4GUHA

1.95 angstrom crystal structure of the salmonella enterica 3-dehydroquinate dehydratase (arod) e86a mutant in complex with dehydroshikimate (crystal form #2)
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
259
structure length
259
Chain Sequence
NLYFQSNAMKTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREADFDILEWRVDHFANVTTAESVLEAAGAIREIITDKPLLFTFRSAKAGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEVKATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQERYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-dehydroquinate dehydratase
publication title Reassessing the type I dehydroquinate dehydratase catalytic triad: Kinetic and structural studies of Glu86 mutants.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Lyase
total genus 90
structure length 259
sequence length 259
chains with identical sequence B
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2012-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01487 DHquinase_I Type I 3-dehydroquinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4guhA00
3IIOA 1XKYA 2E09A 1SQ7A 1TTQA 3TW6A 3A9IA 2Y7DA 3CTLA 1QDSA 2BZNA 3EX2A 4M6QA 3P80A 1R47A 4QISA 3NQVA 2I9EA 3VCRA 3CEPA 4ORMA 1D9EA 2ISSA 1LZOA 1ME8A 2C15A 3TSDA 5D30A 3U2OA 5CG7A 2V30A 2X16A 3DH7A 5G2IA 1Z48A 2NXIA 5LNUA 4LV9A 3G8RA 1KFBA 5D37A 1AL7A 2QCGA 3EXRA 4UIOA 1X1ZA 1WAUA 3W74A 5EPDA 5CSRA 3LXCA 3O1NA 3GB6A 2QDGA 1A5BA 4YXGA 4XKYB 3HG2A 4FNRA 4Z08A 1G4PA 3O6DA 3SSJA 5G4WA 3TR2A 1JVNA 1SFJA 4GNJA 5FI8A 3LXAA 5AYYA 5K9CA 4HNUA 1I45A 4DPPA 1LDCA 5FESA 3UZ5A 1I8JA 1VR6A 2A1YA 3L65A 3RF9A 1ZHAA 4JX6A 5IM51 4P61A 2QR6A 2TSYA 1TPUA 4JTKA 4YLWA 4ADUA 3NQ8A 1IXPA 4IXHA 2Y7EA 3TE9A 1LBFA 3G1XA 1W31A 3VNDA 3W1LA 3W1QA 4FNQA 3I7SA 1F74A 3P8JA 2OJPA 5DXYA 1K7EA 5F2IA 1TRIA 1QPQA 1OFOA 3MI3A 4EOUA 4PCFA 2FB2A 3FS2A 4O19A 4S2BA 4UTHA 3BPWA 1TPH1 4FHAA 3TJLA 3SFKA 3M9YA 5F4SA 3RLVA 1S5VA 3M47A 2FPVA 4CLMA 4A2SA 3N3MA 2GUUA 3W22A 4RLIA 2H8XA 2VC6A 3DZ1A 1FWSA 4M5PA 2E6AA 4MJZA 3FFSA 3DHFA 5I3HA 3PULA 1UB3A 1H61A 3MMTA 1VLWA 2ABBA 4GC4A 2ZZ2A 2YW4A 4NUWA 4UTJA 1DJQA 1XBYA 4LRSA 3TA6A 3O15A 3C52A 3DI0A 3W7RA 2FDSA 3DENA 1V5XA 4TO8A 3TFXA 1RZMA 4BF9A 1F6PA 3G0SA 4NX0A 3S42A 5HWJA 1DVJA 2RDWA 2RKXA 2G95A 3I65A 1GT8A 2A4AA 2ALDA 3M6YA 1YDOA 2P0OA 3GAYA 3LHVA 1VJIA 3HG4A 1LTDA 4OE7A 3HIJA 1VC4A 4OV9A 3DXIA 3WJSA 3W72A 3M16A 3M44A 1ZY9A 1IIGA 4FXRA 4JTUA 3W1NA 1TRDA 1DV7A 2QUUA 3P8IA 1ME7A 4WX2A 3W7PA 1TPEA 1Q6RA 3ELFA 1Z44A 1TQJA 5HJLA 3CQ0A 1FDJA 5BMXA 3NA8A 3PY2A 1THFD 1W1ZA 3KVKA 1FWRA 1G7VA 5U7SA 1YXDA 4O50A 1O5XA 4FB7A 3P62A 2OT0A 3C2OA 1VZWA 4ORIA 4NT0A 5F4WA 3WK2A 4JTHA 1WA3A 1YTDA 1ALDA 3P5YA 3QF0A 5KINA 4RK8A 4N9CA 3S9YA 4WZHA 3MO7A 3ZR4A 3O05A 4HHPA 1Z41A 1FCQA 3T55A 3O8AA 3S5ZA 2VOMA 4BWLC 2BLEA 5BNKA 3NQCA 3LCGA 4QITA 1OX6A 1VH7A 3P82A 1JCMP 2ZRWA 4LUJA 5F4XA 4IQLA 2QJHA 2E6DA 3C3NA 1L9WA 4I7WA 4AWTA 1JR1A 4JTJA 1L2UA 2DORA 1H62A 2C14A 2NXHA 4Y90A 5AFDA 3PSVA 1G7UA 1V7YA 3Q94A 1TCDA 4GXMA 1F5ZA 2GVGA 5AHMA 4BI6A 1W5MA 1SZNA 2ZRXA 2PRLA 2TMDA 4I9AA 1X6UA 3O07A 1P1XA 2CW6A 3IVSA 4Z1CA 4JIPA 1OF6A 1XDLA 2ZA2A 4PA8A 5FF0A 2G96A 3TSMA 4RZ4A 3EX3A 3NQMA 4YL2A 2Z1BA 3QEZA 2YCEA 2WJZA 4AHQA 1GG0A 2HSAA 1H7WA 3UXDA 5TBOA 1IF2A 4ADSA 4LTSA 3M5VA 2V2DA 1KM5A 3W7EA 1HUVA 4NQ1A 1DL3A 3DAQA 4AWSA 5LHEA 4R34A 1J2WA 1RQBA 2ZYFA 4DEFA 2WO5A 4DPQA 1QOPA 1OYBA 4AF0B 4I7VA 1L6SA 3I68A 4NNCA 5AB3A 1EA0A 3TSBA 4IPIA 2J27A 1H1ZA 3F4NA 1G4SA 3EWUA 4UFIA 2WNQA 3W73A 2A6LA 3CPRA 4ALDA 2Y62A 1EUAA 5HR6A 1ZAHA 1LLWA 3UYCA 2NUXA 3BW2A 4MY8A 4DF2A 1ME9A 1QFEA 1TIMA 3NPWA 1FWWA 4K7YA 1P5BA 2NX3A 3IIPA 1LBMA 1WBJA 2EGZA 3S1WA 2G5WA 1MSSA 3MW7A 1R2TA 4LRTA 3T4CA 2EPHA 3MUXA 1EB3A 3THAA 5DELA 4O10A 1SUXA 4N6FA 1J4EA 1B4EA 4AB4A 3W85A 1IXOA 1LRTA 2RHGA 4TX9A 2ATSA 3GXNA 3G1VA 1H1YA 4OGZA 1T96A 1PVNA 4JYFA 3NM1A 3ANYA 3EXSA 4O18A 2DJXA 3NZ1A 3O6CA 1YDVA 1TO3A 3RLUA 3GYEA 4O17A 3W70A 1R2SA 2W0UA 1O95A 4K8HA 1OFBA 3L66A 4M7SA 3S0CA 3B0UX 2PC4A 3R5EA 4UR7A 3Q37A 5LNVA 4JXCA 3STGA 3IIVA 1VYPX 3KXQA 1XI3A 2CZFA 4FIQA 5SWUA 1GWJA 3FIGA 4E0CA 1RR2A 2YYTA 3HG3A 4FNSA 4JTGA 3LTSA 3RNDA 3G3DA 3B8DA 2Z2UA 3GAKA 1TPVA 4YMZA 5BW6A 1KM3A 4O54A 4GUFA 3BLIA 3G1DA 4IMEA 2YFNA 1VS1A 1VCFA 3M5ZA 4NZJA 5FF3A 1F6KA 3LV6A 3MJYA 4L4LA 3QC3A 2Y6ZA 1T0OA 3PBWA 3W6YA 2CLOA 3O06A 3WJYA 3M1ZA 3BK0A 5AHLA 2WOQA 3OA3A 3H54A 3W7DA 4CCEA 1I2RA 4LVFA 4O14A 3STCA 4KFPA 4C1KA 3IVUA 3LCIA 4Z0JA 1TTJA 3W7NA 2X2GA 1Q3NA 1KLYA 4R53A 5LKYA 1ICSA 3VE7A 4HIBA 3E12A 2ZRYA 5E93A 3SIZA 6ALDA 3LLFA 4PODA 3CWOX 3W2NA 4O0KA 4O13A 3P74A 3DU0A 1HL2A 5HQEA 1Q6LA 3KAOA 1PHQA 1XFBA 7TIMA 5F2LA 4KKXA 3W2LA 4G1KA 1K8ZA 3N9SA 4CNNA 1VPXA 1A5SA 4NJGA 1FUYA 3FJLA 4S1FA 4K8EA 3T44A 2W6RA 3R2GA 1H60A 2ZRUA 4WQ6A 4K39A 1Q45A 4DF0A 4IMCA 3QMTA 2ABAA 3UPBA 5AHIA 2CLIA 3TQKA 4ADTA 4GE8A 4TMBA 5IBXC 2NV1A 3M7WA 5CZSA 5FEWA 4NJKA 3A23A 4OHQA 3BGGA 5KTLA 4ZQNA 1PHWA 4OV4A 3TAKA 5HR7A 3ZFHA 4N2YA 1A5CA 3W75A 1FXQA 3GZ3A 3N73A 3A24A 2V2CA 5AHEA 3W83A 5DY3A 2YZRA 4RKAA 5CKSA 2EAWA 3HPZA 4WXZA 1AL8A 3CHVA 4NX5A 4PL2A 3QJAA 4MY1A 4CNPA 3GK0A 2G97A 2A0NA 2DP3A 4JTFA 3C2FA 3W07A 4JYEA 1SO6A 3EWBX 5HUPA 2GPTA 3HQ1A 1KM0A 3IV3A 2QCNA 1LOQA 3H55A 1SR9A 1ICPA 4FXSA 1FWNA 5J5DA 5LNRA 3BW4A 3P81A 4LUIA 4RV8A 3W1PA 5CSSA 3W2MA 4A2RA 3Q58A 5AOUA 3HGJA 1RQEA 4JGDA 1RVGA 4BWLA 2AQWA 2DJLA 2E1DA 2OMAA 1LOLA 4GUGA 1K8YA 2ZQ0A 3N2MA 5DY2A 4Y8FA 3NL2A 4HSNA 5BOOA 3ZWTA 1FCUA 1F73A 2H6RA 1LBLA 4Y9AA 5KSWA 4I7UA 4HT3A 4HKPA 3W86A 4QSHA 3EWYA 2DZTA 2WNZA 1EPXA 5G2HA 4MLJA 3TFCA 4JTIA 1H5YA 1HTIA 1XBXA 2C0AA 3GDTA 4MLRA 1MO0A 3MHUA 4JY8A 2DZPA 2FFCA 1TQXA 5D2TA 1K03A 2FB3A 1KTNA 3UQNA 1CI1A 2ZA1A 3QQ1A 3TQVA 1A5AA 3OG3A 1OF8A 4WOQA 1ONRA 1QMLA 3NL5A 4ONVA 2FPTA 2ZZ7A 3EXTA 3PM6A 5G4EA 3IVTA 3FOKA 1L6WA 3LHTA 1U5JA 1W56A 4LVAA 3B0PA 3NQ7A 3E49A 1PCWA 3HPXA 3PAJA 1Z42A 3FKKA 3W9ZA 3NXFA 4JDBA 3A5FA 3V1PA 2GJNA 4FNUA 3KRUA 3DKLA 4PEKA 3DFTA 3VFLA 2HS8A 1CW2A 3LI1A 2BTMA 3G3MA 3MBDA 2HTMA 1YADA 1VCGA 2V8ZA 1IXNA 5AN7A 1FCVA 3S5OA 3QPZA 3LDVA 3TIMA 4BR1A 1H63A 1K7FA 2A7PA 1PS9A 2CZDA 3L5LA 1ZENA 3G1FA 3OVQA 3MP5A 4N9EA 3RFAA 4RXFA 1VGAA 4GRSA 1JRBA 2VKZG 4RJEA 1GVRA 3O63A 1KLZA 4X2RA 2QUVA 4MUZA 2GQ9A 4EWND 3TROA 1LORA 1KBJA 3N14A 5D32A 3W7CA 4DF1A 3P60A 4ZQCA 5K9DA 3TXZA 3QSRA 3PR2A 4ML9A 2W79A 4LT9A 1QO5A 1TYGA 3DFSA 4MOZA 3P5ZA 1R2RA 2AAMA 3CT7A 1QPOA 2YGYA 1SFLA 1NF0A 5DCBA 1PV8A 2X1SA 1G69A 3W7IA 1M7PA 1GTEA 5LHFA 1GOXA 5HWMA 1UBSA 5K9XA 1F7BA 3NYZA 3IGXA 5H91A 1LM1A 3KRZA 3UWZA 5EYWA 5EKYA 5EA9A 2NLIA 2J88A 2X1RA 4H4IA 1S5WA 1TJRA 2E5CA 1IGSA 4CQAA 1W54A 2CZ5A 3C56A 3TMQA 1SZEA 3GLCA 2R8WA 4HPJA 2BX7A 4R7JA 2J9XA 2CLFA 5D09A 5HMSA 3G1SA 2ZBTA 1H7XA 3UWVA 4JX4A 3IIXA 5FEPA 1H7RA 3NQDA 4MZYA 3CC1A 5DCDA 3GKAA 1Q6QA 1MEWA 1OFQA 4NVTA 4QJ1A 3L5AA 5D03A 3AJXA 3H53A 5HINA 2Y7GA 3GNNA 1OK4A 2XFWA 3ABSA 4M6PA 4R33A 4FNPA 1EP3A 1VYSX 3PC0A 2QEZA 1EUNA 5HULA 4L4MA 4YWIA 2CLLA 3TAOA 3SY5A 3A5VA 2IQTA 2DZWA 3PUOA 3ZS4A 3FYPA 3O6YX 4LVDA 2NWSA 1WOBA 3TU9A 2JGYA 1D3HA 4BK9A 1L6YA 4LS1A 3GDLA 1KTBA 1PCKA 1GVOA 1S5TA 1AW5A 3B06A 3NGJA 3BO9A 1GVQA 3GVGA 3W2UA 1DBTA 3SJ3A 3W76A 3EB2A 1JCJA 3WJWA 1GYNA 2YPIA 1W5QA 1TV5A 2NUWA 5AYXA 3W2KA 1OK6A 2TPSA 3I7RA 4NJIA 3W1TA 3W7JA 2ATMA 1VLIA 3GXPA 3FEMA 3QMSA 3KOFA 4UTMA 3HMJG 2J9ZA 3FYOA 5K4ZA 2VENA 3BGJA 3R12A 4Y6GA 4XWUA 2GVLA 1BWKA 1O94A 3PUDA 4O16A 4HSOA 1NVMA 2ISVA 4RR4A 5IBXA 1JQXA 3TV8A 2V0TA 2E6YA 3MYOA 1VCVA 3NL3A 3QQ0A 1XC4A 3RMJA 2C16A 3KVMA 5CPMA 3L2IA 1HG3A 3LHYA 1SO3A 1NEYA 1C9DA 3PWAA 3QFEA 5K2ZA 1DKWA 4GBUA 3LI0A 3G8EA 2KZHA 5AHFA 3BG3A 1W8SA 1OX4A 1PE1A 1JJKA 1WBHA 3F4WA 1WX0A 3QYQA 1W0MA 4Z1BA 1BTMA 1QR7A 1SZGA 4N9DA 1DJNA 4TMCA 1LLZA 4N6EA 3TXVA 4P2VA 1PIIA 2E6FA 1H7NA 4K36A 3W1XA 4XBSA 1C29A 2V9DA 1OFDA 2QCCA 1XBZA 2VELA 4UTIA 2QKFA 1DQXA 4WY0A 3B04A 3LHZA 1Q6OA 4DO5A 3LHUA 3U6WA 4CNOA 1LRQA 3B03A 4X9SA 1VHCA 3NQEA 1GG1A 1AG1O 2GQAA 4H3DA 2H90A 4LU0A 1EP2A 1N8FA 3CWNA 3HB9A 3W7OA 5CPOA 4MJMA 1T8XA 3G0XA 3BARA 5U4NA 2FIQA 1KV8A 4FNTA 2UV8G 1BWLA 4IUOA 1EEPA 1SZFA 3JS3A 3PBUA 1LOSA 5EY5A 1QCWA 4TR9A 3L67A 4O1CA 3T78A 5D38A 1RD5A 1W3TA 3A21A 4EVZA 4LS0A 3PB0A 1FBAA 2A5HA 4MVAA 1UASA 4QAIA 4EIVA 2EKCA 2DZSA 4NNAA 4UTUA 3MBFA 1H7OA 1TPB1 3NPXA 4OQVA 3QSTA 2PRHA 4OBTA 1NAL1 5C2XA 1MEHA 5CZJA 4J9JA 2NV2A 3ATZA 1VQTA 1DQWA 3LCWA 1OYCA 1X8FA 3W7HA 1XM3A 2PCQA 4MZ1A 3SR7A 5DBUA 1K3UA 4RX0A 2QCLA 2Z0IA 3BLFA 4O15A 1EP1A 1U83A 4MYAA 3HGSA 3WJXA 1HFBA 3KFTA 1TTPA 4CCCA 4UFKA 1A50A 4AHOA 2B7OA 4POCA 3TUUA 3G1HA 5KZMA 1MEIA 2OX1A 2YX0A 4BI5A 3TK7A 4HPXA 2J6XA 4QIUA 5BMWA 3I6RA 3BV4A 5L9FA 1TJPA 1W37A 2FQIA 4UFMA 1G6CA 3D0CA 4MFDA 3TC7A 1N7KA 2Y89A 3OIXA 3C2RA 2O7SA 1P4CA 2FTPA 3HJZA 3SGUA 3U8GA 4K38A 3B4UA 4DQWA 5LNWA 5BRBA 2F7FA 3W88A 2Y85A 3HG5A 3IGSA 1XUUA 3CIWA 3E96A 3WJZA 1TREA 3VKJA 4A22A 3NEVA 2DZVA 4IJBA 1AK5A 1WYIA 3M5XA 4UR8A 4XTDA 5AYZA 4UTKA 3LX9A 3STFA 5EBUA 2Y61A 1OVDA 4Q4KA 3LOTA 3NQAA 2R91A 2VFIA 3G1YA 2Y63A 1KFEA 3HO8A 4FO4A 3CM4A 2QJGA 4LOCA 4U4MA 3WFAA 1QNVA 2QUTA 1ZALA 3GR7A 5CZTA 2H3BA 4IX2A 1FXPA 5CPNA 4N4QA 5EMUA 3G1AA 2X1UA 3L0NA 5GVJA 1YPFA 4O11A 4MY9A 3SZ8A 3GDMA 2C18A 3M5YA 2J24A 1LYXA 4QM1A 3STEA 4FX7A 3TCEA 3IRDA 5C6MA 3EWWA 4NJJA 5LNSA 1LRNA 1KM1A 1BEUA 4Y96A 5AC8A 4WY0F 3L0GA 4O57A 1K02A 1H7PA 1TPDA 3LLDA 4AVFA 2PURA 2WPBA 1GZGA 3S1UA 3GDKA 2ZCGA 2NZLA 2RH9A 3PG9A 3W7KA 3N9RA 4X3ZA 4CQ9A 4DELA 4O52A 5LSMA 2E5DA 2QJIA 2V81A 3NL6A 3M41A 3NVTA 4JTTA 1KBIA 1W5PA 1YTEA 4JY9A 1LCOA 2BSLA 1TPWA 3UNDA 2JKAA 1SSDA 1AW1A 5CPLA 3PG8A 2LLEA 4HNNA 4UCGA 4O53A 1QO2A 3W1AA 2VFGA 1QAPA 5D2WA 3LCXA 1B57A 2F84A 1KM2A 1OYAA 1XBVA 3G18A 1G67A 3T40A 4H6KA 4AH7A 4LV4A 2Y7FA 2JBMA 3MYPA 4MZ8A 1I4NA 2WSQA 2QCFA 5H2ZA 5I3KA 4Z1DA 2DU2A 3MP4A 4O1DA 1KW1A 6TIMA 2ZTKA 3S5NA 4MPQA 2X30A 3W1MA 3MP3A 2V82A 2FPYA 4ICNA 4DBEA 4O12A 3LTPA 1HO1A 3A22A 5L6UA 4IX0A 1SSGA 3BVJA 4GUIA 3ABOA 3MI2A 5HUOA 3L5MA 3MWAA 1YYAA 2C19A 4CCDA 1K7XA 2Z6IA 4M7TA 4AWUA 1A53A 1O60A 1CX9A 2ZTJA 4UC5A 4IWWA 1ML1A 5KMYA 3O16A 1B9BA 1KM6A 2WSYA 3YPIA 2VFFA 1G4EA 3GXTA 1EIXA 2QCDA 4JYDA 2Q3RA 3NQFA 3KRSA 3QZEA 3LCFA 2OZ0A 3W71A 4O0ZA 3W1UA 5E1QA 2ZZ4A 5KZDA 4JNMA 2VXNA 1T99A 1TTIA 5D33A 4D2JA 2QCHA 3DFNA 4N9BA 4NNBA 5I3IA 3W87A 3BLEA 1P0NA 4JS3A 3P61A 3EWXA 3UXAA 2VFEA 5FEZA 2A7NA 4JDYA 5D04C 5AC7A 1JCNA 5D05A 2JGQA 1JRCA 1WV2A 2QF7A 2Z6JA 4XQ6A 2CLEA 1F05A 5F1VA 1RPXA 1FWTA 1YTKA 4A29A 3S6DA 4PL1A 2XN1A 2Q8ZA 1GVFA 2A6NA 3SECA 2ZA3A 4W9TA 5AC6A 3G0UA 2VEMA 3PSWA 3F03K 2ZDRA 2VEKA 1TPFA 2FLIA 3QMRA 3E0IA 3HPSA 4OU1A 3C2VA 4O1AA 4XKYA 3FA5A 4WUIA 1NF7A 4S2CA 3KVLA 3RK8A 1OABA 3EKZA 3OBKA 5F2MA 1ZJIA 4NU7A 4JD4A 3WK0A 2QCEA 3OHIA 3GX9A 3CEUA 3SW6A 5AHNA 5DN1A 1SO5A 3PF3A 4NXKA 1RV8A 1ZAJA 1DHPA 2WKJA 3TW7A 1YDNA 2CWNA 3NNTA 1HO4A 5FF7A 1I2PA 3HGRA 1OFRA 5C55A 2CZEA 4UTWC 1UJPA 3NQ2A 4IPJA 4XZ9A 2VEIA 5CGQA 1GVSA 3UY7A 4UTTC 3LCHA 1DOSA 2XN2A 2DZUA 4XTIA 4CQ8A 1WQ5A 3PVFA 2RDTA 3LRKA 1NSJA 5KITA 4NZFA 2ZZ6A 5I3FA 3PUEA 1I2QA 3W23A 2R14A 4GJ1A 2B4GA 2GVJA 1XDMA 4GUHA 4OT7A 2WNNA 4E38A 1W5OA 3S8HA 5J5RA 2JKPA 2P10A 2VFHA 2E77A 4RXGA 2ZZ3A 5KZEA 2YDAA 1F76A 1GEQA 4RCXA 3WK3A 4BI7A 4KFNA 4DBDA 1GQNA 2RFGA 3W84A 1IIHA 5E0KA 3EX6A 3IIZA 2ZRZA 4Z0SA 4IMGA 4NXSA 2I1OA 3W7QA 2NX9A 3JRKA 2B0MA 2EHHA 1TV8A 5DLCA 2HS6A 3I7QA 4IOTA 1KTCA 4TU1A 4KFOA 4DXVA 4RZ6A 5LGZA 4UXDA 3UWYA 2C1HA 2I14A 1TMHA 3LHWA 4AXKA 2H8ZA 1OFAA 4OWGA 5TIMA 4MYXA 1JUKA 2XN0A 4WOZA 2V2HA 2H3DA 4UFHA 1OHLA 3CU2A 3F1QA 1OFPA 1M6JA 4UNKA 3W3OA 3P84A 2CLMA 1G4TA 1MXSA 2E5BA 1KA9F 4IMFA 1H51A 4ZL1A 4N02A 3R13A 1B3OA 5C54A 4O8RA 3LRLA 3CIXA 3W1RA 4M6VA 3QPYA 3C0JA 1K8XA 3BG5A 3S1XA 1VHNA 3TQ0A 2B7QA 3N19B 1UUMA 4FX6M 4JR5A 3RU6A 2A7RA 3DKJA 1QPNA 2A2IA 1E51A 1QWGA 1NFBA 4KWVA 3NM3A 1VYRA 4UUIA 2A85A 4E2BA 4HN4A 3NZRA 5D2YA 5D02A 4IMDA 2QCMA 3LBMA 3CLMA 4E2DA 1OX4B 2BXVA 5T26A 2TRSA 5G5IA 2YYUA 4LY8A 4X22A 3L0KA 3Q2DA 3T7VA 3NG3A 3UWUA 4K6AA 1ZCOA 3C61A 3G24A 3VE9A 1SW7A 1SW3A 1KFJA 4U28A 3NR0A 4DO6A 2AGKA 1XL9A 3DGRA 4JEQA 4AAJA 3NAVA 3LTYA 4QNEA 2C3ZA 4UNLA 1SW0A 3ZWSA 3KX6A 4Q32A 4UFLA 3PB2A 5A8GA 3HGOA 2DZXA 4WY0B 3C8FA 1JCLA 2WQPA 4RZ5A 3GNDA 1D3GA 4ZVJA 1W3IA 2OCZA 5CZ0A 4HNTA 3NOEA 4LW7A 3LGEA 1N55A 1WXJA 2PE4A 5D2XA 3UY8A 3M43A 3EEGA 4TIMA 3W7LA 3ABRA 3K30A 1W5NA 2P1FA 1YXYA 4N4PA 3TNOA 3S1VA 3OVPA 4WD0A 3C6CA 4ZQPA 1JULA 3MHFA 3QRHA 4LNYA 1KM4A 2PRMA 3LERA 1XCFA 3NDOA 4K7VA 1I2NA 4ZQOA 2A21A 3LB0A 3OVRA 2V5LA 5D2VA 3QW3A 3VI2A 1XUZA 1Y0EA 3PBYA 1X7FA 1FDZA 5HNRA 2NXGA 4FEZA 3PBVA 2WSRA 3E02A 1GTHA 1ZFJA 1EWDA 2CLHA 3L9CA 4JX5A 3BW3A 5FF2A 1S3HA 4AMAA 3HBLA 5FF4A 2Q8LA 5G1TA 2RDUA 3LRMA 3DHDA 3UWQA 4LC8A 2BWGA 1IXQA 3G22A 2D73A 4MKNA 3DFPA 4AF0A 1YPIA 3IGUA 3OEXA 1O4UA 1KFLA 1M5WA 3NQ6A 3P7YA 4JTEA 4JTSA 1QPRA 3TX9A 3WK1A 4KWWA 3TH6A 4FF7A 1WOAA 3L68A 1XXXA 5A5WA 5LZLA 2X1TA 1J5TA 2C13A 1KFKA 1YXCA 3L21A 3P67A 4LVGA 1UUOA 4JIQA 2ZFAA 2NWRA 4UFJA 3LCLA 4C1LA 2Y88A 3R8RA 1F2JA 1BKSA 1GYLA 1MZHA 2R94A 3EX1A 1TB3A 5G2WA 3UD6A 5F2GA 2CLKA 2NX1A 3UZJA 3NPUA 1KFCA 3DBPA 5LGXA 1W3NA 4A21A 1OX5A 3TKFA 4UMBA 2C6QA 3EWZA 3GR8A 4ZQRA 1LP6A 2VFDA 3UPWA 1FDYA 1GJPA 2B7PA 4UMAA 3MHGA 1ZNNA 5HWNA 1TV7A 3E9AA 1VRDA 2Y70A 5G1YA 3FLUA 1JUEA 5EL1A 2QAFA 3PS7A 4FIRA 4EF8A 3W2JA 2E68A 1I2OA 1WDWA 5DXXA 1JCXA 1B4KA 4MIMA 4UTLA 4FX8A 2CFFA 4Q33A 3V75A 5MHBA 3AO0A 4B5NA 2JK2A 3UWWA 4PFMA 3SI9A 4UTWA 2Q3OA 4XUGA 5ABTA 3QH2A 1DORA 3NQGA 1EX5A 3KVJA 1P0KA 1TPC1 1C8VA 2FJKA 2OT1A 4JTLA 4UTTA 4NJHA 3TMLA 2O7QA 4YCOA 5DBTA 1O5KA 4K37A 2V5BA 1FQ0A 4O4VA 4AHPA 2YR1A 1AW2A 3EKLA 1UCWA 2VEPA 3HOJA 4IXXA 4O28A 1SPQA 3FJ6A 3NPVA 3KHJA 1OJXA 3DFQA 3USBA 4JICA 3TJXA 2YFOA 4ZMGA 4EF9A 3S5YA 2NUYA 4LC6A 1GPWA 2EF9A 4LS2A 4DO4A 4M19A 1KV5A 2YW3A 4IGHA 2ZZ5A 5DCEA 4MFEA 2CU0A 1SO4A 5F1UA 3FKRA 4QNWA 4YCPA 3GIYA 4O1BA 3QW4B 3TDFA 2HMCA 4A3UA 4GFSA 3CB8A 2JKEA 1ADOA 3GKFA 1YLVA 5K3VA 1FX6A 1AMKA 3LV5A 3MI6A 2QDHA 3SGZA 3B05A 1RQHA 4LWWA 4LVBA 1ICQA 2B7NA 1JQVA 3R89A 1JCYA 3TC6A 5K4XA 4PC8A 1PL9A 5I3JA 1QOQA 5C5YA 4AEOA 3HF3A 1LROA 1X1OA 3M0ZA 8TIMA 2GQ8A 4Z1AA 4GUJA 3INPA 4WJEA 3N2XA 1EWEA 3BG9A 4WXYA 4UMCA 3C2EA 2ZZ1A 3LBCA 2GJLA 1H50A 5FEXA 3JR2A 4QQ3A 5I3GA 4ZQMA 3DFOA 4BFAA 5K7JA 2TYSA 1OG0A 3GDRA 3LXBA 4GWEA 1JUBA 1FCBA 2ISWA 2QAPA 4JN6A 1M7OA 2J9YA 4PTNA 4XBKA 3N34A 3NO5A 3C4UA 2QCDB 4HNVA 2GOUA 2YXGA 1R46A 3EX4A 3W7MA 3B0VC 3ABQA 2ZRVA 2YSWA 3LM7A 1R30A 1FY6A 2WV8A 1ZAIA 3DI1A 4PH6A 5TQLA 3THQA 3W7GA 3ATYA 4ZZ9A 1OFEA 1TSIA 1SU5A 4O4WA 3QM3A 3IEBA
chains in the Genus database with same CATH superfamily
1P48A 1RBLA 3D5HA 2E09A 3IIOA 3TW6A 1R3QA 2FMNA 4M6QA 4QISA 1NQKA 3NQVA 3WLKX 4Q6JA 3N29A 5GJPA 1LZOA 1T40A 1MW1A 2FZMA 4UNIA 1VJSA 4FF5A 5T9BG 3AIEA 1MW3A 1Z48A 3OGRA 2CESA 3EXRA 4UIOA 5EPDA 4ZEPA 1HN1A 1QATA 1XSKA 5CSRA 2QDGA 4XD6A 4XKYB 2VVSA 3O6DA 4XZNX 3C5QA 3PPFA 1SFJA 1ZCCA 4GNJA 5K9CA 5AYYA 4XAZA 3OZMA 3LGGA 3SUWA 5FESA 4DJEC 4ZXOA 4P7NA 3M0MA 1U1UA 4J3SA 1I8JA 3AHTA 1VR6A 3L65A 3RF9A 4L6DA 1C8QA 5AVNA 1X6NA 3IJIA 2TSYA 3M4HA 4JTKA 2GUYA 1XHGA 3P0WA 1LBFA 1S2TA 4BEQA 3W1QA 3VDHA 1QW8A 4JL1A 4Y9MA 2OJPA 3OLDA 3GXIA 3KOWA 1TRIA 3ZVHB 1QPQA 3RUBL 4C60A 4JHZA 2G37A 6CGTA 4S2BA 3L4ZA 1O1HA 1W3JA 4FHAA 3TJLA 4E3TA 4GA8A 1W1VA 3WBXA 2FPVA 4CLMA 3EOOA 2XU2A 2GUUA 3FVMA 2WHMA 3DZ1A 3FFSA 4XVEA 3MANA 2ABBA 2ZZ2A 4UTJA 4QDPA 3IPWA 1NARA 4IFOA 1XLDA 5BRPA 3WMLA 4S3EA 1RD6A 1RZMA 3BJFA 2Z29A 4S3CA 1F6PA 4NX0A 4LAKA 1H0GA 3KE0A 4LH8A 2BY2A 2RKXA 4DNHA 1NWRA 3GSMA 1UR3M 2W27A 2DUAA 2ZVRA 3DXIA 4C6FA 2GFTA 3W72A 3M16A 1BQCA 3DUGA 2J25A 4JTUA 2XGBA 1TRDA 4HU8A 4EE9A 3B8TA 3QOMA 4Z17A 3ELFA 2W3ZA 1RJQA 1Z44A 4IL2A 5HJLA 8XIMA 3KOYA 5BMXA 5CLTA 1ESWA 4HSHA 1FWRA 5GNZA 3E5PA 4U33A 2HXUA 2VRQA 4Q4QA 2QJNA 1BYBA 4NYYA 3VD3A 1C91A 1FCQA 3T55A 2VOMA 3PPHA 4CQCA 3NWRA 1GVYA 4IQLA 1UP0A 4UQDA 4EXQA 2XFYA 3WX7A 4JTJA 3EA2A 1R87A 5HNUA 3RRXA 3PN8A 5DFAA 4Y90A 1XQLA 1NP0A 3VM7A 3WQFA 3PUGA 2VEFA 4GXMA 3MSDA 5AHMA 3TYEA 2GJPA 1W5MA 2YB1A 2ZRXA 3DDMA 5LYRA 5E5CA 4Z1CA 4JIPA 2BOFX 2WB5A 2YL8A 3I3DA 4RZ4A 4NL1A 4YL2A 2Z1BA 2YCEA 1GG0A 3UXDA 2BHZA 4IPNB 1IF2A 1VPYA 1W1YA 5FSDC 1F6YA 4NQ1A 4IICA 3REQA 3H4XA 1RLCL 1RQBA 4W84A 2VMFA 1DJXA 4CD8A 4DPQA 4G2DA 4G7FA 1SMDA 3EDKA 3FXGA 1H1ZA 4UFIA 2WNQA 4S3KA 3NVDA 3CPRA 1I1XA 3UZXA 4ALDA 4GPNA 4I5UA 3UYCA 2D20A 1QFEA 1JZ7A 2WKLA 1DIKA 3T81A 1FWWA 2EBNA 4K7YA 4G7EA 2CYGA 3RCNA 3CWHA 1MSSA 3WQWA 4LRTA 3NSXA 3KZPA 3MUXA 1CIUA 1OM0A 4N6FA 3E2QA 4AB4A 3UJEA 4ATWA 2ATSA 4GIAA 4K2SA 4BY3A 3A3WA 3R79A 1H1YA 4LAUA 1PVNA 5DEZA 1VIZA 3ANYA 3EXSA 4JPGA 3WQGA 2ZXBA 4QE5A 1TR1A 4PTWA 1IWBA 1OWQA 3GYEA 4ACZA 2W0UA 4RUBA 3RPDA 3O6AA 2OWCA 3B0UX 1BF6A 3MU7A 3U5UA 2V6AA 4CN6A 1N8WA 4Q7BA 3CMJA 1VYPX 3WDRA 2OLHA 1XI3A 2YBUA 4DHGA 3FIGA 4DAIA 1RR2A 4FNSA 3VAVA 4JTGA 3VDCA 2VD9A 4YIWA 1KKRA 3WD2A 2POZA 2PDMA 3G3DA 3GAKA 1E55A 5FAGA 1UP2A 3OZYA 4JIEA 3W01A 3BGAA 1CLVA 3G1DA 3HV9A 1ECEA 4IMEA 1VS1A 4D8ZA 3M5ZA 5JIPA 1V03A 4AQLA 5FF3A 3PZMA 1T8QA 2P3ZA 3DECA 5FD0A 3W6YA 3H21A 4GYKA 3GYCA 2HPIA 1WDSA 4J27A 3GU1A 4Z0JA 3W7NA 1BPLB 1A5NC 1KLYA 3E12A 2I5IA 3EA1A 2ZRYA 3SIZA 6ALDA 1CZ1A 2Z25A 3W2NA 4O0KA 4RNHA 3OBEA 1TJ2A 3T2PA 1PHQA 1XFBA 3GC4A 3ORWA 3N9SA 4NZCA 5AY7A 3BQ5A 3WDHA 1F07A 3ITTA 1PTGA 3SRDA 1ZUAX 1R3VA 4OIFA 2ABAA 1EYWA 3UPBA 3TQKA 4GE8A 1DQUA 5IXEA 5FEWA 4DXXA 4X61A 1VFMA 4AD3A 1VFTA 4NAEA 4QGCA 1A5CA 3AS1A 4QG8A 1WZMA 3D47A 5FJOA 2VRJA 1H09A 5JQ9A 2V2CA 2YZRA 2EAWA 5CGTA 1AL8A 1W9XA 4MG4A 3VIIA 4CN4A 4NZ1A 2A0NA 2DP3A 4QS5A 3N3TA 4JYEA 3EWBX 5HUPA 3SUSA 2ZKMX 3HQ1A 4FS9A 1XIMA 3IV3A 1LOQA 3V7PA 1SR9A 1YKWA 3C2YA 4FXSA 4QR6A 3BW4A 3AHZA 3APTA 1J01A 3W2MA 5AOUA 1R0MA 1QHPA 4H9MA 2AQWA 1XQKA 1JAKA 3LGDA 3DG6A 1LOLA 3S6TA 3KCOA 2ZQ0A 2HBVA 5LA1A 5DY2A 4HSNA 4LPCA 1PEZA 1F73A 3SAZA 3ARTA 1SZRA 3CL6A 3KLLA 3VOGA 1Z8AA 3W86A 4QSHA 2DZTA 3H2FA 1EPXA 4JTDA 4KRTA 3GO2A 3DYMA 1WNOA 1HTIA 1XBXA 4EK7A 2FFCA 1TQXA 2ACRA 3UQNA 1MYRA 3BMVA 3PFMA 2FJUB 3MC5A 3WH7A 3LPOA 1PPIA 3BAKA 4WOQA 4ONVA 2FPTA 3EXTA 3PM6A 3PJWA 2J47A 4I6VA 2QJMA 3LBOA 2Q71A 3TTYA 1SFSA 1OB0A 4LVAA 3B0PA 3VGGA 3PAJA 2VHLA 3W9ZA 1RJRA 2CCRA 1FWJC 1AD1A 2ODOA 5XINA 3DFTA 3VFLA 2HS8A 3MBDA 4TUFA 3OOQA 4P8XA 3LQGA 1QHOA 3CT2A 2J79A 3TYZA 5GJMA 3TIMA 3SQLA 1S39A 3VZYA 3AXKA 2CZDA 4HCDA 3G1FA 4QFUA 2O92A 5DRCA 4RXFA 1HW6A 3IS4A 4HA4A 1VGAA 4GRSA 1JRBA 2VKZG 3O63A 1KLZA 5IOBA 2QUVA 1XISA 3ARXA 4MUZA 2BBFA 5JH1A 1XINA 1KBJA 1NFGA 4IF2A 1VFOA 4DF1A 4I8DA 3TXZA 3QSRA 3T07A 4PULA 2PGEA 2W79A 4LT9A 3P5ZA 1FFRA 1UR2A 1LL6A 5FAJA 2AAMA 3CT7A 2YGYA 5HAOA 1NF0A 4D6FA 2CZVA 3SBFA 3WH5A 3WD1A 5HWMA 2J7EA 1E0WA 3VKBA 2GWNA 4GXPA 3FAXA 3KRZA 3UWZA 3MKVA 2YXOA 5EYWA 5EA9A 2X1RA 1TJRA 1KRCC 1LLOA 3ZT5A 4REQA 3GLCA 3G6MA 1M7JA 5ABFB 3K1DA 4PMYA 4HPJA 3HURA 2PBOA 3UJ2A 2CLFA 5D09A 2PWGA 4U10A 3BLPX 3VCCA 3G1SA 1AH4A 3T9PA 3UWVA 3IIXA 4MZYA 1QW7A 4GVGA 2IS7A 1Q6QA 1OFQA 3S2MA 4NVTA 3HZ3A 4QJ1A 1XWYA 4OECA 2NLYA 3C0QA 8A3HA 2XIQA 5HINA 4GJIA 1OK4A 4M6PA 4B5SA 4FNPA 1TVLA 3WNMA 3AHVA 5HOSA 1UZHA 1SVDA 2Q6ZA 1EUNA 2WCAA 4ZR8A 3T2QA 2CLLA 1NWUA 2IQTA 4HPHA 4GACA 3CASA 2NWSA 1WOBA 3TU9A 4K1WA 2BGSA 1GVOA 1AW5A 2WZHA 4NYUA 2WANA 2J7GA 4XZBA 4ZO9A 1DBTA 2OO0A 3W76A 1ISZA 5JBEA 3W38A 1UD6A 3B8SA 5E9AA 5AYXA 4EP8C 3QV8A 1E15A 4XIAA 1VLIA 4E4UA 4EPEC 3S3GA 3FYOA 2HWGA 5TNVA 2J7BA 3D6NA 4TXEA 1O94A 1A80A 4O16A 4HSOA 1GJUA 3ZQ9A 2F8QA 4RR4A 4Q8MA 3TV8A 3VIFA 1W1IE 3NL3A 4NP7A 3E3HA 3RMJA 1EDTA 1HG3A 4I9TA 4WRHA 4H9XA 3TR9A 3PWAA 4ROPA 5PTDA 3QYQA 3BJTA 3I6TA 4QAWA 3LY0A 4HHLA 3ZJKA 5JBFA 1FWGC 3VNZA 1UROA 2ZX9A 1OGSA 3WQCA 5H8MA 4DJED 1E6NA 3KTCA 2R1PA 4CNOA 1P6WA 1LRQA 4MTVA 5A6MA 3NQEA 3QPEA 2GQAA 2H90A 4IIBA 1ZQ5A 3E0VA 1N8FA 4WHBA 3W7OA 1K9EA 4Q7IA 3GBEA 4MJMA 1JPKA 3G0XA 3BARA 5U4NA 2FIQA 4FNTA 4GLEA 1PTDA 2A3BA 5DANA 1SZFA 4GQRA 4GX8A 2F6XA 3ZSTA 1UHVA 1S1PA 5D38A 2DV0A 4HK6A 4XSLA 4LS0A 3PB0A 1FBAA 2A5HA 3BWWA 3V1HA 4JTQA 1VB9A 5A8MA 3QTPA 4QS6A 4NNAA 2HNEA 1RSCA 2XSAA 1VFFA 3NURA 3MBFA 1H7OA 4W85A 1TPB1 5IFTA 3OTRA 3OQEA 2P76A 4OQVA 2PRHA 1NAL1 5C9ZA 3ZYZA 5CZJA 4Q3MA 4HJWA 4H6RA 4MZ1A 4L56A 5CLWA 1K3UA 1POKA 2QCLA 2Z0IA 1V4YA 1XKJA 1EP1A 1HFBA 3KFTA 1TTPA 2J13A 4HQVA 4C6PA 4UFKA 1Q6FA 1MEIA 2OX1A 4BI5A 3E2VA 3CMFA 4DZAA 4LYQA 4NHVA 5L9FA 3E38A 1W37A 2OPJA 4UFMA 1UOKA 1XLJA 3AIWA 1UR9A 1J93A 1EF2A 3TC7A 4AW7A 1X6LA 1XYMA 1P4CA 1VIWA 4XO7A 1EQPA 4OZOA 5HATA 1X97A 4K38A 2D0HA 1U30A 5BRBA 4UQCA 1IEWA 1CB7B 2NQHA 3CIWA 3NZQA 4X0NA 4DI8A 3G2GA 1C92A 3NEVA 1PDYA 1WYIA 4UR8A 5AYZA 1J0JA 4UTKA 3STFA 2Y61A 3LOTA 1DYSA 2G50A 2R91A 2VFIA 4GZEA 1LT7A 4UZUA 3HO8A 2QJGA 1F8MA 4U4MA 1RXOB 1QNVA 2QUTA 1ZALA 4AY7A 2WVVA 3VU2A 3TTQA 1FXPA 1TX2A 3MDWA 2V3EA 2X1UA 1YPFA 9XIMA 3GDMA 3M5YA 4J3TA 1LYXA 4JFWA 3TCEA 5A69A 3UZZA 5LIXX 5LNSA 2HNHA 4XD3A 3UW6A 1C7SA 3QY7A 1Z6KA 3AS3A 1H7PA 1PYFA 2PURA 2WPBA 3S1UA 3ZT6A 1ZGDA 1VFLA 2PDGA 4B92A 3RITA 2RH9A 3PG9A 4EACA 3ZLFA 3N9RA 4X3ZA 5A95A 2GSEA 4MB1A 2QJIA 1TKKA 3VNJA 1LCOA 2BSLA 1D2KA 4C5YA 1SSDA 1AW1A 4HK5A 5CPLA 3ANUA 4UCGA 1QO2A 1ADSA 3W1AA 3U0HA 1M7XA 2VFGA 1QAPA 2VGFA 4IP5A 3LCXA 4F9DA 4YS1A 2XH7A 2ZUWA 1G67A 1UC5A 3UNTA 5DQPA 5AECA 4FMVA 1MDLA 4DJFC 3WQDA 1GZJA 5IHRA 4Z1DA 3BSMA 3MP4A 1QTWA 3UXKA 2BNJA 3WLSA 3MUZ1 3S5NA 1CGVA 2X30A 1ISVA 5L6UA 5E0CA 3WZ0E 5C9XA 2HQAA 2IKGA 1W91A 5HUOA 3CV2A 2Z6IA 4AWUA 3URQA 1A53A 1CX9A 2ZTJA 4PCSA 3IARA 4NI3A 3GFZA 4AC1X 4H6QA 1B9BA 4ECLA 1KGUA 4YYFA 3RO8A 3GM8A 3C3UA 3T08A 5I2UA 4US5D 3AU2A 1P7TB 2QDDA 3PP7A 4A8LA 1CGUA 5KZDA 3KP1A 4QCEA 2W67A 1W32A 1U1JA 1CENA 4GJJA 1GJWA 2QCHA 2OGYA 1XLIA 2UY3A 5I3IA 3BLEA 3P61A 3EWXA 3THUA 1ZZMA 3UXAA 3N6QA 4NILA 4AD0A 4MAVA 2VFEA 4JHOA 2JGQA 4Q8VA 2QF7A 2W62A 3UETA 3VNLA 4XD5A 1F05A 7PTDA 4AYGA 1YTKA 4A05A 2Z1SA 2ISFA 4PL1A 2Q8ZA 1GVFA 2Y4SA 5I02A 3I10A 3CXOA 2ZA3A 3APYA 4HGXA 4A3RA 2VEMA 3PSWA 3F03K 5CJ5A 2HRWA 2FLIA 1HJUA 4LBUA 4OU1A 4OVXA 1REQB 2CIPA 1XSJA 4XKYA 4GYJA 1NF7A 4EPBC 1TJ1A 1OABA 3SFWA 4I6KA 3OBKA 3S83A 1EGVA 3EMQA 3VNMA 5BOEA 3UWEA 1DHPA 4F2BA 2WKJA 2EXOA 4IIEA 3DIPA 3R0KA 1I2PA 4UTWC 1WUFA 2E28A 3OHMB 3NQ2A 4KIRA 3ME3A 1R9ZA 3WLIA 3UR8A 1DOSA 3WBAA 3COTA 5CEWA 1AJ2A 2ONEA 3UG4A 1Q2RA 1ONXA 3UPMA 1J12A 5KITA 2W92A 3GG8A 1BWVA 3ZVHA 4HOZA 2ZZ6A 3ARVA 5HMEA 2PWHA 1I2QA 2IUZA 4LGXA 4S3GA 2BGQA 3GVVA 3RIKA 5J5RA 3PZIA 2E77A 2X7WA 4MNLA 2W9MA 2R82A 2RAGA 1V79A 3RRAA 4QLKA 1F76A 1GEQA 4DZIA 3NUKA 3WELA 4FALA 1UQYA 4KFNA 2YDSA 4Q8UA 4DBDA 2RFGA 3W84A 1IIHA 3EX6A 2XH2A 4Z0SA 4IMGA 2G41A 2Q02A 1E4NA 3N4EA 3F7JA 3V0TA 4TU1A 4A35A 4J5NA 2XZ7A 4UXDA 4ZO7A 1IWPA 2I14A 3PJXA 2CERA 1F3EA 1B30A 1FH8A 1XLFA 4UFHA 4X9YA 4ZTYA 2Y8UA 4KCUA 4NRRA 3W6LA 5DT5A 1LQ0A 2VGBA 4LBSA 3AIRA 1J0IA 2CLMA 4ZL1A 2EQDA 3KLKA 3HPFA 1Z32X 3T0AA 4GG9A 1Q7QA 1BYCA 4MUPA 3SCNA 3W1RA 3C0JA 3H2MA 3BG5A 4RE2A 2XSBA 1GOIA 4KETA 5DMYA 1UWSA 3TQ0A 2FHFA 4FX6M 3RU6A 4Y2WA 1QPNA 1E51A 1NFBA 4HOXA 4TTGA 1Y7VA 3B8WA 1YHTA 5D02A 1UP3A 4WKFA 3LBMA 4JKLA 3CLMA 4IFKB 3V18A 3ITXA 5T8GA 5T26A 4HNCA 2ZUSA 5G5IA 1HXJA 1VJZA 1RCOB 3EPOA 4J1OA 1UH2A 4V33A 3VE9A 4PMOA 3AHYA 1PZ1A 1SW7A 3SY1A 3F2DA 4A3YA 1MFUA 4DO6A 3LQLA 1ITUA 4UB9A 1TWDA 3SCQA 3NAVA 3LTYA 4QNEA 3PB2A 3HGOA 3GNDA 2VRKA 2VC9A 2OOFA 1D3GA 3SURA 4WDUA 5I06A 3MMWA 5CZ0A 4HP5A 1R7OA 3OGSA 2QIWA 3NOEA 5MKGB 4LW7A 3LGEA 1P0BA 2D2OA 2JEQA 3BV7A 3GUWA 3UY8A 1VBGA 1WKFA 1YNPA 3S1VA 1Y5VA 4WD0A 4GZ7A 4ZQPA 4BQ4A 1JULA 1NM9A 2OODA 3H2AA 1I6NA 3ZOAA 1Q7MA 1KM4A 3LERA 1XCFA 2WMKA 1I2NA 4JQ4A 3QW3A 1TMQA 2NXGA 5ECVA 1WKYA 2WSRA 2VX6A 3R25A 3L9CA 2GVEA 4UOJA 1S3HA 2ZC1A 2Q8LA 2GL5A 4AMAA 4M80A 2RDUA 3LRMA 5JIWA 2XUCA 2D73A 3IGUA 4BS0A 1M5WA 2IPWA 1S2CA 3NQ6A 3P7YA 4JTEA 2OU4A 1J6PA 4H01A 4EANA 3WK1A 4KWWA 3ZSSA 2BFGA 1VF8A 1WOAA 5A5WA 5LZLA 4PSPA 1FHUA 1L6GA 2X1TA 3N2OA 4TX6A 4LVGA 4FA3A 2QVNA 2YCIX 4JIQA 5CCZA 4C1LA 2Y88A 3LPFA 3SCOA 1GYLA 5TAOA 3UD6A 2PI6A 2V5KA 3UEQA 5F2GA 2HPMA 2WCSA 3R0DA 5BXTA 1TMLA 1S2VA 5LGXA 5GJNA 4CEXC 1OX5A 3TKFA 1AMYA 4UMBA 3VD4A 5A2BA 4L61A 1DJHA 3GR8A 3RCYA 4AZ7A 1FDYA 4JAWA 1ZNNA 1TV7A 3WF0A 1VRDA 4HMCA 3PS7A 2E68A 3UG3A 1ECQA 3CAWA 5B7ZA 1XICA 2BOGX 4IZGA 4MIMA 4ATDA 1EJXC 3VC6A 3VK5A 3T09A 4AMCA 3AO0A 4B5NA 3CAKA 5BWFA 3SI9A 4XUGA 3AMGA 4GIYA 2OWXA 2DPEA 1B31A 1EJTC 3KVJA 2WC3A 3RJXA 1C8VA 2FJKA 3MUIA 3ZM8A 2OT1A 4NJHA 4DVOA 5A6JA 4O0QA 3WSUA 4YCOA 4XO6A 1PZ3A 1IEIA 1O5KA 3S2LA 4CU6A 4AEEA 3IK4A 1FQ0A 3AWOA 6PTDA 5I0DA 3NYDA 2AQOA 4GI4A 1OZQA 4AHPA 2QULA 1S2AA 5HMFA 4PMXA 3EKLA 1AW2A 4HTYA 1UCWA 4HPGA 4O28A 3IACA 2BGNE 4RPQA 3KHJA 1OJXA 1G0CA 4PSRA 4JICA 5I5RA 1FWAC 4UQEA 1D8WA 4FP1A 1W8GA 4BQ2A 1AZ2A 4MFEA 2OTDA 5F1UA 3PJTA 4QNWA 3PTDA 1M01A 3TDFA 2HMCA 4A3UA 1NDZA 2JKEA 1ADOA 3GKFA 1AMKA 4MWAE 2GWGA 2W91A 4S23A 4ZOAA 1BGAA 2FVKA 3VPLA 1DJIA 3VUSA 1ICQA 3UF9A 3ICJA 5K4XA 4AIUA 1H49A 1DWGM 4B3ZA 1FWCC 1VENA 3M0ZA 4Z1AA 3M0VA 3SCTA 5DO8A 4GUJA 4QX4A 1P0DA 1XLHA 1RJPA 3N2XA 3BG9A 3GNRA 4WXYA 3FJNA 4R5EA 4CGTA 4WGHA 2WJDA 3C2EA 1Q63A 5AC4A 3O0FA 4ZQMA 3DFOA 4BFAA 1PO9A 2TYSA 1OG0A 3LXBA 3JZUA 4GWEA 4XSMA 4AD2A 4PTNA 1K4HA 3C4UA 3NO5A 4HNVA 4DIAA 4B5WA 3EX4A 3WLRA 1PKMA 1W1B1 2ZRVA 2X0YA 1R30A 3VOIA 3UZWA 1YIXA 1E1CB 3VGBA 1UD3A 2DGAA 3THQA 2ZUTA 4ZZ9A 2RDXA 2RGLA 4PRRA 3KM8A 1V0MA 3QZAA 4I90A 1SQ7A 1TE1A 4C7DA 2BZNA 2OSYA 1R47A 2I9EA 5I00A 1O1ZA 4FPSA 1D9EA 2ISSA 2C15A 3BAJA 3TSDA 3EMZA 5D30A 3B9OA 4XZWA 4YNGA 2W4XA 3DH7A 1M9HA 5LNUA 2OX4A 2R24A 4LV9A 2QW5A 3G8RA 3WH6A 3QTGA 1WAUA 3W74A 2QVHA 4GX9A 1BFNA 1NDYA 3LXCA 3O1NA 3GB6A 3BAXA 3BCDA 2BVTA 3HG2A 1R3YA 4Z08A 7A3HA 1G4PA 2RUSA 3SSJA 2VGGA 2PLCA 3BOLA 3WL1A 3UZ5A 4OOZA 4KRZA 4W93A 1GYMA 4L80A 1TA3B 4GD0A 4S38A 3ITGA 2QR6A 2VO5A 4DWDA 2P5NA 3U57A 2YDRA 1TPUA 2XGIA 4YLWA 3NQ8A 2Y7EA 2Z2BA 4FLOA 2V3FA 3VNDA 3Q45A 4L7ZA 3W1LA 4FNQA 1IYXA 4O8AA 3J7HA 1F74A 3P8JA 5DXYA 1TWZA 2OWWA 3DHUA 2QYGA 3R10A 2DSVA 3MI3A 4EOUA 4PCFA 1JZ8A 3BPWA 2ANUA 1JG9A 4HU3A 3SFKA 4XV0A 3L2LA 3RLVA 3GHRA 3PWIA 3N3MA 4CKQA 1FWSA 4Z2GA 4MJZA 4GC3A 4JKMA 1H61A 1UG6A 2J8TA 1LWIA 1XBYA 3O15A 3R4IA 3C52A 2Y1HA 2FDSA 4HHHA 4ZE4A 3TEVA 1DJGA 1FP9A 1FHDA 3G0SA 5A2AA 1R6WA 2RDWA 2FTYA 3FY1A 4L1GA 2O4QA 3VGEA 1CYGA 2A4AA 3GAYA 5CH9A 1WDRA 1P6CA 1VC4A 4KH2A 1H1NA 4H00A 4FLQA 5ABFA 3M0JA 1FWFC 3W1NA 3ABXA 2XVGA 3W7PA 4JZ5A 4W8AA 5HJXA 1F3XA 4QQUA 4DJFD 3CNYA 3KVKA 1TE6A 1RP8A 4O50A 1XLEA 2FFIA 4ORIA 4JTHA 3QF0A 1V6TA 1P1MA 5KINA 3P93A 4N9CA 3URAA 3S9YA 1E9ZB 4WZHA 2DIEA 4GCAA 1GONA 4FR1A 3S5ZA 2PTDA 4BWLC 3CUHA 1XR2A 4FSAA 3NQCA 3LCGA 1OX6A 3NZGA 3GVQA 3P82A 1UR8A 1RCQA 1EH9A 4LUJA 2RJGA 4ZB5A 2QJHA 2E6DA 1HKWA 1QOXA 1A4MA 4AWTA 2PWVA 1MWOA 4D6DA 1TIWA 4Z42C 2WSPA 1L2QA 1F5ZA 3MKCA 2VJXA 1M65A 4I9AA 2W63A 3IK2A 1DTUA 4B9ZA 3O07A 2PWFA 4PMVA 1NDVA 2FHBA 1OF6A 1DEDA 4PA8A 1ZP3A 1V02A 3CUZA 3EX3A 4CQDA 2WJZA 4YTQA 1TUXA 1H7WA 1Q7ZA 5TBOA 1IR1A 4JQ3A 2WMHA 4LTSA 1U2YA 4PZVA 3HTWA 1HUVA 4UTFA 1DL3A 3DAQA 3WQ4A 3IUIA 4AWSA 1E9YB 2W5FA 5LHEA 3LZ5A 1TV2A 2Z1KA 1Q8AA 1AJZA 2FH8A 2ZYFA 4AIBA 2H9AB 4AF0B 4CNTA 4GISA 4AX7A 3AMCA 3TSBA 4IPIA 4YVXA 3V5OA 1EUAA 2Y8KA 4HA1A 1LLWA 1R85A 5IRPA 2NUXA 3BW2A 2OVLA 4DF2A 1I0BA 3NPWA 2C1IA 1P5BA 3IIPA 3VDGA 2G5WA 2QPUA 1FWDC 4LX4A 2I7GA 5DELA 4O10A 1KRMA 4YVPA 1XGEA 3KBWA 4F0LA 2RHGA 4H2CA 4TX9A 3NTYA 3GXNA 1V6WA 4HZ7A 4Y8EA 4O18A 1QVBA 4PMUA 3NZ1A 3O6CA 1YDVA 3RLUA 2EPLX 1FTXA 3B8IA 1IV8A 2REQB 4D6HA 1VEPA 2IPGA 3CQJA 4XUYA 4GIEA 2GGJA 3R5EA 5LNVA 3T0BA 3BLLA 3STGA 1W9UA 2XDFA 3KXQA 3VMPA 4FIQA 1T41A 4E0CA 1YNQA 1B2YA 3BLOA 4JHMA 4DJEA 3BMXA 1SM9A 2XFFA 3AMDA 3B8DA 4YMZA 4KEUA 4O54A 1LL4A 3C86A 4F9JA 3CZJA 4GUFA 3H8AA 3BLIA 2PAJA 4D8AA 3BSGA 1US2A 3PANA 2PMQA 1HJVA 3KEHA 1KR1A 4L4LA 3EDFA 6A3HA 4OKDA 1LJYA 2Y6ZA 3FSTA 2CLOA 3O06A 4PN2A 3BK0A 3O0KA 5AHLA 1ZTVA 3H54A 1F3TA 3W7DA 1XIEA 4CCEA 1LWHA 4KFPA 4MADA 3AC0A 3IVUA 3LCIA 2VX7A 1TTJA 1Q13A 1S5NA 3UP8A 1IWAA 3B97A 5E93A 2Z4GA 3LLFA 4PMJA 4O13A 3MQTA 3GU9A 3DU0A 1HL2A 4KWOA 3GHUA 1Q4NX 3N25A 1V8EA 4G1KA 1K8ZA 1UOZA 2DZBA 2IXVA 1A5SA 3FJLA 4DM1A 3G1RA 4FOUA 4K8EA 1EO5A 1H60A 1SYTA 4WQ6A 1Q45A 4YTRA 3QMTA 2FZNA 4A4AA 4UCFA 5FIPA 4TMBA 1CXEA 1V6UA 2XVPA 1ONWA 5AZ1A 1NH6A 3M7WA 4NJKA 4OBRA 4H8NA 3A23A 5E6ZA 4GKLA 3EKGA 2YA1A 5KTLA 1UWIA 4F2TA 4N2YA 1FKXA 3W75A 1BD0A 2X42A 1FXQA 3FXYA 3UCCA 4ML4A 3CHVA 4PBGA 4PL2A 2QUNA 2D2GA 1YBQB 1FH7A 3W07A 1QI5A 1SO6A 7ENLA 2GPTA 1KM0A 4IP4A 1C7TA 1XSIA 1ICPA 4OFCA 2WHLA 5LNRA 3MDUA 5CGMA 4KWSA 4GYPC 4LUIA 3GXMA 5EFDA 4H8UA 5CSSA 1EOKA 1Q6EA 3VD9A 4A2RA 2XM1A 3HGJA 1UWRA 5GPRA 2ZE0A 1RQEA 3UR5A 4I9JA 4JGDA 1RVGA 3EDEA 1MUWA 5DRIA 5EMLA 3BTNA 3TJ4A 1KO0A 4YU1A 3VO0A 4GUGA 3K8LA 4HZMA 4IIGA 4AXNA 4Y8FA 2Z1XA 4Y9NA 1O5QA 4G56A 4HT3A 1OQFA 5G2HA 5LA2A 4DM2A 2P0IA 4JTIA 1H5YA 5T9CE 2C0AA 4MLRA 3WBEA 4JY8A 3URBA 3WDIA 1CI1A 4W5UA 1QWKA 5EFFA 3SUVA 3NL5A 3OJGA 2O9TA 3M64A 1XYBA 3WIJA 4HNOA 3IVTA 1P7TA 4RV3A 1W56A 4INFA 3NQ7A 4DYKA 1GVEA 2PWEA 3IRSA 4JDBA 3V1PA 3S46A 2GUBA 3DKLA 3WEZA 1TVNA 1EQCA 3LI1A 1CNVA 4CVUA 4DLMA 1IXNA 4PUNA 1O12A 5H1WA 2E9LA 5CC5A 1EJ7L 1GOKA 5E09A 4PMDA 3OVQA 2OEKA 6REQB 3RFAA 2PZNA 2NSXA 4L5ZA 3AU6A 2DVTA 2UY2A 3WKZA 4EX4A 4C1NB 1X98A 4PUWA 1BF2A 4AZHA 1REQA 4EWND 1LORA 4US5A 3P60A 2X40A 1V3LA 2VCBA 1A5KC 3PZOA 5HBFA 4ML9A 2IPFA 1G01A 4R85A 1R2RA 3RX4A 1SFLA 3KHDA 1PV8A 2FVMA 5ABGA 1G69A 3I6EA 1M7PA 1GTEA 2HBXA 4I5XA 4Q8QA 2I57A 1XRFA 1BLIA 4IG2B 3S1GA 5C9UA 4NKCA 5I23A 3T0CA 3NYZA 3Q65A 3SQMA 4ASTA 3OLGA 3KTSA 2J88A 4PUJA 1TUFA 4CQAA 1W54A 4URIA 4DZ5A 1CGXA 2HZGA 4IQJA 3BOXA 1EHAA 3IANA 2ZBTA 3NQDA 1GZ1A 4HJFA 5HNTA 3CPGA 1R8LA 3GWQA 3GNNA 4DNMA 3TCSA 3LNPA 2XFWA 3ABSA 3GTXA 3GZAA 1Q6CA 2QEZA 1E5JA 4L4MA 4YWIA 4B90A 5CC7A 3TAOA 3SY5A 3A5VA 1BXNA 1XFCA 4ZB2A 4UOQA 1XIHA 3E2SA 3UR7A 1LQAA 1S5TA 3NGJA 2ADAA 1GVQA 2A3CA 4L9YA 2DVXA 1PKNA 3WJWA 1L0PA 2YPIA 4A3HA 1Y5WA 1TV5A 4H9UA 1J0ZA 1UH4A 2X05A 4GGBA 3W1TA 3N12A 3W7JA 3EZ4A 2ATMA 3GXPA 3MCOA 3IAQA 1NWTA 5K4ZA 2VENA 1EIBA 3R12A 1TWWA 3MVTA 4PB4A 1FKWA 5A2CA 1RK5A 4C5ZA 1JFHA 1XLBA 5H8UA 3HQOA 1GQLA 3N1AA 3WUEA 2VX5A 4LYPA 3QQ0A 1XC4A 3S2NA 3L2IA 4RE0A 2JQXA 3QFEA 2JIEA 5K2ZA 1DKWA 3FDKA 3LI0A 4IP7A 3W81A 3G8EA 3NIYA 3BG3A 3AHXA 3NDZA 2Y2WA 4LB4A 4CQBA 3F4WA 1IT7A 3QV9A 4Z1BA 1PYMA 1EJVC 1SZGA 3KDNA 4N9DA 1WZAA 5M17A 3TXVA 2EJ1A 4P2VA 3OP2A 5LXXA 1E6RA 3U7BA 2QCCA 1UR0A 2VELA 4R88A 3DGBA 3GW3A 4MGGA 1OBAA 1V77A 1DQXA 2PDYA 4RW5A 4DO5A 1B90A 3TN5A 4D6GA 3U6WA 1KCXA 3L7RA 2F9RA 3B03A 4PUMA 1GG1A 1AG1O 2TAAA 2PGRA 3TJIA 5MKGA 4H3DA 4LU0A 1PXGA 2CETA 3NO1A 1QI4A 3HB9A 4KCVA 1JNDA 5F7UA 4E8DA 4FZIA 2ZUUA 4JCLA 4GI8A 2VL4A 2CHNA 5MF5A 4ERGA 1LOSA 3L4WA 4Q4RA 1QCWA 9XIAA 3V0SA 2OOGA 3VD5A 2BY3A 1VFHA 5CPQA 5GNYA 4EIVA 2DZSA 4DBUA 4UTUA 3NPXA 4HK7A 5DX7A 3QSTA 4D9PA 5C2XA 2AL2B 1UYQA 3D3FA 5JUVA 3WQEA 3ZT7A 3OG2A 3QN3A 2J78A 4V27A 3WG6A 1EGZA 5ABHA 3PPGA 3E74A 3CBWA 1XM3A 2QUMA 3WYZA 2PCQA 3SR7A 4J3ZA 4J35A 2XVKA 2GDUA 3BLFA 4JIRA 3MV01 4WDXA 3NEHA 1HP5A 3EOLA 4CCCA 1A50A 4POCA 3TUUA 4CD6A 3G1HA 5KZMA 4AG0A 5BMWA 3CL8A 5D9MA 5CAHA 3I6RA 3BV4A 4GY1A 2FQIA 1XD1A 4CU8A 1AJ0A 4PMRA 1OC6A 3GUGA 1JDCA 2L5HA 3BOFA 3DFHA 4DQWA 1E6SM 5LIWX 2Z26A 4M1BA 2NT1A 2BVWA 4LUSB 1AQ0A 1XUUA 4MJ2A 4IJRA 4QEHA 2I9UA 3OGVA 4GQ0A 3ZZ1A 5JVLA 3M0HA 2FZ9A 5A8QA 2DZVA 3KRBA 2BASA 3LX9A 6TAAA 1VEMA 3WY1A 4U5KA 3G1YA 4GZIA 3UXIA 4JTCA 2WAGA 4DX3A 4Q7NA 1YE4A 3ARQA 4LOCA 1CXHA 3WFAA 1G1YA 4IX2A 4AY8A 3JVAA 4N4QA 1EOMA 2AL1A 4O11A 3SZ8A 3TN4A 2A3AA 3FYYA 1J18A 3CZLA 1H0IA 1BQGA 3IRDA 3EWWA 4NJJA 3A4WA 3V3WA 1BGGA 3ONBA 1LUCB 4Y96A 4JTRA 2QF8A 3H12A 4IQEA 2HDJA 4MHBA 1VFUA 1X7IA 1KBBA 2BS9A 2WMFA 1UD5A 2VVNA 4D8LA 3WBWA 4RW3A 3W7KA 1HKJA 2VEGA 2PDWA 1A3HA 2DH3A 4O52A 5LSMA 4BHYA 2YA2A 3M41A 1KBIA 4JY9A 4AD4A 3UNDA 2JKAA 2LLEA 3AZRA 4B5UA 3SCUA 3EPNA 3WFZA 3HN3A 4GMEA 1KWKA 1KM2A 4W8LA 1JF5A 3VX0A 4AH7A 4LV4A 3MYPA 2OSXA 2VDHA 1EO7A 2QCFA 2QPXA 5H2ZA 2DU2A 3KL0A 1V0LA 2WHJA 4MNKA 4O1DA 4KGJA 4J28A 2CKRA 4KRUA 1HO1A 3A22A 3ITYA 4ZOBA 3HMCA 3P0XA 1SSGA 3BVJA 4GUIA 2BB0A 3ABOA 3L5MA 1YYAA 2D69A 4CCDA 3STPA 4UC5A 2V63A 1O5RA 5KMYA 4H9ZA 3WUFA 3RILA 5D8WA 4WJ8A 3GXTA 1EIXA 5LXEA 4GQGA 4AISA 2NQJA 4P5UA 4NASA 4JYDA 3NQBA 3KRSA 1P6BA 3W71A 2GQ3A 3ZJ8A 2ZZ4A 4JNMA 2PUZA 2VXNA 3NDYA 2FGBA 2XGZA 1Y65A 4CVWA 4B91A 2FVLA 3PZTA 4QE4A 5AC7A 1YRRA 4OUEA 4WSKA 2Z6JA 4XQ6A 1AA1B 2CLEA 2PTZA 2CC0A 5F1VA 4BQ3A 1FWTA 3WD0A 1TVPA 2A6NA 1GOOA 5AZ0A 4KCTA 3R7MA 4J40A 3K1GA 2J8GA 5AC6A 4XG1A 2VEKA 1XIGA 3R43A 3OLEA 4JFUA 4S2CA 3UBPC 1R3RA 3EKZA 3UJSA 3VD7A 4JD4A 3CUJA 1ADDA 5A6SA 3ZR5A 1SO5A 3PF3A 3CV6A 1WE5A 2GGGA 3CB3A 4GQQA 4HB7A 1YDNA 4PTMA 3FGCB 4GABA 3NNTA 1SR0A 3CUIA 3HGRA 1OFRA 5C55A 3BH4A 3CUGA 4G9PA 4IPJA 1YDYA 4KCWA 4XZ9A 2VEIA 2ZXQA 4UTTC 3LCHA 4DUVA 1Q66A 4CQ8A 3FNDA 3PWGA 7REQB 2C0HA 1OSEA 2YB4A 1NSJA 3RJYA 7XIMA 4RNJA 1ZS2A 5I3FA 4G6CA 4GJ1A 1XDMA 4GUHA 4E38A 3S8HA 7TAAA 1CEOA 2VFHA 3LG3A 1LG2A 1V3MA 2E67A 3AWNA 2ACSA 2RJHA 2YDAA 5H8PA 1TZ7A 3H2OA 1PIFA 2PTXA 1LF1A 4AX6A 3W7QA 2B0MA 4DUOA 5C7VA 1OEPA 2HS6A 3ITVA 6XIMA 4KFOA 3TYBA 4F3HA 1FFQA 4W5ZA 3LHWA 1N8IA 2H8ZA 4AXKA 4OWGA 5TIMA 3VABA 5HJYA 3PHAA 4MYXA 3SEPA 2XN0A 1YX1A 2V2HA 1MNZA 3BMWA 3CAVA 3QVQA 1OHLA 2PEVA 1HJSA 3TOPA 3CU2A 3F1QA 5FL1A 2R9RA 1G4TA 2XFRA 3W37A 1H51A 4N02A 1B3OA 1MUMA 4GH3A 3LRLA 2ASHA 2IQDA 1RHCA 1K8XA 3S1XA 4D1IA 2NT0A 3ANVA 3BZGA 2VR2A 4MB5A 2B7QA 3N19B 4PE8A 3CHFA 4WKHA 1NOUA 1UD8A 1BVWA 4KMQA 1VYRA 4AVOA 4DBSA 2A85A 3GH4A 4J3VA 4HN4A 3NZRA 3MZNA 5D2YA 1V0KA 4JQ2A 2G3NA 2VZUA 4IMDA 3KS6A 2QCMA 1WKEA 2BXVA 1QU4A 3AIBA 1E4LA 4H19A 3QR1A 2YYUA 4LY8A 2PFHA 4AIEA 3T7VA 4K6AA 3EAUA 4LFYA 4Q8OA 4LYRA 4QCFA 1AZ1A 1KFJA 4U28A 3NR0A 8RUCA 1Q6GA 4Q4PA 3DGRA 2V3GA 4JEQA 3SUTA 1XYFA 2OXNA 2C3ZA 3ZWSA 4S3BA 2OLSA 2DZXA 3C8FA 1CGYA 3MA8A 2ZUMA 1JZ4A 4KWUA 4ZVJA 2E25A 2YA0A 1QUMA 3UG5A 4DJFA 1N55A 3U5YA 1RUSA 3BLKA 4FR6A 1HQTA 4ERIA 4IIDA 3K30A 1NU5A 4N4PA 3GR4A 3VFCA 4G8TA 4LCRA 2MANA 4DLFA 3BE7A 3QRHA 4H7VA 3O2LA 3ES7A 4ZQOA 2A21A 5D2VA 4MSSA 1XC6A 3VI2A 1Y0EA 5HNRA 1X7FA 5E70A 3N17A 1JPDX 5FF2A 1CLKA 3HBLA 4RDYA 1M41A 2H9AA 3DHDA 4MKNA 3G22A 4AF0A 3VIPA 3DFPA 1KFLA 4JTSA 4HA3A 2SFPA 1NQ6A 2PWUA 3TH6A 2D3LA 3WH9A 5HQMA 4C6DA 1IZKA 4E2VA 3SN4A 2R1KA 3RLHA 1Y8BA 3WMCA 2C13A 3P67A 2AGTA 1CDGA 1ODUA 4F2UA 4B5TA 3R8RA 1F2JA 1BKSA 2EO7A 3KL5A 1XF0A 1EHNA 1TB3A 5G2WA 3DC0A 1GNXA 2F2KA 4GNKB 1RALA 2OFJA 5BU6A 2KAUC 3UZJA 2VX4A 3GNPA 3U2EA 4QJ4B 3NPUA 3XIMA 2XISA 1PBGA 2A79A 1GW1A 1NWSA 2REQA 3EB3A 3DX5A 4ZQRA 1XLGA 2PP0A 1GJPA 1B5TA 4UMAA 3RO6A 3MHGA 2BODX 4NSBA 4HN8A 3E9AA 4FOKA 2Y70A 5G1YA 1XH0A 1JUEA 2XM2A 2QAFA 4EF8A 5I24A 3GFYA 1EA9C 1E3ZA 1I2OA 5DXXA 1JCXA 1B4KA 4UTLA 3OPSA 4FX8A 1AH0A 2CFFA 4Q33A 3LM3A 2ZC8A 2UY5A 2JK2A 5I03A 1HJXA 4UTWA 4GY7A 2Z7KA 2QDEA 3K8MA 1E4MM 1DORA 4C6KA 1EX5A 3W0KA 2ZICA 3ARYA 1C8XA 5FJTA 4WF7A 5DBTA 3WLMA 4PMNA 2G3MA 4K37A 2V5BA 1TFVA 4JFSA 1UKTA 1RK6A 5C8BB 5E9XA 4W8BA 2YR1A 2VEPA 3HOJA 3AIVA 1E72M 4GIRA 4NAEB 3ARPA 1HX0A 3NPVA 2I56A 3DFQA 1O66A 4M82A 4ZMGA 3TJXA 3S5YA 3UU0A 3TN3A 1GPWA 4FK9A 4LS2A 2F38A 4DO4A 3ITCA 1KV5A 3H70A 2ZZ5A 4DXKA 1A3XA 1SO4A 3FKRA 2PGFA 4YCPA 1UBPC 3QW4B 3I3BA 3N2BA 3MUY1 1OCQA 2D23A 1CT5A 1XRSA 3T2OA 3LV5A 2XYLA 3PZGA 3MSYA 2QDHA 3SGZA 3QGVA 3T8QA 4LVBA 1ITCA 2B7NA 1JQVA 3SO7A 4JQ1A 1JCYA 2X8RA 4PC8A 4F0KA 2V5DA 1U33A 5I3JA 1JXJA 4LAZA 1LROA 4PBFA 4ZSTA 5M5DA 3FN9A 5DMLA 1J8VA 2CITA 1A0EA 1QT1A 4W7WA 3B8UA 4WJEA 4O1EA 4EXBA 1JPHA 4S3FA 1GOMA 4AZCB 1JPIA 2O0TA 5FEXA 4GOAA 3JR2A 4QQ3A 1YBQA 4O1FA 3KCJA 4HYRA 4GKTA 4PFHA 1ITXA 3WN6A 2ISWA 4JN6A 1TCMA 2J9YA 2P53A 4XBKA 3N34A 2GOUA 3UYIA 3W7MA 1E40A 3QQWA 3B0VC 3ABQA 2YSWA 2DSKA 3LM7A 4WR3A 4PH6A 4MWAC 1BYAA 3W7GA 3A13A 4JFVA 2XSXA 1OFEA 3HA1A 4O4WA 1MW2A 3IEBA 3QY6A 4XZMX 4HZ8A 3IJQA 1XKYA 1JFXA 1CGTA 3A9IA 4IGMA 1QDSA 4L64A 4PEEA 2ALRA 3VCRA 3CEPA 4ORMA 3W4RA 1ME8A 4Z2JA 2AOSA 5AVHA 5CG7A 1EYEA 2V30A 1KCKA 4QSFA 1AL7A 2QCGA 3KS5A 2GOKA 4C6QA 1A5BA 1GCYA 1R9XA 2WWDA 5G4WA 3K13A 1JVNA 3TR2A 3LXAA 3PJUA 4HNUA 5KZ6A 2MUCA 4DPPA 3AI0A 1GHSA 1UIOA 3PTMA 1UMYA 2PDNA 1HJWA 5IM51 4P61A 4LBRA 1R3WA 1PAMA 2QQ6A 1IXPA 4IXHA 1GORA 4J2MA 5BWAA 3TE9A 2W61A 2VDIA 5CQ1A 4BCEA 1W31A 1U5HA 3QY8A 4D1JA 4XB3A 2FGZA 3BLDA 3L4UA 4P7OA 3I7SA 2VWSA 4DWSC 4Z1YA 3VMNA 2I17A 2YIHA 1OD8A 1K7EA 5F2IA 5REQB 3E0WA 4H83A 1KCLA 1OFOA 4EPKA 2X09A 3E2RA 3FS2A 4O19A 3S47A 6REQA 3KBVA 4C6LA 3M9YA 4GVHA 5F4SA 1B54A 1S5VA 3M47A 1QBAA 2H8XA 4M5PA 2VD8A 3GIPA 2WPGA 3AXIA 3DHFA 5I3HA 3PULA 1QW9A 1E6PA 3MMTA 2VUYA 2WLYA 4GC4A 3H7UA 1A0DA 4QLLA 2BVYA 4IHCA 3TA6A 2PDCA 5CG0A 3DI0A 4TV6A 3GG7A 1V5XA 1J11A 3TFXA 4IG2A 2P8CA 1DVJA 8CGTA 2G95A 3I65A 2ALDA 3M6YA 3F4DA 4GFIA 3LHVA 1MNSA 3HG4A 3HIJA 4OV9A 3WJSA 3UCDA 3M44A 4B3LA 4JL2A 4MPKA 4KF1A 1DV7A 3DBNA 2IW0A 3P8IA 1E5NA 3MZ2A 4WX2A 1Q6RA 1VD6A 3N18A 4J4KA 1LT8A 3VNYA 3BQ6A 1TQJA 3WLPA 1MRQA 1FDJA 3B0YA 1GW9A 1THFD 1G7VA 1QNPA 4J3XA 1UW9A 3GS6A 1YXDA 1O5XA 3N13A 2OT0A 1GPFA 4NT0A 4MDOA 5F4WA 3B9EA 1YPXA 2QGYA 1DE6A 1TZ9A 3NZPA 3ZLGA 3WQVA 3MO7A 3ZJ7A 2OELA 3MCNA 1UIPA 4QITA 2C1GA 4HCHA 1VH7A 1JCMP 4ZOCA 2AQVA 2IPJA 5CSUA 5DMNA 3QYSA 3TWBA 1L9WA 1K6AA 1CTNA 1H62A 2C14A 4XK2A 4ZENA 3VGDA 1RCXB 4BKNA 5CSYA 2WC7A 3FW6A 3HM7A 4WGXA 3VIKA 2GVGA 2VP8A 3OZOA 4P7QA 4R3UA 1SZNA 2PRLA 4LAMA 1P1XA 3IVSA 3PNUA 3RU8X 2PBGA 1J2BA 2ZA2A 4KT2A 1PX8A 3NQMA 3CTTA 2EG7A 1ELSA 1N82A 3QEZA 2Z1WA 2CXGA 4WK9A 3E5BA 4ADSA 4H7CA 4KS0A 1PUDA 3M5VA 4MKVA 1KM5A 4DBWA 2DIJA 4FXJA 4C91A 2DT2A 4H8HA 1C9WA 4TX8A 2VT0A 1J2WA 4HU0A 2WO5A 2YCLB 3QBUA 1OYBA 3CMGA 4KGLA 2GZXA 5AB3A 4NNCA 1EA0A 3F4NA 1G4SA 3EWUA 3W73A 2A6LA 3DYOA 3CH9A 2WYSA 1TIMA 3CQKA 3LPGA 3WBYA 2ACUA 2NX3A 2ZOXA 1WBJA 3S1WA 3ARZA 2XVNA 3MUAA 4Q8WA 2XINA 4C65A 3MW7A 1R2TA 3T4CA 1EC9A 2EPHA 1EB3A 3THAA 3RX2A 1SUXA 1E1EA 4YJ5A 1B4EA 5A8OA 3W85A 1IXOA 5EGRA 2EPMX 2OYMA 2YL6A 3DOPA 1JZ5A 1B9ZA 1T96A 2OO6A 2DJXA 4KPLA 1L8NA 1TO3A 3N6HA 2FZ8A 3IGHX 3W70A 2FZDA 2BXZA 3QV6A 2INEA 3DESA 4M7SA 3S0CA 3MSRA 1HKMA 1J96A 4J3UA 5EB8A 4JXCA 3IIVA 3PK7A 2AMXA 5J8LA 3Q4DA 5SWUA 2IKHA 4CD4A 3F5JA 3HG3A 2ICSA 2AL2A 4EWJA 5C7HA 3LU2A 4UOZA 1M03A 1H2JA 1UQZA 3AISA 4TOQA 1E73M 1H41A 2YFNA 1B0IA 3USZA 2D2JA 1F6KA 3LV6A 3MJYA 3LN3A 3SADA 3FAWA 1T0OA 3PBWA 4AYSA 3WJYA 2IKIA 3M1ZA 4E8GA 3MPGA 3OA3A 1DWHM 2VNCA 1E43A 4EXAA 1TELA 4O14A 1IEQA 4C1KA 2PTWA 4F0RA 3B4YA 3HPAA 4YHGA 5HMDA 3CUFA 1XS2A 5LKYA 1ICSA 3VE7A 1KXQA 3RM4A 4JTAA 5A6LA 2NQZA 4LUSA 2F61A 1DPMA 1GKQA 3P74A 1KRBC 2WZTA 5CPTA 2GJXB 3KAOA 1H3GA 7TIMA 4KKXA 3W2LA 4V1XA 3VOCA 4CNNA 1VFSA 1VPXA 3P3BA 3VUPA 4S1FA 4UQBA 3SCSA 3HFTA 3R2GA 1PX3A 2ZRUA 2HISA 3MV11 4K39A 1CBGA 4DF0A 4IMCA 1QK0A 3ERPA 1EBGA 4ADTA 5IBXC 1T5AA 2QJJA 3L4TA 2NV1A 4Q8PA 1SFTA 3DCPA 5CZSA 3K8KA 4AZ5A 3BGGA 4L6OA 1HKIA 3TAKA 1PHWA 1YNYA 3QGAC 3QC0A 1I1WA 1XH2A 4GNVA 3R11A 3GZ3A 1OG6A 4EKJA 3N73A 1LUCA 5DY3A 2YLAA 4WXZA 4NX5A 3QJAA 1AVAA 1RH9A 1IEVA 4JTFA 2GLKA 5G1MA 3VOJA 4AVNA 3IJ9A 2AAAA 3CZGA 1GVIA 1XX1A 2QCNA 3AICA 2YLLA 4RE4A 3SB0A 2DSZA 2PDUA 3AYTA 1HKVA 5JU6A 1FWNA 3WO8A 4V15A 4AC7C 3T6CA 1BVZA 3WLQA 3Q58A 2G3JA 3AYVA 1JDAA 3OA5A 4BWLA 3H26A 1G5AA 2DJLA 2E1DA 3TNBA 1K8YA 3N2MA 1IQ8A 1OGBA 1OC5A 2DY3A 2GGIA 2PDKA 3ZWTA 1FCUA 1W2PA 4G1NA 1AQHA 3GNXA 4IUGA 2VYOA 3TYAA 2QGHA 2I16A 3DYPA 2WNZA 4UQ9A 3W02A 3TFCA 5HPCA 3GDTA 1UZ1A 3MHUA 2DZPA 1WDQA 2DUZA 1KTNA 4MJ4A 3MVIA 1OIFA 2ZA1A 3QQ1A 1JGIA 4QDMA 3GTNA 1A5AA 3POHA 2PDPA 3RLGA 1JYXA 5G4EA 1BKHA 3M0LA 3FOKA 1E0XA 3LHTA 1U5JA 3BCFA 4GI6A 3E49A 1PCWA 1Z42A 3NXFA 3A5FA 1KCZA 3N2TA 1WO2A 4FNUA 3KRUA 4E4FA 2V68A 1CW2A 4DRSA 5C71A 2BTMA 1HT6A 3VMOA 5BZAA 2ZADA 3UGVA 1FCVA 1NOWA 3QPZA 2QLYA 3LDVA 4QG9A 4BR1A 1M68A 1H63A 5I07A 2A7PA 2X0SA 1PS9A 3WD3A 2EPKX 3GG0A 1W3LA 1ZENA 1AD4A 2QNEA 4N9EA 1XG3A 1ZBCA 5XIMA 1A47A 2GQ9A 4IFRA 3TROA 3VA8A 3N14A 1XLLA 5D32A 3W7CA 5K9DA 3BJSA 4ZQCA 4QP0A 1K4GA 1MI3A 3UXLA 1QPOA 1QPKA 4R9OA 1HF6A 5ENLA 2X1SA 3FGCA 5LHFA 4P7RA 1GOXA 4Z2KA 2UBPC 3GBDA 3IJDA 4Y9OA 3VDBA 1J6OA 2WZMA 1UWUA 1RVKA 1HGWA 1UBSA 3IUDA 1F7BA 3IGXA 3C0SA 5H91A 5EKYA 2NLIA 1FHLA 1S5WA 1IGSA 5BCAA 7REQA 3UESA 3BC9A 3TMQA 2XIIA 4GQBA 5M1TA 1R38A 2R8WA 1XIFA 2DQXA 3E0LA 2GGHA 2J9XA 4L1XA 2ISDA 1H4PA 3QKZA 1JGMA 3SCWA 5FEPA 1H7RA 3ZXWA 1DWJM 2J62A 4ZFMA 1NFPA 3CC1A 1NDWA 3NXLA 1BXBA 2HVMA 1XLCA 1MEWA 4WVXA 2VZOA 3L5AA 5D03A 2NSOA 3S9ZA 3H53A 2Y7GA 1MXDA 1PTAA 3VTRA 3SGGA 3GFXA 4R33A 4GYFA 1V3IA 4M24A 1E0VA 3PC0A 4R7WA 1FA2A 2VOTA 2XHYA 2VR4A 2DZWA 3PZVA 3FYPA 1JZ2A 1XRTA 3TA9A 3U9IA 1BG9A 1D3HA 4BK9A 3BCJA 3P2VA 1YW1A 3GDLA 1IEXA 5TD4A 1KTBA 1PCKA 1F8IA 3ZO9A 3B06A 4HTBA 3BO9A 5C2GA 3GVGA 1R3TA 2WM1A 2WXDM 3SJ3A 3WLTA 3UR2A 1GYNA 1W5QA 4A8RA 2NUWA 1F61A 1V3JA 2GK1B 1CCWB 3I7RA 4NJIA 4ACYA 1E3XA 2QHAA 3C8NA 3QLLA 3CAQA 4UTMA 3HMJG 3BGJA 3R94A 2GVLA 4MWAD 1IR2A 3LUTA 3W29A 3WF1A 1BWKA 3PUDA 2HEJA 2EEXA 1XIIA 1YQ2A 1NVMA 2ISVA 2PLKA 1JQXA 4AIOA 2V0TA 3CO8A 3MYOA 1VCVA 3H7RA 4RE3A 4LALA 3TONA 4L4PA 5HDRA 4HMEA 2C16A 5RUBA 1OADA 5EU9A 2A3EA 2YCJA 2BP1A 1D8CA 1R7AA 4GBUA 3D46A 3I4EA 5AHFA 4WCJA 3PBGA 3WNPA 2VUNA 1KQZA 1QK2A 4B2DD 3ZMRA 4TMCA 1EDQA 1PIIA 2E6FA 2D3NA 1H7NA 1RP9A 3W1XA 3WMBA 2V9DA 1DJYA 1XLMA 4YPJA 4YTUA 3O7UA 4HNLA 1TV3A 3GXDA 1EEXA 4GYPA 3NSMA 4PRWA 4MWAB 3VC5A 3B04A 2ZUVA 3LHZA 2GYIA 2OEJA 2XPKA 1Q6OA 3AAMA 1OIMA 1FP8A 1AQMA 2NVDA 5CAKA 3KZSA 4M29A 1XPGA 1ZBVA 1VHCA 3THCA 3AFBA 1EP2A