2CCRA

Structure of beta-1,4-galactanase
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
386
structure length
386
Chain Sequence
GLYVEKVSGLRKDFIKGVDVSSIIALEESGVAFYNESGKKQDIFKTLKEAGVNYVRVRIWNDPYDANGNGYGGGNNDLEKAIQIGKRATANGMKLLADFHYSDFWADPAKQKAPKAWANLNFEDKKTALYQYTKQSLKAMKAAGIDIGMVQVGNETNGGLAGETDWAKMSQLFNAGSQAVRETDSNILVALHFTNPETSGRYAWIAETLHRHHVDYDVFASSYYPFWHGTLKNLTSVLTSVADTYGKKVMVAETSYTYTAEDGDGHGNTAPKNGQTLNNPVTVQGQANAVRDVIQAVSDVGEAGIGVFYWEPAWIPVGPAHRLEKNKALWETYGSGWATSYAAEYDPEDAGKWFGGSAVDNQALFDFKGRPLPSLHVFQYVDTGTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YVFO
publication title Investigating the Binding of Beta-1,4-Galactan to Bacillus Licheniformis Beta-1,4-Galactanase by Crystallography and Computational Modeling.
pubmed doi rcsb
source organism Bacillus licheniformis
molecule tags Hydrolase
total genus 143
structure length 386
sequence length 386
chains with identical sequence B
ec nomenclature ec 3.2.1.89: Arabinogalactan endo-beta-1,4-galactanase.
pdb deposition date 2006-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07745 Glyco_hydro_53 Glycosyl hydrolase family 53
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2ccrA00
2NSXA 5A69A 1E71M 1OCQA 2BHUA 3WD4A 2W61A 5DF0A 4W8LA 3TTQA 4CGTA 1VB9A 4Z2LA 3ZMRA 3WDQA 1UKPA 2Y5EA 1NWUA 1EQPA 4BQ3A 4DUWA 2WANA 1BVZA 4M24A 5FL1A 3T2OA 3AMLA 2NT1A 1ITCA 1XSKA 4QLLA 3EDDA 1DWGM 5E6ZA 4V27A 3WENA 2FH6A 2WHMA 3T2PA 4E2OA 1J11A 1C7TA 1EHAA 2VCBA 1E73M 1RPKA 5ECUA 2DSZA 4H2CA 1JD7A 1V3LA 5A6LA 3VD5A 4Y7EA 1ZBWA 3WIJA 1VENA 5A95A 5E70A 3WQ6A 3VINA 1Q6DA 2D3LA 1NWSA 3VDCA 3RCNA 4MB4A 3U7VA 5A6SA 4U5KA 2Y8VA 3CUFA 2YIHA 2J4GA 4NF7A 1CGUA 1V3HA 2G8ZA 4GZIA 1QHOA 4RE2A 3N13A 1B9ZA 4WK9A 4W85A 3KL5A 3SCTA 1HL9A 2W91A 1K9TA 3AIVA 4IUGA 1R87A 1UZ1A 3AICA 3FN9A 4UR9A 7TAAA 2YJQA 2ZUSA 1SYTA 2UWFA 3JUGA 1CXFA 1XRVA 1QNQA 1OT2A 1YQ2A 4ACZA 1RP8A 3I3DA 1OGBA 2XVPA 2J47A 4RE4A 5LA2A 4F9DA 3AIEA 4OKDA 4CD4A 5HPOA 1TA3B 2E9LA 4EKJA 1RP9A 3WNPA 3OLEA 1E56A 2E8YA 2WHKA 1GOKA 3AIWA 1B3YA 2HVMA 2O9TA 1BYCA 1ECEA 1QPKA 3RDKA 3NSXA 5BYWA 3ZR6A 2VX4A 4K68A 5GNYA 3CUIA 5M5DA 4W87A 3NIYA 1VFUA 2AOSA 3SUWA 5A1AA 3KEHA 1B31A 4Z2KA 2X0YA 1E43A 1JL8A 1JF6A 4TTGA 3L4VA 4MADA 4PMNA 4F8XA 2VJXA 2Z1SA 1OWQA 2GJXA 3EMZA 2WMIB 5FKYA 2DDXA 5JUVA 5CZKA 1VFOA 4MB3A 4KWUA 3MV11 5DMYA 4R5EA 3APGA 1XH1A 5GNZA 4WIWA 2A3AA 3F5LA 1JYVA 1VEMA 2JE8A 5D9NA 4W88A 4X0NA 5I3DA 3RMEA 3AHXA 1J18A 4FK9A 3ARUA 1X6NA 3SCNA 1ISVA 1KBKA 2DT2A 2WC7A 5GQBA 3K8KA 4AIOA 4P8WA 5AC5A 2YKKA 4QCEA 1CEOA 2WK2A 2ZUWA 1UYQA 2OSWA 4RE3A 4BF7A 2O92A 4TUFA 3GNPA 2PC8A 2IUZA 1HNYA 3T0BA 1UD6A 4J3SA 1VJSA 4QFUA 3S2CA 1E6RA 1FH8A 2F8QA 2WVVB 1GOWA 1Q6CA 3II1A 1UD5A 1NARA 1H49A 3WDHA 1TVNA 4M1RA 4URIA 2WB5A 2D2OA 2V3EA 1JD9A 2XFYA 4HMCA 3WMBA 4JKMA 3WD3A 5BCAA 3VM5A 4LX4A 3T0DA 4FLSA 5I24A 2GK1A 4J3VA 4AY1A 3ARYA 3RO8A 3GDBA 1L8NA 3W4RA 3VIFA 1H3GA 4AYSA 1H11A 1KFWA 4PTMA 2YDSA 4CCCA 1U33A 4FMVA 2PWGA 2WLZA 1C91A 3WEOA 3RILA 1EDGA 2D20A 3VGEA 1ODZA 3WUBA 2ZX5A 1UWQA 2EPMX 3VU2A 3SUTA 1WDSA 2ZUMA 2XWDA 4YN5A 2OYMA 1Q6GA 5ABFA 4W7UA 3VGGA 3BXWA 3W27A 1KR0A 4JCLA 1QI4A 4KGLA 3WNOA 4PMDA 4V2XA 4R27A 1G9HA 3SCQA 3W37A 2YL9A 2VRQA 1CGWA 3PZUA 5KZ6A 2XIIA 4ZXOA 1ISWA 3CHFA 1M04A 4JL1A 3VIIA 1E5NA 3NUKA 2G3JA 3GBEA 2CKSA 2E40A 2JF6A 4ACZB 1V08A 2WZIA 4B15A 4OJYA 1M53A 2WZHA 1PBGA 3VMNA 2X0HA 3M46A 1WE5A 3WUEA 4U5IA 3TTYA 4F66A 1E1FA 1LWJA 2VC9A 4JHZA 2VZTA 1AQMA 2E9BA 1W9PA 4YHGA 1DWHM 1G5AA 1CTNA 2WVTA 2Y2WA 2BY0A 4UQAA 1HJSA 3UETA 1XYFA 1CIUA 1UG6A 2DQXA 1FH9A 3BCFA 3VIMA 1BTCA 2V5DA 5I2UA 5C71A 4H8VA 3CTTA 2CIPA 1CDGA 3BAIA 3G6MA 4CU7A 1V0LA 3MU7A 2BHYA 4QLJA 1OIFA 1TVPA 5EMYA 3M7SA 1BVNP 4TX8A 1E4LA 5CLTA 3AMDA 4B3LA 3PZQA 1QI0A 2AMGA 4Z2IA 4GXPA 4DWSC 1XYZA 3A47A 1OD0A 2PWDA 3ARQA 2EO7A 3IANA 1ZBVA 1UR9A 1AQ0A 4LYRA 3TOPA 4UFHA 1E0WA 5A8MA 3VUPA 3L4UA 2YA1A 3RM4A 4OIFA 1H4PA 3W6LA 3W26A 4E4PA 3LPGA 1XC6A 2XFRA 2CBUA 4W89A 1XSIA 4DM2A 3WMSA 3DHUA 5FOOA 4JIEA 1GVIA 5ABGA 3CMGA 1V3JA 3W82A 2EXOA 1V3KA 1JZ2A 2CETA 3LPFA 1B1YA 5E09A 4BA0A 2F61A 5CGMA 3ZOAA 4UFKA 3ZJKA 3RM9A 1HVQA 1PPIA 4W86A 3O6AA 1W2VA 1WZAA 2VR5A 4L4OA 4U2ZA 1QI2A 1CGXA 4UFIA 5AYBA 3KWXA 1NP2A 5A2CA 5LYRA 3VDBA 4TXEA 1VAHA 7CGTA 2Y8KA 4KGJA 2XGBA 1RD6A 1OGSA 3AXHA 4YHEA 3NCOA 2XVKA 4AMCA 4PMQA 4E8CA 2XHYA 3MUIA 2O9RA 4BQ5A 1JDDA 3MANA 3B9DA 3I3EA 2JIWA 4UCFA 3W28A 1QVBA 3UESA 3MUAA 3RM8A 1W32A 5A6KA 1E4MM 2GK1B 1NOUA 2ZUUA 4P7OA 3SIMA 4ATDA 4CD5A 4IPNB 2ZE0A 4UFMA 2VRJA 1Q6FA 2X8RA 1US2A 1TFVA 1I75A 3WH7A 1IT0A 5D8WA 1A3HA 1WB0A 2W62A 3VX1A 5C70A 1J0IA 1AMYA 5A6BA 1UQYA 3VIOA 4JFVA 3WDIA 8A3HA 2TAAA 3ZT6A 1WO2A 3AXXA 1MW2A 1TMQA 2ZXQA 4H8HA 2YLLA 5ABFB 2WSPA 3WFZA 3W0KA 2WCGA 3WF3A 1GOIA 2DSKA 3VGFA 4Z2HA 5A6MA 1PIFA 2XSAA 3GXDA 3VTRA 1UR1A 1J10A 1SFSA 3GH4A 4KRTA 1HXJA 1UQZA 4OBRA 2CHOA 1UWUA 1WZLA 3PN8A 5EFDA 4B3KA 2ZWZA 4BCEA 3CHEA 1FP9A 1WKYA 4M56A 4AD3A 1JZ6A 1QW8A 5M03A 4AZBA 3NJ3A 4HZ6A 1W3KA 3IJ9A 3NSNA 1PX3A 2WHJA 1ISXA 1ESWA 1LG1A 2VVSA 2FHFA 3HN3A 1H0IA 4DWSA 2G3NA 3VIJA 1LL7A 1D7FA 2VR4A 3T09A 1D3CA 5BROA 2XUCA 2VQUA 1UH3A 3VVGA 1GW1A 1V3MA 3W25A 3AYRA 3N12A 2YA0A 5AC4A 3AZTA 3WF1A 1UOKA 2WZEA 2CYGA 3ALGA 3WQ8A 1WDRA 1LF1A 2EPNA 5I78A 1BG9A 3HMCA 4C7FA 4DM1A 1UA3A 3PZOA 3EDJA 4MNKA 3T0AA 1W3HA 2ZUTA 4X0VA 5JBDA 1B3ZA 3ARPA 1GHRA 1Z32X 4D6DA 2VL4A 3WY1A 4W8AA 1J0HA 4ZENA 5LA1A 1H0GA 1JFHA 2UY2A 2E8ZA 5BXRA 1GJUA 2VT0A 1UD4A 5I0DA 4ACYA 1E6NA 1W9UA 1OSEA 3KL0A 3BAJA 3N04A 1VBRA 3ZJ7A 4HZ8A 1VJZA 4D6EA 4W5ZA 3VKKA 2FHBA 1BFNA 1JAEA 4F9JA 4IM4A 1WZMA 3L4XA 5HOSA 4RL3A 4PMOA 5GPRA 3AS1A 3L4TA 4GPNA 3SEPA 3AYSA 3LMYA 4M29A 1W9VA 4CCDA 1QOXA 3K4AA 4XV0A 5IHSA 3NDYA 2ZUNA 1O7AA 4MAZA 2J7GA 2JFEX 5JIPA 4PMZA 1JNDA 1JZ3A 3L2LA 1MFVA 1GJWA 3PZVA 1NP0A 1RH9A 3QR3A 5BXSA 2GJRA 4HA4A 3S6TA 4MDOA 3EYPA 4D6GA 4QDMA 2VVNA 4HTYA 3CUGA 3AI0A 1QBBA 2RGMA 1Q6EA 3TTSA 1B3XA 4AWEA 1V03A 4BZYA 4ZE4A 2UY4A 4UOZA 1V02E 1MW0A 1IZJA 3K4DA 3ARSA 1AQHA 1V6UA 1JAKA 1W91A 1FHDA 3GNRA 2RGLA 1UWTA 3AZSA 1EIBA 1E3ZA 1WDQA 2JIEA 1JF5A 4W7WA 4E8DA 2VMFA 4L4PA 1SMAA 4AD5A 3SCWA 2X05A 1UH2A 4WLCA 2CESA 1EH9A 3ALFA 1ITXA 3UERA 1JYNA 2BXYA 1W9BM 2VX6A 3AHZA 4AZ6A 1KXTA 1D2KA 3HJEA 2VUYA 3B9AA 1ZU8A 1EHNA 3WKZA 1BYDA 2ZOXA 3AS3A 2GSJA 4MNMA 5CG0A 4P8UA 2X2YA 2W5FA 2G3MA 4ATWA 4ML4A 4AD2A 3EDKA 5FD0A 5AYIA 4PSRA 2W4XA 1PIGA 3CZEA 2XM2A 4MJ2A 2J77A 4EAMA 4JFTA 1W3JA 1J0ZA 1BGGA 1FH7A 5CGTA 2XTKA 1K9EA 3BGAA 2CKRA 4UQCA 3PBGA 5IFPA 4AD4A 3VD7A 3SCVA 1YHTA 5E9AA 2VI0A 1BAGA 2D0FA 1WZKA 1MQQA 3VIKA 3ZSSA 1MYRA 3AMGA 3MS8A 2WXDM 6CGTA 1PZ3A 2HISA 4TVCA 3AHVA 2CNCA 4AZIA 1JGIA 3GH5A 1UR0A 1FP8A 1OGGA 4HMDA 2WM0A 2VZSA 1EGZA 1ODUA 2DIEA 4NRRA 5EBAA 5A8OA 2EEXA 2V3DA 4PUEA 2G4FA 1FA2A 4CD7A 2JALA 3OGRA 4M81A 3QGVA 4TVDA 4HOZA 4WSJA 1OB0A 2OSXA 2E4TA 3PTQA 4H04A 2D24A 3WEZA 2WYSA 2OWXA 2J74A 2EPLX 1HN1A 3MUZ1 1ZJBA 3OA5A 3EBVA 2OSYA 1S46A 1R85A 2UY5A 4NRSA 4HU0A 3VD4A 1MW1A 4Q7NA 5CPTA 1V0MA 2J7DA 1VFMA 1JDAA 3ARVA 3DYOA 2CBJA 5F7UA 2QF8A 3ARZA 4XZWA 1KXQA 4A4AA 1I1XA 1NWRA 3UG5A 1E6XM 1QI5A 2JEPA 2IXUA 3AMCA 3CO4A 3OIHA 2WVSA 2DSUA 5IFTA 1QI3A 2ZXAA 1QHPA 4HPGA 4PUDA 5A2AA 2XJ7A 1WAWA 3K1DA 3RJYA 3EDFA 4WKHA 1OM0A 2CEQA 2ZXBA 4UZSA 4WKAA 4WF7A 2QV4A 4D6HA 1UKSA 2GUYA 3FAXA 2UY3A 3SCPA 1EDQA 4CD6A 1MW3A 1OBAA 3AIUA 2GFTA 1WNOA 3BC9A 4XX6A 4CD8A 4ATLA 4JFSA 5A6BD 3DYMA 4J28A 4Z2GA 1UKTA 1KGXA 1AVAA 3VIGA 1W2PA 2D22A 1W1PA 5CLWA 3VGDA 3FHAA 3TP4A 3WBAA 2XVNA 2A3CA 1M03A 1QNSA 4ZXLA 4HOWA 3BMVA 1GCYA 2A3HA 2BY3A 4QCFA 4KRUA 3MKKA 4JKKA 3PZMA 3WMCA 1KWGA 3N9KA 4FLQA 1F4HA 3VD3A 4BS0A 2XPKA 2WBGA 1FFRA 4D6IA 3WNKA 1DEDA 1W9XA 2CXGA 5DEZA 2BHZA 1MQRA 2ZX9A 4GQRA 2W92A 1LG2A 3BCDA 4IISA 1UH4A 4PMYA 1R86A 4X9YA 2VX5A 1PJ9A 4OZOA 4S3JA 1SR0A 2JEQA 3U5YA 3LPPA 2OLHA 1C8QA 1BQCA 1OINA 3GNOA 2YOCA 1BYAA 2YDQA 4PTXA 4OBSA 1ZB5A 3ZR5A 2WLYA 3BH4A 4DWSD 2GJXB 3GXIA 1ZBCA 3K8MA 4OOUA 1HKIA 1NM9A 4C7GA 4XB3A 5DT7A 3IAPA 1W3LA 3THCA 4LYPA 3BSGA 1UHVA 1HKJA 3T08A 3G6LA 2W63A 1VIWA 5HDRA 3WF0A 3D5HA 4JHOA 1B2YA 5HNNA 3CZKA 5D9MA 1E4NA 1MQPA 5D8ZA 3M6DA 5CXPA 2C7FA 3CUJA 1TG7A 5CSUA 1XCXA 2G3IA 3VPLA 4J3UA 1K9FA 3AROA 1E3XA 1G0CA 1W9DM 1JYWA 2DT3A 1O6IA 1IV8A 1MXDA 1V0NA 3OLIA 4J3TA 4B16A 4J3XA 4GO9A 1M01A 1PX4A 1XH0A 4JFUA 4PMXA 4CVUA 2ZX6A 5EFFA 5JBFA 4H7VA 1KBBA 4WKFA 1LLOA 4N0RA 3W29A 2ZWYA 1GQJA 5DT5A 3GXFA 4P7QA 3EMCA 5DFAA 4C7DA 3FW6A 4MAVA 2D0GA 2FGZA 1LL4A 3AZRA 3BLPX 4JKLA 2XFFA 5HPCA 1VEOA 4JCMA 3WL0A 3DYPA 2VURA 5CQ1A 3CPUA 1CENA 1NOFA 2BNJA 1ZS2A 2PWEA 4LQ1A 1E4IA 2DT1A 5CPQA 3SUVA 5JIWA 3IJ7A 1R7OA 3AFBA 1E6ZA 1NQ6A 1UR8A 2C8NA 1HJVA 5D9PA 1JI1A 2W66A 3WNLA 1CGYA 3SUSA 1K9DA 2VX7A 4CN4A 1TA3A 1CGTA 3UG3A 2MANA 2A3EA 1MVYA 2B31A 5EB8A 1E70M 4GQQA 3WNMA 4M8UA 4W8BA 5IXEA 1W1VA 3IAQA 2PF0A 1E6QM 1CBGA 2WBKA 4AD1A 3MSGA 3VDAA 2EJ1A 4EK7A 2J75A 2FDMA 2DPEA 1VEPA 2BXZA 5CSYA 5HXMA 1WP6A 4W84A 5A8NA 3WQVA 5A8QA 3VIHA 4HMEA 1C7SA 1CXHA 4D71A 4W5UA 2WMJA 4Z2JA 4GI9A 4GINA 3WQWA 2QPUA 5I5RA 1U2YA 3CZLA 4AXNA 2D23A 4PYSA 3AQUA 3WD1A 1B90A 1E72M 4BQ2A 3BSHA 5M17A 2FHCA 3WQ4A 1CXEA 2VCCA 3PZ9A 1H2JA 3ZM8A 4JAWA 1WCGA 1HL8A 1DWAM 3IJ8A 3UR7A 5GNXA 2EPKX 4HA3A 3M07A 3B9EA 4HPHA 1PZ2A 5TD4A 5IHRA 1EOMA 2G41A 1W1YA 2WCAA 1BGAA 1E9LA 2VZOA 1NWTA 2PBGA 2Z1KA 1LWHA 4LXFA 3AS2A 3TONA 1HJXA 2OYLA 2YBTA 1GOOA 4PMRA 1E6PA 3PTMA 4ZE5A 4CU6A 3CGTA 3QOMA 3FXYA 2BY1A 2WVVA 2QMJA 4AISA 4P8XA 1HVXA 3BAYA 2WMGA 3ECQA 2WWDA 1HP5A 2BY2A 2CBVA 5C8BB 1J12A 4PTWA 2DIJA 3MMUA 1J01A 1E1EA 3UCQA 3CUHA 1PEZA 5ABHA 4DUVA 2PWHA 3FY1A 4PBGA 4AZHA 4U3AA 1UD2A 5CJ5A 1NH6A 2ZICA 2ESCA 1XH2A 4GI6A 2OWCA 3VNYA 3POCA 3N17A 4W7VA 3VO0A 1ZBKA 3PZGA 2XG9A 2QLYA 3VIPA 2E3ZA 1FOBA 2VCAA 4GI8A 1ZJAA 4AIUA 1JNEA 3KZSA 3WQ5A 3I3BA 3AJ7A 3CBWA 2FGLA 4S3KA 5E6YA 1XCWA 5A8PA 4KMQA 4XUYA 3MO4A 1DWJM 2CCRA 2ZIDA 3VMOA 2YL5A 4U3CA 3SCRA 2J7EA 4FLOA 3BAKA 2J78A 3TA9A 5I6SA 2XIBA 5BXPA 2E0PA 3ZJ8A 3KL3A 2DT0A 3AOFA 2J7BA 3WH8A 1GHSA 1JZ7A 1EDTA 1EOKA 3L4ZA 1JZ8A 2EBNA 4A3HA 2NW0A 3CMJA 1JXJA 1JDCA 3A3HA 4TVUA 3AMKA 2BVTA 2QHAA 1QHZA 3WH6A 1CZ1A 1U30A 1DHKA 1LJYA 4TTUA 4Q22A 3GM8A 1ZL1A 3AIBA 1H1NA 1E0XA 3PTKA 3ARWA 1E6SM 4CUCA 4P7NA 3DECA 1C93A 2PI6A 4PN2A 5BRQA 1KGWA 3ARRA 3VOCA 3QHOA 2PWFA 1KQZA 3W53A 4D6JA 2WNWA 4HA1A 3WFLA 4M82A 4P7RA 1FFQA 1B3WA 5D4YA 2V5CA 1GNXA 3VX0A 5FL0A 4EE9A 3WBEA 1IZKA 1HT6A 3O2LA 3NYDA 1OIMA 1C90A 1OD8A 3MSDA 3RPMA 3A4AA 1M7XA 4AZCA 1EO7A 1BSIA 1GVYA 3VGHA 7A3HA 1FHLA 8CGTA 1GONA 3HU7A 4B9ZA 1V02A 3DHPA 4J27A 3O9NA 3WUGA 2AAAA 4FF5A 3WELA 1UD3A 4PMUA 4LPCA 1UR4A 5A2BA 1TUXA 3WN6A 1TZ7A 3MV01 3GYCA 1UD8A 2J79A 1CXLA 2Y24A 3FAWA 1XD0A 4QLKA 2J8GA 1WPCA 3WDPP 4UQ9A 4GKLA 2XSBA 4NSBA 3WL1A 3EDEA 4DWSB 5DO8A 1HJWA 3K46A 3POHA 1US3A 3OBAA 3VILA 3ZQ9A 4MPKA 2WC4A 3W24A 3W6MA 3W81A 2BVDA 5A6JA 1DWFM 3SUUA 4OUEA 1DP0A 2BS9A 4PCSA 3F5JA 1J9YA 3SCOA 3WF4A 2F2HA 2PB1A 2WPGA 5BXTA 4LYQA 3WDJA 4H8UA 1BF2A 5E0CA 2O9PA 3VMPA 3GBDA 3N15A 4XZBA 2XM1A 1XV8A 3SCUA 3VNZA 1B0IA 5FIPA 1UA7A 1X1NA 3AXIA 4HOXA 1G01A 4JZ5A 2VOTA 2WHLA 1J0KA 1TR1A 5JBEA 3A6OA 1KQYA 2D0HA 2J7FA 3AIQA 4JL2A 3ZSTA 1UUQA 3IK2A 4UQDA 1QBAA 4MB1A 2V3GA 2VTFA 2E9MA 1MXGA 1C3FA 4AD0A 4D1JA 4PTVA 3KE0A 1J0YA 2OYKA 3K8LA 3ZT5A 2J7CA 1ISYA 1J0JA 1EQCA 5M3WA 1H5VA 2YA2A 1P6WA 1SMDA 6TAAA 5HBFA 1HKMA 3AIRA 1CXKA 1UWIA 4PSPA 2DGAA 4CCEA 1H41A 2DH3A 4AZGA 2YBUA 1JIBA 1V0KA 1XGZA 2BV9A 3N18A 2X09A 2WKGA 1HX0A 3QHNA 2CITA 1UZ4A 3GXMA 3VD9A 1CNVA 2VRKA 1EA9C 1BLIA 1PX8A 4WSKA 3U7BA 3GH7A 3VM7A 2CERA 4AEEA 3WNNA 3RJXA 1CECA 1MWOA 2Q8XA 3F4VA 4UOJA 1BPLB 3THDA 4J3WA 2IXVA 3CH9A 1JXKA 4TX6A 3BAXA 2J62A 9CGTA 1N82A 4HU8A 1KB3A 4WJXA 1F4AA 2GDVA 4LGXA 4P7LA 3ZO9A 2YL6A 3VGBA 1TCMA 1HF6A 3FHQA 1XSJA 3OZPA 6A3HA 1KCLA 2VQTA 1VF8A 1PAMA 2XVLA 1ISZA 2WW5A 1KXHA 4MB5A 1XHGA 1E0VA 4U2YA 2FH8A 1LQ0A 4D6CA 4EANA 4UNIA 3CHCA 2GJPA 2OWWA 4GO8A 3VDHA 1B3VA 3UEQA 3F5KA 2CPUA 1HIZA 3OLGA 1KWKA 3CLWA 1HKKA 2A3BA 1W1TA 1JI2A 4FLRA 2YL8A 2ZUVA 1V6VA 3WD2A 3PHAA 4CVWA 4DUXA 4AZCB 2CHNA 1QW9A 2J8FA 1EXPA 1E5JA 3BLKA 3OLDA 3WD0A 4KH2A 3L2MA 1CLVA 1GORA 1XD1A 1CLXA 5I79A 1MFUA 3J7HA 2ZX7A 4PRWA 5FCZA 1HJQA 3SCSA 4HZ7A 2V38A 1BG4A 3DC0A 4J7RA 4UTFA 3A4XA 4TOQA 1V6WA 5BRPA 4N42A 1CYGA 3CZJA 4UOQA 1Y7VA 3ZT7A 5I77A 3BAWA 4UQBA 1NOWA 4CU8A 3OG2A 4PEEA 1KR1A 2D1ZA 2PBOA 1UWSA 1GQLA 1VFFA 1KXVA 2WWCA 3GTNA 4P8VA 4H41A 1HP4A 3FNDA 5ABEA 1JFXA 3ARTA 4GZJA 1H09A 1A47A 1CPUA 1Q4NX 5KEZA 2Y4SA 3WH9A 4B9YA 2JF7A 3N1AA 3W38A 1C8YA 2WCSA 1V6XA 4W93A 4IPLA 1C92A 1R8LA 1I1WA 1GOQA 3PZIA 2WMKA 2GDUA 1KCKA 3OGVA 1X6LA 1V3IA 4A3YA 4PMVA 2CBIA 2NT0A 2DH2A 2WMHA 3NDZA 3BMWA 2YLAA 3WSUA 3B8SA 1KGUA 4HP5A 1EO5A 2BVYA 1QNOA 2GVYA 2J7HA 4U31A 1QNPA 1WDPA 3L4YA 1BHGA 4NI3A 1G94A 4OOZA 3WEMA 3CHDA 4ZEPA 2J25A 3AHYA 4UQEA 3T2QA 3EMQA 1L0PA 1GUVA 2V3FA 2QMKA 3UG4A 3OB8A 4CN6A 3MMWA 2DSVA 1UWRA 1GPFA 1JZ5A 3WUFA 1B30A 2DEPA 1CWYA 1E40A 4UFJA 4GIAA 1JZ4A 3QHMA 5E0FA 5D9OA 2EPOA 1UR2A 1VRXA 2WAGA 3WF2A 2VO5A 1JYXA 4QAWA 4PCTA 2XVGA 1GOMA 4AZ7A 4AZ5A 5IDIA 1V6YA 4JFWA 5AY7A 1VBUA 4MJ4A 5LA0A 2ZX8A 4AIEA 3D3AA 4CKQA 1GQIA 5BWFA 3U57A 2VZVA 1GZJA 4BQ4A 4V28A 1G1YA 2DSWA 3OGSA 2WSKA 3CIVA 2X1IA 1CXIA 3GZAA 2XGIA 3AISA 1HJUA 3MUY1 1C8XA 4QP0A 1UKOA 2ZXDA 2WMIA 1LL6A 1BYBA 1TE1A 1R7AA 4UZUA 3QOKA 3AS0A 4MNJA 4AEFA 3U5UA 2W67A 4MNLA 2O9OA 1UKQA 4YPJA 3CZ8A 2VZUA 5A3HA 4MDPA 3ARXA 3MMDA 4MTVA 4U33A 5CPSA 3PZNA 3ZJ6A 4UFLA 3CZGA 3WH5A 3RIKA 1GQKA 4ZFMA 3UR8A 1QNRA 2WKLA 3L4WA 4D6FA 3AHTA 2QPSA 2XYLA 2WC3A 2WMFA 2WVUA 2C0HA 3N11A 3TTOA 3ZIZA 5A94A 5A6AA 4AC1X 2XWEA 3A4WA 4AW7A 1DWIM 2YDRA 3NSMA 3OZOA 4M80A 4D1IA 2BFGA 4D72A 3WDRA 1E15A 4NZCA 3PZTA 4CN1A 1CGVA 4GZEA 1JG9A 1K6AA 2D3NA 4F79A 2VNCA 1DTUA 1E55A 3E1F1 3SURA 5I23A 1OT1A 2EQDA 3LPOA
chains in the Genus database with same CATH superfamily
2NSXA 1F7BA 1WUEA 1E71M 5FACA 1OX6A 1SO5A 3RRXA 3WD4A 3I10A 3NPWA 1S5TA 4Z0JA 4CGTA 1VB9A 1QRQA 2OGJA 1F2JA 3WDQA 4AWUA 4HNTA 1H50A 3DFYA 3E9AA 2Z24A 1ZLPA 4YMZA 4BQ3A 2WANA 3ZS4A 3TYUA 3SY5A 2W9MA 3AMLA 1LQ2A 2VFIA 2DFAA 3I68A 3ELFA 3GXPA 4JTIA 4NL1A 1C7TA 1JUBA 3ZVHB 1E73M 2W3ZA 1SU5A 1IEVA 2PRMA 3BTNA 1ZBWA 4C65A 4DO7A 4L6HA 1VENA 4ZQOA 3WQ6A 3VOGA 1Q6DA 3TK7A 2QGYA 1XIJA 4MB4A 3B05A 3E2SA 5A6SA 3CUFA 3PPCA 4J2PA 1YW1A 2NQ5A 2PA6A 1RCOB 4X2PA 2QR6A 3L23A 4G7EB 1IEQA 3TSMA 1KM2A 4UB9A 4W85A 3NOEA 2W91A 4B5SA 4Q7BA 4RXFA 1UZ1A 2YX0A 3FN9A 3NGFA 1FWCC 1HO1A 2UWFA 4LNYA 1E0UA 3C2FA 1OT2A 5AFDA 1RP8A 1OGBA 4H01A 3RLVA 1J6OA 4RE4A 2DJXA 3RLGA 3AIEA 4OKDA 5HPOA 2E9LA 4EF8A 2WHKA 2X1UA 3AIWA 4NZFA 4IIDA 5AZ0A 1UZHA 1BYCA 1ECEA 2QV5A 3NSXA 1BEUA 2G0WA 3B4UA 2PP3A 4UTTA 3ENLA 4JHMA 5JXQA 3FIGA 3AYTA 4E6MA 3SUWA 4CNTA 4Z2KA 3PK7A 3DU0A 3MP3A 1L6YA 3GSMA 2X0YA 4Q8OA 1I2QA 4WD0A 5DCDA 3T0CA 3STGA 4N9CA 2V82A 5JUVA 1K8XA 5CZKA 2Z2UA 3IUIA 3W7KA 1VIZA 3QTPA 2V2DA 4DELA 4FHAA 3LSBA 5GNZA 1TB3A 2REQA 3RN6A 4TR9A 5D9NA 4W88A 4IT1A 3WQFA 5I3DA 2CLKA 4X9SA 1AL8A 4FR6A 4S3BA 3VAVA 3KZPA 4TQTA 2YKKA 2OGYA 3AU2A 1XFBA 3NO1A 3ITCA 1UMYA 1QO5A 1TJRA 4M7SA 1EIXA 2OSWA 4FNRA 3NQ7A 3S9IA 2PC8A 4NXKA 4QFUA 2QUNA 4CQ8A 4ZQPA 3UXLA 1E6RA 3ABSA 2WVVB 5CC6A 1OFQA 4K2SA 3II1A 4LC6A 5CCZA 1UD5A 2PDWA 3M5YA 3TN4A 1WQ5A 1H49A 2O56A 3WDHA 4IICA 1V51A 4FO4A 3IJIA 3UPBA 4DNHA 3CJPA 2D2OA 3QR0A 1YPFA 1JD9A 1HGWA 1PUDA 1TV5A 4PMJA 4E5TA 3WLNA 1SW0A 3AO0A 1D8WA 3T0DA 4U10A 4C6EA 1WDDA 2YXGA 3VXGA 3LZ5A 4R7WA 4IMDA 4QROA 1TPFA 5FJUA 1C9DA 1Q13A 2HVNA 3B03A 2ZRXA 4WOZA 4FMVA 1Y8BA 3I4EA 4FX8A 2A7RA 1C91A 4JIRA 3TCEA 2D20A 4O4VA 2OX4A 2ZX5A 2PDUA 1UWQA 4Z1AA 3H4WA 5EL1A 4JTCA 1WDSA 4YN5A 4ASTA 1IE7C 4RX0A 1UJQA 1R5YA 4EF9A 4U28A 5FJIA 1GVEA 5CZJA 3DEQA 4TX9A 3N2CA 1RA5A 3TW7A 4J9JA 1GPWA 3EEZA 4R27A 1G9HA 3W2NA 4GJIA 2YL9A 4MSSA 3PZUA 3BL3A 3V1HA 4KWOA 3UZ5A 4ZXOA 2ISVA 2ZZ7A 1F9CA 2GSEA 3CHFA 3DZ1A 4JL1A 1E5NA 3W1QA 2QIWA 4GH1A 3CYJA 1EX5A 3B8TA 4HGXA 3NQCA 4OJYA 1IGWA 3TCSA 2X42A 4MWAC 1Q8JA 2WZHA 2OFJA 3VMNA 2X0HA 1ZQ5A 1M6JA 1WE5A 4Y9OA 3QQ0A 5XIAA 4JHZA 4DO4A 4EWJA 1HJSA 1WXJA 1TV7A 1XYFA 2DQXA 3FSTA 1YDNA 3U8GA 5C71A 4B92A 3LCXA 4H8VA 1IXNA 1CDGA 4AY7A 4DJDA 3PBWA 2R1NA 2P0OA 1N8IA 3QZAA 4CNPA 3P7YA 1E4LA 4JN7A 4DAFA 1LROA 4NKCA 4WY0F 1SO3A 1QI0A 1THFD 3TN3A 5HNTA 4Z2IA 1BXCA 1TV8A 1OD0A 3ARQA 4A6GA 2A7NA 1QDSA 1XIHA 1E0WA 4BEUA 3L4UA 3LNPA 2OPJA 2JQXA 1H4PA 4O0QA 1P0EA 3W26A 1P0DA 2HCVA 4W89A 4MGGA 3WMSA 5FOOA 2ANUA 1GVIA 4IXHA 4RLIA 3QM3A 1LUCB 1LOSA 4MY9A 2CETA 5LGXA 1JZ2A 1AJ2A 1B1YA 3GD6A 1M1BA 1SW7A 2OCZA 4ZQRA 2ATSA 1U5HA 1HVQA 1RK5A 3O6AA 4KFOA 2YXOA 1EP1A 4C6PA 1QI2A 1NP2A 1H1ZA 3HQPA 4RV3A 2XGBA 3VZZA 1RD6A 3GXNA 3TROA 3B40A 3UGVA 2XVKA 3ERPA 4WDUA 4E8CA 2VELA 1JDDA 3B9DA 1PYMA 2HDJA 1E4MM 3QC3A 4JGDA 1NOUA 3IJQA 4PUNA 4W9TA 1FVPA 4IP5A 2ZE0A 3NURA 3OHMB 1JPKA 1Q6FA 3WH7A 1IT0A 3GUGA 1A3HA 1WB0A 1QT1A 2OOFA 3FYOA 5HULA 4A29A 4HSNA 4DXVA 3D6NA 1UQYA 3VIOA 2PLKA 4JFVA 8A3HA 4XZMX 2TAAA 4GG9A 3S46A 2PC4A 4JTUA 4ICNA 1SGJA 2E28A 1R3VA 1HKWA 2QJHA 5T8GA 3VGFA 3NL2A 4JNMA 4Z2HA 3P81A 2P50A 2PDGA 3GXDA 4TMBA 2R8WA 3T8LA 1A5BA 1UQZA 1WZLA 2C1HA 4A05A 1FP9A 3W1RA 4AD3A 3LD5A 4UTTC 4NIRA 1VLWA 4V1XA 3WQGA 1OFBA 2Y88A 1UJPA 1W3KA 3WLRA 2OEMA 3IJ9A 5LIWX 1PX3A 2XH0A 3E12A 3LRLA 4AIBA 4DWSA 4FI4A 3GFYA 7PTDA 4E38A 1XW8A 4Z42C 1TV4A 1AK5A 3T09A 1YLVA 1D3CA 2VDIA 5BROA 2XUCA 3NZRA 4XZ9A 1LM1A 1UH3A 1V3MA 1OJXA 2Z1WA 2WJZA 1UB3A 1B54A 3QEZA 2WQDA 3KTSA 2PTXA 4GVGA 2WZEA 2CYGA 3WK0A 4NYYA 1XQKA 1VJIA 4NASA 5I78A 3VA8A 3KS6A 1BG9A 3QSTA 2YBVA 3EDJA 1GVOA 4MNKA 3ARPA 3WLSA 4JTHA 4JICA 4ZENA 4MJZA 1H0GA 1SSDA 3KHJA 3TA6A 1XLAA 5I0DA 1BD0A 1OSEA 1G4TA 3O7UA 3I7RA 3GHTA 3BLLA 3VKKA 4KIEA 2FHBA 1N2VA 4IM4A 1AH3A 4PMOA 1OF6A 5CH9A 5I3HA 5XIMA 3LMYA 2J24A 1QOXA 3C0SA 3W88A 2D2HA 4LVDA 1K7EA 1O7AA 3PJXA 5JIPA 1JNDA 1Z8AA 3S6OA 1MFVA 4GIEA 2JK2A 4AHPA 2XU2A 4RV8A 4OHQA 1MRAA 4CNUA 1P0BA 2GJRA 3LGDA 1R2TA 1NSJA 3ZXWA 4MDOA 3KCOA 4QDMA 1EX1A 3GC5A 1SO4A 3CUGA 3TJIA 3GC2A 4MM1A 4A3QA 1QJWA 2A85A 4JX5A 1NAL1 4XIAA 2E5DA 1YBQB 1MW0A 3HPXA 3ARSA 3GKFA 3ABZA 1FHDA 4E3TA 2RGLA 1FCVA 3L5AA 1BVWA 5BMXA 3NM3A 2GYIA 2JIEA 4IMGA 4EWND 1EKOA 2XN0A 3H22A 4WUIA 2X2GA 2X05A 2BP1A 4GY1A 2YDAA 8RUCA 1BF6A 4AF0A 3HF3A 1W9BM 2FTWA 2VX6A 3UA4A 2DW7A 1D2KA 2VUYA 4JX6A 1SZFA 3B9AA 4Y8EA 1BYDA 3RLUA 3H54A 2Y7FA 4MNMA 4DYJA 1T96A 2G96A 2W5FA 3GR8A 1XP3A 5AYIA 4L1WA 3MI2A 5LNUA 2J77A 4G8TA 4PA8A 3GK0A 1US0A 1MXSA 4IMEA 1S2VA 3KBSA 2BXVA 3BGAA 2CKRA 2OEKA 4QDPA 1YHTA 7XIMA 3NAVA 3N6JA 5EGRA 1LBMA 1MQQA 3S1GA 1EUAA 4GC4A 4WX2A 1PCKA 3MS8A 1PKMA 2HISA 4TVCA 3BLDA 3AHVA 2Q01A 3OVQA 1DPMA 1FP8A 3R11A 4IFOA 1ODUA 2OVLA 1IT7A 4IFKA 1EC7A 2G4FA 1FA2A 3HPZA 1O66A 2L5HA 3M64A 4UMAA 3S5NA 4B5NA 1G4PA 4TVDA 3TWAA 3UZYA 1DXEA 1OB0A 1WOAA 4LAUA 4DBSA 2V2HA 4E4UA 2OWXA 3KCLA 2J74A 3E0LA 1TWSA 3VKBA 2EPLX 2C13A 3ZLHA 1ZJBA 1IXPA 3EBVA 2OSYA 1S46A 1K02A 3GDRA 3ABRA 4NRSA 1K03A 2NVCA 4KKXA 3DG6A 1R3TA 4J5NA 3RFAA 2J7DA 3USZA 4C6QA 4PTNA 2QF8A 3ARZA 4S3GA 4MKSA 1KXQA 1DJHA 3JZUA 4AHOA 3TN6A 3UR2A 1E6XM 3KAOA 2JEPA 1DKWA 4L7ZA 3V5OA 3UBPC 2ZXAA 1QHPA 3WQOA 5A2AA 4NZ4A 2C71A 2GGEA 3RJYA 4RE0A 4PUJA 3IPWA 4KCUA 5FJJA 3ZR4A 4FNUA 1UKSA 4UNKA 4GYPA 3PS7A 3ID7A 2I1OA 1QO2A 4ZQNA 2Z25A 3Q45A 3OEXA 4XX6A 3THUA 4JFSA 4MZYA 1BXNA 3DYMA 4J28A 4Z2GA 1NFPA 1AVAA 3VIGA 1EPXA 3P0WA 4F4RA 4MWAD 3WBAA 1FX6A 1YDVA 2OJPA 4E8GA 4DJEA 1M03A 3VNDA 1S2UA 3NG3A 4HOWA 2V69A 4LW7A 2A3HA 4CQCA 2BY3A 4C1NA 4AVOA 2P8CA 4JKKA 3QR1A 3WMCA 4C6FA 4AF0B 2I5GA 2XPKA 1XLMA 3KOWA 3WNKA 1DEDA 1UZDA 4O15A 2BHZA 4AH7A 1MQRA 5AN7A 3MO7A 5AHNA 1HL2A 2W92A 3BCDA 4JR5A 1UH4A 4LUIA 3W85A 1R86A 4X9YA 4OZOA 4YJ5A 3LPPA 1V6TA 1ECQA 1RCQA 4O13A 2XIMA 4ZL1A 2F2KA 2I5QA 2WLYA 3BH4A 1A49A 4NZ3A 2VFGA 3UWEA 1NM9A 2ISFA 5DT7A 1W3LA 3KBMA 3T08A 3SY8A 4LALA 3G6LA 1P1MA 1VIWA 3GIPA 1MRQA 2O55A 4JHOA 1B2YA 1H7RA 3CZKA 2XZ9A 4P5UA 1OZQA 3UG8A 3MPGA 1MQPA 2QAFA 1JCJA 1QATA 5CXPA 3G1DA 4PBFA 2C7FA 3CB8A 3CUJA 3S2JA 2Z4GA 1XCXA 2Y61A 3F2DA 4K6AA 4BKNA 1K9FA 1V7AA 1H7XA 5A6TC 1E3XA 4OBTA 4FPSA 4C1KA 1V0NA 1SZNA 3OLIA 2QJGA 4IFKB 4B16A 1JRCA 2HEJA 1GK8A 1XPYA 1ICPA 3V0SA 4MLRA 1OG6A 4CVUA 3M5VA 4ZB5A 5EFFA 4DXKA 1Q4WA 4JBRA 1OFAA 4BI7A 5HINA 4P7QA 3KOFA 1TV2A 3I6RA 1NEYA 3W07A 1NDZA 4JKLA 3LBMA 1ITQA 5AHIA 4C6MA 3O0KA 3REQA 2VENA 3O16A 4CQ9A 1RQHA 4K8GA 3DYPA 5CQ1A 3NPXA 3K30A 1YNYA 2DT1A 1JCYA 4LF1A 1EEPA 1R7OA 3AFBA 5CPMA 2DZTA 1B4KA 1AD1A 3DFTA 2QUMA 3QGKC 5D9PA 1QU4A 3H2EA 4IPIA 3GUWA 3FVMA 4M19A 4RPPA 1S38A 1MVYA 5EB8A 1E70M 2TYSA 4KT2A 1S39A 4RNHA 3DAQA 4IL0A 5F4XA 3C2YA 4NILA 3H2AA 4AYGA 1Y5XA 2QXWA 2FDMA 2H9AA 2DPEA 4H6RA 5C9XA 3E2VA 5CSYA 1WP6A 4W84A 3RX3A 1O4UA 1JQVA 3RUBL 2NZLA 1FWSA 3DGRA 4HT3A 1UW9A 3WQWA 3STCA 2GSHA 1WBJA 3CZLA 5CJNA 3STPA 1L6SA 1O95A 3QPYA 2PTYA 4GACA 3BSHA 4C1NB 2Z7GA 3PZ9A 1PV8A 1H2JA 1X96A 3ZM8A 3R79A 1A3WA 1PTGA 1I2PA 5F2IA 5D2VA 4Q4PA 2EPKX 3RNDA 3M07A 5IRPA 3A22A 4HPHA 5TD4A 1EYWA 1ZSXA 3H2OA 5HMDA 3LLDA 3BICA 4IPPA 2PBGA 1BXBA 4AWSA 5FJOA 3K2GA 1H1YA 2R1PA 4CU6A 2J6XA 3QOMA 2DVXA 3BAYA 2WMGA 1HP5A 2CBVA 4XWUA 3IK4A 3EB3A 3TOYA 1O1HA 2Z1BA 5C8BB 1YTDA 1IEWA 2EG6A 1R2SA 1J01A 1E1EA 3C61A 3UCQA 1PEZA 1OX5A 2PWHA 3EX3A 3D3FA 3FY1A 4PBGA 3C56A 1UD2A 2NX1A 3WZ0E 2NWRA 1XH2A 3UXIA 3VNYA 3ITVA 5I3JA 2EG8A 3UCDA 3FKRA 4UR8A 3UW6A 3ISIX 3KZSA 4IQLA 3I3BA 4K38A 3CBWA 2NVDA 3S0CA 3G1YA 5E6YA 1XCWA 1IEIA 4I90A 3MO4A 2CCRA 2YL5A 3SCRA 3EOLA 2J78A 2XIBA 2HV5A 5BXPA 5D09A 3KL3A 2DT0A 2QCFA 1ALDA 1EOKA 4RW5A 1XX1A 1JDCA 1EC9A 3AMKA 1UIPA 1CZ1A 1U30A 3NL5A 3LBOA 3FVDA 3SJ3A 2VGIA 1H1NA 3PUOA 3M16A 3E5PA 4QE4A 4CUCA 4JQ3A 4Y9MA 1GEQA 2PWVA 3DECA 1C93A 5DMNA 4B4FA 3REQB 2PI6A 4OV9A 3TQ0A 5BRQA 1KGWA 3M44A 4D6JA 1EJXC 1KQZA 2AL2A 1HW6A 3TMLA 1TPDA 3HQOA 2V5CA 3MA8A 1KRMA 3XINA 4EE9A 3OVRA 3C8NA 1UCWA 1DQXA 4Y90A 4PL2A 3KOYA 2XZ7A 1TPWA 4KW2A 4MWAB 1R46A 1OD8A 3MSDA 4HNUA 1AUSL 1EJ7L 1EO7A 2ODOA 3OA3A 2Z0IA 4GQBA 1GVYA 2NQHA 1IGSA 3MC5A 5D30A 3W1UA 4GJJA 2HROA 3LCHA 3E38A 3C2RA 4AEOA 3HU7A 3LY0A 1V02A 4PRRA 3LOTA 3T8QA 4QE5A 3NQAA 2VD9A 3WELA 1UD3A 4HNLA 4Q4SA 3B0UX 3WN6A 1TZ7A 4GYJA 1NF0A 1DIKA 3IJDA 1CXLA 1XD0A 2PDMA 4QLKA 4DRSA 3QC0A 1WPCA 1KRCC 3IIVA 4AVNA 3FDKA 4YYFA 3WL1A 5DO8A 4EXQA 3YPIA 5HNRA 3W24A 4IL2A 1AL7A 4OUEA 4IG2B 1YRRA 1DP0A 4MG4A 3LUTA 3QVQA 2PB1A 5BXTA 1U22A 4H8UA 1BF2A 3VOIA 1NDVA 5GVJA 4LH8A 1QK0A 1GT8A 1EJUC 2I56A 1KFEA 1T40A 1R2RA 4F3HA 2QULA 3DHFA 4IQDA 2XH7A 4CEUC 2VOTA 5G1TA 2VM8A 1GKPA 5D2YA 2WHLA 1J0KA 5JBEA 1KQYA 3SFWA 2NV2A 1WKDA 2J7FA 1R3QA 2FVLA 5H8PA 3ZSTA 3V36A 1XG4A 4DEFA 3G1AA 4C5ZA 3N6HA 4ONVA 3VOJA 1VS1A 1MXGA 3OVPA 5KZDA 4D1JA 2FPTA 3KE0A 4A3RA 4F40A 3DXIA 3EKZA 3SRFA 2QGHA 1W5OA 3FCPA 3ZT5A 2AKMA 1PB0A 3W1PA 3M5ZA 3B8VA 1NTHA 5FEPA 4YXGA 2QUUA 3IGSA 2E6DA 3AU6A 3C0JA 1UROA 1CXKA 4AFYA 4PSPA 4CCEA 1H41A 2DH3A 1PIIA 3EXSA 3NQVA 4G1NA 4F0KA 1XBXA 2VRKA 4RK8A 4Y9AA 4ZZ9A 3MKCA 3GTXA 2R14A 3U7BA 4XD3A 3VM7A 3NDOA 3WNNA 3RJXA 3EX4A 1CECA 2Q3RA 1MWOA 5D05A 4M0XA 2ZDRA 4UMCA 5I3FA 4V33A 3CH9A 1QAPA 3BAXA 9CGTA 2R1KA 1KBJA 4HU8A 1I60A 1JJKA 3UJFA 4GFIA 5KTLA 2HE5A 7ENLA 4NX0A 2DIKA 1TCMA 3SGZA 5KMYA 2AL2B 2Y62A 1I2OA 3URQA 4MB5A 4JEJA 3QV7A 2FH8A 4EANA 3EA2A 2PDKA 1RLDA 3WJXA 1FUYA 1HKKA 2A3BA 1POJA 1RHCA 2QQ6A 2YL8A 1AJZA 3EPMA 3WD2A 3VOHA 3CT7A 1LOQA 2J8FA 3LM7A 4GK8A 3HQ1A 1VKFA 3P62A 3BLKA 4JTLA 4XSMA 2ZX7A 3TZFA 4R53A 5FCZA 1HFBA 4KBXA 4CCZA 5FEXA 2V38A 1BG4A 4J7RA 3ONBA 2YW4A 4N42A 4E2BA 4KF1A 1Y7VA 3BAWA 3L68A 3HPAA 1A80A 1T41A 5K4XA 4PEEA 1TSIA 2D1ZA 1XISA 1UWSA 1VFFA 2WWCA 4P8VA 2A21A 1OFOA 1QCWA 4BWLC 5D2XA 1G67A 1YXCA 2FVMA 2FGBA 2QKFA 5CEWA 3RRAA 1Y0EA 3AYVA 4QBXA 1JCTA 1R9YA 2QNEA 3IVSA 4M6UA 2VKZG 1Z6KA 3T05A 1C8YA 1C92A 3QPEA 3GTFA 2YFNA 3IGXA 3M0HA 3DGBA 3PZIA 3Q37A 2WMKA 2GDUA 1KCKA 2QJMA 4NZJA 5CBIA 4LVAA 4OGZA 4ORIA 3GTHA 4B90A 3EGJA 2C0AA 4S2BA 1GTEA 2NT0A 3H7RA 2WMHA 1WXZA 4Q6JA 5C5YA 2YLAA 4WCJA 3B8SA 1T6MA 1KGUA 4JTJA 1Z48A 2GVYA 4Q6XA 4NI3A 5D03A 2V9DA 3TXZA 4GH3A 1TVLA 2QAPA 2C14A 4ZQCA 3EMQA 1L0PA 1G4EA 2QMKA 5DX7A 3NQ6A 2YYUA 1KRAC 2XISA 1VHNA 1UWRA 1GPFA 1IF2A 1E40A 1X38A 4GIAA 1TMLA 3Q4DA 3WF2A 4J40A 4IFRA 4AZ7A 3FXGA 3G1RA 4JFWA 1VBUA 4MJ4A 5LA0A 2B7QA 2IKHA 2BASA 4AMAA 1A5LC 5FEWA 3B8DA 1OCJA 1ADSA 4XD5A 3STFA 1IQ8A 2ZA2A 3W87A 2VZVA 4BQ4A 4HKPA 3H21A 4RDVA 3MP4A 4RZ6A 2X1IA 3LBCA 1BRLB 4LUYA 4XZNX 3QMRA 4XO6A 3MDWA 1KBLA 2VEPA 5EU9A 2WMIA 1LL6A 4KQNA 3WLJA 1TE1A 4NAFA 1QTWA 2RJGA 3QOKA 5AZ1A 3LXAA 4MNLA 3CZ8A 4JIIX 3B9NA 4WDTA 4U33A 5CPSA 1K6WA 2ACQA 1VFSA 1GQKA 4QDWA 1W31A 1D7KA 3BGGA 1GGOA 3LXCA 2XYLA 2WVUA 3N11A 4MFDA 2DQWA 1DWIM 2Y7EA 4D72A 4IJRA 3U4AA 3VFLA 5REQA 3FGCA 3PZTA 3ABOA 4GZEA 1K6AA 1U1HA 4JDYA 1DTUA 1VYSX 3LPOA 3APYA 4J35A 1FHVA 1O5RA 3ICJA 1F05A 3NQ2A 3O15A 3BZJA 2QPXA 3TIMA 2F6XA 4Z2LA 4QIUA 2BWGA 3GFXA 4FXRA 4R88A 1JCNA 3LNMA 1EQPA 1OABA 5KZEA 5FL1A 1UUOA 3KHDA 2WSRA 1XSKA 1QUMA 2BOFX 3BQ5A 4DNMA 4LNCA 3T2PA 2WHMA 4DXXA 3KRUA 3W7CA 4K7YA 1QWGA 3L0KA 2YCIX 2VCBA 3HO8A 2PEVA 4IIBA 2E5CA 2DSZA 1PZ1A 4H2CA 1JD7A 2YB4A 4WY0B 3OYXA 2X1RA 3VD5A 4Y7EA 1K4GA 1TWDA 2P1FA 3M43A 3DHDA 1PKLA 3KM8A 3N3TA 3U7VA 2Z1VA 5XINA 2Y8VA 3OO2A 4NVTA 3O1NA 2IPFA 2J4GA 1CGUA 1B57A 4L6DA 1FQ0A 3WQDA 5DMLA 1XYMA 4O1EA 2G8ZA 3WLTA 1S2WA 4YU1A 3VE7A 3UWUA 4WK9A 2EAWA 3RF9A 1XBYA 4O1FA 3OBKA 4JYEA 3SCTA 1DJZA 4O52A 3N29A 4FEZA 1EGVA 3AICA 2ICSA 1DV7A 1WBHA 2YJQA 1H7WA 4CNSA 1CXFA 2TPSA 4LC8A 4Z1BA 3I3DA 2H90A 1EZWA 2XVPA 4BFAA 1A53A 1UIOA 1MZHA 1RP9A 2NX3A 1SO6A 4HN4A 3GU2A 3CUIA 5M5DA 3QJAA 2EKCA 1MEWA 3CNYA 3C2EA 2AOSA 5A1AA 3KEHA 1QPOA 4DZAA 1JF6A 4TTGA 3CAQA 4MADA 1ZGDA 3ES8A 2ABAA 2GJXA 3BUVA 1TPB1 2ON3A 1BKHA 2WMIB 2V30A 5FJTA 4NAFB 4QQUA 4DLMA 5JH1A 4KWUA 3MV11 3QTGA 3QY8A 2PP0A 4I7WA 5TNVA 2FFIA 3F5LA 1JYVA 1F76A 2JE8A 4WSHA 3RMEA 4RXGA 3U3HA 1OG0A 1J18A 2FZBA 1X6NA 2DZPA 3SCNA 4LANA 4S3AA 5AC5A 4QCEA 4GRSA 4JIHA 1Y5WA 2EG7A 4TUFA 3GNPA 4NJIA 2J13A 3CQHA 5KSWA 4LEQA 1UD6A 1VBGA 1VJSA 5HJYA 4XQ6A 4PR4A 4CLMA 1NARA 1FWDC 1RPXA 2WSQA 2BG5A 4M1RA 5BOFA 3W1TA 2PLCA 4GE8A 3ITLA 2PP1A 2XFYA 4HMCA 1F6KA 3QQWA 2J9ZA 5GJMA 3WD3A 1I9CB 1G7UA 2PAJA 5I24A 1I45A 3PPFA 2GK1A 4J3VA 4AY1A 1JPIA 2CZFA 3RO8A 3UP8A 1L8NA 1LLWA 2E1DA 2FZMA 4AYSA 2FZ8A 2E7FA 5HQMA 4FZIA 4CCCA 5FEZA 4OT7A 1SFJA 1EDGA 2Z2AA 1ODZA 3VGEA 2GVEA 6XIMA 3VU2A 3CV1A 4O50A 4W7UA 3PWAA 1ADDA 3W27A 4KGLA 2PGFA 3MT1A 3WNOA 5C9UA 2DZXA 1CGWA 2ACUA 4REQA 3UQNA 4QR6A 2PLJA 2FB2A 3L5MA 1P6CA 3NUKA 3UZXA 3GBEA 2VFDA 2E40A 2FPYA 5PTDA 1V08A 2WZIA 4B15A 4W4QA 3QH2A 1KC7A 1H7NA 3W72A 3EPNA 1M53A 3U9IA 3GS6A 5EMUA 4ZO6A 3WUEA 4C6CA 1MUMA 1AD4A 1EJWC 1E1FA 1LWJA 2VZTA 2V81A 4JTSA 1G5AA 5AHFA 1JVNA 1Q2RA 1CTNA 2WVTA 3NZGA 4UQAA 5C6MA 4PC8A 3WBYA 2A4AA 3KVKA 2DU2A 3LX9A 2C6QA 2BZNA 3TXVA 3OODA 2CIPA 3TQVA 2QCCA 4ADTA 1XLDA 3FOKA 3VZXA 3P0XA 1YNPA 3FFSA 4DI9A 3MU7A 2BHYA 4QLJA 3WK1A 4FR1A 3M7SA 1BVNP 4B5UA 2KZHA 3KXQA 4Q8VA 3QW3A 4A21A 3PZQA 2C19A 3RGTA 5E9XA 4GXPA 1XYZA 1LOLA 3A47A 2NQ9A 2EO7A 1UR9A 1AQ0A 3P14A 1U83A 3VUPA 3CWOX 4OIFA 1PTAA 3W01A 4GVHA 3IGHX 4Q3MA 5FSEC 2E25A 4O12A 3LPGA 3KBNA 1XIBA 2QUVA 1POKA 4GABA 4DM2A 1V3JA 2YCKX 2KAUC 3H2MA 3MKVA 4S2CA 2VHLA 3L67A 2EXOA 3W82A 1V3KA 4L5ZA 1DQWA 5B80A 4RNFA 5CGMA 2PDBA 3PPHA 3RM9A 3W73A 1KLZA 1PPIA 4W86A 3SDOA 1WZAA 2VR5A 4NI8A 2JGQA 5A2CA 1XC4A 3VDBA 7CGTA 2Y8KA 1JUEA 1MI3A 3LHWA 2Z00A 5HJLA 3RK8A 5HWNA 1Q85A 4AMCA 1DJGA 3RX2A 2XHYA 2O9RA 4BQ5A 3RU6A 1Q8AA 2JIWA 2V5KA 1QVBA 3M0MA 4INFA 3MUAA 2YB1A 2HE8A 5A6KA 3T7VA 2NUYA 2GK1B 4CD5A 1IR2A 4IPNB 3GAKA 5D37A 1US2A 6XIAA 1TFVA 1I75A 1SJCA 3VX1A 1AMYA 3MJMA 4M7TA 4A8LA 3HG3A 1FDYA 4ZGYA 3L65A 4DY1A 3E3HA 3NZPA 4XAPA 3WFZA 1OX4A 2WCGA 3THAA 1GOIA 2DSKA 3SW6A 1PIFA 3S3GA 3P5YA 2XSAA 5ENLA 3Q58A 3LXBA 1UR1A 3PB2A 3WQCA 1J10A 4QITA 4PL1A 1O12A 1K8YA 1ZP4A 3M1ZA 3LV5A 4KRTA 4Y2WA 4UR7A 2CHOA 3BG9A 1UWUA 5EFDA 1XRSA 2Q8ZA 1JZ6A 1FWNA 1QW8A 5D33A 3GDLA 1VQTA 3PSWA 4HZ6A 2YR1A 3PG9A 3NSNA 1ZENA 2VVSA 2FHFA 3BLOA 3N6QA 3VIJA 4G9PA 3EOOA 2VR4A 3IEBA 4US6A 4C6BA 2X1TA 1GW1A 2YA0A 1TTQA 3G0XA 2BODX 2CHRA 2R6OA 3LTYA 2XH2A 1VP5A 1LF1A 1SFLA 2EPNA 3IACA 1QPNA 4JTAA 4C7FA 1RBLA 2A0NA 5J5DA 3S5ZA 4FXJA 3T0AA 3VI2A 1ZJIA 1Z32X 2V0TA 3WY1A 2QCLA 4W8AA 1FBAA 1WOBA 2E8ZA 3DI1A 1H62A 5AC7A 1W9UA 3OVGA 4GGBA 4LS1A 3TU9A 4HZ8A 1IEXA 1TQXA 4QNEA 5H2ZA 3LS9A 3GIQA 1JAEA 4HNNA 1WZMA 4D8LA 4RL3A 5K9XA 4LT9A 4GPNA 3GC4A 4XVDA 3NO5A 3K4AA 1G6CA 2NXGA 4H9VA 2ZUNA 2J7GA 2JFEX 2PTZA 3CEPA 2GL5A 1JZ3A 3O8AA 2E6AA 3MI6A 1MEIA 2VC7A 4A2SA 4GA8A 1HG3A 3S6TA 4UCGA 4D6GA 1OQFA 4HNOA 4XBKA 1V77A 4TO8A 1B3XA 2GLKA 1ZAHA 4DJFD 3BG5A 3NZQA 4ZE4A 4I8DA 2UY4A 3ONCA 1OVDA 1NVMA 3K4DA 1AQHA 1W91A 3CH0A 1EIBA 1WDQA 5C7HA 2GGHA 1AZ1A 2QDDA 5I3IA 4W7WA 1PTDA 1W3IA 4FNTA 4AD5A 1UH2A 4S1FA 2R1MA 4O1AA 1VYPX 3LG3A 3Q94A 1PZ0A 3VOFA 3W7MA 1RLCL 1P1XA 3UERA 4LVGA 5LNRA 3UJEA 4KEVA 4HCHA 1ZU8A 1EHNA 3PUGA 1OF8A 3F4NA 3TYDA 2P10A 1GZGA 4MUZA 4RDWA 1DJQA 4ML4A 3EDKA 5FD0A 2W4XA 1NDWA 2C1GA 1NU5A 1W3JA 1OC6A 3B0PA 3PBMA 3TYZA 3VE9A 3S42A 3M0KA 2X7VA 1K9EA 4QJ3B 2O4MA 4RW3A 4GBDA 3VD7A 2FZDA 1Y65A 3CHVA 3M7WA 1Z44A 4J3ZA 5E9AA 4ADUA 3LRMA 3N34A 1WZKA 4M51A 3V5CA 3VIKA 4ERGA 5AC8A 3INPA 5ECVA 2NQLA 2WJFA 3LERA 4NX5A 4TMCA 4EXBA 4AZIA 3WLMA 3H55A 3PVFA 4IQJA 2BB0A 2WM0A 1YX1A 2DIEA 3MWCA 3SB0A 4YTSA 1DJWA 1L2UA 2EEXA 2V3DA 4PUEA 3MSRA 1XCFA 2JALA 5D38A 1LLZA 3OGRA 2ZZ3A 5CGQA 1ZNNA 4M81A 3QGVA 2AQOA 2UV8G 1Q3NA 4FIQA 4H04A 3P5ZA 3WEZA 2WYSA 5DBUA 1TIMA 3OA5A 2HQAA 3TYEA 3KUMA 3A21A 4I7UA 2Y63A 3W83A 5LKYA 2C1IA 1OK4A 5JVLA 4ZOEA 1MW1A 4GKTA 4H00A 4GLEA 4Q7NA 4YIWA 2AQVA 3RR4A 4AX7A 1VFMA 1JDAA 4MFEA 1VFHA 2OTDA 1P5BA 1VPYA 4IGHA 2RH9A 4LS2A 4GCXA 3IIPA 3CPRA 4IXXA 3TQKA 4DZ5A 3UG5A 4AB4A 1RBOB 2CWXA 5DANA 1QI5A 2IXUA 3CO4A 3TJLA 1QFEA 3OIHA 2DSUA 5IFTA 4JIQA 4UIOA 2RDXA 1QI3A 5G4HC 4HPGA 2B0MA 3W6YA 1A0EA 4LUTB 5MKGA 3K1DA 2GZXA 4H19A 3C0LA 4FX7A 3RMJA 1JR1A 2CEQA 4K36A 4UZSA 3QFWA 3EKGA 4WF7A 1F3TA 4D6HA 1AA1B 2Z2BA 3RLHA 3FAXA 2UY3A 3JVAA 4OFCA 3WLLA 2Y5JA 1MW3A 1OBAA 3AIUA 4GX8A 4CD8A 3UD6A 1A5SA 5A6BD 2POTA 1NIUA 3T4WA 1UKTA 2NLYA 4TV6A 1FWHC 1KA9F 2P3EA 4HA0A 2D22A 1PWMA 3TP4A 4UXDA 5JU6A 4EPEC 2XVNA 2ISSA 2A3CA 3I65A 1PSCA 4XZHA 3WQPA 3QW4B 3BMVA 1VHCA 4JNYA 1VCVA 3QV8A 3A24A 1Q66A 3HV9A 4FOUA 4BS0A 2WBGA 2BLEA 1FFRA 1XIEA 2A3LA 1W9XA 2IPWA 4PCNA 3MJYA 4GQRA 1LG2A 4IISA 4PMYA 1RSCA 4EIVA 1JEZA 1KV5A 3EAUA 4S3JA 1SR0A 1DL3A 2JEQA 2GWNA 2X16A 4HYWA 3CLMA 5B7ZA 4Z0SA 2XDFA 3NGJA 3GNOA 2VEGA 1E51A 4PTXA 4E3VA 3KDNA 1YIXA 4OBSA 2OQYA 2GQ3A 3L9CA 4OQVA 4LY8A 5F1UA 4XB3A 3S5OA 4ICCX 4RPQA 3BSGA 1UHVA 3N2XA 3SO7A 4FAMA 1DXIA 4NXSA 4LAKA 2PS2A 3WF0A 3D5HA 2PZNA 2QYGA 4M1BA 4YL2A 2ZBTA 5HNNA 4LV4A 5D9MA 1ZUAX 2PFHA 4JPGA 5D8ZA 1ML1A 3M0VA 1FCBA 4NZ1A 1GVSA 1TG7A 3EEGA 5CSUA 2G3IA 4B4HA 3AROA 3FK4A 2DT3A 3HIJA 2QT3A 1MXDA 2PCEA 3UWWA 4RCXA 1M01A 4BF9A 1XGEA 1OCBA 4EPBC 1RD5A 5JBFA 4H7VA 1P7TA 3WLKX 8XIAA 3SIZA 3HMJG 1LLOA 4N0RA 5DT5A 3FEQA 4BHYA 3GXFA 3BURA 4MWAE 5DFAA 2FKPA 3FW6A 4ZTXA 4G7EA 2PDXA 4MAVA 1JGMA 3LMZA 1F3WA 2DP3A 2D0GA 1TJ1A 2FGZA 1MDRA 1LL4A 3AALA 1VEOA 1NF7A 2ISWA 3HFYA 5JQ9A 4L9YA 1JDEA 3OBEA 1HO4A 1XGDA 2PWEA 1RK6A 2CU0A 5EMMA 1E4IA 3O06A 1IR1A 3UYIA 1R3YA 1NQ6A 1S5NA 3F7JA 1UR8A 3HPFA 3BE7A 1RVKA 1UUMA 2VX7A 2Y0FA 4CN4A 5T91A 1EJSC 1CGTA 5T26A 2B31A 3GE7A 3PUDA 4GQQA 1IXQA 4M8UA 3NEVA 3EOUA 3BOLA 1W1VA 5G2HA 2PF0A 1E6QM 3W2JA 3KRSA 3W02A 1CBGA 2WBKA 3B8UA 4XVEA 4AD1A 3ZZ1A 3NQ8A 3GHUA 4Q33A 5DBTA 1FWFC 3LCWA 2G4JA 3E5BA 4LCRA 3UJ2A 3HTWA 1LDCA 5EKYA 3KP1A 3VIHA 3UF9A 3N2OA 1XLIA 3V5FA 4D71A 4TIMA 4CEXC 4Z2JA 2Q02A 4Q8PA 4QTGA 4Q8TA 1L8PA 1OC7A 2GUBA 1B3OA 1QWKA 4H1ZA 4AXNA 3AQUA 1A5UA 3UPWA 3WD1A 4PB5A 4US5A 2G3FA 2FHCA 1R38A 3SSZA 3N3MA 2P76A 2VCCA 2I16A 2BGNE 3QGAC 4ORMA 1HL8A 1DWAM 3IJ8A 1LRQA 2Z6IA 1DIDA 1PZ2A 4DBUA 2NV9A 2ZRYA 5IHRA 2G41A 4Z1YA 2WCAA 3PJUA 4XKMA 1V79A 4LF2A 1NWTA 3NZ1A 2Z1KA 4HIBA 1LWHA 3TONA 1HJXA 3T42A 1BSLA 2BVWA 2YCEA 1A5NC 1GOOA 3UR5A 5LNVA 4QM1A 4A8IA 1A5AA 3CGTA 3G1SA 1FDJA 2BY1A 2WVVA 1V5XA 1HVXA 3ECQA 1HQTA 1PCWA 2WWDA 3A3WA 3EKLA 5C9WA 1T8QA 2X30A 2VD8A 3P67A 2GQ8A 3U2OA 1DE5A 1IWPA 5CJ5A 1XL9A 3KWSA 1NH6A 5G4WA 2OWCA 4W7VA 3LN3A 4IIFA 1J2WA 4JIPA 2ZRVA 2PDIA 8XIMA 2E3ZA 4LAOA 3M0YA 1XDMA 3NQFA 1ZJAA 4AIUA 2HJPA 3NOYA 3AJ7A 4HHHA 1ZCOA 4S3KA 1KM5A 4DI8A 5A8PA 4KMQA 1DWJM 3VMOA 1NELA 2PUZA 4U3CA 4GCAA 3QQ1A 3FSUA 3TA9A 4H4IA 1OK6A 5BNKA 4LSBA 3AOFA 4AG0A 2J7BA 3GG0A 1P7TB 1EDTA 2FMOA 4KCTA 2NW0A 1JXJA 1LBLA 1DBTA 3T44A 4TVUA 1DJYA 2BVTA 4I9AA 2QHAA 5JMUA 1CI1A 1WKFA 4TTUA 4Q22A 4GOAA 3GM8A 4AXKA 1FKWA 3RCYA 4BEQA 4XAFA 3ARWA 5TBOA 3F2BA 4QE1A 5FJPA 4L1XA 2QCNA 3G3MA 3S5YA 2PWFA 5T9CE 3CV6A 1T99A 4HA1A 4M82A 4P7RA 3IRDA 2DZAA 5D4YA 3P60A 3VX0A 4DUOA 3M0XA 4KWWA 3O2LA 3NYDA 4JOMA 1J79A 3SAZA 2IQTA 3RPMA 1XYAA 4C91A 4IIEA 2QW5A 4AZCA 2HXTA 3KLLA 1BSIA 4O16A 4LBSA 1KO0A 3KX6A 1V93A 5F2MA 3BLEA 4XD4A 3RXZA 2CLIA 1FHLA 5EMLA 2IKIA 8CGTA 3ME3A 5CZTA 5AYYA 3GTIA 4KETA 4J27A 4PBEA 2INFA 4O17A 4FF5A 4X60A 3BV4A 1UD8A 1H7OA 1FWGC 3PWIA 3FAWA 1G7VA 1MNSA 4MF4A 4A8NA 2J8GA 3GIYA 2WO5A 3T9PA 3TFXA 4UQ9A 4GKLA 4NSBA 3K46A 4J4KA 3OBAA 3B4YA 2WC4A 3W6MA 2BVDA 5IBXC 3GY1A 2BS9A 4PCSA 1J9YA 3SCOA 3WF4A 2WPGA 2R1LA 1FWIC 4LYQA 3S1UA 3ZFHA 4FNPA 1ZZMA 1LUCA 5DLCA 2G50A 3T1GA 4M6PA 4WJ8A 5D2WA 3T40A 4L61A 3UVIA 3A23A 3E0VA 3N15A 5AHMA 2XM1A 1XV8A 3VNZA 3NEHA 4G2DA 1MEHA 5FIPA 1UA7A 1XXXA 1RBAA 4HOXA 4NT0A 5C2XA 2PCQA 1XIIA 5EA9A 1PDZA 3DH7A 4S38A 4AU0A 3N14A 3VCRA 2D0HA 3O07A 4JTDA 1UUQA 3IK2A 2AMXA 4FALA 2VTFA 3GVGA 2DZSA 3DFNA 1C3FA 4AD0A 4PTVA 3KRZA 1J0YA 4O0ZA 1F5ZA 5L9FA 3LENA 3K8LA 3GG7A 2J7CA 2PDYA 1RV8A 1EQCA 1KFLA 1ZTVA 3E74A 2YA2A 1SMDA 6TAAA 5HBFA 2AGTA 3AIRA 4I3GA 3V16A 5HANA 2OX1A 3DN5A 4LUSA 3LGEA 1V0KA 2X09A 2WKGA 1HX0A 5AYZA 2WJDA 3VD9A 4Q32A 1LYXA 2O7SA 4GQGA 1PX8A 3GH7A 5HQEA 1HTIA 4C6LA 2SFPA 3F4VA 3RPTA 4J3WA 1JXKA 1V8EA 1AFSA 3KVJA 1VRDA 1KB3A 1EB3A 1J2BA 1ZRQA 2GDVA 3CL8A 1TQJA 3A13A 3EOEA 3FYYA 4GXWA 4QJ4B 4LAZA 2PF8A 5IDZA 4XAGA 5CAKA 1HF6A 1XSJA 1PAMA 2WW5A 1KXHA 1E0VA 3HFTA 3CHCA 2OWWA 3F5KA 2OLSA 1PE1A 1GTHA 3OLGA 3LA4A 1KWKA 4F2UA 4A2RA 4TV5A 5I3GA 2ZUVA 1O60A 3QKZA 1V6VA 3M41A 1A4LA 4CVWA 2R94A 4H7ZA 4AZCB 1B5TA 2CHNA 1FDZA 2E6FA 1N7KA 1XD1A 4HK5A 5I79A 5LIXX 1MFUA 3J7HA 4IH3A 2ZCGA 4TU1A 2ZZ1A 2ZVRA 1CW2A 3DC0A 1XLBA 4UTFA 2OKTA 3A4XA 4MVAA 1V6WA 2VGFA 5BRPA 3MSYA 2HTMA 3CZJA 3WJSA 3ZT7A 3AXMA 4O1CA 5I77A 1XLEA 2BDQA 2PBOA 3W2MA 3QZEA 2ZKMX 3ARTA 3SBFA 1J4EA 1M7PA 1A47A 1CPUA 2RDTA 3E0WA 5D04C 4B9YA 4JS3A 2JF7A 3N1AA 5CJMA 3OHIA 1JRBA 1OADA 4W93A 4IPLA 2OZTA 2YW3A 3PUEA 2H3BA 1HGYA 1C8VA 1GOQA 3OGVA 1QASA 4FXFA 1Q7QA 3VKCA 3NM1A 3NDZA 4L80A 5C9ZA 2YGYA 3BMXA 4HP5A 1EO5A 5B7YA 3EWCA 2YCLA 4U31A 2C3ZA 1WDPA 3TE9A 1G94A 4OOZA 3CHDA 2J25A 4RZ5A 1YBQA 2FDSA 2ZTKA 1GUVA 2P0IA 2OLAA 2V3FA 3UG4A 5F1VA 3LV6A 3MVTA 4ZBCA 1JZ5A 2DEPA 1CWYA 1KFJA 4UFJA 2GVJA 1JZ4A 1H60A 1EA0A 5AOUA 2EPOA 2QDGA 1EZ2A 1Q6RA 2WAGA 3KW3A 2VO5A 3S4TA 1JYXA 1RA0A 2OZ8A 3F4WA 4D2JA 4KRZA 1LORA 5IDIA 3O63A 1V6YA 2ZX8A 3NPUA 3URBA 4IHCA 4LUSB 3UWZA 1K8CA 5I02A 3LRKA 1G1YA 2DSWA 4IF2A 2PDJA 6REQA 3PG8A 1K3UA 3BANA 4GGHA 1C8XA 4IX0A 1UKOA 1XJBA 4GNKB 1R7AA 3AS0A 4GC3A 4GY7A 3U5UA 2W67A 3VDGA 1UKQA 1EF3A 2VZUA 2WV8A 4MTVA 4S3FA 4NYUA 3WH5A 4ZFMA 3L4WA 2HBVA 3QLDA 3DESA 1T7LA 2I17A 4O10A 2XWEA 3W84A 4AW7A 3DFHA 3NSMA 4NAEA 4PB4A 5TQLA 4C90A 3B0VC 1J8VA 3N25A 2PRHA 3DFOA 3EWYA 4PCFA 4NZCA 4CN1A 4DO5A 1CGVA 2D3NA 3KBWA 3R58A 3LHZA 1J6PA 1EFZA 3E1F1 3WO8A 3SURA 1F6PA 3B04A 3FS2A 1H7PA 2HXUA 4DN1A 3QPZA 4JNZA 3GX9A 5A69A 2B4GA 4YCOA 2W61A 5DF0A 3LM3A 4W8LA 2PRLA 2H8ZA 1UKPA 2Y5EA 1F73A 4DUWA 1BVZA 2HNHA 3EA1A 3PTDA 4RDZA 1ITCA 4YCPA 4KPLA 3B8IA 4QLLA 3MCMA 3EDDA 4V27A 1KW1A 4XAZA 2FH6A 4Y9PA 4IIGA 1J11A 3BO9A 5ECUA 4EP8C 5DELA 2VOMA 4IIHA 2CZVA 5KINA 1QMLA 4PEKA 3R8RA 2QCDB 4I9TA 2VGBA 3VINA 3WMLA 3FDGA 1DORA 4CQAA 4ZTYA 2DVUA 4U5KA 4S3EA 2EJAA 4NF7A 1SUXA 3QSRA 3QLLA 1SR9A 1QHOA 4RE2A 4PUKA 3WJWA 3N13A 1B9ZA 2AKZA 3CEUA 5AVNA 1ZJHA 3I6TA 1HL9A 1XLGA 1XG3A 4WRHA 2YCLB 1FTXA 2R82A 1R87A 4UR9A 7TAAA 3PANA 2OO0A 2TRSA 2QIIA 1YQ2A 4YYCA 3K1GA 1CCWB 2OQLA 4Z1DA 1Q6QA 1LCOA 3ES7A 3BWWA 5LA2A 3S1WA 4F9DA 2OMAA 2X41A 3W7JA 1TA3B 2Y5SA 3WNPA 3R0KA 4LWWA 1E56A 3DBNA 1B3YA 1LT7A 2HVMA 2O9TA 1B9BA 2GVGA 5BYWA 4ROQA 1XYLA 4IGNA 3ZR6A 2VX4A 4GISA 4K68A 5GNYA 2HMCA 1YDYA 5HMFA 5G5IA 4W87A 4QRNA 1B31A 1JL8A 4IMAA 3H4XA 6REQB 4PMNA 1OWQA 4UC5A 3DFQA 2GGGA 4Q4RA 3EMZA 2CLMA 1ADOA 3U2ZA 1CB2A 3OZMA 4AY8A 4MB3A 4GY0A 1FWAC 5U4NA 5DMYA 2OT1A 1TPH1 1W5PA 1XH1A 3GRIA 3H23A 3KTCA 4JTEA 4WIWA 2A3AA 5D32A 1VEMA 2Y7GA 5I07A 5FJRA 2PSNA 3AHXA 5GJNA 3PULA 4DQWA 4O28A 4FK9A 4NAEB 5D02A 3G22A 4HD5A 4H9XA 3C2VA 4H6QA 1KBKA 2DT2A 4GZ7A 1RAKA 4AIOA 3SQLA 3W23A 4DJDC 1CEOA 3W1LA 2ZUWA 3N9RA 3IS4A 4FXSA 4RE3A 4BF7A 3NWRA 2B7PA 2O92A 2YZ5A 1W1B1 1E9IA 4LU0A 2WNNA 1B4EA 2BOGX 1TTPA 1MDLA 9XIAA 3S2CA 5BOOA 1FH8A 1DJIA 5BWAA 4WGHA 2J6VA 3I6EA 4N9EA 1TVNA 1EWDA 3LLXA 3R13A 5DRCA 3PNZA 2WB5A 3BOFA 1PKNA 1XIMA 5G4EA 2OT0A 3UFYA 4XD6A 4NUWA 4FLSA 4F0HA 3H26A 1S2TA 2P8BA 1UC5A 3PFRA 3R1ZA 5AHEA 1QOQA 1H11A 1KFWA 3ZLGA 4PTMA 2X0SA 2YDSA 4PZVA 3SJNA 2BGSA 2WLZA 4JYDA 3RILA 4EACA 2Q09A 2NSOA 2ATMA 3SUTA 2CLFA 3VCCA 2B7NA 5ABFA 3MB9A 1S5VA 4LB4A 3THQA 1KR0A 4JCLA 1QI4A 3D47A 3LGGA 3TNBA 5GJPA 4V2XA 3LCFA 1YXYA 5HR6A 4GXMA 1W8SA 1Q2SA 1ISWA 1M04A 1O5QA 3R8GA 2NV1A 2DUXA 5CAHA 2CKSA 3V1PA 4ERAA 3W2LA 2PD5A 4KCVA 4NJGA 3M46A 3R12A 4PUUA 1TPC1 4U5IA 3TTYA 4F66A 4Y6GA 2Y89A 2VC9A 1AQMA 2E9BA 4YHGA 1DWHM 2BY0A 3UETA 3CAKA 5E93A 1UG6A 1W1A1 5LHEA 1BTCA 2V5DA 3H7UA 3UT0A 4XK2A 3GHSA 3S2LA 3CTTA 4GUHA 3FX4A 3GR7A 3KCJA 3W7LA 4B2DA 1V0LA 4M6VA 1OIFA 5EMYA 1M68A 3DKJA 4HSHA 4JY9A 4TX8A 3HM7A 3NVTA 5CLTA 3AMDA 3S1VA 5CKSA 3GKAA 4B3LA 4QISA 4E4FA 3C2OA 4DWSC 4X2RA 2OODA 1W8GA 3GDTA 2PWDA 4MY8A 3L7RA 1ZBVA 3NXFA 4R85A 3TOPA 4UFHA 5A8MA 4DBEA 5FAGA 3CWHA 1HKVA 3XIMA 3FYPA 3W6LA 1Q7MA 4E4PA 2CBUA 3O6DA 1UC4A 1XSIA 4JIEA 5ABGA 4S3DA 5LNSA 1UBSA 4BA0A 3CV2A 1X1OA 2F61A 3PFMA 3ZOAA 1Q6OA 3TDFA 1JQXA 3TN5A 4JTRA 1W2VA 1E9ZB 4L4OA 3TYAA 1CGXA 1GKRA 1F61A 2YSWA 5LYRA 4TXEA 1D3HA 1XRTA 3AXHA 1OGSA 2J9XA 3NCOA 2YYTA 3D46A 2E5BA 2PGWA 3TMQA 4EPDC 1KFKA 1FXPA 4ZO8A 4LCQA 4QQ3A 1RQBA 4O4WA 3GAYA 1EPVA 2ZYFA 3CV7A 1EEXA 3P82A 3I3EA 2MUCA 2J9YA 3TH6A 3IGUA 4UCFA 2I7GA 3W28A 3UESA 3RM8A 4ROPA 3FJLA 4ATDA 2ZUUA 4P7OA 3OG3A 5EYWA 3S9YA 3VK5A 4UFMA 2E67A 1GZ1A 2J27A 3NA8A 2W62A 3F4DA 3W76A 5C70A 3DERA 4H6EA 1MZRA 4R9XA 5FF7A 3OP2A 3WDIA 5CSSA 3ZT6A 3AXXA 5HNUA 4MWAA 3LCIA 1F3EA 1SPQA 2ZXQA 4PFMA 5ABFB 3N73A 3W0KA 3M0IA 3WF3A 3BZGA 3EB4A 4KEMA 3GFZA 1ONWA 1YKWA 1BWLA 2Y85A 3N4EA 1RJQA 2QDHA 3UNTA 1M3UA 3MI3A 3SI9A 2E6YA 1PO9A 3WK3A 4HJFA 1FKXA 3CO8A 3GVRA 3GQYA 3M5XA 3TUUA 3PN8A 3CQJA 4NNBA 3TC7A 3CHEA 4D8AA 4M56A 2Q71A 4HN8A 3SN1A 3BG3A 3NJ3A 3W7HA 2VDGA 5EMJA 3WLPA 2WHJA 4NU7A 1ISXA 3EX2A 3TAOA 1ESWA 2ZC8A 3HN3A 4UTMA 1QXLA 4XAYA 1LL7A 3A64A 5DXXA 4R7JA 4IG2A 1E9YB 3SR7A 3VVGA 3N12A 4JTKA 4HHMA 1K1DA 2ZA1A 2BX7A 2Z29A 3CM4A 3WF1A 3N2BA 3WQ8A 1WDRA 1EP2A 5LIUX 4DM1A 1UA3A 4GNJA 3DOPA 3GW0A 4NNCA 4WXYA 3EWBX 1K7XA 2QS8A 4X0VA 3DC8A 4DBWA 5LA1A 4CNOA 1JFHA 2QJNA 1GJUA 4GJ1A 4EX4A 2VT0A 3KP0A 3NXLA 4AX6A 4ACYA 4O54A 3KL0A 3BAJA 2KX9A 3ZJ7A 3TWBA 1VJZA 4S39A 4L9ZA 4W5ZA 4ZB0A 3I7QA 2UBPC 4AVFA 1BFNA 4F9JA 4UTUA 5HOSA 2HRWA 3AS1A 3L4TA 3O05A 3SEPA 2ACRA 1W9VA 3TFCA 3LCGA 4A35A 3B9OA 3CQKA 1K70A 4PMZA 4XZIA 3L2LA 2OQHA 3A9IA 5AKQA 4YTTA 3QR3A 3G2GA 4XBJA 3A4JA 2ZRUA 3UZZA 3EYPA 2V68A 5DCEA 4HTYA 4EOUA 4NZ5A 1EJTC 3PAJA 1QBBA 3Q2DA 4BZYA 1DHPA 5HJXA 1DOSA 4KFNA 1V02E 1IZJA 1S3TC 2A6NA 3G24A 4JTQA 1V6UA 1JAKA 3GNRA 3AZSA 1E3ZA 1DVJA 3HG5A 2WNZA 1MNZA 1JF5A 3GDKA 1AH0A 2VMFA 1SMAA 2JKEA 4WLCA 4F0RA 1G69A 4IP7A 1PHWA 5BMWA 2CESA 1EH9A 2RAGA 3O0FA 4C6NA 3ALFA 4GYPC 1MUWA 3IV8A 4FIRA 3OTRA 1VGAA 3AHZA 4R33A 3FV9A 4HPNA 3ANVA 4RNIA 3LHUA 4I7VA 4I9JA 1EJRC 1OHLA 2ZOXA 3AS3A 2GSJA 4KS0A 5CG0A 5JH2A 2IS7A 2G3MA 3W7IA 1PIGA 4DJEC 4MJ2A 1H51A 2JGYA 4EAMA 4JFTA 1J0ZA 1FH7A 4KEZA 1EXBA 3OW1A 3AUOA 1IZCA 4ZOBA 2HVOA 1XIGA 3PBGA 5IFPA 3URNA 2CLHA 5J5RA 2QF7A 4JY8A 2D0FA 3HG4A 3SN0A 1SJDA 1I8JA 3ZSSA 5HQLA 1MYRA 3VABA 4DJDD 3AMGA 5LIYX 6CGTA 5AB3A 2GJNA 2FMNA 3R0UA 4BI5A 3GH5A 1UR0A 3B8WA 4WQ6A 1EGZA 4NRRA 5EBAA 5A8OA 1JDFA 5FSDC 3W3OA 4QJ5B 3QV6A 1GVRA 4WSJA 3A12A 3PWGA 4NP7A 3BW3A 4NQ1A 1W54A 2CZEA 3G0SA 3NVDA 4HQVA 1HN1A 3MUZ1 4EVZA 4KEUA 1H5YA 1AG1O 3ITXA 4HU0A 3VD4A 2D73A 4FA3A 3T78A 5CPTA 1L2QA 2JBMA 3DYOA 2CBJA 5F7UA 4XZWA 5H8UA 4A4AA 1I1XA 2ASHA 3FJNA 4N4QA 4OV4A 3UXKA 4IWWA 3W7RA 4XTDA 5BW6A 2WVSA 4C1LA 2XJ7A 3HGJA 2PU1A 1TUFA 1WAWA 1YE4A 1WDWA 3ORWA 4UMBA 2QCEA 3EDFA 3S47A 4WKHA 4DF0A 2ZXBA 4H9YA 2PZ0A 1RJPA 1M7JA 3FA3A 2QV4A 3W74A 5E1QA 4H9MA 1QNVA 2GUYA 2PDPA 4E2DA 3SCPA 1EDQA 4CD6A 3LQLA 3PJWA 1U5JA 4LVFA 2GFTA 1MO0A 3CAVA 3WYZA 4L6OA 3BC9A 5M1TA 2NUXA 4MYXA 1FCQA 4DX3A 3MP5A 1GJPA 1BRLA 2DORA 1W2PA 1J93A 4Z17A 1W1PA 3KTXA 3HJZA 3VGDA 1XWYA 1OCNA 3W22A 4ZXLA 5AYXA 1OFEA 3MYOA 1AMKA 2XN1A 2Y70A 3GYEA 2F6UA 1SM9A 4QCFA 4WGXA 3A5FA 5C2CA 3MKKA 3H2FA 4V1YA 1RXOB 1OFPA 3ITGA 5F2GA 1KWGA 3N9KA 2VWSA 1F4HA 3H24A 4IGMA 1Z7AA 1GG0A 3W1AA 2ZTJA 2CXGA 5DEZA 1OFDA 1UPMB 2XSXA 2ALRA 2E1WA 1I4NA 2VX5A 4ALDA 3UNDA 3U5YA 3ATZA 2OLHA 1ONEA 3TNOA 1C8QA 1OINA 2YOCA 1BYAA 1T5AA 2YDQA 3LZ3A 3ZR5A 5K4ZA 4DWSD 3LDVA 4M3PA 3K8MA 4OOUA 1G4SA 5EBUA 5F4WA 2IW0A 4LYPA