4GUHA

1.95 angstrom crystal structure of the salmonella enterica 3-dehydroquinate dehydratase (arod) e86a mutant in complex with dehydroshikimate (crystal form #2)
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
259
structure length
259
Chain Sequence
b'NLYFQSNAMKTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREADFDILEWRVDHFANVTTAESVLEAAGAIREIITDKPLLFTFRSAKAGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEVKATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQERYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-dehydroquinate dehydratase
publication title Reassessing the type I dehydroquinate dehydratase catalytic triad: Kinetic and structural studies of Glu86 mutants.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Lyase
total genus 90
structure length 259
sequence length 259
chains with identical sequence B
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2012-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01487 DHquinase_I Type I 3-dehydroquinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4guhA00
3SECA 4LC8A 3GDTA 3JR2A 3NL6A 1Z42A 1QDSA 4H4IA 1FY6A 2VFIA 1SSGA 3Q58A 5LGXA 1B4EA 4UC5A 5K9CA 1SQ7A 3TMLA 1FWSA 3L5MA 3M47A 2GVJA 3KRSA 3W07A 3P5YA 1TJRA 3NL3A 3A22A 1C29A 3TJXA 1TCDA 3OVPA 5U7SA 4X9SA 2Z1BA 3S1UA 2J88A 2R94A 4OQVA 3IGUA 2EPHA 4OBTA 1JCMP 4N2YA 2FJKA 4E0CA 4WXYA 2QR6A 4CLMA 1FXQA 1CW2A 1KV5A 4M6PA 3V75A 1J4EA 4UTHA 1ZAHA 1ICPA 2NUWA 1R47A 2GPTA 2NWSA 1RV8A 3TKFA 3NYZA 3W7NA 4B5NA 2VEIA 4LRSA 4Q33A 3DFOA 3TXVA 1V7YA 3G22A 1S5VA 4CQ9A 4FIQA 5G2HA 1TPUA 5CZJA 3T7VA 5HWMA 1DOSA 1PV8A 3CU2A 1IXNA 3UWVA 3M44A 2I1OA 4NVTA 2YFOA 3BW3A 3TUUA 4Y6GA 1YXDA 1KFKA 4HKPA 3ATZA 5KMYA 1GZGA 3DBPA 3DAQA 5J5RA 4UR7A 2X1TA 2X30A 4M6QA 3S1VA 5A8GA 2FB3A 2PRMA 1S5WA 2G95A 5CPMA 2E6AA 4DQWA 3OEXA 1U5JA 1FCBA 3S5OA 3WJZA 5BMWA 1W1ZA 5BW6A 3TSMA 2CLLA 3EWZA 1VYRA 3L65A 3WK1A 5HNRA 5I3IA 5H91A 1LBFA 2CLOA 1MO0A 1UASA 2ZDRA 1G4SA 1N8FA 3B8DA 1C8VA 3QSTA 3B03A 4K7VA 2ZQ0A 1GVRA 2I9EA 4O50A 4FNSA 3NDOA 1P0KA 4XQ6A 4PC8A 3G1DA 2QCGA 4IGHA 1Q3NA 1XM3A 3DXIA 1ZY9A 5F1UA 4O16A 4RZ4A 3LCXA 4UTWA 1R2RA 3INPA 4PH6A 1OHLA 3LLFA 4IWWA 1A5BA 2CLEA 2AQWA 1F7BA 1OABA 1RZMA 3RFAA 2CZDA 4OWGA 3WJYA 5EMUA 4JTGA 3DENA 3DFQA 2ZZ3A 3B4UA 4FNPA 4L4MA 5CSRA 2BSLA 2ISSA 3S0CA 1T99A 5EKYA 3W1AA 2FLIA 2QAFA 4LY8A 1DVJA 4JTTA 1G4TA 1M5WA 2H8ZA 4ML9A 4A22A 4FNTA 1EA0A 4AAJA 3O6DA 1SFJA 1T8XA 3M5VA 4TR9A 3WJSA 3PS7A 4WOQA 3M16A 1FWWA 4O18A 4RXFA 3FIGA 3W75A 4DF0A 1JUEA 5AC8A 1BWKA 1K03A 4RV8A 2EGZA 4XBKA 4ORMA 2EHHA 2J24A 3W2JA 1VRDA 1QNVA 3L2IA 1HG3A 1W3IA 3LXAA 1VHNA 3P62A 4LTSA 4JYDA 1YXCA 4UCGA 5F4WA 3GX9A 4X2RA 5TBOA 3G8RA 4O1CA 1VLWA 3C2RA 4MYXA 5DBUA 3HG5A 2QF7A 4DXVA 3VNDA 1UJPA 1GVQA 1GJPA 1ME7A 2FPTA 2OZ0A 2G5WA 3B0PA 1DHPA 1GQNA 5SWUA 1HFBA 3W76A 4KWWA 1KA9F 2YZRA 3IVUA 2V0TA 3I7RA 1O94A 3CIXA 5AYYA 4WY0F 1H7WA 1JQXA 2V2CA 3M41A 2E5DA 1LBLA 3NPWA 4O8RA 1KTCA 3TJLA 1OFPA 3GVGA 1SZEA 3HGSA 1OYAA 3ANYA 2V9DA 1QPOA 2BLEA 3W2NA 2CLMA 4XKYB 2JGYA 4UFJA 4Y8FA 1FXPA 4K39A 4ONVA 4PFMA 4QITA 4GE8A 4QNEA 3MI2A 1XBZA 4MUZA 3LCGA 2V8ZA 1W5QA 1W5NA 2ISWA 2R14A 4DPPA 3LV6A 3TQKA 3O1NA 3LI1A 3B0VC 3JS3A 4JR5A 2V82A 3HIJA 5D02A 3OVQA 1OX6A 3B0UX 3TMQA 3KRUA 1QPNA 4UTIA 5LNWA 3S5ZA 1WYIA 2CLKA 1EP1A 3TXZA 2C14A 3TSBA 3CM4A 5K4XA 3BV4A 2B0MA 3NQGA 4WXZA 2LLEA 3FJLA 5C6MA 3DKLA 4O1AA 1OX4A 3MW7A 4I7UA 2NXIA 3ABOA 2VFHA 2CZ5A 3N2MA 3I7QA 7TIMA 1JCXA 3RNDA 2JKEA 1W8SA 4QSHA 5I3HA 1MZHA 1OFEA 3LXCA 1XDMA 1KM3A 2ZCGA 1W0MA 4H6KA 3RLUA 4RX0A 4QJ1A 3HG2A 2HS6A 1LOQA 4BI6A 1HUVA 2V2DA 3DFPA 3KVLA 4LVBA 4I7WA 1BWLA 1X1ZA 3NG3A 4OHQA 1PL9A 4KFOA 4R34A 1O4UA 4UTLA 1N55A 5C55A 2GOUA 5EY5A 2B7OA 1RQEA 3PB0A 3W87A 5AOUA 1VCGA 1DJNA 1XBVA 1Q6LA 2Y7EA 3LRLA 3QFEA 4YMZA 5I3JA 2PRLA 3TW6A 1AMKA 3VCRA 5LNUA 2ZRXA 4GUGA 3BLIA 3L5LA 3N19B 3PSVA 5KINA 3LBCA 1OF8A 3LCFA 1ZCOA 3QEZA 4HPJA 4NT0A 4N02A 3DI0A 1H62A 4FO4A 1TREA 1EUAA 5DBTA 2DJLA 5ABTA 4O52A 2Y89A 4ADUA 4BFAA 3UXAA 2H90A 3MBFA 4AXKA 3W72A 3PC0A 1NSJA 2YR1A 1WBJA 3G1AA 1LLZA 2RDUA 1G7VA 3NAVA 4OT7A 1D3HA 3LM7A 1K8YA 1GOXA 4MJZA 3W1PA 3KOFA 4HPXA 3SSJA 1P0NA 3P8IA 4PTNA 1JR1A 2JKPA 3USBA 2PURA 2V2HA 3PBYA 3W71A 1WOAA 5F2GA 1GTEA 1F73A 3L68A 3G0UA 4MKNA 4TU1A 2VXNA 5AB3A 1H61A 1P4CA 3R2GA 4DO6A 4O0KA 1I45A 3R8RA 2XN0A 3W7LA 3S8HA 3PUEA 1NF7A 1QCWA 4WOZA 3MUXA 3S5NA 3UYCA 1PIIA 3S5YA 4TO8A 2RFGA 1UCWA 1VR6A 3W1XA 3O05A 5HWNA 4L4LA 3T55A 4QIUA 3M0ZA 2YW3A 3W7RA 5E93A 1SW7A 4ZQNA 1SFLA 2VOMA 1KV8A 4GUIA 1P1XA 1L2UA 2NX9A 3HPSA 5CPOA 4LS1A 5C5YA 1I2OA 3UWQA 2ZBTA 3NQDA 2QAPA 1QPQA 4UTMA 1SO3A 3UZ5A 1VCVA 3LCLA 4AHOA 4LUJA 3QQ0A 4IUOA 2TPSA 1SR9A 2B4GA 3L66A 3GR8A 3I7SA 4LVFA 3MYPA 1WX0A 4GWEA 3PF3A 4GRSA 5D2XA 1NFBA 2FPYA 3A23A 5CZ0A 1QO2A 5DCDA 4DF2A 3NPUA 3O07A 1YDOA 3CC1A 1B57A 3NEVA 4N4PA 4HNUA 1ZAJA 4P2VA 1VLIA 3E49A 3S9YA 1QOQA 1T0OA 4M7SA 4DBDA 4MLJA 1AW2A 4BWLA 2HS8A 3S1XA 3QJAA 1XCFA 2A7PA 1NF0A 2VELA 1KTNA 4R53A 1LLWA 2VEPA 3NQ2A 4DPQA 5D2VA 1SO4A 4ZVJA 4UFHA 1NEYA 2NXGA 4Q4KA 1TSIA 2A7RA 3GB6A 4GXMA 3EX4A 4WUIA 2WNQA 4PODA 3C8FA 4MJMA 5MHBA 2YCEA 1G6CA 3UY7A 4AF0B 3NNTA 3EWUA 2ZZ6A 2CW6A 4M6VA 4A3UA 5T26A 3GIYA 1EX5A 1MSSA 3LHTA 1XUUA 3FKRA 2Y88A 1PS9A 4HN4A 5D37A 4R7JA 1W56A 1LOLA 2CLFA 2CLHA 4A21A 2E6YA 3CB8A 1A5CA 2ZZ4A 4DEFA 4LV4A 4CQAA 1KM0A 5K9DA 1JCNA 2QDHA 4MPQA 1Z44A 4ZL1A 3PBVA 3K30A 2A21A 2X16A 1ZJIA 3P67A 2NLIA 4UMAA 3H54A 3O6YX 2HTMA 1QOPA 5KTLA 2QDGA 2RKXA 4JNMA 2BXVA 1Q6QA 3NQFA 1I2NA 5CZSA 5DCBA 3EWBX 4O12A 2A7NA 1LOSA 3QF0A 4O10A 3KFTA 3SFKA 4GBUA 3TIMA 5FF0A 5FESA 5FF2A 3GDRA 1THFD 3ABQA 3EX3A 1U83A 2GUUA 4G1KA 2KZHA 2A85A 4NNAA 1SO5A 2Q3OA 3RLVA 5AC7A 4JIQA 4HNNA 3W7IA 4POCA 2VFDA 3UWWA 3E02A 3WJXA 3F4WA 1FDZA 1VS1A 2EKCA 1KW1A 5D05A 4K6AA 3G3MA 4O0ZA 4E2BA 3BGGA 2W6RA 3NQMA 1TYGA 5D30A 3GDLA 5FF4A 1D3GA 3C2VA 3NPVA 3QZEA 3SJ3A 4RJEA 5CSSA 5AHFA 3O63A 3W7JA 3DU0A 3UXDA 1FUYA 4XKYA 4O19A 4HSOA 3B05A 1TPC1 2P10A 2W79A 2OJPA 3T4CA 1KM6A 4IXXA 3HQ1A 4D2JA 3R13A 3E12A 4JY8A 5HQEA 3SIZA 3PY2A 1JUBA 3LGEA 4K7YA 3ZFHA 4HSNA 4RZ6A 3AO0A 4PEKA 3HGJA 3TQ0A 1XKYA 3EWYA 3L0NA 1YYAA 5KZEA 3M5YA 3UPBA 5D04C 4ZQOA 5G5IA 4O13A 5KZMA 4JTLA 3NQ6A 5AFDA 4JTHA 5EPDA 2E09A 1YXYA 3GAKA 2HSAA 1SZNA 3LI0A 3EWXA 3G1XA 1JULA 3PM6A 2IQTA 2Z6IA 1X1OA 4IXHA 1MXSA 4IOTA 1N7KA 2TMDA 4LOCA 3E96A 4JEQA 3NO5A 4UFLA 3STGA 4IJBA 4JTEA 1H7PA 3TFXA 2C16A 3R89A 3N3MA 4JX5A 1JCYA 1ME9A 1FX6A 3W85A 2F7FA 4DO5A 4UFMA 2DZVA 3G18A 4WZHA 3I65A 1HTIA 3VE7A 1TTQA 4JTSA 4CCEA 4QNWA 1RPXA 4O1BA 1JUKA 2J9ZA 3GYEA 3W1NA 3TH6A 1VHCA 1P5BA 2C18A 4AMAA 1GYLA 3CIWA 4LWWA 1GWJA 3GXPA 1HO4A 1XFBA 3PAJA 2J6XA 1H7OA 1TJPA 3MI3A 3W7QA 5K4ZA 5EL1A 1KFLA 4O4VA 5AYZA 5IBXC 1OG0A 4M5PA 3W1UA 1TRIA 1DORA 1TTJA 3L21A 5D2WA 2DZWA 1KLYA 2Z6JA 4R33A 2QCCA 1QAPA 3GR7A 3W1LA 1IXQA 3NM3A 5K3VA 3FS2A 4GUHA 3M9YA 2QCDB 1UUMA 4DO4A 5BRBA 4LW7A 2QJIA 5HR7A 4HT3A 2RH9A 4NX0A 1XBXA 2WSRA 3KRZA 4NNCA 2QUUA 3PULA 2ZRVA 4O4WA 4YCOA 1D9EA 4GJ1A 1PVNA 4GNJA 4ZQPA 3PSWA 4UTTC 3TK7A 3QM3A 2G96A 2RDTA 3W1TA 1SW0A 3PVFA 2QCNA 4Z1DA 4UXDA 2ISVA 1SUXA 3LTYA 3LX9A 1PE1A 5AHEA 3IV3A 4XZ9A 1A50A 2NUXA 3PR2A 3STCA 1QFEA 2ZZ5A 2H6RA 1KBIA 2BTMA 2CZEA 3TDFA 3C2OA 4NJKA 4XWUA 1GVFA 4IMDA 2ZA1A 4JYEA 1OJXA 2ATMA 3G1VA 3LCWA 2X1SA 4EWND 2Y62A 1ONRA 4NQ1A 2CFFA 1SSDA 3UWUA 2W0UA 4O15A 4JTKA 1WBHA 5CKSA 3W2LA 4ADTA 1W31A 3C61A 2RHGA 4WD0A 2F84A 3NQVA 1YTDA 4NJHA 1Y0EA 1MEWA 3S6DA 3TA6A 1XBYA 4IX2A 1H7RA 3A5FA 1DBTA 4LT9A 1TV7A 2FB2A 3DFSA 4FX6M 3M1ZA 3C2EA 4ZZ9A 3N2XA 4LVDA 3G0SA 4JIPA 4N6FA 3LBMA 1K8ZA 3LRMA 3O16A 5DY3A 5BOOA 5K9XA 3LTPA 3LOTA 1IXOA 4RCXA 3HPZA 3MHGA 1SZGA 4HNVA 4KFPA 3LHUA 2O7QA 3EXSA 2V5LA 1GTHA 4MY1A 1FDJA 2ZRUA 3GXNA 2VFEA 4RKAA 5KITA 3TAKA 3EKZA 4FF7A 3GLCA 5F1VA 4PA8A 1S3HA 2Y7DA 3BG5A 3W2UA 4DBEA 1YTEA 3HOJA 3TC6A 2WNZA 5DXXA 2A2IA 5FF3A 4JS3A 3LHWA 3LV5A 4ZQRA 4JD4A 2NV2A 2OMAA 5HINA 3TW7A 1LBMA 5FEWA 3W7EA 1BEUA 5FF7A 1OFDA 2ABBA 4NU7A 2J27A 5KZDA 2RDWA 2YYTA 5FEXA 2ZRWA 1FDYA 2DZTA 4UR8A 4EOUA 5IM51 3S1WA 5U4NA 4YWIA 1A53A 1SPQA 1KBJA 4Z1BA 2Y6ZA 1LRNA 2P1FA 3FYPA 2AGKA 3D0CA 1VQTA 3V1PA 2A6LA 4E38A 4FX7A 4XTDA 5A5WA 2OT1A 3GNDA 3LB0A 3PB2A 1R46A 3FEMA 3GDMA 3QMSA 2D73A 4GUFA 1SO6A 3HPXA 4RLIA 1ZALA 4LC6A 4MVAA 3JRKA 4K37A 1AG1O 2XN2A 4K8EA 5D32A 3A9IA 1FQ0A 1VGAA 4FHAA 4AHQA 2P0OA 1YADA 1B4KA 2BWGA 4X22A 4N4QA 1AK5A 1W5MA 2DZUA 3CLMA 3WJWA 3WK3A 1M7PA 4AB4A 3U2OA 3GK0A 4S1FA 5G1TA 3NA8A 4DF1A 1XUZA 1OK4A 2Q8ZA 3M5ZA 5LSMA 3W9ZA 5DXYA 3BG3A 2Q3RA 4K36A 3L0GA 4ICNA 4O54A 2ZTJA 2Q8LA 3HBLA 3HGRA 1TO3A 2CWNA 3O6CA 1B3OA 2WJZA 3THAA 4BI5A 4JGDA 1F05A 3CQ0A 1ZENA 4A29A 2NX1A 2EF9A 3O15A 3CEPA 3IRDA 3W7PA 2ZRYA 4LV9A 1Q6RA 3LCHA 1O5KA 3GDKA 3QC3A 1W37A 3ZWSA 3NL5A 5LNSA 1X6UA 1QO5A 3IVTA 1OF6A 4UNKA 3LERA 3TV8A 3QQ1A 3A21A 4UMCA 1GT8A 2VFGA 1YPFA 3NOEA 3TCEA 1GEQA 1G7UA 2BX7A 1UB3A 3TAOA 4W9TA 3IIVA 5G2IA 1EPXA 3WK0A 2JK2A 1YLVA 4RK8A 1R30A 2QUTA 1OFBA 4FEZA 2G97A 3UWYA 2E5CA 1H1YA 4A2SA 2E1DA 5CPLA 1IIGA 5LZLA 1PCKA 3MP3A 3O8AA 1EP2A 2V81A 3HG3A 2NV1A 3MO7A 5K2ZA 3MMTA 4KKXA 4YCPA 3HG4A 2ZZ2A 2GJLA 1EEPA 3NQCA 4N9EA 4FNRA 3GKFA 3SZ8A 4WY0B 3ABSA 4Z1AA 5F4XA 3MP4A 3UZJA 4LS2A 5E0KA 4Z08A 3W1MA 3OG3A 1E51A 1TQXA 4TX9A 1OYBA 4JX6A 2ZZ1A 4CNPA 1F6KA 3ZWTA 5F2LA 4CCCA 3C56A 3FKKA 3DI1A 5FI8A 4MZ1A 4NJGA 2Y7FA 2J9XA 2Z2UA 1WAUA 5J5DA 4O1DA 1Z41A 3MHFA 1FBAA 4CNOA 4FIRA 1X7FA 4U4MA 3F4NA 3DH7A 4NZJA 5DN1A 1H63A 1LDCA 1QPRA 2C3ZA 1Q45A 4GFSA 3W22A 1XXXA 1OX4B 2TYSA 3R5EA 4HIBA 3W2MA 3N73A 5BNKA 5C2XA 2JGQA 1FWTA 3LXBA 3MYOA 2V30A 3SW6A 2ALDA 3W7DA 1VCFA 2WO5A 1A5AA 3I6RA 4IX0A 5G1YA 3MWAA 5C54A 2FIQA 1ADOA 4DELA 3BARA 5CG7A 3DKJA 1JQVA 4EVZA 5FEZA 3VE9A 4FX8A 1ALDA 2NX3A 4QAIA 1S5TA 4NJJA 4P61A 5G2WA 3YPIA 3T40A 3BW4A 4U28A 4C1LA 4HNTA 4Q32A 1NAL1 1LM1A 3CPRA 1K7FA 1KM1A 3EB2A 3GZ3A 1LCOA 2E6FA 3Q37A 5HMSA 1WDWA 3EXRA 3LDVA 3F1QA 3WK2A 3STFA 2A5HA 4MY8A 3C4UA 3W7OA 4AWSA 2CZFA 2GVGA 3W84A 1I2RA 3C0JA 4HHPA 2QCDA 3OIXA 2E77A 1O60A 2TSYA 3OVRA 2WSYA 2DZPA 3CWNA 3L0KA 4NJIA 1L6YA 3RK8A 2XN1A 3G1FA 3UWZA 2PRHA 5I3FA 4UTWC 3N34A 1WQ5A 3L9CA 4X3ZA 1K02A 1H51A 3IIOA 4QM1A 2DP3A 2FFCA 3TX9A 3TE9A 2QUVA 3NR0A 2PE4A 4WJEA 3W7CA 3W70A 1SU5A 5HJLA 4FXRA 3HGOA 4NXKA 1MEIA 2E68A 4GC4A 5AC6A 1H1ZA 2A6NA 3U6WA 2QCFA 2ABAA 4I7VA 3UNDA 3NXFA 2NWRA 3IGSA 3HJZA 3BLFA 3TC7A 4ALDA 1CI1A 2QCEA 3LCIA 1RQBA 3C6CA 1T96A 3KX6A 3IIXA 1IIHA 1KM5A 4QQ3A 5K7JA 4YLWA 3W88A 1DKWA 3PWAA 3LLDA 4UIOA 1GG1A 4AEOA 6TIMA 1VC4A 3VKJA 4Y90A 1TIMA 1I4NA 1RVGA 4JY9A 2DZSA 2Y70A 4MZYA 5LKYA 1TPVA 3THQA 1KM2A 5GVJA 3C3NA 2C6QA 2CLIA 2XFWA 1VYSX 1LZOA 4JTFA 3OHIA 5CGQA 4LUIA 4Z0JA 1OK6A 2E6DA 1TPWA 4MFEA 1J5TA 2O7SA 3E0IA 4MOZA 1OFQA 1AL7A 1TV5A 5H2ZA 2TRSA 4S2BA 3RU6A 2YYUA 1OFRA 5D2TA 4ADSA 3W3OA 3PUOA 4UTJA 1QR7A 3MHUA 2ZZ7A 5F2IA 1Q6OA 4PCFA 4Y9AA 5LHFA 3G3DA 3BG9A 1A5SA 1TQJA 1VJIA 3VI2A 2NXHA 3QW4B 5L9FA 4XTIA 3G24A 5AHLA 5AN7A 2WSQA 5LHEA 1I2PA 5L6UA 5D2YA 4OE7A 5G4EA 1LTDA 4TMCA 2B7PA 2GQ8A 1TPB1 3M6YA 4MZ8A 5D33A 3N9SA 1JRBA 2YX0A 1EUNA 3IEBA 5F4SA 3AJXA 3C2FA 4FXSA 1TTIA 1JCJA 3MP5A 2GQ9A 4O17A 2ATSA 4MY9A 3GAYA 4J9JA 1KFJA 3EX6A 3SR7A 3L67A 5LGZA 3NL2A 3H55A 3ABRA 4M19A 2NUYA 3QPYA 3S42A 2H8XA 3LHYA 1H7NA 2C15A 3GNNA 2VENA 4Z0SA 2VC6A 1TV8A 3QMRA 5F2MA 3QW3A 3GKAA 1K8XA 2J9YA 3DFTA 3CTLA 1ME8A 3P8JA 4FNQA 2A0NA 4IPIA 1LP6A 1QMLA 1L6SA 3EKLA 5LNRA 1W3TA 3NQEA 5D03A 2QKFA 3W83A 1LORA 4KWVA 3KVMA 6ALDA 1DQWA 3KVJA 2YW4A 3LHVA 2QCLA 2OCZA 4S2CA 3DFNA 3TR2A 4OV4A 3P81A 1AL8A 3HO8A 1EP3A 1XC4A 5AHNA 2C19A 4XUGA 1QWGA 3OBKA 4O57A 4NXSA 4CQ8A 1EB3A 1FWNA 4LVGA 3MBDA 1YDVA 2DU2A 4BF9A 2EAWA 5HULA 3KAOA 1XI3A 4K8HA 1EIXA 1PHWA 1YDNA 2WKJA 3H53A 5EBUA 3A24A 1OFAA 1K7EA 1YTKA 3PBWA 4UTKA 2YGYA 3P7YA 3STEA 2DZXA 3B06A 2B7NA 1L6WA 3NZ1A 4IMCA 1IXPA 1HL2A 4N9CA 5G4WA 3KHJA 3T78A 4JICA 4M7TA 5I3GA 2B7QA 2ZA3A 3G1SA 2PC4A 1YPIA 1AW1A 1PHQA 2GJNA 3I68A 1R2TA 3P74A 3P84A 1DV7A 1AW5A 1CX9A 2YPIA 3RF9A 1SZFA 1XL9A 2C1HA 3NQ7A 3IGXA 4RXGA 1G4PA 1EWDA 1Z48A 3P5ZA 1KFCA 1OFOA 3TU9A 1SW3A 4NUWA 1OX5A 1M7OA 2VEMA 1UBSA 1XDLA 3B04A 3DZ1A 4K38A 1ICSA 5I3KA 4N9BA 1GG0A 3G8EA 2WQPA 2H3BA 4OU1A 3WFAA 3KXQA 3BW2A 1TTPA 5KSWA 1H50A 1G4EA 3W7MA 1ZFJA 2QEZA 4IPJA 3W7KA 1H5YA 1F76A 2R8WA 1TPDA 3SI9A 3W23A 2GVLA 2WV8A 4MLRA 4WY0A 3BK0A 4UUIA 3M43A 3DGRA 4EF8A 4ZQCA 3UY8A 4JXCA 2QCMA 1J2WA 1VPXA 3NVTA 2YSWA 2X1RA 1C9DA 1M6JA 5FEPA 4CNNA 4O11A 1K7XA 4WX2A 1BKSA 1GVOA 4JYFA 4RR4A 5IBXA 3QPZA 4Z1CA 3CWOX 3LRKA 3M5XA 5AYXA 1LYXA 5HWJA 5EYWA 5CPNA 2VFFA 3G1YA 2FPVA 4TMBA 3SGUA 1V5XA 4AVFA 1KFBA 3T44A 5AHIA 3ZR4A 5D38A 3QYQA 4N9DA 1FCUA 2A4AA 3QRHA 2WOQA 3FOKA 3F03K 3BPWA 4EIVA 4AF0A 2C0AA 3EXTA 1F6PA 1X8FA 1ZHAA 3MJYA 2Y7GA 3TNOA 4EF9A 3W73A 1NVMA 1DQXA 1F2JA 1OVDA 4I9AA 4UTTA 1RD5A 1BTMA 1ICQA 3G1HA 1G69A 3LHZA 1W3NA 3EWWA 2UV8G 4UFIA 1JCLA 3L5AA 4JTJA 3CT7A 3HB9A 2VEKA 3KVKA 1IF2A 5CZTA 3UQNA 2FTPA 3E9AA 3RMJA 1UUOA 3IIPA 4BR1A 4WQ6A 2QJHA 2YXGA 3FA5A 1WOBA 3SGZA 5AHMA 2ZA2A 4BWLC 3ELFA 1LROA 1WXJA 2YDAA 4JDBA 4LNYA 1KM4A 4QISA 3UD6A 2A1YA 4C1KA 2JKAA 2VKZG 4AH7A 5DELA 4O53A 2GQAA 1TPFA 3R12A 1HO1A 2HMCA 2WPBA 4RZ5A 2DORA 4LVAA 3TSDA 4AWTA 2ZTKA 3BLEA 3W86A 4IMFA 3PBUA 3P82A 4PL1A 3N9RA 4IMEA 1W5PA 2FQIA 3CEUA 2AAMA 1GVSA 4LU0A 1FCQA 4YL2A 3C52A 2QCHA 1I8JA 1R2SA 3TQVA 3QH2A 3W1QA 1L9WA 4UNLA 4FB7A 3W2KA 1KLZA 2YFNA 2X2GA 5HUOA 1ZAIA 2WNNA 1W54A 3QMTA 4CCDA 2Z0IA 5E1QA 4KFNA 1H7XA 5HUPA 3CHVA 3TROA 1KFEA 2H3DA 2V5BA 3G0XA 4O28A 5BMXA 1O5XA 5LNVA 5DLCA 2DJXA 3FJ6A 3P61A 4NX5A 3HMJG 2I14A 3O06A 1H60A 3FLUA 1F5ZA 2OX1A 2BZNA 4AHPA 4NNBA 3W7HA 3NZRA 1ML1A 3ZS4A 1EWEA 5D09A 3IIZA 1W5OA 1KTBA 4ZMGA 4JX4A 1JVNA 3BVJA 3DHFA 2JBMA 4AWUA 1K3UA 3FFSA 4MIMA 2X1UA 4N6EA 4BK9A 3A5VA 1TB3A 2R91A 1RQHA 2ZFAA 1DL3A 4JTUA 3QSRA 1B9BA 3P60A 3TFCA 3OA3A 1OYCA 3SY5A 4OV9A 1G67A 5DY2A 1LRTA 4OGZA 3ATYA 3W1RA 3GXTA 5TIMA 3MI6A 3N14A 1FCVA 2CU0A 3NQ8A 4IMGA 3W6YA 3LTSA 2NZLA 1LRQA 3UPWA 4BI7A 3BGJA 2ZRZA 1PCWA 3NGJA 5TQLA 3DHDA 4JN6A 2PCQA 3FYOA 1JRCA 3Q2DA 1VYPX 3U8GA 5HR6A 3PG9A 3HF3A 4H3DA 4LS0A 1TRDA 1VZWA 3EEGA 4YXGA 1DJQA 4UFKA 3BO9A 4GUJA 3Q94A 2Y63A 3P80A 4FNUA 3EX1A 4LRTA 4ORIA 4ZQMA 1FWRA 4MYAA 4A2RA 4JTIA 4E2DA 1TMHA 4XBSA 3NM1A 4Y96A 2FDSA 2OT0A 4PL2A 4TIMA 4UTUA 4UMBA 4JDYA 3W7GA 1I2QA 4NZFA 2Y61A 2ZYFA 3PG8A 2E5BA 3W74A 1WA3A 3VFLA 2Y85A 4MFDA 5DCEA 4O14A 3EX2A 3NQAA 2QJGA 5EA9A 1O95A 3NPXA 3M7WA 4IQLA 1GYNA 8TIMA 1ZNNA 1F74A 1VH7A 1RR2A 3IVSA 1IGSA 1WV2A 1JJKA 1GPWA 1TPEA 1TPH1 2C13A 1MEHA 3PUDA
chains in the Genus database with same CATH superfamily
3SECA 4QE4A 4LC8A 4ZTYA 1A3WA 4H4IA 1FY6A 5LGXA 1SQ7A 3TMLA 1UWSA 3AHXA 4X0NA 3QV7A 3W07A 1TJRA 4GGHA 1SJAA 3RX4A 4TUFA 3LENA 3NL3A 2OLSA 2QS8A 3KM8A 1C29A 3TJXA 2VR5A 4FLQA 3S1UA 4GO8A 4KERA 3VIOA 1JCMP 4N2YA 2FJKA 4E0CA 5LIXX 1IE7C 2EG8A 1L6FA 1CW2A 1KV5A 4M6PA 3C0QA 4UTHA 2NUWA 1R47A 3KBJA 2X40A 2NWSA 2XVLA 3WQEA 1FWEC 1H41A 2VCAA 3W7NA 3B9NA 2FHBA 4H9YA 2BGNE 3CJPA 4LRSA 4Q33A 3DFOA 3S2CA 1ZGDA 1WB0A 5HDRA 4FIQA 3T7VA 2PDLA 1KNWA 3WDQA 3LA4A 2XH4A 1GZJA 1GQLA 2I1OA 1EXPA 3VOFA 3EDJA 3KWXA 4HKPA 1Q85A 3KCLA 1QW8A 4MKVA 1RY0A 2Z7KA 3DAQA 3EBVA 1LUCB 2X30A 4OFCA 5A8GA 3G5EA 1H11A 1UMYA 1S5WA 1BF6A 3SADA 3C5QA 4DQWA 4PMJA 5A6KA 2Q01A 5DMNA 3EMCA 3BE7A 5FJJA 2BBFA 4H00A 1VYRA 3B9OA 4QE1A 5GJMA 4HU4A 2YB1A 1JPDX 3POCA 4GHRA 1G4SA 2IS7A 3QSTA 3B03A 4AC7C 1MUCA 3TJIA 4FNSA 3MTWA 4D71A 1XQKA 1P0KA 5ABFA 4XQ6A 4PC8A 1VJSA 1XISA 3DXIA 1UR1A 4UTWA 3INPA 4IWWA 3VO0A 1S2WA 3JZUA 2ZX8A 1Y65A 2E25A 1TX0A 5D9PA 2AQWA 1DEDA 3AIUA 4HK6A 3QLDA 5EMUA 2D3NA 2OSXA 4I9JA 3DENA 1O1HA 3PP7A 2BS9A 3UJFA 1CEOA 3LG3A 4L4MA 3WF1A 2ASHA 5EKYA 2Z28A 3W1AA 1P1MA 3RCMA 2QAFA 1ODZA 1G4TA 2WK2A 4A22A 1T8XA 4XIMA 4TR9A 3ZJ7A 5FSEC 1TVLA 3ITCA 2EPMX 1G0CA 3CZ8A 4O18A 6XIAA 1V93A 2VR2A 1JDCA 6TAAA 3GU2A 3FVMA 2BMBA 5HA7A 4XBKA 5BYWA 2OKTA 3W2JA 3KOZA 2UY4A 1VRDA 1OC7A 3OTRA 4H8UA 4UOQA 3LXAA 1YXCA 3BLKA 3G8RA 1QW9A 4ZR8A 5H8UA 3HG5A 4DXVA 1GVQA 4DLMA 1ME7A 4HZ6A 3JU2A 2G5WA 3P93A 3B0PA 1GQNA 5SWUA 3WLTA 1KA9F 3T8LA 1MXDA 3I7RA 3CIXA 1R87A 1NDWA 1E40A 1H7WA 3E0FA 3KOYA 4FOUA 3CL8A 3TCSA 1LBLA 2CWXA 3QLLA 3GVGA 1W2PA 1OYAA 3PZTA 4XG1A 2PWDA 3W2NA 1H3GA 4L1XA 4Y8FA 3MVIA 5M3WA 4QNEA 1ECQA 4X2PA 4LQ1A 2V8ZA 1W5QA 1ECEA 3WF2A 5M03A 3B0VC 2D2JA 3WLNA 4GJJA 5D02A 2PC8A 1BYAA 1Q8JA 3B0UX 3KRUA 1QPNA 5LNWA 1AVAA 4OJYA 2CLKA 4ERIA 2I56A 3WG6A 3S2MA 2B0MA 2W92A 5EB8A 3RO6A 4PRRA 1H0IA 1PZ1A 4J3WA 2XWEA 1UWRA 2EG6A 3ABOA 2VFHA 3FYYA 4PRWA 5I3HA 2GFTA 1W0MA 2W3ZA 2BNJA 4QJ1A 3HG2A 1E0XA 3CWHA 3KVLA 3H4XA 4Q6XA 4HA3A 3UZZA 1BWLA 3NG3A 3VMOA 2GGEA 3GZAA 2XH0A 4KFOA 4ZCWA 1HKMA 4LCRA 1N55A 3MZ2A 5C55A 2GOUA 2B7OA 4YMZA 3ITVA 1Y8BA 1V6TA 3TW6A 1ESWA 3CHFA 4PMOA 4GUGA 1NP2A 4XKMA 4B5SA 1UOKA 3N19B 2FH8A 1UIOA 1ZCOA 3AALA 2OQHA 5IOBA 1ISWA 4NT0A 5DBTA 2AMXA 4QX4A 3HJEA 2V63A 4BFAA 3MBFA 3W72A 4AXKA 3TVAA 3XISA 2WWCA 2Y8KA 2YR1A 1WBJA 2WQDA 4LEQA 2RDUA 3M4HA 2X8RA 4F0HA 1D3HA 3LM7A 1GOXA 4WF7A 4JIRA 2XIIA 4HPXA 1HXJA 3H2MA 5A6TC 1S5NA 4EACA 1GVIA 2PURA 2XYLA 1R9XA 3W0KA 3G6MA 4TU1A 4MKNA 2EJAA 2R1PA 1P4CA 1BGAA 3WQVA 3R2GA 4DO6A 1V02E 4O0KA 2XN0A 4H7ZA 3W7LA 3PUEA 3SBFA 1PIIA 3RIKA 2D24A 2OEKA 3DG3A 3AU6A 3O05A 4QIUA 3WH6A 3M0ZA 2YW3A 4C1NA 1SW7A 3RILA 1SFLA 4IIBA 4HCDA 2OZTA 4MDPA 1P1XA 2QVHA 3H6OA 2NX9A 3SDOA 3NSMA 1OIMA 3CNYA 3SRDA 4UTMA 4C90A 2HPMA 1U1UA 3ARVA 4AHOA 3SUTA 3QQ0A 5GPRA 2EQDA 3MMDA 3W02A 3PZQA 2VYOA 1UA3A 4LVFA 4Q8TA 2FZ8A 4H9MA 2UY2A 2RJGA 5LXEA 4GRSA 3W01A 4V1YA 1NFBA 2FPYA 1Q6EA 5CZ0A 1VBHA 3R79A 2DZAA 3T42A 1IZJA 3FA3A 1PJ9A 3NEVA 4BEUA 1W2VA 4P2VA 1SYTA 3POHA 1XYCA 5DT7A 4ZSUA 3QJAA 4DJDC 1NF0A 4M56A 1W9BM 3ITTA 4F8XA 1Q7QA 1EO5A 3NDZA 1SO4A 4WRHA 1CIUA 4GXMA 2WNQA 4PODA 3C8FA 2BP1A 3COTA 3HPAA 2QPXA 3T2QA 3U4AA 3UY7A 3T0AA 1DIEA 2ZZ6A 1W3KA 5KEZA 4R27A 2YBTA 2MANA 4A3UA 1XUUA 3F4CA 4Y2WA 1P0EA 1DWGM 1UUQA 3IJ6A 4UR9A 4U3AA 2E6YA 3PJTA 2HRWA 5GNZA 4ZO9A 2ZZ4A 3U2ZA 4DEFA 4LV4A 4ZBCA 2CLPA 1V8EA 3PBVA 3WENA 1ZJIA 2QULA 4UMAA 4W5ZA 1M53A 1NARA 4N7QA 5IHRA 3VD9A 2CHOA 5HOSA 3SB0A 5KTLA 3NQFA 3PZ9A 2YXXA 4LPCA 5DCBA 1B31A 3EWBX 1JZ3A 1E1EA 4NZ1A 3QF0A 3STPA 1NY1A 3KFTA 1V0NA 5FF0A 5FF2A 4PTXA 3KE0A 3WNKA 1TV3A 1DIDA 5BWAA 3DX5A 2P88A 3KP0A 2JF7A 4HJWA 4CU8A 3R58A 3MPGA 4A3YA 4B5VA 2DW7A 1EHNA 3RLVA 4AXNA 3RPTA 4POCA 1L8PA 4IH3A 1G5AA 3AIQA 1EJWC 1ZCCA 3TNBA 2H9AB 2EPLX 3F4WA 2I5GA 2J6VA 1FDZA 3BSHA 1VS1A 3TJ4A 3WN6A 3G3MA 4I9MA 3LN3A 3AS3A 1PTAA 2VURA 4O0ZA 3LS9A 1J0YA 3NQMA 6XIMA 3E0LA 1XIJA 2G37A 2D2HA 5FF4A 2GDUA 3WDHA 3C2VA 3QZEA 3SJ3A 1W9VA 1EGVA 2GSJA 4DAFA 2DSKA 2Q6ZA 5CSSA 4CN4A 3F7JA 4XKYA 4HSOA 5DFAA 2I5QA 4HYWA 2P10A 2Z1SA 4IXXA 3HQ1A 4ACYA 4S3KA 5CC6A 2FVKA 3E12A 4JY8A 4H41A 3KTSA 4C60A 4KWSA 2PTDA 3W6MA 3GC5A 4JZ5A 4RZ6A 3HGJA 4XD4A 3LGDA 1JPKA 1YYAA 2KAUC 7REQB 3UPBA 1UBPC 4NRSA 3GTXA 4JTLA 3NQ6A 3T8QA 4JTHA 3GAKA 2XIQA 1BVWA 3SIMA 3VC5A 1RY8A 3EWXA 3G1XA 3WH9A 3UJSA 3WLIA 1V6WA 4IOTA 1POJA 3E96A 4W7WA 4UFLA 4F0RA 2DQXA 1XYAA 2YOCA 1C92A 2C16A 1UHVA 4L4PA 5HK4A 2R9RA 3N3MA 5HATA 1FX6A 2G3FA 3W85A 3QN3A 2YDSA 3HFTA 2D0GA 3SCTA 3I65A 3VE7A 1TTQA 4CCEA 3O0FA 4GH1A 3GYEA 3W1NA 3SGGA 4AW7A 4DRSA 4AMAA 4AX7A 1GWJA 2NQHA 3PAJA 3UZWA 3KEHA 3W4RA 1XLBA 5LIYX 1H7OA 1TJPA 2OEJA 2NVDA 4GY1A 2D2GA 1WZAA 5EL1A 1R3RA 1QOXA 1KFLA 3VX1A 4EPBC 4H2HA 3ARPA 4K8GA 2WC3A 1TTJA 2DZWA 4REQB 2BOEX 1QAPA 1GVYA 4GZIA 3NM3A 1LL6A 1TJ2A 4GUHA 1OY0A 2CBJA 3RXZA 4LW7A 1FOBA 5AYBA 1GHRA 3VGDA 4YTQA 4NNCA 9CGTA 3PULA 1XKJA 4FA3A 1E9LA 1X7IA 4B5XA 3TK7A 3EA3A 4G7EA 2RDTA 3ZT7A 1SW0A 3TOYA 4Z1DA 4UXDA 1QASA 1PE1A 5CPTA 5AHEA 1TKKA 5A6LA 5FL0A 3PR2A 4F79A 3WCZA 1KBIA 4TOQA 3DYOA 2PGWA 2BTMA 3C2OA 4NJKA 4XWUA 4U5IA 4YHEA 4TX6A 3LCWA 1XYMA 1XYLA 4NQ1A 1JL8A 3AUOA 5KZ6A 2QPUA 4JTKA 3NTYA 2CETA 4FXFA 4US6A 1YTDA 3PAOA 1Y0EA 2YL6A 1MEWA 5C7VA 3RAOA 1EOMA 1XBYA 3GNPA 3A5FA 4KIEA 3DFSA 4KPLA 3QFWA 1K8ZA 3O16A 5BOOA 2HVNA 3WF4A 2WJFA 5G1MA 4H9VA 1RK5A 3LOTA 4S3GA 3MHGA 1K9DA 1SZGA 2WAGA 4HNVA 4KFPA 3TLQA 3EXSA 3M0YA 2V5LA 3GXNA 4CD7A 4MADA 3TAKA 3GLCA 1S3HA 4G7FA 4FLSA 2XJ7A 4OIFA 2WNZA 4ZQRA 4JD4A 4V27A 4QG8A 4XZHA 4MF4A 3W7EA 1BEUA 1OFDA 4NU7A 3WFZA 1JYNA 5FEXA 1R5YA 2ZRWA 1FDYA 2ZUNA 3TTQA 1R3SA 5JXQA 3R0DA 1V02A 4J3ZA 5H1WA 4UTFA 1KBJA 3U3HA 1US2A 1K4GA 4HNOA 2L5HA 1VQTA 1XIGA 2DEPA 2A6LA 3V1PA 3BANA 1Z69A 2RGLA 3FW6A 1I75A 2OT1A 3AFBA 4I6KA 3GDMA 2BY3A 2D73A 3KZPA 4LC6A 1AG1O 4K8EA 5D32A 1FQ0A 3AISA 3QTPA 2OVLA 1UWQA 1B4KA 2OQYA 3UJRA 4NL1A 2OSYA 3NOYA 3NYDA 2DT0A 2YCIX 3VOJA 1AK5A 1FH9A 1ITCA 4YPJA 2HE8A 2DZUA 3WJWA 1WUFA 3CQKA 1S2UA 1M7PA 2J78A 4Y9NA 2X0YA 4JIEA 3NA8A 4C6BA 4DF1A 4E4PA 5BWFA 3EWCA 3BG3A 1EDQA 4D6DA 3L0GA 4ICNA 2J7FA 1GQIA 3ANUA 1M7JA 3HGRA 1TO3A 1Z8AA 2CWNA 4IG2B 4PMUA 1XH1A 3THAA 4XSMA 2YA0A 2PB1A 1JDFA 2F8QA 3IRDA 1CECA 2GJXB 1YRRA 2EPOA 4ZB0A 4LV9A 5A6BD 3NIYA 1Q6RA 2HE5A 3GDKA 5HMFA 1W37A 1OSEA 3VILA 1PX3A 4IFKA 3MU7A 4QCEA 1OF6A 4UNKA 3FHQA 4F0SA 2CEQA 3QQ1A 1RBOB 1GT8A 4AD1A 4AIUA 5I77A 2VFGA 5I02A 4D1IA 1VFOA 3NOEA 4RNIA 1HX0A 1G7UA 2BX7A 2O9PA 1V3KA 4W9TA 4WGXA 5G2IA 5DMYA 2FVMA 4BJHA 1YLVA 1R30A 2QUTA 1HKWA 5I78A 1ZP4A 5HMEA 3GTIA 4MWAC 4EE9A 2E1DA 5CPLA 1IIGA 3FHAA 3W26A 3M0HA 1PCKA 3MP3A 1Z89A 3HG3A 1XH2A 2AKMA 2NV1A 2CERA 3S2NA 2ZZ2A 3VDHA 3MCNA 1F3TA 2DUAA 4I9TA 3NSXA 3GKFA 3SZ8A 2ANUA 3DN5A 3ABSA 1TUFA 7ODCA 4TX9A 4KRTA 4JX6A 4CNPA 2JEQA 1F6KA 4CCCA 1E0TA 2PSNA 4PZVA 2OELA 3BLDA 4GLEA 3MHFA 4GQRA 4YTTA 1FBAA 2NVCA 3WBAA 4NZJA 4M1RA 1QPRA 2C79A 1Q45A 5E70A 3W22A 3GQYA 3AJ7A 4JIHA 4NZ4A 2NW0A 3W2MA 5BNKA 1NWTA 1FWTA 3OBAA 3Q65A 3F4DA 1DJGA 4LCSA 2ALDA 5J8LA 3XIMA 2Z29A 3I6RA 3AXXA 5C54A 4DELA 5TD4A 3PZOA 3DKJA 1DTUA 3RX3A 3SCRA 4KQNA 3K5XA 1ZQ5A 2NX3A 4QAIA 4H9ZA 3ONBA 1DJHA 3ALGA 3BW4A 1M65A 4XZMX 1TR1A 2E9MA 4IQEA 4DUXA 4HNTA 4Q32A 3ITGA 4G6CA 3KZSA 3UA3A 3RCNA 1OCBA 3M0MA 1AH0A 2I9UA 1KXVA 2W66A 1WDWA 3WK2A 2R1LA 3WQ4A 3OG2A 2CZFA 4AWSA 2GVGA 3W84A 4E3TA 1O60A 3CWNA 3L0KA 3VMPA 1VFMA 3UWZA 2PRHA 3B9AA 4JKKA 3KRBA 3PPCA 1K02A 1OEPA 1WDDA 1HL8A 4X9YA 4PTVA 4K1GA 4LXFA 2PU0A 5AC6A 1GOWA 5M5DA 4HPGA 5I23A 3WQCA 1TCMA 2TAAA 3H2FA 5I0DA 1XLEA 3VD3A 1VBUA 4ACZA 2QCEA 3WQWA 5C0QA 1T96A 1IIHA 1KM5A 3GC4A 3LSBA 4LAOA 3W88A 4FXJA 3LLDA 4UIOA 1D8CA 1NTHA 3C3UA 3GG1A 1EF2A 4JFUA 3EKGA 4JY9A 2DZSA 2Y70A 1OT1A 5GVJA 4IPLA 1KO0A 1XV8A 3EYPA 3V5CA 2XFWA 1VYSX 5CGQA 3G77A 2E6DA 4PCNA 1RJQA 1TPWA 4MFEA 1B30A 1VPYA 3GNXA 1AL7A 3A64A 1TV5A 2YYUA 1W6TA 1UZ4A 3PUOA 4WDXA 3WQOA 3MHUA 3MUZ1 2ZZ7A 5LHFA 1V3LA 3W6LA 3VZZA 3BG9A 4HMDA 3EWDA 2CKRA 4U10A 3RPMA 3CO8A 3UPMA 4JN7A 1I2PA 4PUDA 5L6UA 3QZAA 2VL4A 2GQ8A 4HSHA 4XV0A 3V3WA 3VKBA 4B4FA 1JCJA 4ZA0A 1XPGA 5DANA 2GQ9A 2ATSA 4MY9A 3GAYA 4J9JA 1KFJA 4LUTB 3IJIA 1PBGA 2VX6A 1R86A 1EJTC 1BF2A 4J2PA 1B2YA 1H4PA 3H55A 1LQ2A 4J3SA 1UA7A 3A47A 3ABRA 5JIPA 4RE2A 4M19A 3S42A 3BICA 2C15A 3N2TA 3OYZA 5FACA 3W29A 2P5NA 3QMRA 5F2MA 4FP1A 4DM2A 2YIHA 2R1NA 3FNDA 3P8JA 1LP6A 1QMLA 3L4VA 2YCJA 4GNVA 3BUVA 4UQCA 3CZGA 5D03A 1PTDA 3BAKA 3C2YA 1M7XA 2YW4A 3LHVA 2YCLB 1N2VA 2VRJA 4WSKA 3P81A 1AL8A 3N6JA 4ASTA 1W3JA 1MUWA 3TOPA 1BVNP 1YW1A 1BXNA 4EXAA 2I5IA 5GNYA 5HULA 4AZ6A 3UFYA 2Z7GA 5EBUA 3A24A 1K7EA 3GW3A 4UTKA 4B5WA 1AQ0A 3P7YA 3O3RA 1DPMA 4P7OA 2AL2A 2AQVA 1QBBA 3KHJA 4GQGA 5FL1A 4JICA 4M7TA 5I3GA 2B7QA 4CVWA 1K6WA 3WY1A 1TJ0A 3VUSA 3I68A 4AUBA 5A2BA 2E4TA 3P84A 1DV7A 3VD7A 2PDMA 1NDVA 3A4WA 3RF9A 4WDTA 4GMEA 1XL9A 3OVGA 2C1HA 2VDGA 3E0WA 1EJSC 1G4PA 1Y5WA 4LEFA 1EWDA 4DNMA 3FY1A 2WJEA 1S38A 1SW3A 2GK1A 2VUYA 3BCFA 5B7YA 1DJXA 1M7OA 5I3KA 3NGFA 1LL7A 2H3BA 4DJFC 4OU1A 1VEPA 2J77A 1UD2A 3KXQA 3BL3A 4LH8A 1V0LA 1VEOA 1K4HA 3LUTA 4HGXA 1ZFJA 4IPJA 1H5YA 4ZOEA 1VD6A 5A2CA 4C7GA 3KHDA 4UUIA 1WXZA 1SR0A 4MNJA 3NVTA 2O9RA 4LYQA 1W1YA 1XYFA 1MWOA 1BKSA 4RR4A 5IBXA 5IRPA 4Z1CA 3LRKA 2HZGA 4QSFA 1LYXA 5HWJA 2Z00A 1QNQA 5ABGA 2VFFA 4TMBA 2FPVA 6REQA 3SGUA 1UR0A 1V5XA 3AIBA 3DCPA 4PR4A 3CV6A 1TWWA 3ZR4A 4A3HA 1CDGA 5C2GA 5D38A 4N9DA 2VRQA 2WOQA 3FOKA 3F03K 5ABFB 3G1RA 2C0AA 3EXTA 4AISA 3R11A 2PPGA 1HZYA 3T07A 2QGYA 3TNOA 1B3XA 4L80A 4DJEC 1NVMA 3GHTA 4UZUA 4UTTA 4J3TA 3T4WA 1NIUA 3MSYA 1BRLB 1W3NA 5DX7A 2OZ8A 2UV8G 3NEHA 4AX6A 2IKJA 3L5AA 2ZXAA 3HB9A 2BXYA 1MDLA 2VEKA 1OC5A 5CZTA 1PZ0A 4E8CA 1F3EA 4QG6A 5DF0A 2WMGA 4KCVA 4L9XA 3E9AA 1ISYA 4LYPA 1EGZA 3IIPA 3CL6A 4GABA 2YXGA 4OUEA 5AHMA 5D9MA 4BWLC 2QV5A 1LROA 2ZC1A 3WBXA 2OGJA 3AUJA 3V16A 4LNYA 2A1YA 3UERA 1NWSA 3MCOA 1KCZA 5CBJA 4O53A 2NQ9A 3R12A 1HO1A 2Z1KA 2HMCA 4RZ5A 2DORA 1KGUA 3P82A 3ITLA 1V79A 4J28A 1JZ4A 4HCLA 3RJXA 3VIGA 1CENA 4LU0A 1FCQA 1J6PA 4YL2A 1Q7MA 4CD4A 3BLOA 1R2SA 3QH2A 3FK4A 4DY1A 3S2LA 4KGLA 2YB4A 1KXTA 3E2VA 4UNLA 1VBGA 4KBXA 4B16A 1XLKA 1ADSA 1F07A 3DFHA 3CAKA 5HUPA 4KFNA 3S5SA 2FKPA 2REQB 1SGJA 1O5XA 4ZENA 4NX5A 4Q7NA 3W00A 1VAHA 2I14A 4MSSA 4J3UA 2YDRA 1PIGA 3FLUA 3SM0A 3UW6A 3BJTA 4DNHA 1F5ZA 3P3BA 4NNBA 1EWEA 3BMXA 1UPPA 2GZXA 1LT8A 1QNOA 3PWGA 5BRQA 1UWTA 2QPSA 4LB3A 3GU9A 2PMQA 3FN9A 4JX4A 1JVNA 4PTMA 1K3UA 3CMFA 3V36A 4N6EA 3A5VA 2R91A 1DL3A 4M51A 3GFZA 1NQ6A 1B9BA 4U2ZA 1XP3A 4L1WA 1Q5MA 4CN1A 1U33A 1XD1A 3OA3A 1OYCA 1D8WA 2DGAA 2Y8VA 1HKKA 4F0LA 2GGJA 5DY2A 1C8XA 4OGZA 4Z2GA 4XAPA 3GXTA 4LYKA 4P8WA 3UESA 2CU0A 1XYBA 4W89A 3W6YA 2NZLA 1LRQA 4K68A 5CSUA 1UKQA 4WEVX 1IEWA 1EC8A 4DZIA 1AJ2A 1SFSA 3FXGA 4NZ5A 1UZDA 2Z27A 4R5EA 1TRDA 3IUDA 4PMXA 2VGBA 1DJQA 3PUGA 4UFKA 3NZGA 1KXHA 4QEHA 2WWDA 3E2SA 3U5YA 4IIHA 1QBAA 4MYAA 1FWRA 4JTIA 2C71A 1TMHA 1HJWA 2DH3A 1J5SA 4FF5A 4UTUA 1BQGA 3LY0A 1I2QA 2Y61A 2ZYFA 1J79A 2D20A 3W74A 3G6LA 1EGMA 3ES8A 4O14A 2DIJA 4UNIA 2QJGA 4K1WA 1AA1B 4H8HA 2FH6A 2HISA 3KBWA 3S9ZA 4JQ4A 2PI6A 1FP9A 4ATWA 3AXKA 4NI8A 4L6OA 4FS9A 4RDYA 5ECUA 4LB4A 1OGGA 3V7PA 2FDMA 2QUMA 4Q3MA 3UVIA 1KBLA 1VFFA 1TPEA 1TPH1 2DH2A 2C13A 2ISDA 1Z42A 3DHPA 2A3AA 2GOKA 1B4EA 5K9CA 1W1PA 2D22A 3KRSA 3KBNA 5C70A 3P5YA 4BQ2A 3A22A 1JAKA 4AIEA 2ICSA 3IGUA 5JBFA 3VM5A 3KCJA 1KRBC 1UKPA 3V75A 1ZAHA 1TFVA 3AIWA 3B0XA 1RV8A 4C1NB 1KWKA 1AODA 3HURA 4PMDA 2VEIA 2FMOA 3WH7A 3TXVA 5T91A 3G22A 3W38A 3SQSA 4QLJA 1DJIA 5CZJA 1DOSA 4F9JA 2BVTA 4LFYA 1CCWB 1A5OC 3GHRA 1H09A 3UWVA 1T41A 2YFOA 3BW3A 3EDDA 1XLJA 1H2JA 3PNZA 4FLRA 4H2CA 5E6ZA 4HOWA 4X0VA 2VGGA 4M6QA 3WLLA 5EMYA 2XGZA 1FRBA 1XLLA 3TQPA 2PBGA 2ZUVA 2E6AA 2Z2AA 3ZIZA 2WANA 3OEXA 2IPFA 1LT7A 3MO4A 5C2CA 1C7TA 1FCBA 3KL0A 3S5OA 3WJZA 5BMWA 1W1ZA 3K8KA 5G4HC 3L65A 3WK1A 5HNRA 4J40A 2CLOA 2PD5A 3KL5A 1U1HA 1UASA 1JYXA 2POTA 3VCCA 2ZDRA 2HWGA 1GVRA 4ZGYA 4O50A 5FJIA 5LA1A 3NDOA 2GYIA 5MKGA 3G1DA 2QCGA 1Q3NA 1A47A 4RZ4A 2F38A 3LPOA 3AOFA 1AH3A 4PH6A 1B90A 1OHLA 3LLFA 3IRSA 5CBIA 3QVQA 3U4FA 5C9XA 1VEMA 1EH9A 1RZMA 3EA2A 3RFAA 2BY0A 1XICA 2AOSA 1KCXA 4B9ZA 1QK2A 4MM1A 3B4UA 4FNPA 1V0KA 1D3CA 1WKFA 1JPMA 1PSCA 9XIAA 1S2CA 5A8MA 1DVJA 1RP9A 2P53A 1M5WA 1CPUA 4FNTA 1EA0A 1QXLA 4AAJA 4IJCA 5C9UA 2NT0A 3GY1A 3UP8A 1ISVA 3PS7A 3M16A 3WLRA 7CGTA 3CQIA 2W61A 4HQVA 3H4WA 3DDMA 1EOKA 3R25A 4DN1A 3GVWA 1UC5A 4KRUA 2PWEA 4RXFA 2HPIA 1OINA 2Y0FA 3K1DA 1GGOA 2I7GA 1FWFC 3I10A 1S3TC 4RV8A 1KBBA 3WMSA 5I2UA 2VDIA 1D7FA 1VBJA 3RUBL 4WHBA 1HG3A 1HL9A 5F4WA 3VKAA 1PO9A 1VLWA 3C2RA 1WKDA 1DHPA 1HFBA 3W76A 3S9IA 4KWWA 5FJUA 2V0TA 3VC6A 5AYYA 4ZO6A 1AUSL 4XZLX 4J1OA 5AKQA 1SZEA 2V9DA 3C0LA 1FWHC 4XKYB 1XIIA 1CGWA 2J7CA 1FXPA 4PFMA 4GACA 4Y9PA 2PDGA 1AQHA 3MI2A 4B2DD 1XBZA 4MUZA 2RAGA 4FPSA 2R14A 1O5QA 2YLAA 3WD1A 3N1AA 2OPJA 1OX6A 3TMQA 3O2LA 4C6PA 3GBDA 2FGLA 2X1IA 3ARZA 1EP1A 3KOWA 3TSBA 5CJMA 1UQYA 5K4XA 3NQGA 4WXZA 4HD5A 3WEZA 5C6MA 4QQUA 4AY7A 3BAJA 3FA4A 1CGTA 3N2MA 3I7QA 7TIMA 4DAIA 2PCEA 3RNDA 4QSHA 1W8SA 1MZHA 3LXCA 1Q65A 1KM3A 5XINA 2XZ9A 3GFYA 4V1XA 2WVTA 3RLUA 4RX0A 4Q4PA 1EC9A 3ZO9A 4LVBA 2PGEA 5E6YA 1IT8A 3UR2A 5EY5A 3PB0A 5A2AA 1XBVA 5I3JA 4IICA 1OBAA 2OFJA 5CAKA 3L5LA 1CB7B 2ACUA 3ME3A 1OF8A 3LCFA 4KEMA 1R8LA 4HPJA 3AMDA 2J75A 4Q4OA 4N02A 2YJQA 3DI0A 1H62A 2V67A 4FO4A 3WELA 5ABTA 3LZ3A 3AMLA 2Y89A 4ADUA 2WZHA 3AMKA 3UXAA 4MB5A 1KBKA 2W63A 3S83A 1EDTA 2XDFA 4JTRA 2AQOA 4BQ4A 3SSJA 3P8IA 4PMVA 2QIWA 2V2HA 4JQ3A 3PBYA 2CBIA 1E70M 5F2GA 1GTEA 2EBNA 3L68A 4G7EB 3SCWA 1NF7A 1QCWA 3U0HA 3UYCA 2RFGA 4J4KA 1E4IA 4PBFA 1UCWA 1VR6A 5HWNA 3VOIA 3W7RA 4HBKA 4DBSA 3GE7A 1C8YA 1T7LA 2XFRA 1M1BA 3Q45A 3UZYA 4GUIA 1L6GA 4W7VA 3HFYA 3N2BA 1SM9A 5C5YA 1I2OA 2ZBTA 2QAPA 3HZ3A 2WXDM 1J0IA 1SO3A 5IFTA 3GG8A 3UF9A 4LF2A 4KCTA 3LCLA 3ORWA 2WBKA 4IUOA 2TPSA 3ITOA 1QHOA 3EMQA 3TN3A 3ARWA 3GR8A 2VQTA 2XSAA 5DMMA 4FZIA 1UR3M 2W4XA 3AYTA 5EBAA 5D2XA 2ZADA 3AHZA 3I4KA 3WQ6A 1BYBA 3A23A 5DCDA 5BRPA 4UOZA 4DF2A 1J0KA 4IQJA 3QZ6A 1T6MA 1IHIA 1FKXA 1B57A 3R0UA 2WM0A 4N4PA 3SN4A 1VLIA 1T0OA 3NO1A 4M7SA 4OZOA 4DBDA 1AW2A 2VTFA 3KBSA 3S1XA 4OTKA 4W4QA 2G41A 4PMNA 2BHUA 2VEPA 1H0GA 3VYLA 2ZXBA 3ABXA 4GIAA 4UFHA 4DUVA 4WUIA 3RG6A 2YCEA 3NNTA 3AHTA 4HA0A 2O56A 3E3HA 3QY7A 5HQLA 2CCRA 4B9YA 5D37A 1ZBVA 3CH0A 2CLHA 3SEPA 4ZO7A 1A5CA 2NSXA 4H04A 1ONEA 3ZJ6A 3MCMA 4ZL1A 1Z44A 3VDBA 4PB5A 2FYMA 2NLIA 3H54A 3O6YX 4AWEA 1QOPA 4I3GA 5DT5A 4AYGA 3A6OA 1UP2A 4IISA 5LIKX 4JNMA 1Q6QA 4KWUA 3CYJA 6CGTA 1I2NA 1R3QA 1M9HA 5CZSA 1GUVA 2A7NA 4URIA 1ITXA 2Z1WA 5JUVA 2E1WA 3WLPA 3TIMA 3GDRA 3N4FA 1U83A 4WLCA 2GUUA 4RNJA 1CYGA 2KZHA 2A85A 4NNAA 2W27A 4J7RA 1JD9A 3BOXA 1LQ0A 1MZRA 1AQFA 1VJZA 3VKCA 1WXYA 1UOZA 3DOPA 4QCFA 4G1NA 4JNYA 2VZOA 1WKEA 5A6MA 3EPOA 5FAGA 4K6AA 4IFKB 4S39A 1YE6A 1UH4A 4H8NA 3BGGA 3MV11 3CV1A 1JI2A 4HMNA 4PUWA 2VUNA 3GDLA 3KDOA 4FLOA 1IV8A 1I0DA 5HNNA 4YVPA 1AZ2A 4A8IA 3K4DA 2P76A 3W7JA 3DU0A 4CEXC 4GI9A 5CC7A 1E6ZA 3M6DA 3CZLA 1RD6A 1CXFA 3ZT5A 1HP5A 3B05A 5LIUX 3E5PA 3NJ3A 1KCKA 1EIBA 3ICJA 2OJPA 1QI2A 3AI0A 1VP5A 3R13A 4C6MA 4CQBA 4Z1YA 3K46A 3PY2A 3LGEA 2YA2A 3L2MA 3AHVA 4HSNA 5EFDA 2CHRA 3AO0A 4PEKA 1XKYA 2YZ5A 5KZEA 5DRIA 3T2PA 4GIRA 4ZB5A 5KZMA 2QDEA 5AFDA 5EPDA 3LI0A 1S1PA 1JULA 3T81A 4OBRA 3ARTA 2INEA 1RK6A 1X1OA 3EDEA 1NJJA 1MXSA 1PWMA 4L7ZA 3B8TA 4LOCA 4PN2A 3SN1A 3NO5A 3WQFA 3STGA 4IJBA 1W9UA 3I4EA 1Z7AA 3T0CA 3OHMB 3TFXA 4NP7A 3R89A 2Z2BA 1ME9A 3BAXA 1F61A 2PDYA 5IXEA 3HV9A 1W9XA 4UFMA 4DO5A 3GIPA 4KMQA 2DZVA 3WDRA 4JOMA 4A6GA 1RPXA 3B0YA 1XLCA 5E9AA 1P5BA 2C18A 3IGHX 4CNSA 4LWWA 3GXPA 2PDPA 4BZYA 2J6XA 2FHCA 4M24A 3MI3A 3W7QA 4D1JA 5K4ZA 1KQYA 4OECA 3AMGA 3BTNA 4M5PA 3W1UA 5D2WA 2Z6JA 2UBPC 2NQ5A 2E0PA 3GR7A 5ABHA 1PKNA 3M9YA 1PDYA 5BRBA 4ERAA 1DXEA 2QJIA 5HR7A 2ZE3A 4IIEA 4NX0A 2D2OA 1XLDA 2VX7A 3KRZA 1Q4WA 2NLYA 2QUUA 4QLKA 1V7AA 4XZBA 1W17A 1D9EA 2P50A 4ZQPA 1MUMA 1ZU8A 4IFRA 1EC7A 4EP8C 5I24A 1BSIA 2ISVA 5HPOA 1SUXA 3LX9A 4QRNA 4XZ9A 2E8ZA 2NUXA 2YA1A 3KBMA 3STCA 3UG4A 2ZZ5A 4QP0A 1IR2A 4IIFA 3ID7A 1OZMA 5DRCA 3SJNA 4B15A 1XDJA 1US3A 2ATMA 3G1VA 1A0DA 4YTRA 4ACZB 2Y62A 3RLHA 1RCQA 4AIBA 2V69A 4J2MA 5A6SA 1WBHA 5BXSA 1W31A 1PX4A 3AIVA 2OYKA 1FTXA 4D6FA 5E0FA 1FHUA 2VRKA 4EK7A 4GH3A 4Y9MA 4KCUA 4Q8WA 4IX2A 4LT9A 2FB2A 3CZKA 4N6FA 3LBMA 1LF1A 3LRMA 3GBEA 2F2HA 5DY3A 3CUFA 4YWSA 3TEVA 3LTPA 1UD5A 4NAFA 2ZDSA 4I8YA 4MHBA 2IKHA 1GTHA 3WUBA 1FDJA 2ZWYA 4RKAA 4EAYA 2QV4A 4LAMA 4UCFA 1IWBA 2A3LA 4PA8A 4DBEA 3ZMRA 3WLOA 4H6EA 5D9OA 5FF3A 3URNA 3WEOA 3CTTA 3EOOA 2OMAA 3CAQA 1J12A 2IXUA 5HINA 1LBMA 5FF7A 4GBDA 3TYBA 5KZDA 2J62A 3ZOAA 2DZTA 4UR8A 5HNUA 5IM51 2E40A 2WKLA 8CGTA 4YWIA 5E0CA 2Y6ZA 2P1FA 3FYPA 3SRKA 2WCAA 4JCLA 4XTDA 2KX9A 3GNDA 4IP5A 3PB2A 1XLHA 1IT0A 1KRAC 1R7AA 4DJED 1SMAA 2PA6A 4GUFA 1MW2A 3U7BA 5EMLA 1K9FA 3A4JA 4PCPA 4K37A 2VZSA 4NASA 2P0OA 2PDUA 4WVXA 4HNCA 5A1AA 2PDCA 2HROA 3ZXWA 3WQ5A 3BMVA 2J66A 3UG5A 1DQUA 1DXFA 2OKOA 2BHYA 3CLMA 4TX8A 4AB4A 3RITA 3U2OA 3UXKA 3GH7A 1QNPA 2F61A 1XUZA 3SUSA 4CNUA 1HN1A 3LGGA 3LNPA 4AU0A 5LSMA 3W9ZA 4F48A 3L7RA 4NKCA 3GFXA 2ZTJA 3THCA 1H5VA 1V3HA 5HXMA 3DBNA 1B3OA 4I5RA 4HK5A 1ZBKA 3RR4A 3VNJA 1ZENA 2AL2B 3ISIX 3W37A 3PTDA 1NOFA 3HQPA 3NL5A 5EU9A 3ZWSA 1CWYA 4UMCA 4PUKA 1KCLA 1E9IA 4RDVA 4QLLA 4YIWA 2ODOA 2OEMA 4KGJA 4Z2LA 4G56A 1GEQA 3EDKA 3TAOA 2GK1B 2JK2A 1UH3A 2XVPA 1EBGA 3WQPA 4FEZA 2G97A 3ZT6A 3PTQA 1H1YA 5LZLA 1ZZMA 3O8AA 3MO7A 2YL5A 3MMTA 4YCPA 2Q09A 4FK9A 3NQCA 1MDRA 4N9EA 2XIBA 1V6VA 4Z1AA 5BU9A 5F4XA 3QKZA 4CVUA 3UZJA 3VGFA 1TJ1A 4Z08A 1CZ1A 3LQGA 1G01A 1E51A 4ZOCA 1OYBA 4NILA 1GNXA 3JVAA 3DI1A 5FI8A 4NJGA 2Y7FA 2Z2UA 3WD0A 4H9UA 4YYCA 1Z41A 4A8RA 3EPMA 1E55A 4CNOA 1X7FA 3F4NA 4BS0A 4Q8PA 5IDZA 3EZ4A 1LDCA 4JQ2A 1XXXA 1OX4B 4HIBA 4PUEA 3N73A 2Z26A 4UQ9A 4KESA 3LXBA 2PDWA 2V30A 3NURA 1VCFA 2WO5A 1J11A 4QJ5B 5G1YA 3UGRA 3N29A 2FIQA 1ADOA 1JZ6A 2P8BA 3S47A 1HJSA 1JQVA 1PYFA 4DWSB 1BGGA 3VE9A 4NAEA 3RPDA 1Q6DA 1ALDA 1OGSA 1ZJHA 2VC9A 4W93A 5G2WA 4RE0A 1NWUA 2OX4A 2FVLA 1LM1A 2GUBA 1S46A 3VVGA 2DY3A 2VVNA 1A3HA 1EZ2A 1K7FA 1KM1A 3AROA 3GZ3A 3RGTA 3Q37A 2A5HA 3L23A 3UXIA 1CGXA 3KUMA 3F5JA 2HBXA 3VINA 3VOHA 2VEFA 3BAIA 3DIPA 2WSYA 2DZPA 1R3WA 4PTDA 4NJIA 1L6YA 2Q02A 3G1FA 3RK8A 5CAHA 2BVWA 3RDKA 1W91A 2OWWA 3IIOA 2FFCA 2PAJA 4A4AA 2QUVA 4XO6A 4GC3A 4WJEA 3W7CA 3F5KA 1SU5A 1E5NA 1KGXA 1A5UA 1Q6CA 5HJLA 1ZSXA 2E68A 2DZBA 2A6NA 3U6WA 2ABAA 4I7VA 3NXFA 5BZAA 3BLFA 3TC7A 1VENA 1OQFA 2IW0A 4DJDA 1RQBA 3C6CA 3OZPA 3KX6A 1OWQA 5I3DA 4GQ0A 2VI0A 3IIXA 3VPLA 3PZUA 5K7JA 3QV8A 2BG5A 3PWAA 3TTYA 1GG1A 3P0WA 2WSKA 1XRSA 1UD3A 3UEQA 4Y90A 4EKJA 4XZWA 5LKYA 4MZYA 3THQA 3IANA 3C3NA 1HJQA 3BLPX 4JTFA 4NYYA 3OHIA 3ZJ8A 1XLIA 1O6IA 3IPWA 1QVBA 4MWAE 1M68A 4S3DA 4B5TA 1OFQA 3GG0A 2TRSA 3RU6A 1WPCA 1G94A 1QR7A 3QY8A 4RPPA 2DVXA 5F2IA 4PCFA 2P3EA 1EJRC 1XG4A 5CXPA 1HIZA 5I79A 1BQCA 2NXHA 3QW4B 4YN5A 2HCVA 1LTDA 2B7PA 4LANA 1Y7VA 4MZ8A 5D33A 3N9SA 1JRBA 1KKRA 2YX0A 1EUNA 2EKGA 5F4SA 1TTIA 2QIIA 1CXKA 2FTYA 3TTEA 1EDGA 3CYVA 4AD4A 4O17A 4IIDA 3RMEA 1VFLA 1T40A 1BTCA 3LD5A 3L67A 2WC4A 3VGEA 1FWGC 2NUYA 3OO2A 5LXXA 2H8XA 3LHYA 1H7NA 3GNNA 2VENA 3B8IA 4Z0SA 4MGGA 4LAUA 1L0PA 2VVSA 3CTLA 4GYPC 1ME8A 4FNQA 3L4UA 2A0NA 1Q2SA 5A95A 5T8GA 3WD3A 1L6SA 1TZZA 3QGKC 2QKFA 4JTQA 3W83A 3OGVA 3WNLA 1RBLA 3KVMA 6ALDA 3KVJA 4DI8A 2D69A 5CLTA 3DUGA 2PS2A 3RR1A 4S2CA 4AY8A 1P7TA 3HO8A 1LWHA 2V5DA 4GG9A 2WNWA 4IL0A 3OBKA 1FH7A 4O57A 3WSUA 4CQ8A 1EB3A 1XLGA 2CC0A 3MBDA 2DU2A 2EAWA 1PZ3A 1SVDA 4K8HA 3FGCB 4FR6A 4DVOA 2ZC8A 4D8LA 4DWSC 1YDNA 3H53A 3PBWA 1OFAA 3I6TA 3QOKA 1EYWA 2YGYA 2DZXA 3W24A 3B06A 1L6WA 3A9BA 1HL2A 4N9CA 2BXZA 4RW5A 2X0HA 5G4WA 2DSUA 3VNLA 1PHQA 1R2TA 3DYMA 3UR5A 1CX9A 1U30A 2YPIA 1SZFA 3NQ7A 4HPNA 7PTDA 3IGXA 1Z48A 5BXTA 3P5ZA 1M04A 3PZNA 2WVSA 2VEMA 4K38A 3DZ1A 1W32A 1HKJA 3B8SA 2WMKA 1EJXC 1UP0A 2CESA 4YNGA 3WFAA 3EDFA 3MSRA 5I5RA 3NSNA 3W7MA 4PB4A 3W7KA 1F76A 1QNRA 3A13A 5EGRA 2WV8A 4WY0A 1K9EA 2YCKX 3DGRA 2VMFA 4EF8A 1ZLPA 1A5LC 4GZ7A 4IGNA 1X96A 3C86A 2YSWA 1K8CA 2OB3A 1M6JA 2A3HA 4GVFA 1GVOA 4JYFA 3QPZA 3CWOX 3M5XA 4ZOBA 4LBSA 4O1EA 5JVLA 5CCZA 2IMRA 1MQPA 1K9TA 3ABZA 3T44A 4A8LA 2XH2A 3WMCA 1RH9A 3QHMA 3QYQA 4LBRA 3UYIA 2OODA 5MKGB 3OU8A 3BPWA 4EIVA 2VR4A 4QJ4B 2ON3A 1F6PA 4PULA 1X8FA 1ZHAA 4EF9A 1KWGA 3W73A 1F2JA 1EFZA 1WZMA 1TMQA 1ICQA 4H1ZA 1E56A 4C91A 5FJOA 4XVEA 4UFIA 1XH0A 4JTJA 1CGYA 3U48A 3UQNA 3EB3A 2XSBA 4CKQA 3VGGA 3WL0A 4W86A 3SGZA 1WOBA 5A6AA 5B80A 4B92A 1X1NA 1TMLA 1WXJA 2R82A 2GL5A 1O68A 4JDBA 3PFRA 4RE3A 3UCDA 4QISA 1NP0A 4AZ7A 2JKAA 5ABEA 4L61A 5DELA 4GZJA 2GLKA 3KLLA 2WPBA 1QWKA 3BLEA 3W86A 3PBUA 4L6HA 4ECLA 3N9RA 3SY1A 3TTSA 3AICA 1XW8A 4LAKA 1FA2A 2FZNA 3W53A 1ZTVA 4Q22A 5REQB 3PWIA 1L9WA 4FB7A 2J25A 3CH9A 5FD0A 2GJRA 2WNNA 3VFCA 1C7SA 3E6EA 2WMFA 5E1QA 1H7XA 3OLIA 3TROA 2EEXA 2H3DA 5BMXA 1DE6A 3AIRA 3FJ6A 4I8DA 4PE8A 2VQUA 1XIMA 1H60A 3WLHA 2P0IA 3AS1A 4WDUA 3GH4A 1XC6A 3FJNA 2BZNA 4AHPA 3W7HA 3ZS4A 2PDIA 3AZTA 3FDGA 1WDRA 3CUZA 2OXNA 1WZLA 4XAGA 3CUJA 4CGTA 3OZYA 3DHFA 4IL2A 2JBMA 3FFSA 4BK9A 1RQHA 1B3YA 3SUWA 4EPDC 4PB3A 3SY5A 3GUWA 2PGRA 1G67A 3WO8A 1XIFA 5TIMA 1PXGA 3USZA 3UT0A 2A79A 5MF5A 3LTSA 3UPWA 2Z4GA 3O6AA 5TQLA 1DJYA 1N82A 2E28A 3FYOA 4Q8VA 1JRCA 3U57A 5HR6A 3PG9A 4H3DA 4YXGA 2GGHA 4RUBA 3AYRA 3MS8A 3P80A 3ZQ9A 4ORIA 1Z3NA 2CXGA 2FDSA 2OT0A 3MUIA 7TAAA 4IP4A 1E0WA 3W7GA 4CD6A 4CQDA 1XIEA 3L4WA 1OB0A 1BWVA 2E5BA 3SRFA 4AVOA 3HMCA 2Y85A 1YBQA 4YVXA 5DCEA 5A3HA 2WJDA 2VNCA 3NQAA 5C9ZA 4CU7A 1O95A 3NPXA 4JEJA 3SCVA 2R1MA 3WNOA 3M7WA 3GSMA 3M7SA 2GVEA 1GYNA 5HPCA 2VEGA 4GKTA 4JQ1A 1ZNNA 3H2OA 3M0IA 1VH7A 1IGSA 4HMEA 8XIMA 1KRCC 1JPIA 4F3HA 1EZWA 3JR2A 3NL6A 1HKVA 1QDSA 4MWAA 2VFIA 1SSGA 3K4AA 5HJYA 2DV0A 4UC5A 3M47A 2GVJA 3IS4A 4E4FA 2QXWA 4Y9OA 3OJGA 3T0DA 3L4YA 2J88A 4CNTA 2R94A 1TZ9A 2WC7A 3CMJA 4WXYA 1A80A 2QR6A 4CLMA 1J4EA 3AIEA 3UGVA 2BV9A 2XVGA 1KD0A 1DE5A 4GJIA 1XX1A 3TKFA 1UW9A 2FZMA 4UQDA 5I7GA 4GXPA 2VHLA 3SSZA 3NYZA 3VIJA 4B5NA 1GKRA 1RCXB 2PUZA 3GIQA 1V7YA 3O7UA 1GOQA 1JZ5A 3AYVA 1QU4A 3HQOA 5G2HA 1TPUA 1SJDA 5HWMA 4N0RA 1XIHA 1CGVA 2CPUA 3S2JA 4WJ8A 3M44A 3WMLA 3JW7A 3TUUA 4Y6GA 3CB3A 3SCOA 1KFKA 2Z25A 3ATZA 4Q4SA 3R6IA 1GZGA 3DBPA 4C6DA 1W1IE 5J5RA 3TWBA 1Y5XA 3S1VA 4MNKA 1X97A 5EMKA 3U2CA 5AZ1A 2PRMA 4PCSA 2NQZA 2G95A 1YX1A 2J7BA 4X60A 5CPMA 4DUOA 1QI4A 1U5JA 1GEHA 3NO3A 3MC5A 2ZVIA 1A4MA 1E1FA 3EWZA 5I3IA 5H91A 1LBFA 3UG8A 1D7KA 2ZXQA 1MO0A 3S6TA 1E6XM 4LSBA 1N8FA 3SUUA 2ZQ0A 3R0KA 3VM7A 2I9EA 1XSIA 1PUDA 4ZODA 3G2GA 1ISZA 4EWJA 1W3HA 1ZUAX 3AHYA 3WLJA 3BSMA 1XM3A 3ECQA 2QQ6A 4HP5A 1ZY9A 5F1UA 4XX6A 3ZSTA 1RP8A 2IQ0A 3LCXA 3VAVA 3WUGA 4XVDA 4WKFA 2QT3A 3T9PA 3D6NA 4W8LA 4XZNX 1TVNA 1F7BA 1OABA 3ZSSA 1OD0A 1RUSA 3MSGA 4OWGA 3WJYA 3WNMA 3LLXA 3NQBA 4MKSA 3A4AA 2NQLA 4E6MA 1KR0A 3DFQA 2BSLA 3S0CA 1T99A 5AECA 2BFGA 2FLIA 4S38A 1A5MC 5FKYA 2BGSA 4ML9A 1SFJA 1HJXA 3ARRA 4IGMA 3M5VA 5CSYA 3REQA 4WOQA 4UQBA 1GVEA 1FWWA 3JUGA 2O0TA 1E6PA 4IP7A 1JUEA 5AC8A 1OT2A 1BWKA 4HYRA 3WDPP 1K03A 5A6JA 1XWYA 3FSUA 1M01A 1W3IA 3GM8A 3P62A 4JYDA 1YNYA 4UCGA 3PFMA 5I06A 3GX9A 4M8UA 1KB3A 1LQAA 3BXWA 3H26A 5H6HA 5JU6A 5FSDC 5D8WA 4MYXA 3IARA 4LCQA 2QF7A 3VNDA 1UJPA 1AQMA 1GJPA 3KOXA 2OZ0A 3CUIA 3L4XA 3SURA 3H70A 4JTAA 1O94A 2Z24A 4WY0F 1BFNA 4HYVA 4LX4A 1JQXA 2D3LA 2DPEA 2QLYA 2V2CA 3M41A 2E5DA 4GVHA 2GGGA 2ZX7A 1OFPA 4LY4A 3TJLA 3ANYA 1QPOA 4KIRA 5TF0A 3KCOA 3OA5A 4UFJA 4B5UA 5TAOA 3ARSA 4K39A 1TZ7A 4GXWA 4RE4A 4GE8A 3TTOA 2TODA 3DEQA 2ISWA 4O1FA 4L1GA 1ZJBA 3LV6A 3AU2A 3O1NA 3LI1A 3JS3A 3N6HA 3HQNA 3Q4DA 5E5CA 4QFUA 3MA8A 2PDNA 4UTIA 1F8IA 1FHVA 3S5ZA 3TXZA 2C14A 1XGDA 4HHHA 1J0ZA 1VFUA 3MY9A 1UJQA 3OGSA 3DFYA 2PGFA 2LLEA 3DESA 4QAWA 1XD0A 3DKLA 1V6XA 1CBGA 4O1AA 4U5KA 3MW7A 4GVGA 2NXIA 3WLQA 2CZ5A 2EXOA 1GCYA 5BXRA 1OFEA 3OB8A 1XDMA 4ICMA 1JGIA 2DT3A 2ZCGA 4G5DA 1WZKA 2WVVA 1JNDA 2HS6A 1LOQA 4BI6A 2V2DA 4I7WA 2HEJA 4OHQA 3ZZ1A 1R3TA 1W1TA 4R34A 1O4UA 1N8IA 4JQAA 4ZXOA 4BCEA 4KEZA 1RQEA 3W87A 5AOUA 1VCGA 1DJNA 1Q6LA 2OLAA 2Y7EA 2X7WA 2PRLA 2PZNA 3PPHA 1AMKA 3VCRA 3WBEA 5LNUA 4ROPA 5FJRA 2ZRXA 3BLIA 4D9PA 3CO4A 3IJ9A 5KINA 3LBCA 4D6JA 4DZ5A 1M03A 4C6LA 4ZSTA 1EUAA 2DJLA 4IZGA 4O52A 1UPMB 3MDUA 4P8VA 3H2AA 2H90A 2QVNA 1K77A 3RHGA 3UXLA 3G1AA 4M3PA 1LLZA 1G7VA 3NAVA 3GTNA 4DJFA 1K8YA 2V5CA 1P0NA 1TV2A 2V6AA 2JKPA 1RSCA 4HHLA 2VP8A 1QJWA 2WVUA 1WOAA 4C6NA 3VDGA 5T9BG 1F73A 4ZFMA 3G0UA 5A94A 5AB3A 1H61A 4M82A 4CCZA 3T6CA 4Q8OA 3QKEA 4GNKB 3H4GA 4WOZA 1TV4A 3MUXA 3S5NA 1EO7A 3S5YA 3WYZA 1IGWA 4ZE4A 1R85A 2DFAA 2E9BA 2JFEX 4PGLA 3T55A 1PB0A 1JFHA 2RDXA 3H7RA 3PPGA 4F0MA 3VX0A 3RM8A 1NFGA 2VOMA 4C5YA 2PTWA 1MXGA 2ZUUA 4WIWA 3N4AA 4CN6A 2AGTA 1MYRA 3UWQA 3NQDA 1CXHA 5D4YA 2G3NA 2WKGA 2BB0A 1GOKA 1VCVA 1GONA 4S3AA 1P0DA 4TXEA 4DJEA 4LUJA 3E2RA 1BG9A 1SR9A 1E6QM 2B4GA 3L66A 4WK9A 3I7SA 2V3DA 4OOZA 3O9NA 3MYPA 1WX0A 4GWEA 1GQJA 2C1IA 3BOFA 3VD4A 4KW2A 4V2XA 3BURA 1UD4A 3C0SA 4GKLA 4NAFB 1QO2A 1BSLA 3ARQA 3NPUA 1IWPA 1YDOA 1TELA 1E5JA 1ZAJA 3QPEA 4MLJA 1JNEA 4BWLA 3DG6A 1JIBA 2A7PA 1KTNA 4R53A 1LLWA 3BCJA 3WNNA 4DPQA 1RVKA 5JMUA 4ZVJA 4MAVA 1NEYA 2XZ7A 1UR8A 2GJPA 3EX4A 3URAA 2J7GA 3FDKA 3T05A 1KRMA 4AF0B 4WGHA 4AD2A 1XF0A 2CW6A 4M6VA 1ZBWA 5LYRA 2JEPA 4ZFCA 3GIYA 1EX5A 4P5UA 3FKRA 2Y88A 1BXBA 1PS9A 4HN4A 4R7JA 4WKAA 1LOLA 5M2FX 2CLFA 4A21A 3CB8A 1UH2A 1JDAA 1V77A 4CQAA 1KM0A 5K9DA 2QDHA 1CXLA 5CC3A 3N2OA 3VNIA 3K30A 2A21A 1W1VA 1BAGA 2DUZA 2HTMA 5XIAA 3RRAA 1LWIA 3TYEA 2J74A 4O12A 3NZPA 4U3CA 1LOSA 1TR9A 3V0SA 3SFKA 4D6GA 1I1XA 5FESA 4C7DA 4G2DA 1THFD 5AVHA 1K6AA 4XAFA 3Q67A 4G1KA 3QY6A 4CUCA 2BVYA 2Q3OA 1DWFM 4Q4MA 2DSVA 5AC7A 2Z1VA 4HNNA 1E4LA 3ZJKA 3GRIA 3W7IA 2DVTA 4HA1A 3IJ8A 4HTYA 2BGQA 2VFDA 3E02A 2OWCA 3ITYA 4XK2A 3ZR5A 4MB3A 4F0KA 2EKCA 4OOUA 4C6JA 3LYEA 2XU2A 1FP8A 2XHYA 5EFFA 4E2BA 2CHNA 1TYGA 2XGBA 3V4BA 1D3GA 1FKWA 4ZEPA 4UQAA 2ZX9A 3GNOA 3O63A 2PLKA 4TV6A 1ADDA 5GQBA 3UXDA 1JPHA 1H1NA 1LL4A 1TPC1 3UG3A 2W79A 3T4CA 1JCTA 4HK7A 1EEXA 2VD8A 4D2JA 1UC4A 2VT0A 4DIAA 5HQEA 3JZEA 1JUBA 5GJNA 4K7YA 5FOOA 3ZFHA 1AJ0A 3TQ0A 1EKOA 1YMYA 3EWYA 2P8CA 2BASA 1C8QA 1YHTA 3BAWA 1EJ7L 2Z6IA 3A3HA 4HN8A 4IXHA 1OCQA 4GX9A 2TMDA 1JEZA 1H7PA 2VGFA 1FWJC 2YBVA 2E8YA 1JCYA 1CXEA 1WCGA 3MV01 3SY8A 1P6CA 2F7FA 1BRLA 3L2LA 3TW9A 3WLKX 2GUYA 5I09A 4DYKA 5HAOA 3LMZA 5KETA 3AXHA 1JUKA 2J9ZA 1EX1A 3TH6A 4NAEB 2VZUA 3XINA 4AZHA 3CIWA 4H9TA 1XFBA 2IPWA 2WLZA 4OBSA 3GTFA 3GR4A 2PZ0A 3V18A 2WHLA 1M41A 2BHZA 5CGTA 5JH2A 4JL1A 1TRIA 1DORA 3L21A 3ZLHA 4US5D 3AXMA 1KLYA 4GD0A 4HPHA 2JE8A 4R33A 3W1LA 1TWZA 1IXQA 4HU3A 3FVDA 2VWTA 3DC0A 1NM9A 3N25A 1UUMA 4DO4A 1US0A 3B3DA 2RH9A 3URQA 2WSRA 2ZRVA 4O4WA 3IUHA 4QGCA 1PVNA 3PSWA 5HANA 2G96A 3BMWA 3W1TA 4BEQA 4HU8A 3PVFA 4HB7A 1V4YA