3TK7A

2.0 angstrom resolution crystal structure of transaldolase b (tala) from francisella tularensis in covalent complex with fructose 6-phosphate
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
320
structure length
320
Chain Sequence
b'QKSVLEQLKQVTMVVADTGDFELIKKYKPVDATTNPSLILKAVKEQKYSNLVAETISKVKANNPDLNSDDLVKEIAIEILVSFGIKILDVIEGKVSSEVDARVSFNSATTIDYAKRIIARYESNGIPKDRVLIKIAATWEGIKAAKLLQKEGINCNLTLIFDKAQAKACAEAGVYLVSPFVGRITDWQMQQNNLKTFPAIADDDGVNSVKAIYKLYKSHGFKTIVMGASFRNVEQVIALAGCDALTISPVLLEELKNRDEHLEVKLTKNDDVVTQSPQISEADFRWLMNENAMATHKLAEGIRLFTKDTIELENIIKQNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transaldolase
publication title Adherence to Burgi-Dunitz stereochemical principles requires significant structural rearrangements in Schiff-base formation: insights from transaldolase complexes.
pubmed doi rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Transferase
total genus 141
structure length 320
sequence length 320
chains with identical sequence B
ec nomenclature ec 2.2.1.2: Transaldolase.
pdb deposition date 2011-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00923 TAL_FSA Transaldolase/Fructose-6-phosphate aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3tk7A00
4O1CA 1LRQA 4K7YA 3L2IA 4JDYA 4NJIA 2Y88A 1RD5A 2QUUA 5HULA 4HT3A 3AJXA 3C2FA 2WPBA 4HHPA 4NZFA 3SJ3A 3O1NA 3O15A 5BOOA 3NYZA 1FWNA 3M16A 5AYXA 1H7RA 2YX0A 1H7NA 3E9AA 2VFFA 2Y70A 2A0NA 4ORIA 5FESA 3TFCA 4C1KA 2TMDA 1KM5A 3WK3A 2B0MA 4I7UA 3TQ0A 1TQXA 3H55A 1M5WA 3PG9A 2YPIA 4EIVA 4DO4A 5I3GA 3MBFA 2J9ZA 2DZUA 4LS0A 2ISVA 3IV3A 3TX9A 1TPEA 4O15A 4UMBA 3S0CA 4GXMA 3TH6A 2BWGA 3QFEA 2A6NA 4IXHA 1H62A 1W3IA 2PC4A 3UY7A 4CCEA 5TIMA 3KX6A 4UR8A 2NZLA 3MMTA 3NM3A 4JEQA 3EX3A 4AVFA 1FUYA 4AXKA 2OZ0A 3MBDA 1XDLA 4UTWA 3LGEA 2NXGA 1OX4B 1W5QA 4YWIA 3A22A 2QCCA 1Q6RA 3E12A 3SIZA 2DZXA 2NV2A 1A53A 1GT8A 3QPYA 3P7YA 3YPIA 4XKYB 2GOUA 1FWWA 3NZRA 1LBMA 3W1QA 5BMXA 1BWKA 1KW1A 4NX5A 1B4KA 1PS9A 5F2LA 2R14A 3EXSA 3E96A 3ABRA 1YADA 2C14A 4JY9A 2AAMA 2V9DA 3PUEA 4O0ZA 3NQ2A 2E6YA 5HWMA 2EKCA 4IJBA 3C52A 3BLFA 4JICA 1B3OA 1SZGA 4QNWA 1FDJA 5BMWA 6TIMA 4DF0A 1B57A 4OV9A 1W56A 4MY9A 5LNVA 1YDOA 3DI0A 4WX2A 5CSSA 1SO3A 3P84A 4KKXA 1HL2A 1T99A 2ABAA 2V30A 3BG3A 3PY2A 3LCXA 3LHTA 3G8EA 1N7KA 5IBXA 3NQ7A 2JGQA 3DAQA 1KTBA 3W7EA 1ADOA 2E5CA 1A50A 2X2GA 3IIOA 2ZRXA 5DCEA 1ICQA 3CEPA 3SSJA 1QOPA 1ZALA 3NPXA 2PRLA 4A2SA 4JIQA 2FIQA 3PUOA 4K37A 1QPNA 1TREA 4LVDA 3LCFA 4PC8A 1F6PA 4BWLC 1C29A 4HNNA 1GOXA 3STCA 1Q6QA 2DU2A 1HUVA 1I2OA 1T96A 1DVJA 1FCVA 3A9IA 4NVTA 5D2TA 4UNLA 4O17A 1JCXA 3WJYA 1HO4A 3UPWA 3EX6A 2CZFA 4W9TA 2CLHA 2Y7GA 3NXFA 2CZEA 3HO8A 5EMUA 1K7XA 4OHQA 2KZHA 4N9EA 3TC7A 5DBUA 1EP3A 3KRZA 5FI8A 3DKLA 2QAPA 4HSOA 7TIMA 5FEPA 2H3DA 2A4AA 2X1UA 1P0NA 3NR0A 3DZ1A 4TMBA 5CPOA 1C9DA 1X1OA 3KXQA 3Q94A 2EPHA 1OK6A 4ADSA 3B0VC 1AW5A 3O63A 4AHPA 1TYGA 3NL6A 1RR2A 2VFEA 3DFNA 1KM3A 3RK8A 1CI1A 1UASA 2YDAA 3W1MA 4AWSA 3W75A 2A5HA 3P82A 5GVJA 2CLLA 1I2RA 4RKAA 4CLMA 1TPWA 1TV7A 3TE9A 3BK0A 4N02A 1O60A 1SW0A 4RV8A 4D2JA 4JIPA 3TV8A 4O53A 1LBLA 5LNRA 4K36A 1GG1A 4UR7A 8TIMA 2EHHA 4GC4A 3ZS4A 3DFOA 4A3UA 2A6LA 4K8HA 1LBFA 5FEZA 4LC8A 3TAOA 1OHLA 3LERA 1RV8A 3A23A 5LKYA 2ZRWA 3P5ZA 3I68A 3EWBX 1NFBA 4UMAA 4WUIA 1I2NA 3STGA 5G2WA 4H4IA 4ZQPA 4UFIA 3S1VA 2ZDRA 1VCGA 1I45A 1IIHA 2BLEA 2RDUA 2YW3A 3W71A 1X8FA 1WQ5A 3BW2A 3PULA 3SECA 3TUUA 4R34A 2CLIA 2GQ8A 4MUZA 4AWTA 2DORA 3G1AA 4A21A 4P2VA 4LRTA 4O19A 3F1QA 4MFEA 4ALDA 4XTDA 3QZEA 4UTTA 4Z08A 1QWGA 5HJLA 2FJKA 3IVUA 5EA9A 5FF2A 3LCHA 4MFDA 2V2DA 1XBVA 1ZENA 3N3MA 3RLUA 4MYXA 1RQBA 5I3HA 1DORA 5FEWA 2W0UA 3DU0A 1ONRA 4QIUA 5FF3A 4RZ4A 3PBWA 5G1YA 2YFOA 4Y9AA 2YSWA 2E09A 1QPQA 1RQHA 4CNNA 3CM4A 3KRUA 3N73A 4MOZA 3IIVA 1YXYA 4MKNA 3LHYA 1WBJA 3GKFA 3U6WA 1JVNA 4GUFA 3JS3A 5AHNA 1WX0A 3GZ3A 3TC6A 5A8GA 3EXTA 3T7VA 2ZQ0A 3ATZA 1UUOA 5TQLA 5EYWA 1HG3A 1TPFA 4UMCA 4PL1A 2PRHA 2WNZA 3NL2A 1M7PA 2DZPA 4XUGA 3TJLA 3P81A 3ZWSA 2VFDA 3C2OA 4LOCA 3EB2A 2NLIA 3NQFA 1LP6A 5DELA 3BLIA 3G3MA 4ONVA 5AN7A 3B0PA 1KFLA 1W5MA 5D05A 1GVQA 1YXDA 3FEMA 3M44A 1DQWA 2WSRA 3W70A 1OF6A 1SZNA 2CLOA 1R2SA 4CQ8A 3LI0A 4NU7A 1M7OA 4WXZA 1OX4A 2BX7A 3TW7A 3W2LA 5HWNA 4O18A 2PCQA 4MVAA 4LS2A 3MP3A 1FDZA 3DHFA 3STEA 4KFOA 1LLWA 4XKYA 1QMLA 3DBPA 1F2JA 2C18A 5D37A 2CLMA 3P67A 4FF7A 1JUKA 3KAOA 3P80A 4Z1DA 1A5CA 1LROA 1OK4A 3GKAA 4N9BA 4RXFA 3C56A 3M1ZA 3FOKA 5FF0A 3WFAA 3PM6A 3W2KA 2WNQA 1WA3A 4QM1A 5AYYA 3BGJA 1KFCA 1A5AA 1LOLA 5HQEA 1ZHAA 2H90A 3O07A 4M6PA 3OA3A 2Y7DA 3NPWA 3G1VA 3IRDA 2BXVA 4JX4A 1S5WA 4H3DA 2QCEA 4QNEA 1L2UA 3CHVA 4KFPA 3P8IA 3LHWA 1SSDA 3S8HA 3LOTA 4IQLA 2NX9A 3O8AA 1KFEA 3CEUA 1ME7A 4UC5A 1ZNNA 2XFWA 3W1TA 4AEOA 1G4SA 3HPXA 3SR7A 4WY0B 4HIBA 2ZZ4A 5LNUA 1G4PA 3G1SA 4JTIA 1Z42A 1GVOA 5J5DA 4PFMA 3ABSA 1UCWA 1JRCA 2NWRA 2VC6A 3KVMA 5EL1A 2CZDA 3W85A 4MZ1A 3W7NA 3HG5A 4E38A 2A85A 1UBSA 2ZYFA 3TNOA 2QF7A 2I9EA 1SU5A 4FXSA 4I7VA 5H91A 1PHWA 2NX1A 2ZRUA 3PAJA 3S1XA 4TMCA 4WXYA 4QSHA 3M5VA 2E6AA 2IQTA 1ZJIA 3UWYA 5K3VA 2ZRZA 1OFOA 1FQ0A 3W1PA 3HBLA 4LVBA 2DZVA 3MYOA 5HR6A 3NL3A 1W3NA 4UNKA 3S6DA 1FWTA 2JK2A 4CQAA 1VPXA 4JTHA 3W1AA 4S1FA 3BG5A 1KA9F 4JNMA 2YFNA 3W73A 4UIOA 3DKJA 1OFBA 1P1XA 4KWVA 2Y85A 3LDVA 4RR4A 1EA0A 1EUAA 1OX6A 4AMAA 4UTJA 3UWVA 5ABTA 3B4UA 1OABA 2H8ZA 2H3BA 2NUXA 3W7OA 1UB3A 5AOUA 4OU1A 2ATMA 1TB3A 1JUEA 4ZMGA 2DZWA 4OGZA 4WOQA 3T4CA 4Z1CA 4GBUA 2OT1A 3BPWA 1ALDA 3W76A 3UPBA 5BW6A 3KFTA 3LB0A 1LRTA 3C2RA 5F2GA 3LBMA 4JTGA 2FDSA 3HJZA 4O14A 4IMFA 1DJNA 5F1VA 2VENA 1XC4A 4ZQCA 3OVQA 1TCDA 5H2ZA 3TROA 1F6KA 3UWQA 1TPH1 1K02A 3Q2DA 3NM1A 1SZEA 2ZBTA 3BVJA 1IF2A 3G22A 4LC6A 3BARA 2DZSA 1Q6OA 1UUMA 1K3UA 1YPIA 3C2EA 2X1SA 4MJMA 3C2VA 4DBDA 1G7UA 1H7PA 2VFGA 4M5PA 1YTKA 5KMYA 2O7SA 4FX8A 2WNNA 1NVMA 2FQIA 3EX4A 5HINA 2PURA 2O7QA 1RVGA 3EWZA 4FNPA 5D32A 3W1LA 2G5WA 4UFKA 5F2IA 4CQ9A 2QUTA 4PODA 4PTNA 5MHBA 4QQ3A 4P61A 3IGSA 1SQ7A 4MY1A 4IMCA 4JX6A 5AHFA 3R8RA 1W0MA 3N2XA 3BGGA 4A2RA 2A21A 4RCXA 2B4GA 1U83A 2ZTJA 3FLUA 4NJJA 1BTMA 4O4VA 4RZ5A 5A5WA 2NWSA 5L6UA 5LZLA 3MP5A 4NX0A 3EWXA 1XBYA 5HUOA 3UD6A 1PVNA 4WZHA 2ZRVA 3NDOA 4Z1AA 1V7YA 1GTHA 2A1YA 3HG3A 3A24A 4O12A 4TIMA 2HS6A 3N14A 1WOBA 2QCHA 4ICNA 3QSTA 4NXKA 6ALDA 3W7KA 2VFHA 3NQ8A 5DY2A 1FCUA 1R2RA 1OJXA 4IWWA 4O4WA 1HO1A 3DHDA 2Q3OA 1FWSA 3NA8A 1H7XA 5F4XA 2H6RA 1K8YA 4YXGA 2R94A 4R33A 4TO8A 3KHJA 3NPUA 3MO7A 4UFHA 3PUDA 2CLKA 1EP2A 1BWLA 2YXGA 3BW4A 3ELFA 4LVAA 4MLJA 4JTFA 3CU2A 1NAL1 3IIPA 3FJLA 3WJXA 4UTMA 5KZDA 3TQVA 3LRLA 2DJLA 3W7RA 4Z1BA 2GPTA 2HTMA 1LYXA 4GUIA 5K4XA 1OFQA 3G0SA 3P62A 5E0KA 2Y61A 5G4EA 3U2OA 4DO6A 3O6DA 5DLCA 5E1QA 1JRBA 3RLVA 2H8XA 3LTSA 5G2IA 4LS1A 4ZZ9A 4RX0A 5CZ0A 4JX5A 3W7DA 1TPDA 2FTPA 3L0KA 1ZAJA 3LI1A 3SGUA 1WDWA 5U7SA 1O95A 3QQ1A 3INPA 3THAA 3UZJA 2C19A 3W9ZA 2C6QA 4RZ6A 1QR7A 3ATYA 4DELA 1PE1A 1BKSA 3EWYA 4IGHA 3MI2A 4S2CA 4FXRA 3KVKA 1QCWA 3PWAA 3NZ1A 3G1DA 3GR7A 4BF9A 1QFEA 1Z44A 3W7PA 3ZFHA 2QCLA 4BI5A 5F2MA 2ZCGA 4HSNA 2J9XA 2FPYA 3G8RA 1F73A 3QRHA 2XN0A 3KVJA 1GPWA 3IGXA 2WSYA 1TQJA 3VFLA 4K39A 5KTLA 1VC4A 1YPFA 3I7RA 3LTPA 4NNCA 4M19A 1DQXA 1ME9A 3QH2A 4OBTA 2QDGA 3M9YA 4HN4A 3T44A 4E2DA 1OFRA 4Y96A 2B7QA 1JCMP 1JCLA 1T0OA 4TX9A 1H60A 3TW6A 1J5TA 4IMGA 3S5YA 2BTMA 3R89A 3HF3A 4LVGA 2GVJA 4IX2A 1HFBA 1EB3A 2EAWA 1VCVA 4K38A 5L9FA 2ISSA 3PB0A 1GYLA 5C55A 1I2PA 3M43A 2QJIA 1YTDA 5D02A 3LHVA 3DENA 2C16A 3GAYA 2V2HA 4GRSA 3LBCA 4WJEA 2B7NA 2Y63A 3UXAA 4JTUA 3M47A 4IXXA 3QMTA 3HGJA 3FS2A 1Y0EA 5K7JA 1VJIA 1VLWA 3QW3A 1EP1A 1BEUA 5D33A 4O28A 3MHUA 4DPPA 3TU9A 3G1FA 4U28A 3W07A 1AW1A 3MP4A 2V0TA 3S9YA 2FB3A 2GJLA 3W1UA 3C8FA 1EIXA 4UTKA 5AHMA 1YTEA 4JYEA 3CLMA 2D73A 3TKFA 1W3TA 1SO4A 4LV4A 5HWJA 1OF8A 1TIMA 2Z2UA 5I3FA 3CIWA 3PVFA 1J2WA 1EWEA 5BNKA 3AO0A 4M6QA 5DCDA 3W7QA 4EWND 1LCOA 3DXIA 2Y62A 1VYSX 3FIGA 3M41A 1EUNA 1W5NA 5K9CA 2Q8ZA 5HUPA 1SFJA 2ZA1A 4DF2A 3C4UA 1QO5A 3TAKA 5AHEA 3SFKA 2J24A 4I7WA 3MJYA 3G3DA 3BV4A 1DBTA 1GJPA 2EGZA 3SZ8A 3MWAA 4O13A 4K7VA 3PBUA 3C61A 4FNSA 2FLIA 4MZ8A 1H51A 1GTEA 1LZOA 4M6VA 4N4PA 1T8XA 1NSJA 3GYEA 1DV7A 1QOQA 1CX9A 2QAFA 3W83A 5FF7A 5F4WA 3TXZA 3W87A 1L9WA 5FEXA 4FIQA 1SW7A 3THQA 3M6YA 3S42A 1QAPA 1JJKA 4Q4KA 4GWEA 2FPVA 3NQ6A 2JKEA 3WJZA 3RU6A 5I3KA 1IGSA 1QNVA 3SW6A 5D03A 3B8DA 4N2YA 5IM51 3BW3A 1I4NA 1XBXA 2ZZ1A 3HMJG 1L6YA 5HMSA 3EKLA 3W88A 1TTIA 1ZCOA 2A7PA 3ANYA 2C3ZA 2J6XA 4QJ1A 1U5JA 2VKZG 4MPQA 3W2JA 1JQVA 4OQVA 3QEZA 1G4EA 2G95A 2LLEA 2RDTA 1V5XA 2GQAA 2V5LA 4WY0F 1XDMA 3W7MA 1P0KA 2FB2A 2E6FA 1H5YA 1VR6A 2E5BA 3OVRA 1MXSA 1P4CA 3FJ6A 3ZWTA 3G0UA 4N4QA 2G96A 3F03K 4L4MA 1AL7A 3OVPA 4FO4A 2C13A 5DCBA 2QCNA 2TPSA 1XI3A 4NNBA 3WJSA 3L5LA 2CZ5A 3GVGA 4IUOA 4HKPA 5AHIA 3G1XA 3N2MA 1KV5A 3G24A 5DN1A 1WV2A 4PEKA 2YYUA 1R2TA 3C0JA 3T40A 1XFBA 3KVLA 5CPLA 5KZMA 1PV8A 1WBHA 2OJPA 3BG9A 3LCLA 3HQ1A 4E0CA 3UNDA 2CWNA 2VELA 2A2IA 2YGYA 3W2NA 5EBUA 1ZFJA 3CC1A 3NVTA 3TMLA 3L5MA 1RQEA 2NXIA 2RKXA 3T55A 4FB7A 1L6SA 4HNVA 4HNUA 1ZAIA 2UV8G 1NF7A 2RFGA 5AFDA 2WSQA 3RF9A 3DFTA 2VFIA 3W1RA 3W2UA 3NQCA 2YZRA 1W54A 3GB6A 4Y8FA 4NXSA 1W8SA 3EEGA 2WOQA 1Z48A 3TIMA 3GIYA 3G1HA 3VE9A 3P61A 2Z1BA 4AWUA 3L68A 3P8JA 2GJNA 1Q3NA 5DXYA 3TSBA 2A7RA 2XN1A 3TMQA 1FBAA 1OYBA 2DJXA 3ABOA 5D2VA 5D2WA 3A5VA 2ATSA 2Y7EA 1VYRA 2ISWA 4BI7A 4LY8A 5K4ZA 2AQWA 4DEFA 3W3OA 3M7WA 2VEMA 1TPB1 4PCFA 4XTIA 3VI2A 1XL9A 3LCWA 1J4EA 4L4LA 4O10A 2Q3RA 3PG8A 1X1ZA 4ZQNA 3G18A 1FY6A 4NJHA 4WOZA 3IVTA 4LVFA 2C1HA 2CFFA 4LNYA 3PR2A 1RZMA 1DL3A 1TTQA 3NQEA 4FIRA 3R13A 1XUZA 2YR1A 3IVSA 1DOSA 3TQKA 3LLFA 4I9AA 3S5NA 3LXCA 2GVGA 1ML1A 3GDRA 2V8ZA 3O6CA 4JTLA 5K9DA 4LW7A 4CNOA 4NNAA 4A29A 1DJQA 1TV8A 3GLCA 2P1FA 4KFNA 4XWUA 3W84A 2E68A 3TR2A 5KSWA 4X9SA 3BO9A 3LM7A 3HB9A 3HGOA 3W1NA 1QO2A 3RFAA 2RHGA 3LRKA 1W5PA 3FFSA 3GDKA 3QSRA 4YCOA 4JTSA 4O0KA 1WAUA 3QQ0A 1OYAA 4MJZA 3W7JA 3L66A 1ICPA 3P74A 3EWWA 1TPVA 3MHFA 2Z6IA 2CLEA 2AGKA 4AHQA 2C0AA 1SO6A 3LXAA 4ZQRA 3S5OA 1K7EA 1LOQA 1EX5A 1S3HA 3DFSA 4XBSA 3UYCA 2CLFA 3NQVA 1F05A 1TMHA 5CPNA 2HSAA 3N34A 3W23A 4LU0A 2VXNA 3GXPA 4J9JA 1KFBA 1WYIA 3TCEA 5J5RA 1YXCA 3USBA 3OIXA 3SGZA 3CIXA 4DXVA 3W7IA 3R12A 4BWLA 4BI6A 3LHZA 5E93A 5CGQA 4LUJA 1C8VA 1YYAA 4LTSA 4X3ZA 2TYSA 5CZTA 2GVLA 2VEIA 4GUHA 1QDSA 3QMSA 4O1AA 1XBZA 3TK7A 2WJZA 3UWUA 3R5EA 5HR7A 4POCA 5D09A 2QEZA 2E77A 3LRMA 3N9RA 4JN6A 4FX6M 2Q8LA 1VCFA 3HPZA 1GWJA 1NEYA 3M5ZA 3S5ZA 1TPC1 1TV5A 5LSMA 5I3JA 3GAKA 5SWUA 4JD4A 1VS1A 3B05A 1AW2A 3T78A 2QCGA 2Y89A 3S1WA 3M5YA 4N9CA 2DZTA 3OG3A 3B03A 3PC0A 2E6DA 2J27A 5F1UA 4FNRA 4LWWA 3WK2A 2V82A 3O6YX 3HG2A 2X30A 4Z0JA 3SY5A 3O16A 4H6KA 1LLZA 1ZY9A 2WO5A 1M6JA 1FXPA 1IXNA 3HG4A 5TBOA 2NX3A 5KITA 1FCQA 3EXRA 3NEVA 3IGUA 4RJEA 1SZFA 1H1ZA 1VHCA 4PL2A 4RLIA 3NGJA 3U8GA 4LRSA 3L0GA 5C5YA 2E5DA 2X1TA 1MEWA 1EWDA 3I6RA 4BK9A 1G7VA 3OBKA 3W7LA 1B9BA 3G1YA 3BLEA 3E0IA 2ZA3A 3TDFA 3QYQA 5K2ZA 1SUXA 3L21A 5CKSA 1JCNA 1KM0A 3NAVA 1IXPA 1SSGA 4DO5A 5I3IA 3V1PA 1OG0A 2WKJA 2OX1A 1MO0A 1JR1A 1VYPX 4NZJA 4O16A 3QPZA 2Y6ZA 3RMJA 4AF0B 3QM3A 2OMAA 5AYZA 4DPQA 1LDCA 1MSSA 4MIMA 3HIJA 2YW4A 5C2XA 1FX6A 1TO3A 4OWGA 3FKKA 2Z6JA 3PB2A 4TR9A 3PF3A 3QMRA 3UXDA 1D9EA 2QUVA 1PIIA 4NT0A 3W86A 4DBEA 4EOUA 3W72A 2V81A 2NV1A 1S5TA 2JGYA 1F76A 4ML9A 5EPDA 1GVRA 3R2GA 3NNTA 4ADTA 5D30A 2OT0A 2QJGA 1XUUA 1THFD 5AC6A 2R91A 3VE7A 2Y7FA 2PRMA 3N19B 4A22A 3S1UA 5LNSA 1TJRA 2ZZ3A 1WOAA 3JRKA 3Q58A 1KFKA 4JGDA 4WY0A 1YDNA 2ABBA 1KM2A 4JDBA 3GXNA 1G69A 3GR8A 3Q37A 4Y90A 2DP3A 1G67A 3DH7A 5D2YA 1IXQA 1LTDA 1OYCA 5CSRA 1L6WA 2P10A 4HPJA 1YDVA 3L0NA 1F7BA 2W79A 4GUJA 3NQDA 4Q33A 1K03A 3P60A 1SO5A 3FYPA 2ALDA 3D0CA 1LRNA 1JUBA 4GE8A 4O54A 1Z41A 4E2BA 2ZFAA 2A7NA 1X7FA 2I1OA 2XN2A 4KWWA 1OFPA 4DQWA 3MUXA 1KM1A 3LTYA 5CG7A 3HOJA 4OT7A 1P5BA 1PHQA 3CT7A 5CZJA 4Q32A 4R53A 4CCCA 1R47A 4FNQA 4IPIA 1EEPA 2NUYA 4MLRA 4O50A 4RK8A 1GVFA 1O4UA 4C1LA 5LHEA 3W6YA 1XKYA 3WK1A 1A5SA 3GDTA 4UTIA 2ZRYA 5K9XA 4O52A 1AMKA 4GJ1A 4O57A 4OE7A 1JCYA 2ZZ2A 3A21A 4FX7A 2X1RA 4YMZA 1GYNA 1TTJA 4GNJA 1G6CA 2VEKA 1S5VA 3CB8A 1KTNA 2P0OA 2QKFA 5KINA 1DKWA 4O1BA 4K8EA 1I2QA 4WQ6A 1EPXA 1LORA 3C3NA 3E02A 1OFAA 5AC8A 3VNDA 3K30A 4FHAA 1HTIA 5EKYA 1KV8A 3GK0A 4UTWC 5LHFA 4MY8A 3MW7A 3LCGA 4UUIA 3KRSA 1R46A 4NJGA 3HPSA 4JXCA 4O1DA 2QCDB 4EF8A 1FWRA 2JKPA 3NPVA 2C15A 3PSWA 5C54A 3W7CA 3DFQA 3HGRA 4UFMA 3GXTA 4N9DA 5LNWA 4IMDA 3UQNA 3B0UX 2GQ9A 4JYDA 1GG0A 3I7SA 4IPJA 1XCFA 4UFJA 1W1ZA 2RH9A 1PCWA 1TTPA 5DY3A 5U4NA 4FEZA 4LV9A 5F4SA 2OCZA 1CW2A 3GNDA 4ORMA 3O06A 3NO5A 1K7FA 2ZA2A 4JTJA 5AHLA 2QCMA 1OFEA 3QJAA 3IIXA 3TXVA 1I8JA 1MEHA 1KBJA 1W37A 1OVDA 1B4EA 3CTLA 1KM4A 3QF0A 4EF9A 3F4NA 3F4WA 1JULA 4HNTA 3H53A 3EWUA 1MZHA 4ZQOA 5IBXC 4QISA 4AH7A 1QPOA 3UWWA 2R8WA 3PBVA 4LUIA 4Y6GA 1YLVA 4NUWA 5CZSA 4UTLA 1G4TA 1PCKA 4BR1A 5AC7A 1A5BA 3W22A 1ICSA 1FCBA 4TU1A 1FXQA 4MYAA 5D04C 3EX2A 4JY8A 1W5OA 1W31A 4ZQMA 2QJHA 3W74A 4OV4A 1LM1A 3C6CA 3W7GA 4JR5A 3VCRA 3V75A 5HNRA 4NQ1A 1OFDA 4UTUA 1O5KA 4K6AA 4DF1A 3GX9A 2I14A 4MZYA 4ADUA 1VQTA 3MI6A 3NOEA 3NQAA 3NQMA 4XQ6A 4JYFA 1O5XA 1Q45A 3P5YA 1H50A 3TSMA 1GVSA 2CU0A 4FNTA 3GNNA 2B7OA 1SFLA 4N6EA 1O94A 3FA5A 1AK5A 3LX9A 3QC3A 1WXJA 3I7QA 2TRSA 1MEIA 1F74A 4PA8A 1SW3A 3H54A 2J88A 4AHOA 1SPQA 2QR6A 3L67A 3PS7A 1QPRA 4M7SA 1GEQA 4IX0A 3QW4B 2EF9A 2J9YA 1KTCA 1JQXA 1VGAA 3CQ0A 5G1TA 1VLIA 2BZNA 4BFAA 3LHUA 3OHIA 2JKAA 4S2BA 3CPRA 2RDWA 3O05A 3E49A 3PBYA 4ZVJA 4M7TA 3W7HA 1K8ZA 2YYTA 3DI1A 1OX5A 4UFLA 2NUWA 2FPTA 4AF0A 2PE4A 4EVZA 3VKJA 2V5BA 2Z0IA 3WJWA 4PH6A 3UZ5A 2ZZ5A 4UXDA 3B06A 1KM6A 1H61A 1PL9A 1F5ZA 4N6FA 5CPMA 3GDMA 3EKZA 2TSYA 2WV8A 4R7JA 2V2CA 3I65A 1VRDA 4QAIA 3TJXA 5FF4A 3UY8A 5KZEA 2YCEA 1TSIA 1RPXA 1FDYA 3GDLA 5D38A 3W2MA 2GUUA 2ZZ7A 1H7WA 4YL2A 1AG1O 3N9SA 4O11A 5EY5A 1VH7A 3IIZA 3LCIA 2G97A 2CW6A 3LV6A 5DBTA 5BRBA 2WQPA 2HMCA 1DHPA 3KOFA 2X16A 1IXOA 1KBIA 2F7FA 1TRDA 1KLZA 3LV5A 4UTTC 2FFCA 4U4MA 3TSDA 3ZR4A 1ZAHA 4AB4A 3DFPA 2HS8A 4WD0A 1ME8A 3JR2A 2QCFA 3OEXA 5G2HA 1K8XA 3B04A 4X22A 5DXXA 4B5NA 1AL8A 3TA6A 4GFSA 4HPXA 1NF0A 1X6UA 3HGSA 2E1DA 2NXHA 3MHGA 3EX1A 1TPUA 4Z0SA 3IEBA 2BSLA 4IMEA 3FKRA 4UCGA 1TJPA 1SR9A 2QDHA 4FNUA 4QITA 4CNPA 2W6RA 4XZ9A 3MYPA 5G4WA 3M0ZA 4JTKA 4YCPA 3A5FA 1H63A 1N55A 4LT9A 4GUGA 1UJPA 3SI9A 5LGZA 3UWZA 1N8FA 3MI3A 5G5IA 1GQNA 4XBKA 3TFXA 3STFA 4JTTA 3ABQA 3L65A 4RXGA 5C6MA 1JCJA 2VOMA 3W1XA 3CWNA 3NL5A 3CWOX 4G1KA 1R30A 4UTHA 4X2RA 3WK0A 3NG3A 1KLYA 1D3HA 3FYOA 4AAJA 2VEPA 4ZL1A 1VHNA 3LLDA 3NQGA 3G0XA 2B7PA 1E51A 4NJKA 5LGXA 3RNDA 2ZTKA 1Q6LA 2F84A 5D2XA 5T26A 1IIGA 1GZGA 4O8RA 4JS3A 4IOTA 1XXXA 1XM3A 4CCDA 3M5XA 1TRIA 5AB3A 3DGRA 3PSVA 1H1YA 2ZZ6A 1VZWA 2QCDA 1LOSA 3L9CA 4YLWA 3LXBA 1H7OA 3L5AA 1KFJA 2JBMA 1D3GA 4JTEA
chains in the Genus database with same CATH superfamily
3IJLA 4JDYA 4CN1A 1Q4NX 2QUUA 5HULA 4HT3A 1UWUA 3WQVA 4XVEA 4KERA 1S2CA 2F2HA 3KE0A 3ABZA 3O1NA 3NYZA 3KWXA 2POTA 4WR3A 3M16A 1MW3A 2CIPA 1CXEA 3E9AA 4YWSA 1IEIA 2VFFA 2Y70A 2A0NA 2ZX5A 4DJDC 4Q8WA 1TX0A 5FESA 3VKDA 4C1KA 4QG9A 1FP9A 2HRWA 1KM5A 4FPSA 1C92A 1RXOB 4LNCA 2CHNA 2B0MA 3QR0A 4S3EA 3H55A 1M5WA 2R1MA 4PMNA 3GTNA 3KS5A 3QZ6A 5JUVA 4EIVA 3AZSA 1BSIA 4ACZA 2DSWA 3ANVA 4LS0A 3NGFA 3WLOA 1MDRA 4GXMA 3QFEA 2PC4A 3UY7A 4YVXA 5TIMA 1PKYA 2NZLA 2XH7A 4IQJA 4QLKA 1MRQA 4JEQA 5XIMA 3POCA 5A6JA 2OZ0A 3MBDA 4UTWA 2NXGA 3PWGA 1W5QA 4YWIA 2QCCA 1MRAA 3DYMA 1Q6RA 4NIRA 1XIEA 3PBGA 1I6NA 3KDNA 3NCOA 1A53A 1GT8A 3LSCA 3QPYA 2GOUA 3S1GA 1LBMA 3LPGA 3ITXA 1BWKA 2OYMA 1AFSA 1PS9A 3EXSA 3ABRA 3A4JA 3C52A 3AMDA 1DXIA 4TQTA 4MY9A 1EJRC 2VR4A 2WLYA 1TVLA 1LWJA 1VPYA 5HDRA 4PSRA 4RNJA 4F2TA 1IZJA 1SO3A 2XVGA 2QDEA 4AXNA 4KKXA 1AJ0A 3U57A 2OOGA 2V30A 2Q02A 5IBXA 4X9YA 3WQ4A 4G1NA 1E4NA 4M6UA 4R7WA 2ZX6A 3W7EA 3ZM8A 1Q7ZA 3SSJA 1ZALA 5IHSA 3TOYA 1UW9A 3V5OA 4A2SA 4JIQA 3CHEA 2FIQA 3CZEA 4QCFA 1O68A 1TREA 1XG3A 1EFZA 1ZUAX 4G9PA 2V5DA 1F6PA 4A3RA 4HNNA 4B2DA 1W1B1 1EF2A 4QDPA 3KBSA 4IFKB 1C7TA 2GOKA 3W01A 1HUVA 1R7AA 4R27A 4BQ3A 4C60A 2Z1VA 1KCLA 1IWBA 3FGCA 1IHIA 1XV8A 4LCQA 2E9MA 2FGLA 4ZO7A 3UPWA 4CVUA 3TJIA 2CZFA 4W9TA 4PMRA 2NW0A 4HNOA 1B0IA 3AIEA 2J7GA 1IWPA 1D7KA 5A1AA 3HO8A 5DBUA 1A5UA 1EP3A 3KRZA 5FI8A 3AHZA 7TIMA 2A4AA 2X1UA 3BQ5A 3TYAA 1J93A 2GWNA 1XFCA 3AIWA 3DZ1A 4XKMA 2BOGX 5CPOA 2QGHA 5DF0A 3Q94A 2FZBA 2X05A 5FD0A 1AQFA 1KM3A 2DY3A 3UG8A 1TV4A 3W1MA 3TYBA 4AWSA 2DQXA 2C91A 2A5HA 4JKKA 7ODCA 1XF0A 1I9CB 4U2YA 3T2PA 1TPWA 3GHRA 3TE9A 2DVUA 3BK0A 1RCOB 1O60A 4RV8A 4D2JA 5CBBA 1UWTA 3DFOA 1U33A 1R9XA 2A6LA 4EXAA 5FEZA 4GIYA 4LC8A 3LERA 4HN8A 1E4MM 5LKYA 2ZRWA 3P5ZA 1QHZA 4UMAA 4H4IA 1W91A 3S1VA 2ZDRA 3G1RA 3SN1A 1I45A 1IIHA 2RDUA 2VVSA 3WLHA 3WNKA 2YA2A 4WDXA 1HJUA 3AS1A 3BW2A 3LEPA 1JDAA 3APGA 2DORA 4P8XA 1WZKA 3T07A 4A21A 3CHFA 2VL4A 4XTDA 4CN4A 1E9ZB 3VD3A 3LCHA 3V0UA 4MFDA 1ZENA 1TWWA 1BVNP 1RQBA 1V51A 1PKLA 1Y5XA 5FF3A 4QIUA 1ADSA 4RDWA 3MMWA 4IIHA 4XD4A 3IV8A 1UQZA 1XGZA 1SR0A 3N73A 3FXGA 9CGTA 5A6SA 2GSEA 1JVNA 1LQ0A 3WMLA 4RW5A 3EKGA 2DH2A 1WX0A 3JVAA 4AY8A 3JUGA 3EXTA 4C7DA 3VIOA 1SFSA 3VA8A 2GSHA 1HG3A 1TPFA 3WLMA 2E9BA 3NL2A 5EMJA 3TJLA 4FLOA 3VD7A 3B9EA 1GK8A 1FHUA 1WKDA 3ME3A 5D05A 1X39A 5AVNA 2Z1KA 2OGYA 3FEMA 1O5QA 1DQWA 4KIRA 3W70A 3MO4A 5A6BA 1OY0A 4NU7A 4Z2GA 1J0IA 1M7OA 4WXZA 3H7UA 5EGRA 2DEPA 2PDNA 3TW7A 3W2LA 5HWNA 3BXWA 4O18A 2AMGA 4XV0A 3MP3A 3OQ8A 1RAKA 3B4YA 2E3ZA 3BOFA 4WEVX 4XKYA 2C18A 2YBUA 2CLMA 4CU7A 4PFHA 4HMEA 4R85A 4MKVA 1IWAA 3FYYA 4RXFA 3VOHA 3M1ZA 3FOKA 3U2ZA 3PM6A 1MI3A 1LOLA 5HQEA 3KCLA 5I00A 2H90A 4DJFC 2Y7DA 3IRDA 2BXVA 4H00A 4F3HA 5GNYA 1NU5A 5FJIA 4E4PA 3GH5A 4E2VA 1SSDA 3PPFA 4CU6A 4HVXA 2ONEA 2IMRA 1ZNNA 4AEOA 3W1TA 3HPXA 2XFYA 1CT5A 3SR7A 1G01A 2WJFA 2YL5A 2ZZ4A 1E0XA 4JTIA 2GDQA 4HQVA 5E70A 4AW7A 3BZJA 3FAWA 1GVOA 4PFMA 4NZ3A 2YA0A 1POJA 1UIPA 1JRCA 2PDQA 2VC6A 2Y4SA 2JF6A 1QT1A 2UY5A 3W7NA 3TNOA 2I9EA 1SU5A 4FXSA 2J66A 1SMDA 3WDHA 4DLFA 5H91A 1TA3A 2NX1A 2ZRUA 4HZMA 2ODOA 1DJYA 1EF3A 3PZOA 3ALFA 4CVWA 2J74A 3GZAA 1R38A 1RUSA 4NZ5A 5GNZA 1VFTA 3VGDA 3DHPA 3I10A 1PBGA 1TMLA 1FWTA 3B8IA 3MZ2A 3PZVA 4HNCA 3VZXA 1VPXA 1EXBA 4S1FA 1XJBA 3BG5A 4WVXA 1X8CA 4XD3A 4C1NB 3APTA 3DKJA 4H6EA 2GYIA 5LA0A 3W27A 4WGHA 4L61A 3LDVA 1EA0A 4BCEA 1NJJA 1MFVA 5ABTA 1OABA 2H3BA 4GVHA 3HFYA 4JFSA 2PWDA 2G37A 3BAJA 1JUEA 4ZMGA 3T0TA 2DZWA 4WOQA 3GBEA 4HTYA 2EPOA 4GBUA 4IHCA 2PB1A 4J4KA 1GEHA 3C2RA 3TYDA 1W1YA 1WXYA 3LBMA 3HJZA 4O14A 3WO8A 4D6IA 1VFMA 3ISIX 3QY8A 2VENA 4U5KA 1KNWA 3OVQA 3WEMA 1BG9A 1F6KA 3WDQA 3B0XA 2J79A 2X1IA 2Z2AA 2EEXA 1SZEA 2ZBTA 3FV9A 4S3DA 1IF2A 4NY2A 4B2DD 3SCWA 1UUMA 3CHDA 1WXZA 3C2EA 5D9NA 1H7PA 2CYGA 5A6LA 2WB5A 3ZVHA 6XIMA 2PURA 1HT6A 1RVGA 5D32A 2IPWA 2YDQA 2G5WA 4UBPC 1RK5A 2Y0FA 1ZQ5A 3VU2A 1RVKA 1JPHA 4G5DA 3VMNA 3PZIA 4GQBA 3TCSA 4KRUA 3LQLA 1WKYA 2PP1A 4A2RA 6CGTA 2J8GA 1OG6A 1U83A 5A5WA 2NWSA 1L8PA 5L6UA 1XBYA 3UD6A 4AUBA 4ZENA 1TZ7A 3OGVA 2VCBA 3RGTA 1TWZA 1L6FA 4MADA 3A24A 3ID7A 4TIMA 2PWUA 2PSNA 3PTDA 1CLKA 6ALDA 3NQ8A 1CXHA 3R94A 4M1RA 5BOEA 1AUSL 3FJNA 1H7XA 5H8PA 5F4XA 4UQ9A 5F7UA 2A3LA 3BAIA 3KHJA 4WHBA 3PUDA 4AZCA 4D1IA 1BWLA 1BF2A 3WQEA 4PMYA 4H83A 5KZDA 2DIEA 2V63A 3ITGA 4Z1BA 3UA4A 2IKHA 7TAAA 4OJYA 5CC7A 5A8QA 5G4EA 3U2OA 3O6DA 4YVVA 3RLVA 1FKWA 5G2IA 4QP0A 3C5QA 3VNMA 1SJDA 3WBEA 3BCFA 4NHVA 1WDWA 3I3EA 4JTAA 1C8QA 2QUNA 1KQZA 3INPA 1OCQA 3GW0A 2OZ3A 3UZJA 1OCNA 4MDOA 3ITTA 3W9ZA 2Z1XA 4BA0A 2BP1A 1PE1A 1BKSA 4FOUA 4PBEA 3EWYA 3MA8A 1KGUA 3MDUA 4GQRA 2J62A 3BQ6A 1TUXA 3BURA 3BSHA 3NZ1A 1QWKA 2V3FA 4BF9A 2P3ZA 3MKCA 1QFEA 4I90A 4IISA 2WMIA 2ZUSA 1V08A 3CMGA 3OZMA 1XH2A 3WQFA 5GJNA 2FPYA 1EGZA 3RHGA 3E38A 1PX3A 3N12A 1ZBKA 3QRHA 4FSAA 3QR1A 1TQJA 3HA1A 5A6BD 3VFLA 1X6NA 3F5LA 3AHXA 4LYPA 1QATA 2CKSA 1RK6A 3CZLA 2ZUVA 3S9IA 4NNCA 4Z42C 3UBPC 2GGIA 3Q65A 4MG4A 3BJSA 1VFLA 2UZ9A 4HN4A 3T44A 3R0KA 1PX8A 4QX4A 2B7QA 1JCMP 1JCLA 1T0OA 3TW6A 1J5TA 1KC7A 5ENLA 3CH9A 1QK0A 4NAFA 4RNFA 4LVGA 3EB4A 2GVJA 1PXGA 3UXLA 3VCNA 1W1TA 2G8ZA 2PDFA 4K38A 1X96A 3DYPA 1ZU8A 3PB0A 4YHEA 3OLGA 3T0CA 2Q01A 3WLSA 3M43A 4AC7C 4J5NA 3LHVA 3VPLA 5ABFA 3BLDA 2V2HA 4WJEA 3LENA 3T9PA 1HX0A 4IXXA 3HGJA 1DHKA 4K68A 1VLWA 4MWAA 3VC6A 4O28A 3G1FA 3NO1A 3AUJA 1H09A 1V3MA 5BCAA 2FB3A 1CGVA 3W1UA 3WH9A 1MVYA 3RXZA 2GGJA 3EPNA 5C2GA 4JL1A 4NF7A 3TKFA 4DNMA 4RE2A 3GVRA 3CIWA 1HQTA 5CGTA 3FNDA 3WF3A 3FXYA 2JE8A 2OKTA 1LJYA 5AC4A 4OOUA 2NQ5A 3M41A 3K5XA 3SY1A 3MUIA 4H9UA 3V36A 3AALA 3RM4A 4DF2A 3C4UA 3OLEA 5AHEA 3SFKA 4I7WA 1L0PA 1CBGA 2WWCA 1GJPA 2EGZA 3AYTA 1U1UA 1T8XA 3B9NA 1DV7A 2FZ9A 2PCEA 3EOUA 2RUSA 1OC5A 1GQKA 2OPJA 2YJQA 3ARQA 4F4RA 3W87A 1L9WA 2V38A 3LPOA 3M6YA 5CSUA 3SIMA 3N2OA 2DSZA 4GWEA 4GY7A 4DHGA 4W4QA 1HJSA 1IGSA 4B92A 1LT7A 3SW6A 1W9BM 1BHGA 3GTIA 4PMQA 4AD1A 2RGLA 2ZZ1A 3S2LA 4D1JA 3W88A 2A7PA 3ANYA 2OWWA 2J6XA 4QJ1A 2VKZG 3W2JA 3QEZA 2RDTA 4WY0F 1XDMA 2EG8A 2BY2A 2FZ8A 1ZJBA 1H5YA 5JIPA 4GYFA 3G0UA 4MSSA 1JDDA 1XYAA 2F8QA 5A8OA 4N4QA 3F03K 3K8LA 4L4MA 3FCPA 2XHYA 2QCNA 3QFWA 4NG3A 4NNBA 1Q66A 3WJSA 3GVGA 5FJTA 4HKPA 5AHIA 2QJNA 4IIBA 3TLQA 1R2TA 1PV8A 1RJRA 1EOMA 4AZBA 4E0CA 4ML4A 3A3HA 2VELA 2YGYA 3SY8A 1GOOA 3MU7A 2VZTA 3WLJA 1FWCC 2QPXA 1ONEA 4FB7A 1Q6EA 1ZAIA 2V6AA 2UV8G 3V7PA 1NF7A 3DFTA 2OEKA 3NQCA 1Z32X 2E67A 3GB6A 4Y8FA 4NXSA 3RX3A 1W8SA 1FOBA 4DWSC 4DJDA 2QPUA 1Z48A 2Z27A 1TV3A 3ANUA 3GIYA 3VE9A 3P61A 3WQ6A 2Z1BA 3UXIA 2I57A 4FOJA 5BXPA 2YXOA 2IS7A 2R1NA 2QDDA 1OYBA 4LQ1A 2DJXA 1TG7A 2NQZA 5J8LA 3PZNA 2PODA 1VYRA 5K4ZA 5CJNA 2AQWA 3W3OA 1RSCA 4GK8A 2VEMA 1A0DA 2G3NA 1PX4A 4JBRA 3LCWA 2XIIA 1X1ZA 4ZQNA 3G18A 1FY6A 1H49A 4HZ7A 2C1HA 2CFFA 1SJAA 1RZMA 3WH5A 1DL3A 1V6XA 2VEFA 2WSKA 4GCAA 4FIRA 3R13A 3MPGA 4NAEB 1ZBCA 1IV8A 1DJWA 3IARA 3LXCA 2GVGA 1ML1A 3NEHA 4QGCA 3GNXA 4DBWA 4XWUA 2XFFA 4PTMA 3BO9A 2DW7A 1QO2A 3EMCA 3RFAA 3GDKA 3QSRA 4YCOA 1FHVA 1Q7QA 4IF2A 1UR4A 3QZAA 4PBGA 4HHMA 1CNVA 3P74A 2ZUWA 3EWWA 3E2SA 2Z6IA 3WNMA 2AGKA 4XAYA 2D3LA 4XK2A 1K1DA 3S5OA 3UR8A 1K7EA 1LOQA 1XSKA 4QROA 2P8BA 3UYCA 5LIXX 1WKFA 3VGEA 1A0CA 2QIIA 4HBKA 3N34A 2WSPA 3TN5A 4LU0A 5BWFA 3VKKA 1A4LA 3CL6A 2VGIA 1WYIA 5J5RA 3IUDA 1ZB5A 3CZGA 3OIXA 3CIXA 3ONBA 3WDIA 5I6SA 3R12A 1CEOA 4GQGA 3FY1A 3EZ4A 3LHZA 3TC3A 2DZBA 4JQ4A 1IR1A 1DJZA 1C8VA 1PZ2A 2GVLA 3WBAA 4OBSA 3UA3A 1QDSA 3UVAA 3SRKA 1EXPA 2G50A 4H8HA 4AD0A 2QEZA 2CBVA 1LL7A 2E9LA 3LRMA 2FZMA 4PUJA 4AIEA 1BYCA 1W1VA 4JN6A 3UCDA 2SFPA 6REQB 3HPZA 1ZP4A 3M5ZA 5REQB 3S5ZA 1GOQA 1EQPA 3WQWA 1M7XA 2ZWZA 3BAYA 4EXQA 1M41A 3CAQA 3T78A 1GW9A 1VFUA 4GO9A 4REQA 3KEHA 1M3UA 3CGTA 1MUWA 5F1UA 2ACSA 3HG2A 3QHMA 4MWAD 3O16A 4P8VA 4H6KA 4A3HA 1ZY9A 1UMLA 3REQA 4RNHA 4JQ1A 4XD6A 2WO5A 3SSZA 3HTWA 4A8NA 2TODA 3NEVA 1X98A 1PTAA 3IGUA 1R3VA 5H1WA 4RJEA 4ENLA 4RLIA 1K6AA 2J47A 2RDXA 4B5XA 4C6KA 3AIBA 4BK9A 2XU2A 1PDYA 3OBKA 5HMEA 3QYQA 4ZFCA 5CKSA 4AISA 1JCNA 3GO2A 1OG0A 4W7VA 1VYPX 3CUXA 4NZJA 4O16A 3QPZA 2BGSA 4PZVA 2J25A 3V5FA 1RP8A 3H8AA 4EACA 4IIGA 3ARWA 3A4AA 4ZOAA 2FH8A 1TE6A 1TO3A 4HA3A 3FKKA 4TR9A 3QMRA 4UOZA 1TVNA 3W86A 5CC3A 1CLXA 1RBAA 4EOUA 1NDVA 1WO2A 2V81A 3KOYA 3CUIA 3GE7A 2JGYA 4ML9A 3H2AA 2AKMA 3NNTA 3AXIA 2QJGA 5E09A 2R91A 4HSHA 2E4TA 1GJUA 3CHCA 2ICSA 9XIMA 3N19B 5HBFA 4AIUA 2VVNA 2IPFA 3H12A 5CXPA 4J3XA 2R82A 4WY0A 1J10A 1KM2A 1QTWA 3PNUA 1IXQA 4X0NA 3VKCA 3VFCA 4HOWA 1GCYA 4GABA 4HPJA 1CCWB 1EJSC 1R3YA 3L0NA 4PE8A 4GUJA 1K03A 3P60A 3FYPA 2JEPA 4GGHA 3D0CA 3MQTA 4JIIX 4KCWA 2GDUA 4KGJA 1Z41A 1XIHA 4PSPA 1Y65A 2I1OA 1OFPA 3VIFA 1KM1A 1V02A 4OT7A 3KP1A 1PHQA 5CZJA 2BGQA 3N18A 4R53A 1VKFA 4CCCA 2XM1A 4PTWA 4RK8A 3DFYA 1C91A 4V33A 4TTUA 1A5SA 3GDTA 4UTIA 5JH2A 3UG5A 4PCPA 4ZTYA 4FX7A 3GTFA 1E15A 1TTJA 5M3WA 4GNJA 3CB8A 1S5VA 2P0OA 5KINA 4O1BA 4DJFA 2CBUA 3F2CA 4HA1A 3T8LA 4DJDD 1E1EA 4M51A 1EA9C 1I2QA 4KRTA 3GW3A 3DBNA 1A5MC 3VNDA 4FXJA 3CV7A 3LCGA 3UWEA 1R46A 2G4JA 2QLYA 2YLLA 2QCDB 4EF8A 4NZ4A 2FYMA 2G3IA 2O9PA 3NPVA 1T7LA 2V3EA 4QBXA 3DFQA 4GVIA 3GXTA 5LNWA 4IMDA 4Q4SA 2XWDA 2HPMA 1V6UA 4PRWA 3LQGA 2J7EA 3WDPP 1PCWA 3AHYA 4HGXA 5DY3A 3OBEA 5F4SA 1CW2A 4XZIA 3R79A 4NI8A 4JTJA 3C8NA 4RDYA 2G3FA 4MNKA 4I3GA 1UUQA 4LAOA 1YNQA 1NP0A 1EH9A 2ALRA 3WBWA 2GUBA 1B4EA 3BOLA 2MUCA 1JULA 2Y8KA 3W25A 1V3IA 3GG1A 4WKFA 3EWUA 3WLTA 3WIJA 4R88A 4ACZB 3PHAA 3PBVA 1D3CA 5A3HA 1LWIA 2C8NA 4P7RA 4UTLA 4BR1A 4KEVA 5AC7A 1ICSA 1EX1A 1FXQA 1XD1A 5D04C 1W5OA 4ZQMA 2FMOA 1K9TA 2QJHA 2HNHA 4P7OA 3VTRA 4EANA 4GLEA 1XRFA 3QBUA 4J3VA 1ITQA 6PTDA 2BOFX 4KCUA 5HNRA 4UTUA 1O5KA 3LS9A 2PGWA 3GX9A 4MZYA 4H9MA 1VQTA 4ZXOA 4CKQA 3VM5A 3L4YA 3W00A 2ZUNA 3FA5A 4P7LA 1AK5A 3LX9A 1WXJA 3U9IA 1PZ0A 2TRSA 3LBOA 3NQBA 2AKZA 2ACRA 1SW3A 2BS9A 4AHOA 2BVWA 4F2BA 2VQUA 7A3HA 1AZ2A 1E40A 3QW4B 4C6OA 1KTCA 3MT1A 1V6WA 4HA0A 1LUCA 4WGXA 3OTRA 3CQ0A 1E6RA 1AJZA 4KMQA 4YNGA 3E49A 3WL1A 1MNSA 3AYSA 2V5BA 2DDXA 2X0SA 4U3AA 3AS2A 1K8CA 4V1XA 2ZZ5A 4DRSA 1DIDA 1EHNA 1KM6A 1DXEA 2D1ZA 1KR0A 3E1F1 3SBFA 4R7JA 3UY8A 4F48A 5I5RA 5D38A 4J7RA 5BZAA 5FJRA 2CZVA 3R25A 5E6YA 3IIZA 3BLOA 1VRXA 4RE0A 2CW6A 3FGCB 4L1XA 5BRBA 4AD3A 3V0TA 3ZJ6A 3KOXA 2ON3A 1IXOA 3ITOA 1V0KA 1TRDA 1KLZA 1KQYA 4UTTC 2FFCA 4U4MA 4M56A 1MQRA 1FRBA 3VDGA 2XUCA 2HS8A 2WMKA 4WD0A 3JR2A 1HKJA 3ZLFA 1K8XA 4X22A 3GC4A 5DXXA 2B31A 3H21A 1X6UA 1W3LA 1GOKA 2JFEX 5BRQA 3NUKA 1TPUA 4Z0SA 3IEBA 4IMEA 1XIIA 3A3XA 2QMJA 3S2JA 3W81A 1TJPA 2QDHA 3F2BA 4FNUA 4XZ9A 2IUZA 4H9VA 4PTDA 5ABGA 3W53A 4LT9A 1UJPA 1O7AA 3SN4A 4WSJA 4F2UA 4F0HA 4S3FA 3TONA 5C6MA 1JCJA 1O6IA 2VOMA 5I2UA 4X2RA 3WK0A 1KLYA 1Z89A 3CV6A 3FYOA 1ZJHA 4AAJA 3OO2A 3NQGA 1JPIA 3ARPA 3G0XA 4I9JA 2D23A 1OGGA 3RNDA 1Q6LA 3L2MA 4PTXA 3K1DA 4XIAA 4CCDA 3VIIA 1F07A 5AB3A 4IIDA 2I5GA 1VZWA 3L9CA 4YLWA 3UR2A 4HB7A 4GACA 1BG4A 1H7OA 1KFJA 4F40A 1H0GA 4O1CA 3RRXA 3SUVA 1B3ZA 2Y8UA 3L2IA 4YTTA 1RD5A 4BJHA 1E9LA 1RA5A 1GOIA 4H2CA 1G5AA 5CPSA 4B4HA 1V3KA 3AMGA 3RIKA 3C2FA 3LPPA 4HHPA 4NZFA 1HKKA 2DVXA 2I9UA 3VUPA 3PZMA 5AYXA 1H7RA 2YX0A 4HZ8A 1JZ2A 5CJ5A 3ZXWA 4CD6A 4J40A 2WPGA 2Y2WA 3URQA 5M2FX 1AJ2A 4DJFD 4DO4A 4DYKA 1JDEA 2YBTA 3E3HA 4UMBA 2BWGA 3CUFA 4IXHA 1VB9A 3S9ZA 4OZOA 3EDKA 1GZJA 2DV0A 3UR5A 2PWHA 1ODUA 2VZSA 3EX3A 5KZ6A 4ZR8A 3N04A 4LB3A 4AXKA 1A5NC 4PCNA 1XDLA 4J35A 2E7FA 3HFTA 2D2JA 1H1NA 3A22A 3DYOA 3E12A 2UY2A 3YPIA 4XKYB 4HK5A 1FWWA 3NFUA 5BMXA 2PBGA 1KW1A 3P14A 2R14A 1PDZA 2GUYA 3JU2A 3E96A 4JY9A 1I1XA 2V9DA 5HWMA 4IJBA 1TELA 4FA3A 1B3OA 1FDJA 1QI3A 6TIMA 4DF0A 1W56A 3RM8A 2CESA 5LNVA 3GU1A 3EDJA 1XLBA 1UKQA 4KPLA 5FAJA 8XIAA 3M0IA 3H2CA 3ALGA 4NZCA 3BMVA 2ANUA 5CSSA 3AMLA 4BY3A 3K8MA 3ENLA 3P84A 4DXXA 2DUXA 3LCXA 3QPEA 2BFGA 3LHTA 4I5XA 3G8EA 2EPLX 2WXDM 1N7KA 3QOKA 5CCZA 4WIWA 2O9TA 3UR7A 2JGQA 1KTBA 3HQOA 1ADOA 1GHSA 1X38A 2E5CA 4H19A 1QRQA 3ARSA 3WLRA 1ELSA 3NPXA 2PRLA 5CLTA 3QV6A 1REQA 2HVMA 1TA3B 1W9VA 2AAAA 1GQJA 4PR4A 5C70A 3OG2A 4FXFA 4BWLC 2DU2A 3DN5A 1S2WA 3W26A 1T96A 5I3DA 1TWDA 1FCVA 4M3PA 3U7BA 5D2TA 1E6NA 1JCXA 1XP3A 1W9UA 1VFHA 1UZHA 3WZ0E 4GHRA 1OADA 2KZHA 4HHLA 4OIFA 3H70A 2CITA 4JNZA 1LLOA 2QAPA 3AIRA 4HSOA 4CN6A 3S83A 1P0NA 3NR0A 3E5PA 2PDKA 4TMBA 1GORA 2OKOA 3O9NA 3WQOA 1C9DA 1KBLA 2W3ZA 4MB4A 3THCA 4ADSA 1AW5A 4XZBA 1GUVA 3NL6A 1RR2A 3P3BA 3RK8A 1VENA 1CI1A 1UR9A 3EA3A 4BF7A 1PAMA 4DWSA 5A6AA 1TMQA 5ABHA 3ZLGA 2XGIA 2W92A 2X8RA 1X97A 3PJXA 2CLLA 3VOGA 1LL6A 1TV7A 3TV8A 3WLKX 4US6A 5LNRA 4Q6XA 4WCJA 5CC5A 3L4ZA 3LU2A 3MV11 3TJ4A 8TIMA 2EHHA 4GC4A 4F0RA 4K8HA 1OGSA 5C7VA 1OHLA 3FVDA 5HMDA 3ZVHB 3EWBX 3EA2A 1NFBA 5EMLA 1IZCA 1NOUA 1I2NA 3STGA 4GMEA 2QYGA 4ZQPA 4YVPA 3VC5A 3W71A 3CL7A 3TOPA 4MUZA 2CERA 4P2VA 2BHYA 4LRTA 1VJZA 4ALDA 4FAMA 4AZGA 1P6BA 1KXVA 5FF2A 1AA1B 2HJPA 1CXLA 1XBVA 1V03A 3RLUA 4MYXA 2DH3A 5I3HA 2PGRA 3W0KA 1DORA 3DU0A 1CGYA 1NOWA 1W3KA 1XLCA 3PBWA 4XD5A 3S4TA 3QN3A 2PDGA 3I6TA 1VPQA 3SGGA 4CNNA 2XSBA 4MOZA 3WMCA 4L6HA 1WBJA 3GKFA 4DZ5A 2VT0A 3E6EA 1DWHM 3QY6A 3VIHA 3GVWA 3ATZA 5XIAA 1UUOA 5EYWA 3KLKA 2OB3A 3U48A 2VX7A 1Y8BA 4EPDC 2WNZA 1KRBC 1M7PA 1Q7MA 4XUGA 3ZWSA 3AWNA 3C2OA 2NLIA 4H7ZA 1CB7B 4PBFA 3G3MA 2REQA 4GFIA 4ONVA 1G94A 4AZCB 1KFLA 4L1GA 3M44A 2WSRA 2XH4A 2CLOA 1R2SA 2Z1SA 1WZMA 4UQCA 2D22A 1OX4A 3AISA 5T8GA 2PCQA 4LS2A 4A4AA 5BYWA 2VZVA 3U4AA 3AJ7A 4PYSA 3STEA 1LLWA 1R87A 3HPFA 1A5CA 7REQA 4E2OA 3EPMA 3GKAA 4GKTA 3C56A 3K4AA 4QR6A 1W17A 3W2KA 2WNQA 4QHRA 5AYYA 1KFCA 2JALA 1C3FA 1ZHAA 3O07A 3ZO9A 4M6PA 2JEQA 3OA3A 4IQEA 4JX4A 4C6FA 2DUZA 4H3DA 4QNEA 1F4AA 2VTFA 3TTEA 3HZ3A 1O1HA 4QCEA 3P8IA 2E8YA 3ICJA 3LHWA 3R6IA 3LOTA 2NX9A 1ME7A 3TEVA 3E5BA 2XFWA 3WQDA 3KCJA 2JIWA 1K77A 2WMIB 4ROPA 1J12A 4MM1A 3CWHA 4EPKA 1YRRA 1G4PA 2D2GA 5J5DA 3LD5A 3M46A 2WKGA 2ZE3A 1SJBA 4CCZA 4R5EA 1LL4A 1RALA 5EL1A 4EAMA 4MZ1A 4E38A 4Q8PA 1UBSA 2QF7A 3NSXA 4I7VA 3U4FA 4LPCA 3WH8A 1QNOA 3S1XA 3VIPA 1LQ2A 5I06A 4QLJA 4WXYA 1EJ7L 2E6AA 3VGBA 2PD9A 4HP5A 2WZMA 3UWYA 3ORWA 3KUMA 1OFOA 1FQ0A 1ECQA 3VNIA 2O56A 4JCLA 1GKPA 3RO6A 2DZVA 4MTVA 4PB3A 3IK2A 4ZOCA 1W3NA 3OGSA 4UNKA 1DYSA 2WZHA 3S6DA 1J01A 2D69A 3WDRA 3WLNA 3GXIA 4CQAA 4LUTA 4AZ5A 3QV7A 1KA9F 6XIAA 2YFNA 3ECQA 2C71A 1OFBA 3N13A 3E0LA 3SO7A 3CZKA 4RR4A 2ZX7A 1OX6A 3FN9A 4UTJA 2WCAA 5FCZA 2OLSA 3B4UA 1HP4A 1UD6A 4MWAB 3GUGA 3W7OA 3UJ2A 2J77A 5DRCA 4ZB5A 4H7CA 4AFYA 4XAGA 4B4FA 1UH3A 4OGZA 3WLQA 2WW5A 4KH2A 1D8WA 1ALDA 1RJQA 3UPBA 5BW6A 1PIFA 4W93A 4KWSA 1YE4A 3SUUA 3SN0A 4IMFA 3WNNA 1DJNA 2X41A 3B8VA 3L4WA 4A6GA 1FWAC 1JD9A 3TROA 3QLLA 3WQGA 3UWQA 3P93A 1TFVA 3MWCA 3G22A 4LC6A 2DZSA 4XAZA 2X1SA 4MJMA 3E2VA 4HU0A 2VFGA 1YTKA 2XZ7A 2O7SA 4IIFA 2WNNA 1NVMA 2FQIA 3GG8A 1W1IE 1MDLA 4QEHA 2C79A 3W1LA 1FWHC 1C8YA 4CQ9A 2QUTA 3VAVA 2PF8A 2A3AA 4Y2WA 4LYQA 1WDSA 1QK2A 4AIOA 4IMCA 1XR2A 1YDYA 4GX8A 3RR1A 5AHFA 4GJIA 3R8RA 2V5JA 2FHCA 4KEUA 3N2XA 4DB7A 3BGGA 3A6OA 2A21A 2F38A 2Y1HA 4MJ2A 2ZTJA 3FLUA 3WMBA 4RZ5A 5LZLA 4NX0A 3KLLA 5HUOA 1PVNA 1ONWA 3T8QA 1GTHA 4DWSD 2A1YA 2Y24A 4DUOA 2P88A 3CV1A 1WOBA 2YDSA 2VFHA 1OJXA 4Q8UA 3CUZA 3LNPA 4D6EA 3RYSA 1JL8A 3CMJA 2D20A 2HVOA 2PI6A 4BQ2A 2C7FA 3A12A 2ISFA 2QJMA 4C91A 1FWSA 1LF1A 1DIEA 2INZA 1EGVA 3RN6A 1K8YA 5C9RA 2R94A 4TO8A 4LUSA 2PDPA 2UBPC 3VNLA 3MO7A 2CLKA 3BW4A 4MLJA 1XLEA 4JTFA 4UTMA 1WAWA 2DT2A 3LRLA 2HV5A 3W7RA 1RBOB 2HTMA 4YIWA 1LYXA 1PYMA 3BLLA 2FVLA 1V4YA 3WUBA 5TAOA 3H2NA 1BYAA 1JRBA 2XWEA 3VM7A 4GXPA 1B5TA 5GJMA 3N6JA 4I5RA 4GI4A 4URIA 3W7DA 2FTPA 4MAZA 1ZAJA 3LI1A 2VQTA 4QS6A 4G56A 3BE7A 2VJXA 3QQ1A 1W3HA 4PUWA 2D0FA 5AY7A 4P8WA 2C6QA 4DELA 4B91A 4ZGYA 1A3HA 1U1JA 3ERPA 2MNRA 4ZSUA 1JG9A 3PWAA 4CNTA 4B5UA 3G1DA 4UQEA 5AKQA 1R7OA 2W5FA 3CNYA 5C9WA 4MJ4A 1XYCA 5GPRA 2I5QA 3ZFHA 2QCLA 3ARYA 5F2MA 4M8UA 1EIBA 4HOZA 3H2FA 2J9XA 3MSDA 1FFQA 1JFHA 4ZE5A 1F73A 2XN0A 3OIHA 2OEJA 4ATDA 3S6TA 4K39A 5KTLA 2INEA 3CO8A 1E9IA 3AXHA 1VC4A 4IFOA 3H6OA 1DQXA 1ME9A 3KBVA 4I9MA 1E9YB 3I3DA 4E2DA 1OFRA 4MMWA 5ECVA 1JYXA 4H7VA 4TX9A 2BTMA 2PDBA 3DECA 3BV7A 3ZR6A 3NOYA 1GYLA 1MW0A 1DJIA 4UZSA 4JTUA 3M47A 5AYIA 2F6XA 3QMTA 1Y0EA 5K7JA 1VJIA 5D33A 4DAFA 4DPPA 3TU9A 3W07A 3OW1A 1AW1A 4L7ZA 3VCCA 2GJLA 4AX6A 1EIXA 5AHMA 1YTEA 2W9MA 1VBGA 3UESA 3CLMA 4D9PA 3AROA 3O6AA 5DCDA 1UBPC 2WVVA 3C0QA 4DO7A 3DXIA 2Y62A 1UIOA 1US3A 1VYSX 2WHJA 4NYUA 1W5NA 5K9CA 2Q8ZA 2ZA1A 1J11A 2X0YA 3UVIA 1DBTA 3CUHA 5IDIA 3T05A 2R1KA 4FNSA 2FLIA 4N4PA 2VRJA 1IT8A 3GYEA 1XGDA 1OZQA 1ADDA 2PFHA 4REQB 5F4WA 3SCNA 4GQ0A 5FEXA 1M03A 1SW7A 3THQA 1H5VA 5CPTA 1QAPA 5G1MA 3UW6A 5HANA 2FPVA 4IPPA 3NQ6A 2JKEA 1TX2A 3REQB 3RU6A 4OTKA 3CS2A 2GWGA 3TTYA 5IM51 4AVOA 1SVDA 1XBXA 3ARUA 1KRMA 3HMJG 1AODA 5DT5A 3EKLA 1TTIA 1ZCOA 4MPQA 1JQVA 5HWJA 2GQAA 1JZ6A 3W7MA 1MW2A 3MKVA 2FB2A 2E6FA 4HCHA 1VR6A 2H9AA 4EKJA 4ZOEA 3OVPA 1BRLA 2C13A 5DCBA 4XSLA 3GNRA 2CZ5A 4IUOA 5EU9A 4K1WA 3N2MA 2VWTA 4WDUA 2RJHA 5DMMA 3MANA 2WK2A 3PBMA 5DN1A 4AY7A 1FWGC 4QEEA 3C0JA 2EO7A 5I7GA 1XFBA 3KVLA 4GA8A 3LCLA 1A4MA 3RDKA 1Q8AA 3CC1A 4HNLA 4C7FA 2X7WA 4HNVA 1L6SA 1O66A 1UR8A 4B5VA 3VD5A 2VFIA 3OODA 4GYPA 1W2VA 3W2UA 5D4YA 3TVAA 3MDWA 3ZJ7A 2DIJA 3TIMA 3G1HA 1Q3NA 2FJUB 5DXYA 3TSBA 3AIUA 4NYYA 2XN1A 1OIFA 1XLAA 1FBAA 3NSNA 4GIRA 2PGEA 3A5VA 5E0CA 2ATSA 4AYGA 4UQAA 2XIBA 4LY8A 3M7WA 4GZ7A 3PUGA 2ZE0A 1WNOA 1J4EA 4CD5A 4L4LA 4QE1A 5AC5A 2Q3RA 3PG8A 3EWCA 3GXFA 3CPGA 1DXFA 2I5IA 3PR2A 1VBJA 4FR6A 2PUZA 4IFKA 1CGTA 3HV9A 1HL9A 1PKMA 1UWAA 1XC6A 2Z25A 3ES8A 4K1GA 1HZYA 3GM8A 3GHUA 3PPGA 1KRAC 4DM1A 4PB4A 4JTLA 3EDEA 5IHRA 2X42A 4A29A 5LIUX 3URBA 4LBUA 1H41A 3W84A 2E68A 4X9SA 4GH3A 3LM7A 2Y5JA 1SMAA 3DG7A 3W1NA 1J18A 2RHGA 1W5PA 3VOIA 1V6YA 3WBYA 1ZLPA 3QQ0A 3RCNA 3TZFA 1XLFA 3M0LA 3OZYA 2BASA 1UKOA 1XHGA 4I9TA 1VD6A 3PTKA 1SO6A 3LMYA 3LXAA 4C90A 1XLKA 4D8AA 1P6WA 2WVTA 1EJTC 3AXKA 4S23A 3UPMA 1EX5A 2HBXA 4X61A 1OZMA 3WQCA 5GNXA 3W23A 1PEZA 4LY4A 1YXCA 5AZ1A 3USBA 2OGJA 4O1EA 5FL1A 4BWLA 4BI6A 2IPJA 3QR3A 3PAOA 4J3WA 3DOPA 2YB4A 1CXIA 5D9MA 3FSTA 4AVNA 1KBKA 5CZTA 3GG0A 4IH3A 3QMSA 1N2VA 1V77A 3R5EA 3WBXA 3N9KA 4D72A 1CPUA 3ES7A 3MMUA 4CD7A 3SADA 1QI0A 1FP8A 3S5SA 1VCFA 1NEYA 3C3UA 4GXWA 3K8KA 1VIWA 2Z7GA 1Q8JA 1Y5WA 3T42A 3PPCA 2VNCA 1ISWA 4AZ6A 2Y89A 3S1WA 4E3VA 2IQDA 1E3ZA 4S3BA 3H4GA 4R9XA 3SQSA 4P7QA 3U5YA 1JNDA 2X30A 1VBRA 1VIZA 5CGMA 4X0VA 2VC5A 2XISA 3HG4A 1AVAA 3Q45A 3TR9A 1QHOA 3Q67A 3NSMA 1SZFA 1H1ZA 1QU4A 4UCFA 1UR3M 3NGJA 3KCOA 4L80A 3FEQA 1TCMA 5FJJA 3W7LA 4FI4A 1J5SA 4IIEA 2QGYA 3TDFA 5K2ZA 3GH7A 5DMNA 1IXPA 2G41A 5I3IA 1O1ZA 3CO4A 4P7NA 2WKJA 3ZR5A 1P1MA 3CYJA 4RZBA 1BLIA 2EQDA 3UYIA 2OODA 1WKEA 3FX4A 1MSSA 1SM9A 3H22A 3VK5A 3GG7A 3ZT6A 1UZDA 1BFNA 3EEZA 3AMKA 3PB2A 6ENLA 3PF3A 2I7GA 3OPSA 1PIIA 2PC8A 1MXGA 4Y8EA 4DX3A 3NURA 4PB5A 1I1WA 2YL6A 4ZO8A 1UJQA 3UEQA 3AICA 1S5TA 4Q8VA 3WD2A 5EPDA 3TTSA 4B9ZA 3EYPA 1LQAA 5HK4A 3F5KA 4GYKA 4QJ4B 2OT0A 2XDFA 3SCRA 2E25A 3VE7A 2Y7FA 5DX7A 1B1YA 1TJRA 1UR2A 3JRKA 3Q58A 4JGDA 1YDNA 4PMUA 3GXNA 1WDQA 2W67A 1E72M 1QOXA 1G69A 2DP3A 4S3CA 5D2YA 2E40A 3UZWA 3WNOA 5RUBA 1LTDA 1L6WA 2W79A 1SO5A 3G77A 1QI2A 1VBHA 2ALDA 1JUBA 4O54A 2GSJA 2A7NA 2XN2A 4KWWA 4WF7A 2QMKA 3LTYA 1XH0A 1W1A1 4YS1A 3CT7A 3FK4A 1R47A 4IPIA 1EZWA 5LHEA 4C1LA 1EGMA 4F0KA 1XKYA 3WENA 3WK1A 3CQIA 2ZRYA 1AMKA 4GJ1A 1IZKA 1JCYA 1R3SA 3G2GA 1E1CA 4YMZA 4C1NA 1EDTA 1G6CA 1LG1A 4DYJA 3AYRA 1YKWA 3IAQA 3AU6A 2ZOXA 1YW1A 1T41A 3E02A 2D2HA 3C3NA 3QC0A 2XTKA 5AC8A 3TN3A 4DBSA 2PD5A 3R58A 1HTIA 5EKYA 1KV8A 2HEJA 4UTWC 5LHFA 7XIMA 1MW1A 3URAA 1BKHA 4O1DA 3M0KA 3O2LA 1XCWA 1WUEA 4UNIA 4AZIA 2C15A 5C54A 1R8LA 2PDMA 2ZDSA 1ZSXA 4B3KA 2VHLA 3W7CA 3BH4A 1NDWA 2Q09A 4LXFA 4LB4A 4H9TA 2VC9A 4P8UA 4IGSA 2GQ9A 1QW8A 1B90A 2PDXA 3I7SA 2J7CA 1B31A 3S3GA 4LV9A 3GIPA 3GNDA 3JZEA 3KTCA 4ORMA 3O06A 5BRPA 3NO5A 1HVXA 4CU8A 3GR4A 3RG6A 3QJAA 4LF1A 3RPTA 2VDHA 1I8JA 1MEHA 2W61A 2OVLA 3VIJA 3BGAA 3N29A 1XIJA 3CTLA 3MMDA 1OC6A 3A13A 1UP0A 1KM4A 4F0MA 1QNQA 3F4WA 3RU8X 4HNTA 3RMEA 3WUEA 1OC7A 2D0HA 5IBXC 4S3JA 4QISA 4AH7A 1QPOA 3BMXA 4Y6GA 3IPWA 1YLVA 2OELA 1PYFA 1PCKA 3W22A 3MUCA 3BTNA 4TU1A 5A94A 2DGAA 2JQXA 2HQAA 1KFWA 1MUCA 5HQLA 1UA3A 1JFXA 3AXXA 3BCDA 4EPBC 2R6OA 3C6CA 5DO8A 1OT1A 2P50A 2FZNA 2L5HA 1OFDA 2HNEA 3WY1A 1IR2A 1XIGA 4DF1A 2WMJA 2V3DA 3NOEA 2QXWA 1CLVA 1XS2A 1H50A 1KBBA 1GVSA 3W37A 3CBWA 1P7TA 3OZOA 4C6LA 3I7QA 3WL0A 1FH8A 1GHRA 1R3QA 4PA8A 5HATA 3H54A 4AD2A 3LZ3A 1SPQA 1Q4WA 4O8AA 3WDJA 1A80A 2EF9A 1VGAA 4HJFA 2GZXA 3FA3A 2BVDA 3VGHA 5ABEA 3WQPA 3EMQA 3WX7A 4Z1YA 2RAGA 3MUY1 2W62A 4M7TA 2OEMA 1K8ZA 4UFLA 4AF0A 3IJDA 4EVZA 1PZ1A 4L6DA 3WJWA 3AWOA 1UOZA 4PH6A 1V93A 3UZ5A 3B06A 1OB0A 1REQB 1IEXA 1H61A 3TQPA 1FH7A 3GDMA 5HMFA 2YL8A 3U3HA 3I65A 1VRDA 4GD0A 5FF4A 5KZEA 2IXUA 2YCEA 4I5UA 1FDYA 8RUCA 3W2MA 1GOWA 4YL2A 1EC7A 2OWXA 1AG1O 4O11A 1PIGA 4AQLA 3CV2A 3KTSA 4LUYA 5CJMA 5HPOA 1NFPA 3LV6A 4HTBA 3EDFA 2BY1A 4B5TA 3KOFA 2X16A 3RO8A 4FF5A 1S39A 1NTHA 3BANA 5FL0A 1ZAHA 3DFPA 4S3KA 3OEXA 3EBVA 5ECUA 3B04A 4UOQA 4B5NA 3IRSA 4HPXA 1EPVA 2NXHA 3M0XA 4PN2A 3UNTA 3ZQ9A 1MQQA 1K9EA 1KXHA 3UP8A 3FKRA 1FWEC 3RJXA 3PZGA 3WF1A 1AQHA 4QITA 2W6RA 3M0ZA 4YCPA 3A5FA 1BGAA 2EJAA 2CNCA 4DWSB 3GH4A 1DQUA 4GUGA 5LGZA 1BVWA 1N8FA 3HV8A 5G5IA 2R1LA 4K2SA 5H8UA 1GQNA 3GTXA 3STFA 4JTTA 3L65A 4RXGA 2BDQA 4PMVA 2PP0A 3CWOX 3NL5A 4YTUA 4JIHA 1D3HA 4KEZA 4QAWA 3L12A 1GVYA 3LLDA 3NXLA 1E51A 5LGXA 2ZTKA 5D2XA 4ZB2A 2YCJA 4O8RA 1XLIA 1ZRQA 1XM3A 1EQCA 3WG6A 3SCVA 3M5XA 1TRIA 4JKMA 3IUIA 4BEQA 3PSVA 5MF5A 2Z1WA 8CGTA 2ZZ6A 4BEUA 1GVEA 1R6WA 2Z28A 4C6DA 4W8BA 1D3GA 2HVNA 4JTEA 2WM1A 1S2TA 1LRQA 3FDKA 3MV01 2Y88A 1RD6A 4C6NA 5E5CA 3QYSA 4H2HA 4YYFA 3VDHA 3KL5A 1CECA 2WPBA 3AHTA 3SJ3A 3O15A 1OCBA 5BOOA 1HKWA 4JKLA 3NIYA 1H7NA 2CEQA 1IE7C 5JVLA 3TFCA 3MUZ1 3VMPA 4DM2A 4ICCX 3GYCA 3TQ0A 8A3HA 1DTUA 3PG9A 5T91A 3WEZA 4ASTA 2OQYA 4J3SA 1N8WA 3GBDA 4CQBA 2BG5A 4E8DA 5I3GA 3IV3A 1TPEA 3S0CA 3UF9A 1H62A 2REQB 2VYOA 4PMDA 4CCEA 5JBFA 3FHAA 3KX6A 4UR8A 2HZGA 3NM3A 1MNZA 4AVFA 5EFDA 1Y5VA 3L4TA 8XIMA 1T8QA 1FUYA 5LYRA 2A3HA 1OX4B 4IP5A 2WHKA 3FJ4A 1VBUA 3SIZA 1S5NA 2DZXA 1TJ0A 4JQAA 3P7YA 2WWDA 4DVOA 1DJGA 4FR1A 7REQB 5F2LA 3T6CA 2NVAA 3VDCA 3EOEA 1YADA 2C14A 2JIEA 4JHZA 4XZMX 5GQBA 2AAMA 4XB3A 3PUEA 4O0ZA 3SUWA 3UZYA 1VFSA 2EKCA 2WMHA 2WZIA 2RGMA 4JICA 5T9BG 4QNWA 1B57A 4OV9A 4DN1A 5EB8A 2XGZA 2VRQA 3BLPX 2QIWA 5CBIA 3DI0A 4WX2A 1R9YA 4OVXA 3G5EA 3PWIA 1T99A 2ABAA 4F0SA 1XW8A 3N3TA 2FVMA 3KTXA 1XQKA 3DAQA 1TZZA 3UG3A 1A50A 2X2GA 3IIOA 2ZRXA 1ICQA 1QOPA 3PTMA 1E4IA 4B3LA 1QHPA 3PUOA 4K37A 1QPNA 2PZNA 4LVDA 3LCFA 4C6BA 1V7AA 3W24A 1C29A 1GOXA 4QDWA 1HJVA 1Q6QA 1UD2A 1GQIA 1UYQA 3AHVA 1F9CA 1XRVA 1KR1A 1K6WA 5JU6A 4HPHA 2XVLA 1UH4A 3F7JA 3L7RA 2CLHA 2Y7GA 1I0BA 3H26A 2CZEA 4OHQA 2KX9A 4CD4A 2Y8VA 1QPKA 2OYLA 2PDUA 3TC7A 2W4XA 3E0FA 3DUGA 3DKLA 2H3DA 1JZ8A 5CSYA 4DY1A 1RH9A 3KBMA 3PFRA 3UJRA 2EPHA 1AD1A 1UASA 3VGFA 5KETA 3LK6A 2YDAA 5A6KA 3PK7A 4WLCA 3COTA 3P82A 4EPEC 1EJWC 3R7MA 5GVJA 4CLMA 1VAHA 4JIPA 4M80A 4O53A 2QV4A 4GY0A 1A0EA 4H41A 3A9BA 2FHFA 3LMZA 4A3UA 2HISA 1LBFA 3TAOA 1RV8A 3A23A 4QJ5B 1KCKA 3WUGA 3FHQA 4WJ8A 3HURA 5G2WA 5BU6A 1ZCCA 4UFIA 1VCGA 4L64A 1XG4A 3SECA 3PULA 3TUUA 4R34A 2GQ8A 4Q8NA 4O19A 1JPKA 3A4WA 4H8NA 4Z08A 3PZUA 2X09A 5HJLA 4UTFA 2V2DA 3N3MA 4PEEA 4HA4A 4JIEA 5FEWA 1LG2A 1JEZA 5G4HC 4RZ4A 2EG7A 5G1YA 2PU1A 5LXXA 5DANA 2YFOA 4Y9AA 2WKLA 2YSWA 3GXMA 2VDGA 2E09A 4TXEA 2QZRA 1QPQA 1B3YA 1RQHA 2GJXA 3KRUA 1S46A 4J1OA 5REQA 4UR9A 1C7SA 3AYVA 3JS3A 5AHNA 3GZ3A 1BD0A 3TC6A 1J0HA 4L65A 2ZQ0A 3LGDA 4IJRA 4E4UA 3P81A 1K9FA 2VFDA 4LOCA 3PP7A 3EB2A 3NQFA 1YQ2A 2CPUA 2DW6A 1LP6A 4LUSB 1OBAA 4M0XA 3BLIA 1CXKA 4LALA 4Y9PA 1W5MA 3VNKA 2OTDA 4Q7BA 1GVQA 1YXDA 1OD8A 3OA5A 1OF6A 2Y5SA 3LI0A 5FIPA 1JDCA 5HA7A 4Q4MA 4G7FA 3O7UA 4PCSA 4GVGA 3KBWA 1T5AA 4PTVA 2QVHA 4I6KA 4HD5A 1QMLA 3DBPA 4MWAE 5D37A 2VUYA 3P67A 3P80A 1LROA 1OK4A 4N9BA 3WFLA 4NRRA 5CQ1A 5AECA 4KETA 5TNVA 5FF0A 1JGIA 4L1WA 4C5ZA 1WA3A 3BGJA 2Z2BA 1JI2A 3LGGA 4L6OA 4D6JA 3CHVA 5LA1A 1E55A 4KFPA 3S8HA 2D3NA 4IQLA 1L8NA 3QKEA 4RDZA 1UMYA 2J7BA 1KFEA 3CEUA 4UC5A 1G4SA 1KRCC 2P53A 5LNUA 3RCYA 4W87A 3G1SA 1Z42A 3QQWA 3IACA 1U5VA 2J75A 3ABSA 3AZRA 1M53A 4GH1A 2NWRA 4GPNA 2ZUMA 5JXQA 4QFUA 5IOBA 3WLIA 1CXFA 2CZDA 3W85A 2HK1A 3Q4DA 1DWAM 2WVSA 3MCNA 3BCJA 4UQBA 4TVCA 3CAKA 3PAJA 5DMLA 1XYBA 2VD9A 4QSHA 3M5VA 4HK7A 2HROA 4JEJA 4H9YA 3B9DA 1ZJIA 2ZRZA 3W1PA 3HBLA 4LVBA 3MYOA 1E0WA 5HR6A 1EKOA 1CZ1A 5HQMA 4JTHA 4JNMA 1E0TA 4US5A 3THUA 1P1XA 2A3EA 2VRKA 3BAWA 1QI4A 3V35A 3IS4A 4DUVA 1VEMA 1Z8AA 3QTPA 3CYVA 1EUAA 1NP2A 3VKAA 4AMAA 1C90A 5CH9A 3KOZA 1RY8A 3TTQA 2NUXA 4X60A 2HBVA 3VYLA 1UB3A 4MHBA 4NI3A 4PRTA 2B81A 4OU1A 4HMDA 5CZKA 3V0SA 3ZSTA 1JZ4A 1EC9A 4BF5A 1JDFA 3T4CA 2OT1A 3W76A 3B8TA 3KFTA 3LB0A 3WD1A 5F2GA 2FDSA 3F4DA 5JBEA 1FH9A 1F3EA 1JNEA 4NKCA 4DI8A 1XC4A 4ZQCA 3D46A 2WVVB 1TCDA 5J04A 1ENUA 1K02A 3Q2DA 3NM1A 1QNSA 2AL2A 4IL2A 2J8TA 1RHCA 3QGAC 1K3UA 4GYJA 4W7UA 1YPIA 2QPSA 4JN8A 3C2VA 4DBDA 1G7UA 1F4HA 4LYKA 1PWLA 5CPQA 4KT2A 5HINA 4Q3MA 4W85A 5CLWA 1R3TA 4Z2JA 4FNPA 1NDYA 1JGMA 5M1TA 4Y9NA 4Q4OA 2R1PA 3ZYZA 4PODA 4PTNA 5MHBA 2XYLA 4ZFMA 1N82A 4QQ3A 2VEGA 1SQ7A 4H1ZA 3TYEA 4TV5A 3NVDA 5C8BB 1Z9AA 3SDOA 4JX6A 2O92A 3EGJA 1VF8A 1HKIA 4NJJA 1BTMA 1YIXA 2WC3A 3MP5A 4QTGA 3EWXA 1B54A 5I07A 3HN3A 5A2AA 1R0MA 2ZRVA 3NDOA 1E3XA 3R0DA 4TV6A 3ZIZA 1E0UA 1V7YA 2OU4A 2HS6A 3N14A 2QCHA 3M0YA 2DT3A 3QSTA 2H9AB 3OLDA 1J9YA 1C8XA 1BRLB 2E1WA 3OJGA 4JCMA 4HZ6A 1HJQA 4O4WA 3S47A 1TV2A 1HO1A 5A95A 3DHDA 4L4OA 2VM8A 2Q3OA 3NA8A 5IXEA 4YXGA 3DERA 1IEQA 4KWUA 1J6OA 2FVKA 3HM7A 4R33A 1BXBA 3NPUA 3PFMA 1HGWA 2YXGA 3CL8A 3OQEA 2CC0A 4Y7EA 1NAL1 3MC5A 3WJXA 3O3RA 1ISYA 1BXCA 4OUIA 3TQVA 2DJLA 2VX6A 1D8CA 4ECLA 3KS6A 1EDGA 4GUIA 3T08A 3G0SA 4MF4A 1DE5A 4IFRA 4KF1A 2Y61A 4DO6A 5A6TC 2IKJA 4XIMA 2H8XA 4IPLA 2PTYA 3TYUA 2UY3A 1US2A 2QJJA 3L0KA 3V18A 3LLXA 5U7SA 2E0PA 3VD4A 3RPMA 3OLIA 2PDHA 1W1PA 4ZOBA 4AD4A 3GQYA 3SQMA 1T6MA 4DYEA 4RZ6A 1QR7A 3ATYA 2PDYA 3M4HA 3MI2A 4S2CA 5JH1A 3IJ9A 1YBQA 2WZEA 3NZGA 4XISA 2XIOA 1UQYA 1NELA 3TN6A 4B5SA 1XINA 3W7PA 1E6PA 4U3CA 4BI5A 1XRTA 3P6LA 4HSNA 2POZA 3KL0A 1PB0A 1GPWA 3IGXA 1BWVA 1V6TA 2WSYA 2Z29A 3BC9A 2NT1A 1KGXA 3B97A 2VI0A 3LTPA 3B9OA 4M19A 4OBTA 2QDGA 1UKPA 3M9YA 2QW5A 3NDZA 4IMGA 3S5YA 4OUEA 2ACQA 2ADAA 4HHHA 4GI8A 7CGTA 1IYXA 4M29A 3R89A 2DIKA 2QT3A 4J3TA 2YXXA 4YU1A 3WD4A 1S2VA 1HFBA 1UA7A 1EB3A 3N15A 1VCVA 3MKKA 3IGHX 4QJ3B 4N7QA 2ISSA 5L9FA 3RLHA 5C55A 3H23A 4DNHA 3GAYA 4GRSA 4MUPA 3LBCA 3FA4A 3H4WA 4R7OA 2Y63A 3UXAA 4AZ7A 2ZWYA 3FS2A 5HAOA 2NT0A 2V5CA 1XIBA 3QW3A 1EP1A 3WH6A 4DLMA 1E6ZA 3MJMA 2V3GA 2X7VA 2V0TA 1OM0A 3C8FA 4JYEA 4DBUA 2IKIA 4GO8A 4G7EB 4BS0A 2Z2UA 3PVFA 3R11A 1EWEA 5D9PA 4EWND 1LCOA 1J0ZA 3VXGA 3FIGA 1EUNA 4JTRA 4GQQA 4MNJA 3U5UA 3B0YA