4LY4A

Crystal structure of peptidoglycan deacetylase (hp0310) with zinc from helicobacter pylori
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
290
structure length
290
Chain Sequence
AKEILVAYGVDIDAVAGWLGSYGGEDSPDDISRGLFAGEVGIPRLLKLFKKYHLPATWFVPGHSIETFPEQMKMIVDAGHEVGAHGYSHENPIAMSTKQEEDVLLKSVELIKDLTGKAPTGYVAPWWEFSNITNELLLKHGFKYDHSLMHNDFTPYYVRVGDSWSKIDYSLEAKDWMKPLIRGVETNLVEIPANWYLDDLPPMMFIKKSPNSFGFVSPRDIGQMWIDQFDWVYREMDYAVFSMTIHPDVSARPQVLLMHEKIIEHINKHEGVRWVTFNEIADDFLKRNPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords peptidoglycan deacetylase
publication title Characterization of the divalent metal binding site of bacterial polysaccharide deacetylase using crystallography and quantum chemical calculations.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Hydrolase
total genus 95
structure length 290
sequence length 290
chains with identical sequence B, C, D
ec nomenclature ec 3.1.1.72: Acetylxylan esterase.
pdb deposition date 2013-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01522 Polysacc_deac_1 Polysaccharide deacetylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.370 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase/deacetylase 4ly4A00
1XW8A 3VUSA 2VYOA 1W1B1 4F9DA 4NZ4A 4OUIA 4NZ1A 2C79A 3HFTA 5JMUA 3WX7A 3RXZA 4NZ3A 3CL6A 2IW0A 3QBUA 4NYUA 2Y8UA 1W1A1 2XU2A 4F9JA 3CL8A 2C71A 1W17A 2DFAA 2C1IA 4U10A 2J13A 1V6TA 4L1GA 5BU6A 4WCJA 2QV5A 1Z7AA 2C1GA 4NYYA 1NY1A 2NLYA 3S6OA 4V33A 4LY4A 2W3ZA 4HD5A 3CL7A 4M1BA 4NZ5A 2I5IA 4NY2A 2E67A 2CC0A
chains in the Genus database with same CATH superfamily
4FR1A 2C7FA 2WBGA 4AIBA 3TQPA 3W2JA 4ZO6A 2PTWA 2QPXA 2G95A 4BF9A 4Y90A 4JPGA 2YL6A 1JUKA 4BI7A 4FSAA 1HXJA 5D30A 2RDUA 2WZMA 4BZYA 5CPMA 3RLUA 1I1WA 4N7QA 1T6MA 3MUXA 1UQYA 3ITXA 3M44A 1XBXA 3HO8A 1EXPA 4AZGA 3LENA 1BTCA 4YXGA 2BZNA 1W5PA 2D24A 2PA6A 2DZPA 1B9BA 5AFDA 1O4UA 2QZRA 4ZCWA 3T09A 4IG2A 4ORIA 4Q7NA 1IZCA 1LOLA 1XJBA 1UKPA 4LUTB 4Z2KA 1TB3A 5ABHA 1Q65A 4MLJA 1GKQA 3AWNA 1BYBA 2ICSA 4C6JA 3BSGA 4IIHA 4N9EA 3W28A 1EHAA 2YXXA 4AVNA 4LY4A 1TJ0A 1JCTA 4Q4KA 4YU1A 2JBMA 2GJNA 3ABSA 4LQ1A 2OZ0A 3P84A 1XL9A 1FWWA 1UKQA 3C2YA 3G0XA 2QVHA 4GYJA 2PU0A 5LNWA 3LPPA 2A1YA 2FKPA 4TX8A 2W4XA 1K7XA 3SCSA 4GKTA 1DP0A 4N9CA 1MW1A 4L4OA 4EAMA 3GIQA 1P5BA 4DXVA 1EC7A 5J5DA 3DI0A 3TYBA 4O4WA 2PDPA 1P0EA 4N0RA 4WOZA 3RPTA 3FLUA 1R3YA 2FZBA 3K1GA 3L4WA 2Q3RA 3WCZA 1LQ2A 3LBMA 4QQ3A 1HNYA 4IMDA 1RLDA 2VCCA 4MY8A 2W27A 3S6DA 1J10A 2BVTA 4BA0A 4UQBA 2JGQA 3WL0A 1TV2A 2HE5A 3VD4A 2Y85A 3E0LA 4JIQA 4KH2A 1XHGA 2WKJA 2VZVA 1JDDA 2UY4A 3WEZA 1KO0A 3IEBA 3QQ0A 1MXSA 2H8ZA 1D3HA 3PG9A 3WLJA 2WM1A 4W86A 4XD5A 1UWTA 3TVAA 2ZBTA 1P43A 3E6EA 1EGZA 3PTMA 3DC8A 4KMQA 1EJSC 3IGSA 1WB0A 3B0UX 2WSRA 1ZB5A 1GW1A 1MZHA 3GTFA 1UKSA 1CIUA 3LNPA 2E5DA 4BQ2A 3VGFA 2NXIA 1AZ2A 3SCRA 5C2XA 1KXVA 2Y5JA 5BWAA 4I5XA 1DWIM 2PI6A 2F8QA 2CESA 5IM51 1RCOB 5GQBA 1VH7A 1IXQA 1PEZA 2J79A 1EP1A 3TYAA 3H70A 1QR7A 1XIMA 1SMDA 1POKA 2XIJA 1K8XA 4B16A 1V6TA 4KFOA 3II1A 1D8WA 1WUFA 3C2OA 4JIEA 1QHZA 1TJ1A 5LXEA 4AY7A 1QT1A 2VGIA 2V3EA 2EJAA 1GK8A 2E67A 1WBJA 3HPSA 3OA3A 1XPYA 2QS8A 1GEQA 3C2FA 2WHLA 3W85A 3HBLA 3PB0A 4RK8A 1BVNP 1K1DA 2VRQA 3W1LA 1BGAA 2E6DA 1VEMA 1GOQA 1GHSA 1Y0EA 4UUIA 4IP5A 3OEXA 1JCYA 1Q6OA 5AYYA 5CBJA 4GC4A 4NXSA 4AD5A 3N6JA 4H8NA 4NU7A 3L4TA 1BG4A 3SURA 1W1ZA 4RNHA 3TJXA 2DT0A 4Y8FA 4GQQA 2WQDA 1QDSA 1M9HA 5BXTA 4UFJA 3WQCA 1PS9A 4J5NA 2VC5A 3HOJA 3B3DA 3W7IA 1MVYA 3BJSA 4POCA 4H9MA 2OTDA 2X41A 1C7TA 2ISSA 4IP4A 2G37A 3DGBA 4LX4A 4PH6A 1DJYA 3E74A 2VWSA 3SZ8A 3ZVIA 5BOOA 1FCUA 2B4GA 1IEVA 3MSYA 3Q65A 1AJZA 4MDPA 4PUJA 3N34A 3B0YA 3PBWA 5G1YA 3GM8A 3S42A 2PGEA 2X1SA 3WJSA 4Q4PA 1I1XA 3C0QA 3UWVA 4DUXA 3NM3A 3HF3A 4DO7A 2WPBA 4DWSA 5F2GA 4DLFA 1XR2A 2F38A 1HG3A 2BBFA 4MKVA 2PURA 4Q7IA 4C1LA 3HTWA 1B1YA 3WH6A 1DJZA 2PODA 1EZ2A 4O12A 4HMCA 1UC4A 3QR3A 3EX4A 5HJLA 2DVTA 1QXLA 3ORWA 3E2RA 3T08A 2Y89A 4HPJA 4DI8A 1GG1A 3MZ2A 3TW6A 1Q66A 4H9TA 2VYOA 3RM8A 1PBGA 3IIZA 3GXNA 3U6WA 3S1UA 2XFYA 4YTQA 1AMKA 1UH3A 4RXFA 5HXMA 1J2BA 3VNYA 4AYGA 3EOSA 3RO6A 2P5NA 1F5ZA 3A12A 3W73A 3IJ7A 1ISXA 4KIRA 3AS3A 1B3ZA 2ZX6A 4FOKA 1A5UA 3B9EA 1F3TA 2CBVA 3REQA 5GNYA 4PRWA 1W8SA 3PPGA 1TR1A 3S5YA 1NDZA 1FHDA 1QPOA 4QIUA 3WK1A 3WH5A 3HV8A 5LIKX 1UYQA 3ITVA 3B03A 1PO9A 1HIZA 2OSXA 1OGBA 3M0VA 4MZYA 4S3EA 1OF6A 1O1HA 4EPBC 5D05A 2E68A 5FF3A 4KBXA 3R8RA 4CCDA 4NZ3A 1F2JA 5F2IA 1E1CB 1XYMA 4Z0JA 5A95A 2I16A 1TPWA 3E0IA 3TJ4A 3GAYA 5HOSA 1H60A 1R86A 1XV8A 4V15A 3W1TA 1GYLA 3ISIX 3AXMA 3A13A 5DRIA 4FX8A 1M7OA 4UTMA 2P53A 4OQVA 3TSBA 2QJNA 3L5AA 4Z1BA 1TWIA 1AL8A 4O17A 2WHKA 2G5WA 2XUCA 1XKJA 4GZJA 3SCOA 3OBKA 1RD6A 4AD0A 3N29A 2QUUA 3N13A 2F2KA 5D33A 5BWFA 3MHGA 3BLPX 4BS0A 3KP0A 5ABTA 4MUZA 1VPQA 1JI2A 2VD9A 1PIIA 1X8FA 4GIYA 4Z2LA 5MKGA 1G01A 4W87A 1X1NA 3ITGA 4L6OA 1O94A 2CZ5A 4HK6A 1D8CA 4PMRA 2D20A 3WMBA 5EU9A 2J25A 4GQRA 3L12A 2G3NA 4LF1A 3VIJA 3PY2A 3HJEA 3MUIA 1QNVA 3IUIA 3CO8A 1H5YA 3KCJA 3MVIA 1JG9A 4BR1A 1R7AA 4KWOA 4HPNA 3NEVA 3MWCA 3SRDA 1TPDA 2NSOA 1KD0A 2WOQA 5D2WA 2Z25A 2I1OA 5M17A 4AD1A 8RUCA 1EYEA 4Y8EA 3R79A 1LL6A 2ZX7A 2R6OA 2ZXDA 3SCNA 3MW7A 1YTDA 3L0KA 3LCLA 3TQ0A 1OC6A 1P0BA 3TLLA 2UBPC 4YLWA 3UNDA 2YR1A 4C6IA 4H9UA 1HP4A 2OXNA 3W2UA 3HG5A 4HA0A 1XCFA 3B0VC 3LG3A 4PA8A 1ZJIA 4NL1A 1VKFA 4JKLA 3SCTA 1V5XA 5BU6A 4TTUA 3MHUA 3DI1A 1V3KA 3KVMA 5MF5A 2O92A 1XINA 1W9XA 1FCBA 1F3WA 1F07A 3QYSA 3KBVA 3S1GA 3PAJA 2OEMA 1W56A 5M2FX 3UGVA 4XZNX 3AXXA 3W1PA 3LHYA 1D7FA 3IANA 3WLNA 3PZTA 5A6AA 4I9JA 3S6OA 5D02A 4CN1A 4W7WA 3IARA 5LA1A 1P6BA 5DMLA 3WNMA 1E6QM 1JFHA 4QS5A 3WDJA 1NP0A 3UF9A 2BODX 4EXAA 4ZEPA 3F5LA 3DG7A 1FH7A 1C91A 3V36A 2VP8A 1PCKA 2NX9A 3G1RA 4S1FA 3P5YA 2POZA 1XLKA 3E1F1 1CPUA 1MW2A 3FVMA 2VX4A 1MDRA 1AH0A 1LRNA 4ZXOA 3SSZA 3OBEA 1IGWA 2Y7GA 1GNXA 2XSAA 1RUSA 2P88A 3C2RA 2OYLA 4GBUA 4N02A 2ZZ5A 3CMJA 2I56A 1V51A 4LAUA 3EAUA 3SJ3A 5FJRA 3H2AA 2WC3A 1K9DA 5HULA 1REQB 3ZO9A 1Y7VA 1B3XA 5HQMA 3FCPA 3C8NA 2J4GA 4GI6A 4FNTA 2WCSA 3W71A 3TWAA 3P62A 1YBQB 2W79A 4LUTA 3OHIA 3VIIA 3UYIA 4S2BA 3BCJA 3OW1A 4TTGA 3FV9A 1OFBA 1YW1A 4DO6A 2GSJA 4MB1A 1QW9A 4IMGA 2OMAA 3LV5A 2A0NA 4WDTA 5I79A 3OLEA 3VFLA 1JNEA 1I0DA 3QV7A 2HSAA 3H7RA 5JBEA 3FAWA 3EWUA 3AS2A 1EJ7L 1E72M 3LLXA 3ITLA 2Q3OA 1UB3A 4PL2A 2QF8A 4TX9A 5A2CA 4DF2A 3K30A 4K1GA 2YCJA 4MNJA 4ZR8A 2PTZA 1B5TA 1JCLA 4M82A 4JAWA 1W17A 2TMDA 2XGZA 4W85A 1YNQA 4TQTA 3WQDA 3BAJA 1T8QA 1UWQA 3E5BA 2E8YA 4I7UA 2J74A 4DYJA 3A24A 4O54A 4H8HA 3CNYA 1A50A 2O7QA 1KBBA 3NQMA 2J9YA 3VUSA 4OECA 4JN6A 1HUVA 4TV6A 5EY5A 1BYDA 1DHPA 4AZ5A 9XIAA 3VMPA 4CKQA 4H41A 1VENA 1W1A1 1PVNA 2WXDM 2GZXA 1DQWA 4IFRA 3KOXA 1ZS2A 2NW0A 3R94A 3T42A 2JEQA 1O95A 1S2VA 4D6GA 3FAXA 3H22A 5JIWA 4RL3A 3VIMA 3RHGA 2QNEA 1NU5A 1EA0A 5HMDA 2SFPA 3GVVA 2C13A 3CZLA 5C2CA 3TK7A 1QHPA 1AZ1A 3GYCA 5RUBA 2G3IA 1TR9A 1JFXA 3UWZA 4AIOA 3CLMA 4JX6A 3H4XA 4OV9A 2QULA 4OUIA 3DFNA 3TYUA 4MVAA 3VD7A 2BVDA 2A3CA 2CKSA 4GFIA 4L4PA 2VC7A 3PS7A 2RGLA 3BC9A 4NX5A 1PYMA 3RCYA 3NWRA 3KW3A 2D1ZA 1DTUA 4DM1A 5TNVA 2PDCA 2FZDA 3OZYA 4FO4A 2H3BA 1XRTA 2R82A 5BNKA 3G5EA 4J7RA 4D8LA 1A4LA 1F9CA 2OWWA 1KTNA 1MDLA 1C9WA 2A2IA 4MG4A 1OCBA 3SI9A 4FIQA 4WY0B 4MMWA 2OLAA 4L4MA 4HPGA 2ZZ6A 3VCCA 3NAVA 2VX7A 2UY2A 5J5RA 3WD1A 2WAGA 3ARPA 3UY8A 2GK1B 3G6LA 3LBCA 4P8WA 1SJCA 4HN8A 3U2OA 2HVMA 3G0UA 3AS1A 3NQ6A 2HROA 3BO9A 3BZGA 3O6AA 2IQDA 3TZFA 3USBA 1KFBA 2PGFA 1AL7A 1TRIA 1JCJA 5AOUA 2D22A 4FHAA 3Q37A 3EX2A 5E70A 2E9BA 4CD4A 4MSSA 1G67A 2J13A 1H7WA 1PZ1A 1UHVA 4ZL1A 2DZXA 3W2KA 1XUZA 4PFMA 2I5GA 3H55A 4ZENA 3VZXA 5D9OA 1MNZA 4G1KA 1FA2A 2WVTA 4NX0A 1MW0A 4Q8OA 4CN6A 4PUDA 4CQ8A 1XGZA 1QI0A 4PMDA 4XBSA 1EL3A 2BY0A 3LPOA 4X22A 1UASA 3UNTA 2A7PA 4JZ5A 5G2HA 2OYKA 4CD7A 4WLCA 5IDZA 4UTWA 2TPSA 5EMUA 3BG9A 2J7CA 2B31A 3T8LA 2ZXQA 5HUPA 5HJXA 1WDPA 2ZUNA 5D04C 3BVJA 2BXZA 5CBIA 4R9XA 4O50A 1PWLA 4CU8A 7XIMA 2NV2A 1NTHA 3VOJA 3VGHA 2WZTA 5CPQA 1H1ZA 4LBRA 4ZO9A 3ARZA 3DXIA 1W1PA 4HU3A 2NV1A 3W2NA 5BXPA 2EKGA 5FSDC 3VD5A 4NUWA 4HCLA 2Y62A 4FXJA 3IJQA 3D6NA 3NPXA 2WKGA 4PUMA 2ZRZA 4JCMA 4JBRA 2BY2A 3TROA 3UXLA 3DFYA 1AUSL 1ZP4A 3TCEA 3VKBA 3S83A 3OLDA 3N9RA 1EYWA 1BYCA 3AAMA 1SFLA 1WDSA 1YDOA 4YNGA 1RP9A 4LVBA 3O0KA 1BFNA 3B04A 1FWTA 4AD2A 2Z0IA 2FZNA 1FDYA 2VTFA 3QR1A 3G1VA 3QZEA 3EWWA 1LLWA 1E6NA 4K39A 4NZCA 3ZIZA 3GHRA 1A3WA 3SCVA 9RUBA 5DMMA 1A5LC 5TQLA 4RX0A 3V3WA 3G22A 5D38A 4PSRA 4QJ1A 4US6A 1M65A 1J8VA 4AXKA 3GG0A 1WDDA 1WXJA 4F0RA 1E1CA 4U2YA 1OF8A 4QJ3B 3NZQA 1ECQA 1NOUA 3E96A 4HPXA 2OPJA 2OQHA 4FZIA 3PF3A 3LHTA 3BG5A 2I9EA 5T26A 1H1YA 2VQUA 3MP5A 4JFVA 4AEOA 3OYZA 3QMTA 4W7UA 8XIAA 1DV7A 1P1MA 2W63A 1BD0A 3OLGA 1SZFA 4YCPA 3GU1A 5FKYA 1GJUA 4E4UA 1M5WA 1WKFA 4LJ3A 3SCQA 4Z0SA 2C18A 2HMCA 3A6OA 3KZPA 4E4PA 1VBRA 4AYSA 3N25A 4B5VA 4BI5A 3O05A 1OHLA 4EVZA 2W9MA 1KFLA 1Q6GA 3C3UA 3W7QA 1KXTA 1JCMP 4WX2A 2X40A 2BOEX 2GGIA 2NQHA 4NZJA 3BOLA 4B5NA 1PKLA 5DY2A 4LEQA 3UJSA 5ECVA 4G6CA 4Y9NA 1XFBA 2FVMA 4DBEA 2FZ9A 3UR7A 4HHPA 3S46A 4JTSA 4UB9A 4XZ9A 2ZRXA 1X98A 3NZRA 2WW5A 5EFDA 5C5YA 3WK3A 4JNZA 1DKWA 2QYGA 3M0JA 4LTSA 4Q32A 4DJFC 3VOGA 1GVOA 4N9BA 4M7SA 4DM2A 3NJ3A 1FFQA 4LFYA 3JRKA 3M5XA 4FIRA 2PBOA 4ERGA 2PDGA 5E6ZA 2WVSA 5AC6A 3RCMA 4PULA 3MUZ1 1OD8A 2Q8XA 1R3RA 2J7HA 1S2CA 3H2NA 5HAOA 3WF4A 5C70A 4AWEA 3Q4DA 4LAZA 2GYIA 2QPUA 4RZ6A 1QCWA 3A4XA 1XCXA 4JTKA 4O1DA 2XZ9A 4ZSUA 1PCWA 3KVJA 1DJHA 2OQLA 1F05A 5C55A 1PZ0A 2WMFA 5DBUA 1EF2A 4R7WA 1L6SA 4BI6A 4Q8VA 1DIDA 1P0DA 1Z9AA 2FVKA 1EHNA 4DUVA 4XX6A 1FWRA 2TYSA 4I8DA 3AICA 1E1EA 1M03A 3WBEA 4M29A 1JF6A 3DIPA 2VR2A 1E3XA 3CQ0A 4W5ZA 2XYLA 3VABA 5FI8A 4NAFB 1ICSA 1J4EA 1DWFM 3OHMB 3C8FA 5C7HA 3UZYA 5C9RA 5G2IA 5KSWA 1A5BA 3ITOA 5HPCA 2JF6A 2OR2A 2BGQA 4F66A 1E51A 3M7SA 4EIVA 3N2CA 5G4WA 4UFMA 4ERAA 3NEHA 3CZEA 4O16A 9CGTA 1OX6A 3NFUA 4ZMGA 4MIMA 3GFYA 1G69A 4MZ1A 2PMQA 4LRTA 3KL5A 4FF5A 4Q4SA 3WDPP 1VFMA 5CGTA 4XZIA 2CLPA 3VMOA 5TBOA 3IVUA 1REQA 1JULA 4QG6A 3FKRA 1CGUA 3EB3A 1RA0A 4D6JA 1R46A 1YBQA 1JDAA 4XAPA 4PMQA 2B81A 3RFAA 2UY3A 2R1MA 4LB4A 2PDJA 1E9YB 2ZA2A 1HGWA 1EIXA 4UMCA 3TR2A 1U1HA 1HGYA 3IV8A 4JTQA 3N73A 1UOZA 4QE5A 2JKEA 1IR2A 4L1GA 3EDKA 5CPTA 4EPKA 3C0JA 3PHAA 1C8XA 3H53A 5AC5A 2XSXA 3GC4A 1LWJA 3W87A 1VGAA 1ZBWA 2YOCA 3O6YX 1O5XA 3VXGA 1EJXC 3P8IA 3GXDA 1ITUA 3PPHA 1YXYA 3W6MA 3DERA 1OGGA 1R0MA 4MB5A 4PMJA 3H2EA 3QKEA 4K36A 2XVLA 1XLBA 2G4FA 1XICA 3ZFHA 2YBUA 2CFFA 1XLEA 2VZSA 3N2TA 4LBUA 3EYPA 2VGBA 1F73A 4C7DA 2FHFA 2V5BA 3NR0A 3QFWA 1ONEA 2PWDA 4LUYA 1PDZA 4JX4A 1ICPA 1UWSA 5D32A 1CENA 3IRDA 1V7YA 4CVWA 2Z1XA 3TYZA 2GUYA 4JFSA 1OT2A 2ZA3A 3DG6A 5BYWA 2XVPA 3PC0A 4A8RA 4GGHA 3KL0A 3OBAA 1XIBA 1FTXA 3V0UA 3W02A 2HE8A 3TV8A 1YADA 1P48A 3EWCA 3QOMA 3UJRA 3LN3A 4JD4A 3GXIA 2CXEA 2VR5A 3PK7A 3RM9A 2CBUA 2GVJA 1KQZA 2J7FA 3M5VA 1CB7B 1M53A 3VTRA 4DRSA 1QW8A 4W9TA 1WXZA 1IT7A 1QTWA 3UCQA 1UR3M 1I6NA 1I2QA 3C6CA 4EP8C 5L6UA 4AIEA 3KL3A 3VNDA 4MY1A 3VCRA 4NILA 1LT8A 2NLIA 3RXZA 4O11A 4WY0A 1VJZA 1VCFA 4K2SA 1W5NA 3CUGA 2YGYA 2VUNA 4R7JA 2PB1A 3COTA 2CCRA 2O9PA 4GQ0A 4JIPA 4Q8WA 1GJWA 2GK1A 3IV3A 2QCLA 1VEOA 4LRSA 2ACSA 2X1IA 1I2RA 3B9DA 5LHEA 2D73A 3BMXA 3V35A 1W8GA 3IIXA 3L66A 1PTAA 5AVNA 3WH8A 5A6LA 1J93A 1TUXA 1V6VA 2QUVA 3DX5A 1KR0A 1XIHA 3DUGA 1GZ1A 3W26A 3MVTA 1K70A 1JXKA 1UOKA 3WD0A 4JTLA 4JYFA 2QUNA 2WHMA 1ISWA 3JS3A 3NVTA 4PUUA 4Q4RA 4WSKA 1WKDA 4CEXC 1B31A 2J9ZA 2FVLA 4GIEA 5I06A 4GXWA 4X9SA 5G1TA 2BDQA 4S3CA 2QCHA 3L4UA 3CAWA 2OG9A 1YKWA 1W37A 7A3HA 1O68A 1XYCA 1WAWA 1ZNNA 3I7RA 3P67A 3OQ8A 4PCFA 1SJDA 4XSMA 2B7QA 4PB3A 5KZEA 3TTYA 1XF0A 3GHUA 4BEQA 2E40A 3AIEA 4H9VA 4UMAA 4GXPA 1TVPA 4DJED 1XRVA 3WLSA 1GVFA 2QJJA 4QS6A 3WLTA 4B9YA 3B9AA 1KCZA 3VNKA 1IXNA 3MCOA 4JNMA 3T0BA 4EF8A 3IAQA 3AU6A 3W7NA 2P3ZA 1EJVC 3CH9A 3V1HA 3E0WA 3TU9A 1SO3A 1ADSA 1H4PA 3LM7A 3LRMA 3AMLA 1XX1A 4KT2A 4Z08A 2W62A 3VKJA 4F9DA 3KBMA 4G2DA 2DJXA 5GJPA 4L4LA 2YL5A 2OLSA 1ZCOA 4HGXA 1UD2A 4J3UA 3WLRA 1NDWA 3GC2A 5D03A 5GJNA 4N6EA 3QHNA 4BQ5A 5EBUA 1J5TA 3ZWSA 3STCA 3MZNA 4CCCA 5K4XA 1BYAA 3M46A 4LWWA 4KWUA 1ZSXA 3H26A 3E38A 3NTYA 3V5FA 3W25A 4F40A 3ZXWA 4DAFA 1TTQA 1PPIA 1GGOA 1W6TA 4K68A 4U5KA 1XDLA 4A3YA 3LY0A 4HP5A 4HHHA 3QLLA 3RK8A 3HQNA 1QWKA 3IJLA 1J2WA 1F6PA 4RKAA 1V0KA 3GNOA 4DF0A 1GCYA 4D6IA 4HOZA 2R1LA 1JDFA 1VLIA 1E0VA 3P93A 4FEZA 4Y9MA 3ZYZA 1TTJA 4O57A 1KRMA 2NUWA 3IJIA 2Y70A 3C2EA 4OTKA 2PRMA 1BVWA 4Z2GA 3ALFA 4GUIA 3LCWA 5HANA 4GVGA 3BQ5A 3N2XA 1FWJC 2X1UA 2VEGA 1XLAA 3T0CA 2A7RA 3E9AA 4KW2A 4RNJA 3GNRA 4KRUA 4WIWA 2WLZA 3LSCA 1AQHA 3PBGA 4I9AA 4AD4A 3UWYA 4IHCA 4E3VA 1K02A 1B0IA 1XIFA 5AC8A 3HG2A 3VX1A 2Y1HA 3EPMA 4OKDA 4GH1A 4PEEA 1PWMA 3L4VA 3WEMA 2NUXA 4FNSA 4GY1A 3UG4A 1HTIA 3O6DA 3WD4A 5HQLA 3GH5A 3W7KA 5DFAA 1T99A 3MMDA 5KETA 3L23A 3EB2A 1XW8A 1MO0A 5C71A 2YFOA 4WXZA 4NNCA 2AMXA 1TV7A 3CXOA 3GIYA 3LLFA 3TFXA 4GYPC 4DY1A 3RCNA 4R7OA 3SN1A 4ZBCA 1VF8A 8CGTA 1Q6QA 4AFYA 1TREA 1RBAA 3THAA 5D9NA 1WE5A 3WF1A 4LYKA 4MKSA 1OZMA 2VEFA 3Q58A 1IT8A 4UFHA 2VT0A 3SUUA 2OELA 1FCVA 1FKWA 2NQ9A 3SIZA 4LAKA 3M0XA 4RDYA 1V6XA 2EPKX 3FS2A 3AMDA 3VDGA 3WH7A 4DBDA 4Q8MA 3W7JA 3U48A 1IEWA 3AZTA 1QK0A 1AMYA 5CCZA 1QWGA 2W3ZA 3ERPA 1X7IA 1CI1A 3QXBA 3CV6A 3H6OA 1HW6A 2POTA 5HUOA 4GH3A 2H8XA 3MMWA 3LU2A 4GBDA 1UWIA 2HVOA 1N2VA 3N2BA 1ZBKA 1KGXA 3FW6A 3F2DA 3MI2A 2V67A 2C0AA 2RDXA 4IIFA 1OC7A 2XIIA 5D2XA 2Z7KA 1OFQA 2CBIA 1WV2A 3BDKA 4P61A 2VFDA 3BJTA 5BROA 1TWZA 1NFGA 3W1QA 4UTKA 1VFLA 2OZ8A 3B8WA 4MUPA 3VIOA 1GORA 4LVDA 4NG3A 4QEEA 2ZUSA 3UA3A 1Q6CA 4MB3A 4NAFA 2R1NA 2ZVRA 4AIUA 1XGEA 4A8LA 3VNZA 5F2LA 2E5CA 3NQVA 4O1CA 1RJQA 3IIVA 1W3LA 3A4JA 4ZB2A 1XIIA 1ZU8A 4GD0A 5I02A 1SZEA 3PZMA 3MDUA 1OFRA 3PBMA 1BQGA 2ZDSA 4DZHA 4Z1CA 4FNPA 5I09A 4H9XA 2ZA1A 1DJIA 9XIMA 1MUWA 2PP1A 3W7HA 1KM4A 3NQEA 2CBJA 5TF0A 4HQVA 3E49A 2VZUA 1MEHA 4BQ4A 2J62A 4JTCA 2XN2A 2QIIA 3OQEA 1GZJA 2QUMA 3BW2A 4W8AA 3TNOA 3RN6A 4J27A 3NQ7A 2CLLA 2PLCA 3M0ZA 1LL4A 1EWEA 1SU5A 1F6YA 4D1JA 3IACA 1XIEA 3JR2A 1HL2A 1U5VA 1UD8A 1F61A 3R43A 3GYEA 3AYSA 1SUXA 1U2YA 4O53A 3CZGA 3IIPA 3D47A 5FJPA 1VJIA 3SUVA 3TE9A 3TONA 4HYVA 3RITA 1KBJA 3VO0A 3FA5A 3DECA 5CGMA 5JBFA 3ES7A 3C56A 1OABA 3VOFA 2OX1A 3CYJA 4P7NA 2XFWA 3S5OA 4KWVA 3QRHA 1J0JA 4B9ZA 1NWUA 1K6WA 3L0NA 1KRCC 3MYOA 2AKZA 4U4MA 3KOYA 1UD6A 2V5KA 3W3OA 4QAWA 2VEIA 3NUKA 2VENA 2INFA 1YEYA 2ZVIA 3AMKA 3THQA 4LAOA 4WHBA 1Z7AA 1UZ4A 4IQJA 2OKTA 3NL2A 3U57A 4YTRA 4LALA 3I3DA 1MXDA 2WC7A 4B5XA 3O07A 4UR8A 4TOQA 3AALA 4GJIA 3VIFA 1YNPA 3U2EA 4JQAA 3R11A 3MP4A 4IICA 1I4NA 4ZOEA 3CEUA 1CZ1A 1C7SA 4ROQA 2QEZA 3QMRA 4QITA 4E8GA 3LZ5A 2V5CA 3SIMA 3EA2A 1LYXA 5BRQA 3WFAA 3I68A 4IMFA 4LPCA 3F2BA 3GDBA 2YCLB 3R5EA 4KEVA 2DSVA 5M5DA 1TG7A 1XWYA 4L56A 4H04A 3BOFA 3VE7A 2REQB 3BAYA 4YHEA 4EX4A 2P8CA 2YJQA 3E3HA 4PCNA 1HKMA 1KA9F 4J9JA 3Q45A 4L65A 5CJMA 3F4CA 3WLOA 3KDNA 3ARVA 4X61A 2WC4A 4NJKA 4JGDA 3CQIA 3HG3A 3VILA 4MNLA 4OV4A 5LNSA 1G9HA 2W5FA 4GISA 4A3HA 4WY0F 2GQAA 4XQ6A 4B5UA 1BLIA 4LYRA 4Y9PA 4PMNA 3AQUA 1IWPA 1CGYA 3IK2A 3BAIA 4JFWA 3SBFA 3SCPA 4N4QA 3N2OA 4EACA 4ALDA 4XUGA 1XIJA 2RDWA 3R8HA 1J0ZA 1KC7A 2ZDRA 5XIMA 2YIHA 2XN0A 2WMKA 4DF1A 3KTXA 3NOYA 1YPIA 3ABXA 4IPJA 4JQ1A 3W72A 3L21A 2VVNA 4DVOA 3BGGA 3AZSA 1VBHA 5C54A 1Q6FA 3UZZA 4KIEA 1H7PA 1NOFA 5C6MA 4AY8A 5I78A 2WJDA 1B30A 2QUTA 1OK6A 3WDRA 3W6YA 3RILA 5I3GA 1SO6A 2VDIA 2OWXA 3C52A 4WK9A 4QE1A 1TWSA 4TV5A 1SMAA 3RX2A 1IGSA 5DXYA 3SN0A 3VOHA 1NWRA 4HOWA 3ABOA 2DT1A 3W76A 4PB4A 1V0MA 4C6OA 2BY1A 1KTBA 3UW6A 3HB9A 3SN4A 2E1WA 2DQXA 4YHGA 1H7OA 3T40A 1GHRA 3TN5A 3G8EA 1EDTA 3KRZA 1WAUA 1KFCA 2V5JA 1ITCA 3KE0A 3UFYA 1K4GA 3RIKA 1CLVA 5IOBA 4RE4A 2X42A 3N11A 1QI3A 1UH2A 1O66A 1BEUA 4B5SA 3S5NA 1LUCA 3KLLA 3TJIA 1OCQA 2O9RA 3BICA 1R5YA 2CYGA 3GNPA 5JQ9A 3QTPA 3WUBA 4NXKA 2IUZA 1W1YA 4MAVA 3EX6A 5FCZA 2PFHA 3VC6A 3MSDA 4DELA 4H8VA 3KEHA 3URNA 4AF0B 5H8UA 3U4AA 2PWVA 1NARA 4PCTA 5SWUA 1PTGA 2CLIA 3CL6A 1KQYA 3AUOA 2ZIDA 3JU2A 4M6QA 3R58A 3D3AA 4CNUA 4F0KA 3W1NA 2Z1VA 5A8NA 2CZDA 4LNYA 3W1RA 2BX7A 1TYGA 1YIXA 1UR4A 4XG1A 3UPBA 3VA8A 4PN2A 4GLEA 4MNMA 4QG9A 4QCFA 1ECEA 4AMAA 1YLVA 1B3VA 2DZTA 4JDYA 1OG0A 3WLLA 1Q7QA 5AYIA 3APYA 4M19A 4LSBA 3I10A 3OVRA 7TIMA 1NQKA 4O19A 4X0NA 4RJEA 1PXGA 3TWBA 3UG5A 1GEHA 3IIOA 3RU6A 3DYPA 5G2WA 3NQ2A 2VO5A 3MT1A 3RLHA 3HQOA 1KRAC 3H4WA 4UBPC 2VFEA 1QW7A 1EBHA 1KCLA 2C71A 4CD8A 5EMKA 3MKVA 3EDDA 2WJZA 4F0LA 4ADSA 4P8XA 1OBAA 2YXGA 3ZT7A 1CLKA 1G4TA 1US3A 2P0IA 4JTFA 4NT0A 1A0DA 3C86A 4WDUA 4F0MA 1AQ0A 2YFNA 4J3TA 1RVKA 3STGA 1XLGA 4Q7BA 1G7UA 2P76A 3S3GA 3HURA 2GVEA 1S46A 1E0TA 3AUJA 4XTIA 3FSTA 2J66A 2XISA 3EKGA 5AC7A 1H62A 3UR2A 3W37A 4C5ZA 5CKSA 4DJDD 3EXSA 4WR3A 3AHVA 3CUHA 1WDWA 1EXBA 4IGHA 1FWDC 3VNMA 1RPKA 4E2VA 2WBKA 3K2GA 3APGA 3CV7A 2FPVA 3OP2A 3GKFA 1XD1A 1JQXA 1Z44A 2XDFA 4MLRA 5JVLA 1E40A 3ARUA 2YDRA 3PJWA 2ZWZA 4LC6A 3H4GA 3EX1A 4QEHA 5FJIA 2G4JA 3CUFA 3CB8A 3W6LA 4DWDA 2WCGA 4IP7A 3LPFA 1XLCA 1OG6A 2Y6ZA 3NQ8A 4J2PA 1S5NA 3T55A 1H1NA 4ECLA 1ZGDA 3TC3A 1QMLA 1V3MA 3TOPA 2YL8A 2V82A 1MFVA 3WF0A 4WDXA 2CEQA 5I23A 1Y8BA 2P50A 2G0WA 4DWSC 3CHCA 3GUWA 3IGUA 1SO4A 3TA6A 5DX7A 4FOJA 3EWBX 5IBXA 5H1WA 3HU7A 2ZICA 3O16A 4HOXA 2OGJA 3L68A 3VOCA 1WBHA 3LHUA 4JXCA 2IKHA 1GQJA 4XKYB 1Z8AA 4HU4A 2WMJA 1HP5A 1VFHA 2GFTA 2Z2UA 1X7FA 2X2YA 5M1TA 2WNZA 1XH1A 4AU0A 2J77A 1U5HA 5FA5A 5BCAA 2PWEA 3ARXA 4RR4A 3T81A 4Y7EA 5LNVA 1MI3A 3ZSSA 3DYMA 1J96A 1TTIA 1DPMA 3AZRA 3WUGA 4C6PA 1NELA 4KCTA 3LK6A 4ZXLA 1RCXB 4IIDA 1NAL1 4D6FA 3CMFA 3W84A 1X8CA 4IJRA 3TYCA 1W1VA 4KFNA 3DFQA 1BQCA 2QMKA 1C90A 1TPH1 3O7UA 5JU6A 5FL1A 3CYVA 1CXFA 3N14A 4XSLA 1ZTVA 2R8WA 7PTDA 1VYSX 1DVJA 1FWFC 4D71A 5D9MA 4WSJA 3NZPA 5A8PA 3VE9A 1PSCA 4IX0A 5HWMA 1AQFA 2Z00A 3T07A 5IRPA 4IFOA 5IHSA 5DEZA 4GVIA 4HHMA 3HMJG 1KFJA 3GH7A 3OIHA 3P60A 3DENA 4QQUA 4P7OA 2OO6A 2V6AA 4XV0A 3EBVA 3OJGA 3JZUA 3T2OA 4XIMA 3CLWA 1QOQA 3G6MA 2IMRA 3EZ4A 1ISZA 4MWAD 5DMNA 4NY2A 3R10A 4KFPA 4UTIA 1EO7A 2PTDA 1DJXA 4M6VA 3KOFA 3BV4A 3ZWTA 5DANA 2XFRA 4PBEA 1KRBC 1NVMA 5F7UA 3HG4A 3QFEA 3KOWA 3OVGA 3IAPA 1PHWA 1H7RA 1JRBA 3IGHX 4C6FA 4MYAA 5HINA 3BUVA 3LV6A 3AIBA 3WDIA 3MO4A 1QNRA 3RMEA 3UZWA 1F3XA 3MCMA 3EX3A 4HB7A 1RR2A 1JI1A 1CXEA 4A2RA 4GABA 1EIBA 1QK2A 4J3WA 2NQ5A 2DZAA 2DUXA 5HDRA 3U5YA 2BFGA 1E6SM 1FCQA 1TX2A 2IPGA 2R91A 1CXLA 1XI3A 1YPXA 3CUJA 1RJPA 4UNLA 5CAKA 1QHOA 1VFSA 5CG0A 5AC4A 3LHWA 1PUDA 1GONA 2A5HA 1P6WA 1BSLA 4UQCA 4CN4A 2XVNA 1QPKA 1TE6A 2YCLA 3KHDA 2WVVB 4WOQA 2CHOA 4IT1A 3W1XA 3GUGA 4HSOA 1DIEA 2FMOA 4MAZA 4QLKA 3RRXA 5C9WA 2REQA 1F3EA 3T0AA 4PTWA 4H6EA 3U7BA 4ICNA 4LANA 4PUKA 1EPVA 1PDYA 4TU1A 3GRIA 1MEWA 1HKIA 1HVQA 5FL0A 3QGKC 1LTDA 3ICJA 4ZQCA 3PN8A 1NWSA 2ZFAA 1XG3A 2V3FA 3W82A 1RK6A 1F8IA 2QDEA 4H6KA 1X96A 5A6JA 4O28A 4KPLA 1Z3NA 3MA8A 4ZGYA 3MU7A 1WOBA 3WBXA 3BAWA 4GK8A 4ZQMA 4MTVA 4AZ6A 3A23A 4HMEA 3I7QA 2OCZA 1CDGA 4L7ZA 5T8GA 1G7VA 1E0XA 2YZ5A 4UTFA 4MOZA 4PUNA 5E0KA 1XBYA 4F4RA 3KBSA 4IMCA 1K6AA 1T41A 3IJ8A 5TAOA 1FWBC 4LUSB 2WHJA 4BEUA 2I5IA 3VKDA 2FB2A 3LI0A 3PJUA 3UD6A 2QCNA 2DSWA 1QO2A 1B9ZA 1EDQA 3ANYA 3I65A 1XLHA 1K9TA 2HNEA 5LKYA 1C9DA 1TZZA 4XZWA 5A8QA 2E25A 4IJCA 1P0NA 3KFTA 3RLGA 4LS1A 4KESA 3RO8A 1DIKA 4ENLA 4ATLA 2X0HA 1ITQA 3SGGA 2BTMA 1W9BM 5LGXA 5D8WA 3LTPA 4JQ4A 4GGBA 2CHNA 3W23A 1T7LA 3M5YA 1B4EA 2DW7A 1UR1A 1WKEA 2BXYA 2X8RA 4QX4A 4NZ5A 1IIGA 2UWFA 2G97A 7TAAA 4IGMA 4CEUC 1IXPA 2XPKA 3QZAA 2OSYA 3R6IA 2NT0A 2BGSA 4B3KA 1AW2A 5HJYA 3WO8A 4XIAA 4GKLA 3ZVHB 1QOPA 1NEYA 3ARRA 4GNVA 3XISA 2R94A 3LCXA 4AF0A 1XBZA 3SY8A 4UOJA 4NZ4A 1XYAA 3RM4A 4L5ZA 4TMBA 4C6MA 4J35A 3ZR4A 1XM3A 1EJWC 4DXXA 3W86A 3OZPA 1KLZA 3D46A 2VUYA 5KITA 1QBBA 2P0OA 3PTQA 4M81A 4F9JA 2YLLA 4WJEA 3VDBA 4A35A 1HJWA 3IRSA 1K4HA 2E6AA 4ATDA 1TRDA 2WNQA 1YE6A 1KCKA 5DQPA 1DOSA 4LC8A 2HWGA 2IKJA 3AI0A 3F03K 3LTSA 5J8LA 3EMCA 3E0FA 1CGWA 3WLHA 4UTLA 1S5MA 3ITCA 1JAEA 3ZLGA 2Y88A 2BOGX 3GTXA 4L6DA 1NP2A 4XUYA 1MQPA 4H19A 2QV4A 3CZKA 3MI6A 4KEUA 5LIXX 2FB3A 1J11A 1B3OA 4L61A 4I6KA 1NQ6A 3S9IA 2GGEA 2PRHA 5D4YA 3DG3A 4DB7A 3MJMA 3U3HA 2HDJA 2O0TA 1ODUA 1ME8A 1E0UA 1UP0A 4ZZ9A 3G8RA 2PZ0A 2ZYFA 3VCNA 2IS7A 4S39A 2QV5A 2XIBA 2Z28A 3W7PA 4PMVA 3TAOA 4RCXA 1KKOA 1K77A 3LMYA 4UOQA 1MFUA 3QY7A 3UT0A 1JDEA 1GQLA 3P7YA 3OG2A 1P0KA 3CTTA 4LVGA 2OSWA 5E93A 1FUYA 2NQJA 1LM1A 1E3ZA 5AZ1A 1JR1A 1S1PA 5E1QA 3DOPA 2EEXA 4KERA 1FH8A 3U8GA 1W9PA 4FNUA 2AMGA 3UCCA 4UTUA 3CIXA 1IZJA 3W7MA 3TTSA 1LP6A 3SFWA 3MUY1 4CQCA 5ABGA 5BRBA 5FJUA 4UTWC 3B40A 1WCGA 2BGNE 2UY5A 2DJLA 4JX5A 2O9OA 5U7SA 3LRLA 1HX0A 4IL2A 2PDFA 4W88A 4LEFA 3NL5A 4Z42C 3EWZA 2WZIA 1J18A 3IK4A 3PUEA 6PTDA 3BCDA 1KXQA 1GOOA 3SW6A 3H8AA 5KMYA 4WJ8A 3AXKA 1M3UA 4NRRA 5I3KA 3AMCA 3BW3A 2WZHA 2YCEA 4ACZB 3A3WA 4JDBA 4C6NA 4H01A 4HMDA 1T40A 1PKMA 4MWAB 1LG1A 1UUOA 2ZZ1A 4JS3A 3SRFA 1GOXA 4UMBA 4XKYA 5A6KA 2QDHA 2A3HA 3AOFA 4W4QA 2QQ6A 1V6UA 2FPTA 1CB2A 4BFAA 3T0DA 5C7VA 4CNPA 2FIQA 3CPGA 3CT2A 3ZJKA 5J04A 3FEMA 3B8IA 3KWSA 1W9DM 1RK5A 2V69A 1E5NA 2RFGA 1OIMA 3GO2A 1VAHA 3VIKA 2GJXB 1SR9A 4MADA 1R7OA 4MGGA 2YCKX 3BMVA 3E02A 3SJNA 2CKRA 3R13A 4AUBA 1M01A 2MUCA 4B2DD 1R47A 1YXCA 2Q8ZA 4IPPA 2INZA 3D5HA 3NO3A 4H2CA 1BVZA 4TX6A 2XH2A 1E5JA 5BMXA 3WBWA 3A5VA 5KZ6A 3GVQA 1EKOA 4CQDA 2E0PA 3ZR5A 1J0HA 5EYWA 1IE7C 1HKWA 4I7WA 3H2MA 5T9CE 5F1VA 2W66A 5LZLA 1IEIA 3L4YA 1TV8A 2BVYA 5FJJA 1DEDA 1VIZA 4NZ1A 2EGZA 3B06A 1H5VA 2ZC1A 1KBKA 3DU0A 1TPVA 4YCOA 3MPGA 4A2SA 1Q5MA 1FX6A 3C3NA 1FP8A 3NPVA 3QOKA 5LNRA 3NIYA 1CXIA 4JY8A 4R9OA 2W92A 1NJJA 3LTYA 3GBEA 4H4IA 1MEIA 1UP2A 1OGSA 4JFUA 1KGUA 4D8ZA 4O8AA 5FD0A 2WJFA 4C6KA 3KAOA 3WFZA 2O4MA 4F0HA 1EH9A 2ACUA 1IEXA 2GJLA 3TDFA 1SZGA 2EAWA 1OK4A 4C60A 1YQ2A 2B0MA 1QOXA 1UROA 4RDVA 3M0IA 2JIEA 2QJGA 4J40A 1R3TA 4IPNB 1PJ9A 1EP3A 1ME9A 3MDWA 1PB0A 3F4WA 1JPHA 4B3LA 1TZ7A 1E6XM 1GOWA 1UIPA 2PWHA 4CD6A 2HEJA 1KWGA 1F7BA 3NXFA 3WDQA 4AHOA 2P10A 4O4VA 4Z1DA 1I9CB 2A3LA 3CGTA 4XD4A 4C6QA 4R5EA 1MQRA 5CG7A 3RAOA 1CGTA 3QC0A 4JTHA 3VDAA 5LIWX 3KTCA 3RU8X 2E5BA 3G77A 3NG3A 2FJUB 1VLWA 4WKFA 1S38A 3WZ0E 3PBVA 2CZEA 1GZGA 5HNUA 3SUTA 4RV8A 3HQ1A 1L2UA 3NGFA 3U9IA 3AHXA 2WJEA 2GVYA 2BB0A 4QISA 5ABFB 4AW7A 3RX4A 2I14A 1V08A 4A21A 1TIMA 1GWJA 3N4FA 4R53A 2BV9A 3KCLA 2GJPA 2FDMA 3UWWA 2FFIA 3KBWA 3WQ5A 3T4WA 2DFAA 1V3JA 3XINA 1CXKA 3A21A 1H11A 1M1BA 3FY1A 2PD5A 1VFFA 3PUOA 4ZB0A 2D2JA 4PE8A 2XGBA 3BV7A 3L4ZA 1TPB1 3L0GA 3MSGA 1DE5A 2HVNA 2HISA 4NJJA 1DL3A 3SUSA 2PLKA 2TAAA 3KDOA 2A85A 2XN1A 2ZX5A 3HZ3A 1H3GA 1DWHM 3OU8A 4WD0A 4M6PA 3PP7A 1P6CA 3WMSA 2BSLA 3CZJA 4XZLX 4NKCA 1Z48A 1JZ5A 2X7VA 2QW5A 3EOOA 2WSQA 5CBBA 2CZFA 1JCXA 2W6RA 4JQ3A 2D3NA 1WDQA 5A2BA 5GPRA 3K46A 1SJAA 2GQ9A 2FZ8A 5M3WA 4IGSA 1JRCA 2D3LA 2QDGA 3VZYA 3PANA 4DLMA 3WENA 1DIOA 1MXGA 4LUSA 1HL9A 1KGWA 5HWNA 3GIPA 1LOSA 4AH7A 3WQ8A 3P6LA 2YYTA 3CTLA 2ADAA 3W7CA 2FTWA 4XB3A 3PFRA 2RUSA 2QIWA 5K3VA 3LERA 5IFPA 5ABEA 2QJHA 1MNSA 1NDVA 4FB7A 3ME3A 1B54A 4UQ9A 1R3WA 3M0MA 5F4SA 1SZRA 3PM6A 2PDYA 2DSKA 1XP3A 5CC7A 2D2HA 3BJFA 3W29A 1YDVA 3LYEA 5IXEA 3S2CA 4GJJA 3BGAA 3QKZA 2QXWA 3VK5A 2Y8VA 4IIBA 1VFOA 3LUTA 4JKKA 4BKNA 2B7NA 4B5WA 1QPNA 1H41A 1GOIA 3AJXA 1E6RA 4NNAA 3KLKA 1ZENA 3R0UA 2F61A 4RW5A 2JALA 3GG1A 3SRKA 3C4UA 4OT7A 3KS5A 3V75A 2PEVA 3BLFA 3ARYA 3CL7A 4LUIA 3XIMA 2V2HA 1TKKA 4W5UA 3ZVHA 4OU1A 3LX9A 1PAMA 4DJDA 4NAEB 1BHGA 2HK0A 4DI9A 2G3JA 2ZTJA 1EC9A 1R87A 2VRJA 2ZUVA 3WYZA 3H12A 4IQEA 1Y5WA 4HKPA 2RGMA 4ZTXA 1QPRA 4NRSA 1H0IA 2D23A 3A5FA 2NV9A 4DZAA 1A5AA 2A79A 3B8UA 4K7YA 4C7GA 4M0XA 1WDRA 2MNRA 4PODA 4UR7A 2EG6A 3RPMA 3HFTA 4JNYA 4DBUA 4ZQRA 1U5JA 2J6VA 1W1TA 1YHTA 4KGJA 1JGMA 2E9MA 1TTPA 5K2ZA 4N4PA 3ANVA 4UFLA 2O4QA 2BVWA 3LI1A 1OYBA 3SR7A 4GZEA 3EPNA 3L2IA 3W24A 4R3UA 1UWRA 4EWND 4QDMA 3BAKA 1E9LA 3OZMA 5A6TC 2OU4A 4JCLA 1GQIA 4M1BA 1FHUA 3CWOX 1N82A 2V5LA 3AXHA 1KCXA 5T9BG 2PDWA 5I3FA 1TPEA 2WM0A 4YYCA 3P0WA 3IJ6A 3P3BA 1JZ7A 1XYBA 5BXRA 1R38A 3UESA 1W2VA 3BURA 1TFVA 2NQZA 4HHLA 4LVFA 4K8EA 5HNNA 1TUFA 3B97A 4A3QA 2W67A 1DWGM 3WY1A 4FMVA 1KM1A 2VFIA 3ZQ9A 1SFTA 4HSNA 4JN7A 2DIKA 5A6BD 2Y61A 4HYWA 3GW3A 3DH7A 1ZLPA 3GW0A 2VFGA 1Y5XA 4LV4A 5H8MA 1E1FA 2C14A 1ZALA 3GSMA 3PWIA 1R3SA 4WKHA 3UZXA 2AL1A 3N04A 1ZY9A 3QW3A 3TH6A 4O18A 3RR4A 1W5MA 3DFOA 4UTTA 2DSZA 2VZTA 2E1DA 4HYRA 2Z6JA 4FA3A 1VFUA 3BG3A 4KWWA 4JL1A 3P2VA 1TJ2A 3AROA 2AQWA 3W83A 5DCDA 3B9OA 3E5PA 3F4VA 2VKZG 4B3ZA 2NZLA 1ONWA 2XWDA 3A3XA 5DXXA 1YTEA 2PDHA 1XLJA 2CWNA 5A2AA 4G1NA 3N12A 5I03A 4IX2A 3AHZA 1SPQA 1IQ8A 3GFZA 1UWAA 3DFHA 3NXLA 1IV8A 3D0CA 2ZZ4A 4GNJA 2TSYA 1NF0A 2Y7FA 3I3BA 4YWSA 1VCGA 3T2QA 2G3MA 2EBNA 4ZTYA 1Q3NA 4JICA 1XC6A 3S9YA 3ZT6A 1G4PA 4N2YA 3SCWA 4O8RA 3V5OA 2XIOA 3TMLA 3EDEA 1WO2A 3DAQA 5CZKA 4RZ5A 3A9BA 2PDMA 2GWNA 1VC4A 4UXDA 3L2LA 2NVDA 3VYLA 4OUEA 8A3HA 4ACZA 3QEZA 2G3FA 1W1IE 1U1JA 3N9SA 4MWAA 6A3HA 2X16A 5AHEA 1H51A 4W93A 2V9DA 4IH3A 1YDYA 4GIAA 1I75A 5LA2A 3BH4A 2PP3A 3UY7A 5EGRA 6REQB 2QHAA 4HNNA 3TN4A 3V0TA 4M8UA 1EJRC 2QCMA 3TW9A 5KZDA 2ODOA 1HF6A 4ZE4A 1U83A 3BAXA 4RW3A 4PL1A 3P8JA 4D6CA 3NM1A 3ANUA 2PGWA 5FF4A 4Y9OA 2GJXA 2OLHA 3WJYA 2PF8A 2Z2AA 5CZ0A 3GX9A 5FIPA 1DYSA 2G41A 1BF2A 4D6HA 3W88A 1O5QA 3OGSA 3KRSA 2PSNA 3DHDA 4M7TA 4FP1A 1P7TB 1LWIA 4HA4A 4QLLA 4LOCA 1A4MA 4DUWA 1XLDA 3WJWA 4AY1A 1TWDA 2CHRA 3UZJA 3UVIA 2X2GA 3OIXA 2AAMA 2ZWYA 2IKIA 4MJMA 5B80A 4I6VA 3NQDA 1U1UA 3ONCA 5KTLA 1UBPC 4IFKB 2F6UA 5HATA 3FNDA 1V6WA 4J3SA 1E4NA 1TCDA 2DP3A 3EDJA 3BLIA 4JYEA 1UR2A 2H9AB 3OYXA 3REQB 1E9IA 3M0YA 2ZXAA 3U4FA 4OBSA 4LY8A 6ALDA 5K9DA 1YE4A 3ONBA 3CK5A 1RY8A 5CLWA 1B2YA 3OGRA 1ALDA 5ECUA 1ZHAA 3PVFA 2EXOA 1A5CA 1OJXA 4TIMA 2FTYA 3EB4A 2H90A 3H23A 3BARA 3NSNA 1UQZA 3L4XA 4U28A 4A3RA 3CIVA 3GKAA 1XQLA 5BOEA 2AQOA 2ZKMX 3URBA 3BK0A 1HO1A 1TA3B 5I24A 1NY1A 4FF7A 3QH2A 3PTDA 2VRKA 4AHPA 1KV5A 2ON3A 4PBFA 2PUZA 1TV5A 3GE7A 3SAZA 2HJPA 1EQCA 5AHNA 4MJ4A 3LHZA 4KQNA 2X30A 1QPQA 3NPWA 1U22A 5I3DA 1HJQA 2FQIA 5H91A 5E0CA 2GDUA 5AB3A 3FK4A 4P7QA 1VYPX 4HNCA 4I8YA 4Q6XA 1QNSA 4O1FA 1Q6RA 4D9PA 1L8NA 4EXBA 4LCRA 5CXPA 4QDPA 4I7VA 5EMLA 3T1GA 1Q85A 3KTSA 4K3ZA 4UFKA 1JIBA 3EWYA 3GNXA 3N3TA 4J2MA 1E6PA 1MSSA 3FJLA 5CZJA 3EA1A 2YBTA 4GQGA 3NDOA 3V1PA 8XIMA 2HTMA 4ZB5A 1WZAA 2B7PA 3DC0A 3IPWA 3O8AA 4XBJA 2V3DA 3H24A 3WNKA 4AG0A 4JR5A 1YNYA 4Y6GA 3WQOA 4IUOA 4NASA 4NIRA 3ZLHA 4DIAA 3TAKA 4AB4A 2A6LA 1R3QA 3KRUA 3NL3A 1OINA 3PJTA 3CH0A 1IF2A 1K03A 3GXFA 1EEPA 1LBLA 4NYYA 4DNHA 4XZMX 3G1SA 2Q6ZA 2Y7EA 5G1MA 3LBOA 4Z1YA 4E8DA 4KRZA 5DLCA 3SRHA 4MJ2A 2CLFA 3NDYA 3K13A 3L5MA 3P81A 4JEJA 2PF0A 2WVUA 3L5LA 3A47A 3NSXA 4J3ZA 3LCIA 3MCNA 1D9EA 1TV3A 4JL2A 1BSIA 2E09A 2YPIA 2QF7A 2YSWA 4UOZA 3N4EA 2QJIA 3C0LA 1L9WA 1VS1A 4QG8A 1XPGA 2ALDA 1BF6A 5E9XA 2E7FA 4H6RA 1EUNA 3O6CA 2OEKA 1E70M 3AXIA 3EKLA 4XO6A 2VOTA 3PZNA 1SGJA 1PE1A 5B7ZA 4A29A 3GR8A 4MDOA 3T6CA 3WLKX 4XK2A 1QATA 2JEPA 1TX0A 2GVLA 3VIHA 3VOIA 2YLAA 4I3GA 3N2MA 3AO0A 1VQTA 1OYAA 4PZVA 2V38A 4TVDA 1OSEA 1GOKA 3QBUA 4AD3A 5KZMA 1OFOA 2P3EA 3AIRA 4GCXA 3M1ZA 4RE3A 1JUEA 2C6QA 2PRLA 4MJZA 5LXXA 4V33A 4OIFA 5DT7A 4RPPA 4GQBA 4C1KA 2XVKA 2O55A 3N18A 3DFSA 3CPUA 3AHYA 1B3YA 3CHEA 2HXTA 3G3DA 4HMNA 2ZX9A 2BHUA 4H00A 1S39A 1GOMA 1I0BA 1ISYA 4DQWA 2X0SA 1NFBA 4HNTA 2OQYA 2VDHA 2WCAA 3ENLA 2ACRA 5HR6A 3BLLA 1ZL1A 3LCFA 2F84A 4U31A 4NAEA 1HJUA 3MV01 3TJLA 1A5MC 4Z2JA 3MHFA 4UTJA 3MB9A 5KEZA 3WN6A 2CERA 1IEQA 3IVSA 3TOYA 5DO8A 2PZNA 1FWAC 1KKRA 4GI4A 3Q67A 1M7PA 5G4HC 3LGEA 4PC8A 2C19A 3W7RA 2FTPA 5HMFA 4E6MA 1UR9A 5HQEA 4QJ5B 4H7CA 2AOSA 2RDTA 5BZAA 3EDFA 1S3HA 4NI8A 5K9XA 3W9ZA 4UR9A 1OX4B 3KP1A 1KW1A 4OVXA 6CGTA 4QRNA 2OT1A 2J7GA 4G7EB 3ABZA 2YYUA 1CCWB 1GVYA 3V5CA 4ACYA 1H50A 4L80A 3AYTA 4HK7A 3QSRA 1EFZA 2OYMA 4TR9A 5HMEA 3CC1A 2E6YA 2E6FA 4WCJA 1A5KC 3PZIA 1KV8A 2BNJA 4I9MA 4FALA 1QJWA 5F4XA 1SYTA 1TCMA 5LIYX 2QT3A 4S3AA 7CGTA 4O15A 1X38A 2PDIA 1S1RA 1XLFA 4I90A 4WVXA 2DSUA 3CHDA 3U2CA 4I9TA 2WMHA 3K4WA 4AVOA 3GTHA 1NFPA 1A0CA 3CZ8A 4JHOA 3B8SA 3B4UA 2EPOA 4XAYA 2OKOA 4GY0A 1A47A 1OYCA 2FZMA 3FA3A 5AHFA 4O0KA 3MC5A 5FEPA 4XVDA 3T05A 1GG0A 4C65A 1OFDA 1POJA 2XHYA 2INEA 4G8TA 3MQTA 3JUGA 2WV8A 2V81A 2FDSA 3EEGA 1I8JA 2ACQA 2XH4A 2EF9A 4H9ZA 3SGZA 3PNZA 4QXIA 4GFSA 4HA1A 2YXOA 3TSMA 1VRDA 3F5JA 4B2DA 3UERA 2G50A 4EPEC 4QP0A 3LCGA 3GHTA 4Z1AA 1UMYA 3UR8A 3M7WA 4Q4QA 4ES4A 5IFTA 4GVHA 2VURA 3M16A 4R88A 2QMJA 4KGLA 1I2PA 1E56A 4ZFCA 2ISDA 2DZVA 3C2VA 3WQPA 4HU0A 1TPFA 2VELA 4EKJA 3PUDA 3TYEA 1SW3A 3MO7A 3UP8A 3FYYA 1JPDX 1YPFA 2CLHA 4IPIA 2YBVA 1MRQA 4JTTA 1TWWA 5A3HA 4PYSA 4OOZA 2HBXA 4A22A 2NT1A 1ODZA 2YA1A 4DHGA 3TNBA 1Q13A 2V2DA 1UC5A 3BW4A 3DKJA 4GINA 4Q8NA 4Q22A 4M5PA 1EBGA 3SUWA 1HN1A 1IHIA 3MUAA 2NVAA 3FJ6A 4FXFA 3VC5A 3MWAA 3HMCA 4Q6JA 4HCHA 3GB6A 2XZ7A 1FWGC 3RJYA 3SQMA 5JXQA 3E2QA 5CSUA 3LS9A 3ARQA 1MZRA 3GK0A 2OO0A 4RDWA 1DQUA 3MKKA 3TQVA 3EWDA 2DZWA 2PTYA 4JTAA 1JPMA 2A3EA 2DZBA 3ATZA 4ZFMA 3TLQA 2V2CA 4PMXA 6REQA 3VGGA 5PTDA 4DNMA 5EFFA 3O0FA 3FKKA 3MY9A 5DY3A 1UD4A 3OPSA 2ZE3A 4A8IA 1PKNA 2D0GA 3URAA 2V30A 5E5CA 3UR5A 2V0TA 1UR8A 3WF2A 3CHVA 1XSKA 4QSFA 3BWWA 4AC7C 3HGJA 3FXGA 4C6DA 2QJMA 4X9YA 3DGRA 1FXQA 3W2MA 4L1WA 3AIUA 1RBOB 4FI4A 1UP3A 3S1XA 2ZUUA 3W38A 1U33A 3BLDA 4K8HA 4WGXA 5E6YA 1P7TA 4DAIA 1LORA 2Z24A 3W74A 2E77A 4ZQNA 2J7EA 1E55A 1BXCA 2BWGA 3GNNA 5I3JA 2X0YA 2Z1KA 4S3DA 3W7OA 5M03A 1KR1A 4XWUA 4PTMA 2Q09A 3B05A 4IFKA 2E4TA 2VJXA 3ECQA 1A5OC 2I5QA 4RE0A 2NXHA 2C79A 2H9AA 1W9VA 4H3DA 2GWGA 1SSGA 3RYSA 3G1HA 1BWVA 2EPLX 5A6SA 3B8VA 1ZJAA 3SM0A 2RHGA 1IIHA 2QCDB 1XLMA 2C16A 4OOUA 4DBWA 3QLDA 1LBFA 5XINA 1TO3A 1AG1O 4CLMA 4A05A 3W7LA 4B15A 4XAFA 4IJBA 4LYPA 1TA3A 1J9YA 3EGJA 3LA4A 3DHFA 3S4TA 1Q2RA 3R2GA 1UZ1A 1KNWA 2PCQA 1DWJM 1TMLA 3NDZA 4JTJA 4HU8A 1F74A 2GQ3A 1DBTA 3LLDA 4QNWA 4J3XA 4QR6A 3TC7A 2YB1A 3ZT5A 4REQB 4OHQA 3B0PA 6ENLA 5CSRA 5JUVA 3QN3A 3UG8A 2ONEA 4JTIA 3SECA 3GVGA 1R6WA 2Y5EA 3FEQA 3NPUA 3QPEA 1ZPTA 2C15A 3STEA 2X05A 3VI2A 4GUHA 2NQLA 3GDTA 1OWQA 2Z7GA 1HKKA 1MWOA 1HJXA 2QCCA 2EHHA 1V0NA 4K8GA 4HZ8A 5IBXC 3EOUA 4ZE5A 3WNLA 2IXVA 1RA5A 3AIVA 1CYGA 1V93A 2KX9A 1FH9A 1HFBA 2CLOA 3K4DA 2FLIA 4PSPA 4HIBA 1E9ZB 5B7YA 1T8XA 5GJMA 3ABQA 5CPNA 4W8BA 6TIMA 2GGHA 4OJYA 1EGVA 4FX6M 4NHVA 5I2UA 3S1WA 5EL1A 4O14A 3CASA 3EXRA 4NJGA 4WF7A 3T8QA 1BRLB 3PPFA 1BWKA 4GZIA 3DBPA 3PWAA 3N17A 2J88A 3WQVA 4LUJA 4PR4A 4HNUA 2OOGA 1UPMB 2IPFA 4IXHA 1UIOA 4W89A 4N42A 1EGMA 4MPQA 1LLZA 1EZWA 2R1KA 3IS4A 2PDXA 3FXYA 1DHKA 1UUQA 2DZUA 3FHAA 5D09A 4MWAE 3PG8A 5D9PA 3TTOA 2GPTA 4PRRA 2JQXA 4GA8A 4FOUA 1H63A 2ZRYA 1J79A 1RV8A 1M68A 3B8DA 2FPYA 1LCOA 3A4WA 4MY9A 2ZZ3A 4MKNA 5C0QA 3AC0A 1UZDA 1JQVA 3L7RA 1MW3A 2AGKA 4AZCB 1EC8A 1JF5A 2PPGA 4GUFA 3UWUA 2VOMA 3N4AA 3TIMA 3HPZA 3BPWA 1XRFA 2KAUC 2W0UA 1PIFA 2I17A 4LAMA 1GVIA 3UU0A 1W3HA 3HPXA 1RAKA 1I45A 3R25A 3PJXA 5FAGA 2F9RA 4NJHA 1AD1A 3GXMA 4L1XA 3PPCA 3AIWA 3TTQA 3RG6A 3O15A 1EDGA 2EO7A 3MBFA 3VM7A 4GX8A 4AC1X 3VM5A 3LGDA 2DEPA 1Q8JA 3UBPC 4UCFA 4GRSA 2XINA 1XKYA 1ELSA 5JBDA 1XS2A 3O9NA 3GH4A 3N6HA 6XIMA 1TJPA 2R24A 4C91A 1RH9A 3PULA 3MMUA 4ZODA 5D2TA 1VR6A 3LQLA 4GXMA 5A6BA 4AX6A 2O9TA 4FXRA 4NP7A 2OWCA 4OWGA 1VFTA 1TMHA 3VINA 2YL9A 3N15A 2XM2A 5A8MA 2WZEA 2XGIA 4DZ5A 4H6QA 1RQEA 3USZA 1C92A 1AD4A 2R14A 1OIFA 4LBSA 4MPKA 1Z41A 4FR6A 3SGUA 4IUGA 1B4KA 1S5WA 2P1FA 1G6CA 5D8ZA 2VX5A 1DXIA 6XIAA 3IGXA 1FBAA 3T9PA 5FF7A 2ZOXA 3I6EA 4CU6A 1Q2SA 4PGLA 3SFKA 1PX8A 3ELFA 4GVFA 1JJKA 4MFDA 4CCZA 1E43A 5GVJA 5K9CA 2A3BA 3CUZA 3WIJA 4UQEA 1OX4A 3UWQA 3WLQA 3CV2A 2QGHA 4G7EA 2HPIA 3WK2A 2DORA 4O1BA 4MZ8A 1Z42A 3WNOA 1VEPA 4FLSA 2OZTA 2RJGA 3R12A 1H49A 4HA3A 4V1YA 4O52A 4WKAA 3KUMA 3M07A 4YYFA 1M7XA 4DJEC 2ISWA 2J78A 2QAFA 3C5QA 1KM3A 4DX3A 4HZ7A 4K7VA 3MP3A 1JVNA 1OADA 4NNBA 4EAYA 1WYIA 1LLOA 1PV8A 1RQBA 2WO5A 3FIGA 1Q7MA 3V0SA 4GNKB 4IM4A 2Q02A 4HTYA 2DGAA 3VFCA 3WNPA 1JZ2A 4NZFA 4ONVA 3R89A 5GNZA 4WDWA 5FJOA 4UCGA 3CWNA 2VEMA 2VNCA 4LB3A 1SZNA 3WQ4A 1PZ3A 4EPDC 4IWWA 3P14A 1WP6A 5D2YA 1YXDA 3G1DA 3CIWA 3G3MA 4E3TA 1SW0A 1ZJHA 2PDUA 1EJUC 1QBAA 4DJFD 1W32A 2QDDA 1ONRA 4QFUA 4NF7A 3QYQA 3EPOA 3BQ6A 1JDCA 2C1GA 3PZUA 3VNIA 3GZ3A 1AVAA 5KINA 1P1XA 3UJEA 4AWTA 1CLXA 1THFD 1JYNA 4XKMA 2YW4A 1TPUA 4RUBA 3TN6A 3E0VA 2VL4A 3AJ7A 2Q71A 1S5TA 4A6GA 4F3HA 3PSVA 4H1ZA 4D72A 1PL9A 2DH2A 3WMLA 3GDMA 1R3VA 2OZ3A 3VPLA 3GTIA 3WJXA 3VD3A 4GG9A 4U2ZA 3WQWA 4BK9A 1EOMA 2ATMA 1SSDA 4M6UA 5G5IA 5HNTA 3BCFA 5CEWA 4C6BA 3R1ZA 5H6HA 4PRTA 3ZM8A 4HPHA 3BLEA 3JVAA 3W81A 3INPA 3K4AA 3P5ZA 3Q94A 1DXEA 2AQVA 1XDJA 2QGYA 1OM0A 3DYOA 1PKYA 3WX7A 2BMBA 4AEFA 2J24A 3NO1A 5LGZA 4GACA 1OFAA 4B90A 3GR4A 4YVVA 3HN3A 1UR0A 3LCHA 4P5UA 2R1PA 1QUMA 1IWBA 5A69A 1GVQA 4KWSA 5CJNA 2ISVA 3LXBA 3LOTA 1QO5A 3DZ1A 1JPKA 3WBAA 1BWLA 4R27A 4Y96A 1L2QA 1HT6A 1X39A 1HZYA 1LG2A 3PBYA 1UJPA 4M56A 2QAPA 4NJIA 4PCPA 4IZGA 5E09A 2IXUA 4ERIA 3NYZA 4J28A 2GSHA 3SADA 1IWAA 2H3DA 1KXHA 1VYRA 1G0CA 3HPAA 3UPWA 2DPEA 1S2TA 2VHLA 4ZSTA 4CU7A 2C0HA 2ZZ7A 2D0HA 4PFHA 3KBNA 5I0DA 3VKCA 3WD3A 1D3CA 1GT8A 1ADOA 3GU9A 4JFTA 5CC5A 1FFRA 2G96A 3W7EA 1LZOA 4XBKA 2EPNA 3BSHA 3CPRA 1EX1A 3BLOA 4JYDA 1NH6A 3VDCA 1AJ2A 2PAJA 2OX4A 5FESA 5E9AA 3UGRA 2QCDA 4LF2A 4GJ1A 3CAQA 3FDKA 3TQKA 1KLYA 4HNOA 5L9FA 2PDQA 3I6TA 4FNRA 3A64A 4YWIA 3KS6A 4U5IA 1E0WA 2Q8LA 2XVGA 1W3JA 2VD8A 1E71M 5C2GA 2IQTA 1BXBA 3RLVA 3PB2A 1K7EA 3SQSA 1XLLA 3SSJA 1CEOA 1M41A 1XQKA 1Y5VA 1BTMA 3UYCA 3UXKA 4U10A 1BAGA 1UBSA 3I6RA 2PDNA 5AVHA 4IQDA 4E2OA 4REQA 3QV6A 2GUBA 2ATSA 2DY3A 1XG4A 1E4IA 3WKZA 1EF3A 4KF1A 2DQWA 1DJQA 4ZVJA 4RZBA 1JUBA 1Q63A 5A8GA 4Q8QA 1EJTC 4S23A 2Y8KA 1L6GA 1TELA 3E2SA 4IPLA 2XWEA 2OEJA 1GW9A 2J47A 1YX1A 1ZQ5A 2ZRVA 3POHA 5A5WA 4F8XA 4QDWA 4F2TA 7REQB 4XD6A 2CLMA 5AHMA 4EE9A 4V1XA 1G5AA 4JHZA 5C9ZA 4CNTA 1KB3A 2D69A 2P8BA 5TD4A 2FMNA 3IJ9A 1E73M 4DPPA 1KM6A 2H6RA 3CUXA 3RDKA 4HK5A 5BRPA 2FHCA 3CV1A 4QM1A 1RXOB 1X1ZA 3RGTA 1CT5A 4KRTA 4YTTA 1W91A 2CW6A 2YX0A 4V27A 3WJZA 1BRLA 1F4AA 3NZGA 3VAVA 3M6YA 3DHUA 3GY1A 2XSBA 2JGYA 3LD5A 3LZ3A 3CS2A 3OZOA 1UD3A 1DJGA 4QCEA 4QROA 2BASA 2DT2A 5HMSA 1S2WA 2WMIB 4LVAA 4S3FA 4EANA 2Z4GA 1E4LA 3THCA 3SCUA 3SO7A 3GG7A 1ZAHA 3S9ZA 4KEMA 3DESA 1XLIA 3CU2A 3D3FA 4P7LA 5DCBA 2C1IA 1V4YA 1UA7A 5F4WA 1GQNA 3EMQA 4B4HA 2BLEA 1QNPA 3ZS4A 4TVUA 4FLRA 5CSSA 3S6TA 4ML9A 3R4IA 4GO9A 3LB0A 4AZCA 1RHCA 3UQNA 4H2HA 2F7FA 1GVSA 3WUFA 4UIOA 2C91A 1X6UA 3W4RA 1NWTA 4D6DA 3QPYA 3E12A 2WPGA 3N6QA 1LRQA 2NLYA 1FHLA 3GBDA 2WK2A 2Y5SA 1F8MA 3Q2DA 1XIDA 1R2RA 5A94A 3HM7A 1YMYA 1XYLA 2QCGA 1VJSA 5I77A 5I07A 2C1HA 1I2OA 1ME7A 4DN1A 2PP0A 1J12A 4R34A 4IIEA 1O60A 4GIRA 5LNUA 1Q8AA 3STPA 1GUVA 3SDOA 4ML4A 3M47A 1FWHC 2FYMA 3HV9A 2ZC8A 3LM3A 5CQ1A 3UEQA 3MANA 3LPGA 1V03A 3M6DA 3G24A 2WNNA 1MRAA 2VEKA 4NVTA 4UTHA 4YJ5A 4W7VA 5H8PA 3M5ZA 2QVNA 5H2ZA 4O13A 2X09A 2QKFA 3H7VA 4YTUA 1EWDA 1Q4NX 2C3ZA 5AHIA 3AYVA 2ABBA 4NI3A 1JL8A 4Y9AA 5EMJA 3P82A 5I7GA 1R9ZA 4US5D 4HNLA 1LBMA 4ZOBA 3IUDA 3S2JA 1W31A 3AU2A 3MUCA 4E2DA 2PWUA 2Y24A 3BOXA 1FHVA 3UWEA 2Y7DA 1N8FA 2HBVA 4QSHA 2J8GA 1ZZMA 2NXGA 4BJHA 3WNNA 3QVQA 1JXJA 1H0GA 1R30A 3QV9A 3ITTA 3T7VA 1LQ0A 1VCVA 5CJ5A 1LDCA 4XO7A 4K37A 5IHRA 2X7WA 1XSJA 1ZJBA 4U3CA 5EPDA 1Q45A 4DEFA 3KZSA 4CNSA 1EP2A 4A8NA 3M4HA 4YVXA 3O63A 5AYXA 4GC3A 1TVLA 1BGGA 4HCDA 4PMYA 3ZJ8A 1EUAA 4QE4A 3C0SA 3OVQA 1SJBA 2ZRUA 4E38A 1A5SA 1TV4A 2VDGA 2FH6A 2VFHA 2Y63A 3BZJA 4M1RA 4PMUA 1IR1A 1K3UA 2JIWA 2XM1A 1TQJA 3CMGA 1WZMA 1D2KA 2V68A 4QGCA 4JIIX 5LA0A 4FAMA 3K8MA 1X1OA 1F76A 1UZHA 1G4EA 4LH8A 1GKPA 2Z26A 3GLCA 1JNDA 1JD7A 1CWYA 2EKCA 3M43A 2F6KA 5DRCA 3KWXA 1QNQA 3VKKA 4MM1A 1O12A 4L9YA 2CPUA 3UCDA 1W3IA 3W1MA 3P61A 4NQ1A 2GGJA 4G5DA 4ZO7A 2Y8UA 5HK4A 5AYBA 3WK0A 3CEPA 2ZUTA 3A22A 5FEZA 1LT7A 4WQ6A 3T78A 1W9UA 2ZCGA 3S47A 1RD5A 1RBLA 3PZ9A 3TXVA 3OODA 3GVWA 4FLOA 3AMGA 4UQAA 2VFFA 2JKPA 2PU1A 5I3HA 2PD9A 1FXPA 1DXFA 1O1ZA 3LNMA 4MF4A 1AODA 4YPJA 2YKKA 3U7VA 3JZEA 4W8LA 5G4EA 4HZ6A 3S2MA 4XZBA 1Z6KA 3F1QA 4AWUA 1XUUA 5F2MA 2YDQA 4HTBA 3G18A 3A9IA 4AZBA 3W1UA 5LHFA 1VHNA 1CBGA 3J7HA 3VMNA 1AH3A 3FN9A 2ZUMA 1HVXA 4D8AA 2BS9A 3TFCA 3VU2A 4CVUA 2Z2BA 1GTHA 1R2SA 2WSPA 5DELA 1HJSA 1OX5A 3T4CA 3M9YA 3AS0A 7ODCA 4LT9A 3EEZA 1DORA 4S3KA 1RCQA 4IL0A 4Q8PA 2Z1SA 1KM0A 4PTXA 1ZUAX 2CU0A 4FX7A 3S2NA 3HA1A 3QF0A 2W91A 1KM2A 1Q6EA 5T91A 3ZLFA 1AA1B 1HL8A 3F5KA 2HCVA 3IUHA 2VEPA 2GDVA 1US2A 2HV5A 4H7VA 1FQ0A 1KWKA 2FGZA 4D6EA 2Y2WA 2X1TA 5HR7A 1OB0A 3QHOA 3WLPA 4DJDC 4X60A 2R9RA 2NVCA 3WD2A 1C3FA 2VGGA 3G2GA 2DH3A 2VXNA 4EK7A 1NOWA 4E0CA 3M0HA 4LXFA 4ATWA 1DTNA 1U30A 4HJFA 4DJEA 3W75A 1RPXA 1E4MM 1D3GA 1XRSA 2VM8A 3VGDA 2WSKA 3GNDA 1OVDA 2VWTA 4JIHA 1LUCB 1UJQA 1C29A 1ADDA 1N7KA 3RMJA 3CBWA 2OOFA 4TO8A 3OA5A 1UD5A 1CXHA 1V8EA 3W22A 3CHFA 1V0LA 1Q4WA 4GO8A 1KFWA 3PBUA 2E28A 2Z29A 2WNWA 3MTWA 1K7FA 3ZOAA 1PYFA 2J8FA 1AW1A 1XCWA 1O5KA 4JHMA 3VVGA 4GYFA 4JTGA 1GJPA 2D0FA 4J1OA 4YTSA 1SR0A 1UUMA 1VP5A 2V8ZA 2DU2A 4B91A 2DZSA 1VBJA 3KVLA 3T2PA 1ITXA 3QMSA 1VIWA 3EKZA 2GUUA 1UKTA 1O6IA 4Y2WA 4BF5A 3KCOA 4WXYA 4DYEA 1QNOA 5DF0A 3SY5A 1GVEA 3STFA 4H9YA 3CWHA 1SO5A 2CXGA 3L65A 3VIPA 3VD9A 2HK1A 4YS1A 1XDMA 1JEZA 2OGYA 4KS0A 5DBTA 4M24A 4C90A 3VIGA 4HVXA 3TTEA 2PS2A 2PLJA 4ZO8A 3ZR6A 4S3JA 1QAPA 3GDKA 1T96A 4GI9A 2YA0A 5AZ0A 3S8HA 4Q4OA 4EOUA 2CETA 3QM3A 4CQ9A 2AGTA 1AW5A 4UTTC 1LL7A 3L9CA 2I57A 1L6FA 5REQB 1RY0A 3LEPA 3WH9A 1OFEA 5FSEC 1UH4A 4CNNA 1RVGA 4GI8A 3POCA 3RUBL 3U0HA 1IT0A 4BQ3A 4PMOA 1V3LA 3MKCA 3OO2A 1QI4A 3B4YA 4QBXA 5CGQA 1LOQA 3P74A 4KCUA 3JW7A 3DCPA 4XAZA 4F79A 1NM9A 1YDNA 4EF9A 2HRWA 3BE7A 4C1NB 3I7SA 1T5AA 1RLCL 1J5SA 2CITA 2F2HA 5CSYA 4G9PA 4HJWA 1BKSA 1R9YA 4O10A 3NO5A 1MUMA 4AZIA 2FFCA 2NWSA 3HPFA 4WUIA 1OQFA 2NX3A 4A3UA 2VGFA 2Y0FA 3QGAC 3PUGA 2KZHA 3UJFA 1UG6A 3DDMA 1J0YA 3QW4B 7REQA 3W27A 4D2JA 3CL8A 4JTDA 1S2AA 3ALGA 2ABAA 1TQXA 4K38A 3QJAA 1DJNA 4MWAC 4L9ZA 1JPIA 3IJDA 4XAGA 1A3XA 3VNJA 5FACA 1VZWA 4OBTA 4Q8UA 2BOFX 3WQFA 3TSDA 4Q3MA 2XTKA 4OGZA 4IXXA 5AYZA 2HPMA 4IISA 1IZKA 3I4EA 4TVCA 1SQ7A 3AWOA 1M7JA 1ML1A 4F2UA 1K8CA 4KCWA 4X0VA 3WQEA 1XGDA 5CAHA 3N1AA 1OFPA 2GLKA 3APTA 1CGXA 3K8LA 4CCEA 1WZLA 4JTUA 4L64A 3HGSA 1V02A 4LNCA 5CH9A 4OE7A 1H7XA 1JZ4A 2YCIX 1Q7ZA 2WMIA 3KRBA 2A3AA 3KXQA 5I6SA 4IIGA 3ATYA 4PTVA 3K8KA 4TUFA 3VKAA 2CIPA 1W0MA 2D2OA 5A6MA 3VX0A 4BCEA 3U2ZA 2G8ZA 2JFEX 3DFPA 4AAJA 3OOQA 1ESWA 1R85A 3SEPA 3MYPA 1XH0A 3BLKA 2GGGA 3VNLA 3H54A 3DEQA 2XH0A 2E9LA 2C8NA 3HGRA 5FF2A 4BHYA 2RJHA 4UQDA 1V79A 1YYAA 2JE8A 4RXGA 3M0LA 1A80A 1WPCA 1EPXA 4HD5A 4UNKA 4PTDA 1VD6A 2YZRA 4FNQA 4JTEA 5HA7A 3GS6A 1W2PA 1WQ5A 3H7UA 4C5YA 1FDZA 4NYUA 3TMQA 3FJ4A 2AL2B 4RNIA 1W3KA 5EMYA 2Z27A 1CNVA 1QI5A 3W07A 3QZ6A 2V3GA 4MYXA 1R8LA 3GR7A 2PWFA 4ADUA 1YRRA 1JYVA 4C7FA 1UA3A 1L0PA 2J27A 2Z1WA 1RZMA 1LWHA 4CD5A 4RNFA 5A8OA 1JZ8A 4URIA 5BW6A 1H09A 1KBIA 1S2UA 1FWSA 1E15A 5LIUX 1UCWA 4AX7A 2IKGA 2V63A 1EA9C 3OLIA 3NYDA 4B5TA 3KVKA 4IF2A 4GCAA 4KETA 1V7AA 5CZTA 4UC5A 4ASTA 3FX4A 4EXQA 4AHQA 1O5RA 1SM9A 4GE8A 2ZX8A 4PBGA 4DJFA 3HJZA 5ENLA 2NWRA 1ZBCA 3OB8A 3P80A 4YN5A 4GPNA 2HS8A 5D37A 3ZZ1A 1OY0A 1KTCA 3TP4A 1CW2A 1A3HA 2JF7A 2OB3A 3P0XA 1IYXA 2A6NA 3PNUA 3VUPA 4BWLC 1W54A 3GC5A 3AIQA 3FGCB 4OFCA 1ICQA 2PLMA 1XFCA 4FS9A 4H83A 4QTGA 5EMMA 3HGOA 4V2XA 4TMCA 2CNCA 1N8WA 2DV0A 2FGBA 1V3IA 2RH9A 1KM5A 5EA9A 3M41A 3GWQA 3LMZA 3QC3A 3KX6A 3W7GA 3FA4A 2EQDA 1L6WA 5U4NA 1G94A 2AKMA 2F6XA 1XBVA 3UG3A 3PTKA 2YDAA 1W5QA 4HSHA 4BY3A 4C6EA 2VC9A 3EMZA 5CLTA 4AMCA 1N8IA 2ESCA 4DBSA 1OCNA 3CT7A 1PX4A 2DIJA 4F2BA 2OJPA 5IDIA 1NSJA 4AVFA 1NIUA 1T0OA 4CNOA 3WBYA 2IW0A 2UZ9A 4JQ2A 4GHRA 1QFEA 2HS6A 1GPWA 3F4NA 2CWXA 1K9FA 3FYOA 5BMWA 3AFBA 4IOTA 3NQBA 2Z6IA 2NUYA 3OGVA 2CC0A 2J9XA 1K8YA 4TXEA 4N6FA 1LJYA 1EO5A 2QLYA 4LYQA 4HNVA 4M51A 5JMUA 4N9DA 1NDYA 1PTDA 4V28A 2J8TA 3NOEA 4CQAA 5AECA 4HN4A 2AAAA 2OFJA 1OEPA 3TUUA 1W3NA 3FYPA 2J6XA 3MJYA 4D1IA 1FDJA 4L9XA 1TZ9A 5HBFA 1Y65A 1J0KA 4DWSD 1E6ZA 3DBNA 4ZOAA 4INFA 4KEZA 4AZHA 1X6LA 2GOKA 3M64A 4DO5A 1UMLA 1WA3A 3MMTA 1DJWA 3ARTA 4LW7A 3F2CA 1PZ2A 1PX3A 2FGLA 3TN3A 1WNOA 3SB0A 3HFYA 4CUCA 2ZZ2A 1WXYA 3B8TA 3GDRA 3AYRA 1SFJA 5LYRA 4K6AA 1JCNA 1JYXA 3SQLA 2Q01A 2EPMX 2GVGA 4W84A 1TJRA 2HNHA 4NSBA 4S3BA 4YIWA 5C8BB 3R0KA 4CGTA 5I00A 3A3HA 2A7NA 2DVXA 4GOAA 1B90A 1XC4A 4YVPA 5K7JA 4X3ZA 3WL1A 3WF3A 5EKYA 5CPOA 3OG3A 3ZMRA 1CTNA 3BANA 3FJNA 4JOMA 5FOOA 5JH1A 4I5UA 3G1XA 3WFLA 2XJ7A 4FK9A 3MI3A 3S5SA 2WLYA 2GSEA 2QCFA 2WVVA 5GNXA 1W1B1 1H2JA 2E8ZA 4E5TA 1Z69A 2GJRA 4DPQA 1L6YA 3WUEA 3AHTA 4FPSA 2EJ1A 3DN5A 1J6PA 1S5VA 4QLJA 1HQTA 3ZJ7A 3UXAA 3O2LA 3RPDA 1V3HA 4B92A 4AXNA 4LS0A 3KHJA 3GG8A 3GQYA 3NGJA 2EG7A 2PGRA 1Q6LA 5FF0A 4JKMA 1A0EA 5MHBA 4P8UA 1S3TC 4DO4A 3WQGA 1V77A 5CZSA 3OVPA 2DUAA 2EG8A 3TX9A 5AHLA 1FWIC 5D2VA 2WYSA 4OBRA 1LQAA 3C61A 2XG9A 3PAOA 4WEVX 3LHVA 3S1VA 3VZZA 4QJ4B 1ZBVA 4M3PA 5BU9A 1FWEC 3GHSA 4P2VA 1ZP3A 3CJPA 2Z1BA 1NF7A 3QY6A 1A49A 3V18A 4GYKA 3WLIA 2O7SA 1Q6DA 2WWDA 2YW3A 2OVLA 1RQHA 1CX9A 1I2NA 1VB9A 2WMGA 1TMQA 3V7PA 4ADTA 4H7ZA 2UV8G 1N55A 3LDVA 3GDLA 3CM4A 3UA4A 4WZHA 2PC8A 3M0KA 1V6YA 4L6HA 2L5HA 3EXTA 4S2CA 4RLIA 2WWCA 5AY7A 3PZOA 3LXCA 2PC4A 1EX5A 3W0KA 3QGVA 3NZ1A 4O1EA 5FEWA 4WGHA 1BKHA 1F4HA 2XFFA 4H8UA 4X2RA 3YPIA 4A4AA 2VMFA 3L2MA 4KKXA 4KCVA 1K8ZA 4IG2B 4UZSA 4XTDA 5HNRA 2WQPA 1WX0A 3FDGA 3WG6A 2BHZA 1JAKA 5DT5A 5REQA 3WEOA 4LCQA 3R8GA 3TZNA 3HIJA 3WMCA 2GDQA 2OT0A 4S38A 1JZ6A 1TPC1 3NA8A 1WKYA 5HWJA 3L67A 1ONXA 1XH2A 1TIWA 5CPSA 3TW7A 3NQCA 3F4DA 2RKXA 3UETA 2E3ZA 2QPSA 3A4AA 1J6OA 4ZA0A 3GTNA 1Z89A 3UPMA 1DWAM 2ASHA 1XD0A 3CB3A 3W00A 2BG5A 3PR2A 2LLEA 3CUIA 3ITYA 4C1NA 1WOAA 1ZAIA 4PUWA 1GPFA 1XISA 5K4ZA 3R0DA 4Q33A 1BG9A 3DHPA 4R85A