4LY4A

Crystal structure of peptidoglycan deacetylase (hp0310) with zinc from helicobacter pylori
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
290
structure length
290
Chain Sequence
AKEILVAYGVDIDAVAGWLGSYGGEDSPDDISRGLFAGEVGIPRLLKLFKKYHLPATWFVPGHSIETFPEQMKMIVDAGHEVGAHGYSHENPIAMSTKQEEDVLLKSVELIKDLTGKAPTGYVAPWWEFSNITNELLLKHGFKYDHSLMHNDFTPYYVRVGDSWSKIDYSLEAKDWMKPLIRGVETNLVEIPANWYLDDLPPMMFIKKSPNSFGFVSPRDIGQMWIDQFDWVYREMDYAVFSMTIHPDVSARPQVLLMHEKIIEHINKHEGVRWVTFNEIADDFLKRNPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords peptidoglycan deacetylase
publication title Characterization of the divalent metal binding site of bacterial polysaccharide deacetylase using crystallography and quantum chemical calculations.
pubmed doi rcsb
source organism Helicobacter pylori
total genus 95
structure length 290
sequence length 290
chains with identical sequence B, C, D
ec nomenclature ec 3.1.1.72: Acetylxylan esterase.
pdb deposition date 2013-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01522 Polysacc_deac_1 Polysaccharide deacetylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.370 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase/deacetylase 4ly4A00
3CL8A 2VYOA 1Z7AA 4NYYA 4NYUA 3WX7A 2Y8UA 2C1IA 3CL7A 4NZ1A 4NZ4A 5JMUA 4F9DA 2C79A 4NY2A 1V6TA 2IW0A 4V33A 2XU2A 4F9JA 2QV5A 1W1B1 4M1BA 4OUIA 1W17A 2C71A 4NZ3A 5BU6A 2W3ZA 3RXZA 2C1GA 4LY4A 2DFAA 4WCJA 2I5IA 2CC0A 3QBUA 2NLYA 4NZ5A 2J13A 3VUSA 2E67A 4HD5A 3HFTA 1XW8A 3CL6A 4U10A 4L1GA 1W1A1 3S6OA 1NY1A
chains in the Genus database with same CATH superfamily
1MW1A 1TR1A 1PZ3A 1EHAA 5I3JA 1KM0A 3EX2A 4REQB 2DVXA 1U2YA 2RKXA 4XIMA 4NNBA 2R24A 3GHSA 4AY1A 1M65A 1B0IA 1X6NA 4WUIA 1JQXA 4N9DA 2DVUA 2PCEA 3LD5A 1ONEA 4WDTA 3CIXA 1WUEA 3FJLA 3USBA 2PTYA 1FCQA 3IJQA 3EMZA 5CZSA 2WMJA 1ESWA 3PNUA 4R88A 2JALA 5JBDA 4AQLA 4MPQA 4HU8A 4V1XA 3M0JA 5KEZA 1EWEA 1NDYA 4UMAA 4LPCA 1JPMA 1FP8A 3CV7A 5EMMA 2R82A 1HNYA 1SPQA 2OLHA 1GQNA 5K4XA 1P6WA 2OOFA 2IKJA 2VFEA 4MFDA 3WJWA 2JF6A 3ZSSA 1W3KA 4Q7IA 1UCWA 2WQDA 2VOMA 4HCHA 1VGAA 3W7GA 1SZEA 3HG3A 3AIEA 1RUSA 1W1PA 3AIWA 1RVKA 2ZZ1A 1IEWA 1X1OA 1Q6FA 3OPSA 3VKAA 2BHZA 4JTFA 3BXWA 4L65A 3LPFA 4E38A 1RH9A 4DYJA 3CPGA 1BD0A 4W89A 4O28A 1V0LA 1FWGC 4MYXA 4F4RA 4JL2A 3COTA 4ZENA 2G3MA 1AH3A 3LN3A 3BANA 2WNNA 2G4FA 5KZMA 1ONRA 1ZAHA 2ZTJA 1VFMA 4UQBA 1RJPA 3THQA 5I07A 4KRTA 4Y9PA 1ZAJA 1CLKA 3O06A 5CPSA 4ZQRA 1TJRA 1QAPA 2G8ZA 4JTIA 4QM1A 4TMBA 3KS5A 3WD1A 3PBWA 3PZMA 3VOIA 5CPQA 5FEZA 4UFMA 3SCQA 1NOWA 1NWSA 1UB3A 3MC5A 5CSRA 4D8LA 2V5JA 1T99A 3CWOX 4YVVA 3W23A 2ABAA 4B5XA 1R2TA 3ZWSA 3SGGA 4OWGA 4ERIA 3CT2A 4W7UA 2YCLA 1MQRA 2AQOA 3TCSA 4DWSB 4AF0B 3GVQA 4GHRA 1NVMA 3TSMA 1C93A 5CJMA 4E0CA 4BCEA 4US5A 3EAUA 8TIMA 1OK6A 5D9MA 2YXXA 2CLOA 4GGHA 3E96A 4NYUA 2OLSA 4XQ6A 1TG7A 3BVJA 4J7RA 2CEQA 3OGRA 4KEZA 2FZMA 2BLEA 2C1GA 2YR1A 4W7WA 5EB8A 2VMFA 4L6HA 1Z9AA 3MSDA 1PEZA 4CQBA 4DF0A 3PS7A 4Q6XA 2O9TA 1QPRA 2C0HA 1TRIA 4XKYB 3WNNA 1AL8A 3W00A 1XGDA 1ZBWA 3SN4A 1ZZMA 1CX9A 5GNZA 2IPJA 2BGNE 2WSYA 3EKGA 2WHJA 3VNYA 1MDLA 4KGLA 4FOUA 5BU6A 5GJPA 4LH8A 1F8IA 1GVFA 1JZ7A 3M0YA 1XLBA 1OQFA 3HQNA 3BZGA 1PZ2A 4GKTA 3PZOA 4EVZA 4C90A 3Q37A 4JTQA 1QATA 3PN8A 3NL3A 1OHLA 1BRLA 2CFFA 5L9FA 2IQ0A 3LK6A 3CPRA 1ITXA 2VENA 2MANA 2PWUA 1V6VA 1VYSX 3AWNA 4AC7C 3OGSA 4Q4KA 4Z1AA 3SBFA 3TCEA 4LYKA 1YTDA 1CZ1A 1G4PA 2PA6A 4E2DA 3QH2A 4MUPA 3TYAA 1REQB 5LA0A 3C52A 5LIXX 3L4WA 2WMIA 1KQZA 3KWXA 4HU0A 1TJ1A 1W5NA 4O52A 2PFHA 3GHTA 5FL0A 3S5SA 1T7LA 4N02A 4PTNA 4L80A 2WC4A 3V7PA 3W7QA 4FSAA 2J9XA 4MVAA 2UV8G 2WPBA 1KTNA 2GOUA 4IX0A 3W6YA 4O0ZA 3VCRA 2A3LA 1ZPTA 3P6LA 3WBWA 1TPUA 4W88A 5BXSA 2D2HA 1YTEA 2GGHA 3TNOA 3ABRA 2CLIA 3EKZA 4HN4A 1K6AA 5AZ0A 1KO0A 1OF6A 3T55A 2HJPA 4RNJA 1GW1A 2FKPA 1UKOA 1L2UA 1EJUC 2FYMA 1X98A 2RDWA 4DI9A 3ZYZA 1KKOA 4EXBA 4KWOA 3K8MA 2Q01A 4N42A 4GX9A 4DO5A 4QISA 4LF2A 2YCJA 1M9HA 3WF2A 3EB2A 4YYFA 1R3WA 2OSWA 1L6WA 3G6LA 3A4XA 5TAOA 2W5FA 3IVUA 3CBWA 1XRTA 4ZEPA 3EWYA 1QBBA 3UPWA 5CC6A 1GOQA 4MHBA 1RLCL 1C8VA 5HQEA 3W28A 2QPXA 4HYVA 1HKIA 1NP2A 2ZCGA 2VC9A 1TPDA 1V5XA 2F61A 1KM2A 3WDHA 5CQ1A 4O1AA 3B06A 3ZWTA 5EMJA 2I5IA 1FFRA 2GJRA 1XRSA 3WF3A 3EX6A 2I16A 1KBIA 1J6OA 4A3RA 2F2KA 4U33A 4C60A 4M7SA 1OFAA 3P14A 4IJRA 3MHFA 4AVNA 4MPKA 5GNXA 1GVYA 3ITVA 5A2AA 4DYKA 2ZXDA 3REQB 3TH6A 4QE5A 4O14A 3PZIA 3UR8A 5HNNA 4MFEA 2ESCA 4WY0A 2FVKA 5EGRA 5F2MA 2QV5A 3DFHA 4GPNA 2AL2B 2V3DA 5CLWA 2EQDA 4JTJA 3NZGA 2VP8A 3S3GA 1PYMA 3GXDA 4M80A 1TWSA 1VLIA 3ZIZA 2J74A 9XIMA 4MDOA 3ITYA 2DZSA 4GUFA 3QKZA 4O0KA 3WQ6A 4O19A 2XIBA 4CD6A 1OG0A 1FWHC 3ARTA 5HQLA 3QV7A 1GOMA 2PBOA 4JCLA 4RCXA 4L7ZA 1OIFA 4PSPA 5HUOA 3GC2A 5HJXA 1PPIA 3KVMA 1J5TA 3W72A 1DXEA 5FF0A 5IHSA 5HR7A 3QYQA 4ZOAA 4M6VA 4A8NA 1UZDA 1EB3A 1QI4A 2DW7A 4HSHA 1TTJA 3EPOA 1M7PA 1W9XA 2NSXA 2VM8A 4J3VA 3W82A 2WLYA 1WPCA 3UWVA 4HTYA 3W6MA 1I2RA 1Z7AA 4GCXA 2PDNA 1GNXA 4DLMA 1E6XM 3U48A 1OY0A 2ZIDA 1TZ7A 3QGVA 4IMEA 4Q4MA 4WKHA 1XISA 5AC6A 4BK9A 4RNIA 3KBNA 3QVQA 1EX5A 4K68A 4AVFA 2I17A 1GOOA 2HS6A 1M53A 3EWWA 3W2NA 4D6CA 3KS6A 1EC7A 3BSHA 3BMXA 4TVUA 3V1PA 2R91A 4ZQCA 1L2QA 3B9EA 4LYQA 2HBVA 3BAYA 1IWAA 1CXHA 1MEWA 4BQ2A 3SJ3A 2PUZA 3H26A 4IIHA 1OFPA 3AHZA 1WDDA 5CZ0A 5DN1A 3CPUA 2ISFA 4KWUA 3GZAA 4FIRA 5BZAA 3QXBA 3CHCA 4O12A 3WQEA 2CC0A 1ONWA 2PLJA 3CNYA 1A0DA 4PTMA 5DXXA 2BB0A 1QOQA 4K8EA 2G3NA 1DJQA 4IQJA 4AEEA 1P7TA 2DSWA 4PCNA 1KR0A 3WH6A 1UUQA 4IMCA 2QULA 2R6OA 5BNKA 1V3HA 4AD2A 4XBSA 3GB6A 4FA3A 2J78A 2WC3A 3E5BA 5ABFB 1C8QA 1IE7C 2QJJA 3V36A 2OWXA 5E09A 1KWGA 3MI6A 1EBGA 2NW0A 1GJUA 4DXKA 1BWLA 4KH2A 3E0FA 3KLLA 1LYXA 3C0SA 4CCDA 5E5CA 2XHYA 1XLLA 4C6KA 2GYIA 1FWTA 1RHCA 3K1DA 2GGEA 2ZA1A 4Q8WA 1MRQA 1JCLA 2R1MA 3GHUA 3LQGA 3R2GA 1XP3A 3P8IA 3TTEA 4ADUA 1T96A 5M03A 1T41A 1MVYA 2QCMA 1VRDA 1TV4A 2CXGA 3G1AA 1DXFA 3OZPA 5E6YA 3WMBA 4FX7A 4NHVA 4WF7A 4GY1A 1D7KA 4JIQA 5C2CA 3LB0A 1JYXA 2D2JA 3UVAA 3N13A 2OKTA 1XIGA 1TMQA 2ZUSA 3DFQA 1FWEC 4KFOA 1O94A 3BC9A 4ADSA 2BOGX 4GQRA 3GNOA 1GVRA 4Q8PA 1M68A 1NIUA 1W1TA 1D2KA 3H23A 3JZUA 1WBJA 3Q2DA 4O4VA 1IXPA 1KFLA 4G7EB 3WG6A 4OOUA 3OBKA 5A8PA 1YXDA 4L4OA 3RIKA 3VKKA 1B4KA 1W2PA 4Y2WA 2VX4A 3WIJA 1DTUA 2PDPA 3NQ2A 1LT8A 4AY8A 4M82A 2Q6ZA 4OU1A 4QG6A 1ZHAA 4IUOA 4JTAA 2NUXA 3R12A 5A6BA 4IP4A 1XFCA 1AH4A 3E0LA 4RLIA 4YN5A 4ERAA 3S9ZA 1AUSL 4RW5A 2DU2A 4DJED 4DWDA 3KCJA 3QR3A 3U5YA 5IBXC 1FY6A 2VC7A 2F9RA 4HJWA 3LV6A 4GX8A 5D2VA 1EIXA 3EB3A 2EEXA 3L68A 1R6WA 1SVDA 2VJXA 5CCZA 3MSRA 3WQGA 4V1YA 2XM2A 3AJXA 2J24A 3N4AA 2XH2A 2R94A 4JTGA 3QY8A 1WUFA 3AMDA 1H7RA 4AWUA 1V4YA 1H1ZA 4IPPA 1VLWA 4HPXA 2Q3RA 1BG9A 3PG9A 3F03K 3BLDA 2EJ1A 1F05A 3TN6A 4Q4QA 4E6MA 3MTWA 4PTDA 3UJFA 4W84A 1ZY9A 4IM4A 4FOJA 3ID7A 2XTKA 3KZSA 4GIYA 2NWRA 3W1AA 3QC3A 1OK4A 3IIOA 4RJEA 4UFIA 3RO6A 2A4AA 1DWAM 4R7WA 3IIPA 1V6YA 4GUIA 1YADA 3M9YA 1GKQA 2NQHA 4E8GA 1E6PA 4PCFA 3EBVA 3AROA 4RL3A 3LCGA 4Z2LA 1NSJA 5LIYX 3AQUA 4HMNA 3KVLA 3L7RA 4I9TA 1K77A 2CXEA 1ZTVA 4HB7A 4PMYA 2Z4GA 1Q7QA 1KV5A 1Q66A 4QIUA 3VM7A 1PV8A 1DWJM 3U7BA 1DPMA 3A24A 5HPCA 3I10A 3L4XA 3TOYA 2PE4A 4DUVA 3FYYA 3BLPX 2XFFA 1KGXA 4YTSA 4X3ZA 1F4AA 4Q4OA 3NM1A 1J11A 1LG2A 2BXYA 4GY0A 3NPWA 4IXHA 3FA4A 1KGWA 4H19A 4LEFA 2WWCA 2HBXA 3IUIA 1MW0A 3G0SA 2EJAA 4NSBA 4ASTA 5H8PA 4OUEA 2CHOA 7ODCA 4S3JA 1PZ1A 3V4BA 3UFYA 3W6LA 2QPUA 1UQZA 1NFPA 5RUBA 1S5WA 3NQAA 3AZTA 5M1TA 1VIZA 1VP5A 3UZJA 1PKMA 4MNJA 1JZ5A 2J8TA 2XGIA 3DHFA 3PJUA 4HPJA 2YYUA 2FHCA 4ZOCA 1FA2A 4RX0A 1XIEA 3D3FA 3W29A 2PB1A 1PDZA 1LUCB 1BF2A 2YLAA 3L5MA 1XYLA 3CLMA 3KEHA 2YW4A 2ZICA 1I2NA 5BW6A 3RK8A 2IQTA 1IXQA 1Q4NX 2WYSA 1I2PA 2VZUA 3GR8A 1EZWA 3A13A 1UD2A 4PBEA 3KFTA 5D03A 3I3EA 5I23A 4LNYA 4AZGA 2X42A 5K3VA 3U5UA 3GTHA 1J5SA 3WMSA 1UR9A 2GGJA 3OG2A 2JBMA 1NP0A 5H2ZA 1ZAIA 3MKKA 2OELA 3BW4A 5LNVA 1W9DM 3C86A 3GBDA 2VFDA 1Z44A 4U3AA 3P0WA 3HMCA 5I79A 3BAIA 3AYVA 1RP9A 3GSMA 2DZXA 2INZA 1R3VA 4A8LA 1OM0A 4DJFC 3W2LA 1MZHA 3ZT7A 4GZJA 4EX4A 2GJXB 1EO5A 1OFDA 1SFJA 3BLOA 5G4EA 1XDMA 2E5CA 5T9CE 3WZ0E 4JPGA 2FGBA 4QJ3B 3QLDA 2D73A 4JDBA 1D7FA 1HJQA 3PUEA 4HOWA 4UQCA 5FAJA 3RG6A 2CZDA 4PUUA 3VPLA 4TOQA 1ADSA 3CXOA 3TYEA 1E6QM 1XBYA 2P3ZA 4X9YA 3GW0A 5LIUX 3B0YA 3CV6A 5KZDA 2E0PA 5EMKA 2QYGA 1A53A 1EIBA 3V5OA 1TA3B 4TMCA 5HK4A 3KP1A 1TPEA 2Z2AA 4H04A 1S5MA 2BSLA 1G0CA 4JNYA 4RXFA 4QNWA 3T78A 3BURA 4AD0A 2NUWA 4WSHA 1P0KA 4N9EA 2O4MA 1BYBA 4HK7A 1YXYA 2E3ZA 1VCVA 4JTHA 2Q02A 1H4PA 3KOFA 4IMAA 1L6FA 1DJNA 4WKFA 1ISYA 2OKOA 4H7CA 4WLCA 4MWAB 5C0QA 5KTLA 3SRHA 5EU9A 2DEPA 4M24A 4M1BA 4EAYA 1TMHA 3M0HA 3T09A 2W62A 4O8AA 3T1GA 1DV7A 1YTKA 3BZJA 3I4EA 3URQA 3A6OA 3VVGA 2NT0A 3P82A 2ACQA 1RQHA 3LI1A 4OGZA 2Z1KA 1JRBA 3DYPA 3GC4A 1WXJA 5I03A 3GDTA 1K9EA 2Y70A 3AYRA 3OVPA 1EDQA 3HJEA 1XIJA 5G2HA 1LRQA 1N2VA 5C7VA 1FWCC 2XVGA 3AISA 1QTWA 2WSPA 2WANA 2V81A 1KFCA 3PC0A 4Z42C 7PTDA 1LM1A 1ZGDA 3O2LA 1FWNA 3RXZA 4P61A 3SQSA 2J7CA 4NAFB 2BBFA 1XLGA 1W3LA 4S3FA 1CXKA 4ONVA 1WZAA 1MEHA 3DOPA 1SQ7A 1IXOA 2DZTA 2OXNA 1GPWA 3WLMA 4CEUC 3MS8A 2WNZA 2QDEA 1NDWA 3ICJA 1UR4A 1S2TA 4R7JA 1Q6RA 5G2IA 5BU9A 5BROA 3WY1A 1CW2A 4MB4A 4Z17A 2H9AA 1TMLA 4FI4A 1TZ9A 1DJWA 1FUYA 1CXEA 3GTXA 1FTXA 1UR2A 1K8CA 1WNOA 5H91A 4KETA 4O18A 1TR9A 3N2XA 2XZ7A 1G01A 1ISXA 1XG3A 2PLCA 4H8VA 3AHXA 4IIGA 4JFTA 1RSCA 2XH7A 3N2CA 1FDYA 3BOXA 3B97A 3LBMA 3G0UA 2OOGA 3W7KA 5BWAA 4XTDA 2WCAA 2V30A 3R0KA 1J0IA 3EOOA 4J1OA 1GG0A 3T2OA 4B91A 5CSUA 1RV8A 2C7FA 3N2BA 1UOKA 3R94A 4OV4A 2ACRA 1ICQA 1W32A 1X1NA 1GQIA 1UWSA 2WZIA 3FN9A 4ACZA 1V6WA 3WDRA 4JHOA 4F0RA 1TREA 4B3LA 2W79A 3M7SA 3M6DA 5BRBA 2W4XA 1OT2A 1NOUA 1Y5WA 1XYMA 3PBMA 4ZTYA 3EXSA 3UA3A 3W81A 4IIEA 4CNSA 4JICA 3G22A 4A22A 3NPXA 1FWFC 3S9IA 1UBSA 1YBQA 2X40A 2FZ8A 3TA6A 2GDQA 2BX7A 2B7QA 3MMUA 2ZQ0A 2D0GA 1KBBA 1JDDA 4KS0A 4W8LA 3MUIA 4UTTC 2W91A 1OVDA 2DT1A 2VX7A 3WLLA 3WDPP 1JR1A 2WZMA 3AHVA 3WEOA 1LL4A 2VQTA 4DN1A 3P62A 2ONEA 4FNUA 4CN6A 1ZALA 4GD0A 1UPMB 5FJUA 4JHMA 3UXDA 1DP0A 4B9ZA 3DFOA 1WZKA 1TZZA 4HNVA 3W02A 1GTEA 3S2JA 1FWDC 1Y8BA 1W3IA 4MUZA 4YIWA 1YDOA 1SZGA 1AW2A 4YWIA 3ARYA 3EDJA 3GK0A 4OT7A 4ZGYA 4NNCA 2OZ8A 3E38A 3UGVA 3I7QA 1JYNA 1Q6EA 1VJZA 4PCPA 1IF2A 3DUGA 3QR1A 4AISA 4W86A 2PDBA 1S38A 3SCVA 3G1XA 3GVRA 3AFBA 5JH1A 1QNOA 2IXUA 1B57A 3MO7A 3TK7A 3UXAA 1VBGA 3PJTA 3N29A 1I2OA 5FCZA 1HQTA 4C6IA 2JEPA 1XSIA 1A5OC 1TQXA 3OP2A 4GIEA 1GVEA 4I9AA 3PVFA 1EC8A 3KOZA 3IUHA 1ZUAX 3CO8A 4U10A 4LC6A 1ML1A 4IFRA 1E40A 3OHMB 4IPLA 2YCLB 1M03A 1JCYA 1MEIA 1UUMA 3ONCA 2C79A 4O53A 4XX6A 2G95A 3WNKA 1CECA 4WSKA 4LNCA 2PDKA 1IT0A 3QJAA 1E70M 3GZ3A 1DTNA 3PPGA 1AH0A 3QV9A 4GYPA 4NI3A 3IJ8A 1OFQA 3ZMRA 4D8ZA 3VNDA 4A05A 3HM7A 3TQ0A 2ZZ2A 4IPIA 3TQKA 3VOHA 1FCUA 4H6QA 1VAHA 2FTWA 2J13A 2EG6A 5TQLA 5E0FA 1XW8A 3BJTA 5TD4A 2FMOA 3DIPA 3IJ6A 3BLEA 3VOFA 5DX7A 4FALA 3BMWA 3CUXA 4AZBA 3WBAA 5XIMA 1PTDA 3A21A 4AWSA 3CS2A 3LTPA 4LU0A 3LZ3A 3PZUA 3SSZA 5I3HA 3EKLA 3WLHA 5D04C 1TWIA 4QDWA 3WJSA 2GK1A 4LJ3A 5CEWA 2YBVA 4NRRA 3EX4A 3OYXA 4MWAC 3SSJA 4JN6A 4FXSA 1IZJA 3FXYA 3UR7A 1QI3A 3TEVA 4ZE4A 4F8XA 2VGBA 2VI0A 3QMTA 5IDIA 1BRLB 3ZXWA 1DJIA 1WZMA 2TODA 2QCHA 4M19A 2XWDA 3AS0A 1XKYA 1R38A 2AQVA 3SCTA 1A5KC 4AMAA 4DXVA 2HS8A 1HT6A 3AALA 4AIBA 2YB4A 2Q8XA 4H00A 3LSCA 1QNQA 3TC7A 3SADA 3O7UA 3TYBA 3SY1A 2WMIB 2J66A 1IWBA 3GVGA 1TJ2A 3VD4A 5DBTA 3BUVA 1H1NA 4ATDA 3UF9A 2F7FA 3OLIA 4HZ7A 1VEMA 3AMKA 3TLQA 3DU0A 2NVDA 4Z08A 1BWKA 3S6TA 1R7OA 4J4KA 2POTA 5I6SA 4H6KA 3CTTA 1QI0A 2ZADA 5GNYA 1NFBA 1CGWA 3PFMA 3QBUA 4IUGA 3B8UA 2PODA 3G6MA 2Y7FA 4YU1A 5BXTA 1SM9A 4LS0A 4FMVA 4P8XA 4PB3A 3QQWA 1O7AA 3ZR6A 2E7FA 3L0GA 2XN1A 2X41A 5F7UA 1XKJA 5I09A 3ME3A 4PH6A 5IOBA 4YWSA 3GXPA 3AICA 3S6OA 2DDXA 1UHVA 4EKJA 5C2XA 2BY1A 1GYLA 1I8JA 2ZUVA 1GKPA 3WD4A 5LIWX 2IPGA 3CQJA 3BG5A 1FWIC 1TE6A 5CSSA 5K2ZA 4MADA 3HO8A 4UZSA 4DJDC 5K7JA 5A6SA 3GFXA 2BG5A 2F2HA 1OX5A 1F07A 3OW1A 4JDYA 5KINA 3ARZA 3PJWA 4HN8A 1TX0A 2Z7KA 4JNZA 1ZP3A 5HINA 5HULA 1MI3A 1VFUA 1AW1A 4REQA 3OVQA 3NZ1A 2QUUA 3VIJA 1PXGA 1D3GA 5G2WA 3EOSA 2XYLA 1MXSA 4ZO7A 3M43A 2O9PA 4JNMA 1UWIA 4U2ZA 1W1IE 5CJ5A 3I7RA 3N3MA 1I45A 2R1KA 4P8VA 2E6YA 1HTIA 1JRCA 1PX3A 4MTVA 4IGSA 4XAYA 5D09A 5KITA 4H1ZA 2TPSA 3HPFA 2YCEA 4JYFA 2Y62A 2VR4A 2GOKA 4KIRA 2ZX5A 3VGHA 3TLLA 2ZZ5A 1O5QA 1XIMA 4GO9A 2OSYA 2H8ZA 1AQFA 2O7QA 2DV0A 3M44A 1KV8A 4W9TA 4H7VA 4Q8OA 3FW6A 4NIRA 4PC8A 2DQWA 2WVVA 3ARRA 4YL2A 1RBLA 2EPNA 3DFSA 2ZRZA 3O9NA 3UWQA 3LSBA 5GJMA 3CTLA 4QJ5B 3T05A 3TC6A 4L9ZA 4XSLA 4GFSA 2BHUA 4ZO6A 4DO6A 4C6OA 1JF5A 3P60A 1VPYA 2DP3A 4H9XA 3PF3A 4Y7EA 4ERGA 1NWUA 1LWIA 4UXDA 2W27A 3PUOA 4BF5A 1XS2A 4JY9A 3PM6A 3QFWA 4OHQA 4DELA 3UNDA 4TO8A 4YLWA 4JIRA 1X6LA 4CD7A 3A3HA 4TU1A 1E4NA 4H9VA 1SO3A 2PMQA 2YBTA 1JNEA 2J6VA 4A3QA 2ISVA 3AXIA 1DVJA 3AS1A 3C61A 4LAZA 3O07A 1E9IA 3ALGA 4KEMA 1HZYA 3EXRA 2J79A 3INPA 1FH9A 3OVRA 2VR5A 5CPLA 3LCXA 2GDUA 4C7FA 1CXFA 3RPTA 4MB1A 3CB3A 1GWJA 3CHDA 1A80A 3B8IA 1G4EA 4UR9A 1BKSA 2Z1VA 3CAKA 1A5SA 3MO4A 4AHQA 3MCOA 2FLIA 1AQHA 5A8QA 5LNUA 3TTYA 1CGTA 3HA1A 1S2UA 2QJHA 4H8UA 3IGHX 3CZGA 1OG6A 1EDGA 4N6FA 3AXKA 2R8WA 3BQ6A 5LGXA 4ZTXA 4G6CA 1R9YA 1JGMA 1HKKA 2YCKX 3WQFA 2Y6ZA 5I0DA 4ZA0A 3U7VA 1YW1A 4AYSA 1EQPA 4IFKB 2IKIA 3B8TA 3GIPA 3DG6A 4RDZA 3SRFA 4PA8A 3R79A 4ZL1A 1GOKA 4X2PA 2Y7EA 4C6DA 3TTSA 3WUBA 1P7TB 4K37A 4GE8A 2XSAA 4XV0A 5LHEA 1J2WA 3VK5A 4KRUA 4YTQA 2V38A 4XTIA 1H09A 2V9DA 5C71A 3VOJA 4JTSA 1VEOA 4XKYA 3BJSA 1QUMA 3HN3A 3S4TA 1H5VA 4YVXA 4B4FA 5E70A 1FWSA 3CZEA 3MYOA 3WUFA 5KSWA 3OZMA 3B3DA 1YRRA 2Q09A 4F9DA 5J5RA 4L6OA 4UFJA 4FLOA 3BAXA 3KVJA 2ZYFA 3GD6A 2OPJA 1D9EA 1HKMA 4IXXA 2OYLA 3S2MA 1A5CA 2XN0A 4Q32A 1ZRQA 3NFUA 3CWHA 1DWIM 3VTRA 3LRLA 4WK9A 3QGAC 3QM3A 2Y5JA 3RM4A 3R43A 3NQEA 2PTWA 3EEGA 2WNQA 2ZE0A 5D4YA 1RXOB 2ZUWA 4MKSA 5C9ZA 3AHYA 1W9BM 2G3IA 2AKZA 1RD5A 1F3WA 2HVOA 4UQAA 5JXQA 2YB1A 1M41A 1K03A 1X8CA 4FXRA 4LT9A 3PB0A 3HTWA 4JTUA 1REQA 3RX2A 4I6KA 2CKSA 1HO1A 3NL2A 4OBTA 2JKPA 1TWDA 1QW7A 3LHZA 1XFBA 2FDMA 1LL7A 4RR4A 2IKHA 1EP3A 5AYIA 4PR4A 2UY2A 5DMNA 4LB3A 2NXGA 3MV01 3F2BA 3OLGA 1WBHA 2HRWA 1RVGA 2VGFA 1XGZA 4HSNA 3VXGA 4TXEA 4OIFA 6PTDA 4PMZA 4B5VA 1EPVA 1NDZA 4UOQA 3UWWA 3VIGA 4A6GA 1NH6A 4UNLA 1JD9A 1ZB5A 2PP3A 4XSMA 5AY7A 3GG1A 2QCEA 1X7FA 5A6LA 5LA2A 2V6AA 4C6PA 3LCLA 3BCDA 3O15A 2JGQA 1TWWA 3B03A 1MQPA 3G5EA 3SN1A 1QW8A 3TKFA 3DENA 2J7DA 1NELA 2INFA 3GDMA 2QMJA 3DG7A 4A29A 4DUXA 3NZQA 3H8AA 3FJ6A 4I9MA 1I2QA 2OT0A 4J3SA 4GQGA 1UD4A 2Y5SA 3SAZA 2PDIA 1NARA 5F4WA 1JPDX 3WL0A 4Q7BA 1LWHA 2DZWA 3IK2A 1B5TA 3EPMA 2DSVA 3DHDA 3QZAA 4FLSA 3E6EA 3OBEA 5FJIA 3RGTA 2HNEA 2BTMA 3UYCA 4OBSA 2CW6A 3N3TA 1XH0A 2VO5A 2HMCA 1F4HA 1ODUA 1ZFJA 2D23A 5BRQA 4PN2A 4UIOA 1IWPA 3REQA 5HMFA 1EXPA 4DUOA 2EF9A 2O7SA 4CQ9A 1GYMA 4FAMA 5JU6A 3P3BA 2E9LA 4I8YA 1E9YB 4B5TA 3TWAA 1SUXA 4NP7A 4LUTA 1BLIA 1CGYA 2FGZA 3IEBA 5BXRA 2B0MA 1V7YA 3EA2A 1DJYA 3BV7A 3H2AA 2CLEA 3EDDA 2NV1A 2P50A 4JQ4A 4QX4A 1B90A 3AMCA 3UYIA 3RLHA 1WDPA 2QF8A 1PO9A 4K1WA 1VPQA 4EPBC 4KCUA 2OEMA 1N7KA 3HFYA 3HV9A 1W3HA 2IS7A 3FVMA 1K6WA 1KFJA 2NVCA 4Q8QA 5HMSA 3BAKA 1HJXA 1R87A 5FSDC 1I1XA 4GBUA 3TTOA 3S1GA 4F79A 4WRHA 3LQLA 3V18A 2W6RA 4WJ8A 3N6HA 1F76A 4UCFA 2J9YA 5ECVA 3FEQA 2GUBA 3W9ZA 3DN5A 4BWLA 1AK5A 4BEUA 1XF0A 3N9KA 1OGSA 4PFMA 1CLVA 2OG9A 5D33A 3A4WA 5C5YA 1B31A 3URAA 5D05A 4XZHA 1TPH1 2YDSA 4JR5A 3LPGA 3QHMA 4O16A 2VC6A 3ABSA 5GVJA 4HHPA 4I5XA 4QGCA 1EWDA 1GVSA 3TZNA 4HNOA 1QFEA 1CGXA 3WLNA 1TVLA 4M3PA 4XBJA 3ZJ6A 4YPJA 4QE1A 4WZHA 1NTHA 3LZ5A 1VPXA 4MIMA 1GG1A 2JEQA 3EYPA 5A6KA 1NWRA 1KWKA 4FX6M 3LXCA 3DERA 3KE0A 1FCVA 5MF5A 2VRJA 1PKNA 2CU0A 4AH7A 5JQ9A 4O54A 2B7PA 2EKCA 1GVIA 4US6A 4J35A 4H6RA 2J25A 2CWXA 4LW7A 4AEOA 4UTJA 2PEVA 5HUPA 5AHEA 4BZYA 1UG6A 4NQ1A 4NG3A 4GQBA 2IMRA 3BLKA 5HNRA 2VVNA 2NQZA 2EHHA 3VGGA 4ZB5A 4RZBA 4DLFA 1GOWA 3PBGA 4AZ7A 4QQUA 3C2YA 1Q4WA 3W1UA 4V33A 1EH9A 4LV9A 4LTSA 5ABFA 4XVDA 2J6XA 2H8XA 1ZSXA 5KETA 1H7WA 3IJ7A 2GGGA 3M0IA 1EUNA 4UR8A 1S5NA 1XH1A 2X09A 3CQHA 1EJXC 3MKCA 2PRLA 3LHYA 3SQMA 4HTBA 4KWVA 2W9MA 4ML4A 5HJLA 3ABXA 4H83A 2EPOA 4TV6A 4EF8A 3H54A 1JYVA 3CV2A 1H7PA 4XUYA 1EFZA 3IARA 2MNRA 3PY2A 3P61A 2PURA 4B3ZA 1XLJA 3ANUA 4JKLA 4NX0A 3PNZA 4UQ9A 4D1IA 4UQDA 1Y65A 4TR9A 2EBNA 1BYCA 3HF3A 2CLKA 4C6NA 4E2VA 5C9WA 2C18A 4PMXA 3B4YA 2GWGA 4QCFA 4UTLA 3S0CA 4DHGA 1C7TA 2FPVA 5D9NA 3GRIA 3ARSA 3STGA 1XYCA 3H2FA 4GYKA 2OX1A 4PMDA 1LLZA 2QGYA 5U7SA 1SU5A 3OA3A 2HK1A 3CMGA 3F7JA 3N2OA 2JK2A 2VWSA 3NQBA 4C1LA 2QJNA 1JUKA 1UWTA 3NO5A 1Q45A 5G4WA 4G7EA 1QO5A 3VKBA 3TX9A 1HL8A 1OBAA 2R1NA 3GDKA 3DFTA 3M0VA 1E6NA 2CHRA 5AHNA 3WLIA 4CVUA 3PZ9A 1UA3A 5K4ZA 2OYKA 4UTHA 1OYAA 1XLFA 2ALDA 2OZ3A 5FJTA 1JXJA 1KCKA 2ZZ7A 2WWDA 4DZIA 2WZHA 4U5IA 1U5VA 3QLLA 4HOXA 4HCDA 5ABHA 4JCMA 4MYAA 2GVEA 5ECUA 3Q67A 5JH2A 1WKFA 3E74A 1EXBA 4ZQOA 2DY3A 1E1EA 3AI0A 1GZ1A 4O50A 3UT0A 1ICSA 4NY2A 4DBWA 4BKNA 1K9TA 3WF4A 4DY1A 4IIBA 2WJFA 1BKHA 1Z48A 2VGGA 1R3TA 1Y5VA 4WDXA 1E55A 1E56A 3QEZA 4RE0A 2ZOXA 3BSGA 4NVTA 3OVGA 4YCPA 3L66A 1C9WA 1QOXA 1UJPA 2H3DA 1UH2A 1HW6A 4LBUA 5DMMA 4PTWA 3K13A 1KRMA 1KBKA 4OUIA 5DRCA 3NQDA 5DT7A 3R5EA 4OJYA 3VE7A 1L8PA 5A8OA 4LUSB 3NM3A 5MHBA 1FXPA 4PUKA 4NJJA 1PAMA 3MP3A 3EOUA 3VE9A 4JIIX 5H6HA 4AXNA 5HMEA 4FEZA 3T40A 5HQMA 5I24A 4W87A 1PBGA 1FBAA 3W38A 3T07A 4C6LA 3L0KA 4HPHA 3KTCA 2NX1A 3LG3A 4G2DA 3QV8A 4JEQA 4F3HA 1CGUA 4B5NA 3MPGA 3KUMA 3GTIA 3A47A 3ZR4A 1Z41A 2DSKA 3IIZA 4B2DD 1US2A 2A6LA 3UZWA 1TTQA 2EKGA 2Y7DA 5CC5A 5B80A 1PTGA 3NGFA 5H8MA 4ACZB 2QUNA 1H1YA 1ZJBA 4H7ZA 1JDEA 1IT7A 4AEFA 5JBFA 3NJ3A 4HSOA 1MUCA 2WMKA 4NAEB 3MANA 4MKNA 1XLKA 2A5HA 2WKJA 3E12A 3MUZ1 3AIRA 3PFRA 3TN4A 3NDZA 2TRSA 3V35A 4J3XA 2B4GA 1BAGA 1AD1A 2OODA 3KW3A 1SYTA 3UZ5A 3CUJA 3GY1A 1YBQB 1V6XA 3E1F1 3O6AA 5A8GA 2FHBA 3WQCA 2VZOA 1O68A 1OEPA 3I3BA 2XVPA 3T4CA 4XZNX 3S5OA 2DZPA 1T8XA 3LX9A 4GZ7A 1XPGA 3ARWA 4KCTA 1W9VA 2KX9A 4HBKA 2F84A 4Z1DA 3LCFA 3H55A 3H7UA 1JPHA 3GBEA 2G97A 2PTXA 2DT3A 3R6IA 3QOKA 3S5ZA 2WVTA 4EPKA 2JF7A 1F7BA 2Z27A 3WNLA 1BSLA 4Z2HA 2O9RA 1JUEA 1TUFA 3LM7A 5I5RA 1H11A 1F6KA 2E9BA 1HP4A 2RJHA 1A5BA 3B0XA 2P0OA 3CMJA 3VNZA 3FA3A 4C1NA 4GLEA 2W61A 1OFEA 1B9ZA 3BOFA 4ZXLA 1QR7A 2AMXA 3PBYA 4PSRA 3MT1A 1I6NA 1YPIA 3C4UA 2ZX9A 4BF7A 3ZLGA 3A4JA 3CZ8A 1UUOA 4A21A 2GLKA 5I7GA 2RUSA 2IPWA 4FIQA 3EDKA 1JDAA 1E72M 3CUFA 4JTEA 1DHKA 4F48A 5A6MA 1IEQA 2CBVA 1QNVA 1TUXA 2QCLA 2I56A 3VNLA 4V2XA 4IPNB 1XI3A 1TPVA 1SSDA 5D8ZA 2AGKA 2PI6A 2Z1XA 2PDXA 4IPJA 3LDVA 2XSXA 2EPLX 4D6EA 3OB8A 2DZBA 3ITCA 4B90A 3VKJA 4GIRA 2XGZA 3FYOA 1XM3A 1G5AA 4CN4A 3TDFA 2ZX7A 1C3FA 3WENA 3CM4A 1PUDA 2X0HA 1GEQA 4FX8A 3MVTA 1U30A 1RZMA 1OFBA 3V75A 1CIUA 4QITA 4AVOA 4A3YA 2ATSA 2W92A 3TIMA 2PAJA 4JZ5A 1A0EA 5HWMA 4FS9A 4C6EA 1W1ZA 1I9CB 2ZZ3A 5REQA 3DBNA 1XGEA 3HPXA 4LC8A 5LNSA 4Y9AA 5LYRA 2OWWA 1TTIA 3VDHA 3W7JA 3WLSA 4U5KA 1H49A 2PS2A 4GZEA 3UESA 2FVMA 1EJSC 1EX1A 1M5WA 4KF1A 2HZGA 1F2JA 2J4GA 1UZ4A 9CGTA 1UBPC 5JVLA 2GJPA 3FAWA 4URIA 3VIOA 1WXYA 4QBXA 5FJOA 4QS6A 4GXMA 2NX9A 2CBJA 4LB4A 5BMWA 2DJLA 2IPFA 4HMCA 3M5YA 1UP0A 2VX5A 2VEFA 3ELFA 2PWGA 4XISA 3XINA 4CUCA 2P8BA 4B2DA 1P48A 1UP3A 4Z2IA 7CGTA 4J3WA 5CPOA 1BQCA 1CT5A 1VH7A 2UY3A 2YX0A 1UD5A 3L21A 2WM0A 4NAFA 5A5WA 2G4JA 4FNQA 1LOQA 4PCSA 1QO2A 2C6QA 4QSHA 4O10A 1S5TA 3GNPA 3BL3A 2J7BA 2E9MA 3ERPA 3UVIA 2YL5A 3UGRA 3LTYA 2B7OA 4GH1A 1Q6CA 1QVBA 3AS3A 5C9RA 5JIPA 4LX4A 1RCXB 4UTIA 3CAVA 1TSIA 3EZ4A 1RR2A 1WP6A 4RKAA 3CZLA 4IHCA 5A94A 3IVTA 3B8WA 5DT5A 1UW9A 3IPWA 1FKXA 3V3WA 3Q65A 1XYFA 4UNIA 1YHTA 2OMAA 3GXFA 1YLVA 1AW5A 3WFZA 3N19B 3GS6A 3R13A 3P81A 3OQ8A 3ITLA 5AYZA 3O3RA 2OEKA 3L4TA 4DO4A 2W67A 1W5OA 2DT0A 3QMSA 1E73M 3WQWA 5CGMA 3II1A 1MYRA 3C56A 4N9CA 4CD8A 5A2BA 2FZBA 3O6CA 4CNTA 2FJKA 4J9JA 3EWZA 3LMZA 3IAPA 3ZVHA 1ENUA 1E9LA 3OIXA 1KLYA 2X2GA 2J75A 3T9PA 4JX5A 2AL1A 1XIHA 1VFLA 2J9ZA 3RMEA 1NF7A 5E1QA 3QV6A 3GXIA 1ZBCA 4M81A 1EOKA 2GPTA 1VFSA 4MOZA 3SCUA 2WO5A 1WX0A 1LROA 4ROQA 2DJXA 3EA1A 4QJ4B 1O95A 1G4TA 2ACUA 1PIGA 1SR0A 3UETA 1CWYA 2RHGA 4JY8A 4L61A 4AC1X 3HGOA 4W7VA 2VELA 2WVVB 1LLOA 4FXJA 2AQWA 3CL7A 1GVQA 3RLUA 1TCDA 4FR1A 3H53A 2ZTKA 1K70A 4JAWA 2PF0A 4O17A 3VKCA 5D38A 5CBIA 2PPGA 3ZJKA 2VFFA 3DZ1A 4PRTA 1HN1A 3SIMA 3AC0A 4MY8A 3RAOA 3UG3A 1P0NA 2ZUMA 3WEZA 3QMRA 4LFYA 3W25A 2D1ZA 4WOZA 5LZLA 1XXXA 3JVAA 1FKWA 3GX9A 1NAL1 2EPMX 1TRDA 2VEPA 4HHLA 2C0AA 3LBOA 2ISSA 1S2WA 4UFKA 3C2EA 3ZR5A 5BRPA 1RA5A 3G8RA 1FH8A 2RDXA 2X2YA 1P6BA 2IW0A 1IT8A 3FNDA 4IG2A 4CVWA 1A0CA 5BWFA 3G3DA 3NPVA 5HPOA 4CNNA 1RK5A 3RX4A 1V02A 3W1MA 3AAMA 3GFYA 2CIPA 5T91A 1EBHA 3BG3A 4UTUA 1V6TA 3FS2A 3S42A 4FOKA 4FF5A 2XJ7A 3ZSTA 2EXOA 2P88A 1CXLA 4J3ZA 4LUIA 5EBAA 2Y61A 4GKLA 3VDCA 3A23A 3QHNA 1XCXA 2DH3A 2WSQA 3AIBA 3USZA 1ITCA 1W1YA 4MNLA 3W22A 3VUSA 4S2BA 4XBKA 1AZ2A 4BI6A 1PSCA 1IZCA 6CGTA 2P3EA 3J7HA 3K4WA 2Y8UA 4NXSA 5LXXA 4GYPC 2D2OA 3VC5A 3SJNA 3WJXA 5IFTA 3VU2A 1EOMA 5HAOA 1JZ4A 3SCSA 1XPYA 4X2RA 1JQVA 4IICA 3LGGA 3LLXA 4WHBA 1XYAA 3MJMA 4KCWA 3VD7A 4KKXA 1P1MA 1LDCA 3O63A 3V0SA 1Q3NA 2ZUUA 4D6HA 4N9BA 4I7WA 1AJ0A 3WMLA 1TTPA 1GJWA 3ES8A 4QLLA 4IP5A 9RUBA 2QIIA 2ZDSA 2WKGA 4LVDA 1WKEA 1M04A 1B2YA 1JVNA 1YPFA 1BQGA 4EK7A 1ZENA 1ELSA 3PTDA 2BXZA 1QI2A 2P0IA 1X7IA 5TBOA 1ME8A 1CENA 4Z2KA 2DGAA 1A3XA 1YNPA 1WXZA 3LXBA 1MMFA 5DCBA 1R0MA 1UKPA 4W93A 3NEHA 1OSEA 4HGXA 3C2OA 1VQTA 2HE5A 4POCA 2JKAA 3STCA 3DECA 3SECA 1XG4A 3U57A 2I9UA 4L9YA 5I3GA 2XZ9A 1EGZA 4E8CA 1OJXA 3GVVA 5J04A 4LAMA 3CUGA 1KM1A 2BY0A 4HA1A 5CG0A 5EBUA 3S5NA 1W8SA 3QOMA 3M0XA 4UR7A 1GUVA 3E5PA 1W6TA 5AB3A 4B9YA 1RY8A 4HT3A 1OC5A 4Q4SA 5DCEA 4YCOA 1VBHA 4PMUA 5BOFA 1OFOA 2GDVA 1KKRA 1VJSA 3EWXA 1E1CA 3T0AA 1FHDA 2QEZA 1OYCA 5SWUA 1ADOA 3SY8A 2Z28A 1GGOA 4ZR8A 3AXMA 4KW2A 1LT7A 2Y5EA 1K4GA 1MQQA 3LHUA 5CBJA 3D3AA 4G7FA 5T9BG 2WMGA 4LS1A 1E3ZA 5JBEA 3RF9A 2J7EA 1VBUA 4MB3A 1V0MA 4DNHA 3W7DA 3T81A 1WDRA 2QDHA 4GJ1A 3TVAA 3LI0A 2OFJA 4RNHA 1ICPA 3WQOA 3ENLA 8XIAA 4UTWA 2HROA 1FWWA 4S3BA 3T42A 4Q8NA 3W7EA 1RQEA 1W1B1 5AC4A 2J47A 3W7HA 2E6FA 4GISA 2I57A 3STPA 2G3JA 4ENLA 4HOZA 4NNAA 4GZIA 1PDYA 5C9XA 5AKQA 1GHRA 4JX4A 3GH5A 3ARVA 2ZZ6A 1PHQA 3U2CA 4GYFA 2ZX8A 2ZX6A 3D0CA 4JOMA 5CC3A 4NZ5A 1WDWA 5HOSA 3ABOA 1KGUA 3FDKA 4H2HA 1U22A 4IJBA 1HJSA 1XIIA 1NQ6A 3FK4A 4PRWA 3KRSA 1KFWA 4LUTB 5HWJA 5D02A 3RU8X 1H0IA 2D24A 3W71A 2OLAA 3FSUA 2QGHA 4P8WA 1OCNA 3N4EA 4Z2JA 2O55A 4H8NA 4QEHA 3TYDA 1NFGA 2RGMA 2X16A 3W88A 2OVLA 3TR9A 4WR3A 3TYUA 1K9DA 2O4QA 4GVFA 2WPGA 5I02A 5U4NA 3L2IA 6REQB 1TYGA 5C7HA 4U4MA 3F2DA 1QHZA 3M0MA 4ICMA 3CMFA 4DXXA 4WGXA 4RW3A 4JHZA 4IGHA 4RE2A 3FJ4A 3CIWA 2WVUA 5CLTA 3WH8A 2VCCA 2XIIA 4PEEA 3NQ6A 3LHVA 4CEXC 1DJXA 5TIMA 3CLWA 3OOQA 5DFAA 3W3OA 3MZ2A 4GQQA 1C8YA 1XUUA 5CC7A 4DZHA 4BS0A 1LQ0A 3S2NA 3W0KA 2QW5A 4PYSA 1XDLA 4MZYA 1ODZA 1WO2A 5LA1A 1YMYA 2YZ5A 1MRAA 2BP1A 2DSZA 4AZIA 4L9XA 4NZ4A 4IGNA 4LEQA 3S1UA 3TE9A 1ZP4A 5HWNA 3P67A 2VVSA 1BSIA 1A4LA 3GKFA 4NX5A 1TCMA 4J28A 5M2FX 1CBGA 3RRXA 1R47A 5CGTA 1KM5A 3M16A 1KQYA 2IKGA 4LY8A 2E5DA 3E2VA 1FDJA 1HX0A 1A47A 3LPPA 1BTCA 2DIKA 3TFXA 1JUBA 3O0FA 2Y2WA 1JJKA 3OIHA 1J0JA 1E43A 2PD5A 2VX6A 1CDGA 4U3CA 1YNYA 2YDAA 4H3DA 4DWSC 3DHUA 3CH0A 4IFKA 1DORA 3NYZA 2C19A 1S3TC 3W26A 5AN7A 5B7ZA 3K30A 3HZ3A 2PRHA 2WNWA 5ABGA 4BY3A 3UY8A 1A5MC 5AZ1A 1W9PA 4C6QA 1ME7A 4AIEA 4ZZ9A 1DJZA 2XIQA 4O1FA 1B3XA 4Z1CA 2PDUA 5A95A 1KRAC 2ZBTA 2QVNA 5I06A 3OODA 4NASA 1U5HA 3SZ8A 3FYPA 2XM1A 1TPB1 1B30A 1Q65A 1HIZA 6ENLA 3PG8A 1GVOA 1SFSA 2NQLA 3KBMA 1E4LA 2R1PA 4GNKB 2NUYA 3CH9A 1TV3A 5DO8A 1JI1A 3NR0A 4B16A 3GQYA 3ZVIA 1W17A 2CBIA 3SGZA 1ZCOA 2DPEA 3VCNA 1UMYA 4H4IA 2AMGA 2V3GA 2J8FA 5HNTA 1M3UA 2Y89A 1CB7B 2DH2A 1ME9A 2CKRA 2P10A 4AW7A 3ZM8A 3FFSA 3JW7A 2QMKA 3QTPA 4E5TA 6XIAA 2PC4A 4DX3A 3MMTA 5DMLA 4GUGA 3ZZ1A 1E0XA 3QFEA 4DF2A 3VC6A 3B9AA 4B92A 1QU4A 4KMQA 3GTNA 3RM9A 3E0IA 2WKLA 1SR9A 5JIWA 3F2CA 1MSSA 2Z29A 3RILA 3D5HA 2QCDB 3M5VA 1PCWA 3W7PA 3KOYA 3TZFA 4OVXA 1VD6A 4IFOA 4IL0A 1V3JA 3PZNA 1PIFA 5FI8A 3UJRA 4N6EA 2DZVA 2V5BA 2QS8A 3FGCA 3VI2A 1SMDA 3W70A 1W3JA 2XINA 1TFVA 3MBDA 2Z1SA 3GNXA 1CYGA 4LF1A 2D3NA 1YNQA 4JFWA 4LGXA 4F0SA 5LGZA 3EOEA 3G8EA 5E0KA 3TN5A 3SIZA 4D1JA 3NO1A 4QXIA 4O4WA 3RYSA 3WLRA 2BVYA 5KZ6A 1Q2SA 3TP4A 1N8IA 3AYSA 4R27A 3BAWA 1HL9A 4QLJA 4XVEA 1UIOA 3P8JA 2YPIA 1NM9A 4MF4A 2E1DA 3EPNA 1XBXA 1R2RA 2P8CA 3HQOA 4DEFA 2HQAA 3WBXA 4OFCA 5CH9A 1OCQA 3U0HA 1WAWA 3C0QA 1PHWA 3UR2A 3KVKA 1XUZA 1J0ZA 1WDQA 1K1DA 4Q33A 4S39A 5FJRA 1VFFA 3IK4A 1E1FA 3TW9A 1M6JA 4MWAE 2V8ZA 4C65A 3LMYA 3EWUA 1GOXA 3MU7A 4UB9A 2ZVIA 5LNWA 3H24A 1KM6A 2XIOA 4K1GA 4CNUA 4HNNA 9XIAA 4S3KA 1I4NA 1Q85A 1P6CA 1LG1A 2BWGA 3SGUA 3THAA 4A4AA 1OINA 3RR4A 1HG3A 4EF9A 1HF6A 3NEVA 1WB0A 2BHYA 2WC7A 3VMNA 4MJZA 3GDBA 1P0BA 3H2NA 4M1RA 2E6DA 3KAOA 3DFYA 4PMOA 1TX2A 1A3HA 2J62A 2PP1A 2HVMA 1WKDA 3APGA 1LBMA 1M1BA 4L64A 1P1XA 1GEHA 4QG9A 3MWCA 1LWJA 2IQDA 1SO4A 3N6QA 3UPBA 2OCZA 3HG5A 4MKVA 1XLHA 1H7XA 2A2IA 2NV2A 4HA4A 3ABZA 4LS2A 1UC4A 4E2OA 1X1ZA 2F6KA 1CEOA 1GQLA 2QF7A 1J8VA 2VD9A 1XIFA 4D9PA 2V67A 1JL8A 3BG9A 3GXNA 1RAKA 4Q8UA 1PJ9A 1E71M 3C5QA 3PPCA 4NU7A 1KBLA 4ZB0A 3LHWA 2P53A 3A3WA 3TW7A 2QT3A 2ZE3A 1TPWA 1AL7A 4PUDA 2CPUA 4RZ5A 1O6IA 3A5FA 4NT0A 3NAVA 4HHMA 3W1PA 2BDQA 4D6JA 3AIUA 1BGAA 4L4MA 4U28A 3VZZA 1KXHA 3C2VA 4TUFA 4BWLC 4CCCA 2FIQA 2HPMA 1ZBVA 3SN0A 1J10A 4GK8A 1E0WA 1TKKA 3B05A 3H6OA 3IRDA 3CUIA 1AMKA 5XIAA 1NQKA 5K9CA 4ZSUA 4K36A 1JXKA 1QPQA 1XC4A 1KLZA 2J7GA 4LCRA 1OGBA 4Z0SA 4AWEA 3GH4A 4AHOA 2VT0A 3DX5A 1OX4A 2GL5A 2WJZA 3C0LA 3VNKA 3C8NA 2QIWA 3SUTA 1AVAA 2FDSA 1KRBC 4DZ5A 3HGRA 2Z25A 1EP2A 5HDRA 1JZ2A 3DYMA 3WDJA 3PANA 1EHNA 5HBFA 2X0YA 4C1NB 2GVLA 1EC9A 2V5LA 1FH7A 4WX2A 4G56A 1TJPA 3N12A 4AXKA 3WK2A 5CXPA 3GYEA 1IEIA 4PZVA 1O12A 4GWEA 1UH4A 3MP5A 3M5ZA 1H0GA 3RJYA 5KZEA 2E28A 1GQJA 1VBRA 3NPUA 2DW6A 4EXQA 4JX6A 1DOSA 5H1WA 3ITTA 4J5NA 4LBSA 5AC8A 3AU2A 4IT1A 3DI0A 1KD0A 1UWRA 3UWEA 1RBOB 4J3TA 4HMEA 1ZJHA 2QQ6A 2WMHA 3ECQA 3M6YA 1KB3A 1EEPA 2CESA 1GCYA 1FWJC 1R5YA 1N82A 2XISA 4CGTA 3VIKA 4OZOA 4DJEA 2V5KA 3ZT5A 4ZO8A 1DE5A 3ZO9A 4X61A 4LOCA 4PMJA 1LBFA 3R1ZA 4US5D 3IGXA 1GK8A 4A2SA 1D3HA 1EA0A 2TMDA 1W5QA 3WBEA 4FR6A 4OE7A 4RZ4A 4W4QA 2ISDA 3WUGA 3CWNA 1M7XA 1RPXA 3KL5A 4KWSA 2NX3A 3CL8A 3GR7A 3HB9A 5FF7A 3TMLA 1U83A 4CKQA 3N2MA 1X39A 1JPKA 1H50A 5XINA 1VFOA 2WBKA 1KFEA 5REQB 4PE8A 1W3TA 2XSBA 4MJ2A 1RJQA 4Q6JA 4INFA 2YJQA 2YFOA 3VYLA 1I1WA 1W5MA 1BYDA 2UWFA 3W1LA 3H4XA 5TF0A 4K7VA 4HA0A 4I90A 2D22A 2GVYA 3IGUA 5F1VA 2MUCA 2DZAA 1J4EA 3LUTA 2F8QA 3VOGA 2YW3A 3R8GA 2POZA 4LALA 4C6CA 2WQPA 1UKSA 2XUCA 5LSMA 5FACA 2GJNA 4YYCA 4M51A 1PWLA 4G9PA 4DBDA 5I3IA 4P7RA 2VGIA 2HPIA 3VIPA 4QDMA 3CHFA 4TQTA 3W2KA 1JFXA 4PTXA 1JDFA 3W2JA 2PC8A 2TSYA 1TQJA 5FJPA 3G24A 1LF1A 1XRFA 3PBUA 4UBPC 4Y9OA 3NCOA 4TX9A 3QSTA 4GNJA 3NQGA 3CHVA 1BYAA 3IJIA 5DRIA 3R8RA 3H4WA 1MW2A 1UR0A 1E9ZB 4R85A 2ZA3A 1PZ0A 3APYA 3MWAA 1S46A 4IQEA 1S3HA 5CZKA 1EPXA 3TNBA 1US3A 2CWNA 1R3YA 5A8MA 3AIVA 4LAOA 1KR1A 4XZIA 1C29A 2G96A 4X63A 7XIMA 1Z69A 2PLMA 4DPQA 1EF3A 3WKZA 1QNSA 2V3FA 3VNIA 1EZ2A 3BMVA 4NZCA 4MY9A 3LNMA 3S83A 3P5ZA 4FNPA 5MKGA 4NJHA 1KFKA 1JI2A 3QZ6A 4O11A 1U1UA 4Z0JA 1R3SA 4LUSA 3AUOA 3PWIA 3BICA 1FHLA 5EFFA 2GSHA 1H60A 4JQ2A 4S3GA 4AY7A 3GUGA 3TJXA 3QRHA 5FKYA 4DBUA 4DYEA 4IX2A 3S8HA 4TVCA 3VMOA 1KFBA 1O5RA 4AZ5A 1VFTA 1F6YA 2OQYA 3UEQA 2D3LA 2LLEA 4ADTA 3MA8A 2G41A 5DF0A 3LM3A 3GH7A 4TIMA 3L4UA 1DBTA 4XO7A 3ZVHB 4B5WA 3IJLA 2FQIA 3NQFA 4JQ3A 4IQDA 3UG4A 1PVNA 1BPLB 1MFVA 5CPMA 1GKRA 3TW6A 4RDWA 5CSYA 1F61A 2WOQA 3CK5A 3VIHA 2X1UA 4QE4A 2Q8LA 5D2WA 1GJPA 4NAEA 3MDUA 1HGYA 1RCQA 3HIJA 3RMJA 3W1XA 4B4HA 3UY7A 3KTXA 3MI2A 2YL8A 2QXWA 4EOUA 4PFHA 1GTHA 1Q6OA 4S2CA 2OYMA 3P93A 2V2DA 3Q4DA 5J5DA 2C14A 1H63A 3QN3A 4CQ8A 2W66A 4LAUA 1Y0EA 2X1SA 3A22A 1QPKA 4X60A 4RPPA 2QPSA 2Y88A 4QAWA 3RUBL 2YFNA 5JMUA 3WQVA 4Q8VA 1PE1A 3QC0A 1TE1A 1TWZA 3B0PA 4XAZA 4LRSA 1EF2A 2FZ9A 1TV7A 2OZ0A 1KCZA 3U9IA 1QHOA 4HPGA 4JFSA 4NZ1A 4MZ1A 4MLRA 1R2SA 4F9JA 1Z89A 3THUA 1UA7A 3U4FA 1K7FA 3BGJA 2QNEA 5FSEC 3N18A 3MQTA 3CQIA 1YDVA 4DB7A 2ZRWA 4JS3A 3ARQA 3WF1A 3BSMA 3CJPA 4GINA 4D71A 3BDKA 5L6UA 3R25A 2VL4A 4AMCA 1QT1A 3AYTA 4IG2B 3VUPA 1LQAA 4XO6A 2G0WA 1S39A 4ATLA 2GFTA 2R9RA 3BWWA 3EDEA 2C91A 3MUCA 4QLKA 2PLKA 4XD3A 4AG0A 3GU1A 2OWCA 4XAFA 1H3GA 3H2CA 3S1VA 5LXEA 1D8CA 1XQLA 4BF9A 3JU2A 2INEA 1KC7A 3WCZA 3QR0A 1LJYA 2OR2A 1JCJA 4TX6A 2DZUA 4AHPA 1OZQA 1LOLA 3AU6A 1TB3A 3KBJA 1MUWA 1GZGA 4HVXA 4S23A 5G4HC 4GBDA 3RLGA 3VIFA 2F6XA 3L4ZA 3LS9A 2QHAA 1H5YA 4HKPA 3GNRA 4KERA 1ZBKA 2VRQA 1PX4A 1J01A 1G67A 1IEXA 1QWKA 3KM8A 1B9BA 2NXIA 3IJ9A 2NQ9A 4Z1YA 2Z26A 1E6RA 3BCFA 1BXNA 4MSSA 4LUYA 2E4TA 3GXMA 2B7NA 5A6JA 1NWTA 2BODX 5E9AA 3UU0A 2YA1A 3UWYA 4G1NA 5AC5A 4R33A 4BJHA 1SO5A 1XRVA 2XFWA 3TMQA 5I77A 2ICSA 1PWMA 3WD2A 1JFHA 3KHDA 2E8ZA 3WF0A 1J2BA 3HGSA 3K2GA 3GW3A 1VIWA 4CLMA 3RO8A 3NIYA 2EAWA 2GQ3A 4M7TA 4B5UA 1VFHA 1DQXA 4KEVA 4C6FA 3BAJA 4I9JA 2HWGA 3PTQA 4JD4A 5D2YA 1SMAA 2P76A 3VIMA 2ACSA 7TIMA 1G94A 2NXHA 3UXKA 2QJIA 2WBGA 1OD8A 3TUUA 2CLLA 3UZYA 4PL2A 1JYWA 1DKWA 4DIAA 3PWGA 1DE6A 3VGDA 1O60A 3O6YX 3NA8A 1R9XA 4XD4A 2XG9A 4I7UA 3G1FA 2VD8A 5EL1A 1LRTA 3CU2A 1X6UA 1UIPA 4L56A 2O92A 2NQJA 2CITA 4ALDA 1UWUA 4BR1A 3F4NA 4ZB2A 3KXQA 5IM51 4ORMA 5J8LA 2ZVRA 3QSRA 3I65A 4KCVA 3NSNA 2GUYA 4YTTA 3BGAA 4KRZA 1YYAA 2A85A 4JQAA 2FGLA 3VD9A 1A3WA 4GYJA 1V79A 1JZ6A 4S3CA 2GQ8A 3KCOA 2ATMA 1TJ0A 1DJHA 1CTNA 1OB0A 3SFKA 1RQBA 2QUVA 3T0CA 2OSXA 5FIPA 4GQ0A 5HANA 1RALA 3C2FA 3KOXA 4EANA 1IIHA 4WD0A 2DIJA 1S1RA 1E1CB 1KCLA 5A6BD 1XCWA 4ZXOA 3B9DA 2PF8A 1XIBA 1JGIA 4F2TA 3L65A 3QHOA 4QS5A 1JCNA 3WK3A 3WLKX 3ARUA 1VHCA 2QCFA 4JN7A 1VRXA 3W1NA 2VEKA 1LP6A 2QJMA 2Z1BA 4FLQA 1A5UA 2PTZA 4HIBA 4MMWA 3DHPA 4PBGA 3SCRA 1M7JA 1EO7A 3U2ZA 2WCSA 2PGEA 1E51A 3AO0A 1GQKA 4MAZA 3THDA 2D2GA 2V5DA 2WB5A 1R3RA 4Q22A 1GZJA 4XG1A 4DO7A 3W76A 4AZCA 1W31A 1KBJA 4RV8A 2WCGA 3ANVA 3IAQA 4QHRA 4FB7A 1JAKA 4IGMA 4NZJA 2A3CA 1FVPA 3WMCA 3UJSA 1C90A 5AHLA 5A69A 3CEUA 2QVHA 4Y6GA 3OLEA 2OT1A 4ZOEA 1OT1A 3DFNA 3SY5A 1YIXA 1XJBA 3B9OA 1EQCA 2REQB 2OGYA 4JFUA 3P2VA 4UFLA 2PWHA 1K8XA 4WDUA 2PWFA 3D47A 4HNTA 3D46A 3N14A 3BGGA 1E6ZA 3CIVA 2A79A 2QCNA 5FESA 1E5JA 1NEYA 1X8FA 1RPKA 6ALDA 1AMYA 1AJZA 3XIMA 1AG1O 4I3GA 1VCFA 1W3NA 2QLYA 4D6FA 1Q13A 5C6MA 5GPRA 2FH8A 4QTGA 4ACYA 5G1MA 1B3YA 1O1HA 4M0XA 1T8QA 5CJNA 2PU0A 4H9UA 5LIKX 3UCDA 5FF4A 2DQXA 3VX1A 1FFQA 1RD6A 1HGWA 3FDGA 4Q3MA 4QEEA 4V15A 3OG3A 1J6PA 7TAAA 1LL6A 2VDIA 4MZ8A 5HMDA 3PZQA 5D2TA 1EP1A 4LANA 4M29A 3S6DA 3BQ5A 3R58A 3HG4A 3M0LA 3WO8A 2ZRXA 1EEXA 3GAKA 4GA8A 3O0KA 5CBBA 3KTSA 1ZCCA 5BMXA 8XIMA 4O57A 2HCVA 1JNDA 3UCCA 2OQLA 7REQB 1XLEA 3FV9A 4H9YA 1H7OA 5HA7A 4IF2A 3T0DA 3RPMA 3U2EA 3MHUA 4K39A 4Q7NA 1GHSA 3WDQA 2B31A 2WZTA 3V1HA 4FF7A 4AX6A 4NI8A 4RK8A 5FEXA 4XWUA 3VNMA 3HGJA 3AS2A 3EB4A 2ADAA 2PWEA 1VC4A 3T6CA 5AFDA 4C7DA 1DQUA 3M4HA 2XH4A 3RR1A 4GI6A 1HP5A 3AZRA 1V7AA 4K3ZA 2HE8A 4M5PA 2JIWA 1HJVA 3L9CA 3K5XA 4UUIA 3KRBA 1E4IA 3WQ8A 3CYJA 4J2PA 4B3KA 3VKDA 3WLTA 2XN2A 4YNGA 1S2VA 4R7OA 1XL9A 3N9RA 4P7OA 1ZS2A 1XSJA 1E6SM 3MUAA 3DEQA 1ZU8A 3A5VA 1IHIA 3KL3A 3L5AA 1BG4A 5CGQA 4L1XA 3IRSA 3T0BA 3OQEA 3BW3A 1QK0A 4BQ4A 1QJWA 4I5UA 4Q4PA 2I5QA 2Y8KA 1AQMA 1LCOA 8A3HA 3VGEA 1Q63A 4WXZA 4K7YA 3L5LA 2Y24A 3FXGA 4GXWA 4JFVA 4IISA 2VZTA 1G4SA 5GJNA 4IMDA 1PYFA 2IXVA 2YGYA 3SR7A 4NXKA 1Q6DA 3QF0A 4XD6A 5IFPA 2VZSA 1OZMA 4DM1A 2G50A 1T0OA 4EAMA 4FLRA 2DVTA 1U33A 1XQKA 4GC3A 2BMBA 4AD3A 1LZOA 4FNSA 1IYXA 3W73A 3ZLHA 1N8WA 3H4GA 1OC6A 3BLFA 3URBA 1B3WA 3T8LA 1FDZA 4C5YA 5EMUA 6A3HA 2DORA 3KRUA 3B9NA 3PHAA 3LY0A 4PRRA 3WX7A 2V68A 2E09A 3I7SA 1P0EA 1ISWA 1R7AA 3NOEA 4JTLA 2D0HA 4LXFA 1AD4A 4PL1A 1EJ7L 1POJA 2WHLA 2P1FA 3V16A 3QPZA 1OCBA 1MXDA 3H12A 5C9UA 4XZBA 3B8VA 1W37A 1PL9A 3SURA 3VD5A 3SUVA 4CCZA 4C91A 2ZUNA 1DIDA 3N15A 3FGCB 4MJ4A 5C8BB 1DJGA 3LXAA 4WEVX 3WH9A 2ALRA 1FOBA 2OGJA 3CZKA 2PDYA 2E40A 4J2MA 3SI9A 2DFAA 3GG8A 2HK0A 1TV5A 3N9SA 2BVDA 4PCTA 1MNZA 5DQPA 2BY3A 4R34A 3M46A 4NYYA 3K8KA 1O5XA 2GSEA 3MMWA 4GI8A 1XYBA 1C7SA 4FP1A 2PRMA 1A50A 2WHMA 7ENLA 1UZ1A 1KNWA 2RJGA 3PZTA 4O0QA 3DAQA 3TWBA 1EYWA 1L9WA 3UQNA 1K7XA 3KL0A 2A21A 3MSGA 3TXZA 1CCWB 1MXGA 3GAYA 2OJPA 1YEYA 3W87A 1ONXA 2V2HA 2GQAA 2XWEA 4O1CA 3UBPC 4PUEA 3VGFA 2WW5A 1HKWA 2VUYA 1WE5A 2ZC8A 3CEPA 4TX8A 1PKLA 6TIMA 1WOAA 2G3FA 2DUZA 2J8GA 1D3CA 4RDVA 1R3QA 5DEZA 3CHEA 3R11A 1G69A 3BLIA 4UTWC 4KGJA 2J88A 3BLLA 2W3ZA 3E3HA 4PODA 2VRKA 1VHNA 5D9PA 3I6EA 4P5UA 4S1FA 1YQ2A 1GORA 3CGTA 5BCAA 2WXDM 4OV9A 3S1XA 3GFZA 3NVDA 2JGYA 4HHHA 4MY1A 4K38A 2Y1HA 5AHIA 3ZT6A 1DQWA 2NWSA 1F3XA 3VMPA 3FA5A 2CZVA 5M17A 3UJEA 1EL3A 4ZCWA 4J27A 2Z24A 5PTDA 3WLQA 5ABEA 3B0UX 1BGGA 1SJCA 2PDFA 3LENA 3R89A 3VFLA 3TU9A 1K4HA 1W0MA 1KRCC 3UP8A 4AIUA 2Z6JA 3N73A 4AD4A 4JN8A 1NOFA 3VO0A 4JTCA 4L1WA 5TNVA 3U2OA 4DBSA 5CKSA 5DANA 4F2UA 3LGEA 4RUBA 4A2RA 4GNVA 4X0VA 1N55A 3QQ1A 4OBRA 4WQ6A 1AJ2A 3HMJG 1HKJA 5FEPA 1WZLA 4QR6A 2CBUA 2WJDA 6REQA 2X8RA 4JTRA 3L0NA 2E77A 4AU0A 3ITXA 3A9BA 1TPC1 3MKVA 1E3XA 1QK2A 1SGJA 1SW7A 3SFWA 1X38A 3MMDA 4DNMA 5EKYA 1YXCA 1HXJA 1H41A 1ADDA 3CZJA 3IIXA 4AB4A 3DBPA 3V5FA 1UR8A 2QCCA 4IQLA 1AODA 2VC5A 4JEJA 2L5HA 4XAPA 4GY7A 3K8LA 3M64A 4F0LA 2GUUA 4UZUA 3PP7A 1OWQA 3W2UA 3GR4A 3LV5A 3GE7A 3DG3A 4H2CA 5CAKA 4O1EA 4B15A 3NDOA 4P8UA 3NDYA 1J0YA 5C2GA 1PIIA 4E4UA 2A7PA 4G8TA 4E3TA 1JCTA 5IHRA 1XHGA 1V8EA 3VA8A 2KAUC 2OTDA 1LRNA 1UD3A 4IJCA 2GGIA 3C3NA 1QDSA 3PK7A 2EG7A 1OX4B 3P80A 1WA3A 2RGLA 3W01A 4CU7A 1CXIA 3PSVA 2CHNA 2VXNA 3F1QA 2FTPA 1UD6A 2X1RA 4K6AA 4GH3A 2JQXA 3NQ8A 1R86A 3KP0A 4Y9MA 3OBAA 3MI3A 4DBEA 2FTYA 2VQUA 3GIQA 1VB9A 4XKMA 2XGBA 2OO6A 4NUWA 3JZEA 4GRSA 3AIQA 4QDPA 1DEDA 3FLUA 1R46A 1SJDA 3G1VA 3OGVA 3BARA 1ISVA 2HSAA 3H7VA 3JRKA 5EMLA 3HBLA 5DMYA 1TV2A 4MDPA 2DUXA 3RN6A 3UJ2A 3F4DA 1CB2A 4C7GA 3GKAA 3HPSA 1RP8A 3AZSA 3IWPA 4IZGA 4DZAA 1UOZA 1WDSA 3G3MA 4UFHA 2G5WA 4LYPA 4HCLA 3W4RA 2W0UA 2A3HA 4Q8TA 4K2SA 2QDDA 5T8GA 4QNEA 1KXQA 4JTDA 1XR2A 1IIGA 3GWQA 3L2MA 3KHJA 4GVHA 3UW6A 3SRKA 4W85A 1NF0A 1R30A 3LBCA 4EWJA 2PDGA 5EY5A 4GIAA 1W1A1 3VABA 1FWRA 2PDJA 3KX6A 3E0WA 3NUKA 1FHUA 4MNKA 3CQ0A 3AHTA 2FH6A 4V28A 4GG9A 1WV2A 4WGHA 2PGRA 1P5BA 4QG8A 4HZ6A 2CNCA 4CQAA 2WVSA 4PULA 3N11A 2ZWZA 4I8DA 3LLDA 3N6JA 2NZLA 3KDNA 3MBFA 1V3LA 4Z1BA 1CPUA 2QCDA 4N4QA 4A3HA 2CYGA 4UC5A 4ATWA 4L5ZA 1JDCA 3JS3A 3W7NA 1SZRA 1XV8A 2C1HA 3C8FA 4DQWA 4KWWA 1GT8A 1V3IA 2BV9A 3GC5A 4D6DA 3DDMA 3SCPA 1H61A 3LHTA 1MNSA 3N34A 3G1HA 4OECA 3QY7A 3EDFA 4L6DA 4W8AA 3WH7A 1KTCA 2X0SA 4GO8A 3W53A 3NO3A 4DUWA 3TSBA 4JKMA 1IGWA 2DUAA 1J79A 3SDOA 4ECLA 1VJIA 4KT2A 2VFGA 4A35A 1DHPA 4E4FA 1Z42A 1W2VA 1GYNA 3BK0A 1UYQA 1UKTA 1P0DA 3DGRA 3FY1A 4DI8A 1EGVA 1BVZA 1F3TA 2O9OA 3THCA 4GXPA 5D9OA 4G5DA 5GQBA 1KCXA 4KEUA 1HFBA 4UQEA 3NQCA 1B4EA 3KLKA 2BNJA 4NKCA 1XINA 3K46A 5A3HA 5A8NA 3OLDA 3W7MA 1PS9A 2VKZG 1EKOA 2HNHA 2X30A 3CYVA 2R1LA 3WDIA 2C71A 3TQVA 1EGMA 4WKAA 3P0XA 2VFHA 1MZRA 5CPTA 3WL1A 3ITOA 2D69A 2VYOA 1C9DA 2QUTA 3UERA 3JUGA 5MKGB 4UTKA 1PB0A 1Q7ZA 3BV4A 3BTNA 3MSYA 1SJBA 4HK6A 4PMRA 1JULA 1V0NA 5AHFA 3YPIA 1UWAA 3PR2A 4GUJA 4GC4A 3VD3A 3BPWA 3NZRA 5FJJA 1T5AA 4OTKA 4EIVA 1AZ1A 1V3MA 2HXTA 4GI9A 3LTSA 2Y7GA 1XCFA 2JFEX 4CCEA 4EACA 4B5SA 1H51A 4BQ5A 1I75A 8CGTA 4LY4A 5AYYA 1DYSA 7A3HA 3E2RA 3FVDA 4IH3A 3WK0A 1IGSA 3U8GA 3VILA 1THFD 1JIBA 2V69A 2OZTA 3PBVA 3ATZA 4MAVA 1HO4A 4ZFCA 3S9YA 1UH3A 3L4VA 3W86A 4AWTA 2YSWA 2R14A 2NV9A 3N1AA 2SFPA 3RJXA 1B54A 4CNPA 1VF8A 1W54A 1UASA 1H2JA 2ZA2A 1U1JA 4MLJA 1SFTA 3FJNA 2X7WA 3QY6A 3A4AA 1XLIA 3ARPA 3RU6A 2NLYA 1XH2A 1FRBA 1KA9F 3ARXA 1B3VA 3U4AA 1SZFA 2QCGA 1RBAA 2PDCA 5A2CA 4HP5A 4YMZA 1J18A 2XU2A 1BXCA 4CN1A 3W7CA 2AAMA 3VDAA 3F4CA 2H90A 2RFGA 3EX1A 1DIEA 1ITQA 1K9FA 2V5CA 4GMEA 3IJDA 4FNRA 2OQHA 3SO7A 4G1KA 3R7MA 2TYSA 2CLPA 4UWMA 1I60A 4YJ5A 1XLMA 3W1TA 1FP9A 1FQ0A 2O0TA 3HURA 3Q45A 5EMYA 2QR6A 1IXNA 2AKMA 2C13A 2VTFA 4D2JA 5C54A 3GXTA 4HMDA 4KIEA 2QKFA 2PWDA 4WXYA 3QQ0A 4L4LA 3WLJA 1E5NA 3UXIA 1L6YA 4LYRA 3KBSA 3TTQA 4HPNA 2VEGA 4I5RA 3S2LA 3OZOA 1WKYA 3IS4A 3R4IA 1V0KA 4HU3A 4A8IA 4LVBA 1MFUA 3TXVA 3H22A 3E2QA 2RDTA 4HYWA 3CAWA 5I2UA 3L4YA 3NXFA 4L4PA 4ES4A 3FOKA 3SRDA 3EWCA 4C6BA 3IUDA 3MZNA 3MB9A 1Q5MA 1TO3A 2VCBA 2I1OA 4QCEA 4Y8FA 4CQCA 1J12A 3OJGA 3RHGA 4HQVA 4JGDA 4QSFA 4PUMA 3F4WA 3B40A 4WJXA 4DWSD 4H9ZA 3IV8A 3UA4A 3L23A 2ISWA 2O56A 4H41A 3LRKA 3WQ5A 2ZDRA 4N7QA 2WZEA 4H8HA 2YLLA 3FX4A 4XB3A 4C6JA 3WNOA 2WSKA 3RM8A 4PEKA 1W91A 4DJEC 3O16A 2PP0A 4ZQNA 3SB0A 3NNTA 4BI5A 1F5ZA 4C1KA 3SCNA 3ZJ8A 4N0RA 3HG2A 3DKLA 4R53A 4M6PA 4S3DA 3I4KA 3B4UA 5FOOA 3NWRA 4DPPA 2AAAA 5F2IA 2AGTA 3D6NA 4CD4A 4MJMA 1BVWA 1WCGA 2PGFA 1YE6A 3CASA 3MV11 1XBVA 3EEZA 1QI5A 4XZMX 1B3ZA 1IEVA 2VDHA 2FMNA 3S1WA 3R8HA 2UBPC 1F73A 3GO2A 1S2AA 3MJYA 3UCQA 2E8YA 3PPHA 2FPYA 1W1VA 2ZWYA 2BY2A 1C8XA 4YHGA 3H2OA 3OYZA 3PTMA 1OD0A 4AFYA 2GSJA 3ZLFA 1Q8JA 5AHMA 1V93A 2PGWA 3TJLA 2A3BA 1LORA 1TIWA 5DLCA 3MW7A 3T44A 1VYPX 4I6VA 3UWUA 5EA9A 2CERA 4ZOBA 4DM2A 3LYEA 3RITA 3TA9A 5BOOA 4AAJA 2UY5A 4ZSTA 3RDKA 4IL2A 4EP8C 4WVXA 3NGJA 5E6ZA 1NU5A 3BJFA 2I7GA 5DY3A 1SFLA 3M47A 3WELA 1UZHA 2E25A 4PBFA 3GUWA 4HJFA 3ONBA 1JCXA 3QYSA 1K7EA 3PUGA 1QNPA 3EXTA 3FKKA 4KPLA 1LBLA 5G1YA 5CAHA 1O5KA 1QXLA 4MGGA 2Z0IA 1R8LA 2I5GA 4WY0B 3TAKA 3ATYA 5K9XA 4ZODA 1BF6A 4BFAA 1JAEA 3POHA 1DL3A 3ABQA 2XPKA 3EOLA 3TQPA 3P5YA 4KFNA 3TOPA 1M01A 3HQPA 4MNMA 1W8GA 2OO0A 4D72A 1N8FA 2CLMA 3NL5A 4WIWA 2QDGA 2BZNA 4P7QA 5ABTA 2J7FA 4EXAA 2QAPA 1NY1A 1WOBA 1BWVA 4NILA 4KQNA 1M7OA 3TONA 2JKEA 4CNOA 3W7LA 3UG5A 3PWAA 3N25A 3UZZA 4ICCX 1US0A 4F2BA 3EMQA 2CLFA 4AZCB 4YTRA 1J9YA 4RV3A 4F0MA 2FZDA 5DY2A 4GJIA 5CZJA 4GUHA 3UPMA 1V03A 3DC8A 3W1QA 2YA0A 5F2LA 1UQYA 4MM1A 2XDFA 4Z2GA 4I7VA 2Q8ZA 3B04A 4ZMGA 1GW9A 1YDYA 4O8RA 3G1SA 3VINA 2J27A 3WFAA 5I00A 1AQ0A 1EDTA 2PZNA 3TROA 4UTMA 1RY0A 2VDGA 4RPQA 3UG8A 2WAGA 1J0KA 4AD1A 3NTYA 3KWSA 1G7VA 3VAVA 4O15A 1S1PA 1IR2A 3E02A 3FAXA 1SZNA 3TAOA 1XLDA 2PCQA 3H21A 3WYZA 4DF1A 2PDQA 3LNPA 4DWSA 4AF0A 2V2CA 1SW3A 1UR3M 3BCJA 3LOTA 3W74A 3K4DA 3FKRA 2QUMA 2VCAA 5CPNA 1UWQA 1BHGA 3SCWA 3IIVA 3VDGA 4JTTA 3CAQA 3AWOA 4E4PA 1V3KA 1Q6QA 4PUWA 3AJ7A 3ALFA 2RAGA 3P84A 5KMYA 3PAJA 4HZ8A 4E8DA 1JPIA 5AC7A 4H01A 3VX0A 3ISIX 2BS9A 4HK5A 4LAKA 5HATA 2JIEA 3W24A 4U2YA 4K8HA 2D20A 5DXYA 1IV8A 4EE9A 3M1ZA 3RLVA 4UMBA 1Q6LA 4LBRA 2ZRUA 2A7NA 2WM1A 2Z6IA 1R9ZA 4GVGA 1XIDA 3VZYA 1Q2RA 1S5VA 2BFGA 3TFCA 4TVDA 2KZHA 3B8DA 3NOYA 2VR2A 2ZXQA 1VR6A 5HR6A 1VENA 4GACA 3GHRA 4PUNA 4ZQMA 3WN6A 3OU8A 3H70A 3CV1A 3VDBA 3TR2A 1OC7A 3O6DA 5I3KA 4IP7A 2C16A 3H2EA 3SCOA 4NL1A 4O13A 3GIYA 4S3AA 3LLFA 4WSJA 2EO7A 2PD9A 2FPTA 2CETA 3NSXA 4IOTA 3HU7A 3OA5A 2FVLA 3ZJ7A 3GTFA 3WH5A 4OOZA 3POCA 1JF6A 1AA1B 4K8GA 2E68A 1F9CA 2BOFX 1E4MM 1CLXA 2CZFA 1YDNA 3EGJA 3BOLA 1B3OA 1IR1A 1F6PA 3A64A 1SW0A 4DJFD 4FPSA 4Q4RA 2Z1WA 5I3DA 3H2MA 2YOCA 3OEXA 4R9OA 5EFDA 1ECQA 3PZGA 5DELA 2XFYA 2QZRA 4LVGA 4WDWA 3OHIA 5DBUA 5H8UA 1VZWA 1HJUA 2HEJA 3GU9A 2C15A 3DKJA 5IDZA 2C1IA 3MDWA 2RDUA 3WSUA 1BXBA 3MP4A 1XDJA 1YPXA 3GG7A 1C92A 1YE4A 4JQ1A 5IBXA 1QCWA 3CC1A 3LA4A 3STEA 1W5PA 3NXLA 4JKKA 4LSBA 1G7UA 5JUVA 5F4XA 3ANYA 5FF2A 1Q6GA 1EJWC 2V3EA 3L12A 4FNTA 1PKYA 3P7YA 4Y90A 1L8NA 2YKKA 2CZ5A 1PTAA 3G1YA 1OF8A 1P43A 1YKWA 4ZE5A 5AVHA 3DH7A 2WK2A 1A5NC 3PPFA 2E1WA 1O66A 3LEPA 3T2PA 3Q94A 2XFRA 1D8WA 4PMVA 3WFLA 3FCPA 1TVNA 5EYWA 4WOQA 2VHLA 2FFCA 3EX3A 2WLZA 1A49A 2YCIX 1VYRA 2PSNA 1R85A 3MVIA 3W2MA 3FHQA 3QPEA 4LWWA 3KBVA 3FEMA 4RE3A 3WQ4A 1ZNNA 2ANUA 3O1NA 5F2GA 1L6GA 2UY4A 2GQ9A 2VEMA 3WK1A 2QJGA 4TTUA 4ZO9A 5AOUA 2DT2A 3EWDA 3WLOA 4WCJA 2IUZA 4CQDA 4V27A 4XAGA 1UPPA 1A5AA 1ALDA 4X9SA 5E0CA 2PDWA 4L1GA 1UJQA 2C3ZA 4QJ1A 3JR2A 1X97A 3R10A 1QASA 3MCNA 2A7RA 1MW3A 1QW9A 5M3WA 4CU8A 4RE4A 2AL2A 3VOCA 2EG8A 1TV8A 2ZZ4A 3IVSA 3TN3A 4U31A 1O4UA 1QPOA 2YIHA 1Z6KA 4PUJA 1WYIA 3AXXA 1XD1A 5A1AA 1HL2A 3CB8A 1EJRC 3LERA 5AYBA 1XICA 3QGKC 4GOAA 4RDYA 1GOIA 2AOSA 4WJEA 1Z3NA 5D32A 5IRPA 2ZC1A 4UOJA 1WQ5A 1KXVA 1JG9A 4MG4A 3VCCA 4N2YA 1U1HA 1V77A 4XZWA 3OTRA 1EUAA 1XWYA 2PTDA 3ORWA 4W5ZA 4LQ1A 4Y9NA 3IV3A 4DAIA 1E0TA 1AFSA 3PB2A 4XIAA 3U3HA 2Y8VA 3WEMA 4M6UA 3IACA 3SUSA 2BGQA 3QPYA 2HISA 4S3EA 5E9XA 1DXIA 1CGVA 3F5KA 4WY0F 3VGBA 3BE7A 1HVXA 4HD5A 1BTMA 4EWND 1LTDA 1JD7A 4E2BA 2H3BA 4IMGA 5FA5A 3EWBX 5FAGA 1UP2A 3IGSA 1T6MA 4RNFA 1UC5A 3QTGA 3TYCA 2HV5A 2P5NA 5D30A 5AYXA 2REQA 3U6WA 3G1RA 1OABA 1QOPA 4PGLA 1MWOA 3GNDA 4LV4A 4O1BA 4TV5A 1KM3A 3HV8A 6TAAA 3RCNA 3EMCA 2PDLA 2CLHA 2VZVA 3FSTA 5F4SA 4XUGA 2BVTA 4E3VA 1UD8A 3KBWA 4ILSA 3BW2A 3TJIA 1H62A 2DSUA 3GG0A 3RX3A 3NQ7A 3WLPA 3K4AA 2H6RA 3T2QA 5HXMA 2V82A 4J40A 4HYRA 3RCYA 2ZXAA 2Y85A 1OGGA 1RLDA 4DJFA 2ZKMX 4NRSA 4D6IA 3S46A 4JIHA 1KXTA 5D2XA 3AUJA 5I3FA 1U5JA 1OCJA 4QP0A 4NJKA 2YDQA 2E6AA 3MY9A 5A6AA 4PMQA 1XYZA 3VIIA 4FK9A 1OIMA 3F5JA 4IIDA 1ECEA 4HNCA 1DIKA 3HPAA 2UZ9A 4P7LA 2YYTA 3K1GA 2BGSA 1E15A 2ASHA 1MDRA 2X05A 3NZPA 1XLAA 1BFNA 2HTMA 2A6NA 2JE8A 3STFA 4BHYA 1ISZA 1A5LC 3B8SA 7REQA 3WUEA 2XVLA 2FZNA 2Z2BA 2PU1A 3ZOAA 4JL1A 3F4VA 1TIMA 2WJEA 3N04A 2A0NA 1DWGM 1OX6A 4AD5A 5A6TC 3R0UA 3V5CA 4GGBA 1G6CA 3S5YA 3DYOA 1T40A 3M07A 2YXGA 2ODOA 3RNDA 4AX7A 4W8BA 2X7VA 4FHAA 1KTBA 1FXQA 3E9AA 1BEUA 2BXVA 4ROPA 2GVJA 2VWTA 4PMNA 3UXLA 4UOZA 1CNVA 2BASA 3MYPA 4ML9A 5DCDA 3IANA 2Q3OA 1VBJA 3OO2A 3L67A 3RFAA 4RXGA 1LLWA 1JCMP 3C6CA 4XD5A 4ZFMA 3UD6A 4X22A 3UR5A 2XVKA 1UMLA 1DWHM 3KDOA 4AZ6A 1QMLA 1IQ8A 3I3DA 3WJZA 1VEPA 1XC6A 1EA9C 1OFRA 1OYBA 3W07A 4JIEA 4KBXA 1OADA 2YL9A 3G77A 1A4MA 4LCQA