4GUHA

1.95 angstrom crystal structure of the salmonella enterica 3-dehydroquinate dehydratase (arod) e86a mutant in complex with dehydroshikimate (crystal form #2)
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
259
structure length
259
Chain Sequence
NLYFQSNAMKTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREADFDILEWRVDHFANVTTAESVLEAAGAIREIITDKPLLFTFRSAKAGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEVKATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQERYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords 3-dehydroquinate dehydratase
publication title Reassessing the type I dehydroquinate dehydratase catalytic triad: Kinetic and structural studies of Glu86 mutants.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
total genus 90
structure length 259
sequence length 259
chains with identical sequence B
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2012-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01487 DHquinase_I Type I 3-dehydroquinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4guhA00
1MSSA 4O28A 2J27A 5EY5A 1SZGA 4CQ8A 5BRBA 1TYGA 3M7WA 1R2RA 5EBUA 2QDHA 4RXFA 5F2IA 2QUTA 5K9XA 3HO8A 3G1AA 3M1ZA 5F2MA 5DN1A 4MYAA 4UTTC 3T40A 3TMLA 4R33A 3CHVA 4NU7A 5EYWA 3S6DA 3TSDA 2HSAA 4Q4KA 1VZWA 4NT0A 4LT9A 3W7NA 1EP1A 3Q2DA 1V5XA 1T96A 3G3MA 3TSMA 3O6DA 3W7JA 3MYPA 2FJKA 3DFNA 2DP3A 3BGJA 4JYFA 4O53A 4Q33A 3NPXA 2E6DA 4A29A 4UTHA 4N4PA 5F4SA 4MY8A 4EF8A 2QKFA 2NUXA 4M7TA 1G4TA 3G0XA 1S5TA 5G1TA 1K8YA 3TV8A 3PBVA 1UASA 4MZ8A 4IX0A 2NUWA 3UZ5A 4LY8A 5U7SA 3S5NA 4P61A 1LZOA 1P5BA 5I3KA 3VCRA 4CLMA 3OG3A 2DZWA 5CPOA 3TCEA 1QDSA 3EX6A 4A3UA 3ZR4A 3EWBX 5D03A 1JULA 4K8HA 4O0KA 3NQDA 1ME9A 4M5PA 3NQFA 5HINA 1CW2A 4RR4A 3MO7A 5CPNA 4U4MA 3G8EA 3PBYA 1B4KA 2CLLA 3NQEA 2HTMA 4E2BA 1ZENA 2RH9A 2DJXA 1AL7A 1OJXA 2ZRWA 4GUJA 4AWSA 4IJBA 2OZ0A 1RR2A 4WXYA 3W1TA 3U2OA 3CB8A 3NQMA 4FIQA 5HWMA 3TW7A 1X1OA 1FQ0A 4JTHA 5ABTA 2YR1A 4LV9A 4R34A 3S5ZA 2J88A 4ADSA 3G1VA 2E6AA 2E6YA 3HGOA 4Z1DA 4QQ3A 3HF3A 3A24A 3LV6A 5CPMA 5DBUA 4JS3A 1OK4A 4PL2A 1VYPX 2NV1A 4ALDA 5F4WA 4BI6A 3W2NA 4PEKA 5EL1A 1LP6A 3EWZA 1O5XA 1TPWA 1X1ZA 1VS1A 3O8AA 5MHBA 4UFIA 1JRBA 1TV8A 5D04C 2NV2A 4FNUA 3W73A 4KKXA 3FS2A 4C1LA 2NZLA 2YFNA 3EKLA 5D05A 3KHJA 4DBDA 5DCBA 3G0UA 3OHIA 3KVMA 3C2FA 1K7EA 3PVFA 2YDAA 1K7FA 3CQ0A 4IPIA 3GB6A 2Z6JA 1YPFA 2XN0A 4A2RA 1W8SA 4K7YA 1ZCOA 3NL6A 1G7VA 5G2IA 5TQLA 2H90A 4OU1A 3TA6A 5EMUA 3TW6A 3O63A 4IPJA 2WSQA 4A2SA 3Q37A 3NR0A 5KZDA 1X8FA 2O7SA 3G0SA 1TPEA 1DJNA 5LNWA 1OF8A 2R91A 1WV2A 2R14A 4DQWA 4UTWA 5D2TA 2CZDA 5HMSA 4S2CA 3G8RA 1KM2A 1DHPA 3W7GA 1OFEA 1G4PA 3LTSA 1VPXA 4POCA 3QJAA 1SQ7A 1XBXA 3SY5A 1TJPA 3DFOA 3N34A 3W1MA 2F84A 3L0KA 3USBA 2V5BA 3HG5A 4JDBA 2BXVA 2CW6A 3Q58A 5D2XA 1OYCA 3W7HA 3DKJA 1JR1A 1QO2A 1GPWA 1RV8A 1TV7A 1K8ZA 4BWLC 3TJXA 3L2IA 1GG0A 3GLCA 4PFMA 3W2UA 5K9CA 1W5OA 4BR1A 2RHGA 3N9RA 4IXHA 4UTMA 3EWXA 4R7JA 1O95A 1XC4A 4K38A 1A53A 2YYTA 4O1AA 1LBFA 4TMCA 4DF1A 4EOUA 2Q8ZA 2WNNA 4LU0A 5AYXA 4O16A 1FWWA 4GUFA 3BV4A 4IQLA 1S3HA 1OFDA 3LXBA 3QF0A 3W9ZA 4LVAA 5C55A 4UMBA 4TX9A 3TE9A 1FCUA 7TIMA 1VRDA 1LORA 3UXAA 3F4WA 2Y7FA 3NQ7A 1S5VA 3W72A 1JCLA 1RQBA 1XUZA 2J9ZA 3DGRA 4FX6M 3S5OA 3PUOA 3W07A 1YXCA 1VGAA 3W22A 1TPVA 1I8JA 4G1KA 1EWDA 1PHWA 1PL9A 3S0CA 2QUVA 1YYAA 3LERA 1H51A 3H54A 1SFJA 3F03K 3FEMA 4HT3A 2A6NA 3GNDA 1M6JA 1MEIA 4HPXA 5I3GA 5HWNA 3EX3A 4H3DA 2QCNA 1KBJA 2Y85A 2X1UA 3M41A 5F1VA 1Q6LA 4DELA 1U5JA 2CLEA 4L4LA 1L6SA 1H7XA 1LRNA 4UXDA 3P84A 1KM1A 3FIGA 4I7WA 2V8ZA 1PVNA 1JUKA 3KAOA 3KVLA 3UWQA 3AO0A 1W31A 1GG1A 2X1SA 3MI6A 2D73A 3BPWA 4XBSA 5A8GA 2AAMA 2WSRA 2FPVA 3CLMA 3NVTA 4LC8A 3EKZA 4O4VA 1N55A 1L9WA 3W74A 1GVFA 1WBJA 5EA9A 5GVJA 3TSBA 3SR7A 1TTPA 1JJKA 5U4NA 2WO5A 2WQPA 1GT8A 3DU0A 5E1QA 4CCDA 3DAQA 2VOMA 4JYDA 4RX0A 3C2EA 3W7RA 3MHUA 2WSYA 3ELFA 5A5WA 3HJZA 4WXZA 4FX7A 3L0GA 3FKRA 3NEVA 4YMZA 2BWGA 1R30A 1U83A 2C3ZA 1H7WA 3GYEA 4RV8A 4M6QA 3W1LA 3QW4B 3VE9A 2C19A 3DBPA 1TPH1 4PODA 3R5EA 1DV7A 3P81A 5AHMA 3WK0A 3G1HA 3FFSA 3LHYA 1W0MA 3ZWTA 1W5PA 1XXXA 4OE7A 3KXQA 1HO1A 2GVGA 3EWUA 2FTPA 3TMQA 2VEMA 1IF2A 2A1YA 4LUIA 3TQ0A 3LHTA 3FOKA 2ZTJA 3C4UA 1Y0EA 4PTNA 4ADTA 3R89A 3PSWA 5D2WA 5HJLA 1A5SA 4MZ1A 4TIMA 1NF7A 4PH6A 1HTIA 3LCGA 4UNLA 3WJWA 3TX9A 6ALDA 1WOBA 3U6WA 1GYNA 1LOQA 1F6PA 3BW4A 3A5VA 4MUZA 4UR7A 2B7NA 5CKSA 3L68A 1K7XA 4N9CA 3QRHA 3L21A 4O8RA 1QMLA 1DQWA 4C1KA 1RQHA 3TXVA 2ZZ3A 5FF7A 1SW7A 2C13A 4ZQPA 4CNPA 1TCDA 4HKPA 4O18A 1LOLA 3W86A 3SIZA 3L5LA 4N6EA 2VFFA 4UMCA 3VI2A 4HHPA 4M6PA 4OGZA 2GUUA 1TREA 4O1BA 4NX5A 1PV8A 3PC0A 3FYPA 2AGKA 1GVRA 2E5BA 2YGYA 1TPUA 1J5TA 3MP5A 3LCWA 1EA0A 1XDLA 1YTKA 5LGZA 2V82A 1KTCA 1H1ZA 1VYRA 5DCEA 1R46A 1ZNNA 1SZFA 4OV4A 3W1AA 3VKJA 3LTPA 2FFCA 2CLOA 3W1QA 3W84A 4GXMA 2E68A 4EF9A 2CFFA 4K37A 5DCDA 1NFBA 3PM6A 4AB4A 1T8XA 3B8DA 2EHHA 2NWRA 2Y7DA 3HG3A 1EPXA 3O15A 1Q3NA 3W70A 4O14A 4XTDA 4LVGA 1ALDA 3LV5A 2C18A 2DORA 1UB3A 2DZPA 3W2KA 2YZRA 3QQ1A 1P0KA 1OFRA 3P82A 5KTLA 1QR7A 2C15A 3QSRA 3UYCA 3M5XA 3EXSA 5FF2A 4NJIA 4OQVA 3HMJG 3EX4A 4JDYA 3DZ1A 2YSWA 1VHNA 4KFOA 2HS6A 1JQXA 1XUUA 1ZJIA 3ANYA 1GVOA 3ATYA 2Q3RA 3STCA 3BLEA 3KRZA 3BG9A 3SGZA 3O1NA 4ML9A 1SPQA 8TIMA 1GWJA 2F7FA 3LX9A 2J24A 3QPZA 4UTKA 4UTIA 4EIVA 1W5NA 3MYOA 5SWUA 1F05A 2TMDA 1WXJA 3W75A 5D2VA 3STGA 1VR6A 2VFIA 3NL3A 2NWSA 3PBWA 4ZQNA 2GQAA 3LLFA 2V2CA 2BLEA 3IIXA 2I9EA 3BGGA 3SECA 4NNBA 1TIMA 4AAJA 3HGSA 3NAVA 1WAUA 2C1HA 4S2BA 5D09A 4IMGA 5KZMA 3W7LA 1HG3A 1EIXA 2P0OA 2JK2A 3TROA 4LWWA 1ML1A 2RKXA 4QM1A 5DXYA 3S1WA 3L67A 1K8XA 5AB3A 2E6FA 3G1XA 3PUEA 3I7SA 1XKYA 1ICQA 3MUXA 4MY9A 4LVDA 2ZZ6A 3HPZA 2WOQA 1H7RA 4MVAA 1NEYA 3MHGA 3M47A 3GNNA 3IIOA 1K03A 5BNKA 2WJZA 1LDCA 4RJEA 1TQJA 4Y8FA 4Y9AA 3SGUA 1DBTA 3KFTA 3IGSA 5HULA 2OJPA 5T26A 2GOUA 3GK0A 4IMEA 3DFTA 4PC8A 2XFWA 4UC5A 4JXCA 4NZJA 2A4AA 3QMRA 5L9FA 1FXQA 1EP2A 3LBCA 5G2WA 1D9EA 2EPHA 2WNQA 3C3NA 3TAOA 5F2GA 3GZ3A 4MJZA 1BWLA 1QPNA 2VC6A 5F1UA 2G96A 1TQXA 2X1RA 3BW2A 3STFA 2E77A 3S42A 3MHFA 4NJGA 4WY0F 5TBOA 1OK6A 3HOJA 1N7KA 3SI9A 3A22A 4RZ4A 5KSWA 3C56A 3NPVA 1GZGA 3HGRA 2VXNA 3K30A 1KTBA 1OFAA 3EXTA 4JTFA 1WQ5A 3UWYA 4XBKA 3U8GA 3W7MA 4NX0A 2NUYA 5G5IA 5K3VA 4O12A 2RDTA 3KX6A 2VEPA 2ZZ4A 4ZVJA 3T44A 1OVDA 3TH6A 4O15A 3A23A 3HG4A 1XBZA 3DKLA 2ABBA 1OX4B 1GVSA 4O54A 1KFCA 4JTJA 2WPBA 1HFBA 3IRDA 4BI5A 5KINA 2R94A 3IVSA 5BMXA 1RPXA 1FBAA 1OYBA 3RK8A 3IIVA 3LXCA 1QAPA 1SFLA 5H91A 1F5ZA 4JTEA 4UTWC 3NO5A 2A2IA 2A7PA 2Z1BA 2JBMA 1TRDA 4MFDA 3N14A 2VFEA 1LYXA 4NVTA 1LBMA 2QUUA 2A21A 1O60A 2H3BA 3DFQA 1DVJA 2YXGA 4GNJA 4Z08A 2OT0A 4WX2A 5FEWA 3VNDA 1C8VA 5C54A 4FXRA 1FCQA 1WX0A 4IX2A 5AHIA 1TPFA 3EWWA 4FEZA 2ZBTA 1FWSA 3ABRA 4FO4A 3GR7A 3LRKA 4LS1A 3PULA 2X1TA 1QCWA 3V75A 3W7PA 1G6CA 3DFSA 1H62A 4CNOA 3QMTA 3HG2A 4HSNA 3W2JA 1AW1A 1SR9A 4Z0SA 1PIIA 1QO5A 5FF4A 3I7RA 5K9DA 3EX2A 2DZXA 1LCOA 4UTTA 3PAJA 4X3ZA 2QCMA 2HMCA 1KV5A 4RK8A 1TO3A 1NAL1 4WOZA 1MEHA 2PCQA 2ZRUA 5D2YA 4RKAA 3UXDA 3A9IA 1F2JA 1W56A 3OVPA 2QF7A 3KVJA 1Q6OA 1SU5A 1G7UA 3BK0A 4IMFA 1AW5A 5K4ZA 2OCZA 1IGSA 2QCCA 4LVBA 5HR7A 3W1NA 4JTTA 3DHFA 2YX0A 2Y6ZA 3ATZA 3UD6A 1EUAA 4O13A 4M19A 1VLIA 3B05A 2EKCA 4N02A 4WJEA 5DY3A 1LRQA 4FX8A 3W1UA 4NNCA 3NQGA 3TJLA 5DBTA 1VH7A 1WA3A 1H50A 1OX4A 3IV3A 4LOCA 4LTSA 1XM3A 1K02A 1YTDA 3L5AA 3Q94A 3LOTA 5KITA 1ADOA 1S5WA 1YDNA 5D37A 3E12A 1H1YA 1OF6A 3BG5A 3QFEA 3W7KA 4FIRA 2CLHA 4KFNA 3UWUA 2Y70A 3LCXA 1NSJA 1TMHA 2VEIA 2ZDRA 2PRLA 3CEUA 3FLUA 4ICNA 2ZYFA 4YLWA 4UIOA 4H4IA 5G2HA 1AW2A 4WD0A 4WQ6A 4XKYB 3W85A 1ZHAA 3DXIA 3HBLA 3UZJA 2I1OA 4O1CA 3LHWA 4LRSA 4E2DA 1SSGA 1OABA 5BW6A 3PB0A 3OBKA 3EEGA 2ZFAA 1WOAA 1XDMA 3GR8A 3S1XA 3MP4A 4QNEA 1SW0A 4K39A 4YCOA 3PS7A 4X9SA 1D3GA 1UCWA 3M0ZA 5FF0A 3D0CA 2WKJA 5AHNA 2FLIA 4HNVA 2VELA 2Z0IA 1EB3A 1TB3A 3G1DA 5LNVA 5FEZA 4QAIA 2PRHA 4Z1CA 5FEXA 3GXPA 3L9CA 3I65A 3W1RA 5LHEA 4LS0A 1W5MA 4E38A 3W87A 3IGXA 1B9BA 1XBVA 5AN7A 5H2ZA 4DF2A 4N9BA 3P67A 3TUUA 3BG3A 3TU9A 2QCFA 2B7PA 3TDFA 4DO4A 1TV5A 1ZY9A 2XN1A 4FNPA 1OYAA 1R2TA 3NM3A 4ORIA 5D32A 1T99A 3NM1A 4BK9A 4AHQA 1FDYA 3LCFA 1H7NA 3RLUA 3W7EA 1KM5A 1XFBA 3EWYA 2JKEA 3LHZA 3S1VA 4DPPA 3QQ0A 2ZRVA 2X16A 1KV8A 3UWWA 2JGQA 3L65A 1O4UA 2HS8A 3W83A 1KTNA 1N8FA 1O5KA 4JTLA 2J9XA 1ICSA 3LDVA 1FWNA 1OHLA 1DL3A 4KFPA 5EKYA 4XKYA 4BWLA 4QISA 4IOTA 3NPUA 4NUWA 3QH2A 2EAWA 4UFHA 5FEPA 3NL5A 1KM3A 3GDTA 1NVMA 3MJYA 3P74A 2DZUA 2KZHA 2W6RA 3B4UA 3HPSA 4HNTA 2VFDA 4Q32A 4OBTA 4JYEA 4NXSA 3LCHA 1YLVA 5FF3A 2A7NA 1TTQA 4L4MA 3UNDA 2CU0A 3NGJA 1DJQA 4MZYA 4XQ6A 2V2DA 5I3FA 3MI2A 3O05A 3QPYA 4UTLA 2A85A 3CWOX 3LRLA 2EGZA 4JIQA 1QOPA 4ONVA 4ZL1A 2CLKA 2B7QA 1LROA 3FYOA 2BSLA 1JCXA 3W3OA 1X7FA 1LTDA 4MPQA 3MMTA 1SSDA 1QWGA 4LVFA 4N9DA 1J2WA 2FDSA 1WBHA 1D3HA 3QC3A 5LNRA 3LLDA 3N19B 3M5ZA 4XUGA 3WJYA 3N73A 1BWKA 1JQVA 4UFLA 4ZZ9A 1KLYA 4LW7A 3H53A 4GJ1A 5I3HA 3E49A 2GJLA 3NQ8A 4RXGA 3LCLA 1GVQA 2TSYA 1WYIA 3IEBA 3SW6A 3C2VA 1UJPA 2JKPA 5IBXC 2LLEA 1PCKA 3C61A 1XL9A 2ATSA 4GUIA 3CC1A 1SW3A 5DELA 4BFAA 3VFLA 3ZFHA 4I7VA 3NYZA 5AYYA 1PHQA 3THQA 4OWGA 5L6UA 3N2MA 1EEPA 2QJIA 2TRSA 3GVGA 3V1PA 2QDGA 3G24A 1KM6A 4HN4A 5LHFA 1I2OA 1Q45A 1VCFA 1QPRA 1H5YA 4I7UA 5HQEA 2QJGA 1EP3A 2VFHA 2DZTA 2NX9A 4CQ9A 2YW4A 3RF9A 1SO4A 4FXSA 2E5CA 4ADUA 3C2OA 3CIWA 3HIJA 3P61A 4ZQRA 4W9TA 4QSHA 3DHDA 4CQAA 4O0ZA 1KFBA 3PBUA 3DH7A 1H7PA 4B5NA 4O11A 3RU6A 2GQ9A 4IXXA 2X30A 3QEZA 3LHVA 4GBUA 1DKWA 1SO3A 1VJIA 2QAPA 1G4EA 1ZAHA 2FPTA 1J4EA 3NNTA 1Q6QA 3N9SA 2Y89A 4FHAA 2QJHA 2O7QA 2PC4A 3NQVA 3NZRA 5LZLA 2ATMA 1H61A 5LGXA 1P4CA 2ZTKA 3JR2A 4Y90A 4OV9A 1QPOA 2ZZ7A 5HR6A 1A50A 1TPB1 1HUVA 4FNRA 5D38A 4JTKA 4K6AA 2C0AA 4JTSA 3HQ1A 3NQ6A 1THFD 3DENA 1NF0A 4MLRA 3BLIA 4YL2A 1ZAIA 1VYSX 3FA5A 3W7CA 3QZEA 1ICPA 3W6YA 3GDLA 1IXNA 5LNUA 1TTJA 4UFJA 3G22A 5KMYA 5CZSA 4Z1BA 4GRSA 1UUOA 3M5YA 1MEWA 2E09A 2V5LA 3TXZA 5FESA 3MP3A 3CEPA 4UFKA 4GUHA 1DQXA 2ZRXA 5J5DA 5CSRA 2ZCGA 3RMJA 1F6KA 3OA3A 1SUXA 2CLMA 3KVKA 2B0MA 3PWAA 2QAFA 3GDKA 3P5ZA 1JCYA 5CGQA 1K3UA 2PURA 1JRCA 5AC6A 1RQEA 3NQCA 4JN6A 5AHLA 4PL1A 1PCWA 4PA8A 3QSTA 4CNNA 3E02A 1FDZA 1GTEA 2OMAA 3P60A 5CSSA 1KFJA 2C6QA 4JY8A 2CZFA 1H7OA 4LNYA 3LHUA 2GVLA 3A21A 4JX4A 4UUIA 2W0UA 3TK7A 3MBFA 5DY2A 1OG0A 1B57A 2YW3A 3GIYA 1OFBA 3CM4A 5AOUA 3BARA 1TTIA 1TJRA 3W71A 1VLWA 3S5YA 3P80A 3LI1A 5G4WA 3WK1A 2R8WA 3T7VA 1W54A 3TIMA 1JUBA 2QR6A 2H3DA 4TO8A 4CCEA 4FNQA 3W7IA 1IXQA 3UQNA 2B4GA 1E51A 3PY2A 3T4CA 2G5WA 3CU2A 3OVRA 4IUOA 1G67A 3FJLA 3IIZA 2C14A 3BO9A 3I7QA 4MJMA 3ZWSA 5F4XA 2B7OA 2H8ZA 3W7QA 2J6XA 4Z1AA 3GAKA 4N6FA 3N3MA 1KFKA 2RDWA 4AWTA 4UCGA 1F76A 1JCNA 2ABAA 1EX5A 2V81A 5TIMA 3PG9A 2FQIA 4AH7A 4QIUA 2W79A 2DU2A 4ORMA 4NNAA 1G4SA 3W1XA 3M43A 3DI1A 1R47A 4XWUA 1C9DA 1TPDA 2FB3A 1CX9A 5AFDA 1JCMP 2YFOA 2RFGA 1IIHA 3OVQA 4UTUA 1L6YA 3QYQA 5C2XA 3N2XA 1I4NA 4RZ5A 3G1SA 5LNSA 4K36A 1KBIA 2TYSA 5G1YA 1KFEA 3HB9A 3KRUA 1I2RA 4FNSA 4GUGA 4M6VA 3STEA 1EUNA 4RLIA 2EF9A 5LSMA 1EWEA 3P8JA 1A5BA 4QITA 3F1QA 5AC7A 3B04A 1IIGA 3NQ2A 3O06A 5EPDA 3TAKA 4NJHA 1GOXA 3PSVA 4MLJA 5KZEA 2BX7A 2NXGA 2ZRYA 2QCHA 3IIPA 2YCEA 3RFAA 2I14A 1H63A 1BEUA 4JX6A 3L5MA 5FI8A 1SO6A 1XBYA 4A22A 5CZ0A 3C0JA 2YPIA 1VCVA 1Z48A 2RDUA 3WFAA 2QCDB 4DEFA 2Y61A 5BMWA 5CPLA 3QM3A 5C5YA 1I2QA 1FUYA 3W1PA 3NPWA 1CI1A 2GJNA 4O50A 5G4EA 1B3OA 4TMBA 1HL2A 2NXHA 4AF0B 3M6YA 1KW1A 4AHPA 4ZQMA 5HWJA 4O57A 2P1FA 3BLFA 2ZA1A 2CZEA 3F4NA 3JRKA 2CZ5A 2P10A 2AQWA 2QCEA 1ONRA 3G18A 3O6CA 5I3IA 2DZSA 3DFPA 4JNMA 4M7SA 4P2VA 1W5QA 4HSOA 4XTIA 3UPBA 1LM1A 4FNTA 1YDVA 3NA8A 3ABOA 3CIXA 1OX5A 3TC6A 2OX1A 4IMDA 5AYZA 4XZ9A 4OHQA 3S1UA 5IM51 1M7OA 4IMCA 4X2RA 4D2JA 3SJ3A 1P1XA 4KWVA 1VQTA 4FB7A 3W76A 2FB2A 4RCXA 3WK2A 1BKSA 4YXGA 4O4WA 6TIMA 1W3TA 3FKKA 4LRTA 4HIBA 3UY7A 2V9DA 3A5FA 3S9YA 3YPIA 3JS3A 3OEXA 3LXAA 1TRIA 5CG7A 4RZ6A 3H55A 1MZHA 1SZEA 5D02A 1RZMA 4WY0B 4DBEA 2C16A 2JGYA 3GKAA 4NXKA 2ZA2A 3UWVA 4PCFA 1L2UA 3R13A 4EVZA 2BTMA 2Q8LA 1XCFA 5J5RA 1M7PA 1A5AA 3LRMA 3TFXA 1O94A 3LBMA 3WJXA 5E0KA 2Y88A 2ALDA 3NZ1A 1FWTA 5K4XA 4TR9A 3CT7A 3C8FA 4DXVA 2ZA3A 1AK5A 2QCGA 4CCCA 5D33A 2Y62A 4IGHA 2CWNA 1OFPA 2QCDA 3TC7A 3P5YA 2PE4A 4N4QA 3S8HA 2Q3OA 1FY6A 3IVTA 4K7VA 3C2RA 4MYXA 3SZ8A 1GTHA 4O19A 1ZAJA 4OT7A 4ZMGA 3MBDA 3B06A 5AC8A 3M16A 4AF0A 1VC4A 2V0TA 2NX1A 4DO6A 4KWWA 5I3JA 1B4EA 3GXTA 1JVNA 3EX1A 3O16A 3INPA 1SZNA 2Y63A 2A6LA 3O07A 4GE8A 2Y7GA 3ZS4A 1UBSA 2VENA 5F2LA 3IVUA 3W88A 1L6WA 2E5DA 3CPRA 4Y6GA 1LLZA 4QJ1A 2NXIA 3I6RA 1DOSA 3R12A 4U28A 5K7JA 2CLFA 3NQAA 3OIXA 4TU1A 3NG3A 1LOSA 4QNWA 4UTJA 3GDMA 1JCJA 1YXDA 4LV4A 1Z41A 4GFSA 3TQVA 2IQTA 2V2HA 1TSIA 4AWUA 1GJPA 3M5VA 4E0CA 3NDOA 4N2YA 4NJKA 5HUOA 3AJXA 3QMSA 1OX6A 2G97A 3B03A 2ZZ5A 1I2NA 1PE1A 3T55A 5DXXA 5C6MA 1FCVA 4AVFA 4BI7A 1RD5A 1V7YA 4MFEA 1W1ZA 3MW7A 2XN2A 4MIMA 1KM4A 3NL2A 4AXKA 3B0UX 1QNVA 1SO5A 2H6RA 2J9YA 3UY8A 1X6UA 5CZJA 4AHOA 3NXFA 4DPQA 1IXOA 3WK3A 4O10A 1MXSA 1FDJA 3L0NA 3T78A 4NQ1A 4WY0A 3M9YA 2ZZ1A 1HO4A 4Z0JA 4UR8A 3B0VC 1QPQA 3W7OA 2Y7EA 4UFMA 2FPYA 4AEOA 4I9AA 5K2ZA 1KM0A 3W2LA 4O17A 4AMAA 3BVJA 4MOZA 3UWZA 1MO0A 1XI3A 2E1DA 4N9EA 4NZFA 1IXPA 4DO5A 1T0OA 4X22A 3SSJA 2V30A 5E93A 2QCLA 4JY9A 3P62A 4JEQA 1G69A 1KA9F 1Q6RA 2ISVA 2UV8G 3G1FA 3W7DA 2G95A 3G3DA 3C52A 3C6CA 4JX5A 3RLVA 3GXNA 4A21A 5HUPA 4MY1A 1P0NA 5D30A 3TFCA 4JTIA 3EXRA 3TR2A 1YXYA 1Z42A 3QW3A 1ZALA 3VE7A 5AHFA 4LC6A 1LLWA 3TNOA 1QOQA 3PB2A 3GKFA 4IWWA 3HGJA 3L66A 1FCBA 3TKFA 4HNNA 1LRTA 3LM7A 2H8XA 4FF7A 2OT1A 2A0NA 3RNDA 2ISWA 3MWAA 1YADA 1KLZA 1AMKA 1VHCA 3TQKA 1H60A 3GX9A 1AG1O 2X2GA 4YWIA 4ZQCA 4JGDA 2A7RA 3P8IA 1I45A 3G1YA 1UUMA 1ME8A 2ZQ0A 2A5HA 3E96A 3THAA 3PF3A 2BZNA 1ME7A 5LKYA 2WNZA 1TPC1 3E9AA 4JICA 3LGEA 4GWEA 2Z6IA 3E0IA 3ABSA 1VCGA 3LB0A 3LTYA 2GVJA 4Y96A 4O1DA 1R2SA 1F73A 2ZZ2A 1F74A 3FJ6A 1FWRA 3B0PA 2VFGA 1LBLA 3LI0A 1Z44A 4WZHA 2ISSA 4LS2A 1WDWA 3R2GA 4JTUA 4GC4A 1GQNA 1QFEA 3BW3A 1I2PA 2PRMA 2NLIA 3W2MA 1PS9A 3HPXA 3LCIA 4JIPA 2QEZA 4HNUA 3PUDA 4LUJA 5BOOA 2JKAA 4R53A 3ABQA 2VEKA 2FIQA 1AL8A 3W23A 1YPIA 2DJLA 4JD4A 4J9JA 2VKZG 3GAYA 1FXPA 3WJSA 3O6YX 3PR2A 3I68A 1A5CA 1GYLA 1YDOA 1ZFJA 5AHEA 4NJJA 3PG8A 2WV8A 3P7YA 1KFLA 1F7BA 2Z2UA 1JUEA 4H6KA 3IGUA 3DI0A 3CWNA 4JR5A 3SFKA 2YYUA 1M5WA 3KRSA 3WJZA 4WOQA 3R8RA 3NOEA 3KOFA 1YTEA 4UMAA 4MKNA 2TPSA 1OFQA 4K8EA 5IBXA 4DF0A 1DORA 4S1FA 1RVGA 1GEQA 1C29A 5HNRA 1W37A 2DZVA 4UNKA 1W3NA 2GPTA 1W3IA 3M44A 2ZRZA 3CTLA 1OFOA 4YCPA 2GQ8A 4JTGA 5CZTA 5DLCA 4ZQOA 3UPWA 3EB2A 1BTMA 2CLIA 4HPJA 3MI3A 4BF9A 4O52A 1FX6A 2NX3A 4EWND 3GDRA 4WUIA
chains in the Genus database with same CATH superfamily
4GMEA 4O28A 1VFLA 2J27A 4F0SA 3OODA 2QQ6A 5EBUA 2QDHA 4C6OA 3H6OA 4XO6A 1EX1A 5JMUA 3RDKA 3E2SA 1US2A 5K9XA 2D2JA 3G1AA 2A79A 4MYAA 3LMYA 4UTTC 3PWGA 1DWAM 2WLYA 5I24A 4F40A 3KEHA 4J4KA 2YL9A 4LUTA 1H41A 5A69A 1UZ4A 2OWXA 4M82A 3LEPA 2GVEA 5BXTA 5C9UA 1E1CB 1VFTA 1QNPA 4IL0A 2DP3A 3BGJA 2HCVA 4KEMA 4A29A 4UTHA 3MSRA 2CYGA 2QKFA 4M7TA 3RM8A 3QR1A 4G6CA 1K8YA 2POZA 3H2CA 5C0QA 3W00A 4LY8A 3S5NA 4P61A 3K8KA 5I3KA 2PP3A 3L4UA 1CB7B 3WNLA 4MB5A 2DZWA 3IJ9A 4O1EA 4A3UA 3TLLA 3EWBX 3ZJ8A 4PCTA 1J8VA 3FAWA 3IJIA 4O0KA 1UROA 4M5PA 3NQFA 4XZIA 1HKJA 4U4MA 1HKWA 3PBYA 3B8UA 4GUJA 4IJBA 2OZ0A 1RR2A 4WXYA 3W1TA 4NRSA 3U2OA 3LGDA 4FIQA 5LYRA 5HWMA 1UW9A 5ABTA 4LV9A 4R34A 5TD4A 4Z2GA 1RXOB 1VFMA 2VOTA 3PTDA 2J88A 3DG6A 1IR1A 4J3VA 3HF3A 2VUYA 3WUGA 2YBUA 2INFA 3QN3A 1QNSA 1JZ5A 1PKYA 2O55A 1IZKA 1VYPX 5C9RA 2NV1A 1GOIA 3H4XA 2UY5A 1X1ZA 1TPWA 2XVGA 1H1NA 3N2TA 3LLXA 3UEQA 2DY3A 5A6BD 5ABEA 5E6YA 3W73A 4PFHA 4FLOA 3FS2A 2QMKA 4C1LA 2NZLA 2QYGA 3VGEA 3GFZA 5M2FX 3OHIA 3KVMA 3GWQA 3PVFA 4HQVA 1E6ZA 4IPIA 1O5QA 4S3EA 4XK2A 1YPFA 4A2RA 4GA8A 4FP1A 4O1FA 1FWDC 4XVEA 1G7VA 2VZTA 3DHUA 2GGIA 2XDFA 3CHDA 3WQWA 1Z9AA 4GIEA 5EMUA 2WSQA 3SY1A 3ERPA 2G8ZA 4A2SA 4OIFA 3MKVA 5XIMA 3NR0A 4MWAC 3BCJA 1X39A 1P43A 1DJNA 3BL3A 1OF8A 2R91A 4DQWA 3ID7A 3WDHA 5D2TA 1LL7A 5HMSA 3FHQA 3W7GA 3WQ8A 4Z2IA 2VEGA 4POCA 1PO9A 1TJPA 3W1MA 3L0KA 3UGRA 2XUCA 4JDBA 4B4HA 3QTPA 1JD7A 4WVXA 3W7HA 1JR1A 4MNLA 1BG9A 1IV8A 1XHGA 1RV8A 1EGMA 1K8ZA 2VGGA 4FSAA 5DMMA 2FVKA 1GG0A 3GLCA 3W2UA 2NT0A 4PMJA 3LK6A 2OELA 4IXHA 4UTMA 2BOEX 4R7JA 2C1GA 4KW2A 1A53A 4LB4A 2YYTA 1V6WA 4H6RA 3NXLA 4EOUA 1E4NA 3A3HA 1IT0A 4LU0A 4MHBA 3KWXA 3NDYA 1Q63A 4NIRA 1KGWA 3VIMA 1X38A 1S3HA 1OFDA 3LXBA 3WF1A 2PGRA 4WDTA 4M56A 1A5MC 5C55A 1AQMA 4ZE5A 4R85A 1RCOB 3DC0A 1MDRA 4R27A 5M3WA 1Q6DA 3F4WA 1JZ2A 2XU2A 1JCLA 1RQBA 3RXZA 1EQPA 3S5OA 1YXCA 1VGAA 1TJ1A 3MMUA 3PTMA 2GGGA 4H00A 3W22A 3T8LA 1M1BA 3A47A 2NQ9A 2VHLA 3SN0A 1W9PA 1Q8JA 3F03K 4V27A 5HWNA 1C8YA 3ZVHA 3EX3A 1KBJA 1J12A 5HDRA 1M41A 3UXKA 2X1UA 3M41A 4GKTA 1RJPA 4S38A 1UWAA 3T9PA 3RO6A 3P84A 1KM1A 5DT7A 2Z1XA 4QAWA 4I7WA 1DJIA 3CZEA 4GI9A 4D72A 3UP8A 4GY1A 3UWQA 3WMBA 1W31A 2X1SA 1Q2RA 1VIZA 1AH4A 1CGTA 3TJIA 4XBSA 3NVTA 3W74A 1GVFA 1VF8A 5GVJA 1W2PA 5U4NA 4IQDA 2VOMA 6REQA 3C2EA 3K5XA 5A5WA 1JDEA 3HJZA 3EA1A 4WXZA 4PUKA 3LZ5A 3NEVA 4YMZA 1R30A 1U83A 3GYEA 3FX4A 4M6QA 3W1LA 3VE9A 4ZOCA 4WGHA 1OT1A 3B97A 1AFSA 4F66A 2PTDA 3WK0A 2I17A 4H9VA 4LSBA 1DIEA 2EKGA 5LIYX 4OE7A 3NURA 3EWUA 2FTPA 3TMQA 1NDVA 3SUTA 3HZ3A 3AWNA 3T0CA 1WUEA 4H9MA 2I9UA 2ZTJA 1VFOA 3VINA 4ADTA 1CXLA 4TIMA 1NF7A 1Y65A 1XCWA 4UNLA 6ALDA 1JI1A 1LOQA 3TYDA 3BH4A 4HCHA 3IUDA 2B7NA 1K7XA 3RR4A 2Z00A 2G3MA 1LF1A 3CO8A 4HPNA 3UT0A 2GGJA 4O8RA 1UR4A 1XQLA 2PDCA 3TXVA 2OTDA 5A6BA 1W1PA 2ZZ3A 4ATLA 3H26A 1XYCA 2PDMA 4TQTA 1TCDA 4HKPA 1LOLA 3DIPA 1IT7A 1F6YA 1V79A 3R79A 1V0KA 4XG1A 4OGZA 2OPJA 3OP2A 3FYPA 2AGKA 1RK5A 3IPWA 4MNMA 4NI8A 3DOPA 1EA0A 2J7FA 1YTKA 1KTCA 2RUSA 1R46A 2HZGA 4CQBA 3GVVA 1NY1A 1T41A 4L4PA 4NASA 3W1AA 3LTPA 4GXMA 3VYLA 5DCDA 2VX4A 4PB3A 3HPFA 3NZPA 3HG3A 2Y7DA 1EPXA 2XH0A 1T7LA 3VUPA 4NKCA 4H9YA 2C18A 4JZ5A 1P0KA 2W66A 1TR9A 3UYCA 3URBA 3UF9A 3E0FA 2IKHA 4JDYA 4LF1A 1J2BA 4EKJA 2IKGA 4C6QA 1XIHA 4XZLX 3UR2A 4IT1A 1GQLA 3MJMA 2NSXA 4ENLA 3D47A 3RU8X 1CECA 2JIWA 5HNTA 1SPQA 1DIDA 4K1WA 3AXMA 3NIYA 2F7FA 3LX9A 4CU8A 4UTIA 3MYOA 5SWUA 2TMDA 1NOWA 1WXJA 4MDOA 5D2VA 3BC9A 5IFTA 1VR6A 2VFIA 4C6CA 3W37A 2GQAA 2VGBA 3VU2A 2CHRA 1QPKA 3VKBA 2V3GA 4NNBA 1TIMA 3HGSA 3NAVA 1WAUA 2HNEA 4S2BA 3SCVA 3TP4A 1EIXA 6PTDA 2DEPA 5DANA 3GDBA 4P8VA 2XHYA 1XRTA 3GSMA 4K8GA 1R7OA 5CSYA 4NZ3A 1ML1A 1XW8A 2RKXA 4QM1A 1BKHA 1K8XA 4PYSA 3I7SA 3ARWA 2ZADA 1V77A 2GL5A 4MY9A 2ZZ6A 3HPZA 1H7RA 4D1IA 1R86A 3MHGA 3D46A 3GNNA 4Z17A 4RJEA 4Y8FA 1O1HA 1UOKA 5HULA 5AKQA 4L1WA 1PTAA 3S5SA 4PC8A 4JKKA 2DH2A 1OM0A 3U9IA 4JXCA 3BJSA 2A4AA 1ISYA 3T2PA 1CENA 1WXZA 3LBCA 4Q4PA 5G2WA 2EPHA 3TTQA 3PFRA 4Q8TA 4ES4A 1VFSA 2BGQA 2X1RA 3BW2A 9XIMA 3EOUA 5KETA 2J6VA 1OK6A 1XLEA 3C56A 1GZGA 4JFUA 3UCCA 1KTBA 3VAVA 4DXKA 1VJZA 1OWQA 2YDSA 1WP6A 4JTFA 1UWTA 3RHGA 4NX0A 1N8WA 3VOGA 2NUYA 3DERA 3KX6A 2VEPA 5B80A 2ZZ4A 4ZVJA 3TH6A 3A23A 3XISA 4MB1A 1GVSA 4DLFA 3COTA 5CQ1A 4PTVA 4FXJA 1BYAA 3IVSA 4PE8A 1RPXA 1OYBA 1E1EA 4JTEA 5H91A 3L4TA 2WJEA 3EDDA 3HQPA 4UTWC 4KWUA 2A7PA 5A94A 4FA3A 2JBMA 1JPMA 2VFEA 1LYXA 4KCVA 2QUUA 1NELA 3HURA 1EJSC 1B3ZA 1O60A 4FOUA 3ARQA 3S2MA 3W02A 2ZUNA 4H1ZA 1O7AA 4Z08A 4WX2A 1B3XA 5FEWA 1C8VA 5C54A 3MT1A 4GCXA 4IX2A 3VD4A 3PJXA 2BFGA 1TPFA 3GR7A 3LRKA 2GQ3A 1UKPA 3VD7A 1A49A 1UKTA 4FXFA 5GQBA 3W7PA 4WDUA 2XIJA 4AX6A 4YHEA 4XAYA 2Y24A 1PZ1A 4YVPA 4OKDA 2A3AA 4HGXA 1SR9A 2BS9A 2PAJA 1PIIA 1QO5A 3TN3A 4TX8A 3CMFA 3VNMA 3AUOA 3V3WA 1NAL1 3GH5A 4WOZA 1JGMA 4MG4A 5E0FA 1VFUA 4HZ8A 1FH7A 3KM8A 1ONWA 2QF7A 1SU5A 3BK0A 2EPOA 4HMEA 4E8DA 1EO7A 1H0GA 1IEQA 1O68A 4W8LA 2QCCA 2EEXA 3W1NA 4UBPC 3ZVHB 2D1ZA 2PDQA 1HJVA 2YX0A 3UD6A 1EUAA 4WJXA 4M19A 1VLIA 3ES7A 3B05A 4N02A 4WJEA 5DY3A 1LRQA 4FX8A 1L8NA 1ELSA 3A4AA 1WE5A 4LTSA 1K70A 4H7VA 5KITA 3H7UA 5D37A 1OF6A 3BG5A 4FIRA 2J8GA 1TG7A 1VRXA 3UXLA 3UWUA 1NSJA 4UIOA 1XDJA 1PDZA 1MI3A 4RPPA 3WLHA 1AW2A 2WMFA 2HPIA 2UY2A 4WQ6A 3GXFA 1XICA 3DXIA 3OZYA 3N2OA 3R25A 3UZJA 1A5NC 2PWEA 1OB0A 1TWDA 1X96A 1ENUA 1OABA 5BW6A 4PULA 2UWFA 3DGBA 3K4DA 4KRUA 3EEGA 1WOAA 4RV3A 1XDMA 1DIKA 1ISWA 3S1XA 4XAGA 3QZAA 4GHRA 4US5A 3PS7A 4J28A 4X9SA 3OVGA 3UNTA 3KRBA 1E4IA 2FLIA 3PZVA 1EB3A 1TB3A 1XRFA 2ASHA 1WUFA 1KBBA 3I65A 3CT2A 2YBTA 1B9BA 4ECLA 1B30A 1XBVA 1F07A 4DF2A 3P67A 3TUUA 2PDIA 1S2AA 3BE7A 1DEDA 1ZPTA 3TDFA 4QP0A 2FDMA 4DO4A 4AUBA 2Z25A 3VPLA 2XG9A 5D32A 1S2VA 1H7NA 3VIFA 3H2EA 3RLUA 1BQGA 3EWYA 1QUMA 3EDEA 3HM7A 2JKEA 3S1VA 4DPPA 2VEFA 3QQ0A 1KV8A 2GSHA 4YIWA 3B8VA 3TYCA 1EXPA 3W83A 4ZOBA 1N8FA 1I6NA 1O5KA 2FGBA 5CEWA 2J9XA 2FYMA 2PLCA 2Q6ZA 1OHLA 1DL3A 4KFPA 3IAQA 3BDKA 3BOFA 3LMZA 3WQPA 4XKYA 4BWLA 4QISA 4IUGA 4NUWA 2TODA 3QHNA 1OZMA 3CUZA 3HPSA 2PZ0A 5AYIA 4OBTA 2PGFA 2ZUSA 4NXSA 4Q8MA 2A7NA 4M81A 3CXOA 2R82A 2Q09A 2J7GA 3WLLA 4PEEA 2V2DA 2OOGA 1J0YA 2ZVRA 1Q2SA 1BGAA 1CPUA 2YL8A 4LAMA 3APGA 4N42A 2WMGA 2CLKA 3VMNA 3VGGA 1KXVA 3B3DA 2BVTA 1JCXA 1X7FA 3MMTA 3P6LA 1Z6KA 4LVFA 1D3HA 5LNRA 3M0VA 3LLDA 3M5ZA 3AHTA 5EBAA 3N73A 1BWKA 2AMXA 1FFRA 3N4EA 5FJRA 4I90A 2D3NA 1K4GA 3H53A 1UR2A 2GJLA 2Y8UA 3SSZA 1GVQA 3VNYA 3BOXA 4DWSC 3TTSA 1UR8A 1Z3NA 2FHCA 4DZAA 1MW1A 4DJFA 1OSEA 1TVNA 2JKPA 1MWOA 2EPMX 5CC7A 3IS4A 1PAMA 4GUIA 4GOAA 3THQA 4OWGA 5A8MA 1TJ0A 3WNNA 4RDZA 1PX3A 2I5GA 5LHFA 4MB4A 3MDWA 3QTGA 2I5IA 1FP9A 1TWSA 1LG1A 2YW4A 1UR3M 1SO4A 1FOBA 1A3XA 5B7ZA 1XD1A 3CIWA 1CLKA 3K2GA 4W9TA 4GVHA 1VAHA 3AXHA 4DYJA 1Q5MA 4FAMA 4FLQA 1UH3A 3PBUA 1UH4A 3ZSTA 4B5NA 3QEZA 1IGWA 1DKWA 1KRMA 2QAPA 4TVDA 4PTXA 3W29A 1Q6QA 3N9SA 4PMNA 2O7QA 4C1NA 1H61A 1P4CA 5FCZA 4Y90A 1GEHA 4B9ZA 3DESA 4NZCA 1NDYA 4IM4A 2C71A 3EPOA 4S3BA 4WJ8A 2VRKA 4K6AA 4JTSA 3FCPA 4GKLA 2V5DA 2PSNA 1TE6A 4GBDA 3U7BA 4B2DD 1NU5A 1TMQA 2C91A 4YL2A 1VYSX 4GY0A 2DVUA 1W6TA 2QNEA 3W6YA 2Z4GA 1IXNA 1KO0A 3G22A 3KS6A 1TWIA 3OG2A 3N13A 4GRSA 3R94A 2INZA 3F4DA 2E09A 2V5LA 3TXZA 4PRTA 1PKMA 1E3ZA 1KQZA 3SN4A 4JTDA 3RMJA 4UQCA 5DT5A 3R4IA 3VZXA 1R8LA 3GDKA 3VD3A 5CGQA 5AC6A 3ZMRA 1Z8AA 3LD5A 2KX9A 3NQCA 4RW3A 4JN6A 4DHGA 4CNNA 1GTEA 3SFWA 3CK5A 2C6QA 4H6QA 4JY8A 4EPKA 1U5HA 2OLAA 3VUSA 2GUYA 3EDFA 3A21A 3WENA 4JX4A 1H09A 4L56A 3PNZA 1R87A 2YW3A 3C0SA 4MWAD 5AOUA 2YDQA 2ZX6A 1V3MA 1SR0A 2YBVA 2QDDA 5G4WA 4PMVA 5FD0A 3T7VA 1W54A 1ISXA 1GJUA 4TO8A 3W7IA 4US6A 3NDZA 3SADA 2B4GA 1E51A 2D3LA 3T4CA 1GOKA 1RBAA 3CU2A 3CB3A 2XSAA 3UETA 2GJRA 4Q8UA 3QV8A 3BO9A 3I7QA 3EOSA 4MJMA 2X1IA 3W7QA 2J6XA 3GAKA 4N6FA 3MUAA 1KFKA 4UQEA 2OU4A 5TIMA 3M0MA 4AD3A 4QIUA 2PGWA 5BRPA 4P8XA 1EDGA 1G4SA 1V6TA 1XF0A 3DI1A 1HL9A 1XINA 3ARTA 1C9DA 4C90A 4HMNA 1XIJA 6XIAA 3STPA 1XLHA 5AFDA 4PN2A 3ENLA 2PWHA 5FL1A 2CBVA 1XPGA 3N2XA 3KE0A 3CZGA 3TN5A 3VX0A 4HOXA 4G7EA 2R1NA 3HB9A 1I2RA 1OIMA 2J13A 1MW0A 2EF9A 4KGLA 1DJYA 3CUJA 3TWBA 1EWEA 4DAFA 1O66A 4A8IA 2QPXA 1TZZA 3MVTA 4QITA 2G3FA 3UG4A 3ARRA 4D1JA 3B04A 3NQ2A 1JZ4A 2NXGA 3OO2A 4NY2A 2QCHA 1UG6A 3FA3A 1XYMA 3CPGA 4YTRA 1K8CA 5CZ0A 3C0JA 3EEZA 1IZJA 4GQBA 5CPLA 1QASA 3H21A 3GH4A 1CI1A 4CEUC 2OSXA 3GTNA 4V33A 3H23A 3ZJ6A 3H4WA 2WMHA 2NXHA 4L9ZA 1SM9A 4AHPA 1Q4NX 1AQ0A 3WF4A 5JBEA 4UTFA 3G77A 2ZA1A 2FZ8A 1FH8A 1X6NA 2OLSA 4MF4A 2HJPA 4ZO7A 1T40A 4C6DA 1ONRA 3RITA 1Q4WA 3AU6A 3O6CA 3EKGA 4M7SA 4P2VA 4FNTA 4A35A 1YDVA 4YHGA 1YIXA 3QOMA 4GYFA 5IDZA 2W91A 1DWJM 4IMDA 4K1GA 2FGLA 4Q6XA 1V51A 1GYMA 4OHQA 3RX2A 3TC3A 3B40A 1R38A 4IMCA 4B2DA 5JIWA 2GZXA 5ECVA 4AZGA 4D2JA 4INFA 5CGTA 4LUYA 3JUGA 3WK2A 5CPTA 1WNOA 1W3TA 2REQA 1Q65A 3S9YA 1F8MA 4AW7A 2OKOA 1OT2A 1PSCA 1DIOA 4RZ6A 4F4RA 4XZBA 2X09A 1J01A 5FJTA 4WY0B 2JGYA 1QTWA 4NXKA 3L7RA 3OLEA 3WLSA 3VK5A 4QE1A 2CBIA 4PMZA 1O94A 3LBMA 2QF8A 2VD8A 3NZ1A 2W63A 2ZA3A 2CBJA 5D33A 4IGHA 1OIFA 2PF0A 2QCDA 3TC7A 2OG9A 4D6DA 3N04A 2Q3OA 1FY6A 3CAQA 4FOJA 3WF3A 5JXQA 1UIOA 1ZUAX 3B06A 4PMYA 3ZO9A 3AOFA 1KRCC 3P2VA 2Z1SA 4KWWA 1UR1A 4JOMA 4MWAA 3INPA 1QT1A 1VKFA 2O92A 4YS1A 2Y7GA 1UBSA 2VENA 4XSMA 3VNJA 2W4XA 1L6WA 1UPPA 4S3FA 5CJ5A 4Y6GA 5CPQA 5K7JA 3OIXA 4TU1A 4QNWA 3GDMA 1MYRA 2FJUB 2IKIA 3CUXA 1NDZA 5D4YA 2IQTA 1TSIA 2DH3A 1GJPA 2XIIA 1Z89A 3T0BA 3AJXA 3QMSA 2G97A 3B03A 3T55A 1MW3A 3ITCA 1IWPA 2CITA 2VR5A 1XC6A 1V7YA 4JN7A 2MUCA 3FYYA 1KM4A 2OGYA 3NL2A 1QNVA 3KBSA 2J9YA 3UY8A 1X6UA 4MUPA 1S46A 5EFDA 4A8LA 5C9ZA 4O10A 3L0NA 3T78A 4NQ1A 4XD4A 3IWPA 4HYRA 4JIIX 4UR8A 4Y9MA 1XLBA 3B0VC 3W7OA 1HP5A 4S3DA 5IHSA 2CNCA 3RX4A 4O17A 3CQHA 3SCUA 1MO0A 4A8NA 4BA0A 1T0OA 3KHDA 3SSJA 1ZJHA 4JEQA 4YNGA 2OWWA 1A5LC 3WDJA 3TLQA 3JZEA 3ZXWA 1IEWA 3GNOA 2WBGA 4DWDA 1UA7A 2PDBA 2DT0A 4DWSB 1BRLA 1LLOA 4J27A 1EH9A 2FZ9A 4CUCA 3TN6A 1Z42A 1Q6GA 1AH0A 5AHFA 4LC6A 4UQBA 5JIPA 1QOQA 4IG2B 4IWWA 4WSKA 3LM7A 2H8XA 4FF7A 2MNRA 3VIPA 3P93A 3S2CA 2A0NA 4OOUA 1PIFA 1UKOA 1KLZA 1VHCA 3I4KA 3WQ6A 2PTXA 1H60A 3CAVA 2X2GA 4YWIA 4ZQCA 1E5JA 1I45A 3GD6A 2Q8XA 2C7FA 3RCMA 3E96A 3THAA 3POHA 3B8IA 1QNOA 7A3HA 2WNZA 1EGVA 3E9AA 3VNZA 4B9YA 2Z6IA 4PRRA 3E0IA 3ABSA 1CBGA 2WVUA 1P7TA 4AFYA 4XVDA 1VPQA 3WBWA 1A4MA 3E2VA 3FJ6A 3WSUA 3B0PA 3VA8A 1U2YA 4LYPA 3AMGA 5IRPA 3MSYA 1IZCA 4JTUA 1L6GA 1E5NA 1QFEA 7ENLA 1ZGDA 1RK6A 2NLIA 3NYDA 2HE8A 3ITTA 1ZBCA 2XJ7A 2IXUA 1WB0A 4MKSA 3W2MA 1PS9A 3UERA 4GYPC 3ABQA 1AL8A 1YPIA 3THCA 1E0VA 4J9JA 3O6YX 1ZFJA 2ANUA 4HHMA 2CERA 4R7WA 3SFKA 3IJLA 4JR5A 3UXIA 3TYEA 3QGKC 4WOQA 5IFPA 3VTRA 3KOFA 5C71A 2TPSA 5IBXA 5I7GA 3NUKA 1R0MA 2NVDA 3UPWA 2DSKA 3EB2A 3V0UA 1VEOA 4Q7BA 4AD1A 3OLDA 2A3EA 4J3UA 4HPJA 1R3TA 1XIMA 2NX3A 1UD8A 4CD7A 4ICCX 1JDFA 3FK4A 1EZWA 4YTUA 4HHHA 3HFTA 5BRBA 1TYGA 3FAXA 4H7CA 3M7WA 3B4YA 1SMAA 2PUZA 2PU0A 3RUBL 3HO8A 4WKAA 5I6SA 5EU9A 2P8BA 4ZCWA 4P7RA 5LXXA 3QBUA 4W85A 2A3HA 1EC9A 1BHGA 3N6JA 4R33A 4NU7A 3TSDA 4EP8C 1GVYA 1HKVA 1VZWA 3I3BA 1J18A 5A1AA 1GPFA 1NIUA 4KBXA 1T96A 4E6MA 3G3MA 3TSMA 3O6DA 4MDPA 1I0BA 3MYPA 2FJKA 4QLJA 1B54A 3F7JA 2R9RA 2E6DA 3PJTA 5A2AA 4LAZA 2PLJA 4N4PA 4Y7EA 5F4SA 4EF8A 2NUXA 2E4TA 4W86A 1G4TA 1FVPA 4PUNA 3TOPA 4URIA 2NUWA 1S1PA 3PPHA 4BY3A 1P5BA 3BAKA 1W32A 1V02E 3E2RA 1TZ9A 3AAMA 5HJYA 3AISA 3TCEA 2CC0A 1GOQA 1QDSA 2NQ5A 1JULA 2OZTA 1XIEA 1VP5A 4XZHA 4GGBA 1CW2A 2W61A 4RR4A 3S2JA 3MO7A 1PX4A 5CPNA 3NQEA 2DJXA 1NP2A 1AL7A 3Q45A 4RNJA 1HNYA 2OZ8A 3CB8A 1TA3B 2WK2A 4S3CA 4YYFA 3ZR5A 4JTHA 1AJ2A 3S5ZA 2XH4A 3G1VA 3AU2A 4QFUA 1UP3A 3JW7A 2DIJA 1C9WA 3GVWA 3VXGA 4PL2A 5ENLA 2CHNA 5F4WA 2OXNA 1G01A 4LUSB 2WAGA 1EOMA 5EL1A 1LP6A 1O5XA 5MHBA 3C86A 2YCJA 1JRBA 1TV8A 1KGUA 3LENA 5I78A 3VFCA 2Z26A 3OGRA 4KKXA 1HKKA 2PD5A 4JIEA 3WX7A 1EC8A 5D05A 1F3WA 3JU2A 1W1TA 3TA9A 4WGXA 4FALA 5AC4A 1FH9A 3C2FA 5FACA 1K7EA 1K7FA 3CQ0A 2Z6JA 4ICMA 2XN0A 3L4YA 4REQA 1MW2A 4UZUA 3F5LA 4Y8EA 4OU1A 3T2QA 2BNJA 2WPGA 3MCOA 3TW6A 3O63A 3RCNA 5EMMA 3FY1A 2ZX9A 2OWCA 2XSXA 1EGZA 1X8FA 1Y5VA 1CTNA 1VBHA 1TPEA 4UTWA 1HJQA 1OCJA 4S2CA 4P7QA 1E0UA 3OA5A 2DZAA 1R3QA 3QJAA 4Q7NA 4LPCA 1XBXA 5D8WA 3REQA 3SY5A 5FKYA 4BKNA 1CLVA 5BXRA 2J4GA 1XR2A 3HG5A 4JQAA 3SCWA 3MUCA 1HX0A 1V03A 2XGIA 9RUBA 5D2XA 1C8XA 3THDA 1GPWA 3TR9A 1NWSA 3M6DA 1E6XM 4W4QA 3TJXA 3M0KA 1XIBA 4AVNA 2ZXQA 2EBNA 5K9CA 3LNPA 3H7RA 4I6KA 1C93A 3AQUA 3KBMA 2Q01A 5E09A 3LNMA 5AVHA 1JNEA 2IPGA 2GJXB 4J7RA 1A0DA 3GUWA 4KH2A 2G37A 1FWWA 4GUFA 3BV4A 3QF0A 2YA0A 1NWUA 4EAYA 4TX9A 8RUCA 1JI2A 4W5UA 2X0SA 4RDVA 1S5VA 1MDLA 3W72A 4KS0A 4WKHA 3F2CA 3W07A 1OGBA 1TV2A 3ME3A 2WSKA 1I8JA 5E0CA 4G1KA 4K3ZA 4H8VA 2QUVA 4GI4A 3WF2A 2A6NA 3GBDA 5HQLA 1XD0A 4AD4A 2QCNA 3WLTA 4FS9A 2Y85A 3PNUA 3IAPA 1JPDX 1Q6LA 4DELA 1U5JA 2CLEA 1LRNA 2Y5SA 3CV2A 1F3TA 3VCCA 1JUKA 3CH0A 2ACUA 1KXHA 4KRZA 3NQBA 3IUIA 5LA1A 1GG1A 3QHMA 3QV9A 3MI6A 1RCXB 2E9MA 5DRIA 1ZBKA 3RRXA 5A8GA 2WSRA 2FPVA 3CLMA 3EKZA 4O4VA 1L9WA 5EA9A 1WBJA 1TTPA 1OC5A 2WO5A 4C5YA 3DU0A 4CCDA 2DVXA 2XIOA 4JYDA 5FAGA 5BU9A 2WSYA 3ELFA 1P7TB 4FX7A 2HE5A 3FKRA 1FTXA 1DWHM 5CPSA 2ZKMX 2C19A 3WDQA 4CN6A 1DV7A 3P81A 3T1GA 2RJHA 3G1HA 3LHYA 4Z2KA 1W0MA 1MZRA 3ZWTA 1XXXA 4J2PA 4JBRA 1PIGA 1IT8A 3KXQA 4M1RA 2VEMA 3XINA 1IF2A 4H8UA 4EXQA 3LHTA 4PTNA 2HV5A 2I56A 2A3LA 1M9HA 3PSWA 1A5SA 4GIAA 1HTIA 3WJWA 1UD3A 3U0HA 1PDYA 1F6PA 5CKSA 1CGXA 5I06A 2J7HA 3UYIA 1AH3A 3LYEA 4IISA 4AZBA 1QMLA 4S3GA 1AMYA 3EPMA 3L12A 4IFRA 1SW7A 5FF7A 4CNPA 3WQOA 4O18A 4XUYA 1KXQA 3WEMA 3BAWA 4UMCA 4HHPA 3VI2A 3FDKA 4M6PA 1XIIA 2PU1A 4NX5A 1WPCA 2WZMA 2ZXDA 4I8YA 3S9IA 1BG4A 1J5TA 1F61A 3KBNA 5CLWA 3EA2A 2EPKX 2XVPA 5A8PA 1W9DM 1XDLA 1OC7A 5LGZA 5LIXX 2HQAA 2YA2A 1ZLPA 1PPIA 3EOLA 4YJ5A 1KR1A 1XGDA 4PGLA 1R3RA 4AD0A 4HTBA 4OV4A 1J6OA 2FFCA 3W1QA 2E68A 2YA1A 3ZJ7A 2CFFA 3OGVA 1T8XA 2EHHA 3T05A 5DF0A 2JF6A 3RIKA 3W70A 1HXJA 4O14A 4XTDA 4LVGA 1ALDA 2DORA 2DZPA 3UJFA 3P82A 4GACA 2C15A 1AODA 5BWAA 3M5XA 4A8RA 4BF5A 1G1YA 1XV8A 3EX4A 4CEXC 4Z1YA 2YSWA 4KQNA 2IKJA 1YRRA 2HS6A 1JQXA 5HJXA 1XUUA 3ANYA 3L4WA 3VKAA 1GVOA 3ATYA 2FZNA 3GUGA 1UZHA 5D9NA 1D7FA 4HP5A 1Q6CA 2VGIA 3BG9A 4ML9A 1X97A 8TIMA 1GWJA 4R3UA 2WHLA 3QPZA 4EIVA 3WQVA 2XVKA 1E4MM 3UG3A 5A6MA 3W75A 4X0VA 1QJWA 4Q8VA 5AECA 2GSJA 3T81A 2BLEA 3IIXA 3BGGA 4JHMA 1SFTA 5I5RA 2C1HA 3GHSA 1GQIA 3W7LA 1GKQA 5LIWX 4J3XA 2P0OA 1NWRA 2JK2A 2GK1B 4DXXA 2FMOA 2QS8A 4LWWA 3GC4A 4QS5A 3CLWA 1UZDA 4C91A 3S1WA 3KP1A 1JF5A 3A4XA 3G1XA 3PUEA 4BQ4A 1XFCA 5JH1A 1YW1A 5BNKA 3SEPA 1JZ3A 1QWKA 3URQA 3UZXA 4MGGA 3KFTA 1BSLA 3M0IA 3SJNA 3MVIA 2NT1A 2VC5A 1GVEA 2VGFA 3MKCA 3GK0A 4IMEA 4L5ZA 4UC5A 1A4LA 1BXCA 1B1YA 5REQB 1POJA 5L9FA 1FXQA 1EP2A 1D9EA 3Q67A 4A05A 3TAOA 3H24A 3G6MA 1BWLA 1GKPA 4AY7A 2VC6A 5F1UA 2G96A 1MNZA 3SRDA 2HPMA 2BGSA 2DIKA 4I9JA 4HU0A 3S42A 4JQ1A 4BHYA 4PMXA 2EG6A 4WY0F 3WEOA 4QG6A 3HOJA 1N7KA 1E9YB 4LY4A 2A3CA 1UMLA 4ZO9A 3BCFA 2VXNA 4KCWA 4IIEA 1WQ5A 4XBKA 4XKMA 1W17A 3K1DA 3N25A 3FGCA 2VVSA 4O15A 3RGTA 5LIKX 3WL1A 2ABBA 2Q02A 2R1KA 1E3XA 3IRDA 4BI5A 4R5EA 2WKLA 2DSUA 2R94A 1QK2A 3REQB 3IIVA 3MY9A 1J6PA 2VRQA 3A13A 3NO5A 4F79A 2A2IA 4ZENA 4J1OA 2Z1BA 3EWDA 2ALRA 4MFDA 3N14A 2F9RA 3GHTA 4F9DA 4A4AA 3ZT6A 3P0WA 1KBLA 2BMBA 2D2GA 3MSGA 4B5UA 2YXGA 4GNJA 1JAEA 2OT0A 3VNDA 1FCQA 4D8ZA 1E0TA 3RPDA 2PLMA 3ABRA 1QCWA 1EJWC 2XGBA 2WMKA 3V75A 3WLPA 4C6IA 3QMTA 3OW1A 1A5OC 4Z0SA 3KBWA 3I7RA 5K9DA 1EJTC 2QCMA 2HMCA 4C6NA 1J11A 3RX3A 4UQ9A 1MEHA 2ZRUA 3UCDA 1C8QA 3UWEA 3WQGA 5D9OA 4DBWA 4F0MA 1W56A 4GZ7A 4DUOA 4LYKA 3S9ZA 3PJWA 5JQ9A 1BXNA 2GVYA 1AW5A 5HATA 2OCZA 3AUJA 5HR7A 4U3AA 4HU4A 3DHFA 4W93A 4B5XA 5ABFA 2ZC8A 2Y6ZA 3ATZA 2BV9A 1ADSA 5BOFA 2EKCA 3M0LA 2QGYA 2X0HA 3HV8A 5DMNA 3TJLA 4B91A 1U1UA 1H50A 1OX4A 3VDHA 1XM3A 3Q94A 3LOTA 3AYVA 1KKOA 3E12A 1H1YA 3QFEA 4IFKB 1DWGM 2BHZA 3VGDA 4KFNA 2YKKA 1LQAA 2Y70A 3LCXA 6TAAA 4CCZA 2ZDRA 2PRLA 4ICNA 4L9XA 5G2HA 4AEFA 3CHCA 2CCRA 1CCWB 2DT3A 4FLSA 1OZQA 4IPLA 4BCEA 1XYBA 3MUY1 3N11A 5A6TC 1F9CA 1WDRA 4E2DA 4LRSA 1OCQA 1UZ1A 2D0GA 3PB0A 7REQA 5IXEA 3SUUA 3TWAA 1QXLA 3HU7A 2RAGA 3MP4A 2FGZA 4YCOA 4K39A 3VDGA 5FSEC 1UCWA 3AYSA 4PTWA 5FF0A 3E2QA 1UH2A 2P53A 3UG5A 3VKKA 7PTDA 2VELA 1MXGA 2FH8A 2IPWA 4V2XA 4JIHA 4GX9A 3WDPP 5LNVA 1B5TA 1KB3A 1D8CA 1R7AA 1E70M 4QAIA 1EQCA 3CNYA 3W1RA 4LS0A 1W5MA 4QHRA 4E38A 4LNCA 3IGXA 2WCAA 5H2ZA 1REQA 4AZHA 2UBPC 1KC7A 1TV5A 1GORA 4ORIA 1S3TC 4LANA 5C70A 3W7EA 3LHZA 1XX1A 1J96A 2ZRVA 1X98A 2X16A 1LQ0A 2VQUA 1Q85A 1O4UA 3ARXA 3W4RA 2CLPA 5GPRA 4C65A 2YCLA 3NPUA 1S2UA 2J7CA 1KM3A 2OSYA 3ECQA 3R10A 3MJYA 1UBPC 2DZUA 2KZHA 2W6RA 3B4UA 3ES8A 5I07A 1AQHA 2NQJA 2PBGA 4Q32A 1KR0A 3LCHA 4JFWA 4L1GA 3R8HA 1UIPA 2QULA 4H6EA 1DJQA 1HIZA 1XLCA 3KDNA 3W28A 1LL6A 3CUFA 1DJWA 3I4EA 2EGZA 3SN1A 1NP0A 1QOPA 4JIQA 4OBRA 3FYOA 4JFVA 2PLKA 3BLDA 3W3OA 4MPQA 4KEVA 1QBAA 2X41A 2DVTA 2OODA 1QWGA 3N6HA 4N9DA 1J2WA 2FDSA 2BVDA 4ACZB 2JQXA 3SQLA 3HQNA 5ABHA 4UFLA 1KLYA 4LW7A 1V3HA 3KBJA 3ZLHA 3E49A 4LBSA 4RXGA 4GQRA 2GWGA 3MKKA 1EPVA 1IHIA 2ADAA 3ZFHA 3NYZA 2IXVA 3N2MA 3NSXA 2QJIA 4EAMA 3V1PA 2QDGA 4ZA0A 3G24A 4DJEC 4HN4A 1VCFA 3H2MA 4AEEA 1KWKA 2A3BA 5BZAA 2C0HA 3KOXA 5HQEA 2QJGA 1EP3A 2VFHA 2NX9A 1A3WA 1FKXA 4I9MA 3RF9A 1YBQB 4PUJA 4QR6A 3C2OA 5C2GA 8XIAA 4ZQRA 1CXKA 1QI2A 4QSHA 5KZ6A 3SO7A 4Q3MA 3DHDA 3WMLA 1XKJA 4O0ZA 4TV6A 1KFBA 3I6EA 1H7PA 1JYVA 1E6SM 4H01A 4O11A 3ZOAA 1EKOA 2WVVB 1SGJA 4IXXA 5H8PA 4GBUA 3OZPA 1SO3A 2PI6A 3KUMA 3ZZ1A 3GNRA 1G4EA 1ZAHA 2FPTA 4E4FA 3NNTA 4G56A 1AD1A 2HBVA 3VDAA 2Y89A 1O5RA 3NQVA 3NZRA 2ATMA 2EO7A 4I5XA 4V28A 3OOQA 4OV9A 3FGCB 3UBPC 4GIYA 3IUHA 4DYKA 1FWIC 4FNRA 2WC3A 3WNKA 3WMCA 2C0AA 5E5CA 3NQ6A 1NF0A 4MLRA 4WDXA 2XSBA 4QE5A 1D7KA 3ITOA 1FWFC 3S2NA 3Q65A 1IEXA 1I1XA 3LSCA 1J79A 4UFJA 4DJDC 1X1NA 2X42A 3CS2A 1MEWA 1GZ1A 1AA1B 1HKIA 1V4YA 1TX0A 4GUHA 5FAJA 3MMWA 2DUAA 4DZHA 4YTTA 5CSRA 4HOZA 1XISA 4EXBA 2OO0A 1POKA 1F6KA 3SURA 3WDIA 7CGTA 2B31A 4QQUA 2B0MA 3O0FA 4KERA 1K3UA 1JRCA 2XGZA 3QSTA 4AIEA 4WDWA 2PP0A 5CSSA 4B15A 5A6KA 2DT1A 2Z1WA 3RR1A 1PXGA 3GXDA 2CETA 2E28A 4UUIA 3KL3A 3MBFA 3BJFA 1K9TA 1OG0A 1TJRA 1A0CA 1V6YA 2DSVA 3VOCA 1ZP4A 2E3ZA 2VP8A 2WZEA 3MZNA 1W8GA 3WK1A 5GNXA 1RA5A 3K8LA 2BBFA 5BCAA 4GYPA 1OC6A 3PY2A 4B92A 2G5WA 5BROA 1E55A 3OVRA 1B31A 4GX8A 3DX5A 2C14A 3N4FA 5ECUA 1DXFA 3AIQA 4AD5A 4F2BA 1W1B1 4BQ5A 4UCGA 1F76A 2ABAA 2CHOA 4DNMA 3IACA 2VCBA 1IR2A 1RP9A 4NNAA 3WQ5A 1JYXA 3A64A 4W7WA 1SMDA 2BASA 2OOFA 3BQ6A 5A95A 1TPDA 5H8MA 5FJOA 3UJSA 2NVCA 3ITVA 4NSBA 4MSSA 1SYTA 2X40A 2YFOA 3UVIA 4X2PA 5C2XA 1VBRA 4HYVA 3PWIA 4B5TA 4K36A 1B90A 1EJ7L 1FA2A 2TYSA 3F4CA 1KFEA 2VZUA 3S47A 2EXOA 4FNSA 2IPJA 4RLIA 2VDHA 1TVLA 3AZSA 1EO5A 3U2ZA 4LCRA 1GVIA 1J5SA 1OCNA 1BXBA 4LX4A 4PTMA 2V3FA 5AC7A 3WCZA 5FSDC 5EPDA 3TAKA 1VFFA 3PSVA 4MLJA 5KZEA 2BX7A 2ZRYA 1O6IA 3IIPA 2I14A 5CLTA 4AVOA 1V3IA 2AL2A 1KCKA 2YPIA 2ZUMA 2FVLA 1VCVA 2Y61A 5BMWA 3EOEA 5C5YA 4YWSA 4Q6JA 4E4PA 3UR7A 2XTKA 4L4OA 4O50A 6XIMA 4TMBA 3A6OA 1R6WA 1TELA 2YB1A 2YOCA 3MPGA 4AF0B 4UQAA 3M6YA 3VVGA 1XSIA 4ZQMA 3TZNA 1OGGA 2P1FA 3CZKA 1DJHA 2CZ5A 2P10A 2AQWA 2AL1A 1J0HA 3FHAA 2QCEA 3C8NA 3O9NA 3G18A 4JHOA 2OEMA 4H9UA 4QCFA 2PTYA 1BF2A 3AS3A 3DFPA 4DY1A 1W5QA 4HSOA 1YPXA 3V18A 4DLMA 3TTEA 3CIXA 2OX1A 1TJ2A 3TEVA 4L61A 4KT2A 2W62A 3S1UA 5IM51 3GC5A 4E3VA 4MM1A 1ZJBA 4GC3A 2YCLB 4X2RA 2V5JA 4KWVA 1JXKA 3UJ2A 3W81A 3W76A 2FB2A 3WBXA 1BKSA 4M3PA 1VEPA 4MJ4A 4O4WA 4HIBA 1ZTVA 3DFYA 4RE3A 1HKMA 2HEJA 2BHYA 4RE2A 1TRIA 2MANA 5CG7A 2DW6A 2VNCA 4IL2A 5D02A 4RPQA 3ORWA 1KQYA 3WLQA 4DBEA 3E0WA 4QBXA 1SZRA 4DIAA 2BTMA 3OZOA 1QI4A 1XCFA 2V63A 1A5AA 3LRMA 3BJTA 4HZMA 3WUFA 5E0KA 2Y88A 2ALDA 1TFVA 3URNA 4DXVA 2QCGA 3DYOA 3ARZA 3CWHA 1OFPA 2YLLA 3S83A 5A6SA 4C7FA 5EMKA 2NW0A 4W7VA 1CEOA 3C2RA 2Z2BA 5H1WA 4NRRA 1ZAJA 1XGZA 3QLLA 2QPUA 4OT7A 3MBDA 1QW9A 4IMAA 1UA3A 2NX1A 1CIUA 3R8GA 5I3JA 1B4EA 4ZGYA 1U22A 1JFHA 5CXPA 4EPBC 4X63A 3O16A 4NAEB 4EPDC 4IZGA 2HXUA 2A6LA 3O07A 3TW9A 5F7UA 4LAKA 3QGVA 2ZX7A 4AZ6A 5HK4A 4QJ1A 4EANA 2CLFA 3NQAA 1JCJA 3R43A 2V2HA 4FMVA 4AWUA 3CPUA 4E0CA 1R85A 3NDOA 1JXJA 4N2YA 1A80A 5HUOA 5JVLA 1AQFA 2ZZ5A 3ZLFA 4WRHA 1FCVA 4AVFA 1QVBA 3QQWA 4MFEA 3EDKA 2WCSA 2X05A 4F8XA 2XN2A 3PPFA 4AXKA 4NZ1A 1Y5WA 1SJCA 1N82A 3H4GA 2XVLA 3UJRA 4JIRA 1S2TA 4DPQA 1IYXA 3EMZA 3MTWA 1BFNA 1U1HA 5HPOA 1PUDA 3F4VA 5C2CA 2OZ3A 1XG4A 4PUWA 1XIGA 2Y7EA 4M24A 5D8ZA 4AEOA 1ZCCA 5K2ZA 4AMAA 4H83A 1MMFA 4MOZA 3UWZA 2J75A 1L0PA 2E1DA 4NZFA 1IXPA 1W91A 5BXSA 4X22A 2PDWA 2PZNA 4JY9A 5E93A 3VNLA 2WMIA 2ZVIA 1G69A 4XBJA 5LA2A 2ACRA 1ZB5A 3G1FA 2P76A 1KD0A 4NL1A 2W5FA 3ABZA 2BODX 3C6CA 3RLVA 3GXNA 3GW0A 4A21A 1H49A 5HUPA 4MY1A 1P0NA 4UOJA 5D30A 3SCOA 3TFCA 4ZO6A 4H9TA 4BQ3A 3TR2A 1YXYA 1ITQA 1JGIA 3BZJA 1VJSA 2WHMA 5I00A 2Z29A 1EJVC 1TCMA 1KBKA 3AZRA 3DG7A 4C60A 4RW5A 1YADA 3WD4A 3LPPA 2VC9A 3KTCA 3M64A 4PCPA 4P7NA 3ARVA 1XGEA 1YHTA 1H5VA 3KOYA 5I3DA 5T8GA 3CH9A 2GYIA 3P8IA 1WO2A 1CWYA 1E15A 1F3EA 2ZQ0A 4GIRA 2XWEA 1YKWA 3URAA 2Z1VA 3V0TA 5LKYA 3SDOA 4AISA 2EJAA 3LGEA 4PBFA 4LUTB 3LB0A 3LTYA 3SCPA 2GVJA 4U3CA 4Y96A 4O1DA 1O12A 1F73A 4GZEA 1MQRA 1RJRA 1ISZA 5I2UA 2EPLX 1MUMA 3QY8A 1LBLA 1M03A 1R5YA 3R2GA 3GVRA 4XAZA 3HV9A 4GC4A 3A3XA 1U30A 4F0HA 4D9PA 4ML4A 3PBGA 3VM7A 2PRMA 2VX6A 3WBAA 4F0KA 3N1AA 1K6AA 3OU8A 2QEZA 2GDQA 3PUDA 4HOWA 5MKGA 3KBVA 4HK5A 4LUJA 2JKAA 4U2YA 2JEPA 4JD4A 3BSMA 1Q7ZA 2VKZG 3GAYA 3NZQA 2DIEA 1FXPA 5CC5A 4ACYA 3I68A 1A5CA 2YIHA 3LU2A 4NJJA 1JDCA 1ZU8A 2H9AA 4J3TA 1JNDA 4R9XA 2XZ7A 3DI0A 4PMRA 3WJZA 4MMWA 1CXEA 1YTEA 4MKNA 1X7IA 4L1XA 1OFQA 3WQDA 1OINA 4WSJA 1ZBVA 1C29A 5HNRA 1W37A 3F5KA 4TUFA 1W3NA 3JVAA 4HU3A 2NVAA 3SCNA 1EC7A 3M44A 4I8DA 2ZRZA 3CTLA 3IK4A 4JTGA 5CZTA 4CU6A 4ZQOA 4IGNA 1YDYA 3D5HA 4FR6A 4GXWA 1BTMA 2P0IA 1WKFA 3PTKA 4BF9A 5JBDA 2VURA 4EWND 1MSSA 1RPKA 4IIHA 3F2DA 1SZGA 4Q8PA 4CQ8A 4HCDA 5PTDA 3VMOA 1R2RA 4RXFA 4LCQA 3EMCA 4OJYA 2QUTA 1XLKA 5F2MA 2AL2B 1TKKA 3WQFA 3VO0A 3V16A 3CQKA 2HSAA 2VDIA 4J3ZA 4LT9A 3W7NA 3Q2DA 3ANUA 1V5XA 3W7JA 1NQKA 1HVXA 3DFNA 4JYFA 3NPXA 3EYPA 3ANVA 4MY8A 2V6AA 1E6RA 4WIWA 1KCZA 3CJPA 3G0XA 1S5TA 3GNXA 4QG8A 1U33A 3TV8A 3PBVA 1UC5A 3QPEA 4MADA 4Q4RA 3O7UA 5AVNA 4AU0A 5T91A 2IQDA 5U7SA 3TZFA 3VCRA 4PBEA 5E6ZA 1Y5XA 4A3QA 3OG3A 5CPOA 2J79A 3RILA 1P6CA 3ZR4A 3EGJA 2WZTA 4K8HA 4GQQA 1ME9A 5HINA 3N2BA 3G8EA 1B4KA 4E2BA 1ZENA 1MVYA 2RH9A 4B4FA 2ZRWA 2OYLA 4AWSA 3HN3A 2XFFA 4QDPA 4CD5A 4QEEA 3TW7A 2WHKA 2YR1A 1GW1A 3VNKA 1G0CA 4PCSA 4HPHA 3EPNA 3PANA 2E6YA 4GG9A 3HGOA 1G94A 3RN6A 2RGMA 3A24A 3LV6A 4QLKA 5CPMA 5DBUA 1BLIA 4JS3A 2QJJA 2ZE0A 4ALDA 2XFRA 1UWRA 4PEKA 4HMDA 1EOKA 4JQ3A 1NOUA 3EWZA 1I1WA 3O8AA 1VS1A 4HJWA 4UFIA 5FIPA 3EB4A 2QLYA 5D04C 1EL3A 1QHZA 4OOZA 5B7YA 5I09A 4PBGA 1C92A 3K4AA 3N9KA 4FNUA 2BVYA 4D6EA 3WQEA 4AIBA 2VX7A 2HVNA 3KHJA 4DBDA 1LL4A 1HJXA 5DCBA 5HNNA 4C6BA 1E1CA 4PUUA 2YDAA 3T07A 5TNVA 3GB6A 3E3HA 5HAOA 1B2YA 1EJXC 1BSIA 1DQUA 3PZTA 4MNJA 2GGEA 3TNBA 1W8SA 2J47A 3ZJKA 3KCLA 3NL6A 5TQLA 2DT2A 3TA6A 2CXEA 3MMDA 4BEQA 1KRAC 4IPJA 3BAYA 3Q37A 3CZJA 3M7SA 5KZDA 1BF6A 3G0SA 2PFHA 2P3EA 3H8AA 1JG9A 2CZDA 3VDCA 1LG2A 3G8RA 4ZXLA 3QY6A 1KM2A 4C6JA 3IGHX 1DHPA 1OFEA 1G4PA 1C90A 3LTSA 1SQ7A 3LPGA 3V0SA 2RGLA 3U7VA 4P5UA 3USBA 3KZSA 2V5BA 3AXKA 5EGRA 2BXVA 4GNKB 3CYJA 3EMQA 2OYMA 1FWEC 6REQB 1QO2A 4BWLC 4GYKA 2PTZA 4OUIA 2WC4A 1UWUA 3L2IA 4PFMA 1W5OA 2WB5A 3N9RA 3EWXA 4AIOA 2TAAA 1O95A 1XC4A 4K38A 1SJAA 2POTA 4O1AA 1WDDA 2J8FA 2X8RA 3WH5A 1QI0A 1G9HA 5HPCA 3OBEA 4TMCA 4DF1A 4XX6A 2Q8ZA 2QT3A 1RD6A 5AYXA 2PCEA 4O16A 4ZTXA 1E4LA 4GQ0A 3SRFA 1A0EA 4WEVX 1XP3A 4CN1A 1LUCA 1FCUA 3NGFA 7TIMA 1VRDA 3EWCA 1LORA 3UXAA 2Y7FA 1JPHA 1XUZA 4HYWA 3DGRA 3PUOA 1UPMB 4YTQA 3FDGA 2QV4A 4DJED 4JQ2A 2OFJA 1EWDA 1PHWA 3S0CA 2OR2A 2J74A 4OBSA 4C6PA 3FEMA 4HPXA 5I3GA 4G1NA 4E5TA 4CGTA 2F6XA 4H3DA 4HD5A 5M1TA 4DJFC 3CUGA 4B90A 3EA3A 1L6SA 1H7XA 3FN9A 3FIGA 3QLDA 2V8ZA 2WVTA 3U4AA 1JD9A 3KVLA 4E8GA 3AO0A 4DYEA 1EF2A 4E3TA 5LA0A 3T09A 2ZXAA 2W3ZA 3VOJA 3VC6A 2D73A 3BPWA 1E40A 3GVQA 2AAMA 4P8UA 4LB3A 2YXOA 3SR7A 1O1ZA 3B9AA 1JJKA 3KLLA 4GK8A 2ZX5A 1KKRA 3DAQA 5CSUA 1RP8A 2FFIA 1QOXA 3T0AA 3MHUA 3AXIA 3GU1A 2FZMA 2PPGA 3V4BA 4LQ1A 3VIOA 4ZTYA 5E70A 2BWGA 4GISA 3DBPA 4F0RA 4JFSA 1ONXA 3R5EA 2E40A 4N0RA 1JDAA 3WBYA 1W5PA 3B9OA 4IF2A 1HO1A 2GVGA 3WFLA 1YX1A 1QATA 4LUIA 3MU7A 5G1MA 3FOKA 3C4UA 2VR4A 4TVUA 4DJDD 4PB4A 3R89A 5MKGB 3BQ5A 1OEPA 3TX9A 5GNZA 1E43A 2PEVA 3AIVA 1HJSA 3BW4A 3L68A 3KCOA 1BPLB 3L21A 2VCAA 4YVXA 4HPGA 4RUBA 3AHZA 1DQWA 3OQEA 4DZ5A 1RQHA 3UPMA 4UOQA 3K8MA 3W86A 4QJ5B 3L5LA 4N6EA 2VFFA 1GHRA 3EDJA 1TREA 1PV8A 3AMCA 1DHKA 2BY2A 5A2BA 2E5BA 3FEQA 3MP5A 5CBBA 3RM9A 3LCWA 3E38A 2V82A 2WM0A 4AYSA 1H1ZA 3WO8A 3BAIA 1ITCA 3R0DA 4ZOAA 3WUEA 1ZNNA 4LBUA 1DJZA 3BMXA 3VKJA 1YE6A 2FVMA 3DFHA 4EF9A 4K37A 1V08A 1NFBA 3PM6A 3UG8A 2E0PA 3UFYA 1QK0A 2NWRA 3O15A 1DTNA 3LV5A 4FR1A 2ACQA 1UB3A 3W2KA 2YZRA 3KW3A 2ZC1A 4DZIA 3QSRA 4RDWA 2G4JA 5FF2A 4HA0A 4MJ2A 2C79A 4OQVA 3HMJG 3DZ1A 4Q7IA 1VHNA 4KFOA 3W26A 1ZJIA 1GNXA 1GZJA 1GGOA 4U31A 4PCNA 3HJEA 3S4TA 3TJ4A 2Q3RA 3ITYA 2AAAA 1V6VA 3KOZA 4IPNB 3SGZA 3VIKA 2ZWZA 3KL5A 2GGHA 1W5NA 1XLLA 4KPLA 3STGA 1VPYA 2FKPA 4ZODA 1CXHA 2NWSA 2OQLA 1BTCA 2J7BA 3PBWA 4ZQNA 4J35A 1TR1A 2V2CA 2I9EA 1XS2A 4AAJA 4A3RA 4GLEA 1S38A 4IMGA 3GU9A 2DZBA 3OGSA 4ZFMA 3GXMA 3VIJA 1TV4A 1BVZA 3GFXA 3N6QA 1ESWA 3TQPA 3U4FA 4F0LA 3L67A 4AXNA 3MUXA 4K2SA 1RH9A 4LVDA 2WOQA 3M47A 1DXEA 3IIOA 1K03A 1EYEA 4JNZA 1TQJA 3SGUA 1DBTA 3V36A 1PKNA 3GO2A 5T26A 2GOUA 3KLKA 1AZ2A 4F48A 4NZJA 4U2ZA 1PX8A 2WVSA 3H2OA 3QMRA 3GQYA 3I3DA 2V5CA 4MJZA 4V1XA 3NJ3A 1C7TA 2Y0FA 4U10A 4OVXA 4IGMA 3STFA 2E77A 4W89A 2QPSA 1K6WA 3MHFA 4XSLA 5ABGA 4NJGA 1AJ0A 3N18A 4M8UA 3SI9A 3A22A 4I6VA 4RZ4A 4GVFA 2VQTA 3NPVA 1BAGA 4UNIA 5MF5A 5T9CE 3EXTA 2EG8A 2GLKA 2BG5A 3GR4A 3UWYA 1EFZA 4O12A 2RDTA 3DYPA 4R9OA 3QC0A 3T44A 4QE4A 1XLMA 1QHPA 3HG4A 4GCAA 1KFCA 2VD9A 3OYXA 1XRVA 2WPBA 1RLDA 3LQGA 5KINA 1FBAA 4DJDA 4Q8WA 1SFLA 4R88A 1F5ZA 2HWGA 1SFSA 4L80A 2D20A 1M7JA 1UKSA 1ZP3A 4NVTA 1XWYA 2DFAA 4B16A 1F3XA 5JUVA 1DVJA 4X9YA 1ECEA 2CKSA 2O56A 1WX0A 3QFWA 4MKVA 2W67A 4LS1A 4FO4A 3PULA 2X1TA 3DFSA 4CNOA 1LWHA 1HW6A 2D2OA 1ODUA 4TTUA 2BDQA 3SM0A 2BB0A 2NSOA 5HBFA 1AW1A 3PP7A 1T5AA 3E0LA 2DZXA 4UTTA 1LUCB 3PAJA 1LT8A 2GFTA 4NHVA 1KV5A 1ADDA 2HRWA 3AFBA 4RKAA 5D2YA 1Z7AA 3UXDA 4JTAA 1WZAA 5I23A 3C0LA 4D8LA 1MXDA 3MANA 3FNDA 4IMFA 4HVXA 3AHYA 1V0MA 1W1A1 1GJWA 2AKZA 2DDXA 5K4ZA 3AS1A 4Q8OA 5HMDA 4QJ3B 3SQMA 4JTTA 2VCCA 4O13A 3GW3A 5H8UA 4ERIA 1WAWA 3WFZA 3W1UA 3BMWA 3IK2A 3R58A 2DUXA 2RJGA 1BQCA 3DDMA 1XLGA 2UY3A 1YTDA 3L5AA 5AYBA 1W1VA 2YCKX 5GNYA 3W7KA 2CLHA 1AUSL 2VEIA 4YLWA 3FLUA 3CEUA 1JYWA 1XRSA 3W53A 4H4IA 4QJ4B 1WCGA 1YNPA 4EE9A 4NZ5A 1DPMA 1PJ9A 4XKYB 4L6HA 3BLOA 4CVWA 1Q66A