4GUHA

1.95 angstrom crystal structure of the salmonella enterica 3-dehydroquinate dehydratase (arod) e86a mutant in complex with dehydroshikimate (crystal form #2)
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
259
structure length
259
Chain Sequence
b'NLYFQSNAMKTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREADFDILEWRVDHFANVTTAESVLEAAGAIREIITDKPLLFTFRSAKAGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEVKATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQERYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-dehydroquinate dehydratase
publication title Reassessing the type I dehydroquinate dehydratase catalytic triad: Kinetic and structural studies of Glu86 mutants.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Lyase
total genus 90
structure length 259
sequence length 259
chains with identical sequence B
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2012-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01487 DHquinase_I Type I 3-dehydroquinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4guhA00
1MEIA 3W7NA 2VFEA 3PB2A 4O0KA 5T26A 1W3TA 3HB9A 4OU1A 1KW1A 4PCFA 3QF0A 5AN7A 3PBYA 4Z1AA 4WUIA 3BV4A 1P5BA 3A9IA 4EWND 3EWUA 4FX7A 4Q4KA 3QSTA 1FCVA 2X2GA 3TCEA 4LRSA 3O07A 3P67A 2H90A 1NEYA 1ZCOA 3GZ3A 3LHTA 5EBUA 4Y6GA 4XKYB 3P74A 5D04C 4MKNA 3O63A 3BW3A 4NZFA 2Y63A 1MXSA 2HMCA 2FLIA 3D0CA 1K03A 4Z0SA 4BWLA 3CQ0A 4MYAA 3UWZA 3MYPA 1RD5A 3RFAA 3QQ0A 5KZEA 1JRBA 2E1DA 2CLEA 2P1FA 1E51A 3NZRA 1ZAJA 1W5NA 1EEPA 4JTFA 3TSDA 1UUOA 2OJPA 5C5YA 1JCLA 4O8RA 3EWWA 3I6RA 3UZ5A 3PM6A 3W22A 3W6YA 3W7EA 3SR7A 3W2MA 2E09A 2DZTA 4OBTA 1ME8A 3DKJA 1K7EA 1LYXA 1GYLA 1VCFA 1X1OA 5D2WA 5E93A 1SSDA 3G1DA 3WK3A 4O14A 5AYXA 4PODA 2V2CA 5G1YA 2DJXA 1AW2A 1THFD 4Z08A 3PBVA 2DZWA 4O57A 3LXBA 4WY0F 3U2OA 3Q37A 3TXZA 5D2YA 3KAOA 2W0UA 1ICPA 3NPVA 2E6YA 2ABBA 7TIMA 3GYEA 2WNNA 4R53A 4JTHA 5AOUA 3G18A 3M41A 2A2IA 5HWNA 1JUBA 4GUFA 1FCQA 3QEZA 1LLZA 5IM51 2EAWA 2CZEA 2OMAA 1L9WA 3LTSA 2B7PA 4TX9A 1KFBA 1TYGA 4PL1A 3SW6A 2NLIA 2PCQA 4KWVA 2JKEA 2NXHA 2DP3A 4AH7A 3IVSA 4JD4A 1H7OA 3QH2A 4QITA 3CM4A 1TJRA 3SJ3A 2CZFA 6ALDA 5F1VA 3CT7A 2QEZA 1B4KA 1YTKA 4MUZA 2QUTA 1VR6A 3C8FA 4XBSA 4AB4A 3DENA 2VEMA 4N02A 4O13A 5I3FA 2GPTA 1IXPA 1SFLA 1VYRA 4NZJA 3T78A 3G3DA 3GLCA 3IGSA 2DORA 3W1LA 1RR2A 3TDFA 3SY5A 1EPXA 2X1RA 1YPFA 3TJXA 4I7UA 4DBDA 3KFTA 1HUVA 3CPRA 4WXZA 4JTLA 1F6KA 2C16A 1OX4B 3ATZA 1J5TA 4M6VA 2X1SA 4RXGA 4WOZA 4ORMA 1W37A 1ALDA 3LRMA 3PUOA 4GFSA 3HQ1A 1H7NA 1VS1A 5DY3A 3F03K 2QJIA 1G4TA 1HTIA 5F2GA 4NXSA 2ZZ6A 1MSSA 4LC8A 5HJLA 1D3HA 1WOAA 4POCA 5LKYA 2WNQA 2WSYA 3HPZA 3NOEA 3TW7A 4O16A 3HJZA 3FYOA 4S2BA 1ZJIA 1H5YA 3GDRA 2UV8G 4JTUA 1QR7A 3GDMA 1TPFA 3NA8A 5G2IA 3HGSA 2A7RA 2O7SA 4NJKA 4MPQA 5KZMA 4AWSA 3W23A 2ATSA 3HG5A 3W2NA 5IBXA 3UYCA 2E5DA 3G1XA 3LRLA 5DLCA 1Q6LA 4O1BA 2C1HA 5U4NA 5AHNA 4XKYA 2ZZ5A 2ZA2A 5CZTA 4UNKA 1PVNA 1QPOA 4UUIA 5CSSA 2TYSA 2Y7FA 1O94A 1TQXA 4GUJA 2Y7EA 3S0CA 4UTMA 1KV5A 2BXVA 3ABOA 3MP4A 1WA3A 3SGUA 3EX2A 4MLRA 2Q3OA 3G0XA 4I9AA 3W1NA 3PB0A 4C1LA 3RMJA 3UNDA 1G7UA 1KM1A 1W1ZA 3CEPA 3M6YA 4HPXA 2A7NA 2NUWA 2KZHA 1NVMA 1WX0A 1YLVA 4DPQA 4NJIA 2C18A 3QSRA 5C54A 2YGYA 4MY1A 1DL3A 1MZHA 1CI1A 3T40A 1XUZA 3EXTA 1TTQA 2E6FA 5LNSA 5K2ZA 4Y8FA 4BF9A 4N9BA 1U5JA 3EXSA 1J2WA 3ANYA 3W7KA 3TAKA 3BGJA 1N8FA 1TREA 3MP5A 3TNOA 1W31A 5AHMA 4QQ3A 1TPUA 5D05A 3KRUA 3NQAA 4WY0A 2PRMA 3W1QA 4RV8A 4QNWA 1EX5A 2YZRA 2TPSA 5G4WA 4H4IA 4PTNA 3NQCA 3M7WA 4JX6A 4XQ6A 1OF6A 2FPYA 1ZALA 3MO7A 1JCNA 5F2IA 2A6LA 2E5CA 1LCOA 5D02A 4O15A 5HUPA 3W1MA 2PC4A 4Y9AA 1C8VA 3PC0A 3P62A 3W75A 2ZCGA 1G69A 2Y88A 1F73A 2ISWA 3EWXA 4TO8A 2H3BA 4O52A 2J9ZA 2WSQA 1DV7A 3STFA 4GBUA 4L4LA 3MYOA 3S1VA 1OVDA 1DVJA 1CW2A 5D30A 4ZQCA 1YTEA 2ZZ3A 4AHQA 1TIMA 3CHVA 2DZPA 3TA6A 4AMAA 1PIIA 3GIYA 5CZSA 2NX9A 4MZ8A 3NQGA 2H8ZA 5CZ0A 2R8WA 3N9RA 1JJKA 2JKAA 4JR5A 4JY9A 5ABTA 2QCHA 2GOUA 1VHCA 5I3KA 1GJPA 3TSMA 5DXXA 2CLFA 2QAPA 3QM3A 1OFBA 4UFKA 1KFEA 1KV8A 3RU6A 1AW5A 1XBYA 3O8AA 3ATYA 2BTMA 4NNAA 2NX1A 2B7OA 4DO4A 5LNUA 3FKKA 1KFCA 1KFKA 3GX9A 1LRNA 2Q3RA 2ZRWA 2RDUA 1IIHA 2PRHA 4IWWA 1O5KA 4NJGA 4WOQA 1KBIA 3O6YX 4GC4A 1V7YA 4FO4A 1VLWA 4JTGA 3WJWA 3M5YA 2H3DA 3H53A 4LC6A 3R89A 4E2DA 1F6PA 1IXNA 3QRHA 3CTLA 5D2TA 5C2XA 3G1SA 2HS6A 3GDLA 2HTMA 2QCEA 3NQMA 1ZAHA 1PHQA 5G4EA 1FCUA 1NF0A 3LOTA 2Z0IA 4K7YA 2YW3A 3IIVA 4Y96A 4FNSA 1D3GA 1OK6A 3OIXA 1K7XA 2WOQA 1OK4A 5KINA 3LHWA 4UTUA 4O12A 1H7PA 1K8ZA 3O6DA 2CLLA 2FDSA 4KFNA 2Y85A 4NXKA 4NT0A 5G1TA 4IPJA 4W9TA 3BW2A 3TC7A 3W9ZA 1LZOA 1FWSA 2VFIA 1P0KA 4GXMA 4H6KA 4A21A 3LRKA 4BK9A 3GR7A 1GVFA 1TPWA 2XFWA 2ZA1A 3W2UA 1TRDA 3E9AA 1YXYA 4ICNA 2XN2A 1N7KA 2V30A 2GVJA 4IMDA 4NU7A 4LNYA 3IIPA 2NV2A 3CWOX 3G8RA 3DFOA 4AAJA 3RF9A 4UTTA 3KRSA 3JR2A 3E0IA 3A24A 3W87A 1AK5A 1T99A 4RZ5A 4AWUA 5FEZA 1DJQA 1QCWA 1G6CA 1H61A 3NNTA 3O16A 1X8FA 4LVGA 2GQ9A 3USBA 3UD6A 3IGXA 3LTYA 1V5XA 3FJLA 2WKJA 4JNMA 4XZ9A 1GG0A 4NX0A 4UTHA 2GJLA 3R13A 4RZ4A 1SW0A 2Z6JA 3DU0A 3BG5A 1QPRA 4BWLC 4ADSA 4NNBA 2VEPA 3OHIA 3W7RA 1GT8A 3FKRA 1LRTA 1KLZA 1FDJA 2G97A 1PCWA 4A3UA 1K02A 5LNWA 4IPIA 2VKZG 1R2SA 4BI6A 3TUUA 2I14A 2OT0A 3GAKA 3KVJA 4H3DA 1R2TA 3W7PA 4UFHA 4RK8A 3S1XA 2DU2A 3QPZA 3BLFA 3EKLA 4HNVA 1TPVA 3TSBA 3L0NA 1ADOA 3P8JA 3LCFA 3UWVA 4IOTA 1NSJA 3A21A 3UQNA 4FXRA 2Q8LA 1TCDA 1DORA 2CLIA 1OFPA 4JYFA 1IXQA 4MY9A 3FYPA 3HF3A 4DF1A 1KM6A 3EX1A 4I7WA 5CSRA 2B4GA 3BARA 4DEFA 3UZJA 1A5BA 1TB3A 1ZY9A 4X9SA 4Z1CA 1HFBA 2Y61A 1QPQA 1RPXA 3GKAA 4U28A 1LBLA 2YXGA 2V9DA 2J27A 3CC1A 2YDAA 5I3JA 1VPXA 5L6UA 2BLEA 4O28A 5CG7A 2LLEA 3PWAA 3INPA 4RR4A 3BVJA 2JKPA 3CIWA 3DH7A 3W70A 2GUUA 3LXAA 3W74A 2RH9A 4B5NA 3E02A 1TV7A 5LZLA 4UTWA 3W7DA 4AHOA 4IGHA 3W2KA 1M7PA 1YDNA 1ME9A 1LLWA 2AQWA 3U6WA 3L67A 5BNKA 5HR7A 1XXXA 3M47A 4YMZA 1QPNA 3DZ1A 3GAYA 4UR8A 3QPYA 4X22A 3W1XA 3M5ZA 4CCCA 3WFAA 3WK2A 1JVNA 5D37A 3G0UA 4C1KA 4ALDA 5HWMA 4DF2A 3W83A 2OZ0A 4K8HA 4QJ1A 1K3UA 3QQ1A 3BLIA 4JTSA 4Z1DA 1GTHA 1J4EA 4WD0A 4EVZA 4CNPA 4YLWA 4IXHA 1EA0A 1M7OA 1R47A 3NG3A 3LLFA 4DO5A 1YDOA 3TIMA 4IMFA 3SIZA 4LT9A 3S1WA 1UASA 5D33A 4LWWA 1H1YA 4GUGA 1W56A 3MW7A 2CLKA 5TBOA 3VI2A 2CWNA 4WY0B 4XTIA 1JCYA 4FF7A 5FF0A 3WJXA 1UBSA 1XFBA 4MIMA 1H51A 3W7MA 3CU2A 3V1PA 1HO4A 3H55A 3VNDA 4I7VA 5SWUA 3NPWA 3SZ8A 3SI9A 3P5YA 2ZDRA 5I3HA 2GVGA 4GJ1A 3PSWA 5AYYA 5A8GA 3P8IA 1WBHA 2V82A 4OWGA 2ZFAA 3NM3A 3LM7A 4ML9A 2V2DA 3O06A 1F2JA 2QCGA 3TKFA 3C2OA 2C0AA 1S5VA 4O1AA 2VXNA 1K7FA 3UPWA 4HSNA 5AC7A 2TRSA 4UTKA 5EKYA 4EF8A 5D09A 4K8EA 1HG3A 4JYEA 2QJGA 4K38A 4MZ1A 2Z2UA 4Q33A 3GB6A 1SO6A 1QOQA 3N73A 4RZ6A 3P61A 4M7SA 3C3NA 1T96A 1T0OA 4N6EA 3TU9A 3NQ7A 2QDGA 3FOKA 4IX2A 3S9YA 1FY6A 5DCBA 4CQ8A 5D32A 2EHHA 2BSLA 3EX3A 3PR2A 1WDWA 3MHFA 3HO8A 2IQTA 1XDLA 4LVFA 3RNDA 2RFGA 3JRKA 4QISA 1GVOA 3W86A 1FWRA 1GVRA 3VKJA 4IXXA 3BG3A 8TIMA 1TRIA 4DPPA 3QMSA 2HSAA 3GXTA 1PV8A 3QMRA 1G4EA 5DBTA 4O17A 5FEXA 4A2RA 5J5RA 3UPBA 1ZAIA 3PS7A 4JICA 1W3IA 1HO1A 4N6FA 3NM1A 2J9YA 3LCIA 1KM3A 4MFEA 1B3OA 2YFNA 3N3MA 5U7SA 4PFMA 1PS9A 1P1XA 2JBMA 3O05A 1QO5A 2J24A 3RLVA 1SO5A 3W84A 3G1AA 1R2RA 2EPHA 3S6DA 2GJNA 1W8SA 1YADA 2XN0A 3OVPA 4KWWA 1QDSA 3W1AA 1UUMA 5CGQA 3I7QA 4AXKA 3I68A 3WJZA 3BGGA 3C2RA 3VE9A 3ABSA 4QM1A 5K7JA 1K8XA 3E96A 2ALDA 3ZS4A 4HNUA 2YFOA 2F7FA 1Y0EA 4PL2A 3H54A 3BW4A 5FF3A 1SW7A 3C61A 1OYAA 2QDHA 3G0SA 5KTLA 3GDKA 1B9BA 1LP6A 1M6JA 3NQVA 4DF0A 3NR0A 4R33A 2VEIA 1ML1A 3O15A 3CEUA 4IUOA 4UXDA 3K30A 3MMTA 2R91A 3W3OA 2C3ZA 3EWZA 2BWGA 1SUXA 2VOMA 3PBWA 2WO5A 3RK8A 1W5OA 3LI1A 5EY5A 3FJ6A 1GVQA 4LY8A 2X1TA 3W72A 1LM1A 5C6MA 1WOBA 1I8JA 1DBTA 3FS2A 1C9DA 2GVLA 1I2QA 3QW3A 2OT1A 3TMQA 3WK1A 1G4PA 4JIPA 1X1ZA 3W88A 2DJLA 5CZJA 3B06A 3QYQA 4LVAA 4X3ZA 2EGZA 2A6NA 4PA8A 3NPXA 4HNNA 1H7RA 3PG9A 1L6YA 2WPBA 4UMAA 3O6CA 5LHEA 3EWBX 4ZQRA 1XDMA 4EF9A 3L0KA 2NUYA 2TSYA 1KTBA 1I2RA 1YXDA 3HG2A 1GPWA 2EKCA 2JK2A 3M0ZA 1KM2A 3KRZA 3M44A 3UXAA 4OV9A 4XWUA 3NQEA 4R34A 4XTDA 1VH7A 5HR6A 2ZRXA 1OHLA 1H7XA 3PG8A 3E49A 3B0VC 1RQHA 3TFXA 3DHFA 4PH6A 1LOLA 3LI0A 1Q6QA 1R46A 1XUUA 4Z0JA 2A4AA 5D2VA 2I9EA 1JR1A 4KFOA 3HGJA 3GXNA 5K9XA 1SZFA 5G5IA 1VCGA 1P0NA 3L2IA 2PE4A 3P82A 4A2SA 4HN4A 3PULA 4MVAA 5BMXA 2WQPA 4IMCA 3NQ2A 3B04A 2QCCA 1OF8A 2OCZA 1ZHAA 1W5QA 2ATMA 1H1ZA 4KKXA 4AEOA 1SPQA 4NQ1A 1OG0A 4LV9A 4LW7A 3QW4B 3W85A 1OJXA 3G1VA 2A7PA 3TH6A 3EWYA 4JYDA 4JTEA 3TR2A 3RLUA 4RJEA 3QJAA 3I65A 4MLJA 1FWWA 2J6XA 4JN6A 3S8HA 5F2LA 2X1UA 3C2VA 4S2CA 3TE9A 3A5VA 4GE8A 4JIQA 2C14A 4UTTC 2QCMA 2V5BA 4BR1A 2E6AA 3TX9A 1H63A 1IF2A 3L0GA 1SW3A 4AF0A 5DXYA 2BZNA 1I2NA 3DGRA 3QFEA 3IIXA 3W7QA 1R30A 5H91A 1RQEA 1VJIA 3QMTA 2E6DA 2C13A 3NEVA 3M16A 4MOZA 3W7LA 3MI6A 4OE7A 1F74A 4O1CA 5F4XA 3STGA 5LNVA 1EP2A 1TV5A 2VELA 1JQVA 3B05A 3P84A 2V81A 2V8ZA 3DFQA 1I2OA 1KM5A 4N2YA 3UXDA 3W7GA 1YPIA 1GOXA 4S1FA 2R94A 1GVSA 1NAL1 1OYBA 3KXQA 2ZZ7A 3L5LA 5AFDA 2B0MA 1OFRA 2ISVA 4FX6M 4O10A 1L6SA 2C19A 5BOOA 3S5YA 3L5AA 4LS1A 1TQJA 3GNDA 4TIMA 2CLMA 2WV8A 3L5MA 3NL3A 2VENA 1LTDA 1DHPA 4CNOA 5L9FA 3PAJA 5CPOA 2NUXA 5C55A 4FNUA 1SZNA 1UB3A 3M43A 3N14A 5HUOA 4O53A 4QIUA 3DFPA 2QCNA 1QAPA 3SSJA 4D2JA 1VYPX 2NV1A 2TMDA 3LLDA 4MJMA 3GK0A 1WXJA 3OA3A 4RX0A 5D2XA 3LCXA 1O60A 1FBAA 4X2RA 3BG9A 2Z1BA 2CZ5A 2A0NA 3GKFA 4LS2A 1O95A 4FIQA 3M1ZA 4WXYA 2Q8ZA 1VC4A 1KM4A 3HGRA 2FIQA 2ZRUA 5LNRA 3W7CA 3NPUA 5EMUA 2XN1A 2RDWA 3ZWTA 2NZLA 2P0OA 5I3GA 1LOQA 4O18A 1F5ZA 2ZZ1A 1EP1A 2ABAA 3EEGA 3NL5A 1JCXA 4JDYA 4CNNA 4PC8A 6TIMA 1CX9A 3KVMA 5LGZA 3L9CA 3B03A 1TSIA 3SECA 1VHNA 3GXPA 3UWUA 4A22A 1A5CA 3HPXA 1F7BA 2A85A 3HG4A 3VFLA 1N55A 4JTKA 5E0KA 4RLIA 1I2PA 2ZRYA 2WJZA 3GR8A 2YR1A 3QZEA 1JCJA 1I4NA 2F84A 3HPSA 2W6RA 2Y7GA 4ZL1A 4LRTA 3NL2A 5EL1A 1IIGA 4FNTA 4RCXA 4K39A 2AAMA 1WQ5A 1AMKA 3UWWA 4M6PA 2G5WA 3A22A 5HNRA 1P4CA 2ZBTA 2PURA 5EPDA 4J9JA 3OBKA 4GUIA 3LBMA 4N9DA 4O11A 1FXQA 3HOJA 4FNPA 3SGZA 3TQ0A 1SO3A 3EX4A 5LHFA 3P80A 3G1YA 4ADUA 4K36A 3LHYA 3IVUA 3L66A 5FEPA 3E12A 4HT3A 4QSHA 3IEBA 1OFOA 2QUVA 4BI5A 3UY7A 2FB3A 4IJBA 3S42A 1LRQA 1L2UA 4QAIA 1ZENA 3V75A 3CIXA 3FLUA 5TQLA 3ELFA 3CB8A 1W54A 3THQA 2QF7A 4HSOA 4FHAA 4IQLA 1W3NA 5MHBA 2GQAA 1TPB1 3L68A 4DQWA 4UTJA 5CPNA 3GVGA 4OQVA 5LSMA 2V5LA 2W79A 2QCDB 3IVTA 3TMLA 1EUNA 4JY8A 2QJHA 1FXPA 4FNRA 5HMSA 5AB3A 1YYAA 2CU0A 3HMJG 3WK0A 1D9EA 2Y6ZA 2VFFA 5AHLA 2J9XA 3HBLA 3HIJA 1QWGA 2ZZ4A 3P5ZA 1VYSX 1XBVA 3DHDA 5EA9A 3MI2A 2ZQ0A 3ABQA 1S5TA 3IRDA 1JUKA 2NWRA 5FF2A 3PUEA 4TR9A 5BRBA 1Z41A 4LVDA 1I45A 1SR9A 3FEMA 2RDTA 4ZQPA 4Q32A 1MEWA 4K7VA 1M5WA 3NO5A 4WJEA 2X16A 2H6RA 3W7HA 3W73A 4HHPA 4M19A 3MUXA 5F2MA 1RQBA 2CLOA 4O50A 1OABA 5I3IA 2E77A 1NFBA 4HIBA 5CKSA 3TW6A 3KX6A 3DFSA 1PE1A 3I7SA 5AYZA 2FB2A 3TK7A 4CCDA 3M5VA 1XBXA 1PL9A 4BI7A 2I1OA 1JULA 3G1FA 2CZDA 3DAQA 2X30A 4DXVA 3NVTA 4E38A 4UNLA 4E2BA 3EXRA 4AWTA 3A23A 3B4UA 3W71A 3MJYA 1KTNA 2WNZA 4LU0A 4XUGA 4FIRA 1Q3NA 5AHIA 4FNQA 1EWEA 3PVFA 3LHZA 1NF7A 4LOCA 5IBXC 1QFEA 1VRDA 4O1DA 3TFCA 2ZA3A 1OYCA 3STEA 1PHWA 4GRSA 3R12A 4UTIA 2JGYA 5AC8A 2RHGA 1TTJA 4N4PA 5CPMA 2ZRVA 1VZWA 3SFKA 1JUEA 3PF3A 4LUIA 3TJLA 5K3VA 3Q2DA 2DZXA 1AL8A 4NUWA 3O1NA 4RXFA 3LCGA 2RKXA 4MZYA 1WV2A 1QOPA 1EWDA 3NQ6A 1FDYA 3TXVA 1W0MA 1ZNNA 3MBFA 1H50A 5G2HA 4AVFA 1UCWA 3ABRA 3PBUA 3DBPA 3MBDA 2VFHA 2V2HA 4YWIA 2E68A 1TTIA 1EUAA 4JDBA 5F4WA 4LUJA 1SZEA 2QAFA 3LB0A 5D38A 4ZZ9A 2EF9A 4ONVA 4AF0B 3L65A 3N2MA 1FQ0A 2D73A 3KVLA 3GNNA 4JX5A 5FF7A 3T44A 2J88A 4MJZA 4TU1A 2ZTJA 2FFCA 2WSRA 2AGKA 1QMLA 2B7NA 5AHEA 1X7FA 1A5AA 4K6AA 3MHGA 1GZGA 5KSWA 4P61A 3TROA 5K9CA 4FXSA 3NZ1A 1IGSA 4NX5A 1A53A 1FWTA 1HL2A 3F1QA 5K9DA 1O5XA 3C56A 3WJSA 2YYTA 4LTSA 3IIZA 3Q58A 4Z1BA 3IGUA 2QCDA 4NJHA 3BK0A 1XI3A 3IIOA 3Q94A 1ICQA 5FESA 2V0TA 4BFAA 1ME7A 5G2WA 4K37A 3C4UA 1LORA 3NAVA 4LV4A 2ZZ2A 3G3MA 5E1QA 4DELA 3ZR4A 3YPIA 4FB7A 5KZDA 1KFJA 2Z6IA 1DQWA 2QUUA 2ISSA 1EP3A 2A5HA 3STCA 1TPDA 3MP3A 3L21A 3S5NA 1W5PA 2QKFA 3HG3A 3KHJA 3GDTA 3LHVA 1AW1A 3AO0A 1LDCA 1H7WA 3C52A 2GQ8A 4JXCA 2NXGA 3W1UA 3LTPA 4DBEA 4EIVA 2E5BA 1FWNA 3F4WA 3EB2A 3T4CA 2YSWA 3T7VA 1OFDA 3UWYA 2YPIA 4JTIA 1GG1A 2FQIA 2VC6A 2Y70A 3NGJA 4M6QA 4UFJA 2NX3A 3P60A 3CLMA 3G22A 3P7YA 2DZVA 4XBKA 1K8YA 4N4QA 4ORIA 3DFNA 4CQAA 4A29A 1OX6A 1BKSA 1SSGA 5F4SA 1B57A 4U4MA 2G96A 5TIMA 4IMEA 3P81A 4N9EA 1KLYA 1EB3A 4HKPA 1MEHA 1GTEA 4CQ9A 3TV8A 1LOSA 3N34A 3LBCA 3G24A 1SFJA 5HWJA 1XC4A 2ZYFA 4UMBA 2HS8A 4M7TA 4N9CA 3PUDA 4JTJA 1VLIA 1C29A 3MI3A 2PRLA 1W5MA 5HINA 1WYIA 1F76A 4UCGA 1G67A 2O7QA 3PSVA 3LCLA 3LV5A 3MHUA 2Y62A 4JX4A 2C6QA 4ZQNA 5KITA 5DCEA 4WZHA 4JGDA 1BEUA 1TTPA 1TV8A 4ZVJA 1RVGA 3LHUA 1BTMA 1O4UA 4OV4A 1DJNA 4EOUA 5DN1A 4FX8A 3PY2A 3S5OA 4R7JA 4OGZA 2Y7DA 5HULA 3W2JA 3LXCA 3S5ZA 1KM0A 1VCVA 5FI8A 3U8GA 2JGQA 3W7OA 4CLMA 1BWKA 4HNTA 3NXFA 1SO4A 3VCRA 2QCLA 1LROA 1X6UA 3HGOA 3R8RA 3N2XA 1QO2A 3EX6A 4JS3A 4LS0A 1FCBA 2A21A 3THAA 5AC6A 5FEWA 3KOFA 3N9SA 1S5WA 4O4VA 4QNEA 2YW4A 1RZMA 2R14A 4YL2A 2QR6A 2YX0A 1JRCA 5A5WA 1KFLA 4G1KA 4GWEA 1FDZA 1EIXA 4OHQA 2Y89A 3C2EA 4OT7A 4GNJA 1OX4A 1Q6RA 4P2VA 3R2GA 1GWJA 1H62A 2OX1A 4JEQA 3B8DA 1SZGA 1QNVA 5BW6A 1XL9A 2FPVA 3NQ8A 2C15A 2NWSA 3LX9A 3OEXA 4Y90A 1TPEA 1FUYA 3W1TA 4NNCA 4L4MA 5DCDA 3LERA 3ZFHA 1SQ7A 3DKLA 3G1HA 1VGAA 1Q6OA 4ZQOA 1GEQA 5DY2A 4NJJA 4YCOA 1SU5A 4JTTA 1G7VA 2YCEA 3W1PA 1VQTA 4MYXA 2P10A 1Z48A 1A5SA 5EYWA 3FFSA 2ZRZA 3UWQA 1XM3A 4ZQMA 1AG1O 2DZUA 2CLHA 3BPWA 3A5FA 4ADTA 3TQKA 2FJKA 3FIGA 4FEZA 4NVTA 1YTDA 4ZMGA 4MY8A 1OFAA 3B0PA 1TJPA 2YYUA 3DI1A 3IV3A 4UTLA 5GVJA 3MWAA 4E0CA 5F1UA 5KMYA 3M5XA 1Z42A 3NQFA 4CCEA 1F05A 3NL6A 1DOSA 1JQXA 1WBJA 1H60A 5CPLA 3ZWSA 5DBUA 5DELA 4AHPA 1GQNA 1B4EA 5HQEA 3R5EA 3QC3A 1DQXA 1TMHA 3I7RA 3N19B 1UJPA 3JS3A 4UTWC 3LV6A 1AL7A 3FA5A 3C2FA 3NYZA 1XKYA 4GUHA 1OFQA 1KBJA 1WAUA 2G95A 2H8XA 3UY8A 1OFEA 2BX7A 2QCFA 1LBFA 1YDVA 3DI0A 2VEKA 1LBMA 3M9YA 4UFLA 4O54A 5K4XA 5AHFA 3W1RA 4TMBA 3W2LA 3LCWA 1GYNA 1ICSA 4UMCA 2FTPA 1G4SA 1YXCA 2CW6A 4HPJA 3W7JA 1ZFJA 4WQ6A 5FF4A 3TQVA 3DXIA 1DKWA 1U83A 4UR7A 4O0ZA 4MFDA 3CWNA 4UFMA 4YXGA 1MO0A 1A50A 1TO3A 3NDOA 4UFIA 2VFDA 3VE7A 2CFFA 3F4NA 1OX5A 3KVKA 5J5DA 2FPTA 1JCMP 2VFGA 1IXOA 4IX0A 4O19A 3W76A 3DFTA 4IMGA 3W07A 2B7QA 3NQDA 3WJYA 4DO6A 3C6CA 4RKAA 4TMCA 1XCFA 3BLEA 1Z44A 3TC6A 3LDVA 4KFPA 1XBZA 5K4ZA 3LGEA 3AJXA 4LVBA 3C0JA 2ZTKA 3OG3A 1ONRA 1TPH1 4YCPA 2A1YA 1KA9F 4WX2A 5D03A 4M5PA 2DZSA 5LGXA 4O4WA 1T8XA 5H2ZA 5BMWA 1FX6A 3TAOA 3EKZA 3S1UA 1BWLA 3B0UX 3T55A 3W7IA 4PEKA 1RV8A 1KTCA 3LCHA 4UIOA 1TPC1 3OVRA 4UC5A 2NXIA 3BO9A 1L6WA 3G8EA 1PCKA 1Q45A 1S3HA 3OVQA
chains in the Genus database with same CATH superfamily
4C6OA 4MUPA 1VJZA 4GBDA 1K1DA 3UJ2A 3BUVA 3CAKA 4PCFA 3UG3A 1P5BA 1LLOA 3EOUA 1F3EA 4FX7A 4X60A 2ZVRA 3AIBA 4LRSA 1SJCA 1NEYA 4C7FA 2UY3A 5EBUA 4H83A 3WF1A 1M01A 4FXFA 3GNRA 3HA1A 1E72M 2IS7A 2NT1A 2PEVA 3BW3A 1H0GA 4G7EA 1LG2A 4QEEA 3D0CA 2FTYA 4MYAA 4XAYA 3UWZA 3ITCA 1IHIA 4MSSA 2VZTA 2CLEA 1JNEA 3OGVA 1E4NA 1EDGA 3QVQA 4MWAC 2ISFA 1FHLA 4JTFA 5A6AA 5I6SA 1OZQA 1Z8AA 4HNLA 2OJPA 3VZYA 3ICJA 3QGAC 1JCLA 3I6RA 1BYDA 3W6YA 1E9IA 1HJXA 2DZTA 2E09A 4OBTA 4JL2A 1HF6A 1SSDA 3CQJA 2AMGA 3G1DA 5AYXA 1LL7A 4PMRA 2X0SA 5G1YA 3FGCA 2PDPA 4X63A 1GQKA 1US3A 1THFD 1FH7A 1XKJA 3IJ6A 3BAWA 1ZP4A 3U2OA 3H2FA 1FHDA 3NPVA 3M0YA 2E6YA 3QN3A 5AOUA 4DNHA 1JZ5A 5AC4A 3PZVA 3G18A 2XIOA 2A2IA 3CJPA 1LLZA 5CJNA 1QJWA 5CEWA 4FZIA 1WPCA 2DZAA 3CMGA 4HMNA 4AC7C 3SW6A 2NLIA 1F6YA 3AS3A 2NXHA 4AH7A 4M6UA 3CM4A 1TJRA 3CZEA 5I06A 1RD6A 6ALDA 5F1VA 4V33A 3ITOA 2E9BA 5JIWA 2L5HA 4KBXA 2GL5A 4U31A 3WN6A 3WH9A 1QK0A 4N02A 1YEYA 3ZZ1A 3F5JA 4NF7A 1MNSA 1H1NA 5ENLA 3T6CA 5CCZA 2REQA 1ECEA 3IGSA 4BQ3A 1Z3NA 2QDEA 2X1RA 1VBGA 3QXBA 4U10A 4CU7A 1JFXA 2XISA 2D3NA 5CLWA 4M6VA 4HD5A 1KO0A 2CLPA 4GFSA 1LJYA 1E9ZB 3HQ1A 2V38A 5DY3A 3F5LA 3F03K 2QJIA 1HTIA 4AC1X 4NXSA 3CAWA 2ZZ6A 5A2AA 4LC8A 1WOAA 1VD6A 3V0TA 4ZTXA 5LKYA 2WNQA 2WSYA 4O16A 3HJZA 1H3GA 3FYOA 3W38A 4W89A 4CEUC 3AXXA 1ISXA 4JTUA 4V15A 1GGOA 3PZOA 5G2IA 4QG8A 2O7SA 5HANA 5TD4A 3MSYA 5KZMA 2OYLA 4DAIA 3AJ7A 3W23A 3WLTA 3HG5A 2VHLA 4A3QA 3UYCA 3CZLA 2ZUUA 3MUAA 3LRLA 2EEXA 3K46A 4RW3A 4P7NA 2C1HA 1HW6A 3EOLA 5I5RA 1MQPA 4DYEA 2WW5A 4XKYA 2UY5A 2EPLX 4GI4A 5CZTA 1G5AA 4UUIA 2TYSA 3UR8A 3RUBL 2UBPC 2GVYA 3ABOA 4EWJA 3K2GA 4ZCWA 3G0XA 4I9AA 4C6CA 1DJWA 4E3TA 4HPXA 2A7NA 2PB1A 4P8VA 1XLGA 4DPQA 2FVKA 2VC7A 5LIXX 3AOFA 4Q8PA 2D23A 4H9YA 4MY1A 4HHMA 1CI1A 1PYMA 1TTQA 5G4HC 2E6FA 1ZBKA 3AHYA 3SRFA 1B54A 4N9BA 1J2WA 3DC0A 1TREA 2OEJA 2PWUA 1UYQA 1W31A 3DDMA 4Q7BA 5AHMA 4PBEA 3VD4A 3V5OA 4ERGA 3W1QA 4QNWA 1EX5A 4G2DA 4U33A 4AIUA 2D2JA 5G4WA 5DQPA 1XP3A 3V7PA 4JX6A 4D6HA 1O5RA 1OF6A 2ESCA 3KUMA 2FPYA 3MO7A 5AZ1A 2A6LA 2E5CA 5D02A 3A13A 2XVPA 3NWRA 4ZSTA 2ZKMX 3POCA 1G69A 1F73A 1IGWA 3BLLA 4TO8A 3VIGA 4O52A 3ZLFA 2QJNA 3VC5A 1JZ7A 3WEOA 4LY4A 1DV7A 2Q8XA 2JF6A 3T05A 3SUSA 4E8GA 4FOJA 4H01A 1Z9AA 1OVDA 3RX2A 4JKMA 1V3LA 5D30A 5CBJA 4HZMA 1TVPA 3GH7A 3CHVA 4RW5A 2DZPA 3VGHA 1JYWA 3TA6A 4AMAA 1H11A 1V8EA 3GIYA 4MZ8A 3H2CA 5C9RA 3RRAA 2JKAA 5PTDA 1E55A 1B3YA 3OGRA 4M0XA 2QVNA 1GJPA 4A3YA 4QLKA 4GVGA 2XH7A 4MB3A 1EF2A 4P7OA 3DN5A 4WDUA 1OFBA 3PFRA 3LPGA 3R0DA 3O8AA 4L1XA 2PDBA 5FA5A 3E38A 3H2MA 1J9YA 4DO4A 3WH7A 5LNUA 3FKKA 1LRNA 2PRHA 4GNKB 4NJGA 2Y0FA 4TV6A 1WB0A 4QGCA 4UQBA 3K1DA 3HU7A 4GC4A 2DIJA 1V7YA 1LF1A 4JTGA 4B5XA 3H53A 4LC6A 4E2DA 1F6PA 4QG9A 4YN5A 1MVYA 2WPGA 4GMEA 1NF0A 3LOTA 3IRSA 1EGMA 1XV8A 4Q8VA 2YW3A 3IIVA 4PRWA 3LK6A 1QNSA 1OK6A 3GC5A 4JCLA 1K7XA 2WOQA 4UTUA 1FWDC 3O6DA 3UU0A 2Y85A 3STPA 5G1TA 3LGGA 3T08A 4W9TA 3LNMA 4BK9A 3E9AA 5JXQA 2WWCA 4NU7A 4LNYA 1EX1A 4UTTA 4GVIA 4QDPA 1T99A 4AWUA 5FEZA 2VYOA 1DJZA 2PD5A 2CBUA 2BASA 1X8FA 3GIQA 3UD6A 3FJLA 3OLEA 2GJLA 1EJSC 3DU0A 3WDHA 4BWLC 1GJWA 4NNBA 1JF6A 3OHIA 1LRTA 1KLZA 2BY1A 2G97A 2VKZG 4N42A 1AQ0A 1R2SA 4FSAA 5HXMA 3KVJA 4H3DA 1R2TA 2YL5A 4RK8A 2E7FA 3UJSA 3B0XA 3DFHA 4LFYA 3WNMA 2NQ9A 2YBUA 3VABA 1QI2A 3K8LA 4I7WA 1A5BA 1ZY9A 4F0HA 2WMFA 3OZPA 3ARRA 1QPQA 1QK2A 3UXLA 4ZE5A 3CC1A 1VPXA 2W9MA 4NASA 4ZO8A 3U9IA 1RK5A 4GYJA 1OGGA 4W8BA 2LLEA 3INPA 2ADAA 1MXDA 1NWSA 4US6A 2GUUA 3LXAA 3RR4A 1X98A 3W2KA 1JDAA 4NZCA 3L67A 3DGBA 1EO7A 2D0FA 3EPOA 4REQB 3DZ1A 1I0BA 3FXYA 4UR8A 2VZVA 4BEUA 3PZTA 1MUWA 5ABFA 1E4IA 4QEHA 2VZUA 3IARA 4ZFCA 1EKOA 4Q22A 3MCNA 4DF2A 4QRNA 4QJ1A 1SZRA 5A1AA 2J79A 3QQ1A 2DVUA 1ECQA 5LIWX 4YTRA 4W7VA 3OIHA 3GIPA 4EANA 1J4EA 4EVZA 4KF1A 3HQOA 6CGTA 4JTAA 4C6FA 3SIZA 4LT9A 1DQUA 1CGWA 3MMWA 4LWWA 4R85A 2GWGA 2PUZA 3HN3A 1E73M 4GUGA 4KCVA 4AZCB 4RNFA 1X38A 1J8VA 1S1RA 5TBOA 3AHVA 4DX3A 4FF7A 2XWEA 2V6AA 3GY1A 3W7MA 4H7CA 1VFLA 3H55A 4UQEA 3VNDA 4Y8EA 1KRAC 4I7VA 3SZ8A 2ZDRA 1IQ8A 4GJ1A 8XIAA 1S2UA 5EFDA 1V93A 1PZ1A 3ZVIA 2W92A 1TWDA 3CLWA 3TKFA 1OC7A 3W53A 2C0AA 1MWOA 1A0DA 1MFUA 5FJJA 2CESA 1E0VA 3VIPA 3NUKA 2TRSA 3RHGA 3ARVA 1EH9A 4UTKA 1BTCA 5EKYA 2PWHA 5HPOA 2Z1KA 3MB9A 4K8EA 2DSZA 2DUZA 1VPQA 4DJFD 4K38A 3T42A 3WCZA 4N6EA 1T96A 4IQEA 1I1XA 1UR2A 1GK8A 1RALA 4ZOEA 1E1FA 2XIBA 1UOZA 2Z2BA 4CQ8A 1QNQA 3PR2A 2BSLA 3HV8A 3HO8A 1JPDX 4M24A 1X39A 3RNDA 2YCLB 4QISA 4HU4A 3W86A 1E6NA 1BQCA 5CC5A 3QMRA 1O6IA 1NP2A 4A2RA 3ARSA 1ZAIA 4JICA 1XRSA 2YFNA 3N3MA 5U7SA 1XLIA 4PFMA 3KWSA 5FJIA 2JBMA 4AZ6A 4J3VA 2WSPA 2R82A 1DXFA 3E1F1 1FWCC 2HNEA 2EPHA 4NSBA 4W93A 4LAOA 1W8SA 2XN0A 4H41A 1VPYA 1XIHA 4NRSA 5EB8A 2O55A 4LF1A 5IRPA 2PP0A 3WJZA 4C6LA 3PZ9A 3EPMA 5K7JA 3E96A 4GIEA 1FFRA 5DT7A 1UR1A 4HNUA 1JGIA 2F7FA 1Y0EA 1C9WA 3K5XA 4H8VA 1FWAC 4IJRA 3B97A 4IF2A 1OYAA 2PC8A 3NQVA 2OXNA 4R33A 3WQGA 1V3KA 1UD5A 3O15A 3CEUA 3WQ4A 3OB8A 2R91A 3RCMA 2C3ZA 2VOMA 2VX4A 3RK8A 2UWFA 1NDZA 1XH0A 5EY5A 3PJUA 5H6HA 4LY8A 2X1TA 2DSKA 3URBA 1DBTA 1C9DA 1DWGM 2D20A 3ARXA 3QTPA 3BOFA 4GY7A 3RMEA 2DJLA 4X3ZA 2EGZA 2VI0A 2HV5A 2QZRA 4EF9A 3VGEA 1I2RA 3HG2A 4D8ZA 1UOKA 2JK2A 3M44A 1VH7A 1R9ZA 1OHLA 3PG8A 5A6SA 3N6JA 4E2VA 3IUIA 1IR2A 3TFXA 3SO7A 1R46A 3VGBA 4GQ0A 5D2VA 2I9EA 4DI8A 3M7SA 4KFOA 1AD1A 3VMPA 5G5IA 1PIFA 3VMOA 1XLLA 3NQ2A 4YTSA 3B04A 2J13A 3SRDA 1H1ZA 4KKXA 4Q6XA 1UJQA 2VCAA 1RP9A 2E9LA 3FYYA 2HPMA 3VILA 2ZOXA 2CHNA 1OSEA 4QE1A 3TH6A 4JTEA 4RJEA 2WVTA 1QW7A 4MLJA 3SN0A 1FWWA 4AZHA 1J2BA 3A5VA 2Z24A 4GE8A 2C14A 3AYTA 3WFZA 4IFOA 2OX4A 4GI8A 1IF2A 1XGEA 3L0GA 3F2BA 3RPTA 1J79A 1PUDA 1FH9A 1I2NA 3E0WA 3DGRA 1CCWB 3IIXA 3VA8A 8A3HA 1R30A 1DJIA 2E6DA 2C13A 3SCWA 3W7LA 4LYQA 3ZT7A 1F74A 4QS5A 2G3MA 4KW2A 4AVNA 2VELA 2INZA 4CD8A 4PMVA 1R38A 3O0FA 3AUOA 3KZPA 3WMCA 4L7ZA 1I2OA 3T0CA 2QIIA 2O56A 3W7GA 1QI0A 2R94A 2O4QA 2IXUA 1GZJA 4FF5A 3L5LA 5AFDA 5A8OA 2ISVA 4BKNA 5GNYA 3WNNA 4O10A 1L6SA 1T40A 4GQQA 4RV3A 2AGTA 2C19A 3S5YA 3CNYA 2VENA 3HJEA 3PAJA 3RLGA 5C55A 1C7TA 1SZNA 2Z29A 3GXIA 4O53A 3CT2A 3DFPA 1QAPA 3SSJA 2AKMA 5FJPA 1VYPX 1XPYA 2NV1A 2PDWA 3BSMA 1NDWA 4FMVA 4MJMA 1WXJA 3AIWA 1EGVA 3OA3A 4K1WA 1O60A 3BG9A 2Z1BA 2PTXA 2CZ5A 2YJQA 2NVAA 3JW7A 3M1ZA 4WXYA 5FJUA 2FIQA 2EG7A 4M8UA 5FAJA 3GBEA 2XN1A 3CPUA 4MWAD 5I3GA 4O18A 1F5ZA 2ZZ1A 4XZLX 4LAMA 8RUCA 3NL5A 3TYZA 1JCXA 3NZPA 3GXDA 1MFVA 1B3VA 2PSNA 1CX9A 4WGXA 3UBPC 3KVMA 5LGZA 4IL0A 1MW0A 1TSIA 3SECA 3UWUA 3GXPA 3HPXA 3KLLA 1N55A 5E0KA 3ZMRA 2DW7A 3QZEA 3HPSA 3OQEA 3JVAA 3U7BA 1YNYA 3UCDA 3H8AA 3VD9A 1AH3A 4LRTA 1LG1A 3NL2A 4JTCA 3VNMA 1IIGA 4EX4A 1AMKA 3UWWA 3NO1A 2G5WA 5FJOA 3A22A 1FKXA 5HNRA 2PURA 2FMNA 5EPDA 1AVAA 4J9JA 3OBKA 1X7IA 2GSEA 4O11A 1FXQA 4ML4A 1RXOB 3UERA 3WG6A 1FP8A 1WUEA 3TQ0A 5B80A 1XLMA 1RA0A 2AL1A 2WKLA 4HT3A 4QSHA 2GGEA 2VUNA 3IEBA 1OFOA 3UY7A 3M0HA 2QMKA 4QAIA 5C8BB 3CIXA 4I6VA 3KRBA 1TX2A 4Z17A 1W54A 4FHAA 4FP1A 2BXZA 3N15A 3H7VA 4X0VA 3NSXA 1IWAA 4I90A 2R1KA 1OB0A 1NARA 4EPBC 5AB3A 5HMSA 2CU0A 3HMJG 2ZZ4A 3P5ZA 2OWXA 1XBVA 4F40A 4Q4PA 3DHDA 1V6YA 2PP3A 3MI2A 3ABQA 3IRDA 3PUEA 5FSDC 1Z41A 4F8XA 4XKMA 4ZQPA 2WHKA 3WBEA 3I3BA 3JZUA 3R8GA 1M5WA 4W5ZA 1KRMA 4WJEA 2X16A 3W73A 5HNTA 3BLDA 3QY8A 4QX4A 3QY6A 1CB7B 1V3MA 4E8CA 2DUAA 4O50A 1W1IE 5I3IA 2E77A 1NFBA 1IZCA 5CKSA 4H8NA 3KX6A 2PWEA 1PE1A 4AD1A 5A6BA 1GOWA 3EKGA 2PLJA 4ERIA 5I2UA 2CZDA 5DMMA 4W86A 4E38A 3TLQA 2HWGA 3A23A 1DE6A 3W71A 3ES8A 3LQLA 1E0WA 1IEIA 3EPNA 4DNMA 3WO8A 3TCSA 1XYLA 3L23A 3PVFA 3LHZA 1NF7A 3RX4A 1QFEA 1JYVA 1SJDA 1VRDA 3WQDA 1RAKA 1KC7A 4O1DA 3PPHA 1PHWA 2XWDA 5AC8A 4HU8A 1Q6CA 2Y8VA 2QMJA 3KHDA 2ZRVA 2OO6A 5IXEA 4I9MA 7ENLA 4PR4A 3D5HA 3URNA 2EQDA 3Q2DA 1EQPA 4LCQA 3QBUA 3LBOA 4NUWA 3O1NA 4RXFA 4Z1YA 1V0MA 3VXGA 4MZYA 3RITA 3CHCA 3NQ6A 5JUVA 1FDYA 3TXVA 4D8AA 1ZNNA 3BAIA 4B2DA 4XD3A 2XSXA 3ABRA 5D4YA 2WKGA 2VFHA 1JYNA 2E68A 4CNUA 3N2BA 3QV8A 3TR9A 1SZEA 3LB0A 4U5KA 4ZZ9A 3QC0A 4GJIA 4AF0B 3DFYA 2AKZA 4F0MA 2J75A 1W9XA 3BC9A 1BYAA 1K4HA 3N2MA 1XG3A 3GTIA 3UT0A 4WKHA 3GNNA 2BHUA 1VFTA 3DIPA 5FF7A 4TU1A 1XPGA 2WSRA 2B7NA 5FCZA 4P61A 3TROA 5K9CA 4NY2A 4FXSA 4XG1A 3WD2A 5GNXA 5BXPA 1R7AA 3PZIA 3T8QA 4GZIA 3IGHX 2QS8A 3F1QA 3EDFA 2QF8A 4XBJA 1OCBA 4S3FA 4FS9A 3DG7A 1IT7A 2OSWA 4XAPA 4LTSA 4QDWA 3A4AA 3B40A 2HRWA 1EOKA 2QCDA 4NJHA 3BK0A 2V69A 3Q94A 1ICQA 3GW3A 5FESA 4UOJA 4CKQA 4HN8A 3WQ6A 1P48A 5MF5A 3GDBA 2ZWZA 2G3FA 2A3CA 3NAVA 3FV9A 1PBGA 5E1QA 4EAYA 3ZJ6A 3IAQA 2Z6IA 4H8UA 4W87A 5HJXA 1PIGA 2ISSA 2QUUA 1O68A 3STCA 1TPDA 3MP3A 3L21A 2P3ZA 4I6KA 3SCOA 3I6TA 1DIKA 3E74A 3KHJA 2WZEA 2Q6ZA 3TWAA 4PCPA 3W1UA 4JHZA 5E70A 4DBEA 4EIVA 2A3AA 4ZENA 3F4WA 1U22A 2YSWA 1OFDA 5JMUA 4DB7A 3NGJA 4WEVX 3CLMA 1KRBC 2VP8A 4KWUA 2BVWA 4G56A 4XBKA 1K8YA 4N4QA 4ORIA 4AX7A 2WB5A 1B57A 2DIKA 2G96A 5TIMA 4IMEA 2I16A 1EB3A 4CQ9A 2J25A 2ZE0A 3TV8A 3C0LA 3N34A 3G24A 4UMBA 1AQHA 3PZQA 2R1PA 5HPCA 1ZS2A 2BHYA 3UCCA 1QXLA 1G9HA 5HINA 1FFQA 1GOKA 3LV5A 1ONEA 2VCCA 2C6QA 4ZQNA 3KLKA 4ZVJA 4WGHA 1ISZA 4EOUA 5GJMA 4GO9A 2FH6A 4R7JA 5HULA 4G5DA 3KBSA 3NEHA 3R0UA 4HNTA 2XG9A 3SUWA 2QCLA 1JEZA 1BAGA 5CBIA 5CQ1A 2A21A 3VPLA 4ZBCA 2X41A 3P3BA 3N9SA 1P0EA 1S5WA 5BXSA 2QPXA 3M6DA 1RZMA 5A5WA 4RE3A 4G1KA 5CH9A 1Q13A 5I3DA 1NU5A 4CU8A 4JEQA 3B8DA 1SZGA 4JFVA 1UP0A 3CL7A 4GACA 2FPVA 4GXWA 3DYOA 2WVVA 1MW3A 4WLCA 1UUQA 1IT8A 4Y90A 1TZZA 1JDDA 1FUYA 3UZYA 3SAZA 1Q65A 1ZJAA 2YB1A 1RPKA 4G8TA 4US5D 1PO9A 1SQ7A 1UR4A 4PMNA 3LZ5A 3G1HA 1F3TA 3MPGA 3CH0A 1GEQA 4ZQOA 5DY2A 1SU5A 1POJA 1UKOA 3REQA 4NAEA 2E28A 3W1PA 1HJQA 2P10A 1Z48A 3ALFA 1S2WA 3B9DA 3UWQA 1K77A 4FXJA 3SCPA 1XM3A 4QCFA 4ZQMA 1IYXA 1AG1O 3TYDA 3BPWA 4KEVA 2IPGA 4HNOA 2WWDA 3PNZA 2ZUNA 4XISA 3BZGA 2I7GA 3FIGA 3EOEA 5MKGB 1YTDA 1UIOA 2YA1A 4MY8A 5FJRA 4P8WA 5REQA 3SCUA 1MYRA 5DEZA 2VRQA 2V68A 4LBUA 5F1UA 2EKGA 5KMYA 1PKYA 3M5XA 3NQFA 1F05A 1OIMA 5CPLA 1WBJA 3ZWSA 1H60A 2QQ6A 1GQNA 4CGTA 5HQEA 4AIEA 3F7JA 1IT0A 3QC3A 1E43A 2VEFA 4B5UA 4H7ZA 3EDJA 5FL0A 3JS3A 3FHQA 5IFTA 3LV6A 1AL7A 4PTVA 1NQKA 2XINA 4L9ZA 1ITUA 4GUHA 1OFQA 3N29A 1UD3A 4L4PA 2QCFA 3AZRA 1YDVA 1JZ3A 3VOHA 1EJUC 6REQB 3M07A 3R7MA 3V36A 4O54A 1DWFM 4NKCA 4JQ2A 3W2LA 2Y5EA 1RHCA 1GYNA 1XIDA 1KKOA 3ITYA 4B3ZA 2CW6A 4HPJA 3W7JA 3TQVA 3KZSA 1DJXA 1V3JA 1U83A 4A4AA 2PDFA 4H19A 4R9XA 1TO3A 2CFFA 3F4NA 1OX5A 2VFGA 5HNNA 2J77A 4A6GA 3FJ4A 1ODUA 4IMGA 3P6LA 4DO6A 3J7HA 3VKDA 3PHAA 1XF0A 3LDVA 4KFPA 4M1RA 3KBMA 5ECVA 4ZO9A 1ZCCA 1TPH1 4YCPA 4S3CA 1KA9F 2PLKA 1UWQA 5H2ZA 4XAZA 5BMWA 5FIPA 3B0UX 4MNMA 3T55A 5JH1A 1E6XM 3TN4A 5AKQA 3UF9A 3GC2A 4DIAA 4UC5A 4ZO7A 3MCMA 1XSIA 3CL8A 1UC4A 3G8EA 4R7OA 1OM0A 2PGFA 4HQVA 1UZ4A 4DXKA 3NCOA 1MEIA 3N6QA 2CEQA 4BQ2A 1PWLA 4PSPA 3LS9A 3HB9A 3Q45A 3OZMA 2UZ9A 4Z1AA 4WUIA 4IM4A 3W25A 2HE8A 3EWUA 4NYYA 8CGTA 4Q4KA 3QSTA 4I8YA 2BODX 3R25A 2O4MA 2X2GA 3O07A 3LEPA 3P67A 3R0KA 4TVDA 1A5NC 3GG7A 2NQLA 2V3FA 3LSCA 4JQ1A 1JPHA 1MXSA 2HMCA 1A5UA 2WVSA 3A3HA 2ZXAA 3HFYA 3FVMA 3AMCA 4LAZA 3PTKA 4L65A 1Q66A 3GVQA 4ATDA 4EXBA 1W5NA 1EEPA 3TSDA 1J5SA 1UUOA 4XD5A 2D0GA 4O8RA 4GINA 4MB1A 4Y9PA 3W22A 3W7EA 3A3XA 3FW6A 3DEQA 3BAKA 2VTFA 3KBJA 1LYXA 1GYLA 1X1OA 5D2WA 4ASTA 5E93A 1YBQA 1CLKA 4PODA 3LMYA 3B3DA 3P93A 3WDIA 3MS8A 1AW2A 1DXEA 4Q7NA 4Z08A 4IQDA 2PF8A 3QV6A 2E9MA 2DZWA 4O57A 3LXBA 4HU0A 4J7RA 4V2XA 9RUBA 3V18A 3KDOA 3GSMA 3WEZA 4DWSA 3W27A 1I75A 3AIQA 3EDKA 5HWNA 1FCQA 2EAWA 3H24A 1L9WA 1D2KA 4HCLA 4W84A 1TYGA 3WF0A 2VR2A 2JKEA 1EC7A 4ZE4A 3PPCA 3UETA 2EPNA 1H7OA 3QH2A 4QITA 3WF2A 3OA5A 4U3AA 3SJ3A 3CZ8A 3MT1A 1B4KA 1L6GA 4GK8A 1VR6A 3KE0A 3C8FA 1E0XA 4XBSA 3UR2A 4IIDA 3AXKA 2VEMA 4O13A 3WUEA 1F3XA 3APTA 3BOXA 1IXPA 3HQNA 1RLDA 5D9NA 1XJBA 4NZJA 3T78A 1MUMA 4YYFA 1VFMA 2OLHA 1UIPA 3E3HA 1UWIA 1RR2A 3TDFA 1XG4A 3GG1A 3SY5A 4R9OA 1YPFA 5D8ZA 2WCSA 4I7UA 3AMDA 5HJYA 1F6KA 1OX4B 4KS0A 1J5TA 2XVGA 2X1SA 4RXGA 4WOZA 3KWXA 4DYKA 2AMXA 3PUOA 2RGMA 4IIFA 3RAOA 1VS1A 1DTNA 1G4TA 2E0PA 1E6RA 4V28A 5A8PA 4S2BA 1ZJIA 1H5YA 1JYXA 2Q02A 2EPMX 2ANUA 3MY9A 3GDMA 1Q2SA 2FFIA 3HGSA 4NJKA 1WZMA 1WXZA 1Y5VA 2ATSA 3W2NA 2PDJA 4DJDA 5IBXA 4QE5A 1QBAA 2E5DA 4GZEA 2EO7A 1W3LA 3MDUA 1GONA 5DLCA 3GRIA 5FSEC 1E9YB 2ACQA 1S5NA 1ZLPA 5AHNA 3WIJA 2OYMA 5C0QA 5JH2A 1PVNA 1QPOA 3HZ3A 5EU9A 3EMZA 2XGIA 2Y7EA 1XGZA 4LEQA 4C6MA 3H22A 3RGTA 3SGUA 3EX2A 4J1OA 1UA3A 4MLRA 1AH0A 2D69A 3PB0A 2WJFA 3CEPA 3ZVHB 2KZHA 2EJAA 4NJIA 2CZVA 4OUIA 7REQA 3QSRA 4P7LA 3U2EA 2D2OA 4HOZA 2G0WA 3VDCA 2YGYA 2WMIA 3AMKA 1DL3A 3T40A 1MRQA 1HVXA 2DT0A 4KRUA 4XZMX 1AZ2A 5LNSA 5K2ZA 3TTQA 3VOJA 4DZ5A 1U5JA 3LY0A 3FAWA 1E1CA 3MP5A 5HOSA 2VWTA 4HYRA 5E9AA 1V7AA 3AIRA 3AALA 3NQAA 4WY0A 2PRMA 4RV8A 3VGDA 2WMKA 5E5CA 1BSIA 4AZGA 4PTNA 2OSXA 3NQCA 5EMJA 4UOZA 1ZALA 4X61A 1GKRA 1JAEA 4Y9AA 4C6DA 3RG6A 1C8VA 3PC0A 3P62A 3W75A 2ZCGA 1V0KA 1NWUA 3EWXA 1CPUA 3H7RA 1LT8A 1JF5A 3MYOA 1DVJA 3HTWA 3NIYA 3TYUA 3MMDA 3MSGA 2X1IA 2V3GA 1YTEA 4AHQA 1OZMA 2AQOA 4BA0A 3TLLA 5CSYA 4J35A 5TNVA 3NVDA 4U3CA 3N12A 3VDGA 3MUCA 4PUWA 3JZEA 5FJTA 4QS6A 2YA2A 4JR5A 4YVVA 2QCHA 1U33A 1VHCA 3F2CA 5I3KA 5A94A 1AZ1A 5DXXA 2CLFA 1EL3A 3NDYA 3L4VA 3QM3A 3CXOA 1KFEA 3RU6A 2VC9A 1XBYA 1XYCA 2BTMA 3S6OA 2NX1A 2B7OA 4XIMA 3VOCA 3UJRA 1WDQA 2J6VA 2OLSA 3SADA 1QW8A 3WH5A 1KFCA 1ZP3A 1S3TC 4XAFA 1IIHA 3RPMA 3CS2A 2UY2A 4RNJA 4C60A 4P8UA 1KBIA 4RDYA 2GSHA 2P53A 3L2LA 4H9MA 3WJWA 1CTNA 3R89A 3CTLA 3G1SA 2HS6A 2HTMA 3CASA 4K7YA 1OC6A 4Y96A 1CGYA 1CGXA 1GVYA 3SDOA 3AIVA 3B9EA 2QIWA 1OK4A 1GHSA 3ZSSA 4JTRA 4GVHA 3LQGA 2CLLA 4NG3A 2VT0A 4NT0A 1WZAA 4IPJA 1E15A 1LZOA 3XISA 3ZT5A 4CN6A 5M17A 2YLAA 3OLDA 3R8HA 1TJ2A 2XFWA 3VIJA 4ICNA 4IFKB 2GVJA 2CXEA 2O9RA 1CB2A 3IIPA 2GUYA 1VFHA 3G8RA 3N04A 3KRSA 2D1ZA 3F2DA 3JR2A 1UR9A 3E0IA 5CGTA 1HKIA 3EDDA 3S4TA 1AK5A 3ARYA 3LSBA 1WDDA 5BU6A 1QCWA 1H61A 3O16A 3AHXA 3AWNA 1T41A 2PTWA 4L9XA 4LVGA 4PRTA 3IGXA 3LTYA 1V5XA 2WKJA 1K8CA 1GG0A 1D7FA 3R13A 4JL1A 4KMQA 2G3IA 4ICCX 2I9UA 3S2CA 4ADSA 1CWYA 3VNJA 2VR4A 3VIHA 4Z2LA 3FKRA 3SUVA 1CXIA 2POZA 3CZKA 3UW6A 1IZJA 3NZQA 2HROA 4UFHA 1WNOA 3BWWA 1HP5A 3QPZA 3BLFA 3BTNA 3SQLA 3EKLA 4Y9MA 2XIIA 4Q8WA 4LUSB 4IOTA 1NSJA 3A21A 4AEFA 4IPNB 1TCDA 5BXRA 5TF0A 2J8TA 3EX1A 2B4GA 4DEFA 3C3UA 2Y61A 4FPSA 1RPXA 2F2HA 2DT2A 4H8HA 4QQUA 4U28A 3CO8A 2BGSA 3TNBA 4GQRA 3L4YA 1YHTA 4WJ8A 2BG5A 3VNLA 1XLDA 5CG7A 4UBPC 3TC3A 3PJTA 1GNXA 2HVNA 1MW2A 4RR4A 3AFBA 3BVJA 3CIWA 2XH2A 3DH7A 3W74A 3E02A 1C3FA 1TV7A 5LZLA 1TZ9A 1M7PA 2XIQA 3AC0A 4QE4A 5HR7A 4Y2WA 3M47A 3URQA 1QPNA 5JBDA 3GAYA 3QPYA 4XK2A 3BL3A 2P50A 2C79A 4X22A 3M5ZA 2YDQA 1VKFA 4XVEA 4TTGA 3GBDA 3WK2A 2PDGA 1PTAA 3K13A 3QHNA 4CUCA 4ALDA 1EOMA 4ATWA 2OZ0A 4K8HA 1K3UA 4KESA 4NZ5A 1TA3A 1QATA 1GTHA 1TUXA 1I1WA 4YLWA 1EA0A 2GGHA 3F4DA 4GYKA 1YDOA 3TIMA 2DUXA 2VD8A 4Q8UA 3ANUA 3S1WA 3RCNA 5D33A 1H1YA 3M0KA 4C65A 4V1YA 3R10A 4MWAE 3WKZA 1Q85A 3V4BA 3L4WA 1LUCB 5FF0A 7XIMA 3SBFA 4KH2A 2QPUA 1UBSA 1XFBA 4MIMA 4M80A 3CU2A 4PCNA 3V1PA 1HO4A 4M29A 3NPWA 4F9DA 3UXKA 3WY1A 2IQDA 1SM9A 3CQIA 3RJYA 2WQDA 4OWGA 2ZFAA 3V3WA 3LM7A 2VZSA 1RJRA 5J04A 2GGGA 1KBKA 2XFYA 1UD2A 1TZ7A 5DFAA 1YW1A 2QCGA 1S5VA 2Y5SA 2VURA 5DRIA 3UPWA 4HSNA 1BHGA 1HKKA 5AC7A 2PU1A 1QNRA 2IPJA 1DJYA 2Z7KA 5D09A 3APGA 1AJ2A 3AU2A 4Q33A 3GB6A 1E3ZA 4GG9A 5D8WA 1QOQA 1DWIM 5C9XA 4OUEA 4I9JA 3C3NA 3LZ3A 3TU9A 2I5QA 1FP9A 4AX6A 3L12A 1M04A 5HA7A 2QDGA 3LA4A 4IX2A 1V02A 1F61A 2EHHA 3B9OA 1WDWA 1XDLA 4LVFA 4JIHA 2Z27A 3QOKA 4PMXA 4ZFMA 2RFGA 2NQZA 2QUNA 1FWRA 1PB0A 3TTOA 1GVRA 3EYPA 3PNUA 4CD6A 4IXXA 3BG3A 4NZ3A 8TIMA 2FHFA 2OZTA 3GTXA 4DPPA 2HSAA 3B4YA 4LYKA 4WF7A 3T0BA 3FN9A 1G4EA 4XIAA 5EFFA 1ZTVA 4TV5A 5FEXA 1BXNA 4DBWA 3UPBA 3VINA 2VDIA 4D72A 2I5IA 4MFEA 1B3OA 1GOIA 1PS9A 6A3HA 3WBAA 1QO5A 3NSMA 2J24A 3NTYA 4Q4OA 1SO5A 3VNYA 1R2RA 2XPKA 2ZIDA 1FH8A 2OU4A 3OVPA 4C91A 3W1AA 5CGQA 3THCA 4RPQA 5EMLA 1Q8AA 4AXKA 3GE7A 3C2RA 3VE9A 3ABSA 1HKJA 3L7RA 2YFOA 5DANA 4PL2A 4LCRA 3CV7A 1GORA 5FF3A 5B7ZA 3KBVA 3G0SA 3ORWA 4KIRA 1XLKA 3HPAA 3NR0A 4KGLA 4WKAA 1ML1A 4CU6A 4HA1A 4IUOA 3M46A 1SUXA 3OO2A 3V1HA 1ESWA 1W5OA 3L4XA 3L2MA 1YNPA 3VKBA 3FJ6A 5I09A 4KEZA 4KCTA 3BJSA 2PBGA 3VM7A 1WO2A 1WOBA 1XYMA 3W29A 4A8NA 4AMCA 3EWCA 4GGBA 3PN8A 4JIPA 3W4RA 4AZCA 4LVAA 2GJXB 2F38A 3ZR6A 1H7RA 3PWIA 3O6CA 5LHEA 1W91A 1XDMA 3QQWA 3PTQA 4ZQRA 5A8QA 2TSYA 2PTZA 1CYGA 3U57A 3AWOA 5HR6A 4XTDA 3NOYA 2ZRXA 1RQHA 3CUZA 6XIMA 1E6ZA 4FR1A 2F9RA 3LI0A 3WDQA 1KKRA 3AIEA 1R3WA 4Z0JA 3FEQA 3VD5A 2A4AA 4QAWA 3HGJA 2E67A 5K9XA 4J3WA 4F66A 4C90A 1P0NA 1VBUA 3L2IA 3A9BA 2R1MA 3WENA 4DHGA 2WQPA 4IMCA 3V5FA 4OECA 3QYSA 4PUKA 4AEOA 1HJWA 1SPQA 4NQ1A 1OGBA 3VD3A 5KEZA 1NOWA 3GZAA 3HV9A 2ALRA 4MNLA 5C2CA 5HQMA 1K6AA 1VRXA 1XLJA 4AZIA 2A79A 4MTVA 1KXTA 2W62A 1Q63A 1BYCA 3TR2A 2BVDA 2WLZA 3I65A 2J6XA 2XTKA 4C6KA 2X1UA 3TE9A 3N9KA 1NFPA 4BR1A 2E8ZA 4HJFA 1F3WA 1V6VA 5H8MA 4G7FA 1I6NA 2YCLA 2PMQA 1QPKA 3MSRA 4DZAA 1QTWA 5DXYA 3GTHA 4GYPA 1TE6A 2WZHA 1N8IA 1H4PA 3E0LA 2RJHA 3QFEA 2CBIA 2V5KA 2E4TA 1OG6A 3QMTA 4DJFA 4QJ3B 2EJ1A 1A3XA 4B3LA 3MI6A 3WLNA 4OE7A 4O1CA 5F4XA 3KM8A 4MADA 3TW9A 2BXYA 5HQLA 4JQ4A 3B8WA 3CV6A 3P84A 2V81A 4O1FA 2V8ZA 3GUGA 4J3ZA 3ABXA 2D22A 1KM5A 3UXDA 3VX1A 2INEA 1B1YA 1GVSA 1XIFA 3N1AA 1OYBA 5CC6A 1TG7A 3H4XA 2B0MA 2ACRA 3QLLA 1HKMA 2WM1A 4FX6M 4X2PA 2DVXA 1JZ2A 4DUOA 3CBWA 5BOOA 1HGYA 4LS1A 1A80A 1S5MA 3KL5A 3GNDA 4GO8A 3EZ4A 2WV8A 3W24A 1DHPA 4M82A 2DT3A 4L64A 2FMOA 5I00A 2PDCA 3P2VA 5CPOA 5C2GA 4HOXA 2J62A 1CZ1A 4PEEA 1UB3A 1TV4A 4GXPA 2NW0A 3M43A 3N14A 3L4UA 1MRAA 4AYGA 4QIUA 4PULA 3AYSA 2I17A 1JI2A 4MAZA 4RPPA 1EYEA 4HK5A 5D2XA 3LCXA 4X2RA 4D8LA 2A0NA 3VGFA 1Q4WA 1VC4A 2BGQA 1GQJA 1IEWA 3W7CA 1OQFA 1VFOA 5EMUA 5CC3A 2RDWA 4ZB0A 1GOQA 2GK1B 3DBNA 3P14A 2PDUA 1EP1A 3PTMA 4DJEA 3RM8A 5A8NA 3GW0A 4PC8A 4DLMA 2WNWA 1WE5A 1VHNA 4A22A 2A85A 3V16A 1TJ0A 1I2PA 2ZRYA 3BOLA 5BRQA 2R1LA 1E9LA 3W00A 5DT5A 1R8LA 3QKZA 1M9HA 5G1MA 3NGFA 3O7UA 3ZLGA 1UBPC 5EL1A 1JG9A 4FNTA 4RCXA 4AFYA 2AAMA 1WQ5A 4JHMA 4M6PA 2FKPA 4GIYA 2Z00A 2OO0A 2QGYA 4KQNA 4BEQA 2DQWA 4B16A 3B8IA 1B3WA 4GUIA 4JOMA 3C8NA 4AISA 3RJXA 4IISA 1ITCA 2HK1A 3ECQA 1DE5A 4GZ7A 5LHFA 1DTUA 1XRTA 1KGWA 3KBWA 4DWSC 3II1A 2OYKA 2WC4A 3IVUA 4FLSA 4IICA 3E6EA 3FX4A 3E12A 4BI5A 5KETA 1CXKA 1ADSA 1ZENA 1UP2A 3V75A 5TQLA 3ELFA 5CC7A 3CB8A 2F6UA 3THQA 2QF7A 2VVSA 1W3NA 1XH2A 3FVDA 2GQAA 1TPB1 2PFHA 4DQWA 3EA2A 4MMWA 2EPKX 4UZSA 4EAMA 5CPNA 1TFVA 3GVGA 4AY7A 5LSMA 2W79A 3LU2A 3V35A 2QJHA 1EC8A 3K4WA 3WK0A 3SGGA 3H4GA 2J9XA 5AHLA 2AL2B 3HBLA 1V79A 1VYSX 3NURA 3E2RA 2ZQ0A 3TEVA 3IWPA 4F0SA 1I45A 2GZXA 3FEMA 4QFUA 3N2TA 4Q32A 4HA4A 3B9AA 2H6RA 3OU8A 5LXXA 3KP0A 1O7AA 3WZ0E 3MUXA 3LYEA 3ITLA 4GGHA 2HPIA 1OABA 2WM0A 1L2QA 3UESA 3DFSA 1XISA 3I7SA 1U2YA 2FB2A 3TK7A 4QBXA 4CCDA 3WD0A 3VIOA 2R1NA 4LCSA 2I1OA 2Q71A 4U2ZA 3TP4A 1KXHA 4YTTA 3A4WA 4WJXA 9XIAA 2WNZA 1SFTA 1CECA 3GNXA 2ZICA 3G77A 3H21A 4DJDC 4JN7A 5IBXC 4JZ5A 4M51A 4C7GA 2XUCA 3TFCA 2ZA3A 1W8GA 3STEA 2DZBA 3R12A 1J0HA 2J7DA 4E3VA 4A3HA 1PTGA 4IUGA 1R9YA 3TJLA 3LG3A 1AUSL 2DZXA 3M64A 2AAAA 3LCGA 2RKXA 1WV2A 1EWDA 3CUXA 1W0MA 5CLTA 4LQ1A 3HFTA 4GD0A 3V5CA 4AVFA 2QDDA 3PBUA 3ZJKA 3MBDA 3R6IA 3TZFA 1TTIA 4JDBA 5F4WA 4AQLA 3WD1A 4LUJA 2GJPA 2QAFA 2I56A 3TTEA 3A64A 3GHUA 1K9FA 2EF9A 3SCTA 2CBJA 4FR6A 1OIFA 2PD9A 1V51A 4JX5A 4LGXA 2BHZA 1EXPA 2FFCA 1EZWA 1WP6A 2AGKA 4LBRA 3GHSA 5C9WA 5AHEA 1X7FA 1JD9A 2CYGA 3Q4DA 4DAFA 1E6QM 3EEZA 4NX5A 3CUGA 5K9DA 1PKNA 7A3HA 1O5XA 3RRXA 1KCXA 2OZ3A 3RN6A 4E4PA 2YYTA 4GISA 2ZX9A 4Z1BA 3IGUA 4P7RA 2XU2A 4R88A 1SVDA 1ONWA 1XCXA 2NLYA 5IFPA 1BQGA 2PBOA 1Q6DA 4JCMA 3GC4A 2ZZ2A 1KFJA 5I77A 1EP3A 1PDYA 2NQHA 3S5NA 4A8LA 4J40A 1LDCA 1H7WA 2GQ8A 3BLKA 2OQHA 4S3JA 2E5BA 3FSUA 4FLOA 1FWNA 3EB2A 4FAMA 1JDCA 4JTIA 2FQIA 4M6QA 3WQWA 3APYA 1S2AA 4YTQA 2NX3A 3P60A 1AH4A 3G22A 1B5TA 3UNTA 2OVLA 2YIHA 3DFNA 2ZXDA 4CQAA 5CXPA 1SSGA 4HPNA 3P81A 1KLYA 3V0SA 3T0AA 4UR9A 2A3HA 1LOSA 1BLIA 1W1PA 2QYGA 1UKSA 1ISVA 3PUDA 2GDQA 4GY1A 3N18A 5C7HA 3NQBA 2YCJA 1VP5A 2PRLA 3DERA 1WYIA 1CDGA 4PB5A 1NDVA 2OWWA 4D6DA 4LB3A 2OWCA 2NQJA 3TN6A 4JFWA 1UH2A 3U2ZA 3PY2A 4ENLA 1QUMA 3P0WA 4OGZA 2XFFA 2Y7DA 2Z28A 2ZUMA 3GYCA 3PANA 1VCVA 5M5DA 1ZBCA 3SCQA 3U8GA 2JGQA 4CLMA 1HQTA 2YCIX 4PTXA 5C7VA 4NAFB 3VIIA 1X6UA 2ZC1A 2W61A 4PBGA 4RNHA 3T1GA 5AC6A 3WX7A 5FEWA 1DWHM 1W1B1 5LYRA 1V0LA 4QNEA 3KDNA 2RJGA 2QR6A 4ZXLA 1JRCA 1BF2A 1KFLA 1JI1A 1FDZA 3SRHA 1EIXA 4OHQA 5EMYA 2Y89A 1Q6RA 4P2VA 2TAAA 3R2GA 4Z42C 3T9PA 2PWVA 4OOUA 2SFPA 1QNVA 5A6BD 1VFSA 4HCDA 3RR1A 3WD4A 3LX9A 4XD4A 1LWHA 3OVGA 1HX0A 1TPEA 1LL6A 1YE4A 4NNCA 4QDMA 2VZOA 4L4MA 1HXJA 4RL3A 3LERA 1EXBA 4MGGA 3TTYA 3M4HA 3DKLA 4XZWA 3OZYA 4LBSA 1KNWA 1NOUA 5EYWA 3FFSA 2YL9A 2ZRZA 1CBGA 4KWSA 1NJJA 2DZUA 4CQDA 2BV9A 1V3IA 1RSCA 1V08A 2XIMA 4ADTA 3TQKA 3VKKA 2FJKA 1BRLA 3AUJA 3TN5A 4FLRA 4FALA 4GY0A 1OEPA 1OFAA 2HQAA 1TJPA 4JKLA 4WR3A 3AHZA 3IV3A 4UTLA 5GVJA 1KXVA 1QRQA 3R79A 3MWAA 4WKFA 3VX0A 1DWJM 5DBUA 4L61A 1ISWA 3SCVA 1E56A 1TMHA 4DVOA 4EK7A 3N19B 1UJPA 4B2DD 1K9TA 1UQYA 2J7CA 3NYZA 3UY8A 1OFEA 3KEHA 5I0DA 1LBFA 2HXUA 4RZBA 4EKJA 1WDRA 1GVEA 1PKLA 3ZQ9A 3S2JA 2WCAA 1BXBA 1UWUA 1GVIA 3R58A 2XDFA 3W1RA 2PODA 3GTFA 3SFWA 3ZLHA 3T2QA 3WQVA 4C1NB 1G4SA 4L6OA 1ZFJA 2X7WA 2FDMA 4UFMA 2F2KA 3S6TA 3GS6A 3NDOA 1YDYA 4NRRA 3IK4A 3KVKA 5J5DA 2FPTA 3BAYA 4IX0A 3H2EA 3W76A 3W07A 3C6CA 4DLFA 4RKAA 4TMCA 3XIMA 3BLEA 1JAKA 2A3EA 2XGBA 3TC6A 4K1GA 2VRJA 1XBZA 5K4ZA 3LGEA 3AJXA 3RLHA 1NY1A 3C0JA 3MV11 2NSXA 2X7VA 4IG2B 2ZTKA 3ZJ7A 2Y1HA 1ONRA 2A1YA 1XR2A 4M5PA 2DZSA 5LGXA 1H5VA 4WRHA 3WLIA 1FX6A 3EKZA 3S1UA 1S2CA 3VMNA 4Y7EA 3QR1A 2IPFA 4PEKA 4GIAA 3LCHA 3SQMA 3BJFA 1QU4A 1HNYA 3MO4A 1L6WA 1AODA 4QROA 1XD1A 5LIUX 1PZ0A 2GDUA 5JIPA 1W3TA 4H1ZA 1KW1A 4DY1A 3PBYA 5CSUA 3NXLA 3BV4A 3D6NA 5DF0A 4WHBA 2W91A 2H90A 2VEGA 3GZ3A 1NIUA 4Y6GA 1G1YA 3P74A 2HVOA 3CHDA 4MKNA 3O63A 4GQGA 3EA1A 1J6PA 3WH8A 2FLIA 1K03A 3AXIA 4BWLA 1W9PA 3CQ0A 5KZEA 1NWRA 3TJIA 2P1FA 4LUTB 3B9NA 1EGZA 1ZAJA 2FZBA 2J7BA 2RUSA 4XO6A 2DQXA 1ENUA 1D3CA 5C5YA 1FWGC 4L6DA 3BE7A 1AA1B 3EWWA 3UZ5A 3PM6A 4EXQA 5MKGA 3SQSA 2ZADA 3W2MA 2OELA 1PX4A 4DBSA 2Z4GA 1C8YA 1ME8A 3DKJA 1K7EA 1VCFA 1R0MA 1RBAA 1KGXA 2V2CA 1GJUA 2D2HA 4CNTA 1ITQA 4DBUA 3VOFA 3H2OA 1UKPA 3QZ6A 3KTSA 4IH3A 1SMDA 1VBHA 3Q37A 3TXZA 5D2YA 3ABZA 2W0UA 3CUIA 2IKHA 3MVTA 2NQ5A 1A3WA 7TIMA 3TWBA 1XIEA 2WNNA 5BXTA 1RCOB 4JTHA 3M41A 6REQA 3KL0A 3IACA 2OOGA 3KBNA 2DVTA 2CZEA 2WAGA 4PGLA 4UTFA 3AS1A 3LTSA 2B7PA 4TX9A 1KFBA 4PL1A 2R24A 4RDVA 1VJSA 3VDHA 3KW3A 4KWVA 3IVSA 4JD4A 3Q67A 2D24A 4XZIA 4MUZA 2QEZA 1J96A 1YTKA 4OBSA 1E4MM 5GQBA 2GGJA 1B30A 2FZMA 4AB4A 2QULA 3DENA 4ZGYA 2OKOA 3VNIA 2GPTA 4PN2A 4F0RA 1YRRA 2E3ZA 1VYRA 1A49A 1XC6A 2C8NA 2F6XA 3LM3A 3G3DA 4IP5A 3GLCA 2DORA 4GOAA 3W1LA 3W02A 4MJ2A 4TOQA 8XIMA 3TJXA 4AXNA 2TODA 3CPRA 4JTLA 3AS2A 2FGBA 2WMGA 1W37A 3LRMA 2CKSA 3TZNA 4CN4A 1VB9A 7CGTA 3N6HA 5BWAA 5C9UA 1MSSA 5HJLA 4POCA 1B2YA 3HPZA 3UJFA 3TW7A 2UV8G 1QOXA 3WLJA 4UCFA 1QR7A 1TPFA 3NA8A 3REQB 4GKTA 1O1HA 2GVEA 2VM8A 2X0HA 5GPRA 9XIMA 4AWSA 6XIAA 1DYSA 1RCQA 1IEQA 4D1IA 4O1BA 1AQFA 1W1A1 2ZZ5A 3N17A 3R43A 3MTWA 4UNKA 1K70A 2Y7FA 1TQXA 1R3TA 4GUJA 5I79A 3VVGA 3S0CA 4UTMA 1HIZA 3CV2A 1G94A 1N8WA 1WA3A 1W9VA 1M03A 3UZWA 4DUWA 2JE8A 1KXQA 7ODCA 3W1NA 4C1LA 3UNDA 3HM7A 2PZ0A 1OCQA 1KM1A 4Q8MA 1XIGA 2PDQA 4GYPC 1VEPA 4Z2IA 2JIWA 1WX0A 1QI3A 2WC3A 4HVXA 2PDNA 3GG8A 1H0IA 5C54A 1E70M 4JN8A 1XUZA 2ZE3A 2WZIA 4HK7A 4Y8FA 1W2VA 3ANYA 4HTYA 3TAKA 3BGJA 1Z6KA 3TNOA 4QQ3A 3T07A 1SJAA 3L4ZA 1K6WA 1TPUA 1I9CB 3QY7A 3TOPA 4XX6A 4E5TA 1W3HA 4H4IA 1X96A 1E1EA 2P3EA 4DI9A 3M7WA 4XQ6A 3R94A 1XW8A 1WXYA 3UP8A 1JCNA 4DZHA 4J3XA 4JIIX 5HUPA 2YXOA 1HZYA 3PWGA 1ISYA 3BMWA 1EJTC 3WLKX 3IAPA 4ILSA 2H3BA 4ZR8A 5IDIA 2WSQA 4JQ3A 3STFA 4L4LA 1EJ7L 1POKA 1CW2A 1XDJA 3PJWA 4ZQCA 1GZ1A 1ZBVA 3CB3A 4HMCA 3TOYA 2DGAA 2XM1A 1EC9A 3CPGA 1CXLA 3CZGA 3IUHA 1LL4A 2NX9A 3NQGA 4LAKA 4KCUA 5CZ0A 1FVPA 3N9RA 1JJKA 5T9CE 1KCLA 4JY9A 5ABTA 4BF5A 4JKKA 3RPDA 2GOUA 4B4HA 3SM0A 4MHBA 2C1GA 4DO7A 3ARWA 2MUCA 4GFIA 1DEDA 3GHRA 4JTQA 3C86A 1KV8A 4DJEC 3BMVA 3RO8A 3WUGA 1KFKA 2Q3RA 4MPKA 4HMEA 2RDUA 1O5KA 2YBVA 4ES4A 2EBNA 3MZNA 1NP0A 1IEVA 3CQKA 2OKTA 4WOQA 2J7EA 3O6YX 4FO4A 1DIEA 2FGZA 2H3DA 5CJ5A 2VC5A 1IXNA 1Q2RA 2C91A 9CGTA 5C2XA 4AWEA 2QCEA 1GQLA 5AZ0A 1ZAHA 1PHQA 1FKWA 5G4EA 7PTDA 1FCUA 5BROA 1S2TA 4DWSD 4D71A 4IQJA 2Z0IA 1D3GA 3OIXA 5XIAA 1GPFA 4HHLA 4EACA 2J7GA 4O12A 1H7PA 1K8ZA 2Y2WA 1UC5A 2FDSA 3NDZA 3EBVA 4NXKA 2WHLA 1G01A 2GGIA 3BW2A 1XIMA 3TC7A 3W9ZA 2VFIA 1TV3A 4GXMA 4G1NA 5ECUA 2FZ8A 3ZVHA 3GR7A 1ZU8A 1GVFA 2XIJA 2ZA1A 3W2UA 1TRDA 1YXYA 4BQ4A 4EP8C 2J66A 1QW9A 4K68A 2ACSA 3CWOX 3RF9A 3TJ4A 1A0EA 1TJ1A 3A24A 4RZ5A 4GI6A 2HVMA 1DJQA 1UH4A 4OTKA 4O1EA 3NNTA 4WVXA 2WHMA 3CUJA 3D3AA 4QLJA 3USBA 1M7JA 3E0FA 2DSUA 1UWSA 5B7YA 4JNMA 3T4WA 4XZ9A 4NX0A 4UTHA 4M1BA 3IJQA 1XSJA 1SW0A 4AD2A 2Z6JA 1IEXA 3BG5A 3WD3A 1QHZA 5GJPA 4LNCA 4NP7A 1GT8A 4GC3A 3LPFA 4O8AA 1PCWA 4A3UA 5LNWA 1XHGA 5DMYA 2I14A 2OT0A 1CT5A 3W7PA 1KB3A 2VJXA 1KQZA 3GH5A 4CD7A 1HJSA 2DU2A 1HKWA 1MNZA 3TSBA 3L0NA 1V6TA 3U3HA 3IJLA 1W17A 3LCFA 1UWTA 3B8UA 3VIFA 4DJDD 3UQNA 2AOSA 4RE4A 2Q8LA 1DORA 1NELA 2CLIA 2QJMA 4MWAB 4JYFA 1IXQA 4MY9A 3B8SA 3VGGA 4JNYA 3N25A 3FYPA 4C6JA 5CPTA 3MUZ1 3RIKA 4DF1A 1KM6A 2FZNA 5CSRA 3BARA 1TB3A 3G1RA 4X9SA 4Q8QA 3VZXA 1MMFA 4BHYA 1Y7VA 4XO7A 4GH1A 2YXGA 2WHJA 2Y4SA 2YDAA 1A47A 4S3AA 3MZ2A 4LEFA 4BCEA 5L6UA 4CNSA 3CAVA 2EG8A 1TMQA 2J7FA 5FD0A 3VD7A 1M7XA 4HZ8A 4XAGA 1DP0A 4C6PA 1Z7AA 2JKPA 3W70A 1JGMA 1M68A 1Y5XA 1TR1A 3AS0A 4ICMA 3LENA 1HP4A 1YDNA 4HZ7A 4UQCA 3U6WA 3GVRA 4I9TA 2W66A 1UKQA 4YMZA 4UOQA 1BF6A 5IHRA 3OLGA 5AECA 3W1XA 3ZR5A 3WLLA 3WFAA 3AAMA 1JVNA 3KOXA 2XFRA 5D37A 4C1KA 5HWMA 1E4LA 4RUBA 3W83A 1X6NA 3ENLA 2ZUVA 4LUYA 2WVUA 7REQB 1T7LA 4AU0A 3BLIA 4PZVA 4JTSA 4ZOBA 5T8GA 3KCLA 4GVFA 2WMIB 1R47A 3NG3A 3W82A 3WYZA 1UASA 4KIEA 2EG6A 1E1CB 1C8XA 3UVIA 1W56A 6TAAA 3MW7A 1RK6A 2ODOA 4L1WA 1P7TA 3ARTA 4ZA0A 4WY0B 4XTIA 3WNLA 4G9PA 2BBFA 4IFKA 3WJXA 3NJ3A 1KWKA 4LB4A 3VTRA 3UZXA 4PTWA 5DMLA 5SWUA 3Q65A 3P5YA 5I3HA 3PSWA 5AYYA 3P8IA 2V82A 3H23A 2WBKA 3FHAA 1KBLA 1LT7A 3K8MA 2X09A 4ML9A 1X1NA 2V2DA 1M53A 4EPKA 3O06A 3WSUA 3KTCA 3LMZA 1QWKA 2VXNA 3K4DA 1P6BA 2RDXA 1V6XA 3ARUA 1FHVA 3ME3A 2YCKX 2CBVA 3EA3A 3VFCA 1HG3A 2Y8KA 4AG0A 4KPLA 2QJGA 4MZ1A 3E2SA 3AHTA 4EPDC 5J8LA 1R85A 3N73A 3OYZA 4RZ6A 3P61A 1QNPA 4ZEPA 2OLAA 4FOUA 1OT2A 3GTNA 3AU6A 3RX3A 4PTMA 3AMLA 3FOKA 3CH9A 2XVKA 4LX4A 3S9YA 4NL1A 4N7QA 1FY6A 5DCBA 4LUSA 3EX3A 2PGRA 3MHFA 3O0KA 4GX9A 2IQTA 4TQTA 4B5WA 4IT1A 5C70A 3VKJA 4J2MA 4D9PA 1V03A 3I6EA 2Z1XA 4J3UA 3GXTA 2E8YA 3UVAA 2ZC8A 1EO5A 2OSYA 4OKDA 3FK4A 2VQTA 1W3IA 4NIRA 4N6FA 4NI3A 3CIVA 1KM3A 4YNGA 3GVWA 1HJUA 2J78A 3O05A 3UA3A 2OG9A 3W37A