2CCRA

Structure of beta-1,4-galactanase
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
386
structure length
386
Chain Sequence
b'GLYVEKVSGLRKDFIKGVDVSSIIALEESGVAFYNESGKKQDIFKTLKEAGVNYVRVRIWNDPYDANGNGYGGGNNDLEKAIQIGKRATANGMKLLADFHYSDFWADPAKQKAPKAWANLNFEDKKTALYQYTKQSLKAMKAAGIDIGMVQVGNETNGGLAGETDWAKMSQLFNAGSQAVRETDSNILVALHFTNPETSGRYAWIAETLHRHHVDYDVFASSYYPFWHGTLKNLTSVLTSVADTYGKKVMVAETSYTYTAEDGDGHGNTAPKNGQTLNNPVTVQGQANAVRDVIQAVSDVGEAGIGVFYWEPAWIPVGPAHRLEKNKALWETYGSGWATSYAAEYDPEDAGKWFGGSAVDNQALFDFKGRPLPSLHVFQYVDTGTP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YVFO
publication title Investigating the Binding of Beta-1,4-Galactan to Bacillus Licheniformis Beta-1,4-Galactanase by Crystallography and Computational Modeling.
pubmed doi rcsb
source organism Bacillus licheniformis
molecule tags Hydrolase
total genus 143
structure length 386
sequence length 386
chains with identical sequence B
ec nomenclature ec 3.2.1.89: Arabinogalactan endo-beta-1,4-galactanase.
pdb deposition date 2006-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07745 Glyco_hydro_53 Glycosyl hydrolase family 53
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2ccrA00
1ODZA 5C71A 3WEZA 1UWIA 3II1A 2WNWA 3W24A 5GNZA 5LA2A 3KWXA 4C7DA 4J28A 3TONA 3GTNA 3L4WA 5CQ1A 2QHAA 1K9EA 1V08A 5FL1A 3OG2A 3WMCA 1WP6A 2WCAA 4OOUA 1VIWA 5CSYA 5E0CA 2VJXA 4M80A 2RGMA 2WC3A 2DIJA 4V2XA 2C8NA 1RD6A 4AZHA 2DH3A 1EOMA 4MB1A 1GJWA 5D9NA 3VO0A 4D6JA 1BQCA 1VBRA 2XIBA 4AIOA 6CGTA 4JZ5A 1H49A 4BF7A 3OBAA 2WLYA 3AISA 5GNYA 2JF7A 2F61A 3WEOA 1ISYA 1H11A 1JXKA 3BMWA 1VFUA 2WKGA 4QLKA 3PZMA 3CZEA 3AIRA 1XSJA 2ZIDA 3UCQA 3WNOA 2GFTA 1H09A 2VMFA 3VDAA 3POCA 2W63A 2J8GA 4AD4A 1WDQA 4NRSA 1E3ZA 4W8AA 2F2HA 4NZCA 2Y8VA 3AHTA 2BVTA 3NYDA 1TUXA 1EIBA 1FH7A 3WD1A 3PZQA 2QMJA 1C8YA 3O9NA 1C7TA 2CHNA 4R27A 3F5KA 4CUCA 2GJXA 2YL9A 4J7RA 4EANA 3AS3A 2WWDA 5D8WA 2EJ1A 2EEXA 3AMCA 3W6LA 2CESA 1GOQA 3QGVA 3W53A 4B9ZA 3ZT6A 5ABFA 4IPNB 4CN6A 4AZGA 3WUBA 1IZKA 1PJ9A 2EBNA 4BQ3A 3ZT7A 1V6WA 2ESCA 1GJUA 1NOFA 4AEEA 2E9MA 5FOOA 4QDMA 1V0MA 2FH6A 1EOKA 2XVGA 1KWKA 1J9YA 1XH0A 4U5IA 2GJRA 1V6UA 1QNQA 2E40A 2A3BA 4BQ2A 3SCSA 5BRPA 3SCWA 2CHOA 3WH6A 5A8MA 1R87A 4ACYA 3CGTA 9CGTA 2W61A 2EO7A 3BAWA 1J01A 4KH2A 1OD8A 3LPGA 5FD0A 4AZ5A 2BY3A 2O9TA 3PTQA 2JE8A 4HZ8A 3TTYA 3WNPA 3WN6A 1J0ZA 3BAKA 1TZ7A 2BY0A 2ZX7A 4MNJA 4Z2IA 1E6QM 4KGJA 5CPTA 3GM8A 3ECQA 4E2OA 1JYXA 4YHGA 3WKZA 1XSKA 3HJEA 1W9UA 3DHUA 5GQBA 2Y2WA 2WCSA 2FGLA 1MYRA 1TR1A 3GH7A 1J11A 4OIFA 2FHBA 1ODUA 3FHQA 3W82A 5A2CA 3WDIA 2WHLA 4GO9A 2J7CA 3IJ9A 2W92A 1FP8A 4HA4A 2D1ZA 2JIEA 2J47A 5E09A 4U2YA 3WUFA 3RM8A 1KB3A 1V02A 2ZUWA 2CKRA 2VZTA 1RH9A 1UG6A 3BCFA 2J74A 1I1XA 4HP5A 1KGUA 3VKKA 4PCSA 4W7WA 3CUHA 5A6SA 3VDCA 4XZBA 5DFAA 1XCWA 2WC7A 3NSMA 5IHRA 2YA1A 3CTTA 4GKLA 1NP0A 1EQCA 3RJXA 1V6VA 1GW1A 1H41A 3F5LA 1UKPA 3MMUA 4JFVA 3WF3A 5JIWA 3WH7A 4D6HA 4QCEA 4UFIA 2FDMA 2UY2A 5FL0A 2BV9A 1Q6CA 1SYTA 3AFBA 3RM4A 1XRVA 4H2CA 1W9XA 3OZOA 4MNKA 3U7VA 1PZ3A 1CPUA 4B3LA 3CHEA 3AIQA 2J75A 3UEQA 3VIIA 4JIEA 2AOSA 3MUAA 2XVPA 3M6DA 4M29A 3WDQA 3AXIA 4W88A 1UWSA 1DEDA 1H5VA 4ZXOA 2VO5A 4ZFMA 2XSAA 1UKQA 3B9DA 1A3HA 1KFWA 3WY1A 1KBKA 3QR3A 2EPMX 4PEEA 4RE3A 5ABGA 3QOKA 4GZIA 3W0KA 4KGLA 1P6WA 4W7UA 2VRJA 5CLWA 3VTRA 2AAAA 1R85A 4LYRA 1EGZA 1GVIA 1UZ4A 2JEPA 3VNZA 3AYSA 2DT0A 1UD4A 3D5HA 4D72A 4PSPA 3A47A 1WZMA 2GDUA 1HIZA 1RP9A 4D6GA 3AIEA 2J7BA 3TOPA 3SIMA 3AHZA 1DP0A 1ECEA 5DF0A 1E5JA 1WE5A 3CO4A 3SCRA 1HJSA 3IJ7A 1QI2A 4B9YA 1OT1A 1C93A 1PPIA 2VZSA 3ZT5A 3SCVA 1PX4A 1W91A 4UFJA 4CCCA 1BGAA 1S46A 2ZUVA 1XH2A 5BXPA 2VZOA 3T08A 1GOWA 1KBBA 1JL8A 3GZAA 3DECA 1MFVA 3WD0A 1BSIA 1E72M 1VBUA 3ZJ8A 4A4AA 3FAXA 2WC4A 4ZENA 2VQTA 4UQCA 3AXHA 1CXIA 4HA1A 1E56A 2Y8KA 2WSKA 4FLQA 5E6YA 2DPEA 4PUEA 4EE9A 3VIPA 2XVNA 3N1AA 1CXHA 2YKKA 1H4PA 1W3LA 3VDHA 2WKLA 3WF2A 1KR0A 1E4IA 4Z2HA 3I3EA 2O9PA 1BHGA 4RE2A 3ZSSA 4H41A 5D8ZA 3VIMA 4J3SA 3UR7A 1TVNA 3MMWA 4JHOA 3O6AA 4QP0A 5ABEA 1VEPA 1J12A 1WCGA 5D9MA 1JF5A 4W89A 4HMEA 1ZBKA 5BYWA 1UD2A 3WDHA 1V3MA 3SCTA 4WJXA 4UNIA 2GSJA 1ZJBA 2O92A 5A6JA 4D6DA 3L2LA 3DYPA 5I6SA 2WMJA 4GPNA 2A3EA 1FP9A 1BAGA 3BLKA 4EKJA 2V3FA 1SMDA 4B16A 4W8BA 2W4XA 4WIWA 1UD5A 1XH1A 4GINA 3GBDA 4GI8A 4Z2LA 4ATWA 2QPSA 5E9AA 3VD4A 5A6KA 1XC6A 2DT2A 4ATDA 4WK9A 4YPJA 4F79A 4DM1A 1BFNA 1HT6A 4DUWA 3WQ8A 1HKMA 5GNXA 1EO7A 3ZR5A 1FHDA 2YJQA 3GH4A 5A6MA 4PMYA 3CHFA 4KMQA 4WKAA 1JD7A 4M1RA 1W1TA 4N42A 4AZBA 4PBGA 5BXTA 1DWJM 2WHKA 5A8OA 3L4UA 4OJYA 3ARYA 2TAAA 3VGEA 4W8LA 3U5YA 4BQ5A 2B31A 3BAJA 3WH9A 2O9RA 1X6LA 2XG9A 5JBDA 5I77A 3AROA 3GXIA 3WBEA 2VZVA 3VMNA 3GNRA 3W81A 4JFUA 2GK1A 2FHFA 1NARA 2OWXA 3NJ3A 1HJQA 3VU2A 4AD2A 3KE0A 2XTKA 2UY3A 4PMNA 3WF0A 3OGRA 3TA9A 2Y24A 3WFLA 2YBUA 4OZOA 2DT1A 1LF1A 2J7GA 4X0NA 2VUYA 1W3JA 1M03A 1M53A 2EPNA 4EK7A 1DWAM 1KGXA 1VFMA 3OLIA 5EMYA 4PRWA 3VMOA 3PZ9A 1JNEA 1E6RA 2D0FA 4ZE5A 2PWDA 1UD6A 1E5NA 1OT2A 4W86A 3EDEA 1GQIA 1UWTA 1MQPA 2EPKX 1V03A 4WLCA 4AZIA 4W7VA 4A3HA 5BROA 4TTUA 3CZ8A 3PN8A 1E1EA 2VX6A 2WMKA 1MW1A 1M7XA 5A94A 1MQQA 4NF7A 1AQ0A 4AD3A 4X0VA 2CCRA 3T0DA 2DSUA 4H8VA 2J4GA 3WDRA 2BHUA 3NSXA 1CGVA 4U3CA 1AQHA 2VCCA 2CIPA 1OM0A 1C7SA 1HN1A 3SUSA 1G94A 1OB0A 4CU8A 3TTOA 2AMGA 3B8SA 1IZJA 2GJPA 3SCQA 3UERA 1WPCA 3AZTA 4U5KA 3SCNA 1UOKA 1G9HA 3CUFA 3MANA 3OLGA 1UKSA 3VM7A 3A6OA 1C8XA 3SUVA 2NT0A 3N17A 1UH3A 2BNJA 4JKKA 5IHSA 2VVSA 1Q6EA 1HKKA 3W38A 1EHAA 4HPGA 1BG4A 1L0PA 4JFSA 4OBRA 5CZKA 3PBGA 1NWSA 1QHOA 2Q8XA 3LPOA 2BHZA 3ZJ7A 1CXLA 5A2BA 3M46A 2G3MA 1WB0A 4P7QA 3T0BA 2YL6A 1DWGM 5IFTA 5KZ6A 4UZSA 1UWRA 1HKIA 2YA2A 1BLIA 1E6PA 2VQUA 3VIOA 2VL4A 1BYCA 2BXYA 2D24A 2WMGA 2WMIA 3U5UA 2ZUTA 1UR4A 1BPLB 1E55A 3AJ7A 3ZMRA 1QI3A 5E6ZA 3CH9A 3K8MA 1MXDA 2E4TA 1CGWA 4Q22A 1RP8A 4UQDA 2QV4A 1HF6A 1E6NA 1X1NA 2DEPA 3EDJA 1HX0A 3LPFA 1JAKA 4CD6A 2OSWA 2ZUNA 2D0HA 3VD9A 2PWFA 3ARXA 1KXQA 1R8LA 5AY7A 2Y5EA 4ACZA 1TFVA 3WD3A 4YN5A 4Z2KA 2VX7A 2ZX9A 2EQDA 1ZJAA 2ZX5A 1JNDA 1ZB5A 1ITXA 3VIKA 3GNPA 3POHA 1ZBWA 3ZQ9A 3UR8A 3MSDA 1GOIA 1UR1A 1LL7A 1VJSA 1LG1A 2E8YA 3NUKA 3WDJA 1JYWA 3GNOA 4AY1A 3D3AA 1E71M 2CPUA 2DSKA 3VGGA 4M56A 3EDDA 1FH8A 4U33A 3OGSA 3ZM8A 4AXNA 4P8XA 3CHDA 2ZXAA 2DT3A 2EPOA 5A2AA 3S2CA 1VENA 3ARZA 1KWGA 2VT0A 4QFUA 1EQPA 1XSIA 3T2OA 2WZHA 2G3IA 5EFFA 1QNOA 4QCFA 4N0RA 1CYGA 1UR9A 1W1PA 2FH8A 1JGIA 1C3FA 3VGBA 1WDPA 1NP2A 5DT5A 1YQ2A 5C8BB 2VURA 5IDIA 3PZNA 3AHYA 1HNYA 3B9EA 3VIGA 5JIPA 1UA7A 1GQJA 2XSBA 3CBWA 3A4AA 4U31A 4DWSC 4LX4A 3WNKA 2VR5A 4UFLA 3WH8A 1BYAA 3AIBA 3RILA 3WQ5A 2BXZA 2VOTA 5A69A 3CIVA 3VPLA 3VIFA 1UYQA 4CU6A 4MB3A 1VFFA 4URIA 3RM9A 1A47A 1ISXA 4DUXA 1NOUA 1E15A 1HJWA 1QW9A 3CLWA 2G4FA 4M24A 1JDDA 1BF2A 4GI9A 4XZWA 1JZ6A 4W87A 4A3YA 3SEPA 1UZ1A 4B15A 2X0YA 4CD4A 4PMZA 1TA3A 2PBOA 1SFSA 3UESA 4M82A 1WZLA 1V6YA 2ZUSA 4Z2JA 1CXKA 4JFTA 3CPUA 5JUVA 2V3DA 5HPOA 2BVDA 3W29A 2JFEX 5DMYA 1JDCA 1OD0A 2E3ZA 1U30A 3O2LA 3CHCA 2WZIA 2WWCA 4NI3A 5CG0A 1VJZA 1QNRA 2D23A 1JZ8A 1EDTA 2XFFA 4CCDA 1JZ5A 4P8VA 5LA1A 4KRUA 3SUTA 4TVUA 4BQ4A 5A8PA 2YA0A 3N9KA 1ZU8A 4CN1A 1OIMA 3UG4A 6TAAA 3IJ8A 3EYPA 5M17A 2ZX6A 1LQ0A 1CDGA 2OYMA 4GQQA 2JF6A 1ESWA 3SUUA 1IT0A 2DSZA 4UFHA 2XUCA 3PZUA 1FHLA 3WMSA 1DWIM 2ZXQA 4MJ2A 3AQUA 1V3JA 3ZO9A 1E0XA 4XX6A 2D20A 1W3KA 4AYSA 5A3HA 1GQLA 3BXWA 3I3DA 2GVYA 3QHNA 1RPKA 3W6MA 4WF7A 1MW0A 3FW6A 4H8HA 1W2PA 5A8NA 3WUEA 3DHPA 2OSXA 3SCUA 2GDVA 2XIIA 1H1NA 4UFMA 4YHEA 2ZWZA 3GYCA 3B9AA 2WHJA 2XWDA 7A3HA 2VCAA 4M81A 3PTMA 2V5DA 2A3AA 3VGHA 1B90A 5EBAA 1Y7VA 3UETA 2DSVA 2D3LA 2ZE0A 1W1VA 3QOMA 1AVAA 4W5UA 4XB3A 4L4OA 2QMKA 5DT7A 2D22A 4RE4A 2PWGA 1PAMA 3WDPP 5I23A 4GZEA 1PIFA 1PZ2A 1FFQA 5IFPA 2JIWA 1DWFM 5DO8A 3WD4A 4S3JA 1V0KA 1W32A 5EB8A 1C90A 4V27A 2GK1B 4UQAA 1MWOA 2ZXBA 2UWFA 3CZKA 4HOWA 4U3AA 3BSGA 3EMQA 3OLDA 3RIKA 4WSJA 3TP4A 4AISA 3DYMA 2YLLA 2JALA 2CBUA 3EMZA 1CXEA 1C92A 2PC8A 5HDRA 1PBGA 1QHZA 1OGGA 1DTUA 2QF8A 5GPRA 3THCA 1UWQA 3SCOA 3KZSA 3GXMA 1JXJA 2VZUA 4OKDA 1BG9A 2YDSA 3TTSA 4PUDA 2FGZA 1V02E 3VD7A 3K8LA 1KQZA 2X1IA 2O9OA 5E70A 1ZBVA 2J7DA 4P8UA 1HL9A 1XD1A 3OIHA 1VEOA 3EMCA 1CGTA 1PX3A 4J3UA 4GIAA 2J7HA 1US3A 4D6IA 3L4VA 1R7AA 3IAQA 4H7VA 4GQRA 1GNXA 4BS0A 1NOWA 4LQ1A 1LLOA 4MB4A 1CIUA 2W67A 3AS1A 3DYOA 4WSKA 2VX4A 1HXJA 1E4LA 2VTFA 4AZCA 2V3GA 3ARQA 3GXFA 4F8XA 1TVPA 3AS0A 3N15A 3OLEA 4TOQA 1TG7A 2PF0A 3L4XA 3WUGA 3WENA 3OGVA 4ML4A 1N82A 3BMVA 1UHVA 1B3VA 2OWWA 5CPQA 5I78A 1HP5A 3NIYA 3BAYA 2WXDM 3MUZ1 4MTVA 3G6LA 1QNPA 1D3CA 2FHCA 1GUVA 1EO5A 5C70A 2DQXA 3WQVA 2CKSA 4FLSA 4P7RA 3VX0A 2A3CA 4CVUA 3W4RA 3PZGA 2XFRA 1I75A 1CZ1A 5I79A 2E8ZA 1HVXA 2UY5A 3CMJA 4V28A 1O7AA 4D6CA 3NDYA 3WL0A 1V3LA 1G1YA 1GONA 2VRKA 2WCGA 3FXYA 4D1JA 2G8ZA 2J62A 2WMIB 4MJ4A 1V3HA 1JYVA 1OINA 3WH5A 2X05A 3I3BA 3ZJ6A 5D9OA 4UQ9A 3MKKA 1UQYA 4W84A 1NWRA 3RDKA 1XV8A 3CZLA 3KL5A 4PTVA 2WZEA 1EA9C 3U7BA 4MADA 2VR4A 2YDQA 2YL5A 1VRXA 4DWSD 4MB5A 5HPCA 5HOSA 1QVBA 4DWSA 3N18A 3GXDA 3FNDA 1WDSA 4ACZB 1FOBA 1NH6A 4C7FA 5I0DA 3NSNA 3VX1A 1E3XA 4LGXA 4IUGA 3TTQA 1EXPA 2J25A 4OUEA 1GQKA 4CU7A 1GOKA 4AD5A 3AHVA 1U33A 2BY2A 1J0JA 2WSPA 3L2MA 2X8RA 5JBEA 4D6FA 5BCAA 1B3ZA 3VOCA 1FFRA 2YDRA 2VRQA 1LG2A 4AD0A 3IAPA 4R5EA 4TVDA 4AZ6A 3THDA 3N13A 4HPHA 4UTFA 3WQ6A 2CYGA 4FMVA 4Z2GA 2WVTA 5A6AA 4W93A 1GPFA 5D9PA 3AMGA 3K4DA 4XUYA 3VILA 1YHTA 1SR0A 4BA0A 2VVNA 4UR9A 4QAWA 2XJ7A 1VB9A 2VNCA 1K9TA 3SCPA 3W26A 3OB8A 3L4YA 4HTYA 5BRQA 3ALFA 1JD9A 4E8DA 3K8KA 2HISA 3ARVA 2XVKA 4PMOA 3VIHA 4HA3A 5IXEA 3DC0A 4P7OA 5M03A 1GCYA 4AWEA 1W2VA 1HJVA 3OZPA 2C7FA 3A4XA 2PB1A 3CUJA 1Q6GA 1NWTA 3CZGA 4RL3A 1B2YA 4H04A 4J3WA 2ZXDA 1JZ2A 3WF4A 7CGTA 3F4VA 1V3IA 3APGA 5ABHA 1VF8A 2EPLX 1CGUA 5DEZA 3NCOA 1E0VA 1PEZA 1XCXA 4UZUA 1UA3A 2CNCA 2WW5A 3MU7A 1KXHA 2NSXA 4FLRA 2XGBA 1CLXA 1C8QA 2YL8A 2W91A 2XGIA 1TA3B 1QI0A 4HOXA 5CLTA 4P7LA 3F5JA 1HJUA 3RCNA 3IANA 4W5ZA 3UG3A 1R86A 1QOXA 3RMEA 3VGDA 4ZE4A 1WO2A 5D4YA 4WKFA 1EDGA 4FF5A 1UKTA 3IK2A 4ATLA 3AOFA 2J79A 1NM9A 5BWFA 1VFOA 2WMFA 5BXSA 4C7GA 2WPGA 4PMVA 2DGAA 4JFWA 4W85A 1CXFA 4B3KA 2VC9A 1MW3A 2XYLA 8A3HA 1GZJA 3KEHA 4CGTA 1F4AA 5CSUA 1QBBA 1BYDA 1V3KA 3RJYA 5HNNA 3AHXA 5EFDA 3FY1A 3QHOA 2DH2A 1Q6FA 3VUPA 3AIVA 3MSGA 1JG9A 1XYFA 3PZVA 4HOZA 3WMBA 3QHMA 3ZSTA 5A8QA 5I24A 5I3DA 5JBFA 5BXRA 2BFGA 3CMGA 2BS9A 3UG5A 4FLOA 1QHPA 3ARSA 2VI0A 4GXPA 3CZJA 1QI4A 2X2YA 2XVLA 4D6EA 1KR1A 3AYRA 1NWUA 3FN9A 3NDZA 1E6XM 1ZL1A 1M04A 3AIWA 3W28A 1KCKA 4AZ7A 3MV11 4CVWA 3BAXA 4PMQA 3AICA 4S3KA 3WL1A 2OYKA 4ZEPA 3WQ4A 4X9YA 1JZ7A 1KCLA 5TD4A 3WELA 1BYBA 3ARPA 1OCQA 4J3TA 3KL3A 1B31A 1G5AA 2D0GA 4HU0A 1W3HA 2WHMA 2ZUMA 4E4PA 1XYZA 1Z32X 4PTXA 2DSWA 3HN3A 1OWQA 1LL6A 2XPKA 3WFZA 2RGLA 2ZWYA 4UOQA 2V5CA 3VIJA 4PMXA 2G3NA 3FHAA 4LYQA 2OWCA 4JKLA 2D2OA 3AMKA 3ZR6A 4AIUA 3BGAA 3WIJA 1C91A 2WLZA 3VM5A 2W62A 2NW0A 1UKOA 1HJXA 4JHZA 3U57A 1J18A 4IPLA 3AZRA 2GUYA 1Q6DA 4D1IA 1W9BM 5AYIA 4MPKA 1CGXA 1AQMA 1ZS2A 3T2PA 3VNYA 3AMDA 1CTNA 1B0IA 2WBKA 5AC4A 4H8UA 1E40A 3AXXA 4FK9A 5HBFA 3MUY1 4Q7NA 1J0IA 1UH2A 3LPPA 5I5RA 4MNLA 1G01A 3K4AA 3N11A 2WVSA 1QBAA 2WVVB 2V38A 3M07A 1QNSA 1H2JA 2XM1A 2ZOXA 2C0HA 4JL2A 3KL0A 2BHYA 4IISA 2EXOA 2J8FA 1WAWA 1O6IA 4CD8A 4DUVA 3SURA 2CETA 1W1YA 1JYNA 4PSRA 4E8CA 1MW2A 2X0HA 1PX8A 3BLPX 1B1YA 1CBGA 4UOJA 3WNLA 4DM2A 4PTWA 1EHNA 3VDBA 4JCMA 4AZCB 4PN2A 1UR2A 2CEQA 1GOOA 1XD0A 3T2QA 3K46A 1UWUA 3S6TA 4TXEA 1V0NA 3VD3A 5HXMA 1L8NA 5E0FA 5M5DA 1KXVA 3J7HA 4Y7EA 3WD2A 4F9DA 4GI6A 4AMCA 1JIBA 1ITCA 5M3WA 1LWHA 4IM4A 1E1FA 1UR0A 1B3YA 2CITA 1BVZA 1TMQA 3WBAA 1J0YA 2J7FA 4HZ6A 3BC9A 4BZYA 3ZJKA 4TUFA 4MAZA 1KXTA 3ARRA 2J78A 1OGSA 3PHAA 5FIPA 1ISVA 4JAWA 2JEQA 4PCTA 2CXGA 2J77A 4EAMA 1TE1A 4MNMA 1GORA 3N12A 3SUWA 1EH9A 3RPMA 3W27A 5FCZA 3G6MA 2E9BA 4XV0A 1MXGA 3VGFA 4QLLA 2WMHA 1I1WA 1E9LA 3AMLA 2CBVA 4LYPA 4K68A 3ALGA 3PTKA 1HKJA 3GDBA 2UY4A 3PZTA 5LA0A 1GHRA 2J7EA 2QLYA 2NT1A 3MS8A 1UD8A 3WEMA 1KGWA 1PIGA 1UUQA 3W25A 3W37A 4M8UA 1H0IA 3AZSA 3AS2A 1B3XA 1U2YA 4DWSB 1US2A 2HVMA 1TCMA 4CN4A 2WAGA 2XWEA 4AEFA 2PI6A 2PWEA 2XHYA 1Q4NX 1CGYA 4PMRA 1JF6A 5CPSA 1V0LA 1E4MM 3HU7A 4UQEA 2WVVA 1R7OA 1D7FA 1OBAA 1OGBA 1JDAA 3CUIA 2WB5A 3FAWA 2XM2A 4UQBA 3WNNA 4U2ZA 4PMDA 1B30A 1VEMA 2CERA 2BY1A 1LWJA 3ARUA 3N04A 4JL1A 3HMCA 5CJ5A 5AYBA 1WNOA 1K9DA 4AIEA 1UR8A 6A3HA 2WBGA 1GOMA 3RO8A 5A1AA 1E4NA 1D2KA 3WF1A 2V3EA 4HZ7A 1JFHA 2MANA 4D71A 1OIFA 4P8WA 1E6SM 5FKYA 4TTGA 4PTMA 1IV8A 1W9VA 4TX8A 1JZ3A 2E0PA 4CD7A 5LYRA 1DWHM 2OSYA 1MVYA 3JUGA 3L4TA 1ZBCA 4MDPA 3WQWA 2W5FA 1JZ4A 2OYLA 1XGZA 4L4PA 1HVQA 2VX5A 4KWUA 1WDRA 2WM0A 1CENA 2IXUA 4LPCA 3ZIZA 2F8QA 1K9FA 3PZIA 3M7SA 1UH4A 2IXVA 4CD5A 4J27A 1LJYA 3ARWA 3ZOAA 1CNVA 1CWYA 1F4HA 4UOZA 1FH9A 5A95A 4PMUA 3MO4A 2Z1SA 2IUZA 3A3HA 1G0CA 1E73M 1M01A 1X6NA 4HMDA 4AC1X 1E0WA 5A6BD 1MQRA 2QPUA 4NRRA 2VCBA 2BVYA 2YBTA 5A6BA 1ISWA 4TVCA 5A6LA 1B9ZA 1UD3A 4OBSA 2OLHA 3WNMA 1HP4A 1W9PA 4JCLA 2W66A 1GHSA 3AIUA 4CKQA 4GZJA 2XFYA 2WYSA 3BH4A 1JAEA 3EBVA 2Z1KA 4JKMA 1WZKA 5ECUA 3BSHA 3L4ZA 3T0AA 1EDQA 1WKYA 1BTCA 3VVGA 1SMAA 3VD5A 1J0KA 3ARTA 4WKHA 4OOZA 5AC5A 2E9LA 3WSUA 4CCEA 5CGTA 2ZICA 3AI0A 1QI5A 4TX6A 3T09A 3CUGA 4UCFA 1JI1A 2WANA 1WZAA 2PWHA 1CECA 3K1DA 4MDOA 1FA2A 1W9DM 2D3NA 1CLVA 4NSBA 3GBEA 5I2UA 1CEOA 1H0GA 1AMYA 1BVNP 2GJXB 4HU8A 3VMPA 2YLAA 4QLJA 1VAHA 8CGTA 1MFUA 1QPKA 4ZXLA 4AD1A 1DHKA 2DDXA 2X09A 4HMCA 5ABFB 7TAAA 4F66A 3E1F1 2CBJA 3EDKA 1E6ZA 2WVUA 2YIHA 4J3XA 3MUIA 3MMDA 1UQZA 2DIEA 3EDFA 1OSEA 1E70M 4AW7A 3A4WA 1JFXA 5CXPA 5F7UA 4KRTA 4UFKA 5CGMA 4LXFA 4BCEA 1H3GA 1LL4A 3VINA 1NQ6A 1HL8A 4P7NA 1ISZA 1K6AA 3BCDA 2A3HA 2G3JA 2ZUUA 3OA5A 1XHGA 1E43A 1V6XA 4J3VA 4F9JA 5KEZA 1JI2A 2WK2A 1B3WA 2ZX8A 1GVYA 1J10A 4MAVA 1BGGA 4PYSA 4GO8A 3MV01 3PZOA 2PBGA 3LMYA 3BAIA 2G41A 1J0HA 2CBIA 1QW8A 1KQYA 3GH5A 2Y4SA 2YOCA
chains in the Genus database with same CATH superfamily
3BW3A 1ODZA 2AKMA 4KEZA 1PDYA 2WNWA 4C7DA 4IL0A 4S1FA 3GTNA 5HMFA 5HNUA 3RRAA 3AWOA 1X38A 8RUCA 4OOUA 5CSYA 4M80A 1TV3A 2WC3A 3ZZ1A 1W8GA 1ZJIA 3W7MA 1XRFA 1W1ZA 4AZHA 2DH3A 4MB1A 4DWDA 2GGHA 4O28A 1PTGA 4ECLA 1DJQA 2XIBA 3S47A 3BV7A 1OADA 1H49A 3RR1A 1VFSA 3NQBA 3TFCA 3TW9A 1G69A 4K2SA 2F61A 3LTSA 1DIEA 5HR6A 3TLQA 3BMWA 4Y9MA 2ZZ4A 2WKGA 1WUEA 3BQ5A 2CHRA 4C6QA 1KW1A 2VMFA 1O1HA 1I60A 2W63A 3T81A 4XZ9A 1WDQA 1FCBA 1E3ZA 1DOSA 3CT2A 3OBEA 3AHTA 3W7HA 1RXOB 4O8RA 1FH7A 1Z42A 2CLIA 1C8YA 4IIHA 1NFPA 3O9NA 4R27A 3S46A 2GJXA 1P0NA 3QGVA 3ZT6A 3BLLA 3OG3A 4IPNB 4JY8A 3O0KA 1Z9AA 1B5TA 1W5MA 4EWND 4B2DD 4H6RA 1CLKA 1XGDA 1VFHA 2FPYA 3ICJA 3TN4A 3ZT7A 4DXXA 1JVNA 2ESCA 1GJUA 3TWAA 1NOFA 2Z4GA 3TUUA 5JVLA 2E9MA 1EOKA 1KWKA 2R82A 5LGXA 3ABXA 4A8IA 4BI7A 2A3BA 3SCSA 4C6OA 5BRPA 1RZMA 2CHOA 2PGRA 4ACYA 1EBGA 3BQ6A 3EB2A 1EJWC 3DDMA 2EO7A 3W2NA 1J01A 1TJ0A 4IF2A 4AZ5A 2PCQA 3TC3A 3RGTA 2ZRUA 2BY3A 3WQEA 4J9JA 1Z44A 1E51A 3LV5A 1A5NC 3KLLA 1E6QM 3VOHA 1Y65A 2Y5JA 4RK8A 2WM1A 3U3HA 2L5HA 3WLQA 3W86A 3OTRA 4DF0A 2DUXA 2OO0A 1W9UA 3VOGA 3UWQA 3VKCA 1J11A 4NAFA 4UMCA 3W82A 2DZSA 1BRLA 2WHLA 4GO9A 1H61A 1EGVA 1PL9A 1R0MA 4HYVA 1SU5A 2JIEA 2I1OA 2XISA 3VOIA 1FKWA 2J47A 3TAOA 2MUCA 5E09A 5FEZA 3W84A 3RM8A 3WUFA 3PY2A 2CKRA 1TPB1 1RH9A 1Y0EA 5D09A 3VKKA 3LTYA 4W7WA 4Q4SA 2OQYA 2PP0A 4X60A 3RF9A 3VDCA 4XZBA 4EX4A 5DFAA 3EWBX 4H9UA 1KM3A 1FXPA 1HW6A 4Z1AA 5I07A 3MJMA 2X30A 1NP0A 2O56A 3RJXA 1QOQA 3UGVA 3ZVHB 1SO4A 1YDYA 2H9AB 2E6FA 3HGSA 1T8QA 2BV9A 2GQAA 2WV8A 2ACQA 2OQHA 1W9XA 4Z17A 1PZ3A 1A53A 1C9WA 2GOKA 2QCCA 4GQGA 3AIQA 4NP7A 2YW4A 1H62A 3HG5A 3QKZA 1GVOA 3EXRA 3TQVA 3AUJA 2FB2A 2AOSA 1EZ2A 2VC6A 2YW3A 5K9XA 1UWSA 2ATSA 2HRWA 4ZXOA 2VM8A 3T0CA 3PWAA 1UKQA 3GQYA 1ONEA 4NXSA 1KBKA 2B7NA 4GQ0A 2EPMX 3GTXA 2C15A 4KGLA 4XBKA 4W7UA 4FR1A 3T4WA 4LYRA 1GVIA 5FF3A 5A8GA 3KOFA 4PULA 4WR3A 1JRBA 2CLKA 4D72A 1HKVA 4J2PA 2QAPA 4O4VA 4D6GA 1X7IA 2J7BA 3AIEA 4XUGA 1VFTA 2PWVA 3R89A 4MOZA 3ZS4A 4JN8A 1XC4A 4LAOA 5DF0A 2WSYA 3NWRA 3MVIA 1VYPX 3IJ7A 3WBYA 1QI2A 4Q8NA 1PX4A 1W91A 3XISA 3UWWA 3S6OA 4MLRA 4PB3A 1F73A 2OX4A 3T08A 4OUIA 3GZAA 4E3VA 3HJZA 2NZLA 3DECA 3EWUA 2VFGA 3WD0A 1E72M 3ZJ8A 1VBUA 4A4AA 4DO6A 5EMKA 3MUXA 4POCA 2ACUA 1H5YA 5M2FX 2C1GA 1VD6A 5BMWA 3N1AA 3CV6A 1SFTA 1W3LA 3WJSA 3WF2A 3BO9A 3W2UA 1H7XA 1EA0A 3S1GA 3V5FA 1EL3A 1HQTA 1XICA 5CCZA 3P0XA 5LHFA 3RU8X 1TVNA 3L67A 3MMWA 2ABBA 3G0SA 4S3FA 3T7VA 3BOFA 4H9MA 2CFFA 1XRSA 4HMEA 3B0PA 1C9DA 5E9XA 2EG7A 4K37A 1X1ZA 1CB2A 3LTPA 3SCTA 4UNIA 3GNXA 4XWUA 4Y8FA 3L2LA 2FFIA 4G56A 3GSMA 3UZJA 4RR4A 3AUOA 2V3FA 1VBGA 2E5DA 5XIAA 3OVQA 1TPVA 1Q2SA 4PC8A 5IRPA 4GI8A 3T07A 1T96A 4C5YA 3AYTA 2QPSA 3TSDA 3VD4A 3DFPA 5A6KA 4XSMA 4KEUA 4DUWA 1RCXB 5GNXA 1P0BA 2CLPA 2NXIA 3LK6A 1TWZA 5KZMA 3ZR5A 3GH4A 3CHFA 4GFSA 1O5XA 1Q4WA 4O0ZA 5BXTA 3DENA 4PBGA 3U48A 2QUMA 4U10A 4IQLA 2WHKA 3L4UA 2J8TA 4OJYA 1FX6A 4W8LA 2B81A 1HL2A 2B31A 2F38A 1A5AA 3GTIA 4V15A 3SECA 3WH9A 1Z7AA 1X6LA 2V63A 5H8UA 1TJPA 3AROA 4PRRA 1FQ0A 3VMNA 4JTSA 2GK1A 3QMTA 2ZRYA 3O3RA 2PDKA 1NARA 3NJ3A 1SR9A 1HJQA 3VU2A 3EKLA 3W1MA 4PMNA 3WFLA 4BWLC 2V69A 4O54A 3CASA 2DT1A 4X0NA 1TQJA 1W3JA 2GVLA 1J4EA 1TRIA 3PZ9A 3G1FA 1WDWA 3R94A 1TKKA 5CKSA 3NQ8A 3TFXA 3L65A 3PJTA 2EPKX 1SFJA 1IXNA 1XLDA 3IJDA 4GY1A 3AWNA 3DGBA 1KO0A 1MW1A 1M7XA 4RZBA 2Z1XA 5A94A 3R25A 2Y5SA 1YPFA 3CC1A 4AD3A 1GGOA 3W23A 1ITUA 1ZTVA 3THQA 3NQDA 4L1GA 4U3CA 1G4EA 1YRRA 1C7SA 3Q65A 3SCQA 2GJPA 1YEYA 2RJHA 1D9EA 4U5KA 2ZE3A 1G9HA 3CUFA 5GJPA 3BL3A 3VM7A 3H2CA 2BWGA 3SUVA 1JCXA 4IOTA 1PVNA 5DANA 1BG4A 2Z29A 2PRMA 3C56A 4OBRA 3PBGA 1NWSA 2Q8XA 4DPQA 4YWSA 2PTXA 2B4GA 3MJYA 1BWLA 3ABQA 3DN5A 1OFBA 3R58A 1WB0A 1RLDA 1M6JA 5HA7A 1VCGA 2H90A 4UZSA 2PGWA 2QUVA 2PRHA 1HKIA 1OFEA 5FF2A 3VIOA 1RPXA 1BYCA 2Y63A 2WMIA 1F3WA 4I9AA 4M5PA 3E0VA 2PTDA 1UR4A 1BPLB 2BLEA 2IQTA 3AJ7A 1QATA 3C8FA 4I90A 2DIKA 1S2WA 1WKFA 2E4TA 3BE7A 4LC8A 3R13A 3CQIA 1I2RA 1MO0A 4XAGA 1E6NA 4KEMA 2QKFA 3LPFA 2ZUNA 3VD9A 1Q8AA 5AY7A 4LRTA 1RUSA 3TX9A 5AB3A 2G0WA 2V5KA 3NOYA 4Z2KA 3UZ5A 3VNLA 1ZJAA 2ZX5A 1ITXA 3VIKA 4L9XA 3POHA 4HNCA 2FLIA 2TODA 3WJWA 1UR1A 4O0QA 3R10A 1YPXA 4H00A 4JQ3A 1ZCOA 5C2CA 4Q4OA 4RDYA 8XIMA 4QSFA 1VS1A 3D3AA 1SO6A 3VGGA 3VK5A 2ZQ0A 3G5EA 2ANUA 3PSVA 2ZZ7A 2FKPA 3P62A 5A6TC 5A2AA 2NSOA 4A35A 3HURA 2WZHA 2NVDA 1QNOA 2QCHA 1F2JA 2OEJA 3L0KA 1TTIA 3EPOA 2HQAA 4MUZA 4GCXA 2HBXA 5BW6A 1ZENA 3SGZA 3PZNA 3SZ8A 1HNYA 1UA7A 2XSBA 3IRDA 4DWSC 5LIWX 3WNKA 1EEXA 4M6QA 1VPYA 3WBWA 1B9BA 3BLOA 5F2GA 3WQ5A 1XLAA 1QXLA 3C6CA 3QGKC 4CU6A 3CWHA 4EIVA 3RM9A 4XQ6A 3FGCA 1ISXA 3MT1A 3AU2A 4C90A 4A3YA 3V7PA 3SEPA 5EKYA 5KTLA 4GFIA 4PUMA 2PBOA 1PZ0A 1K77A 4M82A 1WZLA 2ZUSA 1TWSA 1GKQA 3CPUA 5JUVA 1FDZA 2E3ZA 3WLHA 4AC7C 1IE7C 2WWCA 1IWAA 1QNRA 1DJXA 5LA1A 4KRUA 3PPHA 4TVUA 3MP4A 4PUJA 5K7JA 3LDVA 2F6XA 1RA5A 1IXOA 2QJMA 3NQEA 3UG4A 4OECA 3E6EA 2Q09A 2ZC8A 4GIYA 5BWAA 1XLHA 4LS1A 4TIMA 1IT0A 1EJSC 1FHLA 1DWIM 1LBMA 6REQA 3QLLA 4GBUA 2D20A 1W3KA 4RNJA 5A3HA 4AUBA 2GVYA 3QHNA 4K3ZA 1RPKA 3TJLA 4WF7A 3BWWA 1MW0A 1W2PA 2V0TA 2YFNA 1EP2A 4JDBA 2XIIA 4UFMA 4YHEA 1NAL1 3L2IA 1UROA 4M81A 3H23A 3B06A 2GUUA 3S8HA 2YPIA 3PTMA 1NIUA 4NXKA 1Y7VA 3CJPA 4C6BA 2ZE0A 3G1VA 3TC7A 5RUBA 4QAIA 1K4GA 3W1QA 4NY2A 3STGA 5I23A 1KBLA 5IFPA 4Q4RA 1DWFM 2YB1A 3GD6A 5CZ0A 3WD4A 1GYNA 5EB8A 4V27A 3KBJA 4UQAA 4GVHA 2UWFA 4HOWA 3BSGA 3EMQA 3RIKA 3WK2A 3NXLA 1FY6A 2ZTKA 1L8PA 2DU2A 3W22A 3Q2DA 4HBKA 1CXEA 3R0DA 1V4YA 1OGGA 5C6MA 3GHSA 3N9RA 3RLHA 1GVEA 3VI2A 3KX6A 3S9ZA 1ZAJA 3GXMA 4BKNA 4FEZA 2FVMA 1ZALA 1FCVA 1V02E 4DZAA 3VD7A 1KQZA 3BANA 4I9TA 3EX6A 2X1IA 3N29A 1MMFA 5E70A 1ZBVA 1JDEA 4P8UA 2CW6A 3LXAA 5AVHA 3EMCA 4J3UA 1EC9A 3A9BA 4ZQCA 3UR5A 1GK8A 2QDHA 3LX9A 4D6IA 3IAQA 2XIMA 2Z0IA 4O1AA 2BG5A 2GJNA 4BS0A 1NOWA 1TV8A 4AHQA 4CCZA 4MB4A 4GNVA 3LHUA 4RDZA 1UZHA 3DYOA 1RR2A 2VX4A 3E96A 1UJQA 2EG8A 4HPXA 1JCYA 5IBXA 3N15A 1DE6A 5FEPA 1OJXA 4R3UA 1PUDA 3N2XA 4WCJA 3EPNA 3T1GA 3FVDA 4ML4A 1N82A 1K7EA 1UHVA 2OWWA 4DQWA 2WJDA 1F3TA 4KPLA 2H8ZA 5L6UA 4MTVA 3VOFA 1GUVA 2PDJA 2DQXA 3H53A 4UTMA 3MI3A 3VCNA 4CEXC 3W4RA 3V3WA 2XFRA 4H1ZA 2E8ZA 2EG6A 3G1XA 4AHPA 3ATZA 1TRDA 1TPC1 3MCMA 4D6CA 1QPNA 4L56A 4KIEA 2Q01A 2ICSA 1V3LA 2PD5A 3UW6A 2WCGA 2PDCA 3T78A 2J62A 3LCFA 4MJ4A 1MDLA 5EA9A 1OINA 4JEQA 3I3BA 4F2TA 2A1YA 3NA8A 3QQ0A 5D9OA 5I02A 4FR6A 1L6WA 3DFYA 1UQYA 4W84A 4Q8PA 1EA9C 4MADA 5AECA 2YDQA 4DWSD 1PHWA 2RDXA 5MKGB 3BJFA 2WQDA 1FOBA 1LLWA 1QK2A 3MWAA 4LGXA 4IUGA 4UMBA 1OABA 1S39A 1GOKA 1OYAA 3QEZA 2BY2A 3PNUA 2INZA 4FIRA 3SO7A 1DQXA 2NQ9A 4ENLA 1WQ5A 3G3MA 1P48A 5BCAA 3BV4A 2PCEA 1FFRA 3VOCA 2YDRA 3NQCA 4QTGA 3UFYA 1MDRA 3WBXA 4C1NB 3W7JA 4TVDA 4JNMA 1XG3A 4GVGA 1XQLA 1TPEA 1UIPA 2V5LA 1KRCC 3TMQA 1A3WA 4XO7A 3H7UA 3BICA 5EMMA 4O1DA 3V0SA 1PCWA 4BHYA 3KUMA 3W85A 3UWEA 1XRTA 2VNCA 4CNOA 3SCPA 1SJBA 4DF2A 4AAJA 1KFKA 4UTTA 4JTTA 3CLMA 4PRTA 2PP1A 1Q45A 4MWAA 2Q6ZA 2HISA 5IXEA 4HA3A 1KM2A 3MY9A 3BLEA 4X22A 4AWEA 3T42A 3V4BA 1R2SA 4GJJA 3OZPA 4K1GA 2OXNA 2QULA 1UMYA 3BMXA 4RL3A 1B2YA 1LOSA 2QVNA 3W2JA 2HVOA 2X1UA 4AX6A 2ZXDA 3WF4A 3VDGA 7CGTA 3F4VA 2Z27A 4GHRA 2POTA 4EPKA 1V3IA 2J13A 2PS2A 3CYJA 5B80A 4LEQA 2WNQA 2QDGA 4G7EA 4OGZA 3T05A 3GUWA 2DUZA 1MEHA 1S3HA 1UA3A 1O66A 2VFFA 4ROPA 3MU7A 1OC7A 5HK4A 1K03A 3KVKA 1F6YA 3KVMA 4LB4A 3WG6A 2OEKA 2OELA 1R46A 2XGIA 3AJXA 3ITTA 3CB8A 4P7LA 4C6PA 1XDLA 3SQMA 1RBLA 4W5ZA 1QOXA 3RMEA 5PTDA 4FXJA 4HHPA 3THAA 4FF5A 1UKTA 3AOFA 1P0KA 3GVWA 3IUHA 1TIMA 4HPNA 3H2FA 1ME9A 3CAVA 1TPWA 2P76A 2WPGA 1MW3A 3KVJA 1GJPA 1PO9A 3KEHA 5FF7A 4XAPA 5CSUA 3AAMA 3JZEA 1R3RA 2X0SA 3AHXA 3QV8A 2BASA 2NUXA 3UBPC 2DH2A 1AJ0A 4NX5A 3LLXA 5LXXA 1DJIA 1XYFA 4O1FA 4LT9A 3PZVA 4HOZA 1W5NA 2OKOA 3ZSTA 4AHOA 3B9NA 5F2MA 1NDYA 4TX9A 1Z69A 2VD9A 4O1CA 2VEFA 3B0VC 4F0HA 4YXGA 1BWKA 4FLOA 2QCDA 1PWMA 3ARSA 4BJHA 3O8AA 5F4WA 1KR1A 4IIGA 1NWUA 3TYZA 3WK0A 4DYJA 1B4EA 1M04A 4FXSA 3M0XA 3FXGA 3BAXA 4PMQA 3AICA 3WL1A 1J6PA 2OYKA 1FBAA 3ITGA 2V6AA 1JZ7A 5G2WA 7ENLA 1CI1A 1GEQA 1OCQA 4HU0A 1EFZA 3EKGA 4IMDA 2WHMA 4ZCWA 3LMZA 1Z32X 3SSJA 3WFZA 3VIJA 3FOKA 5C9ZA 4X61A 2YB4A 4LALA 4LF1A 4AIUA 3WJZA 1KC7A 2WLZA 3IJQA 2W62A 4Q4MA 1PKYA 5I3IA 3CPGA 3VNIA 5CH9A 2W9MA 4MY9A 3U8GA 4IPLA 2FFCA 3K1GA 3UJFA 5AYIA 3M43A 4MPKA 1CTNA 1OFPA 4IX2A 3DUGA 1M1BA 1XIIA 3W1LA 1RJPA 4ZB2A 4AF0B 1HZYA 3WQFA 1CX9A 2BTMA 5J5DA 1UH2A 1IGWA 2GYIA 3C2YA 2PDLA 4LCQA 4MNLA 4XIAA 2WVSA 4Q8TA 4ZO8A 1HO4A 3VE7A 2WVVB 1H7WA 3M07A 3SJNA 1QNSA 5DCDA 2WO5A 3CWNA 2GJLA 4IISA 3LNPA 4CD8A 4PSRA 2X0HA 1PX8A 2FZBA 4UOJA 4ZQMA 1EKOA 2ATMA 4IPIA 1XLEA 2VKZG 4AZCB 2AGTA 5EL1A 2CEQA 4KWSA 4LW7A 3TE9A 1IT8A 1XD0A 1WKEA 3DAQA 3L66A 4IIFA 4JYEA 3OOQA 3VD3A 5HXMA 4K8HA 2Y89A 4HU4A 3M7WA 4KCVA 4RZ5A 2R1KA 5C0QA 5M5DA 4DPPA 3TCSA 4JXCA 3GK0A 4BI6A 3WD2A 3Q4DA 4GI6A 3U6WA 1ITCA 4IL2A 4WUIA 3H54A 1E1FA 1UR0A 2C16A 1BVZA 1TMQA 5HAOA 3RRXA 3ZWTA 3GDRA 2J7FA 3ELFA 3EKZA 3A12A 3ZJKA 1UP0A 2A3LA 5T9BG 3H2EA 3PHAA 3FCPA 1QJWA 3P81A 2JEQA 4PCTA 2XN1A 2CXGA 2J9XA 1EJRC 4EAMA 4FB7A 4FXRA 1DXEA 5C7HA 1TE1A 3URNA 3MCOA 1LUCB 5FCZA 3G6MA 2E9BA 3CU2A 5FEXA 1E9LA 3AMLA 4YVXA 1UJPA 1LRNA 3GDBA 2UY4A 4JIIX 1T0OA 2TYSA 4H9XA 3IUDA 1UD8A 4Q32A 3WEMA 3KTXA 1KGWA 2YCLB 4S2BA 3W25A 3I6TA 3IACA 1XS2A 1NEYA 1A4MA 2YZRA 2PDHA 3SRKA 2XWEA 4JQ1A 2PWEA 2XHYA 1PHQA 1SJCA 1CGYA 1DTNA 1F8IA 1NDVA 4H19A 3QV6A 1FCQA 2Y70A 4LUJA 1OBAA 1OGBA 3SDOA 3CUIA 4U2ZA 3NQGA 4PMDA 3T6CA 3MSYA 3GG0A 4L1XA 2BY1A 4JTIA 3ARUA 4JL1A 1IEQA 3APTA 1UR8A 1GOMA 1QCWA 4AY7A 5A1AA 4LUTA 2VEKA 3QR1A 4ZSUA 4N9DA 1A5KC 4JPGA 4MF4A 1AUSL 2XSXA 1EWEA 2Q8LA 2GSHA 1TV4A 1Q7ZA 5FJTA 3P6LA 5LYRA 1JULA 2OSYA 1GVQA 3NL2A 1H1YA 2FTYA 3MP3A 3TWBA 4GX9A 4RXGA 3NL3A 4LPCA 1Y5VA 1ADDA 2O55A 4Q7BA 5EMJA 3VXGA 2C18A 4NG3A 5FF4A 1XCFA 3ZOAA 1CNVA 4ZGYA 4GE8A 5MHBA 4UOZA 1FH9A 3MO4A 4BEUA 5C9WA 3N25A 4AC1X 4M19A 1E0WA 2ZC1A 5A6BD 2QPUA 4NRRA 4L61A 1TO3A 4X3ZA 4LB3A 3V0TA 1B9ZA 1F76A 4GABA 4F0KA 5CPMA 2OLHA 3FSTA 1LT8A 4EPEC 2W66A 2E5BA 3SADA 2WYSA 4JKMA 3DHDA 3HPAA 1S5VA 1SMAA 1J0KA 3ARTA 4WKHA 2WQPA 4R7WA 2NQHA 1LCOA 3WSUA 2PWUA 4A3QA 1F5ZA 2ZICA 1QI5A 2VD8A 1DJGA 2HWGA 4DLMA 1CECA 1V77A 1FA2A 1TV5A 1OG6A 4GQBA 1F05A 3TYEA 1SGJA 1DJZA 4NSBA 5DX7A 4DRSA 1TB3A 2PSNA 4WDWA 5I2UA 2P5NA 3IVSA 1CEOA 2JGQA 1CT5A 2GJXB 2PDNA 1VAHA 2E7FA 3M4HA 1TZ9A 4ZXLA 2DDXA 1AQFA 1T99A 4HMCA 1IR2A 1UCWA 5DMNA 3UCDA 7TAAA 3PK7A 1TIWA 3EEZA 1D3HA 2WVUA 2VDHA 3MMDA 4RW3A 4ZO7A 5F4XA 1W3IA 2DIEA 3EDFA 1E70M 3KP0A 1ONWA 4KRTA 3WLNA 5DY2A 1ZPTA 2OT1A 1GVRA 4P7NA 4QJ5B 1E43A 4F9JA 3U9IA 4XTIA 1B3WA 5D04C 1JPKA 4GO8A 3MV01 3D47A 3QFEA 3MI6A 3E12A 3CV1A 3RXZA 2CBIA 1R5YA 3QC0A 2FZNA 3DC8A 3WEZA 3U2EA 4Y2WA 3W24A 5GNZA 5LA2A 1OCNA 3KBSA 2VEIA 3GRIA 3B3DA 3GS6A 4QIUA 1V08A 2XFWA 5FL1A 4C60A 1WP6A 3VCCA 1QWKA 1BKSA 2RGMA 1CCWB 2DIJA 2VWSA 1EX1A 1A5MC 4HHHA 3KBWA 3NYZA 4M1BA 1S5NA 1YXYA 3UWVA 1UUOA 4NAFB 1RK5A 3CQHA 1VBRA 6CGTA 3QKEA 4HNVA 3NQ2A 3OBAA 2WLYA 3SJ3A 1PB0A 2JF7A 4G8TA 3UCCA 1H11A 3LLFA 3P60A 2PLMA 2PDXA 3NEVA 4QLKA 3PZMA 3DFHA 1XSJA 2ZIDA 2GFTA 1KTBA 3POCA 2QGYA 2J8GA 4QGCA 1L2UA 4PTDA 4W8AA 2X40A 4QE5A 3L5LA 3QYSA 1SW3A 2BVTA 3NYDA 2B7OA 4H2HA 3R11A 1EIBA 4JTUA 4JDYA 3JR2A 4G7FA 3F5KA 2X16A 4J7RA 4EANA 3AS3A 5D8WA 1KRBC 3AMCA 3W6LA 3GC4A 2PGEA 4KWWA 5ABFA 3QSRA 4JTAA 4J1OA 3GIYA 4LV4A 1IZKA 1PJ9A 2V2CA 2SFPA 4O57A 3ES7A 4X2RA 2KX9A 5MF5A 2CLEA 1HGWA 3WQDA 4A2SA 5FJRA 4AEEA 4WDTA 5FOOA 4QDMA 1V0MA 2I5QA 1XH0A 4CQAA 4JGDA 2A2IA 4U5IA 2GJRA 3SM0A 3W02A 4JX5A 1F8MA 3SN1A 3SIZA 3SCWA 1R87A 4MHBA 4OU1A 4NYYA 1YNPA 4PCPA 5D2VA 2A6NA 3BAWA 3W9ZA 4O1EA 1KRAC 4L64A 5FD0A 1IT7A 3B8TA 2O9TA 4HZ8A 2OOGA 3A4JA 1DBTA 4HYWA 3WN6A 1J0ZA 4KQNA 1JRCA 1TZ7A 3K2GA 4MNJA 4IMCA 4KGJA 2WJEA 5CPTA 2DFAA 1OCBA 3LU2A 2CZEA 2Z00A 4L4MA 3ECQA 4IQDA 1EJUC 2G96A 3HJEA 4XBJA 2Y2WA 2WCSA 4YLWA 4OIFA 2FHBA 5AHEA 1U22A 2J9YA 4S3AA 2J7CA 3D3FA 3IJ9A 3KRSA 4OFCA 2D1ZA 3NR0A 1FWJC 2E1WA 1XYBA 3NO1A 2ZUWA 2Z24A 4WVXA 1SZEA 2WNZA 3BCFA 2J74A 3M0VA 3W7LA 1I1XA 4HP5A 1KGUA 3KZPA 4IZGA 1ZP4A 1XCWA 2WC7A 3PVFA 3BSMA 5IHRA 3CTTA 2CZDA 4E5TA 5EMLA 3U2ZA 3TW7A 3W88A 3S1WA 4HVXA 1V6VA 1W1IE 3MC5A 5AYYA 3GG1A 3L5AA 4FX8A 1Z48A 3UVIA 3PPCA 4UFIA 1LOLA 5FL0A 3AFBA 1SO3A 2A4AA 4H2CA 1KLZA 3N3MA 1J8VA 2HE8A 3U7VA 3LS9A 3ZLFA 5FJJA 5H8MA 3B8WA 4NZ4A 4O53A 3UEQA 4WGHA 2XVPA 3M6DA 3ITLA 3WDQA 3FDKA 4W88A 1DEDA 1H5VA 2FZMA 3TN3A 4ZA0A 3PM6A 4ZFMA 2XSAA 1L6YA 1ZCCA 3B9DA 3WY1A 2FVLA 4RE3A 3QOKA 4GZIA 3W0KA 1P6WA 4EWJA 5CLWA 1R85A 1EGZA 2JEPA 5CPNA 1K3UA 5AZ0A 1P4CA 2VEMA 5AC7A 1P6CA 3A47A 1HIZA 3SIMA 2CZVA 3NZPA 4PMJA 3HQNA 4CQDA 4B9YA 1VBHA 1C93A 1LT7A 4CCCA 1BGAA 3BG3A 1LYXA 5BXPA 1U1HA 3PTDA 4AH7A 1KBBA 1XLLA 2QAFA 3A5VA 4S39A 3PBMA 1BSIA 3VAVA 4DJEC 3FAXA 2I9UA 3KVLA 4Q33A 2XH4A 3PBWA 4H7CA 1SVDA 3E5PA 4QDWA 3G18A 4UQCA 3TK7A 4HCLA 3AXHA 4EXAA 1O94A 1FUYA 1E56A 1Y8BA 2WSKA 4FLQA 4DYKA 4PUEA 3M0JA 2Z26A 3UJSA 4Y6GA 4DELA 1SJAA 3N19B 2WKLA 4K7VA 3LRKA 4AVOA 9XIAA 1QMLA 1P0DA 4MM1A 1BHGA 4RE2A 3I4EA 1GVFA 3N2BA 5D8ZA 3VIMA 4O15A 3C0QA 5DMMA 4PL1A 3WQGA 3UG8A 1VEPA 1J12A 5D9MA 2NUWA 5HNTA 4M6UA 4O17A 1T40A 2GQ8A 3T55A 3GR7A 1V3MA 3N2MA 3RLVA 2GSJA 5K4XA 4D6DA 3HTWA 2BXVA 2PP3A 2Z7GA 2NX1A 5G4EA 1R3SA 2NUYA 5I6SA 2WMJA 1D8WA 2XIQA 4XK2A 3ANVA 4GYPA 4L6HA 1FP9A 5FI8A 3A9IA 1XPYA 1ICSA 4W8BA 4WIWA 1VZWA 2ZBTA 3W2MA 3P5YA 1UD5A 3C3NA 2PDPA 3SRHA 5AC8A 1G7VA 3GBDA 4Z2LA 4E8GA 1TMHA 4ATWA 4WK9A 1G4PA 1W3TA 3GIQA 1TZZA 2OQLA 3S5NA 3STFA 5CZTA 4AWSA 4PMYA 3MHFA 4OHQA 9XIMA 3TNOA 3G1RA 1XUUA 4WKAA 4GLEA 4B92A 4M1RA 4N42A 4AZBA 1ELSA 3N2OA 2ZKMX 2ZYFA 3ARYA 1X1OA 2NV1A 2BMBA 1TREA 2PU0A 2GDQA 2HS6A 3DBNA 1O5QA 2O9RA 2XG9A 2Q02A 5JBDA 3GXIA 3WBEA 2VZVA 3VKDA 2PLJA 3HM7A 4MJMA 3LD5A 1XDJA 3QMRA 1N8FA 2Q3RA 2OKTA 2Z6IA 2UY3A 3WF0A 3OGRA 3TA9A 2Y24A 2YBUA 3G1YA 2NXHA 2FJKA 5HJYA 4R53A 4PR4A 3UYCA 1KFCA 4DZHA 4US6A 4W9TA 1M03A 1M3UA 1KGXA 1VFMA 3VMOA 2PDWA 3TCEA 4ZOCA 4NZFA 1JNEA 3PULA 4ZE5A 2PWDA 4RPPA 1IIGA 2HBVA 1OFRA 5DXXA 5JH1A 3W7CA 4AZIA 4FO4A 4QNEA 1LLZA 5BROA 4TTUA 4M51A 2PDUA 3CZ8A 4MZ1A 3L68A 1OX4B 2FQIA 3GIPA 4GBDA 3APYA 7REQA 3T0DA 4RNHA 2X7VA 4TMCA 4IH3A 3LI1A 4H6KA 5C54A 1HN1A 3SUSA 2OCZA 3GHRA 1OB0A 1NDZA 1V7YA 4LBUA 5G4WA 3PP7A 3SCNA 5LNSA 3B8DA 1XKYA 3OLGA 4LRSA 4AU0A 1OYBA 3S5YA 1C8XA 2NT0A 3UGRA 1DIKA 1UH3A 2BNJA 5U4NA 1UASA 2OOFA 5IHSA 3SY1A 1Q6EA 2QT3A 3LQGA 5CZKA 1L6GA 4IIDA 3LPOA 1BVWA 2WSRA 4J35A 5H8PA 1CXLA 3REQA 3E0LA 3VFCA 1GT8A 3B4YA 3TSMA 5KZ6A 3HA1A 4GH3A 1IEXA 3FGCB 3KRUA 2GWNA 2R8WA 1BQGA 2HXTA 3CV7A 3U5UA 2G50A 1FWIC 3ZMRA 1QI3A 2QQ6A 5E6ZA 1ZP3A 3CH9A 1F3XA 3K8MA 3IIXA 1CGWA 4UQDA 2VFDA 1GPWA 2RH9A 2QV4A 1I4NA 5IBXC 1TYGA 5F1UA 2OSWA 2BSLA 1JJKA 3GR8A 4HCHA 3B8UA 5MKGA 2Y5EA 3VCRA 1TFVA 5CPOA 4CQ9A 4MFEA 2YCIX 2EQDA 4QE1A 1JNDA 1ZB5A 3CAKA 3P74A 3MSDA 4JTEA 3PSWA 4LNYA 1LL7A 1VJSA 4WRHA 4I7UA 1OFQA 3RU6A 3RG6A 3TC6A 2O4MA 1E71M 2DSKA 4M56A 1MNZA 2BB0A 2ZXAA 3UXLA 3CV2A 3S2CA 3ARZA 2Q8ZA 4QFUA 1EQPA 3V1HA 1KV5A 2NQZA 4HCDA 1XSIA 3LY0A 4DUOA 4QCFA 4C5ZA 4N0RA 3R2GA 1UR9A 1C3FA 1DJHA 3LB0A 1NP2A 3CIXA 3LHZA 5C8BB 3GY1A 4IT1A 1TQXA 2AL1A 1XIHA 5JIPA 5K4ZA 5DCBA 1TPUA 3WH8A 1BYAA 3NGJA 3AIBA 4O18A 3RILA 3H8AA 4QROA 2G37A 2VOTA 5A69A 3MDWA 2VYOA 4DJDA 4MB3A 2A0NA 3JZUA 5JMUA 1U83A 2XN2A 3V36A 1A47A 3M0KA 3WFAA 4K38A 3R1ZA 4DUXA 4LANA 4HSNA 4GH1A 4C6EA 2EPHA 1QW9A 3CLWA 2G4FA 4M24A 3WQPA 2Z28A 4WY0A 4XZWA 1JZ6A 4W87A 3JVAA 3A23A 3H12A 5EMUA 1FWHC 3N73A 3GHUA 3C2RA 1V6YA 2GGGA 4Z2JA 3TYAA 1CXKA 2ZDSA 4EF8A 4JFTA 3R5EA 3TZNA 4AYGA 1S38A 2V3DA 4DJFA 5T91A 4JIHA 3QJAA 3HB9A 5I3HA 2NQJA 2IPFA 3O2LA 3CHCA 2R9RA 4Z0JA 3CNYA 3F1QA 5CG0A 4H9ZA 1JZ8A 1EDTA 4CCDA 4GIRA 1JZ5A 3SUTA 2O0TA 4UTTC 2I9EA 3F4NA 2YA0A 3N9KA 4QJ3B 1OIMA 1OEPA 1YE6A 3IJ8A 1XIGA 2JF6A 2YXXA 1I2QA 5D2YA 5CJNA 3ZLGA 4EPDC 2PEVA 1ZGDA 3GVGA 4LAKA 2ZXQA 4MJ2A 2H3BA 2X7WA 3OA3A 3I7RA 3TW6A 4AYSA 4AX7A 3BW4A 3LCXA 1G6CA 2V67A 1AA1B 3FEQA 1JDFA 4LCRA 4B4FA 4C6JA 2V2HA 2FJUB 5A8NA 4IGSA 1H1NA 4G1KA 2ZWZA 2Z25A 4QS5A 3DGRA 4PBEA 1B90A 3NVDA 1R3YA 3V18A 1W1VA 3QOMA 1AVAA 1QASA 4AG0A 3L21A 3PB2A 2R14A 4L4OA 2D22A 4RE4A 1OF6A 5BMXA 1MSSA 5IM51 1PIFA 1PZ2A 1FFQA 4MFDA 2JIWA 2IMRA 5DO8A 2QDEA 1W32A 3TYUA 8XIAA 3UZZA 1MWOA 2BBFA 5CZJA 3OLDA 4WSJA 5EU9A 5BU6A 4AISA 3H4GA 1F74A 2JALA 2OEMA 4RX0A 4TV6A 1R6WA 5HDRA 2PC8A 3RLUA 4XO6A 3UNDA 3QLDA 3EXTA 1DTUA 6ENLA 2HNEA 1FHUA 1WUFA 1UWQA 5BNKA 4TU1A 5LZLA 1DL3A 3HMJG 3M5YA 3UZWA 1EJTC 2YDSA 1RD5A 1WA3A 3TTSA 4A21A 2OTDA 3S2LA 1OX6A 3KTSA 3HPFA 4GNJA 4N4QA 2QPXA 3T0TA 1JCLA 1DPMA 1XD1A 3UVAA 4GIAA 4H9TA 3WLJA 4WDXA 3L4VA 1R7AA 4H7VA 1KFJA 4GQRA 2V82A 1V8EA 3WCZA 3CB3A 1EPXA 1CIUA 3AS1A 2BZNA 3BURA 1IYXA 1QOPA 1HXJA 3F7JA 4NJGA 2HCVA 1JCMP 2VTFA 4AZCA 3ARQA 4JX6A 5TNVA 1SW0A 1LRTA 1TVPA 1VYRA 3AS0A 3OLEA 4HSOA 4S3CA 4IMEA 5XIMA 3FFSA 4U28A 3OGVA 4YVPA 4JY9A 1WAUA 3SAZA 3VNDA 1R2RA 5I78A 2YCJA 1WOBA 2OO6A 3MUZ1 3CM4A 4MWAB 3ITOA 3WO8A 4WD0A 3UWUA 1MZRA 5C70A 3WQVA 3WLOA 2R94A 4P7RA 2PDFA 5I79A 3HQOA 1ZQ5A 4US5A 3GUGA 1A49A 3G1DA 1EB3A 1EYWA 1O7AA 3EAUA 3IJLA 1EP1A 4G7EB 5HJXA 1GONA 3GKAA 4D1JA 2G8ZA 5EBUA 3C4UA 1HTIA 5DQPA 3WH5A 2X05A 6TIMA 4UQ9A 5H1WA 1JCNA 2TSYA 1GW9A 5G2IA 3KL5A 4PTVA 2WZEA 2YCLA 4ERGA 3BK0A 3Q45A 1T5AA 1KKRA 1XQKA 2YL5A 4MB5A 3GXDA 1XLCA 4ZQNA 4L4LA 3WK1A 4ACZB 1NH6A 2VGGA 3KS5A 4M3PA 5G1TA 1EXPA 3ABOA 2J25A 1OFOA 4CU7A 5BOFA 3AHVA 1J0JA 1EJXC 2WSPA 3QY8A 2Q3OA 3L2MA 2X8RA 5JBEA 4RCXA 3PJUA 1XF0A 2CLHA 2QUNA 3LGEA 2VRQA 1QW7A 4XZHA 4HNNA 4HU3A 3N13A 4IGHA 4HPHA 2Y6ZA 4DEFA 4B5SA 4H01A 4Z2GA 1Y5WA 2VXNA 1GPFA 5D9PA 3NQ6A 4IIEA 2QCDB 3K4DA 3VILA 3PFRA 4PCFA 1YHTA 3C52A 4TO8A 3SGGA 3W00A 4Q7IA 3H55A 1TCDA 4RV8A 3NTYA 1D8CA 2DVUA 4XVDA 5BRQA 4MWAD 2BOGX 5CSRA 2TRSA 3H4WA 1PDZA 3W1TA 2XVKA 4PMOA 4IFKA 1W0MA 1GCYA 3VC6A 4M0XA 3EWWA 1HJVA 4JS3A 1XG4A 2PB1A 4JD4A 4ZOAA 1JZ2A 4MUPA 5JH2A 2JGYA 3EEGA 2EPLX 1FTXA 4XZNX 2WNNA 4H3DA 2I5GA 1E0VA 4ZODA 3BJSA 2J9ZA 3PUOA 3IWPA 4NJJA 5C2GA 1Q6LA 3QTPA 3KW3A 2FGBA 5AZ1A 2W91A 4KCUA 3NO5A 1TA3B 3TYDA 1Q7QA 2NX3A 1J2WA 3RR4A 3MZNA 4WQ6A 3TVAA 2DJLA 4DBWA 3GVVA 3VGDA 4ZE4A 3CAWA 2QCGA 1S2AA 2G4JA 3RPTA 4BFAA 4JFWA 3MYOA 3L0NA 4B3KA 3USBA 4IJRA 2VC9A 1ZAHA 3EX2A 3FDGA 1POKA 5CJMA 3S1VA 4NZ3A 4S3EA 1R47A 2P0IA 1QBBA 2WOQA 1UC5A 4ASTA 2LLEA 4YCPA 5HNNA 2VGFA 5EFDA 1F9CA 1R38A 3CXOA 2EF9A 3UPWA 3G8RA 5I24A 5JBFA 4YTUA 2NQLA 3ZR4A 4W4QA 4O52A 4DO7A 2BS9A 4K7YA 1FWTA 1OX5A 1I0DA 1YBQB 4JQ2A 1H7PA 2Y0FA 3JRKA 4GXPA 3CZJA 1Q2RA 3TLLA 4EACA 1E6XM 3AIWA 4KF1A 1KCKA 2BODX 4ZB0A 4S3KA 1H60A 2F6KA 2JKEA 1F61A 4QNWA 3EWDA 4HKPA 2NVAA 4OV9A 3WELA 1W56A 1OCJA 4J3TA 3GFXA 4QEEA 1B31A 1G5AA 4HJWA 3I65A 3IJ6A 4BY3A 2IPGA 4WXZA 3K5XA 1KKOA 4PTXA 3NDOA 4D2JA 1KBIA 4RNFA 2XPKA 1H63A 2PZ0A 4PMXA 3Q94A 4ZBCA 4G1NA 5EY5A 3AO0A 5F2IA 1SPQA 1SZRA 3ZR6A 3MP5A 3BGAA 1RQHA 1MRQA 1UKOA 1O12A 1J18A 1Q6DA 1CGXA 1ZS2A 3OZYA 3AMDA 3FYPA 4XD3A 5J5RA 2WBKA 3DOPA 2XIOA 1E40A 2RKXA 1XUZA 5C9XA 3LM7A 3A3XA 2GGEA 3MUY1 4C1KA 4GZ7A 1W1B1 3GDLA 3P80A 5HULA 4R34A 1OK6A 4JN6A 1EXBA 3BVJA 2G95A 3WJXA 3D0CA 4MLJA 4R9OA 1DXIA 2ZOXA 4GJIA 2C0HA 2ZVRA 4JL2A 4FNSA 2X2GA 3N34A 2R1PA 4DIAA 1IR1A 3BGGA 4D8ZA 2EXOA 2R1NA 1WAWA 4BWLA 2CETA 1W1YA 3Q58A 4E8CA 3BLPX 1XGEA 3NZQA 1HFBA 4DM2A 4LUTB 4PTWA 5FJPA 4JCMA 4PN2A 3KM8A 3BDKA 4E38A 3T2QA 3K46A 3NZGA 1YLVA 4TXEA 1V0NA 1YDNA 2QJHA 4XAFA 3LHYA 4NAEA 1QUMA 2O4QA 2FPTA 4Y7EA 3GG7A 3HBLA 4YTQA 3HF3A 3DH7A 3GYEA 4IM4A 3LBCA 1B3YA 2YYUA 3GAYA 1SW7A 1YPIA 1TX0A 3ITXA 2AMXA 2Z1BA 4HSHA 1FHVA 2J78A 3ANYA 1F6PA 4V1YA 4B5VA 3F2BA 1T6MA 5FSEC 1VR6A 5FIPA 1ISVA 4RV3A 2J77A 5AOUA 2FTWA 4MNMA 2P88A 2XINA 3W27A 3RHGA 4IQJA 4HQVA 4QLLA 2WMHA 1TUFA 2C19A 4LYPA 1W54A 4K68A 3S1UA 3PTKA 1A4LA 3R8HA 5E0KA 1LBLA 1Q3NA 3NURA 1H7NA 1S2UA 5D2TA 2J7EA 2NT1A 2WJZA 4IMGA 4FSAA 3B4UA 1HG3A 4R85A 4DBEA 3W37A 2RDWA 1VPXA 1H0IA 3AZSA 4C6CA 3O0FA 2GVGA 3DX5A 1TCMA 3KDOA 4NNBA 4AEFA 2Y8UA 1UBPC 2CZFA 5C2XA 1IEIA 1JPIA 1JF6A 1V0LA 4UTLA 1AD4A 1E4MM 3HU7A 5H2ZA 3YPIA 1AZ2A 1R7OA 3UA4A 4O16A 2V5BA 3UD6A 4UQBA 3IIVA 3WNNA 3UP8A 1TJ1A 3W7PA 3N04A 3PWIA 5BRBA 1B54A 4HPJA 3RO8A 3PBVA 4XAZA 2NLYA 1D2KA 3CL8A 2V81A 4XKMA 3WF1A 3PFMA 3W7NA 3ZLHA 3HQPA 4WGXA 4D71A 4ERAA 1OIFA 1TWWA 4PTMA 3K13A 4WJEA 1QR7A 1JZ3A 4LTSA 2E0PA 4MJZA 3LLDA 4PODA 4YCOA 3DFQA 4LF2A 3RAOA 2R6OA 4L5ZA 3H26A 4ZMGA 3WQWA 4HA0A 1JZ4A 1Q63A 4R9XA 3L0GA 4L4PA 1HVQA 1SM9A 3F2DA 1LQ2A 1WDRA 1ONXA 2WM0A 5EPDA 1AJ2A 3SQSA 3GDMA 4Q4KA 3THUA 3M7SA 3UZXA 4H6QA 4CD5A 4J27A 3ARWA 2ACRA 3MUCA 4N9EA 3A3HA 3LCWA 4IGNA 1G0CA 1M01A 5HWNA 3EZ4A 2ZRWA 1G7UA 4RZ4A 2JK2A 4UTWA 2VCBA 4TVCA 1KFEA 1YTDA 2HS8A 5FA5A 1HP4A 4E3TA 1W9PA 4UXDA 4UR8A 1XM3A 4GX8A 3VA8A 2P8CA 4CKQA 1IEWA 3BH4A 3N3TA 1JAEA 3EBVA 3L4ZA 1UW9A 3KDNA 1WKYA 2AGKA 1BTCA 2D69A 2HPIA 3VD5A 2FTPA 1M7JA 3E0FA 5AC5A 3KCLA 3NNTA 3M6YA 1PZ1A 3IGXA 4CCEA 1DIOA 1RCQA 4PE8A 3AI0A 4NZ5A 2A79A 4GYFA 3TQKA 1JI1A 3K1DA 2Z2AA 4JTGA 3GFYA 4CNUA 4JQ4A 3TZFA 4NL1A 4DI8A 4ZTYA 1A3XA 3BLFA 3A21A 3GBEA 4JTJA 4HU8A 3UYIA 2YLAA 3OEXA 1UUMA 1FWSA 1MFUA 1QPKA 2XDFA 4UCGA 2OR2A 4N02A 2X09A 3VOJA 3GW0A 3IVUA 5ABFB 4L9YA 4RNIA 2YIHA 4J3XA 3MUIA 4HMNA 1SSGA 1OSEA 3RLGA 3GVQA 3S4TA 5CXPA 4MY1A 4AMAA 4WOQA 3NG3A 3KRBA 4L7ZA 3GNNA 1HL8A 4AFYA 3ERPA 3N4EA 3BTNA 4NKCA 2A3HA 5CPLA 1P0EA 2ZUUA 3OA5A 4IPPA 4J3VA 5KEZA 3ABSA 2WZTA 2AL2A 1GZ1A 4LAZA 4AQLA 4YNGA 1GVYA 1YDVA 1BGGA 1M7PA 1PTDA 3BAIA 3KS6A 1X97A 3GH5A 1YW1A 2YOCA 3HOJA 2QR6A 5AHFA 5C71A 1I2PA 1M9HA 4DVOA 4J28A 5CQ1A 3OG2A 2QV5A 1VIWA 5E0CA 4ALDA 4UTJA 1DJYA 4FNRA 5HUPA 4V2XA 3IJIA 2BGQA 4IJCA 1GJWA 4C6FA 3GC5A 4D6JA 5JU6A 2ODOA 4AIOA 4JZ5A 4JIPA 4NT0A 5GJMA 3EXSA 3PJWA 5GNYA 3WEOA 2J27A 2OT0A 1ISYA 5D32A 3BPWA 4TMBA 1VFUA 3AIRA 3MTWA 2QCEA 3MHUA 3CIWA 2YXGA 3VDAA 4F48A 4GYPC 5SWUA 4AD4A 1FWBC 3PAJA 3P93A 3G1SA 2IKIA 4N6FA 4NZCA 2P3ZA 2Y8VA 2OGJA 1MEWA 3V16A 3BW2A 2QMJA 3GO2A 3URBA 4RDWA 1C7TA 4G9PA 2YL9A 2WWDA 2EEXA 1RVKA 4DI9A 2CESA 4QG9A 1T8XA 4B9ZA 1OX4A 5C5YA 2I5IA 5CZSA 4CN6A 3WUBA 2NWRA 3LRLA 2EBNA 3WZ0E 4GISA 2Y7DA 1X98A 4I7VA 2W79A 3B97A 3QF0A 5LNRA 1EC8A 4Q8QA 1RVGA 3W7RA 2QW5A 1P6BA 2FH6A 4ZL1A 2ZZ3A 3GU1A 2XVGA 4O0KA 3QPZA 1GKRA 2HROA 3VFLA 3QW3A 2ZA2A 2W27A 4N6EA 5A8MA 2A21A 3CGTA 4JR5A 4KH2A 1OD8A 4Q8WA 4RDVA 1W31A 4K8GA 4HN4A 4B91A 3VZXA 3R12A 3OPSA 3WNPA 5U7SA 5TAOA 3GM8A 1MRAA 2RJGA 2ZDRA 2OX1A 4FNTA 1JYXA 4YHGA 3BUVA 1XSKA 2IPJA 3GB6A 3DHUA 2QEZA 5GQBA 4AIBA 2FGLA 1MYRA 1IZCA 4Q8MA 1ODUA 3FHQA 2BDQA 1T7LA 5A2CA 2C14A 3WDIA 4XIMA 2V8ZA 2W92A 1FP8A 4HA4A 3VNKA 3LENA 4UB9A 4U2YA 3EOUA 1V02A 1WYIA 2ISSA 2VDIA 2VZTA 5REQA 1XPGA 1UG6A 4IG2B 3C86A 4QG8A 1ZRQA 2W6RA 3W1NA 3GLCA 3WLMA 1KFBA 2IKJA 2H3DA 1L9WA 1O68A 4ZFCA 2POZA 1JCTA 5ENLA 2KZHA 3HPZA 4GKLA 4Y9PA 1OQFA 1K70A 1EQCA 3MPGA 1ZHAA 4IP4A 3KCOA 5HWJA 4WZHA 4G2DA 1DQWA 3EB4A 3F5LA 3GXTA 5FJIA 3E2SA 4KWOA 3OHIA 4QCEA 4AEOA 2HXUA 2GGJA 2QJIA 2FDMA 4OWGA 2UY2A 3HGJA 3GVRA 1R9YA 2J24A 2V30A 1XRVA 1H50A 2DVXA 3D6NA 3P0WA 4PUNA 3MB9A 2INFA 3EX3A 3QY6A 3SRDA 3CHEA 3V5CA 5KMYA 2J75A 2PDIA 4XKYB 3VIIA 4R88A 1XIMA 3F03K 3KBVA 2QCLA 3W2LA 2I7GA 1Q6RA 3R8GA 3UXKA 2A5HA 4J40A 4D9PA 1VRDA 1AZ1A 3RO6A 1A3HA 3DZ1A 3TXVA 3V75A 4DF1A 1XKJA 2V5JA 4LU0A 3WK3A 1V7AA 3D46A 3VTRA 3QRHA 2QZRA 3I68A 3VNZA 1SO5A 3AYSA 1UD4A 4LWWA 4IFOA 3B0UX 3W71A 3M47A 4Z1CA 2HDJA 3E0IA 1X6UA 3AHZA 4NJKA 4PUKA 1E5JA 1WE5A 3CO4A 3OZMA 1KRMA 3CEPA 1HJSA 4K1WA 1PPIA 4B3ZA 2E6DA 1MUCA 1S46A 2ZUVA 2VZOA 1A5CA 4OV4A 4ZO6A 1GOWA 1QDSA 3W1RA 3M44A 1MFVA 1W6TA 2VQTA 5LHEA 2NLIA 3PNZA 9RUBA 2QJJA 1IF2A 2Y8KA 2FDSA 4GACA 4PCNA 3GAKA 5E6YA 2DPEA 5CC5A 3E2QA 3VIPA 3FYOA 2XVNA 2VGIA 2YKKA 4GRSA 1KM6A 1WBJA 3IS4A 2OG9A 2GQ9A 3CQKA 4QHRA 3VABA 3H4XA 3LSBA 4Z2HA 1EJVC 3CH0A 2DQWA 3I3EA 2WKJA 3ZSSA 2PPGA 4H41A 6XIMA 3OJGA 2XN0A 4HK7A 1A5UA 4M7TA 3M5ZA 3UR7A 3DI0A 3WQOA 2DVTA 3N9SA 4JHOA 3O6AA 4QP0A 5ABEA 3E9AA 3E74A 1WCGA 1JF5A 3E49A 2W0UA 4W89A 4K39A 1WOAA 4O19A 4ML9A 4YIWA 7REQB 1ZBKA 1LROA 5BYWA 1QO2A 1DHPA 1ZJBA 2D2HA 4I6VA 3DYPA 3IPWA 4PZVA 5FEWA 4DJDC 1XXXA 2F84A 3M64A 3BLKA 3M0YA 1SMDA 2YFOA 1FWNA 4B16A 2ZZ2A 1DV7A 2W4XA 1NSJA 4DBUA 1XH1A 3L12A 3KFTA 4GINA 4ICMA 3DG7A 4UWMA 3EWZA 5E9AA 4FHAA 2DT2A 4JNYA 4YPJA 4F79A 3HZ3A 4KESA 4DM1A 4M6VA 3WQ8A 1GEHA 1HKMA 1FHDA 2YJQA 4DJFC 3LUTA 5A6MA 4X2PA 2QS8A 4HNUA 3IGSA 3M16A 3P61A 3U5YA 4BQ5A 3REQB 3MDUA 4O11A 5F2LA 1WXYA 3NZ1A 1TV7A 3HIJA 3C0SA 3W81A 3S2MA 2C3ZA 2VC7A 2XTKA 4OZOA 1LF1A 3EWCA 1FDJA 1S1RA 1M53A 2EPNA 4EK7A 1HKWA 1DWAM 4GXWA 3OLIA 3W1XA 2PLKA 4PRWA 1ZZMA 3QTGA 1E6RA 1VCVA 4HJFA 4GYJA 2CWNA 1E5NA 4W86A 1UWTA 1MQPA 1V03A 3SY5A 1Z6KA 5K2ZA 3PN8A 3RMJA 3FA5A 2VX6A 2WMKA 1W17A 5K3VA 2H6RA 4P2VA 1G4TA 1E0UA 4NF7A 4LYKA 2CCRA 1AL8A 2YXOA 2J4GA 3WDRA 5LGZA 3W70A 1AQHA 2VCCA 1FDYA 1AJZA 5HMSA 5CC6A 1NQKA 1BD0A 2IW0A 1OM0A 4CU8A 3TTOA 1QFEA 2QDDA 4GXMA 3HV8A 3B8SA 1YTEA 3UERA 1WPCA 4A8LA 1PKLA 1UOKA 3MANA 1SQ7A 2NX9A 1UKSA 3GWQA 3A6OA 1I9CB 5LXEA 2ISDA 4JKKA 1RJQA 1LBFA 3DHFA 2HK0A 2VVSA 1TTQA 1Q5MA 1HKKA 1EHAA 4QDPA 2AAMA 1CW2A 1Q13A 1L0PA 3WLKX 2QIIA 1O95A 2DZVA 3SR7A 2HTMA 1XLKA 3PG8A 1XBZA 4O13A 2OLAA 4GI4A 4P7QA 4E6MA 3T0BA 2YL6A 1DWGM 5IFTA 1UWRA 3IVTA 1RBOB 1BLIA 5D2WA 1E6PA 2VL4A 2D24A 4Z0SA 3RK8A 3I7QA 4WY0B 3NVTA 2HZGA 1H51A 4HYRA 4E4FA 2DORA 4Q22A 1RP8A 1D7KA 3PPGA 3NXFA 3LV6A 1HF6A 1X1NA 4UNKA 1OF8A 2DEPA 3IIOA 3EDJA 4CD6A 1PTAA 3ISIX 4RXFA 2PWFA 1R8LA 4ZZ9A 2HSAA 4ACZA 1PSCA 5G2HA 4CNNA 1QWGA 3DKLA 5B7YA 1EPVA 2VX7A 2OB3A 2ZX9A 3LXBA 3C2OA 3BJTA 3GNPA 4MMWA 4GG9A 1ZBWA 3ZQ9A 3UR8A 4FPSA 1GOIA 4BR1A 1TPDA 4ADTA 1WDDA 1LG1A 1RBAA 3NUKA 1XL9A 3C0JA 1BKHA 3WDJA 1JYWA 2JBMA 1LM1A 3GNOA 4AY1A 1TR9A 3NFUA 4UTKA 1X96A 3MW7A 4HTBA 3TOYA 1FH8A 4U33A 3ZM8A 2PDBA 4H7ZA 4AXNA 4P8XA 3CHDA 3G1AA 4MZ8A 3MMTA 2EAWA 2OU4A 5K9DA 2J6XA 3T2OA 2G3IA 7PTDA 1KTCA 4HD5A 3TXZA 3LQLA 3TDFA 1UWAA 2NVCA 1W1PA 1PCKA 2FH8A 1JGIA 3PPFA 1WDPA 2JKPA 5DT5A 4NILA 4QITA 4EVZA 1NELA 5IDIA 3SQLA 3VIGA 3A4AA 4U31A 2VR5A 4UFLA 3CQ0A 2ZRXA 1P7TA 2VENA 4DJDD 4PBFA 3CIVA 3LNMA 3VIFA 3UNTA 1VFFA 4URIA 4E0CA 4O4WA 2QF7A 1AODA 3SFKA 3UJRA 3GG8A 1QRQA 1M41A 3QV9A 3BZJA 3PAOA 4UMAA 3V0UA 4V33A 1UOZA 5CSSA 1HJWA 4IFRA 3WLSA 1JDDA 4GI9A 3CK5A 2X1TA 1O5RA 1UZ1A 4B15A 4PMZA 1E9YB 1TA3A 3K30A 3UESA 1JGMA 2NWSA 2GQ3A 5CBBA 4DJFD 4C6LA 1PIIA 2A85A 2BGNE 3W29A 2JFEX 1JDCA 1OD0A 2ISFA 4FI4A 3USZA 4NI3A 1VJZA 4FNQA 2D23A 2XFFA 3ABZA 4AB4A 3M41A 4BQ4A 4CQ8A 4UUIA 5A8PA 2ZTJA 1ZU8A 4CN1A 3NQMA 3CUZA 4UBPC 3EYPA 2ZX6A 1LQ0A 2HNHA 1CDGA 2OYMA 5HMEA 4GQQA 3O06A 5ABTA 1ESWA 2DSZA 1AH0A 2XUCA 3WMSA 4LY8A 3W7GA 3AQUA 1E0XA 4FNPA 3BXWA 4FIQA 4GC4A 3FYYA 5BU9A 4PUWA 3TIMA 2CZ5A 1YBQA 1SUXA 2OSXA 2GDVA 3LERA 3MKVA 4NIRA 1US0A 3S0CA 2WHJA 3RITA 3TV8A 4GKTA 3NL6A 2V5DA 2Y85A 2A3AA 3QY7A 3UETA 3M0ZA 2E1DA 1KM0A 4MKNA 3C3UA 2OZ0A 2QJGA 4CNPA 3DG3A 1ME7A 3G8EA 4XB3A 2QMKA 5DT7A 2PU1A 2PWGA 4IUOA 1JUKA 3WDPP 1NDWA 3NAVA 4GZEA 3S5SA 4YTRA 1PS9A 4FNUA 5AHNA 1KFLA 1V0KA 1D3GA 4JNZA 1C90A 3HG2A 2FYMA 4DO4A 1C29A 1BXCA 3DFTA 1SZNA 2ZXBA 2YDAA 1ZUAX 1EP3A 4L6DA 2EJAA 3HV9A 2P1FA 3WQCA 1GYLA 1PYFA 1KCXA 2XZ7A 3TJ4A 3TR9A 2PMQA 4JYFA 4JHMA 1C92A 1QHZA 2DZXA 1RALA 1MXSA 5HQMA 4DXVA 2ZA3A 3LHVA 3GE7A 3LA4A 1K02A 2ASHA 3SCOA 3KZSA 3LOTA 2GSEA 1JXJA 3S5OA 3BOXA 3N6HA 1UPMB 1BG9A 2FGZA 5HNRA 2QCMA 3K8LA 1VH7A 3ONCA 1PKNA 1UB3A 3XIMA 2O9OA 2V2DA 2EKGA 4ZVJA 3DFNA 2O7QA 4IWWA 2WZMA 3OQEA 1GNXA 2ADAA 3E02A 3ORWA 1VLWA 2OODA 1ENUA 2ZFAA 4NJHA 3W6YA 5BOOA 3R8RA 4WSKA 1E4LA 3UF9A 3GXFA 4F8XA 1GG1A 3UZYA 2CLOA 3ZYZA 3WENA 3W7KA 5DRIA 3BMVA 3PANA 5CPQA 5M1TA 3E3HA 1JCJA 3NIYA