3TK7A

2.0 angstrom resolution crystal structure of transaldolase b (tala) from francisella tularensis in covalent complex with fructose 6-phosphate
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
320
structure length
320
Chain Sequence
QKSVLEQLKQVTMVVADTGDFELIKKYKPVDATTNPSLILKAVKEQKYSNLVAETISKVKANNPDLNSDDLVKEIAIEILVSFGIKILDVIEGKVSSEVDARVSFNSATTIDYAKRIIARYESNGIPKDRVLIKIAATWEGIKAAKLLQKEGINCNLTLIFDKAQAKACAEAGVYLVSPFVGRITDWQMQQNNLKTFPAIADDDGVNSVKAIYKLYKSHGFKTIVMGASFRNVEQVIALAGCDALTISPVLLEELKNRDEHLEVKLTKNDDVVTQSPQISEADFRWLMNENAMATHKLAEGIRLFTKDTIELENIIKQNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transaldolase
publication title Adherence to Burgi-Dunitz stereochemical principles requires significant structural rearrangements in Schiff-base formation: insights from transaldolase complexes.
pubmed doi rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Transferase
total genus 141
structure length 320
sequence length 320
chains with identical sequence B
ec nomenclature ec 2.2.1.2: Transaldolase.
pdb deposition date 2011-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00923 TAL_FSA Transaldolase/Fructose-6-phosphate aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3tk7A00
3LI1A 1LM1A 4HPJA 4TIMA 5D05A 5D38A 3TROA 4MLRA 3G1FA 4JNMA 3M43A 1JUBA 4L4MA 3NQ6A 1D9EA 4M6VA 3QMSA 3BGGA 5AYYA 3NQ7A 4NJGA 3VKJA 4DQWA 2TMDA 5G2HA 1KA9F 4O0ZA 1BWKA 3HPXA 3QH2A 3L5LA 2OZ0A 1WX0A 4LVAA 5CZTA 2DZPA 2D73A 2YCEA 1F6KA 3FKKA 1XUZA 1TPDA 1F7BA 3W23A 3PUDA 4CCDA 3A21A 2ZZ4A 1TJRA 1DJNA 2VXNA 1HTIA 1TTQA 3E12A 2ISSA 4LW7A 4N9BA 4XKYB 1RPXA 4O1DA 2YDAA 2GVJA 4KWVA 2QEZA 3H55A 1QPRA 1DQXA 1K8XA 4KFOA 1FQ0A 2YZRA 1H61A 1FCQA 3TQ0A 1H60A 3R13A 3LHTA 4O0KA 2RKXA 1NAL1 2X1UA 3S9YA 4UMBA 3HG3A 1C9DA 3O07A 3SZ8A 4JTGA 2YX0A 4UTHA 4JD4A 2ZZ7A 1H7WA 2QUTA 4MZ1A 5MHBA 2YYUA 3PAJA 5DCBA 3GDLA 1DVJA 2CLHA 3THAA 3NNTA 2NX9A 2QCEA 2DORA 2Q8ZA 2WSQA 3L2IA 5EL1A 3UNDA 4UFHA 1EUAA 3W7IA 3CWNA 4IGHA 2Y7EA 1KM5A 3H53A 4AXKA 2J9ZA 4FX6M 3LHZA 4ZVJA 1PE1A 1WBHA 3UY8A 3DFQA 3W1PA 2X2GA 5AHNA 1SQ7A 5LKYA 5CGQA 4WQ6A 3W1RA 3LBMA 1VS1A 1AW2A 4FO4A 5HUPA 3D0CA 1X1ZA 4JTEA 4RJEA 1EEPA 1LP6A 1L2UA 3LTPA 4HNTA 2CLLA 4MYAA 3PBYA 3DFSA 4NZFA 3TDFA 2YR1A 4X22A 1FCUA 2EGZA 4RV8A 1MEIA 4UTTA 3SGUA 2QJHA 1VHNA 1TREA 4UTWC 3ZWSA 3NQVA 3TJLA 1GEQA 2EHHA 4DBDA 3EWYA 1E51A 2E1DA 2J27A 3AJXA 1VRDA 5CG7A 2CWNA 3PB2A 5L6UA 3PG8A 3L68A 2TYSA 2H3BA 2B4GA 1WYIA 1T0OA 3A9IA 5G5IA 1M6JA 4A3UA 4AWUA 1A5CA 3CB8A 3TX9A 2WV8A 1K7FA 2HMCA 2C6QA 3UQNA 4K6AA 1F05A 3AO0A 3UWWA 2PCQA 4JS3A 4JIPA 1BTMA 1G4SA 4XTIA 3HB9A 3RU6A 2A7RA 5LGZA 3OA3A 8TIMA 3RMJA 4DPPA 5FESA 2ZRWA 3BGJA 4OGZA 4NX5A 3BARA 1OK4A 5TBOA 4MKNA 5C6MA 3LXCA 2J6XA 3MP4A 3FFSA 5K7JA 1YPIA 4HSOA 3EB2A 3G3DA 1YXCA 3F1QA 3W1NA 3T40A 2GQ8A 5HQEA 3KHJA 1WQ5A 3LCXA 1C29A 1SZFA 5LZLA 1GTHA 5HNRA 3RFAA 1JJKA 3NL3A 3QC3A 3CHVA 2X30A 4YCPA 1YXDA 4HPXA 1M7PA 4EIVA 1T99A 1UBSA 3L21A 4K7VA 1H1YA 3HJZA 4LUJA 4MY1A 3KRZA 1PIIA 1YADA 3DFPA 4UCGA 2CZFA 2JKAA 1ZALA 3DKLA 3IGUA 3O16A 2GJNA 1SO4A 4DF1A 2CFFA 2NX1A 4MY8A 3ZWTA 5AHIA 1OX4A 2X1SA 1ONRA 3QSTA 1XUUA 1RVGA 3M5XA 3W74A 2A7NA 3HF3A 4LVGA 2B0MA 3SFKA 3MMTA 1OFEA 5HINA 1TPFA 1OFQA 4NJIA 4N4QA 5KZMA 4AAJA 2V8ZA 1RR2A 1TQJA 1FDJA 2C15A 4LV4A 4GUIA 1G67A 1KFJA 4WXZA 3N2MA 1P5BA 3QYQA 1X8FA 3I7SA 2BWGA 1WOBA 4DO6A 3L67A 4GUJA 1KTBA 3WK1A 3WJSA 1H7OA 1ZFJA 4GUFA 1DORA 2EAWA 3I7RA 5A8GA 4YMZA 4R53A 2E6YA 4S2CA 2XFWA 1SW7A 5T26A 3MWAA 1SZNA 2NX3A 1W3NA 3MP3A 1F5ZA 3S1WA 5FF7A 4FX7A 4IJBA 1GQNA 4O50A 3TV8A 4Y90A 1JQVA 1JUEA 1WBJA 1HL2A 1ZENA 1A5AA 1AMKA 2V2DA 2V0TA 3S1UA 2BTMA 2Q8LA 3TXZA 3S0CA 2G5WA 4LRSA 1R2TA 3GR7A 4Q4KA 1GT8A 3E0IA 5F1UA 3W85A 1D3GA 4WZHA 5A5WA 2PE4A 1ZNNA 4AHPA 3MI6A 3JS3A 4OV9A 3LLDA 4BK9A 5LNUA 3W7MA 4JR5A 4PA8A 1GVSA 4TR9A 3W2KA 1W5OA 4N6FA 1VJIA 3IEBA 1S5WA 4LV9A 3CTLA 4WOQA 3STFA 5D2XA 1B4EA 3IV3A 3W1MA 3DAQA 3EXTA 1VYSX 1TB3A 3HOJA 5F4SA 3DENA 4UTLA 4AVFA 3STCA 4JTIA 3W7NA 3LV6A 3NPUA 3N9RA 3LHYA 3NL5A 2DP3A 4JTKA 1ICPA 4QNWA 2ZRVA 1LBMA 3TMLA 2BXVA 1V7YA 4WY0A 4Z1BA 3VFLA 4GC4A 3B03A 1JRBA 1PCKA 4M19A 1SO3A 3S5OA 2WJZA 3W6YA 3G8RA 3HG2A 1THFD 3MBDA 3G0UA 4ML9A 3C4UA 3HG4A 2ABBA 3TNOA 4UNKA 4UTUA 2YGYA 1K8YA 2C3ZA 3IVTA 2I9EA 5DCDA 3TAKA 2A21A 1J5TA 1W3TA 1JRCA 1OYBA 2DZSA 2V81A 5AFDA 2H3DA 3L0GA 5KINA 2QUUA 1OYAA 1H7NA 3LRLA 3TSBA 3V1PA 5AHFA 4WX2A 4K8HA 3TIMA 3EWUA 3GVGA 4RKAA 3P60A 3S5YA 1WAUA 3CM4A 4Z1CA 3FS2A 4NXSA 2NXGA 5L9FA 3KX6A 1XDMA 4NX0A 2HS6A 2PRHA 4PL1A 1H7RA 4O53A 5D37A 4JYDA 3W7HA 4DF0A 1OK6A 2OT1A 3PSWA 2VEIA 7TIMA 3UWZA 4P2VA 4YCOA 3DGRA 4ZMGA 1QO5A 4LC8A 5BOOA 2TSYA 1EP3A 1VLIA 3NPVA 2R94A 4NNCA 4JTTA 4N9DA 1EIXA 3I68A 3QPYA 3MYPA 4JEQA 3FYOA 1QAPA 2C19A 1ME9A 3W7GA 4MZYA 1Y0EA 4UTWA 3UWYA 1SFLA 1TPVA 1T8XA 4JTSA 1GOXA 3B0VC 1K03A 3PY2A 4K36A 3GKAA 2A5HA 4O57A 4N6EA 3PS7A 2UV8G 3FJLA 3QJAA 5CKSA 4UTKA 3W07A 2HS8A 3KVKA 4IMEA 2ZRXA 2VELA 5AC8A 4DO4A 4FIRA 4UMCA 3HGSA 1TV8A 3C2OA 3JR2A 1UUOA 2G97A 1J4EA 1Q6OA 2QR6A 4CLMA 2X1TA 5AHLA 3LLFA 3W2MA 5EY5A 3MBFA 1PV8A 4LRTA 3G1YA 2Z6IA 5DELA 4UTIA 3MO7A 2H90A 5K9XA 2QDHA 3PR2A 4WXYA 4GXMA 1L6WA 1A5BA 3FLUA 4JX5A 3U6WA 4ZQNA 2PURA 4U28A 1FUYA 5FEXA 3UD6A 3E9AA 4JTJA 3NG3A 1FDYA 4N2YA 4UFLA 1OFPA 4GFSA 5CPNA 1LDCA 3NZRA 3YPIA 1EB3A 3BO9A 3TQKA 3UPBA 4YWIA 1YDNA 3GDKA 3C2VA 4U4MA 3IIPA 3TXVA 3CIWA 2YSWA 3NQ2A 4Z0SA 2WKJA 3OBKA 4UFIA 3TW6A 3SGZA 3TCEA 1PVNA 3C2RA 3ABSA 4O17A 3THQA 3GXNA 3NQCA 1G6CA 4K38A 4UTMA 4ZQPA 2FJKA 4FHAA 5I3GA 2E77A 5U4NA 1IXPA 4CQ8A 3H54A 2C14A 1KFBA 2E6AA 5DLCA 1GVOA 5K9DA 2QCCA 1W37A 1XXXA 3LHUA 5F4WA 1SSGA 4LVBA 3NVTA 4UFMA 3C61A 4LWWA 2C18A 4Y6GA 1EWDA 2DZTA 3RLVA 4EVZA 1DL3A 2R14A 2A4AA 4FNSA 3IGXA 1TV7A 1SW0A 1G7VA 4BI5A 4W9TA 1I8JA 1FWNA 3CC1A 3Q2DA 4X9SA 1H1ZA 2ZTKA 1UUMA 3ABQA 3PUEA 1TSIA 4S1FA 3TU9A 2Y70A 4PTNA 4N9EA 4Y96A 3BLIA 4E0CA 1LBFA 3W73A 5F4XA 4DO5A 1TQXA 1KLYA 4LVDA 3F4WA 3NEVA 4FNQA 4ONVA 3V75A 1X1OA 2E5CA 4O54A 4HNUA 5TIMA 3IIXA 1XBXA 3BK0A 1QPOA 1DQWA 1CI1A 3UWUA 1ZCOA 3L65A 5C55A 3WJXA 4O16A 3L9CA 1KM4A 1TPH1 3M1ZA 4JDYA 3O8AA 4UR7A 3G3MA 3STEA 2NWRA 4FEZA 2Z0IA 1ML1A 3L66A 3W7PA 2VC6A 1JUKA 1LLWA 3G8EA 3M7WA 3ZFHA 1JULA 2Z6JA 3A22A 5AB3A 3S5NA 5E0KA 2QJIA 1R46A 4ZQMA 4JTLA 5HR7A 1QPQA 3PULA 4KFNA 5CZSA 4L4LA 1FBAA 1O94A 5CZJA 3B05A 1IGSA 1LZOA 1QDSA 1XBZA 2V2CA 3G22A 5E93A 2E6DA 2RHGA 5KTLA 4IMCA 4HNVA 5BRBA 3IGSA 4R34A 2VEPA 2AQWA 2FDSA 3UWVA 2GQAA 5C2XA 3LOTA 3I6RA 3LTSA 2E09A 1MEHA 3ANYA 5G4WA 1ICSA 3P8IA 2B7PA 4UFKA 4XBKA 4ADSA 4BR1A 3WK0A 4IXXA 4IMDA 4JXCA 3I7QA 1VHCA 3W71A 3MYOA 5K9CA 4M7SA 3S5ZA 3LCLA 1MO0A 1RQEA 3DBPA 1OJXA 4O52A 2ISWA 1KFLA 3NPWA 3W1AA 1H62A 1Q3NA 3TK7A 3M44A 5F2LA 2WOQA 1KV8A 4AEOA 2EF9A 4J9JA 2VENA 3UXAA 5EPDA 3PVFA 5IM51 1QOPA 4FF7A 3DFTA 1OX4B 2NUWA 3W88A 2CLIA 3G1VA 1Q6RA 3NAVA 2GUUA 4GJ1A 3PC0A 2C13A 3F03K 5AOUA 2V9DA 3UXDA 2VFIA 2JGYA 1OFDA 3C56A 3W2UA 3SSJA 4XWUA 5LGXA 4UMAA 3HIJA 5ABTA 4NXKA 1OX6A 2Y7GA 5E1QA 3N14A 5FF2A 4ALDA 1OHLA 2YYTA 5G2IA 4NNAA 3G24A 1W5NA 3CU2A 4UNLA 5D2TA 2GVLA 2YW3A 1TIMA 4JX6A 2ZZ5A 3A24A 4JY9A 3FYPA 5HWMA 4S2BA 1IF2A 3MW7A 4CCCA 3L5AA 1ZJIA 1XFBA 2QKFA 2H8XA 4Z08A 3W7JA 1K02A 2FPVA 3P7YA 4X2RA 3TUUA 1VLWA 2A2IA 1RZMA 3TH6A 3DH7A 3DXIA 4FNPA 3EEGA 1TTIA 4P61A 5D03A 2EKCA 2A1YA 5D30A 5D04C 1OFAA 1W56A 5CZ0A 1SPQA 4NT0A 1OF6A 1TPC1 4I7UA 1YXYA 4UUIA 2NUYA 3IIZA 4NU7A 4MY9A 1ALDA 2CLKA 1FY6A 1DBTA 3C2EA 4MYXA 2E5DA 3MHUA 3PBUA 3TC7A 4CNOA 1TPWA 2ZTJA 5EA9A 1H51A 3TA6A 1GYNA 3MI3A 1F73A 3U8GA 4JICA 4Z0JA 2Y7FA 3ZS4A 1JCYA 3P8JA 2ZDRA 1WV2A 4RCXA 2Y62A 1W1ZA 1NF7A 3M47A 4TX9A 3SW6A 1X7FA 4XQ6A 3W22A 1KM6A 3O63A 3KVJA 2V30A 2ZFAA 3MI2A 1AK5A 5KZEA 1W8SA 4WY0B 3HPSA 5FF4A 4HT3A 1SZGA 2GPTA 1QMLA 3RLUA 4BFAA 5DXYA 3O6DA 5LNWA 5DCEA 2QCHA 3STGA 3R2GA 1GYLA 3FEMA 3VCRA 3G1HA 1DOSA 2VFFA 4FIQA 1TTJA 4KFPA 3P81A 3W1LA 3BG9A 1QWGA 1F74A 3GB6A 4AMAA 3CWOX 3G1DA 5D09A 2VFHA 1IIHA 2CLMA 2RFGA 3EX3A 3B04A 5EKYA 4LS1A 1XBYA 1JCNA 4JTHA 3QZEA 2VOMA 3LRKA 3S1VA 3W7KA 1RQHA 1W3IA 3TJXA 2WNQA 1VYPX 1KLZA 1ADOA 4NJKA 2VFEA 3NM1A 1GJPA 3NL2A 4NZJA 3SI9A 2OJPA 4O19A 2TRSA 1IXNA 2FTPA 4QSHA 3BG3A 1N7KA 1SO6A 3I65A 2FPYA 4YLWA 1Z41A 1I2PA 3PWAA 2JBMA 3W1XA 4C1KA 4OU1A 3GAKA 3HPZA 3LCFA 3QM3A 4O11A 4NJHA 5AYXA 2A7PA 2PRLA 2QF7A 1JVNA 3L5MA 3NQ8A 4PH6A 3GYEA 3FIGA 2V5LA 1WXJA 1YLVA 4LY8A 3NQDA 5F1VA 4AB4A 1FWTA 1A50A 1UB3A 4CQ9A 1W5QA 4JGDA 4LTSA 1M7OA 2WNZA 3PF3A 5D2VA 3LCGA 1L6SA 2FIQA 3KAOA 2H8ZA 4X3ZA 3W83A 1G4PA 3ABRA 3NM3A 2OCZA 1MSSA 3P80A 2ZZ1A 5G1YA 5AHEA 1Z42A 2P0OA 2P1FA 4PC8A 1Q6LA 2ZBTA 2FB2A 4DXVA 1PHQA 2E68A 2WNNA 3C3NA 4D2JA 4LUIA 4NJJA 1TYGA 1OFBA 3O05A 1TO3A 3GDTA 3LV5A 3C8FA 3OVQA 3EKZA 5AYZA 1B4KA 1HO4A 1VR6A 2DZUA 1B57A 3WJZA 4PODA 3TC6A 1I45A 3M0ZA 1VGAA 5DY2A 2KZHA 3N19B 3O6CA 1XBVA 3A5FA 4UFJA 1O95A 3LCHA 4FXRA 2X16A 1FXQA 3B8DA 1O5XA 5TQLA 2OMAA 3W2JA 1R30A 2CU0A 3QMTA 4AF0A 4A22A 5I3IA 3IIOA 4NVTA 2J88A 2XN2A 5BW6A 1NSJA 5DXXA 1LTDA 2OT0A 2QCDA 1TRDA 2QCNA 2Y61A 2QCGA 2R8WA 1Q45A 4MFEA 3QRHA 2ALDA 3P84A 4UC5A 3SJ3A 1I2QA 4UR8A 3W2NA 1JCLA 4GRSA 3LDVA 4YXGA 4O28A 2RDWA 1LOSA 5DBUA 4DBEA 2NWSA 4TMCA 2CLFA 1KV5A 3OVPA 3WJWA 5CSSA 5LNSA 3W3OA 2DJXA 4MLJA 3W7OA 3DHFA 1KBJA 3BVJA 4GUHA 1AW5A 2JGQA 3OEXA 3W7DA 1Q6QA 3LCWA 4ADTA 1K7XA 4R33A 4N4PA 2CZ5A 3TSDA 3C2FA 4ADUA 4LS2A 1IXOA 4JTUA 3QQ0A 3GXTA 1BKSA 4PEKA 4Q33A 2P10A 5CPOA 5CSRA 2PC4A 3G18A 4HSNA 4MZ8A 5KZDA 4HN4A 2J9XA 3UWQA 4ZQRA 2FFCA 4GNJA 3TFCA 3LM7A 3NGJA 1LRNA 1EX5A 3QW3A 4ICNA 3BV4A 4ORIA 5I3FA 5BMWA 1SR9A 3P5YA 3M6YA 3CPRA 4ORMA 1TTPA 2DU2A 3B0UX 4IPIA 3TR2A 4WJEA 1LRQA 2FPTA 5I3KA 3FJ6A 3W84A 2YW4A 1AG1O 1K7EA 2ZRUA 3ABOA 4NUWA 3CEPA 3NA8A 3OIXA 4HHPA 5G2WA 3T7VA 2VEKA 3S42A 3BW3A 2DZXA 4RZ6A 1W54A 4PCFA 1GWJA 4LOCA 5K2ZA 1VC4A 2B7OA 4DF2A 6TIMA 1K3UA 5D32A 3LCIA 5BNKA 4I7WA 4EF9A 2ZZ6A 1W5PA 5AC7A 3W9ZA 2RDTA 3GZ3A 4BWLC 2ZA3A 3E49A 3S8HA 2B7NA 3C52A 3EX2A 3PUOA 3CLMA 2QCFA 3UY7A 4N02A 2Z1BA 1XKYA 3RK8A 3USBA 4JY8A 1OFOA 4O10A 1KM3A 1M5WA 5D2YA 1X6UA 3WFAA 3VNDA 3MJYA 1LRTA 3IRDA 4O8RA 1SO5A 1H7PA 1KM2A 2C0AA 3HGOA 1F6PA 1OYCA 2Y88A 4NQ1A 3L0KA 4M6PA 3ATZA 1W5MA 4O4WA 3NQEA 4E2DA 3N2XA 1GVRA 1JQXA 3W76A 2VFDA 1JR1A 4RLIA 2NXIA 1R47A 1P0NA 1RQBA 3DFNA 1MXSA 2GVGA 1F2JA 1KBIA 3G1XA 2J24A 4UIOA 3NQMA 3TFXA 2H6RA 4UXDA 3CIXA 3KFTA 4ZQOA 3R8RA 3E96A 3IVSA 5K4XA 1UCWA 3DI1A 2Y6ZA 3GKFA 3EXRA 1VQTA 2QAFA 3GK0A 3EX6A 1OX5A 3GDMA 5SWUA 4M7TA 4PFMA 1ZHAA 2TPSA 1ZY9A 3DZ1A 4MVAA 1R2SA 4B5NA 2NLIA 1Z48A 1JCXA 1EPXA 1VCVA 1EP1A 1XL9A 5FEWA 2FLIA 4IX2A 5LHFA 2FB3A 2BLEA 3ELFA 4H3DA 1UASA 3BPWA 3KRSA 1QCWA 3BW2A 4GUGA 1U5JA 1QNVA 1WDWA 2A6LA 3M5ZA 3QF0A 1EUNA 4ZQCA 3P5ZA 3W75A 4K8EA 4RK8A 2WQPA 5HWNA 5FEPA 3R5EA 1FXPA 4KKXA 2W6RA 6ALDA 4K37A 1XI3A 2NV2A 2V2HA 2NZLA 3LERA 3GX9A 3M9YA 3NPXA 4IXHA 2E6FA 1H50A 4JYFA 2X1RA 3W2LA 1D3HA 3B0PA 3LI0A 5H2ZA 4FXSA 4RXGA 3SECA 1NFBA 1GG1A 1UJPA 2DJLA 2CZEA 1VYRA 1CX9A 4HKPA 2LLEA 1XDLA 3VI2A 3LXAA 4EF8A 3PG9A 3A23A 1YYAA 3PBVA 1OF8A 1LROA 4QM1A 1YTKA 1ME7A 2OX1A 3WK2A 3NQAA 1HUVA 1S5TA 2W79A 3NL6A 1SFJA 3TW7A 3WJYA 4H6KA 1LLZA 3LHVA 1XCFA 3R89A 2W0UA 3P74A 3U2OA 4M5PA 3B4UA 3Q94A 4TO8A 3S6DA 1P0KA 5DN1A 1Z44A 3GXPA 4MJZA 2WO5A 2GQ9A 3DHDA 4FNTA 4PL2A 1TPB1 1A5SA 1I4NA 3QW4B 2F84A 3W7QA 3VE9A 3PB0A 4IWWA 3TAOA 4R7JA 4WUIA 2O7SA 1RD5A 3UPWA 4ZZ9A 3N9SA 4FNRA 4M6QA 3QQ1A 4QIUA 4LT9A 4E38A 3O06A 2PRMA 1HO1A 1GG0A 3INPA 3GNNA 2ZRZA 3G0XA 2ZZ2A 5AHMA 3HG5A 2XN1A 4AHQA 3EKLA 2ZYFA 1B9BA 2V5BA 1VPXA 1KTNA 2AAMA 1KW1A 2WPBA 1OG0A 2Q3OA 3G1SA 1SW3A 4RZ5A 4XKYA 5AN7A 5HULA 3KVMA 3NZ1A 1TMHA 2NV1A 3NR0A 1G7UA 1YTDA 4G1KA 1QO2A 4OT7A 4Q32A 2FQIA 1QFEA 4AWTA 5FF0A 3BLEA 1QPNA 1U83A 2YFOA 4IX0A 4QISA 4CQAA 1PL9A 4H4IA 4MOZA 3R12A 1JCMP 1TPEA 3K30A 5IBXC 3W1QA 1O5KA 1GZGA 3HBLA 1ICQA 4AHOA 4XTDA 3QEZA 4GBUA 1HG3A 3W1UA 3TMQA 3KOFA 1KM1A 3QMRA 4OWGA 3GIYA 1G4EA 3NQFA 4I9AA 4LC6A 1KM0A 1ZAHA 5KSWA 3S1XA 3UZJA 2C16A 3CQ0A 2HTMA 2IQTA 3W7LA 3W7RA 4O1CA 4LNYA 5DY3A 2EPHA 1ZAJA 4TU1A 4A21A 3GAYA 1LYXA 4Y8FA 4EOUA 4OBTA 3MHFA 1GVQA 3PM6A 4WOZA 4OE7A 3WK3A 4JYEA 3NYZA 4O1AA 3FA5A 4JDBA 1HFBA 1ME8A 3LTYA 4LS0A 1N8FA 3DI0A 1TJPA 3TE9A 2WSYA 3EWXA 1GTEA 2A85A 1DKWA 4O12A 1WA3A 3C6CA 1AW1A 4FX8A 4ZL1A 1VCGA 1B3OA 4DELA 5LNRA 1CW2A 2ZA1A 2VKZG 3ZR4A 1P1XA 4CNNA 1R2RA 2Y7DA 4IMGA 4A2RA 2QDGA 1LOQA 5GVJA 4MIMA 1F76A 1QR7A 3DKJA 3W72A 2DZWA 2J9YA 1JCJA 1PCWA 3BG5A 5J5DA 4BWLA 3MHGA 3GDRA 3TKFA 3KXQA 3SR7A 3QSRA 4JIQA 3LB0A 1C8VA 4AF0B 4TMBA 1O4UA 1SUXA 3OVRA 3LRMA 3M16A 1IIGA 1SZEA 1J2WA 2Q3RA 2QCDB 4Z1DA 3F4NA 2B7QA 1NVMA 3TQVA 3L0NA 4A2SA 1FDZA 4LU0A 4RX0A 1TPUA 1I2NA 3W86A 2YFNA 2RH9A 1L9WA 2C1HA 3Q58A 1KFEA 1PHWA 1SSDA 2I14A 3T78A 1K8ZA 1TV5A 3G1AA 5I3HA 2Y89A 5F2MA 2G96A 1AL7A 4DEFA 4O4VA 1FWSA 1S3HA 4RR4A 3HO8A 2YPIA 3HGRA 3RNDA 2CZDA 3HMJG 2QUVA 5H91A 4DPQA 3M5VA 1XC4A 3N34A 1LBLA 1OVDA 1VH7A 2E5BA 1KTCA 5G1TA 3W70A 1EWEA 3T4CA 4O15A 3LXBA 3LX9A 1O60A 1XM3A 1QOQA 1BWLA 1LOLA 3OHIA 1G69A 4QNEA 4K39A 5FEZA 3A5VA 1FWRA 5CPMA 4OV4A 3TSMA 4GWEA 5HJLA 3PBWA 5K3VA 1DHPA 2VFGA 3GLCA 2I1OA 1YDOA 3HQ1A 4I7VA 4YL2A 4KWWA 4QAIA 4UTJA 4BF9A 1S5VA 2CLOA 4WY0F 4C1LA 2Y63A 4UTTC 5AC6A 5KITA 1OFRA 5HR6A 2RDUA 3N3MA 4AWSA 4FB7A 2NUXA 1RV8A 2QAPA 3LHWA 3W7CA 1AL8A 3ATYA 3DFOA 1H63A 3VE7A 4E2BA 1GPWA 4Z1AA 5I3JA 1YPFA 2AGKA 1SU5A 2BSLA 1N55A 3UZ5A 4BI6A 1DV7A 3W7EA 1YDVA 4XBSA 3FKRA 1EP2A 1H7XA 2A6NA 3JRKA 4AH7A 3NO5A 4QQ3A 2ZA2A 4IUOA 3KVLA 1FCVA 3BLFA 2ISVA 5FI8A 3M41A 2ABAA 5D2WA 3IIVA 2BZNA 1VCFA 4HIBA 5HUOA 3O6YX 5C5YA 4JX4A 4IOTA 1H5YA 4HNNA 4O13A 3NQGA 4GE8A 5D02A 4POCA 2O7QA 3FOKA 4LVFA 2DZVA 4A29A 2JK2A 2VEMA 1PS9A 4MJMA 2ZQ0A 2ZCGA 3UYCA 3EWZA 4QITA 1I2RA 2A0NA 5LHEA 4MUZA 3P61A 1IXQA 3O1NA 2YXGA 3T55A 4XUGA 4MFDA 5EYWA 1FCBA 4WD0A 5J5RA 3C0JA 3SIZA 4CCEA 5F2GA 4IMFA 1BEUA 1A53A 1FX6A 5DBTA 2QCLA 2V82A 3HGJA 4NNBA 2GJLA 2R91A 5LNVA 4OHQA 4MPQA 5U7SA 3EWBX 3P67A 4O14A 5CPLA 5K4ZA 3CEUA 3NDOA 1LORA 3P82A 2ZRYA 1L6YA 2CLEA 1LCOA 3P62A 3Q37A 4FNUA 4N9CA 3W1TA 1G4TA 2Z2UA 2ATSA 5HWJA 3NXFA 1NEYA 5EMUA 3W87A 1I2OA 2ATMA 2JKEA 2BX7A 5D33A 1TCDA 3OG3A 1GVFA 5LSMA 3QPZA 3E02A 4XZ9A 3T44A 3NOEA 3LGEA 3BW4A 5F2IA 3O15A 4JN6A 1KFCA 3MUXA 5C54A 3QFEA 2QCMA 3EX1A 2Y85A 4QJ1A 4O18A 1W0MA 3EWWA 3N73A 3G0SA 4CNPA 4RZ4A 4O1BA 1MEWA 3B06A 3LBCA 4OQVA 3GR8A 2G95A 1T96A 4RXFA 2NXHA 1DJQA 5IBXA 1ZAIA 3CT7A 3PSVA 3MP5A 1WOAA 2XN0A 3DU0A 1MZHA 3M5YA 1V5XA 2CW6A 2GOUA 3RF9A 1VZWA 4EWND 3KRUA 1YTEA 3EXSA 1TRIA 5BMXA 2QJGA 5G4EA 2WSRA 3SY5A 1NF0A 1W31A 5FF3A 2HSAA 2ZZ3A 3EX4A 1EA0A 4BI7A 5EBUA 1KFKA 4K7YA 5HMSA 3IVUA 4IQLA 4JTFA 5KMYA 4Y9AA 1P4CA 3GNDA 2F7FA 4IPJA 1OABA 1FWWA 2JKPA
chains in the Genus database with same CATH superfamily
2J66A 5D05A 4MLRA 1Q2SA 5CCZA 4L4MA 4IIGA 3BGGA 4KH2A 3VKJA 1R38A 4DQWA 3EDKA 1BWKA 3UPMA 3QH2A 1CBGA 4LVAA 5CBBA 1WX0A 4W89A 1O5QA 1L8NA 2YCEA 1F6KA 3FKKA 3VD4A 4DHGA 1TPDA 4GG9A 1F7BA 4CCDA 1K4GA 2XZ7A 1XH0A 4WSHA 1J18A 2CHNA 3U7VA 3WD1A 2AOSA 3E12A 5FJIA 4QDWA 4IIHA 3GS6A 3G6MA 3H12A 4XZWA 2QEZA 3H55A 4AD0A 4KRZA 1UR0A 5ENLA 1IEWA 1H60A 2Z25A 4IUGA 4DJED 5FJJA 1NAL1 2X1UA 1MUCA 4US5A 1C9DA 3O07A 2YX0A 4MADA 2GZXA 2ZZ7A 3OP2A 3WBEA 3E5PA 1Y7VA 4MZ1A 2YYUA 3LGDA 3AS3A 1QPKA 4C7GA 1DVJA 2CLHA 4H41A 3WD2A 2YJQA 2NX9A 4PMXA 4GLEA 2FHCA 2Q8ZA 4ZSUA 1JDFA 4TV5A 2ZKMX 5CJMA 3GHTA 1EUAA 1R3VA 1XLMA 3W7IA 1EJTC 2Y7EA 1KM5A 4LUTA 2VP8A 1TZ9A 4IP4A 4NL1A 4FX6M 4ZVJA 1PO9A 5DT5A 3ZT7A 1J0ZA 5D4YA 1CECA 1HL8A 2O55A 2X2GA 1GW1A 5LKYA 1NY1A 2Z29A 3LBMA 1PZ3A 3H70A 4YVVA 2C91A 2W5FA 1BLIA 4FO4A 3WNNA 3D0CA 1X1ZA 4EXBA 4TOQA 3AYRA 4Q4SA 1H2JA 5A8MA 1YNQA 4GI4A 1MWOA 1L2UA 1VENA 5XIAA 1FFRA 2C71A 4Q7IA 3TDFA 3MCOA 4TXEA 3CUFA 3GHSA 4UTTA 2BY2A 2VI0A 2BMBA 4UTWC 3ZWSA 3M4HA 3VIGA 2E1DA 3AJXA 1FHUA 1ZTVA 3PG8A 3FAWA 3REQA 3N25A 4L9XA 5DMLA 5JUVA 1MRQA 2V6AA 1T0OA 4LNCA 3BANA 2PDJA 1A5CA 2J7DA 4GYPC 3TX9A 1K7FA 1M9HA 4IZGA 3VOIA 3UWWA 1DE6A 4JIPA 1BTMA 1Q65A 3LQGA 3RU6A 3RMJA 1HL9A 4AIEA 3TONA 3R8HA 4V27A 4MKNA 4LAZA 4YVPA 2J6XA 1XW8A 3ZT5A 4ROQA 2F61A 4HSOA 3EB2A 1P1MA 4KWSA 4F2BA 3N4FA 5HQEA 2QUNA 5ABFA 3L2MA 1OM0A 4XO6A 2BNJA 5E70A 1GTHA 5CJNA 3RFAA 3QXBA 3PK7A 1YXDA 4HPXA 1LLOA 3IACA 2XM2A 5EMMA 3FVDA 3HJZA 4LUJA 3WF2A 3DFPA 5CPTA 1FWEC 5A6SA 1UJQA 4I5RA 2ZXQA 1LQ0A 3DKLA 3GU2A 3IGUA 1LJYA 1MUWA 3UZYA 3RO6A 4R27A 4ZOEA 1RY0A 2X1SA 3RPMA 1RVGA 3W74A 2RUSA 4Q8TA 3RITA 4BKNA 1ODUA 3K4WA 1QU4A 1OFEA 1V51A 1TPFA 2FH8A 4N4QA 4NAEA 5KZMA 1UR2A 1O12A 1Y8BA 2J77A 1RR2A 4EAYA 4LV4A 3Q4DA 4WDWA 4ZR8A 4WXZA 3OG2A 1EJ7L 1P5BA 3ZJ8A 1AQHA 4E8CA 1WOBA 1XIHA 4DO6A 4GUJA 1EGZA 2DVTA 1CGUA 4MWAC 3WJSA 4GUFA 2QPSA 3DERA 1S2TA 2VRKA 4R53A 4OUIA 2E6YA 3CQHA 5HNNA 3CWHA 1W3NA 2PP3A 4C6KA 4ZO7A 3S1WA 1E55A 4ES4A 3ZLHA 3U57A 4IJBA 1GQNA 4O50A 3OO2A 1EF3A 4PBGA 2V0TA 3TXZA 3S0CA 2G5WA 5CSYA 5F1UA 3MV01 4DWSD 4WZHA 1FKWA 2PE4A 3GBDA 3ANVA 1ZNNA 2XVGA 1B2YA 6REQA 3LLDA 3R0KA 5HPOA 4BQ5A 4RL3A 4N6FA 1VJSA 2NW0A 1J01A 1S5WA 4LV9A 3ARRA 4AVOA 3W1MA 4J3SA 3HOJA 4AX6A 2HBXA 1OCJA 3EOSA 4JTIA 3LV6A 3N9RA 2Z27A 4Q8NA 4JTKA 4AZ6A 3IPWA 4Z1BA 1NIUA 3TYCA 1FWBC 4M19A 2WJZA 4S3CA 3WO8A 4HK7A 5M2FX 1A5LC 4PSPA 2Z7GA 1CEOA 3G0UA 2V3EA 4QQUA 3TNOA 4G7FA 4PRRA 1CGXA 4UNKA 2YGYA 4PULA 7CGTA 2PLCA 3MWCA 3U2CA 3VGEA 3LBOA 2A21A 2PDBA 4OOUA 1W3TA 1OYBA 5AFDA 2H3DA 5KINA 1TIWA 3W6MA 3TTSA 1EDTA 2I9UA 1HGYA 4IF2A 2VDIA 1LQ2A 2YIHA 4WX2A 3S2CA 5LIKX 3EWUA 1XLBA 3P14A 1WAUA 4HOWA 4NX0A 1H7RA 4GX9A 2Y8VA 1OK6A 2PSNA 2OT1A 2OOGA 4IFKA 5C9XA 1AD1A 3ITCA 1QO5A 4LC8A 2TSYA 1EP3A 1VLIA 4Y8EA 2QQ6A 2HZGA 1F3TA 4P8UA 2QMJA 5I7GA 2C8NA 3WDRA 3U5UA 3QPYA 2XISA 4JEQA 3E0VA 1N8IA 3VDCA 1TPVA 5C7VA 3H2NA 1T8XA 3TEVA 1GOXA 1K03A 2J8FA 3GKAA 4O57A 3V35A 4H6QA 1B30A 5CKSA 4UTKA 4GX8A 3KVKA 1CENA 1DIEA 2Z00A 2VR2A 1S2VA 2EPMX 1EBGA 4DO4A 2Z1VA 3CASA 4UMCA 3HGSA 1TV8A 2GDVA 1OCQA 2QR6A 1XLLA 2PTXA 5AHLA 1TELA 4I3GA 2Z6IA 2FH6A 5PTDA 1IEXA 2Q02A 1Q6GA 1O5RA 2H90A 2QDHA 3PR2A 1CTNA 3V3WA 4UZUA 4O0QA 3KS6A 3H4XA 3UU0A 1E71M 3FLUA 3UCDA 3U6WA 3IGHX 5HDRA 1NWTA 3OGSA 4U28A 1FUYA 4PUNA 5FEXA 3UD6A 4C5ZA 2P76A 3A4WA 4RZBA 2E8YA 4N2YA 2XSXA 4F0HA 4UFLA 4Z42C 4HA1A 1LDCA 3NZRA 3YPIA 1EB3A 3BO9A 2ZX7A 3VZZA 3RJXA 2D2GA 1YDNA 4U4MA 2IMRA 3QY6A 1CXFA 3CIWA 1MDRA 3OBKA 3ITGA 3C2RA 3POHA 4PYSA 4HNCA 5CPSA 2R1NA 2CXEA 3AIQA 4FHAA 2XH7A 3FN9A 4CQ8A 1IXPA 4CN1A 3H54A 2WVVB 1PIGA 4HCDA 4M81A 1IT0A 3C61A 2C18A 4Y6GA 1XJBA 3EOLA 2R14A 4JL2A 3POCA 1TV7A 3PZQA 1I8JA 2PA6A 3Q2DA 3URNA 4X9SA 2XIIA 2QMKA 2ZTKA 3PUEA 1TSIA 4S1FA 3TU9A 3QZAA 3WDIA 4YJ5A 4MAVA 3BLIA 1LBFA 3B3DA 1KLYA 4FNQA 1X8CA 1FKXA 2V5KA 2E5CA 3FJ4A 4L1XA 3RLHA 3IIXA 1XBXA 1M1BA 5LXEA 1UD8A 4S3DA 3L65A 1TPH1 2GJXA 2PZNA 4JDYA 4UR7A 1GPFA 3CIVA 3WLLA 3L66A 1JUKA 3G8EA 3M7WA 3D47A 2V5CA 5E0KA 4QBXA 1R46A 1IZCA 4ZQMA 4U5IA 4MNLA 1JFHA 3PULA 4KFNA 5CZSA 1O94A 4GVFA 1TV3A 5ECUA 1IGSA 1LZOA 1CXKA 2V2CA 3G22A 4XIMA 3E2QA 3A3WA 5BRBA 3CNYA 2VEPA 3SSZA 4Z2LA 4MNMA 1XLDA 4PUKA 3LTSA 3WD3A 1MEHA 2WHLA 1Q66A 5JBFA 4P8WA 4XBKA 4BR1A 4JXCA 3VUPA 2P53A 1GZ1A 3HFTA 2ISWA 4F0MA 3NPWA 3SEPA 2BFGA 1OSEA 4LUSA 5F2LA 3DC8A 4EPDC 1KV8A 3I4KA 2VENA 1K6WA 5A2BA 2CWXA 3NDYA 2J7CA 1M65A 2OOFA 4OOZA 3RX4A 3GNPA 1RHCA 4ZGYA 4DO7A 3RCNA 1U2YA 1JNDA 3WH9A 2JGYA 4DBSA 4H1ZA 2XUCA 2PTDA 4AZ7A 3MU7A 3SSJA 1GW9A 2PU1A 5ABTA 3VGFA 3FEQA 2Y7GA 3B0XA 4DI8A 1VBGA 4L4OA 1CGVA 1OHLA 4GH3A 3AYVA 1W5NA 3CU2A 4IH3A 4IL2A 2FVMA 1EDGA 3VIFA 4C5YA 2HK0A 1CLVA 3APYA 3FYPA 1J6OA 3MSRA 3TJIA 1XIGA 4S2BA 1IF2A 1ESWA 4D8ZA 3L5AA 1VB9A 3EEZA 4PN2A 3A3XA 3S2NA 3A9BA 1XLAA 1RLDA 1K02A 4UQDA 3TUUA 2A2IA 1RZMA 2BG5A 2Q8XA 3DH7A 2QUMA 3PTMA 3EEGA 1TTIA 3GTNA 3KOZA 4HJWA 1NOWA 1TPC1 4I90A 3GY1A 1EEXA 3PANA 1NDZA 3K1GA 4NU7A 1ALDA 3ZR5A 4E3VA 1PAMA 3GU9A 3WL0A 3TC7A 4NYUA 1HIZA 4H9MA 5EA9A 3TA6A 1GYNA 1F73A 3U8GA 4HVXA 4Z0JA 1VJZA 5DRIA 4DJFD 4H7VA 5BOFA 1QJWA 4B5SA 1GNXA 4YTSA 2G4JA 4HQVA 1NF7A 3CO4A 4K3ZA 4TX9A 1VIWA 1X7FA 3V5OA 3W22A 1H0IA 1I9CB 1QHZA 4L5ZA 5KZEA 1PKLA 4IISA 2XG9A 2BB0A 1PPIA 5ABHA 1SZGA 1X98A 4Y9MA 5DXYA 2WHKA 5I77A 4ZBCA 5C9RA 3STGA 3R2GA 3VCRA 3G1HA 3GZAA 2VFFA 1UC4A 2XH2A 2PD5A 2VGIA 4PMOA 3QGKC 1LG2A 3BG9A 4DJDC 1QWGA 3M64A 5CXPA 1RP8A 3GB6A 2J7EA 3B97A 5D09A 1IIHA 3N12A 4DXKA 3EX3A 4YPJA 1JCNA 3QZEA 3W7KA 3CPUA 2CHOA 3T0BA 3BAWA 1KLZA 1QUMA 1XICA 1ADOA 2PDIA 2VC9A 3WBWA 5I06A 2WAGA 3NL2A 4LXFA 3SI9A 2F2HA 2TRSA 3UG8A 2FTPA 2Z1WA 3GWQA 4AZCB 1QATA 4C6PA 4JIHA 1I2PA 4HA3A 1GYMA 2I16A 2J25A 4C1KA 3M0XA 3QM3A 3AICA 1FH8A 4NJHA 2A7PA 2OZTA 4GQ0A 3A64A 3GYEA 1XF0A 1MVYA 1KQYA 4MB1A 3UESA 2W3ZA 3WLNA 4AB4A 1FWTA 1V0KA 1UB3A 4CQ9A 2VL4A 1W5QA 5CC5A 4LTSA 1J6PA 1EYWA 4AYSA 3RM4A 3THUA 2H8ZA 3W83A 3P80A 1CDGA 4M1BA 4QJ3B 2VHLA 1Z42A 1F8IA 3QR1A 5FCZA 3SN1A 5JVLA 3OLGA 2WNNA 3C3NA 1WDPA 1JGMA 2BHUA 4NJJA 1TYGA 5CC7A 1OFBA 4E8GA 3HPAA 3HTWA 2HK1A 3LV5A 3C8FA 3OVQA 1E6PA 5A69A 1JPMA 1VR6A 2DZUA 2ODOA 4PUUA 3RN6A 4A3HA 3L23A 3UJFA 4PODA 3TC6A 4Z2GA 1XYBA 3UVAA 3F2DA 3CAWA 1I45A 3OB8A 1H1NA 5DY2A 3WMLA 4UBPC 3SRKA 3O6CA 3A5FA 1XPGA 3LCHA 2X16A 1FXQA 3NOYA 1GGOA 3WKZA 4G7EA 3TLLA 3SCOA 1WPCA 2YDSA 2W27A 4NVTA 2WZMA 1XHGA 3TCSA 2GVEA 1LTDA 2OT0A 5HJXA 3THCA 2QCDA 2QJMA 4ZENA 1P6BA 1ISXA 3MVIA 4DZHA 3G77A 2P3EA 4MG4A 4UC5A 3UJ2A 2XFFA 5AYIA 1YMYA 4QR6A 2ACUA 2RDWA 1S38A 1GORA 3WQFA 2CLFA 3WJWA 1YE6A 1HJXA 2CNCA 5FAJA 2ZICA 4QAWA 3VOHA 4MLJA 1KRMA 3W7OA 3DHFA 1KBJA 4RW3A 1AW5A 1ISWA 3GVWA 2FHFA 4ADTA 4R33A 4N4PA 4HA4A 1UOZA 3C2FA 4ADUA 3QQ0A 2E4TA 4Q33A 4KWUA 4Q4MA 3VM7A 2YBUA 3G18A 3N2TA 2WPGA 4JCLA 4RDYA 2WVSA 2J9XA 4PFHA 4OFCA 1ELSA 3NGJA 1UKQA 1MQQA 4IJCA 2OO6A 5GNXA 3QW3A 3EKGA 2QHAA 4LCQA 1XLHA 4NP7A 3WQ8A 1TTPA 1US2A 4MWAB 3V36A 5HBFA 2D0HA 2NQ5A 3SCQA 2Z28A 3QZ6A 2ZE3A 4ATWA 1AG1O 3P2VA 4NUWA 2Z2BA 3T7VA 3S42A 3VDGA 1GOIA 1V6WA 5EMKA 4X63A 3CGTA 2WANA 1KCXA 3WUGA 2ZX5A 2B7OA 1K3UA 4GVHA 1XH1A 2G50A 3GM8A 2GSJA 4BY3A 2HVNA 1M3UA 1WO2A 4L61A 3S8HA 1KO0A 3C52A 3QQWA 4QE5A 3HQNA 3PUOA 3CLMA 2QCFA 3FA4A 4N02A 2Z1BA 4O10A 1A0CA 1M5WA 1SMAA 3B0YA 4PMDA 2ZVRA 2VDHA 1FWGC 4OBRA 1SO5A 1H7PA 4M82A 3U3HA 2F38A 1OYCA 4BCEA 1D7FA 1QRQA 4M6PA 4XZNX 1UG6A 1W5MA 3SUVA 2YZ5A 3WQ5A 3S47A 4PMRA 3BURA 3FSUA 4E2DA 4HTYA 3KWXA 3RX3A 4RLIA 3AZTA 1ZS2A 1R47A 3A6OA 1PWMA 3GNXA 4UQCA 1MXSA 5B80A 5JQ9A 2J24A 3N6JA 1WKFA 4JFTA 4WDTA 2WLZA 3NQMA 4ZQOA 5HMFA 4DYEA 2J7GA 1Z89A 2XVPA 3EXRA 1OX5A 2TODA 2WXDM 4EAMA 1ZHAA 3JZUA 4I5UA 1ZY9A 3AUOA 1R2SA 1Z48A 1VD6A 1JAKA 1EPXA 3H2CA 4KF1A 1EP1A 5FEWA 2FLIA 4IX2A 3QHNA 3B4YA 3BPWA 3L4UA 2PWDA 2X8RA 1A5MC 1F07A 4ZQCA 3P5ZA 5FEPA 2QS8A 1XI3A 1SMDA 2V2HA 2R6OA 1LUCB 3GX9A 3M9YA 2X1RA 5H2ZA 4W8BA 4RXGA 2O9OA 1NFBA 1UJPA 1QI2A 4LYRA 1VYRA 2LLEA 6XIAA 3SCNA 1A3XA 5H8MA 3PG9A 3JU2A 2HEJA 3ES8A 1V02A 4QM1A 4KCVA 2OX1A 1HUVA 2W79A 3NL6A 1KWKA 3WJYA 1BKHA 1XCFA 3P74A 2HXTA 3KZSA 3B4UA 5LIWX 1GOKA 6A3HA 1TG7A 2FFIA 3WQDA 3S6DA 5DN1A 4GD0A 1KRCC 4TUFA 4NKCA 4MJZA 3RM8A 2GQ9A 3GXIA 4FNTA 4PL2A 1TPB1 1A5SA 4ROPA 2YL6A 1WXZA 1QNPA 4HPHA 4GA8A 5DEZA 4AX7A 4QIUA 3O06A 3QC0A 1GG0A 1VFTA 3GBEA 2NVAA 4XIAA 1KGUA 4AHQA 1UWQA 2ZYFA 1KTNA 1AH0A 1EFZA 1GONA 1OG0A 1XH2A 4MKSA 3A13A 1DJHA 1A3WA 3BSHA 2I57A 1HVXA 1TMHA 3NR0A 1YTDA 4G1KA 1W1YA 1QO2A 4OT7A 1F3EA 4NRSA 4Q8PA 2WQDA 3N11A 2YFOA 3B8WA 4CQAA 4PCNA 4FF5A 4V15A 1HXJA 1RK6A 5FSEC 1XRVA 3R12A 3WIJA 3HBLA 4AVNA 3W1UA 1ZQ5A 1I0DA 1KM1A 1JZ6A 4PB4A 3GIYA 2QDDA 4MHBA 5KSWA 3UZJA 4DUWA 5CGTA 2VZVA 3IK2A 4O1CA 4LNYA 4XAPA 1ZAJA 4EXQA 2NSXA 4A21A 5CC3A 4RPQA 4OBTA 1MFVA 1GVQA 4WOZA 4NZ3A 2VEGA 3ZYZA 3NYZA 3UETA 4Q7BA 4O1AA 3SJNA 1HFBA 1JIBA 2XSBA 3BH4A 3GNRA 1HKVA 3DI0A 4ZO6A 1TJPA 4DWSA 4HGXA 2WSYA 4KGJA 2A85A 2ZUUA 1WA3A 4D6HA 1R5YA 4K1WA 1B3OA 5LNRA 4LPCA 4E4PA 3SUTA 1R2RA 2P0IA 5CC6A 1LOQA 4XD6A 4QHRA 2DZWA 4HHHA 5HPCA 3E0WA 1F9CA 2W9MA 7REQB 3GDRA 1QNSA 3WQVA 3SR7A 1VFLA 1C8VA 3SCTA 4AF0B 3W82A 1O4UA 2VX7A 1RP9A 1TWDA 3TYAA 3LRMA 3TW9A 1E0WA 4I8DA 4PMZA 1B0IA 3MY9A 1GKRA 3F4NA 4AD1A 3M46A 1OT2A 3TQVA 2JIEA 2VGBA 1FDZA 4Z2JA 1TPUA 3C86A 3BC9A 2RDXA 1XGZA 3EOOA 2IPWA 1H0GA 5I3HA 5F2MA 4LY4A 1S3HA 4PTWA 3WBYA 2ASHA 4W88A 4WDXA 3PZMA 4ZO9A 1JG9A 2QUVA 4DPQA 3ZO9A 4EPEC 4FI4A 2GWNA 2VQTA 3FGCA 1EWEA 3T4CA 3LX9A 1C92A 2PDMA 1QI0A 3WEOA 1W2VA 1XM3A 2YDRA 2FZBA 1BWLA 1LOLA 4JTCA 4ZB5A 1JI2A 4GKTA 4K39A 2ZDSA 4GIAA 3AXHA 4AZGA 2I5GA 3O0FA 1FWRA 4OV4A 1LL4A 2BGNE 1KWGA 4GWEA 5HJLA 2YCLB 3C8NA 3VZYA 2ZXBA 3RHGA 4JQ1A 2J4GA 2PDYA 4NILA 3T0AA 2E25A 4QAIA 4BF9A 4CGTA 2P8BA 4C1LA 3UZWA 4UTTC 4FLOA 3N3TA 4KETA 4AWSA 3W7CA 3DFOA 3TYDA 4W5UA 2WMIB 1DXEA 3ZOAA 1DV7A 2DIKA 5DANA 4C1NA 4XBSA 2D2HA 2BHYA 3FKRA 5J04A 1H7XA 2A6NA 3JRKA 1RD6A 3NO5A 4WIWA 4QQ3A 2ZA2A 2ABAA 3M0LA 1VCFA 5HUOA 3O6YX 4AG0A 4GIYA 4JX4A 3VK5A 3R11A 4O13A 3NQGA 4LVFA 3E74A 3NSXA 4A29A 1BSLA 1DQUA 4QDMA 4D72A 2WCAA 5LHEA 2YXGA 4MFDA 1BYCA 5EYWA 3P0XA 3BMVA 4IL0A 4GACA 4YHGA 3WFZA 4I9TA 3U4FA 4CU7A 5LNVA 3LZ3A 3PJXA 4C7DA 4ACZB 3MDWA 3EWBX 5CPLA 3TNBA 2H9AA 1E6NA 5K4ZA 3BAIA 3NDOA 1LORA 4W87A 2ZRYA 3P62A 1LWJA 4TVDA 4EK7A 4FNUA 1WZLA 3W1TA 4PMQA 1TR9A 1R0MA 4R7WA 3W87A 2JKEA 4Y7EA 4NSBA 1TCDA 3IJ6A 3E02A 1XLJA 2Z4GA 4L9ZA 3MUXA 3EX1A 2OKTA 2Y85A 1QW9A 3N73A 4MB4A 3NZQA 2OGYA 1MEWA 3B06A 4TVCA 4MB3A 1GHSA 3JZEA 3Q65A 3ARQA 3DU0A 4GCXA 2P88A 3QV6A 1RUSA 4KGLA 2GOUA 3T42A 2Z1SA 2NT1A 2DUZA 1NDVA 4W93A 5MKGB 3TYZA 5G4EA 1GQKA 1AZ2A 3SY5A 1NF0A 4V2XA 1EA0A 4HHLA 5EBUA 3TQPA 3WLQA 1P4CA 2F7FA 4H9ZA 4IPJA 2DQXA 2CBIA 1LM1A 3CUIA 4TIMA 3TROA 3G1FA 3NSMA 3M43A 1XYCA 4M6VA 3QMSA 1RA0A 3KCJA 4H04A 3BICA 1ZLPA 3IJLA 4GJJA 5G2HA 3AMGA 1KA9F 2X42A 4EPKA 2OZ0A 4JQ4A 2YCIX 2DZPA 3R79A 3TN5A 2XZ9A 8XIMA 1L6GA 3RR4A 3FXGA 1XUZA 2QW5A 3IS4A 3W23A 3WN6A 2AMGA 2A3BA 3PUDA 1JPKA 2GL5A 1R3WA 4R9XA 1TJRA 5LA2A 1BYDA 1XINA 2VXNA 4XAFA 3OU8A 1HTIA 3CV6A 1DWIM 2ISSA 4LW7A 4QJ5B 1RSCA 4LAUA 1XKJA 1RXOB 2YDAA 2E28A 2GVJA 1UA7A 3VMOA 1FQ0A 1H61A 2X0HA 1FA2A 4D8AA 1QK2A 3S9YA 1JPIA 4R9OA 4DM2A 2ZIDA 4JTGA 4UTHA 2QGHA 1H7WA 1KGXA 2QUTA 3H2OA 3WD0A 2WC4A 1GVYA 4C6JA 1MRAA 3UEQA 3V0UA 1C91A 2WSQA 3W28A 4A8LA 3LU2A 4UFHA 2VO5A 3SN4A 4X0VA 2DUAA 4MWAD 3LHZA 1PE1A 1PWLA 3DFQA 3NJ3A 1SQ7A 4B5TA 3W1RA 1LL6A 1XQLA 4UQBA 5HUPA 2XJ7A 3BDKA 4JTEA 1Q2RA 2YA2A 1VIZA 4KBXA 1LP6A 1ZJHA 1OCBA 4HNTA 6TAAA 3PBYA 3DFSA 2PFHA 4BEQA 3H7UA 1E72M 2O9PA 2EGZA 4RV8A 4QEEA 1V0LA 1VHNA 1IT8A 1WE5A 2IXUA 3AMKA 1TFVA 3S83A 1PSCA 2GJPA 4DJFA 3T09A 4LAOA 1E43A 4GXPA 1B3ZA 1GCYA 2MNRA 3SM0A 3QHOA 3MCNA 3S3GA 3PUGA 2C6QA 3WLPA 1MFUA 2D3LA 4DZAA 2PCQA 2VEFA 1G4SA 1BVZA 3O0KA 4D71A 5LGZA 2A7RA 3DGBA 1AODA 5FESA 2ZRWA 2WJEA 4NX5A 1OK4A 5C6MA 2J8TA 3MP4A 3FFSA 5K7JA 1QW8A 4QG9A 7TAAA 2CETA 2DSZA 5E6ZA 2R1MA 4DI9A 3CAQA 2OYMA 1J0KA 1SZFA 5LZLA 4JFWA 3QC3A 4RNFA 4NAFA 1M7PA 2XGBA 3EWCA 3L21A 4AXNA 3HJEA 4XVEA 1MW1A 1YADA 2JKAA 1ZALA 4KRUA 3KCOA 3KDOA 5BYWA 4RUBA 2DT1A 1OZQA 4IM4A 2GJNA 1LF1A 3FW6A 2NX1A 5E0FA 2PPGA 4MY8A 3ZWTA 4BEUA 2VVNA 5AHIA 3DHPA 3GTFA 3M5XA 2JALA 4WKAA 2A7NA 3HF3A 4LVGA 3IUIA 2HV5A 1VFUA 1FDJA 3ZVHB 2PU0A 1KFJA 4ZCWA 2QDEA 1IZJA 1YKWA 4KT2A 4IP5A 1MW3A 3SUWA 1X8FA 2CC0A 1UKOA 4PBEA 2BWGA 1W1VA 3H24A 4L4PA 4AEFA 3GFZA 3I7RA 1MYRA 4YMZA 1SW7A 3M07A 4CD5A 1SZNA 2NX3A 1TE1A 1F5ZA 5FF7A 2V2DA 2AL1A 2BTMA 1GK8A 1R2TA 1NWSA 4HMDA 3E0IA 3W85A 4CUCA 2A3EA 2POTA 4AHPA 3HMCA 3B8SA 4YS1A 1YNPA 5GQBA 3KRBA 4REQB 3JS3A 2ZUTA 4JR5A 4PA8A 3SY1A 1GVSA 1W1B1 5BWFA 3N2CA 4P5UA 3IEBA 3CTLA 4E8DA 2R82A 1CLKA 1PTDA 1UKTA 1B4EA 3V4BA 3IV3A 1QHOA 3BZGA 4F0LA 4M6UA 4B91A 4YTQA 3EXTA 4NZCA 4RE3A 5F4SA 3QV8A 3STCA 3W7NA 1ZJBA 2FYMA 3NL5A 3PPHA 5C9ZA 1CT5A 2D2OA 3QFWA 2PGFA 1UWSA 4QXIA 2BXVA 3V0SA 2UBPC 1V0NA 1V7YA 4WY0A 2OSWA 1XG4A 3VFLA 3AXMA 3WDQA 1ECEA 3MC5A 1PCKA 1DXIA 4CQBA 3S5OA 3W6YA 2WLYA 3DFYA 3MBDA 3OVGA 1OD8A 3C4UA 1F3XA 1BGGA 1XGEA 3M0YA 4C6EA 4UTUA 4FALA 3IVTA 4H7ZA 2EBNA 3QVQA 5DCDA 1PJ9A 1A49A 1JRCA 2V81A 2DZSA 3WQ4A 1OYAA 4U5KA 3BQ5A 3UBPC 4DUOA 1BGAA 3NXLA 4FS9A 3CM4A 4NYYA 3FS2A 4C6QA 3PPCA 2VZTA 2NXGA 3LYEA 3DESA 4JEJA 2HS6A 4MDOA 1N2VA 2PRHA 2GGHA 3A47A 1UR9A 4O53A 4JYDA 2CESA 1FWAC 3QKZA 3UWZA 1JDDA 3WLJA 4ZMGA 1XIJA 5BOOA 4NNCA 2R94A 2FGLA 1UZ1A 2PDFA 2DSKA 2D1ZA 4JTTA 4FXJA 2J74A 3BJFA 4N9DA 1GVEA 1EIXA 1M01A 2X0YA 2C19A 1ME9A 3VNKA 1H3GA 3GE7A 6ENLA 4Y9OA 1QNRA 1QT1A 3OZMA 3PY2A 3TOYA 3FJLA 1H4PA 3QYSA 4KS0A 4IMEA 3DOPA 3JR2A 2X2YA 3VA8A 1UUOA 2G97A 1K77A 1J4EA 4QDPA 3MBFA 4LRTA 3BZJA 1EX1A 2DVXA 5HMDA 1BSIA 4OBSA 2INFA 1ZBKA 3LUTA 3NGFA 4J35A 4WXYA 2DZBA 4PBFA 4JX5A 4B16A 3BAKA 3M0JA 1DHKA 4NZ4A 3N17A 1JI1A 4P7LA 4BF7A 1OFPA 2A79A 3OZYA 3RPTA 1X6LA 3TQKA 1XYAA 4GXWA 4H7CA 5C9WA 2OPJA 3TXVA 4JFUA 4JAWA 3TW6A 3SGZA 3TCEA 4UR9A 3K8KA 3R4IA 3ABSA 4O17A 2AQOA 3THQA 4LUTB 1G6CA 2OODA 4GISA 4ZB0A 3RO8A 3PNUA 4UTMA 4DM1A 4ZQPA 2FJKA 2GGJA 2GYIA 2OYKA 2D3NA 2E77A 5FJUA 1PTAA 3GU1A 5DO8A 2PAJA 4HK5A 1VPQA 2E6AA 1GVOA 4J40A 1U30A 1W9UA 5I0DA 3RLVA 1DL3A 2A4AA 1E40A 4FNSA 1XCXA 3IGXA 3QGVA 1SW0A 2FDMA 3N18A 3ZT6A 4TQTA 1TA3A 1UUMA 1KBLA 4BS0A 2PTWA 4PUMA 4DVOA 5FJRA 4NG3A 4E0CA 5F4XA 5A8PA 2W92A 1CGYA 4KPLA 1V6XA 1TQXA 2E1WA 3REQB 3F4WA 3NEVA 3V75A 2GK1B 3TWBA 1X1OA 4H8NA 2IQ0A 4O54A 5TIMA 1ISYA 1QPOA 1TV2A 3UWUA 1ZCOA 5C55A 4O16A 3RRAA 3M1ZA 3O8AA 3V5FA 2Y5JA 3STEA 4OKDA 2UY2A 3GQYA 4RNHA 1KBBA 2L5HA 4QLLA 2Z0IA 2PGRA 1ML1A 1D7KA 2X7VA 2VR4A 3W7PA 3Q67A 1LLWA 5LA1A 5C0QA 1JULA 4Q4RA 3R6IA 1VEMA 5FAGA 5HR7A 2GSEA 2JF6A 5CZJA 2NT0A 1XFCA 1J11A 4GC3A 5E93A 3DUGA 2RHGA 4IMCA 4HNVA 4XX6A 3IGSA 4DJDD 5ABFB 3OODA 4R34A 2AQWA 4HN8A 3UWVA 1OADA 3SQSA 5C2XA 2OB3A 5G4WA 1ICSA 4H8VA 4UFKA 3WK0A 4IXXA 1AFSA 4IMDA 4GNKB 3I7QA 1AJ2A 3AHVA 3W71A 3W00A 4N0RA 3T6CA 2OWWA 3LCLA 1RQEA 3DBPA 1E6QM 1G94A 1KFLA 4F0KA 1H62A 4YYFA 3TK7A 1EYEA 3M0KA 2WOQA 4J9JA 5EPDA 2KAUC 3T07A 3VIMA 3CHCA 2WMGA 3APTA 2UY4A 2CLIA 2WKGA 2ADAA 3VZXA 1N8WA 2EPNA 5EFDA 2C13A 3MO4A 5AOUA 2D23A 2VFIA 3CB3A 2W91A 4NAEB 3PPFA 4H00A 3CUGA 3TC3A 3EBVA 3W2UA 4XWUA 4UMAA 1TCMA 4NXKA 3PNZA 2OTDA 3CH9A 3N14A 2O9RA 5FF2A 1A3HA 2YYTA 3I3BA 4NNAA 5G2IA 5DMNA 3W01A 4AY8A 1Q13A 1T40A 2YW3A 1TIMA 4JX6A 2ZZ5A 4JY9A 4GI6A 1FH7A 2OO0A 2W63A 3VOCA 4E5TA 4GINA 4CCCA 1ZP4A 1GKQA 4B5WA 4H2CA 3PZTA 3VINA 4EP8C 2ACQA 3P7YA 1UUQA 4X2RA 1VLWA 3DXIA 3WEMA 3MV11 2ICSA 3PZ9A 4P61A 2XH0A 3GFYA 5B7ZA 1W56A 1SPQA 1OF6A 2J7BA 1P6WA 4MY9A 1ZL1A 6REQB 4ZFCA 2CLKA 3AHXA 3WNOA 4DLFA 1E9YB 1DBTA 3C2EA 4MYXA 3EB3A 2E5DA 3MHUA 3PBUA 4GNVA 5E9XA 1ZBVA 3MI3A 3AMDA 2G4FA 2Y7FA 5ECVA 3GRIA 3ZS4A 4Q3MA 4HD5A 1JCYA 2G3FA 5AC5A 2J47A 1WV2A 1A5OC 1JDEA 5C2GA 1TR1A 3H26A 4AIOA 4GYKA 3B9DA 3T2OA 4YWSA 5T8GA 1SJCA 4J7RA 3HPSA 4W4QA 1UP0A 3DC0A 2CIPA 1QMLA 3II1A 3RLUA 1R7OA 3O6DA 3VX1A 1UD2A 5LNWA 4DBUA 3W27A 1GYLA 5A6MA 1TTJA 4HMEA 4KFPA 3VFCA 4GI9A 3W1LA 1DTUA 3LN3A 1NWRA 1F74A 4AY7A 3VOGA 3G1DA 2CLMA 5A6TC 2JF7A 3PFMA 1JPDX 5JU6A 2C7FA 3OGVA 3WH5A 2HPMA 1M7JA 4Q4QA 5JH2A 2EJAA 1KKOA 1RQHA 3AXIA 3TJXA 2WNQA 4Q6JA 1VYPX 4BHYA 4LALA 4FOUA 2FJUB 5HXMA 1XIIA 2EPOA 1E3XA 3RYSA 4HZ8A 3VNZA 4KCWA 2J62A 1SO6A 1M03A 3I65A 5T9CE 2PEVA 3B8UA 4YLWA 4KIRA 4Q8OA 1WUEA 1Z41A 4IFKB 2CLPA 2NSOA 4U33A 3PWAA 3MTWA 3QR0A 3GAKA 3WUFA 3HPZA 4O11A 3S46A 1JVNA 4PH6A 1EQCA 2V5LA 1WXJA 3NQDA 5F1VA 3W02A 4D1IA 3EAUA 3WX7A 1ISZA 1M7OA 2WNZA 4X0NA 1EA9C 1W3LA 3PF3A 2CBJA 1HJSA 4K2SA 1YNYA 2FIQA 1L2QA 4X3ZA 3L4YA 1G4PA 3ABRA 1E1EA 3NFUA 3WF1A 5G1YA 4NZ1A 2EO7A 4W86A 4MF4A 4PC8A 1EJXC 2QIIA 4DXVA 3WNMA 3V18A 4I6VA 4B5VA 3W6LA 3AWOA 3MZNA 5AYZA 1AQ0A 1E0UA 1B57A 4KEUA 2P50A 3WCZA 1M41A 1AVAA 1W9DM 3LMYA 2V67A 1CXHA 3FX4A 4F0SA 1VGAA 2XSAA 3AMCA 1OY0A 1PYMA 3VMPA 3RXZA 1GQJA 1O5XA 2CU0A 3SCWA 2OZ3A 4W8LA 4QRNA 4A22A 4LSBA 5FL0A 1NFGA 1W1A1 3BCFA 3QGAC 3SQMA 3KBJA 2G41A 1TRDA 2QCGA 1BHGA 1NU5A 2R8WA 1K1DA 4RDVA 4MFEA 4MM1A 4MNKA 3ZXWA 3UXKA 3ZZ1A 1B3XA 5EU9A 2WKLA 4S3EA 1SFTA 2XU2A 3VIKA 8CGTA 4IIBA 3W3OA 2DJXA 1C8QA 3IJ8A 5FSDC 3BVJA 3EDDA 1JDAA 5AY7A 3T81A 2DUXA 3RDKA 4ZTXA 3KLLA 3EYPA 2NQHA 1DIDA 4H9XA 7XIMA 2XVKA 1NELA 4PEKA 4OJYA 5CPOA 1R86A 5CSRA 2PC4A 5BCAA 2FZDA 4JN7A 4G5DA 5LA0A 1DWHM 1NFPA 3TFCA 1Z9AA 3FDKA 4FR6A 4X9YA 1EX5A 1MNSA 2ZC8A 4ORIA 5I3FA 5BMWA 3P5YA 3CPRA 3TR9A 2DU2A 3B0UX 4WJEA 2Y24A 5BWAA 3W84A 2EPKX 5BXTA 2ZRUA 3ABOA 3UVIA 4HHPA 5G2WA 3MKCA 1B3YA 1XIFA 2HNEA 4RDWA 2GJXB 4RZ6A 1XX1A 1JAEA 5I2UA 1W1PA 4WJXA 1VC4A 1ZBWA 5C71A 2QV5A 1EXBA 5BNKA 4AW7A 1KCLA 3QOKA 2G0WA 4EF9A 1GKPA 1EXPA 4Q6XA 2FMOA 3E49A 3IJ7A 2B7NA 3QN3A 4C90A 3FNDA 5A8NA 3UY7A 3WF0A 1E15A 2Y1HA 3EPNA 3TZFA 1WDRA 4ZSTA 4Q4OA 1LRTA 4O8RA 1IEVA 1ITCA 2PWUA 4Q4PA 1F6PA 4NQ1A 1EH9A 4BZYA 3E0LA 4BF5A 3AZSA 1O1HA 1GVRA 1JQXA 3BLOA 4LUSB 1PZ1A 1HP5A 1GZJA 2NXIA 2D69A 3AALA 1P0NA 1RQBA 2GVGA 1YRRA 1Z7AA 1R9ZA 4UIOA 1QOXA 4DAFA 4H9YA 2WZEA 3WNLA 4YTTA 4YTRA 1UCWA 3DI1A 1NOFA 3GDMA 3VKDA 1AQFA 4PMYA 5I07A 5SWUA 4QS5A 3DDMA 4MVAA 3GH7A 1O7AA 4B5NA 1UD6A 4GYFA 4XSLA 1JCXA 4LAKA 2OSXA 1B3WA 5LHFA 3WLSA 2FB3A 4H3DA 3LLXA 1CZ1A 1U5JA 1OINA 3GXDA 1V03A 3C5QA 2XDFA 3QF0A 3DIPA 4GZEA 2WQPA 5HWNA 3R5EA 3GG7A 6ALDA 4QS6A 3VKAA 3BGAA 4IXHA 2E6FA 3RU8X 5D9MA 3B0PA 3H2FA 4FXSA 1Q6DA 2DJLA 4XZHA 4V28A 3WMBA 1UZ4A 4P7OA 4EF8A 3A23A 4ASTA 1UMYA 1OF8A 1ME7A 3BMWA 1JZ5A 3WK2A 3NQAA 1B31A 1S5TA 2PDXA 2PLKA 3IANA 1KXHA 4PUWA 2XINA 4H6KA 3R89A 3QKEA 1A47A 5I23A 1W32A 2WO5A 3GTIA 4D6JA 2F84A 3KBSA 3W7QA 2F8QA 3WYZA 4B3ZA 1AUSL 3NDZA 4MUPA 4AIBA 4ZZ9A 3N9SA 4US5D 5GPRA 4LJ3A 1NM9A 1PDZA 4BJHA 4LT9A 2DT0A 4Q8VA 1HO1A 3K4DA 3FCPA 4GQRA 3G0XA 5D9OA 5AHMA 3HG5A 2PLMA 1IR1A 2HNHA 3EKLA 1B9BA 2XHYA 1CXLA 2V5BA 1VPXA 4E3TA 4K68A 4B5UA 2ON3A 2AAMA 2GOKA 1KW1A 1VBJA 5A6LA 1UROA 4JIRA 3UZXA 2Q3OA 3G1SA 1SW3A 3VM5A 3OZOA 4K8GA 3CS2A 4XKYA 3KVMA 3WD4A 2IPJA 3K46A 4QLJA 1G7UA 3MANA 1O1ZA 3FDGA 4OZOA 5ABEA 2IKIA 4Q32A 2FQIA 2GLKA 1QFEA 5FF0A 1R9XA 3FVMA 5FL1A 1UPMB 3UXLA 3RRXA 2OU4A 4QISA 3CV1A 4TTUA 4NHVA 1DJYA 4XK2A 5CPQA 3VC6A 3BAYA 3HPFA 3W1QA 1TWWA 2GFTA 3B9EA 1GZGA 2QLYA 1ZB5A 3GC4A 3QEZA 1RY8A 2X1IA 2BOGX 3GR4A 4QX4A 3BAXA 3QMRA 5TAOA 3UG5A 2NV9A 4I9AA 4LC6A 1KM0A 4M8UA 1ZAHA 5H8UA 4CN4A 1GOWA 2C16A 2HTMA 3LM3A 1YW1A 1BF6A 4QTGA 3ZSTA 1O68A 4TU1A 1LYXA 4EOUA 3MHFA 4AWEA 2IUZA 3HQPA 3AIEA 3GVRA 3E2SA 1AH3A 3FA5A 4JDBA 1ME8A 4PCPA 2PMQA 4Q22A 3EWXA 2WWDA 4C7FA 1DKWA 1AW1A 4ZOBA 2VX6A 3L12A 1VCGA 2VCCA 4IPNB 2HE8A 1VFHA 4H8HA 2ZA1A 2VKZG 4NY2A 2WC3A 2YA0A 2Y7DA 4A2RA 2QDGA 3AFBA 1XIDA 2OR2A 4MGGA 4MIMA 1QR7A 3WLTA 4GZIA 3F2CA 3W72A 1W3JA 2J9YA 1JCJA 1OC5A 3ITXA 1EZWA 5J5DA 4BWLA 3MHGA 1M68A 4LH8A 4G7EB 3B9NA 3KXQA 2BASA 4JIQA 1SUXA 3U9IA 3M16A 3CMGA 3OBEA 2A3LA 4NI3A 1ADDA 1NDYA 1UQZA 2QCDB 4PUEA 2VNCA 5JBDA 3CPGA 4LU0A 4B4FA 1I2NA 3W86A 2RH9A 2C1HA 3Q58A 1X38A 1EO5A 1TV5A 3G1AA 1FTXA 2Y89A 5TNVA 2G96A 2PDNA 3ITYA 3VCCA 4DEFA 3UJEA 3WH8A 3AXXA 3RNDA 2CZDA 1VEPA 3ITVA 3T0TA 4ATDA 5A6AA 1KRAC 5DRCA 5G1TA 1C9WA 3N6QA 4JHZA 2NQLA 5ABGA 3FK4A 1E0TA 1G69A 5DT7A 3ARUA 1VFFA 5CPMA 5HK4A 4JNZA 2JEPA 3PBWA 4F40A 5K3VA 1DHPA 3GLCA 3QLLA 3GO2A 3ARWA 3E5BA 1DJIA 1H49A 4I7VA 4KWWA 1IT7A 2QPUA 3VO0A 1XSJA 4NIRA 4AC1X 3CHFA 1FWHC 3PP7A 2Y63A 3ZSSA 5KITA 3BWWA 3WENA 4EWJA 4H9TA 2RDUA 3CZ8A 4FB7A 4CD7A 2NUXA 3EGJA 1V3IA 3KE0A 1Q63A 3ATYA 1GPWA 3SDOA 4Z1AA 5I3JA 4HP5A 1CWYA 1SU5A 4DJFC 3UZ5A 4GIEA 3WLMA 1JEZA 3W7EA 4CCZA 4L6OA 2ISDA 2J75A 1DWJM 1U22A 2ALRA 2VD8A 4F4RA 3TYBA 2XVNA 1Y5XA 3GG0A 1F61A 2X09A 1UOKA 4HHMA 5FI8A 3M41A 1KKRA 5D2WA 1UKPA 1C8XA 2XGZA 3MUAA 5AZ0A 4IOTA 1H5YA 4H6RA 1E3ZA 2WSPA 5D02A 1HQTA 2DH2A 2JK2A 2VEMA 4MJMA 2ZQ0A 3A4XA 1VEOA 2ZCGA 2DGAA 3JUGA 3UYCA 3UW6A 4QITA 4MUZA 3P61A 1IXQA 3O1NA 1KRBC 3T55A 1CCWB 1FCBA 4KEVA 4WD0A 3DHUA 5J5RA 5LIXX 3SIZA 1OGBA 4CCEA 5F2GA 3WFLA 4LF1A 4G6CA 4A8IA 4C6BA 2WM1A 2BVYA 3B8VA 3CBWA 3RM9A 4A35A 2GJLA 4OHQA 2NQJA 2CHRA 4P7QA 1CXIA 4HB7A 2XFYA 4AZIA 1L6YA 1XV8A 3L4TA 1S5MA 2ZOXA 1G4TA 1ZRQA 4LANA 5A8QA 5CBJA 4I6KA 1E6XM 3T44A 1G01A 3BW4A 5F2IA 3PZGA 5C54A 1WKYA 4E2OA 3WQGA 5D9NA 4O18A 1W0MA 3KBMA 2PWEA 3S4TA 3VNIA 3U5YA 3HQOA 3GR8A 1SGJA 4DZIA 5A6BA 4DYKA 1D8CA 4GKLA 1XYZA 2REQA 3CT7A 3PN8A 1WOAA 4PRWA 1I1WA 1XYLA 3WQOA 3KRUA 2G8ZA 3BOFA 5BMXA 2QJGA 2GDUA 4RE0A 3AIVA 3WZ0E 3CAKA 5EBAA 1CLXA 3A3HA 1W31A 2ZZ3A 3EDFA 4CKQA 2Y5EA 4BI7A 1KFKA 4K7YA 4GHRA 3GUGA 3GNDA 4J28A 1OABA 2JKPA 3LI1A 3O7UA 5D38A 4GQQA 3OTRA 3QV7A 4KQNA 2POZA 3WLOA 3AWNA 4XZLX 3CQIA 1S1RA 2EPLX 1JUBA 3VGDA 3WUBA 3NQ6A 1D9EA 5J8LA 3I10A 1S46A 3TLQA 2FZ8A 4AZBA 4WR3A 3HPXA 1DTNA 2PWGA 3C0SA 2D73A 3ERPA 3GDBA 5AVHA 1DP0A 3MMWA 1Y5VA 1OEPA 3GH4A 2R1PA 3AIBA 1BAGA 3KZPA 3W25A 3B40A 1XYMA 3E6EA 3R0UA 1CXEA 1J93A 3F5KA 1D8WA 4N9BA 2QJNA 1V79A 1RPXA 4O1DA 1X39A 3SN0A 1DQXA 3EWDA 3T05A 5EFFA 1NDWA 4XISA 4A3RA 3LHTA 1KNWA 4B2DD 2RKXA 4I9JA 4UMBA 3AIRA 1EJWC 4K1GA 1UP3A 5JMUA 1CNVA 3SZ8A 3AYSA 1LL7A 1VPYA 5MHBA 3WNPA 1YIXA 4FR1A 3PAJA 4MKVA 1XRFA 3THAA 1BPLB 3NNTA 2BOFX 2QCEA 3L2IA 1XYFA 3CZLA 1X7IA 7ENLA 2Y0FA 4H6EA 2VX4A 1SJBA 4Z2HA 5CH9A 4AXKA 1QVBA 3BCDA 1VBHA 5A8OA 3C3UA 1WBHA 3UY8A 3W1PA 2IKJA 3EA1A 5CGQA 4WQ6A 5HJYA 2C0HA 1VS1A 2GGGA 1AW2A 1JD7A 4YN5A 4C6CA 3AC0A 4RJEA 1EEPA 1JGIA 3LTPA 4MYAA 2W4XA 5IFTA 4X22A 1FCUA 4ZE5A 1GOOA 2WBKA 1Z6KA 3SGUA 4EACA 1SZRA 3TJLA 3UG4A 1IQ8A 1GEQA 2WW5A 1VRDA 5CG7A 3PB2A 5L6UA 1EJSC 3L68A 3T1GA 2H3BA 4LYKA 3EMZA 3S5SA 4DIAA 3A9IA 4QSFA 1M6JA 4AWUA 3FHQA 1TVNA 3V0TA 3VKBA 4HK6A 3ZLGA 4RE2A 2WV8A 3GXMA 3NWRA 2HMCA 3BOLA 1F05A 4K6AA 3AO0A 3T2PA 3UR7A 2VQUA 4CD4A 4W84A 2I5QA 3UG3A 2WC7A 1OBAA 3HB9A 4GQBA 3OA3A 8TIMA 3BTNA 3AJ7A 4DPPA 3VXGA 3IUDA 2ZUVA 3BGJA 2XVLA 3KBWA 3RX2A 1FWFC 3GYCA 3LXCA 5JH1A 4A6GA 3S2JA 3ITOA 1YXCA 4GPNA 3PWGA 2GQ8A 4GABA 4FP1A 3KHJA 2OFJA 4U10A 1PXGA 1WQ5A 2EJ1A 2VRQA 1V6UA 1XIBA 1JJKA 2OQYA 5T91A 4DUVA 3FGCB 4XZBA 2X30A 1ENUA 4YCPA 1T99A 1UBSA 3F4CA 1H1YA 1F3WA 4EPBC 4MY1A 3KRZA 1PIIA 4AY1A 3MVTA 3WDJA 5HQMA 1W17A 2QIWA 1U33A 4DF1A 4GOAA 4FLSA 4HU4A 1OX4A 1ONRA 3QSTA 1XUUA 1Q5MA 1M53A 4X61A 3TN6A 3EA3A 2B0MA 3IAPA 3MMTA 1R8LA 3KM8A 3SFKA 3IUHA 5HINA 1OFQA 2PDPA 4AAJA 1HN1A 2V8ZA 3ZJ7A 1WCGA 2XFRA 1W8GA 2QXWA 4GUIA 4F3HA 1G67A 3VYLA 3QYQA 5I3DA 1E9ZB 3T0DA 3I7SA 3L4XA 1KTBA 3WK1A 4C1NB 5KEZA 1H7OA 3N4EA 4LGXA 3TJ4A 2QNEA 4NZ5A 4QJ4B 2RJGA 5T26A 3MWAA 3W38A 3GC5A 2ZUMA 5AECA 3MP3A 4LFYA 3DECA 4HMNA 4XZMX 1HZYA 3LENA 3GH5A 1JUEA 1A5AA 1AMKA 4MMWA 3S1UA 2Q8LA 4UWMA 4LRSA 1GT8A 3K1DA 1JYVA 1A80A 1RJPA 2XIJA 1LT8A 2HJPA 4OV9A 4UZSA 3W7MA 4TR9A 3URAA 3DG6A 1VJIA 1SVDA 4WOQA 3T4WA 3STFA 2GQ3A 1P0BA 2OWXA 3DAQA 2GUYA 1VYSX 2VYOA 1BF2A 2H9AB 2C1IA 4UTLA 1B1YA 4AVFA 2PZ0A 3LHYA 3UJRA 2YA1A 2DP3A 1Q7QA 3FAXA 2ZRVA 1LBMA 3KOXA 3TMLA 1YX1A 1CYGA 1TZ7A 3B03A 1SO3A 3G8RA 3NIYA 3HG2A 1THFD 1ZU8A 1BRLA 1JF6A 1V02E 4L80A 4PB3A 4H9UA 2C3ZA 4LX4A 1W6TA 2V68A 1GVIA 3TAKA 3EPMA 3UYIA 3RLGA 4E4UA 1H7NA 2A3HA 3GSMA 3E3HA 3CH0A 3TSBA 3V1PA 3TIMA 3GVGA 3S5YA 4Z1CA 4DBWA 8A3HA 1TX2A 4WK9A 4NXSA 3NCOA 3H4WA 3QBUA 3SBFA 1RJRA 4PL1A 4Q8WA 1PKMA 3W7HA 4CN6A 4BQ4A 3PSWA 7TIMA 4HSHA 4P2VA 4YCOA 4REQA 3DGRA 3BUVA 1DJZA 1M04A 3MT1A 2NVDA 3UA4A 5A2AA 4LEQA 3EOEA 3CTTA 4HJFA 2O0TA 3I68A 4MJ4A 1UWTA 3MYPA 3FYOA 5KZ6A 3AAMA 1PB0A 1Y0EA 3UWYA 4P8XA 2GJRA 3AQUA 4HBKA 4JTSA 3WLIA 4PB5A 1PTGA 4K36A 2A5HA 2F9RA 1ZZMA 3G2GA 2UV8G 4KIEA 3SAZA 3KOYA 3W07A 1EGMA 2ZXAA 1RCOB 1WAWA 3AIWA 3AS2A 1X6NA 1FHVA 4FIRA 1SJDA 4DYJA 5CGMA 5LXXA 1V3JA 1BYBA 5G1MA 2D22A 1Q6OA 3E0FA 2X1TA 3SCPA 3LLFA 1PV8A 3JVAA 3G1YA 2GSHA 5DELA 5M5DA 3MO7A 5TD4A 3N6HA 5K9XA 1A5NC 1L6WA 2OSYA 1SR0A 4Q8QA 4PEEA 4ZQNA 3ITLA 2PC8A 2PURA 1G9HA 1JF5A 4U31A 2WJDA 3ARTA 1E70M 1EGVA 4RW5A 3NG3A 3LG3A 2WWCA 1IWAA 2AL2A 3MUIA 3GUWA 4GFSA 1R6WA 3OJGA 1RALA 2G3MA 1V6VA 3UPBA 4YWIA 2WK2A 3GDKA 3C2VA 3ECQA 1MXDA 1REQA 1XS2A 1X1NA 2O56A 3NQ2A 4Z0SA 3SCSA 4UFIA 2P5NA 1A0DA 1UD5A 5DX7A 4AIUA 4LQ1A 2YLAA 3NQCA 4LUYA 1AA1B 3UCCA 2BGQA 4V1XA 1V6TA 1K6AA 4AZHA 5HNTA 4DJEA 3F4DA 1KC7A 2C14A 3R1ZA 1KFBA 5DLCA 3WEZA 1RVKA 4GH1A 5K9DA 2Q6ZA 2QCCA 1XLIA 4P7NA 3LHUA 1F4AA 1SSGA 4XBJA 4LVBA 3VDBA 4LWWA 1EWDA 4JTAA 4EVZA 4GYJA 2DIJA 4HZ7A 4G1NA 1G7VA 4W9TA 3SCUA 2HXUA 4B90A 3K2GA 4KCUA 4JZ5A 5REQA 2Y70A 4XB3A 4PTNA 4N9EA 4Y96A 3L4ZA 1TJ1A 4KWOA 1MUMA 4LVDA 3PZIA 3GC2A 4HNUA 4GO9A 3BK0A 2QZRA 4ZODA 3WQWA 3G3MA 4L6DA 4R7OA 2NWRA 2YBTA 3G5EA 1E6SM 5I6SA 3W24A 3NYDA 1W3KA 2Z6JA 3A22A 2QJIA 1YQ2A 1WNOA 4JTLA 1QPQA 1UC5A 1FBAA 1DEDA 2OLAA 4C6OA 1QDSA 4C6MA 2E6DA 5A1AA 5KTLA 3CT2A 3VKCA 4W5ZA 4IFOA 5I03A 2FDSA 4JKKA 3U2EA 2GQAA 3I6RA 2DW6A 2HDJA 3ANYA 3P8IA 2B7PA 4JL1A 4AEEA 1J0JA 4NASA 5A6KA 2PF0A 1PX3A 1VP5A 4NAFB 4C6NA 1VHCA 3MYOA 4CVUA 4ZXOA 4M7SA 4ZO8A 3U2ZA 1MO0A 3UT0A 1OJXA 4IIDA 4O52A 1XRSA 4HOXA 3W1AA 2QPXA 4B15A 3QR3A 3M44A 3RILA 1I60A 4AEOA 1ISVA 4PSRA 4UOJA 3UXAA 2O4QA 3FSTA 1OWQA 1YBQA 4FF7A 3BJSA 2BP1A 4S23A 3CUZA 3W88A 1GQIA 3G1VA 1Q6RA 1KBKA 2GUUA 4GJ1A 1JXKA 2V9DA 2J13A 3UXDA 3UR2A 3OW1A 2E40A 1OFDA 2X7WA 3G1RA 4AISA 1BTCA 4GVIA 5LGXA 3GIQA 1OX6A 4DB7A 5E1QA 2GK1A 1B54A 1M7XA 3ANUA 3VILA 2Q71A 4UNLA 5D2TA 3OYXA 1RA5A 4O1EA 1EJVC 1JCTA 3PTKA 4S3KA 3A24A 5HWMA 3MW7A 1V0MA 1XLFA 4FLRA 4CVWA 4G8TA 3ZLFA 2D2JA 3SY8A 3VIPA 3WLRA 2QKFA 2H8XA 3G6LA 3VNMA 3W7JA 2FPVA 4CNUA 3QY7A 3T9PA 3TH6A 3QY8A 5D03A 2EKCA 5D30A 5D04C 1OQFA 2DH3A 3HV8A 5CZ0A 1YXYA 4UUIA 2OQHA 1BVNP 3IIZA 4W7VA 2WHMA 1ZP3A 1FY6A 2V3DA 4AUBA 4F48A 1JYXA 5BXSA 1P7TA 1IZKA 3GD6A 3W0KA 4CNOA 1TPWA 2ZTJA 4B92A 1H51A 1TKKA 1PKYA 1EJRC 2GDQA 2G37A 3S6OA 3P8JA 4RCXA 5IDIA 2Y62A 3M47A 3S6TA 2BODX 1W2PA 3SW6A 4XQ6A 4KEZA 5HOSA 1E4IA 1KM6A 3O63A 4INFA 2ZFAA 1US3A 3MI2A 1AK5A 3DEQ<