4LY4A

Crystal structure of peptidoglycan deacetylase (hp0310) with zinc from helicobacter pylori
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
290
structure length
290
Chain Sequence
AKEILVAYGVDIDAVAGWLGSYGGEDSPDDISRGLFAGEVGIPRLLKLFKKYHLPATWFVPGHSIETFPEQMKMIVDAGHEVGAHGYSHENPIAMSTKQEEDVLLKSVELIKDLTGKAPTGYVAPWWEFSNITNELLLKHGFKYDHSLMHNDFTPYYVRVGDSWSKIDYSLEAKDWMKPLIRGVETNLVEIPANWYLDDLPPMMFIKKSPNSFGFVSPRDIGQMWIDQFDWVYREMDYAVFSMTIHPDVSARPQVLLMHEKIIEHINKHEGVRWVTFNEIADDFLKRNPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords peptidoglycan deacetylase
publication title Characterization of the divalent metal binding site of bacterial polysaccharide deacetylase using crystallography and quantum chemical calculations.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Hydrolase
total genus 95
structure length 290
sequence length 290
chains with identical sequence B, C, D
ec nomenclature ec 3.1.1.72: Acetylxylan esterase.
pdb deposition date 2013-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01522 Polysacc_deac_1 Polysaccharide deacetylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.370 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase/deacetylase 4ly4A00
2I5IA 3CL6A 4U10A 2IW0A 4LY4A 4NYYA 4V33A 2XU2A 4NZ1A 2E67A 4NZ3A 2DFAA 1W1A1 3WX7A 2NLYA 2C1IA 4M1BA 4NY2A 1NY1A 1Z7AA 5BU6A 3HFTA 3RXZA 1W1B1 1V6TA 3QBUA 3CL7A 3CL8A 4F9JA 4L1GA 2CC0A 4F9DA 2Y8UA 2C79A 2C71A 1XW8A 1W17A 5JMUA 3VUSA 3S6OA 4OUIA 2J13A 4NYUA 2W3ZA 4NZ4A 4HD5A 4NZ5A 2C1GA 2QV5A 2VYOA 4WCJA
chains in the Genus database with same CATH superfamily
4CEXC 2ZX8A 3VIMA 4MFDA 3G2GA 2Z6JA 3AIQA 2PDHA 3C2YA 3GM8A 4EPKA 1BSLA 1KTNA 1KR0A 4NU7A 4JTTA 1K9EA 2ATMA 2IKGA 1GVSA 5FOOA 1EF3A 3L7RA 2D2OA 4M0XA 3FAXA 4L6OA 3B8DA 2AL2A 1P0KA 3I68A 2QUTA 3SCWA 5BRBA 9XIAA 4YTSA 4X61A 1EWDA 3GB6A 1K9DA 4A3HA 1SO4A 2FHBA 4ZE4A 4HMCA 4F79A 2OO6A 3GH7A 3LS9A 3R43A 4IMGA 1LBMA 3WD2A 4KH2A 4HP5A 1TZ9A 1WZMA 3KVJA 1E9IA 2J78A 3B3DA 2FVMA 1V0MA 1PHQA 5FSDC 4QLLA 3EGJA 1RJRA 1BGGA 4JN7A 3NGFA 3ME3A 5FAGA 1AJ2A 2L5HA 1VBJA 1TB3A 5DXYA 4XBSA 1I8JA 3T6CA 1U5JA 4JTKA 5FCZA 4PR4A 3UEQA 4D6IA 4ZBCA 1TA3B 3E2RA 3G1SA 3KTCA 4B90A 2VDIA 4ZO6A 4AYSA 5A5WA 4W8LA 3W71A 5LNSA 2RKXA 3LEPA 3FLUA 5FEPA 2INFA 3KBMA 1BYAA 2FGZA 2Q01A 4FLQA 4U5KA 1W6TA 2Q8ZA 5JBDA 4DYJA 2E3ZA 4NXSA 2NV9A 3ZZ1A 4O1BA 5AOUA 1RQEA 2DT0A 4JOMA 4WK9A 2DSVA 1WBHA 3L4VA 5C7VA 1DJQA 3JR2A 4NJHA 2XFWA 3RCNA 1ONWA 4XO7A 2J7DA 3O0KA 5DN1A 3BAXA 3WQ5A 4XV0A 5C71A 3NXLA 2AGTA 2WK2A 2ALDA 5LIWX 3EXTA 2JGQA 3FJLA 1OIMA 3ITOA 4ADUA 1GVRA 1DIDA 2IMRA 4NILA 3G3MA 5A2CA 2BXZA 4XZWA 3WEMA 3IJ7A 2J7GA 4ENLA 1GVEA 4HU3A 2YJQA 1DP0A 3SQSA 4WIWA 3TMLA 7REQB 4MWAE 4U31A 5EMJA 1CWYA 3NZ1A 3VZZA 4OV9A 4KEZA 5CJNA 3EA3A 2W61A 3TLQA 4AB4A 1XUZA 4KPLA 5CPLA 4CN6A 3P80A 3BOXA 4OFCA 1WDQA 4RV3A 1DQUA 1IR1A 1EH9A 4S1FA 3RLGA 4BK9A 1ISXA 2KZHA 3LNPA 3NPWA 2I57A 5TF0A 3BAKA 1JYNA 3KBSA 4PZVA 4ACZB 6TIMA 2E8YA 4D72A 4IMAA 3GXIA 4CN4A 1QNSA 3W2UA 4ZXLA 1EHAA 4J9JA 1GVQA 1TUFA 5CSUA 1DHPA 2Z1VA 3D3FA 3AHTA 2ZUTA 4JIPA 3QGVA 2DP3A 4S3FA 4JTEA 3UJFA 2PDGA 2IPJA 5M03A 3LOTA 2VR2A 4ZE5A 2QS8A 1W8GA 1E6PA 1KFLA 3P5YA 4WRHA 1JI1A 2FMNA 4QXIA 3S47A 5EYWA 3FJNA 3VVGA 3DFOA 1J5TA 4YTUA 4DWSD 3W02A 4Q8VA 5IHRA 3LPPA 1S2UA 3SCRA 2ZTJA 3U4AA 3LTPA 1U22A 4QJ3B 4JIEA 3HQPA 4QDPA 3I7QA 1BWLA 1W3KA 2GUBA 2WC3A 8XIMA 3NPXA 3ZR5A 4LALA 4GQBA 5CLTA 3VGHA 4FSAA 2WVTA 3VC6A 5BXTA 1UR0A 4O1FA 2BVTA 3C4UA 5H8MA 2OGJA 3LK6A 1LF1A 4LUSB 3AIUA 1SJAA 3V5CA 3B9AA 3OLEA 4QHRA 4IFRA 5B80A 4RZBA 3ITGA 2Q3OA 4Q8QA 1PSCA 2DSWA 3KRZA 2Z4GA 3BAIA 3WUEA 3N6QA 1Q63A 4L9XA 4FNSA 1PV8A 1ZAJA 4GBUA 8TIMA 4R7OA 1OSEA 4ZQCA 4F48A 2QMJA 3WBYA 2R9RA 3IJDA 4H9VA 6TAAA 2YA2A 2VD8A 1RP9A 3EXSA 3TYZA 1PZ3A 1UUMA 4CU8A 2D0HA 3W7CA 3R5EA 4D2JA 3ABSA 2PC4A 3U2EA 2OT1A 1XIHA 4DEFA 2RJHA 1NP0A 3GO2A 5DRIA 1F3XA 3OA3A 4QJ1A 1OX4A 4M5PA 3II1A 2D3NA 2ZXAA 1SW7A 1W3IA 3ARYA 1EF2A 2J9ZA 4HNVA 1Y7VA 2YCIX 3TZNA 5LGXA 4GUJA 4NKCA 1KFBA 1ZZMA 4OU1A 2GOUA 2EJAA 5I3HA 3AS1A 3L0NA 1GQIA 3ZJ6A 4ZQNA 3HG3A 1QCWA 3NDZA 1UP0A 4NXKA 2J79A 3HJZA 3M47A 3E5PA 4IISA 1OCJA 4AMAA 4LY8A 4JR5A 3EX6A 3N14A 5XIMA 1ZB5A 3F5LA 4NYUA 1XS2A 1XYCA 3EB4A 4HYWA 3ZJ8A 2PTXA 5I07A 4A29A 1AQHA 4HOWA 3BICA 4GIRA 2HMCA 1H2JA 3W7IA 4NJJA 4NJKA 4IIDA 3BC9A 4JBRA 2CXEA 1ZBKA 4A2RA 1EC9A 1QBAA 1TTJA 4BI7A 2DZSA 2Y7GA 4J27A 4CLMA 2I1OA 2JGYA 2E6FA 2CEQA 1I2PA 2XIMA 2QDDA 2WNWA 1HIZA 1PZ0A 2G96A 3WG6A 4PH6A 4K1GA 2REQA 2ZZ6A 1POKA 3U7VA 1NFPA 2VZUA 5A6SA 2FB2A 2OWCA 5F4SA 4E4FA 3N11A 3VOJA 3CL7A 4US5A 1JPMA 4UQ9A 3UWUA 4ZA0A 2A3LA 1M03A 5FEXA 5J04A 2F6KA 2HBXA 3SN0A 3GTIA 1JCNA 4TX8A 3PJUA 4FF5A 2X09A 2ZX6A 4F0LA 3N4FA 5XIAA 2RDTA 4REQA 2WLYA 1K7FA 3RN6A 4UTHA 1EWEA 3AS2A 3G0UA 3KAOA 5RUBA 4J2MA 2XN1A 3CIWA 1K77A 3GFYA 3O6AA 4A35A 4PUDA 3T0BA 4L9YA 3ICJA 3SY5A 1Q6CA 3IJQA 4S3BA 3SN4A 2PGEA 1Q85A 4UFHA 4Y7EA 5CBIA 5T26A 3CMGA 3TUUA 1LL6A 1RV8A 1Q7MA 1JYVA 3FJ4A 3GY1A 2PDXA 3L5LA 3O6YX 5H91A 4DZHA 3I6RA 4DWSC 3MV11 4KWWA 2QW5A 1NWSA 1VYSX 3KVLA 1T99A 4PTVA 1V0LA 4JTQA 2I9EA 4I9MA 1C3FA 2OSWA 1A5BA 1OD8A 5FI8A 3MI3A 4YLWA 1FXQA 1OQFA 1W0MA 2QIWA 4GZJA 5DO8A 1J8VA 4JIIX 3L66A 1XFCA 3U5UA 1V7YA 3ZIZA 1OCQA 4NZCA 4UBPC 5LA0A 1VBGA 1H62A 1VR6A 4W5UA 3CAQA 1Q5MA 3V75A 6PTDA 2VX7A 3LQLA 4FO4A 4S3KA 4XG1A 4UMAA 5AECA 4IHCA 1C91A 4GZ7A 2PTZA 4AZHA 4IQDA 3CL6A 3G6LA 3URNA 5JVLA 2X30A 3TV8A 2DJXA 1TVNA 3U9IA 4DZIA 2WMGA 1UKPA 3UR8A 2OTDA 4B5UA 3GC5A 4GUGA 1BKSA 3GXPA 3NTYA 3MO4A 2DUZA 3TC6A 3KW3A 5CC3A 2OO0A 3GSMA 3L4ZA 1Z41A 2QUVA 3AYSA 2MUCA 1VIZA 2VTFA 1JF6A 3E0IA 5HWJA 1SJDA 2X7VA 1E4NA 2OEKA 3DEQA 1W5NA 1HTIA 3LCIA 2G8ZA 4EKJA 2UY4A 1ITCA 1J0HA 2C0HA 1RXOB 1RA0A 4UR7A 4IP4A 4UTKA 4A3RA 2DZWA 5FJPA 1HP4A 4OVXA 4AH7A 2R1MA 2Y5EA 1TVLA 4PUUA 4W9TA 1JCTA 1NF7A 4UFJA 2BG5A 4CQCA 4DB7A 3W23A 4KGJA 3IARA 3BXWA 3QOMA 3VKCA 5K3VA 1PZ1A 3QXBA 2HK0A 3BQ6A 1O94A 2EHHA 1K8ZA 1LQ2A 3B05A 3M4HA 2BFGA 2J9XA 4C6IA 1UD5A 1WUEA 3WK2A 1QRQA 3WD1A 4CEUC 2GJPA 3TXZA 1IXNA 3EKZA 3N9SA 5TQLA 5I7GA 5I09A 1KB3A 4XISA 1BTCA 3MUIA 4O14A 3WK0A 4O0KA 4X0NA 3B9DA 2XPKA 2OFJA 2WHLA 3A64A 3LSBA 3W37A 4CQ8A 1K3UA 4ZQOA 3GU2A 1Q45A 1M5WA 1PUDA 1XLJA 3NPUA 1O5QA 2AGKA 3C2VA 1T5AA 4PMOA 5U4NA 3SSZA 3WDRA 1ZU8A 1CGUA 3WQVA 4TMCA 5CXPA 1WPCA 1P0EA 4R34A 2XIQA 2DIJA 2VFFA 2QPXA 1PHWA 3UWEA 1FWIC 2GGGA 4GVGA 5CZSA 4CD8A 3QLLA 1B3WA 1JPDX 3SRFA 3MV01 2LLEA 4WHBA 3FXYA 3WFAA 1DJHA 4YMZA 2WCAA 1PYMA 3I10A 3TJXA 1WXZA 3WLKX 1XQLA 1S2WA 3Q37A 1XYMA 3GIPA 2E1DA 4IMCA 1OFRA 4N9BA 4EXQA 3WJZA 1L6SA 5HJLA 3OGRA 1WB0A 3K30A 1IEXA 4O18A 1BTMA 2A85A 4W8BA 3UCDA 1CECA 3BV4A 2PCQA 2GJLA 1ECEA 1OFBA 1XD1A 3MMUA 1E0TA 4H7ZA 2HXUA 3FHAA 1KBLA 1TV2A 3P0WA 4IT1A 4IG2B 2FH6A 3W2LA 1V6VA 4NF7A 3WBAA 3WBEA 4J35A 2CWXA 1JG9A 2ADAA 4S2BA 1JNEA 4RZ4A 1U5HA 1J12A 5T91A 3LBCA 4NAEB 2D69A 1WX0A 1UWAA 1E43A 2VC9A 2GZXA 3T4WA 3S6DA 4C60A 3EDFA 1TA3A 4I9JA 4UQCA 3N34A 1NQ6A 3UJRA 1R86A 4AZBA 1KFEA 3W6LA 4L1WA 4AZ7A 3KCLA 1VHCA 1QU4A 2BSLA 1P5BA 1Z42A 2VGBA 1E70M 5H1WA 1G7VA 4XZ9A 3VGFA 2C7FA 1UMLA 1PKNA 4JN8A 2Z26A 4CNPA 3V0SA 3EEZA 3VDBA 3SCPA 2ZICA 4IF2A 2BHYA 2W92A 3IUIA 1E73M 1TO3A 3RLHA 2YW3A 1QPRA 4CGTA 3HG2A 1GKPA 3DG3A 1TV3A 3EKGA 3L21A 1YXDA 2VEFA 1FWHC 1S39A 4G7FA 3UWWA 1E4IA 5D37A 1B90A 3P67A 2J7CA 2G3NA 5AVNA 3F7JA 4DJED 4EWJA 3W25A 1J2WA 1WDSA 4R53A 3EEGA 3ZM8A 1QJWA 6A3HA 4AWSA 1G1YA 3H4WA 1CDGA 1UD6A 5HAOA 7REQA 3DGBA 1XLCA 3W7MA 2TMDA 1NVMA 2J6VA 2R1KA 3KWSA 1F61A 1MNZA 5DX7A 3NSXA 5ABFA 2XH0A 7ODCA 1BG9A 1UHVA 5JIWA 2WMFA 2XGBA 5DCEA 3DC0A 1YXYA 1UBPC 1BGAA 2VELA 4IQLA 3JUGA 2QCFA 3CHDA 4ACZA 2EPKX 2B7PA 4DBWA 1UZ1A 2GOKA 2EEXA 5E0KA 1P0NA 4QE5A 4U3AA 1YTKA 3N3TA 2XSAA 3G77A 2OU4A 1E51A 1MQRA 3TWBA 3UVAA 4CCDA 4LY4A 1YEYA 3HGOA 4M1BA 3LLFA 3AUOA 3MUAA 3PULA 5BRQA 3BLFA 2VEGA 3PZVA 3RR1A 1EBGA 3SY1A 3VGGA 3VM5A 2QAPA 3UJSA 2YR1A 2XJ7A 4GI4A 4WOZA 1Z9AA 3APTA 2WC4A 2B0MA 3D0CA 3ZWTA 4A6GA 2WMHA 3PPFA 4JFSA 3ZLGA 5HNTA 1MEHA 4PB4A 3B9NA 4MWAD 2WBGA 3W86A 1ZQ5A 3TW6A 5EGRA 3RPDA 5ABEA 4O10A 2DY3A 1F4AA 4NAFA 3MP3A 4E3TA 3HGSA 3NO5A 4Y90A 1TJRA 3CTTA 2CLHA 4LUSA 4J28A 3W0KA 5C7HA 2FQIA 3W74A 2FFCA 3T7VA 4DNMA 3UW6A 4M19A 2W63A 2W62A 1A5CA 3SCOA 2OKTA 1E0UA 1JDEA 1W9DM 1WDPA 5J8LA 1JCMP 3W7GA 1LOSA 3T0CA 2ZA3A 2E1WA 4JIHA 1FFQA 1I0BA 1QNRA 1XLDA 2OYLA 3UPMA 3GXNA 3VMPA 4CQAA 1O68A 4PN2A 2GSJA 3GVGA 3OIXA 4JDYA 4AISA 1GTHA 4UTTC 4QLJA 2BY0A 3GHUA 1B4KA 2WM0A 4LBSA 3AZSA 4LC6A 2JFEX 1KCXA 2DVXA 3MJYA 2D2HA 4D8ZA 1PX8A 2QCHA 4RW3A 3USZA 4GKTA 2B31A 1AK5A 4JQ2A 1OHLA 3DERA 4PMXA 2WSYA 3KXQA 3NSMA 1J9YA 1GYMA 4IOTA 5ECVA 3VO0A 1E6ZA 1UG6A 2TRSA 3BAJA 3CWNA 3IJLA 1ENUA 1PE1A 4I7UA 4IX0A 4Z42C 1QT1A 1IT7A 1DHKA 1W1ZA 1UIPA 3B8TA 1JIBA 3U2CA 2RJGA 4UTLA 1LG2A 1RR2A 3VU2A 1Q6RA 2GQ8A 4ZFMA 4H8VA 3IRDA 1LBLA 3C56A 3G24A 1EYEA 4KIRA 4AC7C 2PDPA 4NZ5A 4HA1A 2QJGA 3V35A 4HZ8A 4IH3A 3L9CA 1P7TA 2G3IA 2O92A 1UOKA 3VNIA 4EX4A 3A22A 4AD1A 2BWGA 1E3XA 1US2A 3S1WA 4EAMA 4P8UA 2NVAA 1F4HA 5DMLA 2PZNA 4DXVA 1J79A 4GK8A 1VZWA 4F4RA 2JKPA 4CCEA 3QH2A 4B3LA 2R91A 1QI4A 3W70A 3NG3A 4DJEC 3A24A 4GXWA 4GVFA 2NX3A 1V4YA 4AVOA 5TNVA 3VE7A 4US6A 1A80A 4MSSA 1OG6A 1GQLA 3OODA 4HMDA 4G8TA 1JCJA 4ZSUA 3TYEA 5CZTA 3RM9A 2WVVB 3TE9A 3V3WA 4D6HA 5DLCA 1GWJA 1J18A 4MJ2A 2WM1A 1PVNA 5K9CA 3MHUA 2V30A 3ZR6A 4RE2A 3S9YA 1W5QA 3V1PA 3RK8A 1E4MM 4ICMA 1CPUA 1JNDA 1U5VA 4DRSA 1EX5A 1EDGA 4H8HA 3GKFA 2Z2AA 3T4CA 1XKYA 2YLAA 5EKYA 4DO5A 3VPLA 1OJXA 3FIGA 2ZZ3A 4ORIA 3MVIA 2DVTA 3B8IA 1EUNA 3PPGA 4Q4QA 3PJTA 3LERA 3K4AA 2A21A 2C19A 3W22A 4BA0A 4GOAA 4GABA 1D3CA 5JQ9A 2CZFA 1T96A 2PE4A 1NOWA 1YQ2A 2Q02A 3XISA 1A4MA 4Z0JA 3ITTA 1TJPA 2OX1A 4JTFA 4O15A 5DMMA 9CGTA 3H24A 2XSBA 4P7RA 1TRIA 4MWAC 3RMEA 1H1YA 5JH2A 1KWGA 1E5NA 4A3YA 2ZFAA 7TAAA 3NXFA 3EA1A 4Y9AA 3HIJA 2VURA 1V3MA 1GKQA 4J2PA 4Y6GA 3VGBA 3VCNA 3W53A 4PULA 4L1XA 1C9WA 1NU5A 5HQMA 2WC7A 1H09A 4GA8A 1DBTA 3CV6A 3IAPA 4MPQA 4C7GA 1W9UA 4V1XA 4IX2A 3GH4A 3QN3A 4DZAA 3SY8A 4E5TA 4L9ZA 1KM5A 4IGSA 1FH7A 4J1OA 3M0MA 1M3UA 4F8XA 4ML4A 1OCNA 1VJSA 3EPOA 4GX8A 2V2HA 4GY0A 1MUWA 3AXMA 4E3VA 3GXFA 1SFSA 4NG3A 1XPGA 3LHUA 5BW6A 2VFEA 4HK6A 3IACA 2Y5JA 3L12A 5DANA 4DI8A 1VENA 3NYDA 2OELA 3UZ5A 1Q13A 3UYCA 4U28A 5LNRA 1KXQA 5IOBA 4KRZA 3VDAA 5I5RA 3CL8A 3POCA 3S1GA 3G1RA 1TUXA 1XGEA 2YDRA 4GG9A 2PWEA 4JNMA 3B0XA 1KGXA 4NT0A 4H8NA 4KERA 2QKFA 4JKKA 5KSWA 5G1TA 2PDUA 3UWQA 3VMNA 3TYBA 4AYGA 3UR5A 2V5JA 1VCVA 1XM3A 4S3DA 3VDCA 1X98A 3H53A 1HL2A 5CGMA 3W82A 5F2MA 2PD9A 1A5UA 3T44A 4GYPA 3BQ5A 1TPWA 3UESA 1BYBA 3F2DA 2Z1WA 3ZT6A 3OQ8A 3ZQ9A 3BG9A 1NFBA 4S3CA 5EBAA 1DIEA 2W79A 4GLEA 3M0HA 1MI3A 2PP0A 4TV6A 4JZ5A 3T9PA 2WV8A 2ISFA 3WH8A 2E5CA 5BZAA 2A3CA 4MM1A 4AVFA 2V3DA 4PB5A 4Y9MA 4DNHA 3O6DA 4G7EB 2NQZA 2P3ZA 1BF6A 1US3A 1LJYA 5CAHA 5JBFA 2NLIA 4PBGA 3BOLA 2CWNA 1EJSC 2NX1A 4JX5A 5I79A 3QHNA 1V79A 1H61A 4LC8A 3G1XA 3LGEA 3W7RA 5GJNA 3UU0A 1H7RA 5J5RA 2A0NA 3ZSSA 4XZMX 4RR4A 1E0XA 3UCQA 2PFHA 4OBRA 3KFTA 4LB3A 3Q45A 3BWWA 2CW6A 3NAVA 3AXXA 3G1AA 1RQBA 1X7FA 3F4NA 1AMKA 4RV8A 1SMAA 4JTUA 2IKHA 2XGIA 3L4UA 4XAPA 4HNCA 1XSJA 3FKRA 2QULA 5F2IA 1NWTA 4OGZA 3G1FA 1CXHA 2F6UA 2VR4A 1JVNA 3JS3A 1C8YA 1TQJA 1FWRA 3W1TA 5HUOA 3P8IA 2VGIA 3RM4A 3QR1A 3H55A 1KM2A 4RJEA 3VYLA 4IPLA 1R3YA 4JGDA 4IG2A 1QNQA 3QZAA 4DWSB 1VLIA 7PTDA 5H8UA 1JULA 2G50A 1W17A 4QG8A 1EX1A 1XRVA 1OGGA 1RPXA 4R5EA 3P84A 4QDMA 1X1NA 1ZJAA 2H3BA 1EGMA 4AIEA 2QPUA 4M3PA 1A0EA 2YA1A 5JXQA 5GNZA 3CPRA 4XSMA 3AIWA 3ATYA 4PMJA 1JZ7A 2GGHA 1UP2A 3SW6A 3WO8A 1NELA 3ZLFA 3T2PA 3W1LA 1REQA 4ZODA 1V0KA 3O6CA 1QWGA 2E25A 1XIJA 3EPNA 3TFCA 3SFWA 1SW0A 5BOEA 3AU2A 2O56A 4FF7A 4YN5A 1WDDA 3WDIA 5ECUA 1X97A 4H83A 1HJWA 2GVGA 2YXOA 1FHUA 1B30A 4JAWA 4O13A 2BX7A 3B0VC 3CBWA 2ZRUA 4JX4A 3W1NA 4DJFD 3CC1A 3KZSA 1DWGM 5DT5A 4AG0A 2TSYA 4FLOA 2DSUA 2XWDA 3CTLA 4HU0A 4HVXA 4A3QA 4QE4A 1KRCC 1U1JA 1A49A 1R3VA 4FXSA 1OC5A 4IM4A 1ZAIA 4HD5A 4F2TA 5JBEA 3WBWA 3DX5A 1QR7A 4UB9A 1DVJA 2C0AA 1DWFM 2YCJA 3VABA 1R46A 3EWZA 4NNCA 4QEHA 4MYAA 1AH4A 3R25A 4QNEA 5LIUX 2OXNA 3IWPA 1YKWA 3EMCA 4HA0A 5BOOA 3IVSA 5CPOA 3STFA 4F0HA 5HJXA 4LCQA 4WVXA 3WDHA 3LZ5A 1HT6A 2PGFA 2C15A 1LCOA 1QI3A 3NZRA 1AD4A 4JIRA 3RCYA 2OCZA 3REQB 2GWGA 3W7JA 2J25A 3CHVA 2D2JA 3VOFA 2QIIA 3LNMA 4JY8A 3WFLA 2WZTA 5K4XA 1W1B1 5ABGA 1R2TA 3SCSA 1JZ5A 2GDVA 2DZPA 1WXYA 3LPGA 3PUOA 2OSYA 3SRKA 1VHNA 4Q8PA 3SCNA 3ITVA 5E9XA 5I3DA 3VX0A 4H6RA 1TPUA 3EX2A 2MANA 4QG6A 3MHFA 1XRFA 5D9OA 2IS7A 3WELA 3CAKA 4GXMA 1WKFA 3IRSA 2CERA 1F07A 2EPNA 4JHOA 1K6AA 3DBNA 3SB0A 1GK8A 1SFLA 3DH7A 4HT3A 2QUNA 4JTIA 3KUMA 1S2CA 1Q7QA 3FGCB 5G4WA 2Z6IA 3LBOA 4QIUA 4OBSA 3W76A 3TN5A 2EG8A 2Y0FA 3CASA 3UZYA 4NX0A 3A4XA 4LSBA 4B4HA 1WBJA 3L4YA 4FNQA 3H6OA 1XWYA 3W85A 2GL5A 1O12A 1GQJA 1PIFA 2ABAA 1SMDA 3SRHA 1G69A 4GY7A 1VS1A 3RFAA 4Y2WA 1F3WA 1Z69A 1AVAA 3K8KA 5E0FA 1CXEA 4V2XA 4OJYA 5C8BB 3RX3A 4PB3A 5EMKA 2A79A 3CXOA 2FTWA 1ML1A 3MI2A 3PBVA 3BLDA 4W7WA 4FIRA 4EVZA 1EZ2A 2FHCA 3H2EA 1U30A 3UWZA 4Q32A 5A8NA 2IPWA 3E3HA 3HA1A 2WHJA 3N2BA 2O9OA 1GPFA 5MHBA 4QX4A 3TQ0A 3VILA 3URAA 3W2MA 2E67A 2WAGA 4E8DA 5CG0A 4QITA 5FF4A 1XYBA 1OBAA 4IZGA 3EOUA 4ZB5A 4XVDA 2Y70A 2I5IA 5FJIA 3KBNA 2E9LA 2XIOA 1HO4A 3TN4A 3PS7A 5A8GA 3MP4A 2QUMA 1BXCA 2A7PA 4QRNA 1FWNA 1LRTA 2ZUWA 4DLFA 4W7VA 1JUKA 3VC5A 2E28A 4JTHA 1IZCA 3AHZA 3I6EA 1FWDC 1B9ZA 2ANUA 4U3CA 1KGWA 3O07A 5A8OA 3HPXA 1GOMA 4LAZA 1KM1A 4ZQPA 3QMRA 2ZZ2A 3BL3A 4H9UA 2CKSA 4XAZA 5IXEA 1EFZA 4DJFC 4H9MA 4U33A 4S2CA 3BURA 3DDMA 2HNHA 3UWVA 1DJWA 1NOUA 2E9MA 4IPPA 3BLLA 4D6GA 4L61A 2FDMA 4OV4A 2NV2A 1VBRA 1XIDA 2IXVA 3NEVA 1TYGA 1FXPA 4MF4A 3MMDA 4E8GA 4KETA 4BQ4A 4BFAA 3WQGA 4F0KA 3WQ8A 3DKJA 3WH9A 3LCHA 3ARXA 4X9YA 1EA9C 4XTDA 3KLKA 1SZFA 2WVVA 4TVCA 1EJRC 1GGOA 1KGUA 2HROA 3SAZA 3PAJA 2I17A 1UCWA 4LT9A 4B5XA 3S9ZA 2BGNE 3MWAA 2X16A 2PGWA 3N12A 3T78A 3D6NA 5CZKA 5FD0A 3TQPA 4WY0B 1Z44A 2OGYA 1YDVA 4LAMA 5BXRA 1RBOB 2CLFA 2V38A 3VM7A 1LOLA 4C6OA 3KL3A 4QS6A 3GDLA 4HSNA 2VEMA 2VWSA 4PODA 3AXKA 3UQNA 1F6KA 3VOGA 3KVMA 1GOKA 5ABHA 3UXIA 1X1ZA 4RPPA 1W54A 2UY3A 3NFUA 3W9ZA 2DJLA 4UTUA 5F7UA 2NQ9A 2OMAA 3LI1A 4IGHA 3URBA 4FOJA 3BSMA 2IUZA 1RD5A 3SGZA 4BCEA 4H8UA 3EB2A 1H7OA 3MO7A 1H63A 1W1A1 4J3XA 5DF0A 1AUSL 3IV8A 1ZLPA 3I7SA 5G2IA 3ZYZA 4RE4A 3QPYA 3M6DA 1SO5A 3F4DA 2Y85A 4KKXA 3W1PA 2H6RA 1EJXC 4X22A 4DJDD 3URQA 3NUKA 3PWIA 2Y88A 1SFTA 4K3ZA 2G5WA 3CH0A 3U0HA 4XBJA 3TTSA 1VFSA 4RL3A 2WKJA 1GKRA 5IBXC 3E2VA 4MVAA 3ARZA 5AC7A 1UWIA 3GW3A 3MCMA 4ICCX 1MEIA 4D6JA 1Q3NA 2CKRA 3EWXA 3TC7A 4Q4KA 1EIBA 3AHYA 2YIHA 4R9XA 5EB8A 3UG3A 3QVQA 2J6XA 2G41A 5LXEA 1GOWA 2CLEA 1JRBA 1R2SA 4KEMA 4PBEA 2R8WA 3E1F1 3L4XA 5EMYA 4GVHA 2JQXA 4CNSA 1A0CA 4C6EA 3N4AA 4DO6A 2HDJA 3LMZA 2PDJA 3NQEA 4YU1A 1HXJA 4ERGA 1A3WA 3N2TA 2QJHA 4Q4PA 1DWHM 3WUGA 4HPNA 2V63A 1VKFA 2VXNA 3B9EA 3TU9A 2EPLX 4K8HA 3NNTA 4QAIA 4UFIA 1KM4A 4JD4A 4UFKA 4KS0A 1PBGA 3CPGA 1J0JA 3E2SA 3W1XA 4IFKB 5AY7A 1H50A 1P6WA 3GR4A 5BXSA 1P43A 4GI8A 3WNOA 4NRRA 2PI6A 4IXHA 3GZ3A 2DPEA 4LFYA 1FY6A 3KCOA 3QFEA 2D24A 3M41A 2QCDB 2RH9A 2XHYA 4TTUA 1V77A 4B5TA 2PWGA 3A9BA 4HYRA 1RD6A 5G1YA 4X2PA 2XTKA 3PB2A 5BWFA 4HIBA 4HU8A 4Z17A 3P0XA 2J4GA 4P61A 3QQ1A 3VGEA 1WA3A 3MHGA 3SCTA 3BGJA 1V3HA 3PSWA 3H2CA 4MFEA 2A7NA 3KZPA 1GG1A 2CHOA 4KT2A 2J88A 1X38A 3T07A 4HNTA 2XVKA 5D4YA 5BMXA 2H8XA 4WZHA 3TQVA 3CAVA 3KRSA 4RNHA 3LRLA 3W84A 1UW9A 4GCXA 5HPOA 3OPSA 1AL7A 1M01A 1ALDA 2Z0IA 4HZMA 4P7LA 3NYZA 4H01A 3DU0A 2BDQA 3U6WA 3M9YA 2ACSA 1QPQA 4ZCWA 4R9OA 4G7EA 5GJMA 2WXDM 3OOQA 4V1YA 3ONCA 5FAJA 2DQWA 3SIMA 4YHGA 3Q67A 2AKMA 1JPIA 4FS9A 2NUWA 5LA1A 1XV8A 3H22A 5HWNA 1EP1A 1Y5WA 3LCLA 3ECQA 2UWFA 5M1TA 1GZJA 3SUVA 4YS1A 2FKPA 3UA4A 3KOXA 4IP5A 3BMVA 4AD3A 5IRPA 3ERPA 3E0VA 1I0DA 1KNWA 3FFSA 2E6DA 1ONXA 1IEIA 4NIRA 1JDFA 3MPGA 3O05A 1I2OA 4N9CA 1WE5A 3RCMA 2NSXA 5TBOA 2CNCA 1UH4A 4N02A 3A13A 1PTAA 3HU7A 1K02A 3KP0A 2NXIA 3BGAA 3CHEA 5D33A 5BNKA 1Z6KA 3W4RA 1XIGA 4C6KA 4CQ9A 2CPUA 4YPJA 3ANVA 4EF8A 2V3EA 1C8XA 4UR8A 1NY1A 2BLEA 4N4QA 1GYNA 4P8WA 3EA2A 3GDMA 3VIPA 2WZIA 1AQMA 5I2UA 3RJYA 1XG4A 3UGRA 5KMYA 3WJXA 4AW7A 1EKOA 4J4KA 2ATSA 5D9PA 4V15A 3TN6A 4DWSA 4ROQA 1E40A 2YBTA 4MIMA 3UNTA 1M41A 1GOQA 3QOKA 2YZ5A 3U2OA 4PCTA 4PCPA 1W32A 2CLLA 1ISVA 1A5AA 3M5YA 4F2UA 3UPBA 4DJDC 2VOTA 4MWAB 1C29A 4OUIA 4UTWC 2Y1HA 4B5VA 3V1HA 1FP8A 4UOZA 4GQRA 3H26A 2QLYA 1CGYA 1CLVA 1GONA 1XBVA 3UD6A 1UZHA 3PANA 1S1PA 1KLYA 3A4WA 4RXGA 3CEUA 2VC7A 2BHZA 3DKLA 4US5D 4X60A 4C6DA 5HOSA 3KBWA 3OLDA 2QVNA 1R7AA 2X1RA 3AZRA 3EWDA 5G5IA 4AHOA 1H5VA 5AC8A 1KV8A 1W3TA 4QE1A 3VD4A 4DPQA 2WNZA 3COTA 4CQDA 1MMFA 5HXMA 5AYIA 1I6NA 1ZFJA 3DI0A 4P2VA 1L8PA 4W85A 3G1VA 3PBUA 1ZY9A 2ZDSA 3R6IA 2OLHA 4AHQA 4LS0A 1GEHA 1PKLA 4NQ1A 4ZGYA 1Q7ZA 1AH3A 4GQGA 4LUJA 4KFOA 4AZCA 3SZ8A 3VINA 1P6BA 3DFQA 1WNOA 1GOOA 3KOWA 2YGYA 3UYIA 2VDHA 4QFUA 1D8WA 1VBHA 3KX6A 1G94A 3PZIA 2ZYFA 2BVDA 2ZOXA 1A47A 3RGTA 4HPGA 1UIOA 1V3KA 4GIEA 3QKZA 1G9HA 2WLZA 2CBJA 5HMDA 2XM2A 4K37A 2QGYA 1UD2A 4DBSA 3HTWA 3WZ0E 4EIVA 2QT3A 1QBBA 1O95A 3VDGA 1MZRA 2UBPC 2PWFA 4ZQRA 2E9BA 4LVDA 3WNNA 3S5YA 1LTDA 1WZKA 1MYRA 3RJXA 8RUCA 1KXTA 3K13A 3K8LA 1GW1A 4IUGA 4KRTA 5HA7A 3R4IA 1FDJA 1EOKA 3H21A 2I9UA 4KGLA 2GSHA 1GNXA 3S0CA 1MVYA 1H11A 1IHIA 3PF3A 4PUWA 3OBAA 1IXQA 2ZRXA 3H2MA 1O1ZA 1FWWA 2DFAA 2JEQA 3S9IA 5D2YA 4PUEA 1YNQA 3DFPA 1N7KA 3VKBA 5I3GA 3NQVA 1JL8A 4E0CA 1QWKA 1XKJA 2XH7A 3QC0A 2ZWZA 2RDUA 1AJZA 2PBGA 1J01A 1HJSA 2YDAA 3CUJA 3TYDA 2E6AA 4DI9A 5M2FX 3QY6A 4JEJA 3P14A 2CITA 1TFVA 3EX4A 2WSRA 1DPMA 1B5TA 3MSGA 3OJGA 4DWDA 3EX1A 4CCZA 1JI2A 2DH3A 3PZUA 5GQBA 3HQOA 2D0GA 3CS2A 3KTSA 2C1IA 2WSKA 1UZDA 3CM4A 1WKDA 2VNCA 4RW5A 2WOQA 2X0HA 3WEZA 1FTXA 4JDBA 1G4PA 2OOFA 3RRXA 3HOJA 1TE6A 4LCSA 1ZSXA 1CT5A 4RNIA 1H51A 1PB0A 3WBXA 3O63A 4GYJA 5HQLA 3QEZA 4PEKA 4B2DD 3ZVHB 4LUTA 2AAMA 3H4XA 4AX7A 3BV7A 1HKMA 1XRSA 3DHUA 4CU7A 3F5KA 4DY1A 5IDZA 4V28A 2QV5A 2YXXA 1XLLA 1XDJA 2FZBA 1RHCA 2NUXA 1VBUA 4Z08A 3CUGA 2WHMA 4BS0A 3MY9A 3DCPA 3QBUA 4KCUA 1H7WA 3UWYA 4I9TA 2QCMA 2CLPA 1GQKA 5IFPA 4MOZA 1IR2A 1K4HA 3KOYA 3WLMA 2OEJA 1NARA 3IGXA 2OLAA 4I3GA 3PJXA 1MW0A 2YFOA 3UVIA 3E74A 4LUYA 1MSSA 5CH9A 3ARRA 4RE3A 2ZADA 2D20A 3PWGA 4GVIA 1UWUA 2P53A 2FTPA 3H7UA 2KAUC 2V3FA 3WLLA 3KLLA 3DESA 4HA3A 2PWHA 3TCSA 3CV1A 3RO8A 3BG5A 3W6YA 4GI6A 4HJFA 3GNOA 3TR9A 1E6NA 1LQAA 2IQDA 1YHTA 2QHAA 1Q6DA 4IPNB 1AA1B 1H7PA 1FWSA 1L2QA 2BOFX 4NSBA 3WH7A 1UJQA 1Z48A 3NQCA 4L6HA 1AZ2A 1TTPA 3HO8A 1JUBA 2ZRVA 5E6YA 1W1YA 5MKGA 3CO4A 2W66A 2WVUA 3K1GA 3VD5A 1GVYA 1S3TC 3VX1A 4BWLC 3N6HA 2X0YA 2HNEA 1HJUA 3VAVA 3QGAC 7CGTA 3VNJA 1FCQA 1YIXA 3W7DA 3RAOA 3PZNA 3P82A 3WNLA 1S5VA 1SZEA 4CNNA 5AYBA 1XC6A 3B8SA 3BCFA 3N25A 4LV4A 3GC4A 2NQHA 1TELA 3PWAA 4B3ZA 2YA0A 2GFTA 5LHEA 4IICA 4IGNA 5LYRA 1TWIA 4XB3A 4IJCA 1FUYA 1IV8A 3CPUA 4WY0A 1A4LA 2CZ5A 4LVGA 4XUGA 4PL1A 3CT7A 4KBXA 3GS6A 1XCFA 2PDCA 1XF0A 3CV2A 2PMQA 3H2NA 1RVKA 2ZC1A 3CQKA 4RNJA 4A8NA 4A8IA 3W00A 4DM1A 1NDWA 1V03A 4LXFA 5IM51 1LZOA 3CUZA 2DH2A 2OT0A 3NQDA 4GJIA 1UZ4A 3VD7A 1PTDA 3HPFA 4EACA 3M1ZA 3QGKC 1SPQA 3F5JA 1SFJA 3GFXA 3K2GA 2ESCA 3NVTA 1MXDA 1TVPA 5E5CA 3PB0A 1F8IA 3QV7A 1UR8A 1ZAHA 1A53A 2R82A 3UXAA 5BYWA 4XWUA 5BU9A 4M6QA 4QSHA 3KOFA 1P0DA 2AQVA 4IWWA 1HGWA 1M68A 2IW0A 5LXXA 2D73A 3MA8A 4K39A 3C0JA 1I9CB 1P1MA 2AOSA 4E8CA 3NQ8A 5JU6A 1F74A 2DVUA 2VHLA 2C79A 4C5YA 1PZ2A 4HCDA 1EOMA 1O4UA 4UCGA 1Q4WA 1XIIA 2VEIA 4ZO8A 4S3GA 3AHXA 2PODA 3MMWA 4O8AA 3WDPP 2QVHA 4QSFA 3H8AA 1XSIA 2ZXQA 4JQ3A 4MJZA 4QTGA 3TIMA 2J75A 3SGGA 5FACA 1JD7A 2XG9A 4HHMA 3RYSA 3I7RA 1W9PA 2JEPA 3P74A 3TDFA 3PBWA 1F2JA 4O0ZA 3WF0A 2F6XA 5CCZA 4HK5A 2A2IA 3P7YA 3UP8A 1XISA 3C8NA 2YZRA 2X0SA 1IEVA 4UTTA 1ZNNA 2WMKA 4LU0A 2ONEA 4U5IA 1W5PA 1BFNA 3LPFA 4JHZA 3I4KA 3CJPA 2P1FA 5AVHA 4GISA 4O4VA 3T8QA 2PLKA 1VD6A 4RE0A 4IFKA 3O15A 3R8RA 3CV7A 2CBUA 2BS9A 1NOFA 3ES7A 2CHNA 4AIUA 3IK2A 3BAYA 2ZDRA 4FR1A 2QCDA 4X63A 4YVVA 4MPKA 2PEVA 4F66A 1QNVA 1ZBCA 3E12A 3L68A 4IPIA 3EOLA 4MADA 4YYCA 3DGRA 2PP1A 4L64A 3ABZA 2J62A 4Z2LA 1Y5VA 3I3EA 2FZ8A 3DYPA 1CX9A 1J6OA 2DZVA 1M7OA 2Y7EA 1FWJC 1PS9A 5DT7A 3IK4A 3UXLA 5E09A 3VNMA 4B92A 3OA5A 4OHQA 1XDLA 5M17A 1MUMA 4O1DA 3WQCA 1W1PA 1NAL1 4G6CA 4KCTA 2RAGA 4ZOCA 3TROA 4LYQA 3W7EA 5FA5A 3ZT5A 3UCCA 2NLYA 3CK5A 1M1BA 1E72M 4XQ6A 1FFRA 2Z2UA 1V02A 3CHCA 3LSCA 1RBLA 3CU2A 2ZQ0A 3NOYA 1XCWA 3EZ4A 2AAAA 4NYYA 4EE9A 4N9EA 2VM8A 4P7NA 4UFLA 5TD4A 3G22A 4RDZA 3W26A 3WLPA 3RU6A 4XX6A 3FK4A 1TREA 3CYVA 1CTNA 3LLXA 3WDJA 1EJWC 1YBQB 2HVMA 4BEUA 4AD0A 3SFKA 2BXVA 1B54A 2PPGA 2PRLA 4AU0A 2E5DA 2ZKMX 3PUEA 2DSKA 3MP5A 4M82A 1EC8A 1WXJA 2E68A 1CIUA 3GX9A 1E6RA 2OWWA 4M56A 4FNTA 4K38A 4FOKA 3BLIA 1H7NA 3P60A 3GXDA 3KDNA 1IIGA 3TTYA 4E2BA 1CB2A 3CNYA 4KFNA 4XAFA 5JMUA 1B9BA 3N04A 4M6UA 1KKOA 3R89A 2ZUMA 3TK7A 1BPLB 1ICQA 1PXGA 2TAAA 3UZJA 4PTWA 1H3GA 4C5ZA 3C52A 4L7ZA 4W93A 4UTIA 2PF8A 3SDOA 1LROA 3GTNA 1G5AA 1OFOA 2FGLA 4MWAA 4ADTA 4ERIA 1EUAA 1ISYA 1ADSA 1DORA 5HWMA 2XINA 1L6FA 3SQMA 3GXTA 2DZXA 5LHFA 1NWRA 3NIYA 2P88A 3K8MA 1BF2A 4TQTA 4HK7A 1WDRA 3THUA 4Z2HA 2XH2A 1SZNA 1W3HA 2A6LA 4UWMA 2BV9A 3T0DA 2WJEA 4HQVA 2YCEA 2VEPA 3TN3A 3OVPA 3GFZA 4J3WA 2ZZ4A 2V5CA 1AW1A 4LNYA 4CKQA 4R7JA 5I24A 1TKKA 1T40A 1VLWA 3MT1A 4PUJA 4W7UA 2R1LA 5XINA 1B2YA 4MNMA 4B16A 5D2TA 4JS3A 2PBOA 3WK3A 4NASA 2JF6A 2BOGX 1HJVA 4DF0A 2WJZA 4GHRA 1R38A 2PLCA 2FB3A 3M0ZA 3BLOA 3AS0A 1E0VA 3OG2A 4O4WA 1SSGA 2YBVA 3NL3A 1QK2A 3LM7A 4RKAA 2ZXBA 1L6GA 3VCCA 2OG9A 4ZTXA 3QY8A 3N9KA 4UQBA 1U2YA 4HA4A 5D03A 2J7HA 3DG7A 1S2TA 2OPJA 3T2OA 2CU0A 1D3GA 5CBJA 1UKSA 2O7SA 4L4LA 3AUJA 5F2GA 4H9XA 5CQ1A 3PR2A 3NDOA 4H3DA 5CZJA 1EEXA 2DZAA 3MI6A 3VKKA 2ZX5A 1JF5A 5BOFA 2ZRWA 2OLSA 5E93A 2C14A 1RJQA 2QUUA 1RCQA 3QPEA 4MGGA 1XLMA 2HVNA 1A5LC 4QCEA 1DXEA 1DIOA 1X6NA 3ARPA 2AL1A 2QYGA 4LGXA 4PMDA 3DFNA 1W2VA 4E4PA 4D6FA 3HMCA 2ZXDA 3MWCA 1OC6A 4CVUA 1DV7A 2OOGA 3DIPA 3SR7A 2DQXA 3FEQA 1CNVA 1MW1A 3POHA 3S5NA 4P8VA 1R3TA 4AF0B 1RJPA 2Q3RA 3NDYA 3CIVA 3V0UA 1PTGA 3BG3A 4CN1A 4C6LA 5DELA 2Q8XA 2C1HA 3RUBL 1MXSA 2JIEA 4GXPA 2XZ9A 5K9XA 1OIFA 2R1NA 3RDKA 3W3OA 5CAKA 2V81A 1ZBWA 5AZ0A 1EDQA 1QI2A 3OBKA 1W8SA 1VJZA 1KXVA 3A23A 1HKWA 3PPCA 8XIAA 1VC4A 1XHGA 3F4VA 4JYDA 1RSCA 4CCCA 3A4AA 1XH2A 4UTFA 4XZHA 4LVBA 1HNYA 5T9BG 1XBZA 4O1EA 3N1AA 1GVFA 3EWBX 4P7OA 1WOBA 3VIOA 2HTMA 3AALA 3EDKA 3AS3A 2BGSA 1MXGA 1UR4A 3PC0A 3PZOA 3DAQA 4M7SA 1XW8A 4NL1A 1TIMA 2E77A 1BHGA 5I0DA 2VRQA 1BSIA 1OYCA 2G95A 2A1YA 1ZS2A 4C6QA 4R7WA 3KHJA 3AMDA 3CQJA 2W5FA 4LBRA 3OHMB 3HGJA 3ZSTA 4WGXA 3B40A 1HX0A 4CD4A 4MLRA 1LM1A 1G7UA 6CGTA 1QNOA 2OSXA 4WXZA 3ZVHA 2CLMA 1H5YA 1TPB1 4IXXA 4BQ3A 3AC0A 3WK1A 3UGVA 1P1XA 1YTEA 5AKQA 3T42A 1MUCA 5EA9A 3B4YA 1IWAA 3W1QA 4JTAA 2YB1A 9RUBA 5FKYA 2O7QA 1A5OC 2O4MA 4UFMA 4MG4A 2EGZA 3QTGA 4UQDA 3CZLA 1CXKA 1M65A 2WWDA 1UPMB 2DU2A 4IP7A 5CEWA 4PUKA 2W9MA 1S5MA 4R3UA 2WZHA 3XINA 1VFOA 3A12A 2WVSA 4P8XA 3WF4A 4WGHA 1EIXA 4WF7A 3NQAA 3RF9A 4YTRA 5FJTA 4MJMA 1YE6A 3UY7A 5T8GA 1R30A 1SYTA 2P8BA 2VKZG 1EYWA 3ALGA 3P93A 4UOJA 2BNJA 5I77A 4PCFA 3ELFA 1OINA 3LTYA 1LWHA 1JGMA 3AIBA 1HKKA 5HULA 2QAFA 1DQXA 2ISSA 1YDYA 1LLOA 1T8XA 4Q3MA 1VQTA 1FDZA 4Q7BA 3IGHX 5A6LA 3WMSA 2VWTA 2V82A 5C54A 1QOQA 3HN3A 1S5WA 2ISVA 4I5UA 4MLJA 1FKWA 4YIWA 4Q4MA 5F4WA 3LCWA 4A3UA 1XXXA 1D7KA 1QASA 1VPYA 1UP3A 1NDYA 2C16A 3IPWA 1F6PA 4QROA 4DX3A 4O52A 3BZJA 1C90A 4GD0A 5ABTA 2VFIA 5EU9A 2FPYA 3CEPA 5FF3A 1KBKA 3W81A 5LNWA 1S46A 1K03A 2F7FA 6ENLA 3HPAA 3R1ZA 3LLDA 2Y8KA 4MKVA 4N2YA 2JBMA 3AICA 1H1NA 1TCDA 4UTJA 1NSJA 1UR2A 3TLLA 2YYUA 2P10A 1JFHA 4I8YA 3AIEA 3SQLA 3GTFA 3IGUA 3GUGA 4POCA 4EXAA 4GO8A 2VC6A 2DEPA 2DDXA 4K8EA 4N6EA 1XLIA 1KQZA 5HINA 1R3SA 1F6YA 3WH5A 2P50A 3R0UA 4CQBA 4EP8C 2VRJA 3LYEA 3BW4A 3DUGA 3HPZA 4HOXA 1JQVA 4AVNA 2ZE0A 1NWUA 1NTHA 3WF2A 3ZMRA 1RP8A 3KRBA 4C6JA 3KCJA 3A4JA 2J66A 1R9XA 5BCAA 1PWMA 3WUBA 3WLSA 4HZ7A 4LRTA 4A2SA 3QPZA 2DGAA 4WY0F 3JZEA 4OWGA 1A3XA 4MZ1A 4HOZA 1SO3A 1POJA 4OZOA 1D8CA 3BGGA 3PZ9A 3VUPA 2BHUA 4Y8EA 4M24A 3TR2A 2WJDA 2SFPA 3MB9A 3W7KA 3WENA 2VGFA 3H2FA 5FIPA 4HPJA 4Q8TA 4QG9A 5EL1A 1ODUA 3TSBA 4NZFA 1OZMA 2OZ3A 3QRHA 2I5QA 4ZL1A 1L0PA 1YDNA 4LUIA 4A8RA 2C13A 4PFMA 3GU9A 4WJEA 2YXGA 4FXRA 3IAQA 3STPA 1NF0A 4GC4A 4BI6A 2V3GA 1XLHA 1E6XM 2YL8A 4BQ2A 3FEMA 3PNUA 3ITXA 4MNLA 3BOFA 2WSQA 3MS8A 1K70A 1PIIA 3RPMA 4IPJA 1EB3A 3G8RA 4GIYA 5HANA 3W83A 4LEQA 1I75A 3UG4A 1KBJA 1E1EA 5A8QA 4DVOA 1VYPX 5SWUA 1J93A 2RGMA 4LEFA 1NEYA 4YTQA 3M0XA 4UNLA 3W2KA 3AYVA 2VCBA 2KX9A 1YNPA 5IFTA 1FWCC 2R24A 1IT8A 1NP2A 2WYSA 2INEA 1AODA 3N6JA 3WJYA 3GHRA 4Q6JA 3K1DA 1UKQA 5C9WA 3V18A 4JTRA 1UASA 4XUYA 3TTQA 1W37A 4MKNA 4BQ5A 4GZEA 3ANUA 3N9RA 5I3KA 2F9RA 1DE5A 2V2CA 4YTTA 4JNZA 1JXJA 4KF1A 2P76A 1B31A 2OB3A 3QY7A 3FXGA 3LXAA 2VX6A 3UBPC 3WNKA 1X1OA 3MKKA 2W4XA 2R94A 4G9PA 5JUVA 3W1RA 1ZJIA 4Z1YA 4O1CA 1KM0A 3KS5A 1WAWA 4GKLA 3F2CA 2QPSA 4DJFA 1FWTA 1BEUA 4FX7A 4YYFA 2XDFA 1K8XA 2PS2A 4QLKA 3W1UA 3UNDA 1ZTVA 1U83A 3KRUA 4JNYA 4Q22A 4EWND 2XZ7A 4HGXA 2Y24A 2HZGA 1UKTA 3EDDA 2Y7FA 3WQOA 1PJ9A 4ICNA 4XAYA 1CYGA 2XM1A 1R3RA 5EMLA 4B5WA 3E0FA 3PSVA 5CGQA 4IFOA 1V0NA 1ZPTA 2ACUA 2OZ8A 1TWZA 2F2HA 3LQGA 4D1IA 3S2JA 2WKGA 5LIKX 1X39A 4AD4A 2V69A 3H12A 4RZ6A 3NL6A 1OFPA 4OTKA 1EXPA 5F1UA 2PDKA 1F8MA 1RVGA 1YBQA 1M04A 1YDOA 4PE8A 3V7PA 2EKCA 1E4LA 1W91A 3LDVA 1OVDA 2I5GA 4MB1A 3GXMA 5FEZA 2CETA 2B4GA 2HSAA 3GNDA 4NX5A 4WDXA 3V16A 1DYSA 3H2OA 4ATWA 1MWOA 1FOBA 4AD5A 2WANA 3OG3A 4JL1A 5AYXA 3MDUA 2PLMA 2GGEA 2PWDA 1J4EA 4DO4A 2EO7A 1I2RA 4GBDA 4CNOA 1WOAA 1F05A 5HQEA 1ISZA 3VXGA 3VNDA 3BTNA 1BVZA 3PFMA 3ARSA 5CPQA 1S38A 2GVEA 1AH0A 4HU4A 3OTRA 1A50A 1ITUA 1R9ZA 3RILA 2DUAA 3DZ1A 3VOHA 1XIEA 4AZIA 3NURA 4GMEA 4KMQA 4H2CA 4HN4A 3LB0A 4TVDA 4Z1DA 2VR5A 4B15A 3QQ0A 3G5EA 1ICPA 1IXPA 3KM8A 2BY1A 4HJWA 1IF2A 3GZAA 2Z2BA 4J40A 5IBXA 4ADSA 2VMFA 2O9RA 3A3HA 4PMQA 1ADDA 3HQ1A 4PMYA 4D8AA 4EOUA 3FKKA 3WL1A 1VFFA 4F0MA 5DBTA 3W7NA 3N3MA 4LS1A 4YCPA 3RR4A 4RXFA 3JRKA 1CXLA 5DY2A 4UMCA 2YW4A 1HF6A 2NXGA 2GQ9A 2Y7DA 3A5VA 3FYYA 4FK9A 4I9AA 1DJYA 4G1NA 4LV9A 2I16A 1X8CA 1Q8JA 4OBTA 1XP3A 3ABRA 3QJAA 3VNKA 4FLSA 1W3LA 3LCXA 1O66A 4FIQA 1E55A 1VB9A 3VIIA 1KCLA 3VA8A 3OO2A 4IIFA 3LZ3A 4PEEA 1Y5XA 5CPSA 2FJKA 1HG3A 4PMUA 1W9VA 4BEQA 3A6OA 1CBGA 2F61A 4EANA 3QV8A 1AQ0A 4TUFA 4QS5A 4MY8A 2ZIDA 1FA2A 3THAA 1TQXA 3EDJA 2J8FA 1VFLA 1OG0A 3WF3A 1I60A 4FA3A 1IZKA 2EPHA 3B8VA 3EOEA 3GR7A 1TMLA 3GG7A 4U2YA 1CCWB 3SUTA 7XIMA 5C9ZA 3UG8A 4NY2A 2FTYA 1ZJBA 1FWBC 3O16A 4MJ4A 4MHBA 2OR2A 3TCEA 4XKMA 3NQ7A 3BMWA 4LOCA 3C2RA 1M7PA 2PDNA 2J7EA 1DJIA 3LU2A 1MW3A 3MYOA 3N15A 1DWJM 1WKEA 4YCOA 1CGTA 1BWKA 4AF0A 3ALFA 3HQNA 1MDRA 1ESWA 1ONEA 4LAOA 3QW4B 2QDGA 3ARVA 3IIVA 1PL9A 1PEZA 4UNKA 2DW6A 2OWXA 2G3MA 1CEOA 1IEQA 2V5DA 3TSDA 1UQYA 2E4TA 3QYQA 4U4MA 5AHFA 1F3TA 1BRLB 1IWPA 1V02E 2XISA 1SVDA 4OUEA 2PDIA 2IQTA 4LJ3A 2GVYA 3VFLA 2X42A 4M7TA 1QAPA 3IUHA 3STGA 1YXCA 4G5DA 3SI9A 1SUXA 3LHTA 3QQWA 3PTQA 3NWRA 1FWFC 4PMRA 3SUSA 5DBUA 4FB7A 4O8RA 3PFRA 3J7HA 2NVCA 2O55A 4MB3A 1XYFA 5D2XA 2HV5A 3UF9A 3PHAA 2OQHA 1V3JA 2PC8A 4I8DA 1K1DA 3DFSA 2AMGA 4UC5A 4L1GA 3MQTA 3M64A 2XWEA 1UR9A 3U57A 1OX5A 3N2MA 1V93A 3IIZA 4WDWA 4H6KA 3AMGA 2ZUUA 4IIEA 5KETA 3AMCA 2YPIA 2DW7A 1V08A 4BI5A 3GTXA 1GJPA 5D8WA 3M44A 4R33A 4PYSA 3ENLA 3B8WA 3KEHA 2ALRA 2RDWA 1R5YA 3TC3A 5I6SA 3TMQA 3QTPA 4K2SA 3SBFA 3HFYA 1FP9A 2GGJA 5REQB 1JZ6A 3DENA 5C55A 1GTEA 1SO6A 4QCFA 5CBBA 4YHEA 2OVLA 3CZKA 1VRXA 1FQ0A 5D2VA 4DJDA 3GR8A 4C6FA 1RPKA 4UTWA 4DHGA 1XX1A 1BG4A 2G3JA 5A69A 4CU6A 2CLIA 3SCVA 3WQ4A 5CLWA 4LBUA 3ARUA 3BCJA 4FNUA 1KRBC 3L0KA 3ZO9A 1V6XA 2H8ZA 2BTMA 3GLCA 2X40A 4GY1A 1NQKA 1G0CA 3AZTA 5ABFB 4PTMA 3S1UA 2C3ZA 1YNYA 1IWBA 2ZWYA 1VEOA 1PYFA 4LF2A 2FZMA 1XH1A 2HCVA 1R3QA 3FS2A 3SGUA 4K7YA 4F0RA 4MAZA 3MSRA 4GUHA 4ZVJA 5HDRA 5IHSA 3AROA 4DM2A 5DCBA 4Y9PA 3KS6A 1J0KA 2CZDA 4AD2A 3S8HA 1ECQA 1FCVA 4JXCA 5LIXX 2R14A 1LRNA 1QOPA 3GTHA 1XJBA 4LANA 1JYWA 4KWVA 4ZSTA 4JQ1A 1R8LA 1GCYA 2C8NA 1OYAA 2J8GA 3RU8X 4D9PA 4QQ3A 1S5TA 1D2KA 4NJGA 3TOPA 1VH7A 4MB4A 1ODZA 4AHPA 2IPGA 3AJXA 3HPSA 3NQMA 3NJ3A 4C65A 4JYEA 1KM3A 4AC1X 3GG1A 2EG6A 3C3UA 3OVGA 1Y0EA 2PDQA 3EKLA 2GVLA 3WCZA 2E09A 3EWWA 2VQTA 2HWGA 3W2NA 3M07A 4QJ4B 2PDBA 2PUZA 1TR1A 2DT3A 2ZZ5A 4UR9A 4AEEA 1C7SA 2VDGA 5AN7A 2YSWA 4RUBA 4UCFA 3WL0A 4NAFB 2GUUA 4X3ZA 1GG0A 3WJSA 3DHDA 3BDKA 3NZGA 4GC3A 1K8YA 1TG7A 3CUIA 4H41A 1DWIM 3ATZA 3GH5A 5GPRA 3FDGA 2WCGA 4QP0A 5F2LA 3UR7A 1LT7A 3F1QA 1UR1A 4HSHA 1BLIA 5FSEC 2B7QA 1RAKA 2Y8VA 5HATA 3BAWA 1PO9A 1V51A 2BGQA 2X1SA 4MUPA 5E9AA 5M5DA 3WQDA 1QI5A 4D6DA 4BR1A 3R58A 1LUCB 3IV3A 3WLRA 4PCSA 1VPXA 1X96A 4WKHA 3RLVA 3GHSA 2PRMA 4QNWA 4J3ZA 1XD0A 4UMBA 4LCRA 2WBKA 1JAEA 3G3DA 2NQ5A 4TU1A 1V6WA 4Z1AA 2DORA 4PUMA 4DELA 3ZJ7A 1TMQA 1DIKA 2V67A 3M0VA 1ELSA 2VZOA 3BK0A 3FAWA 3MCNA 4AZ6A 1K6WA 3WLNA 4JTCA 2ACRA 3T08A 5HMSA 1GZ1A 3C6CA 1V6YA 1UD8A 4MYXA 5M3WA 4L4MA 2W0UA 3BJFA 3T1GA 4W4QA 1GJWA 3NM1A 5GVJA 4WJ8A 5L9FA 3FYPA 4O11A 8A3HA 4LF1A 2ZTKA 3GBEA 4Q8MA 3M5XA 1L2UA 2PU1A 4Y9OA 3SO7A 1GORA 5CJ5A 2PWUA 3FA5A 4Q8WA 1EJVC 1FCUA 1P7TB 4CNUA 1THFD 2TYSA 3EMQA 4Q6XA 3QR3A 1KBBA 1QHOA 2YKKA 1DQWA 4JICA 2ZUNA 5JIPA 3JU2A 4RDWA 7A3HA 4TV5A 3GVQA 3DN5A 3CWHA 1SZRA 1F9CA 1I4NA 4PC8A 5BU6A 1NDVA 4HPXA 4JPGA 4JQ4A 4XZIA 3VOIA 1VFHA 1LL4A 4PSRA 3NOEA 1PDZA 1JDDA 2VRKA 3N18A 4NAEA 3VOCA 2XU2A 3BO9A 2X05A 1IGSA 5G1MA 4IQJA 2HEJA 2J24A 1F5ZA 2IKIA 2WB5A 5C5YA 3QSTA 3AQUA 1F3EA 2WO5A 3K46A 1UWSA 2GJRA 3TTEA 4M81A 1B1YA 3E38A 2E5BA 1RUSA 3INPA 5AHLA 4CVWA 4G2DA 1BD0A 1RLCL 1XBXA 1O1HA 1HVXA 5HNRA 5CPNA 4BWLA 2NT0A 1OFQA 3E5BA 2F2KA 1W1VA 3HG5A 1QK0A 4G1KA 4J5NA 3OYXA 4C6NA 3MSDA 3VIKA 4U2ZA 5C6MA 1QPNA 3NR0A 1GT8A 1IQ8A 1XC4A 2FGBA 3FOKA 4C1KA 3N19B 4MAVA 4B4FA 1XCXA 1M7JA 3BPWA 1I2QA 3MU7A 4FXFA 3SCUA 4PMVA 1VPQA 4ACYA 5D05A 2BASA 3KL5A 4C6CA 4GYFA 3S1XA 3FVMA 1HN1A 5U7SA 1K7EA 2DV0A 3W1AA 1UC4A 2ZRYA 1IXOA 4E6MA 2ZA1A 2E8ZA 1UPPA 5CPTA 4JN6A 3H70A 1KTCA 4ZB2A 1UB3A 2EQDA 1IE7C 1ZRQA 1I1XA 4LTSA 3MTWA 3P5ZA 3GAKA 1QI0A 3CHFA 4QAWA 4OKDA 3W2JA 3DXIA 4UUIA 3GRIA 4JFVA 3W7OA 4KESA 3NZPA 4IL2A 1H0IA 4HHHA 5FF0A 2VX4A 1E9YB 3ARTA 4Z0SA 1HJQA 3S42A 4K68A 4K7VA 5L6UA 3LXBA 3S5OA 1RK6A 2B81A 5A3HA 1US0A 2PLJA 3DI1A 1YMYA 2WQPA 4ZTYA 1N55A 4XZNX 3UT0A 1GOXA 4DYEA 1CLKA 1V7AA 3MUZ1 5A6BD 3RG6A 3KBJA 3M0KA 4W88A 1T0OA 3G18A 4GRSA 3O9NA 3NEHA 3VIHA 3M0YA 3MJMA 3A21A 2PZ0A 4DAFA 1C93A 4MKSA 2XIIA 1GEQA 4GNKB 1EJUC 3S46A 3A9IA 3NPVA 4PTDA 1W2PA 5E6ZA 1LQ0A 2Y89A 4J7RA 5EFFA 2FIQA 1XYAA 4LYPA 1XYZA 4WJXA 4GUFA 3VNYA 1MRQA 1UYQA 3PTMA 2QNEA 3WUFA 1OWQA 3AMLA 3PBGA 1PKMA 2UY2A 3NO3A 4B2DA 1TPEA 4ASTA 4NI8A 3NL2A 4XSLA 1Q6EA 2AQWA 2GJNA 1XH0A 1MEWA 2CIPA 1LL7A 1K4GA 3MUXA 3GC2A 5HBFA 4UOQA 1LORA 3DC8A 2X2YA 3CQ0A 4XK2A 1XPYA 3D5HA 4DN1A 2BB0A 1V5XA 1LLZA 3MZ2A 2HBVA 4OE7A 1LWIA 2HS8A 1T7LA 3CZ8A 5HR7A 2O9PA 4GJJA 1MW2A 4LW7A 2CXGA 1U1UA 2XVLA 3Q2DA 4FALA 2D1ZA 5BROA 1JAKA 3GBDA 2VFDA 2X2GA 1KM6A 1P4CA 2G3FA 3WLQA 4R85A 3G0SA 2EXOA 5CC5A 3I3BA 2WQDA 1E6QM 1V3LA 3IIPA 5GNYA 1SU5A 1A5SA 3BH4A 1KA9F 3NQBA 4XBKA 1V6TA 4Q7IA 1J0IA 2J27A 4Q33A 3GD6A 1E9LA 3NA8A 4WUIA 3UZXA 4TIMA 4CD7A 3IVTA 3G1HA 5DMYA 1UBSA 2WMJA 3T8LA 3TTOA 5CG7A 4IMFA 4Y9NA 3QZ6A 3UXKA 3OHIA 1UH2A 4KWSA 4XVEA 3UJ2A 5I78A 3ZR4A 4C90A 3GG8A 2Z7KA 1CLXA 3ANYA 3DECA 1XIBA 4KFPA 1EGVA 3O1NA 5FF7A 5FF2A 3OW1A 1KFJA 4H7CA 5G4EA 2QCEA 2PDFA 3I4EA 4F40A 4RCXA 2Z00A 2V68A 2Z25A 1M6JA 3KP1A 4JTSA 4GIAA 4S3JA 1BRLA 3TJ4A 4WDUA 2WZEA 3MUY1 2NWSA 2ACQA 2O9TA 3VKJA 1Y65A 2DZTA 3R11A 2A3AA 3S3GA 4RDYA 3R8HA 4LWWA 1PCKA 1N8WA 2C6QA 4C7DA 3JW7A 3WD0A 2POZA 3B0PA 1AJ0A 2YL6A 1XUUA 2H9AB 4KCWA 4QM1A 4GACA 1R3WA 4XD3A 1T41A 2WMIB 4F2BA 2X8RA 1RLDA 2WNQA 3PG9A 2VO5A 1REQB 3DG6A 5D09A 3WQ6A 4UTMA 3LHZA 3E96A 1XL9A 3GE7A 3LCFA 1OABA 4YWIA 4JHMA 1GUVA 4HSOA 2VVNA 3L2MA 2Z29A 4BJHA 5KZEA 1ISWA 1ZP4A 4HMNA 1OEPA 3EDEA 4X0VA 1JZ3A 4AZGA 2YCKX 3FW6A 5T9CE 3QSRA 8CGTA 4C91A 1E56A 4LAUA 1N2VA 3ZFHA 5REQA 4WEVX 3AIRA 3B03A 2G0WA 1UUOA 2NXHA 2XVPA 3SN1A 1JZ4A 4MTVA 3B97A 1GHRA 3W7HA 2F8QA 4O53A 3V0TA 1TWSA 3SJ3A 1ITXA 1HO1A 2BOEX 1TTQA 5BMWA 4KRUA 2WPGA 4O54A 1QXLA 3EBVA 4FX8A 3U2ZA 2VFHA 3TX9A 3N2XA 3VFCA 4GI9A 4UQAA 3A3XA 1KW1A 4HYVA 1AL8A 1E1CB 2GJXB 3G6MA 1Z32X 2PDWA 5A8PA 2QF7A 5ENLA 4OIFA 2OKOA 3H2AA 4JCMA 5EY5A 4LX4A 3WN6A 2AKZA 3GQYA 4L56A 5A95A 3PZMA 1EXBA 1DXIA 4GGHA 3APYA 3K4WA 3PJWA 5AC5A 1XLFA 3NQGA 3IS4A 4WQ6A 1DJZA 1EL3A 3OZMA 4N42A 3QYSA 4H6QA 1JEZA 3RIKA 5HMFA 2DZBA 4M29A 2QCGA 1HFBA 4S23A 3IGSA 2HRWA 3EOOA 2RHGA 4ES4A 1WP6A 5I00A 3IJ9A 4E4UA 2ON3A 4ZXOA 1M53A 2V6AA 4F0SA 1FX6A 4M80A 2VENA 1QHPA 4Z2GA 3LXCA 3CGTA 4BY3A 5HR6A 5DXXA 4WLCA 1QMLA 4GFSA 1OGSA 4ZENA 3UFYA 4O1AA 4X9SA 1XLEA 3HMJG 5JH1A 2PDLA 3HJEA 4GCAA 1MNSA 3CZEA 2X1TA 3MBDA 3VNLA 1ADOA 1VEPA 2EJ1A 3F4WA 3UZZA 1OFDA 3STEA 4GPNA 4H19A 1GW9A 1J2BA 1R6WA 5AHIA 2Y61A 3RM8A 3C86A 5E0CA 5HNUA 3GVWA 2JK2A 1D7FA 1TZZA 1OK4A 2VI0A 1OX6A 3Q4DA 3PZTA 3UETA 2ZE3A 1OGBA 3AFBA 4RNFA 2PB1A 3M0JA 1A5NC 1UQZA 3QV9A 4DUXA 3ID7A 2XYLA 2HJPA 1P0BA 4IUOA 3T0AA 3BE7A 1VCGA 4O28A 3HURA 3GNXA 2O4QA 3H7RA 4DQWA 1XQKA 1HL8A 4J3SA 3EXRA 1F76A 4B9YA 1C92A 3Q65A 4C1LA 1DJNA 3C2OA 4WSHA 1EHNA 1LUCA 2PU0A 1X7IA 2A6NA 1FDYA 3N2OA 3EOSA 3WLTA 3QMTA 2Y2WA 4Q4SA 4R88A 2HPIA 4QEEA 1W9XA 2ZVRA 1MDLA 3V5OA 3NQFA 5H2ZA 1Q2SA 3BSHA 1FCBA 4NRSA 1WUFA 3WDQA 4A4AA 2ZUSA 3APGA 4GQQA 1L6WA 1O7AA 2HPMA 5DMNA 1XIMA 4O19A 1VIWA 2PAJA 3P61A 1XGDA 3GK0A 3GG0A 1OCBA 4QGCA 1JCXA 3ARWA 1RQHA 2Q6ZA 4Q8UA 3R79A 3S1VA 5PTDA 1WKYA 3RO6A 4WSJA 4XZLX 1EPVA 1TSIA 2XN0A 4MDPA 1PX4A 3QHOA 1SZGA 4B9ZA 4DAIA 1JJKA 4S3AA 1UA3A 2XSXA 1PKYA 3DFYA 1BQCA 5K2ZA 3QC3A 4C6BA 3AHVA 4I7WA 4KWUA 4NZJA 3BW2A 3LHVA 5BRPA 2WHKA 3MYPA 1VGAA 1MZHA 4PCNA 3O8AA 5HJYA 1KR1A 1VFUA 1RCXB 3NQ6A 4ML9A 4OOUA 2IXUA 2J8TA 5I3FA 1EJTC 1E9ZB 2DIKA 5CSRA 3OZOA 4LAKA 4FI4A 3OGVA 2ISWA 1XG3A 2XFRA 3PAOA 2WCSA 2W6RA 5EMMA 4C7FA 2YYTA 1EQCA 5CGTA 3AXHA 3NCOA 3R7MA 1NDZA 3STCA 2HK1A 2VZTA 1NJJA 1A5KC 1G4TA 2ZX9A 1F73A 5FJRA 4RX0A 1GQNA 4ZEPA 1CI1A 1XDMA 2YX0A 3M6YA 4K1WA 2PTDA 3LA4A 4J3UA 3TAOA 4LPCA 2RDXA 3T0TA 3CLMA 3FSTA 1H7XA 1Z3NA 3LV6A 1QO5A 3RXZA 5FESA 2ZA2A 3SURA 3HV8A 3WMLA 3HBLA 4PUNA 1UKOA 2GQ3A 3U8GA 4OOZA 2PTYA 3RLUA 3E2QA 1JCYA 4MB5A 2WZMA 3GAYA 1YPXA 6REQB 2CC0A 4V27A 3TZFA 2J77A 1XLAA 2AMXA 2YCLB 1HUVA 2E6YA 5AHNA 4E2VA 3TOYA 4P7QA 2NX9A 5GNXA 5LGZA 3LI0A 3WH6A 1BAGA 1W1IE 1J5SA 2I14A 3VIFA 1SW3A 5I02A 1RK5A 1R9YA 5EMUA 1OFAA 5F4XA 3VKAA 3VNZA 1B4EA 3W7QA 4KEVA 5AHMA 3PZQA 1JPKA 3AI0A 2VGGA 5LNUA 1M9HA 2OODA 1UD3A 5H8PA 1WAUA 3LRMA 3DYMA 2OJPA 3GUWA 1JD9A 2EKGA 2NT1A 3ISIX 3ARQA 3XIMA 4B5SA 3L5MA 1LT8A 3M0IA 1TX2A 4CD5A 1T6MA 1Y8BA 2NUYA 3VTRA 4IJRA 3MBFA 3REQA 2EG7A 3P6LA 1JYXA 3O0FA 1TV5A 3BMXA 4O0QA 3AIVA 5CJMA 3KWXA 1IYXA 3V5FA 1N8FA 3IVUA 3BLPX 5G4HC 2EF9A 5D04C 4I90A 2D22A 4FAMA 4AY1A 3PBMA 1YRRA 3ITYA 1HQTA 2NV1A 2EPOA 5C9XA 1EC7A 1YADA 3WX7A 1XBYA 1AW5A 3UY8A 1ZUAX 2PD5A 2VZVA 1E5JA 5DCDA 2VOMA 4JFUA 1QDSA 2PTWA 4GINA 4HCHA 5I3JA 3SECA 3VUSA 4UIOA 4FMVA 2D2GA 3CO8A 2WWCA 1NH6A 4XD6A 3GWQA 2NZLA 3MVTA 1L6YA 4M8UA 3FNDA 6ALDA 3QKEA 3VI2A 1W5OA 3U4FA 3T2QA 2FPTA 1QHZA 1LP6A 2BZNA 4KQNA 3FGCA 4MUZA 4AZ5A 4UXDA 2YL9A 5KZMA 1S2VA 4D71A 5DQPA 3ORWA 1XFBA 3LUTA 3TXVA 2QMKA 4TOQA 1ITQA 1ZL1A 2JF7A 4TVUA 3NSNA 3CB8A 4NHVA 3KOZA 2WNNA 3L4TA 2CZVA 2XIJA 1HKVA 4MNKA 3CZJA 4A8LA 1YX1A 3IANA 4MZYA 4JTJA 3GNRA 1TRDA 4W8AA 3O2LA 1Z89A 4XKYB 3PG8A 1Q4NX 3S2LA 1HZYA 4C1NB 5EFDA 1TJ2A 4BKNA 1AMYA 3RPTA 4AWEA 1AZ1A 3C0LA 3CT2A 4LVFA 4XIAA 2QF8A 4NNBA 4KWOA 4DBEA 3E49A 5I06A 3HF3A 4PTXA 3GDKA 3B04A 4JIQA 1XINA 2JE8A 1B0IA 4OQVA 1MO0A 1EA0A 5TAOA 1W56A 4JTDA 4F3HA 1QTWA 1WV2A 2A5HA 4NNAA 3TONA 3B8UA 2CBVA 4GFIA 2HISA 4U10A 1IGWA 3WFZA 3BZGA 4IIGA 4JY9A 3VK5A 3W07A 1XSKA 4DLMA 1ME7A 1WDWA 2A4AA 3T55A 4WDTA 1TV8A 3WYZA 3FYOA 1CXFA 5TIMA 2GDQA 2W91A 2GDUA 2VC5A 4H1ZA 1Z8AA 3QLDA 4YVXA 1ZALA 3W24A 3I65A 1Q6QA 3TEVA 3TA9A 3GYCA 1TWDA 3GIYA 3SSJA 1UA7A 4PFHA 2VEKA 1EO5A 4H2HA 1GVOA 2OZ0A 4FX6M 3H7VA 4L80A 1H49A 3L4WA 4CNTA 3AMKA 2ABBA 2QXWA 1VEMA 4Q4OA 3W73A 1VFMA 2E40A 1SR9A 2X41A 1OT1A 3IUDA 3P3BA 4H9YA 2VZSA 4XAGA 4AY7A 4C6MA 1OK6A 1QW9A 4ILSA 4Y8FA 1H0GA 3YPIA 4H00A 4NZ4A 1PX3A 4RZ5A 5C70A 3D47A 4FNRA 5I3IA 2ZRZA 3EWYA 2OYMA 3H54A 3I3DA 1B3XA 1JUEA 1RALA 4ERAA 3EWUA 1KCZA 1RY8A 2H9AA 1A3HA 1FH8A 2NVDA 3TNBA 5BXPA 1V6UA 2BY3A 3TYCA 2WMIA 3E0WA 4AFYA 2PDMA 2FPVA 2WJFA 3L0GA 1W1TA 4LYRA 1MFVA 4ZO7A 3S2MA 3KTXA 1CGWA 1OF6A 4TTGA 3M43A 3M16A 3K4DA 4PRRA 3U7BA 1MRAA 1RA5A 3LGGA 3VE9A 2XGZA 4XO6A 4FNPA 2CESA 2A7RA 5F1VA 3B06A 1PWLA 3FSUA 1S3HA 5CC6A 4DBDA 1UWTA 5AHEA 1VYRA 5A8MA 3CUHA 1GYLA 3PUDA 3TAKA 1JRCA 1OT2A 1ZP3A 2XVNA 2YLLA 4L65A 4AZCB 2GPTA 3R0KA 1KFWA 1C9DA 2HXTA 5H6HA 4ZFCA 4ECLA 6XIAA 3EMZA 2FZ9A 3TQKA 1K9FA 4I5RA 3DOPA 2Y63A 2C1GA 3W7PA 3GU1A 1JR1A 3HGRA 1E1CA 3PM6A 2GJXA 1PAMA 1G6CA 4E38A 1KCKA 4O12A 2CLOA 2P8CA 1UJPA 1DJGA 4HTBA 4PGLA 5GJPA 4ATDA 4UZUA 2VL4A 4YNGA 4JQAA 3GNNA 3THCA 2ZZ1A 3QR0A 1TPC1 1ZENA 3ABOA 4JFTA 4XIMA 2BXYA 4D8LA 4HKPA 2CLKA 1JDAA 1CW2A 4GX9A 2B7NA 1R85A 1XLGA 1RCOB 1G67A 4AQLA 2FVLA 4JCLA 1DL3A 2W27A 4P5UA 2PDYA 3ZVIA 3N17A 2Q8LA 5DFAA 2VX5A 4YXGA 1OYBA 3LG3A 3DFTA 1BXNA 3WKZA 1QPOA 2R1PA 3QM3A 2RUSA 4L4OA 3HM7A 2YDSA 1L8NA 4AIOA 4QBXA 1X6LA 4ONVA 3SJNA 4L6DA 5AYYA 2BMBA 3MSYA 3ITCA 2Z1BA 4FZIA 1AFSA 1VP5A 3CMFA 3WLJA 2QDEA 1ZCOA 1YLVA 3CB3A 4S3EA 2MNRA 3VIJA 4O50A 1YTDA 1O60A 4LRSA 5HUPA 1ME8A 2WPBA 3EWCA 4K6AA 1S2AA 4Q8OA 3QHMA 3B9OA 1TWWA 4H7VA 5CSSA 3FJ6A 4QDWA 4XD5A 4PBFA 3DHFA 4B5NA 4NUWA 2VCAA 3W7LA 1FHLA 3BJTA 3BLKA 1CENA 5KINA 1BQGA 3U48A 1LDCA 3VKDA 4S39A 1IEWA 1AG1O 2V5BA 2TODA 4G56A 3RNDA 5DEZA 2ZC8A 4TO8A 3T40A 4LUTB 2QJNA 3PBYA 1UUQA 2HE8A 1J10A 1KFCA 3A47A 4Z2IA 2XFFA 3MC5A 4JL2A 3R2GA 3PP7A 3MANA 4FOUA 3AWOA 1Q66A 2F38A 4FR6A 3WQEA 5AC6A 2CBIA 2DZUA 3LRKA 5C0QA 1WCGA 2QDHA 4N9DA 4IJBA 3VGDA 1JPHA 2IQ0A 2AQOA 1DXFA 1HP5A 4MZ8A 4DJEA 4K8GA 4XZBA 3GVVA 4UNIA 3HV9A 4DUVA 4ZB0A 4HCLA 3SUUA 2YB4A 3ZOAA 2QCNA 2OZTA 3ES8A 1SGJA 1IIHA 3NVDA 1BWVA 1I1WA 1CGXA 1UH3A 1O5RA 4B3KA 3PNZA 4I7VA 2VP8A 3E9AA 3LBMA 3UXDA 1JGIA 4RLIA 3L67A 2OX4A 1YPIA 1A5MC 3UR2A 4WKFA 4XD4A 3B0YA 3UPWA 3ZT7A 2DUXA 4L5ZA 4RDVA 1XICA 4I5XA 4Y96A 4ZZ9A 4RPQA 2G37A 3C5QA 1RH9A 3OZYA 3WSUA 2P5NA 3W6MA 2GK1B 4QISA 4AEFA 2ODOA 1Q65A 1ZGDA 4D1JA 1FHDA 5MKGB 1KKRA 1KRMA 1Q8AA 1TPVA 4NP7A 3V4BA 5LNVA 1LBFA 1L9WA 2VJXA 4I6VA 1FRBA 3UG5A 2Y8UA 5G2WA 3AO0A 3WY1A 1UWRA 1BXBA 2Z1XA 4ZQMA 1B3YA 4B91A 1ZBVA 3LV5A 3S6OA 4JYFA 3OZPA 1VAHA 2JKEA 3DYOA 2ISDA 4ATLA 4DYKA 2CHRA 1E3ZA 5AC4A 3LENA 4WCJA 3MKVA 3ITLA 3OB8A 2BVYA 2Z7GA 3E02A 2D0FA 3S2CA 1E15A 1UROA 2PWVA 1R87A 3R13A 4MY9A 3R94A 1RZMA 4CUCA 4FPSA 5DY3A 3LX9A 3FA4A 5FL1A 3GHTA 3RMJA 3TFXA 3UERA 1EBHA 3V36A 3FX4A 5LKYA 1GZGA 1FBAA 2VT0A 3MUCA 5EPDA 4M1RA 4H6EA 1ONRA 2CCRA 1TJ0A 4IIBA 2YBUA 4HBKA 3VD3A 3D46A 3VCRA 3N2CA 3NL5A 3P62A 2PGRA 3W01A 4LQ1A 1LG1A 1C8VA 4FP1A 4TXEA 4QR6A 3VMOA 3WLIA 1OADA 5I23A 1BVNP 3FHQA 4IGMA 1TJ1A 3TSMA 3WLHA 2GUYA 3NO1A 1GHSA 1SQ7A 2XIBA 2X1IA 6REQA 4EPDC 2E7FA 1KV5A 3AYTA 2YCLA 2B7OA 3PY2A 1J0YA 3VDHA 2Q71A 3B4UA 1MQPA 3E6EA 3T05A 1Q6GA 3B0UX 1V3IA 1HVQA 3UZWA 2X7WA 1GPWA 4X2RA 1YYAA 1IZJA 1ZJHA 2J7BA 5E1QA 5FJUA 4F9DA 4KCVA 4EAYA 2ZX7A 3OP2A 5FJOA 4N6FA 1U33A 2Z27A 5D9NA 3JVAA 2DIEA 1NM9A 4YJ5A 2HQAA 3S5ZA 2VCCA 1E71M 4AMCA 3OQEA 1OD0A 1SSDA 2NQLA 3HZ3A 3ZWSA 1SM9A 1T8QA 5K7JA 3T09A 3PPHA 1U1HA 3CWOX 3LN3A 1K8CA 4GE8A 3CH9A 2EAWA 1KWKA 2VYOA 4FEZA 3C2EA 4PA8A 5C9UA 3KDOA 3G1YA 4H9TA 3R10A 1X6UA 2P0OA 4R27A 1OF8A 3I6TA 3S83A 1BYDA 3A5FA 4IL0A 4AWUA 4BZYA 4JFWA 3WNMA 3CLWA 3TW9A 1QPKA 1MQQA 5D02A 3BW3A 3SM0A 3O7UA 1RBAA 1KC7A 4LYKA 3THDA 1B3ZA 3GW0A 3BCDA 3W38A 1CB7B 4MNJA 1G4EA 3VIGA 2XH4A 1UOZA 1YE4A 1B3VA 1XLKA 3R8GA 1TPH1 2EPMX 5A6MA 3C2FA 1M7XA 5LSMA 1IT0A 4O16A 1LOQA 1JZ2A 4GJ1A 4GGBA 2AL2B 3CUFA 2VD9A 4GZIA 5DRCA 1H60A 4W5ZA 4Q4RA 3OLGA 1R0MA 3RX4A 1ME9A 2PA6A 3Q94A 5G2HA 3G8EA 1D3HA 4HTYA 3RITA 3MMTA 4JTGA 2C18A 1DTNA 2VFGA 2Y5SA 3CZGA 4XTIA 1W3NA 2ZZ7A 5B7YA 5CSYA 4I6KA 4BHYA 2A3HA 3N73A 4W87A 1V8EA 3AXIA 4AXNA 5I03A 3CQHA 3SRDA 1DEDA 1DE6A 3WQWA 4TR9A 5K9DA 2VUNA 1O6IA 1EDTA 3WEOA 1N8IA 3UA3A 2WSPA 4EXBA 1TV4A 4PMZA 2PCEA 2Z24A 3LM3A 4H4IA 4XKYA 3O06A 3IEBA 3OLIA 4DIAA 3QF0A 4C1NA 1F7BA 5A2AA 3RX2A 5KTLA 4KW2A 1GJUA 3ABQA 1DTUA 3LHYA 1J96A 1R47A 3DHPA 1KQYA 3LY0A 2PF0A 4YWSA 1QFEA 3EPMA 3W88A 1C8QA 3GVRA 4GWEA 3S5SA 3IIXA 2G4FA 3H4GA 4GQ0A 4HHLA 1Q2RA 2GYIA 4FLRA 4HZ6A 2D3LA 2QCLA 1TCMA 5A94A 1WYIA 4Z1BA 5A1AA 3OEXA 1E1FA 4PRTA 1Q6LA 3TYAA 3IJIA 3NZQA 3OYZA 1KD0A 2FYMA 4C6PA 4NVTA 1VRDA 3P81A 4DXXA 4JX6A 1R7OA 2OYKA 3AAMA 1FVPA 2GGIA 3CQIA 4DBUA 1K9TA 4W86A 2O0TA 3L23A 1XGZA 2XUCA 2W3ZA 3TP4A 3WJWA 2FHFA 2FH8A 3P8JA 2QV4A 1ICSA 3C0SA 3BARA 4LB4A 2UY5A 3P2VA 2JIWA 4GO9A 4A05A 1TV7A 1DWAM 3MZNA 4INFA 1KFKA 3KHDA 2GVJA 2A3BA 1Q6FA 1G01A 3WMBA 3LTSA 3M7SA 3IJ8A 4HHPA 2QJIA 5BWAA 4M6VA 4A21A 1LLWA 3T81A 2FMOA 3M5ZA 1OB0A 3HFTA 1S5NA 4M51A 3FVDA 3CUXA 2Y62A 4DXKA 2JKAA 3AU6A 1VFTA 3CAWA 5D32A 4DZ5A 1KBIA 3GNPA 3W29A 4GH1A 1E6SM 2J13A 3S6TA 4D6CA 1DKWA 2BY2A 4E2DA 4JKLA 4E2OA 2YDQA 2G4JA 2Y4SA 2WW5A 4CD6A 1BYCA 3OBEA 2ASHA 4ROPA 2V0TA 1HKIA 4HMEA 3FCPA 1WZAA 4Q7NA 3CIXA 3C61A 2Z1KA 1UWQA 4ZMGA 3DFHA 4Z2KA 2V2DA 4UQEA 3QFWA 3M0LA 5A6AA 1HL9A 4LNCA 2C71A 2QCCA 3USBA 3R0DA 3C8FA 3CMJA 3FV9A 1KTBA 1XR2A 4TMBA 4EF9A 3FY1A 1H4PA 1UMYA 2OQLA 3M7WA