1XLCA 3PNUA 2BSLA 2WLYA 2ZX7A 1CBGA 3OVQA 1QT1A 4Q7IA 3TTSA 3OG2A 3PNZA 9XIMA 2PE4A 2C79A 4F4RA 4I3GA 3N18A 1JUBA 4GYFA 1S5TA 1M7OA 3NPXA 1IXPA 3WH8A 1S5MA 5KEZA 1KD0A 1MFVA 3M0IA 2ACUA 4WDUA 3H2OA 4I6VA 3WLIA 2D3NA 3SN4A 3PFMA 1GPWA 2E09A 3IGUA 4J35A 2ZA2A 1W9UA 1AJZA 4ACYA 1AD4A 3DG7A 4ZTYA 1H7OA 3WH9A 1BXNA 2XH4A 4Q4SA 2QAPA 3OOQA 3U2CA 1BEUA 1PIFA 3NQ2A 5FKYA 4K8EA 2HRWA 2VR4A 3EWBX 1E0WA 1UOZA 1IYXA 3GFYA 2YBUA 4NVTA 3CWOX 2H8XA 5HMFA 1YMYA 1OFAA 1SJDA 4DBSA 3IIZA 3N4FA 3EXTA 2HV5A 1BGAA 4ZOAA 1ICQA 4AHQA 2DIJA 3IV3A 2VELA 2GK1A 3FJNA 2GSEA 2PC8A 3NO5A 3W1PA 3N1AA 1HJQA 3OBAA 1RD6A 3D3AA 3KCJA 2D2HA 5DRCA 1KCLA 3PVFA 1JDEA 3AALA 3WLLA 5EGRA 4X2PA 4F0LA 3PN8A 3FA4A 3ZT6A 4N4QA 4XO6A 2WBKA 5M17A 1I2NA 4KEZA 2G0WA 4D6EA 2G3FA 1LOLA 3SO7A 1ZP3A 3LEPA 5ABFA 4Z2LA 3VNYA 4D6GA 4H8UA 3QF0A 1SW7A 4QFUA 3PBMA 3LQLA 2G50A 3LX9A 2X1SA 3POHA 2VX7A 1XI3A 4NILA 3MMDA 3NL5A 4AU0A 3IARA 1KFKA 1XLJA 1WB0A 2J7GA 1WUFA 3C2VA 4ORIA 1GOXA 4JTLA 3W7IA 1PS9A 3LPFA 1GW9A 3BZJA 3F4WA 3QQWA 3VMNA 2GVJA 1WDQA 2V30A 2E6FA 1H63A 1MVYA 3RIKA 3T0CA 3DGBA 2C3ZA 1NSJA 2J8TA 1A50A 3G1YA 4PCSA 3DU0A 1A53A 4LNCA 3P67A 2WCGA 5TD4A 4JIPA 1XLEA 4JFTA 2ADAA 4L9YA 4ZO7A 1HKWA 3UPBA 2B7QA 5FEZA 4S3KA 4GY0A 4G6CA 1HTIA 2IS7A 1AH4A 1TR1A 4POCA 2QIWA 4UB9A 4O28A 4M3PA 1QI3A 1SO4A 3GNOA 1LWJA 2EPLX 2WHMA 2VP8A 5GQBA 3S6OA 4RXFA 5FF7A 2PI6A 4TR9A 2Y2WA 4HK6A 3H2EA 1AW2A 3RLHA 2RJGA 2I17A 4E3VA 3KRSA 1KLZA 4YVVA 5KSWA 1V8EA 1XBXA 4PB3A 3V16A 2W3ZA 1BSLA 4Z2GA 5BWFA 1L8NA 4S3BA 4DF2A 3WX7A 1R8LA 3PHAA 1UIPA 3ITLA 1E1FA 3L66A 1T96A 3P8IA 2HROA 4W8BA 3E49A 4MSSA 1W3TA 3NZPA 2Y7FA 3M46A 4HHLA 3TSMA 1R87A 4DJFA 5RUBA 1ISVA 2J6XA 1KBLA 1XLIA 1OFQA 3M5YA 4OT7A 4N4PA 4AUBA 1CW2A 4MVAA 5DCEA 2WKGA 4J7RA 3WLKX 3UXKA 4UTWA 2DVXA 3NQ8A 4JIHA 4DUVA 4EX4A 5FEXA 2QPUA 5CXPA 1WNOA 1W5MA 4UZUA 5H8MA 2IKHA 4E8DA 3L12A 3V1HA 3PPCA 1WAWA 4IPIA 3CK5A 3L21A 1QI5A 5E6YA 5EKYA 2RGMA 5LKYA 2HE8A 3RPMA 4KQNA 4FXFA 1E40A 1Z7AA 3KWXA 2DIEA 1LT8A 3TN6A 3EPMA 1HKVA 1UKPA 4KCTA 4X2RA 2ZZ2A 5G2WA 4GGBA 2IXUA 1XUZA 3WBYA 3TQKA 4EOUA 4RL3A 3MMTA 1ZBWA 3VA8A 1N55A 2X2GA 2A79A 4NHVA 3T7VA 3WMSA 3DC8A 3NO3A 4JTAA 4Y9AA 1P5BA 3ONCA 3N3TA 3BDKA 3CHDA 3DI0A 3GY1A 4DXKA 4GUGA 1GZ1A 1OBAA 4P7NA 4HPXA 3H4WA 1GUVA 1OINA 2FGBA 1DEDA 1CLXA 3H8AA 2VJXA 1ESWA 1A0DA 4ZE5A 4D6CA 4HSHA 5I2UA 2IPGA 2DZWA 2NQ9A 3PZOA 4O1BA 1JCXA 1U33A 3H22A 4J3UA 3MDWA 1XUUA 1XIDA 2EG6A 4WSJA 3G5EA 4IMGA 4HPJA 4LB3A 2AMXA 3VK5A 4LYKA 4DO6A 3CZJA 1XLLA 4UNLA 1EA9C 4X9SA 4S3AA 2J77A 3GDKA 5BYWA 3AXMA 1JULA 4HMCA 3TMQA 3LCWA 1ZAIA 3VUSA 1M9HA 3ZWSA 3W26A 3MT1A 4K8GA 3DHUA 1W1TA 3UWWA 1FWIC 5CSYA 3W7JA 4IJRA 3GC5A 3N6JA 4LUSA 2RH9A 3O1NA 1P1MA 1MRQA 5DF0A 1LBFA 2QVHA 3O0KA 1M7JA 4WJEA 4FNPA 4PUUA 2ZWZA 4UBPC 2DUAA 1S3HA 5J8LA 4JFUA 1KLYA 1OD8A 4UNKA 3QC0A 2CCRA 5A2AA 1Q6CA 3W23A 1MRAA 3VAVA 1RCQA 2B4GA 3BXWA 3WNOA 1GGOA 3NL6A 3WMBA 2V69A 5PTDA 1JYVA 1XIFA 5HQLA 3I3DA 1IIGA 4R7OA 3KX6A 2QR6A 4I7WA 4TXEA 1TPH1 1KGXA 1AW1A 4WIWA 3U7VA 5CLTA 2WCSA 3QKEA 5A6MA 1JR1A 1ADOA 4FXSA 2GJLA 1A3WA 1H62A 3IAQA 2NUYA 4URIA 3RM4A 1RBAA 1V0NA 4MY1A 3MO7A 3MO4A 4NF7A 2YXXA 1X1NA 4WDXA 3VDAA 3GDMA 2EJAA 4PTDA 1V6VA 1E9LA 1ZU8A 3OEXA 3U0HA 2EKGA 4XAGA 4U5IA 1J93A 2WHKA 4U4MA 1TZ7A 4D8LA 4Q6JA 2BODX 3N14A 2EAWA 3AUJA 3SSZA 1LQAA 3B03A 3QSTA 3TAKA 3T0DA 3VOFA 4J1OA 2Y5JA 3IIVA 3TNBA 1SR9A 2W61A 1F3EA 1XFBA 2INEA 2PTDA 4HCHA 3OA5A 1UA7A 3DAQA 1ELSA 3BGJA 4Q4QA 1QNPA 2J7CA 3BAXA 1VYRA 3R58A 4MY9A 2PZNA 3PG9A 1YDNA 3TQ0A 4GA8A 3P0XA 1PKNA 1NVMA 4A3HA 2OZ0A 3RU8X 2VDHA 4UTTA 2UZ9A 3WDRA 3O9NA 5AHIA 5DRIA 3FS2A 1JPDX 2VOTA 4J5NA 3TV8A 5C55A 1LOSA 2SFPA 4MYXA 3URNA 1E9IA 4F3HA 4MWAA 2F6XA 2MNRA 3B0VC 3WCZA 3NR0A 5BOEA 4XBSA 4AYGA 3VGDA 4H9ZA 3WDQA 3EB2A 1HJWA 2R14A 2VD9A 4DWSC 1GJWA 2ZZ3A 1F3WA 3NSXA 4HBKA 2IPJA 4IIBA 2TRSA 3R89A 1IEIA 2GWGA 3V1PA 2Z27A 5K9XA 4KFOA 2F2HA 4YLWA 3II1A 2ZUWA 4ZXOA 1YE4A 2Y7EA 1YDOA 3BANA 2TAAA 4QG8A 2E4TA 4UTKA 1LUCB 4GABA 2YL8A 4A2RA 5BROA 1RBLA 1ZTVA 2PTWA 4UFIA 3B9DA 3GAKA 1ZENA 2DP3A 4TOQA 2GQ8A 3FX4A 1ZZMA 7ENLA 1ZJBA 1IWAA 1BKHA 4GYKA 4D9PA 2CLEA 5HINA 1QI4A 1XGZA 1EJWC 4CNTA 3B9AA 4GC3A 1OG6A 3SCQA 3DFPA 3EX2A 2VURA 4B5SA 1UBSA 4O1AA 4F40A 1XCXA 1W8SA 3NQAA 1REQA 3VIJA 2J88A 1VFLA 3M4HA 4HD5A 1F73A 2VX6A 3C8NA 4P8VA 4OKDA 3W73A 3EXSA 4UIOA 5C8BB 3PZNA 4REQA 3CL7A 4P7LA 4EPKA 1U5JA 4PCFA 1TA3B 4QLJA 1JPIA 4BQ4A 4FALA 3BCJA 1BVZA 1TRIA 1F05A 1PVNA 4E38A 4XD4A 3LCHA 2E9MA 4G7EA 1Q8AA 2WSPA 3LI1A 4YYCA 3J7HA 3G6LA 5L6UA 4A8NA 2CLIA 4TO8A 5EB8A 3TYDA 3A4WA 4FLOA 4UMBA 2ZZ5A 1JUEA 3NTYA 5GJMA 2Y5SA 5LGXA 3BPWA 3ZT5A 3SCWA 3PZGA 3VX1A 2DU2A 5D30A 2GVYA 2BTMA 4W5ZA 4O17A 1W8GA 4WY0B 3KOXA 1I4NA 2HQAA 1ISYA 3W02A 1E73M 4TVCA 4KETA 3CT2A 3GDLA 3VC6A 2CITA 4KBXA 4GQBA 4LRSA 4GCXA 4JX4A 4LVBA 3S5OA 5HJLA 4RV3A 5REQA 7TIMA 4PMVA 1V4YA 4LS2A 1RA0A 9XIAA 4C6NA 1HUVA 4BFAA 4M19A 1R3RA 2DJLA 5LNSA 1FWBC 3NAVA 5HMSA 3TWAA 4LV9A 5I24A 3BICA 3IJLA 1FDYA 2QCHA 2J13A 3RAOA 2JGYA 2XINA 4Q8NA 2DW7A 5EMYA 1NDVA 2YCJA 4AIBA 3S5SA 3E5PA 1IEXA 3UWVA 4BI6A 4MM1A 3L2IA 1H51A 1MXSA 4MZYA 3W4RA 2H9AA 1UZ4A 2VT0A 1H50A 1KFCA 4UFMA 1IV8A 1OWQA 4ONVA 1QW9A 1KM4A 4R33A 2Q6ZA 3SY8A 3CL6A 2RKXA 3VDGA 1E5JA 4I5RA 3W53A 3W7OA 4Q7NA 1LQ0A 4JL1A 4KERA 4RW3A 2C0AA 5A2BA 4IUOA 1H7XA 2GJPA 1BF2A 3EGJA 4QISA 3IJ8A 4A8RA 3PUGA 1TVLA 4TUFA 3R7MA 1QATA 1QK0A 4JTDA 1ZQ5A 2PLJA 3OA3A 1E15A 4LY8A 3KZPA 4J3TA 1R6WA 1UR1A 2J62A 3A9IA 1TCMA 2NW0A 1EBGA 4H9TA 4J4KA 2W27A 1XD1A 3W37A 1KNWA 1WDPA 2PURA 1TMLA 4MNKA 4XZ9A 5FSEC 5BOOA 3O06A 1S1PA 1IXOA 1UPMB 4DPQA 3RRAA 1V3IA 2CEQA 3URBA 4HA1A 1D3HA 3AOFA 5D9PA 4N9EA 3QV6A 1V7AA 4RDZA 1BKSA 3ARZA 3IAPA 3OP2A 2BHZA 1KGWA 1EFZA 5G1MA 2IKGA 4F0SA 2V2CA 1R9YA 5CPSA 5AC7A 2Y62A 1SSGA 2TODA 2DZVA 2QV4A 4E0CA 2O92A 3B06A 4CEUC 1BHGA 4AXNA 1ZRQA 2RUSA 3H54A 3GH7A 4C7DA 5HQMA 2PDQA 2NT0A 2QJHA 4UQEA 1A5SA 2WJEA 3WQ4A 3H53A 4NI3A 3SIZA 4UCGA 4YTTA 2O0TA 2AKZA 2BB0A 3CHCA 1DE5A 3TN5A 3B9EA 3H2NA 2JF7A 3RMEA 3UNTA 1V0KA 3ICJA 3UPMA 1Z44A 2CLLA 4MMWA 3TSBA 3EMZA 4N2YA 3QV8A 3TH6A 4B9YA 1KTNA 1XIEA 3HB9A 3OVPA 3LHYA 1PTGA 2REQB 5M5DA 3QC3A 3WF1A 3DHFA 2PLCA 1GOQA 1CGVA 2ZX6A 2O9TA 3PM6A 2XGIA 4MDOA 2AL2B 4DLFA 3AXHA 4PULA 2QCFA 4O57A 3UXAA 3CV6A 2NV1A 3MUY1 2FZNA 5AY7A 3UY8A 3S5NA 2TSYA 4YWSA 1B3XA 1DWHM 2W9MA 3KXQA 4M81A 3CEPA 4OE7A 2OKOA 2E8YA 2BGSA 2DZAA 4ZEPA 2Q3OA 2ZX9A 3GG1A 2P0IA 3F7JA 4CD8A 5DCBA 1Q7MA 2DPEA 4F2TA 3SGZA 2XZ7A 3BURA 1T5AA 7CGTA 4JDYA 1C9WA 4B3ZA 3W1MA 4JCMA 4AX7A 1IT7A 6CGTA 4LPCA 4Q8VA 3VFLA 1AQHA 2HISA 4X22A 1CENA 2JQXA 2VOMA 2NSXA 4QR6A 1C8YA 4PMOA 4B9ZA 3MW7A 4XZIA 3BCFA 4JXCA 5HBFA 1QHOA 3WG6A 1M03A 2OX4A 4JAWA 4O53A 2V38A 3A47A 3H2MA 1X6NA 2CERA 3PWAA 4CVWA 4I90A 1T40A 4IG2A 3C86A 4XG1A 3CUIA 3ZYZA 2W91A 3AHTA 4HZMA 2ACQA 3A6OA 7REQB 3QZ6A 2NQZA 3NPUA 4O50A 1Q6LA 2AAMA 1TELA 1LWHA 2CHNA 1M41A 4NY2A 3NEHA 3BLLA 4PMZA 4GJ1A 1RUSA 4NG3A 3NOEA 3I3EA 1EC7A 2V67A 1POJA 4C90A 3W7GA 1YXCA 3WUGA 4IFRA 2OEKA 3H2CA 4M0XA 1B90A 3WLSA 4EPEC 1AA1B 3AC0A 1QCWA 3XIMA 4A2SA 4GH3A 2PSNA 3TYBA 3TUUA 2XVGA 5BXPA 2OSYA 2X42A 1DVJA 4R34A 3BTNA 1IGWA 5HWMA 3ZJ8A 4A29A 4JTHA 5GVJA 4JGDA 2D2OA 3W24A 2FKPA 4DJDC 1SGJA 1TWZA 1XBVA 3QVQA 1VZWA 3STEA 3BSGA 3R1ZA 3AISA 2ZZ7A 2FDMA 3GNDA 4PB5A 3CWNA 4CNUA 4GJJA 3OODA 1UMLA 5FAJA 1MDLA 3RCMA 3CIWA 4OUEA 3ABRA 4CN1A 1PKLA 2NV9A 3L0GA 3M0VA 3R8GA 3WQVA 1PKYA 3KTSA 1UR2A 1H1NA 3I65A 4LCSA 4LVAA 3SY1A 3QJAA 3KRBA 5C71A 5I3FA 3T4CA 3M6YA 1NDYA 1V6UA 1GOWA 3CXOA 3RLVA 2NVAA 3HV8A 2OB3A 4OOZA 3GXMA 4DBEA 4HNUA 4E5TA 4Q3MA 3UG5A 1KBKA 4RDWA 4F9JA 2OQYA 1NFPA 2BXZA 1B5TA 1S5VA 4KFNA 3CTTA 1K9FA 5EMJA 3WD0A 3OPSA 2INFA 1DQXA 4MWAD 3SJ3A 2G3MA 1G4EA 5D09A 2X30A 2DFAA 3WO8A 4W9TA 3ITCA 3BSHA 1JF6A 1N8FA 1UD4A 4A22A 3ZJ6A 4JIQA 1GTEA 4RZ4A 2R9RA 1J18A 3V0UA 4JTFA 2PB1A 3OLGA 4ZB5A 2FMNA 1DKWA 4B5UA 1VS1A 2GGJA 2PWFA 2NUWA 2A6NA 4OIFA 2Z7GA 3E2QA 4ZOBA 2ZXQA 4IJBA 2H3DA 1QBAA 4IJCA 4PMQA 3M16A 4Y2WA 5D2XA 2NQ5A 2EO7A 2VZUA 4H19A 3NA8A 1SFSA 2WZMA 3WUEA 4KF1A 2I7GA 5ABHA 3GXIA 1R3QA 1RHCA 2XFFA 3M0LA 1K8XA 3G8RA 4R3UA 5K2ZA 3LD5A 1ZAHA 1KRAC 4KMQA 3W83A 2J47A 1ZBCA 4DZIA 1WKYA 1MI3A 4QJ5B 3H12A 5FJUA 1HKKA 3MTWA 4R7WA 2WBGA 3EEZA 2OT1A 3ATYA 1GHRA 1F61A 3QYQA 4DJFC 2FZDA 4MB3A 1TRDA 4D8ZA 2PDUA 4BQ2A 1CTNA 2P3EA 3OGVA 4RNFA 1EDTA 1V6TA 2ISDA 3P93A 4K7VA 5LIWX 3GDTA 1A5NC 1CGXA 3RK8A 2YSWA 2PRHA 4O0KA 3GHSA 1GQJA 4MOZA 3TLQA 1ICPA 1E4IA 4F66A 2GDUA 3AHXA 3LN3A 2ZXDA 3PPHA 1IZKA 3S8HA 3GXFA 5I03A 4GYJA 3CV1A 1A5CA 7ODCA 4IIFA 1RR2A 3MC5A 2PWUA 2JGQA 4UCFA 1VCGA 3W7LA 4LYRA 3TMLA 5F1UA 2CIPA 3YPIA 1JDDA 3APYA 1NF7A 3VCCA 2E5BA 3UWQA 3HG3A 4I5XA 3S1GA 1W2PA 1WX0A 2ALDA 1DIDA 2Y88A 1OYBA 4DO5A 1MSSA 5I6SA 3R4IA 5I3GA 1FWDC 3B05A 1EJVC 4DZ5A 2ZWYA 4M56A 1I60A 3TAOA 4PBEA 4I9TA 3S3GA 5EMMA 4LS0A 2AKMA 3SR7A 3GVVA 5KZEA 1CCWB 4B91A 3UJ2A 1TWWA 1NARA 2HPIA 2WZIA 4GZJA 4GYPC 4ZCWA 4WR3A 3ZWTA 1E1CA 2YCKX 4NJHA 1U5VA 3IGHX 3PBYA 3UWEA 4ERIA 3URAA 2V5CA 4OV9A 3R94A 1HJVA 1XFCA 1BQGA 1W3HA 1OFBA 3WEZA 3MY9A 2Y8UA 3GHTA 1H3GA 3AIQA 4MG4A 5A6AA 1VEPA 4IICA 3ARUA 2PDLA 3NQVA 3L4VA 4W7WA 3GTNA 3MP3A 4HPNA 3DC0A 1NU5A 5I3IA 1E72M 1UZ1A 1EP2A 4AW7A 1WAUA 2EPMX 4I5UA 2ZA1A 1LQ2A 1CDGA 3QPEA 5E5CA 3HZ3A 4R85A 4Z1AA 3WQCA 1I6NA 3VO0A 3TN3A 2CBIA 1FXQA 4M8UA 1QR7A 3L0NA 4UQBA 1R30A 1SSDA 1PDZA 1MEWA 4ES4A 1B3OA 4E2BA 4UQDA 2X1UA 1YBQB 2E6AA 4NZCA 1PZ0A 2JE8A 4GBDA 4U5KA 3W72A 4JIIX 2YCIX 5LA2A 1FWEC 4HTYA 1S2WA 5G5IA 2FDSA 1TPDA 1XCWA 4IXXA 5FSDC 4DQWA 5HR6A 4ASTA 3S1XA 1C8VA 5CZKA 3TE9A 4GH1A 1JCNA 5JBFA 1ADSA 2C1HA 2UY5A 8TIMA 4W86A 5AC8A 4JNYA 3NJ3A 4Z1YA 1OY0A 3OQ8A 3L5LA 2XIMA 2A3CA 4PH6A 5BRPA 5AVHA 5I3DA 1G6CA 4M24A 3ZZ1A 4KWUA 3NDZA 1UCWA 1H4PA 1W1ZA 2ZDRA 4QHRA 5BXRA 4RW5A 3RF9A 1XYZA 5FJRA 3T1GA 3TFCA 2YYTA 3Q4DA 1K8CA 4PL1A 2W92A 3VD5A 2PWHA 4NXKA 3CMGA 2TYSA 1S46A 4O10A 1ISZA 4RK8A 1QMLA 4YTSA 1G01A 1UWAA 2RAGA 1I9CB 1VIWA 2VRQA 3L9CA 4JEJA 4QJ4B 3SCUA 2BNJA 3VYLA 1A0EA 1EJTC 2DQWA 4CD4A 1OFRA 3VDHA 3OGSA 2VI0A 4BWLA 4XZLX 3USBA 2VZSA 3SW6A 2XJ7A 3D46A 4HOWA 3ZQ9A 4KWWA 4DBDA 2PGWA 4OBRA 3W7RA 3CT7A 3LBMA 2Z1SA 3QKZA 3M0ZA 1UH2A 2A3EA 3C56A 3GHUA 3H21A 2W63A 1L6SA 1J9YA 1JIBA 3NQ7A 2AAAA 1GEQA 2IW0A 1PL9A 5HUOA 1H7PA 2HNHA 1WXZA 3AS0A 4HYWA 2VM8A 1P43A 6XIMA 3IIXA 2ANUA 2PDXA 4JFSA 2XSAA 3FXYA 1DORA 1WUEA 3OQEA 3VGEA 4Z2KA 4AC7C 3GXNA 4B5XA 1UBPC 3CUGA 4HGXA 3W6YA 5D2YA 3WJXA 2KZHA 3TFXA 4A8IA 4QE5A 2Q01A 2VFGA 5A8OA 3M5VA 3AJXA 4YHEA 3U2OA 3LTPA 4BF5A 3OIXA 4C1NA 3QLLA 3WBAA 3EYPA 2NT1A 4B4FA 1P6CA 2Y70A 2YFNA 3CQ0A 1QWKA 1H1YA 4QROA 5A6BD 3WNKA 4REQB 3H7VA 2KAUC 3WSUA 2Y6ZA 3NVDA 3ZR5A 4XX6A 3W76A 4DWSA 1O5XA 3N11A 1XLGA 3S46A 2FVKA 2FZ8A 3RPDA 2FB2A 5DBTA 1X8CA 2ZRXA 3LHWA 4UOQA 3K5XA 2F6UA 2EPNA 1CB2A 3FSUA 4DM1A 4NYYA 1X6LA 4LC6A 3H55A 4H8NA 4S3FA 4XZNX 2PTYA 1C7TA 2BS9A 4B4HA 4L6OA 3F5KA 1JF5A 5A94A 1UC5A 3L23A 4F48A 2WMFA 4QDPA 4X0VA 2BGQA 1I2RA 4LF1A 3R10A 4GUFA 5D02A 5GNZA 3I6TA 5B7ZA 3P8JA 1UOKA 3I6EA 2EJ1A 2EEXA 4LJ3A 5LYRA 1G4SA 1YYAA 4WD0A 3MCNA 5K3VA 3KW3A 1C8QA 1DXIA 2HK0A 5AHEA 4NIRA 3EA1A 3CJPA 4TMCA 1CXEA 1EJUC 5F2MA 1I2OA 4UTLA 2ZUNA 1TPEA 2C15A 1KV5A 3B0YA 1L6GA 4GI9A 3Q65A 3LMZA 2AGTA 5CSRA 3ITXA 4IISA 4MTVA 3BG3A 2Y7GA 1X38A 1VP5A 4K38A 1G7UA 4FNRA 5E70A 4GI6A 1QDSA 4Q8TA 3APGA 3HG5A 3N9SA 3WD3A 1B3WA 1Q2SA 3VNDA 3NZ1A 1TJ1A 3EDEA 1MW3A 1PDYA 1AL7A 1AW5A 3W2LA 1VBGA 2R1MA 4Y9NA 3IACA 3NDYA 3O07A 4LAZA 3DGRA 4V15A 2WANA 4QS5A 1W9XA 4Y8FA 4XTDA 3N12A 7XIMA 2ZTKA 3GE7A 1F3TA 3SFKA 2EQDA 5C9UA 1RP8A 4IP4A 1XV8A 3WDJA 3RLGA 1OC6A 3L5AA 5IDZA 4GG9A 1E9ZB 3TXVA 3K46A 5A5WA 3WLRA 1JZ6A 5CJ5A 1E6QM 3LCXA 2PWDA 2G95A 3BLKA 1EJSC 4DWSD 4S38A 2VQUA 1EYEA 3AS1A 3NSMA 2JK2A 4S3CA 5AN7A 1Q4NX 1G67A 1YW1A 1HVQA 1XPYA 5DT7A 4EVZA 1PSCA 5HATA 5HNTA 4D2JA 3UY7A 2ZE0A 2QUNA 3W82A 4UUIA 7PTDA 1G1YA 3R43A 3UYCA 4FZIA 5M1TA 3WBWA 1J0JA 4ZXLA 5LNUA 2WYSA 2R1KA 3OYZA 4ZSUA 4ALDA 1E1CB 4HNVA 1WV2A 2O4MA 3M0XA 3W7CA 4KH2A 4S3JA 2DV0A 3W3OA 1Z42A 5CG7A 1R3WA 2E25A 3QW3A 3VE9A 1DIEA 3HGSA 2Z1XA 1YRRA 3CAWA 1H11A 4IGMA 3FOKA 2YLLA 2WJFA 4FK9A 4LUYA 3BH4A 2PLKA 1ZALA 3LPOA 4HP5A 3ITGA 4CU6A 4IL0A 5FF4A 1RV8A 1PWMA 4W84A 2CKSA 2XH0A 3FJ6A 2PU0A 3G1HA 3TW7A 3GLCA 4LOCA 4A6GA 3E1F1 4J9JA 3PTQA 1RJPA 1NH6A 1FDZA 4DJEC 2OOFA 3GM8A 4YTQA 2GGEA 4CCDA 3VI2A 3P14A 2MANA 4JTEA 4MY8A 1CPUA 2PWVA 3GC4A 3RJXA 1G0CA 3EPOA 1OCBA 2F38A 3BGGA 2WB5A 1W54A 4CU8A 1ZJIA 1GTHA 1TUFA 4A3RA 3W7NA 4AH7A 1SW3A 4DRSA 3EA3A 4QNEA 1F7BA 1LROA 1M68A 2VFIA 1EOKA 2Y1HA 3NXLA 2ZXBA 2OODA 4W85A 2FZ9A 1TWSA 1AG1O 4DBUA 4AZCA 3N3MA 5DMYA 1TG7A 4WLCA 2XTKA 2CWNA 2ZQ0A 4AC1X 2X40A 4ICNA 3FDGA 3IANA 3CO8A 4QTGA 2ZTJA 4GACA 1XLBA 1XG3A 2BX7A 2XG9A 3KOYA 2O55A 1B4KA 3AMGA 1UWTA 4PGLA 2Z2UA 2QLYA 4MLJA 1XSIA 1W1VA 2XU2A 1V77A 2OVLA 4LW7A 3UR5A 1O6IA 5A8QA 1FWFC 1PZ2A 2Y4SA 1ZPTA 3BLIA 2VKZG 1F5ZA 3QQ1A 3PANA 4XVEA 2NUXA 1C8XA 1ONEA 2UWFA 2C8NA 5LIUX 4L4PA 2EG7A 3RDKA 4CVUA 5JBEA 2QPXA 3KOWA 3UZ5A 1RPKA 3WNLA 2ATMA 2PP1A 5E6ZA 1R3SA 5IBXA 3G3DA 1Y8BA 1NFBA 4DAIA 3ANUA 3LDVA 1XR2A 2WMKA 4H01A 2XN2A 3MS8A 2QDDA 3OBKA 3GS6A 4UR7A 2WMIA 1VPQA 3H7RA 2Q3RA 3UYIA 4EE9A 4DXVA 2C16A 1MW0A 5IFPA 2GJXB 2C14A 4L64A 1J01A 4O52A 4K37A 4TVUA 1SJBA 2G41A 4UTTC 1FHVA 4I8YA 1T7LA 3EWCA 4R9OA 4DO4A 3GIQA 3W7PA 4L80A 4GXPA 3WNPA 3AFBA 1H7RA 4CKQA 4D6IA 2G3NA 3TWBA 3WD1A 5ABFB 2PD5A 3G1FA 4B2DA 1OX6A 1Q6GA 2BLEA 4CCZA 4PYSA 1B30A 3DKLA 4TU1A 3W81A 1JZ7A 4EP8C 1W1YA 3HQPA 3LRLA 2J9XA 3KZSA 2GSHA 3PPFA 2J78A 1J0YA 4FNUA 3ITTA 1W1B1 3N9KA 3DYMA 2UY2A 1KBBA 1TPUA 3M0KA 3HG2A 1P4CA 3EKZA 1S5WA 4TV5A 4AVFA 3DDMA 4O8RA 3SDOA 2WHLA 3S42A 5K9CA 4Z17A 5ABTA 4JN8A 5DY2A 5KZ6A 3MWAA 2ZRYA 1LRTA 3KCOA 2VRJA 2VO5A 1V3HA 2YLAA 4XD3A 2HPMA 3I68A 1XRVA 3FK4A 1EX1A 1QNOA 3A4JA 4UTIA 1BXBA 1VJIA 1VFMA 4MF4A 1JDFA 2A6LA 5BNKA 5EMKA 1TQXA 3NG3A 3T6CA 1UUMA 3L4TA 1M5WA 3OG3A 1I2PA 1LBMA 2QCCA 3A13A 4A21A 8XIMA 4GX9A 2YDSA 3VNMA 4H04A 2HZGA 5C7VA 1TB3A 1VH7A 1XH0A 3NM3A 3PJWA 1EQCA 1W9BM 1E0TA 1WBJA 4IMEA 1ADDA 4PUKA 4NU7A 2ZZ1A 1V03A 4AAJA 1K7EA 3RITA 1SO5A 1DJIA 4Q4KA 2CWXA 4OVXA 2CLKA 5T8GA 1TFVA 4JQAA 3NNTA 2XH7A 3ARTA 1JNEA 2HWGA 2DUZA 1JNDA 4M6QA 5E0FA 4WJXA 3WENA 3W0KA 2A3LA 5E9XA 1W3JA 1E0XA 3QY6A 1SMDA 3EBVA 4C6EA 5CPMA 3B40A 3BJTA 3S5ZA 3AS2A 3KS5A 3REQA 2PDNA 4GUHA 3AQUA 4QSHA 4M51A 4I9AA 4X61A 3K1DA 3OZMA 3PUOA 4LEFA 1KRMA 1TPVA 1HL2A 3N2BA 3UD6A 2QHAA 3GU9A 4GQRA 4DPPA 1H7WA 3EX1A 4QGCA 1KBIA 4NX5A 5A6SA 3GU1A 4IGHA 3WJSA 2ZRWA 3WLPA 4J40A 3QFWA 5CZTA 5FESA 1FFRA 4GO8A 2BASA 6TAAA 4MFEA 3HMCA 1CGTA 4DYEA 3IJ6A 1R3VA 1JL8A 3KCLA 1VEOA 1FWNA 1UWIA 4J3XA 1XM3A 4TMBA 3WJWA 4GZEA 1YPXA 2BDQA 2ZUVA 4LGXA 1F8MA 1UKOA 4M6VA 3M0MA 4MDPA 2NX1A 2WLZA 3U5YA 1OVDA 2POTA 1JRCA 4Z2IA 4IMCA 3V3WA 3LRKA 1Q3NA 2CLOA 3ZVIA 1UKTA 2WXDM 2BY3A 4HU0A 1KWGA 4U3AA 5LNRA 3P80A 5FJPA 4C65A 1DPMA 1X8FA 4XWUA 1C3FA 1AFSA 1JUKA 2VZTA 5CPOA 4MHBA 1ZBVA 4H41A 2GJNA 4QITA 5A6BA 3OIHA 1ZLPA 3TTEA 1P0DA 4A05A 2YW3A 2GLKA 4GVHA 2DZUA 3NQEA 4CNOA 3N6HA 3KE0A 3U2ZA 4LT9A 1YPFA 5AECA 5C2CA 2V3DA 4LUTA 4YVXA 2P3ZA 5E1QA 1TPB1 3CL8A 1W31A 1J5SA 2OGJA 3MI6A 3THDA 5A6KA 1EB3A 3VIKA 2CETA 3GC2A 1FY6A 3CUJA 4Q4PA 1M7PA 2HVOA 5FF3A 2EF9A 1NAL1 3WQPA 4US5D 5LNVA 5AFDA 2YOCA 2G4JA 4L65A 1PXGA 5ABGA 4DO7A 3A23A 5EBAA 5H1WA 3C61A 1EJXC 3HBLA 2NXGA 2X2YA 5I0DA 3T8QA 3AIVA 1YHTA 3LZ3A 3QTPA 4RXGA 5DCDA 5H91A 4W93A 1LCOA 2R1PA 1IE7C 4LS1A 2OLHA 3PBUA 2GFTA 1OQFA 2B0MA 2CYGA 1UG6A 3P3BA 2GUBA 4EXQA 5LNWA 1ZFJA 4JYFA 4FF7A 5TQLA 3D3FA 5JIWA 2V5BA 4NZ1A 1FQ0A 3W1UA 3L5MA 2ALRA 2OO0A 1ITXA 1DJNA 3M07A 3BOLA 3W22A 1WKFA 1OIMA 3PUDA 1VLIA 5EMUA 1W3IA 3C52A 1W32A 4CQCA 1L6FA 3LHTA 5G2HA 2OYLA 5CSUA 3GFXA 5FA5A 3NCOA 4XZMX 5HMEA 3WQOA 4PB4A 5HUPA 1H0GA 1GQKA 3L4WA 5CAKA 3W2JA 4JY9A 3BMXA 3PK7A 1KFBA 4JTJA 4JTUA 3W07A 4M7TA 5M3WA 4GNVA 3VGHA 2XM1A 2ZZ4A 3IGXA 3WQDA 2OR2A 4JZ5A 3QV7A 1LM1A 1DJZA 1GVRA 2JEQA 1WYIA 2VWTA 5AC6A 3QFEA 2WJZA 3VINA 2W4XA 3R6IA 3VOJA 3GO2A 1GJUA 1RSCA 3E0FA 1HP5A 1PEZA 3D6NA 3BWWA 2GQAA 3DUGA 3ALGA 2E3ZA 3RNDA 5BOFA 3AMCA 3CYJA 3E5BA 4L1XA 4C1NB 2YB1A 3V0TA 3UT0A 2OWWA 1E56A 1IWBA 2OLAA 4HHHA 1FH7A 1NM9A 1AJ2A 3RILA 1UD5A 4B5VA 3E0VA 1G4TA 1SJAA 3IIPA 3LS9A 5I77A 3V35A 4LUJA 2J79A 3LZ5A 3PSVA 1TV7A 3U9IA 4UFHA 4NZ5A 5FD0A 4HQVA 1VRXA 1PHQA 4H8VA 3LM7A 2WSYA 3SRFA 3DFQA 3GQYA 1HGWA 3UGVA 2HEJA 1PCWA 2XN1A 1Q6RA 1NIUA 3HG4A 2Q8XA 5BMWA 5HR7A 3VKBA 2Y8VA 5D05A 4DF0A 3CEUA 3T0BA 4PFMA 3OW1A 4JN6A 1A0CA 1WDSA 4XV0A 1XYBA 1P1XA 2XFRA 1K9TA 3ME3A 2DH3A 4DUWA 1AZ1A 3DECA 1JCMP 3A12A 1NWUA 1TTJA 5H8PA 2POZA 4DN1A 1IZJA 1GQIA 4NJIA 2QMKA 4C6OA 3SCPA 3FA5A 4MPQA 3MBFA 4DAFA 2GGIA 1LL4A 3GG0A 2PDWA 3KBNA 2B7NA 3M64A 3QV9A 2ZUMA 5LXEA 3C5QA 3HGOA 3EOEA 5BXTA 2VUYA 4C6CA 1V6YA 4Q4OA 4ZTXA 4EAYA 4RNIA 5FIPA 3RHGA 4W7UA 3IJ9A 1UWUA 1CYGA 4MKNA 4BF9A 2Z6JA 2Z24A 5KTLA 2X7WA 1TJPA 1XIGA 3UQNA 3LCGA 4H83A 3D0CA 4ZFMA 3WK0A 4K2SA 1LL6A 2WVUA 4QS6A 3O3RA 4F8XA 4P7QA 4LBRA 4WRHA 5D9MA 4CNSA 3QW4B 3PWGA 4FHAA 4P2VA 1GOIA 2BVYA 2YDAA 4OQVA 5AYXA 1TV8A 3CIXA 1S2UA 3M5XA 3L4ZA 3T2QA 3S2MA 2DT1A 2VFFA 2FFIA 1DV7A 4GCAA 5HJXA 2HS6A 2O9RA 2DT0A 1PZ3A 4JBRA 5CPNA 4HU8A 4GKTA 3FHQA 1HJSA 5C2XA 1E4LA 1CNVA 5JU6A 2BHYA 3CQHA 3LTSA 3U8GA 3EMCA 4C1KA 1EZ2A 2BBFA 1YDVA 3T44A 3TDFA 1US0A 3UZXA 2CW6A 4OZOA 5FJJA 2CBUA 4IHCA 3B8SA 4UQCA 4HZ8A 2PS2A 2E6YA 4JL2A 1VBJA 1XKJA 3OTRA 4J2MA 2CLPA 1KXVA 4ZOEA 1TPFA 1R3TA 2B7OA 4JTGA 3OJGA 1HW6A 3QY8A 1UWRA 1V6XA 1XDMA 1UKSA 1WQ5A 3WD2A 3W1LA 2BG5A 2JKEA 5AB3A 2QS8A 3EKLA 3CH9A 3SIMA 3VNJA 5LSMA 1J96A 1SZNA 2FPTA 4J3SA 4GXWA 1V3LA 1EUAA 4GVIA 5MKGA 2YL9A 4BKNA 1GOOA 1SJCA 3EPNA 1LLOA 4KFPA 2PDHA 3RO6A 3T09A 2QJNA 3BG5A 2EKCA 1VHNA 4Q22A 5LGZA 3UA4A 3IVTA 5I07A 4BS0A 1C93A 4PTMA 3GSMA 1PYMA 2FHBA 3GTIA 3QQ0A 5A8MA 4K3ZA 3S6DA 4ATLA 3T08A 5D04C 3JW7A 3IJ7A 4JHMA 3E0WA 3W25A 3UR8A 1P0EA 3VM7A 1GYLA 1LLZA 1RXOB 1P0KA 1Z3NA 3E2VA 3PTKA 4PMDA 1XRTA 4JR5A 4CCCA 1RVKA 1JXJA 3LLDA 4S3GA 2PZ0A 4GMEA 1K02A 2VEGA 4ORMA 3TZNA 4EXBA 5K4XA 1FP8A 2I56A 4NZFA 1JFHA 2VC9A 4FPSA 1E1EA 1MQQA 4W88A 3A3HA 4R9XA 2WSQA 4MWAB 1RD5A 1TVNA 3GH5A 1TPC1 4CNPA 4ZQMA 3TCSA 4M6PA 2GSJA 2CU0A 2CZDA 1CXFA 2P0OA 1HKMA 3KAOA 4MB5A 1XLAA 3VE7A 3CM4A 2J7DA 5HPOA 4PL2A 1ZS2A 3TONA 4HCLA 4CNNA 3P5YA 3ARWA 2F6KA 1JZ8A 4RKAA 5REQB 4AMCA 2FHCA 4NAEA 4N6EA 1E6XM 4NKCA 4XB3A 4H6KA 1MZHA 5H2ZA 1YLVA 2OZTA 3VGFA 1HNYA 4DEFA 3IUHA 2QV5A 1K1DA 5BXSA 1VF8A 1CB7B 2J7FA 1MEIA 2OJPA 1F8IA 3ARSA 3FYOA 1QPRA 1BVNP 1FH8A 3QOMA 4XUYA 4WGHA 5DMMA 3G0XA 5C0QA 1XJBA 2VR5A 1ITUA 1ME9A 1SU5A 2J6VA 1O5QA 3W2NA 1WOBA 3A22A 2O9PA 1BFNA 4Q32A 3N29A 2CZFA 1B57A 4J28A 2PCQA 2GOKA 1Q63A 1DIOA 1UR4A 1IXQA 3ARYA 2A21A 2BOEX 2PPGA 3VIOA 4GI4A 1ME7A 3CIVA 4HNTA 1J0KA 1GHSA 2D22A 6REQA 3C4UA 3UCCA 3F4CA 5BW6A 2YX0A 4KIEA 1SZRA 2GWNA 3HPXA 2A7NA 3D5HA 3THAA 3RM9A 2Y85A 3MI2A 5C2GA 4P61A 3QM3A 2PTXA 2AOSA 4QRNA 1VAHA 3DI1A 4PODA 4PTVA 3TP4A 3O6CA 3L68A 3HU7A 4H6QA 3NZQA 5CPQA 5A6LA 4W4QA 3TVAA 4W5UA 3PZTA 2P5NA 1PKMA 3TOPA 1JGIA 4IH3A 4IUGA 2PTZA 1T8XA 1Q45A 4PUEA 4QQUA 1V5XA 1XIMA 2FYMA 3BO9A 3HPSA 5JUVA 4HIBA 4GINA 2Q8ZA 8A3HA 4XAPA 2HVNA 4PMJA 4NQ1A 5FEWA 3W7EA 3AJ7A 3CMFA 1O68A 4PEEA 2YW4A 4DB7A 4ZB2A 4FEZA 3BL3A 4X63A 3MV11 5HQEA 5C7HA 3Q58A 1ZJHA 3UXIA 3WH5A 1EJ7L 4FNTA 4M82A 3HFTA 3U3HA 3DESA 3CASA 2W67A 3TLLA 1GVEA 2OWXA 4ROQA 3UG4A 4NZ3A 4ZO9A 2F2KA 2QCDB 3VIPA 1S1RA 3SSJA 2CXEA 4UTHA 3NPVA 1TR9A 2X0SA 1EIBA 2ZIDA 3VDBA 5CC5A 2JBMA 3VX0A 1PTAA 4G9PA 5C9RA 2WZTA 4PBFA 4ENLA 3DZ1A 4X60A 4HYRA 3WF4A 3PJTA 3S0CA 4GLEA 2LLEA 4JTCA 4MAZA 3QMSA 2Y89A 1UZHA 4OBTA 2WC4A 3O63A 4YTUA 1CXIA 2X7VA 4UFJA 1US3A 3KRUA 4E2OA 2E5DA 1H60A 1QXLA 2WZHA 1EQPA 3TK7A 2F84A 3WQ6A 3AZTA 2GPTA 5F1VA 4LQ1A 1U83A 5CGQA 4MIMA 5I06A 3WUFA 3GR4A 1GNXA 3VZZA 5TF0A 4HJFA 3MVTA 1GZJA 4HK7A 3CHFA 4RE0A 1EIXA 1NWSA 2GL5A 4GRSA 1EF2A 2WVTA 2NLYA 3HV9A 4D8AA 4PRTA 4C6QA 4C6KA 2E5CA 2FFCA 3EEGA 1XXXA 2VVNA 4FXJA 3GDRA 1J10A 5I79A 4Z1BA 4NRRA 3H70A 3SCRA 3S2JA 4FNSA 1QK2A 1T8QA 3PF3A 3R25A 4JICA 4XD5A 1ITQA 1XYLA 5A95A 3QGAC 3T0AA 2H90A 2OELA 3WELA 4IQEA 2FPYA 3U4FA 1LT7A 5KETA 3W2MA 1QOPA 3N2MA 4GZIA 1XD0A 2I57A 4ROPA 5HNRA 1W1A1 4C6BA 1H7NA 4PC8A 5DXXA 4M80A 4WY0F 4MAVA 1RJQA 4Z08A 8XIAA 3WLJA 5I7GA 2W79A 3TJ4A 1K8YA 3I7RA 1GQNA 2PBGA 1ZCOA 4AG0A 3ZOAA 3WN6A 2EBNA 1FWWA 1H49A 2RJHA 1JDAA 2I16A 1V7YA 5KMYA 1UP3A 4ZFCA 1MDRA 4YNGA 3N19B 3A4XA 3W1RA 1VBRA 1TJRA 3RGTA 4CD7A 1VHCA 1HFBA 2PDCA 1OJXA 1X1ZA 1MNZA 2FLIA 3L2MA 3A3XA 4FXRA 4CEXC 4GVGA 1OEPA 3U6WA 3TTYA 4D6HA 3DYOA 4F0KA 1Y5XA 4L6HA 3RM8A 1PYFA 1R2TA 1AD1A 1F4AA 2OPJA 3SJNA 1E0VA 1EZWA 3GB6A 3AWNA 3W6MA 4V33A 2A2IA 4FAMA 1KTBA 2E9LA 3UPWA 1BF6A 3AU6A 4RR4A 3GUWA 3XISA 3PZQA 1UJPA 3LLXA 3I4KA 3CPRA 1XHGA 3DH7A 3TN4A 1MZRA 4N7QA 2BY0A 1GKQA 2QGHA 4KW2A 3SB0A 3C3UA 2A0NA 1J5TA 2FJUB 2YKKA 2GZXA 1UROA 1KFEA 4ATWA 2V3GA 4AZCB 1RCXB 1E3XA 3TZFA 3FKRA 3ECQA 3C0SA 2WNQA 2CLMA 5E9AA 3WJYA 4ZENA 1KBJA 5CBJA 2OT0A 3A64A 2ISSA 5DN1A 4IFOA 1GZGA 2MUCA 2VD8A 2Y61A 4WJ8A 3GNRA 1NQKA 2V5LA 3MUIA 3TX9A 3IPWA 4XZHA 3IGSA 1YTEA 1OD0A 1EWDA 2WC3A 3HQOA 1IR2A 1PX3A 1UWQA 3ZSSA 3PZIA 4LAMA 4IPNB 2PA6A 4R7JA 1FDJA 2OXNA 3BSMA 1RCOB 1Y5VA 1KB3A 3APTA 4GIEA 4QEHA 4ZODA 1IGSA 2VXNA 3NL3A 2WQPA 3NVTA 4GQ0A 5DEZA 3FIGA 5XINA 3SQMA 3WJZA 3UA3A 4GC4A 5AHLA 3PZVA 1JI1A 2PGRA 2FVLA 3VKJA 4DJEA 3SFWA 2Q09A 4TIMA 3W6LA 5DXYA 3MUZ1 1SZGA 1RLDA 1Q66A 1BQCA 3EDDA 4O18A 1DYSA 1S2TA 5EL1A 1FXPA 1QNSA 3STGA 3NYZA 2QDGA 1UD8A 2WKLA 2HTMA 3H24A 4YYFA 4GVFA 2PGFA 4MZ8A 1R47A 4HZ7A 1SQ7A 4UQ9A 4JS3A 3FW6A 1XP3A 2YIHA 3FYYA 2ZC8A 3L4XA 1V6WA 2ZYFA 5D8WA 4N6FA 3AIUA 1B9ZA 5EY5A 1W3LA 3WMLA 1JZ4A 1MQRA 4KESA 2R6OA 2GVEA 2CLFA 2D69A 3BLDA 1JCYA 4G7FA 4JNMA 1KR0A 1ZJAA 1TE1A 5G2IA 1GG1A 3V36A 1XLMA 3MZ2A 1UP0A 5FI8A 2HJPA 2PGEA 1F76A 1XH1A 5M03A 1A3XA 4DHGA 3O15A 1UWSA 2FGLA 2WVVB 3LA4A 4AHPA 5J5DA 1I0BA 3UZYA 3V0SA 4O4VA 3IS4A 1O66A 1EP3A 3UP8A 5CZJA 4WZHA 2PDJA 4NJJA 3LB0A 4XKYB 3UXDA 2V5JA 3AUOA 3BJFA 3T07A 4H9YA 3R11A 4TX8A 3MYPA 3TSDA 1Q6EA 1Q6DA 4UXDA 3GTHA 2XUCA 4IFKB 3UEQA 2J75A 3PZUA 3GHRA 2WSKA 3DKJA 2QJMA 1DP0A 2PUZA 1Z8AA 2PDKA 4QCEA 1HO1A 3PJXA 5G4HC 3KM8A 5JXQA 1U1JA 1YXDA 4GQQA 3STPA 1ZY9A 1THFD 1IQ8A 2DSWA 1EC8A 4O19A 2WC7A 1Q7ZA 3BAJA 2WK2A 1REQB 3KHDA 3LGDA 1VIZA 5IM51 2VEPA 5T9CE 4MJZA