4M5PA

Oye2.6 y78w, i113c
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
404
structure length
404
Chain Sequence
SSVKISPLKDSEAFQSIKVGNNTLQTKIVYPPTTRFRALEDHTPSDLQLQYYGDRSTFPGTLLITEATFVSPQASGWEGAAPGIWTDKHAKAWKVITDKVHANGSFVSTQLCFLGRVADPAVMKTRGLNPVSASATYESDAAKEAAEAVGNPVRALTTQEVKDLVYEAYTNAAQKAMDAGFDYIELHAAHGYLLDQFLQPCTNQRTDEYGGSIENRARLILELIDHLSTIVGADKIGIRISPWATFQNMKAHKDTVHPLTTFSYLVHELQQRADKGQGIAYISVVEPRVSGNVDVSEEDQAGDNEFVSKIWKGVILKAGNYSYDAPEFKTLKEDIADKRTLVGFSRYFTSNPNLVWKLRDGIDLVPYDRNTFYSDNNYGYNTFSMDSEEVDKELEIKRVPSAIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords NADPH dehydrogenase
publication title Residues Controlling Facial Selectivity in an Alkene Reductase and Semirational Alterations to Create Stereocomplementary Variants.
pubmed doi rcsb
source organism Scheffersomyces stipitis
total genus 157
structure length 404
sequence length 404
ec nomenclature
pdb deposition date 2013-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4m5pA00
1KM2A 1SZGA 3GNDA 3EWWA 4K7YA 4Z1BA 1GYNA 1BTMA 3NL2A 3P8IA 1MSSA 3P84A 2A1YA 3B4UA 2C1HA 1GTHA 1SZEA 1BKSA 1XDMA 4RZ4A 1OFAA 4K37A 5CZSA 2H3DA 4JY8A 1BWLA 4UNLA 5AYZA 4Z08A 3FJLA 4BF9A 4EF8A 5TBOA 5HINA 1KBIA 4UUIA 2EKCA 3PY2A 4UNKA 4JIQA 1H63A 4LTSA 3L68A 3L0NA 4M7TA 4N4PA 3WJYA 3I7QA 1OFPA 2KZHA 1VCFA 4FXRA 1ML1A 1PHQA 4N02A 2EPHA 5E1QA 3GR8A 5L9FA 1QDSA 3SJ3A 3TUUA 3BW4A 5AYYA 1MZHA 2V9DA 3W7EA 4GE8A 3MP3A 3FS2A 1S3HA 3G1VA 1K8ZA 4WOQA 4QNEA 3H54A 4ADSA 3U8GA 2WPBA 3AO0A 2XN1A 4HPXA 2A21A 4O19A 3M16A 3B04A 4NU7A 1KV8A 3HG5A 3HBLA 2WKJA 3GXTA 5AN7A 4ZQOA 1G6CA 3O05A 1SW3A 1LP6A 3W7IA 4OU1A 4O14A 4KWVA 4JTJA 1P5BA 4MUZA 1VCGA 4UTMA 1J2WA 2V5LA 3LV6A 1JRBA 4DEFA 3NPXA 1EP2A 2A7PA 1EWEA 2ZTKA 3WJXA 2XN2A 3MYPA 3CEUA 1TPVA 7TIMA 1H5YA 5DY3A 4LVAA 2A0NA 3T40A 3OEXA 1L6SA 3SY5A 4KKXA 3DKJA 1T99A 2HS6A 3GAKA 3LHYA 3GKAA 1KM3A 3E9AA 4FNPA 1Q3NA 3S42A 1TPDA 3N9SA 3LERA 1EPXA 4TR9A 3W1XA 1SO4A 4AHQA 1H1ZA 2Y7GA 3VFLA 3MMTA 2YZRA 1W3TA 4PCFA 1QOPA 4HN4A 3KRZA 4EVZA 1P1XA 1IGSA 3S0CA 4JTHA 3OIXA 1WOBA 1DQXA 1OFQA 1OF8A 1K8YA 1KW1A 4FIQA 4M7SA 2B7PA 1QCWA 3N19B 4HNVA 1AW5A 2FQIA 4ALDA 2ZZ1A 4DPQA 2I14A 3TSDA 4XBSA 1YXYA 1VCVA 3QF0A 5DCBA 1GQNA 4KWWA 2FPVA 3I68A 3BW3A 3C6CA 1W5QA 3BVJA 5L6UA 4QISA 3LI0A 2ZFAA 4ORMA 2NV2A 4OHQA 3UXAA 1C29A 4A21A 2J9YA 3O15A 2BLEA 2QJGA 1HFBA 3TR2A 1N55A 3Q58A 1OFEA 1TMHA 1GYLA 4KFOA 4O13A 3RNDA 3HGRA 3PG9A 3O6YX 1VGAA 4S2BA 1A5SA 2BTMA 1UUMA 5A8GA 3FA5A 1KFKA 3LCWA 4E2BA 5D33A 2LLEA 4LUIA 1LRQA 4QNWA 4NX0A 1R47A 2C6QA 3HG4A 2WSYA 2DZTA 1H1YA 3QZEA 4RZ5A 4EIVA 5CPLA 4FNQA 2V2HA 1VZWA 2DJLA 2HTMA 4RX0A 3C2EA 1KFCA 1OVDA 1SO6A 2I9EA 1JQVA 1XBYA 2QUUA 1JCXA 1N7KA 1PE1A 2BWGA 4DO6A 2QCGA 3FKKA 1Q6RA 3QH2A 3FOKA 3C4UA 1R2RA 2ISWA 5A5WA 4K7VA 5EBUA 4O0KA 4UTIA 3TXVA 1I2RA 1ONRA 2Q8LA 5MHBA 1G69A 2Y61A 1THFD 4JTKA 3L2IA 2E6FA 1JCLA 2GUUA 3DHFA 3DKLA 3W1LA 1FBAA 2R14A 1W54A 3NDOA 3LTSA 2YFOA 4I7UA 2JK2A 2P0OA 2X1UA 3D0CA 1CW2A 3JR2A 4MIMA 4FHAA 2CLEA 1SZNA 3GAYA 4LUJA 3CQ0A 4K8HA 5U7SA 4NQ1A 1KTNA 4XTDA 3QW3A 3SECA 4O12A 2R91A 3MBDA 4M5PA 3W7MA 3CM4A 1XL9A 1VLIA 4NJGA 1W31A 3W75A 1HL2A 4JS3A 1S5VA 2QJHA 4UTUA 4K39A 3B0VC 3NPVA 3W7PA 3QW4B 1W5OA 4M6VA 4CQ9A 5D32A 1MO0A 3DHDA 1OX4A 4RK8A 3ZWTA 1WV2A 2W79A 3NL5A 3NPWA 2OJPA 4O11A 3WJSA 3OHIA 5LGXA 2VFGA 3W1AA 4M19A 1OFRA 1X7FA 5HUPA 3KRSA 3C2FA 4FO4A 4MJZA 1VLWA 2Y70A 3KVJA 1I2PA 1SSDA 3W7GA 4O4VA 2V81A 3UWZA 1B9BA 1B57A 2Z2UA 3GXNA 5HR7A 1XBZA 1ZFJA 4NNCA 2TSYA 2WNNA 1NVMA 2E09A 3FLUA 1LRTA 2ZZ3A 1YXDA 1XM3A 3SZ8A 1H50A 4BWLC 1ZAHA 2NXIA 5GVJA 3UWVA 4QSHA 5LHEA 2A6NA 3A5FA 5CPNA 5AYXA 1M6JA 4JD4A 4B5NA 4MLRA 3H55A 4QITA 2Z6JA 2Q3RA 2VEKA 3UYCA 3G1FA 3THQA 4IPJA 3EWBX 2X1SA 3BG5A 1L6WA 4N9EA 3UPBA 3I7RA 3E49A 5CPMA 2R8WA 1RQBA 3RF9A 3LHTA 3PBYA 1M7PA 1GOXA 4ICNA 3TE9A 1G7VA 3IVSA 3SGZA 3A21A 2ZRZA 3DZ1A 4DELA 4UFJA 4IGHA 4LV4A 2X16A 2C13A 3HGOA 4PA8A 3A5VA 4GBUA 3T78A 4JTGA 4RLIA 3DXIA 2OZ0A 2HS8A 1EWDA 1H7RA 5BOOA 2YSWA 3ABQA 4IMDA 2X30A 1CX9A 1R46A 2NZLA 3L9CA 3NA8A 1GVFA 4UTLA 4X2RA 4NX5A 1F7BA 1KM6A 1SPQA 3W70A 1P0NA 3UWQA 3EWUA 4XTIA 4OE7A 2IQTA 3DGRA 3MHUA 2D73A 5LNVA 4WUIA 2FJKA 5D30A 5D2YA 2DZPA 4ZL1A 4K36A 5F1VA 5KITA 4RZ6A 4EOUA 2NX9A 4L4LA 1TREA 2E6AA 1OX4B 5BMWA 3M47A 3KVLA 3WJWA 4BI6A 4ZQNA 5HWMA 4MYAA 4O50A 3A9IA 1JJKA 1NAL1 3PSWA 4QIUA 5HJLA 3QPYA 1I2QA 3LB0A 1TV8A 2BXVA 3P80A 1GG1A 4LT9A 1NF7A 3R8RA 5KZDA 1L6YA 5DY2A 2GQ8A 3RK8A 1GVOA 3GKFA 2E6DA 1SO5A 1YADA 4UIOA 2QUTA 5HULA 2G96A 2WV8A 2E68A 5EL1A 4Y6GA 1UASA 1ICPA 1TQJA 3FJ6A 4GRSA 4O1AA 1Y0EA 3N3MA 4DBDA 3MYOA 3G1HA 1J5TA 3R2GA 4JIPA 1F5ZA 1IXOA 5I3HA 5LSMA 3GIYA 3IVTA 1H60A 3NQ2A 1JQXA 3TQKA 5SWUA 4GWEA 4R34A 3W2NA 3W7OA 1GZGA 3FYOA 5D05A 2QJIA 4I7WA 2QDGA 1PCKA 2FIQA 2GJLA 3C2RA 5K4ZA 2VEIA 2CW6A 4O1BA 1KLZA 4IX2A 4BI5A 4MYXA 1W3IA 2C19A 3CIXA 2RDUA 4MY8A 1W5MA 1W1ZA 2ZZ2A 3HQ1A 3DH7A 2B0MA 4R33A 4MFEA 3KVMA 3GVGA 5TQLA 1BWKA 3PS7A 5IBXC 1GTEA 1OYAA 3NG3A 3SSJA 3L0GA 2FTPA 3OBKA 3TQVA 4K38A 1DORA 4N2YA 5CSSA 3A22A 3TJLA 1B4EA 1QNVA 4S2CA 4WOZA 5C2XA 3MJYA 6TIMA 3NQEA 3TA6A 2QEZA 4UTWC 4HNTA 3EX3A 4GNJA 3S1WA 2C16A 4ONVA 3FKRA 4O28A 1TTPA 3IGSA 3RU6A 2ZZ7A 1EUNA 3O16A 1X8FA 1OFOA 3LI1A 4I9AA 1ZJIA 1G4TA 1KFLA 3LXAA 5K9DA 4EWND 1G7UA 1YTDA 1F6KA 2PCQA 1M7OA 3E02A 1LLZA 4K6AA 1TSIA 2RKXA 2UV8G 4UMCA 3S5YA 2BX7A 4JY9A 5H91A 1GVQA 5LGZA 4LW7A 2QCDA 3L21A 3IGXA 1MEIA 1EB3A 1K7FA 5J5RA 2AGKA 4JX4A 2FPYA 4N9BA 1FWWA 3EXSA 1TYGA 1VC4A 3P5YA 3ABOA 2ZBTA 3TX9A 1LCOA 3PUOA 3QM3A 1XI3A 1YPIA 4UC5A 2TYSA 3BGGA 3W1RA 3EX4A 2WSRA 3QMSA 2NUYA 3RLVA 4DF1A 4JYDA 2Y7FA 4FNTA 1KTBA 3ELFA 3TCEA 1FXPA 1KM1A 3R89A 1TJPA 3B0PA 4H4IA 1JULA 4C1KA 3HIJA 1L9WA 4MVAA 1XUZA 4UCGA 4Q4KA 3A24A 1R30A 1SFJA 1YYAA 3KOFA 1EIXA 3STEA 5FEPA 3KXQA 4K8EA 1W37A 2DJXA 3NNTA 5F2IA 2E5CA 4WXZA 3CB8A 3W88A 5LNWA 2CLLA 2ZZ4A 3W2LA 2QAFA 5AHIA 3R5EA 2ZCGA 3VNDA 3B06A 1WQ5A 2YX0A 3LM7A 4U4MA 3S6DA 1RVGA 3N2XA 4TU1A 1ALDA 1PIIA 3QPZA 3R12A 1A53A 2C14A 4UMBA 1K02A 1TTIA 4IOTA 3QYQA 3IIXA 2W0UA 3IVUA 4MKNA 3W7RA 1H7WA 4LOCA 3T44A 5EYWA 3ATZA 2ZZ5A 5FEZA 2JBMA 3NO5A 3FEMA 4QAIA 3GX9A 5KTLA 4XKYA 1D3HA 5LKYA 4P2VA 3NQ8A 4UXDA 1K7EA 4A29A 2CLIA 1K3UA 3TFXA 2YFNA 3ZWSA 3H53A 4O53A 1K03A 4LV9A 3LHVA 3LV5A 1H62A 1A50A 5DBTA 2WQPA 2HSAA 2QCDB 4CNOA 3W23A 3PG8A 4JTSA 1R2TA 5F4XA 3NOEA 1UUOA 3ANYA 1ZALA 1QOQA 4LVFA 4DQWA 3SIZA 3W84A 3W7QA 2X2GA 3NQDA 5AC6A 4WZHA 3W2JA 1R2SA 1F74A 1Z48A 1ZY9A 4OV4A 3PC0A 1TIMA 2ZRYA 3JRKA 3NQVA 4HIBA 3G1YA 1TJRA 3TC6A 3DI0A 2F7FA 1WA3A 3AJXA 4YCPA 4XQ6A 5AHEA 3QMTA 3M5YA 4NXSA 4TMCA 1GPWA 1KLYA 5I3IA 5G2HA 3HB9A 8TIMA 1YTKA 3W7DA 1X1OA 2ZA3A 3C2OA 1H7PA 5G4EA 4HNUA 2R94A 1LOSA 3KVKA 4RKAA 1FDYA 2A7NA 1LOQA 2CLOA 4PFMA 3W74A 1Q6OA 2Y63A 1DQWA 4LVBA 1SU5A 2OX1A 4QJ1A 4RV8A 2ISVA 3KHJA 2CWNA 3W3OA 2Y89A 1SZFA 1YPFA 1QFEA 5FF4A 2YGYA 5H2ZA 1KM4A 4ORIA 1E51A 3DI1A 1VR6A 2E6YA 1WX0A 4BR1A 4AWTA 1QPOA 2V8ZA 5F1UA 2WOQA 4W9TA 2A5HA 4WJEA 3TNOA 2B7OA 4MPQA 2GQAA 2H3BA 2V82A 2DORA 3G18A 4WD0A 1T96A 1F76A 2EF9A 3EXTA 1D3GA 4JYFA 4XKYB 5HWNA 5D2WA 1EA0A 2DU2A 3MHFA 3HOJA 1K7XA 3U2OA 5F4SA 3G1SA 4Z0SA 4O1CA 3M5VA 2WJZA 1YDOA 2GJNA 4ADUA 3P74A 1MEHA 3V75A 1DKWA 3FFSA 1QR7A 2Y88A 1RZMA 3UZJA 5KINA 1W8SA 3UWUA 1KFJA 4Z1CA 2J9XA 1CI1A 3M0ZA 3CWOX 1JCYA 3HMJG 2JKEA 2RHGA 3CTLA 5F2GA 1VH7A 1H7XA 5TIMA 5EA9A 4KFPA 2P1FA 2W6RA 3MI2A 3C3NA 4IMEA 1ME8A 1A5AA 2Z1BA 5FF0A 5FF3A 1D9EA 4LVGA 4Z0JA 1FWSA 3K30A 3IIVA 4GFSA 5AC8A 3HF3A 3NZRA 3QFEA 2CU0A 4UFIA 1OHLA 2YR1A 3SW6A 2YPIA 1HG3A 1O5KA 2NLIA 3QRHA 2V0TA 1YTEA 1IIHA 3RLUA 1WDWA 3KRUA 1HTIA 5CG7A 2V30A 1ZHAA 3MWAA 3DFNA 3TMQA 1DJNA 1YLVA 3W73A 1IF2A 5DN1A 4R7JA 1TPWA 1JUEA 3LCHA 4A22A 4E2DA 3HPXA 4CQ8A 4FB7A 3N2MA 2WNQA 2CLFA 1N8FA 3G1DA 2ZTJA 1HUVA 3GZ3A 4JX6A 4UTTA 1V7YA 2NXGA 4PODA 3TFCA 4DBEA 5KMYA 2AQWA 3BLFA 4DO5A 1VYRA 3MI3A 3EX1A 5G4WA 4JDYA 3CU2A 1PV8A 2QR6A 1TCDA 2WO5A 3LOTA 1QMLA 2QCCA 3S8HA 1RQEA 2OT0A 3HG3A 2G97A 3NM1A 2CFFA 2A85A 3W7JA 3LRLA 1B4KA 3W07A 5D2XA 1WBJA 3S1XA 3C2VA 1OX6A 2P10A 2Q3OA 3TSMA 3LBCA 3OG3A 3GB6A 3GDMA 4UTHA 3LRMA 1QPQA 1LRNA 5DXXA 3G0UA 5CPOA 2A7RA 4YMZA 3YPIA 2YCEA 3FIGA 1G4PA 1NEYA 3N14A 5EKYA 5K4XA 1XBXA 4AWUA 4JGDA 2OT1A 4AHOA 2PRHA 3GR7A 1PL9A 4JTLA 3CEPA 4TX9A 3W7CA 4NNBA 1RR2A 1LOLA 1SW0A 4QM1A 1FX6A 4IXHA 4JEQA 4TIMA 5ABTA 4PL2A 3G24A 4HT3A 1L2UA 3TW7A 4MY1A 4BI7A 1KFBA 4OQVA 1NSJA 2F84A 4N9DA 2A2IA 3NM3A 1S5TA 3L67A 4X9SA 3UPWA 3W7KA 2C0AA 5G2IA 3B0UX 2GOUA 1TRIA 1EEPA 3OVRA 3STCA 1U5JA 1O95A 1FDJA 1QO2A 3C0JA 3SI9A 1Q6LA 3W7NA 3MW7A 4YLWA 1FWNA 3MO7A 2WNZA 1I4NA 2ALDA 3G8EA 4HKPA 5FEXA 1O94A 3EKLA 4IJBA 3ZFHA 3TIMA 4WY0F 3IGUA 3V1PA 4NXKA 4CQAA 1K8XA 1JCMP 4UFMA 1OFDA 5C55A 1HO4A 3DFPA 5KZEA 4NT0A 1XC4A 3N34A 2QCMA 4YCOA 3R13A 1QPNA 3CT7A 2NX1A 3WFAA 3UQNA 3W6YA 3G22A 3QJAA 1AW2A 5C6MA 2ZDRA 3NR0A 2Y6ZA 1EP1A 3L66A 1OABA 3UY8A 3KAOA 1VPXA 3QSRA 3O8AA 1ME9A 5EMUA 2NUWA 2NX3A 1WXJA 2GVGA 1ZAJA 2QCLA 3S5NA 2EGZA 3W1TA 1W0MA 4YXGA 5AOUA 4ADTA 5K2ZA 4J9JA 1C9DA 2GVLA 2NUXA 5C54A 2DZWA 3NQ7A 3P82A 3F4WA 4YL2A 1TPFA 2C18A 2YW3A 3G1XA 3G0XA 3LCGA 4NZJA 3TAOA 3W2MA 2V2CA 3DAQA 5AC7A 2G5WA 1TRDA 1FUYA 2JKPA 4UFLA 1W5PA 5K7JA 2ISSA 3GXPA 2QAPA 2PC4A 3WK0A 4XUGA 3ZR4A 3TC7A 2JGQA 1QAPA 4M6PA 4LU0A 1JUBA 1SQ7A 4GUIA 5HWJA 3ATYA 1VS1A 1WBHA 2TMDA 1XXXA 1DVJA 4HHPA 4ZQPA 3GDLA 3L5LA 2NWSA 2XN0A 3TJXA 3CLMA 3GDKA 5CGQA 3VI2A 2PRMA 3W87A 5KZMA 3I6RA 3W85A 3O07A 3O6CA 2QF7A 2RH9A 4JDBA 3UY7A 1RD5A 3W1PA 1MXSA 4OV9A 2Z0IA 1TPEA 1I45A 3SGUA 2Y62A 1OFBA 1TB3A 1VYSX 3PBVA 2VFFA 4XZ9A 2CZEA 1GG0A 3NQGA 3NQMA 3QSTA 2QUVA 5BNKA 5DBUA 1FY6A 3Q2DA 1VHNA 3LGEA 5BW6A 3O63A 3LCIA 3TKFA 3E12A 3BG3A 4O15A 2YYUA 5EPDA 3NL6A 4FX6M 1FWRA 3TAKA 5D04C 3DFOA 4LS1A 5F2LA 4NNAA 2ZYFA 2Y85A 3S5ZA 3HPZA 3LCXA 3P61A 4WY0A 1A5BA 5DELA 2DZVA 3W1MA 1SFLA 2HMCA 1RPXA 2I1OA 5E0KA 4JTUA 3OVQA 3UWWA 3LHUA 3IIOA 4MJMA 4CNNA 3VKJA 2H6RA 2QKFA 2Y7DA 3CHVA 3HO8A 3PBUA 1QWGA 3MP5A 1O4UA 1PCWA 3IEBA 5HUOA 3TV8A 3HJZA 3PWAA 6ALDA 3LHZA 2Y7EA 2B7NA 1SUXA 3MHGA 4IX0A 1S5WA 1O60A 1C8VA 2DZSA 3TROA 4X3ZA 2TPSA 3PULA 5EY5A 1AW1A 1ICQA 1I8JA 4AMAA 1SO3A 1ZCOA 4GUGA 5AFDA 1VHCA 3F4NA 1TPB1 3G3DA 1TV7A 1IXNA 1IXPA 4UTKA 1LBMA 4PL1A 3EX6A 3NYZA 3IRDA 1KFEA 3M9YA 1VQTA 4NJIA 5CKSA 3W1UA 5D02A 4AXKA 5D09A 2CLMA 3NL3A 4PC8A 3I7SA 1A5CA 2CLHA 2ZA2A 2NV1A 3Q94A 4JYEA 3W1NA 3ABSA 1GJPA 4LRSA 4M6QA 3BLEA 3BPWA 3N73A 4MY9A 5D38A 4TMBA 3L5MA 1W56A 4RR4A 3IIZA 2OMAA 4CLMA 3GYEA 4LS0A 3MP4A 3W7LA 3PF3A 1PHWA 3EWYA 1KM5A 1XCFA 1LZOA 4HPJA 4NJKA 1WOAA 1JCNA 3VE9A 5FI8A 3NQAA 2H8XA 4PEKA 3CWNA 5DCDA 1I2NA 4S1FA 4UFKA 3BGJA 2PURA 4E38A 4O1DA 4O16A 5D03A 3M7WA 3F1QA 2BSLA 4FIRA 4A2SA 4LS2A 4WY0B 2G95A 4IMGA 4JXCA 5CZ0A 5HMSA 2XFWA 4N9CA 4O4WA 3CC1A 2GVJA 3TW6A 1LBLA 4UMAA 3NGJA 1PS9A 4MZ8A 4POCA 4UR8A 1P4CA 4CNPA 1G4EA 4MFDA 1EUAA 1SSGA 2YXGA 4FF7A 5G2WA 1TQXA 3TDFA 4FNSA 2CLKA 5K9CA 5KSWA 3L0KA 1H7OA 5D2VA 1HO1A 5AHNA 5CSRA 1TPH1 4OGZA 1ADOA 4CCDA 2J24A 3ZS4A 3HG2A 4JTTA 5CZTA 1FCBA 2A4AA 1TTJA 2BZNA 4Y90A 1I2OA 3W2KA 3LXCA 3B03A 1T0OA 3HGJA 4AHPA 5LHFA 4HSNA 5I3JA 1VRDA 3MBFA 1TO3A 3NQCA 4DF0A 1G67A 1GT8A 4MOZA 4E0CA 3EKZA 1AK5A 3BK0A 3M41A 1UB3A 1GWJA 1VYPX 1GVRA 2CZ5A 2H8ZA 1PVNA 1SW7A 1LDCA 3NXFA 5I3KA 3O06A 4DO4A 5I3FA 1UJPA 5AHLA 2ZQ0A 2RDWA 3EWZA 2O7QA 1Z42A 4N6FA 3WK3A 4IMFA 5AHFA 3M5XA 1Z41A 2YDAA 1DHPA 3NPUA 4GXMA 1JR1A 1RQHA 3ABRA 5K9XA 2J9ZA 3S1UA 1H7NA 2E5BA 3BV4A 5FF7A 4G1KA 1P0KA 3M44A 3GK0A 4BWLA 4HSOA 3L65A 1F05A 4LC8A 2VFDA 3S1VA 1UCWA 5HNRA 3NAVA 4Y9AA 2PRLA 4QQ3A 3TMLA 4UTJA 4MZYA 4NVTA 1WAUA 2C15A 4JTFA 3M43A 4FEZA 4JR5A 4LY8A 5T26A 2H90A 2ABBA 1XDLA 3EWXA 1LTDA 2DP3A 2FDSA 3W9ZA 3T7VA 2Z6IA 4Z1AA 4A2RA 3BLIA 1KV5A 1FCVA 5LNUA 2E5DA 3NEVA 4RCXA 3UD6A 3N9RA 5AHMA 1H51A 3PSVA 3T55A 1AMKA 1ICSA 2J27A 2PE4A 1DJQA 3M1ZA 1LM1A 3P5ZA 1KTCA 5K3VA 3PM6A 2YYTA 2VOMA 4FNUA 4N4QA 1XFBA 4RXGA 5G1TA 1JRCA 4CCEA 4WQ6A 4AEOA 3LTPA 1U83A 2V2DA 3W86A 1YDNA 3EB2A 4ZQMA 4OWGA 4LC6A 2QCFA 4EF9A 3O1NA 3CIWA 1G4SA 2RDTA 1T8XA 2ATSA 3DENA 2B4GA 2X1TA 4LVDA 5I3GA 1ZENA 3UNDA 5HQEA 4AWSA 2ZA1A 3TXZA 1YDVA 2X1RA 5G1YA 3CPRA 3F03K 3LHWA 3MUXA 3I65A 5J5DA 4GC4A 1XBVA 2VC6A 3PUDA 3HGSA 2TRSA 3GLCA 5DCEA 3LCLA 3TQ0A 3W22A 2FB2A 3GNNA 4P61A 1DBTA 3QQ0A 3SFKA 5LNSA 3Q37A 5U4NA 3C52A 4R53A 1AG1O 5BRBA 1WYIA 1V5XA 1DL3A 4RJEA 2VXNA 1QO5A 1TPUA 4O10A 4AF0A 2CZDA 2FFCA 2ZZ6A 4O54A 2FB3A 3W72A 3C56A 1OF6A 2FLIA 1ZAIA 1ZNNA 3P81A 4O52A 2Q8ZA 1GVSA 2V5BA 4FX7A 3M6YA 1OYCA 3DU0A 1YXCA 3NQ6A 3QMRA 1DOSA 3PUEA 3LRKA 2O7SA 2AAMA 2VFHA 3W76A 2JGYA 4FNRA 3EX2A 3LLDA 1BEUA 4PTNA 1LLWA 5FF2A 3MI6A 1JUKA 4GJ1A 3P8JA 3BW2A 1ME7A 3GDTA 5G5IA 3JS3A 4UFHA 5FESA 5IBXA 5D37A 4JTIA 2QCHA 4RXFA 3RMJA 4XBKA 3INPA 4ZZ9A 2ZRXA 2FPTA 4Y8FA 4HNNA 4N6EA 4O0ZA 3QQ1A 4DF2A 2EHHA 1XKYA 4AAJA 5C5YA 4NZFA 1X6UA 2WSQA 1M5WA 4UTWA 1IXQA 4FXSA 4ML9A 5F2MA 3B8DA 3EXRA 1X1ZA 2VFIA 3P62A 1MEWA 1NFBA 3W2UA 2QCEA 2ZRWA 4X22A 3KX6A 1QPRA 3PBWA 5FEWA 4H3DA 4IUOA 3STFA 3W1QA 2ZRUA 3W7HA 4NJJA 2NWRA 4NJHA 1OG0A 3LDVA 4XWUA 3S5OA 3GDRA 4OBTA 4JICA 1OJXA 4AH7A 4KFNA 4FX8A 5AB3A 3QC3A 3B05A 4LWWA 4TO8A 3PB0A 4OT7A 3HPSA 4LNYA 2GPTA 2ZRVA 2QDHA 4WXYA 1LROA 1OK4A 1Z44A 4AF0B 1F2JA 3O6DA 3G0SA 3DFQA 2C3ZA 1JVNA 3TK7A 5DLCA 3E0IA 3LBMA 2E77A 3L5AA 1NF0A 3C61A 3UWYA 4IXXA 1TV5A 3THAA 2J88A 3LTYA 4ZVJA 1F73A 3LX9A 3WJZA 4ZQRA 5D2TA 3W71A 3NVTA 4O57A 1VJIA 4CCCA 4Y96A 5F4WA 3OA3A 3BO9A 3BG9A 1Q6QA 4NUWA 3KFTA 3USBA 2CZFA 3RFAA 2ABAA 1AL7A 2VFEA 3TU9A 1KA9F 3E96A 4O18A 2E1DA 1LBFA 4AB4A 3NZ1A 5E93A 1FDZA 1LYXA 4IMCA 3P60A 5CZJA 4GUHA 1JCJA 4UR7A 4ZMGA 4I7VA 1LORA 4UTTC 1FQ0A 5LNRA 3A23A 1FWTA 2YW4A 4DPPA 3PR2A 3G8RA 4LRTA 3WK2A 3DFSA 1RV8A 4Q32A 4AVFA 1TPC1 3WK1A 4Z1DA 4JTEA 2B7QA 1H61A 4JNMA 5DXYA 1J4EA 3PAJA 1KBJA 3P67A 1FCUA 3LXBA 3P7YA 1W3NA 4C1LA 5HR6A 1KM0A 1GEQA 1O5XA 4A3UA 1EP3A 4MZ1A 4MLJA 1SR9A 3IV3A 1B3OA 3S9YA 2RFGA 2A6LA 3STGA 2VENA 1OK6A 1OYBA 1Q45A 3C8FA 4ZQCA 1TTQA 2GQ9A 3G3MA 1AL8A 1OX5A 4YWIA 2DZUA 4IWWA 3EEGA 3PB2A 4BK9A 3FYPA 4IPIA 1EX5A 3QEZA 2VELA 3DBPA 2DZXA 4U28A 4GUJA 2NXHA 4D2JA 2JKAA 1FCQA 2EAWA 3UZ5A 1FXQA 2OCZA 3DFTA 4O8RA 3VCRA 4H6KA 3OVPA 3BARA 3TSBA 3M5ZA 2J6XA 3TH6A 4JN6A 1DV7A 1W5NA 4GUFA 3NQFA 2VEPA 1F6PA 5LZLA 3G1AA 3T4CA 3VE7A 3W83A 4IQLA 4JX5A 1UBSA 2ATMA 1IIGA 4Q33A 3UXDA 2QCNA 4O17A 5BMXA 3IIPA 2VEMA 3LLFA 4WX2A 3SR7A 3U6WA 4DXVA 1XUUA 5IM51 3LCFA 4PH6A 2VKZG 4L4MA 4BFAA 3PVFA
chains in the Genus database with same CATH superfamily
4IIBA 1SZGA 4K7YA 4Z1BA 1GYNA 1XYBA 2YA1A 3P8IA 4ZOAA 1XLKA 3KZPA 1QOXA 1EC8A 2C1HA 7REQA 2BY3A 1MQPA 5I09A 2GGJA 5H6HA 2ZXBA 3F5LA 2PWVA 6REQB 3WQ6A 3TTEA 2PTDA 1R3TA 1LL7A 4LTSA 3L0NA 4DWSD 1OFPA 1CYGA 1PSCA 2PDUA 1FA2A 4ZB5A 3VNKA 1ML1A 1QBBA 1QW9A 3KEHA 5CGTA 2EPHA 2PP3A 5E1QA 2WPGA 1VP5A 1QI0A 4OVXA 3SJ3A 3BSHA 4YYCA 1JD7A 2V9DA 4LEFA 2BASA 2GYIA 3G1VA 3U8GA 2OQHA 3AO0A 2O55A 3D46A 2A21A 3UFYA 3EDEA 1OM0A 2HEJA 4NU7A 4B4HA 1KV8A 3HG5A 4H9UA 1B31A 3CV6A 3HBLA 4ZQOA 2HXUA 1G6CA 2YCIX 3O05A 3VOHA 4ERAA 1NWRA 1UD5A 1BYDA 1MW3A 3MKCA 4JTJA 1P5BA 4L9XA 4R5EA 1VCGA 1J2WA 3M0VA 3CZJA 3MY9A 2A7PA 4CVUA 2BHUA 3WJXA 2XN2A 5A2AA 1TPVA 1H5YA 4DI9A 1JEZA 4B5TA 4KWSA 3T40A 2EXOA 3I3EA 4MWAD 1S46A 1T40A 3AXXA 4Q4PA 3W1XA 3H2OA 2IQDA 3VIKA 1H1ZA 3PZGA 2VVNA 3MMTA 3TA9A 1W1VA 4FR6A 2Y5EA 2XH2A 4JTHA 2F6UA 4M1RA 1DQXA 2ONEA 3FJ4A 4QG9A 1K8YA 4FIQA 5HNUA 5I7GA 3OZMA 3E0FA 4MF4A 1CWYA 2ZZ1A 1EKOA 4DPQA 4XBSA 1YXYA 5XIMA 1VCVA 1XYMA 3QF0A 2PTWA 1GQNA 1XH1A 4KWWA 1KKOA 3VGDA 4OOZA 3H7VA 4LUYA 1DXEA 2OXNA 5L6UA 3CV7A 3LI0A 4ORMA 3SRDA 4W8BA 2BLEA 3TR2A 1N55A 1HJXA 2X05A 3APYA 2QIWA 4O13A 4X63A 3RNDA 1GQIA 5CAHA 4WSHA 2BTMA 5RUBA 4D6IA 5HANA 4K3ZA 4TXEA 5CQ1A 5D33A 5CPTA 3THUA 3CV1A 2C6QA 2REQA 3HG4A 2DZTA 3QZEA 4PSPA 2V2HA 1VZWA 3MQTA 3H22A 2AL2A 3NFUA 1PE1A 2YA0A 1YE4A 4B92A 4DO6A 2QCGA 3RR4A 2O9TA 1EXPA 3QV8A 4HU0A 4GLEA 3QH2A 1T41A 3C4UA 2XH7A 5JIPA 4UTIA 2UY5A 2NQZA 4Y2WA 2Q8LA 4P7OA 3URAA 4AFYA 2BMBA 3QHMA 3NTYA 1U1HA 2E6FA 3E6EA 1TX0A 3W1LA 4CQCA 2R14A 3NDOA 3LTSA 2YFOA 4H6RA 1XGEA 2P0OA 3MUAA 1CW2A 2CBUA 4FHAA 4MIMA 3GAYA 4HHHA 4XTDA 4O12A 2XSBA 3VNZA 3MU7A 3ARWA 5GNYA 3CM4A 4B15A 2PDJA 1XL9A 2BGNE 2ZX5A 4NJGA 1W31A 4DUWA 1HL2A 4K39A 1AD4A 1Z89A 4ILSA 3T0TA 3M07A 4A3YA 4R3UA 2VYOA 4HJWA 2WAGA 4H6QA 5D32A 2DT3A 3DHDA 5I79A 1A80A 3ZWTA 1VFSA 3BAXA 4O11A 3FEQA 2PDNA 3WJSA 3OHIA 5LGXA 2VFGA 3R1ZA 1PJ9A 1OFRA 3KRSA 1M41A 1U33A 3A3WA 4WSKA 2Y70A 2E67A 2NQHA 1I2PA 4IP7A 2W3ZA 3WD4A 3VUPA 3WLKX 3N3TA 3DOPA 4RW5A 1ZFJA 2WNNA 4S3JA 2W4XA 3OO2A 1LRTA 2VEGA 3SZ8A 1CTNA 1RUSA 5REQA 2VURA 2FMNA 3S46A 1LJYA 5LHEA 3WUBA 1IR1A 3LMYA 3WLJA 2XINA 3F2BA 4JD4A 4B5NA 4MLRA 2FH8A 3UYCA 4D8ZA 3THQA 2CLPA 4XSMA 3HQNA 1TCMA 1L6WA 2HRWA 3OQEA 4LAMA 5HJYA 2DH3A 2X41A 1RQBA 3LHTA 3PBYA 1GOXA 2P76A 3IVSA 2ZRZA 4UFJA 4IGHA 2C13A 3OVGA 3WLIA 1I60A 4RLIA 3DXIA 1AVAA 3AISA 2CC0A 1NH6A 4KCTA 4AD3A 2X30A 1R46A 5JIWA 2NZLA 1GVFA 4LEQA 3NSMA 4JHOA 1F7BA 3NDZA 3GTNA 2YL6A 4V1XA 1MW0A 4GVGA 2IQTA 4R7WA 4B5UA 4YTTA 1K9DA 2FJKA 5D30A 4K36A 4RZ6A 2NX9A 4AZ6A 5EMYA 3AXMA 3WJWA 4JNZA 2Q6ZA 2PDKA 4H19A 3A9IA 1JJKA 1YBQA 2Y24A 1I2QA 2WC3A 1GG1A 4MPKA 5AYIA 3VOCA 2HK1A 5CH9A 1OADA 3GSMA 4HNCA 5DY2A 2VRQA 1XG4A 4FZIA 3SQMA 5HULA 4M51A 4LUTA 2E68A 1F4HA 4Y6GA 1VRXA 1TE1A 1TQJA 3FJ6A 4O1AA 4YTQA 3N3MA 4DBDA 1XH0A 1IXOA 2FZMA 3GVVA 5H1WA 1T6MA 2GJXA 1H60A 3W00A 4PUUA 4Q8OA 3SCOA 3W7OA 1MFUA 4KCWA 5D05A 4KH2A 2QJIA 1JGIA 1OCQA 2AGTA 2EJAA 2QDGA 2YL5A 2OELA 5K4ZA 2VEIA 3SCNA 2DVXA 2J8GA 4O1BA 4DNMA 5A6MA 1GKPA 2QMJA 2J25A 5AKQA 4AZ7A 1QI3A 1W1ZA 2ZZ2A 3ABXA 4D6GA 1XLLA 1Q13A 4NAEB 5CC6A 1BWKA 3PS7A 5IBXC 1GTEA 3SSJA 3PFMA 1MXGA 1MYRA 4H6EA 1DORA 3S2MA 5CSSA 5FA5A 3TJLA 1XQLA 2BHYA 1QNVA 2YKKA 4RDVA 1PTDA 2VD9A 6TIMA 1BQCA 3NQEA 3VIPA 3EX3A 2PDMA 4GIYA 3FKRA 3QGVA 1TTPA 3MMUA 2VX5A 4UQ9A 2ZZ7A 2JQXA 4XX6A 3O16A 1OFOA 1TWSA 1G4TA 4QDWA 4PTWA 4BS0A 4WR3A 8CGTA 1YTDA 2PCQA 1M7OA 1M9HA 3E02A 3KL5A 1NQ6A 4JFTA 4HZ7A 4U2YA 2UV8G 2HBXA 3S5YA 4JY9A 5H91A 1GVQA 2Z1SA 3D5HA 5KZ6A 1A3XA 3L21A 4AY7A 5J5RA 4JX4A 1U1JA 5A95A 2FPYA 2BOGX 3EXSA 1V6VA 1LF1A 3NZGA 3P5YA 3GNRA 2C0HA 5GQBA 3PUOA 2Z00A 1YPIA 3H7UA 4JYDA 4FNTA 3RHGA 3ELFA 4LYKA 1FXPA 3ZVHB 3STPA 1AH4A 5M3WA 2INZA 2WMHA 4E8CA 3FSTA 1HGYA 2WMIA 4MVAA 3A24A 1R30A 3ECQA 3STEA 3RU8X 3KXQA 4K8EA 1VB9A 4ATLA 3NNTA 3Q45A 4GI8A 3CB8A 3W88A 2PDPA 4A8LA 3W2LA 1ZBKA 4J3VA 1R3QA 4OBRA 5IFPA 5DEZA 3LM7A 3S6DA 3WNOA 4HPGA 2ZOXA 3LPPA 2NT0A 1ALDA 3R12A 5EGRA 1J8VA 2RDXA 2QULA 1CGXA 1K02A 1CDGA 4IOTA 1QK2A 2A3CA 3IIXA 1Y8BA 3VOIA 3W7RA 3T44A 4E3TA 2NQ5A 5FEZA 3VINA 2JBMA 3AXHA 4QAIA 1ITCA 1D3HA 4EPDC 4P2VA 3WUEA 2VGIA 4JIIX 3V36A 4KEUA 2J7EA 2CLIA 3EPOA 1K03A 3LHVA 3IGHX 2QDEA 3PZOA 2XIQA 3II1A 4CNOA 3CQHA 4W5UA 4JTSA 5F4XA 1U5VA 3F2DA 3ANYA 1QOQA 3UBPC 3B40A 7REQB 3SN1A 1R2SA 3M0YA 1Z48A 5CJMA 2VT0A 3JRKA 2ZRYA 3NQVA 4HIBA 3R43A 4ASTA 2G50A 3CYJA 3DI0A 3KP0A 1E0TA 3DHPA 4JIHA 4TMCA 4PTDA 4Q6XA 1KLYA 2OU4A 2GLKA 5CPQA 1YW1A 3R79A 1YTKA 1CZ1A 3ZSTA 3ZJKA 2ZA3A 3C2OA 3OIHA 1S5MA 1LOSA 4XISA 2OLHA 4LAZA 1DQWA 1SU5A 4NRSA 2ISVA 3KLKA 3W3OA 1JDAA 1SZFA 3AMCA 3S2CA 5FF4A 1XLEA 2CZVA 3B9NA 3DI1A 2WBKA 1WX0A 1QPOA 3SN0A 4W9TA 3VNMA 2BVWA 4GABA 2Z29A 2Y5SA 3T0DA 2H3BA 3VC6A 3BCDA 3SUSA 3L23A 1T96A 1F76A 3UG3A 3K4DA 3VGFA 4HA3A 1E0VA 1TUFA 5HWNA 3GS6A 1W3HA 5D2WA 1EA0A 4HMCA 2XIJA 4AEFA 1CLKA 3N9KA 3MC5A 3V4BA 3HOJA 3BLOA 1K7XA 3U2OA 3UNTA 4O1CA 1YDOA 3V75A 2OG9A 4UTFA 1W8SA 2DSUA 1QU4A 4Z1CA 2YDQA 2I5IA 5E6ZA 2J9XA 3UG8A 1TVNA 1R3RA 3FDGA 2OWWA 2RHGA 4DZAA 3BE7A 2Z2AA 5LA2A 4C6PA 2W6RA 1E0UA 3C3NA 3LS9A 3B0XA 2Z1BA 4J3UA 1D9EA 3HA1A 1UZHA 3OPSA 1P7TA 3UU0A 3K30A 3IIVA 3N6HA 5AC8A 1B9ZA 3NZRA 4WDTA 3CHEA 4OECA 1IZJA 3WQOA 3DX5A 2VRJA 3SW6A 2XIOA 3DG7A 3EDDA 1QT1A 3N4FA 3M6DA 4IH3A 1C8QA 3KRUA 4GNKB 1F3TA 1C90A 3ISIX 2OEMA 3BOXA 1Q7ZA 4A22A 3WF3A 3COTA 4PB5A 4C6OA 1C92A 3RUBL 2D0GA 3HPXA 3L4YA 2VDIA 1GEHA 3A47A 4EXQA 3PFRA 4GVFA 3CT2A 1Q6CA 3ZLGA 4UTTA 1PIFA 3TFCA 1PX4A 3UA4A 1ITXA 1XIMA 2X0YA 4D71A 4Z17A 3CU2A 1KB3A 1XCXA 3LOTA 4C6LA 3HV8A 1W1B1 4F8XA 1ZTVA 1RQEA 5CC3A 5ENLA 1XYAA 3WQGA 2CFFA 2YZ5A 3LRLA 3DFHA 1UR1A 1WBJA 3C2VA 1FVPA 3I10A 3TSMA 3OG3A 3U5UA 4UTHA 3LRMA 1LRNA 4YMZA 3YPIA 3FIGA 2WKGA 4US6A 4PMVA 4S3BA 3TJ4A 1D2KA 1QBAA 2OT1A 2PRHA 3AIBA 3G6LA 3GR7A 1LOLA 4QM1A 3C0SA 5ABTA 1VD6A 4PL2A 4HT3A 4BI7A 3HFYA 2F84A 1RLCL 1GOMA 3L67A 4F0RA 2BFGA 4MDOA 1V0MA 4H01A 1V79A 1UC4A 1J0YA 3W7KA 3MKKA 1TRIA 4DVOA 1E1CA 1KD0A 5CEWA 1LL4A 1Q6LA 1U30A 2QGYA 1FWNA 2JEQA 2HV5A 3EKLA 4IJBA 2A3LA 4GH1A 3VIMA 1G0CA 3EYPA 4NXKA 4E6MA 4LQ1A 1K8XA 3URQA 4UFMA 1K4GA 3NGFA 2PGFA 3GTHA 2ZWZA 3ZQ9A 2G4JA 4GK8A 3WFAA 3G22A 3QJAA 3WL1A 5C6MA 2DIJA 3NR0A 5EB8A 5HNNA 2GUYA 1EP1A 1DIKA 3ARRA 3O8AA 2NUWA 2NX3A 2GVGA 2QCLA 1ZCCA 3W1TA 2Y8UA 3MCOA 4ADTA 5HOSA 1O5RA 4J9JA 1PWMA 3P82A 3F4WA 1ZGDA 2Q09A 1CGWA 3G0XA 5BCAA 1UWUA 1XYCA 2QGHA 5AC7A 1TRDA 3WLRA 2Z26A 2JKPA 4UFLA 1W5PA 3RM9A 4W85A 3F5KA 2O4MA 5FACA 4XUGA 1YEYA 3IV8A 3E0VA 2PLKA 3KOXA 2D24A 2XVLA 3ATYA 2HVMA 4FF5A 1VS1A 4CD4A 4M56A 2PBGA 2GSEA 4DJED 1DVJA 3D3AA 2DUAA 5A6BA 2OQLA 4ZFMA 2NWSA 3CLMA 1GW1A 4DJFD 3GDKA 2W9MA 2PRMA 3W87A 5KZMA 2QF7A 1DJIA 4JDBA 4AZ5A 1NARA 3ITCA 3MSYA 3BLPX 3H7RA 4J35A 2V68A 2XZ9A 4L6HA 1W3KA 4FPSA 3ZXWA 1P6WA 5DO8A 3WD2A 2ZICA 1VHNA 3LGEA 2DQWA 1S38A 3TKFA 1PYMA 1WPCA 2YYUA 5EPDA 1FWRA 3SQLA 3TAKA 4QCFA 2VHLA 2ZYFA 3VTRA 2EBNA 3S5ZA 4IUGA 4TVUA 5DELA 5AC4A 3W1MA 3S6TA 2J77A 2HMCA 3CMFA 3R0DA 3KTCA 4DXKA 1H1NA 3L4UA 3IIOA 4MJMA 1ZJHA 4CNNA 2Y7DA 2QJJA 3LPGA 1QWGA 1O4UA 1TJ0A 3WDRA 1PCWA 3TV8A 3PWAA 1DJWA 1UOKA 3LHZA 1Q65A 1XKJA 3UZWA 4WDUA 2GSJA 3NUKA 1NWSA 3I4KA 1S5WA 3WLOA 1JL8A 1O60A 4G8TA 1BGGA 2DZSA 5EY5A 3B9DA 3EOOA 2V5KA 1AW1A 2YCLB 3LUTA 4GUGA 1EGZA 1SO3A 1VBJA 1TV7A 4UTKA 4PL1A 1UKTA 4NL1A 1KFEA 3N25A 5E5CA 4CEUC 5CKSA 1V08A 1QUMA 3WD1A 1PAMA 5D09A 3ARVA 4ENLA 3I7SA 4JZ5A 5FSEC 5HPCA 4FK9A 4LRSA 4KS0A 2BXYA 4M6QA 3FHQA 4MM1A 2VM8A 4MY9A 1HKMA 4MTVA 1RLDA 1W56A 4AWEA 3FGCA 4CLMA 2ALRA 3LGGA 1XLJA 4GQBA 4LS0A 3MP4A 4KRUA 1KM5A 3IRSA 3OTRA 4HPJA 4Z2HA 4G7EA 4NJKA 2FFIA 3GXFA 2H8XA 1GQLA 5DCDA 5T8GA 2VJXA 3T9PA 1V03A 2PURA 4E38A 5D03A 4FLRA 3F1QA 2O9OA 4FIRA 5CZ0A 2HJPA 2P3ZA 1P43A 2QF8A 3WKZA 2QV4A 1LBLA 4NSBA 4LUSB 3S9IA 4RDZA 4CNPA 1XQKA 3XIMA 1B2YA 1V6WA 3SCRA 3W24A 2YDSA 3TDFA 5A94A 4F40A 4RNHA 2CLKA 5K9CA 5D2VA 1HO1A 1QW7A 3HURA 9CGTA 1V6YA 2J24A 3ZS4A 1HVQA 4JTTA 2INEA 3QPEA 5CBIA 2PAJA 1I2OA 1W1TA 4GO8A 1DEDA 1QWKA 4R88A 3VZYA 2ZDSA 3MBFA 4PUKA 3FA3A 3NQCA 1GT8A 5BU9A 3EKZA 1ISZA 2CITA 4WGHA 1UB3A 3BJSA 3SURA 3CWHA 2OSXA 2BXZA 2H8ZA 2VZOA 4AX6A 1NP0A 4DO4A 3A9BA 1PEZA 5AHLA 3GDBA 3WNMA 5JBFA 4GQGA 4ZOBA 2O7QA 3WUFA 4N6FA 3M7SA 5J04A 3M5XA 5C9UA 5JXQA 1JR1A 1TA3A 3S1UA 4G1KA 1L8NA 4UBPC 3HV9A 4BWLA 4PTMA 1ZLPA 3AIQA 1IV8A 3UPMA 1F05A 4KEZA 1MWOA 1WDQA 2VEFA 4CKQA 5HNRA 3P14A 4Y9AA 3VIFA 4QQ3A 3TMLA 2I5QA 4Y9MA 4QROA 3SO7A 4LY8A 4PUMA 3WQ5A 6ENLA 1XDLA 3EWXA 1HKKA 4GI4A 3W9ZA 2YDRA 1IEXA 1FCVA 5LNUA 2VC5A 3UD6A 5DT7A 3AXIA 3WENA 1H51A 3VKAA 3LSCA 1VFHA 3SY1A 3AYVA 1AMKA 3GU2A 2R1KA 3WH9A 4D6JA 1LM1A 1B3ZA 2D23A 4EP8C 3N1AA 3MV11 2YYTA 4NYUA 4RXGA 1JRCA 3HPAA 4WQ6A 4AEOA 1U83A 3EB2A 1WKEA 3S6OA 4EF9A 1G4SA 1BRLB 4CNTA 2AKMA 2B4GA 4LVDA 5HQEA 2ZA1A 1JZ8A 5D9MA 1YDVA 4H9TA 2HBVA 3F03K 6PTDA 5A6SA 3APGA 4H00A 3DN5A 1JNEA 3HGSA 2DQXA 4M82A 5ABFA 5IXEA 3HJEA 2ZX7A 5EMJA 1IYXA 1DL3A 2VXNA 2J47A 4AF0A 1SM9A 4O54A 2ZZ6A 1ZP4A 3W26A 4Q4MA 1OF6A 1PB0A 2FLIA 2POZA 2ZADA 1H0GA 1W32A 4ZO6A 4HNOA 4IM4A 5F7UA 3S2NA 3NQ6A 4XAZA 3C0LA 2BY0A 2VWTA 5FL1A 2GOKA 3OBAA 3UG5A 2VFHA 3W76A 2JGYA 1QNQA 4YHGA 4Y7EA 4PBGA 2O4QA 2WM0A 3K8MA 4GQRA 4K68A 1EJRC 2EKGA 3FJNA 3GDTA 4NG3A 4UFHA 4JKKA 3S3GA 1UG6A 1AA1B 3N4EA 1JD9A 4JTIA 3RMJA 3BMXA 4YNGA 4P7QA 2ACRA 4A4AA 4HNNA 3BUVA 1P7TB 1AQ0A 4AAJA 5C5YA 4X60A 1M5WA 3H2CA 4UTWA 2ACQA 1IXQA 4MHBA 4FXSA 5F2MA 2BOEX 3B8DA 4JN7A 5HMDA 1F9CA 5E9XA 3W2UA 1MEWA 1NFBA 3UT0A 3GG0A 3N29A 3OODA 1JPHA 1QPRA 4IIHA 1TV2A 2AQOA 4JTAA 4NJHA 2OO0A 5GPRA 2QT3A 3GUWA 3S5OA 3GDRA 3WLPA 4JICA 2PD5A 4KFNA 3OU8A 5AB3A 3GHUA 3B05A 1F61A 4LWWA 3TYUA 3VIOA 4OT7A 2QS8A 3EOLA 3PZ9A 4NZCA 3WMLA 4KETA 2ZRVA 4WXYA 1LROA 2WZHA 3V1HA 1ELSA 3ABZA 2C3ZA 1RCQA 2OB3A 3E0IA 1TELA 5I06A 4OFCA 4QJ3B 3WDIA 2FZ9A 2ZUMA 4DYKA 3LTYA 1OWQA 4ZVJA 2NLYA 3LX9A 2D2HA 2ADAA 4QG8A 4YHEA 4ACZB 6XIMA 3W71A 4B91A 4Y96A 3GNPA 5I6SA 4WGXA 5CJ5A 4R9XA 3PJWA 2J8FA 3A4XA 2IPFA 3ITVA 1X6NA 1EZ2A 1UHVA 5C71A 5IOBA 2CZFA 3CTTA 3RFAA 2ABAA 4UOJA 1YDYA 3ZJ7A 2Z27A 5D8ZA 4H2HA 3RO8A 3NZQA 1VPYA 3TR9A 2TAAA 3FXYA 3NZ1A 1KQYA 1FDZA 1BAGA 4J2MA 4IMCA 1JCJA 4WKHA 3RPTA 1LORA 3B8WA 3PR2A 4Q8QA 3SCUA 3PZTA 1XIBA 2B7QA 1HX0A 5DXYA 1J4EA 2XFYA 2XG9A 3WQDA 3LXBA 4C1LA 1DJGA 3RCMA 1VEOA 2PF0A 1ZPTA 2X2YA 3MV01 2A6LA 2VENA 4WDWA 3WQ8A 3L7RA 3C8FA 3H8AA 3IJ7A 4QLKA 1F3EA 3SDOA 2GGIA 1OX5A 1TG7A 3UXLA 3MSRA 2PZNA 4D8LA 1ITUA 1EZWA 4AUBA 3PB2A 4BK9A 1P6CA 3CH0A 2DZXA 4D2JA 3CJPA 4PUNA 1XG3A 3UZ5A 2OCZA 1A0CA 4O8RA 3VCRA 1UP3A 4M24A 1HJWA 2WANA 3AZTA 3FV9A 1J96A 2J6XA 1F6PA 1HNYA 3ZZ1A 4REQA 1UROA 4S39A 4IQLA 3FAWA 1FKWA 3B8VA 5H8PA 4HYVA 2VZVA 3CQJA 3UXDA 2QCNA 3BQ6A 2GDUA 3LLFA 4WX2A 4EPKA 2PDCA 3U6WA 3OZYA 2PWDA 3LCFA 4PH6A 1DE6A 4ZE4A 4KIRA 4L4MA 2HVOA 4BQ2A 3H4WA 1KXHA 1TJ2A 1BTMA 2VCBA 2L5HA 3BXWA 2QDDA 3DFYA 3P84A 1GTHA 2E8YA 2Z1VA 1XDMA 1SZRA 2WC7A 1VFFA 1OFAA 4RV3A 2H3DA 3WBEA 3DYPA 4UNLA 3T42A 1IWAA 3T0BA 1Q2RA 4Z08A 2DSZA 3FJLA 4C6MA 4PULA 4PCTA 1MNSA 3G77A 5HINA 4UUIA 4UNKA 1XIIA 4I5XA 3KWSA 4AIOA 4N4PA 3I7QA 3TYCA 1XCWA 3WLMA 2CWXA 2DVUA 4DZHA 3BLDA 2HWGA 2BP1A 3UR2A 3NQBA 1ZBVA 2OKTA 4R27A 4Z2GA 4IPPA 5L9FA 2DIEA 5D4YA 1EGVA 2BVDA 5AYYA 4GE8A 1S3HA 1K8ZA 2OSWA 4H8VA 2CHNA 4XAPA 2CYGA 2WPBA 1KRAC 2XN1A 4O19A 4LBRA 2F8QA 1OC6A 1XRFA 1E1FA 3GXTA 2ZUUA 3GTIA 5AN7A 3ID7A 4QJ4B 2FVMA 1SW3A 3EEZA 3W7IA 4OU1A 5JUVA 1PTAA 4F3HA 4O14A 1QVBA 4MUZA 3VM7A 2V5LA 2VVSA 4DEFA 3SJNA 2I57A 1PDZA 4LVAA 1FWIC 3XISA 4HMDA 3OEXA 3SY5A 2BY2A 3DKJA 1T99A 2HS6A 4DZIA 2OSYA 3AUJA 1Q3NA 3S42A 1TPDA 3NOYA 1EPXA 2P3EA 1OCBA 2D3NA 1ZZMA 3VFLA 3U57A 4EVZA 1P1XA 1IGSA 1RSCA 3TTSA 1WOBA 4I6VA 4ZTXA 2PWHA 3GD6A 2F61A 4XUYA 2FVKA 4M7SA 4HOXA 3PZNA 2B7PA 3FGCB 1V6TA 3WNNA 3N19B 3GNOA 4JNYA 4ALDA 2EPKX 1SFTA 4JTRA 3WMCA 3QV6A 3TSDA 4GD0A 5DCBA 3ZT5A 4E8GA 2PP1A 3MT1A 2R9RA 3B3DA 3C6CA 3E1F1 4W7WA 1TMQA 1DP0A 3LY0A 3VIJA 3BCFA 4OHQA 4A21A 3O15A 1GOKA 3WLSA 5BWFA 2QJGA 1HFBA 2FZBA 4E5TA 1GYLA 3HGRA 4ZCWA 4E2OA 3B0YA 3QHOA 3QC0A 3ARZA 2F38A 4Q8PA 1UUMA 1KFKA 3PK7A 1R47A 4C7FA 1GHRA 3ZR6A 1NJJA 4RZ5A 4EIVA 2DJLA 1WZLA 4RX0A 3C2EA 3TTOA 1OVDA 1SO6A 2Y2WA 1XBYA 2QUUA 1XV8A 1FWDC 2BWGA 4U5KA 2IPGA 3WEOA 4F66A 4ZB0A 4GYKA 3Q67A 4GX8A 4XZHA 1VBGA 4NZ3A 2ISWA 2WW5A 5A5WA 4K7VA 3ARXA 1QRQA 1L8PA 5EBUA 4O0KA 3IJIA 4ECLA 3LA4A 2XDFA 3TXVA 1ONRA 1EOMA 4FOUA 1THFD 5HJXA 2D69A 4DWSB 4PRWA 3U2CA 1JCLA 4UQEA 2GUUA 2KAUC 3MB9A 6A3HA 2PDBA 3WD3A 4I7UA 5CG0A 2JK2A 3VNIA 2X1UA 3R94A 3T8LA 3VZZA 4LUJA 3UW6A 4DJDA 1KTNA 3OGVA 3BAYA 2WMKA 3VKKA 3K13A 4DUXA 2R91A 4DI8A 2CNCA 4M5PA 2B31A 4P5UA 4JQ2A 4UTUA 1S5VA 2QJHA 4B5XA 3OLDA 3MUCA 4CQBA 4G2DA 4QR6A 2PDGA 4F48A 2V3FA 4S23A 1V6UA 1IGWA 3W29A 5GJMA 1OX4A 2PTYA 3AHYA 4H83A 3SEPA 2W79A 2QUNA 3NPWA 3P3BA 1JZ6A 3W1AA 3N18A 1X7FA 3EDJA 1SSDA 5C9XA 3KL3A 1B9BA 1M01A 4MWAB 2Z2UA 3GXNA 1XBZA 3EDFA 4B5WA 1YXDA 3U7BA 4CD5A 4A6GA 1ZAHA 4CUCA 3GG1A 2DT1A 3R8HA 5C2CA 2A6NA 2W92A 5I07A 2O9RA 3QKZA 5AYXA 1M6JA 3F5JA 4GY1A 2VEKA 1IHIA 1UH2A 3G1FA 5PTDA 4IPJA 3EWBX 4PRTA 2X1SA 1F4AA 3BG5A 3BZJA 3E49A 4G6CA 4C6QA 4QSFA 3RF9A 5I78A 4X0NA 1M7PA 3WCZA 2WQDA 4DELA 2PI6A 1JYWA 4PA8A 4NI3A 1IT0A 2HS8A 1H7RA 2YSWA 4CEXC 1HKVA 5IDIA 1UKSA 2IKGA 3E2VA 2JIEA 1G1YA 1XC6A 1KM6A 1SPQA 1KXTA 2Z7KA 1BKHA 2CBVA 4OE7A 3UZZA 2D73A 4WUIA 3WNPA 3WEZA 1J0JA 5KITA 4EOUA 4ZENA 4GGBA 1BVZA 1NOUA 1TREA 2EJ1A 2E6AA 1LWHA 4KMQA 3M47A 5I5RA 4BI6A 4O50A 4WEVX 1NAL1 5HJLA 3GFXA 1J6PA 1R7AA 3CAWA 2P8BA 2BXVA 3P80A 2RJGA 1J6OA 4LT9A 1NF7A 4TVDA 4WHBA 1IEVA 3VD3A 5KZDA 4WLCA 2GQ8A 4URIA 3RG6A 3UXIA 5C0QA 1HJSA 2VRKA 3MZNA 2PEVA 4IQEA 4U33A 3ZT7A 1TWDA 5I03A 4D6DA 4BQ5A 3TP4A 3GO2A 3TTQA 2VD8A 4G7FA 2BNJA 5JU6A 4JIPA 3AZSA 2OLSA 1PO9A 4IHCA 1F5ZA 1L6FA 4QDMA 3APTA 2P8CA 3IVTA 5CBJA 1XYLA 2DT2A 3ITXA 5SWUA 2VCAA 5DANA 2WVVA 1XLIA 3OLIA 4YVPA 3FYOA 1N2VA 1NWTA 1PCKA 4MB3A 2GJLA 1TX2A 4US5A 1RK5A 3AC0A 1KLZA 4FLSA 4MYXA 1W3IA 1HJVA 4HMNA 2X09A 1W5MA 4L5ZA 4R33A 4MFEA 3KVMA 4H04A 3RMEA 5TQLA 4AVOA 1OYAA 3NG3A 1C7SA 1U22A 3OBKA 1AH0A 1IT7A 3KHDA 4QHRA 3A22A 1KCZA 4QE5A 3VMOA 1LUCA 3BAIA 4E3VA 1DPMA 3TA6A 2QEZA 3Q4DA 4HNTA 3BSMA 3S1WA 5DMLA 3OB8A 3MTWA 4PGLA 4O28A 3EMZA 4C65A 4KWOA 4C6IA 1NP2A 1EUNA 4CU7A 1MDLA 1X8FA 1DWIM 3GXIA 5IHRA 3LI1A 4I9AA 1KFLA 4WKAA 2DY3A 4KIEA 1Q6GA 1NDZA 3AS3A 1LLZA 4JQ4A 1JPMA 2BX7A 2QCDA 3CUIA 4PBFA 1V02A 4I9JA 3W4RA 1Q4NX 1FWWA 3MDWA 4H8UA 3H26A 3WQFA 2ISDA 5JH2A 1WUFA 3QM3A 3U48A 2TYSA 3W1RA 1KFWA 1V3JA 2WSRA 3EX4A 3QMSA 2NUYA 5EMKA 4DF1A 3T81A 1KTBA 4C6FA 3ITGA 3WUGA 1KM1A 4AEEA 1JULA 3QR0A 1E9LA 1L9WA 5M1TA 1IEQA 2X1IA 2XYLA 4PN2A 3KCOA 1SFJA 1YYAA 1BVWA 2EEXA 2E5CA 2ZZ4A 3UA3A 2FHFA 5FJJA 3R5EA 2D1ZA 3J7HA 2VC7A 3GW0A 2A3BA 1IE7C 1UKQA 1RHCA 3B06A 3L2MA 3SCPA 3POHA 3N2XA 4TU1A 4W86A 2VMFA 3N6QA 7ODCA 4X2PA 1TTIA 3HQOA 3IVUA 4MKNA 1H7WA 5EYWA 2YLLA 2GJPA 4LFYA 2ZZ5A 2OYMA 3WQPA 1XHGA 5KTLA 4UXDA 4KT2A 1K3UA 3QLLA 5H8MA 1TV4A 2KX9A 4KEVA 4Z42C 2ZUVA 4YTUA 3DC8A 3H53A 1XF0A 4LV9A 4S3FA 3U5YA 1A50A 5FSDC 1GOIA 3SCQA 3WY1A 3PTQA 4KF1A 3W23A 4EXBA 5I23A 1R2TA 1A49A 1ZALA 3QN3A 1M03A 1XGZA 2ANUA 4FAMA 4AIBA 4DQWA 3W84A 1XPYA 1M65A 1DWGM 4WZHA 4J3XA 1WO2A 2DW6A 1ZY9A 2UY2A 4H8NA 1TIMA 4W7VA 2J7DA 3G1YA 3TC6A 3DCPA 1WZMA 1WA3A 1F07A 4YCPA 5C9RA 3NDYA 3VMPA 3RPDA 2WMFA 4A3RA 5I3IA 5G2HA 3IJ6A 8TIMA 3W7DA 1GOOA 5HK4A 3KVKA 4CNUA 1FDYA 2A7NA 2CXGA 4JBRA 3W74A 2XTKA 1Q6OA 2OX1A 4QJ1A 4JTDA 4IJRA 2X40A 2WHJA 1T5AA 4C7DA 2YGYA 4ORIA 5EU9A 3UR8A 4D72A 1WDRA 2D2OA 3NIYA 1RCXB 4AWTA 2V8ZA 5F1UA 2WOQA 2INFA 1US0A 2I56A 1CT5A 2VQTA 3OG2A 4MPQA 2UBPC 3AU2A 3KBNA 1B1YA 3OZOA 5EMLA 2EF9A 2G3IA 1HP5A 1OC7A 3BAKA 4XKYB 1XX1A 1VENA 3CH9A 3BANA 2VUNA 3CL7A 4LJ3A 2Y8KA 3O7UA 5JVLA 3RCNA 3MMDA 4Z0SA 4GFIA 1RALA 4ADUA 4PUWA 1MEHA 1QR7A 2Y88A 4HP5A 1KFJA 5HXMA 1K6WA 5CBBA 5CCZA 2V3EA 4HGXA 3CWOX 4L61A 1JCYA 2RAGA 4GKLA 5BXSA 3H2FA 2P1FA 4IMEA 4IG2B 1QJWA 4BF5A 1CENA 3MCMA 3CB3A 3TNBA 1ME8A 1OGSA 1FHVA 5FF0A 5FF3A 4LVGA 4AX7A 4Z0JA 3PNZA 1DWFM 3T8QA 4QQUA 1EX1A 2J7BA 3E0WA 1B54A 2XU2A 1CEOA 1MQRA 3QFEA 4UFIA 1I1XA 4J7RA 1Z7AA 2YPIA 1HG3A 1O5KA 2NLIA 3QRHA 3LZ3A 3HM7A 4D6HA 3REQA 2WBGA 3RLUA 1EJTC 1DTNA 5CZKA 3DFNA 1OCNA 1IF2A 4LNCA 1TPWA 3LCHA 1UD2A 1W8GA 2PLCA 3DG6A 1UYQA 4TQTA 1C8XA 1S2CA 1XWYA 5EMMA 2OYLA 3G1DA 1HUVA 3I3BA 3GZ3A 4TX6A 1UIOA 4PODA 2AQWA 3BLFA 3W02A 1QNOA 3PJTA 3MI3A 3HN3A 1PV8A 2QMKA 4QE4A 2WO5A 3MCNA 1P0BA 1QMLA 4MKVA 3WELA 2OT0A 4RPQA 3HG3A 2G97A 3NM1A 4DWSC 4F0SA 1Y5XA 4PR4A 3W07A 1JZ2A 5D2XA 1GKQA 1OX6A 3I6TA 4IPLA 1JDCA 2DSVA 2D2GA 3PPFA 5DMYA 4WK9A 1KR0A 3IS4A 3GDMA 3K8LA 4GXWA 5DXXA 4DYEA 2BGQA 2A7RA 4WCJA 2GWGA 1NEYA 5EKYA 1XBXA 3S4TA 1UQYA 3VUSA 4AWUA 2OZ3A 4JGDA 4AHOA 4E4UA 1EDGA 4NAFA 1O1ZA 2BG5A 3W7CA 5HPOA 3SUVA 1RR2A 3VPLA 1VIWA 3WDHA 4ZODA 4IXHA 4JEQA 1P1MA 2W5FA 1OT2A 1KFBA 4OQVA 1NSJA 2E9LA 2A2IA 1V3KA 3CMJA 1BGAA 4XD3A 4YN5A 2WKLA 1JDEA 2C0AA 5G2IA 1EEPA 3STCA 1O95A 3QTGA 1FDJA 3VM5A 1QO2A 4GQ0A 5A6BD 3W7NA 2XSXA 2WNZA 1A3WA 4QTGA 3G8EA 1UD4A 5FEXA 1O94A 1CLXA 1K70A 1YQ2A 2PBOA 3R6IA 4WY0F 3V1PA 1LQ2A 4H2CA 4XIMA 4DLFA 1WE5A 4B9ZA 5FAGA 2VO5A 5C55A 4GI6A 4YCOA 2I5GA 4RE4A 1NDWA 3CT7A 4DIAA 1E72M 2BVYA 1AW2A 3QVQA 3QV9A 2ZDRA 4C1NA 2MNRA 4PUDA 1ECQA 1AQHA 1AODA 1LG2A 1OABA 4N7QA 1NOFA 4PFHA 1GHSA 5TD4A 4HK6A 1W0MA 3OBEA 4IQDA 1C9DA 4NF7A 3WL0A 3NQ7A 1Q8AA 1R87A 5I0DA 3G1XA 2E1WA 3W2MA 3LCGA 7ENLA 4LAOA 1XISA 3C0QA 1QI2A 1TWWA 4NASA 2CPUA 5ECVA 1QI4A 4ML4A 1U5HA 1V93A 2ISSA 5K7JA 3TC7A 2JGQA 3U2ZA 4M6PA 1Q6FA 4GUIA 1W9XA 3N2TA 4U10A 3GUGA 2TMDA 4MJ2A 2JALA 4ZQPA 3B4YA 1MW2A 3TJXA 4JFSA 4JL1A 1YMYA 3WO8A 5CGQA 2GDVA 4OTKA 3W85A 2PWEA 3CUJA 1ZP3A 1UJQA 1XRVA 4S3CA 3VX0A 1EJ7L 1MXSA 2Z0IA 1TPEA 3VA8A 3MUIA 1I45A 3SGUA 1VYSX 2V5CA 1W6TA 1XIHA 2CZEA 2WLZA 1I0DA 1SVDA 1L2QA 3VXGA 1FY6A 3PP7A 2AKZA 4XSLA 1KRBC 4PMYA 4O15A 3EGJA 3NL6A 1LL6A 5D04C 4LS1A 5F2LA 4NNAA 4PYSA 1TWZA 4DX3A 2Y85A 3WNLA 3D47A 4XIAA 4AY1A 4PB3A 1GOQA 1UPPA 1RPXA 4EXAA 1XIFA 3DYMA 3VKJA 3PBUA 2PF8A 4HSHA 2F9RA 1V8EA 3FK4A 3HJZA 1OGGA 3UCCA 6ALDA 4MG4A 1XH2A 1W3JA 2Y7EA 3VDBA 4IX0A 2AQVA 1KCLA 4O1EA 1H0IA 1C8VA 3BTNA 2I17A 4X3ZA 3PULA 3LK6A 3AROA 1ICQA 1ISVA 4AMAA 1FRBA 1VHCA 1TPB1 3G3DA 4EWJA 1IXNA 4S3GA 1LBMA 1J0KA 1EFZA 3DECA 4Q22A 5E70A 2OWCA 1GZJA 3MKVA 1U1UA 1K9FA 3VD9A 1QW8A 2YB4A 2CLHA 2ZA2A 3ABSA 3RX3A 1GJPA 1B3VA 3KE0A 2P50A 4B90A 4DY1A 3OP2A 4Q4RA 1JXKA 5D38A 3RX2A 1UWIA 3L5MA 4RR4A 4UQAA 1OZMA 4V33A 3GYEA 3PF3A 3EWYA 4AVNA 5CLTA 1XCFA 3VE9A 1C7TA 3K46A 5FI8A 4PEKA 4D6FA 1R3YA 4S1FA 4IICA 3M7WA 1CBGA 4WY0B 3W6LA 1LLOA 4O4WA 2XFWA 2GVJA 3TW6A 3EBVA 3NGJA 3CL6A 1P4CA 1Q7QA 1FWFC 3IK4A 1EUAA 5G2WA 1XYFA 4CVWA 4UQBA 1K9EA 1ONEA 3KBSA 1FFQA 2CEQA 3W82A 3GVWA 3E0LA 2HPMA 2FTYA 3ANVA 4CCDA 3HG2A 1R7OA 2A4AA 3QZ6A 4Y90A 3KRBA 4HZMA 2WC4A 3HGJA 4AHPA 3ARSA 2ZXAA 4V28A 1PX8A 4M81A 3AHTA 3ZR5A 4DF0A 3CQIA 4E0CA 3AS2A 1AK5A 4JAWA 1VYPX 2CZ5A 2VZUA 5I3FA 4LF2A 1OT1A 3UR7A 2RDWA 1W1A1 2YDAA 1Z69A 4F9JA 1DHPA 1RQHA 3ABRA 1WKYA 4QE1A 4Y9PA 5K9XA 5FF7A 4J3WA 1IEIA 3GU9A 3L65A 5D9PA 1NM9A 4UTJA 3IWPA 2XH0A 3W38A 2J7HA 2HE5A 3QOMA 4R9OA 3M43A 1V7AA 4FEZA 1L0PA 2H90A 2PTZA 3PWIA 3VKBA 2E4TA 1LTDA 2DP3A 2FDSA 3SQSA 4U31A 3DIPA 2G37A 2VUYA 3B8IA 2PGEA 2ZC1A 4A2RA 1EGMA 3F4CA 4AZCB 1TE6A 4RCXA 1F8MA 1GNXA 3USZA 2YXXA 2J27A 2PE4A 1J79A 2PUZA 1O1HA 3ES8A 3UCDA 8XIMA 3PM6A 4B3KA 4HU4A 4FNUA 4N4QA 1XFBA 5G1TA 3UP8A 4GPNA 2XUCA 5AVHA 3IACA 3W86A 1REQA 1Y5VA 1YDNA 3OZPA 1EF2A 3GY1A 4OWGA 2P5NA 1UMLA 4WRHA 3M0IA 2RDTA 2HZGA 5I3GA 1ZENA 1HQTA 3V0TA 3W6MA 1EQCA 2R24A 1VIZA 4WVXA 3AQUA 4M1BA 1Q85A 1KBLA 2CHRA 2D22A 3F2CA 3PUDA 3CZKA 3LCLA 4D6CA 4DXXA 2FB2A 1QI5A 5LNSA 5U4NA 4W88A 1AG1O 1WYIA 2C8NA 4JKMA 3AIUA 1TPUA 1EJWC 4KESA 1KBBA 1EJUC 4TUFA 3WMSA 1DXIA 3OA5A 2PD9A 3W72A 3C56A 1VFOA 2FH6A 4O52A 1GVSA 2DUXA 3OGRA 3T07A 1DWAM 3IARA 2FZ8A 4DLMA 2XWDA 2PB1A 3WH6A 1FWAC 4IFKA 1FTXA 3UVAA 1Q4WA 3FHAA 4FNRA 3VDGA 3LLDA 4L65A 1BEUA 4PTNA 3WQCA 5DMNA 3T1GA 3CO4A 3TCSA 3S2LA 3PAOA 3VOFA 5IBXA 1BXNA 4GJIA 2QCHA 3HTWA 2YL9A 1G9HA 2ZRXA 1N8IA 2WZMA 4JTQA 3M0JA 3UERA 3VNYA 3QGKC 4DF2A 1NOWA 5AVNA 4NZFA 2WNWA 2WSQA 4GYPC 4XD6A 2OFJA 1AUSL 4F0KA 3VIGA 4DBWA 1XIJA 4UWMA 3VGGA 4ML9A 5I2UA 2WVUA 3A3HA 3EXRA 5HQLA 3REQB 5FJOA 7CGTA 3P62A 3LENA 3AWNA 2QCEA 2GUBA 2Z4GA 2ZRWA 4X22A 1EYWA 1W2PA 3QQWA 2XIBA 2WWDA 4JL2A 3PBWA 4A8IA 5FEWA 3R25A 4IUOA 3W1QA 5CC5A 1VKFA 2WHLA 2NWRA 4NJJA 4ES4A 2FHBA 3LDVA 3FN9A 1PZ3A 1OJXA 1R9ZA 1QNSA 4LB3A 5C7VA 3ZIZA 2QDHA 1OK4A 1F2JA 1BWVA 1EL3A 3WD0A 3L4TA 3O6DA 1CXHA 1OC5A 1D8WA 1I75A 1OIMA 5DLCA 3LBMA 3AMKA 3C61A 4MSSA 4HZ6A 3UWYA 1VBUA 2WB5A 3AYTA 3GE7A 3IJQA 1V4YA 4CN1A 5BROA 4LGXA 4IGNA 4K1GA 3GU1A 4ZSUA 1F73A 4BJHA 3WJZA 1V77A 5GNZA 3MZ2A 3NVTA 2FKPA 4O57A 2VGGA 1VJIA 3TN5A 3BO9A 3BG9A 4GINA 4PEEA 3C2YA 4TV5A 3UJEA 4NUWA 3H12A 3USBA 4OIFA 3TU9A 1NU5A 1HIZA 1KA9F 3E96A 2E1DA 2ACSA 2DGAA 3H2MA 4AB4A 3E5PA 1JXJA 3JW7A 4UR7A 4I7VA 2BBFA 2W27A 3ONBA 1M7JA 3A23A 4AYGA 1FWTA 3URBA 2HE8A 2ZE3A 2QQ6A 2OWXA 1N8WA 2QPUA 3LGDA 4DPPA 4LRTA 6REQA 3WK1A 4Z1DA 1EYEA 4JNMA 3PAJA 1KM0A 1EP3A 3I3DA 4ERIA 4MZ1A 3AHXA 3DDMA 4E4FA 3N15A 2AOSA 3STGA 4EPEC 1XIEA 5XINA 4ZQCA 4KBXA 4J5NA 2ESCA 1TTQA 3G3MA 1AL8A 4YWIA 2DZUA 4IWWA 3PUGA 5A6JA 2XSAA 2GK1B 3K8KA 3AFBA 4DYJA 5LIKX 3UEQA 1ISWA 2YCJA 3FYPA 4IPIA 4RE2A 2VELA 4HA4A 5ABEA 4U28A 4GUJA 2OGYA 3ZO9A 3KDNA 1PDYA 1H09A 1W9BM 3TJIA 2BODX 2EAWA 1FXQA 5JBDA 1A5LC 4H6KA 3TSBA 3F7JA 3PZVA 3M5ZA 3FSUA 5JMUA 4GUFA 2J8TA 3NQFA 3T4CA 3W83A 3XINA 4JX5A 1UBSA 1JAEA 1SYTA 5A2BA 5JBEA 1SJAA 2G3NA 2MANA 4JIEA 5BXRA 2QPSA 4HK5A 2VKZG 4HHLA 4C60A 4BFAA 3PVFA 1KM2A 3CS2A 1B30A 4EACA 2EPLX 1UWQA 5G1MA 1BG9A 2A1YA 3B4UA 4DM1A 4XZMX 4L1GA 3DBNA 1BKSA 3ZJ6A 3CO8A 1E4IA 4K37A 4JY8A 2PDWA 1BWLA 2C1GA 3WNKA 4BF9A 1V02E 1A5OC 5TBOA 1KBIA 2EKCA 1LWIA 3LD5A 4IQJA 4JIQA 2BVTA 3L68A 4M7TA 3WJYA 1VCFA 3WYZA 4FXRA 4GIRA 2H9AB 2W66A 3FXGA 2Y5JA 4N02A 4ZO8A 3LPFA 3EA2A 3VX1A 3VK5A 3GR8A 1VAHA 3A4JA 6XIAA 3TUUA 3UR5A 5ABGA 5MF5A 2J7FA 1D7FA 3W7EA 3I4EA 3MP3A 3FS2A 3IAQA 4WOQA 2WK2A 3H54A 4ADSA 7TAAA 1UWSA 4DM2A 4HPXA 3M16A 3B04A 3CK5A 4QRNA 3PBGA 1V3HA 2WKJA 1BXCA 1ONXA 4KWVA 3KBMA 3WH8A 1EXBA 4OUEA 3VABA 3LV6A 4LYPA 3ORWA 3LNMA 3TWBA 3ARPA 1VJSA 1EWEA 2ZTKA 3MYPA 3CEUA 5DY3A 3EWDA 3UJRA 4XZBA 2VX6A 1L6SA 4KKXA 4RDWA 1UR4A 3GAKA 1KM3A 3E9AA 1DXFA 1NFPA 1WKDA 3NYDA 1JFHA 2EO7A 3NURA 1SO4A 3RLHA 4AHQA 5AC5A 4N0RA 2B81A 2YZRA 1W3TA 1QOPA 3MWCA 1IQ8A 2GGEA 4LY4A 4H9ZA 4MADA 3O3RA 3ARYA 1SGJA 1OF8A 4NRRA 2HXTA 3QR1A 4F79A 3WQ4A 1KW1A 1ZL1A 4IP5A 1TWIA 2G41A 1J11A 4LCRA 1QCWA 3UG4A 7XIMA 4ACYA 1CECA 2FZDA 2I14A 1NIUA 5AYBA 3A64A 1I0BA 4HCDA 2WHKA 1WNOA 4DJDD 1OCJA 1PUDA 3ONCA 1DJYA 4I5UA 3BVJA 3UXAA 2NV2A 4H7ZA 1C29A 3QHNA 2J9YA 2OVLA 4DJEC 4OKDA 1OFEA 4RPPA 1TMHA 4DJFC 1MW1A 3UESA 4KFOA 4ZOEA 1UR8A 1EBHA 3O6YX 4H7VA 4S2BA 3T2QA 1VBHA 3QXBA 4DB7A 1LQ0A 3L4VA 3FA5A 4E2BA 2LLEA 1XLMA 4LUIA 1LRQA 4QNWA 4NX0A 3A4AA 4NKCA 1H1YA 5CPLA 4FNQA 5CC7A 5D9OA 2I9EA 1JQVA 1CXLA 3IJLA 1S2TA 1FWGC 1X6LA 1AQMA 2QW5A 1PKYA 1YPXA 3NEHA 4KEMA 1UP0A 1R2RA 2FGZA 1LT8A 3AZRA 3DHUA 4F2TA 4JQ3A 2HNEA 1I2RA 5MHBA 1IZKA 1G69A 4NILA 2Y61A 1HN1A 1B3WA 3WEMA 3L2IA 1W17A 3UCQA 4IMAA 2VC9A 3DHFA 3DKLA 4L4PA 3SADA 4AC7C 2PDQA 4AD2A 3TONA 3BJTA 3D0CA 3RYSA 1IZCA 3JR2A 3KOZA 2CLEA 3CQ0A 4NQ1A 4C5YA 3SRKA 4B4FA 1E70M 2Z1WA 4S3DA 3W7MA 1ODZA 2HISA 4JS3A 3SCWA 3VDCA 1AJ2A 3B0VC 1BFNA 3NPVA 3TC3A 3QW4B 1W5OA 3RITA 1S1RA 5BU6A 1EJSC 4QLJA 3FDKA 1HJQA 4GYJA 4W87A 4YU1A 2XGIA 1WV2A 2WLYA 4P8UA 5TNVA 5BYWA 3SCVA 4HQVA 5BRPA 2EG6A 2WWCA 5HUPA 4YPJA 4FO4A 2YXOA 3F4VA 4PMQA 1C3FA 2OGJA 2REQB 3GC2A 4O4VA 2V81A 3BSGA 4GZIA 3RM8A 3MANA 3GTFA 4LH8A 2ASHA 3WDPP 4NNCA 3M0KA 2TSYA 4FR1A 1Z9AA 3FLUA 2AL2B 2ZZ3A 4ZTYA 4IL0A 4QDPA 8RUCA 1J93A 3VMNA 2NXIA 1ZQ5A 4MMWA 4FS9A 3A5FA 1V0NA 3KW3A 1US2A 1OZQA 3H55A 3A6OA 3CHFA 1M1BA 3KCLA 4A35A 3IUHA 1FH8A 4N9EA 1UD8A 4PMRA 4INFA 2X7WA 4ICNA 5FJIA 3TE9A 1G7VA 3SGZA 3A21A 2I9UA 3NCOA 3HGOA 4HVXA 2WJFA 3A5VA 2DIKA 3T78A 1OBAA 2OZ0A 3WFLA 3WLNA 4HOWA 4US5D 5BOOA 1R3WA 3ABQA 4FMVA 3L9CA 3H6OA 4NAEA 2VOTA 1HXJA 1MUCA 4NX5A 1Q2SA 3PJUA 4EPBC 1E56A 1YHTA 5HQMA 4NZ4A 3UWQA 4XTIA 1UOZA 1BYBA 5LNVA 3RAOA 1R3VA 4AW7A 4XO7A 5D2YA 4ZL1A 2PLJA 3PWGA 1HP4A 2XJ7A 2BOFX 5BMWA 5HWMA 4FA3A 4QCEA 1R6WA 4QIUA 1W9VA 3QPYA 3LB0A 3DUGA 1TV8A 3O9NA 5FIPA 5CAKA 5KETA 4GG9A 1L6YA 1JF5A 3RK8A 3V16A 1GVOA 1UA7A 4BQ4A 2OQYA 1SO5A 1YADA 4UIOA 3W01A 5LYRA 4LB4A 5EL1A 1XLFA 2PDYA 2W62A 3TN4A 4DRSA 3ZVIA 5REQB 3BC9A 3MYOA 1I9CB 1J5TA 3R2GA 4XK2A 2PTXA 5I3HA 1NQKA 1GUVA 4DAFA 3ITYA 4GIEA 1FWCC 1R5YA 4J40A 3TQKA 4IGSA 1Q6EA 2PFHA 4GWEA 3PNUA 4QFUA 4R34A 2G3FA 2XPKA 1GZGA 3GIPA 4YS1A 3TN3A 3LYEA 3VNLA 1E4MM 1UKOA 3VFCA 3ZVHA 2FIQA 4J3SA 3C2RA 2CW6A 1POJA 3BMWA 1ADDA 4AG0A 4IZGA 1PXGA 4IX2A 4BI5A 2WHMA 1OEPA 3KCJA 1KO0A 4C6CA 2RDUA 3HQ1A 2B0MA 2R1LA 3ICJA 2J13A 1UZ1A 2IKIA 2VWSA 3WBWA 2YB1A 2IUZA 2FTPA 4AZIA 3TQVA 4N2YA 1QNRA 1R86A 1B4EA 5HBFA 4WOZA 5C2XA 1WKFA 3MJYA 2ZX6A 1QXLA 4CD8A 1A0DA 4X9YA 3CUZA 4CD6A 3RXZA 3WH7A 1CXEA 2F2HA 3IGSA 4U3CA 3RU6A 4S3AA 2YBTA 3AIEA 1YBQB 2YBVA 4MUPA 2YLAA 1XR2A 4IF2A 3DG3A 1ZJIA 4BF7A 3CBWA 4Q8WA 1NY1A 4B9YA 2ZXDA 5K9DA 2J74A 3KTSA 1B0IA 4BCEA 1G7UA 1F6KA 3B9EA 1CXIA 1TSIA 2RKXA 4LUTB 4UMCA 1HZYA 5LGZA 1BF6A 3WZ0E 1K7FA 2AGKA 1JYVA 3QFWA 3GHTA 2QV5A 1TYGA 1VC4A 3ABOA 2GJXB 1IR2A 1KCXA 4JHZA 4JOMA 4UC5A 3VDHA 2E7FA 4C6NA 3RLVA 2P0IA 8XIAA 2GFTA 1JZ3A 4P8WA 3RX4A 4H9XA 1EOKA 1GONA 3R89A 1TJPA 4QAWA 4UOZA 4C1KA 4D1IA 1KKRA 5T91A 3HIJA 1VFLA 3ZOAA 1XUZA 3K4WA 2Z28A 3KOFA 3E38A 5FEPA 3PTKA 4MJ4A 1WXYA 3AMLA 5F2IA 4WXZA 4PMJA 2VI0A 4IISA 4GZEA 5AHIA 3Q65A 3VNDA 4IPNB 1X8CA 3VD5A 3DGBA 4ZO9A 1WQ5A 2A3HA 2YX0A 2QYGA 1NDVA 4U4MA 4FOKA 1RVGA 1WUEA 1PIIA 3QPZA 2PLMA 5DFAA 2G3JA 1KBKA 2Z7GA 2W0UA 3NVDA 3KWXA 1WXZA 1J2BA 1SJDA 3NO5A 3FEMA 4J4KA 5LKYA 3NQ8A 5A8MA 1K7EA 1GK8A 3KM8A 4A29A 2PDFA 3TFXA 2YFNA 3ZWSA 1E6XM 2ZX8A 1C8YA 3LV5A 1B3YA 5DBTA 5FJTA 5A8QA 2WVTA 2OX4A 4CN4A 5DT5A 2HSAA 3CLWA 2HQAA 1D7KA 1UUOA 4GXPA 5DF0A 4LVFA 1UR2A 3W7QA 4UOQA 4GACA 4KGLA 3W2JA 1F74A 1XFCA 4OV4A 1E43A 4LCSA 3T0AA 1E6PA 1TJRA 2VTFA 1R85A 2F7FA 4WF7A 3JVAA 4XQ6A 5AHEA 4NXSA 2ZXQA 1GPWA 2J6VA 3POCA 2WMIB 3HB9A 2OZ8A 4KGJA 1H7PA 5G4EA 4HNUA 3KS5A 2R94A 1LOQA 2CLOA 2GJRA 5FJPA 2ZUWA 4RV8A 3KHJA 2DSWA 3DC0A 1QFEA 3TOYA 7A3HA 2AL1A 1E51A 1E3XA 3BLKA 1VR6A 4PCPA 4CD7A 4AD0A 2DSKA 2GL5A 1R38A 5FD0A 2A5HA 3MPGA 3TNOA 4HA0A 2NVAA 4KWUA 3LSBA 2GQAA 1GPFA 4KRTA 2V82A 4XD4A 1IWPA 3PJXA 1CCWB 1MUWA 3H21A 1BSIA 5I3DA 3EXTA 3HFTA 5I00A 4JYFA 1NDYA 5FOOA 1CIUA 3HU7A 1FHUA 2DUZA 4S3KA 3ZMRA 4EAMA 1OSEA 3P74A 1DJXA 2GQ3A 1DKWA 3FFSA 1RZMA 5KINA 3UWUA