4M5PA

Oye2.6 y78w, i113c
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
404
structure length
404
Chain Sequence
SSVKISPLKDSEAFQSIKVGNNTLQTKIVYPPTTRFRALEDHTPSDLQLQYYGDRSTFPGTLLITEATFVSPQASGWEGAAPGIWTDKHAKAWKVITDKVHANGSFVSTQLCFLGRVADPAVMKTRGLNPVSASATYESDAAKEAAEAVGNPVRALTTQEVKDLVYEAYTNAAQKAMDAGFDYIELHAAHGYLLDQFLQPCTNQRTDEYGGSIENRARLILELIDHLSTIVGADKIGIRISPWATFQNMKAHKDTVHPLTTFSYLVHELQQRADKGQGIAYISVVEPRVSGNVDVSEEDQAGDNEFVSKIWKGVILKAGNYSYDAPEFKTLKEDIADKRTLVGFSRYFTSNPNLVWKLRDGIDLVPYDRNTFYSDNNYGYNTFSMDSEEVDKELEIKRVPSAIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADPH dehydrogenase
publication title Residues Controlling Facial Selectivity in an Alkene Reductase and Semirational Alterations to Create Stereocomplementary Variants.
pubmed doi rcsb
source organism Scheffersomyces stipitis
molecule tags Oxidoreductase
total genus 157
structure length 404
sequence length 404
ec nomenclature
pdb deposition date 2013-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4m5pA00
1YYAA 3FLUA 1AG1O 1YPFA 2RDTA 2WQPA 3I65A 1DVJA 5C54A 3NQ6A 1OJXA 3C0JA 2GQ8A 4PODA 4IMCA 3UWQA 3OHIA 3C2RA 5BNKA 3U6WA 2GVJA 4H6KA 4JGDA 4WQ6A 4U28A 2R91A 1FCBA 2A1YA 3CQ0A 1OABA 3NO5A 2QAFA 1M5WA 3W1LA 5AYXA 3L65A 3P61A 5AHFA 5DN1A 3W2JA 4IUOA 3W2UA 1JR1A 3BO9A 3MJYA 4BWLC 3GR8A 3OEXA 1FXQA 3ATYA 1GYNA 1S5WA 1OK4A 2A0NA 3S42A 4UTTC 3Q58A 4E0CA 3EWUA 1A50A 4JR5A 5LGXA 3GNNA 1YXCA 1SR9A 2ZQ0A 1S3HA 3MP5A 4R33A 5IBXC 3U8GA 3UXDA 4NX5A 1UUMA 3KRZA 4Y9AA 4M6PA 2DZPA 2TSYA 2B7OA 3NGJA 4UFHA 2IQTA 1ICPA 2ZZ4A 5BOOA 2C16A 3M16A 5E0KA 3VKJA 5DXYA 1RD5A 5C55A 3L9CA 5F4WA 3PBVA 4MOZA 1FWRA 2QCLA 3HQ1A 1C29A 4Q32A 3TMQA 4YCPA 2CLOA 3G8EA 3O05A 4Z1BA 1N7KA 1L9WA 1GVFA 4NJGA 3E0IA 3IVUA 4CCEA 4LWWA 3TDFA 3W1TA 1WV2A 4UFKA 4IWWA 4NZJA 1YDVA 1IXNA 3QFEA 5DLCA 2H8ZA 3EX4A 2G5WA 1WXJA 4JDBA 4NXKA 3FA5A 3HG5A 5CG7A 3W7LA 4TX9A 5CSSA 1KTBA 4K7VA 3S5YA 1I45A 1ZENA 1VLIA 2YGYA 3STGA 3DAQA 1SO3A 3M41A 2ZYFA 4TIMA 3CWNA 3TC7A 4NNCA 3BLIA 4I9AA 4ORMA 4O11A 2ISVA 3G18A 4O18A 3LLFA 1WX0A 2JKEA 5DBTA 3P62A 2A6LA 2DP3A 3BGJA 5L9FA 3DI0A 1AMKA 3LV6A 5LNUA 3LCWA 3G1HA 3IRDA 4IMGA 2HTMA 3MP4A 3L0KA 4Z08A 3ATZA 5D03A 2QCFA 3IGUA 3NEVA 1EWEA 8TIMA 3WJXA 1D3GA 1YPIA 1OFQA 4DO5A 4RCXA 2B7QA 4JY8A 4O54A 4PL1A 4GWEA 4A21A 2WSYA 1VRDA 4QIUA 1VLWA 4O1AA 2VFHA 1TV7A 1PCWA 4TMBA 1DQWA 3W7HA 1KBJA 1QPRA 5K4XA 1PL9A 1WDWA 3W7GA 1FUYA 2X16A 5G2WA 1OFEA 2J9XA 4UMBA 2E5CA 4YWIA 3O07A 2FLIA 1L6SA 1THFD 4MFEA 2J9YA 3QH2A 3MMTA 2Y6ZA 1PE1A 4LNYA 4DF1A 4O1BA 5KINA 4HN4A 2GQAA 3W86A 3UQNA 1FDYA 2AGKA 1F6PA 2CLEA 1YDNA 4O28A 4O12A 1GYLA 1V7YA 3MBFA 3W7CA 2NXIA 4CNOA 3MI6A 2ZFAA 3GK0A 4EWND 3DU0A 1WOAA 2WNNA 4Z0JA 4KWWA 2DZWA 4O0KA 3KVMA 1EA0A 2ZRUA 4G1KA 2WSQA 3H54A 2VKZG 3G1YA 4LS0A 4BWLA 1XDLA 1KM2A 3N73A 1QOQA 3UWUA 2ZRWA 3NQCA 3D0CA 2X1RA 4UTTA 3QF0A 5EY5A 1VS1A 5GVJA 4JNMA 1TQXA 3P5ZA 4RZ6A 2WKJA 2V2HA 3MW7A 4DXVA 4R34A 3M7WA 5LSMA 3TQVA 5IBXA 2Q3OA 5K4ZA 4QJ1A 3P84A 2PURA 4X3ZA 1FWSA 5I3IA 3EWWA 4LVGA 4AF0B 1WBJA 3PUDA 3QPYA 5LHFA 3NQ8A 1K7FA 3S5ZA 3TJLA 4MYAA 4O15A 4HHPA 2FFCA 3TAOA 2VOMA 3ZFHA 1T96A 3BW3A 5FESA 3FIGA 1ZFJA 1O60A 1PCKA 5AHNA 1TB3A 1SQ7A 1EUAA 1W5MA 1ME7A 5CSRA 5K2ZA 3AJXA 1XFBA 2DU2A 4FNRA 4WY0B 1W56A 3CTLA 3OVQA 4MUZA 4PEKA 1WBHA 4A2RA 3QQ1A 2J6XA 4RXGA 3LGEA 2PC4A 3FJ6A 3NVTA 2VENA 4DF0A 4UNLA 4MY8A 1PV8A 4A2SA 1MEWA 4OGZA 4E2DA 1YDOA 3NXFA 4ADTA 2VFGA 4D2JA 2V5BA 2QDGA 3M44A 4AVFA 3W87A 1C8VA 4O1CA 5K9DA 3HGJA 3SR7A 1N55A 2PCQA 2DJLA 2ZDRA 1FWWA 1PHQA 5D33A 1W3NA 3LBMA 4PL2A 4DO6A 3IIVA 3E49A 3S1UA 1OX6A 1VHNA 3STCA 4BF9A 1FBAA 2WOQA 1V5XA 3B03A 2RHGA 1B4KA 3SGUA 3QPZA 2QJHA 4ZQOA 4O16A 1ZALA 3W85A 4LW7A 3GDTA 3TV8A 1TTPA 3G24A 3QC3A 5LNRA 1B3OA 1TPB1 1KFBA 4GUJA 1KV5A 1KM3A 4LVAA 3TIMA 3CWOX 2HSAA 1EP3A 3O1NA 5HQEA 3LXCA 1Z48A 2Y7GA 4HNUA 2CWNA 3IVTA 3PSVA 2WNZA 4HNVA 4LT9A 3S1XA 1F5ZA 1XKYA 1TPWA 4AHQA 2E09A 3W6YA 5LNSA 2ZRYA 3FFSA 3S6DA 3T4CA 3VI2A 2ZA2A 4RJEA 2D73A 3NQ2A 5F2GA 3VNDA 2YCEA 3PG8A 4PA8A 3LRMA 5I3GA 1M7OA 4EF8A 4NQ1A 3OBKA 1G69A 1LROA 4JTEA 4O57A 1EB3A 1O4UA 3PR2A 3JR2A 3NL5A 2WSRA 5DELA 4JTUA 3TW6A 4J9JA 3RMJA 1MEHA 5HUOA 2ZA3A 1K02A 2EKCA 3JS3A 3PAJA 4HNNA 3SIZA 3GDRA 3WJZA 4CQ8A 3WJYA 1SFLA 3UWVA 1F05A 3DXIA 2QCCA 4UFMA 1ZAHA 1OFRA 4JX4A 3GVGA 3W9ZA 1K7EA 3CHVA 4EVZA 2NV1A 3BV4A 1XXXA 2TYSA 1TPC1 5CKSA 2NWSA 1QFEA 1W8SA 3KVLA 3T44A 4YXGA 3W2KA 5FEXA 2O7QA 4BR1A 4O52A 5F1UA 3W7QA 5FF3A 1DORA 3KAOA 1TTJA 1QAPA 5U7SA 5FI8A 4JIQA 3TC6A 2Y63A 4UTKA 4K38A 1MO0A 3W1AA 1G7VA 2W0UA 3HGOA 4M7TA 4WD0A 5DXXA 4JICA 1JCMP 1QO5A 3SSJA 2E68A 2QR6A 4FNTA 4ZQRA 4ONVA 4ZQNA 4FIQA 1DL3A 1DKWA 3BLEA 4M5PA 3FS2A 4ADSA 1JVNA 1X6UA 1BTMA 3GR7A 4JXCA 3L21A 1OF6A 5G5IA 3TNOA 2A6NA 1A5BA 2AQWA 2VELA 3C2EA 2ZRXA 3W7EA 1XUUA 3LLDA 2CLHA 1VYSX 3G0SA 3KXQA 4O10A 2CFFA 4JEQA 4MFDA 3VFLA 4O4WA 4N4PA 3QQ0A 2JGQA 3L68A 3LDVA 4NNBA 4W9TA 2NLIA 4IPIA 3W1RA 3GIYA 3EKLA 1L2UA 3IIOA 2R14A 4WXZA 3O6YX 5KSWA 4JX5A 5D30A 3BPWA 1I2QA 3W70A 2E77A 4L4MA 5F4SA 1LRTA 3UWWA 4UTWC 4UTMA 4IOTA 1DHPA 2A7PA 4P61A 4NT0A 1UJPA 1IGSA 2A7NA 1DJQA 3TSDA 2EPHA 3WK3A 3VE9A 3HB9A 4O19A 1ML1A 2FPVA 4UTHA 3G8RA 5I3KA 4ZQCA 3S0CA 1GTEA 1GWJA 2E6FA 2A85A 3A23A 1QOPA 4HSOA 1J2WA 5AHEA 1W3IA 2C0AA 5BW6A 4RZ4A 1HTIA 3PULA 2G96A 2H90A 2ISWA 4DPQA 5AC6A 3P60A 3VE7A 1EWDA 3A21A 1ME9A 3C4UA 4GNJA 2OX1A 3DKLA 3QSRA 3IGXA 3L0GA 2BTMA 4FNPA 5J5DA 1KM1A 3TFXA 4GBUA 1LRQA 3NAVA 2ABAA 1XL9A 3O6CA 1F2JA 1X8FA 4XBKA 4JX6A 5KITA 4HT3A 3CU2A 1B57A 3W1PA 5AOUA 3W7MA 3TJXA 2QCHA 1GOXA 3N19B 3FEMA 2CLFA 4IMDA 3PUOA 1FDJA 1SO5A 3DHFA 4OU1A 4Z1CA 2B7PA 1A53A 2W6RA 2GPTA 1NF7A 3CB8A 1LDCA 1TPFA 4CQ9A 2ZBTA 3G0UA 3B4UA 1QPQA 1MZHA 3IVSA 3B06A 2GOUA 4LC8A 4OV9A 3NPXA 3LHVA 3PBWA 5BRBA 4X9SA 2Y70A 4AB4A 3T7VA 5ABTA 4IMEA 3B8DA 5D09A 3HPZA 1JUKA 2DZVA 3W84A 2C18A 4AH7A 4X22A 3BW4A 1GPWA 3A5FA 4Y90A 4RKAA 4WXYA 1JRCA 2C6QA 5AFDA 4RXFA 3TU9A 1LOLA 5CPLA 4UTJA 4DPPA 1LM1A 4QM1A 1FWNA 1I4NA 1ICQA 4E2BA 2C3ZA 1AW1A 3NZRA 4FX6M 1Z42A 1X1OA 3U2OA 3R12A 3F1QA 4QITA 4UFLA 1OFAA 4LUIA 4U4MA 2G95A 3NQMA 1P5BA 1RVGA 3PG9A 3TXVA 1I2RA 3S1VA 5HWNA 4LY8A 3LCLA 3UYCA 5BMXA 4JYFA 3E12A 4N9BA 3THQA 1ZHAA 4WZHA 3NPVA 3NPWA 1YTKA 4FIRA 1R46A 1CW2A 3THAA 1WQ5A 2C14A 5D2XA 1VZWA 1RQBA 3NQFA 3W76A 2QUTA 2YW4A 4ZL1A 3EXTA 4LS1A 1KFKA 1FCVA 3H53A 1MEIA 3PS7A 2YZRA 2DZUA 1ZAJA 4O53A 2JK2A 1ADOA 2YFOA 2X30A 5K7JA 3EEGA 3RFAA 4A22A 1SSGA 2YYUA 4OE7A 2QCNA 4ZQPA 5T26A 1NEYA 5D38A 3CPRA 4TO8A 4UTWA 5DCEA 2Q8LA 3M1ZA 1HFBA 4JTHA 3O06A 2P0OA 3Q2DA 1GEQA 1K8YA 5AHMA 5HWJA 3LHWA 5LZLA 2WV8A 4MIMA 2JKPA 5EYWA 2Y89A 3BGGA 4LRTA 3TMLA 1M7PA 4MY1A 3USBA 2A5HA 3C52A 3MHGA 1Z41A 5LNVA 1S5VA 2V82A 3DZ1A 1YADA 1DBTA 5EA9A 2V2DA 3P7YA 5D04C 3QM3A 3W1NA 1ONRA 5LGZA 1OYAA 2J9ZA 2OMAA 3EKZA 2NV2A 1IXPA 3BARA 3SZ8A 1O94A 4JS3A 1LZOA 5G4EA 2ZRVA 2QJGA 3W7KA 3BLFA 3M0ZA 5BMWA 5HWMA 2DZXA 4JYDA 1H1YA 4UMCA 1YXDA 1M6JA 3P8IA 2E6YA 4R7JA 5I3JA 3LCXA 1JUBA 5FEWA 2CLIA 2VEMA 3NL2A 1XM3A 6TIMA 4IMFA 1Q6QA 3LTYA 3MHUA 1QMLA 3L5MA 3SJ3A 2ZZ1A 4N6FA 3RLVA 4QISA 5AB3A 4B5NA 3DFSA 5TBOA 3UY8A 4I7UA 2H6RA 1J5TA 2NUYA 3H55A 3OVPA 1EEPA 1HG3A 3HPSA 2VFFA 1K8ZA 3UWZA 4O14A 2CZEA 1FY6A 3HPXA 1H63A 1GG0A 4XWUA 1KTCA 4JTJA 3UD6A 1KLYA 1HO4A 1KFJA 4OT7A 2H3DA 2HMCA 1Q3NA 4ICNA 4ML9A 3TH6A 4ALDA 1H51A 5E93A 1ZY9A 2NZLA 1TMHA 3V1PA 3M47A 4XTIA 3ZS4A 1VHCA 4POCA 3NQVA 3F4WA 3CM4A 4O17A 3TSMA 5HNRA 1SUXA 3N9SA 1FXPA 3N2MA 4Z1DA 4K37A 4NX0A 3GKAA 4KFOA 5G1TA 3SY5A 5AC8A 3I7QA 3CIWA 4WX2A 5A8GA 1VCVA 3HG2A 1H61A 3HG3A 2Y7EA 3DHDA 1WYIA 1VQTA 1BEUA 2BXVA 4N4QA 4DO4A 2OCZA 1TTIA 3C6CA 2VEIA 4FF7A 3W7JA 1OFDA 4NJKA 1VC4A 3QMRA 4OHQA 4AF0A 5G2IA 3G22A 5D05A 4NVTA 5G1YA 3NNTA 1VYPX 4LV9A 4N9CA 3P80A 2KZHA 3GXPA 3DBPA 1UBSA 4FX8A 2UV8G 1KA9F 3PY2A 5DY3A 4WOQA 4UCGA 2FPYA 4XQ6A 3QEZA 1EP1A 2QF7A 4BI6A 1Z44A 3DFPA 3UNDA 1WA3A 3LHUA 1FDZA 2EHHA 3MI3A 1SPQA 4KWVA 1EUNA 5SWUA 4OBTA 4HKPA 5D2TA 4XKYB 2ZTKA 4PC8A 1LOSA 4WY0A 1PIIA 4JTFA 1UASA 4DEFA 2FTPA 5CPNA 3DH7A 1R30A 4CNNA 3P81A 3R89A 3PSWA 3QSTA 3LRLA 3IIXA 1RQHA 3Q94A 2HS8A 3PWAA 3HBLA 5A5WA 2WNQA 3C3NA 3T55A 3EX1A 2P1FA 3LRKA 2FB3A 1CI1A 2I14A 2E6DA 1DOSA 3I7SA 4CCDA 1KM5A 1I2PA 2O7SA 3W1XA 1W5QA 2E1DA 4YLWA 4MJMA 3G1SA 1K8XA 4WY0F 1TYGA 5D2WA 3L67A 3C2FA 3OG3A 1P4CA 3QZEA 3TUUA 4GC4A 4S2CA 2NX9A 3EX2A 3QYQA 1H7XA 1O5XA 3S5NA 4XKYA 3HMJG 4LS2A 3W07A 2B4GA 1X1ZA 3Q37A 3A5VA 4GRSA 4XBSA 4JDYA 1SW0A 2QKFA 2OZ0A 2ZZ5A 3L2IA 2QCGA 3DKJA 3M5YA 3TKFA 2E5DA 1H7OA 4LU0A 4DELA 3TA6A 2OJPA 1TPEA 4GE8A 3G1FA 5IM51 5CZJA 1QCWA 3G1AA 1GVSA 3G3DA 4RLIA 1PS9A 1TCDA 3W71A 3I6RA 5CZ0A 4YL2A 3FJLA 3TR2A 2C1HA 2QDHA 1T0OA 2NWRA 2DZTA 1T99A 1XBYA 3GX9A 4MJZA 1YTEA 4BFAA 3HOJA 4ZMGA 2NXGA 1LCOA 4MY9A 3BG5A 3LCHA 4LVDA 3I7RA 1SZGA 5FF4A 4XUGA 4GFSA 2QCDB 2ZA1A 1AL7A 4KKXA 2JGYA 1H1ZA 2ZCGA 4ZQMA 1KW1A 3GDKA 3LXAA 5G4WA 5K9CA 4Q4KA 3S9YA 1KFLA 5K9XA 5D02A 5E1QA 2Y85A 1B4EA 1SZEA 3HO8A 3GXNA 2YPIA 3P8JA 5C6MA 3RF9A 1HO1A 2CLMA 2NX3A 2Z6IA 3QW3A 1XUZA 4GXMA 1SO4A 2BLEA 3PB0A 1LRNA 1SFJA 4LOCA 1OYCA 4QNEA 3LOTA 3INPA 1IF2A 1K7XA 3NPUA 1G4PA 5F2MA 4Y8FA 4NU7A 2GVLA 1AK5A 3P82A 1ZJIA 1VPXA 3SI9A 1IXOA 1JQVA 4FHAA 1XBXA 2FJKA 4JYEA 1LTDA 4JTTA 4JY9A 2VEPA 1PVNA 3LXBA 4AXKA 1KTNA 4PCFA 1SU5A 1G4SA 3P5YA 1LLZA 4TR9A 3W75A 1E51A 1G67A 4N9DA 3ELFA 2PRLA 1I2NA 5AN7A 3W7PA 3GAYA 1I8JA 4KFNA 4LVFA 4MPQA 5K3VA 3B0UX 2GVGA 4GUGA 2QCEA 4ORIA 2HS6A 4FX7A 3LBCA 2Y61A 3WFAA 3A9IA 3L66A 3L5LA 3MBDA 3IV3A 5CPOA 4MVAA 2FQIA 4LVBA 5AHIA 3GYEA 1WAUA 3C2OA 1LLWA 3TQKA 2VFDA 2NUWA 3W3OA 3W2MA 5CPMA 1TO3A 3EXSA 3NOEA 1BWLA 4PFMA 4GJ1A 3W7RA 3LHTA 1U5JA 3TE9A 4N02A 4LC6A 2Y62A 1BWKA 2EGZA 5FEPA 3C2VA 3WJWA 1LORA 5HULA 2Q3RA 3SFKA 4NXSA 1TPH1 3T78A 1IXQA 4PH6A 3NQEA 2YYTA 2G97A 1OG0A 4K8EA 3TQ0A 2ATMA 3NQDA 2X1TA 2X1SA 1G4TA 3M5ZA 3W2NA 3P74A 3C8FA 1O95A 1QWGA 3W72A 3GXTA 4UNKA 3OIXA 3NDOA 3OA3A 3NM1A 4TU1A 4UTUA 4Y6GA 1G6CA 5C2XA 2W79A 1C9DA 3R13A 4BK9A 4ZVJA 3QRHA 2VFIA 3N14A 4FNSA 2DZSA 3A22A 2CZ5A 1GZGA 3GZ3A 4IXHA 3GLCA 4CNPA 3E02A 3EWYA 2CLKA 3MHFA 4K6AA 1Q6OA 2R8WA 4CLMA 5HR6A 3PF3A 4DQWA 3FKRA 5KZDA 1ALDA 3I68A 4MLRA 5FF0A 2Z0IA 1K03A 3DFTA 2YW3A 3MI2A 4Y96A 4MZ1A 1OHLA 3EWBX 4M6QA 4N2YA 2Y88A 1FWTA 1W31A 3O8AA 1LYXA 5HMSA 2YDAA 1D9EA 2RDUA 4GUFA 3M43A 3LTPA 1EPXA 1R2RA 3NG3A 2RDWA 4FEZA 1KFEA 4M7SA 1AW2A 1Q6LA 1RV8A 5EL1A 5F1VA 4S1FA 5HR7A 4NJHA 3GAKA 1F76A 1ME8A 2C15A 3G0XA 3LHZA 1T8XA 4UFIA 2C13A 2YFNA 4N9EA 3IIPA 1BKSA 2LLEA 3KRSA 4AWTA 4AWSA 4R53A 4NNAA 4AHOA 1QDSA 1FCUA 4IX0A 3BW2A 3WK2A 2TPSA 4WOZA 3CEUA 2TRSA 5KTLA 3W7IA 3T40A 2E5BA 4FNQA 1R47A 4YMZA 2BWGA 2CU0A 3ABQA 4LTSA 2RFGA 4FXRA 1MSSA 3L0NA 1W5OA 1JUEA 4HPJA 3ABOA 1W0MA 1H7NA 2WPBA 2VC6A 2PE4A 4Z0SA 3TROA 4UTIA 3STFA 1YTDA 2XN1A 3B0VC 2QUVA 1OX4B 5D32A 3ZR4A 1GVOA 1JQXA 3RNDA 3DFOA 3TAKA 4GUIA 3NQ7A 4QSHA 4MZ8A 1RR2A 5FF2A 5D2YA 4UR7A 1QPNA 5TQLA 3W2LA 1XCFA 3KFTA 4JIPA 3W7NA 1GT8A 3KOFA 3HIJA 1LP6A 5EKYA 4KFPA 1QR7A 3CLMA 3LM7A 3KRUA 1SO6A 4FXSA 4AEOA 3O6DA 1PHWA 1QPOA 2GUUA 3M5VA 1OX4A 3DGRA 3MYOA 4C1LA 4LV4A 4QQ3A 4N6EA 2QAPA 4FB7A 3N34A 3LTSA 4UFJA 1EX5A 4UTLA 1IIHA 3BG3A 3DFNA 4UXDA 2F7FA 3PC0A 1H7RA 4JTIA 2Y7FA 1SW7A 3MP3A 2FIQA 3BK0A 4DBDA 2J27A 3NZ1A 5L6UA 1D3HA 3FOKA 2WJZA 3HGRA 5I3HA 5CZSA 4EIVA 1H7WA 4ZZ9A 1DJNA 3B05A 4FNUA 4P2VA 2H3BA 2Z6JA 4IPJA 4I7VA 4Q33A 3LCIA 4A29A 3QW4B 5F2LA 1RPXA 2A21A 2YR1A 4E38A 3W88A 1FCQA 4NJJA 3EWXA 1RQEA 2ZZ2A 4RK8A 1P0KA 1N8FA 3SGZA 2CW6A 5AHLA 1NSJA 3CT7A 3KVKA 3PM6A 1HL2A 5KZMA 3LCGA 2QEZA 3TK7A 3TW7A 3N2XA 3G3MA 3GB6A 1OYBA 4JD4A 3EX6A 3AO0A 4JTLA 1P0NA 1MXSA 3HJZA 2P10A 3E9AA 4WJEA 4K8HA 2R94A 4HSNA 3ABSA 1L6WA 4HPXA 3S8HA 3KHJA 5CGQA 1SSDA 5HUPA 1NVMA 2C19A 4UUIA 4X2RA 3LERA 5G2HA 1KFCA 2YX0A 4IJBA 5LKYA 3O15A 1XC4A 1XBVA 4O4VA 3W1MA 2X1UA 2GJNA 1U83A 1OX5A 3N9RA 1OVDA 1GQNA 4UMAA 1R2SA 2Q8ZA 2QCMA 4BI7A 1O5KA 3GDLA 2RKXA 3SECA 3P67A 3GKFA 1JCNA 1TQJA 3W22A 1OFPA 3ZWTA 3F4NA 2EAWA 3MYPA 2Z2UA 3E96A 3LI0A 2CLLA 2I9EA 1TJRA 4YCOA 4O8RA 1VCFA 1YLVA 2OT1A 4OV4A 5EMUA 2ZRZA 1GVRA 4K7YA 4DF2A 2OT0A 1TSIA 4MYXA 3QMTA 1H50A 3KVJA 4S2BA 7TIMA 4OQVA 2ZZ7A 5HINA 2YSWA 1L6YA 2V30A 1VGAA 4IGHA 5D2VA 3RK8A 1OF8A 3UZ5A 2CZFA 2GJLA 4LUJA 1YXYA 5MHBA 2V2CA 1F7BA 3IIZA 3FYOA 1KV8A 3EX3A 3G1XA 1NFBA 4IX2A 2J24A 3NL6A 2PRMA 3CC1A 1H60A 4GUHA 3VCRA 3C61A 5FEZA 3UPWA 2X2GA 1VCGA 4TMCA 2ZZ6A 3ZWSA 1QNVA 2GQ9A 5H2ZA 5FF7A 2VEKA 3R2GA 1Q45A 1OFOA 3W74A 1X7FA 2A2IA 4AAJA 5U4NA 1ICSA 3B0PA 4PTNA 1JCYA 3W83A 5C5YA 3O63A 1SZNA 4I7WA 1HUVA 2ATSA 5EPDA 2RH9A 3CEPA 5TIMA 2F84A 3TCEA 5DBUA 1NF0A 3R8RA 4C1KA 1TRIA 4O0ZA 5LHEA 2A4AA 2EF9A 2QJIA 4CQAA 1KBIA 1LOQA 1R2TA 4IXXA 3WK1A 2J88A 1AW5A 4K39A 2ZTJA 1VR6A 3YPIA 1TPVA 3IGSA 3WK0A 1DQXA 4IQLA 1G7UA 2ISSA 3ABRA 3PBUA 5AYYA 4H3DA 2I1OA 2BZNA 2WO5A 4MLJA 4MKNA 4NUWA 2Y7DA 3A24A 1UB3A 2NX1A 5KZEA 3S1WA 2XFWA 1K3UA 3WJSA 5KMYA 3LB0A 3NM3A 3DENA 4O13A 4FO4A 4RV8A 2DORA 4UIOA 2DJXA 3N3MA 2Z1BA 3F03K 3TSBA 3HG4A 4UC5A 3W1UA 3L5AA 2ALDA 3CIXA 1A5AA 1OK6A 2FPTA 4O50A 5F4XA 4WUIA 3ANYA 2BX7A 3MO7A 5AC7A 4Z1AA 3UPBA 1XDMA 2E6AA 5AYZA 3W7OA 2QUUA 3GNDA 1H62A 3V75A 4QNWA 4CCCA 1AL8A 1GTHA 3NQAA 3M5XA 4QAIA 1A5SA 1W54A 4XTDA 1TREA 3W73A 1QO2A 1TV5A 2ABBA 1A5CA 3NQGA 1JCXA 5D37A 1S5TA 2A7RA 3JRKA 1W3TA 1FQ0A 1JCJA 2XN2A 3UXAA 3FYPA 3TXZA 4LRSA 1LBLA 4JN6A 3STEA 5J5RA 2H8XA 1VJIA 3NR0A 4ADUA 3BG9A 2JBMA 3B04A 2V9DA 1LBMA 5EBUA 1H7PA 2BSLA 4A3UA 1W37A 2XN0A 3PVFA 1H5YA 1CX9A 4AHPA 3W7DA 1P1XA 4OWGA 2FB2A 2QCDA 2NUXA 2TMDA 6ALDA 1KM4A 1DV7A 3IEBA 1GG1A 1GJPA 3LX9A 1IIGA 1ZAIA 1F6KA 4JTKA 5LNWA 3QJAA 4UR8A 1TRDA 3SW6A 1I2OA 1TPDA 3EXRA 3W23A 1XI3A 4JTSA 3TX9A 3NYZA 1LBFA 1KM6A 3HGSA 4XZ9A 3QMSA 3G1DA 3MUXA 4RX0A 3C56A 1UUOA 3PBYA 4EOUA 1JULA 4JTGA 1ZNNA 1SW3A 2AAMA 3UZJA 2PRHA 4BI5A 5DY2A 1XBZA 2V8ZA 3UY7A 4M6VA 3OVRA 1VYRA 3GDMA 4K36A 3R5EA 2V5LA 2FDSA 3UWYA 1JRBA 3RU6A 3MWAA 2CZDA 2V81A 3LI1A 3PB2A 2YXGA 5DCBA 2V0TA 4O1DA 1OFBA 1TPUA 3FKKA 2B0MA 3LHYA 1F73A 1KLZA 4L4LA 4RR4A 5DCDA 5CZTA 1G4EA 1KM0A 4AWUA 1RZMA 1SZFA 4MZYA 3DFQA 1ZCOA 3DI1A 4HNTA 3TFCA 3NA8A 1W5NA 3LV5A 2NXHA 4EF9A 1Y0EA 2VFEA 3KX6A 1Q6RA 3BVJA 1TJPA 1EIXA 4NZFA 3EB2A 3RLUA 1TIMA 3K30A 4NJIA 1NAL1 1F74A 4AMAA 1W1ZA 1J4EA 1WOBA 1B9BA 2ZZ3A 3HF3A 1FX6A 1JJKA 3G1VA 5F2IA 1UCWA 5H91A 1GVQA 1EP2A 3M9YA 5I3FA 1VH7A 2VXNA 3S5OA 1JCLA 4HIBA 1TV8A 3PUEA 3LCFA 3O16A 2B7NA 5HJLA 4M19A 1TTQA 2JKAA 4H4IA 3M6YA 4DBEA 1W5PA 3NL3A 3EWZA 3W1QA 4RZ5A
chains in the Genus database with same CATH superfamily
1YYAA 1AG1O 4IIGA 4PTWA 2OLAA 2RDTA 2WQPA 1R3SA 1CGTA 2GQ8A 4IMCA 1JDAA 5BNKA 3U6WA 4ZTYA 4GX9A 1VFFA 4H6KA 4G7FA 4JGDA 3SDOA 1WZMA 4WQ6A 3WDHA 1D8CA 4MWAD 1E9LA 1XINA 5T91A 3W1LA 1T8QA 3L65A 3P61A 2VC9A 5AHFA 3W2UA 3H22A 4C90A 4LEQA 3BO9A 3N2BA 1A5UA 4BWLC 3OEXA 3ATYA 5BWAA 1GYNA 1J2BA 3EWUA 1KD0A 3IUHA 1YXCA 1V0NA 4H8HA 2ZQ0A 4F0HA 1S3HA 2X42A 1FWDC 3TTOA 1UUMA 3M0MA 2DZPA 4M6UA 2GFTA 1XQKA 3EOEA 3MMDA 1BD0A 3B9DA 3R6IA 4LX4A 3VKJA 3SUVA 2HPMA 3TWBA 2EG7A 4MOZA 2P8CA 3OO2A 1A5OC 2W63A 3PPFA 3PJTA 3G8EA 3VOGA 4DYJA 3L12A 3O05A 3UPMA 1N7KA 1L9WA 1GVFA 1ZBVA 4NHVA 4WRHA 4CCEA 3GBEA 4LWWA 2ZXAA 1WV2A 4UFKA 3QC0A 3B8SA 1YW1A 1SFSA 5DLCA 2G5WA 1WXJA 1JCTA 4NXKA 4ATDA 5CG7A 2PTXA 2YXOA 4JBRA 3SIMA 1ZENA 1VLIA 2YGYA 3VTRA 1DJWA 2PD5A 3RYSA 4HOWA 5B80A 1D7FA 5GJNA 3TC7A 1JI1A 4NNCA 3FXYA 1FOBA 1E9IA 3FA3A 2QPSA 3TNBA 3G18A 4JKKA 3VZXA 3WQFA 1WX0A 4C6PA 5A8QA 3LPGA 3P62A 1IZKA 2A6LA 3BGJA 3QYSA 5LNUA 4MAZA 2H9AA 5I03A 3MP4A 4Z08A 1TZ7A 4AC7C 8TIMA 1QT1A 4PUKA 1XHGA 5BRPA 3KZSA 4GWEA 4C6OA 4B9YA 2WSYA 1VRDA 2O9PA 4Q8WA 4MM1A 1BPLB 4J1OA 3WLJA 1K4HA 5CBIA 4TMBA 4FAMA 1KBJA 1UKPA 1PL9A 2HBVA 5EBAA 2X16A 3UEQA 3OGVA 1OFEA 3VOIA 3O07A 2J9YA 2C7FA 4D6JA 3MMTA 3KDNA 2Y6ZA 1L6FA 2F8QA 4DF1A 1JFXA 4NY2A 4HN4A 1DWJM 3WNPA 3PK7A 3H2EA 4WVXA 2PDFA 2VVNA 1F6PA 1VD6A 3L4VA 3WH9A 4KCTA 2PU0A 2G3MA 4O28A 4O12A 1GYLA 1V7YA 3W7CA 3T0AA 1ZU8A 4DBSA 1WOAA 2WNNA 1JPHA 3NVDA 2V63A 1ZS2A 4TUFA 3UFYA 3H54A 1KR0A 2VKZG 3N17A 1FWHC 3RXZA 3UWUA 2VGIA 5JBDA 3V0UA 3D0CA 2X1RA 3BOFA 3TOYA 3QF0A 4GYJA 4EXAA 2Z1XA 4J5NA 1OCJA 1ZTVA 3P5ZA 3UP8A 4R34A 3DG7A 2Q3OA 4WDXA 1UOZA 1R38A 2EPLX 4DUVA 4PULA 1WBJA 1J01A 1NARA 4DM2A 2DQXA 1GZJA 4UCFA 1F9CA 3ZJ6A 4GY1A 2FZMA 1RBOB 2PGEA 1ZFJA 3FJ4A 3WEMA 2J4GA 4REQB 1SQ7A 4HYWA 3GTHA 4XG1A 2HV5A 1XFBA 2P88A 1CECA 2DSVA 4WY0B 1W56A 4W7WA 1WBHA 1ITUA 4A2RA 1OC6A 4RXGA 2J6XA 3LGEA 3FJ6A 2VENA 2RGLA 4UNLA 4ZSUA 3TP4A 4A2SA 1YNPA 4QEHA 1EX1A 3USZA 3QFWA 4F3HA 4F48A 4D2JA 2V5BA 2X0HA 3W87A 3VPLA 4S3AA 4D6HA 3NIYA 2DJLA 1FWWA 4L6DA 3APYA 4XO6A 2GJXA 3AXHA 2WB5A 3IIVA 3H6OA 4L4PA 1US2A 1U1HA 2OTDA 1KKOA 4BF9A 4CD4A 2F38A 1V08A 1ISXA 2RHGA 1JD7A 4ZQOA 3CH9A 3GDTA 3G24A 3QC3A 4R85A 3VD4A 3BICA 1TUFA 1QJWA 1KM3A 3G77A 4WSHA 3OP2A 1W1B1 4N42A 1TWSA 3BAIA 3LXCA 3O7UA 4PUWA 2UBPC 3B0XA 2CWNA 4GQRA 3IRSA 3EMZA 1TFVA 2G3FA 4LT9A 1OGSA 3KP0A 5I0DA 1TPWA 2GUBA 3T0TA 2QQ6A 4O1FA 3FFSA 4ACYA 3T4CA 4RJEA 3DYOA 3B9OA 4AD3A 2YCKX 1A3WA 1UH2A 2OLHA 3LRMA 1XYBA 4CQCA 1EO7A 4JTEA 4O57A 3PR2A 3JR2A 3U2ZA 5DELA 3AXIA 3TW6A 2DIJA 2Q8XA 4J9JA 1MEHA 2PODA 4GMEA 2EKCA 4HNNA 5IHRA 3SIZA 1K77A 4UFMA 1OFRA 4MWAB 3VD3A 2YOCA 4PUNA 2DH2A 2XFYA 4M81A 2HCVA 4NKCA 4XZMX 1XXXA 5CKSA 5I79A 3W2KA 5FEXA 5F1UA 1UPPA 5FD0A 3VCNA 1CXKA 4L9XA 1RK5A 1QAPA 3LENA 4ICMA 3HQPA 4K38A 1MO0A 3S5SA 3W38A 1G7VA 3HGOA 4WD0A 4NI3A 4BEUA 4XD5A 5D9PA 3FHQA 2GJPA 3OLEA 2ZXBA 3SSJA 5D9MA 3UJRA 4Q4QA 1DL3A 4UB9A 3FS2A 4DLMA 1JVNA 1R3YA 2PDKA 4W5UA 2X09A 1CLVA 2ZC8A 4S3FA 5HDRA 5JH2A 2C8NA 5A69A 2AQWA 2DT1A 1W3HA 2VELA 3S46A 2XWDA 4MNJA 1FTXA 3THUA 3W7EA 3B9AA 3LLDA 2CLHA 3U3HA 4MFDA 3WMBA 3QQ0A 2JGQA 2ZX6A 4K1GA 4NASA 1V0MA 1LL4A 2HRWA 4C91A 4CN1A 3PPCA 1L2UA 4KGJA 4XVDA 1CB7B 2OLSA 3OHMB 3JU2A 3L4YA 4F0SA 3V0SA 1DWAM 4EX4A 3U4FA 3GQYA 3RGTA 1V02E 4NT0A 1HP5A 2A7NA 1IGSA 3MSDA 4AIUA 2P3EA 2VR2A 3E38A 2EPHA 3VE9A 2E9BA 3H4XA 3HB9A 3MKVA 4FZIA 1ML1A 5FCZA 4UTHA 4YVPA 1BAGA 1LWHA 4OKDA 3G8RA 5I3KA 2AOSA 8CGTA 4QAWA 5CG0A 3S0CA 1EYWA 4DZ5A 1GWJA 2E6FA 2A85A 3C3UA 2QPUA 4GH1A 5BW6A 4H8NA 2H90A 2OO0A 1OD8A 2X7WA 2ISWA 2R1MA 5AC6A 4IF2A 4IFRA 3AHYA 5AC4A 1FHVA 2WW5A 3GBDA 2FTWA 3DKLA 3VYLA 5KETA 1KM1A 2CERA 4HOXA 2OFJA 3TFXA 4GBUA 1W1PA 2ABAA 5EMJA 4L80A 2D0GA 3C2YA 2J78A 4BCEA 3O6CA 1UHVA 4B3ZA 4BY3A 1F2JA 2REQB 2PBOA 3BCFA 3W7MA 2P76A 1XSIA 3FEMA 3URNA 3PUOA 1AQ0A 1A5LC 3RO6A 1SO5A 2X8RA 4OU1A 4Z1CA 1B3WA 4ROQA 3AMLA 1NF7A 2PU1A 1TA3A 1LDCA 4ICCX 2OWWA 3SN0A 4D1IA 1MZHA 2DQWA 3BXWA 3HFTA 1REQB 2GOUA 3ZJKA 4AISA 1PEZA 5BRBA 4JN7A 4AB4A 3WUEA 5ABTA 2YXXA 1XYAA 4C5ZA 4IMEA 3SRKA 2C18A 1JDEA 3H2NA 4AG0A 1EYEA 4H7ZA 3BW4A 3QGVA 4RKAA 2C6QA 4RNJA 3WMSA 4RXFA 3TU9A 4FR6A 4UTJA 5XIAA 1LM1A 5I7GA 3NCOA 4E2BA 3AMGA 2DIEA 3U2OA 1OFAA 4MNMA 4U4MA 3G6LA 1JG9A 2J6VA 1XRVA 5ECVA 5HWNA 1F3EA 4LY8A 4PMNA 3LCLA 4JQ2A 3E12A 3THQA 2EPMX 3NPVA 3CASA 1S3TC 3WDRA 1CW2A 4QG9A 4PCTA 4YVXA 1WQ5A 2C14A 5D2XA 1XQLA 2QUTA 7CGTA 1FCVA 3H53A 2OYLA 1MEIA 3PS7A 4B90A 2UY4A 1XRSA 2BY0A 1ADOA 3S6TA 1MQPA 1PAMA 1JI2A 3K4DA 2YKKA 4OE7A 2QCNA 4ZQPA 4JL2A 5E5CA 3AIWA 3CZJA 1BXNA 1X96A 2VX7A 4UTWA 3FX4A 3WG6A 2Q8LA 1HFBA 4JTHA 2VC5A 2XSAA 3ITGA 4XIAA 2P0OA 3Q2DA 2G8ZA 5HWJA 3UG3A 1OCNA 5EYWA 2Y89A 4ZOAA 4MY1A 4HA3A 4ZR8A 1KR1A 2D1ZA 1DYSA 3A4WA 3UT0A 1Z41A 4KRTA 1S5VA 2HVMA 1YADA 5EA9A 4QFUA 1XGZA 3P7YA 3WELA 3RN6A 3WD3A 1ONRA 3AS0A 5LGZA 1OYAA 2OMAA 4MB4A 3EKZA 2XH4A 5HMEA 4RDZA 3WNOA 2JQXA 4GKLA 2V67A 4XK2A 1BLIA 4KWSA 4DZIA 4FLOA 4HN8A 2PB1A 4JS3A 1LZOA 1GJUA 2NV9A 1C91A 3W7KA 5BMWA 5HWMA 4UMCA 4DB7A 1YXDA 1MFVA 2XVGA 3LCXA 1JUBA 1R6WA 2GWGA 2CLIA 3NL2A 6TIMA 1Q6QA 1HKWA 2XSBA 3LTYA 4QROA 1P0EA 1PUDA 4KEZA 4I5RA 3SJ3A 4DUWA 2DT2A 2ZZ1A 2I5QA 4IJRA 3AIVA 3MPGA 4QISA 4TVUA 4W8BA 2DT3A 5JXQA 3EMCA 1OT2A 1HG3A 3O0KA 1JIBA 3MKKA 3UWZA 2CZEA 2AMXA 2PGWA 1GG0A 4XWUA 1KLYA 1HO4A 4OJYA 1GONA 3UJ2A 4LY4A 1RSCA 4IJCA 4ICNA 3TH6A 1C9WA 1ZY9A 2WMGA 1TMHA 1B3VA 2UY3A 4XTIA 3RX4A 3CUZA 1VHCA 4POCA 2WLZA 3NQVA 3CM4A 4O17A 3DHUA 2GDUA 4S39A 2J79A 3GKAA 3H26A 5IXEA 3M7SA 2Y7EA 1M3UA 4N4QA 3S9IA 3LLXA 2OCZA 1TTIA 3C6CA 4CEUC 3W7JA 5JH1A 4NJKA 1PZ0A 1VC4A 5G2IA 4I3GA 5D05A 5G1YA 1KKRA 4M1BA 1UG6A 3SEPA 2KZHA 3DBPA 5DEZA 1JDFA 3M6DA 4FX8A 5TD4A 2VEGA 2WM0A 4WOQA 4ZE4A 3TTQA 3QEZA 1ONWA 4RNHA 2AAAA 4OVXA 3DFPA 4I8YA 2WMIB 4REQA 2BY1A 3RR4A 1NTHA 4PC8A 4WY0A 2FTPA 3DH7A 3PSWA 2YB1A 1SJAA 1Q4NX 3I6TA 2DVXA 1YMYA 2XINA 2WNQA 1BFNA 3T55A 3EX1A 2CKSA 2P1FA 2Y1HA 1CI1A 2I14A 1DOSA 4CCDA 3H2CA 3AUOA 4YLWA 2D2JA 4S3KA 2GDQA 4GQ0A 4HMDA 1TYGA 3F7JA 1R3WA 3OG3A 1P4CA 3TUUA 2FGLA 2O9RA 4PCNA 2XISA 4W84A 1UD4A 2VVSA 4WDUA 4IIEA 4MNLA 4XKYA 3W07A 2JF7A 4F9DA 3K4AA 3I6EA 1JFHA 2QCGA 4RDVA 3M5YA 3QVQA 3TKFA 2PDBA 1S2WA 1H7OA 1L0PA 1X6LA 3GO2A 3G1FA 4WK9A 1QCWA 3G3DA 1GVSA 4RLIA 1J12A 1PS9A 3FJLA 5C2CA 4J3ZA 2QDHA 4V27A 1T0OA 3GX9A 3RX2A 4MJZA 4RV3A 4QDWA 4BFAA 3VUSA 2NXGA 5E0CA 4C6QA 1GORA 3QV8A 1AL7A 1NQKA 2OPJA 4ZQMA 4WGXA 5AZ1A 3GDKA 2J7CA 3LXAA 1FWGC 4C7GA 4AZBA 1T7LA 4NZ1A 1KFLA 4DY1A 5D02A 4UNIA 1O5QA 1DTNA 4NZ3A 2BLEA 3LOTA 1IF2A 3FVDA 5F2MA 4M56A 1HNYA 2FZ9A 3T09A 2IUZA 2GLKA 4MWAA 2GVLA 1EHAA 1P0DA 1KCXA 1EOKA 1IXOA 1IZJA 2FJKA 3W82A 1LTDA 4JY9A 2VEPA 4AXKA 3TYAA 4TR9A 1UKOA 1E51A 3V1HA 4N9DA 2ZUMA 3ELFA 3WDPP 1I2NA 3W7PA 1BTCA 3ZJ7A 4UQDA 3S83A 2E40A 2GSHA 1BGAA 2VRKA 3EPMA 3ORWA 2Y4SA 4ORIA 2HS6A 3LBCA 2XM2A 2D23A 2WSPA 3A9IA 3TOPA 3MBDA 1E6PA 3H7VA 4GY0A 2YL5A 4L7ZA 3C2OA 1Z89A 3EXSA 1A5MC 1FKWA 4GJ1A 3W7RA 1U5JA 1XR2A 3LA4A 5I00A 3C0QA 3WFZA 4KBXA 1ISVA 1V4YA 3PNUA 4Q8OA 4GIRA 3AJ7A 3BAKA 4H83A 1FWAC 2G97A 7ODCA 1OG0A 2VDIA 3TQ0A 3NQDA 1YE6A 2VNCA 1QWGA 2X0SA 1M9HA 1Q6EA 4FR1A 1E4NA 1RXOB 4Y6GA 2AL2B 1G6CA 4W88A 2W79A 4BK9A 1ZJAA 1MMFA 4XSMA 2PAJA 5HATA 5MKGB 5I23A 2PCEA 3IK2A 3PFRA 3U4AA 1EBHA 3RMEA 3QBUA 4AWEA 3SCSA 3DN5A 3LPOA 3EWYA 3ISIX 3AZRA 4DN1A 4W85A 5HR6A 3T8QA 5ABFB 5KZDA 4NZCA 1ZSXA 4Z17A 3ARWA 5FF0A 2Z0IA 3DFTA 4LAZA 2DW7A 4M6QA 3LD5A 2I17A 2WHLA 3GRIA 1W1VA 1O1HA 4BA0A 2QDEA 4GUFA 4GISA 1EPXA 4GG9A 1WKDA 1HJUA 4L9YA 1KFEA 1AW2A 2REQA 2JF6A 1VFLA 3BAWA 4NJHA 2PDXA 1AQMA 3V7PA 3RLHA 5DFAA 3ABXA 3P2VA 1PKYA 2FVKA 3LHZA 1JZ6A 2BMBA 1CWYA 4IPNB 2YCLB 3LK6A 2E8ZA 4NNAA 3TYDA 2OQLA 3EBVA 5DF0A 3KBJA 1REQA 4D6DA 4DAFA 3UZWA 3QPEA 1RP8A 2E5BA 4FNQA 3QTGA 2BWGA 3M0KA 1CLKA 3ARTA 1YBQB 1XCWA 3ABQA 5LXXA 4FXRA 4DWDA 1MSSA 1W5OA 4HPJA 3VGGA 2VC6A 3ERPA 4Z0SA 3TROA 1Y7VA 3SADA 5HMFA 2XN1A 3B0VC 3OPSA 1ITQA 3E0LA 1OX4B 5D32A 4R7OA 4M3PA 3LS9A 5HXMA 5FF2A 3U5YA 5D2YA 4XB3A 4UR7A 4GBDA 2O9TA 4TX6A 2D69A 1OD0A 3W2LA 3MB9A 3S9ZA 4JIPA 3HMCA 3J7HA 2YL6A 1GT8A 2E67A 3VC5A 3HIJA 4WF7A 2CBUA 2OR2A 1LP6A 1QBAA 2QV4A 1QR7A 2D2GA 2W66A 4GJIA 2XUCA 1QPOA 4PUJA 4ZOBA 3QY8A 4AIOA 4QQ3A 4HSHA 1RA5A 1EGZA 3N34A 1XH1A 1FWBC 4UFJA 1P1MA 2ZXQA 3OA5A 4IM4A 2F7FA 3PC0A 3VMOA 1NWUA 4R3UA 1KGXA 2J27A 2WCSA 3HM7A 3S2CA 2WWCA 1TMQA 3HGRA 4M29A 1UMLA 5LIKX 4FNUA 4P2VA 1FVPA 4XBJA 4WKAA 4IPJA 4I7VA 1B30A 2F9RA 4NIRA 4LNCA 4DZHA 1XIJA 2ALRA 1AJ0A 4HHLA 4A29A 2YR1A 4E38A 4NJJA 3CYVA 4B5VA 3P0WA 3SGZA 5AHLA 3G6MA 1YIXA 1GOQA 3TW7A 4LAUA 1UA7A 5HAOA 4HD5A 3G3MA 3FW6A 5CAHA 4JD4A 5BOFA 2VWTA 3AO0A 1P0NA 4N7QA 2JIWA 2AQVA 4R7WA 3XINA 4WJEA 3FXGA 2NSOA 3UA4A 3ABSA 2PDNA 3QOMA 5CGQA 2BB0A 1BQCA 5HUPA 2C19A 1EJXC 1UQZA 2W67A 4DJEC 4X2RA 3OQ8A 5LKYA 1S5NA 4AYSA 2Z00A 4C6NA 2HNHA 3UZYA 4PRRA 1XGDA 2Q8ZA 4LAMA 1R3VA 1O5KA 3OZOA 3GDLA 3P67A 3GKFA 1JCNA 4QCFA 1E56A 1H4PA 1J0JA 2Z2UA 3E96A 1S5MA 3T1GA 1VCFA 2F2HA 2VUYA 3H7UA 3M0JA 3H2AA 2XGIA 4YWSA 1WKEA 3K5XA 1V0LA 4DF2A 3QMTA 3KVJA 4S2BA 3KDOA 3N11A 2WVVA 3GD6A 3RR1A 5GJMA 2YBUA 4R9XA 3AS2A 3WH7A 2V30A 3WF3A 4IGHA 3ITVA 3BWWA 2GJLA 4D6GA 3IIZA 4GJJA 3WUFA 1KV8A 3EX3A 4LCSA 1PX3A 5A2AA 2O4QA 2FZBA 1W9UA 4BQ5A 4EE9A 1TELA 1KWGA 3C61A 2X2GA 1OY0A 1X7IA 1HGYA 4TOQA 3ZWSA 2PTZA 2VEKA 4HU8A 3W37A 5CC6A 3RHGA 5U4NA 5C9RA 2HVNA 3W4RA 5A6BA 3MMUA 1JXKA 1HUVA 3QHNA 4I7WA 1VFHA 4AZCB 3GW0A 2RH9A 4A05A 4UOJA 4O0ZA 5D8WA 3OBEA 2WMIA 3WK1A 2ZTJA 3BSHA 1GK8A 4IP4A 4DWSD 4Y8EA 5LIWX 3IGSA 3CLWA 4IQLA 4CNUA 3VK5A 2ISSA 4K1WA 3LSCA 1DE6A 1UB3A 2YDRA 3CAVA 4DZAA 5KMYA 3LB0A 1PYMA 3KZPA 2DORA 2DJXA 4JIIX 3COTA 3LYEA 3W1UA 3L5AA 1C8YA 4IP5A 3CIXA 1OK6A 4CN6A 4W8AA 5CQ1A 4Y7EA 4BQ2A 5AC7A 5AYZA 2QUUA 3GNDA 3MJMA 3SO7A 3WLNA 3NQAA 3VILA 4QAIA 3SCVA 4GI8A 1ZRQA 2B81A 1TREA 2POZA 5FOOA 2ABBA 3NQGA 1JCXA 5D37A 1JPMA 3FV9A 2VHLA 2XN2A 2AKMA 1BVZA 4OZOA 1CENA 4LRSA 4Z1YA 5J5RA 3SM0A 1VJIA 4A4AA 4FXJA 3B04A 5EBUA 1H7PA 2BSLA 1GYMA 1W37A 3NYDA 3T6CA 1UD5A 5A6AA 3ARYA 2TMDA 1DV7A 3IEBA 1GJPA 2FZNA 3LX9A 1EJWC 1UR4A 4XV0A 2J8GA 1CT5A 4GVHA 4DX3A 4JTSA 1TMLA 4GINA 4CD6A 1XLMA 3HGSA 3N13A 4HA0A 2V5CA 4ACZB 3QMSA 3G1DA 3MUXA 3WQCA 1UUOA 1ZNNA 3PPHA 2AAMA 2PDPA 4HZ6A 3UY7A 2AKZA 4B2DD 5CBJA 4F2TA 3KOYA 4YJ5A 2MNRA 2IKHA 1JRBA 2IKGA 1Y5WA 3PB2A 2A3LA 2YXGA 2HK1A 4GI4A 1PJ9A 1J6PA 2V0TA 3HV8A 1TPUA 3LHYA 1KLZA 1KQZA 3ZLGA 1PZ3A 1KM0A 4AWUA 1SZFA 3UR7A 3AMDA 1F3XA 3A4AA 1YDYA 2D0FA 4Z2KA 2D24A 3DFQA 4ERIA 2WPGA 3UNTA 3QHOA 1MRQA 1Y0EA 3PWGA 4EWJA 1MNSA 2PDCA 2Z1KA 2VZTA 1IEIA 3UCCA 1EIXA 1X1NA 3VDHA 3K30A 3WF2A 2VC7A 1XG3A 1W1ZA 4F9JA 3Q65A 3WQPA 5E70A 3G1VA 5F2IA 5H91A 1ZBWA 1GVQA 4HK7A 3H23A 2VXNA 1TV8A 4JZ5A 1WO2A 3H4GA 3LCFA 1QWKA 2W27A 5HJLA 4M19A 5AECA 1ISYA 3CAWA 3MSRA 4H4IA 3M6YA 1C8XA 2CNCA 1W5PA 3NL3A 4A8RA 3EWZA 3W1QA 1LJYA 4RZ5A 1QK2A 1WDSA 1YPFA 3WEOA 3I65A 4L4OA 4NP7A 3C0JA 1RHCA 3H2FA 1AH0A 2WLYA 1XD1A 3OHIA 3C2RA 2ZUUA 3GU1A 4XKMA 3AI0A 2R91A 1VEPA 1AD4A 3NO5A 1T40A 5HJYA 1M5WA 1HN1A 3NSMA 4WDTA 4MPKA 3KW3A 3ZLHA 4WKFA 2A3CA 3PHAA 1UMYA 1JR1A 3MJYA 3WSUA 4QLKA 1FXQA 1D7KA 1ENUA 2A3HA 4QE1A 3M0IA 4UTTC 2Z1SA 1Q63A 1D3CA 3T9PA 4ASTA 1A50A 3AHVA 5LGXA 2WNWA 2XYLA 2Y8VA 1S1PA 1W17A 3MP5A 1GW1A 1P0BA 2VI0A 1MQRA 3BLPX 3CAKA 1GZ1A 3KRZA 5ABFA 4M6PA 1DJZA 2B7OA 4UFHA 1ICPA 2EPKX 2C16A 1XJBA 7REQB 1YX1A 4GY7A 3VX0A 3GE7A 1DHKA 5F4WA 3FA4A 1FWRA 3HQ1A 1C29A 4Q32A 3LZ5A 4GZEA 3A64A 4Z1BA 4NJGA 4UZSA 2V5JA 4PBGA 1J5SA 2PPGA 1YDVA 4KEMA 1US3A 3QFEA 3DX5A 1GW9A 3VGFA 3CV7A 4JDBA 4NZ5A 3H24A 3UWEA 5FAGA 4TX9A 3EA3A 4K7VA 2ACSA 2C0HA 3STGA 2YCLA 4EAYA 2QV5A 1VFOA 2ZIDA 1OCBA 1H41A 1J0YA 2EEXA 1TWZA 2JKEA 3F2DA 4RE2A 1IT0A 3CUXA 3DI0A 3VDGA 3LCWA 1K9TA 1YBQA 3IRDA 3QN3A 4QSFA 3L0KA 4Y9OA 3IGUA 3D5HA 5DO8A 3FHAA 3CMGA 2R1PA 3BJTA 1YPIA 4R9OA 4RCXA 2EBNA 4JY8A 2J25A 2OQYA 4O54A 4DXXA 4A21A 2QW5A 4JQ1A 1NWTA 4Q8NA 4E8GA 4S3JA 3KHDA 4MDPA 2BOFX 3RM8A 1DQWA 3W7HA 5K4XA 4AZHA 1WDWA 2E0PA 4B5WA 5G2WA 2J9XA 1THFD 1I6NA 3FSTA 1XYCA 3WO8A 5LA2A 3W86A 1W91A 4DWSB 6REQA 1E5JA 1FDYA 4MJ2A 3WBEA 3EWCA 3MTWA 2CBVA 3UVIA 2OSYA 4EPKA 1PTAA 3MBFA 1GVYA 3E6EA 4CNOA 1RJRA 3MI6A 3GK0A 3DU0A 3WLRA 4KWWA 4C6DA 4GVIA 2DZWA 3PJUA 4O0KA 1EA0A 3OQEA 3MS8A 2WSQA 4FP1A 4YTQA 3B8WA 1QATA 2PWEA 4GI9A 3N18A 3CK5A 1CYGA 3G1YA 3F5KA 3KBNA 3VM7A 3N73A 1HVQA 3D3FA 4IGMA 3OLIA 1ZJHA 4X61A 4U2ZA 1VS1A 3ITOA 3TYZA 3O6AA 4JNMA 2PC8A 4RZ6A 1A4MA 2RJGA 5IBXA 5K4ZA 1HL9A 3NSNA 3P84A 2PURA 3IPWA 5I3IA 4A6GA 1MVYA 1E4IA 4KCVA 2BG5A 3VIGA 1S2AA 4MYAA 4C6CA 4O15A 1BYDA 2FYMA 2FFCA 1OG6A 1GVIA 3ONBA 1NH6A 3BW3A 3MSYA 4B91A 3FIGA 1X38A 3VM5A 1HKVA 3II1A 5AHNA 1EUAA 5CJNA 1DXFA 4QJ5B 3Q45A 2PWGA 2XIOA 2OOGA 4W4QA 4A3YA 3AZSA 4PMQA 3NVTA 3E2SA 4ZO8A 1ONEA 1PV8A 4IFOA 1MEWA 1R7OA 4F0LA 1XC6A 4Y2WA 5K9DA 4HB7A 4Q7IA 3GHUA 1N55A 4YHEA 4ERAA 5BU9A 1Q7MA 3UR5A 3W6LA 2X40A 1W3NA 4PL2A 3ANVA 4DO6A 1WPCA 2OELA 1OX6A 1VHNA 3UGRA 3E74A 4IMAA 3SGUA 3QPZA 2QJHA 4Z2GA 3TV8A 3CQIA 1TTPA 5AKQA 1KFBA 4GUJA 3ONCA 3CWOX 2ZX7A 2ACRA 4V2XA 5BCAA 5HQEA 4DI8A 4HNUA 3PSVA 2WNZA 2BS9A 2Z4GA 2AMGA 1C3FA 3W6YA 4JKMA 4ENLA 4RZBA 3S6DA 4M80A 2ZA2A 1FFRA 3NQ2A 5F2GA 3KCLA 3VNDA 2YCEA 3PG8A 4PA8A 1R9XA 4EF8A 4YIWA 1G69A 1LROA 1O7AA 1VAHA 2GQ3A 3BAJA 5AVHA 3O0FA 5HOSA 5LA0A 4RNFA 3NL5A 4UWMA 5FKYA 3RMJA 2ZA3A 1ZGDA 1K02A 3GDRA 4CQ8A 3KRBA 2PSNA 3MCOA 3GVQA 1KBKA 1B90A 4BS0A 1ZAHA 4JX4A 3GVGA 1K7EA 2WC4A 2OZTA 4J2PA 2TYSA 4JKLA 1QFEA 1W8SA 5FJPA 5FF3A 3E5PA 4X2PA 1TTJA 1JPKA 3B8VA 5U7SA 1KRMA 1KXQA 4A3HA 2A79A 4UTKA 3W1AA 3WQ8A 1RJPA 4EPDC 2QT3A 1JCMP 4MMWA 2W62A 2E68A 2QR6A 3EPNA 4FNTA 4ZQRA 3WLHA 5C0QA 1UKTA 2PDMA 1DKWA 1JXJA 2J66A 4ADSA 1TR9A 1X6UA 3FYYA 1CB2A 3G1RA 4CD8A 3L21A 1A0DA 1HF6A 1OF6A 1JZ2A 3U0HA 2V38A 3TNOA 3UR2A 4Y9MA 5CPTA 3EAUA 1U30A 2EXOA 4JN8A 3DESA 1XUUA 4O10A 2Y5SA 1RH9A 3VFLA 2ESCA 4EAMA 4B5TA 2Q01A 1NDWA 6ENLA 3LDVA 4NNBA 3W24A 3UCQA 5KEZA 1AMYA 1Q5MA 4IPIA 3HZ3A 1Q6CA 2Z26A 1MZRA 3BPWA 2E8YA 4TTUA 4E5TA 2E77A 5CEWA 1Q4WA 3FN9A 4IOTA 4KS0A 1UJPA 3PANA 4GGHA 3TCSA 3WK3A 1UWRA 2CC0A 4RW5A 3FJNA 5DMYA 4PMJA 2FMNA 3RJYA 4HSOA 3N1AA 4HK5A 4GABA 5E6YA 2G96A 3R10A 2OVLA 1JZ4A 3LPPA 3VMNA 1QI5A 3CIVA 5IFTA 4GACA 1ME9A 4HHMA 1G01A 3NUKA 2OX1A 3EB3A 2VGFA 3V5OA 1Z32X 3QLLA 3IGXA 5J5DA 2VM8A 4AZ7A 2MANA 1J79A 1UYQA 1LL6A 1XL9A 1EC7A 1TZ9A 3AUJA 3WNLA 1KRCC 1XLKA 1X8FA 3MT1A 4HT3A 1RCXB 3CU2A 1B57A 1AQFA 5AOUA 3GH5A 1DP0A 4PFHA 1EGVA 3P14A 2CLFA 3KWSA 1IEQA 3V0TA 4IP7A 1NOWA 3DHFA 1WUEA 1UW9A 1A53A 2W6RA 3AOFA 1EQPA 4PB3A 1Q2RA 1XD0A 3CB8A 4QXIA 4MUPA 1TPFA 4HU4A 3G0UA 3HA1A 1B0IA 3UXIA 1X6NA 4FA3A 1LG1A 4LC8A 4OV9A 2D20A 3NPXA 3FAWA 1NFGA 4JIHA 3T7VA 1T41A 2FZ8A 3HPZA 1JUKA 3W84A 3BH4A 5JU6A 3WL0A 3GIPA 4AH7A 2X0YA 1ESWA 4X22A 1U22A 2J7GA 4Y90A 1LOLA 5CC5A 1KBBA 1I4NA 4PUDA 2C3ZA 1AW1A 4FX6M 3ARUA 2P0IA 1FKXA 3R12A 2O56A 1ZCCA 2BHZA 4UFLA 1P7TA 2ASHA 3NQMA 5DMLA 2QGHA 1KC7A 1MDLA 4MF4A 1P5BA 3N4AA 3TXVA 3ARRA 4JYFA 4N9BA 4I90A 3H70A 2PWHA 1W3KA 3RO8A 4JTAA 3RJXA 3THAA 1RAKA 3BAXA 1U1UA 5DT5A 1VZWA 7REQA 4NG3A 4P8WA 4O53A 2X30A 4JCLA 1HKJA 5K7JA 3EEGA 3AXKA 1SSGA 2YYUA 2BASA 5T26A 3CQKA 4TO8A 1MXGA 4JQ3A 5HPCA 3RPDA 5H1WA 3B8UA 1R86A 3TC3A 5HQLA 1K8YA 4GVGA 1V6YA 1PKNA 5LZLA 1IWAA 4I5UA 2WV8A 3MUAA 3Q67A 3KCJA 5H8MA 4AVNA 3CZKA 3MHGA 2W91A 4KCWA 4GYPC 3DZ1A 1HL8A 1MDRA 4LYPA 5D04C 3IAPA 1U33A 5IFPA 2J9ZA 3W81A 1TZZA 5JVLA 2NV2A 3MV11 1GUVA 1DWGM 3EA1A 4S38A 5CH9A 3BLFA 3K8KA 3RCYA 1BSLA 1CGYA 4JYDA 4HPGA 3P8IA 2E6YA 2ONEA 5I3JA 2G3NA 4WDWA 1UUQA 3CPGA 4LUTB 1V02A 1IWBA 2WBKA 4I9TA 5FEWA 1J0KA 2J77A 4QEEA 1V3IA 4IMFA 3QZ6A 4JCMA 1QMLA 4DAIA 4IG2A 2V3FA 3A13A 1RBLA 4MAVA 3RLGA 4ZB2A 3E2RA 1TCMA 4N6FA 3RLVA 1DIOA 2ZE0A 2FJUB 5TBOA 1QW9A 4HCLA 3UY8A 1WXYA 4I7UA 3IJ7A 1X98A 1J5TA 4HCHA 3QKZA 1EEPA 1EJVC 4FF5A 3HPSA 1K8ZA 1EGMA 2VRJA 1FY6A 1H63A 1XICA 3WD0A 1KTCA 2PGRA 5ABEA 1QNRA 2HMCA 1Q3NA 1JZ7A 3EB4A 1J9YA 1XRFA 2ZUWA 5E93A 2YJQA 4ES4A 2XVKA 3M47A 2WYSA 3OW1A 3ZS4A 4KPLA 2G3JA 3W26A 3TSMA 1SUXA 4HCDA 3UERA 1RVKA 1XYLA 3ZM8A 4KFOA 1C92A 4PTMA 5AC8A 2CZVA 3CIWA 1XLEA 3FDGA 1OIMA 1WYIA 1VQTA 3E0VA 1W3JA 4WJXA 5HNNA 3EDJA 3AU2A 5B7YA 4H9UA 1JEZA 4LV9A 5LXEA 3P80A 4D9PA 3W29A 1AVAA 3PY2A 3OB8A 5BROA 1SJBA 4L65A 3TVAA 4UCGA 2FPYA 3OOQA 4F2UA 1DJIA 1HW6A 1P48A 1V3LA 3LU2A 4BI6A 2B31A 4ILSA 1UWUA 5H8PA 2EHHA 3MI3A 5FJJA 1R8LA 4QE5A 2ZTKA 1ITCA 5CPNA 1I9CB 5DT7A 1R30A 4CNNA 3EPOA 3UJEA 4LGXA 3Q94A 4C60A 3C3NA 1OINA 3RCMA 2J75A 3MUZ1 4G9PA 2E6DA 3I7SA 1KM5A 1I2PA 1W5QA 4TXEA 3G1SA 4L64A 4B15A 3F5LA 4D72A 2CIPA 3L67A 3QZEA 2QVNA 3OVGA 4ZENA 3UJFA 4S2CA 3K2GA 4CN4A 5CZKA 1E4LA 3S5NA 2GDVA 2A3EA 2V5DA 3AIUA 4IHCA 3SCPA 1NP0A 3GW3A 3A5VA 3GTNA 4JDYA 4GD0A 2OZ0A 3L2IA 3ZT6A 4H2CA 3L2LA 3CUGA 4LU0A 2Y5JA 4DELA 4QR6A 2OJPA 5CZJA 3G1AA 3I6RA 4YL2A 1U5VA 3HFYA 1VIZA 8A3HA 4P8XA 2C1HA 4FK9A 2V3DA 1FH8A 2DZTA 5BRQA 1YTEA 2XHYA 3OYZA 2ISDA 1ODUA 4RNIA 3CQJA 4TX8A 3TJIA 4GFSA 4LBSA 2WCAA 1OGGA 4AZGA 2JGYA 4J3UA 2QIWA 9XIMA 1KW1A 1OWQA 3PAOA 4GIAA 3H4WA 3I4EA 3S9YA 5K9XA 3V4BA 3LM3A 4C1NA 3GXNA 5HANA 2YPIA 4ZCWA 1Q8JA 3RF9A 2YBVA 2CLMA 4AX7A 4BJHA 3KBVA 3WNMA 2NX3A 3EOUA 3RUBL 5EGRA 3PB0A 3B40A 1OYCA 4U3CA 1UWQA 1TVLA 1G4PA 4Y8FA 3MC5A 4LH8A 4NU7A 1EH9A 2E7FA 2ZUTA 3BQ6A 3KL3A 1TVPA 2DUZA 2OEKA 1VPXA 4Q4RA 2G37A 3NZGA 4IIHA 3AIQA 3LXBA 3AIRA 1SU5A 1G4SA 1LLZA 3U9IA 4XX6A 3ZYZA 4Q7NA 2PRLA 3WLMA 3TYUA 4IFKB 1LQ0A 1I75A 2OEJA 1EO5A 2QCEA 1QTWA 2Y61A 4CEXC 1G9HA 1B3XA 3N6QA 4RE0A 4ZGYA 5FSDC 1QOXA 3GYEA 4DUOA 5LIUX 3TQKA 2FGBA 3N04A 1Q8AA 3CBWA 5HNTA 2F6UA 4N02A 4LC6A 1BWKA 5FEPA 3WJWA 1M03A 2Q3RA 5GNYA 4JTDA 1BVWA 4PH6A 3GDBA 4V33A 4LCQA 1RPKA 2G50A 3CUJA 3F4DA 4K8EA 4PUEA 2X1TA 1R3TA 4KMQA 2X1SA 1G4TA 3P74A 4P8UA 3C8FA 1O95A 3W72A 3WD1A 3TTSA 4B3KA 3OA3A 3N3TA 4FI4A 3WD4A 4DJDC 1XLDA 1JAEA 3MVIA 4R5EA 5C2XA 3R13A 1C9DA 4ATWA 4ZVJA 2G3IA 4KETA 3BLKA 1AFSA 1QVBA 2YIHA 3SCTA 4Q8PA 2ICSA 4DLFA 3R0UA 3PFMA 2YBTA 3GZ3A 5M3WA 4IXHA 4DYKA 4OBRA 4JAWA 2DUAA 2VCBA 2CLKA 5XIMA 1PXGA 3CGTA 1Q6OA 4BEQA 2P3ZA 1FRBA 3E0FA 1LUCA 3N6JA 3QTPA 3VKAA 3PF3A 3U7BA 3I68A 4MLRA 3K46A 3THDA 3WNKA 3MI2A 1B2YA 3EEZA 1TJ1A 4MZ1A 2XFFA 4XAGA 3VKKA 1W31A 2QVHA 1LYXA 5HMSA 2HE5A 2VCAA 2IMRA 4H04A 3WQ4A 1R2RA 2ZXDA 3NG3A 4FEZA 4LCRA 3KS5A 1UOKA 3VIOA 4RDWA 1RV8A 5EL1A 3KOXA 1X8CA 2GSEA 3RPMA 1V3HA 1F76A 3Q4DA 1ME8A 2DZBA 2C15A 3W28A 2VQTA 4AXNA 4BHYA 3RG6A 4GGBA 3R79A 4YYCA 2VDGA 1R3QA 5GNXA 4Z2JA 4AWTA 4PMYA 3IJ8A 1S39A 4DJFC 4AHOA 4IX0A 3BW2A 1N82A 4MB5A 4WOZA 1UZ4A 4XISA 2TRSA 5JIPA 3T40A 1R47A 2HROA 3M64A 3IANA 3L0NA 2WPBA 1EJSC 3GVWA 9CGTA 2PE4A 1WAWA 4Q4SA 5AC5A 2J7DA 1O1ZA 4HU3A 1JQXA 3RNDA 3ARXA 4GUIA 2I57A 3WLLA 3ZOAA 5A1AA 1RR2A 5HNUA 3S1GA 3TN3A 1QPNA 5TQLA 3QV9A 2PFHA 1XCFA 3AISA 1VENA 1LQAA 2J7FA 2RDXA 3UGVA 4CD5A 3KOFA 4KGLA 4AYGA 1W32A 3SQSA 3XISA 4J3TA 1SO6A 1W1YA 1PHWA 3L4XA 3OGSA 1GOWA 1IHIA 2QYGA 3H8AA 1KWKA 4JIEA 4C1LA 2WKLA 4NL1A 1EX5A 4UTLA 1IIHA 1EL3A 1RP9A 3BG3A 3DFNA 2OXNA 2XH0A 2CBJA 2VL4A 2L5HA 3FAXA 4LEFA 5FAJA 2QIIA 1XFCA 4B92A 4LYQA 1SW7A 3MP3A 2FIQA 1I0DA 3PZTA 2E3ZA 3NZ1A 5CZSA 3BQ5A 1DJNA 3TLQA 4XZLX 1NDVA 4ZB5A 3TZNA 3PZUA 4JNZA 3CAQA 1DE5A 4RPQA 1QBBA 1RPXA 1XWYA 3R1ZA 4ZXOA 3W88A 3EWXA 2A3AA 1P0KA 1VRXA 4D6EA 4L6OA 3B8IA 1Q6FA 1BGGA 1RCOB 3LG3A 3N2XA 2DY3A 1OYBA 4UQCA 1DQUA 4JTLA 2FVLA 1E1CA 4YTUA 3KWXA 4PB4A 4K8HA 4JQ4A 2X2YA 2WANA 3BUVA 2Y2WA 4HPXA 3KTXA 1NVMA 1ZJBA 3VGBA 5G2HA 1JGIA 3E2VA 2YX0A 4IJBA 4UZUA 2VR4A 2QMJA 1XBVA 2ZOXA 4O4VA 3W1MA 4ERGA 1OX5A 1R2SA 3H7RA 2WHKA 3N2TA 2QCMA 3AMCA 3GR4A 4BKNA 2IXUA 2OG9A 4XD4A 3W22A 3ARZA 2JIEA 1OFPA 2VCCA 3AZTA 4W87A 1AZ2A 1GVRA 4K7YA 1TSIA 4AEFA 7TIMA 2VTFA 4OQVA 2ZZ7A 2YSWA 1L6YA 1A0EA 1VGAA 5D2VA 3WLIA 3UZ5A 1EIBA 1YPXA 4LUJA 2XVLA 3L23A 3U57A 5MHBA 4KEVA 2EO7A 4IX2A 5J8LA 4GQGA 3NL6A 1OSEA 2PRMA 2WVTA 2HJPA 4IL0A 1H60A 3CMJA 3ARSA 5FEZA 5T9BG 1CXEA 3CHFA 2CKRA 4WSKA 9XIAA 1H0IA 2GQ9A 1A5KC 1Q45A 1XGEA 3W74A 2SFPA 2A2IA 4M1RA 4CNSA 3H12A 4HGXA 1JCYA 3W83A 5C5YA 3AICA 4AEEA 2AGTA 2IKIA 2XGBA 5TIMA 5M5DA 5DBUA 1CGVA 2PF8A 1QHZA 5LHEA 2A4AA 3IJDA 3IS4A 4M82A 1UKQA 4C7FA 3BGAA 1UPMB 7XIMA 3F2BA 5D9OA 2QJJA 1AW5A 3E1F1 1LWJA 5C70A 3WK0A 1DQXA 2C1GA 3DG3A 1G7UA 3PBUA 5AYYA 3K8LA 2I1OA 4U5KA 5HQMA 4RE4A 1ITXA 1MNZA 4US6A 3SUUA 3S1WA 3GUGA 3IJQA 1NM9A 3WJSA 4M51A 3NM3A 4X9YA 2CXEA 2OSXA 2XPKA 3H21A 3N3MA 4I6VA 3VUPA 5D4YA 3FGCA 2ZVRA 3F03K 3TSBA 1HJSA 3HG4A 3FNDA 1XLBA 1VPQA 2IPFA 4O50A 4WUIA 1UA3A 4Q8TA 3UXKA 1AJ2A 4QNWA 4CCCA 1AL8A 1GTHA 5BOEA 3LMYA 5A8NA 3M5XA 2D2OA 1A5SA 1WDDA 1UZ1A 2VOTA 1W54A 1GGOA 4JFTA 3ZVHB 3VNIA 3UZZA 1A5CA 2RGMA 3VD9A 1PKLA 1W3TA 5H6HA 1FQ0A 1JCJA 2XVPA 3FYPA 1EJTC 2H8XA 3NR0A 3R4IA 4ADUA 1W2VA 2JBMA 1R9ZA 1SM9A 1HKIA 1AA1B 3QV7A 1H5YA 2VP8A 2PDUA 3MZNA 4O1EA 2FB2A 4OWGA 4QTGA 4CVUA 3ENLA 5IOBA 3GSMA 6ALDA 4A8IA 1VFTA 4BQ3A 1OEPA 1FWJC 1RUSA 3BMVA 1ZAIA 3WYZA 4JTKA 2P50A 3MUY1 5H8UA 1H1NA 3TX9A 4WCJA 5IRPA 1KCKA 4IPLA 1LBFA 1BRLA 4YTRA 4RX0A 2ZUSA 3WQOA 2PRHA 4URIA 3OVRA 2J8TA 1VYRA 4K36A 5DX7A 3R5EA 2V5LA 3OODA 3RU6A 2XH7A 3LI1A 3CO4A 3RM9A 3FKKA 4RDYA 4L4LA 4RR4A 3VDAA 3R11A 1AZ1A 3A6OA 2JE8A 3CYJA 3DI1A 3NA8A 2PI6A 4W7UA 4EF9A 1LWIA 2INZA 2VX6A 2BVWA 3KX6A 1Q6RA 2GYIA 5C2GA 3R0KA 3EB2A 1XH0A 5FIPA 5PTDA 1E0UA 1PIFA 3URQA 1YQ2A 1FX6A 1L2QA 2I56A 4YHGA 3CV6A 3T4WA 3S5OA 1CXHA 1XV8A 3O16A 2B7NA 4ZFCA 4G1NA 2ZWZA 1TTQA 2W3ZA 2VYOA 3QY7A 5DMNA 3L7RA 3FLUA 1XIDA 2DGAA 3HTWA 1DVJA 5C54A 1OJXA 2PZ0A 3UW6A 5FSEC 5I3DA 1CBGA 3F5JA 4PODA 4GIYA 2PEVA 3NXLA 5C9UA 3CQ0A 1H09A 3PTMA 1OABA 2BDQA 2WHMA 4UOQA 3VIHA 4IQJA 3W2JA 3GR8A 1S5WA 3S42A 4GKTA 3VNKA 4E0CA 1KRBC 4JR5A 4MNKA 2VX5A 3GXDA 4XVEA 5A6TC 2VX4A 3SCUA 2PLKA 3GXMA 1GQJA 4C7DA 2VD8A 3U8GA 3UXDA 4NX5A 2TSYA 2PF0A 3NGJA 3AWOA 4FLQA 3DECA 4C5YA 3WQWA 1M41A 2ZZ4A 2O9OA 1RY8A 1N2VA 5FJUA 3M16A 5E0KA 3N12A 2BHUA 5DXYA 1RD5A 4M24A 2QCLA 3PZOA 5CXPA 1GHRA 3WLQA 5HJXA 3IVUA 3ALGA 3RILA 2H9AB 3MSGA 1FH9A 1PZ2A 2Y8UA 4IWWA 2X7VA 1ISZA 3FEQA 3HG5A 3KBSA 1G5AA 1XP3A 4NI8A 5JQ9A 3S5YA 1I45A 4GXWA 2WKGA 1MW3A 2POTA 1HP4A 1SO3A 3M41A 2ZYFA 4QLJA 3BLIA 4I9AA 3V5FA 2ISVA 4PMUA 4P7QA 2O92A 3T2OA 2V68A 2PTWA 3QOKA 1BWVA 3VINA 4XZNX 3AROA 3CWHA 5EU9A 2DP3A 1V3KA 3GHTA 1AMKA 2CYGA 3OGRA 1XPYA 2YDQA 1KXTA 4IMGA 2HTMA 1XSJA 5HK4A 4MKVA 4H9XA 3WF0A 2QCFA 1QHPA 1EWEA 1IGWA 1D3GA 3OBAA 3UG5A 1VBGA 2Z29A 3DCPA 3IAQA 3NWRA 3N2OA 1UH4A 4P7RA 4JTCA 4KF1A 1PCWA 3AC0A 4B5UA 4LUSB 1QPRA 3TR9A 3GFZA 1FUYA 4UMBA 2XZ7A 2E5CA 4YWIA 2FLIA 1L6SA 4B3LA 4EXQA 4MFEA 4TTGA 3MCMA 3QH2A 2GZXA 5A95A 2FHBA 4H9VA 4HA4A 3DGBA 4LF1A 5KINA 2EQDA 2GQAA 1GKRA 2VUNA 2WVUA 4ZO7A 5F7UA 1TR1A 2CLEA 4ZO9A 2FGZA 3NSXA 4P8VA 2V3EA 3M0YA 3UVAA 4H7CA 2ADAA 2D2HA 2NXIA 3B3DA 2ZFAA 3KVMA 2ZRUA 1V93A 3RAOA 3VKDA 1GHSA 4LS0A 4BWLA 1J0IA 1KM2A 2QDDA 4IGSA 1QOQA 1F8IA 1IEXA 4QE4A 5EY5A 4GNVA 4LYRA 2E25A 5GVJA 2WKJA 2V2HA 5C7VA 5LSMA 3TQVA 2AL1A 4QJ1A 4X3ZA 1UWSA 4LVGA 5LHFA 3S5ZA 3CHCA 1YNQA 4HHPA 1XSKA 1W9XA 2IXVA 4WJ8A 2VOMA 3EMQA 5EMKA 2PDQA 5FESA 4PTDA 1CZ1A 1QASA 2GJXB 5BXTA 1TB3A 2PP0A 1E1EA 1NQ6A 1ME7A 4F8XA 1B3YA 1Y65A 2X1IA 1VFSA 2WHJA 3AJXA 4FNRA 2DU2A 2NQJA 3CTLA 5AYBA 4PEKA 4MUZA 3TJ4A 4PMVA 3KUMA 2PC4A 1P43A 1ZUAX 3VC6A 3CZEA 4MY8A 3TQPA 4OGZA 1YDOA 4HU0A 3BTNA 2VFGA 2QDGA 1C8VA 4O1CA 1FWCC 4HJWA 2PLJA 2PDJA 3HGJA 3SR7A 2WWDA 1N8IA 2ZDRA 1HXJA 1KQYA 1CNVA 3LBMA 3SSZA 2Q09A 3S1UA 2DSKA 3OZPA 2WOQA 1V5XA 4D6IA 1B4KA 2R82A 5CAKA 1EKOA 3V16A 4TVDA 3UYIA 3PTDA 5EFDA 5LNRA 1B3OA 4IISA 4C6LA 4LSBA 2YDSA 3TIMA 1ZL1A 2HSAA 1EP3A 3WH6A 3O1NA 1W6TA 1Z48A 3ZXWA 3IJ9A 1ZBKA 1A5NC 3V35A 4HNVA 1F5ZA 1XKYA 4AHQA 2OODA 2E09A 1KXHA 4OBSA 5CBBA 4K68A 1GJWA 5LNSA 4GZJA 1V7AA 1HVXA 1H2JA 3VI2A 4ZO6A 2BFGA 4AIEA 3SCQA 2D73A 3SGGA 1VFUA 1IEVA 3WLKX 3OBKA 3TZFA 1O4UA 5CC3A 4UQEA 5GJPA 7A3HA 3AQUA 5HUOA 5AY7A 1H5VA 1POJA 1DTUA 3JS3A 3PAJA 3RCNA 1BVNP 2FFIA 3WJZA 1WDRA 2YCIX 2BGQA 3UWVA 1F05A 3DXIA 2QCCA 4JFUA 3AYRA 5BXSA 4GO9A 1ONXA 4G7EB 2XH2A 1Z69A 5CPSA 2NV1A 3BV4A 4UQBA 1TPC1 4H01A 4U2YA 2E4TA 2O7QA 4BR1A 4OUEA 4I9JA 2W9MA 1NFPA 2F6KA 3DC8A 3WD2A 3DG6A 2WZIA 3KAOA 4S3CA 3GH7A 4LALA 1MYRA 4QX4A 1VBRA 3WQGA 4M7TA 1IWPA 5DXXA 2PMQA 4JICA 3TN6A 1QO5A 1ECEA 3R0DA 2UY5A 4ZQNA 3ZVHA 1JAKA 4FIQA 1MWOA 3BLEA 5EB8A 2GK1B 5CLTA 2FDMA 4QGCA 2DSUA 1BTMA 1SZRA 4B4FA 3L4TA 4YTTA 1IR1A 1VB9A 2A6NA 1J6OA 3FCPA 3FK4A 3C2EA 4V28A 2ZRXA 1TV3A 2QHAA 1Q66A 1VYSX 3KXQA 2GUYA 2CFFA 3U48A 4JEQA 2VWSA 3L4ZA 1XIHA 3ZR5A 4N4PA 3WEZA 1M7JA 4A8LA 4W9TA 2NLIA 3W1RA 3VD7A 3EKLA 3IIOA 1NOFA 3ICJA 1JZ3A 3R58A 4WXZA 3MA8A 2QNEA 1CXFA 5A6LA 3WL1A 1LRTA 4QG8A 4UTWC 4UTMA 1DHPA 3HURA 4P61A 4PR4A 3CZ8A 1DJQA 1FWEC 4J2MA 1HT6A 4ATLA 1QI2A 3TSDA 4O19A 5I2UA 2FPVA 2XGZA 5TNVA 2Z2AA 1EDGA 1B54A 1VJZA 4UQ9A 1V79A 1QOPA 2CLPA 1IT7A 1J2WA 4PYSA 5AHEA 1W3IA 2C0AA 3ITYA 3BMWA 5G1MA 3UZXA 1R5YA 2PUZA 4LXFA 3I10A 3VE7A 4E4UA 2G4JA 1TA3B 3DDMA 1Q6DA 1M1BA 4GNJA 1E15A 3FVMA 4DJED 1JF6A 2Q02A 1D8WA 2WSKA 3ZLFA 4DUXA 4HZMA 3L0GA 2BTMA 4FNPA 4H9YA 1RCQA 4D8LA 2EJAA 3WENA 5FA5A 5TAOA 1KBLA 1MW1A 3GY1A 2QF8A 1HJXA 4KRUA 3NDZA 1QI0A 1Q65A 1XYZA 3GU2A 4LBUA 2IPWA 1GQKA 3T05A 3AFBA 4IMDA 3VOHA 3ZZ1A 1FDJA 2OGJA 4S3GA 2B7PA 4MB3A 1E6RA 2GPTA 3IACA 2OX4A 1AODA 1GVEA 2FH6A 2QUNA 2ZBTA 1QPQA 3B06A 3SQLA 3LHVA 2Y70A 3VIMA 1YNYA 3UESA 3CUIA 1ADDA 4IIFA 3B8DA 1RALA 5D09A 5FJIA 2QJNA 4GCXA 5AZ0A 2OO6A 3KL0A 1JRCA 2WZTA 5AFDA 3EKGA 5CPLA 4XSLA 4DPPA 1QUMA 4QM1A 1FWNA 3AAMA 2UY2A 2X41A 1X1OA 2OYMA 4LUIA 1C90A 2G95A 3S47A 4MJ4A 3N4FA 1AD1A 1BXCA 1K1DA 3PG9A 4YPJA 3S1VA 1TV4A 3UYCA 5BMXA 1ZHAA 4H41A 4WSJA 4JFWA 4WZHA 1YTKA 1JNDA 2I7GA 1RQBA 2WMFA 1ADSA 1EBGA 3JZUA 4LS1A 2J13A 4B4HA 4F79A 1ZAJA 3AIBA 5JBFA 5A2CA 2JK2A 5B7ZA 2YFOA 3QV6A 3R25A 3VKBA 2BOGX 5J04A 3RFAA 4O0QA 1TJ2A 2GVYA 1E70M 4AW7A 3U2CA 2NT0A 3K1DA 3EOSA 4H8VA 3VNMA 5D38A 5DCEA 1CTNA 1U2YA 1GEQA 2WXDM 3L4WA 4WIWA 5AHMA 3LHWA 4MGGA 4MIMA 3TMLA 4LRTA 4FMVA 2A5HA 4X63A 1M68A 4NRSA 2YZ5A 1OC5A 4QG6A 1DBTA 3T0BA 1CDGA 3QM3A 1E73M 4JPGA 1HKKA 1PDZA 1K6WA 4CVWA 4IH3A 3BSGA 3SZ8A 3BARA 3OU8A 3WQDA 3QXBA 4ZA0A 5G4EA 2QJGA 1LF1A 5A6KA 3P0XA 3CB3A 4MDOA 4GCAA 1O5RA 4R7JA 4V1YA 4XAPA 2G4FA 4LUSA 4OUIA 2VEMA 1XM3A 3NJ3A 2XM1A 1VBUA 3MHUA 2YA0A 4G8TA 1MW2A 1A4LA 3L5MA 4XUYA 3VNLA 1CCWB 4CGTA 1KCLA 3LGDA 1Y5VA 3M4HA 3WQEA 3BJFA 4B5NA 3BMXA 1UWAA 2Z27A 2H6RA 2YA1A 3H55A 3C8NA 3KL5A 3GU9A 3N2CA 3EDFA 1YRRA 4O14A 3HPXA 1PB0A 4JTJA 3UD6A 4CCZA 1KFJA 2RUSA 4JOMA 4OT7A 1R9YA 1DIDA 2H3DA 1H49A 4GX8A 4US5D 3BV7A 1D2KA 4WEVX 3WCZA 2OWCA 3SJNA 1SYTA 4FPSA 4JNYA 1PX8A 4X60A 3PZIA 3RITA 4F66A 4K3ZA 4MWAC 3E2QA 4K37A 3VMPA 4DIAA 3SY5A 4WX2A 1VCVA 3CXOA 3NFUA 3HG3A 2WJDA 3OLDA 2PP1A 1RLCL 1U1JA 3HU7A 2VEIA 4FF7A 1OFDA 4W7VA