3O8AA

Crystal structure of plasmodium falciparum dihydroorotate dehydrogenase bound with novel inhibitor genz667348
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
375
structure length
375
Chain Sequence
b'YNPEFFLYDIFLKFCLKYIDGEICHDLFLLLGKYNILPYDTSNDSIYACTNIKHLDFINPFGVAAGFDKNGVCIDSILKLGFSFIEIGTITPRGQTGNAKPRIFRDVESRSIINSCGFNNMGCDKVTENLILFRKRQEEDKLLSKHIVGVSIGKNKDTVNIVDDLKYCINKIGRYADYIAINVSSPNTPGLRDNQEAGKLKNIILSVKEEIDNLEKNNIMNDEFLWFNTTKKKPLVFVKLAPDLNQEQKKEIADVLLETNIDGMIISNTTTQINDIKSFENKKGGVSGAKLKDISTKFICEMYNYTNKQIPIIASGGIFSGLDALEKIEAGASVCQLYSCLVFNGMKSAVQIKRELNHLLYQRGYYNLKEAIGRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase homolog, mitochondrial
molecule tags Oxidoreductase
source organism Plasmodium falciparum
publication title Novel inhibitors of Plasmodium falciparum dihydroorotate dehydrogenase with anti-malarial activity in the mouse model.
pubmed doi rcsb
total genus 148
structure length 375
sequence length 375
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2010-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3o8aA00
3DFOA 1VC4A 4O8RA 1SW7A 3GLCA 4UNLA 1YXCA 3NQEA 2NWRA 1YDVA 1F7BA 1JCLA 3VKJA 1KLZA 3L66A 3I7RA 4CLMA 1KV5A 3LCGA 1QO5A 2QAFA 3LXBA 4RZ5A 1KTNA 3NEVA 1K3UA 4BR1A 5KITA 4MVAA 4N4QA 2H3BA 1DJNA 4MYXA 1SR9A 2W79A 1SO5A 1BWLA 3G1SA 1BKSA 1KTBA 2JK2A 4ZMGA 1OJXA 2Y85A 1RV8A 2BXVA 3PB2A 2A7RA 3O6YX 1PV8A 3W1XA 3DKLA 1DOSA 3NA8A 2YFOA 3O16A 1W0MA 1P0NA 2BLEA 3B0VC 5CZ0A 3KOFA 2V2HA 4XQ6A 1H7RA 4XBSA 3GDMA 3M9YA 1Q6QA 2Q8ZA 3O1NA 4UFKA 3CB8A 4ML9A 1AK5A 3S1UA 3MW7A 3Q58A 3QF0A 3QRHA 4KWWA 1TTQA 1P4CA 1LOSA 1BTMA 1FWTA 4DELA 1TV5A 3O6CA 3RFAA 2R8WA 1YPFA 3BLIA 1TJPA 2NWSA 1N8FA 3DI0A 5J5RA 1TQJA 4IPIA 5J5DA 1KM2A 3NQ7A 2D73A 3E02A 1WOBA 4QNEA 4UUIA 3TW6A 3W2UA 1IXPA 1W5MA 3PWAA 2YYTA 1FCVA 4FNPA 1TMHA 5MHBA 4WQ6A 4B5NA 2E5BA 3DFPA 4FEZA 4WX2A 1QPNA 1X7FA 4Z1BA 1M5WA 3WJWA 3QW4B 1UBSA 5LZLA 1DKWA 3W2MA 1WX0A 1W31A 3DH7A 3LRLA 4TMBA 1VPXA 4W9TA 4MUZA 1TPC1 1YDOA 3W6YA 1XBXA 2YPIA 1XKYA 4IMFA 1OABA 5AYYA 1T99A 1EWEA 3IVSA 5EKYA 3W7JA 2PRHA 1TB3A 4AF0A 2ISVA 3MMTA 4UMBA 3WJZA 3NZRA 1BWKA 1PS9A 1OX4A 4A2SA 1GJPA 1G6CA 3FIGA 3CU2A 5FEWA 2QEZA 3MYOA 2V2CA 5F4SA 1VQTA 1UUMA 4CNNA 3EWYA 3W1QA 2E5CA 1M7PA 1GG0A 2DORA 5LKYA 4NU7A 3EXSA 1M7OA 3PULA 4XBKA 1FDJA 1OFRA 3CEPA 3A24A 2VELA 4GUFA 5HULA 3N19B 4JDYA 1T8XA 4O1AA 1VCFA 5LNWA 3S5YA 2NLIA 3QEZA 1O94A 3VE9A 2VEPA 5LNRA 5E1QA 3MBDA 4LVGA 2J9ZA 3THAA 1NAL1 4IMDA 4K8EA 5G2WA 2A2IA 4OV9A 1TPVA 4KKXA 5EYWA 4HIBA 2NUXA 3EKLA 4R33A 2VFGA 4AB4A 1SW3A 3PAJA 3T7VA 3R12A 4Y9AA 4UFIA 4R53A 4WXZA 4RV8A 3QMRA 3W7HA 4ZL1A 3SIZA 2NX9A 3OA3A 1QPRA 5K4ZA 4WD0A 2E5DA 4ADSA 1TPEA 5C2XA 3GIYA 3NL6A 4FO4A 3SZ8A 3VI2A 5LGXA 3KX6A 1R30A 4GWEA 1KFBA 5D30A 3GDLA 1OFAA 5AC7A 3S1VA 3W74A 2ZQ0A 4UNKA 4PODA 1FXPA 3N34A 3OBKA 2Y62A 3W2LA 3B0UX 3P8JA 4FNUA 4A2RA 4A22A 3RLUA 4TX9A 1GVFA 1DVJA 1Q3NA 1FXQA 1P1XA 3MO7A 3MHFA 4DPPA 3FKRA 3M44A 1XC4A 3LBCA 3NL3A 3MP5A 3TSBA 5K9DA 2NUYA 4DEFA 5D2TA 3USBA 1EUAA 3C4UA 3T55A 3G22A 3O8AA 4MY8A 1DJQA 3JRKA 4UTHA 3KRSA 3MWAA 2OX1A 4QSHA 4DBEA 3YPIA 3HIJA 3OVRA 2JKEA 2CLHA 4JN6A 3ABQA 5F2MA 4NXKA 3T4CA 2VFHA 4UFJA 3IVTA 5TBOA 4WZHA 2RDUA 4GUJA 2H8ZA 1BEUA 3NQAA 3WJXA 1XBYA 2X1UA 2YYUA 3C2VA 3BW2A 1I8JA 2ALDA 3N2XA 6ALDA 3S5OA 3P8IA 1FCQA 3IGXA 1IXNA 4MLRA 1TPB1 2QCDB 4PH6A 1EP1A 3IIPA 5C6MA 4AMAA 1L9WA 1TIMA 1MXSA 2GOUA 3M1ZA 5D2WA 2AQWA 3GDTA 2Y61A 3UZJA 3L0KA 1TJRA 2ABAA 4PTNA 3NM1A 2OZ0A 2QCEA 3TSDA 1LRQA 2I9EA 4X22A 1G4EA 1H60A 3PVFA 4QM1A 1ZY9A 1KFKA 4JX6A 1W5PA 1VLWA 3S1XA 1Q6LA 1N7KA 2RDTA 4LC6A 3H53A 3BVJA 1B9BA 2B7OA 1HO4A 3PC0A 4NJHA 2QF7A 1QO2A 2LLEA 3F1QA 3C52A 3LTSA 3NR0A 5LNSA 2NX1A 4O19A 2GUUA 3R5EA 1DL3A 3W76A 2QCFA 1TQXA 2BZNA 4JY9A 5FF4A 5G4WA 3W7IA 2KZHA 3U8GA 4EWND 1G4TA 3M6YA 1HUVA 4TO8A 2RH9A 5LGZA 2A21A 1A5CA 1OYAA 2YX0A 3TCEA 5I3HA 5FEPA 4X3ZA 5DCDA 4AHOA 4AVFA 1CW2A 2Z6JA 5EA9A 4JX4A 3LCXA 3PY2A 3RMJA 4CCDA 5HWJA 1XXXA 2CLEA 1LLZA 3HB9A 4RJEA 5AHNA 2CLIA 5GVJA 4CNOA 4AF0B 3DKJA 3W73A 3KVLA 3TQ0A 1OFDA 4MLJA 3FLUA 4ZZ9A 3ELFA 2WJZA 5F2LA 4HPJA 1GVRA 1F6PA 4GE8A 3ABSA 1EX5A 5G4EA 3E12A 3DHFA 1C9DA 3R13A 3M5XA 2FB2A 3LX9A 3U6WA 1A5SA 1YLVA 3IVUA 5K3VA 3G1XA 2CU0A 3EX3A 1O5KA 4AHQA 2GVGA 2PC4A 3MHUA 3L21A 4I7WA 1UJPA 2FQIA 4MFEA 4LV4A 5H2ZA 1FY6A 1H1YA 1XI3A 3W7MA 3NQMA 1F6KA 5HUOA 3GXNA 5FI8A 4A3UA 5CPMA 3OVPA 2VFDA 4PL1A 4NNCA 1KFEA 4E2BA 1DHPA 3O05A 3TROA 1GPWA 1D3GA 4YXGA 4MZ8A 3HG5A 2C3ZA 3LRKA 2J6XA 2A85A 5K7JA 4DBDA 3I65A 3LXCA 4LW7A 3LCLA 2VFIA 1SPQA 4XUGA 1FUYA 1F5ZA 3L5LA 4UMAA 5BW6A 3VFLA 2OT0A 3WJSA 2E6FA 4HNVA 1JQVA 3LXAA 3TX9A 4JTUA 4FNTA 3BW3A 4NJGA 1NVMA 1ME7A 3ATYA 3R8RA 4O15A 4JX5A 4PA8A 1TYGA 2A7NA 2GJLA 1TTIA 4ORIA 1OF8A 1H7WA 2HSAA 3C2RA 3C2FA 1QPOA 1Z42A 4XKYB 1JULA 2IQTA 2HTMA 2P1FA 4ZQPA 3RNDA 4UCGA 1GG1A 1WV2A 5D03A 1LCOA 4JTFA 5HUPA 3F4WA 3EWWA 4UFHA 4JD4A 4TMCA 4XTDA 1I4NA 2Z0IA 4FIRA 1KFLA 2JGQA 3UPBA 3STGA 2DZXA 3S0CA 4AAJA 2B7QA 3G18A 3G8EA 3A5FA 1VYSX 2H8XA 3NPWA 4O11A 3W2NA 2C6QA 1KLYA 5D2YA 4OHQA 3UPWA 4P2VA 4JYFA 4N4PA 5EBUA 4O53A 3VCRA 2JKAA 2OMAA 3GDRA 4OWGA 4IMEA 5KZEA 1J5TA 3CWNA 3N73A 3LRMA 3LDVA 2WOQA 3PBVA 3NAVA 3OIXA 3MP3A 4OE7A 1IF2A 1X1OA 3ANYA 4YCPA 2E6AA 5CSSA 2GJNA 3TA6A 3L67A 4CQ8A 1RQEA 1HL2A 4FHAA 3CT7A 3L5MA 3IGUA 4LVBA 5KZMA 4JYDA 3W2JA 5L9FA 5K9XA 1OFEA 1W3IA 3HG4A 2A5HA 1XCFA 2BX7A 4WY0B 4UFMA 5G5IA 4GFSA 2R14A 4JTKA 3W1PA 5DY3A 4JIQA 3MUXA 3NL2A 1ME8A 3TR2A 1H7XA 1QWGA 3GNDA 3LHUA 3TNOA 3GZ3A 2ZA2A 1SZGA 1LOQA 2GVLA 1KTCA 3SSJA 3PSVA 2QUVA 3ABRA 3NG3A 5AHFA 5DN1A 4NJKA 1NSJA 2FDSA 4O0ZA 1RQHA 2OJPA 4K39A 1A5BA 2FFCA 1OFPA 2WSQA 3AJXA 3ZR4A 1R2TA 1JR1A 4O50A 3TW7A 3G0XA 1AG1O 4ALDA 1MEIA 1JCNA 1KBIA 2GQ9A 4EIVA 2OT1A 6TIMA 3TAKA 3T40A 1PCWA 5D04C 5D38A 3MP4A 3PSWA 4O12A 4UC5A 1IGSA 2VKZG 4Z1AA 1H7NA 1KM0A 1SQ7A 1A50A 3KFTA 1I2RA 4QAIA 1I2PA 1W54A 4O1CA 3LTYA 4RKAA 4EF9A 4UFLA 3G1FA 1OFQA 2GVJA 1FWSA 2WSRA 3W86A 3DFNA 2YDAA 1THFD 1FCBA 4BF9A 2Y7GA 3DHDA 2DZUA 1JVNA 3HPXA 4HSOA 3SFKA 3W7NA 2FPVA 2Y6ZA 4ORMA 1YXYA 1R2SA 4M7SA 5KZDA 3W1LA 4CQAA 1QR7A 3W83A 2DJLA 2VOMA 4LVDA 3IIVA 2C0AA 1G67A 4IQLA 1ZFJA 3LERA 5AHIA 4P61A 1W5NA 4J9JA 4I7VA 5CG7A 3TXZA 2VEKA 3P61A 3NZ1A 3C2EA 3HGRA 1ZCOA 2TPSA 1PCKA 4JXCA 3EXRA 3TFXA 1KM6A 2NX3A 1O4UA 3BG3A 3G1YA 3UXAA 2QCLA 2G96A 2P0OA 4Q33A 4E0CA 3BGJA 1N55A 1TPDA 1FDYA 1FWNA 1P0KA 3RU6A 1SSGA 3O07A 4GNJA 4GRSA 2RHGA 5AYZA 4ONVA 3LHWA 4XKYA 1OYCA 3SI9A 3TE9A 2E1DA 4HT3A 3NQCA 4DF1A 3TXVA 2ABBA 1LP6A 2WO5A 1FQ0A 4JICA 1GVOA 2TMDA 1LDCA 5KSWA 3STEA 4RR4A 2O7QA 1KV8A 1OYBA 2EKCA 3W7KA 1EWDA 4LRSA 4JS3A 1W5QA 3GK0A 4FNRA 4LT9A 1GOXA 5LNUA 2CLKA 3LI0A 3E9AA 3IRDA 3QZEA 3FYOA 3SGZA 3HOJA 4PCFA 5A8GA 2ATSA 3KAOA 2AGKA 3S5ZA 2YR1A 4LS0A 2V8ZA 1SW0A 2X30A 1A53A 4FB7A 1AW5A 4M19A 5G1TA 3HG3A 2ZRVA 5CSRA 4CNPA 3TSMA 4FIQA 2FJKA 3QSRA 3W75A 1SO4A 2FTPA 1PHWA 3BW4A 1LTDA 3QQ1A 1QMLA 1SU5A 3DU0A 1ICPA 4MIMA 4MY9A 3U2OA 1L6YA 5AHMA 4O28A 1ICSA 3LGEA 2R94A 3M43A 5BMXA 1GWJA 3B8DA 5EMUA 1TO3A 5DCBA 3PBUA 4RZ6A 5HQEA 4LTSA 3BK0A 4M6PA 3NOEA 2ZDRA 1TPWA 1HO1A 1H1ZA 4EVZA 4QNWA 4C1LA 4WY0F 2YZRA 2ZTJA 4LY8A 1OF6A 3IEBA 3WFAA 2C13A 4GJ1A 3CIWA 2EHHA 3OEXA 1OHLA 3W1AA 4DF2A 3JS3A 5AN7A 2WNZA 1V5XA 2PCQA 4FXSA 1ICQA 2C15A 4HNTA 2G5WA 3N3MA 4IPJA 5HMSA 2I1OA 2VFFA 3V75A 4M6VA 4NZJA 4C1KA 4NJJA 5G1YA 2G97A 3Q94A 4UMCA 3DAQA 3E49A 4GUIA 3BLEA 4JY8A 4JTTA 3CIXA 4N9CA 2Z2UA 1MO0A 1G7VA 4ICNA 1EB3A 3NPUA 2J9YA 2X1SA 3ZS4A 5HR6A 3SW6A 1JCYA 3AO0A 2YGYA 1WXJA 1PE1A 3HF3A 3S42A 2ZCGA 4NNBA 2TSYA 4AEOA 1LBFA 3P62A 2CZFA 1W8SA 1VZWA 1WQ5A 3M5VA 4O10A 3LTPA 1X8FA 3QH2A 1F76A 4HHPA 4JTJA 4WOZA 3GAKA 2ZRUA 2CLMA 2QJIA 4H3DA 4LU0A 4UR8A 4UTTA 2J88A 3W1UA 3MYPA 4FX6M 2NXIA 1WOAA 5AC6A 1V7YA 1H7PA 4JTIA 1QOPA 2ZRZA 5CPOA 4O13A 4YLWA 4JYEA 4IXHA 3KXQA 3GYEA 2RDWA 2DZTA 5F4XA 4GBUA 5HR7A 5D32A 3NL5A 4FF7A 4DO5A 3N2MA 1FWWA 4FXRA 1O60A 2H90A 2GQAA 1SUXA 1Z41A 4KFPA 4DQWA 1S5WA 4MKNA 3CLMA 5DXYA 4LNYA 1I45A 4A29A 1XBVA 2Y7FA 3UZ5A 2C14A 3HQ1A 3IIOA 4JDBA 1FX6A 4XZ9A 1Q45A 3QMSA 3EWUA 1VH7A 3HG2A 1GVSA 1PHQA 2ZA3A 2QAPA 4U4MA 5IBXA 3W7EA 2PRLA 2ZRXA 4RXFA 1AW2A 3G8RA 3BGGA 5LHEA 1EP2A 2V5BA 4CCCA 3SY5A 4ADTA 8TIMA 4Q4KA 3SGUA 3BG5A 3UYCA 3MI2A 4ZQNA 3I7QA 2ISWA 4R7JA 5C5YA 1Q6OA 2YSWA 1ML1A 2A6LA 3P5ZA 3R2GA 3S9YA 3ZFHA 1H61A 1EUNA 2WKJA 3LCHA 1K02A 3ABOA 4O18A 4LWWA 1SO3A 3PF3A 3NQGA 3EWXA 3TJXA 2PE4A 1ZAHA 4WUIA 3MBFA 5LHFA 3W7LA 4H6KA 2WNNA 3TAOA 2YFNA 1FCUA 1WAUA 2X1RA 4AWSA 3PG9A 2DP3A 1NEYA 2C18A 2AAMA 2CLOA 3HGSA 3G0SA 1OFOA 2DU2A 1XDLA 3M16A 3GAYA 4UTUA 1KM3A 2XN0A 3A23A 4UTWA 3NQDA 5I3KA 2ZZ5A 4L4LA 3W7GA 2J24A 4CQ9A 4K37A 4DO4A 3LOTA 3R89A 2FPTA 3FOKA 1UASA 3M5ZA 3P80A 4LVFA 4N6EA 4CCEA 3NDOA 3S5NA 4NZFA 4OV4A 1SFLA 4Y6GA 3NQ2A 1W1ZA 3W7PA 3TDFA 2C16A 3PS7A 3C2OA 4MJZA 3MI3A 2VENA 1F2JA 4JR5A 3S6DA 3CHVA 5TQLA 1O95A 1ZJIA 2VEMA 4WXYA 1YTEA 2V30A 1JUKA 3C3NA 1PIIA 1VGAA 4ZVJA 2Q3OA 3KHJA 4DXVA 5DCEA 4X2RA 3HJZA 4K8HA 5CKSA 4NX5A 3STFA 4WY0A 1H5YA 5AHEA 3Q2DA 1T0OA 3IIZA 1SZFA 1WYIA 4YMZA 3M0ZA 4KFNA 3FJ6A 4XWUA 4IOTA 3GB6A 3G0UA 3H54A 2R91A 5F2IA 3DBPA 3W23A 3GVGA 3HPSA 3W72A 1LLWA 1S5VA 2ZBTA 2JGYA 3LV6A 5D02A 1RZMA 4RLIA 1TCDA 4YCOA 1CX9A 4LC8A 1F73A 3TUUA 3OVQA 2RFGA 1DV7A 1I2OA 4OGZA 5CPNA 3TC7A 2F84A 3W1RA 4MPQA 2E68A 1L2UA 3CTLA 2E09A 1NFBA 4O4WA 1VHCA 3KRZA 2ISSA 4AWTA 5IM51 5CGQA 3EKZA 2EPHA 3W3OA 3B06A 4KFOA 4O52A 2VXNA 4HSNA 3DFQA 1TPUA 2P10A 5D09A 4M5PA 4NQ1A 4HNNA 1H7OA 2DZVA 4Z08A 5U4NA 1LM1A 4NJIA 1RPXA 3B0PA 3LHVA 3LM7A 2ZTKA 3M47A 2Y63A 3LHZA 4JTLA 1WA3A 3EWZA 1JQXA 3TH6A 3NPVA 3W7RA 3UWUA 4O57A 3NGJA 5F1UA 1QNVA 3L0GA 4ZQOA 2Y7EA 1EIXA 3HGJA 5AYXA 4D2JA 2O7SA 3TK7A 5E0KA 2JKPA 3QQ0A 1B4EA 2Y89A 1RD5A 2Y7DA 1MSSA 4G1KA 1NF0A 1KA9F 3NM3A 1FWRA 2Q8LA 2QJHA 1UUOA 1T96A 1OX5A 2RKXA 3NQFA 2G95A 1KFJA 1K03A 5C55A 4JGDA 3T78A 3BPWA 3P81A 3I7SA 4JNMA 2QDGA 3N9RA 1B57A 4UTLA 4O4VA 4NVTA 2C1HA 3W7DA 1XL9A 5HWNA 1W37A 4Z1CA 2V5LA 3L9CA 4QITA 5DELA 4PEKA 1QFEA 4R34A 1PL9A 2ZZ1A 3BG9A 4K7VA 3STCA 1D3HA 1JJKA 3TQKA 2WV8A 3O63A 4IUOA 4BWLA 4N6FA 3KVMA 1ALDA 3QW3A 2EAWA 3C8FA 4BI5A 2BSLA 1ZNNA 4X9SA 2HS6A 2ZZ7A 4IX0A 5F4WA 1L6SA 1P5BA 2ZFAA 3TV8A 3GR7A 4IX2A 3LB0A 1WBHA 1K7FA 3FS2A 3JR2A 7TIMA 1OG0A 1UB3A 3Q37A 2QCGA 3E0IA 3S8HA 1F05A 3MHGA 1K7XA 4N9DA 2FIQA 4JTSA 1JCMP 2FPYA 4POCA 4N9EA 4Z0JA 2HS8A 5FF7A 4GXMA 3GNNA 4Z1DA 5CPLA 3KVKA 1YPIA 4U28A 1NF7A 4N02A 2QCDA 1Z48A 2QUUA 4DO6A 3PG8A 3HPZA 1QPQA 3BLFA 3C6CA 1QCWA 4S2CA 4AHPA 3NNTA 5I3GA 3W1NA 2I14A 3W85A 3BV4A 4O16A 5I3FA 3F4NA 3W87A 3CQ0A 2QCNA 3W7OA 5BOOA 4K7YA 1MZHA 3LI1A 3M5YA 3OHIA 3UD6A 3CC1A 2BTMA 4H4IA 1WDWA 4HKPA 1B3OA 2WPBA 4QQ3A 3QPYA 4M6QA 4ADUA 2BWGA 2DZWA 2OCZA 2Z1BA 1K8ZA 2CW6A 5T26A 2VFEA 1G4PA 1SSDA 3M41A 1FBAA 1H51A 4OT7A 1TPH1 2CFFA 4FNSA 1MEHA 1R47A 4S1FA 2YCEA 5AFDA 4UXDA 3UWQA 2CZ5A 3FYPA 3WJYA 2DZPA 4DPQA 2E6YA 3GXTA 1X1ZA 5FF2A 3FFSA 3C0JA 5E93A 1SO6A 5D2XA 1HFBA 3FA5A 5DY2A 3FKKA 3L5AA 5SWUA 2TYSA 3EXTA 3O6DA 1X6UA 3EX1A 3LCIA 1VRDA 4M7TA 4LRTA 3TQVA 1Y0EA 5HNRA 5DBUA 4YL2A 1TPFA 3P5YA 2XFWA 3QYQA 1J4EA 3KVJA 3TMLA 4LVAA 2V81A 3UY8A 4RCXA 3UXDA 3CM4A 4BI7A 2XN1A 3PUOA 4K6AA 3LHTA 3TIMA 2GPTA 2NV2A 4RK8A 3W84A 5FEXA 5D2VA 3W1TA 3O15A 5TIMA 2NXHA 3G24A 2A6NA 2QUTA 1XUUA 1G7UA 1A5AA 3QM3A 2YW4A 1HTIA 1GTEA 1R46A 1YYAA 1H50A 1TV7A 5DBTA 3NQ6A 4GUGA 5D05A 1ZENA 1CI1A 3V1PA 2ZZ3A 3B05A 3VNDA 5H91A 1O5XA 3L0NA 2FLIA 1U83A 1U5JA 2A4AA 1LBLA 4MYAA 2JBMA 1FDZA 3EX4A 3QMTA 4IMCA 4WOQA 4NUWA 4QIUA 3C56A 1PVNA 3TC6A 1OX6A 3B4UA 1G69A 5D37A 1E51A 2FB3A 5BRBA 3SJ3A 3D0CA 4O0KA 1K8XA 4UTTC 1ZHAA 3DENA 1W56A 2B0MA 4IMGA 5U7SA 4KWVA 4FX8A 1JUEA 2V0TA 4LUIA 1EP3A 1KM1A 5EL1A 4BWLC 2QJGA 4LUJA 1HG3A 1H62A 4O17A 3L2IA 2NV1A 1TRIA 5EY5A 4JEQA 3QC3A 5AC8A 2W6RA 4DF0A 3I6RA 4BK9A 3HMJG 4ZQCA 4GUHA 5AB3A 1YDNA 2TRSA 3CEUA 3UQNA 4Y8FA 5F2GA 2QR6A 3PB0A 3THQA 3IIXA 3DFTA 3BARA 3WK0A 4ZQMA 3P84A 1QAPA 4MOZA 3W7CA 1RQBA 1LORA 2Y70A 1YADA 4FX7A 3L65A 1OFBA 1TRDA 1VR6A 4HNUA 2X16A 4PC8A 2CWNA 3LLFA 1GTHA 5BNKA 5LSMA 1IXOA 4MFDA 1JRBA 1DBTA 1XFBA 2J27A 1VHNA 2H3DA 3WK2A 4OU1A 5K4XA 4IGHA 1LRNA 5HINA 1EEPA 3GDKA 5F1VA 1VCGA 4QJ1A 3G3MA 3WK1A 4O1DA 5A5WA 1ADOA 1OK4A 5FF3A 3EWBX 3MJYA 4OQVA 4BI6A 4I9AA 1C8VA 4RZ4A 3RLVA 3T44A 3QJAA 3UWVA 4AXKA 1LBMA 1UCWA 1SZEA 4QISA 1GQNA 3DXIA 3E96A 1AL7A 3UY7A 4O1BA 1M6JA 2B4GA 1SFJA 5K2ZA 5C54A 4ZQRA 3P7YA 4MZ1A 1TV8A 3LHYA 1GT8A 4Y90A 2NUWA 3LV5A 3FEMA 2W0UA 3NYZA 2DJXA 3UWZA 5CZJA 3W70A 3N14A 3LCFA 2GQ8A 2X2GA 4OBTA 4K38A 2QCMA 4RX0A 3QPZA 1ZALA 3GR8A 4Y96A 1GVQA 1K8YA 1JUBA 3NXFA 4E2DA 1DQWA 2WSYA 4I7UA 4XTIA 3IGSA 1ZAJA 2CZDA 3L68A 5DLCA 3H55A 2EF9A 5I3JA 3W71A 4L4MA 2QCHA 3G3DA 3UWYA 1ONRA 2ZRWA 5HJLA 3GXPA 4K36A 1D9EA 3WK3A 4Z0SA 1SZNA 1ME9A 3B04A 5FESA 1Q6RA 1XBZA 3ZWSA 4YWIA 2F7FA 3IV3A 3HGOA 1LRTA 4UTKA 4HPXA 2ATMA 3TJLA 3CPRA 1LZOA 3LBMA 3TMQA 2ZRYA 4GC4A 3VE7A 3ATZA 4EF8A 2QCCA 3ZWTA 2C19A 5DXXA 4IWWA 3NVTA 2YW3A 3KRUA 4WJEA 1IXQA 1GEQA 3PR2A 2ZZ6A 2E77A 1S5TA 3W22A 4LS2A 3HO8A 4JTHA 3P67A 4FNQA 4TU1A 4EOUA 4N2YA 3W9ZA 1EPXA 3I68A 3M7WA 4MY1A 2E6DA 4UTWC 1LOLA 3F03K 1VS1A 5KTLA 2NZLA 5LNVA 1W3NA 3A22A 4RXGA 4LV9A 3DI1A 1DQXA 2Z6IA 5I3IA 1VYRA 5AOUA 3DGRA 2Q3RA 1XM3A 1KM5A 2XN2A 3A5VA 2ZYFA 4JTGA 4JTEA 3SECA 4MJMA 5KINA 3G1AA 3W88A 1L6WA 3GKFA 5CZTA 1G4SA 2ZA1A 3C61A 3PUDA 3P74A 5K9CA 3B03A 4E38A 3W07A 1W5OA 2PURA 2YXGA 5ABTA 3LCWA 1I2NA 4JIPA 1Z44A 5EPDA 1KW1A 3MI6A 3RF9A 2CLLA 1AL8A 1AMKA 4BFAA 4LS1A 1QDSA 2A0NA 3P82A 2HMCA 2Y88A 1JCJA 1RVGA 1TTJA 3GX9A 4PL2A 1IIHA 1LYXA 4PFMA 1YXDA 3QFEA 5IBXC 1KM4A 2B7PA 2J9XA 2UV8G 2A1YA 1R2RA 1MEWA 5G2IA 3TKFA 3OG3A 3TFCA 1W3TA 2X1TA 1J2WA 4HN4A 1JCXA 1EA0A 4UTIA 2QKFA 1F74A 2WQPA 1WBJA 3FJLA 2H6RA 3RK8A 1H63A 4AWUA 5BMWA 3QSTA 1DORA 2VEIA 3W2KA 4A21A 1VYPX 4NT0A 1GYLA 2B7NA 1GYNA 2CLFA 1S3HA 1KFCA 2ZZ2A 1TSIA 5FEZA 3P60A 3NO5A 3PBYA 3LLDA 1JRCA 3W7QA 3SR7A 1YTKA 3EEGA 3TU9A 1VCVA 5KMYA 1GZGA 3UWWA 2QDHA 4AH7A 4IXXA 1QOQA 4O54A 2VC6A 4Q32A 1K7EA 3INPA 5CZSA 4UIOA 3NPXA 1TTPA 1B4KA 3HBLA 3PBWA 3PM6A 5L6UA 3S1WA 4IJBA 3NQ8A 1VJIA 3G1HA 4N9BA 2V2DA 1RR2A 1OVDA 2V9DA 3BO9A 1C29A 2DZSA 5AHLA 3EX6A 3A21A 3O06A 1I2QA 4MZYA 1OX4B 3GKAA 2NXGA 3EX2A 1XUZA 3K30A 1XDMA 1LROA 3EB2A 3NQVA 4S2BA 2WNQA 2ZZ4A 4NX0A 4O14A 3A9IA 3G1DA 4UTMA 4UR7A 5G2HA 3G1VA 5D33A 5FF0A 2CZEA 1AW1A 1OK6A 1KBJA 3CWOX 4LOCA 3DZ1A 5HWMA 3UNDA 1IIGA 2V82A 1TREA 3N9SA 3W1MA 1ZAIA 2A7PA 4TR9A 4NXSA 2EGZA 3DFSA 4TIMA 1YTDA 4NNAA 2PRMA 1VLIA 3PUEA 4UTJA
chains in the Genus database with same CATH superfamily
3WG6A 1KC7A 4Y7EA 1JZ4A 1KBLA 3CUFA 1SW7A 4WHBA 1YXCA 2ZXBA 1HGWA 1YDVA 2QJNA 1QT1A 4WJXA 2XYLA 2XM1A 1HT6A 1KV5A 4GI9A 2BVTA 4HA0A 1WKFA 2BHYA 1KGWA 1QUMA 3AICA 1M9HA 4AZIA 5B7YA 3HV9A 1VF8A 5HQLA 2JK2A 3BQ6A 2EG8A 3EMZA 2A7RA 4B5XA 3UR7A 2HWGA 3DKLA 1DOSA 4ATLA 1F4HA 1V6TA 3KOFA 4D6FA 1MQQA 1HJVA 2PI6A 3L4UA 3PP7A 3CZJA 1L6FA 3CB8A 2D0GA 4ZCWA 3S1UA 3QF0A 2FZ8A 4LEQA 3N2TA 1TJPA 4CD7A 2NWSA 4ZENA 1E4LA 3MSRA 2D73A 1WOBA 4QNEA 3TW6A 3W2UA 2OTDA 4QDMA 1FCVA 1B1YA 5MHBA 5CAKA 3WNMA 2EBNA 1M5WA 4PE8A 5LZLA 3W2MA 1IHIA 1W31A 3SN4A 3DH7A 1XBXA 4IMFA 1B3WA 1V3JA 1T99A 1EWEA 1JXJA 3IVSA 3WBYA 1CENA 2XM2A 1TB3A 3D47A 3V0SA 3WJZA 1OX4A 1GJPA 3FIGA 4DI9A 3WQCA 3WLNA 2V2CA 1VQTA 2BDQA 4C5YA 1ZU8A 3AYRA 3SN0A 4X9YA 5LKYA 1TWDA 3B97A 1FWIC 3WL0A 3M7SA 4PGLA 1S1RA 3P93A 3WLPA 4K8GA 2PUZA 3CL8A 4O1AA 3MUAA 1VCFA 5LNWA 2W66A 3QEZA 2I7GA 2VEPA 2HBXA 4LBRA 3WY1A 3WH9A 1TPVA 1ONXA 4KKXA 4HIBA 2NUXA 2VR5A 1SGJA 2VFGA 5J04A 2BXYA 1Q5MA 1YPXA 4WXZA 3LNMA 3QMRA 4L6HA 4KMQA 1TPEA 3GIYA 2DVUA 2E8ZA 3RX3A 5LGXA 4IIBA 1R3WA 2ZQ0A 1O1ZA 4CN1A 1E4NA 3MV01 4EKJA 3UBPC 3GTNA 1PTDA 3W2LA 1XD1A 3ZR5A 2WM0A 1REQA 3VIGA 2OU4A 1Q3NA 1P1XA 4NZ4A 3MO7A 3MHFA 2FZDA 2VD8A 1XH2A 2E7FA 4IIEA 1XC4A 2E9LA 3AXIA 1EUAA 3C4UA 4UQEA 2DW7A 1XWYA 5FA5A 1Q4NX 4CEUC 4UTHA 1TFVA 4RW5A 3BLDA 2W4XA 1D7FA 3BAJA 2CLHA 1UH2A 3HA1A 2CPUA 4XIMA 5TBOA 1Z3NA 3MMWA 1BEUA 2RAGA 3SURA 2YYUA 3C2VA 1I8JA 4V2XA 6ALDA 1FCQA 3IGXA 2EPMX 4MLRA 4QE1A 2PC8A 5IOBA 4LANA 2P8BA 1FP8A 3M1ZA 3QV6A 1FWCC 2Y61A 1XP3A 1QNOA 3VKBA 3DG3A 3NM1A 5T91A 3AAMA 2I9EA 1XH0A 5MF5A 5BROA 1KFKA 3HPAA 1N7KA 2RDTA 3R79A 3PC0A 1HO4A 5FL0A 4J4KA 2VC9A 3KL0A 4O19A 3SBFA 2ZC1A 5A6AA 3WQ8A 2KZHA 4J3SA 4IP5A 3ZOAA 4EWND 1G4TA 2WM1A 1HUVA 5IFTA 3UPMA 2A21A 3VOFA 3H12A 3ENLA 2J7GA 2Z6JA 5HOSA 4QRNA 3B0XA 1YDYA 1PBGA 2CLEA 1LLZA 5I02A 4RJEA 4AU0A 3NVDA 2AL1A 2CLIA 5GVJA 4CNOA 1MFVA 3DGBA 4A8RA 1TCMA 3WLLA 1UKQA 3W73A 2OQLA 2VNCA 4CN6A 3S2LA 2QF8A 4HPJA 4M8UA 4J2MA 3CASA 3EDKA 4GE8A 1XGDA 3V16A 4CD6A 1K9EA 1PEZA 2GLKA 3AZRA 3VK5A 3VIOA 1V3IA 1E6NA 3G1XA 3OLIA 3AIVA 3EX3A 4AD2A 1O5KA 2GVGA 3LMZA 1K6WA 3L21A 4P8UA 1UJPA 4MFEA 3UERA 1WKDA 1R5YA 4CUCA 4M80A 3NQMA 1DPMA 3GXNA 1DIDA 1B54A 3N9KA 3EDFA 3OVPA 1S2AA 3R94A 4CCZA 4AZBA 4PL1A 4NNCA 4Q22A 4HA4A 1UD2A 3O05A 3TROA 4A3YA 1D3GA 4MZ8A 5A8NA 4DBDA 1EYEA 3LCLA 2PGRA 1V6VA 3K1DA 3VFLA 3N4AA 3ZMRA 3LXAA 2J75A 1RAKA 3BW3A 1NVMA 1PKNA 4JX5A 5CGMA 1TYGA 3D5HA 2GJLA 3V5CA 2H9AA 3SCTA 4B90A 2IQTA 4ZQPA 3VIPA 1GG1A 1WV2A 7CGTA 4PRRA 5HUPA 2WZTA 5BXSA 3SJNA 3VDBA 4TMCA 3E5BA 1I4NA 3B0YA 3JU2A 4FIRA 3KL3A 4FI4A 1QW7A 3SDOA 2YZ5A 3STGA 1Z6KA 2B7QA 3G18A 2WB5A 1RXOB 1VYSX 3FVDA 4Q8VA 1KLYA 3NURA 3EB3A 5EB8A 3UPWA 3LS9A 1OT1A 4P2VA 3VCRA 3ZSSA 1ECEA 4OWGA 4IMEA 3STPA 3QTGA 3CQJA 5C7VA 3ANUA 3CWNA 3N73A 3N2CA 3AIWA 1UKOA 3WQOA 4Q8QA 2INZA 4GX9A 2ZUNA 3PBVA 3OIXA 1RBAA 4OE7A 1MDLA 1GORA 5CSSA 5C71A 4E2OA 4CQ8A 3NOYA 4A6GA 3L5MA 5KZMA 4JYDA 1WB0A 4EPKA 1OFEA 2FZBA 4IF2A 5EU9A 1DEDA 3ORWA 3IUDA 3AROA 4WY0B 4IHCA 4GFSA 4JTKA 4JIEA 3W1PA 5DY3A 2RJHA 3SAZA 1H7XA 4B3KA 3GNDA 2ZA2A 1SZGA 2VRKA 4KWOA 3W29A 4RNFA 5CLTA 3NG3A 5AHFA 4FK9A 4JL2A 2VX7A 4JHOA 3CAVA 1NSJA 2GGJA 2OJPA 1M7XA 4R88A 4PUUA 3IRSA 2AQVA 1KRMA 3TW7A 1XLGA 2PAJA 1AG1O 4GA8A 2Z24A 1JCNA 4U2ZA 1KO0A 3TAKA 3N17A 1UR9A 2R1KA 3HMCA 1IGSA 3UP8A 4Z1AA 3EOLA 4J27A 1KM0A 1A50A 4QAIA 3ITGA 2ODOA 3BANA 1OFQA 2GVJA 4HYRA 3QY8A 2WSRA 4A05A 1AUSL 3GBEA 1MUMA 2VOTA 4OVXA 3DHDA 2Q71A 1R9ZA 3SFKA 1ZBWA 3WMSA 3NDZA 2FGBA 3P2VA 3W7NA 2FPVA 3VD4A 1QR7A 2DJLA 2VOMA 4H2HA 1MW3A 3POHA 1UD8A 5LIWX 5AHIA 3CNYA 3HPFA 2BMBA 4I7VA 3WUEA 3BL3A 3QN3A 3O9NA 3BLKA 4XO7A 3OGSA 4GYPC 5LIUX 2NX3A 4LUSA 1PAMA 1EH9A 1O4UA 3BG3A 3UXAA 5XIAA 2QCLA 3SCUA 3O0FA 2G96A 2HXTA 3AXXA 3CXOA 4HMNA 2WJDA 5AYZA 4XKYA 3LHWA 3SI9A 4W86A 1VBRA 1FQ0A 4L4PA 4L4OA 2ZICA 3UYIA 1Y5WA 3FSUA 3OQEA 3STEA 5HNTA 2O7QA 1GVYA 1KV8A 1OYBA 4DHGA 2PDQA 3MKKA 2VGFA 4F2BA 2PDGA 1R3RA 3W24A 2J79A 4F0LA 2YXXA 4HPNA 1J96A 2AGKA 1RY0A 3AFBA 3EA3A 3NDYA 4JFTA 3W02A 3TYUA 4D1IA 2V8ZA 4GQBA 2X30A 1GQIA 1GOKA 5CSRA 2IPFA 4JQ3A 4L9XA 4HCDA 3QSRA 2NW0A 1PHWA 3TLQA 1QMLA 2PDBA 4MIMA 5LXXA 2DQWA 1A0CA 3NZQA 3ZVHB 2WVUA 2ANUA 1QI0A 3B8DA 1CCWB 1KBBA 4RZ6A 2WSPA 3WD2A 3LQGA 3GW0A 3WH8A 3RHGA 4C1LA 2VVNA 4LY8A 2QMJA 4PMNA 2EHHA 3OEXA 4H41A 4YYFA 5E0CA 3WQGA 4H01A 4S23A 3OZPA 1BQCA 1SJAA 2Z1XA 2C15A 2PZ0A 1AH3A 3N3MA 3UXKA 3V75A 4M6VA 1IE7C 1Q6GA 5I77A 1VBHA 4NZJA 2Q6ZA 1ZQ5A 3Q94A 3MDWA 3WUGA 3BLEA 4JY8A 4JTTA 3CIXA 3VGBA 3BXWA 5CJNA 1HJWA 5CBBA 2J9YA 2X1SA 4N7QA 1DQUA 3M0YA 1S5NA 2CESA 4PSPA 2OLHA 2YGYA 3O0KA 1JPIA 7XIMA 3RJXA 1XYFA 3HF3A 5REQA 3S42A 5C9RA 3WIJA 3E38A 5C2GA 5CPQA 2XSAA 4ICCX 2RUSA 3M5VA 1X8FA 3L7RA 4CD5A 3GAKA 1M3UA 5E5CA 4UR8A 4AD0A 2OZ3A 3M64A 2E40A 2YA1A 5AC6A 1V08A 3RDKA 1LWHA 3MWCA 1TG7A 1PKLA 3KS5A 2ZRZA 4L9YA 3WQFA 4YLWA 3W81A 9XIMA 3SADA 4J28A 3GYEA 3R8GA 1Q8JA 2JQXA 1UR3M 4GBUA 3WO8A 3BGAA 1W9PA 3WCZA 3OJGA 3BSGA 3MA8A 1O60A 1FKXA 4YTRA 4GZEA 1XLMA 4JFVA 1ZP3A 3WLOA 1I45A 3U4AA 1XBVA 2Y7FA 3VKCA 1GOMA 1FX6A 3GH4A 4HJFA 3BCDA 3ONCA 3EWUA 3DECA 3HG2A 1GVSA 3UG5A 3OHMB 2QAPA 4U4MA 5MKGA 1X39A 4FF5A 3BGGA 5LHEA 3NO1A 2Y8UA 2XSBA 8TIMA 3SY5A 4ADTA 4RPPA 4XO6A 3GR4A 2OODA 3WNLA 3P0XA 4R7JA 2ZX6A 5C5YA 3KWXA 1ML1A 2A6LA 3ZFHA 1H61A 2PDJA 3AMCA 4A8IA 2X0SA 2D0HA 2WKJA 3LCHA 3OB8A 3ABOA 4DLFA 3PF3A 4UZSA 4IIHA 1K70A 3AWNA 1VPYA 4WVXA 3W7LA 4H6KA 5M3WA 9XIAA 1HZYA 1B0IA 1TMQA 1I75A 1R3SA 1NP2A 1WAUA 4S3KA 4LALA 3LUTA 2C18A 1YKWA 4GLEA 3G0SA 2DU2A 3K4WA 1O1HA 4FALA 2V5DA 5DEZA 5CXPA 1O5QA 2XN0A 3CAQA 4G2DA 5I3KA 4L4LA 4CQ9A 1E73M 1XIMA 2VC5A 3WDJA 4KWUA 4KWSA 2FPTA 3H2NA 2ZUUA 1UASA 4ZSTA 3T07A 1LQ0A 4N6EA 3CUJA 1R9XA 3N18A 3NTYA 4GNKB 4DXKA 4Y6GA 2C16A 2CERA 2GFTA 3NCOA 3T09A 3MI3A 2R82A 4JR5A 3VNYA 5TQLA 4PMQA 1EPVA 4HP5A 1YTEA 1JUKA 1VGAA 4ZVJA 3VUPA 2Q3OA 4JIIX 4DXVA 3LPPA 3VDAA 2BVYA 4C60A 4NX5A 4ZSUA 3PJTA 2I16A 2ZXQA 4JPGA 3MY9A 4KFNA 2BBFA 3FJ6A 3KRBA 4PUDA 3HJEA 4G7EA 4RNIA 3H54A 3W23A 1HF6A 3HPSA 3MSGA 1CPUA 3GVRA 2ZBTA 4TV5A 5D02A 1RZMA 2YL6A 3ZT5A 1BYBA 1F73A 3WDPP 4PCTA 2PDHA 4C6CA 3TC7A 4EPEC 2NVDA 1DJWA 4AYSA 3ANVA 4PUKA 3KRZA 4AWTA 1EQPA 1GNXA 2YLLA 5CGQA 3W3OA 3SCNA 4GI4A 2VXNA 3QGKC 1Q2SA 4DLMA 3AHXA 1HQTA 1TPUA 4S39A 5D09A 4E8DA 1OG6A 4NQ1A 5C2CA 4HNNA 2DZVA 4RZBA 4GMEA 1B90A 5RUBA 4MG4A 4AEEA 3MUZ1 1H3GA 3LM7A 2V67A 5JBFA 1S46A 1TV4A 4MF4A 1KB3A 3WLKX 3AHTA 3W7RA 3EPOA 3NZGA 3NGJA 4W5ZA 3VCCA 5F1UA 4ZQOA 4TVUA 5H1WA 3DFHA 3RX4A 2WWCA 3QLDA 1FH7A 1OC5A 1RD5A 2VZSA 1UWRA 4G1KA 4HNOA 2YXOA 4ZO6A 4UCFA 8XIAA 5I5RA 2DVXA 3BC9A 4TXEA 3S1GA 2H9AB 4IH3A 5I06A 1J0JA 4O4VA 3KLLA 2WANA 4NVTA 3B9DA 4FR1A 1W37A 4Z1CA 1DTNA 4GYJA 3EPMA 3ERPA 4IIFA 4N6FA 1ALDA 4E8GA 1ZNNA 4IX0A 3WF1A 4IGMA 2ZOXA 1P5BA 2ZFAA 3TV8A 3GR7A 1K7FA 1H41A 4C91A 2QPXA 1HIZA 3QGVA 1DWAM 1UKPA 3VX0A 3CV7A 1JCMP 4BJHA 1OIFA 2HS8A 1KCXA 1XISA 1IWBA 1ISWA 3KVKA 1YPIA 4U28A 1KR0A 2Z1KA 2RGMA 2BP1A 2O55A 5MKGB 3HPZA 3LGGA 4I5UA 2ZUWA 4ATDA 4AHPA 5CH9A 2PWEA 4EE9A 3BV4A 4M0XA 1XGEA 3CQ0A 3W87A 3BJFA 1XR2A 2OEJA 3W7OA 4H6RA 2O9TA 2NVAA 1MZHA 3M5YA 5A2CA 3TVAA 2PDUA 5BYWA 1WDWA 1P6WA 4DJED 4QQ3A 3W25A 3CYVA 5FJTA 2CW6A 2VFEA 1G4PA 3S4TA 3SCVA 2BG5A 2RJGA 1WDPA 1H51A 3L4XA 3RPTA 5DMYA 1R47A 4Q6XA 4AX6A 4X63A 4HJWA 1SJCA 2YIHA 2QHAA 3R4IA 1Y5XA 2DZPA 2O4MA 3E74A 2VCBA 1CBGA 3GXTA 1X1ZA 2X8RA 3GD6A 3SQMA 1YNPA 1HFBA 4M24A 2TYSA 3EXTA 1BSLA 4AZ7A 4AD3A 4RE0A 3TA9A 4JN8A 3A47A 1SJBA 1DJXA 5HNRA 1V0LA 4YL2A 1UJQA 3PWGA 3UEQA 1J4EA 2X40A 3KVJA 2JF7A 4ZFCA 4QG8A 4LVAA 5JH2A 3UY8A 1CWYA 3PNUA 3VGFA 5DX7A 4K6AA 1UD3A 3TIMA 2J77A 5D2VA 1XUUA 4OZOA 3AU2A 4BQ5A 2R1LA 2YW4A 4QSFA 1GTEA 2ZXAA 1OB0A 4DUVA 1J18A 2JIWA 4UQAA 1CI1A 3WUBA 3DN5A 3VNDA 4D6CA 3MU7A 2FLIA 1U83A 4TVCA 4Y8EA 2YL5A 2JBMA 3EX4A 3QMTA 3GHTA 3C56A 1PVNA 4J5NA 3B4UA 1G69A 1E51A 3VIKA 5BRBA 5IHRA 3QQWA 4O0KA 4PB3A 4ZB2A 4UOQA 1YX1A 3L4VA 3BWWA 4NSBA 1ZHAA 1W56A 1V3MA 1L6GA 1W17A 5U7SA 4AC7C 1N2VA 3HN3A 4KCTA 4LUIA 3L12A 3IJ8A 7REQB 1SMAA 1CXFA 1C92A 2DSKA 2FH8A 2Z1VA 3VD7A 1XFCA 4BF5A 5I24A 4GABA 5AYIA 3QC3A 1JL8A 1XLHA 1M41A 4DF0A 2CEQA 3WD0A 3I6RA 1T5AA 4NZ5A 1T41A 3AQUA 4GUHA 5AB3A 2V69A 1RSCA 5F2GA 3PB0A 3BARA 3WK0A 2PLMA 1E71M 1JZ6A 2GL5A 3N3TA 5KEZA 3WBAA 1YMYA 4JIRA 3IK4A 3TYAA 3WMBA 4MOZA 3W7CA 2ZVIA 4HD5A 3LZ5A 3A4AA 3IPWA 4PN2A 2Y70A 5FKYA 1YADA 2FYMA 4PB5A 4WSJA 3II1A 3L65A 3OIHA 5LSMA 1W2VA 2BY2A 3LA4A 3QXBA 4PSRA 1EL3A 4TVDA 2EPNA 4IGHA 1LRNA 5HINA 1XLBA 4M3PA 4LUTB 1OSEA 1J6OA 3GSMA 2J13A 5FF3A 1OK4A 1Q7MA 2WYSA 4I9AA 4ROPA 1Q85A 3W82A 1UCWA 5G4HC 1M6JA 2B4GA 4DWSD 5K2ZA 2VT0A 4ERGA 2OX4A 5C54A 4ZQRA 3AUJA 1YNYA 1TV8A 4I9JA 4QAWA 2OEKA 4Y90A 2NUWA 3LV5A 1DWJM 2Z26A 3PTQA 3W70A 3TC3A 1DHKA 4DAIA 3QPZA 2PDLA 4GKTA 3L4WA 3PPGA 4LF2A 1GKQA 4E2DA 1JUBA 2WSYA 2E28A 1ZAJA 2CZDA 4Q6JA 1G0CA 2HISA 3GU2A 3G3DA 4BEQA 1ONEA 3ITVA 2YCLB 4JKLA 1HL8A 2WHMA 1W1TA 2XVNA 3B04A 3SRKA 4PEEA 3ZWSA 4FLSA 1PZ0A 5BOEA 1Q2RA 4JQ4A 4D8ZA 3HGOA 4G6CA 2PGWA 3BOLA 3I3EA 3TJLA 3SFWA 1W2PA 1J79A 4EF8A 3PBMA 1CYGA 2CHNA 3U4FA 3V0UA 4WJEA 3SSZA 1IXQA 3B9OA 3CZ8A 4M51A 1GW1A 2IKGA 4JTHA 3P67A 4FNQA 4HK5A 4MB5A 3W9ZA 1S2UA 2WCGA 3W53A 1LG2A 4JQAA 1XQLA 3CHDA 3WDHA 5LNVA 1W3NA 4GJIA 3A22A 3W6LA 2XVPA 5I3IA 1VYRA 1A5MC 1WPCA 1XM3A 2XN2A 2ZYFA 1F61A 1X96A 4GKLA 1QJWA 4KGLA 4BHYA 3W88A 1ESWA 5CZTA 2ZA1A 1EOMA 1DJGA 1EO5A 3W07A 4DJEA 3UW6A 1I2NA 3VC5A 1S2VA 1RA5A 4JIPA 6XIAA 1Z44A 4LUTA 1VFSA 4I5RA 4IPLA 2CLLA 1AL8A 3LK6A 3MSDA 4Q4PA 2VEGA 3E0LA 2Y88A 1RVGA 1J10A 1JZ2A 1IIHA 4PFMA 1CGWA 1KM4A 1I60A 1O5RA 4HN8A 1QHZA 4IM4A 4S38A 2NQHA 4W88A 4G1NA 1X97A 4NILA 1ZTVA 4XZMX 4QROA 1TZ9A 4UTIA 1F74A 2H6RA 3VNJA 3WQDA 3RK8A 5EBAA 3GHUA 3EDEA 5BMWA 4EANA 3W2KA 4A21A 2BY3A 3CWHA 2P5NA 1S3HA 3P60A 3QBUA 3VNKA 3EEGA 3TU9A 1QI5A 1VCVA 1QOQA 1R87A 2E9MA 1RY8A 4Q32A 4US6A 4R85A 4HQVA 1K7EA 1UZ4A 2VJXA 4G56A 1JEZA 1TTPA 3PBWA 3PM6A 3PFRA 4IJBA 3LSCA 3RR4A 1RR2A 3BO9A 3MKVA 3SY8A 5AHLA 4U5KA 2I5GA 4C6EA 1I2QA 2CBIA 3EAUA 3UF9A 2NXGA 3EX2A 1XUZA 3NQVA 4PMYA 1CDGA 4S2BA 5BXPA 3G1DA 2PODA 5A6BA 4CD4A 4PBGA 5D33A 5FF0A 3RMEA 4U3CA 1AW1A 5FCZA 3PFMA 4JTQA 3CWOX 3DZ1A 4UWMA 3DYMA 1XYCA 2BVDA 1TREA 3ZO9A 2XIJA 3G77A 1ZAIA 4NXSA 1PTGA 4R7WA 4DYKA 1YTDA 2PRMA 3DFOA 2ACUA 3VCNA 4CU8A 3VIHA 5HDRA 3CL7A 4D6GA 3BSHA 4UNLA 1VEOA 2NQLA 1GOQA 3NQEA 4MGGA 2UY5A 4IIDA 3VKJA 1KLZA 2X42A 3GYCA 3ITTA 2BASA 4MWAD 4UQBA 5ABHA 6REQA 5KITA 4GYFA 2Y5EA 4MVAA 3WDIA 1BWLA 4OBSA 1HNYA 1RV8A 3PB2A 3VC6A 1VENA 4J3UA 3NA8A 4KIEA 5CC3A 4XVEA 1CLVA 3B0VC 4GO8A 3VTRA 5HMDA 5CZ0A 1DIEA 3M9YA 1WDDA 2Z1SA 1EBHA 1NP0A 3QR1A 4ML9A 4ZBCA 1BF6A 1W3JA 2GUYA 2WKLA 4KWWA 1TTQA 3Q45A 1RK5A 1TV5A 4GXWA 3O6CA 3QKEA 4E5TA 4P7RA 3BLIA 5D9NA 1TVPA 3DI0A 1TQJA 3NZPA 2XH0A 3NQ7A 3E02A 4UUIA 4GQGA 1EGMA 3ZM8A 3S2JA 2YYTA 2E5BA 1H0GA 3ZT7A 1GW9A 4WX2A 2MNRA 1QPNA 1X7FA 3WJWA 3QW4B 5T9CE 2PPGA 1WX0A 3WFLA 3CO4A 3GNOA 3LRLA 1EKOA 1VEMA 1K9DA 3W6YA 4BF7A 2CBJA 3U9IA 1U1JA 1ZJAA 3GXDA 1R85A 2PRHA 3QZAA 4AF0A 2YKKA 4EAYA 3V35A 5DO8A 1G6CA 4MAVA 3CU2A 1XIFA 2EQDA 3S2NA 4R9XA 4BQ3A 4EWJA 4CNNA 3AIRA 3KCJA 2HRWA 2C0HA 1NM9A 1E3XA 1GG0A 2J4GA 3PZOA 2YCLA 4MWAE 2XVKA 4Q4SA 3PULA 1FDJA 3CUHA 2JF6A 1Q7ZA 3ZJKA 9RUBA 1M65A 4I6VA 4GUFA 4PUNA 3GC5A 3N19B 3UG3A 1T40A 3QFWA 1F07A 4LCRA 2FFIA 5FD0A 2OKTA 2CETA 3VE9A 3HURA 3ZQ9A 4QTGA 1XLEA 1UP2A 4IMDA 4K8EA 5G2WA 1G1YA 2OO6A 2BGQA 1HX0A 3R12A 4Y9AA 4TQTA 4Q7BA 1AQ0A 4RV8A 3OBAA 3W7HA 5GJMA 2NX9A 1D3CA 1QPRA 5K4ZA 4WD0A 1DWFM 2BOEX 5C2XA 3OLDA 3KX6A 4QJ5B 1KFBA 4DYJA 1OFAA 1TJ2A 3BLLA 3OGRA 3C0QA 4PODA 5DMMA 5D4YA 3LY0A 3N34A 4M29A 1HL9A 4XZIA 1M1BA 4MMWA 2PSNA 3UU0A 4Q8OA 3ARYA 1B5TA 2PDPA 4AEFA 4TX9A 3BZJA 1GVFA 3TZNA 3FKRA 3DCPA 3VVGA 3WQVA 2CKRA 3TYZA 1UMYA 3VIFA 3H6OA 5K9DA 1JYNA 4X2PA 3USBA 4KGJA 2BGNE 5I7GA 1DJQA 3WF3A 1ISZA 3MWAA 2OX1A 1ZS2A 4QSHA 3HIJA 3OVRA 2JKEA 2WAGA 4HZ8A 2YCKX 5HXMA 2VFHA 1FP9A 4UFJA 3WEOA 2IUZA 2RDUA 4Q4MA 2X1IA 5I79A 3SUVA 3ZXWA 3KCOA 4J3WA 2X1UA 8XIMA 2ALDA 1BYDA 3IARA 4PFHA 5HNUA 1V03A 2CLPA 3VIIA 4GCXA 1EP1A 2VGGA 5EFDA 5C6MA 1JFXA 1L9WA 1PYMA 2GOUA 5D2WA 2AQWA 3OLEA 1TJRA 3QYSA 2PMQA 4O8AA 1UR2A 4RW3A 2OZ0A 3CMJA 5DMLA 1LRQA 1AH4A 1IZCA 4X22A 4AWEA 3M07A 4QM1A 4ML4A 1ZY9A 3CHCA 1VLWA 3LM3A 3KBNA 3S1XA 3R0KA 4LC6A 1DXFA 3FCPA 4QLKA 3WYZA 2W61A 3BVJA 2B7OA 2LLEA 3C52A 1OD0A 1E6RA 4WLCA 3T05A 2ZUSA 2GUUA 3DEQA 3R5EA 3RRAA 1BG9A 3W7IA 5G4WA 2ACRA 5FF4A 4H9UA 1TWWA 2CYGA 4ZO8A 2D22A 2RH9A 3VM7A 1OYAA 3TCEA 5FEPA 5DCDA 5AZ0A 4AHOA 3R43A 1FHDA 2NT1A 4B2DA 4W93A 4NAEB 3MZ2A 1VFOA 3PY2A 3HB9A 5AZ1A 1E9ZB 5AHNA 3CYJA 3E2QA 3ZSTA 4OJYA 3B8SA 4Y9MA 2Z25A 3SM0A 2W27A 3ELFA 1GGOA 1V0MA 2CHOA 3GY1A 3ABSA 5G4EA 1UP0A 2D2HA 3DHFA 4Z2LA 2QIWA 1YLVA 3MC5A 1BKHA 1EC8A 4QHRA 1WDQA 2FZNA 1US3A 5LIKX 2FQIA 3PZTA 3V7PA 3WNNA 1F6KA 3GG7A 5HUOA 3BAWA 3FXYA 4MDOA 4C1NA 4JCLA 3VGDA 2ADAA 4Y9NA 1OGGA 2NQ9A 3WDQA 2ASHA 2PLCA 4YXGA 1R8LA 3BURA 2C3ZA 1ENUA 3L4YA 3LRKA 2J6XA 3GC4A 3NSMA 3B8TA 3I65A 1N8IA 2WBKA 3SUWA 2VFIA 1SPQA 1FUYA 3L5LA 1GZ1A 2AGTA 2E6FA 3R0UA 1FVPA 3TX9A 4JTUA 1WZAA 4NJGA 2EPKX 1ME7A 3ATYA 4HVXA 4O15A 4JTRA 4PA8A 2A7NA 7REQA 1WAWA 1TTIA 1K4HA 3Q67A 3WMCA 2DVTA 1QNPA 1FTXA 2YDSA 4NL1A 5D03A 2XIBA 3ZIZA 1KQZA 1H1NA 4F48A 4EAMA 4JD4A 1P43A 1ZP4A 2Z0IA 1B3ZA 3EOOA 3EZ4A 4LB3A 2DZXA 5D9PA 3EBVA 1WZMA 4AAJA 3S0CA 3KZSA 3AHVA 2POZA 3G8EA 3VD3A 1KD0A 3AOFA 4XAZA 2EG6A 1AZ1A 2H8XA 5D2YA 1DJIA 2PDIA 4N4PA 4O53A 3OZOA 2JKAA 2OMAA 4M6UA 5KZEA 1J5TA 3VDHA 3LRMA 3QHOA 3TN4A 3POCA 3NAVA 5HMFA 3WX7A 5D8WA 4BKNA 3UG8A 4HU4A 1U33A 3ANYA 4HGXA 4L80A 4YCPA 5TD4A 1BVNP 4HK6A 5HA7A 1UIPA 1RQEA 4E8CA 4FHAA 4Z2GA 3W2JA 3FHQA 1F3WA 2A5HA 3WF4A 4L1GA 4YTTA 2BX7A 4CU6A 1HP4A 4I8YA 2G3JA 2RDXA 5G5IA 3URBA 3GRIA 2R14A 1EDQA 1ME8A 3TNOA 3GZ3A 4AUBA 4FZIA 3VZXA 1KTCA 2ZADA 4REQB 3URAA 2O9OA 4ASTA 4WDTA 1TV3A 5DN1A 4NJKA 3QZ6A 2FDSA 4K39A 4WKHA 1A5BA 3VMPA 1CZ1A 4QS6A 1QPKA 1E72M 2CXGA 4CGTA 3ZR4A 4HTYA 1R2TA 4IZGA 4DZAA 4PULA 3R8HA 3G0XA 4ALDA 2XGIA 4RDVA 1MEIA 4RUBA 4E4FA 2GQ9A 4EIVA 2OT1A 1OCNA 3S2MA 3T40A 4C7FA 4F0KA 4MJ4A 3MSYA 3RILA 1LWIA 3SGGA 4F2UA 2AQOA 4DJEC 3KW3A 3F5KA 1SQ7A 1TJ0A 1I2RA 1O12A 2WVVA 1W54A 1EJSC 3WBWA 4O1CA 3PWIA 4UFLA 1JZ3A 1U5VA 1VRXA 1UMLA 1TX0A 1A47A 3KCLA 3BMWA 3XIMA 2NVCA 2GDUA 2WMIB 2DZUA 1JVNA 4HSOA 1R3VA 3TOPA 3GG0A 4AYGA 2QPUA 2Y6ZA 2YBUA 4ORMA 1F3EA 5A6TC 1A80A 3DOPA 1BD0A 1ITCA 2MUCA 3VMNA 3BE7A 3W83A 4D6DA 3IIVA 4V27A 4IQLA 1NH6A 2ON3A 3TTYA 1RJRA 2WJEA 4Q3MA 4NI8A 4Z2IA 1RD6A 1ZCOA 1QW9A 3F5LA 4WIWA 3DFYA 1PCKA 3KBWA 3TONA 5A8MA 3IWPA 2D3LA 3WH6A 4RPQA 2OG9A 1VBUA 4Q33A 1N55A 1P0KA 3FYYA 2QJMA 1JZ7A 3PZQA 4TOQA 1BQGA 3CZLA 1RK6A 2E1DA 3S6OA 1LP6A 2PBGA 4HU3A 1IEIA 2TMDA 3OYZA 2CCRA 1JYWA 4JTDA 4RR4A 5E6ZA 4BEUA 2EKCA 2YA0A 2J62A 1EWDA 4R5EA 4V1YA 2ZKMX 1W5QA 4FNRA 2V38A 2CLKA 1MYRA 3QZEA 3FYOA 2VDIA 4QGCA 3HOJA 5CC5A 5FL1A 1M01A 4H00A 2XWDA 3KAOA 1UQZA 1FWFC 3ZJ8A 4UTFA 2WVSA 3I4EA 2VO5A 3H4XA 1H0IA 4AW7A 2OEMA 4M19A 4CNPA 4FIQA 2GVEA 4KRZA 2FJKA 2XFFA 2OWCA 3C0LA 3SCOA 3PBGA 3HM7A 1QBAA 2NQ5A 1A49A 2DFAA 1AJ0A 2OQHA 3ICJA 3U2OA 2ZIDA 4O28A 3A3XA 1ICSA 1GWJA 4IP4A 4BA0A 3PBUA 3DC0A 4LTSA 4PUJA 4M6PA 1E6QM 1TPWA 2VX5A 1A4LA 3APTA 3GM8A 4QNWA 4YIWA 4WY0F 2ZTJA 2C13A 4JQ1A 2JIEA 4E2VA 3GFYA 2C71A 3CJPA 5AN7A 1V5XA 3PN8A 3CIVA 1GEHA 1FH9A 2I1OA 2YDQA 2VFFA 1HP5A 3R0DA 4OTKA 2YBTA 4N9CA 4ICNA 2ZXDA 3GXMA 8CGTA 2J8GA 5HR6A 3FXGA 1JCYA 1AMYA 3AO0A 3WLQA 3EGJA 3O3RA 3L2MA 1PE1A 2ZCGA 4NNBA 4AEOA 3K5XA 1LBFA 3UZWA 2CZFA 4LNCA 3GU9A 5BOFA 2DH2A 4JTJA 4WOZA 4YJ5A 3CV6A 2GSEA 2ZRUA 1NU5A 2CLMA 4H3DA 4FX6M 5D9OA 3W4RA 1MW0A 3THDA 3VILA 1V7YA 1H7PA 1HJUA 4JTIA 2R1NA 1UWSA 4JEJA 3RO8A 5M5DA 4ZTYA 2NT0A 4JYEA 4IXHA 4PMZA 1S2CA 1POJA 2RDWA 2DZTA 4FR6A 5F4XA 5HR7A 1FWWA 4FXRA 3TYDA 1DTUA 3CQIA 2GQAA 1ISYA 1Z41A 1XS2A 1PWLA 1S1PA 2OWXA 4KFPA 4NRSA 1HW6A 4MKNA 4S3JA 3RIKA 4J7RA 4A29A 5C0QA 2G4FA 3UZ5A 2C14A 3FAXA 4JDBA 1Q45A 3QMSA 4KEUA 1BF2A 3BCFA 3KOXA 3VKAA 5A6SA 1VH7A 1PHQA 3GTHA 3ARTA 1A3HA 2PZNA 5IBXA 3W7EA 3ZLHA 4Y9PA 2PRLA 4U33A 4NYUA 1QBBA 2PWGA 4Z2JA 5JXQA 4MWAC 3BLPX 2ZX9A 5C7HA 3UYCA 3NWRA 4OBRA 4C6NA 1S2TA 2ISWA 1CXHA 2FHCA 4PBFA 2BNJA 1UR1A 4D8AA 2ZWYA 2CXEA 4UOJA 3RCNA 1XGZA 3S9YA 1EUNA 4LY4A 4ATWA 3DYPA 4LWWA 3NQGA 3EWXA 3PZIA 3PJXA 1ZAHA 5LHFA 5CGTA 2QDEA 1TR1A 4F66A 1YHTA 1V02E 5EGRA 1BVWA 1F3TA 1GHRA 2CLOA 5AC5A 2J7FA 5JUVA 2FVKA 2AL2A 3GVVA 5I6SA 1BGAA 2FTYA 3GAYA 4UTUA 1KM3A 3U2ZA 1MRAA 3CLWA 4AZCA 3A23A 2BHZA 2G50A 4UTWA 3NQDA 3AYVA 1IZJA 4BQ2A 1TIWA 1OIMA 1CECA 5FIPA 3FOKA 4LVFA 4CCEA 3NDOA 2VQTA 1WXZA 1W1ZA 1RLCL 4LAZA 3TDFA 1XC6A 3PS7A 3G2GA 3S6DA 2FGLA 1O95A 4V15A 1OM0A 1V6UA 3C3NA 2ONEA 3KHJA 3RLGA 4FSAA 4X2RA 4ZA0A 4O0QA 4K8HA 5CKSA 1E43A 5AHEA 3Q2DA 3WLJA 1K8CA 1WYIA 2F6UA 4YMZA 3H22A 4X0VA 4GQ0A 1MXDA 2A3AA 5IHSA 1UZ1A 3UCQA 1JFHA 2C1IA 3N4FA 1YNQA 3DBPA 3V36A 4GGHA 4PUMA 3GVGA 1X1NA 4WGXA 3W72A 1E6SM 3CV1A 4L9ZA 3LEPA 3WLMA 4KERA 4RLIA 3O2LA 4HA1A 1X6NA 3U5UA 4D8LA 2BVWA 2WBGA 3C86A 3IUHA 1XQKA 1EHNA 3TUUA 3OVQA 2RFGA 1DV7A 3T0DA 1H2JA 3CUZA 4HB7A 4MPQA 3N29A 2E68A 3CTLA 2E09A 4GY1A 1NFBA 4O4WA 2PBOA 4H8NA 5A3HA 3K13A 2XVLA 3P3BA 4GD0A 7ODCA 4HSNA 1TMLA 1VP5A 1W8GA 3PJWA 4M5PA 4NRRA 2J7BA 3K8KA 1UBPC 1KWGA 2VX4A 4FA3A 3CAWA 1LM1A 3TN5A 4D1JA 2D69A 3B0PA 3LHVA 3AYTA 3M47A 2Y63A 2F61A 3EWZA 3DESA 1JQXA 4HA3A 3NPVA 1MZRA 4ICMA 3SRDA 5ECVA 1QNVA 2XINA 2DIJA 5CSYA 3E2RA 4KPLA 3PUGA 5AYXA 2O7SA 4MNLA 3QQ0A 1B4EA 1E6ZA 2Y7DA 1MSSA 1DWHM 3TJIA 3NM3A 1U30A 1FWRA 1T96A 4W5UA 1OX5A 3B9AA 2RKXA 5HNNA 1UPPA 3N6JA 1OEPA 3PTDA 3MMDA 3VOIA 3P81A 2OOFA 2WKGA 4JNMA 4LAUA 4H8HA 1EXBA 4XK2A 2QV5A 1S38A 1B57A 1GONA 2XHYA 4MKSA 2V5LA 1XH1A 5DELA 1XRFA 1EF2A 1KGXA 4L65A 1QFEA 2WJFA 3ZZ1A 1PL9A 1JJKA 4IUOA 4BWLA 2DGAA 2WXDM 3KVMA 3V1HA 3QW3A 4KETA 2EJAA 2CHRA 2INFA 4X9SA 2HS6A 2HXUA 1P7TB 2Y5SA 1XCXA 1L6SA 3APYA 3LB0A 7TIMA 1UB3A 3Q37A 4EPBC 3E0FA 1K9TA 3A9BA 1PYFA 3MHGA 4JTSA 2FPYA 2Y0FA 4N9EA 5CPSA 1R38A 5FF7A 4HNCA 4JFWA 2R1MA 1KCKA 2OLAA 5E09A 1B3VA 1NELA 2IW0A 7A3HA 4X61A 4DUXA 5GNXA 3FDKA 1NF7A 2DZAA 5IFPA 2VMFA 1UA3A 2QCDA 1ELSA 2EO7A 1Z48A 2QUUA 3SCPA 4DO6A 3EOSA 1QPQA 4H9XA 2VR4A 1DIKA 5M2FX 4HHHA 3NNTA 3W1NA 2HVMA 2I14A 1UHVA 3W85A 5HJXA 3QY6A 1CGYA 3NSNA 1XW8A 3F4NA 5JVLA 2QCNA 5BOOA 4XX6A 4YTSA 3OHIA 3SUTA 3CC1A 4H4IA 4HKPA 1B3OA 3CMFA 1SJDA 1ODZA 2UWFA 4ADUA 4C65A 3IUIA 1BLIA 2HK1A 1XYLA 2FH6A 2Q02A 5T26A 5CJMA 3AS3A 1FOBA 3M41A 1W9VA 1MEHA 4S1FA 1PWMA 1FHUA 3UWQA 5C8BB 4H6QA 1PXGA 5BRQA 2CZ5A 1CIUA 2BGSA 4DY1A 3WJYA 5JMUA 4YPJA 1E4MM 9CGTA 3FSTA 4WDXA 1Q6FA 5E93A 1SO6A 4H9MA 2J8TA 5T9BG 3RLHA 4FAMA 1FA2A 1MNSA 2VDGA 1YQ2A 4FPSA 1ZB5A 3L5AA 2DV0A 1Q65A 1TUFA 3O6DA 1UROA 2QJJA 3VOHA 1SR0A 4DUWA 3TQVA 5DBUA 1RA0A 2F8QA 4XKMA 2XFWA 3RG6A 3AISA 3CZGA 3QYQA 4IFKB 4D9PA 4H7ZA 4WDWA 3OTRA 4RCXA 3SRHA 4DJDA 3CM4A 1IEXA 1KXVA 4LFYA 5H8UA 4C6IA 4BI7A 1HKKA 1KRBC 2NV2A 4DZHA 3W84A 2NXHA 3G24A 2QUTA 5C9XA 1A5AA 4X60A 4O1FA 1R46A 1YYAA 4QG9A 1OD8A 1TV7A 1E6PA 2FMOA 4WJ8A 1IT8A 1KXHA 1ZENA 4NASA 1QU4A 4RE4A 1O5XA 1MMFA 3L0NA 2HE5A 3ID7A 3TP4A 2I9UA 1A5UA 3PPHA 1U5JA 3R10A 1ZCCA 2Y2WA 3WL1A 4KEMA 1J9YA 4NUWA 4QIUA 4UBPC 1OX6A 3S2CA 1R7OA 4JKKA 1ITQA 3SJ3A 2WHJA 2R1PA 2W92A 3I3DA 5DF0A 1FH8A 4KWVA 1FWJC 1G9HA 1ODUA 2OR2A 2V0TA 2D20A 3TEVA 2Y24A 1H62A 4GIAA 4OIFA 1W3LA 2OXNA 4DBWA 5CLWA 3E1F1 1FFQA 1XDJA 2V3DA 2QT3A 2Q09A 4BCEA 7PTDA 3THQA 3IIXA 4LH8A 4HPGA 3A4WA 3WD4A 3JVAA 3L4ZA 3BAIA 3GHRA 3CAKA 1WZLA 2Z28A 4C6BA 1RQBA 1LORA 2Y8KA 2HK0A 1ONWA 1SM9A 1VR6A 1V79A 4KRTA 4QE4A 1PX3A 4PC8A 1IWAA 1TELA 3LLFA 4C5ZA 1LL4A 4MFDA 4TX6A 3M0LA 1J0YA 2H3DA 1W9DM 3NFUA 1W6TA 2QS8A 3GDKA 3K46A 1D7KA 1VCGA 3GS6A 4XZBA 4ZOEA 1TZZA 1BVZA 3LENA 2WMFA 5FJPA 4ZTXA 4MKVA 4OQVA 2YB1A 4RZ4A 3Q4DA 3T44A 2GWNA 1QI4A 1SZEA 2EG7A 4QISA 4WSKA 3DXIA 2Z2AA 3TYCA 3SB0A 4O1BA 1UP3A 1F8MA 2GK1A 2YLAA 4PR4A 2J6VA 3H2AA 3LHYA 1BHGA 4NF7A 2DJXA 3UWZA 4HHLA 3LCFA 2X2YA 1BGGA 3R25A 1ZALA 3B8WA 2X7WA 1OQFA 1GVQA 3IGSA 2E8YA 3L68A 1KRAC 2EF9A 5I3JA 1GVEA 3VD9A 2V3EA 2PDFA 3UWYA 2YL8A 1Z69A 5HJLA 1W9UA 4K36A 4DI8A 5DRIA 4Z0SA 1M03A 2OSWA 1Q6RA 4I5XA 1XBZA 2FJUB 3T2QA 2BHUA 4W7UA 3BSMA 1LRTA 2HCVA 1VFTA 1NOUA 5J8LA 2ATMA 3CPRA 3TMQA 2ZRYA 3UZXA 5DXXA 4IWWA 3NVTA 2YW3A 4GYPA 1GEQA 3VOJA 3IANA 4S3EA 2IPJA 1HJXA 2E77A 4LS2A 3HO8A 3ARQA 1EJXC 4EOUA 3I68A 4Q8MA 3WQPA 4K1WA 3AI0A 3QPEA 5KTLA 2XGZA 1EQCA 3LPGA 1E15A 4RXGA 2V6AA 1C7TA 5AOUA 2Q3RA 6PTDA 2DSVA 4G8TA 3H23A 3HFTA 3DERA 5C9WA 1BYAA 2GJPA 2R24A 4MJMA 4CEXC 4ZGYA 4XVDA 4GY0A 4B9ZA 1Z8AA 4MADA 1G4SA 3PUDA 3P74A 5K9CA 3B03A 3GUWA 2D0FA 3S46A 2Z7GA 3KBMA 4C6PA 4GXPA 1KW1A 5HQMA 1UR4A 3TZFA 5IRPA 4B3ZA 4LS1A 4R3UA 4MWAA 4HMCA 2HMCA 1JCJA 1TTJA 4GZIA 3OA5A 2PLKA 2YA2A 1AH0A 4LCSA 4KESA 2J7DA 5IBXC 4F0HA 3KM8A 4DM1A 1E1FA 2GK1B 1SFSA 3VGEA 4W8AA 3W27A 1MEWA 4NHVA 1J2WA 1TVLA 1GHSA 1BRLA 3DBNA 2QKFA 4AFYA 2JEQA 3BQ5A 2XH2A 2VEIA 2A79A 1H09A 1V3HA 1UR8A 1GYLA 5CBJA 2CLFA 2POTA 1EJUC 3QGAC 3NO5A 3MZNA 1DE6A 3W7QA 1WP6A 1VJZA 5FSDC 3SR7A 1YTKA 1GK8A 5AVNA 4PTXA 3MCOA 5LIYX 3UWWA 1B3YA 4AH7A 1GZJA 2Y8VA 2I57A 1N8WA 1MXGA 3F2DA 4IGSA 2PP0A 3INPA 4UIOA 1UYQA 4IFOA 1B4KA 2DT1A 2Z29A 2HNEA 4MSSA 4BS0A 3S1WA 3NQ8A 5I78A 2DY3A 4N9BA 4Z2HA 4K3ZA 2V9DA 2BY0A 1C29A 3RXZA 2W5FA 5A8QA 4RE2A 3AS0A 4MZYA 3ITLA 3CUGA 3K30A 1LROA 3EB2A 3SRFA 1I0BA 2ZZ4A 4O14A 4UTMA 5G2HA 3BAKA 4ZXLA 2NV9A 2VRQA 1KBJA 5HWMA 1IIGA 3N9SA 5DRCA 1MVYA 3MS8A 3W1MA 4TR9A 4I8DA 3DFSA 2F9RA 3VNLA 3IJDA 2AOSA 3PUEA 1BXBA 1UD4A 3CH9A 5C9UA 2NWRA 3W6MA 5A6JA 5LIXX 1Q6CA 3I7RA 3MT1A 1FHVA 1MW2A 1QO5A 3LXBA 4RZ5A 1KTNA 4JZ5A 3WBXA 5IDZA 4AIUA 3VMOA 1FHLA 4N4QA 2H3BA 4MYXA 1J8VA 4GX8A 2W79A 1SO5A 1KTBA 4S3DA 4ZMGA 2X05A 2QQ6A 2BXVA 1KGUA 3W1XA 2YFOA 4MNJA 3O16A 5A94A 3DHPA 1P0NA 3AMLA 4XQ6A 2ACSA 1H7RA 4XBSA 4N42A 1Q6QA 3B9NA 2WW5A 4J40A 7TAAA 1HVXA 4HYVA 4UFKA 1OCJA 1AK5A 4IGNA 3Q58A 1P4CA 3RM9A 1FWTA 2DSUA 4DELA 3FN9A 3RFAA 2R8WA 5LA0A 1YPFA 1VB9A 5J5RA 1NDVA 4IPIA 1M53A 4EPDC 1KM2A 2PWDA 5LYRA 3WQ4A 4QJ3B 4L1XA 2PTYA 4IQJA 1W5MA 3LGDA 1TMHA 4WQ6A 4B5NA 2GGIA 5CZKA 2IKIA 5BCAA 4Z1BA 4B5SA 2XWEA 3AALA 3MCMA 1UBSA 3EEZA 5E6YA 4AC1X 1MUCA 3EKGA 1MW1A 1WUEA 4TMBA 1E1CA 1VPXA 1P48A 3OQ8A 1YDOA 4IISA 2G37A 3RCYA 2W3ZA 2YPIA 4GOAA 2GZXA 3AHYA 1JNEA 4C6LA 1EGZA 3W7JA 2WZHA 4HZ6A 2ISVA 3T0AA 3MMTA 4UMBA 5GNYA 1PS9A 4A2SA 3REQB 2OSYA 1EJWC 5FEWA 2KX9A 2QEZA 3UCCA 3MYOA 2WHKA 1KKOA 1UUMA 1WZKA 3W1QA 2E5CA 4HOZA 4ACZA 3EXSA 2O9RA 1M7OA 3DDMA 2OGJA 4XBKA 4UQCA 1OFRA 2VWSA 3CEPA 3A24A 2VELA 1QRQA 2YOCA 4JDYA 3S5YA 5A2AA 2NLIA 5XIMA 1O94A 2VM8A 4Z42C 4LJ3A 2FDMA 3COTA 3MBDA 4LVGA 2J9ZA 3F4DA 1CEOA 2A2IA 4IIGA 4WR3A 5EYWA 3E2SA 1GUVA 2VCCA 4A3HA 4R33A 3WDRA 5BWAA 4UFIA 1ZJHA 4L7ZA 4TUFA 4R53A 3ES7A 1NFPA 2E9BA 2C8NA 1PO9A 3SIZA 3OA3A 3B3DA 2PWVA 4GO9A 2E5DA 2I56A 4YNGA 5ECUA 5T8GA 1R30A 3GDLA 3S1VA 4LBUA 3W74A 3K4AA 3IJ6A 2QW5A 1NTHA 4UNKA 1ITUA 3CK5A 1EBGA 1FXPA 3SCWA 3B0UX 1JDDA 1D2KA 1EEXA 1P0BA 4JIHA 1UD5A 3HFYA 2WVVB 4FNUA 4A2RA 3C5QA 1JPHA 1FXQA 4DB7A 5B80A 1J12A 1DE5A 3VOCA 3MP5A 6CGTA 4XD6A 1IYXA 4DEFA 5D2TA 5KZ6A 2G3MA 2I17A 4J2PA 3G22A 3O8AA 4MM1A 5JBDA 3JRKA 1OCBA 1IEVA 2Y4SA 4PBEA 4FOJA 1PDZA 4JN6A 4KT2A 3ABQA 5EFFA 3KTCA 4D72A 4NXKA 3T4CA 4AZ6A 4LUSB 2XSXA 1F6YA 3IVTA 5HK4A 4WZHA 4GUJA 3L4TA 3MQTA 4PMRA 3WJXA 3B40A 3WMLA 1WE5A 1XBYA 3WLIA 1S5MA 3BW2A 4ERAA 3IACA 2HPIA 3S5OA 3B4YA 3HV8A 4S3FA 2QCDB 3IIPA 4PTMA 5CPTA 5I03A 3KBVA 7ENLA 2Q01A 1MXSA 4S3CA 3GDTA 4XD5A 3UZJA 3L0KA 4PTNA 2OKOA 2Z27A 3VDCA 2QCEA 3PZUA 3GG1A 3E2VA 1H60A 4JX6A 1F3XA 1W5PA 3H53A 4NJHA 4PCSA 4TV6A 3LTSA 1VFMA 2PTWA 2NX1A 1Q8AA 2UY3A 3AIQA 4IUGA 1DL3A 1Q6DA 2QCFA 1PX8A 1TQXA 4F9JA 2WMGA 2CKSA 2PWUA 2W91A 3NJ3A 4XAGA 3M6YA 2GGEA 4TO8A 2O9PA 4H8VA 1A5CA 2YX0A 4X3ZA 4AVFA 1CW2A 1WDRA 4EXBA 3SCQA 1C3FA 2XFYA 1XLCA 4JX4A 5A6BD 3RMJA 4CCDA 4E6MA 5HWJA 3KDNA 3S47A 3WD1A 2CBUA 4AF0B 3DKJA 4UB9A 3KVLA 2QGHA 3TQ0A 1OFDA 3BCJA 4MLJA 1QNQA 3FLUA 4ZZ9A 5EMMA 2OO0A 1R9YA 2WJZA 1P1MA 3G1RA 4LSBA 4KEVA 1GVRA 1F6PA 3FEQA 1EX5A 4F2TA 5AY7A 5M03A 3E12A 1WUFA 1LQ2A 3IJQA 3VO0A 4B91A 5DQPA 1EO7A 3IVUA 5K3VA 1XYZA 4LYPA 2HNHA 1EJVC 3MANA 3MHUA 4I7WA 1TJ1A 5H2ZA 1H1YA 3QHMA 4UOZA 5FI8A 5I3DA 2DT3A 3RGTA 3HU7A 2OWWA 1KFEA 4E2BA 1S2WA 2IXUA 2XISA 2A3BA 3HG5A 2VWTA 2A85A 4QEHA 5K7JA 2O56A 4U2YA 4GBDA 1W91A 3QC0A 3MMUA 3WSUA 1F5ZA 4NAFA 3KTXA 1L8NA 4UMAA 2OT0A 4HNVA 2FTWA 4G7FA 1JQVA 4PRTA 3QV9A 1MQRA 1XLAA 2BV9A 3R8RA 2ISFA 2WQDA 4AZHA 3R6IA 1GVIA 4AX7A 1OF8A 2FZ9A 2DZBA 1H7WA 3ARPA 2HSAA 1R3YA 3C2FA 3C2RA 3N15A 3VD5A 1JULA 2YB4A 4UCGA 4LB4A 1P0DA 2X09A 3F4WA 4A4AA 1GJUA 2VURA 4XTDA 2OVLA 3EOEA 1KFWA 1KFLA 3UPBA 4FXFA 3WELA 1ZUAX 4NAEA 3H2FA 4W4QA 5HAOA 3FNDA 4K68A 4OHQA 4JYFA 5EBUA 1W1PA 4QX4A 2P76A 3RO6A 2HJPA 3LDVA 1XYMA 4CQCA 3EDDA 1BXNA 1IF2A 3GU1A 1X1OA 3NSXA 4GACA 4GVHA 3ARWA 4XD4A 3GFXA 2F6XA 2V63A 3L67A 2WC4A 1HL2A 3IGUA 2VC7A 1W3IA 1HJSA 3EA2A 5C70A 1XCFA 2YBVA 1OADA 2A3LA 4JIQA 3MUXA 3NL2A 3TR2A 3W01A 5H6HA 5FJRA 1QWGA 1JDCA 3LHUA 4CNTA 1R3TA 3FV9A 3PSVA 2QUVA 4BQ4A 1XRSA 3ZLGA 2XG9A 4JN7A 3OP2A 1UR0A 4O0ZA 2FFCA 1OFPA 2E4TA 2WSQA 3ZJ7A 2PTXA 5F7UA 1VPQA 1JR1A 3LPFA 4OOUA 1PIGA 1V93A 2WZMA 3FAWA 1KBIA 3H7VA 6TIMA 4V1XA 1PCWA 3DC8A 3TWAA 1E9LA 5D38A 4H9TA 3PSWA 4O12A 2XVGA 4AXNA 1A3XA 5GNZA 2VKZG 1XSIA 1H7NA 3K2GA 3B9EA 1C90A 3KFTA 1PJ9A 3ABXA 2UY2A 4M82A 4E4PA 4RL3A 3VGHA 1UWAA 3W86A 1A5LC 2BB0A 1THFD 2PGFA 3N2BA 4BF9A 5D9MA 1UWQA 4W87A 3H21A 4DXXA 1OZMA 1PZ1A 2GSJA 3HPXA 3AIUA 2RGLA 3BOXA 1IV8A 2VR2A 1QTWA 4QDPA 1ZBVA 1UPMB 2VZOA 1YXYA 1UWUA 3GQYA 4M7SA 3MV11 3F4CA 5KZDA 1NWUA 3W1LA 1EIBA 1MDRA 4LVDA 2C0AA 1IR1A 3LERA 4P61A 2KAUC 1HKVA 1W5NA 3H24A 4AG0A 5CG7A 3TXZA 5G1MA 2VEKA 3HGRA 1XJBA 3SO7A 2TPSA 3WUFA 4JXCA 3EXRA 3TFXA 1KM6A 1HGYA 1PPIA 3ITCA 1OINA 5CAHA 3UA3A 4E0CA 4B5UA 3BGJA 4AMCA 1FWNA 1AVAA 3RU6A 5BXRA 2Z1WA 4H9ZA 4INFA 3TE9A 1OYCA 4MB1A 3B8IA 1CGXA 4HT3A 4DF1A 3TXVA 2ABBA 1VIWA 3OW1A 4JICA 2FVLA 5CEWA 1EZ2A 1XIGA 4AD5A 5KSWA 2FKPA 2XU2A 1QHOA 4KQNA 3W7KA 4GVIA 3BDKA 1YE6A 1AJ2A 1PTAA 4LT9A 1GOXA 1VEPA 5LNUA 1QW8A 3LI0A 1ISXA 3SGZA 4AZGA 3ARUA 2ATSA 3S5ZA 1JNDA 1W9BM 3TN6A 1SW0A 4FB7A 2QZRA 1UW9A 1LUCB 5G1TA 3HG3A 2ZRVA 1XIBA 2PDNA 3FVMA 3SY1A 4X0NA 3TYEA 4C6FA 1NWRA 2D1ZA 2YCIX 1YE4A 3FA4A 2PS2A 3M0VA 4HMDA 3W75A 4UNIA 2FTPA 1E6XM 3BW4A 1LTDA 3IK2A 3QQ1A 4LXFA 3DU0A 3MO4A 3ME3A 5AHMA 2WMIA 3LGEA 2OB3A 3T1GA 1TO3A 5EMUA 1XD0A 1CXKA 4Y2WA 5HQEA 1RBOB 2IS7A 3EDJA 1W1A1 4C6JA 2QPSA 1H1ZA 2PDWA 4EVZA 2VGBA 1QOXA 2QULA 3IEBA 3WFAA 2QLYA 2PDXA 1ZL1A 3CIWA 4GJ1A 3ITYA 3GE7A 1OHLA 2EEXA 4MB3A 3GTIA 3H70A 5REQB 4HTBA 1C8QA 4H2CA 1JAEA 2QNEA 2WNZA 2PCQA