3O8AA

Crystal structure of plasmodium falciparum dihydroorotate dehydrogenase bound with novel inhibitor genz667348
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
375
structure length
375
Chain Sequence
YNPEFFLYDIFLKFCLKYIDGEICHDLFLLLGKYNILPYDTSNDSIYACTNIKHLDFINPFGVAAGFDKNGVCIDSILKLGFSFIEIGTITPRGQTGNAKPRIFRDVESRSIINSCGFNNMGCDKVTENLILFRKRQEEDKLLSKHIVGVSIGKNKDTVNIVDDLKYCINKIGRYADYIAINVSSPNTPGLRDNQEAGKLKNIILSVKEEIDNLEKNNIMNDEFLWFNTTKKKPLVFVKLAPDLNQEQKKEIADVLLETNIDGMIISNTTTQINDIKSFENKKGGVSGAKLKDISTKFICEMYNYTNKQIPIIASGGIFSGLDALEKIEAGASVCQLYSCLVFNGMKSAVQIKRELNHLLYQRGYYNLKEAIGRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel inhibitors of Plasmodium falciparum dihydroorotate dehydrogenase with anti-malarial activity in the mouse model.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
molecule keywords Dihydroorotate dehydrogenase homolog, mitochondrial
total genus 148
structure length 375
sequence length 375
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2010-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3o8aA00
1VHNA 1XCFA 4E0CA 1LCOA 3M6YA 3L66A 4JTGA 2A7PA 3DZ1A 3UWZA 2ZRVA 3MWAA 3NQFA 2P10A 3FOKA 3T44A 1FXPA 1DJNA 4WXZA 1O60A 2A1YA 2ZZ3A 3P61A 4DEFA 5C55A 1R2TA 1XDMA 3C2FA 2CLFA 4MY8A 4QM1A 4O17A 1S5TA 4NT0A 3GNDA 2I14A 1FX6A 1TCDA 1G4TA 5AYYA 2QCEA 1XUUA 4FF7A 4FNSA 3M43A 4HNNA 3ZFHA 2ZA2A 4CCDA 2V5BA 4FXRA 2W79A 2AAMA 3TJXA 3PM6A 2DZXA 1RVGA 1TPUA 2Z1BA 1KFKA 4AHOA 3B03A 2V81A 1F5ZA 4KWWA 4E38A 1S5VA 5J5DA 2OX1A 2R91A 2DP3A 2H8ZA 2YXGA 3LLDA 4BFAA 2AGKA 4LVGA 1ZCOA 4JTFA 3S5NA 2CZFA 4EWND 5KMYA 5D2VA 3PR2A 1W56A 3FKKA 3G3MA 3OVQA 4OHQA 2VEMA 1OFOA 3CC1A 4LRTA 1OX4B 1OFBA 1NF0A 1I4NA 8TIMA 2WNZA 1B9BA 1BTMA 4XUGA 4OU1A 1I8JA 4LY8A 4IMGA 3CWOX 5GVJA 3GKFA 4JX6A 4FX6M 3TK7A 3UY7A 2GOUA 3F4WA 3IIXA 4LTSA 2Y85A 4JY9A 3PBUA 2F7FA 1NEYA 2VFHA 3MW7A 1W54A 2X2GA 3MHFA 4JTJA 5D04C 5F2MA 4X2RA 3M5YA 4OT7A 2WOQA 3IEBA 4UFMA 3PUOA 2JBMA 3SIZA 2OCZA 2HSAA 2WPBA 2FTPA 1G6CA 5AC6A 3QW4B 3EXTA 1F76A 3VI2A 3R12A 2A7RA 1IIGA 2WSRA 3MUXA 3P80A 3WK3A 3HGOA 3CHVA 3EXRA 4MUZA 5CPOA 2P1FA 3RU6A 4FNUA 4ORMA 4A29A 4O1BA 1QFEA 3WK1A 2Q3OA 4NNCA 1D9EA 1H63A 3ANYA 3RLVA 2Y7FA 5AHLA 3OVRA 2V2CA 2GQ9A 2E6YA 3PAJA 1CW2A 2OZ0A 1VYSX 1VPXA 1ZJIA 5DXXA 1PHQA 1OK6A 5LNSA 2WJZA 2ZTJA 1WQ5A 1TB3A 3EWZA 4P2VA 3H55A 3O6DA 4TIMA 1EWDA 4I7UA 1FWWA 3IGUA 3A24A 1MEHA 5D33A 2WSQA 5CZTA 1KV5A 1YTEA 2X30A 3C8FA 1UASA 5L6UA 1DVJA 3M9YA 1W37A 5HWMA 3KRUA 1NAL1 1TSIA 4LS0A 1YDNA 1KFEA 4D2JA 4CQAA 3SY5A 1TIMA 2JKEA 2V8ZA 5FESA 4FNPA 4O19A 3LV6A 1Q45A 3SFKA 3QRHA 3I7SA 2ZRZA 2VFGA 2Y88A 1EB3A 1LLWA 5I3HA 3NZRA 4YXGA 4OWGA 3DH7A 3PULA 1W0MA 5LGZA 5FF7A 4N4QA 4JD4A 1T0OA 5F1UA 1LRTA 3L5AA 2QCLA 3CIWA 3CT7A 4DF0A 1GPWA 2NXIA 1PHWA 1JRBA 2VFDA 3W7JA 1QAPA 1XXXA 3W1LA 4PTNA 4Y9AA 2ATSA 3VNDA 3O6CA 3W2KA 4NJIA 2YX0A 5D05A 3HPXA 3C3NA 3W1UA 4HSNA 4K39A 2B7PA 1TPDA 3LV5A 1T8XA 4JTIA 1SQ7A 2C14A 3G1VA 4BWLA 3LERA 2C3ZA 4YLWA 3PVFA 4MVAA 1TPC1 2UV8G 2Y7EA 3G18A 3GZ3A 3YPIA 1HL2A 1Q6LA 2WSYA 2CWNA 4ZQPA 1OHLA 3W73A 3HIJA 4Q33A 3TU9A 3CTLA 3LHTA 1H7RA 1HUVA 3TA6A 4FNTA 2Y61A 2PC4A 2ZRUA 4POCA 4K7YA 3GLCA 3ZS4A 3MI6A 3W88A 4JX5A 3TFXA 4UMBA 3W7GA 2QAPA 4JTSA 3VCRA 5CG7A 3SI9A 1IIHA 1C29A 3F4NA 3NQ2A 1HTIA 2VKZG 3IGSA 1B4EA 3F1QA 4JYEA 4DXVA 5KTLA 4IX0A 2ZFAA 3HB9A 1SO4A 3W7NA 3L5LA 1TTIA 4UTTC 3FA5A 4HKPA 1FY6A 2NX3A 1QWGA 5SWUA 1YYAA 3W7CA 2A85A 2JKPA 1KTNA 3DFOA 1A5SA 3W86A 4JS3A 4Y8FA 4CNPA 2QR6A 4HNVA 3NDOA 3TJLA 3BLEA 2QKFA 5EYWA 3S8HA 5FF2A 3EKZA 1V5XA 3KRSA 4XWUA 4N9CA 5FF0A 5K9CA 2NX1A 4RKAA 4FB7A 1GVQA 3HPSA 3GX9A 4WY0B 1K03A 3HQ1A 2OJPA 3TX9A 4JY8A 5D32A 2CLIA 3EX6A 4GBUA 5CPLA 2ZZ7A 4TU1A 2DU2A 3EWUA 4WOZA 4OE7A 4N02A 4XBSA 1VS1A 4AEOA 1TQJA 3UPWA 1P1XA 3NQAA 1JCLA 1LORA 2VEKA 1KTCA 3ATZA 1VJIA 3PBWA 3DFQA 3UXAA 5D2TA 2ISVA 2RFGA 2A6LA 1EP1A 1N8FA 5CZSA 3E49A 3LTSA 4AWSA 2OMAA 4A2SA 3TSDA 3KHJA 4S2CA 3LTYA 2ZZ6A 4C1KA 1GZGA 1OYAA 4M6PA 3PB0A 4JR5A 1F7BA 4EOUA 2VENA 3GR7A 1SUXA 3MHUA 4MZYA 1KLZA 1B57A 1FCVA 4O53A 4DBEA 5D2YA 2BLEA 2HS6A 5CSRA 3HMJG 2DJXA 3NQDA 4CLMA 3T40A 2QCDA 3QZEA 5AHNA 1DOSA 3W23A 1VHCA 5BMXA 3L0KA 2C16A 5D03A 4JTTA 3BPWA 1I2OA 2ZA3A 4U4MA 1QNVA 2QAFA 1X1ZA 2FLIA 1EPXA 5LGXA 4W9TA 3HGRA 3O63A 4Y6GA 1ICSA 3SECA 3T4CA 3TSBA 3OIXA 1GTEA 4RCXA 4LUJA 4QISA 1XUZA 3CLMA 2B4GA 4LC8A 1FWNA 1KV8A 3G22A 5FI8A 3GDRA 1LRQA 3W1TA 4JTEA 5I3KA 1GTHA 3NG3A 4ZMGA 4KFOA 1M5WA 3W76A 4RLIA 4IGHA 3DKLA 1OG0A 3PUDA 3P81A 1OFRA 3TQVA 4UNLA 2NXHA 4I7VA 1VYPX 3NQGA 3NL3A 5TIMA 1QO2A 3BG9A 2CZDA 1BEUA 2BX7A 2Y70A 4XTIA 3WJSA 1W5OA 4O8RA 3NM1A 3TNOA 4BR1A 1CX9A 1YPFA 3SW6A 3MYOA 1ZENA 1OF8A 1K02A 1LZOA 2QCFA 4BI5A 2BTMA 3A5VA 3QMRA 1OFQA 2DZVA 3PF3A 1NVMA 5TQLA 3GYEA 1G69A 2VFFA 2PURA 3TE9A 2R94A 3IIPA 3S1XA 4JX4A 4WX2A 4HN4A 3GDKA 3WK0A 5DBTA 2Z6IA 2ZRXA 3B06A 3N2XA 4Q4KA 3O07A 2YPIA 3MYPA 4LUIA 3OEXA 4QAIA 5I3GA 3GXPA 3HF3A 4N9DA 3KFTA 1SZGA 3W6YA 5KSWA 2GVJA 1Z41A 3PC0A 4DBDA 3HOJA 1HO4A 1ZAJA 1HFBA 1YADA 2JGQA 3L0GA 1OFAA 4M19A 2C18A 1A50A 1X6UA 1OX6A 2E68A 2I1OA 4QJ1A 4PL1A 5CPNA 2G96A 4UR8A 3M1ZA 4B5NA 1QOPA 2X1RA 4FX7A 1DL3A 1TYGA 4CNOA 2QCNA 1HO1A 1KM6A 2V0TA 3TXVA 3S1VA 1JCJA 4KWVA 2NV2A 5CGQA 3AO0A 2E09A 1MZHA 1XBVA 4A2RA 1FUYA 2A4AA 1OVDA 1YXYA 2Y63A 1H62A 5FEZA 3IV3A 4IWWA 2EGZA 4N6FA 2YFOA 4CCCA 1H7WA 5EBUA 4AF0B 1SW0A 4PC8A 2ZZ5A 4LS2A 2YFNA 1MEWA 5J5RA 1TJPA 3MP3A 3N19B 1IXPA 1A5AA 4LNYA 4UTLA 3VE9A 1GVOA 4LOCA 2R14A 1J5TA 4WXYA 2AQWA 2ZRYA 1OYCA 2X16A 3L65A 4MLJA 5HMSA 4AHQA 3PUEA 5A5WA 3GK0A 3TROA 2DJLA 3G1SA 1J2WA 2RDWA 4UCGA 2WV8A 5EA9A 1K8XA 1LP6A 1XBZA 3LHWA 3E12A 2RDTA 4O11A 1DQWA 1O4UA 2QCCA 2Z0IA 3TKFA 3FYOA 4KFPA 3N2MA 2R8WA 1XFBA 2EPHA 2GVLA 5T26A 3Q2DA 3IIZA 5D2XA 1GYLA 4DPPA 3NM3A 3P5ZA 2QCHA 2ZBTA 1GYNA 3TSMA 2DZUA 3NGJA 1EEPA 3N14A 3M7WA 1PIIA 4X3ZA 3RK8A 5IBXC 3UYCA 4WZHA 2GJNA 1SW7A 1EP3A 1X1OA 2CLEA 4LT9A 3N34A 3ABOA 5F4XA 5I3FA 1FCBA 5F2GA 2YR1A 5AYZA 2CFFA 4MY9A 1Z42A 3G1AA 3UZ5A 2ZZ4A 2Z2UA 5ABTA 1GEQA 1YLVA 4ZQCA 5U4NA 1K3UA 4JDYA 3HPZA 5HQEA 1AW5A 4N2YA 3DBPA 1KM4A 3Q94A 2RH9A 1WXJA 2TMDA 3LHUA 1F73A 2GUUA 4M7SA 1LBFA 3NQVA 2E6AA 3NQ6A 3B05A 1KFJA 3LDVA 4LS1A 3CEPA 4JTUA 2E1DA 3NL5A 1EX5A 5K4ZA 1KM1A 2IQTA 2QCMA 2XN1A 1WOAA 4WY0A 3GDMA 4NNAA 1Q6QA 5A8GA 1U5JA 4XTDA 2CLKA 4O16A 4FHAA 3STCA 1F6PA 1WV2A 1AK5A 3G1DA 3A22A 1H7PA 1L6SA 5FEWA 1SO6A 3LHYA 3B0VC 3VFLA 4ML9A 4ZZ9A 4UFIA 3P62A 4UTMA 3STEA 5CZJA 3QF0A 4XKYA 1F6KA 3QM3A 3FLUA 2Q8LA 3G8RA 4Z0JA 1VRDA 3BV4A 1SSDA 2YDAA 1Z48A 2CW6A 2V9DA 3GNNA 3DI1A 5DLCA 1RV8A 3BO9A 7TIMA 4DO5A 4GWEA 3TUUA 2Y7DA 1KLYA 1W31A 4NUWA 3I7QA 4Z08A 4UMCA 5BRBA 2ZZ1A 3W1PA 2NLIA 3W84A 1GG1A 4UTWC 3LCFA 1JUBA 1H7OA 3FEMA 4ZVJA 3RF9A 5G2HA 5H91A 2FPYA 2CLMA 3KRZA 4Q32A 3WJZA 2VOMA 5KINA 2V2DA 1R2RA 4LU0A 4NJKA 5HUOA 3G0UA 3L9CA 3MJYA 3M47A 2QUVA 4FEZA 3NPVA 3BW2A 5HNRA 5LNUA 3CM4A 3GIYA 2YCEA 1MSSA 3HG4A 3L0NA 5MHBA 3M5XA 5D2WA 1DKWA 3R13A 3B0PA 3BK0A 4IXHA 2XFWA 1GT8A 3W7OA 4M6VA 4UXDA 1OX4A 3PG8A 3H54A 2TSYA 2FFCA 4HPJA 4UFKA 4WD0A 2A6NA 1MEIA 1KBIA 1I2PA 2O7SA 3QW3A 3NYZA 1RD5A 2V2HA 3LCIA 4O14A 3TMLA 3GXNA 1SZFA 1TPH1 3TDFA 4UTUA 2H6RA 3CWNA 1L2UA 1V7YA 3LCWA 4YCOA 1W3NA 3S5OA 1LM1A 3W7PA 2XN0A 3TXZA 2QUUA 4GUGA 4DF2A 1K7FA 2QJGA 5G4WA 4HNTA 1WA3A 3O6YX 1NFBA 1M6JA 1JJKA 1QPOA 4NQ1A 4HHPA 3IIOA 1QPRA 1JQVA 4RXGA 4IPIA 5LNVA 3NPXA 3W87A 2H3BA 1GG0A 2E5DA 3W22A 2QF7A 1FDZA 4FX8A 4MFDA 4UTHA 2ABBA 4LRSA 3UWQA 2QCDB 3U6WA 4K8EA 3TCEA 3GDLA 1FXQA 1JUKA 1DORA 4CNNA 3EWBX 3CIXA 3W74A 2VFEA 1KM3A 3QPZA 4O10A 4PFMA 2TRSA 3TC7A 3L68A 3R89A 5LKYA 1T99A 4LV4A 1WAUA 1Z44A 3G1HA 4N6EA 1W3IA 1XBXA 3O1NA 3BARA 4GRSA 2J88A 5AN7A 5HUPA 1JUEA 3HGSA 5KITA 4JTLA 4IPJA 3DHFA 1W3TA 4EF8A 5KZDA 3LXAA 3MP5A 3R2GA 2J9YA 4IXXA 4K8HA 4LVFA 4O15A 2J27A 4XZ9A 3LX9A 5IBXA 4MYAA 3NQ8A 3TQ0A 1WYIA 1FDYA 1RZMA 1XI3A 3L5MA 4GC4A 4RZ4A 4ZQOA 2CLLA 4C1LA 3EX4A 4AWTA 5BW6A 1TMHA 4MYXA 3FJ6A 3TIMA 5G2WA 1GVRA 3SGZA 1QPNA 1VQTA 1LBMA 3LCXA 1FWTA 4O4WA 4GNJA 3PY2A 3PS7A 5LNWA 4O0KA 4TMCA 1VLWA 1LYXA 4FIRA 3I68A 3A21A 1OF6A 3W7QA 3NA8A 1H60A 2YZRA 3M41A 1QR7A 1N7KA 3N9SA 3HG2A 1IGSA 3W7IA 1ZAHA 4NJHA 4NXKA 3ABSA 2EF9A 1W1ZA 5AFDA 2YW3A 3T78A 6ALDA 2E5CA 3TQKA 1FDJA 3ZWTA 3KVJA 3I65A 2ATMA 2FQIA 4M5PA 3M5ZA 3TC6A 3HBLA 1RQEA 5G4EA 3NQ7A 3U2OA 4X9SA 1VGAA 4O12A 4NVTA 4UTIA 3UXDA 3SZ8A 1F74A 3SGUA 4GUJA 1UB3A 3BLFA 3S5ZA 3LGEA 3LCGA 3DXIA 2A21A 1O94A 4OBTA 4X22A 5FEXA 5TBOA 4AF0A 1Y0EA 3S6DA 4ALDA 1A5CA 3H53A 4R53A 1JRCA 1N55A 3KVKA 1ICQA 4QQ3A 1YPIA 3RNDA 4UTWA 3W2LA 1SO3A 5DELA 2WQPA 2DZTA 3P8IA 3BW4A 3QQ0A 4UTJA 5HINA 1M7PA 3KXQA 1CI1A 2VEIA 3LRMA 5CZ0A 4K37A 4QITA 3TW7A 1PCKA 4Z1BA 5AHFA 1W5QA 3BG3A 3IGXA 3NPUA 4RZ5A 2QCGA 3QMSA 1BKSA 3BW3A 1LLZA 3FFSA 4RXFA 3TAOA 5DCBA 5D09A 3O05A 4GUFA 3UWYA 5DCEA 3MI2A 4Y90A 1P0KA 1EA0A 3EXSA 4Z1AA 5D38A 3MP4A 3W75A 1P0NA 2YSWA 3OHIA 2PCQA 2LLEA 3T7VA 2HS8A 2B0MA 5K2ZA 4DO6A 1H7NA 1DJQA 3P60A 1RR2A 1GQNA 5D30A 4FO4A 5K4XA 1XBYA 4A21A 1BWKA 1NF7A 2B7QA 3QPYA 2H90A 3TMQA 5EMUA 1TPB1 2ZCGA 3IVTA 1KM2A 1L9WA 2FPTA 4J9JA 2ISWA 3QYQA 1UUOA 2Y62A 4TR9A 3V1PA 1QMLA 3FKRA 5LSMA 3HG3A 1EUNA 3G3DA 3PSWA 4O50A 5E93A 4AAJA 3ZWSA 2XN2A 1XC4A 5E1QA 3EKLA 1O5XA 1ZALA 2NWSA 4LVBA 4NJJA 1TRIA 2J24A 5G5IA 2BXVA 2PRMA 5CKSA 4FIQA 3P7YA 4O1AA 4H6KA 2OT0A 3C2EA 2NWRA 2VC6A 5K9XA 3GDTA 5BNKA 3R5EA 3MHGA 4IMEA 5F1VA 3O06A 3UWWA 3LXBA 5FEPA 1AL8A 3N9RA 3W1RA 5EL1A 3W7HA 4NJGA 1S3HA 3O15A 1J4EA 1LOQA 1FWRA 4MKNA 3W7LA 1OFEA 2F84A 3LLFA 1OJXA 5DBUA 3G24A 3S5YA 4AH7A 3JR2A 4JIPA 2FJKA 2NZLA 5EPDA 1YDVA 2YYUA 3O16A 3C2RA 2C13A 4AXKA 4KKXA 4ADSA 1ML1A 2DZSA 3NVTA 2DORA 3S1UA 5HR6A 2OT1A 2VELA 1RQBA 4ORIA 1K7XA 4Y96A 3SJ3A 3KOFA 1KM5A 3LRKA 3LCLA 4YL2A 4JIQA 2GPTA 4IUOA 3STGA 1R2SA 3TFCA 1VCVA 3W1AA 2DZWA 3P5YA 1BWLA 3IIVA 1ME8A 2JK2A 1ZY9A 2EKCA 3LCHA 2JKAA 1YDOA 2NUYA 4I9AA 1PS9A 3C4UA 1SFJA 1EUAA 2TYSA 4JDBA 1X7FA 4JEQA 4K7VA 1AW2A 1SR9A 2ZQ0A 3MI3A 1XL9A 4P61A 3QSRA 3QH2A 1JULA 1YTKA 4OV9A 4MJZA 1H50A 4O13A 4BF9A 3ELFA 1JCYA 4NU7A 4NXSA 4OGZA 4CCEA 5C54A 2VEPA 4HNUA 3THQA 3TV8A 1VCGA 4UFJA 4CQ8A 2BWGA 3E0IA 5DCDA 1H51A 4JTKA 4O28A 4BWLC 4UNKA 3THAA 4KFNA 1TPFA 2WO5A 3R8RA 1TV8A 5C5YA 4K6AA 2V30A 4L4LA 3I6RA 1ADOA 4QSHA 3ATYA 1VH7A 1LOLA 2WNNA 3W85A 2B7OA 1IXNA 2A5HA 3NQCA 4N9BA 4HIBA 4LVAA 1GVFA 4R7JA 3TH6A 2B7NA 1I2NA 5LZLA 3S42A 2CLHA 4WJEA 4GXMA 3OVPA 4RR4A 3D0CA 4S1FA 4RX0A 4ADTA 1F05A 1O5KA 2J6XA 1LRNA 4QIUA 4Z0SA 4ICNA 1QOQA 4YCPA 1JCNA 5G1YA 2ZRWA 2G5WA 3G0SA 4NZFA 3BLIA 3JS3A 1KA9F 5HWJA 4OQVA 1FBAA 3UD6A 2Y7GA 1KW1A 3LM7A 2FIQA 2W6RA 2A0NA 1W5PA 2E6DA 1THFD 3W71A 3BGGA 3E02A 2PRLA 2Q3RA 4IOTA 3CU2A 2E77A 3KVLA 4AHPA 3QFEA 2DZPA 4RK8A 5LHFA 1UBSA 1FCUA 3W2UA 1TV7A 3RMJA 1IF2A 5AC7A 4XQ6A 4R34A 3GB6A 4LC6A 1GOXA 3UZJA 3W1XA 3DGRA 1VCFA 5K7JA 1Q6OA 4O1DA 3B8DA 4XKYB 3I7RA 3W9ZA 4IQLA 1B4KA 4H3DA 4L4MA 3FIGA 3LRLA 3NOEA 3KX6A 5G2IA 3EWXA 3ZR4A 4PODA 1R47A 1M7OA 1DQXA 5HWNA 4EF9A 2WNQA 3FYPA 4UTTA 3DU0A 1SO5A 1TPEA 4NX0A 3BGJA 5LHEA 2ZDRA 4GFSA 5I3IA 3NXFA 3FS2A 4ZL1A 3MBDA 3W2JA 3N3MA 1ME7A 1S5WA 3Q58A 1OYBA 4AB4A 4M7TA 1PE1A 4DELA 3DHDA 3DFNA 5I3JA 5AOUA 3IVUA 3W1MA 1T96A 3PWAA 3PG9A 1H61A 3GAYA 2Z6JA 4Z1CA 4NX5A 2Y6ZA 1SFLA 2YYTA 3HGJA 3W7EA 3JRKA 4PL2A 5G1TA 1SU5A 4JXCA 2NV1A 5H2ZA 5K3VA 4BI7A 1HG3A 1IXOA 3C2VA 3G1YA 4U28A 3M16A 3S9YA 2GQ8A 5C2XA 3FJLA 1OK4A 2Y89A 3WJXA 1QPQA 3C6CA 5BOOA 2QDHA 2BZNA 3GVGA 1UUMA 3LB0A 1TO3A 3W7KA 4ADUA 3G0XA 2YW4A 2ZA1A 4WUIA 3GR8A 4RV8A 3QJAA 2ZTKA 5K9DA 2QJHA 4O52A 3LXCA 4MFEA 1SZNA 2H8XA 3T55A 3C56A 5AC8A 5F2LA 4A22A 3LBCA 2RHGA 2C0AA 1WDWA 1R30A 3DI0A 3USBA 1XM3A 1W5NA 2PE4A 5AHMA 3VE7A 2X1UA 1JR1A 4H4IA 3W72A 2BSLA 2G97A 3NNTA 3PSVA 1TPWA 3U8GA 4QNEA 1AMKA 1I45A 1K7EA 3V75A 4G1KA 1Q6RA 4FNRA 4LWWA 3OG3A 5DXYA 1G7UA 4AVFA 4Z1DA 3NL2A 4MZ8A 3EWWA 4YWIA 1L6YA 3W2MA 1C8VA 3LI1A 1JCMP 3UWVA 5KZMA 3NAVA 2W0UA 1IXQA 2A7NA 1XDLA 3B0UX 1TTPA 3W1QA 3L21A 3KAOA 3L2IA 1D3HA 1WOBA 1LTDA 1TREA 3RLUA 4O4VA 3TW6A 3DAQA 1H7XA 3E9AA 3L67A 5FF4A 4PA8A 4WQ6A 2EAWA 4WOQA 3LHZA 3C0JA 1ME9A 2HTMA 4O54A 3M0ZA 1MO0A 3CEUA 4MOZA 1LBLA 3NQMA 3QEZA 4MPQA 2E5BA 1G67A 1VC4A 1AW1A 1VYRA 3W07A 1Q3NA 1TQXA 3O8AA 1W5MA 4EIVA 4MJMA 3CPRA 2O7QA 3ABQA 5AB3A 2E6FA 1TTQA 1JCXA 2FDSA 3UPBA 2EHHA 3DFTA 3NPWA 1LDCA 1P4CA 2H3DA 2KZHA 4IX2A 1OX5A 4PH6A 3DKJA 4PEKA 5E0KA 3GXTA 4GUIA 5KZEA 4DQWA 1QDSA 4JNMA 3LTPA 1TV5A 1PL9A 1OFPA 4A3UA 1JVNA 4ONVA 4LV9A 2A2IA 3CB8A 3AJXA 2TPSA 2QEZA 2C6QA 4O57A 5DY2A 3NEVA 4I7WA 3PBYA 4N9EA 1DBTA 2FPVA 2X1SA 4MZ1A 4E2DA 2RKXA 4UFHA 1ICPA 3UWUA 3HO8A 2C15A 1O95A 1KFCA 4E2BA 3PBVA 1YTDA 1KBJA 1KTBA 4YMZA 1A5BA 3W7RA 3NL6A 2GVGA 1UJPA 1LOSA 1SSGA 1I2RA 3EB2A 1ZAIA 4IMFA 1PVNA 3P67A 4O0ZA 1W8SA 3QMTA 1VLIA 1TTJA 4JN6A 4ZQMA 1X8FA 2FB3A 1EWEA 4GUHA 1QCWA 1PCWA 4FNQA 3EEGA 5IM51 3W2NA 1YXDA 1D3GA 1LROA 1E51A 1UCWA 1A53A 3EX1A 4JTHA 1XKYA 3A5FA 1FCQA 4NZJA 3KVMA 1F2JA 3B04A 1K8YA 5HJLA 1RPXA 4FXSA 4JYDA 2ALDA 4S2BA 4UR7A 1G4SA 3QQ1A 2YGYA 3ABRA 4R33A 4MLRA 4DF1A 3HJZA 1TJRA 1ZHAA 2HMCA 1PV8A 5DN1A 2NXGA 3STFA 5F4SA 3QC3A 3E96A 1KFLA 3S1WA 1K8ZA 4MY1A 3NZ1A 5AHEA 3WK2A 5U7SA 4DPQA 3S0CA 2JGYA 2QJIA 5HR7A 2GJLA 1ZFJA 3LHVA 2P0OA 2ZYFA 3G8EA 4JICA 1G4EA 3SSJA 2J9ZA 3A23A 1H1YA 4CQ9A 3P84A 1VZWA 4UFLA 3TAKA 4GE8A 1DHPA 2CLOA 3WFAA 1NSJA 3LI0A 2I9EA 1OABA 4DO4A 2RDUA 3F03K 2G95A 5F2IA 1U83A 3C52A 2VXNA 1SZEA 2V82A 4HT3A 4RZ6A 2ISSA 1GWJA 1DV7A 3IVSA 4EVZA 1I2QA 3W7DA 3Q37A 3N73A 3W70A 5AYXA 2QDGA 3W3OA 4RJEA 3UY8A 3DENA 4BK9A 2C19A 3OA3A 2WKJA 3VKJA 4UTKA 1SW3A 2NUWA 4JYFA 2PRHA 4IJBA 4ZQNA 2NUXA 4HPXA 2ZZ2A 3IRDA 4N4PA 3LOTA 5FF3A 3NO5A 5F4WA 3NQEA 1KFBA 3MBFA 1AG1O 1WBHA 3P8JA 3B4UA 5LNRA 4K38A 3DFSA 4TX9A 1L6WA 3M44A 4OV4A 1R46A 3GKAA 3W7MA 5CSSA 6TIMA 1EIXA 2VFIA 2D73A 2FB2A 1GVSA 4PCFA 2CU0A 1MXSA 3P74A 4UC5A 5L9FA 1AL7A 4LVDA 1C9DA 3INPA 1WBJA 4NNBA 4TO8A 4IMDA 4AMAA 4M6QA 1KM0A 3W83A 3LBMA 3G1FA 3TR2A 2V5LA 2GQAA 1FQ0A 1ZNNA 3C2OA 4MIMA 4UIOA 1G7VA 4UUIA 3CQ0A 3EX3A 5DY3A 4AWUA 5D37A 5HULA 4BI6A 3MMTA 3RFAA 1GJPA 3M5VA 3P82A 2ABAA 5D02A 3WJYA 5C6MA 4JGDA 1B3OA 3WJWA 3SR7A 4K36A 1G4PA 3QSTA 4QNWA 2NX9A 1JQXA 4TMBA 4WY0F 4GJ1A 3GAKA 1P5BA 3MO7A 2QUTA 1QO5A 1FWSA 1TRDA 3DFPA 4O1CA 3PB2A 5CPMA 3BVJA 4O18A 1ALDA 2Q8ZA 2C1HA 3UNDA 3K30A 1EP2A 4XBKA 1OFDA 1VR6A 3C61A 3A9IA 3G1XA 3W1NA 5BMWA 1WX0A 4ZQRA 1H1ZA 1YXCA 5AHIA 3EX2A 3UQNA 1ONRA 1SPQA 4IMCA 2CZ5A 2X1TA 1RQHA 3EWYA 3OBKA 2J9XA 5EY5A 5EKYA 4UMAA 4LW7A 4HSOA 3BG5A 3HG5A 3NR0A 1H5YA 1TPVA 2CZEA
chains in the Genus database with same CATH superfamily
1OT2A 2NQHA 4E0CA 4RE2A 1LCOA 4US5A 5A8MA 1I0DA 2CITA 3WH5A 4DAFA 3CQHA 3DZ1A 4XD3A 2ZX6A 1FXPA 4WXZA 1O60A 2ZZ3A 4DEFA 1E4LA 5C55A 1MYRA 3RU8X 3GS6A 1PTDA 4QM1A 1HKMA 4JAWA 1NH6A 4O17A 1S5TA 3IJIA 3MMUA 5CGMA 1TCDA 1G4TA 2QCEA 2UY5A 1JGMA 4FNSA 3ITCA 3TTOA 4CCDA 5DEZA 2J7HA 2V5BA 2W79A 1X39A 3WQVA 1FWFC 4LYPA 1J0JA 1YBQA 1YIXA 1XS2A 4E38A 1EXPA 2DP3A 3FYYA 2H8ZA 4WHBA 4JFUA 4ZXLA 2OWWA 4JTFA 3FAXA 1RLDA 1D2KA 3OVQA 3SCVA 3VIHA 3T0CA 2VEMA 3VILA 4HQVA 1MNSA 4LRTA 1OX4B 2PWDA 3H2CA 1B9BA 1BTMA 1B2YA 1W1VA 4IQEA 4IMGA 1E9ZB 1OBAA 4XV0A 4R88A 3F4WA 3E5BA 2F7FA 1NEYA 3MW7A 2JIEA 2F61A 3MHFA 1JZ5A 3MA8A 2EG7A 5F2MA 5A6KA 2WOQA 2Z7KA 3WLJA 2VVNA 5BWFA 4CU8A 2OCZA 4H9UA 2HSAA 2WPBA 3WZ0E 3UG8A 2IKHA 3VI2A 4GINA 1HKJA 3UBPC 1MW0A 3EXRA 4J7RA 1RCQA 4HD5A 2P1FA 5ENLA 2RJGA 3CV1A 4A29A 1GOOA 3WK1A 1KXVA 1B5TA 4JFVA 3ARRA 3OVRA 3CT2A 2E6YA 3LNMA 1CW2A 1VIWA 1X8CA 4L6OA 3AU6A 5DXXA 3HV9A 1PHQA 3WNKA 2ISFA 4BQ2A 3GHSA 3LU2A 3QGVA 2ZTJA 2Q02A 3EWZA 3H55A 3P0XA 3WMCA 3CXOA 4DXKA 1MEHA 2WSQA 3VNMA 3KE0A 4C6JA 1UKTA 1W37A 1TCMA 1NAL1 1U5VA 3QR3A 3S2NA 3SY5A 4Q8MA 1TIMA 4S3KA 5CPSA 2BHZA 3WUGA 3HZ3A 3SFKA 4EE9A 2PGWA 3TOYA 3QRHA 4UCFA 4DBWA 2NW0A 2ZRZA 3CZJA 2DPEA 2D20A 1E0XA 4YXGA 3NZRA 3DH7A 1UKOA 3ARWA 4QG9A 5E9XA 4QS5A 3C5QA 5F1UA 5ABFA 2F6KA 1E6ZA 4MKVA 4DF0A 1TWSA 1GPWA 2WMFA 2IPFA 3FXGA 3ID7A 5M2FX 1JRBA 3W1LA 3R25A 5BOEA 3O6CA 1XP3A 3HPXA 1E4MM 4MNJA 2B7PA 1TPDA 1T8XA 2DH2A 3G1VA 3E2SA 3LERA 5GJPA 4IZGA 3BAKA 2UV8G 2Y7EA 4ERGA 3NIYA 5KEZA 4JIRA 5CXPA 2WSYA 4ZQPA 1B30A 3HIJA 4Q33A 3TU9A 4PUMA 4C6IA 2PC4A 1EF3A 5J8LA 5EGRA 1AD1A 1VJSA 4DUVA 1BSLA 3TNBA 3GD6A 4GGHA 4LANA 3VCRA 5CG7A 3SI9A 4E8CA 1C29A 2H9AB 2C91A 3L12A 2FZDA 5A8QA 5AC4A 3W38A 4I5XA 1TTIA 1SJBA 3FA5A 4HKPA 1YYAA 2Z2AA 2JKPA 4GIYA 5FKYA 3ZSSA 2QR6A 4R85A 4HNVA 5I2UA 1XQLA 2D69A 3BLEA 4WR3A 2CCRA 1YE4A 1FP9A 1EL3A 2O56A 4J5NA 3VDHA 3S8HA 4DZHA 3KDOA 5FF2A 4PCSA 3KRSA 2NQ9A 1KCXA 4XWUA 4DUWA 3WG6A 4DHGA 1DWIM 1K03A 2J6VA 3TX9A 3WFLA 4HCLA 4QJ3B 2DU2A 4DAIA 1XIGA 3RLHA 2PF8A 1WUEA 4XBSA 4W8LA 1KTCA 3EWDA 3SUTA 4U2ZA 5CZSA 1S2CA 1Q13A 4WK9A 1MW3A 1WZAA 4PUWA 2XINA 2J79A 3LTYA 2ZZ6A 4NKCA 1XG3A 3R79A 1DJXA 3OVGA 3PB0A 2FZ9A 4EOUA 7ODCA 3GR7A 1SUXA 1HJSA 4ERIA 3MHUA 2R1PA 1CXIA 4O53A 4B9YA 3FAWA 3UERA 2BLEA 1WKYA 4KETA 3HMJG 3NQDA 3IUIA 4CLMA 4W7WA 4YWSA 2IKIA 1NM9A 3TN3A 4V15A 1UKQA 2C16A 4OBSA 3HQPA 3VOIA 2ZXAA 3BPWA 5C70A 4C65A 2PDPA 3B40A 2QAFA 1X1ZA 1CXFA 4D6CA 1DXIA 3H4GA 3WQ4A 3UNTA 1UH2A 3SECA 2CBVA 3TSBA 4F0SA 1BFNA 1UWUA 2DDXA 4LUJA 4QISA 2UBPC 5CEWA 1J93A 4LC8A 3IJ7A 3G22A 1KV8A 2FZMA 3MT1A 3GDRA 3T2PA 2WMGA 4ZB0A 3L4ZA 3GXDA 4PRTA 1DWFM 3W76A 4RLIA 3CZ8A 2J4GA 1FWJC 2EBNA 3TQVA 1RHCA 1VYPX 1QO2A 4PMNA 2BX7A 1UHVA 3SUVA 4O8RA 3PFMA 1RY8A 4BR1A 3U4AA 3NZPA 1ZENA 1OF8A 2QCFA 1BTCA 2QNEA 2BTMA 2ZE3A 2XIMA 3QMRA 1U2YA 1V6TA 3PF3A 4F0KA 3GYEA 3LZ3A 1G69A 1KGXA 5LA2A 1F61A 2OZTA 3O9NA 1V3JA 3WK0A 3QHNA 4IIEA 4G7FA 1QNPA 2ZRXA 3N2XA 1YDYA 2C0HA 3O07A 3ZR5A 4G5DA 4L4OA 4N9DA 5GQBA 3VK5A 3E6EA 3OLGA 3VDAA 2PDQA 2AMXA 2VCCA 3MUIA 2YDQA 3THUA 1Z41A 1E1FA 3S47A 1EO5A 1HO4A 1ZAJA 1B3ZA 4OECA 2JGQA 1L8PA 4UQBA 3APTA 3CUZA 4NASA 3N18A 1X6UA 3W27A 1JPKA 2WHJA 2G96A 3IWPA 4UR8A 3MQTA 4GKLA 4B5NA 2X1RA 4FAMA 2F9RA 1D7KA 3APGA 2QCNA 3T9PA 4CNOA 1KM6A 3TXVA 3S1VA 1JCJA 4KWVA 4DBUA 1IEWA 1ZP3A 1NFPA 3SRFA 2BOFX 3IV3A 3KWXA 4IWWA 4CCCA 4C6MA 3BMWA 3CUGA 5EBUA 1IHIA 2WW5A 4CKQA 3B0XA 2ZZ5A 3EOUA 3TA9A 3AJ7A 3MJMA 4IISA 1MEWA 2I5QA 3AXHA 4DJEA 5J5RA 1TJPA 2PDWA 1ISWA 3MP3A 1IXPA 2YBUA 3HA1A 4CD4A 2ZRYA 4YU1A 6XIMA 1BSIA 2X16A 3ANVA 4MLJA 4W87A 5A5WA 3LBOA 2DJLA 3PWIA 1A47A 2WV8A 1LP6A 4RW5A 3E12A 1DQWA 3F5LA 2Z0IA 2GWGA 3WN6A 1HJVA 3LPGA 1G01A 4A8IA 2EPHA 1CECA 3IIZA 5D2XA 4QJ5B 3F5KA 2Z1KA 1E6RA 1PTAA 3KBVA 1GYNA 3FJ4A 1PIIA 4HZMA 4DZIA 4AY7A 5IBXC 3UYCA 2GJNA 2NQJA 1O5RA 1Y7VA 4FI4A 3SQMA 2YR1A 1H2JA 2YZ5A 1GEQA 3FGCB 1B3XA 3E1F1 3DBPA 3CK5A 4C1NB 3HQNA 4Q6JA 3FHAA 3GVWA 1WXJA 3F2CA 4M7SA 3E0WA 3D46A 1VB9A 4HHHA 1HXJA 2E1DA 2X2YA 3L4XA 3FX4A 3H26A 2XN1A 1Q6QA 4HZ7A 1FTXA 5A8GA 5EFFA 2FVKA 1WDSA 1AJZA 4ZEPA 1R3TA 4GABA 1ITCA 1AK5A 3G1DA 3A22A 3URQA 1L6SA 4GIRA 1K4GA 4GJIA 1UR4A 3B0VC 3VFLA 3HMCA 3NDYA 3WQFA 3VNZA 5FD0A 3LLXA 1FFRA 3UVIA 3BOLA 3BJSA 2DY3A 2PBGA 4GFIA 4XK2A 3QM3A 3PZVA 1VRDA 1XF0A 2VM8A 1SSDA 1FFQA 2V9DA 1PDYA 1RA5A 5CPQA 3OHMB 1YX1A 3NGFA 3UZWA 5TD4A 1FWAC 3LCFA 1JUBA 1H7OA 1UP2A 4NAEB 1V3KA 3BMXA 1T5AA 3WJZA 1XH0A 5CCZA 1Q6GA 2ZX8A 3MCOA 1S2AA 2HBXA 4LU0A 4CU6A 3G0UA 1W3LA 1UWQA 2QPSA 2QUVA 4FEZA 2BODX 3OZOA 6REQB 1GEHA 4OTKA 4IP4A 2O4QA 4ZSTA 3KBSA 3ES8A 2J47A 3DN5A 3MTWA 1AVAA 2DV0A 2IS7A 4E4UA 5CJ5A 1G9HA 4UZSA 4V28A 4KQNA 2XFWA 1LL6A 1J10A 4PYSA 3VNYA 4MMWA 1WAWA 1OADA 1KBIA 4AD5A 4W5ZA 2O7SA 2Z25A 3NYZA 5CAKA 2YCKX 3TDFA 4UTUA 3VVGA 5LA0A 3LQGA 1E0TA 3LCWA 4JQAA 4YCOA 1UWAA 3CUJA 4C6FA 3S5OA 1LM1A 2XN0A 4AVOA 1M04A 1EJTC 3VKCA 3H8AA 3KBMA 3S3GA 3G77A 2WCGA 4LBSA 2VD9A 3A9BA 4W7VA 3B8UA 1JJKA 3DC8A 4HHPA 1UP0A 3K5XA 3IIOA 1QPRA 4HNCA 3UA3A 4IPIA 4L5ZA 2J13A 1GG0A 2E5DA 1V6WA 3H2NA 4MFDA 4NAFA 3M0HA 4LXFA 1S2UA 2ZOXA 1A0CA 3TC3A 1OB0A 3UWQA 4K8EA 6TAAA 1GQKA 1M7XA 3EWBX 2BVWA 1KM3A 1BPLB 1LJYA 3TC7A 1VBHA 2ONEA 3R89A 4F0RA 1T99A 1Z44A 1W3IA 1AA1B 5FL1A 3EBVA 1W2PA 4J4KA 3HGSA 1HJUA 4JTLA 3DHFA 1W3TA 1IEVA 3ARXA 4PULA 2Q8XA 3LXAA 4IXXA 5ABGA 1ZBWA 3TQ0A 1MDLA 3K13A 1WYIA 1K6WA 3WF0A 2J78A 3EX4A 1E6NA 4V2XA 3DESA 3QGAC 4YTTA 1JFHA 3TIMA 3SGZA 3WBYA 1E0WA 4C5ZA 3LCXA 1FWTA 2X8RA 4O4WA 1JXJA 5LNWA 4H8VA 3JVAA 4GGBA 2P8BA 3R6IA 3ORWA 3B8IA 1Q7MA 3WH6A 3M7SA 5F7UA 3I3EA 4B5UA 1H60A 3M41A 1GOWA 1N7KA 2YA0A 4JIIX 1ZAHA 4KWSA 2V3FA 3ABSA 2EF9A 1ZUAX 5AFDA 3BE7A 4GIAA 1FDJA 3KVJA 4H9ZA 4JN8A 3AIUA 2PCEA 3TC6A 2BGQA 5G4EA 4X9SA 1K9DA 1VGAA 4O12A 2DIEA 4BF5A 3A4WA 2F6XA 1QUMA 1PKLA 3S5ZA 3T0DA 3LGEA 3LCGA 4IIFA 5FEXA 5AVNA 1GW1A 2E3ZA 9XIAA 1TFVA 3CZLA 3S6DA 4GQGA 1A5CA 4DJFD 1BRLA 3KVKA 1ICQA 4B16A 1BXNA 2XHYA 3HQOA 4QQ3A 4BY3A 3M0LA 2PP1A 3ZLGA 1CI1A 5CZ0A 1PX8A 2GWNA 1UZHA 3BG3A 4DIAA 4FXJA 2PP0A 3LEPA 2J8TA 3VZYA 4D8ZA 4W7UA 4HSHA 3D47A 2W66A 3R43A 3MI2A 5I3DA 1EA0A 1OCQA 1MMFA 5D38A 3MP4A 3W75A 5ABFB 2VR2A 3OHIA 4PN2A 3P6LA 2B0MA 2G50A 1OC7A 3AISA 4PUDA 1DJQA 2OTDA 2V67A 3W29A 3F4CA 4PTXA 1NF7A 2B7QA 3W81A 3QPYA 2H90A 3TZFA 4IPLA 3PUGA 4UNIA 4PEEA 1GUVA 1KM2A 4J9JA 1SMDA 4L64A 2CNCA 2Y62A 2PTWA 1QMLA 3HG3A 1EUNA 4O50A 5E93A 4AAJA 5D9NA 4KRZA 2XN2A 1XC4A 1XSIA 2Y0FA 2ZXBA 1TRIA 3N15A 2J24A 3CL7A 3IAQA 4GACA 3WUEA 3P7YA 5DMYA 4EPKA 1S1PA 5AYBA 3GDTA 1H49A 5BNKA 2WVSA 4GQRA 2H9AA 1NTHA 3R5EA 3H4WA 3MHGA 4IMEA 5F1VA 3N9RA 1XLMA 3W1RA 4I8DA 4B3ZA 5I24A 1GVYA 4MKNA 5CJMA 3LLFA 1GNXA 5DBUA 3VM7A 2YYUA 3KLKA 4Q7BA 3C2RA 4KKXA 4ADSA 1PIGA 4NZ4A 3NVTA 2OT1A 3K4WA 4ORIA 3KHDA 1Q6DA 3ARSA 3SADA 5JU6A 1FHDA 3LRKA 4XSLA 3B3DA 3G6LA 1V6XA 1IT8A 2IXUA 2GPTA 3WF2A 3ZXWA 5FA5A 3TFCA 1BWLA 3IIVA 3JZEA 3EA2A 4I6VA 2EKCA 3WDPP 1Z3NA 3U2ZA 3GIPA 4L4PA 1B0IA 4JEQA 4PGLA 4FSAA 3QN3A 1XYLA 2V63A 2CXGA 4O1FA 1JULA 4OV9A 1H50A 4BF9A 3ELFA 4NU7A 1UD4A 4NXSA 4OGZA 4CCEA 1X1NA 3THQA 4C7GA 4F4RA 1VCGA 3HPAA 1ISXA 2BWGA 3E0IA 1UZ1A 4JTKA 4BWLC 4KFNA 3BCJA 2EQDA 3R8RA 3T08A 5C5YA 2INEA 2VZTA 1O6IA 3I6RA 2OODA 1CXEA 2HVMA 5M03A 4N9BA 4LVAA 4ACZA 3WH9A 2B7NA 1I2NA 2VP8A 3V3WA 1K70A 5LZLA 1UP3A 3S42A 2CLHA 4GXMA 5EBAA 4FPSA 1JZ2A 1EYWA 3KZPA 3N2TA 4ADTA 1CGXA 3P2VA 3UR5A 1F05A 1GOQA 2BB0A 4GNKB 3F2DA 4IH3A 1JZ8A 1K6AA 2I56A 4ICNA 1DJZA 1JCNA 3RHGA 1CCWB 2WSPA 3AMGA 1JDEA 4H00A 1EA9C 1UIPA 3LM7A 1CPUA 1XIFA 1QI5A 3VFCA 1Q5MA 1GZJA 2VMFA 3E02A 4IOTA 1A5UA 2PGRA 3ABZA 3KVLA 4RK8A 4ASTA 1Q7ZA 1VRXA 1BF2A 2V3DA 1RCXB 3W2UA 4OZOA 3WLNA 3QHMA 1FWIC 4R34A 3PZOA 3DGRA 1VCFA 3KL5A 1Q6OA 1ZBVA 4O1DA 1Q7QA 1KRCC 4KWUA 5CSYA 3I7RA 3TYZA 3W9ZA 4IQLA 1B4KA 1D8WA 3Q4DA 1TZ7A 1WNOA 4LF2A 5G2IA 2DSWA 4BEQA 3ZR4A 3HPFA 1EF2A 4H8HA 2VTFA 1DQXA 4EF9A 1SO5A 4DYJA 3E2RA 1PYFA 3UU0A 1JGIA 4GZIA 4IT1A 3NXFA 1A3HA 3THDA 3W2JA 1ME7A 1OYBA 4U33A 4ICMA 3UJ2A 1GJWA 3K4AA 3DHDA 3GXFA 1W6TA 4G9PA 4PCNA 3P14A 1A0DA 4JKMA 3PWGA 4KIRA 3UG4A 3I6TA 1B90A 3N9KA 5CGTA 4JXCA 3FA4A 5H2ZA 1S2TA 4LSBA 2PUZA 4BI7A 1HG3A 1P0DA 1IXOA 4U28A 3M16A 3IK4A 1UOKA 2GQ8A 3WJXA 2OZ8A 3VINA 4YS1A 2YJQA 3CHCA 3E0LA 2IPJA 1BYCA 4V33A 4C6KA 3H7RA 5HMEA 4KT2A 4LB3A 4LEFA 2WVUA 1TX0A 2PODA 3VYLA 4ADUA 1R3SA 3G0XA 4Q8NA 1V0NA 1DJIA 3W82A 2ZTKA 4WKFA 1MW1A 4R9OA 2Z24A 4PZVA 3WMSA 1SZNA 5GNYA 3GFZA 5BROA 1WDPA 3LBCA 2BXZA 2RHGA 1EC7A 3AI0A 1R30A 2YOCA 3SCUA 2XFFA 1OZQA 3GHUA 3VE7A 1PZ1A 4H4IA 3WD1A 1ECQA 1TPWA 1QI3A 1AMKA 1Q6RA 3F5JA 3OOQA 3GC5A 3MUAA 4YWIA 2HROA 8XIMA 1ISVA 4KRUA 3NAVA 3RLUA 3TW6A 1I75A 1AQMA 3GG8A 1H7XA 1ZTVA 5HPCA 2EAWA 1V0KA 2HV5A 3GNPA 1ME9A 1DQUA 1RD6A 3K8KA 1XLBA 4ZOCA 2OWCA 4ZO8A 1IR1A 2E5BA 2G3MA 1VYRA 3WF3A 3W07A 2EPMX 4Q4MA 1UD8A 3OA5A 1Q85A 4DNHA 1PDZA 3CPRA 4AW7A 1WZMA 2WC4A 1JCXA 2WM0A 1O1ZA 3NPWA 1LDCA 2H3DA 3UA4A 4S3CA 4DLFA 3I10A 1CNVA 4IMAA 1ODZA 4GUIA 2YCIX 1QDSA 4JNMA 1TV5A 1OFPA 1VENA 5M1TA 4Q8TA 5DY2A 2JEQA 4N9EA 5RUBA 1XLFA 4E2DA 4L6DA 2RKXA 1UJQA 1J0IA 3HO8A 3B8TA 5A6TC 1ZBCA 2WVTA 1KFCA 2YB4A 1A4LA 5HQLA 3PBVA 1B54A 5DQPA 3MCMA 1LOSA 1I2RA 3EB2A 1ZAIA 3OGSA 3NZQA 5DFAA 3ICJA 4EPEC 1CGVA 1Z7AA 1PVNA 2QPUA 1TVLA 1E15A 3U3HA 2P76A 1VLIA 3MV11 1TTJA 4ZQMA 5DRCA 4U5IA 3OJGA 4FNQA 4IFKA 5IM51 3W2NA 1E51A 1UCWA 2RGMA 2BASA 4J3XA 1OIFA 3H7VA 4JTHA 4NZJA 5HJLA 2BXYA 4DX3A 3MV01 4JYDA 4S2BA 4UR7A 2A3HA 5LA1A 5GJNA 4WSKA 3ABRA 3GNRA 1JFXA 4PBGA 1R3WA 4DF1A 3HJZA 2JE8A 3NO3A 1HGYA 1BYBA 2YCJA 1EPVA 5A94A 2W61A 1B9ZA 3XINA 3STFA 2ACQA 2VC9A 4MY1A 4XG1A 3DG3A 2HXUA 5AHEA 5U7SA 2QJIA 5HR7A 2GJLA 3LHVA 2ZYFA 3VPLA 3G8EA 1US3A 3SSJA 3A23A 5I79A 4CQ9A 3D5HA 1UR2A 1U22A 2BVTA 2IXVA 2CLOA 4KWOA 1IE7C 1NSJA 5BU9A 1P0EA 2OX4A 5F2IA 3WUBA 3C52A 2J7GA 3MUY1 1F6YA 3ARTA 2C1IA 2FGZA 3TVAA 3MPGA 3NTYA 1SJDA 1Q8JA 3UY8A 2Z26A 5BYWA 3WMBA 2XJ7A 3OA3A 2WKJA 1JYNA 3R11A 2PRHA 4GQQA 4M29A 4NIRA 4JPGA 1AZ1A 5CC3A 5J04A 2RGLA 2IKJA 4W85A 1X96A 3N04A 3VIKA 3BV7A 3B4UA 3LPOA 3QZAA 5LNRA 3ZLHA 1L6WA 3S2MA 4AC7C 3GM8A 4MB4A 1S39A 1GQJA 3V36A 4IPNB 2FB2A 4DWSC 1RBOB 3TYUA 3TR9A 1POKA 1FWEC 1C9DA 3INPA 2MANA 1YKWA 1WBJA 4M1RA 1BVZA 4MADA 1E6XM 4M6QA 1KM0A 4PMQA 1A3WA 3CBWA 4MIMA 4UIOA 5CSUA 3N2BA 3UW6A 3LENA 1JCTA 3CQ0A 3EX3A 2VVSA 5D37A 4BI6A 3VD7A 3VA8A 3P82A 3FV9A 3WJYA 4C6EA 1RBAA 1YNQA 3LSBA 4GXPA 3WJWA 3SR7A 2HPMA 3FDGA 1JQXA 2VDHA 3MO7A 4NF7A 3AIVA 3VTRA 5CPMA 2NQ5A 2AMGA 5E6ZA 3GVQA 2PAJA 5H6HA 4OOUA 3G1XA 5BMWA 2R1KA 4ZQRA 3UQNA 1BD0A 3WNPA 4IMCA 2CZ5A 1RXOB 1RQHA 2GGEA 2QJJA 3AXIA 4KEMA 1WXZA 2JF6A 1M7JA 3NR0A 3EOEA 1TPVA 2ICSA 3VNLA 2AQOA 4PTVA 4JBRA 4FR1A 4JTGA 2A7PA 4RNFA 5C9RA 2ZRVA 1BRLB 3NSNA 3NQFA 3T44A 1DJNA 3KOWA 2WZHA 4Q8OA 3P61A 4UZUA 1XDMA 1LT7A 3C2FA 4MY8A 3EGJA 1R9ZA 4ROPA 3MU7A 1FX6A 3E0FA 3T8QA 4AD0A 1HJWA 4CVUA 4HNNA 3ZFHA 2ZA2A 1B31A 5CLWA 1EGMA 2AAMA 3POHA 3HU7A 3PM6A 1J0ZA 4CVWA 3W53A 1RVGA 5E09A 1R9XA 5C9ZA 2DFAA 3MUZ1 2INZA 1F5ZA 2D23A 4XZBA 5J5DA 2V5DA 2OX1A 3WLTA 1REQA 2YXGA 3LLDA 4NZ1A 4BFAA 2AGTA 4MB3A 4LVGA 5D2VA 1W56A 4JL1A 3VIFA 4MF4A 4HU8A 2IKGA 3CC1A 2E9LA 1NF0A 1I4NA 1IEIA 2J8GA 2D2HA 4E8GA 1X6LA 3LA4A 4MPKA 3UY7A 4MDOA 3IIXA 2Y85A 3WX7A 1PWLA 4BQ5A 4WDUA 1HKWA 4CEXC 5DMNA 5A3HA 2HNHA 1SFSA 4PMUA 4JTJA 3IEBA 4HYRA 2DH3A 1XRVA 3PUOA 2PLMA 3RO6A 5HATA 1R5YA 2VGFA 3QW4B 3NQBA 4HPHA 1F76A 1BXCA 3EMCA 2WSRA 2PDXA 4MWAA 4MUZA 5CPOA 3VXGA 2QULA 4O1BA 1QFEA 1XWYA 2Q3OA 1MRAA 4JFWA 4KERA 5JMUA 4NNCA 3TYBA 3K46A 1VBGA 2DT2A 5ABHA 1U1JA 2YIHA 4GC3A 5A69A 2Y7FA 4AZHA 4NAEA 2VT0A 3PAJA 2OZ0A 1VYSX 1DTNA 1OGGA 1OK6A 4C90A 3TTSA 1Z9AA 3PP7A 1WQ5A 4JCLA 3ZSTA 4P2VA 1JZ3A 3O6DA 2WYSA 1FWWA 4H6EA 4I7UA 5D33A 1YTEA 2X30A 1UASA 5L6UA 3M9YA 2ZADA 1J6OA 4I5UA 5I00A 1KFEA 4D2JA 1EHNA 2V8ZA 5A6MA 4FNPA 4O19A 1Q45A 9CGTA 5GNZA 1YNYA 7PTDA 4XD5A 2VFGA 4B5TA 2IW0A 4Z2IA 2QS8A 3RMEA 2P0IA 4OWGA 2OG9A 1W0MA 2PWUA 4LFYA 4N4QA 1JDCA 2QCLA 3L5AA 4AD4A 3KZSA 2E8YA 4W86A 3T2QA 1UYQA 3AXKA 5IRPA 3ARUA 4PTNA 4UTFA 1P6CA 2YX0A 4K39A 2XZ9A 4IIDA 3VIPA 2C3ZA 4I90A 3PVFA 1UH4A 3T8LA 3GU9A 4KMQA 1G94A 3G18A 4I9TA 4JHMA 3CV7A 4S3AA 4IPPA 4XIMA 2CWNA 1OHLA 3W73A 3CTLA 3LHTA 1HUVA 1BG9A 4FNTA 2ZRUA 1E5JA 4J40A 1S38A 1GHRA 4Q4PA 4K7YA 5GPRA 4JX5A 3TFXA 4UMBA 3QXBA 2QAPA 1E4IA 3F4NA 1WP6A 4S38A 3N25A 3SM0A 4DWSB 4DZAA 2GYIA 4AZBA 1B4EA 3UT0A 5KTLA 1W2VA 4IX0A 3BLLA 1ELSA 3L5LA 1XFCA 2NX3A 1QWGA 3W7CA 1EYEA 1KTNA 1AQFA 4CNPA 3TJLA 2OR2A 3WL0A 4GYPC 4H19A 2QKFA 2VR4A 5EYWA 2WQDA 2CPUA 3GFXA 1RP9A 2HJPA 4DJDC 1V5XA 4H1ZA 1GORA 2XGIA 3RX3A 4WF7A 3DFYA 4K3ZA 2NX1A 5K9CA 4RKAA 3WH7A 1GVQA 3GG1A 2R1NA 3EX6A 1AJ2A 2W27A 4GBUA 5CPLA 4PMDA 1TA3A 2ZZ7A 2GGIA 1UR8A 4FF5A 2PPGA 1VS1A 4AEOA 4ZB2A 3ATZA 3AZRA 1VJIA 1VJZA 3WQ8A 3LUTA 2XZ7A 2PWEA 4AFYA 1N8FA 3CAVA 3E49A 3LTSA 4ZR8A 4HNLA 2HK0A 3KHJA 4S2CA 4NRRA 1JD9A 1GZGA 1OYAA 3EMZA 3KOYA 1VIZA 1F7BA 3VZZA 1M9HA 2D0FA 2JF7A 1KLZA 1B57A 1CXHA 4QDPA 2D0GA 3DEQA 2QQ6A 4A05A 4D8AA 1C3FA 4REQA 1F4HA 2ZICA 2DJXA 1KQZA 3T40A 2QCDA 4GI9A 3QZEA 3W23A 3UJSA 4EXAA 3TZNA 4JTTA 1WE5A 4LUTB 4G6CA 2ZA3A 4U4MA 5GJMA 3QFWA 4CGTA 3IANA 2Y8VA 4HZ6A 4DJFA 1E1EA 1EPXA 4LCSA 4B92A 2DSVA 1ISYA 4HMCA 1RJRA 2EPKX 4Y6GA 3T4CA 1GJUA 3ZT5A 3GU2A 3WUFA 3ITVA 1GTEA 2HWGA 1J01A 3V18A 3ARVA 5DMLA 2C71A 1XUZA 1FP8A 1S5MA 3U2EA 4ZMGA 1GTHA 5MKGB 2XG9A 5EMYA 3MDUA 3DKLA 4KS0A 1RCOB 5HAOA 1I1XA 5FJTA 3PUDA 4XVEA 3T07A 1XRTA 4JHZA 3NL3A 4LCQA 4MB5A 4XTIA 1FWCC 1WUFA 2EKGA 3NM1A 3TNOA 3VAVA 1CX9A 1YPFA 3SCQA 5CH9A 5E5CA 4BI5A 5IDZA 3A5VA 4B90A 3O0FA 4GI8A 2Z2BA 1OFQA 1W9XA 3F7JA 3WD2A 5TQLA 4PUNA 3TE9A 3IIPA 4JX4A 1AODA 2G4JA 8CGTA 3BUVA 1I9CB 4Q4KA 4JFTA 1W32A 4LUIA 2J7BA 3HF3A 2GUBA 3GXIA 1SZGA 2OYKA 3W6YA 2RUSA 3WQWA 5KSWA 3V1HA 4AC1X 4DBDA 2CBUA 1XDJA 3EB4A 3EPMA 2C18A 4AISA 1GKPA 4MWAE 1B1YA 2C8NA 1U1UA 1DL3A 1NOFA 3M4HA 1HO1A 2V0TA 1HP5A 4G1NA 3B9EA 2ACSA 2OEMA 3AO0A 3RPDA 2OFJA 1ZL1A 5FEZA 4AMCA 2YFOA 1BKHA 1H7WA 1SW0A 3ARPA 3TP4A 2J75A 3QR0A 2YFNA 3IUDA 2VJXA 3VIGA 3EDKA 4HU0A 3GTIA 3N19B 4PBFA 5EMLA 2PDHA 2GDQA 4LOCA 1J5TA 2AQWA 3NSXA 4E2VA 3V5FA 3WNLA 4AHQA 1OSEA 4BQ3A 1J2WA 4KIEA 4Z17A 4AIOA 1XBZA 3LHWA 4O11A 3TCSA 2VWSA 2DUXA 1XIJA 4KFPA 4UBPC 2R8WA 3BZGA 3AIWA 2GVLA 1ISZA 1JNEA 3BGAA 1GYLA 4DPPA 4J3UA 3P5ZA 3TTYA 3WQ6A 2VD8A 1AUSL 1EDTA 2WANA 3N14A 3M7WA 4I9MA 1Y8BA 3U5YA 1SW7A 1EP3A 1BLIA 4MM1A 4CNTA 1X1OA 2CLEA 3EDEA 4WJ8A 1Z32X 5F4XA 5I3FA 5AYZA 2CHRA 3OZPA 2CFFA 4FOKA 5LIWX 3ISIX 1WKEA 2ASHA 4X61A 2Z2UA 5ABTA 1KRBC 2Z4GA 4ZQCA 5U4NA 3CNYA 1K3UA 2OPJA 5EU9A 1AW5A 3RM4A 1CIUA 1VFUA 1KM4A 3M0KA 5E6YA 2ESCA 2VX7A 2XGZA 5BRPA 1FWHC 1LQ0A 2FZNA 3NQVA 2XSXA 1TE1A 3B05A 1KFJA 2VZSA 1FKXA 2HCVA 4W89A 5JBDA 1YHTA 3GBEA 3CEPA 1XPGA 2UY2A 4AZ7A 1WOAA 4V27A 4WY0A 2JEPA 1U5JA 4XTDA 1IWPA 4FHAA 3T42A 1RK6A 1H7PA 2WJEA 1DJYA 4L1GA 3LHYA 3NFUA 4ML9A 4UFIA 3GH7A 3P62A 3STEA 5CZJA 4Y9MA 1X6NA 1R3QA 1UKSA 4A8NA 2YB1A 3N29A 4BEUA 2Q8LA 3G8RA 2IPWA 3C86A 1MUCA 1GPFA 1XLCA 1JPMA 3BV4A 1E73M 2CW6A 3GNNA 1L2QA 3DI1A 3UCQA 4IFRA 3EA1A 4FZIA 3BO9A 7TIMA 4DO5A 1HT6A 4GWEA 3TUUA 3WY1A 5HQMA 4NUWA 4O8AA 3I7QA 4Z08A 3GTHA 4UMCA 2NLIA 2WJFA 4UQCA 4ZVJA 1QPKA 5G2HA 3BXWA 3PPCA 3W26A 1SJAA 4HCHA 4Q32A 2VOMA 2GK1B 4B5SA 1R2RA 4AZ6A 5HUOA 3MJYA 3I3DA 5FAJA 4IG2B 3M47A 1HQTA 4PB3A 1TUFA 3CL6A 2CIPA 3TQPA 3BW2A 1G0CA 4JTAA 4PMYA 3NO1A 4PRRA 1E9LA 4MNMA 2PDKA 4F79A 3C3UA 1EJUC 1UMLA 4H04A 1HKKA 2QPXA 3HG4A 1NELA 5D2WA 4Q3MA 3R13A 3EDFA 2J7DA 3A13A 1GT8A 1OM0A 3H54A 3PTKA 2WMKA 5I07A 1DXEA 3R10A 2WVVB 4HPJA 2E4TA 2A6NA 1LUCB 1I2PA 3QW3A 3QZ6A 3OLEA 1EQPA 4C7FA 2X0YA 4KBXA 2WB5A 1SZFA 2E7FA 2H6RA 3FJNA 1L2UA 3TTQA 2J25A 2W5FA 1VD6A 1W3NA 2OWXA 3KUMA 4ROQA 3W7PA 1GZ1A 4R7OA 2QUUA 4IL0A 2VWTA 1EJ7L 1K7FA 2FYMA 4J28A 4AWEA 2EJAA 2QJGA 5G4WA 4HNTA 1WA3A 3O6YX 1QPOA 4NQ1A 4NYYA 3S83A 4RXGA 1KCKA 3NPXA 5FJUA 3W87A 2A3EA 4RPPA 5C9XA 4UTHA 4F9JA 2PTZA 4R5EA 1FWBC 5H8MA 3U6WA 1JI2A 1QATA 2QUNA 3AIEA 1VKFA 3CV2A 1YMYA 3LG3A 2OEKA 3W74A 2VFEA 3AU2A 3UETA 1JL8A 1QNRA 3BSGA 3G1HA 2F2KA 2J88A 4PR4A 5IXEA 1W9PA 1JUEA 2R9RA 5FSDC 4EF8A 1MQQA 1DE6A 1TJ2A 2WKGA 2J27A 2CWXA 4MYAA 2NT0A 1FDYA 4O0QA 3WD0A 4GC4A 1FWDC 2CLLA 4C1LA 3MCNA 2X0HA 4BQ4A 1UC4A 3MSYA 4MYXA 5G2WA 3I3BA 1VQTA 1EKOA 1NIUA 4LYRA 4GNJA 3U0HA 2JALA 4YPJA 4NZ3A 4KESA 4FIRA 1LLOA 3WLSA 1E71M 3B9DA 1OF6A 1LT8A 2AKMA 3VIOA 4Z1YA 1RSCA 3B9NA 5HJXA 2YZRA 2A3LA 2YKKA 2I5GA 4NXKA 1W1ZA 2YL5A 3LM3A 3T78A 2E5CA 5HMFA 1JD7A 3TQKA 4UB9A 1CYGA 3ZWTA 3UJRA 2YXXA 2ATMA 2FQIA 2JIWA 4M5PA 2VR5A 3HBLA 3FN9A 3RPMA 1BVWA 7REQB 1PJ9A 3VZXA 3IGHX 3M07A 2CKSA 4NVTA 5BZAA 1XLIA 2EXOA 2DVXA 4LEQA 2NV9A 3FHQA 5JQ9A 3D3AA 2PP3A 4X22A 3OIHA 1ZJBA 1AH3A 1JRCA 1QBBA 3EDJA 4UTWA 3W2LA 1SO3A 2QGYA 2DZTA 3M0IA 3P8IA 3CO8A 4RNIA 5C7VA 3R1ZA 2VEIA 4K37A 5CAHA 3TW7A 5JXQA 1GKRA 4EAYA 5KZDA 3WLMA 2QCGA 3TAOA 5DCBA 3DIPA 3PPHA 1ZLPA 4MG4A 1TV4A 5D9PA 1QNSA 1ZCCA 4Z1AA 5C71A 3VNJA 4J3TA 4NI3A 3T7VA 4QS6A 5K2ZA 4PCTA 5D30A 3QV7A 3VIIA 4FO4A 5K4XA 1PYMA 3N2OA 3U57A 1EOMA 1BWKA 4A21A 4D9PA 2Z1SA 3WF1A 5EMUA 3H24A 1TPB1 2FPTA 1UUOA 2QLYA 3FKRA 3R0UA 3MANA 3G3DA 2FH6A 5FIPA 3KP0A 3ZWSA 4YNGA 1A49A 1Q4WA 3EKLA 2NWSA 4JEJA 3QGKC 4FIQA 4P7NA 3H21A 1MVYA 2E25A 3WQOA 2NWRA 2VC6A 5K9XA 4DJFC 5MKGA 1EJVC 1S2VA 4FOUA 3V16A 2OXNA 4L9YA 1BQCA 3O06A 3LXBA 2QMJA 5D9OA 3NJ3A 4NJGA 1XGEA 2FHFA 1LOQA 3W7LA 2PS2A 4WJXA 2FVLA 4Z2LA 3G24A 3S5YA 5HBFA 4AH7A 3SY8A 1YDVA 3FSTA 2OKOA 3O16A 1SJCA 4C6OA 1V3IA 4AYGA 4AXKA 2GJRA 2DZSA 1J0YA 4MGGA 5A6BD 2DORA 1UR3M 2VELA 1A5KC 1RQBA 3SJ3A 3KOFA 1I6NA 3LCLA 8A3HA 5I23A 4FOJA 4Z2JA 3JZUA 2OU4A 1W1IE 4JFSA 1ONXA 1E0VA 1VCVA 1C9WA 4AZ5A 4IICA 2KX9A 4EXQA 1ME8A 4HP5A 3WQCA 1ZY9A 2JKAA 1YDOA 3WDQA 1AQ0A 1X38A 1Y5XA 1PS9A 4EACA 1QNQA 4K8GA 2Y4SA 4JDBA 1X7FA 4K7VA 2GDUA 5EB8A 1SR9A 2ZQ0A 3MI3A 4UOJA 1JAKA 4P61A 1YTKA 5C54A 2VEPA 1JYWA 3B8VA 4CQ8A 2J7EA 5H8UA 4J3VA 4MKSA 4MTVA 1MRQA 2YDSA 4UNKA 3SIMA 2P3EA 4GOAA 1J79A 4DJDA 4W4QA 2REQB 1QW9A 3MKKA 4QSHA 2ON3A 3WLLA 3HJEA 4R7JA 3TH6A 4BA0A 1XICA 3AAMA 3EOOA 3D0CA 4S1FA 5IHSA 3BAXA 1O5KA 5TAOA 4QIUA 1N8IA 4JQ4A 3PZMA 1ITQA 5G1YA 2ZRWA 4ZOEA 1K1DA 3B9OA 3H2OA 1KA9F 5HWJA 4PUKA 3W01A 1FBAA 3UD6A 4KEVA 3K8LA 1Z89A 4ZBCA 2W6RA 1QW8A 2BHYA 2CHOA 2O55A 2E6DA 3BGGA 1CB2A 2HDJA 3WLIA 4TOQA 3QFEA 2DZPA 3K4DA 4JZ5A 3AXMA 1FCUA 3CUXA 1IWBA 2B81A 5AC7A 3UVAA 3GB6A 1CZ1A 1GOXA 3W1XA 3V35A 4B2DD 3IK2A 1ZU8A 4GHRA 1TKKA 4XKYB 4TTGA 3TLQA 3PNZA 1MFVA 1ZB5A 3RYSA 4L4MA 2WCSA 1TMLA 1WB0A 2L5HA 3LRLA 3NOEA 3S2LA 3QV9A 4LGXA 1M7OA 2WNQA 3DU0A 5D8WA 1DJHA 2ZDRA 3GIQA 3K1GA 1GVEA 1CGYA 5FACA 3R4IA 4B3LA 3BQ5A 3RM9A 3FS2A 4AB4A 4M7TA 1OT1A 4DELA 2VURA 4ATDA 1E5NA 5AOUA 3IVUA 2X1IA 7CGTA 3PWAA 1XLHA 2Z6JA 4Y9NA 3SRHA 3HGJA 3JRKA 1ADDA 4PL2A 1V4YA 1GW9A 4ZXOA 2ZWZA 1TWZA 2NV1A 1O1HA 4YHEA 1REQB 3FSUA 3L2MA 1ZP4A 3WEZA 1PWMA 3CZEA 2VZOA 4XAPA 3GQYA 2INFA 5C9UA 1DXFA 2Z1VA 2QDHA 4B91A 5JBFA 2BZNA 1JZ4A 1JPHA 1GONA 1UD6A 1DJGA 2CXEA 1J6PA 2YW4A 4GH3A 4DXXA 2ZA1A 2NVAA 3GR8A 3QJAA 1MWOA 2BDQA 1N8WA 4WGXA 4O52A 3VCNA 3LXCA 3LQLA 2PWHA 4I8YA 1A5MC 5HJYA 3C56A 3MSDA 1DPMA 2AQVA 3OZMA 5B7ZA 2C0AA 1WDWA 2O4MA 3DI0A 1HZYA 4B5VA 2PE4A 1A80A 4G7EB 4RPQA 2X1UA 1JR1A 3W72A 1MI3A 3GE7A 4J1OA 3W0KA 1E9YB 3EAUA 3U8GA 4MWAB 4G1KA 4FNRA 1VEMA 4LWWA 3OG3A 2R24A 5DXYA 4Z1DA 4MZ8A 1BQGA 2PLJA 3LI1A 3M6DA 3UWVA 1PZ0A 1QI0A 1E1CB 4MJ2A 1PX4A 3EKGA 1XH2A 3WO8A 2W0UA 2R1LA 3PPGA 3B8SA 3B0UX 4JKLA 1TTPA 2VRJA 1T6MA 3KAOA 3L2IA 1TREA 4KRTA 3ZJ7A 3PFRA 1BAGA 3MVIA 1Z6KA 5GNXA 4DYKA 2GSHA 1ADSA 3PAOA 1DEDA 3NSMA 4FLSA 2PC8A 2HTMA 4O54A 3ZYZA 1LBLA 4H83A 1EJXC 4MPQA 3C0LA 1BGGA 1H11A 5CBIA 1AW1A 3DDMA 1W5MA 1IR2A 4MJMA 2PGFA 3CHEA 3ZJKA 2FDSA 3DFTA 2Y2WA 4RUBA 5C8BB 1OX5A 3ZJ8A 3AYSA 1W91A 1JYVA 2VDIA 1DIEA 4ZFMA 4A3UA 4ONVA 4LV9A 3E0VA 3CB8A 2QEZA 1TWDA 5I78A 4O57A 3NEVA 3L4WA 4LUTA 4N0RA 1GK8A 4U31A 3WQGA 2WHKA 3UXKA 2A3BA 4UFHA 4OUEA 1OG6A 3OU8A 4LPCA 1BHGA 1ITXA 4GX9A 4ZA0A 3CQJA 4YMZA 1KTBA 2VOTA 3TONA 1UJPA 3MO4A 4DI9A 2ZX7A 2PDYA 2VRKA 5JVLA 5I6SA 3TW9A 2V68A 4IM4A 1X8FA 2FB3A 4AQLA 4NILA 4HHLA 3EEGA 1D3GA 2VC7A 5A2BA 3A5FA 3KVMA 1F2JA 1K8YA 3PZIA 4YVPA 4YHGA 4RDYA 2QW5A 1UKPA 1IGWA 2CESA 4CN6A 3BTNA 5DN1A 5I77A 2NXGA 2WHMA 5A8OA 5A6BA 5A8PA 3CAKA 2UY3A 3NZ1A 4E5TA 3WK2A 3S0CA 4UR9A 4F0MA 4H9XA 3SB0A 1G4EA 1XD0A 4IFKB 4F9DA 1H1YA 4HA4A 1V08A 4UFLA 1YNPA 3BZJA 3TAKA 4GE8A 3ZM8A 3UR7A 3L7RA 1LWHA 3WFAA 2VC5A 3N4EA 1OZMA 1XCXA 3QYSA 1XLAA 4DJEC 4GISA 1U33A 4RZ6A 2CERA 2ISSA 1XX1A 3AIRA 1D8CA 4EVZA 5TNVA 1HVQA 2C19A 3UXIA 1X97A 4UTKA 1RPKA 1SW3A 4ACYA 4P5UA 4JYFA 4U2YA 5CG0A 3FXYA 4ZQNA 2JFEX 3SCTA 3LPFA 3N2CA 2WAGA 3PPFA 4N42A 4C60A 2TAAA 4ES4A 4PUJA 5F4WA 4H2HA 3NQEA 3OQEA 5MF5A 3DHUA 3P8JA 3DFSA 4TX9A 2VCBA 1R46A 1PKNA 3SO7A 1V3MA 4FMVA 4HVXA 3BLPX 4HZ8A 3KBWA 5CPTA 2ZUNA 4UC5A 3QHOA 3A3XA 4LVDA 4PTDA 1XRSA 3W83A 3LBMA 2I9UA 3RITA 2ISDA 2GQAA 4F2TA 4GMEA 1TR1A 3VD5A 2ZC8A 4AWUA 2PBOA 5DY3A 4IGSA 2DSZA 3VNKA 4OBRA 3MMTA 2WBKA 1DIKA 5C2GA 1GJPA 1OIMA 2ABAA 4GZEA 4ATWA 3S2JA 1QI4A 3OZYA 1ITUA 1B3OA 3CHFA 3T81A 3GO2A 3N6JA 2PTDA 2ZUWA 4YTUA 4WY0F 3SRKA 1P5BA 5T9CE 1QO5A 3S5SA 3LGGA 4O1CA 3WD3A 4MHBA 1Y5WA 4O18A 1UR1A 3O2LA 4NG3A 1IZCA 2TODA 3K30A 4XBKA 3IV8A 1XIBA 4GYJA 4DM1A 1OFDA 3A9IA 2WMJA 2I17A 1H1ZA 1YXCA 5AHIA 1ONRA 1DIDA 1SPQA 2X1TA 4GZ7A 1XC6A 2Z28A 1ZPTA 3OBKA 4QE5A 3VKBA 4IP5A 3L4UA 4UMAA 1QWKA 3MC5A 9XIMA 5CZKA 4X2PA 3OPSA 1VHNA 1XCFA 4D6IA 3L66A 2EO7A 4QX4A 3STPA 1XQKA 3UWZA 2OYMA 3MWAA 3TWBA 3FOKA 2Q09A 3N4FA 4D6FA 3G2GA 1UBPC 4B4FA 4RDVA 2GSJA 4L1XA 4ZTYA 5ABEA 5CC6A 3GNDA 4GNVA 5AYYA 1EFZA 3JUGA 1XUUA 1GYMA 1GOMA 3M43A 4FXRA 3B4YA 4AG0A 1QVBA 2DZXA 5EMKA 1I1WA 1DYSA 2Z1BA 2OSXA 2PDNA 3UJFA 3B03A 2GJXB 1LWJA 4KWWA 1R0MA 1BF6A 4LUSA 1XHGA 4TVDA 3ZT7A 3LN3A 3S5NA 2CZFA 1QT1A 2QGHA 3O0KA 4BCEA 4EWND 5KMYA 3PR2A 3FKKA 2V5KA 1PEZA 1NDZA 1OQFA 1TZZA 8TIMA 2WNZA 1QTWA 4AX6A 4OU1A 1I8JA 4XD4A 3CWOX 3KW3A 5GVJA 2HNEA 4FX6M 1LUCA 2X7WA 3T2OA 3TK7A 4HK6A 2GOUA 2WC7A 4IIHA 4JY9A 3NVDA 4ZENA 2PZ0A 5FJPA 1NP0A 2X2GA 2V3GA 5D04C 1PZ3A 4U3CA 3IPWA 4UFMA 3AMKA 3SIZA 4OFCA 3VD3A 4A4AA 4QSFA 2FTPA 3EXTA 2A7RA 4Y9OA 1OCJA 1Q6EA 3UCCA 5AC5A 3P80A 3AS1A 3HGOA 3CHVA 3S2CA 2GFTA 3RU6A 4FNUA 3II1A 3DG6A 4CN4A 3U48A 1V6YA 5IDIA 4O1EA 3A3WA 5AHLA 2V2CA 1AQHA 2GQ9A 4ZODA 4E3TA 1ZJIA 3SCNA 4ZE4A 2OQLA 4M81A 4Z2KA 5LNSA 3EOLA 2IQDA 3BL3A 1XLEA 1RLCL 1UQYA 2PEVA 2FTYA 1W9DM 3KLLA 2R82A 4QE1A 3A24A 4KCWA 4M8UA 4ZTXA 2XUCA 3VX1A 3BWWA 4B9ZA 1DVJA 1VBUA 5HWMA 3V5OA 3W28A 3E38A 4W93A 4LS0A 3ERPA 2XPKA 1QHZA 2P53A 2OGYA 1GQLA 3KTCA 1XYZA 3PTDA 4AIUA 4CQAA 2JKEA 5BU6A 2PDLA 5CLTA 5FESA 3P93A 4RE4A 3LV6A 1QASA 4HPGA 4EPBC 1TWWA 1GHSA 3I7SA 3BDKA 3AHXA 2Y88A 2Z1WA 4RW3A 1XIMA 3MZ2A 5LGZA 4JD4A 4S3DA 1T0OA 3CIWA 1UD5A 3CT7A 2PTYA 3CLWA 3GY1A 1PHWA 3OQ8A 4HA1A 1VF8A 4FA3A 1ONWA 4Y9AA 5FSEC 3W2KA 4NJIA 4RNHA 4ILSA 3C3NA 4HSNA 4JTIA 1JIBA 3QKZA 3AHTA 3CUIA 4TX6A 4BWLA 4D6JA 2PDUA 4MVAA 3GC2A 5T8GA 4H7VA 4LUSB 2VEFA 3GZ3A 3TLLA 2FKPA 1Q6LA 5ECUA 4NYUA 2WZTA 1V3LA 2HXTA 3RX4A 3TA6A 3V0SA 2GK1A 5A8NA 2Y61A 3WLHA 2W62A 1E6SM 3GLCA 1HP4A 3WQDA 1FKWA 3ZZ1A 3W7GA 1MNZA 4H2CA 4LB4A 1UPPA 4JTSA 1HVXA 4E6MA 2ZX5A 1P43A 1HTIA 3VIJA 3ALFA 2O9OA 4IFOA 3F1QA 1JNDA 4JYEA 2ZFAA 1SO4A 3W7NA 3ITTA 3KTSA 2BFGA 4I9JA 4UTTC 1D3CA 2A85A 3W86A 3VUSA 4WVXA 3NDOA 5FJIA 1Q6CA 1UMYA 2XM2A 2BGSA 1QBAA 3BCFA 2MUCA 2AL2B 3EKZA 4C6QA 4N9CA 5FF0A 2J7FA 1V02E 3GW3A 3HPSA 3RDKA 4WY0B 3HQ1A 4GBDA 2OJPA 4JY8A 1F3WA 2CLIA 4U5KA 4TUFA 4OE7A 4N02A 3H70A 3KS6A 1FH9A 1P1XA 3VKKA 3VO0A 4N7QA 3URNA 4PUEA 1TVPA 1Q6FA 3PBWA 3UXAA 1PKYA 2J7CA 2ISVA 1XLKA 2RFGA 1HKIA 1EP1A 2A6LA 1MW2A 2XIIA 2DZBA 1P0BA 2OMAA 4A2SA 2GDVA 3TSDA 4L61A 1Q63A 4Q4SA 1BWVA 4M6PA 5E0CA 4QG6A 3MSRA 1KGUA 4DO7A 2WWDA 4HMNA 3VOFA 2BOGX 3TYAA 5A95A 5I02A 2OOGA 4DBEA 4D1JA 4J2PA 2FVMA 1C7TA 5CSRA 3D6NA 2BOEX 1YPXA 4CD8A 3GUGA 3ME3A 1DWJM 1DOSA 1VHCA 3RM8A 5BMXA 3L0KA 4H9VA 5D03A 4TVUA 5HMDA 2PMQA 3HGRA 4WDXA 3QR1A 1ICSA 5CJNA 2OYLA 1R3YA 4J3SA 4RCXA 5C0QA 2Q01A 3CLMA 1TJ1A 2B4GA 2FGBA 5FI8A 1LRQA 3W1TA 5I3KA 7XIMA 4KFOA 3PZ9A 3GU1A 1K8CA 4IGHA 1WZLA 4KF1A 4TX8A 2NXHA 3IJLA 5TIMA 2VX6A 3SJNA 2CZDA 2V3EA 1W5OA 1KBBA 2PWVA 3SW6A 4MUPA 1S2WA 3OP2A 3MKCA 1NP2A 4M3PA 5FJJA 4F3HA 2DZVA 4QROA 1NVMA 2EPNA 4TTUA 1L6FA 3S6TA 4J35A 2WKLA 3S1XA 4QRNA 3VU2A 3I4EA 2C79A 3C0SA 3SQSA 2PGEA 3GZAA 5I7GA 4MAZA 4Z42C 4QAIA 3K2GA 5I3GA 1R87A 3GXPA 1L0PA 3KFTA 1J12A 5M5DA 2G3JA 1FHVA 3PC0A 3GTFA 1Q4NX 3HOJA 1EX1A 1AJ0A 1YQ2A 2F38A 1HFBA 2E9BA 1NFGA 1OFAA 4M19A 1W8GA 1A50A 1OX6A 1RJPA 1EJRC 3F4DA 5CPNA 4A6GA 4C6CA 1E56A 3M1ZA 3CPUA 1CXLA 4Y8EA 2G37A 1QOPA 3LYEA 4FX7A 1TYGA 1T8QA 1TIWA 2NV2A 2E09A 4LYKA 1MZHA 1XBVA 4IJRA 4A2RA 1FUYA 2A4AA 3BJFA 5I5RA 4IF2A 2DQXA 4HMDA 4L6HA 2ZUSA 2ANUA 3FA3A 3VGFA 4ZCWA 3PBGA 3AMCA 2YLLA 3FEQA 2YBVA 1A5AA 4LNYA 4UTLA 3VE9A 3H12A 3WBEA 2IUZA 1OYCA 1TWIA 5HMSA 3QOMA 3GK0A 3G1SA 4D8LA 3AUOA 1KR1A 2CYGA 3MB9A 4UCGA 2YA1A 1K8XA 2ZDSA 3AYTA 3BAWA 4MSSA 1O4UA 2QCCA 2X41A 4CU7A 3TKFA 2VHLA 3T1GA 3CPGA 3FGCA 4LAOA 1R9YA 3NM3A 2Y24A 3QBUA 4GVFA 1DWGM 2QCHA 3VKDA 3TSMA 4QDMA 2GQ3A 1A5LC 1EEPA 3UCDA 4P7QA 3LMZA 3WCZA 3APYA 2VNCA 1Z42A 4PMZA 3AXXA 3UZ5A 3U9IA 5ECVA 1YLVA 4JDYA 3HPZA 5HQEA 3KOXA 1NWUA 4ZO6A 2RH9A 4OKDA 4HGXA 3LHUA 1F73A 2GUUA 2VEGA 1LBFA 4CD5A 2E6AA 3NQ6A 9RUBA 1H4PA 1TG7A 3OYXA 4E4PA 4LS1A 1E72M 4JTUA 3G5EA 3H7UA 1EX5A 1KM1A 2IQTA 5XIMA 3KCJA 4ECLA 2ZVIA 3CAQA 3AICA 1RALA 3BICA 2CLKA 3OO2A 4XAYA 1HKVA 1F6PA 3NEHA 3URBA 4Y7EA 1XJBA 4JQ3A 2D22A 1FHUA 2Z00A 3KL3A 4QXIA 4ZZ9A 3PZGA 4XKYA 4NAFB 1E9IA 5DMMA 7TAAA 1EXBA 3FLUA 3NURA 2PDFA 3HM7A 5M17A 4XZMX 2YDAA 3THCA 1Z48A 4X0NA 3PZTA 1RV8A 1EDGA 2Y7DA 2MNRA 4PSPA 2XISA 3REQB 1IV8A 2NVCA 2ZZ1A 3W1PA 4X60A 1GG1A 4UTWC 4NL1A 3FEMA 2CLMA 3KRZA 4GK8A 3ZT6A 2P8CA 1J18A 2V2DA 2D2OA 4S39A 2PFHA 3OLDA 3Q45A 3L9CA 5BXTA 4HBKA 3VGDA 2CKRA 4JL2A 4B15A 5I06A 5I09A 2AOSA 2QF8A 4L80A 3GIYA 2YCEA 1DWHM 3DG7A 1UW9A 1Q8AA 3L0NA 4M1BA 5MHBA 3M5XA 1NOUA 1DKWA 4QP0A 3BK0A 1VPYA 2CBIA 2EPLX 2XH7A 3W7OA 4QG8A 4M6VA 4C6DA 3IUHA 1OX4A 5D8ZA 1WDDA 3A64A 3SGGA 4WD0A 1MEIA 2DW6A 3LCIA 1I0BA 4LALA 4O14A 2VGGA 1IT0A 3TMLA 2UY4A 3GXNA 3CWNA 4MNKA 3UFYA 1CWYA 4ML4A 4JN7A 2OVLA 2YCLB 3GFYA 1G5AA 4D6EA 3AC0A 5HDRA 3TXZA 2FZ8A 1C91A 1NDWA 1NFBA 1H3GA 2ZVRA 1M6JA 4F2UA 1K9FA 1JQVA 3EYPA 2H3BA 4LYQA 5CQ1A 4FX8A 1XISA 3CV6A 2BVDA 1EC8A 3SURA 2QMKA 2QYGA 1R7OA 3O3RA 3SN1A 4PFMA 2WLZA 2OKTA 3AIBA 4P8XA 5LKYA 2BY3A 4LV4A 5LIUX 1EC9A 1PBGA 3O1NA 2PA6A 3BARA 2GJPA 4I3GA 5AN7A 5KITA 4IPJA 3BH4A 3NYDA 6A3HA 2XTKA 2OEJA 3MP5A 4K8HA 4O15A 5EFDA 4DYEA 4XZ9A 3LX9A 3LZ5A 5IBXA 3QTPA 3H4XA 4P7OA 3GTXA 1U30A 4RZ4A 4RE3A 3GTNA</