3G1XA

Crystal structure of the mutant d70g of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with uridine 5'-monophosphate
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
213
structure length
213
Chain Sequence
VMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIAGFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Mechanism of the orotidine 5'-monophosphate decarboxylase-catalyzed reaction: evidence for substrate destabilization.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
total genus 80
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2009-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3g1xA00
2QAPA 3NEVA 2OT0A 4MYAA 4YMZA 3ATYA 4HSOA 2H6RA 1G6CA 3HG5A 3PC0A 1AW5A 3GXNA 3B8DA 5C6MA 4ICNA 3S1VA 3THQA 1IIHA 1OJXA 4AB4A 5BNKA 2DU2A 3M5ZA 4S1FA 1RQEA 1QNVA 3HPSA 3DFOA 4W9TA 3QMSA 3QJAA 3T7VA 1BTMA 3LRLA 3L5LA 2J9ZA 1I2OA 1TPDA 1TTQA 2B0MA 4O13A 4ZQCA 1W5OA 3NXFA 4O14A 3WJXA 1WYIA 2C15A 3CEUA 1PCKA 3GZ3A 3HOJA 1IXNA 2H8XA 1WX0A 1PHQA 1P5BA 1FXPA 4N4QA 2R14A 1YPFA 2OZ0A 2EKCA 1VLIA 3MUXA 4YL2A 1PL9A 5K9CA 2VFFA 4FXRA 4NXSA 4OT7A 3EX2A 3BGJA 1Z41A 3GDRA 1YDVA 4MZYA 3W1PA 1K3UA 1HL2A 4GUJA 3GDMA 5D2TA 5T26A 1VCGA 3ANYA 3MHUA 3G1XA 4PEKA 3VNDA 4GRSA 4HIBA 1OX5A 2A6NA 1H51A 1TRIA 3A5VA 3N34A 4H6KA 5HUOA 3TSDA 1SW0A 5LSMA 4PA8A 3C2VA 1FX6A 3DZ1A 2YYTA 2NUWA 5LNRA 1ZAHA 1OG0A 3LRMA 3S1UA 3DU0A 2JBMA 3OVPA 2H90A 3F1QA 1C29A 4GUHA 1LRNA 4UCGA 2R8WA 5BMXA 2DZSA 3VFLA 3W7LA 3W74A 1IIGA 1S5VA 3LV6A 4XZ9A 1O5KA 4I7WA 2QF7A 1K03A 1TREA 2CLMA 1LBLA 3S5YA 3UQNA 3FA5A 5HJLA 1W37A 3IGSA 8TIMA 2H3DA 4LS0A 2VEKA 4LTSA 2X1RA 1KM5A 2CLHA 2ISSA 3PY2A 2ZBTA 4JTEA 3G8EA 2LLEA 4NUWA 2E6AA 3NAVA 5C55A 3NQ8A 4CCDA 3MMTA 3E49A 2Z6IA 1FDYA 2BX7A 3B05A 3UZJA 3GVGA 4DO6A 2QCEA 3OBKA 3A9IA 3LCFA 1SO5A 5IBXA 3NGJA 4U28A 1WA3A 1QOQA 1F74A 4ADSA 1JCXA 4C1KA 4JS3A 3DAQA 4Z1AA 1LDCA 3W73A 4DO5A 4GE8A 3W2LA 3NG3A 4O53A 5I3FA 1I8JA 5K4XA 4FF7A 3CPRA 3BGGA 3LI0A 4RCXA 4HPXA 1C8VA 4LWWA 3KHJA 4MLRA 4CNNA 2Q3OA 4H3DA 3GLCA 3OHIA 3TJXA 5FF0A 3PR2A 2E6DA 1VQTA 2HTMA 4HHPA 2RDUA 3H55A 1L9WA 4UR8A 4N2YA 1PS9A 2TSYA 5A5WA 2VXNA 3LHZA 4NJHA 5CPLA 5AHMA 3IIZA 1SZEA 3S42A 4UFJA 3M16A 1AG1O 3W1UA 1XDMA 3QYQA 3I7QA 4LC6A 4R7JA 5K3VA 4FHAA 3TE9A 1P1XA 2TPSA 5AYYA 4J9JA 1PV8A 2CW6A 3B4UA 1G4EA 2AGKA 1FWRA 2X1UA 2J88A 3TIMA 3GK0A 1OF8A 3DFSA 1Q6RA 4A29A 2VENA 1DKWA 3MI2A 1TCDA 2QCHA 3DFPA 4TR9A 3A24A 3MHGA 1H62A 5K9XA 3R13A 3W1TA 2QJIA 1A50A 4GXMA 2DP3A 3VKJA 1I2RA 3O15A 4DXVA 3HQ1A 1K02A 3L0GA 3A21A 3LDVA 1GTEA 2EPHA 5C5YA 4YCPA 4HN4A 1TQJA 2JKPA 1FXQA 3HIJA 3PB2A 4MPQA 1F76A 3NL2A 2ZZ3A 3LX9A 5C2XA 3U6WA 2D73A 3GXTA 5U7SA 4JTLA 2X2GA 1GG0A 1KV5A 3NPUA 3P67A 4MLJA 5CZ0A 2Q3RA 3TMLA 2QAFA 5AHFA 3FLUA 4R53A 1CW2A 3W7NA 4JIPA 5KZDA 1KA9F 2YXGA 2BXVA 2C13A 5KZEA 2GVGA 4C1LA 1VC4A 1MEHA 3EWUA 1PIIA 2W6RA 1H5YA 2A0NA 2AQWA 1GJPA 1VHCA 3LCXA 4O4VA 3BG9A 1GOXA 5DXXA 2Y7DA 1SQ7A 5EMUA 3B04A 3C2EA 4O50A 2DZVA 3HJZA 3FYOA 4IPJA 1FQ0A 1LOLA 3W23A 5LZLA 2BTMA 3LCIA 3UWWA 1N8FA 5KMYA 1ZHAA 1FCQA 3NQAA 4JTJA 2DORA 4K39A 3NL3A 2QUUA 1OFRA 2YZRA 4NZJA 1GYNA 4GNJA 2V30A 1JCNA 4LOCA 4IJBA 4JX6A 1L2UA 4O0KA 4LNYA 1EA0A 2X30A 1JCMP 1G69A 1FBAA 1ONRA 4WY0A 1AW1A 3WJWA 5TQLA 5F1UA 4Q4KA 2JGYA 6ALDA 1KFKA 1G4PA 3QM3A 5F2MA 2ISWA 3QF0A 2ZRZA 4MJZA 2VFDA 3VE9A 3FIGA 5D32A 5E93A 2QCMA 2Y61A 2I1OA 4S2BA 1WBHA 3L2IA 4UUIA 2V2DA 4EF8A 4UTWC 1XUUA 2ZTJA 2H3BA 2C1HA 1XUZA 4QISA 5D2YA 5LKYA 1TPC1 5CSSA 1GVSA 1PE1A 1KM4A 4FNQA 4RXFA 3W1AA 3W88A 1H1ZA 2YCEA 4IOTA 3G1DA 3RMJA 1N7KA 1W5PA 1NAL1 1OHLA 1IXOA 1YTKA 3O05A 3HBLA 1S5TA 3CC1A 3RF9A 3W7DA 5E0KA 3LOTA 3NYZA 2QDHA 3NQMA 4JICA 4O1CA 3S5NA 3FJ6A 4PC8A 1R2RA 5KINA 3U2OA 4AF0A 4DEFA 2YFNA 4O11A 4RJEA 2GVLA 3PBUA 4D2JA 1G7VA 5HULA 3DHDA 2YW3A 7TIMA 5AB3A 4QSHA 5C54A 5L9FA 4AWSA 1VYSX 5D2XA 1ML1A 4UNKA 4RKAA 1QCWA 5FF4A 3LXAA 3S5ZA 4MJMA 3S8HA 4AF0B 5HQEA 3W7GA 3ELFA 4EWND 4PCFA 2ZFAA 3G3MA 2RKXA 5F2LA 4ONVA 3W75A 3BLIA 3SFKA 1VZWA 3LHWA 3BARA 2ALDA 4GFSA 1ZFJA 1YTEA 4Z1CA 3G18A 3PG8A 1F6PA 3TH6A 1EWEA 1TPUA 2J9XA 3HGRA 1W56A 5CGQA 3M6YA 4O8RA 3PVFA 3FFSA 4NX5A 1BEUA 3S5OA 3CWNA 3DKLA 3W7OA 4PL2A 5CZTA 1GG1A 3W7MA 1ME9A 4XTIA 4M6PA 3NOEA 3GNNA 2QJGA 3PULA 3JS3A 2PE4A 1LOQA 1EUAA 3CLMA 3MHFA 3M44A 1TJPA 5EKYA 3LCLA 3EWYA 3P61A 2VEIA 4MYXA 1AW2A 3SGZA 2CWNA 1QPNA 4ALDA 5KSWA 1WOBA 4O17A 1QO5A 2A4AA 3NVTA 4IXHA 5CKSA 1OFEA 5DXYA 1BWLA 1W3TA 5DY3A 5D38A 2PC4A 3UWYA 2XFWA 3L0NA 4DPPA 3M5VA 3C2RA 4O18A 1OFPA 3TV8A 4QITA 3M43A 1YYAA 5K7JA 2HMCA 2VEMA 5DBUA 1OF6A 2ZZ7A 1HO1A 4BI5A 4IX0A 4E2DA 1ICSA 3NO5A 4UTUA 5TBOA 3W7PA 4UC5A 5I3HA 2ZRVA 3IVSA 3C52A 4ZQMA 3BG3A 4N9BA 1B3OA 4QJ1A 3EWXA 4WX2A 3WJSA 5LNUA 1LROA 1I2PA 1CX9A 3UNDA 1O95A 5IBXC 4HT3A 5D2VA 2ISVA 2W0UA 1W3NA 2XN0A 2Z1BA 3P80A 3SY5A 3HF3A 4ZQOA 1DJNA 1UUOA 3NQFA 4FNUA 1XBYA 3K30A 4UMAA 4UTIA 4WOQA 1GT8A 2DJXA 1ME8A 3N3MA 3O07A 4CQ8A 2VFEA 3UZ5A 1NFBA 3LBMA 3WFAA 4RXGA 1MO0A 1ZCOA 3C61A 4O0ZA 2ZQ0A 4UFKA 3EX6A 3KFTA 3GDLA 3WJZA 2QUVA 1VCFA 3TC7A 4N4PA 3B0VC 4OBTA 3EXRA 2NUXA 3LXBA 4JTUA 1KBIA 3STEA 2E68A 3OEXA 3W76A 5HWNA 3TC6A 2GOUA 2TYSA 5LHFA 5DN1A 3UXDA 1TQXA 1MZHA 1EWDA 5HMSA 3HPZA 1OVDA 1OFAA 2VELA 1BWKA 1LP6A 4K6AA 3NPVA 4O28A 5KTLA 3RU6A 3BG5A 5DBTA 3WK2A 3C56A 2CLLA 5EY5A 1JUBA 3N9RA 3LBCA 3LTYA 3P8IA 5FF3A 3NQ7A 3DFQA 3TW7A 5K2ZA 2A7RA 2OCZA 1TPFA 2ABAA 1PCWA 4RLIA 5AYXA 4O4WA 3N9SA 2FPYA 5FEXA 5DCEA 4I7UA 3SIZA 3A22A 3LV5A 1QAPA 1JULA 3EWWA 4K7VA 1QPRA 3KVLA 4JX4A 4WQ6A 2OJPA 4IXXA 2P1FA 3INPA 3QPYA 2Y70A 1X6UA 4NX0A 4XUGA 1SW7A 2WV8A 3HGOA 5I3IA 1O94A 3QZEA 1VYPX 2XN1A 1SR9A 1TV8A 1VLWA 3L66A 2TMDA 1MSSA 4XBKA 4BI6A 3TSBA 4NVTA 3W22A 3P60A 3AO0A 3EEGA 1Q3NA 1ZAIA 2FB3A 2RH9A 3BLEA 3IIPA 4S2CA 5G2HA 2ZYFA 5G2WA 3GR7A 4QAIA 1E51A 1XBZA 1B4EA 5AN7A 2H8ZA 4K7YA 3CIXA 5D2WA 1A5CA 5E1QA 4M6QA 2YFOA 3NQVA 1JRCA 4MY1A 4L4LA 3IIXA 1LZOA 2C3ZA 2QUTA 3R89A 4BWLA 1QO2A 1LOSA 2GQ8A 4Y8FA 4TU1A 1LBFA 3TX9A 2UV8G 2WSRA 2FDSA 3TAOA 1TTIA 3BV4A 5D37A 3C8FA 4O1AA 5KITA 3WK3A 3G24A 1GWJA 2X16A 1I2NA 1RPXA 1KFLA 1Q6QA 4AXKA 1YDOA 1X8FA 4WY0F 3TSMA 1L6WA 1TPVA 5BOOA 2TRSA 3NDOA 1J4EA 3CM4A 4IMGA 4U4MA 2Q8LA 2Z2UA 4CCCA 5FESA 4ZZ9A 5EA9A 4N9EA 3PF3A 3W9ZA 2QCCA 1SSGA 3P8JA 3QW4B 4O57A 5D30A 3CEPA 4QM1A 2WKJA 4LS1A 4JD4A 1KLYA 1XM3A 3SSJA 2FQIA 4RZ6A 3M5YA 1HTIA 3CTLA 3GKFA 1KM0A 4POCA 3W83A 4AMAA 4N9DA 4O12A 1MEWA 5AFDA 4FB7A 3OVQA 3BW4A 3IIVA 2V0TA 2ZZ2A 3TNOA 1M7PA 2E5BA 2DZPA 4HNUA 1TPWA 3JRKA 4GWEA 4X22A 4AHOA 1RVGA 3W70A 2C6QA 3DFNA 4LV9A 2QCNA 3TJLA 4O19A 5AC6A 3M9YA 1H61A 3DH7A 3CT7A 3L68A 2C16A 5DY2A 3KVMA 5EBUA 3FOKA 3MI6A 4RZ4A 3BVJA 1A5BA 5CZSA 3T44A 2FFCA 4EIVA 3QEZA 1XFBA 3IGUA 3PAJA 1O4UA 2FIQA 4X2RA 4JY8A 3LRKA 5FEWA 3F4NA 5LNVA 2YYUA 1WQ5A 5AHNA 3GXPA 4LVGA 3LCGA 2Y89A 4MZ8A 3W2KA 4ZL1A 1D3HA 3W2UA 5HINA 3BK0A 4CNPA 5F2GA 4IGHA 1A53A 3VE7A 1B57A 2A5HA 2I14A 2WSYA 3ATZA 5AHLA 1LBMA 1KLZA 2F7FA 4AVFA 1M6JA 4QNEA 5FI8A 5G4WA 3TK7A 4RZ5A 1LTDA 3BPWA 4KFPA 1LYXA 3EWBX 4OE7A 3DHFA 4E2BA 1W3IA 2HS8A 4HNVA 1MXSA 3VI2A 1W5MA 4Y96A 3STFA 4Z0SA 1SZGA 5H91A 1W54A 3T40A 2G5WA 3N2MA 5D33A 1OFDA 3S1WA 3NM1A 3TCEA 1UASA 3W7KA 2EHHA 5HWMA 1QFEA 4UFHA 4WZHA 5LGXA 3HG3A 3BO9A 3CIWA 1XI3A 2A7NA 2DZUA 3NA8A 5EPDA 3CU2A 5CSRA 2A21A 3O8AA 1OX6A 2FPTA 1XBXA 3UWQA 4UFMA 3W07A 2A85A 3TFCA 3IRDA 3W2NA 4A3UA 4DF2A 3OIXA 2O7SA 3W1MA 3QC3A 3VCRA 5HWJA 2GVJA 2YX0A 3I6RA 2DZWA 1SU5A 3GIYA 3B06A 3IV3A 5ABTA 3P62A 1YTDA 1KW1A 3THAA 2J6XA 1J5TA 3QMRA 2RFGA 2C0AA 2QJHA 3P81A 3UD6A 3W7EA 1H50A 3G1HA 3NQDA 3C2OA 1LLWA 2V2HA 2XN2A 2FPVA 4XKYA 3R8RA 3W86A 1HO4A 4JTFA 3EWZA 2ZRXA 4AEOA 3QSRA 4RX0A 3QQ1A 4XQ6A 3TXZA 4O10A 4AHQA 2GQAA 1ZENA 1JVNA 3L65A 3AJXA 1EX5A 1NSJA 4I9AA 4ZQNA 1VH7A 4AWTA 1QPOA 3A5FA 3HO8A 1FWTA 1NF7A 3HB9A 4UXDA 2A2IA 3LGEA 2J27A 4UR7A 2VOMA 5MHBA 4XKYB 4JTSA 3H54A 1VJIA 4M6VA 3QW3A 3ZFHA 1VPXA 2Y62A 1TRDA 4KFNA 4KFOA 3PB0A 4ZQRA 1G4SA 2BSLA 3FS2A 4ZQPA 5AC7A 1SW3A 2JKAA 2YSWA 3W1RA 4UTTA 4JTGA 3UYCA 1GEQA 4WY0B 1HFBA 4EF9A 2PURA 5AOUA 1LRQA 2C18A 4ZMGA 1RZMA 4NJKA 3P5ZA 1V5XA 4Q33A 3USBA 5LGZA 4Z1DA 2NX1A 1VYRA 4FIRA 3QMTA 1GVFA 4LT9A 1I45A 3UPWA 4UTHA 1ADOA 1IXQA 4LRTA 1JUKA 1OYAA 1JRBA 2A1YA 3PUOA 2Y88A 3C2FA 2QKFA 4LVBA 3U8GA 3W3OA 3W7QA 3M7WA 3DXIA 3SW6A 3PUDA 4WUIA 1P4CA 1G4TA 4UMBA 1YXDA 4N02A 4LUJA 1ME7A 5D03A 4WXZA 5GVJA 3NR0A 2Z0IA 1DORA 1TV5A 1KTNA 4FX7A 1TTJA 3W7HA 3EB2A 1SPQA 2E5DA 1YDNA 1OK4A 3JR2A 2GPTA 2PRMA 3W87A 1H7PA 4XTDA 3GB6A 5AYZA 4JDYA 5CZJA 3NPXA 1GYLA 1KM2A 3N73A 4LS2A 2WJZA 1GVQA 1FUYA 4XWUA 4FX8A 2E09A 4HNNA 5TIMA 4R33A 2E6YA 2YGYA 1QR7A 1SO3A 4HNTA 5F2IA 3TDFA 4E0CA 2V9DA 4NU7A 3I68A 1HG3A 1Z48A 1JUEA 2ZDRA 3O6YX 3PSWA 1WXJA 1W5QA 2VKZG 2HSAA 3QRHA 1FCVA 2WPBA 3UXAA 1S5WA 1Z42A 1FCBA 3NQ2A 1HUVA 5FF2A 2P10A 1QOPA 3E96A 1TTPA 3NL5A 3PWAA 3UY7A 2CZFA 4K37A 1Q6LA 1M7OA 3M1ZA 1OFQA 2QCGA 4BFAA 4JTTA 4Z0JA 5BMWA 2QDGA 4GUIA 1UBSA 2QR6A 4LY8A 3S0CA 1JJKA 2NZLA 1I2QA 3S9YA 3PBYA 2ZRWA 3Q58A 4UTMA 2YDAA 1J2WA 1SO6A 2PRHA 4NNAA 3E02A 2FB2A 4BWLC 4KWVA 3FKRA 1WDWA 1V7YA 3GAYA 3LHVA 5FEPA 3GDKA 2DJLA 1SFLA 2NWSA 1U5JA 2A6LA 5LNSA 1X1ZA 2NXGA 1AK5A 3D0CA 3QSTA 3SZ8A 2V5BA 2J9YA 3LM7A 1EP3A 1GTHA 1GVOA 3V1PA 3KVJA 4R34A 3LCHA 4NZFA 4AWUA 1U83A 1TJRA 4GUFA 2ZTKA 3GAKA 3MW7A 2CFFA 1RQBA 3WK0A 4Z08A 5I3JA 1Q45A 3TUUA 1SO4A 1EEPA 1FY6A 3PS7A 1R30A 1UCWA 3W7JA 1FWNA 1TB3A 1DJQA 4OGZA 4ADUA 3O6DA 1H7RA 3FYPA 4JYEA 1QDSA 1F73A 4FNSA 3HGSA 1OK6A 2VFGA 3IIOA 5CG7A 3HG4A 1OX4A 4JTKA 3ZWTA 4ORIA 4BR1A 4RK8A 5BW6A 4JTIA 4Q32A 2HS6A 2V2CA 4WOZA 4CQAA 1X7FA 5FF7A 3DBPA 3MJYA 3LERA 4Y6GA 4KWWA 3EKLA 1SSDA 3UPBA 3LCWA 5HUPA 3LLFA 4YCOA 1LM1A 3UWVA 2CLKA 5HR7A 4Z1BA 4WJEA 3RNDA 4CCEA 1W5NA 1K8ZA 4YLWA 5F1VA 4IQLA 2B7NA 5G5IA 1K7EA 4M7TA 4X9SA 1G7UA 1R2TA 2V82A 4HPJA 1S3HA 1X1OA 4BK9A 2E77A 2C19A 4P61A 2FLIA 4UTKA 3R2GA 4BF9A 4DPQA 2OT1A 3IEBA 3OG3A 3KVKA 2ZRUA 1EPXA 1O60A 5H2ZA 4E38A 2GJNA 4X3ZA 3SECA 4MUZA 5K4ZA 3C3NA 3FEMA 3SJ3A 1G67A 5L6UA 4NNCA 4AAJA 5LNWA 3KAOA 4GBUA 2QEZA 2GQ9A 2NUYA 3PUEA 1OABA 1EB3A 4PL1A 3W7IA 5CPMA 2NX3A 3B0PA 4LC8A 2CZ5A 1RQHA 3LTPA 2CLOA 1QPQA 3L5MA 5EYWA 1QWGA 3DFTA 2G96A 3KRSA 3R12A 4EVZA 1LORA 1KBJA 3FKKA 4OV4A 1Q6OA 1B9BA 2QCFA 2WSQA 4O16A 1N55A 3G1FA 5FEZA 2ATMA 4A21A 3W71A 3BW3A 3W84A 3LHTA 3HGJA 3P82A 1JR1A 2EGZA 3GKAA 1YXYA 1H7XA 1OFBA 2VC6A 4JR5A 3NQ6A 2ZZ6A 2ZCGA 1WAUA 2ZRYA 1LRTA 4NJIA 2J24A 1TIMA 3HG2A 1TO3A 2OMAA 1I4NA 3UWZA 4K8HA 4FNRA 4JEQA 1K7FA 2CLEA 4JN6A 2X1TA 1VCVA 3F03K 4TMBA 3GNDA 1P0NA 4CNOA 2BWGA 2E6FA 4LW7A 3KOFA 1WV2A 4XBSA 3G1VA 3TFXA 1XXXA 3NL6A 3I7RA 2Y6ZA 3G0UA 1W31A 1JQXA 1Y0EA 3STGA 2B7OA 1K8YA 4UNLA 3FJLA 4DQWA 1EP2A 2JKEA 4FNTA 3L5AA 1ZY9A 4JTHA 5AC8A 2E1DA 3OA3A 1UB3A 2ZZ5A 1GQNA 4IUOA 3LHYA 1D9EA 1T99A 4IPIA 3G3DA 1KFCA 4DF1A 1SZNA 2DZXA 4OV9A 3TXVA 2B7QA 1WBJA 3TQ0A 2GUUA 5DLCA 1EP1A 3O06A 5DCBA 2ATSA 3O16A 3TKFA 5F4SA 1EUNA 5CPOA 4NJGA 5HNRA 2JK2A 2WNNA 4O52A 3T78A 5G4EA 3G1AA 1JQVA 3GX9A 4GC4A 5CPNA 4LRSA 5KZMA 1IGSA 4UTTC 3NQCA 4JGDA 3W7RA 1SZFA 3EXTA 4CQ9A 4AHPA 5HR6A 2I9EA 1AL8A 3W1XA 3LLDA 3G1YA 2PRLA 1TSIA 2P0OA 3LHUA 4A2RA 1KV8A 3BLFA 3QQ0A 1DOSA 5DCDA 4NJJA 4FX6M 4LVFA 4MFEA 4MY9A 4UTJA 3GR8A 1DQWA 2R94A 1ICQA 2ZA1A 3IGXA 2B7PA 3NQGA 2GJLA 4JYDA 1H7NA 3DGRA 1OYBA 4IMEA 1KFBA 4PODA 5AHEA 2E5CA 4M7SA 4NXKA 3TAKA 5J5DA 1NVMA 1DBTA 4N9CA 1CI1A 3C4UA 3TQKA 4IWWA 4MY8A 2IQTA 4NT0A 4MOZA 3MP3A 4NNBA 5U4NA 3RLVA 5I3GA 1DVJA 2R91A 3LI1A 5I3KA 4RR4A 1RD5A 2Y7FA 1DQXA 5D04C 3W2JA 4QIUA 2Y7GA 3ZR4A 4AH7A 3MP4A 2ZA2A 3STCA 3NNTA 4FIQA 3MBDA 3PM6A 1H63A 3PBWA 3TMQA 4LU0A 4OU1A 1PHWA 3RLUA 3PSVA 1R2SA 3DI0A 3CQ0A 5D09A 3EKZA 4LUIA 4B5NA 4P2VA 3W6YA 1W0MA 4TO8A 5SWUA 3C6CA 1AMKA 3MP5A 3TA6A 2A7PA 1H1YA 3EX3A 3GDTA 3ZS4A 2YR1A 3I7SA 2VEPA 4OQVA 3IVTA 4OHQA 1THFD 2OX1A 4M5PA 3H53A 2NXIA 2VFHA 1XL9A 2JGQA 3YPIA 4WD0A 4BI7A 4CLMA 5J5RA 3MI3A 1XKYA 4M19A 3BW2A 4UIOA 3CB8A 4WXYA 4IMDA 2ABBA 1H7WA 3E9AA 1YXCA 1QMLA 5F4WA 4LVAA 3TU9A 1NF0A 3ZWSA 4K36A 1F5ZA 1K7XA 3W1LA 2CU0A 3W85A 3W2MA 1FWWA 1XBVA 4O15A 4DBEA 3NZRA 5AHIA 1W1ZA 3M0ZA 3KRUA 3G1SA 2CLIA 2QCDA 3N2XA 3C0JA 1VR6A 4KKXA 4JYFA 2NX9A 4HKPA 1VS1A 3ABRA 1DL3A 3P7YA 2V81A 4TMCA 3G0SA 4UFIA 3SR7A 1K8XA 4H4IA 4MFDA 4MVAA 5F4XA 3W1QA 1RV8A 1EIXA 1GZGA 3M5XA 3UWUA 3W1NA 2RHGA 4LVDA 3EX4A 4LV4A 2PCQA 1FDZA 1F6KA 2CZEA 3P84A 1TPEA 4RV8A 1R47A 3T55A 4EOUA 3DI1A 4JY9A 3B0UX 3HMJG 1KFEA 1TV7A 2BLEA 2QCDB 1DHPA 4UMCA 1TYGA 1GVRA 2RDTA 1C9DA 1F05A 1VGAA 4Y9AA 4IMCA 3E0IA 4L4MA 5LHEA 3MBFA 4ML9A 1XCFA 4JXCA 3O6CA 1A5AA 3KX6A 2V8ZA 3W72A 1SUXA 4FEZA 2YW4A 4G1KA 5K9DA 3HPXA 3M41A 4K38A 1P0KA 2G95A 1ZJIA 4GJ1A 5G1YA 3WK1A 3W7CA 2WQPA 2Q8ZA 1XC4A 3L21A 3MO7A 4UTLA 2NLIA 3L0KA 2Y63A 1DV7A 1L6SA 2ZA3A 3TW6A 1YPIA 1TMHA 4JIQA 3Q2DA 2YPIA 4UFLA 2NWRA 3ABSA 4JX5A 1KTCA 2FTPA 3Q37A 2NXHA 1M5WA 2Y7EA 3O1NA 4DF0A 1YLVA 4A22A 3S1XA 1KTBA 5D05A 3S6DA 3QFEA 2ZZ4A 4DO4A 1IF2A 1KM1A 2VFIA 3LB0A 3NPWA 3M47A 3CWOX 3G8RA 1VRDA 1ALDA 1W8SA 1L6YA 3SI9A 1JCYA 4OWGA 4JDBA 4DELA 1JCJA 2QCLA 3P74A 3O63A 4N6EA 5G2IA 1H60A 3PG9A 4K8EA 1RR2A 1UUMA 3R5EA 1O5XA 5DELA 1ICPA 4FNPA 4NQ1A 1T8XA 1T0OA 1NEYA 3TR2A 4TX9A 3TROA 3RK8A 5BRBA 4FXSA 3GYEA 5G1TA 1Z44A 4I7VA 2ZZ1A 3NQEA 4ORMA 1XDLA 4YXGA 4O1DA 2C14A 3RFAA 3CHVA 3P5YA 2WO5A 3MWAA 3F4WA 1TPB1 2FJKA 6TIMA 2W79A 4MIMA 3LXCA 4YWIA 4DBDA 3DKJA 1YADA 2WNZA 3KRZA 1D3GA 3L9CA 3N19B 2KZHA 3B03A 1WOAA 3DENA 4N6FA 4PTNA 4QQ3A 1MEIA 4O1BA 2G97A 3TQVA 3SGUA 1PVNA 2B4GA 3IVUA 4PH6A 5EL1A 4MKNA 1BKSA 1ZALA 4O54A 2Y85A 1SFJA 3E12A 1ZAJA 3Q94A 3ABOA 1ZNNA 1VHNA 4GUGA 2EAWA 4QNWA 3QH2A 3MYPA 3UY8A 4Y90A 3EXSA 5D02A 1R46A 1FCUA 2WNQA 3T4CA 1TPH1 4ADTA 4ZVJA 1LCOA 2BZNA 4IX2A 4HSNA 2CLFA 3A23A 2O7QA 2WOQA 3NZ1A 5IM51 3ABQA 3N14A 2V5LA 4JNMA 4TIMA 2AAMA 3I65A 3L67A 3WJYA 4FO4A 1A5SA 1H7OA 1B4KA 3KXQA 3G0XA 4PFMA 1F2JA 2RDWA 1OYCA 1GPWA 3QPZA 1AL7A 4UTWA 2NV1A 1KM6A 2Z6JA 1LLZA 3V75A 3PBVA 2DZTA 4IMFA 3NM3A 2EF9A 2X1SA 3OVRA 1FWSA 3G22A 1IXPA 1OFOA 1UJPA 4A2SA 1F7BA 1JCLA 1KM3A 1KFJA 2CZDA 5A8GA 1FDJA 1T96A 2NV2A 2F84A 3LTSA 3MYOA 3EX1A 4MZ1A 1OX4B
chains in the Genus database with same CATH superfamily
4LH8A 3NEVA 1E0WA 4MYAA 3ATYA 4HSOA 1FVPA 1S38A 3BWWA 4ERGA 2XH4A 4KEZA 3S1VA 3THQA 5DMLA 5BNKA 4JCMA 3W26A 1E70M 1ECEA 3HPSA 5DRIA 3DFOA 2P0IA 3QMSA 3QJAA 3LRLA 5CBJA 3RO6A 1BXBA 2J9ZA 2DIJA 3D47A 4IHCA 2Z1XA 3WJXA 1W5OA 3ME3A 1WYIA 1XYZA 2C15A 2PWFA 3RJXA 3GZ3A 1WX0A 4ZO7A 1P5BA 1FXPA 5D9OA 3BSMA 3N4FA 2PB1A 4YL2A 1PL9A 3SURA 2VFFA 1BVNP 3MT1A 3EX2A 3BGJA 3W1PA 1V3MA 1XWYA 1K3UA 4GUJA 1J11A 1SMAA 1JXJA 4XAGA 3VNDA 3TYCA 2FZMA 1UMYA 2VRKA 3T1GA 3WLMA 4IL2A 5LSMA 4PA8A 4L80A 2HDJA 2YYTA 4E4FA 3CHDA 1ZAHA 2D69A 2ZX6A 3S1UA 4DB7A 1QBAA 3BCDA 1EJTC 1BF2A 2IPFA 3WMLA 2G3NA 3DU0A 4M1BA 3RJYA 5M03A 1C29A 2QVNA 3B8VA 3VILA 5BOFA 2W27A 2DZSA 3AXXA 3VFLA 2INZA 3LV6A 5HQLA 5BXPA 2ZKMX 4DJFC 1MXDA 2QF7A 1K03A 3OLIA 1HKVA 2Z26A 3FA5A 5HJLA 1X96A 4XB3A 3IGSA 3L12A 4FLSA 2WSPA 3JU2A 4LTSA 5CPSA 2X1RA 5JBDA 1W32A 3AWNA 2QUMA 3WBXA 3PY2A 3G8EA 3UW6A 2ZXBA 2LLEA 4NUWA 2AQVA 4W8BA 3NQ8A 1SFSA 3E49A 3H4XA 2ESCA 1PUDA 4B9YA 3LCFA 3M0YA 3WIJA 2PBOA 2YJQA 2Z7KA 3WD4A 3DHPA 3AHZA 3NGJA 1ITUA 3TC3A 2YXXA 3UVIA 4HU8A 2Y5EA 2A3HA 3W73A 4DO5A 4IFKA 1YHTA 3W2LA 3WO8A 3NG3A 5I3FA 4AQLA 4AY7A 1UYQA 4FF7A 2X40A 5BU6A 4XK2A 4DUOA 3KHJA 3ZYZA 2PZNA 4WCJA 4D9PA 4H3DA 3DOPA 2ON3A 4K8GA 5FF0A 2E6DA 4AEEA 2QJJA 2VZTA 1A47A 4RZBA 2RDUA 3WUEA 3JVAA 3CS2A 2TSYA 5A5WA 1PYFA 4NJHA 5CPLA 3ITVA 1SZEA 2PWGA 4UFJA 2FGLA 3QYQA 2QJNA 4XKMA 4ACZB 1OCNA 1ITCA 2TPSA 3VNKA 5AYYA 3DYPA 2OYMA 2VP8A 1PV8A 3B4UA 2E9BA 5CLWA 4W87A 1XKJA 1LQ0A 1UJQA 1KO0A 2J88A 1EQPA 3TIMA 3DFSA 2BXZA 4J3VA 1DJXA 2DW7A 4HK7A 3IAQA 3WNPA 1M1BA 5FCZA 3DFPA 4YTQA 4L9ZA 4GHRA 1H62A 5K9XA 3MUCA 5CGMA 4GXWA 3W1TA 2QJIA 1QWKA 1A50A 1YNQA 2VR5A 1EDGA 3RYSA 3LDVA 2V67A 3NDZA 3IUHA 3HIJA 2C7FA 4GQ0A 1XRVA 2ZZ3A 3LX9A 3EGJA 3N3TA 3U6WA 1EH9A 3L23A 4ATLA 1GW1A 5U7SA 4JTLA 1W9PA 3NPUA 3MVTA 4DWSB 2QAFA 5DEZA 3W7NA 4R53A 2E8ZA 4KCUA 5KZDA 5KZEA 3B0YA 2GVGA 4C1LA 1VC4A 4IICA 5M17A 1JYNA 3BDKA 1MEHA 1Q7MA 1VHCA 3MMUA 3PPCA 1M04A 5EMUA 1XSIA 2BTMA 3KDOA 3GQYA 4JIHA 2WCGA 1VFSA 1N2VA 4JTJA 5GNZA 3WUGA 4G6CA 2QUUA 1BFNA 3NVDA 1YW1A 3N9KA 1L2UA 2IKJA 1W9BM 3GW0A 4LNYA 3EMQA 5HOSA 1GK8A 1JCMP 1KKOA 4HB7A 3S4TA 1AW1A 3GFZA 1K9FA 2DH3A 1J79A 4PE8A 4OBSA 1Y7VA 2PZ0A 4IPNB 1K4HA 4AG0A 4OTKA 1NWTA 5D32A 2QCMA 1HVQA 3GTIA 3ARXA 4ZSUA 1EX1A 4S2BA 1H49A 4IGSA 4UUIA 2V2DA 4EF8A 1LG2A 2AAAA 2H9AB 1XUUA 2ZTJA 1GOWA 1H4PA 2C1HA 5D2YA 5CSSA 2C91A 4X9YA 1KM4A 4UB9A 4FNQA 3RMJA 4QG8A 4YHEA 1N7KA 1W5PA 4HHMA 5I02A 1NAL1 5BZAA 1IXOA 3FN9A 3O05A 3HBLA 3CC1A 1E6RA 1UW9A 3RF9A 1OCQA 3LOTA 1A5MC 4HGXA 3K1DA 1RPKA 3ES8A 4R27A 1R2RA 1O66A 3U5UA 3LG3A 2FZBA 4G9PA 4AD2A 3H26A 4AF0A 1W17A 4E2VA 4O11A 3UA3A 4RJEA 4BZYA 3PBUA 4QDPA 2OPJA 4D2JA 4P5UA 4K1GA 5HULA 3CV2A 4QSHA 5C54A 5GJNA 5A6MA 7REQA 3DESA 1FWFC 4IZGA 4BEUA 4LSBA 2F6UA 3JUGA 4MAVA 1HT6A 1FWCC 3S5ZA 3UG8A 1TWDA 2ZX8A 3W7GA 3ELFA 2VQUA 1WDRA 2J7HA 3UEQA 2RKXA 2WYSA 4ONVA 3W75A 2FGBA 2PDMA 4GFSA 1XIMA 1FH8A 1GVEA 4DBWA 3G18A 3MMWA 3AHTA 4PUDA 3OLEA 1F6PA 3DBNA 2PA6A 3EKGA 2O4QA 4AYSA 2ZX9A 3S9ZA 3BC9A 4NX5A 3GVVA 1XLMA 5CZTA 1ME9A 1FWHC 5RUBA 3PULA 3JS3A 2PE4A 3EYPA 1TJPA 2OQLA 1AW2A 1Z9AA 4MYXA 5EMMA 1BLIA 1RY8A 4G7EB 5HJXA 1WOBA 1QO5A 5CKSA 4P8UA 7TAAA 5DXYA 3MDWA 5DY3A 3L0NA 4WSKA 3ARQA 1V0MA 2WZMA 3NZQA 4O18A 3C2RA 4BKNA 4QITA 1XLHA 1SR0A 5K7JA 1R9ZA 2J7FA 1OF6A 4ZTXA 4WDXA 3BOLA 1XIIA 2PDFA 4IX0A 1I75A 5DQPA 2YCLA 3MCMA 4D1IA 1QI3A 3HMCA 4HOZA 3CUJA 1B3OA 3WF3A 3CMFA 4W86A 5LNUA 1LROA 5JIPA 1I2PA 2Y2WA 1KQYA 1OSEA 5IBXC 4HT3A 2GGEA 4ZQOA 4GY1A 1DJNA 1J6PA 3NCOA 2X0YA 3BANA 1GQKA 2F6KA 2VGGA 2IS7A 3K30A 4UTIA 3N04A 4ZTYA 2W3ZA 1UIPA 5A2CA 1R3SA 3B3DA 5I3DA 4CQ8A 3LPGA 5G1MA 2VFEA 3UZ5A 3V0UA 4C91A 1NFBA 1J01A 4TVUA 2KX9A 1ZCOA 3C61A 4W85A 4QX4A 5CPTA 1BRLA 4QSFA 3S5SA 3RU8X 3QKZA 4N4PA 5XIAA 3PBMA 4JQ4A 3W76A 5LHFA 3GC2A 1MZHA 3HM7A 4PUMA 4HZ8A 1MVYA 2WVVA 2OWCA 3R43A 2XM1A 4O28A 3RU6A 3BG5A 5DBTA 1ZL1A 3P8IA 3NQ7A 5JU6A 3DFQA 5K2ZA 3ALFA 3WENA 1PCWA 2C1GA 3KLLA 2VC7A 3R0UA 3KVLA 4IXXA 3INPA 3IJ6A 2Y70A 2PP1A 2P53A 2XN1A 4KERA 3TWBA 2QGYA 1JDAA 4XBKA 3TSBA 1GQLA 1Z6KA 5G4HC 1P0EA 1ZAIA 2RH9A 3ECQA 5AC4A 1IEIA 4XAFA 4QR6A 3GR7A 1I1XA 4QAIA 1E51A 4EKJA 1HP5A 1B4EA 4JKLA 3KEHA 4EPEC 4QDMA 3CIXA 5D2WA 1PB0A 3DFHA 2ACQA 2VRJA 5E1QA 4M6QA 1O68A 5EMJA 4DWSD 2X8RA 2WMKA 3R89A 3ZLHA 1QO2A 1AJ0A 1MW2A 2WSRA 2XPKA 4CN1A 1A5KC 5HJYA 3TAOA 1POJA 2VZVA 2VZOA 4O1AA 3G24A 1RPXA 3VZXA 4CVWA 1KFLA 3SN4A 3NZPA 1P48A 1CWYA 1L6WA 5FL0A 1TPVA 5BOOA 5XINA 1I9CB 4QRNA 2TRSA 1J4EA 3CM4A 2Z2UA 1QI2A 1ENUA 4J3XA 2P8CA 4PMJA 5C9ZA 3P8JA 3QW4B 3GUWA 2J7DA 4L6OA 2GWNA 2NQHA 2WKJA 4LS1A 4JD4A 1OD8A 4F66A 3EBVA 4MKVA 1KLYA 2FQIA 3GKFA 3QQWA 4N9DA 3K4DA 3WQGA 1PZ0A 5HMEA 3KDNA 3B9AA 2CIPA 3IIVA 1R0MA 2I5QA 4H9ZA 3JRKA 1BYBA 2AKZA 4AHOA 1RVGA 2YDSA 2VC5A 4ZOBA 4PB3A 4PB4A 1DIOA 4ZENA 3WDIA 2ZXDA 3U57A 1UR8A 4FI4A 3CT7A 3L68A 5DY2A 2R82A 1YEYA 2BB0A 1TWSA 3U2ZA 3FK4A 3BVJA 2OWWA 3T44A 3D6NA 2FFCA 3GDBA 1UR4A 1E9LA 3NTYA 4EIVA 1E71M 2X7VA 3IGUA 3PAJA 1EJXC 1CGUA 3BGAA 1SYTA 4Q7NA 4D6CA 1QNQA 3ZLGA 3LCGA 3C0QA 2Y89A 3W2UA 4CNPA 5F2GA 3QHNA 3WF2A 1A53A 5AHLA 2WSYA 4AVFA 1ISZA 4F40A 1K77A 2IPWA 5FI8A 5G4WA 3H4WA 3EOOA 3VU2A 3BPWA 4KFPA 4DBSA 3WD3A 3GHSA 2UZ9A 3LSBA 3RXZA 2CWXA 5HATA 1W5MA 1J5SA 4Y96A 4Z0SA 2XIMA 4GNVA 3N2MA 3PZMA 3PNZA 1UASA 4UFHA 4OUIA 3CGTA 3CIWA 3CU2A 4MB4A 4GY7A 2FPTA 1XBXA 4WHBA 3N18A 2VT0A 3W07A 2A85A 1XFCA 1TVNA 1QW9A 4AMCA 2I5IA 3TFCA 3IRDA 1W3HA 4X61A 3W1MA 1UC5A 3QC3A 3VCRA 3ARUA 5HWJA 2GVJA 3WBEA 3GVRA 2I17A 3B06A 1KW1A 1H1NA 2OGYA 2QYGA 3W7EA 3AHYA 2PFHA 3G1HA 1H41A 1LLWA 4GQQA 1XLLA 3MB9A 5REQB 5IFTA 4D6HA 3WLKX 2PWUA 3EOUA 1WZLA 1CCWB 4CU7A 1FOBA 2NV9A 1ZENA 3L65A 5FAJA 2E0PA 1R86A 2W61A 3DECA 4JPGA 1QPOA 3A5FA 1NF7A 3HB9A 4WGHA 3FJNA 2V3GA 4MNMA 1KKRA 1VFFA 4JTSA 3H54A 1UKQA 2VGBA 4M6VA 2IW0A 4S23A 4GI9A 1VPXA 3P0XA 1B9ZA 2HROA 4S3CA 5GNYA 3IUDA 3PB0A 4OJYA 1KD0A 2BSLA 1SW3A 4QCFA 3W1RA 3UYCA 1GEQA 1XH1A 4AXNA 5M3WA 2PURA 4ZMGA 1RZMA 4NJKA 4Q33A 2QGHA 4JQAA 2REQA 1BHGA 3AMKA 3UPWA 1IXQA 3GTFA 1C9WA 1WO2A 1XLIA 3COTA 3GU1A 3G6MA 3VOJA 1EBHA 1FWAC 4AY8A 4H1ZA 4N02A 4LUJA 2DSKA 3LSCA 4H8UA 3OZYA 3HJEA 5GVJA 2EQDA 3HFYA 2R24A 1DORA 3W28A 3W7HA 3EB2A 1P7TB 4H8HA 4JAWA 1OK4A 4DVOA 3NIYA 2GPTA 2PDJA 2PRMA 3CUHA 4GY0A 3GB6A 4EXQA 5IHRA 3GE7A 5BXTA 1J2BA 4JDYA 3WY1A 1M7XA 5CZJA 5AC5A 1GYLA 1V6VA 5A6BA 1VBHA 3NO1A 4R85A 4LS2A 5C8BB 4XWUA 2GUYA 5TIMA 3TNBA 2E40A 2FZ8A 1DPMA 1SO3A 4DYJA 1XPYA 3KCLA 2OLSA 2VX4A 3SRHA 4YTRA 1XYBA 3TDFA 4E0CA 2GVYA 1QVBA 1A0DA 3CTTA 7REQB 2D0FA 4RUBA 1HG3A 1JUEA 1MW3A 3N12A 2WHKA 1QRQA 1KXVA 3GC5A 4GVGA 1H11A 3UXAA 4TUFA 3NQ2A 1HUVA 4H04A 5FF2A 1QOPA 3NL5A 3WN6A 4I9MA 3MVIA 4HBKA 1Q6LA 1SVDA 2QCGA 1EXPA 2YBVA 2PDWA 4LGXA 3ZXWA 3PBYA 2ZRWA 4Q8QA 3Q58A 4UTMA 3CH0A 2PWDA 1SO6A 4NNAA 3E02A 3QZAA 3FKRA 4L61A 1OCBA 5A95A 4KPLA 4GVIA 4DYKA 2ZIDA 4QCEA 2A6LA 4Q8PA 2ZUSA 4WVXA 1AK5A 3VCCA 3MUAA 2VZUA 3W29A 2V5BA 1EP3A 2WLZA 3VDAA 1EDTA 1S2WA 3KVJA 4GUFA 1HNYA 2WAGA 4J2PA 2ZTKA 3MW7A 3WK0A 3PTMA 1GZ1A 1J18A 1IEVA 3BXWA 4RE0A 4AZ7A 1FWNA 1TB3A 4M29A 3FYPA 1MRQA 1QDSA 1F73A 4HMDA 4GZIA 4F0SA 1OK6A 2VFGA 1Q6CA 2Z2BA 1OBAA 3VVGA 1REQA 4W8LA 1OX4A 4JTKA 4HK6A 4HA0A 2BGNE 2D2GA 4JTIA 2ZX7A 5B7YA 3KLKA 5HK4A 4CQAA 3MJYA 1OIFA 2HRWA 2NW0A 3BMWA 2J74A 4Y6GA 2HE8A 3QV9A 3UPBA 4XBJA 3H2EA 3BLLA 5HUPA 4EXBA 4YCOA 4HHLA 1F8MA 2G3FA 4Y9OA 3BAIA 2DZBA 3GYCA 3RNDA 4REQA 4JNZA 4MNKA 1K8ZA 3H4GA 5F1VA 2BFGA 2OQYA 2HPMA 4AD4A 4BA0A 2F6XA 1S3HA 5DO8A 1J0YA 3VOGA 2I57A 1GNXA 3CL8A 1LG1A 2IKIA 4HA3A 2YA0A 4DPQA 1XLBA 1XLCA 4H9VA 4UBPC 1V3KA 3AOFA 3UCQA 1QNOA 1Q2RA 1HKMA 3GG7A 3C3NA 1A4MA 3FEMA 3SJ3A 1G67A 3BAJA 5L6UA 1DTNA 2WVVB 3CV1A 3KAOA 4D6JA 1QBBA 2CLOA 1QPQA 4U31A 2J7EA 1QWGA 5IDZA 3DFTA 4WGXA 5LYRA 3JZUA 4EVZA 4JCLA 2IQ0A 2IPJA 3TYBA 2BDQA 4INFA 1KBJA 3M0KA 3FSUA 4TX8A 2WKGA 4FAMA 2QCFA 2WJEA 3G1FA 2GDVA 1MUCA 1E3ZA 2ATMA 2QUNA 4B5VA 3WZ0E 2OO6A 1IHIA 4MNLA 1JR1A 2EGZA 1UQZA 2UY5A 1H7XA 1X97A 1VRXA 2AQOA 1QI5A 4MWAC 2ZCGA 1WAUA 1C7SA 2ZRYA 2HXTA 2HE5A 3HG2A 3WLTA 3UWZA 1DQUA 4L1WA 4LUTA 4FNRA 4A8IA 5IXEA 2CLEA 2AGTA 2IKGA 4JN6A 1IZKA 4LUYA 1AVAA 1Q8AA 4TMBA 2PP3A 1TA3A 1P0NA 3R25A 3FAXA 5LXEA 2BWGA 2E6FA 4WJ8A 4DJEC 1WV2A 2YL6A 1T5AA 4E4UA 1BAGA 3SDOA 4FLRA 2Y6ZA 1S5MA 2EPMX 1WZKA 2DT3A 4YTSA 3FV9A 3STGA 2B7OA 4UNLA 4AD5A 3FJLA 2JKEA 3L5AA 1YE6A 3SCPA 2ZZ5A 4PRWA 1KB3A 1JDEA 4IUOA 3TW9A 1T99A 4GI6A 5CC5A 4OBRA 1SZNA 2DZXA 5ENLA 1K9TA 3TQ0A 5DLCA 1EP1A 2QS8A 5DCBA 1V6TA 2ATSA 3EPMA 2G50A 2XVLA 4Z1YA 1Z7AA 5F4SA 4UQBA 5CPOA 1X1NA 2I7GA 5G4EA 3QGKC 5I0DA 2V5JA 3GX9A 3OLGA 3USZA 2POZA 5CGTA 2GJPA 2GDUA 8A3HA 3EDFA 3MKCA 4UTTC 3GXIA 3EXTA 3URNA 1KRCC 2ZUVA 2I9EA 3A3XA 3UU0A 1DYSA 1X8CA 7A3HA 1XLDA 1UD6A 3PP7A 3K13A 2HNEA 3BLFA 3MU7A 1HGYA 4R7OA 1PTGA 1WUEA 5DCDA 1YBQB 1VBGA 4NJJA 5LA0A 5I00A 4MY9A 4UTJA 2QQ6A 1DXEA 1DP0A 2R94A 3NQGA 1Y65A 1V0KA 4IMEA 3VIGA 4AYGA 5BYWA 3BE7A 2D2JA 4FXJA 3TAKA 1DBTA 1KBLA 4X63A 1V79A 4C6EA 3C4UA 2I9UA 2QNEA 3WEOA 4MY8A 4TTGA 4NT0A 3MWCA 3UZYA 4H83A 3RLVA 2Y7FA 1QASA 1DQXA 3WQOA 2BGQA 3BL3A 5D04C 4A8NA 3ZR4A 4ZXOA 2ZA2A 3E2VA 2X0HA 2V3DA 4PMNA 3KRBA 3TMQA 3ANVA 3DI0A 5D09A 4LUIA 1WDPA 5E6YA 4B5NA 1PZ1A 1ZB5A 4Y8EA 4LUSB 3NFUA 3MP5A 3TA6A 3GDTA 3ZS4A 1TV4A 1XLJA 3U4AA 3I7SA 2VEPA 3GXDA 4OHQA 1UWIA 4G8TA 2JGQA 4GI4A 3M0IA 2D3NA 1B5TA 4QG6A 3AYTA 4WD0A 4CLMA 2X1IA 4Q8TA 3U7BA 1G0CA 4W7VA 2VR4A 2EJAA 1H7WA 3E9AA 3TCSA 1QMLA 1NF0A 5CH9A 3ZWSA 3MZNA 4Z2GA 5FA5A 1BG4A 4O15A 4RDVA 1W1ZA 3M0ZA 2J25A 1VR6A 1UKOA 1VFMA 1AA1B 1JPIA 3P7YA 2ZOXA 4I8YA 2PTXA 4TMCA 1PKNA 4Z2KA 1K8XA 4H4IA 3W1QA 1W8GA 1RV8A 4EAYA 1ZBVA 3BQ6A 1S1RA 4LVDA 3VIKA 2PCQA 4AD1A 5ECUA 2JALA 1TPEA 2PLJA 1WB0A 3T55A 1JD9A 4EOUA 2RGLA 2IQDA 3B0UX 4LBUA 2BLEA 1DHPA 3IJIA 1KGUA 1DE5A 3EB3A 3BAWA 1C9DA 4MADA 5E70A 2R1NA 1A49A 2ZUTA 1GYMA 3DGBA 1TIWA 3E0IA 1CLXA 1MQQA 3T05A 1A5AA 4MPKA 1SUXA 3AIVA 3R10A 1S2UA 4IL0A 3VGBA 2PWVA 5K9DA 1K1DA 3LQLA 4MG4A 3ZJKA 4AUBA 3W4RA 4F2TA 3RR1A 2VVNA 1CXLA 4KBXA 1R3RA 4WEVX 3OYXA 3L0KA 1NARA 1JGMA 3WNLA 3LZ5A 3GBEA 3W81A 5C7HA 1PKMA 2REQB 4P7NA 1PDYA 5GJMA 3O1NA 4GYPC 3T4WA 1KTBA 5D05A 3S6DA 2O92A 2WMIB 1EFZA 3M47A 2O0TA 2VC9A 4B3KA 1LL6A 2V68A 3CWOX 1VBRA 1FWEC 1VRDA 1JPMA 4WKFA 4GPNA 1PXGA 3AUJA 2QCLA 1EXBA 3O63A 4KRZA 1DWHM 3ZJ6A 4J35A 3PG9A 1UUMA 1IR2A 1W3JA 2PAJA 3R5EA 3SN0A 2W5FA 4N42A 4GA8A 3UP8A 6CGTA 2BGSA 3RK8A 3QV6A 1HKJA 4FXSA 1QNRA 5DMYA 3EWCA 3GYEA 4DUVA 5G1TA 2ZZ1A 3NQEA 5E5CA 4ORMA 3WLPA 5EMYA 4YXGA 4O1DA 4J40A 3MWAA 2QIWA 3NQBA 1E0VA 1PYMA 4YWIA 5FJOA 5FACA 3IACA 3AIWA 3GHRA 3UZWA 1V77A 4QQ3A 3MUIA 1JXKA 1VBJA 4IFOA 1T6MA 4I5RA 1B3YA 1ZALA 4I5UA 2PSNA 4PUWA 3KE0A 2AL1A 3ABOA 4GUGA 2EAWA 3ENLA 3MYPA 1UG6A 6XIAA 4S3EA 4CGTA 4ADTA 1TPH1 1CXEA 1LCOA 4IX2A 4GJIA 2CLFA 3A23A 2O7QA 5BWFA 5KZ6A 3NZ1A 3B9NA 3SAZA 4TIMA 4YPJA 4FO4A 1B4KA 2AMGA 3G0XA 3SB0A 5E9AA 1OZQA 3QPZA 1AL7A 2NV1A 1XYLA 1KM6A 4QLKA 5DMNA 3V75A 1GZJA 4GGHA 1IT0A 2XFRA 3DC8A 1E6PA 2X1SA 3OVRA 1FWSA 3CK5A 4KRUA 4A2SA 1F7BA 4H2CA 3MTWA 3QFWA 4J4KA 1FH7A 4F79A 4GIAA 1A3HA 3EX1A 4DHGA 3WBWA 5LIWX 1OX4B 2VR2A 4YMZA 1V6UA 3PC0A 1MDRA 4UR9A 5HQMA 4ICNA 1OJXA 3DDMA 4X0NA 3D3FA 3M0JA 1RQEA 1CGTA 3KBMA 1RCOB 3ZZ1A 3OG2A 4J3SA 1TPDA 9XIMA 4O13A 4HZ6A 4ZQCA 4O14A 1EZ2A 1G94A 1PCKA 1IXNA 2H8XA 1AQ0A 2EO7A 3AIRA 5IRPA 4N4QA 1YE4A 3MUXA 1B2YA 4FXRA 3W27A 1WKDA 4GGBA 9XIAA 1V3JA 3WQVA 1ZZMA 5D2TA 5T26A 1TJ1A 3MHUA 1ELSA 1BGGA 1GKPA 5EMLA 2XZ7A 4W4QA 4TXEA 4G2DA 1M03A 1WDQA 1H51A 3HQPA 2RGMA 3A5VA 3N34A 5HUOA 1K6WA 4XAZA 4LYKA 2Y1HA 2PLCA 1SW0A 5E9XA 5HAOA 1I60A 2QPXA 2OYLA 2YIHA 1XH0A 3RDKA 2JBMA 3OVPA 1V0NA 2H90A 3F1QA 4NASA 4UCGA 2AOSA 3WX7A 4C7DA 1GPFA 5BMXA 3QYSA 1IIGA 1S5VA 4U5KA 1W1YA 3ONCA 1NDYA 4MMWA 1CZ1A 1LBLA 1UP3A 1W37A 2H3DA 2YXOA 2PP0A 3B8TA 2VEKA 4GMEA 3GG1A 1JNEA 1UOZA 2ZBTA 2Q02A 3K4WA 4PTXA 3NAVA 5C55A 4DJFD 1W3KA 1E6SM 3MMTA 4XD6A 3ARTA 2Z6IA 4AZ6A 1TA3B 1FDYA 2PF0A 3UZJA 3GVGA 4AU0A 4MF4A 3WF4A 1SO5A 4H00A 3MS8A 2PTYA 4B5SA 1JF6A 3B97A 4C5YA 4Z1AA 4GE8A 1T7LA 2VNCA 1QW8A 5AECA 4IG2A 1CDGA 1NWRA 3AAMA 1V0LA 3CPRA 3LI0A 5CG0A 2VWTA 4CNNA 1IEWA 3PHAA 5M1TA 1DJIA 3CAVA 1GKRA 3WQ5A 4LXFA 3PR2A 1VQTA 4FOUA 2HTMA 2ADAA 1O1ZA 3E0LA 3H55A 1V7AA 4HNOA 3LMZA 3EMZA 4N2YA 4QHRA 2VXNA 3LHZA 1MNSA 5AHMA 4H7ZA 3G6LA 4AW7A 2BVDA 1UR0A 1AG1O 7PTDA 3W1UA 2BVYA 4LJ3A 1FWIC 3TE9A 3TJ4A 2J62A 1HKKA 1OT2A 1DEDA 2ONEA 2CW6A 3RR4A 2AGKA 1FWRA 2X1UA 3GK0A 1Q6RA 3H2FA 1DKWA 4JIIX 5FJJA 2BBFA 4NY2A 1XISA 1XLGA 4AD0A 4GYJA 3R13A 1NTHA 5C9XA 4HJFA 3VKJA 4M56A 1I2RA 4DXVA 3HQ1A 3L0GA 3SCUA 2NVDA 1GTEA 3Q65A 4YCPA 2JKPA 4OOZA 4Q4QA 2XSAA 1LLOA 3RPMA 1B31A 3QR0A 1PSCA 4H7VA 2X2GA 5CZ0A 3IJ9A 1O5RA 3FLUA 1JYVA 4RE4A 2BXVA 1JL8A 3CPGA 2GOKA 4YVXA 4ACYA 4ZOAA 1H5YA 1P6BA 2AQWA 1GJPA 3LCXA 2ACRA 4O4VA 2Y7DA 3B04A 1XLFA 4O50A 2DZVA 1UWRA 3L4YA 5DF0A 5HXMA 1G9HA 1LOLA 3GU2A 5LZLA 4W8AA 1UWSA 5KMYA 3NQAA 1FCQA 4GQRA 4PBEA 2WCSA 1OFRA 2BP1A 1GOQA 1OEPA 2V30A 1JCNA 4IJBA 4JX6A 4O0KA 4QLJA 2DEPA 4NI8A 1G69A 4YWSA 1ONRA 4WY0A 3WL0A 5TQLA 1SFTA 5F1UA 1X6NA 4GX9A 4UZUA 3QM3A 1G5AA 2G3JA 2WB5A 3QF0A 2ZRZA 4MJZA 3FIGA 3AXKA 2Y61A 2I1OA 3EWDA 1WBHA 3BMXA 1JD7A 5DRCA 5B7ZA 1TPC1 2J7GA 1GVSA 1PE1A 4Y9NA 2PDCA 4V15A 2FZNA 2CBUA 1H1ZA 2YCEA 3G1DA 4J27A 3OGRA 4CQDA 1OHLA 4ICMA 1YTKA 1SGJA 3W7DA 4HMEA 1K9DA 5E0KA 3H6OA 4YVPA 2WVTA 1DWAM 3M0HA 3NQMA 5C7VA 2WWDA 4O1CA 3FJ6A 4PC8A 3WQPA 3T0BA 4MUPA 2VGIA 1NP0A 4AZBA 5KINA 1IV8A 4PMOA 3HZ3A 4DEFA 1UOKA 1F9CA 4C6IA 5A94A 3DHDA 3CASA 2YW3A 7TIMA 1C91A 4GABA 2YL9A 1TZ7A 2ACUA 4AWSA 5D2XA 1ML1A 1CECA 2WJFA 3LXAA 1XCWA 3APTA 4MJMA 3S8HA 2BHZA 2ACSA 9CGTA 1SJAA 4EWND 2XWDA 4HA1A 3BLIA 3SFKA 1VZWA 2UY2A 2ALDA 3VABA 1ZFJA 3BSHA 5LA2A 3AS0A 3EOEA 3M0MA 4Z1CA 3AFBA 3TH6A 2OQHA 1TPUA 3F4DA 1HIZA 5CGQA 2CXGA 3PVFA 3FFSA 1J93A 1B90A 2GSJA 1GG1A 4IIDA 4M6PA 3GNNA 3VX0A 4FOJA 4K1WA 1TZ9A 1VPYA 5D4YA 1QHPA 3MHFA 5EKYA 1XINA 1DJYA 2CWNA 4ALDA 1P43A 1ADDA 4IXHA 4KEMA 2PC4A 1RBOB 3AUOA 5H8UA 3IUIA 3WLIA 3TV8A 4HQVA 2HMCA 4TVDA 1XP3A 4H9UA 3U2EA 2ZZ7A 1HO1A 1HJQA 1IZCA 3NO5A 4F0LA 4UTUA 2DT1A 1QI4A 3THUA 3WD2A 2VDIA 4BQ3A 2FTWA 4ZQMA 5A6KA 5MKGA 2WBKA 2F9RA 4N9BA 1CXIA 3WJSA 3QY6A 3WLJA 5AZ1A 4AIOA 1VJZA 2YL5A 3WEMA 2ISVA 3SQSA 2XN0A 2Z1BA 4IQEA 1V6YA 3HF3A 4DZIA 2DH2A 1Q7QA 4J28A 2HQAA 3CHCA 2CHOA 3A3HA 3UG3A 4GLEA 2W4XA 1ZP3A 1SM9A 1X6LA 4WOQA 4NSBA 2WVUA 4D6DA 4B91A 3ALGA 3VD5A 3VNIA 3PPGA 1IYXA 3WFAA 3UR8A 3T2PA 4NYUA 4A8RA 4O0ZA 4S3FA 4J3ZA 2ZADA 2FZDA 2QUVA 1VCFA 3TC7A 5I23A 3B0VC 3EXRA 5IHSA 2NUXA 3STEA 5LXXA 4DBUA 5HWNA 3T9PA 4QJ3B 5DN1A 3VIIA 4KMQA 4A3YA 4YHGA 1RJPA 1OFAA 2VELA 1BWKA 1LP6A 3Q67A 3QY8A 4K6AA 3WK2A 5EY5A 4GYPA 3LBCA 3N25A 4ZFCA 1Q66A 3LLXA 3TW7A 1TPFA 1B3XA 1TWZA 2ABAA 5AYXA 3POHA 4O4WA 3FY1A 4CD4A 5FEXA 1VFLA 3T2OA 4I7UA 2NLYA 3KBWA 1JULA 1W9UA 2GFTA 3FVDA 3QPYA 2DSVA 4NX0A 3LZ3A 3UZZA 4WSJA 5ABEA 3SCRA 1VYPX 1SR9A 4J3UA 3C0LA 3L66A 2TMDA 1V51A 4US5A 1MSSA 3NWRA 2FGZA 2Z27A 2WBGA 4NIRA 4NVTA 3P60A 1RVKA 4M8UA 3EEGA 2Q71A 1Q3NA 2FB3A 3BLEA 4C6NA 3IIPA 5G2HA 5G2WA 3R0DA 3LN3A 2H8ZA 1A5CA 2CBVA 2Y8UA 1XJBA 1UKTA 3W6MA 2BS9A 2FKPA 4UCFA 1GJWA 4NAFB 1XD0A 4L4LA 1RBAA 2O9PA 2GQ8A 4TU1A 1LBFA 1XLAA 2WMFA 4RNHA 2YKKA 2FDSA 3CT2A 3VNLA 5KITA 1F4HA 1QHOA 1JFHA 1GWJA 1I2NA 3F2BA 6ENLA 1Q6QA 2VM8A 3TSMA 3B8WA 3E5PA 4E3VA 1ZQ5A 3NDOA 3PJUA 2XVPA 3CLWA 2Q8LA 5FESA 3RLHA 4ZZ9A 1KWKA 3LGDA 3PF3A 4A4AA 3W9ZA 2QCCA 1SSGA 5DMMA 4O57A 5D30A 5JXQA 1ZTVA 1JI1A 3T8QA 1UH4A 3CEPA 3KL5A 4G7FA 4RDYA 4M1RA 1E3XA 1S1PA 1C8YA 4D6EA 3CTLA 3W83A 4O12A 1MEWA 1O1HA 2NT1A 4DXKA 3OVQA 2V0TA 1P0DA 1M7PA 2E5BA 2DZPA 4HNUA 1XICA 2GQ3A 2GVEA 1DWJM 3IPWA 2C79A 1E15A 1SJCA 4HA4A 1E1EA 1S46A 2QCNA 4JTCA 4O19A 5AC6A 1W1TA 3M9YA 4FLOA 5MF5A 2GGIA 2OR2A 1B3VA 1RA0A 4XAYA 4GVHA 1XSKA 5EBUA 4EACA 3EDDA 3V36A 1ZSXA 1M68A 4MGGA 5CC6A 4ILSA 1A5BA 4LAUA 1MZRA 4EANA 3W25A 2Q09A 3QEZA 4NAEA 4QTGA 4KRTA 2GWGA 2G4JA 4X2RA 1VFHA 3WDPP 4JY8A 3F4NA 5LNVA 3VD3A 4FS9A 1WQ5A 1XC6A 3GXPA 3QOMA 1OB0A 3O0KA 2XFFA 2QMJA 1D3HA 5HINA 3BK0A 3OBAA 4HPNA 1X98A 3VE7A 1ISVA 1F6YA 2I14A 1E1CB 2F7FA 3GZAA 1M6JA 4QNEA 4CEUC 3GRIA 4HMNA 3AC0A 4OE7A 3DHFA 5DT5A 1J10A 2DUXA 2GJXA 3VI2A 4C6FA 3STFA 1SZGA 5H91A 1W91A 2VVSA 3FW6A 5I09A 2JEPA 2WMHA 3VCNA 2PD9A 2GYIA 4FLQA 1QFEA 1Z3NA 3WMSA 4WZHA 5LGXA 3HG3A 2WC3A 4F4RA 1VENA 4GG9A 1U5VA 3O8AA 2Y4SA 1OX6A 2ZVRA 5CBBA 3IJ7A 3ZVHA 5CPQA 1E40A 3GD6A 4XZBA 3ARZA 4H9YA 1DE6A 4A3UA 4DF2A 3OYZA 1ISXA 2YX0A 3I6RA 2DZWA 2XVNA 3UCCA 2F38A 3KM8A 3THAA 2DQXA 4WKAA 1J5TA 3T09A 3K8LA 5HNTA 2WM0A 3VDCA 3C2OA 4LAZA 4FR1A 3GHTA 4AFYA 4MWAB 3WH7A 4F9DA 1XIJA 3H2OA 4XKYA 4MAZA 4NZ3A 4JTFA 3EWZA 2ZRXA 3OO2A 1EC8A 3IGHX 1QW7A 3H12A 4RDWA 4HZ7A 3AJXA 4HCDA 3CPUA 3RMEA 4RPQA 2E9LA 5HMFA 2A2IA 1NIUA 4UR7A 3CZGA 5MHBA 3EDJA 2WW5A 3ZFHA 3IANA 2NQLA 2QJMA 3BSGA 3SQMA 3MCNA 1DJHA 4ZQRA 3S1GA 2O9OA 4PMUA 2CXEA 3SUTA 4WY0B 4B5UA 4EF9A 3GH4A 3PFRA 3E74A 1LRQA 3CAKA 1XRSA 2QPUA 4PUEA 3VIMA 3USBA 1VIWA 4Y7EA 3H7VA 1IGWA 1OADA 3ITCA 3QMTA 1GVFA 1CPUA 3WH6A 3VGEA 1RJRA 3SRFA 1OYAA 1MW1A 3T81A 2XU2A 3W7QA 1IEQA 3AS1A 5FL1A 3DXIA 3N13A 4CU6A 5DT7A 2B81A 5EGRA 4HN8A 4UMBA 1YXDA 2CBIA 1XYAA 4Q4RA 3PNUA 3K4AA 2X42A 4YVVA 4ZR8A 2OEJA 1TV5A 3W24A 1RAKA 1SPQA 2X7WA 2E5DA 4CU8A 1BKHA 3CAWA 5FJIA 5AYZA 3BOFA 2NQZA 3NPXA 3WLQA 2EJ1A 4FA3A 3U0HA 1F3XA 4GJJA 4JL2A 1BWVA 1HZYA 1U1JA 2XM2A 2OTDA 3C8NA 4C1NA 1S3TC 2YGYA 1QR7A 2KAUC 2PBGA 5F2IA 5TAOA 1MXGA 3VD9A 5HPCA 2J47A 3ZIZA 4NU7A 2ICSA 4V1XA 3PSWA 2W62A 3ZM8A 1WXJA 3WQDA 3SY1A 1W5QA 3F7JA 2F2KA 1XQLA 3VIPA 1OG6A 4JEJA 4PULA 3S9IA 4XD3A 1FCVA 4GYFA 1Z42A 1MFUA 5ABFA 3GBDA 3V35A 2YB1A 3PWAA 3UY7A 2WXDM 2I56A 5AYIA 3VGHA 3N29A 3RCNA 4ERAA 1H3GA 4C5ZA 1X38A 2QDGA 4GUIA 2QR6A 6TAAA 1NOUA 1I2QA 2NZLA 3S9YA 4P7OA 3GG0A 2POTA 2PDHA 2FMOA 2XGZA 2OU4A 2WHJA 2PRHA 4ATDA 1V7YA 2VL4A 4HU4A 1S2VA 3GDKA 4IP4A 5FJPA 1GUVA 5LNSA 3QSTA 4LPCA 3U4FA 1AJ2A 2J9YA 3TA9A 3V1PA 1E4IA 3XIMA 3CUFA 4GX8A 4NZFA 4IIFA 1TJRA 2YCKX 4PRRA 1UD8A 3GAKA 2CFFA 1RQBA 3TUUA 5I3JA 1Q45A 1SO4A 1EEPA 4D1JA 1NWSA 2ZDSA 3W7JA 1DJQA 3IARA 2VD8A 3BUVA 2GSHA 1CEOA 1H7RA 4JYEA 2R1LA 2XIOA 2J7CA 3DUGA 1FHVA 1EHAA 4FNSA 3UR5A 4JFTA 4RE2A 1Y8BA 4LCRA 3WDJA 5CG7A 3URBA 4F0KA 2WC7A 1AODA 1AFSA 4RK8A 5BW6A 3BZGA 4Q32A 4PTWA 2JF7A 4PMDA 1RP8A 4QEHA 1NDVA 5FSEC 2AL2A 3WELA 4KWWA 2D2OA 4KCVA 3LLFA 3TZNA 1LM1A 2CLKA 3VD7A 4V2XA 3LPFA 3H7RA 4Q6JA 4WJEA 5A2AA 1W5NA 4AIEA 1XG4A 4FSAA 4GFIA 3OGSA 4M7TA 4AC7C 4AC1X 3KUMA 1NM9A 1HW6A 2A3EA 1DHKA 3NOYA 4HSHA 3R2GA 1XR2A 3II1A 4A3RA 2XHYA 2OLHA 3OG3A 4QEEA 1UROA 3KVKA 2ZRUA 3LNPA 5H2ZA 1UZ4A 1D3CA 4MUZA 3RM8A 2FHBA 4J5NA 4DM2A 3VX1A 3MC5A 1ONWA 4GBUA 3ID7A 2QEZA 4HCHA 1A3XA 4CNSA 2GQ9A 2NUYA 4PL1A 3AS2A 4WJXA 1UHVA 1RQHA 1V02E 1AQMA 3KRSA 4LQ1A 1F3TA 8CGTA 2BG5A 3FKKA 1B9BA 2WSQA 4PBGA 3OU8A 4DJDD 4IJRA 4A21A 3ZT6A 3L4VA 3J7HA 3GKAA 5T8GA 1OFBA 2VC6A 3NQ6A 2ZZ6A 5BU9A 1LRTA 4UQAA 4BEQA 1TIMA 5CQ1A 1TO3A 1CTNA 1I4NA 2OMAA 4JEQA 4XUYA 3P3BA 1J12A 4B2DD 1VCVA 5C2CA 3F03K 3GNDA 4ICCX 2Z1KA 2SFPA 4GO8A 1IR1A 3G1VA 1HVXA 1XXXA 3W38A 3G0UA 4MWAD 1JQXA 2Z1SA 1K8YA 1AMYA 2VX7A 2E28A 1EP2A 4OIFA 5HDRA 2E1DA 3OA3A 2BOFX 1OWQA 1WKEA 4DIAA 3M0XA 3R0KA 1D9EA 4IPIA 1TG7A 4DJED 3G3DA 2BASA 4JTQA 4XD4A 3O0FA 2RJGA 2HVNA 3SGGA 2EG7A 1XRFA 3JW7A 4F2UA 1W1B1 4M24A 3AYSA 2QULA 5HNRA 2WNNA 3ITXA 2Q8XA 3G1AA 3DN5A 1JQVA 4GC4A 3TVAA 1ITQA 3WUFA 2VI0A 3TN3A 4B4FA 2ALRA 4S38A 4PUUA 4JGDA 3W7RA 4CQ9A 4KWOA 8RUCA 4XSMA 4NRRA 5HR6A 5EMKA 1W3LA 3AS3A 3LLDA 2ZC8A 3W0KA 1E9YB 4JL1A 3LHUA 2OSYA 4A2RA 2EPNA 1DOSA 4E8CA 3T42A 3ORWA 4MFEA 2QLYA 2XINA 4WLCA 2XGBA 3GR8A 3ZVIA 1ICQA 2ZA1A 3IGXA 2B7PA 3KS5A 3OQ8A 1H7NA 1E55A 4BQ4A 1OYBA 1K9EA 3CIVA 2DDXA 3PN8A 3BMVA 2E5CA 4M7SA 2FH8A 3EA2A 3L4TA 3QGVA 1E5JA 4N9CA 1CI1A 4DJDA 1ZGDA 4IWWA 3VKDA 1LWJA 1XYCA 2VCBA 1E9ZB 3IJ8A 1U33A 1WPCA 2R91A 3TOPA 5CC3A 1R3VA 1XV8A 3CJPA 3KBNA 1TWIA 1KCXA 4AH7A 5H6HA 3MP4A 3STCA 3SRDA 5E6ZA 1E56A 3PM6A 4ASTA 1OC6A 2G37A 4OU1A 1PHWA 1I1WA 2HVOA 3RLUA 3H22A 1CLKA 4P2VA 3W6YA 3W53A 1W0MA 4C60A 1AMKA 3T07A 1H1YA 3MV01 5AZ0A 3RM9A 1JAEA 4XZLX 5KEZA 4PMQA 4M5PA 4MNJA 2MNRA 1ISWA 4BI7A 4K2SA 5J5RA 4M19A 3MUY1 1TMLA 4UIOA 1BYCA 2CKSA 4WXYA 4IMDA 2ABBA 5F4WA 3WBAA 3TU9A 2HV5A 1K7XA 4JHZA 3R8GA 4NZ4A 3W1LA 4GZ7A 4F0HA 1RLDA 4D6IA 5AHIA 1YIXA 3ZSSA 2YLAA 2YCIX 3HPAA 4RDZA 3C0JA 1PTDA 3WCZA 3ABRA 1DL3A 2D23A 4S3AA 3EPOA 3NSNA 4XVDA 4H7CA 3VM5A 1PX4A 2RHGA 4LV4A 4FZIA 2PU0A 1F6KA 1XGEA 1UP0A 3ZT5A 2GL5A 2CZEA 1CGXA 1J0HA 4WDTA 1JPKA 3FAWA 2FHFA 4JY9A 1CGVA 1KFEA 1MWOA 3STPA 2QCDB 4XIAA 2G8ZA 2F2HA 3GNPA 3M07A 2OODA 1F8IA 4B3ZA 3MBFA 1TMQA 1C8QA 3O6CA 3T0TA 4UQ9A 1KRMA 3PPFA 1VFUA 2NVAA 4KF1A 4GJ1A 5G1YA 1W2PA 1XC4A 4UTLA 3UJFA 2NLIA 1I0BA 5EFDA 1Y5XA 1LJYA 1YPIA 4UQEA 1JEZA 3Q2DA 3NGFA 2OYKA 4UFLA 5I6SA 2W92A 1KTCA 3Q37A 2NXHA 1M5WA 3B4YA 3WQCA 4DF0A 1C90A 4HYWA 1YPXA 4DO4A 3LB0A 4CD5A 4AVOA 3ZR6A 1UPPA 2OSXA 3GSMA 3AZSA 1ALDA 1L6YA 1JCYA 1W9XA 4OWGA 3D3AA 4DELA 1JCJA 1ONEA 3MSDA 1CIUA 4Z2LA 5EFFA 4N6EA 5I03A 2ZICA 3T6CA 1F3EA 4DNHA 1UA3A 1QHZA 3PUGA 1T0OA 4TTUA 2OXNA 3TROA 1GVYA 3B8UA 2PCEA 3QR1A 1FWJC 4E8GA 5A8PA 3KP0A 3RFAA 1F4AA 2WO5A 3CZKA 1MNZA 4DLFA 1Z89A 4MIMA 2HEJA 2WC4A 4DBDA 2WNZA 1CNVA 2GDQA 1WOAA 4N6FA 1MEIA 3PAOA 4O1BA 2G97A 3B0XA 1RALA 3SGUA 1K4GA 2MUCA 1Q63A 3KWSA 4Q7BA 2W66A 1BKSA 1ISYA 4YIWA 4O54A 2Y85A 1SFJA 3E12A 1ZAJA 3Q94A 1E6XM 3KCJA 4F0MA 2PDXA 2WMGA 1ZNNA 4TV6A 3VFCA 3QH2A 3N2BA 4KWUA 3ABXA 3EXSA 5CZKA 1VEPA 3ZJ7A 1KGWA 4ZB0A 5I78A 2BZNA 3LGGA 4HSNA 1Q6FA 3FGCB 1H5VA 2PTDA 3MSYA 4JNMA 1JPHA 3MSGA 3N17A 3L67A 3WJYA 2GK1B 1A5SA 1H7OA 2GLKA 3KXQA 4PFMA 4NZ1A 4IM4A 3B40A 4UTWA 5FOOA 2V38A 2ZE3A 4HU3A 4H8NA 4IT1A 2DZTA 3T8LA 3G22A 1UJPA 1G1YA 5BXRA 3WH8A 1JCLA 5A8GA 4J2MA 3WMCA 2NV2A 2F84A 1LT7A 1PPIA 2DVXA 2QAPA 2OT0A 1G6CA 1H2JA 3ABZA 3EB4A 3B8DA 1VPQA 5C6MA 1XG3A 4FR6A 4S1FA 4HMCA 3UGRA 3PZQA 1RUSA 4B5XA 4FF5A 5I7GA 3FXYA 3L4WA 2J13A 1WNOA 2DSUA 1BTMA 2VGFA 3B9EA 4QE4A 1I2OA 2VUNA 2DV0A 3CYVA 3GNXA 3NXFA 3EDKA 1WUFA 3VTRA 1XIGA 1R3TA 4HYRA 3HOJA 4AEFA 2HVMA 2R14A 5LIUX 2OZ0A 1UZHA 2PGRA 1TVPA 4NXSA 5I07A 1Z41A 3GDRA 2FFIA 1VCGA 1R9XA 2PDQA 5CCZA 3XISA 2HWGA 2QW5A 1OX5A 4HIBA 4IGNA 1TRIA 4H6KA 3BAKA 3TSDA 3JZEA 1PTAA 3WLRA 3CMJA 5FAGA 1T40A 2NUWA 2E8YA 3LRMA 2E3ZA 3VNMA 2OFJA 4GUHA 4E2OA 1LRNA 3GNRA 3W74A 4I9TA 1WP6A 4XZ9A 3L7RA 2CLMA 1V02A 3UQNA 4RNJA 2YCJA 3GR4A 4X0VA 1QK2A 8TIMA 5HA7A 1KM5A 3F2CA 2CLHA 2ISSA 4JTEA 4BHYA 1GOKA 5ABGA 3F5KA 1C8XA 3CYJA 2Z00A 4CCDA 1EJ7L 4ZBCA 4OUEA 5JUVA 3B05A 4DO6A 2HNHA 4P8XA 9RUBA 6PTDA 4BJHA 1CB7B 4U28A 1WA3A 3EAUA 4CEXC 1ZCCA 3QGAC 1LDCA 3A4XA 3AXMA 4CUCA 1EA9C 3GVQA 3A6OA 2NT0A 1YNYA 4RNIA 2EG8A 5K4XA 1XF0A 2PDBA 1B3WA 1UA7A 2DGAA 3TJIA 3BGGA 4RCXA 3CMGA 5KETA 4HPXA 4H6RA 4LWWA 2D1ZA 4PMXA 1WAWA 3UWEA 3OHIA 3TJXA 4LEQA 1CT5A 4HHPA 3GFYA 4IFKB 4XG1A 4UR8A 3C0SA 2P3ZA 3CZJA 1PS9A 1TV2A 2XJ7A 4MB5A 1F61A 3AZRA 5HNNA 4Q3MA 1MRAA 3IWPA 1XDMA 3KZPA 4WIWA 1EC9A 5K3VA 4MTVA 3VPLA 1P1XA 1JDDA 2CLPA 1JFXA 1NDWA 4J9JA 2OEMA 2W91A 1BPLB 5T91A 1HQTA 4W88A 1HP4A 1OF8A 2ASHA 4QROA 3WEZA 2HK0A 2WHLA 3MI2A 1TCDA 2DT0A 3VKBA 4EXAA 3GY1A 3NXLA 4C6BA 4DWSA 4CCZA 3U7VA 4A35A 4HOXA 3E0WA 1S2CA 1BF6A 1KCZA 5FJUA 4GXMA 2HZGA 1HL9A 4H9MA 2TODA 4NP7A 3M7SA 1B1YA 2Y0FA 1KBBA 1HN1A 1TQJA 3E1F1 1F76A 2D73A 3GXTA 1M53A 1KV5A 3P67A 1EGMA 1JDFA 1JZ2A 2Q3RA 3TMLA 1A0EA 2Z25A 3CV6A 3QPEA 4A8LA 1KA9F 1RBLA 2C13A 4PYSA 5FSDC 1VEMA 2OSWA 1BQGA 5DXXA 1SQ7A 3RGTA 1Q2SA 1O7AA 3C2EA 4L6DA 1FQ0A 3GXMA 3W23A 2J66A 1RD6A 3LCIA 4PTMA 3UWWA 1N8FA 3TTYA 1ZHAA 4KWSA 3P0WA 4K39A 3NL3A 3BJTA 2YZRA 4C6DA 3GG8A 4GNJA 1TX2A 2DW6A 2H9AA 1Y5WA 1TWWA 2HJPA 1FBAA 3RITA 3S47A 2OOFA 1JG9A 3KTXA 4Q4KA 5JH2A 3GUGA 6ALDA 1ZBWA 1KFKA 1G4PA 1JF5A 3LNMA 1W1VA 3HV9A 4XV0A 1BXNA 3SIMA 3KTCA 4I3GA 3CQHA 4F48A 1RK5A 3VOIA 4RE3A 1PIFA 1XUZA 3AYRA 3KW3A 2O55A 4KIRA 1GCYA 3E0FA 3VOCA 2J77A 3W1AA 1YMYA 3AMCA 4IOTA 1BQCA 4C6OA 1O6IA 4CD6A 3VGDA 4V28A 1JYWA 4FXFA 4Q4OA 2PGFA 4G1NA 3VM7A 4NZCA 4BF7A 2CERA 4C6LA 3EOSA 4PUNA 3BLKA 4JICA 1P6CA 3TONA 3S5NA 3AIEA 3PZ9A 2PODA 3SCTA 4D71A 3U2OA 3S2CA 3V5CA 1BSIA 2YBTA 1R5YA 1PAMA 3LQGA 4P8VA 2IPGA 4CQBA 1G7VA 1IWBA 5AB3A 1VYSX 4ML4A 4UNKA 4RKAA 1L6FA 1QCWA 3TR9A 1CLVA 2ZVIA 4AF0B 3CO8A 4AIUA 3VK5A 8XIAA 2XVKA 3BARA 4JKKA 1B54A 2VX6A 4G7EA 3ZSTA 1CBGA 3PG8A 3LK6A 5I2UA 5J8LA 4DUWA 1EWEA 2PD5A 1AQFA 3HGRA 4MM1A 3OP2A 4X2PA 4I5XA 3PZOA 3CWNA 3DKLA 4PL2A 4RW3A 3W7MA 3WLNA 3PJXA 3NOEA 2QJGA 1K70A 4XVEA 1RK6A 4YYCA 1J9YA 1EUAA 4GQGA 4QBXA 3LCLA 3EWYA 3K1GA 3UJEA 4ROQA 4AX7A 2D22A 1QPNA 4L4OA 3AIQA 5KSWA 4O17A 4E5TA 2A4AA 3V4BA 3F4VA 4H01A 4S3DA 3BZJA 4IIGA 1D8CA 1ZUAX 3B8SA 3P14A 2CHRA 1W3TA 5D38A 2XFWA 2ZUMA 4ZCWA 3M5VA 4DPPA 1OFPA 3M43A 1YYAA 1VFTA 1CENA 4BI5A 5A6AA 4E2DA 1ICSA 1ODUA 3W7PA 4W89A 2ZRVA 3IVSA 3BG3A 2OKOA 3SUVA 3L4ZA 4WX2A 1CX9A 3UNDA 1O95A 4W84A 2PUZA 3AI0A 1DIKA 1EPVA 5D2VA 2W0UA 1W3NA 3GNOA 3PZVA 2O9RA 3BQ5A 3WQFA 2XDFA 1UUOA 1N8WA 3N15A 1XBYA 3HPFA 1XIFA 1GQIA 1DJGA 3N11A 2YCLB 1RXOB 1V3IA 4GC3A 1GT8A 2VEFA 2DJXA 1ME8A 1PWMA 1HJSA 1LF1A 3LBMA 5GJPA 1U5HA 2NVCA 4RXGA 1MO0A 4DM1A 1POKA 4JTRA 3TYZA 4UFKA 3EX6A 1QATA 3GDLA 3URQA 3FHQA 2VDGA 3IAPA 3ZQ9A 1B30A 4LCSA 2EKGA 4LEFA 2GOUA 1RH9A 3UXDA 4GZJA 1UD2A 1HF6A 3HPZA 1OVDA 3NPVA 3OODA 3RPDA 1BRLB 4O1FA 2CLLA 3LTYA 5FF3A 1J6OA 2A7RA 2OCZA 3LMYA 1Z8AA 3HFTA 4B16A 4RLIA 4ENLA 1EC7A 3OZMA 1V03A 1PJ9A 2J79A 2FPYA 4ZB5A 1QAPA 3EWWA 4JBRA 1QPRA 4WQ6A 4H19A 2P1FA 2EG6A 3TP4A 3P6LA 1X6UA 4XUGA 1SW7A 2WANA 2WV8A 4GH1A 2Q6ZA 1O94A 3OJGA 3QZEA 4XZIA 1AD1A 3WQWA 4EK7A 1VLWA 3KBSA 1F07A 4QGCA 3LS9A 4B5WA 3TLQA 4JHOA 4AISA 1TFVA 3KOXA 3SCVA 1GOIA 4YS1A 4S2CA 3T0CA 3B9OA 1BYAA 3LYEA 4FOKA 2VHLA 1P6WA 3LU2A 1BTCA 1KXHA 3V0SA 3NQVA 4MY1A 1Q6GA 3IIXA 1LZOA 1A80A 4BWLA 1LOSA 4Y8FA 2UBPC 3DERA 2UV8G 5C9WA 1JNDA 3H2NA 1TTIA 3OPSA 3C8FA 3WK3A 3PTKA 2BOGX 2X16A 5A8MA 3RAOA 3UJSA 1CXHA 1X7IA 1BG9A 4K3ZA 1YDOA 4IF2A 3AU6A 4U4MA 4AZHA 3WNMA 2I5GA 1LWHA 5EA9A 4P8WA 1OZMA 1CGYA 1UUQA 3R79A 2VRQA 1T41A 3T0DA 2INFA 1XM3A 4RZ6A 1HTIA 1GVIA 1KM0A 4AMAA 4AZCA 1HKWA 3IRSA 3QLDA 3WQEA 5AFDA 3ZR5A 4FB7A 1Q4NX 2E1WA 3BW4A 2ZZ2A 3VA8A 4KGJA 3RCYA 3ARPA 4GWEA 4X22A 3W70A 3PZNA 3QHOA 3DFNA 1PWLA 3OLDA 1H61A 3DH7A 1BVWA 5A3HA 1IT8A 3KVMA 4RZ4A 4S3KA 3E2SA 1ODZA 3W00A 1XFBA 1O4UA 2FIQA 3HV8A 3LRKA 5FEWA 4AY1A 4NF7A 4DX3A 4OOUA 5AHNA 4WDUA 2BOEX 4LVGA 3DCPA 4ZL1A 3IS4A 3P2VA 4IGHA 2D20A 4QJ4B 1U2YA 1UIOA 3ATZA 4Q4PA 1LBMA 1JAKA 1KLZA 4C7GA 3H2AA 1FH9A 5I06A 3OHMB 3QY7A 2IUZA 4E4PA 4P7QA 4LCQA 5AY7A 2FVLA 2HS8A 4HNVA 3I4KA 4PCPA 1W54A 4Q4SA 2G5WA 4H41A 5D33A 3TCEA 3IJQA 4ZOEA 1E1FA 3EA1A 1W6TA