3G1XA

Crystal structure of the mutant d70g of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with uridine 5'-monophosphate
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
213
structure length
213
Chain Sequence
VMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIAGFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Mechanism of the orotidine 5'-monophosphate decarboxylase-catalyzed reaction: evidence for substrate destabilization.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
molecule tags Lyase
total genus 80
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2009-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3g1xA00
4MJZA 3ZS4A 1JCLA 1OX5A 3QM3A 3S0CA 1JUKA 3NVTA 2H90A 5D38A 2Z2UA 4YLWA 2ZRZA 3G8EA 1ICSA 4PH6A 4UNLA 3N2XA 3W88A 5L6UA 3UXAA 3O07A 1PL9A 1H1ZA 1F5ZA 4PTNA 2WKJA 3C2VA 4HPXA 3HGSA 2DU2A 4QITA 3STGA 3N14A 3ATYA 2VEIA 1XI3A 1N8FA 4LWWA 1IF2A 1PHWA 1Z44A 2WJZA 3GDKA 2H8XA 3NQ6A 4MKNA 1TPEA 2YFOA 5BMXA 1YTEA 3TQVA 3BW3A 2OZ0A 2YW4A 4UFKA 5LNVA 2BXVA 3C52A 3PUEA 1TQXA 4XQ6A 4KWVA 2GQ8A 3GAKA 1TRIA 2X2GA 2OT0A 2FFCA 5D2VA 3S1VA 1LTDA 1RD5A 4DF2A 3GZ3A 4JX6A 4Q33A 1DJQA 2ZZ1A 1JULA 3BG9A 4Z08A 2RH9A 1G7UA 3RFAA 3MP4A 3B03A 3C2FA 4JY8A 2WNQA 3L68A 2BZNA 1TPWA 4S1FA 5CPMA 1LRQA 2EPHA 1DHPA 3M5XA 4H3DA 3OVQA 3UQNA 3HG3A 1W3NA 4GC4A 1C9DA 1SFJA 1TPC1 3DHDA 2CLHA 4IWWA 3W7PA 2A7RA 1UJPA 1SW3A 4JTLA 4POCA 3U8GA 3LI0A 4LT9A 3CWNA 1OYBA 3IIXA 1H1YA 5KMYA 5EA9A 1W37A 4NX5A 3NQEA 1ALDA 3LGEA 2JKEA 1YXCA 4O1BA 4GBUA 2QEZA 3W1UA 5FF4A 2DZUA 4M19A 4S2CA 3TC7A 5KITA 1LLZA 4ZL1A 2XN2A 4TIMA 3HPSA 3IIPA 1R47A 1W1ZA 2A4AA 4K38A 5A5WA 1YADA 2OMAA 2CFFA 1KBIA 4FIRA 1L6SA 4BI5A 2NUYA 1EP1A 3GNDA 2RDTA 3KX6A 4JTHA 2QAFA 2CLLA 2VFHA 3N9SA 2AAMA 1LOSA 3QH2A 1I8JA 1H61A 1M7PA 3L0NA 5BMWA 5HUOA 4DF1A 1PVNA 1X1OA 1H7WA 5LHEA 1XM3A 3TDFA 2WNZA 4GFSA 4O28A 4PODA 3OEXA 1EP3A 1YXYA 4M6PA 1HFBA 2C18A 4IXHA 3W73A 4OV4A 2JBMA 3BGJA 3SGUA 3AO0A 3FKRA 1IIHA 1OYAA 2I1OA 1JUBA 2R14A 4UTWC 2WSRA 4JS3A 5A8GA 3TUUA 3CT7A 4XUGA 1SU5A 4IMDA 3G1SA 4KKXA 4FNSA 2XN0A 3EX6A 3G1HA 4O57A 4O14A 2DJXA 4OBTA 3P84A 1VRDA 3GDLA 4BWLC 1GG0A 1EUAA 2E5CA 4O15A 3NQFA 5CZ0A 1OK4A 3V1PA 1TTPA 3TROA 1H7PA 2Y7GA 4GJ1A 3NM3A 4ADUA 5D2TA 1VQTA 3CWOX 1QOPA 3G0SA 1I45A 5HWMA 3BARA 5AB3A 1VLWA 1DQWA 5F1VA 4I9AA 3FJLA 4WQ6A 5I3IA 1FWWA 1NSJA 3DFPA 5IBXC 3M41A 1QDSA 3NXFA 1OF6A 3GVGA 5K4XA 3JS3A 1W5OA 3DAQA 3N9RA 5C6MA 1U5JA 3W1RA 2RFGA 2YCEA 4MZ1A 1KLZA 5CPLA 1PCWA 4JIPA 1SSGA 2A5HA 3IIOA 2TRSA 4EF9A 3W70A 5K7JA 1J2WA 1H7RA 2C6QA 3W1AA 4MUZA 3PS7A 1F05A 3P81A 5BRBA 3S5OA 1LBMA 5D04C 5FF3A 3UWQA 3H53A 3FOKA 4NU7A 3B0UX 4IPIA 2P10A 1GTEA 4FX8A 5AC7A 1KM4A 4FX6M 4NZJA 1R2RA 1QO2A 5G5IA 4P61A 2CLFA 4BI6A 1H7NA 2R94A 1T96A 4WY0B 2ZRYA 3B8DA 1TV7A 2G96A 2DP3A 4YL2A 1YLVA 5AYZA 3T44A 1VYRA 1FCVA 4JYEA 2QCEA 5IBXA 1KA9F 2WPBA 4K8EA 1LZOA 1HUVA 1MEWA 4UCGA 2ZCGA 2J6XA 1I4NA 3QMRA 1Q6OA 3QZEA 4RXGA 1W5PA 4NXKA 4O12A 3WK2A 4CNPA 3LCFA 2X1SA 3PR2A 3W7CA 3TIMA 3W7JA 5H2ZA 5LKYA 2CLOA 3C0JA 5KINA 1F6PA 3ATZA 1WDWA 4XKYA 4Z1BA 2B7QA 5D33A 3GK0A 4FHAA 1ONRA 3MYPA 3HG4A 1W5QA 1P5BA 5EKYA 2DZVA 5EBUA 1TJRA 1GEQA 3E9AA 4N9DA 2VC6A 1SO5A 2WSQA 2E5DA 1IXPA 4MZ8A 3EEGA 1IXOA 3SZ8A 3W9ZA 4ZQOA 3P8IA 3NL6A 1KV5A 4Y90A 5D30A 3A23A 4UTUA 1KV8A 1YTKA 2YFNA 3M1ZA 3KFTA 1X1ZA 2ABAA 4FNTA 4NJHA 4M7TA 1DJNA 1WA3A 1R2SA 3MWAA 4LVBA 4QSHA 2GVLA 4I7WA 2F84A 4LS0A 3QJAA 2PURA 4IX0A 3TX9A 1D3GA 1LP6A 2JGQA 1ZAHA 1KM1A 4OV9A 4KWWA 4LUIA 5DCDA 3JRKA 3L9CA 5DELA 3OIXA 3PBWA 3HJZA 3THQA 4LW7A 3LXCA 2YGYA 1H50A 2YZRA 3R89A 1F74A 4Y6GA 1MEHA 3TSBA 4WX2A 4BI7A 1GOXA 7TIMA 1MEIA 3MUXA 1YTDA 4LVAA 4JYDA 4PL1A 1GG1A 5H91A 4JTJA 1VZWA 2Y63A 3IVUA 4MYAA 5TQLA 1MXSA 1IIGA 1UCWA 3TSMA 1BEUA 2A2IA 4ZZ9A 1EUNA 1AL8A 3O6CA 1Z42A 4CQ9A 4ZQPA 1I2OA 1NFBA 1ME8A 5EYWA 3CPRA 2OCZA 4A3UA 4O4VA 3U2OA 3HG5A 2QR6A 5G4WA 2V81A 3W1MA 4E2BA 1F2JA 5BOOA 3H55A 4JDBA 2RKXA 1SSDA 3HG2A 3OA3A 4YWIA 5U4NA 3W6YA 4Q4KA 2QCHA 1FX6A 2DZXA 2C1HA 2NLIA 3P8JA 1OFQA 1GQNA 1VPXA 3LRMA 1HO4A 1KBJA 1LBFA 1UBSA 2EGZA 5K9DA 1PV8A 4JXCA 3LRLA 2ZDRA 3NGJA 1LM1A 3O6DA 4L4MA 4GXMA 2X1RA 4JYFA 1JQXA 2PRHA 2B0MA 3L5LA 4AXKA 5AHIA 1QCWA 1C8VA 2FQIA 2QUVA 2BLEA 4ONVA 4DO4A 2C0AA 1K3UA 4OHQA 3W85A 3BO9A 3M44A 2YSWA 1DL3A 2NZLA 2R8WA 5K4ZA 3FIGA 3QC3A 4AB4A 1CI1A 2NUXA 3EX2A 3W23A 4R34A 4QJ1A 3LCHA 1XFBA 3TFCA 4UR7A 5EY5A 1K7FA 5DXYA 3I68A 1W0MA 2ZRUA 4RZ5A 1TTIA 3NM1A 3YPIA 2TPSA 3GIYA 1ZNNA 2H3DA 3M47A 3M5YA 2J24A 1VCGA 5HJLA 3QRHA 2CZEA 4PEKA 3NAVA 3NL2A 3VE7A 4O1DA 5AN7A 2P0OA 2OJPA 2VFEA 4NQ1A 3CQ0A 3O1NA 1XCFA 4NX0A 1EEPA 5DCBA 3USBA 5LGZA 4AMAA 3NR0A 1K8ZA 4PFMA 3DKJA 4IJBA 3G8RA 3THAA 2EF9A 3D0CA 4K8HA 2CU0A 1VH7A 5KSWA 2QUUA 2C15A 5DLCA 3KRSA 4XBKA 3RU6A 3W7QA 3W76A 1B3OA 3EXSA 1JR1A 4UIOA 1LDCA 4LY8A 3WJSA 3NEVA 1V7YA 4AEOA 3ZWSA 1OK6A 1DVJA 2A7PA 4O1CA 2P1FA 3UWWA 1X7FA 2XN1A 1HL2A 1N7KA 3CEPA 4ZQNA 3UWYA 4MY9A 3C2RA 1DQXA 1Q45A 1OFBA 1VJIA 4FNPA 3QQ0A 3W1NA 3P80A 4O53A 1FDYA 2NV1A 1B9BA 4ZQMA 2VFGA 4EVZA 2ZZ3A 4UNKA 1VCFA 2Y70A 2QDGA 3LM7A 1R30A 2GUUA 2E6DA 4Z0JA 5AC8A 1TB3A 2H3BA 2QCLA 3L65A 4UTLA 2DZPA 3WJXA 3IVSA 1QOQA 5LNRA 4GUGA 5C55A 1XBZA 1J4EA 4JNMA 5FF2A 3HB9A 1VHCA 1H7XA 1QNVA 1JCMP 2Y7EA 1VHNA 3W2NA 3STEA 2E6YA 1TPDA 3G1YA 1LCOA 5DBTA 4KFOA 3CM4A 1RVGA 5HNRA 1OJXA 4EF8A 3O05A 3W7OA 4JTGA 2JKPA 4B5NA 3VI2A 3I65A 1JRBA 1Q6RA 3W22A 5KTLA 4N6EA 2A6LA 2H8ZA 4CCDA 2DZSA 5FEXA 3W7MA 1S5VA 1TJPA 3TW7A 3C6CA 5IM51 2O7SA 2VEMA 4RR4A 1TTJA 4W9TA 5MHBA 1KTBA 4UMBA 5C2XA 2ZA1A 1TPH1 2FJKA 1K7EA 4K6AA 3G0XA 5AYXA 3T40A 3EB2A 3PC0A 4O4WA 4R33A 1ML1A 3DGRA 4Y8FA 1M5WA 3IRDA 3N19B 1OX4A 3ELFA 4N9EA 3HF3A 3M43A 5G1YA 2CZFA 2PRMA 2Y61A 3PG8A 3S8HA 4Y96A 3P61A 3TW6A 1ZJIA 1TPUA 1RQBA 2YYUA 2KZHA 3PWAA 3FEMA 4X22A 4LUJA 3GXTA 4UMAA 2FPTA 4GUHA 1RQHA 4UR8A 1LOQA 2FPVA 2YX0A 1GYLA 1QPQA 4MFEA 5SWUA 4DBDA 3FYPA 4FNRA 3G1AA 4DEFA 2FTPA 3IGSA 4WXYA 1KM2A 3TXVA 5F2IA 3CEUA 2RHGA 3DFSA 1QPOA 2YPIA 4XKYB 1AMKA 1F73A 3RNDA 5K3VA 3TV8A 3LTSA 5D32A 5TBOA 3L2IA 2JKAA 3MMTA 2LLEA 3P67A 5BW6A 3R5EA 2D73A 3MW7A 3W7GA 4YCPA 1YPIA 1FCQA 4MIMA 4N4PA 3W84A 4CCCA 3HIJA 2NWRA 3O8AA 5AFDA 4IXXA 1L6WA 3UWUA 3PUOA 1GVOA 4ORMA 1M7OA 1JCNA 3TJXA 2NUWA 4N4QA 1JCXA 1UASA 3TH6A 1YXDA 5AHMA 4O8RA 1F7BA 3M9YA 2A0NA 3GX9A 3G3MA 3W1QA 3LHWA 3MHGA 3G1DA 1T0OA 1LBLA 2CWNA 3IIVA 3L67A 1VS1A 3LHTA 3IGUA 3SECA 1CX9A 1H7OA 3LHYA 1LROA 2QCNA 5T26A 4O17A 3S1UA 3TQ0A 4AF0A 3SW6A 5LHFA 2ZZ6A 1QWGA 1D3HA 4XWUA 3PG9A 1K02A 1A5CA 3I6RA 1X6UA 1PHQA 3W86A 1Q3NA 1VCVA 3QSRA 3LB0A 3EKZA 2ZRVA 3RMJA 3ZR4A 3QYQA 1KM5A 4O19A 4UMCA 1EP2A 1W3IA 4N2YA 1QO5A 1F76A 1QR7A 3W7LA 1BTMA 3EX3A 4NZFA 3W2JA 1EPXA 1FWTA 4MY1A 4ZVJA 3HBLA 3LERA 3BG5A 5U7SA 5J5DA 3PSVA 2GJNA 4TMBA 5AHNA 1FCUA 3BLFA 2CW6A 1F6KA 3UD6A 4Z0SA 3NYZA 3GDRA 4JTIA 3W1PA 4OT7A 1TCDA 3DXIA 3R13A 4OE7A 4RXFA 5LNSA 3DI0A 1XL9A 1PS9A 1YDNA 3W1TA 4Z1AA 4K7VA 3BV4A 2Q3OA 1XDLA 4M6QA 4JTSA 3SIZA 4JICA 5F2MA 4HNVA 2HS8A 3EXRA 2G5WA 2WO5A 2ZTJA 2V9DA 1ZFJA 3VCRA 3EWWA 5CPNA 1SFLA 2VEKA 5FF7A 5EMUA 1W54A 1KLYA 4X3ZA 3CB8A 2VENA 1TQJA 5D37A 3QMTA 3PM6A 1JQVA 3MO7A 4A2SA 5D05A 4LC6A 2Y88A 3MI6A 4ADTA 3W74A 3S1XA 3CLMA 4WY0F 4M7SA 1SO6A 5G2HA 1MZHA 3TFXA 1U83A 4UTKA 3C4UA 3IIZA 2ISVA 5E0KA 2ATSA 3WJWA 2GVGA 5E93A 4K37A 3T78A 4UTMA 3UPBA 4FO4A 4FX7A 3GAYA 4J9JA 3FKKA 3EWXA 3GDTA 1EWEA 1KFBA 2QJIA 3W72A 3P7YA 3NQ7A 4A22A 2PRLA 3C2EA 5F4WA 3LCGA 3QQ1A 2PE4A 5HUPA 3NPXA 1AW2A 1OFAA 3G1FA 3HOJA 4NT0A 4D2JA 1YYAA 1EX5A 2FPYA 4UTHA 1VR6A 3KRZA 3M0ZA 5AC6A 3LTPA 4ORIA 2CLEA 1O4UA 4K36A 3NQGA 2NXHA 4AH7A 3M16A 3N2MA 2V0TA 3NZ1A 1DBTA 4Y9AA 2RDWA 4S2BA 4LRSA 3PB2A 3Q58A 5FI8A 5HMSA 1XC4A 3NQMA 3PF3A 4U28A 2VKZG 3DU0A 3O63A 3Q2DA 1YPFA 1RQEA 4CLMA 3B05A 1D9EA 1G4PA 3FYOA 4LS1A 4JTUA 4A21A 3DBPA 1QFEA 2VFFA 4AWTA 1W56A 6ALDA 3N34A 3INPA 2G95A 3EWYA 4PC8A 2WSYA 4NVTA 1ME9A 2XFWA 5KZMA 4I7VA 3QF0A 4ALDA 1WOAA 1UUOA 2VFIA 3BG3A 4KFNA 3VNDA 3MBFA 5HWNA 1XBVA 4TR9A 4AHOA 3NA8A 3A21A 1O94A 2NXIA 3FS2A 2C16A 1GTHA 3L21A 3NL5A 3SR7A 1ZCOA 2ATMA 1B57A 1XBYA 1O5XA 4CQ8A 1FWNA 4AWSA 3UWVA 2ISSA 2Z6IA 1NF0A 1BWKA 3LTYA 5K2ZA 3VKJA 1WV2A 5I3HA 5FEPA 4FEZA 2E6FA 3ZFHA 5G2WA 3WJYA 4DO6A 3CIXA 2E77A 4LVGA 2DZWA 3NL3A 1TREA 2E1DA 2GQ9A 4RZ4A 2A7NA 5LNUA 4FF7A 1I2NA 5LZLA 1DV7A 4DPPA 2QCFA 1JCYA 3ABQA 3PY2A 3W87A 2Z0IA 4KFPA 1SZGA 1WOBA 2F7FA 5EPDA 3S42A 3ZWTA 4PCFA 1WBJA 3TAOA 2HS6A 2Q8LA 3SSJA 2QAPA 1LRNA 1J5TA 2Y6ZA 2ZQ0A 3DFQA 4LS2A 4R53A 3RF9A 3STCA 2C14A 4OU1A 1VGAA 3P62A 3OBKA 3W75A 1Z41A 1LRTA 1SUXA 1SZNA 5G2IA 3TE9A 4TU1A 5ABTA 4RK8A 2ZZ2A 3GKFA 5LNWA 3L0KA 3EWBX 4HKPA 4A29A 1OFPA 3UWZA 3QFEA 4UFJA 3DFOA 3SY5A 1G4SA 1VYPX 2Y85A 4IMGA 3PBVA 3LBMA 1KFLA 1OX4B 2JGYA 3LLFA 3MI3A 1HO1A 3PULA 2V8ZA 1JUEA 3W83A 1FCBA 4OQVA 3DFTA 1K03A 2E09A 3KAOA 5HQEA 3W1XA 4QQ3A 2QCCA 5KZEA 4GWEA 1SW0A 3T7VA 4FNUA 5CZJA 2QUTA 4HNUA 3UNDA 1TPFA 4MZYA 4DQWA 3HGRA 1FDZA 2CZDA 1L6YA 3TR2A 4WOZA 3C3NA 3W07A 1NAL1 4JY9A 1BWLA 4UFHA 3EX4A 1OX6A 1OHLA 1MO0A 4O13A 3UYCA 3UPWA 2H6RA 3W7RA 3U6WA 3G22A 3LRKA 5GVJA 3C56A 3TKFA 1GZGA 1HTIA 2QCGA 1OABA 3KVJA 3STFA 2V82A 2DZTA 1A5SA 5DY3A 3OG3A 2FDSA 1W31A 2Q8ZA 3DI1A 3E49A 1KTCA 2ZTKA 3W1LA 1LORA 1WAUA 1A53A 2V30A 3F4NA 3RLVA 1E51A 3DH7A 5I3FA 3LHZA 1AG1O 2ZA3A 3HMJG 1HG3A 1SO4A 4IUOA 1AW5A 3GB6A 4WXZA 2B7OA 2CLKA 3FA5A 3K30A 3NQVA 3P5YA 1ADOA 1JJKA 2QCDA 3LHVA 4IMCA 2E5BA 2NXGA 4K39A 3TK7A 3C61A 3EWUA 3TC6A 3P5ZA 4HT3A 2TYSA 4RKAA 1CW2A 3CHVA 5FF0A 5CSRA 3P60A 1QPNA 3LV5A 1ZAIA 1T99A 2A85A 5I3JA 4E2DA 2W0UA 4RX0A 2ZZ4A 4YXGA 3B06A 1AL7A 1P0KA 3PBYA 1XDMA 3GDMA 4A2RA 5HR6A 5LSMA 2C3ZA 2I9EA 1ICQA 1SZFA 2OX1A 4AHQA 3PSWA 3TXZA 4C1KA 1EWDA 4NJIA 3B0VC 5TIMA 1PCKA 2NWSA 1OG0A 4AF0B 3O06A 3L5AA 3LDVA 4LV4A 4TO8A 4CQAA 5D02A 3BK0A 2YR1A 3LXBA 1OFOA 4WUIA 5L9FA 1ICPA 4NJJA 1A5BA 5AYYA 5DY2A 3ABSA 4G1KA 2NV2A 1G69A 2WOQA 1TYGA 3LOTA 4N9CA 1H60A 4DPQA 1G67A 1FDJA 5HWJA 2AQWA 2ZZ7A 1OVDA 4UFIA 1TTQA 1T8XA 4RV8A 3BVJA 1O5KA 3R12A 3N73A 4X2RA 3TU9A 1XUZA 2Y7DA 5HR7A 1FY6A 4IOTA 2HMCA 2V5LA 1KFKA 4UUIA 2V2CA 1EB3A 3LCWA 3Q37A 1JRCA 4JEQA 1GVSA 2YDAA 1L9WA 3HGOA 1LOLA 1I2QA 1JVNA 4R7JA 4EOUA 4ZQCA 3UXDA 1IXNA 3HPXA 4O0ZA 1H51A 3MHFA 3VFLA 2V2DA 1FWRA 4MPQA 4MFDA 4XBSA 1A5AA 1DKWA 3BW2A 1N55A 3R2GA 5CZSA 1G6CA 4HIBA 4LVDA 3WJZA 4CNOA 3O15A 5FEZA 4JTKA 3SJ3A 3GXNA 2O7QA 1VC4A 5D09A 4NXSA 1M6JA 4HNTA 3M5VA 3W7NA 4DF0A 4O50A 2GVJA 1PIIA 4JR5A 3QW3A 4GE8A 2QF7A 1SZEA 5CG7A 3QW4B 3PVFA 2QKFA 4Q32A 3E02A 3TMLA 8TIMA 1S3HA 4WD0A 4O18A 3W2KA 2ZA2A 1VLIA 1TIMA 1NEYA 1RZMA 3G0UA 3WK1A 3QPZA 4NNBA 3QPYA 4ZQRA 4HNNA 3L5MA 4AAJA 1RV8A 3GXPA 1FUYA 3GR8A 4JX5A 3W2MA 4LVFA 1AK5A 5F4XA 4N9BA 5KZDA 4DXVA 3BW4A 4Z1CA 1Q6LA 4WJEA 3UY7A 3Q94A 1S5TA 3NPUA 4NJKA 3M6YA 4FXSA 1XBXA 1B4EA 4LRTA 2VXNA 2J9YA 3B04A 2CZ5A 4AVFA 3OVRA 5CKSA 3KOFA 3TMQA 3CTLA 4WOQA 4MLRA 2PCQA 3NPVA 1TPVA 3M5ZA 1W8SA 3P74A 1OYCA 2BSLA 5LGXA 2UV8G 3GYEA 2X1TA 1W5MA 3NPWA 4GUJA 4EWND 2EHHA 4UTIA 1NVMA 1WX0A 2VELA 4HSNA 5J5RA 3E0IA 4O0KA 2DJLA 3H54A 4PA8A 4IX2A 4JN6A 5DBUA 2BX7A 3SFKA 1I2PA 4QISA 1THFD 4TMCA 1LLWA 3VE9A 3IGXA 3ANYA 3W7EA 4O11A 4FXRA 3C8FA 4OGZA 3G1VA 1G4EA 5CSSA 5DN1A 3QSTA 4ZMGA 1L2UA 1RPXA 1AW1A 2ZZ5A 3EX1A 3NNTA 5K9XA 3NZRA 3WK3A 2J27A 3M7WA 3EWZA 3TJLA 4K7YA 3LHUA 4MY8A 3BPWA 3TCEA 4NNAA 1KFJA 3W7HA 2IQTA 3G3DA 4FB7A 3FLUA 4AWUA 4DO5A 1KM6A 1WXJA 4X9SA 4FNQA 1YDVA 1W5NA 4UTWA 1GVRA 4ICNA 2HSAA 4RZ6A 3OVPA 3L0GA 3NQDA 4MVAA 3EKLA 3HGJA 3O6YX 4LU0A 1TRDA 4HN4A 4ADSA 5FEWA 1IGSA 1W3TA 3PB0A 2NX3A 4BWLA 3GR7A 4DBEA 2ZRXA 4RCXA 4E0CA 2Z1BA 4JD4A 3W71A 1KM0A 3CIWA 4DELA 5CPOA 4Z1DA 2AGKA 1FQ0A 1VYSX 3GNNA 3S5ZA 1GJPA 1A50A 4LOCA 2CLMA 2YYTA 5G1TA 2X30A 6TIMA 2I14A 3LBCA 1KFCA 2E6AA 3MHUA 3NDOA 3NG3A 4JIQA 4MJMA 4CCEA 2R91A 3TA6A 4UXDA 3A24A 1P1XA 2V5BA 5CGQA 3NQCA 4XZ9A 4QAIA 2FB3A 1SPQA 3S6DA 4IPJA 2HTMA 4EIVA 3NQ8A 1KM3A 2GPTA 4U4MA 1ZAJA 3SGZA 4JDYA 2QJHA 4QIUA 3MYOA 5D2XA 3W7KA 1ZENA 4M6VA 4MOZA 3OHIA 2CLIA 1FWSA 1GYNA 2A1YA 4XTDA 5F1UA 3QMSA 1BKSA 4IMEA 4MYXA 5BNKA 1Y0EA 4FIQA 2EAWA 1I2RA 4XTIA 2VEPA 3HQ1A 3DFNA 3PAJA 3IV3A 3LLDA 3LXAA 4GUIA 4N02A 2NX1A 5G4EA 1O95A 4HSOA 5HINA 3V75A 4YCOA 5AOUA 2J9ZA 3S5NA 2BWGA 3GLCA 4O10A 2OT1A 4RJEA 3TAKA 3I7QA 2RDUA 2G97A 2Y62A 3LCXA 2JK2A 3LI1A 3UZJA 2GOUA 4BFAA 2ZYFA 2QJGA 3N3MA 1TMHA 1H62A 2V2HA 3W3OA 3NQ2A 3F03K 1DORA 1FXPA 3DENA 5HULA 3TSDA 4AHPA 4TX9A 3B0PA 5D03A 2C19A 3NO5A 3MP5A 1OFDA 3RLUA 3F4WA 3S1WA 2ABBA 3ABRA 3E96A 3IEBA 2ISWA 3BLEA 3TNOA 3CU2A 1QMLA 4QNWA 4JGDA 3MI2A 3LCLA 2QCMA 2NX9A 1JCJA 4I7UA 2B7NA 1FXQA 2QCDB 4JTFA 1B4KA 1ZHAA 2ZBTA 4H6KA 5I3KA 4UFLA 3A9IA 4N6FA 2ALDA 1G7VA 5K9CA 3NQAA 2A6NA 2DORA 1GWJA 4NNCA 1O60A 1WYIA 3UZ5A 4OWGA 3B4UA 5C5YA 2Y89A 1H63A 2WNNA 3ABOA 3HO8A 4HHPA 3UY8A 3G24A 1UUMA 3DZ1A 1R2TA 2VOMA 1XKYA 1SW7A 5DXXA 3KVKA 4GNJA 3W2UA 3FFSA 4WZHA 2FB2A 3R8RA 1X8FA 4UTJA 2X1UA 2GJLA 5F2LA 4O52A 2WQPA 3HPZA 4BF9A 2WV8A 1H5YA 4HPJA 4NUWA 1TV5A 4LTSA 3JR2A 4IMFA 4WY0A 1C29A 1Q6QA 2YXGA 3P82A 2Y7FA 3TQKA 1R46A 4GRSA 1SO3A 1S5WA 4LC8A 1IXQA 2BTMA 3C2OA 3EXTA 5F4SA 1YDOA 2GQAA 3KHJA 4JTEA 5AHEA 5F2GA 1G4TA 3LX9A 2B4GA 1GVQA 3CC1A 4YMZA 1KW1A 1GVFA 1KFEA 1LYXA 4CNNA 3W7IA 1ME7A 4O54A 1NF7A 3IVTA 3G18A 3DHFA 2EKCA 2X16A 1TPB1 1P0NA 3LV6A 3WFAA 1DOSA 2ZFAA 5AHFA 2YW3A 2Z6JA 2C13A 4L4LA 2FIQA 2A21A 3E12A 1EA0A 3KVMA 5D2YA 3MJYA 1P4CA 3QEZA 3T4CA 3I7RA 3GKAA 1QAPA 4LNYA 3LCIA 3F1QA 5CZTA 1EIXA 4IQLA 3RK8A 1UB3A 3S5YA 1OF8A 3O16A 3FJ6A 4GUFA 4UTTC 1SR9A 1TSIA 1MSSA 3MBDA 4LV9A 4E38A 2QDHA 2FLIA 4O1AA 2J9XA 2W79A 4QNEA 2B7PA 2J88A 2PC4A 4JX4A 3KVLA 1V5XA 3W2LA 4O16A 5I3GA 3WK0A 4QM1A 4MLJA 4UC5A 4C1LA 1SQ7A 3I7SA 3NOEA 1GT8A 3DKLA 1K7XA 1TV8A 3BLIA 3MP3A 1XUUA 3PBUA 4JTTA 4P2VA 4PL2A 1K8XA 1FBAA 1QPRA 5EL1A 4ML9A 1PE1A 1KTNA 5FESA 1OFRA 1WBHA 4BR1A 1GPWA 4M5PA 3L66A 2TSYA 3KXQA 4H4IA 4NJGA 3AJXA 5E1QA 1ZY9A 5DCEA 5AHLA 3S9YA 4IGHA 2Q3RA 3T55A 3BGGA 2E68A 4UFMA 1RR2A 3A22A 3PUDA 2TMDA 1OFEA 3A5FA 1XXXA 2W6RA 5C54A 4UTTA 4BK9A 2ZRWA 1WQ5A 3SI9A 1TO3A 3A5VA 4RLIA 3KRUA 5D2WA 1Z48A 1ZALA 1K8YA 3G1XA 3W7DA 2VFDA
chains in the Genus database with same CATH superfamily
5C2CA 3ZS4A 3V1HA 2H90A 1PKYA 3WUBA 4YLWA 3G8EA 2AL1A 3M64A 4UNLA 1WZAA 1RPKA 3O07A 5M17A 1PL9A 2J75A 1CWYA 1V03A 2O9RA 3WLSA 3BLKA 1AQMA 3TWBA 3ATYA 3TVAA 3STPA 4LWWA 3H21A 2WJZA 2H8XA 1G5AA 4IFRA 3TQVA 3LENA 4UFKA 5C0QA 5MKGB 2X2GA 1F3XA 2OT0A 1LTDA 1RD5A 2GDUA 4Q33A 1DJQA 1JULA 3BG9A 4Z08A 2D23A 4C6QA 3TTYA 4S1FA 1LRQA 9CGTA 1DHPA 3M5XA 4H3DA 4QEEA 2INEA 5LA2A 2JIWA 3W7PA 3CAKA 5JIWA 1SW3A 3DYMA 3T07A 2OLAA 1A0EA 3CWNA 3GDBA 4DHGA 1Z69A 1W37A 4D8LA 1YXCA 4O1BA 3RPMA 2PDQA 5FF4A 6REQA 4M19A 1LLZA 3RCNA 4ZL1A 1RCXB 1TFVA 4KMQA 2QMKA 1LT8A 1R47A 3WDIA 2WNWA 4GNKB 3GH7A 2CFFA 1L6SA 2J13A 4BI5A 3V5CA 4GI6A 1E1FA 1X39A 1E55A 2VFHA 3N9SA 3D3FA 4KRZA 1I8JA 1BQGA 3L0NA 5AC4A 5BMWA 3S47A 4ATWA 4XD6A 4DF1A 5BRQA 1X1OA 1H7WA 2WNZA 3XINA 3QGVA 3OEXA 1EP3A 1E4MM 1YXYA 4M6PA 2Z1KA 3MDWA 1FA2A 1VPQA 2AGTA 4YIWA 3E0VA 2OWWA 3WD2A 4YYFA 3ES7A 5MF5A 4PUUA 4MDPA 1IIHA 3ID7A 2R14A 1K77A 1O68A 4JS3A 3TUUA 1FWGC 4IMDA 4ROPA 5FL1A 3G1HA 4Z2IA 4QBXA 1PYFA 2DJXA 2E67A 3KL3A 2YKKA 4KCTA 4KWUA 1OK4A 4AEFA 3MMWA 1EH9A 3MT1A 2OU4A 4I6VA 4GQBA 3W00A 2WANA 4D6FA 2ZUTA 4ZO9A 3AIBA 1VQTA 3CWOX 5HATA 2ASHA 3I4KA 3DFPA 4K8GA 1F3EA 3MDUA 1QDSA 3KE0A 1OIMA 1JZ6A 3A4XA 4CD8A 3DAQA 1QI3A 5HK4A 1J8VA 3UERA 2YCEA 4MZ1A 1FP8A 3ITVA 4JIPA 4JKKA 2A5HA 2TRSA 5E70A 3W70A 1S1RA 1H7RA 2C6QA 4HB7A 4BJHA 3FXGA 1MXDA 5FF3A 3UWQA 1JNDA 3UFYA 4NU7A 3B0UX 4IPIA 1JYNA 3AIVA 4MNLA 1QO2A 4P61A 4BI6A 3GH4A 1RA0A 2G3FA 5AYZA 3T44A 1BRLB 1FCVA 2QCEA 3GM8A 4W86A 3QZEA 1C8YA 1VBRA 4NXKA 3WK2A 1J0KA 4CNPA 3LCFA 3S9ZA 3PR2A 4AIBA 3S2CA 5FACA 4ATDA 4ZOCA 3WH7A 3ATZA 5M2FX 1E6NA 1U1HA 1IT7A 2INZA 4FHAA 2XGIA 3MYPA 2VHLA 4ZGYA 5EKYA 4LEQA 3SAZA 1EJVC 2JALA 5EBUA 4N9DA 4O1EA 1SO5A 3VX0A 3EWCA 4R3UA 4PBEA 4ZQOA 3NL6A 5DFAA 2FYMA 2VWSA 1AJ2A 3A23A 1KV8A 4I9MA 1YTKA 2YFNA 4NAEB 3KFTA 2YCIX 2Z1WA 1K9DA 3SIMA 4I9TA 3IJ7A 1R2SA 3QR0A 4I7WA 3VIIA 2PURA 3TX9A 1D3GA 2JGQA 3HPFA 1KM1A 3MO4A 4LUIA 4F48A 1EQPA 2YBTA 3JRKA 5DELA 1RALA 4LW7A 2YZRA 5ENLA 2X2YA 4Y6GA 1R3VA 4BI7A 3BOXA 1YTDA 4LVAA 4JYDA 2WZEA 5TQLA 3CL8A 1IIGA 4ZZ9A 2ICSA 1EUNA 3VOIA 5AZ0A 4CQ9A 4J3VA 3L2MA 3M0XA 4YS1A 1ME8A 4DJED 1I1XA 1EZWA 3U2OA 5CC3A 1GONA 4RNFA 4JHOA 2V81A 2GSJA 5BOOA 4GVIA 3QHOA 4QDMA 2I5GA 2GGHA 3H55A 1SSDA 3OA3A 4YWIA 1VFTA 4JPGA 5U4NA 4EKJA 2QCHA 3N1AA 4PMUA 1FX6A 1J5SA 5T9BG 4MAZA 5BOEA 3K4AA 1OFQA 1X6LA 3MCMA 9XIAA 4AY8A 3LRMA 4DJDD 2HVOA 1EJXC 1HO4A 1KBJA 1UBSA 2EGZA 3Q4DA 2OO6A 1LM1A 4DZHA 1O1ZA 2X1RA 1JQXA 2B0MA 3F5LA 3PTDA 4JNYA 2QUVA 2BLEA 1E4NA 1IHIA 2C0AA 3BO9A 1I9CB 4OTKA 2YSWA 4LSBA 3MVIA 4JL1A 3BLPX 3EX2A 5E5CA 3AUJA 1NOFA 4ECLA 1JFXA 1OINA 3LCHA 3TFCA 4UR7A 5EY5A 1K7FA 4XAZA 2TODA 3AMCA 1H0IA 3U5YA 1R38A 1TTIA 1ZJBA 4ML4A 3NM1A 3FXYA 1JDDA 5FJJA 5IDIA 4HNLA 4C5YA 4UQDA 3N13A 1S46A 4J27A 2CZEA 4O1DA 2VFEA 1IR1A 4NX0A 1W2PA 1EEPA 5LGZA 1D7FA 3EA1A 1K8ZA 1RP8A 6REQB 3C8NA 3THAA 2OB3A 4G7EA 3N3TA 1F61A 4ICCX 2CU0A 4DYEA 1EYWA 2ALRA 1VB9A 3VMPA 3KRSA 4B3LA 3DDMA 4KERA 3GTHA 3SDOA 4GIAA 3FV9A 3VKDA 4G6CA 2WBKA 3M4HA 1TZZA 5A8MA 4YN5A 1XIJA 1X7FA 4NYYA 2CETA 1V7AA 4MHBA 1GEHA 1XS2A 3IACA 3USZA 3C2RA 1DQXA 3EB4A 1XLEA 3FY1A 3P80A 3B0XA 4A4AA 3P14A 3LM7A 2GUUA 5AC8A 1KQYA 2XG9A 2PPGA 2QCLA 4UTLA 4ZA0A 3AAMA 5C55A 1XBZA 3W28A 1E1CA 3HB9A 1UQYA 3CMGA 1JCMP 3A47A 3CAVA 3V3WA 4C6FA 3FCPA 1NWRA 4KFOA 2A3BA 4EF8A 1OC6A 3FA3A 3RO8A 3BANA 4R9OA 1XJBA 3W22A 2QGHA 3CH9A 2BY2A 2A6LA 2PTZA 4IQJA 4ZOEA 1OZMA 2XSBA 4RR4A 1PWLA 3VK5A 3ECQA 1U5VA 4UMBA 5C2XA 1E9IA 2ZA1A 3KOZA 1UZDA 2WCGA 5TNVA 2ACRA 1LJYA 1K7EA 1BF2A 4K6AA 4XIMA 4I5RA 1Q6CA 7TAAA 1YE4A 3ZYZA 3V35A 4EWJA 1A5LC 2R6OA 5JBEA 3JW7A 2QJNA 1W3KA 1TELA 5G1YA 3BSMA 4AU0A 3MUCA 2Y61A 3V7PA 1HJVA 4Q8VA 4RW5A 3TW6A 4OVXA 1RQBA 1UWQA 2KZHA 2YYUA 3B8VA 3FEMA 3DN5A 3KS6A 3TYEA 4QHRA 3BGAA 5LA1A 5FL0A 3P0XA 1QPQA 4PTXA 4DBDA 1M03A 1E9YB 3FYPA 3I6TA 4EPBC 3UPMA 1W9BM 1HJSA 4ZCWA 3IGSA 3EDJA 4DM1A 3CEUA 5IFTA 1XD0A 3GC2A 5D9NA 1JPIA 5D32A 5TBOA 5GJNA 2BGNE 3MMTA 3P67A 5LIWX 2D73A 4MPKA 2WWCA 1IR2A 2NWRA 1BVZA 2XH2A 1L6WA 3PUOA 3AYSA 3T8LA 1M7OA 1XIBA 2ZVRA 2FZ8A 1JCXA 2VX5A 1UASA 1HGYA 4FI4A 3UJEA 2D2GA 4DYJA 1WXYA 2G3MA 1AQ0A 4RDWA 5HANA 2VCAA 1XH1A 2EQDA 4A05A 3RDKA 5A6KA 1CGTA 4DWSB 3S4TA 1EIBA 3LHWA 1GZJA 2ISFA 1XHGA 1AQFA 2CWNA 1FKWA 3KW3A 2IQDA 3IGUA 3PZOA 3SECA 1H7OA 3LHYA 4WGXA 2QCNA 3TJ4A 3S1UA 1QWGA 4XWUA 3KTSA 4AMCA 1PHQA 3NZPA 2BS9A 3TTOA 1BYDA 8XIAA 3VZXA 3ZR4A 3PZNA 1KM5A 4UMCA 4FR1A 1F76A 3KBVA 4ZVJA 3HBLA 3PSVA 4X63A 1BYBA 4PMYA 3IPWA 5AHNA 1R85A 3NYZA 4GBDA 3RHGA 4Q8OA 4JTIA 3W1PA 3LSCA 4OT7A 3DXIA 1NFPA 3R13A 4OE7A 4RXFA 3DI0A 4MF4A 4Z1AA 3MCNA 3BV4A 1QOXA 2Q3OA 3LSBA 1Q4NX 4JTSA 4JICA 5F2MA 3P3BA 1KD0A 1R7AA 4LY4A 2G5WA 2ZTJA 3CUHA 1K9FA 3QFWA 5CPNA 5FAJA 1C93A 3MJMA 3RR4A 2VR2A 2YCLA 2Y0FA 5FF7A 5H8MA 5EMUA 1GKPA 4BQ3A 2VENA 2A3LA 1TQJA 3RIKA 3BAXA 1HKWA 3PM6A 3OGSA 3VIJA 1US3A 1WKEA 1AJZA 1PWMA 4ADTA 4WY0F 4M7SA 1R8LA 1SO6A 5G2HA 3SSZA 2PFHA 5HQLA 4URIA 1UPPA 4UTKA 1A4MA 3C4UA 4BQ5A 4QDPA 3WF1A 3PPGA 2ATSA 3AALA 3W27A 3TN5A 3T78A 4F9JA 3DUGA 1XICA 3WBYA 1J18A 1KGXA 1BAGA 4J9JA 3BJFA 1EWEA 1KFBA 3W72A 3P7YA 4A22A 5F4WA 2E7FA 5XIMA 3LCGA 5CJMA 2XFFA 1OFAA 3HOJA 4NT0A 2FPYA 3M0ZA 3KRZA 3LPGA 2G3NA 4FPSA 5XINA 4MG4A 3RR1A 4GXPA 3M16A 2OGJA 3DFYA 2V0TA 1A5UA 5I23A 1QNOA 4S2BA 3LM3A 5LXEA 1XC4A 3PF3A 2WM1A 1ZBVA 3O63A 3I4EA 1V6XA 1XFCA 2OSXA 1D9EA 4IJCA 4JTUA 1DEDA 4Y9OA 2PUZA 3EBVA 4AWTA 2C71A 1W56A 2DGAA 1X7IA 1YDYA 3N34A 2HRWA 2WKGA 2V3EA 3LS9A 1SJDA 2KX9A 3WNLA 5JVLA 2XFWA 2Y1HA 3MSGA 2DT3A 4AWEA 4I7VA 5AVNA 3EKGA 4ALDA 2XIBA 3UCQA 1DJGA 3M0LA 4GJJA 1AFSA 1W32A 1BFNA 2WZIA 3MBFA 4F3HA 3BCDA 3LPOA 3LQGA 4PTMA 1M1BA 2I5IA 3NA8A 2G37A 2IQ0A 4B9ZA 3VNZA 2C16A 4P8WA 3PN8A 3HM7A 3MMDA 1FWNA 4FZIA 4QROA 1K4GA 5K2ZA 1JZ5A 4FEZA 2PWUA 3ZT6A 3WQGA 4A35A 4CGTA 2X7VA 2DZWA 3RJYA 1OEPA 1S1PA 2GQ9A 3I3BA 1NQ6A 1I2NA 1DV7A 2QCFA 1W1YA 4KFPA 1LF1A 2F7FA 3XIMA 2XIJA 3QHMA 3GC5A 5AC5A 1WBJA 2HS6A 3SSJA 5FJRA 1J5TA 3GIQA 3DFQA 4AIOA 4R53A 2E0PA 1YQ2A 1VGAA 2GWGA 3IAPA 2XH4A 4S3GA 4L9ZA 1PXGA 1SZNA 4WKAA 4JQAA 3KP1A 3TE9A 1JDEA 4DUVA 4D6JA 4TU1A 5ABTA 2ZZ2A 3VC6A 5TAOA 3VFCA 3K13A 3UWZA 3L4WA 3QFEA 3EPMA 1V6YA 1UKTA 2Y85A 1R3WA 1UH3A 4AZCA 1ISWA 4HOZA 3WNNA 1EOKA 3U5UA 3PULA 1IZJA 2CNCA 1CZ1A 3AWNA 1FCBA 4KCWA 3H2OA 3MKCA 3ZLHA 1K03A 2E09A 1DYSA 3CTTA 3E0FA 1QHOA 3PJXA 4GWEA 3T7VA 1MFUA 5CZJA 1JI2A 1TPFA 4MZYA 2GQ3A 3BMXA 1MUMA 1FDZA 3SN0A 2CZDA 1NOWA 4WOZA 3TR2A 3RM8A 5JUVA 3GG8A 2GOKA 3CIVA 3EX4A 1OHLA 2WC7A 3AIRA 2FDMA 2BG5A 3U6WA 3LRKA 3BCFA 3TOYA 1HKMA 1HTIA 1X98A 4GZEA 4JIEA 1OCQA 4LBUA 5DY3A 4WDXA 3ONBA 4PRTA 1W31A 2CKSA 4G1NA 2W66A 3U7BA 2CBJA 3IS4A 3RLVA 3TC3A 3EOEA 4WJXA 1HG3A 4IUOA 3GB6A 4WXZA 2CLKA 1QTWA 2DW7A 3FA5A 4UZUA 3GFYA 2E5BA 4H2HA 3C61A 3VIKA 2PDGA 2R1KA 3CZEA 1JF5A 1XDJA 4HT3A 1E9LA 1CW2A 7ENLA 5FF0A 2WMKA 2QIIA 4Q3MA 4HCDA 3MANA 3TYDA 4PYSA 1Q6FA 1ZAIA 1UROA 2HE5A 3CASA 1PIGA 3RPTA 4A2RA 5HR6A 4GY1A 1ZS2A 2OX1A 2WMFA 1EWDA 3WBWA 1PCKA 2NWSA 1OG0A 2XUCA 3MY9A 4YU1A 1M01A 3BK0A 3FSTA 3LXBA 1OFOA 3ZVIA 5L9FA 1XIFA 1E72M 1A5BA 5AYYA 4LB4A 4BEUA 1REQA 4D6CA 2CYGA 3GW0A 4HPNA 4GQ0A 1TYGA 3LOTA 4N9CA 4AISA 1H60A 1S2CA 1IWBA 3E1F1 1FDJA 1M53A 1W91A 3TCSA 9RUBA 2I57A 1OVDA 3TZNA 1CB7B 3BVJA 4O1FA 3BLDA 4S3AA 2OSWA 3N73A 3TU9A 3RRAA 2D0FA 4EAYA 1FY6A 1KFKA 3UXKA 2V2CA 1VPYA 5EFFA 4ZB5A 1NJJA 2C8NA 4F8XA 1UWSA 4ZOAA 2HROA 4EOUA 1X6NA 3NO3A 3AHXA 3HPXA 3EWDA 5C9ZA 5ABHA 1POKA 2YB4A 1BG4A 4UWMA 4MPQA 4MFDA 1A5AA 1DKWA 3U0HA 1YPXA 1UH2A 2YCLB 2V68A 1B0IA 4B5SA 4HIBA 4NSBA 3O15A 3SJ3A 3GXNA 3W37A 1ZGDA 4DXKA 8RUCA 2GVJA 4JR5A 3T1GA 4GE8A 3WMCA 3UG8A 2ZA2A 1P6BA 4S3CA 3G0UA 4NNBA 3SN4A 1DIDA 2E8ZA 3O0KA 4Q7BA 3VINA 2YBUA 4AAJA 4W5UA 3GXPA 5HNTA 1CLXA 3L23A 1LWJA 5H8PA 3L7RA 1CYGA 1AK5A 4N9BA 3TQPA 4LAKA 1V3KA 4WRHA 1DXFA 1J0JA 1Q6LA 3UY7A 1KWGA 1S5TA 1O7AA 3M6YA 1B4EA 4DY1A 3GQYA 1KR0A 4W7UA 3MC5A 3OVRA 3KOFA 2OEJA 4MLRA 2OZ8A 2PCQA 3B8IA 3VIPA 1TPVA 3M5ZA 1OYCA 3ZVHA 2ON3A 1N8WA 2Q09A 4UTIA 4WDTA 1HNYA 3E0IA 2L5HA 1FHUA 4FAMA 5DBUA 1JCTA 1I2PA 4QISA 1Q4WA 2OX4A 3PZVA 2OOFA 1FH9A 3WH5A 1M3UA 4FXRA 1NWTA 1TV4A 4RNHA 4OGZA 3M6DA 3WDRA 2GJXA 3R10A 3WDJA 4WSKA 2ZZ5A 3WMSA 2IKHA 1TUFA 4K7YA 3WLPA 2PLJA 3BPWA 4HU3A 4YTTA 2GGIA 2IQTA 3ZSTA 1KM6A 4X9SA 1XSIA 3WYZA 4FNQA 3T2QA 2HSAA 1QHZA 3CNYA 3OVPA 4IQDA 3O6YX 1WXZA 4HU8A 4HMEA 2P53A 3UWEA 8A3HA 3VGBA 4BWLA 1F07A 4RCXA 4WSHA 4BHYA 4S23A 2Z1BA 4IP5A 3W71A 4E3TA 3CIWA 4BEQA 3UETA 5CPOA 3AXIA 2CZVA 2AGKA 3D46A 1WDSA 4HJFA 1FQ0A 1S3TC 4JQ3A 2DVXA 1GYMA 4LPCA 3PBGA 1Q8JA 4A3YA 2I14A 3GXFA 2E9BA 1KFCA 3SY1A 3AYRA 1S2TA 2J66A 1MI3A 3GG0A 4CCEA 2R91A 4BY3A 5E0FA 2VL4A 4UXDA 5C8BB 3NQCA 1PYMA 1SPQA 4EIVA 1LQAA 4L64A 2HPIA 5CJ5A 2I9UA 3OU8A 1EX1A 2VQUA 3N04A 2HXTA 1TIWA 2FZMA 1ADSA 3PP7A 3F2DA 5G1MA 4V1XA 4OJYA 3MSDA 4R27A 4AZCB 3RO6A 1FWSA 1GYNA 3CH0A 5F1UA 3QMSA 1SFSA 1V02E 1BKSA 4MYXA 4FIQA 2EAWA 2XISA 3HQ1A 3PAJA 3GFXA 3LLDA 4GUIA 4N02A 2NX1A 4DI9A 1VEMA 1B30A 4DJFA 3OYZA 4O10A 5GNXA 1NOUA 2Y62A 2JK2A 5AY7A 1OBAA 4IL0A 4MMWA 1POJA 1H2JA 3W3OA 4PUMA 1ESWA 2BASA 4HYVA 4B5VA 4AHPA 4PB4A 1WZLA 1OFDA 4G5DA 3RLUA 2ABBA 4S3EA 2BB0A 3R94A 3FNDA 3VNIA 3CU2A 1ZBKA 2D2JA 4B90A 4XZWA 1IEVA 1C90A 3GHUA 2GGEA 3IRSA 3BURA 1FXQA 3N2TA 3AIQA 2GZXA 1HL9A 3VX1A 2ZBTA 1BQCA 2FZNA 4H6KA 5D4YA 4HZ7A 2ALDA 3BQ5A 1BLIA 1ZL1A 1SR0A 3T0CA 3TA9A 1VP5A 2A6NA 4NNCA 1O60A 3UZ5A 4HK6A 3ABOA 2DT1A 2FH6A 3HO8A 3WNMA 1QUMA 3UY8A 3WQDA 3G24A 1JDCA 3WZ0E 2VOMA 2OQYA 4JHZA 4GNJA 1GK8A 4FA3A 2I56A 2FB2A 1WE5A 4PCPA 1X8FA 4UTJA 3N17A 1UZ1A 3GS6A 4KS0A 2OR2A 3PPCA 1J0YA 3U3HA 2WV8A 4HPJA 5GJMA 1TV5A 4LTSA 2WQDA 4WY0A 1Q6QA 1REQB 4TVCA 3VIFA 3TQKA 4J3UA 4LC8A 3L4YA 4H8HA 1XYZA 3HQPA 3KHJA 4HOXA 3P6LA 4LAZA 2EPMX 1OWQA 2WMIA 3OW1A 4CNNA 3OZOA 1QXLA 1DJZA 1G9HA 2PU1A 1CPUA 1DWGM 4YPJA 2X16A 4WGHA 1DOSA 4XVEA 3AU6A 3IUIA 1DIKA 4PBFA 2Z6JA 3V5FA 3GVVA 4XIAA 1R7OA 1EA0A 3SB0A 3T4CA 3GTFA 3MQTA 2ODOA 1BD0A 4LNYA 4P5UA 3F1QA 3VMNA 5CZTA 1EIXA 4EK7A 3NURA 3RK8A 3MKVA 1OF8A 4ZFCA 3PPFA 3G6MA 3O16A 4FR6A 1TSIA 1WP6A 1EC7A 4E38A 3CPGA 2QDHA 1BXNA 2J88A 4JX4A 1IEQA 2HV5A 3QKZA 4UC5A 3NOEA 3FA4A 2OGYA 1ODUA 3PBUA 1P0DA 4Y8EA 1K8XA 1XPYA 3KBJA 3HURA 1TKKA 3QV6A 5EL1A 4QRNA 4ML9A 1YNYA 3PTKA 3EB3A 1OFRA 4FLQA 1Z7AA 4M5PA 4NRRA 2TSYA 1LUCA 5I78A 3S9YA 1EA9C 2Q3RA 2ZUSA 3T55A 2OKTA 3BGGA 4A3HA 2E68A 3T0DA 2QPUA 4AIUA 1OFEA 1PTGA 1UWUA 2W6RA 5HMEA 5C54A 3RILA 4IIBA 3KWSA 4BK9A 2PF8A 2ZRWA 1XYBA 3ZVHB 1T40A 4QG6A 1Z48A 1ZALA 2WJDA 2CXGA 1RBAA 5AZ1A 3TTSA 3DIPA 3EDFA 5CJNA 1JCLA 1OX5A 1JUKA 3NVTA 3T81A 5D38A 4K1GA 2Z2UA 3K46A 4F0LA 3ORWA 4JCLA 3U9IA 4PE8A 5A6BD 5L6UA 3OHMB 1FWHC 1GCYA 1F5ZA 4TXEA 4HPXA 3SRFA 3THDA 5BZAA 2BHZA 1XLJA 1XGDA 3WMBA 3UU0A 2GJXB 1XI3A 1N8FA 1IF2A 1WO2A 2DQXA 2VI0A 2YCKX 3GDKA 1HZYA 3A9BA 4MKNA 2I7GA 2YFOA 1I75A 3BMWA 1YTEA 2OZ0A 1JAKA 1VD6A 3C52A 1TQXA 1FRBA 4IGNA 3GYCA 3GAKA 2HVMA 1JL8A 1H4PA 4PGLA 2FFCA 5D2VA 3S1VA 5FIPA 1TWIA 1HKIA 3DX5A 2HEJA 4ZE5A 3SCTA 1PZ3A 2HZGA 4H7CA 4JY8A 2WNQA 4WDUA 3L68A 1XSKA 2BZNA 5J04A 3VOFA 5C9XA 1GZ1A 1C9DA 1DQUA 2WW5A 1SFJA 1TPC1 1MRAA 2CLHA 1UJPA 4OZOA 5BROA 4POCA 4LT9A 4JL2A 2GLKA 3IIXA 3LGEA 3M0IA 4ENLA 3H2CA 3L4VA 3WQOA 4MB1A 4MWAE 4YNGA 5KITA 1GOOA 2BOGX 2PTDA 1W1ZA 2A4AA 2PP0A 3MUAA 1YADA 2OMAA 3V18A 1GHSA 4FIRA 3LEPA 2ANUA 5CLTA 2NUYA 4M80A 3WDHA 1D8WA 3KX6A 5PTDA 5LIUX 3AS0A 3CQJA 4H7VA 2BOFX 2QAFA 2CLLA 2HBVA 2IPFA 2AAMA 5CCZA 3QH2A 1MUWA 4DWSD 2Z24A 2ZX6A 1H61A 1C92A 5LA0A 1QI0A 3OQ8A 3VKCA 3CV2A 5HUOA 4DZAA 5LHEA 3SADA 3TDFA 1FHVA 4GFSA 5A6MA 4RUBA 4ICMA 4W7VA 3ITGA 2WLYA 2C18A 1GVEA 4OV4A 1IWPA 3SGUA 1MWOA 4QE4A 3FKRA 4U3AA 1MDLA 1VF8A 1UH4A 5CC5A 4IIFA 3ENLA 3ARPA 4UTWC 3EOOA 2WSRA 3VD5A 3MWCA 1SU5A 4KKXA 3HV9A 4FNSA 3OGRA 2XN0A 3EX6A 2FMNA 3P84A 2PWHA 1VENA 3W4RA 2C0HA 5I79A 3QV9A 1MW1A 1Y65A 4H9TA 4O15A 5CZ0A 3V1PA 4QEHA 5A95A 5JIPA 3WLRA 4ACZA 3VDCA 3NM3A 1UA7A 5HWMA 3C0QA 3BARA 3B9OA 5AB3A 3FJLA 4GI8A 4U2YA 4MM1A 1FWWA 1NSJA 1GORA 5IBXC 2J78A 3M41A 1JIBA 1OF6A 3GVGA 2DH3A 4DZIA 1Q66A 3JS3A 4Y9PA 2F6UA 2WHKA 1CEOA 5HMFA 3S46A 5C6MA 1MW2A 3CJPA 2ZE3A 4WEVX 4C6OA 3B9DA 3IIOA 2UZ9A 4EF9A 2GGGA 3GNOA 4MSSA 3DC0A 3VD4A 3WL1A 1S5MA 4E3VA 3BAWA 3W1AA 4MUZA 3QV8A 1NH6A 4Z42C 3BZGA 1XP3A 4Q8MA 3KCOA 1LBMA 3S5OA 3NSMA 4K3ZA 5D04C 4NILA 5DMNA 2VEGA 3GNXA 1GTEA 2I16A 2QXWA 1UKQA 1H7NA 2R94A 4WY0B 3F4VA 3B8DA 1TV7A 4M56A 4CUCA 2YJQA 3MKKA 1YLVA 4Z1YA 4JYEA 1BGGA 1E73M 1L6FA 5IBXA 1KA9F 2VRKA 1FWDC 3EOUA 1HUVA 2POTA 1XLAA 2ZCGA 2WMIB 4HU0A 1I4NA 3VNMA 1Q6OA 4ZBCA 2PDPA 8XIMA 2W63A 4O12A 4GIRA 2W4XA 2GJPA 3TIMA 3W7JA 5DQPA 4M82A 2CLOA 3OLGA 3C0JA 3RLHA 2ZUMA 1WDWA 4Z1BA 5D33A 3GK0A 3WLHA 4LGXA 3HG4A 1W5QA 5I07A 1GEQA 3E9AA 2VC6A 5EMKA 1IXPA 4MZ8A 3S5SA 1IXOA 3SZ8A 4AZHA 1UD5A 3W9ZA 2PBOA 3PZUA 4Y90A 3ZM8A 2OYKA 3M1ZA 4OIFA 2PZ0A 4JFWA 5JXQA 1DJNA 4LVBA 3UG4A 2F84A 4XAPA 1MQPA 5DCDA 4XAFA 1W9XA 3L9CA 1OC7A 1BTCA 3HJZA 1W6TA 2J62A 2YGYA 4MB5A 2ZDSA 4FOJA 3TSBA 3AMLA 7TIMA 1GOXA 1LUCB 1MEIA 4PL1A 5H91A 4JTJA 1F8MA 1VZWA 3PTQA 5CXPA 3IVUA 2VZTA 1A0CA 3PNZA 1UCWA 5A8PA 1BEUA 1Z42A 3KL0A 4E8DA 1NFBA 1MMFA 2YZ5A 3CPRA 4RE0A 4O4VA 1BYCA 4AD1A 2RDXA 3AC0A 5G4WA 3SUTA 1XGZA 2C7FA 4H1ZA 1F2JA 2WVSA 3EMCA 1EJ7L 4JDBA 2O9TA 1SJAA 3KS5A 4HSHA 4Q4KA 4U2ZA 1OT2A 1PKNA 3FHAA 5I77A 2PWGA 2ZOXA 2PGRA 3Q45A 5K9DA 5HJYA 4HA4A 2ZDRA 1K4HA 3BC9A 3O6DA 4L4MA 4H01A 2FVKA 1EQCA 4JYFA 5I2UA 3NGFA 2WBGA 1VBUA 4V28A 1B2YA 1QCWA 1C8VA 3HA1A 2DW6A 1K3UA 4OHQA 3MVTA 3W85A 3M44A 2O9PA 2HE8A 2OLHA 2NZLA 1PSCA 1WDDA 1W3LA 3OVGA 1TVNA 2GYIA 4AB4A 3N18A 3T42A 3GWQA 1XFBA 5DXYA 3I68A 1W0MA 2XYLA 2D2OA 1JZ8A 4YHEA 4UQCA 2EXOA 3LPFA 3KLLA 2XVKA 2TPSA 2H3DA 4RE2A 3M47A 1GUVA 5HJLA 2WJFA 4NQ1A 3O1NA 1Q7MA 3DFHA 3APGA 4AMAA 4PFMA 2WSKA 3G8RA 4Z2JA 3D0CA 4GMEA 1H0GA 5KSWA 4GO9A 2J7DA 2C15A 4L6DA 3RU6A 3W7QA 1EGVA 4EP8C 3EXSA 2FMOA 1JR1A 2YDQA 4DO7A 4UIOA 4V2XA 1XIIA 3OZMA 4LY8A 2GGJA 3WJSA 3NEVA 4FMVA 3V36A 1ADDA 3ARYA 2WWDA 4AEOA 1OK6A 1DWFM 2W5FA 1DVJA 1XYMA 2XN1A 4PCTA 1N7KA 3CEPA 1XINA 2PP3A 1KKOA 3URQA 2EPOA 1OFBA 4FNPA 3QQ0A 1FHLA 2Z2BA 1B9BA 4ZQMA 4DYKA 3WCZA 2VC7A 1VCFA 1R30A 2C1IA 1HL8A 4Z0JA 4HPHA 4Q8WA 3PFRA 1VFHA 4RE3A 5LNRA 4GUGA 1B54A 2PD9A 5FF2A 1VHCA 5BXRA 5HJXA 3UXLA 2EG7A 1TCMA 3G1RA 2V5DA 3W2NA 1XG3A 3P2VA 3G1YA 1TWWA 1N8IA 1RVGA 2NW0A 5B80A 1UR0A 3FVMA 1IE7C 3H7RA 3VKAA 5CAKA 3W7OA 3VI2A 1JRBA 1Q6RA 1EJTC 3B8WA 2PDKA 3HTWA 2GUYA 4XZMX 1M7JA 2DZSA 2WHMA 3QY6A 3K2GA 2PAJA 4I8DA 4Q8UA 3T08A 2O7SA 1TTJA 1E15A 2GWNA 4TUFA 1GQKA 1GQLA 1E5JA 1CXEA 3G0XA 5GJPA 3T40A 3EB2A 4NI8A 3UR8A 3PC0A 4O4WA 3AMGA 3DGRA 4Y8FA 2QDDA 1M5WA 4J1OA 3N19B 2YIHA 1QWKA 1GHRA 3OGVA 3W6LA 2CZFA 4WCJA 2PRMA 4Z2KA 3SRKA 4Q8NA 1OD8A 2GDVA 4MB3A 1GQIA 3PG8A 3P61A 2EJ1A 1TX2A 2BHYA 4C6KA 1EGZA 3F4CA 4GKTA 2ZICA 4X22A 4LUJA 2FPTA 4N0RA 2XHYA 3CUGA 3VIMA 1RAKA 1UR3M 3R43A 4W4QA 1FH8A 4REQA 3CUIA 3E5BA 4XX6A 4FNRA 3G1AA 4I5XA 4OKDA 1AQHA 4GVFA 7ODCA 2FTPA 1HVQA 1KM2A 1UWAA 2OZ3A 2Z26A 3RNDA 3TV8A 1RP9A 2LLEA 3R5EA 3MW7A 4KWSA 4XBJA 2PEVA 5IRPA 5EMLA 1FCQA 3A6OA 1OT1A 4QFUA 3IJ9A 1EPVA 1ZTVA 4MIMA 2OTDA 4N4PA 3W84A 3HIJA 3JZEA 4Q8TA 1YNPA 4GFIA 2R1NA 1G01A 4B5WA 3E6EA 2XZ9A 4E4PA 1XIGA 4E2VA 2OVLA 4CNUA 4HA1A 4O8RA 4J4KA 1E0TA 4ZO6A 1TE1A 1JYVA 3MHGA 2BXYA 3B40A 5ABFA 2ZWZA 3BOFA 3IANA 4UOJA 1VS1A 1SYTA 1S2AA 3NOYA 2OSYA 4YHGA 1NM9A 5T26A 1C7SA 4QX4A 3E2VA 3LZ5A 1X1NA 3TQ0A 4AF0A 2AMGA 2IKGA 4ZB0A 2ZZ6A 3SW6A 1K02A 1A5CA 1OC5A 2ZADA 1X6UA 3E38A 5I24A 4PTDA 2Y2WA 4E4UA 1Q3NA 1VCVA 3RMJA 3VO0A 2Z27A 3VXGA 4O19A 4R5EA 1EP2A 3SCSA 1QR7A 2CHRA 3W7LA 3EX3A 1FWTA 4MY1A 4B15A 3BG5A 4FSAA 3QHNA 1A3WA 1FCUA 1KO0A 3W82A 7PTDA 4Z0SA 3BSHA 4G7FA 3GDRA 2BXZA 1I0DA 1NWUA 4QSFA 1XL9A 3W1TA 1O66A 4K7VA 4KEMA 3ALGA 1WKYA 1XDLA 4M6QA 3SIZA 3FJNA 3PJUA 2HS8A 1GOQA 2WO5A 1R86A 2V9DA 1ZFJA 2Z1SA 2PGFA 3POCA 5FJPA 1TZ7A 3EWWA 1SFLA 3ISIX 2VEKA 5LYRA 2PB1A 2ZXDA 1WZKA 3QMTA 5JH1A 1OGBA 4A2SA 1KRCC 5D05A 3SQSA 2QULA 4LC6A 4RV3A 3S1XA 3GXMA 2D0GA 3SUSA 1MZHA 3TFXA 1U83A 2OELA 2ISVA 1S2UA 4X60A 2R1MA 4UR9A 5E93A 3IJ6A 3UPBA 3VGEA 4FX7A 1QASA 3FKKA 3EWXA 3WEMA 5IHSA 3U57A 2VDHA 4X0NA 2PRLA 3C2EA 3QQ1A 4D2JA 5AC6A 2XSAA 4PCSA 1FFQA 1O4UA 2PGWA 2X1IA 3R7MA 4OUEA 3IGHX 3NQGA 4Z2GA 3EOLA 4GY0A 4AH7A 1UA3A 3N9KA 3ARWA 2RDWA 3Q58A 1PX3A 5FI8A 5HMSA 3NIYA 4U28A 1PX4A 4CD7A 4NYUA 3APYA 2YCJA 5A69A 1CBGA 3DBPA 1RD6A 2VFFA 5IDZA 2O55A 4CU8A 4J3SA 1JZ7A 1IZKA 4PC8A 4F0SA 2WSYA 3QF0A 1UUOA 4KFNA 3FGCA 3L12A 5HWNA 1B1YA 4MWAB 3URNA 3A21A 4YTUA 4LX4A 1DE6A 1WDQA 3M07A 4EPEC 1UR4A 1U1JA 3L21A 2XFRA 4HPGA 1XBYA 1O5XA 4CQ8A 1XLCA 1FWCC 1YBQA 3QGKC 4TQTA 3NTYA 1VIWA 3WH6A 3VKJA 1J10A 2V5JA 2E6FA 3AUOA 3GHRA 2PC8A 2ZKMX 1CB2A 4FF7A 3PY2A 3GXDA 2Z0IA 3BSGA 3UP8A 4PCFA 3TAOA 1UPMB 3R4IA 1LWIA 3VZZA 4LS2A 3RF9A 4CD5A 4XO6A 3OBKA 1Z41A 4D9PA 2A3AA 1LRTA 4RNJA 1SUXA 3LNMA 4FXJA 4GHRA 4TOQA 3ITLA 3MU7A 1KRAC 3GKFA 2WVUA 2YB1A 2D1ZA 3IJQA 1OFPA 4UFJA 2HXUA 1H5VA 2Q6ZA 3SY5A 3GU1A 3WDPP 1VYPX 4AW7A 3LLFA 2VGFA 4RDYA 1GW9A 4C6BA 1Q2RA 1JUEA 3VC5A 4OQVA 2QV4A 4FF5A 1TA3A 3DFTA 3KAOA 5HQEA 3W1XA 4WIWA 2AOSA 3DHUA 4PSPA 3WLOA 4EANA 1SW0A 4GGBA 4FNUA 4GK8A 3RUBL 1LQ0A 4XVDA 3HGRA 4REQB 1RUSA 3NSXA 1OX6A 1K70A 3UYCA 1NDZA 4H83A 3UEQA 2NVAA 2CLPA 1I1WA 3CMJA 1OABA 3STFA 2V82A 1EL3A 2DZTA 1A5SA 4DJEC 4K1WA 2FDSA 2Q8ZA 3DI1A 4HHHA 1KTCA 1R9YA 3W1LA 3F4NA 1E51A 3DH7A 3GFZA 3LHZA 1ZLPA 3B3DA 1EJWC 2GK1A 1A0DA 4AYSA 1LWHA 2V3GA 3P5YA 2QCDA 2V3DA 5T8GA 4AZIA 4DNHA 1UJQA 1YMYA 3P5ZA 4RKAA 2TYSA 2J4GA 3GVQA 2DVTA 3CHVA 5M5DA 4DJDC 1O5RA 3P60A 2GVEA 1LLOA 3HFYA 5ABFB 2A85A 4E2DA 3B06A 4AEEA 7REQB 1XDMA 5LSMA 3SURA 2X09A 5JBFA 3PSWA 3CXOA 1YIXA 4C1KA 3GH5A 5TIMA 1DHKA 4PUKA 4NZ5A 4AF0B 5A8NA 4TO8A 4LV4A 4HU4A 5D02A 2YR1A 4WUIA 1ICPA 4NJJA 1Z3NA 3QN3A 4H41A 5DY2A 3N4AA 2NV2A 1G69A 3HMCA 1QW8A 3W29A 1YNQA 2VZSA 1V0NA 2EG8A 4D6HA 4M1RA 5DEZA 2ACQA 3GD6A 2AAAA 4UFIA 3SFWA 4DJDA 1UUQA 2WZTA 3R12A 1ZZMA 4X2RA 3SN1A 1OIFA 5HR7A 1XF0A 1JF6A 2VRQA 1P7TB 3LCWA 4JEQA 1U22A 1LOLA 1I2QA 3HGOA 4L56A 4KRUA 2RGMA 4R7JA 3CYVA 1TG7A 3WLNA 1H1NA 3TR9A 3KM8A 1IXNA 4O0ZA 1H51A 4JOMA 1XX1A 3W26A 3R2GA 3T6CA 2JE8A 4CNOA 4E8CA 1J12A 6ENLA 3V0SA 4HNTA 4BZYA 4DJFD 1PIIA 1MRQA 1VBGA 4GA8A 1S3HA 4WD0A 1AZ1A 1TIMA 3FAXA 1NEYA 3H7UA 3E0LA 4IFKB 3QPZA 2BGQA 5EGRA 3S2NA 4HNNA 1ELSA 3PJTA 1J6OA 4C6JA 2J7CA 4CQDA 1KB3A 4AFYA 4Q22A 2NLYA 3HN3A 1EDTA 2BHUA 4HMNA 1VFLA 4DXVA 2CBIA 1RSCA 3NPUA 3RAOA 1XBXA 3B04A 4OOZA 1OADA 5HOSA 2CZ5A 4HA0A 3HU7A 4P7LA 4YVPA 4WOQA 3WF3A 3P74A 1W8SA 5H6HA 3FK4A 1R9ZA 2PWFA 5LGXA 3K8KA 5LXXA 1W5MA 4EWND 2EHHA 1GVIA 1ZQ5A 3BLOA 3WQCA 2XH0A 1EXPA 1WX0A 1J79A 2VELA 2CBUA 4E5TA 4HSNA 4PA8A 3SFKA 3H2MA 1FKXA 3VE9A 3IGXA 3VNLA 2WHJA 3OPSA 4B3ZA 5CQ1A 3G1VA 5M03A 3IK4A 3WD0A 4ZMGA 5C9UA 4DWDA 1L2UA 3EX1A 3NNTA 4W87A 5CGTA 3FGCB 3NZRA 3EWZA 3TJLA 5I6SA 3S83A 3LHUA 1R3RA 4QG9A 1YKWA 3H2FA 5BU9A 1CGWA 2A3HA 2PD5A 3W7HA 3G3DA 4FB7A 4OECA 3U4AA 4W84A 2P76A 3CYJA 1GVRA 2ISDA 3NQDA 2XM2A 1TRDA 4HN4A 4O0QA 4HMCA 3PB0A 1SGJA 4EE9A 3GR7A 4DBEA 3AMDA 1KM0A 4HTYA 1WDPA 3QKEA 3MUZ1 1Z32X 1VYSX 4IIEA 5A6LA 3GNNA 3S5ZA 3JU2A 5G1TA 2BODX 2X30A 1A4LA 5E6ZA 2OKOA 4MJMA 2WCSA 1KFWA 5CGQA 4ZO8A 1KXQA 4XZ9A 1E0WA 1P43A 1KM3A 2GPTA 1TR1A 6XIMA 5HQMA 1D3CA 1VFOA 1ZAJA 3SGZA 4JDYA 2QJHA 3VUSA 4DB7A 3IJ8A 2XIQA 1IZCA 1Q2SA 4MOZA 2A1YA 2WJEA 2PDWA 4BKNA 4WJ8A 6PTDA 1R5YA 4S3KA 4XTIA 3BWWA 3DFNA 1TA3B 2Z2AA 2NQJA 4JKMA 3LXAA 1EBGA 1C9WA 1O95A 4HSOA 5HINA 4L4PA 5I09A 4YCOA 3S5NA 4NAFB 2BWGA 4HCHA 3CWHA 5CAHA 1AMYA 2XU2A 2ZYFA 2QJGA 1TMHA 3PTMA 1RCOB 2V2HA 3ZR5A 4K2SA 1GOKA 4HHLA 4MKSA 2BDQA 3DENA 3TSDA 2PF0A 1BVNP 3B0PA 4AD3A 4HK7A 1X96A 2C19A 3S1WA 4UQ9A 4H8VA 1ISVA 4QNWA 2BVWA 2VGBA 4QG8A 2NX9A 1EOMA 1NP0A 4QTGA 5CH9A 3CUZA 2GK1B 3GNRA 5A8OA 4KIEA 3H8AA 2QCDB 2BP1A 4A3QA 1B4KA 1ZHAA 3P93A 1W1B1 1G7VA 3RM9A 2DORA 4IIDA 3EPOA 4OWGA 4WK9A 5IXEA 3VMOA 3B4UA 5C5YA 2Y89A 2YL6A 1TV3A 4LB3A 4CEXC 3ZJ6A 4DM2A 1UUMA 1PPIA 3DZ1A 4Q4SA 2ONEA 3KZSA 3FVDA 5BYWA 3R8RA 1B9ZA 3WY1A 3UNTA 2GJLA 4KQNA 2GDQA 1J01A 2VX6A 2QS8A 3HPZA 4PULA 2RJHA 4BF9A 3ONCA 3WBEA 1BG9A 4IMFA 1C29A 1N2VA 5FJIA 2YXGA 3P82A 2Y7FA 3VCNA 4GRSA 5LIKX 1S5WA 1NDYA 3C2OA 5F4SA 1QNSA 2GQAA 1V93A 1G4TA 2B4GA 3HQOA 4YMZA 1KW1A 1GVFA 1HJUA 3W7IA 1BXBA 1ME7A 1UHVA 4TX6A 5FJTA 3IVTA 1UR1A 4FP1A 1V6UA 1TPB1 1P0NA 1DIOA 4GKLA 2DFAA 2ZUVA 2NQZA 1IGWA 3B9EA 3K4WA 2YW3A 3CHDA 3JVAA 5FA5A 4L4LA 1JG9A 1UIPA 3KVMA 2XVLA 1QAPA 3ZXWA 3SBFA 3IAQA 1UB3A 3S5YA 3UXIA 3MMUA 3ANVA 3FJ6A 4UTTC 1MSSA 3ARXA 3MBDA 2R9RA 3OOQA 3ARRA 1EXBA 1K9EA 2E4TA 3A12A 1WKDA 5C9RA 5EBAA 2B7PA 1HW6A 2PC4A 4XZHA 3LK6A 3W2LA 5I3GA 5EFDA 2WVTA 3WK0A 1JZ3A 4C1LA 3KLKA 1V51A 2O0TA 4PL2A 1OGSA 2CITA 3BXWA 2YOCA 3WQEA 1QPRA 2D2HA 1PE1A 3TLQA 2Q02A 3PANA 1A80A 2DT0A 4IISA 2WC3A 3VGDA 4B2DD 4OBRA 3UGVA 4H4IA 4NJGA 3WNKA 4C1NA 4EXBA 5E1QA 5DCEA 4W7WA 1GKQA 3ANUA 3AXKA 4IGHA 3UR7A 3LBOA 4UFMA 2WC4A 4IICA 2PGEA 3VD7A 3RN6A 4UTTA 1WQ5A 3NQBA 4C6EA 2VC9A 3A5VA 4RLIA 3KRUA 5D2WA 1TMLA 3GHSA 3G1XA 5I03A 3FYYA 1ONWA 2VRJA 3QM3A 3ZT5A 5ECUA 1E56A 2FHCA 3WFLA 2ZRZA 1ICSA 5FD0A 3N2XA 4NZ3A 3QXBA 4L6HA 1VFFA 1AD4A 1P48A 4EACA 4GNVA 3WX7A 3HGSA 2PWEA 3SCNA 3N14A 1VFSA 2VEIA 4ZO7A 3T0BA 4M6UA 4PUNA 1PHWA 2E9LA 3NQ6A 4HCLA 1TPEA 5BMXA 2XZ7A 4XQ6A 4C60A 4MJ2A 4YYCA 1KGUA 3S2JA 2QT3A 1TRIA 2X41A 4FLRA 4GYPC 2NVDA 5C70A 3GZ3A 3ITYA 1UD8A 2QVHA 3RFAA 2IUZA 3MP4A 1JGIA 3S1GA 2V67A 3B03A 3FW6A 2E9MA 1RJRA 3C2FA 4OFCA 4PTVA 4P7RA 3GE7A 2TAAA 3N29A 2W9MA 4ROQA 2QF8A 1XSJA 4KGJA 1MW0A 4Y9MA 3UQNA 1W3NA 3ZLFA 1WDRA 3DHDA 3AIEA 3L2LA 4IWWA 2A7RA 4UOQA 1E3XA 4CD4A 4JTLA 2JF7A 3U8GA 2OEMA 3LI0A 1H1YA 3H23A 5KMYA 1DTNA 2JKEA 3O7UA 4GBUA 2QEZA 3B9AA 2Z00A 2IMRA 3N11A 3KBSA 3TC7A 2AL2A 2XN2A 3V4BA 4TIMA 3IIPA 2DSVA 1J93A 4JZ5A 1KBIA 2BVYA 4IP4A 1EP1A 3GNDA 3BCJA 3PZGA 4ZSTA 1C8QA 4JTHA 3AHVA 1Q7QA 3LU2A 4AZ6A 1PVNA 2E40A 1XM3A 1UKSA 3LY0A 1ECQA 4PODA 4ZR8A 2IW0A 1HFBA 3W73A 4GPNA 1JPKA 3WNOA 1CGXA 2YDRA 3AO0A 4IT1A 3W0KA 3WQ5A 1XCWA 4XUGA 3N15A 1ZRQA 2W91A 4JFTA 3G1SA 3EYPA 2PBGA 3LD5A 1VRDA 5CLWA 3ZSSA 1BKHA 3GDLA 3WUFA 4JTRA 1A3XA 4J2MA 2ZIDA 1EUAA 3D5HA 5BXTA 3NQFA 3TROA 4IGMA 2Y7GA 4GJ1A 1QHPA 4ADUA 4LBRA 4KWOA 5D2TA 1I45A 2CHNA 4IUGA 4QP0A 1XLMA 4GQQA 3UJRA 1DQWA 5F1VA 5F7UA 4B5TA 4H8UA 4WQ6A 4WDWA 3NXFA 3UVAA 4U10A 5MKGA 1Q6EA 5GPRA 5K4XA 4DI8A 1TJ2A 1R3SA 2OQLA 3CZLA 4J3XA 2FTWA 1KLZA 5CPLA 2AKZA 1PCWA 1KBLA 2YA2A 3CUFA 5K7JA 3O2LA 2PTYA 1J2WA 3PS7A 1F05A 1AA1B 1OG6A 3OIHA 4M0XA 3H53A 2P10A 1E0UA 1R2RA 5G5IA 1XD1A 1AJ0A 2ZRYA 4H00A 3FSUA 4YL2A 3UYIA 1VYRA 1XYCA 4K8EA 2ZX8A 1I6NA 4XSMA 4UCGA 2FTYA 3QMRA 3IUHA 4RXGA 4FOUA 1W5PA 2IXUA 4OUIA 3DEQA 2X1SA 4INFA 3WLMA 2P3EA 4LNCA 4J3TA 5LKYA 3TTEA 1PB0A 4HMDA 1K8CA 3AIWA 5KINA 4ZENA 2J7BA 1E4LA 2FGLA 3UZYA 1ONRA 2OWXA 2P3ZA 4I8YA 1YEYA 3I3DA 4HK5A 3EZ4A 4AIEA 1TJRA 2FVLA 3IUDA 2WSQA 1DP0A 3EEGA 5HPOA 1ZB5A 1TJ0A 4L4OA 3P8IA 1KV5A 3WD3A 1UP2A 5D30A 4QS6A 2ABAA 2P88A 1TZ9A 4KCUA 4KEVA 4XD3A 1NY1A 1WA3A 4G7EB 2GVLA 3LMZA 3MZ2A 4LS0A 4JN7A 3QJAA 4IX0A 4MWAD 4UNIA 1JFHA 4S39A 1JXJA 4AY7A 2INFA 2PS2A 4FXFA 1LQ2A 5A3HA 4KWWA 1JZ2A 1QK0A 3PBWA 3AOFA 1HF6A 3THQA 5BXPA 1H50A 1F74A 1MEHA 4WX2A 3MUXA 3TW9A 3UJFA 4C1NB 4W8BA 2JIEA 2Y63A 5CZKA 1MXSA 4U33A 2A2IA 5JBDA 1AL8A 1Y8BA 4ZQPA 1I2OA 3O9NA 2OCZA 3WUGA 4TTUA 5D8WA 1Z9AA 2QLYA 4A8IA 3HG5A 4U3CA 3KHDA 2V5CA 3GTNA 1J0HA 4M8UA 3W1MA 4MADA 4DN1A 4GXWA 4A3RA 4U5KA 2J7EA 3THCA 3W6YA 2RKXA 1RHCA 1B3VA 1NQKA 1E1CB 2ACSA 5FSDC 4EXAA 4TTGA 2C1HA 3P8JA 4KRTA 1EO7A 3CQHA 1VPXA 3UA4A 3UG5A 1XIHA 4JTDA 1CLKA 3IK2A 2D22A 1PV8A 4JXCA 3LRLA 3RU8X 3NGJA 1BXCA 2NV9A 2BVTA 3N4FA 4GY7A 1C91A 4OBSA 3L5LA 3W24A 5AHIA 2FQIA 1HX0A 1VEOA 4G8TA 4DO4A 1DJHA 2GVYA 1QU4A 1UG6A 4HZ6A 1DL3A 2EO7A 2VVSA 2G3JA 3FIGA 1J11A 3SY8A 1ZUAX 3XISA 2NUXA 3W23A 1IYXA 4R34A 4QJ1A 4I6KA 2VVNA 1I60A 2Y5JA 1BYAA 3ZJ8A 1SFTA 2YA1A 1FWBC 3OA5A 4KCVA 2AQVA 3BQ6A 1L6GA 5DMLA 1OCNA 3GXIA 2Y8VA 2Z29A 3TN3A 1OY0A 2J24A 1VCGA 1WB0A 3BAJA 1D2KA 3NL2A 1XCFA 3MCOA 4NAEA 1YW1A 4NZ4A 3NR0A 3DKJA 2IPWA 3QR1A 2EF9A 2AL2B 4F0MA 2QUUA 4YVXA 3SCOA 3PWGA 5C7HA 1C7TA 4CQBA 5C71A 3UGRA 5DLCA 4XBKA 1W3JA 3VCCA 3VOGA 4IFOA 4IGSA 2O9OA 5DRIA 4MNKA 2VMFA 1UR8A 1A5OC 2POZA 4RPPA 4IJRA 4O1CA 2P1FA 2Z7GA 1XLFA 3UWWA 1HL2A 1EHNA 3UWYA 2R1PA 3RMEA 4MY9A 1Y5WA 4W89A 2WM0A 1Q45A 3R8GA 1VJIA 3W1NA 2ADAA 3MB9A 1R3YA 1FDYA 1Q63A 1QW7A 3KBWA 3CB3A 2Y70A 2QDGA 1Q85A 4F40A 1A5KC 1TB3A 2VD8A 3VKKA 2J7GA 1QOQA 1XLHA 1AD1A 3HPAA 1J4EA 3GVWA 1WZMA 2VT0A 4GABA 2Y7EA 2YL9A 3STEA 1P0BA 3E3HA 1TPDA 3AHYA 3CM4A 5HNRA 3KBMA 1OJXA 3SUWA 4O8AA 2HK1A 3O05A 1V6TA 1P1MA 1EKOA 1RK6A 1XLKA 1HXJA 4HZMA 4JTGA 2JKPA 4B5NA 3I65A 2HNHA 1JEZA 1RJQA 3U48A 1UW9A 4N6EA 4H2CA 4W8LA 4CCDA 3W7MA 1ITUA 4ZSUA 3WLLA 1S5VA 1TJPA 2VUYA 3H7VA 3LPPA 4AD5A 5A94A 3T0TA 2EJAA 2VQTA 5IM51 5HNUA 4W9TA 5MHBA 2XINA 2CESA 1TJ1A 3BAKA 3TYBA 1TPH1 4CD6A 3UCDA 1V6WA 2FJKA 1US2A 5AYXA 3MA8A 2OFJA 4R88A 3WNPA 3N25A 4R33A 2X40A 2PMQA 3ICJA 1OX4A 2DIJA 4N9EA 3UZWA 4W88A 2Y24A 3M43A 5CBIA 1E0XA 5I06A 1F9CA 3S8HA 4Y96A 1UMYA 1AH3A 1ZJIA 4AVNA 2WB5A 2UY2A 4FLSA 1XYLA 1TMQA 4UMAA 4V33A 4GUHA 4UR8A 1NARA 2BV9A 2FPVA 1WPCA 1RBOB 2YX0A 1GYLA 2PDBA 1EO5A 3G77A 4DEFA 2EPKX 4XUYA 3IWPA 3M46A 1XYAA 3K5XA 5LIXX 5F2IA 1JPMA 2RHGA 3DFSA 1QPOA 1AZ2A 3TLLA 1F73A 1V3HA 4NZ1A 3L2IA 2JKAA 1R0MA 1EF2A 3VPLA 2BNJA 3ZMRA 3ZJ7A 4CCCA 4ILSA 3O8AA 3FEQA 3WBXA 3ZIZA 3KL5A 3ZT7A 4RW3A 3PBMA 2NUWA 5FKYA 3W81A 2A3EA 3B8SA 3QC0A 1GW1A 3GHTA 1F7BA 3REQA 5A6SA 3W1QA 3V16A 1JD9A 1E4IA 3G1DA 5DF0A 1LBLA 4H04A 3NUKA 3CUJA 1C3FA 3L67A 1EEXA 4W5ZA 1IQ8A 4NG3A 1HJQA 4GISA 1CX9A 2WMHA 1DJWA 4L1WA 4O17A 3CPUA 5DMMA 1ISXA 4KEUA 1D3HA 2PDYA 3GSMA 3PUGA 3I6RA 4XKMA 4QJ3B 2ZRVA 3M0MA 2ZXBA 3QYQA 5ECVA 1UKPA 3QZAA 4UTFA 5A6BA 1BTMA 4NZFA 1DPMA 5FJUA 3T09A 2C91A 5U7SA 2GJRA 4LCSA 2CW6A 1F6KA 3UD6A 4JTCA 1YHTA 3CHEA 2OODA 6CGTA 5LNSA 4TVUA 1YDNA 1XPGA 1TVPA 3H2AA 4PBGA 1E6QM 1EFZA 2AQOA 4HNVA 1UWIA 4A8RA 1LL4A 3VCRA 3GNPA 3CQKA 2VURA 4GIEA 3SCVA 4Q4PA 3AXHA 5D37A 1NU5A 4DWSC 1FTXA 2O92A 1JQVA 3MO7A 3CL6A 3VYLA 2Y88A 3AI0A 2VR5A 4LYQA 3CLMA 3SJNA 3IIZA 3U2CA 1H11A 4GLEA 2GVGA 3LGDA 4K37A 1PDZA 4DNMA 3G5EA 2BGSA 4JCMA 3NQ7A 1NDVA 2KAUC 1E9ZB 4Q6JA 1B90A 1LG1A 2V69A 3NPXA 3WBAA 1YYAA 1EX5A 4UTHA 4LCRA 3VTRA 3LTPA 3AZRA 3VIOA 2CLEA 1HJWA 1FWIC 4DX3A 4H6EA 3C86A 3N2MA 4DWSA 3NZ1A 1DBTA 3PB2A 3NQMA 1HKJA 3DU0A 3Q2DA 4D1JA 1RQEA 4CLMA 3B05A 1GOMA 1G4PA 3DYPA 4WKFA 4LS1A 3R6IA 2JQXA 3E0WA 4A21A 3MV11 2E28A 2F2KA 4UB9A 3HJEA 6ALDA 3BZJA 2JEPA 2ZXQA 2VM8A 1UZ4A 3A3HA 4S3DA 3BG3A 3TN4A 3VNDA 5FAGA 3FDGA 2AMXA 2DY3A 3AQUA 4GQRA 1O5QA 1XIDA 4C6PA 4H9ZA