3O8AA

Crystal structure of plasmodium falciparum dihydroorotate dehydrogenase bound with novel inhibitor genz667348
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
375
structure length
375
Chain Sequence
YNPEFFLYDIFLKFCLKYIDGEICHDLFLLLGKYNILPYDTSNDSIYACTNIKHLDFINPFGVAAGFDKNGVCIDSILKLGFSFIEIGTITPRGQTGNAKPRIFRDVESRSIINSCGFNNMGCDKVTENLILFRKRQEEDKLLSKHIVGVSIGKNKDTVNIVDDLKYCINKIGRYADYIAINVSSPNTPGLRDNQEAGKLKNIILSVKEEIDNLEKNNIMNDEFLWFNTTKKKPLVFVKLAPDLNQEQKKEIADVLLETNIDGMIISNTTTQINDIKSFENKKGGVSGAKLKDISTKFICEMYNYTNKQIPIIASGGIFSGLDALEKIEAGASVCQLYSCLVFNGMKSAVQIKRELNHLLYQRGYYNLKEAIGRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Dihydroorotate dehydrogenase homolog, mitochondrial
publication title Novel inhibitors of Plasmodium falciparum dihydroorotate dehydrogenase with anti-malarial activity in the mouse model.
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 148
structure length 375
sequence length 375
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2010-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3o8aA00
2V30A 1H7XA 2PE4A 5L6UA 3CM4A 2NX3A 4O4WA 4NX5A 4LVFA 4UFHA 1ME8A 4GE8A 1P4CA 1XBXA 3GXPA 4GC4A 5DCEA 1RVGA 1VR6A 1NVMA 1VJIA 4ZVJA 1GYLA 1H60A 2Y63A 3F4WA 3OHIA 4XKYB 5AOUA 1GZGA 3ATYA 1KM1A 2BSLA 5LSMA 2R91A 3B0VC 2CLMA 4NZJA 4UIOA 3SIZA 4YXGA 4JICA 3W7KA 4LUJA 3TJXA 3QM3A 4RXGA 1OFPA 1AK5A 2RKXA 1OJXA 4OWGA 5KZDA 3C61A 3FS2A 1H7NA 1JQVA 2XN0A 1P1XA 1BKSA 3UWUA 2CW6A 4FNSA 1WOAA 4MKNA 3OVPA 1FDZA 5CZTA 5AC6A 2GJNA 4N9EA 2P10A 5SWUA 3N34A 4AF0A 3UXDA 2J9YA 3TSMA 4AB4A 4ZMGA 3LM7A 1EPXA 4RCXA 3PAJA 2VXNA 4JDBA 5TQLA 3A22A 3CT7A 5CKSA 3C6CA 3DENA 4AMAA 2A7RA 1R30A 3G22A 4Q32A 1B4EA 5DCDA 3P62A 1QNVA 2ATSA 2ZRUA 4Y6GA 2JK2A 4JX5A 1YTDA 4K37A 3WFAA 3NDOA 2QCEA 1NEYA 4RXFA 5EMUA 1SU5A 5U7SA 3S42A 5LZLA 4ICNA 1VGAA 4BR1A 3W86A 3GZ3A 1V5XA 2A21A 3O8AA 3H53A 4LVBA 1F6KA 2OX1A 4PEKA 1KBIA 1IXNA 3FOKA 3MP4A 3O6CA 1GVOA 4IXXA 5KINA 4LVDA 3P82A 4XZ9A 2VOMA 5G2IA 2C15A 2QDGA 3LDVA 3A9IA 3WJWA 4MJMA 3S1UA 1H61A 2ZA2A 1YDOA 1A53A 5HR6A 4UUIA 4GJ1A 4LS1A 3F4NA 4O17A 1VYSX 3QMSA 1F73A 1FX6A 4JTEA 2X1UA 5HJLA 3T4CA 5D37A 4JD4A 4LTSA 2C13A 5CPOA 4AWTA 2I14A 2H8XA 5KZMA 4LUIA 1LZOA 3CWNA 4O54A 3G0XA 3IIZA 2ISVA 1TTJA 2WKJA 2E5BA 4QNWA 3W7EA 2PC4A 4EWND 2GOUA 3FYPA 3L5LA 4ZL1A 3TQKA 1PCWA 1TTPA 2R8WA 4EOUA 4L4MA 3ZWTA 5AN7A 3C2FA 3HG2A 3QW3A 5AHIA 1ZJIA 1EIXA 3QH2A 4JS3A 4DF1A 4UMAA 3UYCA 4E0CA 4UC5A 3A5FA 1KA9F 1OHLA 2DJXA 1QO5A 2V2DA 1ME9A 2YFNA 5KITA 3NM1A 4XQ6A 2ZQ0A 1MO0A 3VNDA 1ICPA 2FFCA 1IIGA 4RJEA 1MSSA 4CCDA 1B57A 1I2NA 1LYXA 3NL5A 4GUHA 3NQFA 3UZ5A 1OFAA 1OFDA 4N9CA 3SR7A 5EA9A 5J5RA 1QR7A 2CZFA 5BRBA 5IBXA 1PE1A 4RLIA 3BV4A 4MFEA 4GWEA 4ADTA 4UTLA 3GR8A 1YLVA 1AW5A 4AHPA 4N9DA 4O18A 3P67A 5G2HA 4A2RA 2V5BA 3QMTA 3WJSA 5AFDA 3CB8A 5EYWA 1D3GA 3W1RA 3HG3A 3P60A 1TPB1 2Y88A 1QPQA 3IIVA 5DCBA 3KRSA 2FPYA 3FIGA 3W74A 2YDAA 2H8ZA 4NJHA 3V1PA 2FPVA 4UR8A 5G1TA 1U83A 3CHVA 4JY8A 3CIWA 2QAFA 5KTLA 1ZHAA 5GVJA 1U5JA 3TX9A 3S5OA 1A5AA 2W6RA 4BI6A 4N4QA 2G96A 4RZ5A 1OYAA 2ZZ5A 3LGEA 2Q8LA 1OX5A 2A5HA 5AHNA 5C54A 3T40A 2Y61A 4IPIA 1VCGA 4IMEA 2XN2A 3TE9A 3E49A 4HNTA 1ZNNA 3F1QA 1S5TA 3LI1A 3QQ1A 5HNRA 3KRZA 3R12A 4FNPA 4MY9A 3M5YA 1P5BA 4WUIA 4FXSA 1KFCA 3GK0A 4UXDA 1TV7A 1QDSA 1AMKA 1VLIA 1THFD 3TDFA 4O4VA 4LNYA 4I7UA 2ZRZA 3NL6A 1SW3A 1BWKA 3RNDA 3DXIA 1A5BA 3G3DA 1XC4A 3Q37A 1R47A 1O5KA 3DBPA 4HT3A 4FIQA 2J88A 3BARA 4AEOA 3W1AA 1JUEA 1SUXA 2ZZ2A 3B0PA 3GXTA 3NQCA 2J24A 1GWJA 1SW0A 3G0SA 1L6WA 1H7PA 1SZGA 1VS1A 4GFSA 1OVDA 4ZQPA 1FCQA 3KXQA 2KZHA 2Z0IA 2NXHA 4FEZA 4UFLA 2G95A 3W6YA 1F76A 2E6DA 5D2YA 3C2RA 1YXDA 1AL7A 1JCYA 3C2EA 3TJLA 3YPIA 2QR6A 4JY9A 1AL8A 4LVAA 4UTJA 1OX4B 3PSVA 1T0OA 3V75A 2VEIA 1VYPX 5D05A 3QRHA 3ZWSA 4O8RA 1QFEA 3ELFA 4HSNA 1TJPA 1XI3A 1WAUA 2NX1A 1C9DA 1F74A 4S1FA 1RD5A 4Y96A 1FDYA 4CCCA 5BMXA 5FESA 4N6FA 3RK8A 3T78A 5FF2A 1F5ZA 3S1WA 4ML9A 3MO7A 3SJ3A 3G1FA 2CLLA 3OVRA 3LX9A 3B0UX 4K7YA 1UCWA 2B7QA 2OMAA 4DBDA 4XKYA 1LOQA 1JVNA 4XUGA 3W1PA 1H7OA 1HUVA 4X3ZA 4ZZ9A 5F1VA 1F2JA 2HTMA 2V2HA 4LW7A 3W23A 4QAIA 1G69A 3TCEA 2R94A 3GDMA 4TR9A 2ALDA 3QSTA 4MOZA 1W1ZA 1AG1O 1FCVA 2QAPA 3BW3A 2ZTKA 4JTIA 3RFAA 3NQGA 3P81A 5BMWA 1Z41A 3P84A 3W1XA 4XTIA 1S5WA 2NX9A 3UY8A 3QMRA 3FEMA 3PBVA 1GOXA 3JRKA 4MY1A 3W2MA 1LM1A 4HKPA 2HS8A 1T8XA 3W7JA 2ZTJA 1GVSA 3STGA 2Y70A 1BTMA 1K03A 5CSSA 3GDKA 5DXYA 2A7NA 3P8JA 4N9BA 2EF9A 1JULA 4DF2A 2GQ9A 4YCPA 1PIIA 1JR1A 3BVJA 4KFPA 4TMCA 4JTHA 3S1VA 1DV7A 5I3FA 4Y90A 1W3TA 3SECA 3L0NA 1PL9A 1KTCA 1G7VA 1JCLA 2E5CA 3TH6A 1UB3A 4NNCA 2BZNA 4DELA 4KKXA 3MP3A 5EKYA 4CNOA 2Y6ZA 1EUAA 3DFOA 1TRIA 3NQ7A 4QJ1A 1PS9A 3QEZA 1XBYA 4O15A 5I3KA 2A85A 1VH7A 1PHWA 3TQVA 1HL2A 5G4WA 2E6AA 3NQEA 5A8GA 5D32A 3GR7A 1Q6RA 3LTSA 1G7UA 1GG1A 3BK0A 3RLUA 2ATMA 5EBUA 4EVZA 1XL9A 4QQ3A 5CPMA 3H55A 3W7DA 4OGZA 2CWNA 6TIMA 2E68A 3TAOA 4UNLA 2V8ZA 2H3DA 3S1XA 2NXGA 5K9DA 3PY2A 3U8GA 4NX0A 4O14A 4MUZA 2JGQA 1XBZA 2F7FA 3GNNA 4S2CA 4UTUA 1R46A 1OABA 3HGSA 4JYEA 5K9CA 1IF2A 2QJGA 2PRHA 1QCWA 1FWSA 1DQWA 3DKLA 2FB2A 2YZRA 1CI1A 3P5ZA 5IM51 5K4ZA 4O1AA 4MVAA 1O4UA 1ZENA 2XN1A 3LXBA 5FEPA 4BI5A 5F4WA 3JS3A 3QPYA 3DFPA 2RDTA 1RQHA 3DKJA 4IGHA 2WSRA 4YWIA 1OX6A 3PBUA 2C1HA 5KMYA 3SW6A 3QW4B 3W07A 4H6KA 2E77A 4PODA 3UWZA 5CPLA 3F03K 4XTDA 5AC8A 1JRCA 2FPTA 3QJAA 3GAYA 2GVGA 3G1VA 5I3IA 3ANYA 1KM5A 1DOSA 4XBSA 3NOEA 3O63A 2Y7DA 4DO4A 1TREA 2YSWA 5BOOA 1IXPA 4ZQRA 4W9TA 2WSYA 3W1LA 2WV8A 1X8FA 1DKWA 3MHFA 3UXAA 2WNNA 3BGGA 4KFNA 3UZJA 3B8DA 1W37A 3ATZA 2YW3A 1MXSA 5F2MA 3GKFA 4I7WA 4ZQOA 5AB3A 1B4KA 1LLWA 3C2OA 4NJJA 4Q33A 2HSAA 3M5XA 4M6PA 1JCXA 3W7LA 2VENA 3BLEA 4DQWA 5AHEA 1XBVA 4LS0A 5U4NA 1JUBA 3OVQA 3PS7A 4O12A 4LY8A 3KFTA 4S2BA 1SO4A 2CLEA 2GQ8A 2QCNA 3NM3A 4UFKA 5G4EA 2Z6IA 5I3JA 1VYRA 1GPWA 3KVLA 3EWBX 3S9YA 3CEPA 2I9EA 2A7PA 1W5MA 3FYOA 2PCQA 4GUFA 4WY0F 4N2YA 1Q45A 5D03A 1VCVA 1OF6A 2X30A 2ZZ6A 3WK2A 2B0MA 3UNDA 2YGYA 1LP6A 2G97A 1M6JA 2QUVA 5AHMA 3PM6A 3TXVA 3A23A 4AXKA 5MHBA 3NNTA 1EWDA 4DPPA 2OJPA 5E93A 3WJXA 5FEWA 4MZ1A 3M16A 3N73A 3TQ0A 1NSJA 1GYNA 1SSGA 3LERA 3CEUA 2B7OA 2NXIA 1VCFA 2FJKA 3LHZA 4FO4A 4HPXA 3TMQA 3KVKA 1XFBA 3NGJA 2V2CA 4MY8A 4UNKA 3C52A 4IMGA 3SGUA 3QYQA 4UTTA 3T55A 4O50A 3LV6A 3DHDA 3DHFA 1GQNA 3W1NA 5HWJA 2ZRWA 3PSWA 1AW1A 4QSHA 4PFMA 3KHJA 4O1DA 4OHQA 2RFGA 3B04A 3WJYA 2X1SA 4TU1A 3EB2A 4LVGA 4OQVA 3BW2A 3IV3A 2PRLA 3STCA 4JTUA 3W87A 2RH9A 1KW1A 2VELA 4BK9A 2Q3RA 3LCIA 3W1QA 5AHLA 5IBXC 1YTKA 3UQNA 1OFRA 5HINA 4HNVA 3W72A 2ZZ1A 1TO3A 2WPBA 4K38A 3N14A 2JKEA 2FLIA 2JKPA 4RK8A 5DN1A 1OX4A 3I6RA 1KLYA 2NV2A 1JJKA 4R34A 3NPWA 3PB0A 3Q58A 1WDWA 3I7QA 4AHQA 3IVUA 1BWLA 4O0KA 2QCMA 3KAOA 4LV4A 3W7GA 2YYTA 1HFBA 3ABQA 3MI3A 4C1KA 1XCFA 3LHVA 4NJGA 1RV8A 4JXCA 3QFEA 4WX2A 3IRDA 1ONRA 3IVSA 3LRMA 3W88A 3NVTA 3DGRA 2B7PA 4UFMA 1QO2A 4PTNA 2CZ5A 3N9SA 3L65A 4P2VA 5FF7A 5LGZA 4I7VA 2A6LA 1FWWA 4A22A 4LU0A 5DLCA 3LCWA 3M1ZA 2TYSA 1I45A 3NPUA 4D2JA 5DY3A 2VEKA 4BI7A 4UMBA 2TMDA 3KOFA 3TW6A 1TB3A 2Y7EA 5AC7A 2C14A 4CCEA 5K7JA 2Y85A 1XUUA 1JCMP 4DO6A 1QPNA 3PG8A 4HSOA 5BNKA 3MW7A 3L5MA 2DZWA 3W2LA 4KFOA 5CZJA 3NQAA 4R53A 1B3OA 1TV8A 4H4IA 1GVFA 1CX9A 4PC8A 1SO3A 2B7NA 1O60A 3M7WA 3NPXA 5D30A 4R7JA 5LHFA 4MYAA 2C0AA 3MI2A 2DZTA 3DI0A 3HGRA 4NUWA 1DJQA 1SZEA 4WY0A 1FWNA 3M43A 4CQ9A 1W31A 2DZPA 4O19A 3PUEA 2GVLA 1I8JA 1LTDA 4MZ8A 1Q3NA 2C6QA 1QAPA 3N19B 5I3HA 5L9FA 1HO4A 4K39A 2H6RA 1JQXA 2ZBTA 2X1TA 3KVMA 3T44A 4HNNA 3LOTA 4JYFA 3GXNA 3A5VA 1WQ5A 3FKKA 3TK7A 1TPDA 1WBHA 3M6YA 1GVRA 3M5ZA 1TPVA 2Y7GA 3FA5A 4UCGA 4UTHA 3NQMA 1RPXA 2DZXA 4GUJA 2PURA 4YMZA 2B4GA 4ZQCA 4K7VA 1XDMA 2BLEA 4GXMA 1I2OA 3GAKA 3DU0A 1SSDA 2QF7A 1LDCA 2E5DA 4K8EA 1W56A 4NJKA 5K3VA 1O95A 3EX2A 3G24A 1MZHA 1XKYA 4H3DA 2EKCA 2XFWA 1X1OA 5H91A 2E6YA 3M5VA 4LRSA 5FI8A 1I2PA 3GIYA 1KM2A 3LLDA 2VFIA 3DFSA 4ALDA 1YADA 3NL3A 3EWZA 3UY7A 3THAA 1LBMA 2TRSA 1E51A 1FY6A 2A6NA 4WXYA 1K7XA 4LOCA 1QPOA 1W5PA 4B5NA 3N9RA 2GQAA 3QF0A 4WOZA 2GUUA 1FQ0A 1C29A 4AVFA 3PULA 1VQTA 3O15A 3L68A 3GLCA 1ZFJA 4DPQA 1K02A 4PH6A 1LOLA 1SFLA 4PL1A 4LV9A 4K36A 3NG3A 3LCGA 3L9CA 3P7YA 2WNZA 4N6EA 3LXAA 3NQ6A 3HMJG 3TROA 1ZCOA 2ZZ3A 4OT7A 2GVJA 3NQVA 3CTLA 2UV8G 1Q6LA 1MEIA 4Y8FA 2J6XA 1W3NA 3E96A 4GNJA 3MYPA 5EL1A 4QITA 1BEUA 2YXGA 3MMTA 4ADSA 1TPUA 3O05A 2VFFA 1X1ZA 1LORA 3W9ZA 1TPH1 4HNUA 3I7RA 5D04C 4X2RA 2F84A 3E0IA 3TR2A 2P1FA 1WBJA 1DJNA 2FQIA 4O11A 1FCBA 1T99A 3TFCA 4UFIA 1SQ7A 1WXJA 1TPEA 3GVGA 3B05A 3TNOA 3IVTA 4EF8A 3QQ0A 2ZRXA 4MPQA 4X9SA 2V9DA 1UJPA 5HUPA 1GTEA 3MUXA 1V7YA 5AYYA 1IIHA 1R2RA 2ZZ4A 1ICQA 4L4LA 4ZQNA 1LRQA 4KWWA 1IXOA 4MYXA 3MI6A 1YDNA 3LBCA 1LBLA 1KFBA 1X7FA 1H1ZA 4N02A 5LNWA 5D2XA 3W7QA 4O10A 1N55A 3EWXA 1FDJA 1FXQA 1TCDA 2Z2UA 1QWGA 3ABOA 4ORMA 2WOQA 3C2VA 3W7HA 4OV4A 3IEBA 3NA8A 5F1UA 4DBEA 4AHOA 4EF9A 1GJPA 2BWGA 3DZ1A 3LCHA 3EWUA 4RZ6A 2A2IA 3HGJA 1LBFA 1A5SA 4IMFA 4JGDA 3W1TA 2J9XA 4FNRA 3IIOA 3I65A 5I3GA 1I2RA 1P0KA 3EEGA 2NWSA 2RHGA 5CPNA 2BXVA 3FJ6A 3DH7A 3MYOA 1YDVA 3PWAA 3GDLA 5C2XA 3W7NA 2DP3A 3B03A 4BF9A 4AWSA 4DO5A 1M7OA 3S5ZA 4IXHA 2ZYFA 4HPJA 1VLWA 1DQXA 2CLHA 3W2UA 2QUUA 4MLJA 4JNMA 3G8EA 4NZFA 3PVFA 3H54A 4IPJA 2Y7FA 3W7MA 2C16A 1KLZA 5EY5A 4POCA 4IMCA 4NJIA 2V81A 3O6YX 1GVQA 3THQA 4FIRA 2HS6A 3HG5A 4ADUA 3C4UA 3CC1A 3TAKA 3N2MA 4Z1AA 5G1YA 4ORIA 4E2DA 2JBMA 2WQPA 2CZDA 2AGKA 5DBUA 2CLIA 1H51A 4G1KA 3PC0A 5LNRA 2E09A 4FNTA 3CIXA 1EA0A 4JTGA 2QCDB 2Z6JA 2H90A 3QZEA 5TBOA 4UTMA 3HF3A 1NF7A 2ZZ7A 2TPSA 3S5NA 4RR4A 3Q94A 2YFOA 3L0GA 4QM1A 4OU1A 4MFDA 3BGJA 3HQ1A 3U2OA 1N7KA 4UTKA 3LCXA 2NZLA 3PR2A 1KFLA 3EX1A 5EPDA 1TTIA 1W5QA 3TW7A 4WOQA 4AWUA 1H63A 3GYEA 3G3MA 5D02A 4FX7A 5CSRA 4LWWA 3EKLA 3G1XA 1TJRA 3NXFA 4EIVA 1D9EA 2X2GA 1M7PA 3W83A 1W0MA 1TQJA 3EWWA 2NV1A 1LROA 1ZAIA 4UTTC 3SZ8A 3MHGA 4O0ZA 3S8HA 4WXZA 1KV8A 1L6YA 4I9AA 4HHPA 4WD0A 4O1CA 4M7TA 1JRBA 1KV5A 2QJHA 3W2KA 1A5CA 2ZCGA 3W7CA 4QIUA 5LHEA 1YXYA 4U28A 2Z1BA 3W22A 4JX4A 3FFSA 3JR2A 1W3IA 1H5YA 2G5WA 1W54A 4GUIA 1XUZA 3MP5A 3NQ2A 2VFHA 3TC6A 3G1YA 1W5NA 2X1RA 4RZ4A 1YPIA 2OZ0A 1EUNA 3AO0A 3BPWA 2V5LA 4C1LA 4BWLC 2BX7A 2YPIA 2CLFA 1TIMA 5LGXA 3TA6A 2C19A 2HMCA 3L66A 5CG7A 4E38A 3AJXA 3W70A 4Y9AA 2QUTA 3D0CA 3NQ8A 3LI0A 2NUXA 5AYZA 1DVJA 1FCUA 2NUWA 4ONVA 4BFAA 5LKYA 3S5YA 1XXXA 1LRTA 4RX0A 1DORA 5ABTA 1S3HA 2A0NA 3FKRA 1CW2A 1TYGA 3GKAA 4FB7A 1KFKA 2ZRVA 1J5TA 3P61A 4OE7A 5BW6A 3P74A 2Q8ZA 5D38A 3TFXA 3L21A 1I2QA 4IUOA 3VKJA 3ABSA 3CWOX 3IGXA 4A21A 4N4PA 3BW4A 2VFDA 3P80A 3PB2A 4J9JA 1T96A 5FF3A 1EEPA 5KZEA 1PV8A 2ISSA 3PBWA 3OIXA 1G4SA 5K4XA 3O07A 1SW7A 1FWTA 2WSQA 2QKFA 3ABRA 5TIMA 4M6VA 1SO5A 1OG0A 1Y0EA 2QJIA 3GDTA 3LHTA 4JN6A 5HQEA 5C55A 3G1HA 1EWEA 3NAVA 3TV8A 1W5OA 2ABBA 3STEA 1VHNA 5T26A 4MLRA 1JCJA 3SY5A 3A24A 5C6MA 3P8IA 1IXQA 1L9WA 2QCFA 1DHPA 1EX5A 3MHUA 4PCFA 5K9XA 5AYXA 3K30A 1ALDA 4YLWA 4PA8A 2O7QA 1TPWA 2Y89A 5CZ0A 4FXRA 3LHWA 1SPQA 3E9AA 4IOTA 4JYDA 4JIPA 4U4MA 4BWLA 5DBTA 3QSRA 3LHUA 4JTTA 3EKZA 3BO9A 1G6CA 1K8XA 1TQXA 4HIBA 3UPBA 2I1OA 3QC3A 2VC6A 1H7RA 5J5DA 3NL2A 3W85A 1OYBA 3UPWA 1K7FA 1M5WA 3Q2DA 3UWYA 8TIMA 1KTNA 3NR0A 3UWVA 3TIMA 5HWMA 3HJZA 4LS2A 4AAJA 1LLZA 3FJLA 1C8VA 1VRDA 3EXSA 1ZAHA 5DY2A 3HIJA 4MZYA 1F6PA 4UFJA 4JDYA 2FTPA 3G1DA 4IMDA 3RMJA 5KSWA 2OT0A 1RQBA 3LCLA 1LOSA 2X16A 4NXSA 1OFOA 1G67A 3TC7A 1GG0A 5D2TA 3CQ0A 1YPFA 4IJBA 4O1BA 5F2LA 4Q4KA 5AHFA 3M41A 3G8RA 2AAMA 2IQTA 3W2NA 3ZS4A 1YYAA 5CGQA 3SGZA 2E1DA 3G18A 3NEVA 1I4NA 1OF8A 2W0UA 3WK3A 4NXKA 3R5EA 4GBUA 1D3HA 3VFLA 5C5YA 4M6QA 3B06A 3KVJA 4E2BA 1RZMA 1GTHA 3M9YA 2CU0A 2DZSA 1TPFA 2EGZA 3TKFA 1SZFA 3HPXA 5F2IA 1O94A 2NUYA 1KTBA 1VC4A 4A2SA 3NZRA 3LHYA 3PF3A 1GT8A 1KM6A 4RV8A 3HPZA 3RU6A 3SFKA 2TSYA 3ZR4A 3A21A 1IGSA 5F2GA 4UR7A 3R89A 2ZA3A 3LTYA 1FUYA 1K8YA 1PCKA 1EP2A 2AQWA 4Z08A 3KRUA 2V0TA 3IIPA 1Z42A 3EWYA 3O1NA 2ZFAA 2GPTA 2DU2A 3BG3A 3N2XA 4K6AA 3KX6A 4NNBA 4UMCA 3W7OA 3HGOA 1NF0A 3OBKA 4KWVA 4A29A 3W76A 1SZNA 4FF7A 3EXTA 3MBFA 3OEXA 3W3OA 1JUKA 2BTMA 4FNQA 4JTLA 1OK6A 2VEMA 3N3MA 4CNNA 4FX8A 3FLUA 1JCNA 2C18A 3M47A 2VFEA 2ISWA 1O5XA 1H62A 1LCOA 5FEZA 3TSBA 1TSIA 2EPHA 4O13A 5G2WA 3W7PA 4P61A 2WO5A 2QCDA 3IGSA 1K3UA 2RDUA 1Q6QA 1S5VA 3WK0A 1Z44A 5CZSA 3LBMA 4UTWC 1R2SA 2VKZG 1H50A 1SR9A 4NU7A 3DFQA 4JR5A 1ZY9A 4AF0B 1UBSA 1MEHA 1Z48A 2QCHA 4O57A 4IWWA 5HWNA 2YCEA 1FWRA 3LRLA 3BG5A 3SSJA 3NO5A 1HO1A 1K7EA 3M0ZA 5D09A 2NLIA 5D33A 1HG3A 5HR7A 3EX3A 4OV9A 4Z0JA 1SFJA 4FHAA 4IQLA 1YXCA 2QCLA 2Y62A 3P5YA 3I68A 3TU9A 4CLMA 1PVNA 3BG9A 4UTIA 5E1QA 2YW4A 3RLVA 1OFBA 3HG4A 3G1AA 3MJYA 2YX0A 4LC8A 1GEQA 1WV2A 1H7WA 4OBTA 3UWQA 3VE9A 1WA3A 4JX6A 2O7SA 3OG3A 5FF0A 4M7SA 2FDSA 1W8SA 4NQ1A 2R14A 3R2GA 1EB3A 5DELA 5FF4A 3LTPA 1YTEA 6ALDA 4AH7A 3VI2A 3RF9A 4Z0SA 4Z1BA 3ZFHA 1QOPA 3C0JA 3CU2A 3TSDA 2QEZA 3HBLA 3LV5A 1TTQA 3U6WA 3INPA 3O16A 4O53A 4WQ6A 3MBDA 5LNUA 5F4XA 1MEWA 3L5AA 4JTSA 5A5WA 1OFEA 3O06A 2C3ZA 3EX6A 1EP3A 4LRTA 1TV5A 3W75A 2DORA 5F4SA 3HO8A 2DJLA 4Z1CA 1Q6OA 3NYZA 2LLEA 5H2ZA 2P0OA 3EX4A 3W7IA 2D73A 1G4TA 4UTWA 1F7BA 1PHQA 4NT0A 2EAWA 4TIMA 3UWWA 2QDHA 1ICSA 4CNPA 2PRMA 5G5IA 3PUOA 4JIQA 4IX2A 3CPRA 3W84A 1WOBA 1XM3A 2DZUA 1J4EA 2WJZA 4XWUA 1TMHA 4FX6M 1KM3A 4ZQMA 1UASA 3LCFA 4TX9A 3W73A 3NZ1A 2ZRYA 1AW2A 4CQ8A 1RQEA 1WYIA 3SI9A 4MIMA 3HB9A 2OT1A 3S0CA 3C56A 2RDWA 2E6FA 2YR1A 2V82A 4K8HA 1KFEA 3PG9A 1NFBA 1ADOA 5DXXA 3MWAA 1FXPA 5HMSA 3GDRA 5D2VA 2FB3A 3HOJA 1HTIA 2FIQA 2A4AA 2Q3OA 1QPRA 4JTFA 4M19A 2W79A 2ZA1A 3E02A 1R2TA 4X22A 1VHCA 3WK1A 3O6DA 2VEPA 4GRSA 1KBJA 2CLOA 5K2ZA 2OCZA 3DFTA 3W1MA 3LB0A 2CLKA 3NQDA 4O52A 3BLIA 4WY0B 3G1SA 3EXRA 3T7VA 4XBKA 4LC6A 1WX0A 3UD6A 4DEFA 3B4UA 3R13A 3LXCA 4YCOA 2DZVA 3M44A 4LT9A 4DF0A 1ZALA 1G4EA 1ME7A 3PUDA 3G0UA 4QISA 2NWRA 1TRDA 2J9ZA 1RR2A 3QPZA 4TMBA 1OFQA 3L0KA 4QNEA 1XDLA 7TIMA 3GB6A 3DFNA 4WJEA 1UUMA 2JGYA 5D2WA 3IGUA 4NVTA 4WZHA 5E0KA 1DL3A 4JTJA 1A50A 1KM0A 4IX0A 5HUOA 4TO8A 1QMLA 2QCCA 1TPC1 4RKAA 5LNSA 2CFFA 2YYUA 1L6SA 1NAL1 2ABAA 3TMLA 4A3UA 3W2JA 1QOQA 1OYCA 3DAQA 3W7RA 1ZAJA 1N8FA 1G4PA 3L67A 1OK4A 1J2WA 4Z1DA 4CQAA 2VFGA 3TUUA 1X6UA 1P0NA 3GX9A 3STFA 1L2UA 1FBAA 3W71A 2J27A 3LRKA 4JTKA 4HN4A 2QCGA 4O28A 3S6DA 1VPXA 3C8FA 4MJZA 3GNDA 2H3BA 2JKAA 4NNAA 4O16A 4R33A 3VCRA 3W1UA 5LNVA 2ZDRA 3L2IA 3DI1A 3IIXA 4FNUA 3R8RA 4GUGA 1LRNA 3E12A 1SO6A 1VZWA 1H1YA 1K8ZA 1KM4A 3C3NA 4JEQA 2WNQA 2CZEA 1EP1A 1UUOA 1DBTA 5HULA 3OA3A 4YL2A 4M5PA 3HPSA 3TXZA 3WJZA 2GJLA 1F05A 4PL2A 1ML1A 3VE7A 2EHHA 1KFJA 4DXVA 3BLFA 3I7SA 3LLFA 3CLMA 3USBA 3NPVA 1B9BA 2A1YA 5FEXA 3PBYA
chains in the Genus database with same CATH superfamily
3A3XA 1VIWA 5T8GA 3R8GA 1EBHA 2NX3A 4LVFA 1FHDA 1P4CA 1C7SA 1XBXA 4GC4A 3POCA 2GUYA 2IQ0A 5AOUA 1KM1A 2JIEA 1CB2A 2Q71A 2R91A 4OOZA 4NZJA 4A8LA 4DAFA 3SIZA 4YXGA 3W7KA 1O66A 2W92A 1VFOA 4RXGA 3RYSA 4OWGA 1V79A 5KZDA 3C61A 2WMFA 1H7NA 2G3MA 3C5QA 1EHNA 1ECQA 1M7XA 1P1XA 4H8UA 4YTQA 1VFHA 2CW6A 2G4FA 3GXMA 3OVPA 4D6HA 1XD0A 1FDZA 5E0FA 3W6MA 1G1YA 2EBNA 2D0GA 2TODA 2OOFA 2PP0A 2J9YA 4R9OA 3TSMA 4ZMGA 4L9ZA 3T0CA 4RCXA 5HA7A 1IEXA 1UIPA 3CT7A 2PBOA 2A7RA 2OWWA 5DCDA 1QNVA 4TQTA 4Y6GA 5CJ5A 3O2LA 2ZXQA 3NDOA 3PK7A 5DMNA 4HZMA 4RXFA 4XSLA 5U7SA 5LZLA 4ICNA 4H9VA 1VGAA 3W86A 3U5UA 2A21A 3ITCA 3H53A 5CC6A 1F6KA 4LFYA 1HQTA 1C8YA 1IXNA 3FOKA 1XLAA 4IXXA 3CL8A 4OBRA 1EGMA 1FHUA 4EXQA 4XZ9A 5EU9A 4AVNA 2Z1WA 2QDGA 1DIKA 1EF3A 4J1OA 4S38A 3S1UA 2ZA2A 4QQUA 3UETA 4UUIA 5JU6A 3L4ZA 3F4NA 4O17A 3HPFA 2W61A 4GI6A 2X1UA 4CN4A 5CC5A 3WLPA 3NZGA 4NL1A 1TCMA 5EMLA 4QE4A 3G0XA 5IDIA 1HJSA 3MSGA 2GOUA 3BGAA 3UJEA 1VBJA 1TTPA 1XLMA 4HTBA 2P50A 4J40A 3Q4DA 4L4MA 3ZWTA 3C0QA 2QMJA 3QH2A 4UMAA 4E0CA 1H4PA 3A5FA 1KA9F 4MWAE 2PP3A 2V2DA 1ME9A 1TX2A 5KITA 4XQ6A 1MO0A 1BSIA 4CCDA 3ES8A 2BY3A 3AHTA 3GIPA 4H9XA 4NAEA 1R38A 1OFAA 1I0BA 3NDYA 1TJ1A 1OFDA 1VENA 2Z27A 3ZLGA 4FA3A 3VDHA 1EOKA 2CZFA 3QHMA 5BRBA 1GJUA 1QI0A 1J12A 3BV4A 4MFEA 1O5QA 1NWSA 5FJRA 3CUZA 4DX3A 1YLVA 3LA4A 1E3ZA 3GHTA 1B54A 1BKHA 2V5BA 7REQB 4HJFA 3OYZA 1ZRQA 1M01A 3KRSA 2NQZA 3V1PA 2PGEA 1TV4A 4DRSA 4GZEA 4F2UA 1U83A 3CHVA 4JY8A 3CIWA 3SCPA 1ZHAA 1RHCA 1PB0A 4BI6A 4N4QA 2G96A 3VD7A 2WPGA 5IDZA 1OX5A 2A5HA 4PCNA 5AHNA 5C54A 2Y61A 1FWIC 1N8WA 3TE9A 3E49A 4IT1A 2HWGA 5I5RA 5HNRA 3LENA 1Q85A 1JGIA 4B5UA 2WVTA 3GK0A 6PTDA 3M64A 2BHZA 3BICA 3HM7A 1VLIA 3AIBA 3OLEA 4O4VA 2ZRZA 6REQA 4IPNB 1SW3A 3VPLA 5HXMA 5GNXA 2FVLA 3QBUA 1PZ1A 1TJ2A 4HT3A 4FIQA 2J88A 3BARA 4GMEA 2OYLA 3GUWA 2ZZ2A 3B0PA 4YVXA 3QKEA 1YHTA 3V1HA 2J74A 3K1DA 2FZDA 1H7PA 1D8CA 4JKLA 2KZHA 1VIZA 2G95A 3T0BA 2E6DA 1EC8A 6ENLA 1PTAA 3C2EA 4LY4A 3TJLA 4CQCA 3VGHA 1OX4B 3S3GA 1OQFA 1T0OA 2VMFA 4V28A 2VEIA 3ZLHA 6A3HA 2PC8A 3MKVA 3WH9A 1E6QM 3BOLA 3DN5A 3ZWSA 4E6MA 4O8RA 1J8VA 3ELFA 2PP1A 1XSIA 3PWIA 3D47A 1HP4A 1WAUA 2NX1A 3TLLA 2WHKA 1C9DA 4PUWA 3T07A 5BMXA 1FDYA 5FESA 3S2MA 1GQKA 4ZBCA 5FJOA 4LF2A 3CUGA 4QDMA 2CYGA 4A35A 3C3UA 4LAMA 4CNTA 2WVVB 4K7YA 1H1NA 4DBDA 4XKYA 1JVNA 3MV01 4X3ZA 5F1VA 2V2HA 1ZJAA 1JF5A 3TCEA 3TYBA 3EAUA 2QAPA 3BW3A 4IIHA 3BAJA 3P81A 1Z41A 3W1XA 1S5WA 5TAOA 2NX9A 4A3YA 5A6AA 3QMRA 3R1ZA 5CAHA 1GOXA 5JBEA 1E0VA 4MY1A 2HS8A 3SDOA 4HK6A 3WBYA 4DLMA 4JL2A 4X9YA 3QQWA 2YCKX 3ABXA 1U33A 4Z17A 3KWXA 3GDKA 1UPMB 3FN9A 1VFMA 2Y2WA 2NSXA 4N9BA 2J66A 4DF2A 4NP7A 2GQ9A 5ABGA 4PTDA 4TMCA 3KM8A 3AISA 2HZGA 3S1VA 1FWEC 3EB3A 3A4AA 1QBBA 3B4YA 4Y90A 1W3TA 3N4FA 4FLOA 3OGVA 3CYJA 1HJXA 4EP8C 1UB3A 4PSPA 4DELA 4KKXA 3MP3A 3OPSA 1JDEA 2QZRA 4YU1A 3DFOA 3GXFA 3NQ7A 4QJ1A 1UZHA 4L65A 3BSMA 1XBYA 2G41A 5I3KA 2DQWA 1VH7A 1PHWA 3TQVA 5G4WA 2E6AA 5A8GA 1V93A 4ROQA 5EMMA 4JFWA 3L23A 2W62A 3REQA 5DT7A 4EVZA 2CBVA 3H55A 1KXTA 2GJXB 4OGZA 1Y5WA 2CWNA 3DERA 2NXGA 1S2WA 4MWAB 4JN7A 3PY2A 3U8GA 3N6HA 3AZRA 1ZLPA 2DVXA 4Z2IA 5H8MA 2C0HA 2Q6ZA 3OOQA 1QCWA 3Q67A 2FB2A 2YZRA 1CI1A 3QGKC 1HX0A 3CO4A 3P5ZA 5K4ZA 5JUVA 1O4UA 3EPNA 2XN1A 4BI5A 4PEEA 3QPYA 4AYGA 2RDTA 3PJUA 3BQ6A 4L5ZA 2BMBA 2DQXA 4DM2A 3SW6A 1XGZA 4PODA 2E77A 3GNRA 1GZ1A 1V0MA 1JRCA 2FPTA 5ECVA 5BOFA 3FJ4A 3NOEA 2X09A 2XG9A 1E0TA 1Q65A 3ENLA 1IXPA 4ZQRA 4R7OA 4W9TA 1K4GA 3F7JA 3B9OA 3W1LA 1E9LA 4V2XA 1X8FA 2OPJA 5D8ZA 3KLKA 2SFPA 2DUAA 3SEPA 3UXAA 3BGGA 4R9XA 3ABZA 1XP3A 3ATZA 3BMWA 3IJ8A 1A5KC 1CZ1A 4I7WA 1UR0A 3WLOA 4NJJA 3EMQA 1XLBA 4M6PA 1JCXA 4NHVA 5AHEA 1V6VA 2VVSA 1XBVA 1U1JA 4KCTA 3H7RA 4O12A 4LY8A 2CLEA 3NM3A 1NWUA 4Q8PA 2I9EA 5C7HA 1W5MA 5CH9A 3FYOA 4GUFA 4WY0F 3XISA 2X30A 3FK4A 3AHVA 3UNDA 1FWBC 2O4MA 5HANA 1QHZA 2QUVA 3LNMA 3H26A 1VJSA 3TXVA 1ITCA 3JZEA 1C3FA 5MKGB 3RILA 3BLPX 5E93A 4DPPA 3D3FA 2EG8A 1XQKA 4FS9A 4MGGA 5CSYA 2PWDA 5FEWA 4GK8A 3M16A 4BEQA 1MNZA 1EX1A 1E1CB 3LHZA 3GYCA 4IMGA 3SGUA 3LQLA 5E5CA 3AHZA 2DGAA 5CEWA 3VD5A 3W1NA 1HW6A 2ZRWA 2OB3A 1K8CA 2BVTA 3MSYA 4O1DA 5FACA 2PGRA 3CYVA 3VTRA 2YBTA 1XGEA 4RE4A 4TU1A 3WELA 2YDRA 4GX8A 4Z42C 8XIAA 1A47A 3LCIA 4MUPA 2I17A 5GNYA 5HINA 4X60A 2Y8VA 3DCPA 2WPBA 3VGBA 2JKPA 3LPFA 4J27A 3EMZA 1CLKA 1JJKA 4REQB 4GY7A 1V3HA 3NPWA 1I1XA 1EF2A 1W1B1 1RLCL 2HE8A 1HJQA 4WK9A 2F6UA 3I7QA 4AHQA 1BF6A 2DT3A 2QCMA 3VNJA 3GTXA 3GVRA 4GISA 1E4MM 4C1KA 1SMDA 4NJGA 3M0KA 2BOFX 2Z4GA 3QXBA 1CXHA 3MMUA 3DGRA 1G94A 1QO2A 3ZIZA 3L65A 1RSCA 4P2VA 4I7VA 4DBUA 5DLCA 3LCWA 4OUEA 3BLLA 4Q22A 1FWFC 1CYGA 5C70A 4Q7BA 4D2JA 5DY3A 4MWAC 3A4WA 5BU6A 3MCMA 3TW6A 5AC7A 4F0RA 4F0LA 4V15A 1XUUA 1JCMP 1WB0A 1UC4A 3MW7A 2OKTA 4E8CA 5T9CE 4KFOA 4UOQA 5CZJA 1PZ0A 1B3OA 2YJQA 4AD3A 3WH7A 2ESCA 3B8TA 4DO7A 1CX9A 4PC8A 1XSKA 1WUEA 2POTA 1O60A 3VD3A 4WIWA 4PTXA 3ZXWA 3IRSA 1W9PA 3HGRA 1SZEA 5T9BG 4IGNA 4CQ9A 4Z2GA 4QDPA 2X0SA 3GBDA 3ZVHB 4G7FA 4W7UA 3E0LA 4K2SA 3CO8A 4O1FA 2C6QA 2FTYA 5I3HA 4M24A 1HO4A 1VPQA 2H6RA 4K39A 1JQXA 3L7RA 3M0VA 3MWCA 4DJFD 3A5VA 1MRAA 4GH3A 1ECEA 2BHYA 3TZFA 5I02A 1GVRA 2PPGA 1TPVA 1EZWA 3MC5A 4PMYA 4GUJA 1E6RA 1VBUA 3T1GA 2DSWA 3CHEA 1XDMA 2BLEA 1X6NA 1QTWA 4CKQA 1E43A 4ZO9A 4A8RA 4JL1A 5K3VA 7ENLA 2YCJA 2POZA 2XFWA 3V4BA 1X1OA 4UBPC 1RP9A 3CUJA 5FI8A 2O55A 1X6LA 2BGNE 3OU8A 3OA5A 2VFIA 3APTA 3DFSA 1NJJA 3N3TA 5IFPA 3EWZA 3UY7A 3H21A 1DJIA 1LBMA 3THAA 4E8DA 5HATA 4CD6A 4B5NA 4HMDA 2GQAA 4PYSA 1FQ0A 1C29A 3KW3A 2NT0A 4AVFA 3L68A 3KEHA 3QTPA 4LV9A 4K36A 4NILA 3NG3A 4L7ZA 4N6EA 3TROA 1LG2A 1ZCOA 2DIJA 1RVKA 2ZZ3A 4LUSB 2VZUA 4ZR8A 4K1GA 5LA1A 1XIIA 3TEVA 3N2TA 3HZ3A 2OZ8A 3SCSA 4KWSA 4GNJA 4FLSA 2MNRA 2UY3A 1GGOA 3HV9A 2YXGA 2XGZA 4W8AA 4ADSA 3D5HA 5HAOA 5B7ZA 1R87A 3E0IA 3TR2A 2P1FA 2FQIA 3N29A 4XB3A 5HNTA 1ZP3A 3BOFA 1TPEA 3B05A 3BLDA 3IVTA 3VVGA 4EF8A 4MPQA 2G4JA 4C6NA 4X9SA 2C7FA 3WDPP 3S2CA 1BQGA 2BXYA 1VKFA 5DMYA 5AYYA 2WVSA 4L4LA 3I6TA 2YA0A 1GHRA 4KWWA 2RGMA 2IKJA 4MYXA 3URBA 4BF7A 1W9BM 3AYSA 3DG7A 3GW3A 2C79A 1EFZA 3IWPA 3W7HA 3DOPA 4YTUA 1ZGDA 1Q6EA 3UG8A 4WSKA 4EF9A 1GJPA 3LCHA 3GTHA 4RZ6A 3S2LA 3T9PA 4IMFA 4MB4A 4HTYA 4I5XA 4WKFA 3W1TA 2J9XA 4AIUA 2BY2A 5BYWA 4HPHA 1JDCA 3EEGA 2AL2A 3FGCA 1J01A 3PWAA 3CV1A 5JIWA 1JZ6A 2DP3A 3B03A 2QNEA 1BXCA 3NZQA 1M41A 1D7FA 4C6CA 3PVFA 3H54A 3W7MA 4W85A 2V81A 4M80A 1QNOA 4KWUA 3NCOA 4PMVA 3GIQA 2XPKA 3HG5A 4ADUA 2E8ZA 1TWZA 3AXXA 3CC1A 2WWCA 3TAKA 4TVCA 1YW1A 2JBMA 3AWNA 3E38A 3IV8A 2VHLA 1F3XA 4FNTA 4LBUA 1CGTA 4HCDA 3RPTA 5HNNA 5BXSA 3QZEA 2ZX8A 4Q6JA 3RR1A 4UTMA 2QMKA 3HF3A 4TOQA 1UQZA 5I06A 4Q3MA 5HPOA 4D8ZA 3L0GA 4FSAA 4OU1A 4MFDA 3BGJA 1DIEA 3HQ1A 1N7KA 3U2OA 2BV9A 3HTWA 2YB1A 1TTIA 3COTA 4DJFA 3TW7A 2BVYA 1JD9A 3TN3A 3LPOA 3NWRA 3KOYA 4AWUA 3T2OA 3GYEA 4FX7A 1KXHA 3WF2A 1BRLA 4LWWA 1TJRA 3S1GA 4EIVA 4ICMA 1UZ4A 2H9AB 4HHLA 2DUZA 1Q8JA 1W9VA 3CV7A 3R4IA 4RE3A 1ZAIA 3MHGA 4O0ZA 3RX3A 5PTDA 1XRSA 4AD1A 1UP2A 4HHPA 4O1CA 2QJHA 4G8TA 4XZNX 1AH4A 2ZCGA 4QIUA 3U4FA 4U28A 4FPSA 4AZIA 4JX4A 2G8ZA 1SMAA 1MW1A 1XUZA 1TKKA 5BXTA 3FSTA 1G9HA 2E1WA 3TC6A 4QS6A 3AO0A 4C1LA 4BWLC 2CLFA 1S2TA 5LGXA 3LYEA 4G7EB 3AJXA 4Y9AA 1HKMA 3NQ8A 3LI0A 1PIGA 5LIUX 4C6FA 1DVJA 2PDXA 1NELA 4ONVA 4BFAA 3S5YA 2DV0A 1DORA 5ABTA 1TYGA 3GKAA 1DPMA 1J5TA 4OE7A 3NJ3A 2Q8ZA 2AGTA 4PBFA 3L21A 5C2GA 5CBBA 1YNQA 1RAKA 3SCQA 3VKJA 1CXFA 4P8XA 2CBJA 2INZA 3FYYA 1T96A 4KERA 5FF3A 3SM0A 5A6MA 3WSUA 1IZCA 5H8PA 1IV8A 1YEYA 5AZ1A 2D1ZA 2YBUA 3K5XA 3ZT5A 3A4XA 2VCCA 4HU0A 4NZ3A 4JN6A 1Y0EA 3BAYA 3BCDA 4J3UA 4GYFA 3IAQA 1VHNA 2YDQA 4DJED 4NKCA 2OSYA 1IGWA 3U7BA 4GACA 3QHNA 1Y5XA 3GFZA 5FA5A 3P8IA 4YVVA 3WLRA 1L9WA 5K9XA 5HMDA 1OC5A 2UY2A 3K30A 5AYXA 2O7QA 4LNCA 4FXRA 1SPQA 1ADSA 2VGIA 2VJXA 4HMEA 4JTTA 1EJVC 4UZSA 3UPBA 3QC3A 2VC6A 1HJUA 3QV6A 3S2NA 5FAGA 3W85A 3DC8A 1KTNA 4H04A 2G3JA 1E6NA 3HQNA 4MZYA 4GD0A 4JDYA 3KZSA 3G1DA 4IFKB 5KSWA 1K6WA 2OT0A 1LOSA 5A2CA 3ALFA 4NSBA 4QLLA 5AC5A 1G67A 3PUGA 1GG0A 4P7LA 4HK7A 3CQ0A 4IJBA 1SYTA 3ZS4A 3UG5A 2CZVA 3DHUA 1YYAA 3WUGA 1O6IA 2D22A 4QCFA 3G18A 3V5OA 2P8CA 3T8LA 2W0UA 4P8WA 3VFLA 4GQQA 3RN6A 2BNJA 4EPDC 4M6QA 4BS0A 3KVJA 2F8QA 4RNJA 1RZMA 1GTHA 1LQ0A 4LBRA 3QV8A 3VMOA 2EGZA 5EMKA 5F2IA 4JCMA 1O94A 4AISA 1XYAA 2FVKA 1HZYA 3O0KA 2YCIX 1S5MA 4TXEA 4ZTYA 3NZRA 2MUCA 4H41A 4QGCA 1J18A 2Q01A 3KCJA 3CL6A 4GA8A 3ZR4A 2PD9A 1IGSA 4UR7A 3K1GA 5J8LA 4ERAA 4LAKA 1FUYA 1K8YA 1XCWA 1W6TA 3VYLA 4QLJA 4W87A 1GVYA 1NDYA 3FNDA 2ZX6A 2BY1A 3GZAA 3EWYA 4DJDD 3T4WA 3BG3A 3N2XA 4K6AA 1PX4A 3HGOA 5CPTA 3H23A 3T0TA 2ISDA 4W86A 2GK1A 3EWDA 3LQGA 1QASA 4CEUC 4HU4A 3BZGA 3GG8A 1XRTA 1JUKA 4FNQA 4JTLA 1OK6A 1TUXA 4FX8A 2GSEA 2ISWA 3R0KA 1V0NA 2V5KA 1O5XA 4IFOA 5XINA 1LCOA 3TSBA 3MY9A 2XIMA 3E6EA 1S5VA 2C1GA 1O68A 1SR9A 4NU7A 3ZJ8A 4C6BA 1W32A 3VUSA 2DIEA 1G0CA 1Z48A 4O57A 9RUBA 4IWWA 2YCEA 3OZMA 1FWRA 1GOOA 1XF0A 3IJLA 1HO1A 3QV7A 1XLJA 3M0ZA 1SFSA 2BB0A 1HG3A 3EX3A 4GHRA 1XW8A 1VFTA 3FJNA 5HDRA 1UD6A 3O0FA 1J0ZA 4IQLA 3AFBA 1H41A 3U4AA 2PEVA 3OHMB 4LEQA 3G1AA 1JFXA 3WDIA 5FF0A 1A4MA 1W8SA 1QNPA 5LYRA 2RAGA 3R2GA 3IJ9A 1LG1A 3V0UA 5DELA 1DJWA 6ALDA 4HD5A 2DT1A 3ITLA 1Q4NX 3KUMA 5JH2A 3C0JA 2QEZA 3PJTA 1TTQA 4KEMA 1U30A 2OZTA 3F5LA 5LNUA 1MEWA 4J3VA 4XZMX 4JTSA 2QV5A 2C3ZA 3EX6A 3LSCA 3OGSA 4H00A 4S3KA 1Q6OA 4QR6A 3UR8A 3UXIA 2LLEA 3K8LA 5H2ZA 2WKLA 1BYDA 2HVOA 3W7IA 5D9OA 3WD0A 4UTWA 3TTYA 2O9OA 3AS1A 2JALA 2PRMA 4JIQA 1VJZA 1Q7MA 3W84A 1ZBVA 1P48A 1XM3A 1J4EA 4OFCA 4F4RA 2PDCA 1KM3A 3TYUA 4TX9A 3NZ1A 1AW2A 4OZOA 4E2OA 3RJXA 4S3GA 1W3HA 4A3HA 3S0CA 1XRFA 4K8HA 3PG9A 1NWRA 3MWAA 1FXPA 2FB3A 1MW2A 3VGGA 3DG6A 1CT5A 1R6WA 3KTXA 5AC4A 4JTFA 4HMCA 4H19A 1MRQA 3JZUA 1QK2A 4GBDA 1EQPA 4XIMA 3G5EA 1X7IA 2VC5A 5K2ZA 3HPAA 3LB0A 2CLKA 3NQDA 4GZJA 4QLKA 1W1PA 4IIEA 3EPOA 3I3EA 4XBKA 3OJGA 1WX0A 1W9XA 3UD6A 3B4UA 3W53A 3UZZA 1NQKA 5AY7A 6CGTA 3F5JA 4M29A 3VK5A 1B31A 2D2JA 3DUGA 1ISXA 3G0UA 2VURA 3V16A 5C9XA 1TVLA 5GNZA 4TMBA 4XD4A 1JAEA 4M81A 4X63A 1XDLA 3SCTA 5D2WA 5HJYA 4L4OA 5E0KA 1DL3A 1WKFA 1XHGA 1A50A 5HUOA 4D6GA 2YIHA 1TPC1 4O8AA 2HVMA 5GQBA 1K9TA 1HVQA 1OYCA 4DJDA 3DAQA 1G4PA 4Z1DA 2I5IA 2UWFA 4AIEA 1I9CB 3EPMA 3OLDA 4RUBA 2R1LA 1AQHA 1FBAA 2OLSA 6REQB 1FWCC 4HN4A 4C65A 1V02A 2QCGA 4I8YA 1AH3A 4IG2A 2PLJA 3WIJA 4MJZA 4O16A 4R33A 4Y7EA 4AC1X 4Z2HA 2BFGA 3W1UA 1EC9A 3L2IA 4QX4A 3GY1A 4FNUA 2A3AA 1J93A 3P93A 5A6JA 1AJ0A 2WNQA 2BG5A 2V69A 3WL0A 3HPSA 3TXZA 2GJLA 1F05A 4TV5A 2BOEX 1ML1A 2PODA 3ITYA 2OZ3A 3AU6A 4ES4A 4JAWA 2EJAA 4NAFA 4M82A 1MUCA 4BJHA 3WLHA 4XAZA 3GDBA 5FEXA 4W84A 3D3AA 3CM4A 3EBVA 4BKNA 4O4WA 4UFHA 3NQBA 3UYIA 1O12A 1NVMA 4ZVJA 5A6SA 3QLDA 1GYLA 3SCWA 3AICA 3KWSA 1MXDA 4XKYB 1EYWA 2QV4A 3T0AA 1GZGA 3S9IA 3ZR5A 1EXPA 2OSXA 1C8XA 3VIGA 4JICA 2WXDM 3TJXA 1Q6DA 2EO7A 2RKXA 3MDUA 4ZTXA 2WZEA 3MUCA 3FS2A 1NWTA 2QHAA 1AJZA 3KS6A 2XWDA 4C5YA 1Q8AA 3WH5A 3UWUA 4FNSA 1WOAA 5ENLA 2X7VA 1YNYA 3UWEA 2GL5A 4B16A 3QGAC 3ES7A 1IT7A 4Q8MA 2CC0A 4W7VA 2OFJA 5E9XA 2CESA 4AF0A 3UXDA 2D69A 4AB4A 3ZSSA 2J7CA 4PMDA 3PAJA 5TQLA 3RM4A 3A22A 3GS6A 1XIFA 4GVIA 1TZ9A 3C6CA 1YMYA 3EZ4A 4L9XA 1R30A 4C6JA 3PAOA 3P62A 7ODCA 2WQDA 1T5AA 4JX5A 4Q8QA 4E4PA 1OGBA 1AODA 4P7QA 2VRKA 3E2QA 3WFAA 3UJ2A 1SU5A 1W3JA 3QLLA 1YBQB 4BR1A 1V5XA 4UQEA 3REQB 3K8MA 2XYLA 4S3DA 3M6DA 1GVOA 5KINA 3R43A 1HKKA 4RPPA 1EDQA 2ZADA 3P82A 1BGGA 4LQ1A 4LB4A 1O7AA 3CH0A 5G2IA 2C15A 4WKAA 1XC6A 3WJWA 1HP5A 4MJMA 2OODA 3E1F1 3RMEA 2ZUSA 3E0VA 1A53A 5HR6A 3SN0A 3VXGA 4NIRA 1VYSX 4RNHA 3M0LA 1FX6A 4JTEA 3T4CA 1RBOB 4KESA 1ITQA 2EPLX 2C13A 1JIBA 1TIWA 2HCVA 1IR2A 4O54A 3ZVIA 2ISVA 4MB1A 3W7EA 1ONEA 1U1UA 1MWOA 4EWND 4P7NA 3C2FA 3QW3A 4ICCX 4DF1A 3BAKA 3LN3A 1OHLA 2ONEA 1QO5A 3GNPA 4B5TA 1FWJC 2QXWA 4IPLA 3NM1A 3TJ4A 4B4HA 6XIAA 3V35A 3ZO9A 2IXUA 1HJWA 1I2NA 1JCTA 3NQFA 3UZ5A 2WMHA 2WCSA 3DDMA 3AUOA 2IQDA 5EA9A 1ADDA 4OKDA 4GINA 1PE1A 1Z69A 1JNDA 1S1PA 1SZRA 4GWEA 3U57A 3GR8A 4GPNA 4BF5A 4Y2WA 2YCLA 4IH3A 4AHPA 5EBAA 3CZGA 2VM8A 3SY1A 4N9DA 5C9WA 3ZJ7A 5G2HA 2J7EA 1IR1A 1V03A 3MMWA 4M56A 4H6EA 1RJQA 4ASTA 1I6NA 5EYWA 1B9ZA 3HG3A 1HL8A 1QPQA 3QGVA 2J7GA 4U3CA 5DCBA 2DDXA 1YIXA 4K3ZA 2FPYA 1IWPA 1L8NA 3QOMA 1V0LA 5G1TA 3VKBA 1J2BA 5E6ZA 4KQNA 5DX7A 1TWWA 5GVJA 3TX9A 5JQ9A 1SJDA 1DXFA 3B9EA 1PUDA 2XU2A 2OXNA 4FR6A 4XX6A 2Z1VA 4RZ5A 3PNZA 4CN6A 2Y8KA 4PUDA 4ATLA 1UWIA 3AIUA 3CHDA 3T8QA 3W25A 4IMEA 3P14A 1EXBA 4E4UA 4HNTA 1Q66A 3A13A 3HURA 2I16A 2AKZA 5LIKX 1P5BA 1BXNA 1NH6A 1VBRA 3MMDA 1WDDA 3DECA 5I79A 3VIHA 1THFD 3L4UA 3MDWA 1VB9A 3GWQA 3NL6A 1NQ6A 1G5AA 1QPKA 1XC4A 3Q37A 1GVIA 1O5KA 1TR1A 2ANUA 1SUXA 1XYFA 4Q6XA 1PZ3A 3WLQA 3HN3A 3N4AA 1F4AA 3KXQA 2PU0A 4B91A 1F76A 3VC5A 3VIMA 1MXGA 3CQIA 3ORWA 4JY9A 2A3LA 3ZQ9A 5ABFB 3PSVA 2FHFA 2V3FA 4B2DD 1VYPX 5D05A 1S2CA 2WC4A 4C6LA 3IUIA 1MDRA 1QFEA 1E73M 1KR0A 3PNUA 2PGFA 4FXFA 2Y5EA 4I5RA 1PKMA 4GIEA 4ML9A 4DYJA 3MO7A 1K9EA 3SJ3A 3OVRA 4CD7A 2YXXA 2OMAA 4D1JA 4URIA 1LOQA 3WF1A 1HUVA 1QRQA 5CBJA 2GYIA 3QR3A 4U5IA 4QG6A 1X1NA 1G69A 9CGTA 4I8DA 2VCAA 3GDMA 1F07A 4DUXA 2CKRA 4AX6A 3QSTA 3CAVA 1AG1O 3WLJA 3NQGA 2W27A 3P84A 3WKZA 3NO1A 1LJYA 4H2CA 2QUMA 3AS3A 4IM4A 1US0A 2XIBA 1GQJA 3T2PA 5BCAA 8A3HA 3W2MA 3BANA 3KTSA 4LAOA 4LEFA 1GVSA 1YKWA 3ITOA 3NXLA 2Y70A 1BTMA 2OLAA 3XINA 1AA1B 2FGLA 4ILSA 4R27A 2A7NA 4IF2A 4WKHA 3LK6A 3SJNA 3EEZA 4YCPA 1PIIA 1JR1A 4JQ3A 4KFPA 3TYDA 1UH4A 5I3FA 2OTDA 2ZWYA 1GOMA 4P7RA 3W01A 1JCLA 2E5CA 4WCJA 3WLIA 3QFWA 2Y6ZA 1EUAA 3GHSA 1TRIA 4CVUA 4HVXA 1E4LA 1R7AA 1TWDA 4HA3A 5EMJA 2VZTA 4XAGA 4XD5A 4U5KA 2PDQA 3NEHA 5GJMA 1KRCC 5CG0A 3RLUA 3L12A 4AXNA 4QQ3A 5CPMA 1LUCB 1XLIA 4FLQA 3WD4A 4JHOA 4XZBA 3TAOA 3L4VA 5IXEA 5A8MA 1A5UA 3UGRA 5I00A 5K9DA 2F7FA 1XIHA 2XIOA 2WNWA 3T0DA 3HGSA 1DWIM 4S3JA 1JGMA 3WNOA 1S2VA 2QJGA 2PRHA 1M1BA 4OIFA 4MKVA 4CVWA 3WDRA 4C7GA 1MW3A 5FL0A 2HNEA 3LXBA 3FVDA 1XJBA 5F4WA 3JS3A 1RLDA 1RQHA 3CQKA 3N2BA 4IGHA 4YWIA 1OX6A 3QW4B 2ZDSA 4Q7IA 3CQHA 1RK6A 3QJAA 2DVTA 3NOYA 2PWFA 3G1VA 3VABA 2ZE0A 5FSEC 1KM5A 1R5YA 4PCPA 2Y7DA 4OUIA 2YSWA 4DZ5A 3GC5A 2VX5A 3DC0A 4FLRA 2WV8A 3R0UA 3F2CA 1B3ZA 3MHFA 1OCNA 1MXSA 1E0WA 5F2MA 4AVOA 1IZJA 2D20A 5FJJA 4EPKA 3I4EA 1LLWA 3C2OA 3AUJA 2PTXA 2OYMA 3W7LA 3BLEA 3RRAA 1WKDA 4EXAA 4CNSA 1JL8A 4LS0A 2O9PA 1JUBA 1DHKA 3PS7A 3BOXA 4S2BA 3AHXA 4UFKA 1GPWA 4LAZA 3KVLA 5C7VA 3CEPA 3FXGA 2PCQA 2XGBA 1JYNA 4B5SA 1QNQA 1YQ2A 5D03A 2IMRA 3SO7A 1O1ZA 1XLGA 1VCVA 4HA0A 3WK2A 2B0MA 1DJZA 2YGYA 1F8IA 4ZENA 2G97A 1BPLB 5AHMA 2PBGA 3H2CA 3MKCA 3TWBA 4E3VA 2YL8A 5MHBA 1EWDA 2OJPA 1ISYA 1JF6A 1KCLA 4AEEA 3WJXA 3UZWA 3EA2A 1BVWA 2VEGA 4MZ1A 1IE7C 3N73A 4MJ4A 3ZLFA 4CNUA 1NSJA 2WVUA 3LERA 3VAVA 4R85A 4WF7A 2NXIA 1VCFA 2FJKA 4FO4A 4UNKA 3C52A 4I6KA 1ODUA 1KWKA 2WC7A 4EACA 3E2SA 3DHDA 4J2PA 3CPUA 4HSHA 3A47A 3FGCB 3QPEA 5I03A 3OBAA 3B04A 4B4FA 2PF0A 3RCYA 3EB2A 5F7UA 1K70A 1HXJA 2UY4A 4PUEA 5LXXA 3WBWA 1NP0A 3W87A 2CEQA 3JUGA 2VELA 3VZXA 3W1QA 2A3CA 4X2PA 5IBXC 3UQNA 4WRHA 2GWGA 3WFLA 1OFRA 3WYZA 4BQ4A 1KXVA 4HNVA 5I2UA 3PZGA 2ZZ1A 1TO3A 1QI2A 3N14A 4JTQA 1L8PA 3I6RA 1KLYA 1XX1A 4NI3A 1PX3A 4R34A 3WH8A 4F9DA 3PB0A 1JPIA 1JFHA 3FAWA 1J0IA 3IVUA 2VWSA 4C6PA 2YL6A 3KAOA 4LV4A 2YYTA 1U22A 2PLKA 3N6JA 3ABQA 4RV3A 3LHVA 1J79A 3IAPA 3IRDA 3LRMA 1KFWA 1V8EA 4RPQA 3LGDA 4ACZA 4NASA 4PTNA 5CJNA 2CZ5A 1Q2SA 1XR2A 1JPMA 2YLAA 4A22A 2OWCA 3R25A 1J0JA 1J11A 3UESA 3NPUA 1H5VA 4Q8WA 2VEKA 4BI7A 1PKYA 4CCEA 3TYAA 5FJUA 2Y5SA 4DWSD 4DO6A 1UA3A 2ZIDA 5IRPA 5BWAA 3MUIA 3NQAA 4R53A 4B5VA 3LSBA 2I57A 3VKAA 1AQFA 3LY0A 3AIVA 3U2EA 3T42A 4GOAA 1ITXA 3NPXA 5C9ZA 5LHFA 3U2ZA 1UR9A 4M1RA 2KX9A 4WSHA 4AFYA 2CETA 4NUWA 1DJQA 3WQ5A 2HJPA 2J4GA 1W31A 1UR3M 2DZPA 1D8WA 1HVXA 5B80A 4GVFA 4UQCA 4UQBA 2G0WA 1PKLA 1ELSA 4QEEA 1QAPA 2ZBTA 4DY1A 2X1TA 3KVMA 3SN4A 3T44A 4H9UA 3E2VA 3LOTA 3MZNA 3ME3A 4FOKA 4JYFA 5KETA 3VIIA 2X7WA 3D46A 3FHAA 1H09A 2W4XA 3P6LA 1E70M 4B90A 2Y7GA 4UCGA 4BQ2A 3NQMA 2PURA 4IIBA 3CZLA 3O7UA 3O6AA 2VDHA 1WE5A 4YIWA 4MADA 3GAKA 3IJDA 2GGJA 1SSDA 1LDCA 4M6UA 2ZE3A 4NJKA 1VEOA 3VNKA 3G24A 4IP7A 1MZHA 1XKYA 3IK2A 4H3DA 1FP8A 3MS8A 5H91A 1VRXA 3M5VA 1L6GA 3NTYA 1I2PA 1PYMA 3GIYA 2JQXA 1SM9A 4I9TA 4P8VA 4ZOCA 3NL3A 4LUTB 5C8BB 1GCYA 3SQSA 2WJFA 1W5PA 1UUQA 4GYPA 2QPUA 4KCWA 4PSRA 3PULA 1VQTA 2FHBA 1Z3NA 1ZFJA 4PH6A 1LOLA 2P8BA 4ZXLA 4EAYA 5AKQA 3LCGA 1F61A 1VBGA 3P7YA 1LT7A 3RPDA 2WNZA 3LXAA 2VWTA 4FI4A 2FGBA 2GVJA 3N2CA 3CTLA 1JZ4A 1FKWA 4S3AA 1MEIA 3MYPA 2WAGA 4QITA 2NSOA 1TPUA 3O05A 4RDZA 3F2DA 1X1ZA 1LORA 3W9ZA 4DUOA 4GI4A 3I7RA 1EJXC 2F84A 1EC7A 4X2RA 4H01A 1WBJA 1WPCA 4O11A 1T99A 3GUGA 2VR2A 1T7LA 1R9YA 3GC2A 5HUPA 3MUXA 1K9FA 5A6KA 2A79A 4ZQNA 1LRQA 4G6CA 3WDHA 1YDNA 2QJMA 3LBCA 4G9PA 1P0EA 4B9ZA 4F0MA 3P0XA 1N55A 4A8IA 1C92A 2FZ8A 1FXQA 2ZC1A 1QWGA 4ORMA 2WOQA 1QWKA 3PZTA 3NA8A 2E40A 4AHOA 4W88A 3V3WA 1ZCCA 3BCFA 4DJFC 3HGJA 3PTDA 1V02E 4DN1A 2OLHA 2ALRA 5LA0A 3OZOA 2GZXA 3H2NA 5ABHA 4FNRA 3AIEA 5I3GA 1I2RA 2RHGA 5CPNA 2BXVA 4J3WA 5LIYX 3DH7A 4JTAA 3MYOA 4W89A 4DO5A 5I6SA 4D6DA 2V5DA 4PGLA 1M7OA 1PAMA 4IXHA 4DWSA 3OYXA 1VLWA 1DQXA 4FK9A 2QUUA 2B81A 2R9RA 4B5XA 4IPJA 1KRAC 3SURA 4POCA 4DAIA 3BSHA 1FTXA 4D6FA 2HS6A 3VOGA 1VFFA 1P1MA 4F79A 3VIOA 4IUGA 5G1YA 1QNSA 1UR4A 4E2DA 5I78A 3BDKA 4G1KA 4R5EA 3PC0A 5LNRA 2E09A 3PZ9A 5A3HA 5GPRA 1DE5A 3A64A 4D8LA 1EA0A 1JAKA 5TBOA 2VD9A 1NF7A 1RD6A 1DTUA 2TPSA 3NYDA 5FKYA 4QM1A 3VU2A 1F3TA 1CCWB 4HNLA 4UTKA 2NZLA 3PR2A 1E5JA 1KFLA 4A05A 4D6JA 3FX4A 4WDXA 4QRNA 4F40A 3NSMA 3H8AA 3GVWA 5CSRA 3EKLA 1FFRA 3G1XA 1DEDA 3NXFA 4DUVA 4JNYA 1FA2A 1FH7A 4PUNA 1D3CA 3W83A 1TQJA 4KT2A 4GIYA 2GQ3A 4B92A 1DP0A 3TYCA 1XG4A 2NV1A 2J7HA 1LROA 3SZ8A 6TAAA 9XIAA 3OGRA 4KS0A 3L4TA 1KV8A 2PFHA 4KWOA 2VVNA 1L6YA 4M7TA 2PDPA 5LHEA 2OQYA 4LB3A 2IKHA 2PZNA 1IEQA 1CTNA 4KRUA 3WX7A 3HQOA 1Q5MA 5E9AA 1W1YA 7REQA 2G5WA 2VZVA 4AIOA 3WLNA 1BG9A 1IEVA 1XYCA 2G3IA 2QPXA 1W5NA 4H9TA 2X1RA 4RZ4A 5DF0A 1OT1A 3BPWA 1KGWA 3TA6A 3UZYA 4E38A 1HN1A 1CLVA 2Y24A 2XDFA 3D0CA 3P2VA 4ZOAA 2NUXA 1Z32X 1FCUA 4DUWA 4O1EA 3QHOA 3UBPC 5DO8A 1LRTA 4DB7A 3VOFA 1CBGA 5BW6A 3P74A 1J96A 1UD8A 5D38A 3TFXA 2FTWA 3CIVA 1FWAC 2Z24A 3C0SA 5AECA 4HZ6A 2VR4A 4LH8A 3VIPA 1CXIA 5CLWA 3PTQA 1FWHC 4P7OA 5KZEA 4C6EA 1UQYA 2FZMA 2ISSA 4C7DA 3PTMA 3KBWA 1G4SA 3O07A 1XLFA 3EMCA 4B9YA 1B3WA 1GK8A 2PU1A 2VQUA 3WDJA 2QKFA 3APYA 1QT1A 3V7PA 1OG0A 1XLEA 2HDJA 1NDZA 2PWUA 2QJIA 3GDTA 4Q4QA 3R8HA 1EWEA 3TV8A 1W5OA 3STEA 4BEUA 4CD5A 3M0HA 4MLRA 2OEKA 3AS0A 3A24A 3VM5A 4IISA 2DT0A 3PZUA 2QCFA 4ROPA 3KOZA 4GGBA 1ALDA 4PA8A 3S47A 1JYVA 2ZICA 4IOTA 1MQRA 3LHUA 4C1NB 5FJPA 2PCEA 1QW8A 1TQXA 2I1OA 4C90A 1AUSL 2R24A 1H7RA 5J5DA 1NU5A 1OYBA 1OIMA 3SUUA 3WQDA 1M5WA 1TZ7A 1QNRA 2HBXA 2GLKA 3UWVA 3NR0A 1ESWA 3QTGA 3Q45A 2VEFA 3BMVA 2VYOA 4AAJA 1VRDA 3EXSA 5DY2A 3HIJA 1DWHM 3OW1A 5FD0A 4GXPA 1F3EA 4PTWA 3RMJA 4W8LA 1RQBA 5I0DA 2QGHA 3BAXA 1XD1A 3NIYA 1V3KA 2PF8A 2FVMA 4S23A 5EFDA 4HU3A 2VUYA 3WF4A 3TC7A 5D2TA 1YPFA 5F2LA 3LEPA 4MNJA 3M41A 4G2DA 2FYMA 3QY7A 3DGBA 3W2NA 1FWGC 4PZVA 4IG2B 1JEZA 4W8BA 4L1XA 2A3BA 3CMJA 3NEVA 1EJWC 3OQEA 2MANA 1UWSA 4JBRA 1R3SA 5C5YA 3B06A 4E2BA 1JZ2A 3QYSA 4QAWA 2CU0A 2DZSA 3TKFA 4MNMA 3HPXA 1DWJM 4MF4A 1JI1A 3MUY1 2HPIA 4UNIA 1R86A 4CEXC 2CXGA 3CAKA 3HPZA 4C6MA 1N82A 2WCGA 5GJNA 3R89A 1XIBA 4XD6A 2ZA3A 1CB7B 1NFGA 3ZJ6A 4D6EA 2BDQA 3PZVA 2PDHA 4QE1A 4M3PA 3PANA 3KRUA 1ZSXA 2V0TA 4LJ3A 4AD4A 1Z42A 2DSZA 1O5RA 3RXZA 5H6HA 4ZFMA 2GPTA 3KX6A 3UU0A 3W7OA 1LWIA 4ENLA 3OBKA 4KWVA 2ODOA 1BYCA 3EXTA 3LUTA 4GG9A 1YE4A 4DWDA 3MBFA 2GJXA 3OEXA 3W3OA 1CNVA 4DJEC 2EKGA 4CNNA 1K77A 4LCRA 3FLUA 4QEHA 2Y8UA 3AOFA 4S3CA 5FEZA 4C6KA 4W5ZA 2EPHA 5G2WA 1E6PA 3IGSA 4JQ2A 1TELA 1Z44A 5CZSA 5DMMA 2DH2A 4KMQA 1CPUA 4UTWC 2XSXA 2CHNA 3DFQA 4AF0B 1XWYA 1EJRC 2Z2AA 2Y5JA 3CTTA 3SSJA 1OD8A 3NO5A 1K7EA 3TW9A 3VINA 4H9MA 5HR7A 1TV3A 4Z0JA 4BY3A 1S46A 1V0KA 3I68A 3TU9A 1PVNA 3BG9A 4UTIA 4FMVA 3POHA 1QK0A 4KH2A 3KDOA 2YX0A 3TN5A 4OBTA 3UWQA 3BJSA 3OG3A 3LD5A 3GXIA 4KEZA 2B31A 3EA1A 3LTPA 4HCLA 2QQ6A 3GRIA 1JZ8A 1EH9A 3H2MA 3Q65A 4Z1BA 3ZFHA 3CU2A 1R8LA 3U6WA 4DZHA 4DZIA 1E40A 4O53A 3QY6A 4ECLA 3RGTA 4PMXA 2XSBA 4US6A 3KBJA 5A5WA 3O06A 4GYKA 1TUFA 4L6OA 4PUKA 4Z2JA 1UP3A 2QF8A 5M1TA 4WHBA 3NYZA 4TV6A 1ENUA 2P0OA 3EX4A 2D73A 3LGGA 1F7BA 4QSFA 1PHQA 4MM1A 4TIMA 3UWWA 4DI9A 3BJFA 3ID7A 4ATWA 1HKJA 5G5IA 2WSKA 4IX2A 1KD0A 5FCZA 3ARSA 1A5NC 2CKSA 3VOIA 2ZRYA 2GFTA 3LPPA 1AZ2A 1WYIA 3SAZA 3SI9A 4DJDC 2P53A 3HB9A 2E6FA 2V82A 3WQVA 1E1CA 1ADOA 4KW2A 1I0DA 3SRHA 3GDRA 2D2GA 2A4AA 2Q3OA 4JZ5A 2GVYA 3R7MA 1GKQA 3DEQA 2W79A 2ZA1A 3E02A 3OB8A 2GSJA 4X22A 3BAWA 4KEVA 1VHCA 3RHGA 3D6NA 3O6DA 4GRSA 2Y0FA 3ZM8A 1LQAA 1Q4WA 3DFTA 2ADAA 3W1MA 3BLIA 3AC0A 4WY0B 1A3XA 3G1SA 3EXRA 4HOXA 3VILA 4H83A 3M44A 4LT9A 1C9WA 3VDGA 1RXOB 4DF0A 3USZA 3CB3A 1ZALA 4TTGA 2XTKA 4PMNA 1Y65A 4QISA 2R1PA 2J9ZA 3L0KA 4R7WA 2VL4A 3CK5A 3GB6A 7TIMA 3DFNA 3IGUA 4NVTA 4ACYA 3K13A 4REQA 2W9MA 2XH7A 1KM0A 2YL5A 2W91A 3TTSA 3TQPA 2QCCA 4GIAA 4GO8A 3GR4A 4RKAA 3VCNA 5LNSA 1WKEA 1AD4A 1F8MA 4FZIA 1L6SA 1NAL1 2ABAA 3TMLA 3GU2A 3SCUA 3W2JA 1QOQA 3MSRA 3SUVA 4FOJA 1N8FA 3URNA 2XVKA 3CJPA 4CQAA 2UY5A 3LU2A 4W5UA 2EPMX 1BYAA 2W63A 1XQLA 4HNCA 3GX9A 2WHMA 3W71A 1YX1A 4O28A 4AY1A 2QW5A 3DX5A 1EBGA 4MB5A 3S6DA 1OBAA 4Y9NA 3GNDA 4NNAA 3UG3A 3ARXA 3BSGA 2J8TA 5ECUA 2WZIA 4GUGA 2OU4A 3E12A 4DYKA 1KM4A 4JEQA 2CZEA 4L80A 2J79A 1E0UA 1EP1A 1DBTA 3OA3A 1T6MA 2WYSA 1KGXA 3WJZA 4LYQA 2YOCA 7PTDA 3I7SA 3KL3A 1EPVA 4GQRA 1R3YA 2ZX5A 3PBYA 3ZVHA 2PE4A 1FOBA 1US2A 4WSJA 2C71A 3ZT7A 1KRBC 1ME8A 5FOOA 3IGHX 5DCEA 1RVGA 1VR6A 2Y63A 3OHIA 5HQLA 3KL5A 2BSLA 4BCEA 3HFTA 4UIOA 4J4KA 1FHLA 3LZ3A 1NDWA 2OO6A 3WNPA 3SUWA 3SIMA 1BKSA 1A3WA 3MO4A 4GVGA 3URAA 4UZUA 3WD3A 5BROA 4I5UA 2YXOA 1OINA 4KEUA 3B8IA 3ICJA 3KBSA 1UWTA 5CZTA 2BY0A 1EJUC 2WMKA 4R88A 1REQA 2GJNA 5AC6A 5SWUA 4F2BA 3R11A 3N34A 1V08A 1HT6A 4HYRA 3WLMA 3LM7A 4PCTA 2HROA 1EPXA 1JPHA 2VO5A 2VXNA 3CT2A 4H8HA 4AMAA 2CCRA 4G5DA 4Q32A 4YTSA 1B4EA 1Y5VA 3AXIA 4QJ4B 3VIJA 2JK2A 1NP2A 3RR4A 3UNTA 3UR5A 1YTDA 1LL6A 1B5TA 2FJUB 2C91A 4ZOEA 3NVDA 2XFYA 3RCNA 3ISIX 1CXKA 3O8AA 3B9DA 2VD8A 3VC6A 4PMUA 1R3RA 1POKA 1KBIA 3MP4A 3WO8A 4Q8UA 2BGQA 1R9ZA 3LDVA 3A9IA 1H61A 3TNBA 4AZ5A 5D4YA 4GJ1A 4LS1A 3CGTA 1XIJA 1F73A 1E72M 5D37A 2I14A 5KZMA 4LUIA 3CWNA 1RUSA 3IJ6A 1VFSA 4QNWA 3V0SA 4BZYA 2PC4A 3U48A 3L5LA 3FYPA 4ZL1A 3TQKA 3LBOA 2X8RA 1RP8A 1UMLA 3WG6A 4W4QA 3UA4A 2FH8A 4EOUA 2Z25A 1V6YA 5AN7A 5AHIA 3UYCA 4UC5A 5JBDA 1UIOA 3H2AA 1J0KA 2F9RA 1JI2A 2YFNA 1EO5A 4HPGA 3VNDA 2FFCA 4QG9A 1IIGA 4RJEA 3RU8X 1B57A 1MVYA 1LYXA 4L61A 4YHGA 4GUHA 1CWYA 2XH0A 3G1RA 2E9BA 4LALA 2WZTA 3GW0A 4H7VA 4N9CA 3SR7A 4UQ9A 1CIUA 4KGLA 3RRXA 2XZ9A 5M5DA 1QR7A 2FMNA 3O3RA 5IBXA 4RLIA 1XYMA 4U2ZA 1XDJA 4GFIA 4M0XA 4UTLA 1BXBA 1AW5A 1DE6A 1R0MA 1X97A 3GXDA 1JPKA 1HKIA 5AFDA 3CB8A 3HA1A 3AZSA 2WANA 3VM7A 2Y88A 4YTRA 3I10A 4GO9A 3FIGA 2OKOA 3W74A 2X0YA 2H8ZA 3BCJA 4NJHA 5XIAA 4UR8A 3RJYA 3UT0A 3UXKA 3VOHA 3KRBA 4HA4A 5KTLA 4A3RA 4GABA 1U5JA 3M0MA 4DVOA 5TNVA 1OYAA 2ZZ5A 3LGEA 2Q8LA 4NI8A 2WBGA 3T40A 4XO6A 4PMRA 2P3EA 4A8NA 1ZNNA 3UZXA 3LI1A 3QQ1A 3SBFA 1XLKA 2JIWA 3KRZA 3R12A 4LPCA 4YNGA 5DANA 1TZZA 3M5YA 4WUIA 4JIIX 1AZ1A 4UXDA 1TV7A 5REQB 1QDSA 4JHZA 3M46A 1HNYA 4I7UA 1BWKA 4DHGA 3DXIA 1A5BA 3UF9A 4X0VA 2Z29A 1XIEA 3DBPA 3U3HA 2Q02A 3ITXA 2CNCA 3VIKA 2E3ZA 1FWDC 3CPGA 2PDNA 1L6WA 1VS1A 1OVDA 4ZQPA 1FCQA 1E1EA 4IHCA 4UWMA 3W6YA 3H7VA 3C2RA 3XIMA 3DG3A 3H7UA 1QUMA 1AMYA 3YPIA 4CGTA 4LVAA 1AL8A 1IEWA 4L56A 3VUPA 1V51A 4J3XA 4NRSA 4GY0A 4HSNA 1TJPA 3UR7A 1F74A 4CCCA 2VX6A 3RX4A 3T78A 1TX0A 2Y1HA 3V5CA 1ZJBA 2Z1XA 2ZX7A 1F5ZA 3S1WA 1A5LC 2CLLA 4RE0A 8RUCA 3LX9A 2XIJA 4AZGA 4AZ6A 1QXLA 4PB3A 1UCWA 2B7QA 3RX2A 3W26A 4N0RA 2VC7A 3AWOA 2V38A 3W1PA 5BOEA 4ZZ9A 3CV6A 1PTGA 4LW7A 2PGWA 2R94A 4JTCA 4MOZA 1W1ZA 3VNIA 1RJRA 1UD5A 2ZTKA 4JTIA 5CQ1A 4KCVA 3RFAA 2PTYA 3B97A 1PIFA 5BU9A 3MUAA 4ZGYA 3W38A 5A6LA 1LM1A 1XIMA 1XH2A 4V1YA 3EDJA 5E6YA 2EEXA 5I77A 4C60A 1ZB5A 1XYBA 1GPFA 2EF9A 1AFSA 1JULA 2F2KA 3BVJA 3WMSA 3ARTA 1WAWA 1DV7A 3KCLA 2GJRA 1PSCA 3SECA 1KTCA 1AVAA 1G7VA 4G56A 1JDFA 1LF1A 1WNOA 3TH6A 1HIZA 4NNCA 1YPXA 3SADA 1AQMA 3S46A 1E4NA 4ZB5A 3T08A 4BHYA 5AVHA 5M03A 3IARA 3F4VA 4J3ZA 1KKOA 4FALA 2A85A 1PKNA 5CPSA 1XPYA 4GJIA 3E5PA 4CD8A 2R82A 3GR7A 3OP2A 1Q6RA 3LTSA 1G7UA 1GG1A 2OG9A 3BK0A 1FRBA 2DFAA 1KCZA 1IWBA 6TIMA 2UZ9A 2V5JA 2E68A 4AG0A 5JXQA 2V8ZA 4IL2A 3S1XA 1PPIA 1A4LA 4GY1A 3N25A 3VGFA 3WNKA 4MUZA 4GI8A 4UTUA 4NY2A 1R46A 2F38A 3F2BA 1RY0A 4A6GA 5K9CA 1IF2A 2A3HA 3PWGA 2WWDA 1FWSA 1F4HA 1DQWA 4IGSA 3DKLA 3B8UA 4JOMA 2R6OA 2CHOA 3BLKA 2O0TA 5IM51 5A95A 4O1AA 4KBXA 1Z8AA 1OCQA 1S2AA 1ZENA 1JZ7A 1E71M 5JVLA 3DKJA 2WSRA 3PBUA 2G50A 2PA6A 2OX4A 3FSUA 3GTIA 5I07A 3U5YA 4H6KA 1XYZA 3UWZA 3TLQA 5CPLA 1B90A 2XFFA 4XTDA 5AC8A 4HYVA 1EO7A 1N8IA 5KEZA 2J7BA 3ANYA 1MZRA 1DTNA 1DOSA 1E56A 3O63A 4QROA 3EKGA 1TREA 5BOOA 3VGDA 2WSYA 1KB3A 3B9AA 3WLLA 4DLFA 1QU4A 2NQHA 1DKWA 2ACQA 4H9YA 5H8UA 1BGAA 1W37A 1EDTA 3GG1A 1BHGA 3THCA 4ZQOA 1KBLA 3M0JA 1B4KA 5AB3A 3M0XA 4Q33A 4JKKA 3M5XA 4XKMA 2VENA 4QP0A 4UR9A 4D6IA 3BZJA 3JU2A 5U4NA 4PTVA 1OM0A 4I9JA 3K4DA 1J9YA 3KFTA 2O92A 1VYRA 2ZWZA 3WLTA 3EWBX 1WKYA 2PDJA 2A7PA 2CLPA 5FIPA 4N2YA 1GOQA 1ZP4A 1OF6A 3GE7A 1RCXB 3UA3A 2X05A 1WXZA 5A2BA 1UWQA 3A23A 1ITUA 3NNTA 4M51A 3UJFA 1OC7A 5C2CA 1A49A 4Q4PA 4PR4A 4E5TA 2Q09A 3TQ0A 1GYNA 1SSGA 3CEUA 4W93A 1S1RA 4P8UA 3AIWA 2FZBA 2EXOA 4HPXA 3TMQA 3KVKA 1XFBA 3NGJA 2V2CA 4LSBA 4J35A 4MY8A 2O4QA 3T55A 4O50A 3K4WA 1Z89A 3R10A 3W27A 5HWJA 5A2AA 3PSWA 4QSHA 4AQLA 3NGFA 4OHQA 2RFGA 1LL4A 3WJYA 2X1SA 4LVGA 3IV3A 4J5NA 4DWSB 3GC4A 3VKCA 3CUIA 4JTUA 2VGBA 1WDQA 3DIPA 2Q3RA 2WSPA 3UJRA 4BQ5A 4CU6A 4K68A 1WDPA 2PLMA 1YTKA 5M2FX 3W72A 4K38A 1E9ZB 2JKEA 4F3HA 5DN1A 1AJ2A 3OVGA 3W00A 2OQLA 2P88A 1X39A 2PDLA 2NVCA 1WZAA 4O0KA 3W7GA 2VCBA 5CC3A 2L5HA 1SGJA 4QHRA 1UH2A 1XCFA 1UH3A 4JXCA 1MYRA 1OT2A 3B9NA 3QFEA 4RW5A 1ONRA 2W67A 3IVSA 3WDQA 3W88A 4UFMA 4NZ1A 1EJTC 4GCXA 4V27A 5CPQA 3WQEA 3N9SA 3B8WA 3NSXA 5FF7A 4ZOBA 1FWWA 4LU0A 4JIHA 3M1ZA 2TYSA 5D9PA 1Q7ZA 3G77A 3MJMA 1ZBWA 4HU8A 2E0PA 2TMDA 4LANA 1E55A 3S6OA 3KOFA 1TB3A 1S5NA 3AHYA 2QT3A 1J6PA 2E7FA 5K7JA 4RNFA 1J6OA 4HSOA 5BNKA 2PAJA 4YPJA 3MZ2A 3N6QA 2DZWA 3W2LA 4HNOA 3VNLA 4AZCA 1JZ5A 4TVUA 1GVFA 3LLXA 2QVNA 1QI4A 1SO3A 2B7NA 4CU8A 3SRDA 1KWGA 1VP5A 4JFVA 5D30A 2C0AA 3MI2A 2DZTA 3DI0A 4GYPC 3ALGA 3T81A 3KE0A 4XZIA 3M43A 4XZWA 4Y9OA 4O19A 3U9IA 5XIMA 3RLGA 1I8JA 1LTDA 1ZUAX 2BGSA 2F6XA 4MZ8A 4YVPA 4H7CA 3N19B 3G2GA 3APGA 5L9FA 5E09A 4WJXA 4HNNA 4IIGA 1OB0A 1KGUA 3NZPA 1WQ5A 3FKKA 3GHUA 3WD1A 1ZU8A 3WF0A 1WBHA 3N13A 4DNHA 3M5ZA 3O9NA 3FA5A 2C1IA 2NW0A 2DZXA 4YMZA 2B4GA 4ZQCA 4GC3A 1O1HA 1JXKA 1WZMA 2OVLA 4GXMA 4IIDA 4UB9A 1I2OA 4YN5A 3CAQA