3O8AA

Crystal structure of plasmodium falciparum dihydroorotate dehydrogenase bound with novel inhibitor genz667348
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
375
structure length
375
Chain Sequence
b'YNPEFFLYDIFLKFCLKYIDGEICHDLFLLLGKYNILPYDTSNDSIYACTNIKHLDFINPFGVAAGFDKNGVCIDSILKLGFSFIEIGTITPRGQTGNAKPRIFRDVESRSIINSCGFNNMGCDKVTENLILFRKRQEEDKLLSKHIVGVSIGKNKDTVNIVDDLKYCINKIGRYADYIAINVSSPNTPGLRDNQEAGKLKNIILSVKEEIDNLEKNNIMNDEFLWFNTTKKKPLVFVKLAPDLNQEQKKEIADVLLETNIDGMIISNTTTQINDIKSFENKKGGVSGAKLKDISTKFICEMYNYTNKQIPIIASGGIFSGLDALEKIEAGASVCQLYSCLVFNGMKSAVQIKRELNHLLYQRGYYNLKEAIGRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase homolog, mitochondrial
publication title Novel inhibitors of Plasmodium falciparum dihydroorotate dehydrogenase with anti-malarial activity in the mouse model.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
total genus 148
structure length 375
sequence length 375
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2010-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3o8aA00
2QUVA 1OYAA 3SECA 1W5OA 2A6LA 3L21A 2ISVA 3PWAA 4X2RA 3OIXA 3BO9A 3GZ3A 3RNDA 2VXNA 3DZ1A 2E5BA 4HPXA 5EYWA 1QWGA 2V82A 2XN0A 1ICSA 2WOQA 4JTIA 5FI8A 4Z1BA 4MJMA 1JR1A 4AVFA 4E0CA 1R2SA 4BK9A 1WDWA 3AJXA 1TTJA 4AF0A 1NEYA 1KM2A 1ZCOA 4QNEA 1QOQA 3W85A 2CU0A 3MP3A 4UR7A 3OVRA 2GVJA 5BRBA 2CLIA 3S42A 3HBLA 1AMKA 1IXPA 4IPIA 4O4VA 1JRBA 4BI7A 3LRKA 3TDFA 3NPUA 4IXXA 4I7VA 3BARA 3G0XA 4XTDA 3M5XA 4JTTA 3DAQA 3C2OA 3GB6A 1VCVA 3UXDA 3MHGA 4O54A 3W6YA 4GUGA 3NQ7A 4O17A 4OWGA 3W1UA 2G5WA 4XBKA 1VYRA 4KFNA 4NQ1A 1W5QA 3RMJA 2PRMA 3SW6A 1K8YA 2Z6JA 3B8DA 3TSBA 3VE9A 1G69A 3FA5A 5EBUA 1OF8A 1G7UA 1Y0EA 4DQWA 3DFNA 2E77A 5I3FA 3N9SA 1TPB1 3S6DA 4MIMA 3P82A 1RR2A 1WBJA 5LNRA 5J5RA 2YYUA 3MI2A 3W84A 4TX9A 3LI0A 3P5YA 4JIPA 3HG3A 3UY7A 2OZ0A 4K7VA 2WPBA 3W7IA 5HNRA 3RLUA 1R2TA 5FF7A 3W88A 2ZRXA 3TQ0A 1LRTA 1SSDA 2TPSA 5A5WA 4OQVA 2B7OA 1YXYA 3L0NA 1ZENA 2TYSA 2QUTA 3UD6A 3UY8A 3BW3A 4BWLC 2DZSA 2C3ZA 1VLWA 1U5JA 3W3OA 3LGEA 5HUOA 5H91A 3C3NA 1SO4A 1TTPA 4E2BA 1JCLA 3P80A 3W7OA 1HL2A 2ZFAA 3BW2A 3MHUA 3R2GA 4Y6GA 3S8HA 1EA0A 4J9JA 1KFEA 4YLWA 3LRMA 1AK5A 2FB3A 2ZZ6A 3G1DA 3C2RA 4N4PA 3LXBA 2V81A 3L67A 6TIMA 2BZNA 3DU0A 5U7SA 3W2NA 1KBJA 1LYXA 3L0KA 1OFQA 3NL2A 5LGZA 4QM1A 3M47A 2VEKA 3DFOA 1LLWA 5G4EA 4GRSA 1V7YA 4S1FA 3LCGA 1LBLA 1FWTA 2P0OA 2Y85A 3LLDA 5DY3A 1G4PA 3R8RA 1TPC1 1YTKA 1PVNA 1TO3A 3HPSA 3HGSA 1K7EA 1ONRA 3QMRA 3HG4A 2Y7EA 1QFEA 5I3KA 3QMTA 2C15A 2VEMA 3QQ1A 4UTKA 3IGSA 1SO5A 2R8WA 3E0IA 4ZQOA 3CB8A 2QAFA 5D2YA 1TQJA 4DXVA 4QQ3A 1IXOA 2GJNA 1GYNA 3WJWA 1P0KA 1LOLA 4JTKA 3W7NA 5HINA 2PRHA 4A22A 4Z1AA 3GDTA 1K03A 3O16A 3TV8A 1LORA 1KTNA 3WJXA 3EX6A 1J4EA 1Q6QA 3G1AA 3I7RA 2Y7FA 3IRDA 2QCDA 3IIOA 1FBAA 5FEXA 2X16A 1FWRA 2OJPA 2BTMA 1RV8A 1SSGA 3SI9A 1C8VA 1XUZA 4CLMA 1BKSA 3NQFA 4JY8A 1NVMA 3LBCA 4GBUA 2WNNA 3V1PA 4A3UA 1EUAA 2VFDA 3TUUA 2A7PA 2VC6A 2CW6A 4O1AA 5TBOA 1MEIA 4JN6A 3W2JA 2BWGA 4R34A 3TNOA 3EX4A 3V75A 1JUEA 2GVGA 4LT9A 1FXPA 1TV8A 2BX7A 5AN7A 3BLEA 4U28A 2JKPA 2NV1A 2C1HA 4JNMA 4KWVA 4XTIA 3K30A 4BI6A 4AHQA 1ME7A 2V8ZA 3MI6A 3UZJA 1XBXA 2QCNA 1DVJA 1PE1A 1WV2A 2V30A 3W83A 3L0GA 4RV8A 4NJIA 1I8JA 5F2IA 2Q3RA 3LHWA 4IUOA 3N73A 3THAA 1EP1A 2PRLA 2V5BA 1GG1A 2EHHA 3F4NA 1M5WA 4DF1A 4HNUA 2TSYA 2I14A 5F2GA 2A6NA 4NNBA 3VI2A 4RKAA 4O57A 2O7SA 5HUPA 3NVTA 1JCXA 1SUXA 2YCEA 4CCEA 1B4EA 3HGRA 3FKKA 3KRZA 2AGKA 3PC0A 4O18A 5C55A 1VH7A 3GXTA 2GVLA 4FB7A 1T96A 2Q3OA 4PODA 5AC8A 4QNWA 3CIWA 1AG1O 2ISSA 5KSWA 2TMDA 2DZXA 5BMXA 3LDVA 1TPVA 4M7TA 2Y6ZA 5K9XA 1VCFA 3CU2A 2CLEA 4YMZA 4PTNA 4NJKA 3KRSA 1TYGA 4LU0A 1UASA 3W70A 4HNTA 1OK4A 3NM3A 1N55A 3TCEA 1YADA 1H1YA 1K8XA 2WSQA 1S5TA 5DLCA 1PCWA 4ADSA 3WK2A 3W1RA 1I2OA 5F2MA 3UWYA 3MUXA 3OVPA 3SIZA 5CZ0A 3HGJA 4XKYA 1GVOA 3GDLA 3DHFA 4Y96A 2WSRA 3FYOA 2NV2A 3Q58A 5EY5A 1SU5A 1VYPX 1W5NA 1SZFA 5DBTA 1DQXA 4ZQRA 4A21A 1A50A 1L2UA 5K4ZA 3TA6A 4YWIA 3MHFA 5T26A 4UMAA 4OU1A 2Y89A 1GVQA 1H51A 3HG5A 1X7FA 5TIMA 4ZQCA 4MY8A 2JKAA 4UTLA 1TRDA 4TMCA 3LB0A 3B0VC 4N6EA 1XBYA 1PCKA 4TMBA 1GTHA 1H60A 1AW5A 2J9ZA 3NL6A 3EKZA 4ZVJA 3DFPA 2FPTA 3LV6A 1HUVA 4HKPA 4MZYA 3KAOA 1OABA 4JTSA 3TR2A 1VCGA 3E02A 3IGUA 2GQAA 5C6MA 5LNVA 4QIUA 1OF6A 1GPWA 1KA9F 1XXXA 3PG9A 4UFHA 1ZALA 2VFGA 3O05A 3VFLA 1LBMA 4FNTA 4LV9A 1B3OA 3THQA 3I65A 3U2OA 2J9XA 4ADTA 4LRTA 4O12A 5CZTA 4M7SA 1OFDA 1TJPA 4O4WA 3UPBA 4D2JA 4HIBA 2XN2A 1W3IA 1SZNA 4JDYA 1D9EA 3DI0A 2ZA1A 5AOUA 3LOTA 4UFKA 2Z1BA 3BG5A 4EF9A 5F1UA 3PVFA 4HPJA 1M7OA 1QCWA 2OMAA 1RQEA 2FLIA 4LC8A 1VR6A 3HOJA 3L5AA 4OV9A 4QJ1A 1X1OA 4S2BA 1X8FA 1TPEA 2A0NA 3BGGA 5AHEA 1OYCA 4DO5A 4PA8A 3P8JA 3W1TA 4JR5A 3NA8A 1DHPA 1OX4B 1NF7A 1X1ZA 3OA3A 1ZAJA 2B0MA 3W71A 3M5VA 3TXZA 4AEOA 4O1CA 1WOBA 1DJNA 1FWNA 1I2PA 2HS8A 2VEIA 3O07A 3MBFA 3VNDA 2FB2A 2ZTJA 3A22A 2ZZ4A 3NQDA 2TRSA 3GKFA 4UFLA 3BG9A 3C4UA 3B04A 1W3TA 4X3ZA 1P4CA 1BWKA 1THFD 1JUKA 2ZA3A 4FIRA 5AC6A 2KZHA 4FF7A 4FXRA 4LOCA 5CKSA 2CLHA 1FXQA 3EB2A 1K7FA 4BR1A 1QPNA 3GX9A 4OT7A 1KFJA 4LWWA 4AWTA 2DZPA 3QSRA 4KFPA 1OYBA 4WX2A 4N2YA 4MLJA 3NL3A 3QQ0A 4UTWC 5FEZA 5D2VA 3ATZA 1I2QA 3TFCA 1EWEA 4PC8A 2GQ8A 3I7SA 4QSHA 2QUUA 1VS1A 4UFMA 4NXSA 1PS9A 1WYIA 3M16A 4AF0B 4GC4A 1HO4A 1F05A 3PS7A 4K8HA 4Z08A 3NNTA 3P62A 3OHIA 3W76A 1SZGA 5EA9A 3NQEA 1KV5A 4RCXA 4X22A 1TPH1 3IVSA 1WXJA 3MP5A 3OG3A 4EOUA 3P81A 5I3GA 1IIHA 3B0PA 1XL9A 2B7NA 2QAPA 3L66A 4DBDA 3PUOA 3UNDA 3GDKA 5D09A 1PHWA 4R33A 5KITA 3ZWTA 4LVBA 3VCRA 1OHLA 1CW2A 1H1ZA 1BTMA 3CWNA 4O19A 3S1WA 1SPQA 1GG0A 1I2NA 3WK0A 4TR9A 3BK0A 5L9FA 4ZL1A 3CWOX 3LXCA 3PSWA 1ZAIA 3SZ8A 2J88A 2X1UA 4Q32A 5HMSA 3HJZA 2OT0A 1WX0A 3C2VA 5LSMA 3W7LA 3UWQA 1Q6RA 3H53A 1XDLA 2Y70A 2O7QA 3MI3A 3VKJA 4UTMA 1UUMA 3NZRA 4HNNA 3W1QA 1YPFA 3W7QA 1EPXA 3IGXA 3OVQA 3SGZA 3SGUA 1YLVA 4M19A 1A53A 3G1YA 4GFSA 4NXKA 4R7JA 4FNPA 3W2LA 1F6KA 1L6YA 1VYSX 3ABOA 1ZFJA 2CFFA 2H6RA 4WZHA 4OHQA 3USBA 1VJIA 3HMJG 2ZYFA 1AL8A 3IEBA 4M6QA 4MKNA 4IQLA 4N9CA 5DXYA 2YR1A 1LRQA 3NQ8A 4UFJA 4UTTA 4K37A 3CIXA 4MJZA 1H62A 3P5ZA 3C0JA 3NGJA 3GDRA 3T44A 5HULA 1MXSA 1TTQA 5CPOA 4ADUA 3JS3A 4W9TA 4IMDA 3T55A 4EWND 1JULA 3STFA 1XDMA 3U6WA 3QEZA 4OV4A 3HPZA 3QC3A 1JCNA 2Q8LA 2CLKA 2FTPA 5F4SA 3QRHA 4UTUA 4N9DA 3A21A 3HPXA 1YXDA 1KLZA 2R91A 1TV5A 1VQTA 1IF2A 2ALDA 2H3DA 3W75A 5CZSA 2OT1A 2G96A 5DBUA 2ZCGA 1OFRA 4FNSA 2YDAA 2DU2A 4XZ9A 3R12A 2NLIA 3CPRA 3C8FA 4A2RA 4BF9A 1TPUA 2C0AA 3PBVA 1FQ0A 1F6PA 1LZOA 1DBTA 3TROA 3MYOA 4S2CA 3R13A 3W1AA 3W07A 1F73A 3TAKA 1SO6A 2HMCA 4WY0B 5AHLA 4ORIA 4CNOA 2Z0IA 1AW2A 5K4XA 3OEXA 1TJRA 3M44A 3MWAA 2ZA2A 3LX9A 4L4LA 4AH7A 1CX9A 1F2JA 4HN4A 4CQ8A 2YPIA 1PIIA 4O1DA 4BFAA 3W22A 5K2ZA 4PEKA 1QMLA 4XUGA 3G1VA 2JKEA 1YYAA 4N9EA 4LS0A 3TMLA 2QCDB 4ML9A 1MO0A 1GEQA 1OFAA 4MY1A 3PBWA 1NSJA 3BPWA 2NUXA 1LDCA 3ANYA 5GVJA 1B4KA 1QR7A 2GJLA 3EXTA 4OBTA 5EPDA 2NX9A 2B7PA 1A5CA 4O1BA 4JIQA 2C16A 4AHPA 3PAJA 3S0CA 3MP4A 3RF9A 4WUIA 1KW1A 4O8RA 3SR7A 4FO4A 3TIMA 1ICPA 5FF3A 1XCFA 3BVJA 1ALDA 4I7WA 3B4UA 5K9CA 4K7YA 5D30A 5EKYA 5I3HA 3TK7A 1OVDA 3S9YA 1VHNA 3R5EA 3QYQA 1YPIA 2D73A 4NJGA 2F84A 3WFAA 3S5ZA 1H5YA 3NQAA 1YTDA 3KOFA 1XM3A 1WBHA 5HQEA 2J6XA 3GVGA 3TH6A 4AWUA 2Y7DA 3FFSA 5CG7A 2A21A 4GXMA 3SSJA 5KMYA 1QO5A 3NPXA 3NQMA 3GXPA 3DFSA 4IJBA 3G1XA 3W1MA 2E09A 2A5HA 5HWNA 7TIMA 3DKLA 2QJGA 3M1ZA 3W7MA 3W7CA 4RZ6A 4O52A 3STCA 3NOEA 4BWLA 4LS1A 2JGYA 3MW7A 4O10A 1ML1A 3N3MA 5J5DA 3UQNA 2CZ5A 2ZRWA 4G1KA 1DJQA 3E12A 5CPLA 3W1NA 3QPZA 1H7WA 4YCPA 1KFBA 1KFLA 1JRCA 2Q8ZA 1E51A 4E2DA 4GUIA 2VFHA 3F03K 1ICQA 3LBMA 3I7QA 2DZWA 4MFDA 2PE4A 2GQ9A 2GUUA 2NWSA 2VENA 3HO8A 3T4CA 2V0TA 2RKXA 4Y9AA 2YFOA 5C5YA 3KVJA 4MVAA 2FIQA 4H6KA 3D0CA 4MLRA 1FCUA 3GIYA 1N8FA 3GLCA 3HG2A 1S3HA 3UZ5A 4MUZA 1EUNA 1RD5A 4C1LA 1P0NA 3SY5A 2J24A 1TPDA 1VPXA 2CWNA 4HSOA 1XUUA 4XKYB 3WJSA 1FCVA 4O0ZA 2VEPA 3NYZA 1KM6A 4JGDA 4K38A 2YZRA 3CTLA 4Z1DA 3O6CA 1KM5A 4UIOA 4H3DA 3S5OA 5DCBA 4UNLA 4M6VA 3G22A 3M6YA 3N14A 1AW1A 4DEFA 1L6SA 5MHBA 1SW3A 4YXGA 1JJKA 4A2SA 2ZQ0A 1EP3A 3NG3A 4ALDA 2CLOA 2FJKA 1SW7A 4IXHA 5FF0A 2NXHA 2ZRYA 3L2IA 1RVGA 2DZUA 3L9CA 3A5FA 1GYLA 4O14A 4Q4KA 3HQ1A 1QNVA 3B05A 3NQ2A 5D02A 3M0ZA 4RLIA 3E49A 4AHOA 1G4SA 1PHQA 2Y7GA 2C14A 1NAL1 3CHVA 3PB0A 2H8ZA 1GVSA 4YL2A 1RPXA 3O15A 1RZMA 1W0MA 2HSAA 1DV7A 3TFXA 4JXCA 5G5IA 1TTIA 4PL2A 4HSNA 3CM4A 1Q45A 1SW0A 3NQVA 4JYFA 5LNSA 3QFEA 3FOKA 1LOQA 2QCCA 5A8GA 4N9BA 5LKYA 2NXGA 3UWWA 8TIMA 2WNQA 4HT3A 2XN1A 4NJJA 3LTYA 5LGXA 3N9RA 1S5VA 1BEUA 2I9EA 4AB4A 1KM3A 1FWSA 3KVMA 1UJPA 3B0UX 4JICA 5HR6A 2UV8G 3ABRA 3I68A 1XFBA 4UMCA 1W31A 4TU1A 1KFCA 3TXVA 1KFKA 5DCEA 4IPJA 1EIXA 3CC1A 1HTIA 3NPWA 3PSVA 2E5CA 1L6WA 3LERA 1VHCA 1XKYA 2H3BA 1C9DA 3O8AA 4LV4A 4FIQA 3ZR4A 4IWWA 5AB3A 4EIVA 3NZ1A 1OJXA 2ZRUA 3NQGA 4N02A 3P7YA 5AFDA 3PBUA 1JQVA 3UWVA 1K02A 3QMSA 5AC7A 1QO2A 2FQIA 1VGAA 4LTSA 2HS6A 3FKRA 4N6FA 3N2XA 3LCWA 3G1HA 2Y63A 2E6YA 1KV8A 4BI5A 2NX3A 2FPYA 1LRNA 4NJHA 5BW6A 3RU6A 1NFBA 2EF9A 3BG3A 3F4WA 1GVRA 3ELFA 1N7KA 3A23A 1GOXA 1UB3A 1S5WA 3TQVA 5G2WA 3O63A 1JQXA 2QDGA 3TSMA 2CLMA 1G67A 5TQLA 3WJZA 3RLVA 3W1LA 4ZMGA 3FEMA 4X9SA 1H7XA 3O6DA 1OX5A 1L9WA 1LCOA 2A7NA 1YDVA 1SO3A 1VZWA 4HHPA 2C18A 4I9AA 4WOQA 5AHFA 4JYEA 1W56A 5FEPA 3IVTA 4K39A 2X1SA 3G3DA 4FNRA 4UR8A 2B7QA 3GDMA 2XFWA 2RDTA 3P74A 4DELA 4TIMA 1SR9A 3LCIA 2CLLA 1CI1A 4XQ6A 2QR6A 3W2UA 4LUIA 4IMGA 4U4MA 2IQTA 2FPVA 3DFTA 4MOZA 2OCZA 1QOPA 4JTFA 4JS3A 1GT8A 2ZZ7A 3KXQA 1OG0A 4PCFA 4KWWA 1H7PA 3LHZA 4LUJA 4WOZA 1FUYA 2RFGA 3CLMA 3LHUA 2QCFA 1W54A 4QISA 1W5MA 4WXZA 3W7EA 5F2LA 1LROA 2ABAA 1TREA 2WO5A 1YTEA 3W23A 4GNJA 1KM1A 3W7KA 3LTSA 1O4UA 2YGYA 3G24A 4PL1A 2DZTA 1RQHA 3L65A 5G1YA 3TW7A 3TMQA 5G2IA 1G7VA 5G2HA 2DP3A 4WD0A 3PBYA 1KLYA 4NZJA 3STGA 2W6RA 1QPRA 1ME8A 3LHVA 2AQWA 2Z6IA 3G18A 3LV5A 5D04C 2ZTKA 3TC6A 4K8EA 1GVFA 5FF4A 1OFOA 3A24A 1DKWA 3W73A 1A5SA 5G1TA 4LW7A 3FIGA 1JCJA 2ATSA 1I4NA 3IIXA 4DF2A 4Y8FA 4LVDA 2V2CA 4IMCA 1EX5A 4ZQNA 5HJLA 4L4MA 1OX4A 1U83A 2C19A 2EGZA 3TE9A 3DENA 4KFOA 4Z0JA 1Z48A 2NWRA 1XBVA 2DORA 3OBKA 4I7UA 2V5LA 2R94A 3CQ0A 1H63A 3LCFA 4IOTA 5LNWA 3G1SA 1H7OA 1ZJIA 3LTPA 5D38A 1TRIA 1PV8A 5E1QA 3IIPA 1H7RA 1B57A 1FX6A 5L6UA 4UCGA 4ZZ9A 3M41A 1J2WA 1A5AA 3NPVA 2W79A 4RZ5A 1R46A 2PCQA 4Z1CA 1ZNNA 2BSLA 6ALDA 2A7RA 3UWZA 5AHNA 3MBDA 3EWYA 4GWEA 2ZZ1A 1Q6LA 3UYCA 1O60A 3GXNA 3NEVA 1K3UA 4K36A 3DH7A 1O5KA 5D2XA 1Z42A 4JEQA 4OGZA 3TAOA 1WA3A 4UC5A 4RX0A 4XWUA 3C61A 3L5MA 3PM6A 3N34A 3HB9A 3M9YA 3LLFA 1QPQA 2E1DA 2E6AA 2ZRZA 1T99A 4UTWA 4JTEA 1FDYA 3L5LA 5K9DA 5KZMA 3NL5A 4LS2A 3A5VA 1BWLA 2A4AA 3BGJA 1WOAA 1QAPA 5HWJA 1DL3A 3B06A 3C2EA 4JX5A 5D37A 1TSIA 3NO5A 3RK8A 3TU9A 1GWJA 2NX1A 3RFAA 3STEA 4IGHA 2QJIA 1M7PA 1IXNA 3KX6A 1MSSA 3G0UA 3HF3A 3KVKA 3N2MA 1TCDA 3EWUA 1K7XA 5E0KA 1WAUA 3O1NA 4R53A 2RDWA 2QDHA 5F4XA 1TQXA 4C1KA 4DBEA 1IIGA 2E6FA 5CSRA 5AYYA 3LM7A 3G8EA 1EWDA 5AYZA 1UUOA 2RHGA 3EX3A 1KM0A 2YXGA 1XI3A 1G6CA 4NX5A 3ZS4A 2BXVA 1F5ZA 4JD4A 4MZ8A 5LZLA 3P67A 5AHIA 1R47A 3PF3A 2HTMA 1KBIA 1W5PA 5DELA 5BMWA 3LHYA 3QPYA 4LY8A 4ZQPA 3EX2A 4CNPA 5K3VA 4FXSA 4M6PA 4GJ1A 3HGOA 1YDOA 2BLEA 1DORA 3LCLA 3O6YX 1EP2A 4UNKA 3NDOA 4O53A 4IX2A 3NQ6A 2YYTA 4MY9A 4RXFA 5H2ZA 1LM1A 3C2FA 2JK2A 1VC4A 4UTJA 3IV3A 2CLFA 4FX7A 2H90A 3P61A 1OFBA 3E96A 4XBSA 1ZY9A 2C13A 2NZLA 3QW4B 4DF0A 1T8XA 4UTHA 3QM3A 3KHJA 3KFTA 1P5BA 4JY9A 2DZVA 3GKAA 1V5XA 2JBMA 1Z44A 2WV8A 4B5NA 4NNCA 4GUJA 4JDBA 4O11A 5K7JA 2G95A 1QDSA 3W72A 3PUDA 4NZFA 3L68A 2WQPA 3WK1A 1FCBA 3FJLA 4Y90A 3G0SA 1JUBA 3W7JA 1TB3A 3S1UA 1TPWA 1TIMA 2ABBA 3IIVA 4JTJA 4AMAA 1JCYA 3A9IA 5EMUA 1HFBA 5CPMA 1R2RA 4YCOA 3MJYA 4OE7A 5HWMA 1SFJA 2OX1A 3DXIA 2A1YA 5C2XA 3T7VA 2QCHA 3GNNA 2VFFA 1ZHAA 1H7NA 4FEZA 3S1XA 3JRKA 2QCEA 3TC7A 4WY0F 1VRDA 1T0OA 3FS2A 5BOOA 1DQWA 2WSYA 5LNUA 1MEWA 2QEZA 2YSWA 3GNDA 4CCDA 1O94A 4O16A 4IMFA 3LI1A 5CGQA 1Z41A 5I3IA 3PB2A 3BLIA 1F74A 5CPNA 1WQ5A 1A5BA 3GAKA 3P8IA 5HR7A 2YFNA 5IM51 2JGQA 3LCXA 4JTLA 4WY0A 3F1QA 3HIJA 4Q33A 5DN1A 5F4WA 5G4WA 3UWUA 5KTLA 2FFCA 3ABSA 2ZBTA 3QH2A 3VE7A 2C6QA 1UCWA 3PY2A 5D05A 1G4EA 3W1PA 3I6RA 1O95A 3W86A 5AHMA 3KVLA 5FESA 2DJXA 4DPPA 4JX6A 4RJEA 3QJAA 3W7PA 3MMTA 5SWUA 4JX4A 2VFEA 1X6UA 2QF7A 4LC6A 3M5YA 2F7FA 3Q2DA 2J9YA 1OFPA 4CQ9A 2GOUA 3FJ6A 2ZDRA 5E93A 1FDZA 5KINA 4WJEA 5D33A 3Q94A 4A29A 4LVAA 3EXSA 3QF0A 2VELA 2RDUA 2Z2UA 3C52A 3BLFA 5KZDA 3C6CA 3TSDA 4JYDA 5F1VA 1EB3A 2QCLA 1W37A 5IBXC 1J5TA 3GYEA 4P61A 4E38A 3EEGA 3EX1A 4QAIA 1GTEA 4CNNA 5LHFA 1I45A 1SFLA 2GPTA 2I1OA 3T78A 2ZZ3A 4IX0A 4PH6A 4JTUA 4FX6M 2ISWA 5FEWA 5BNKA 1H61A 1IXQA 2ATMA 4P2VA 4AAJA 4Z0SA 1KTCA 3DBPA 5DY2A 1R30A 4O0KA 1JCMP 2NUWA 2EAWA 5LHEA 3PULA 1NF0A 3INPA 4KKXA 4FNQA 3R89A 4UMBA 4HNVA 1C29A 4RZ4A 4RK8A 4ONVA 5CSSA 1M6JA 1ADOA 4M5PA 4UUIA 1ME9A 4ZQMA 5DXXA 3S5NA 1KM4A 3G1FA 3C56A 3W74A 4RXGA 1P1XA 3CT7A 3W2KA 3P84A 4ICNA 4GE8A 3ZWSA 3PR2A 3LRLA 4MZ1A 4N4QA 3FLUA 3FYPA 1O5XA 3TKFA 1XC4A 2W0UA 3SJ3A 3SFKA 1VLIA 4QITA 3TQKA 1I2RA 3P60A 2E5DA 3W7HA 2Y88A 4WXYA 3W7GA 2CZFA 1HO1A 3M43A 3LXAA 3N19B 3MYPA 4PFMA 3ATYA 3NXFA 4AXKA 4NU7A 3Q37A 1K8ZA 4LRSA 4DO4A 4NUWA 5KZEA 1YXCA 3DFQA 2CZDA 2QKFA 3WK3A 4NVTA 3EXRA 3NM1A 1D3GA 2Y62A 3TJLA 3PUEA 1LBFA 3W9ZA 2CZEA 4NNAA 5DCDA 2WNZA 1PL9A 3KRUA 3UXAA 3TW6A 4UFIA 3PG8A 3G3MA 4EVZA 3W2MA 4GUFA 4LNYA 3EWBX 5IBXA 1OFEA 3CEUA 2V2DA 4UXDA 5D2WA 3IVUA 2A85A 4K6AA 1SQ7A 2FDSA 1Q3NA 3H54A 4RR4A 3W7RA 1MEHA 2RH9A 5C54A 3BW4A 1FDJA 2B4GA 4MFEA 1ZAHA 3ZFHA 2PC4A 5D03A 4FHAA 2G97A 3LHTA 1W8SA 4NT0A 3W7DA 1FCQA 1F7BA 4AWSA 1LTDA 3GK0A 3QZEA 3TX9A 5I3JA 1TPFA 4EF8A 1TV7A 2X1TA 1JVNA 2NXIA 2WKJA 3MO7A 2YX0A 2YW4A 3AO0A 4H4IA 3EWXA 2V9DA 4UTIA 1GJPA 2QCMA 2NUYA 3DI1A 1H50A 1F76A 3ABQA 4TO8A 3EKLA 4O28A 2J27A 3QSTA 4JTGA 3WJYA 4FX8A 2X2GA 1DOSA 1GZGA 2EPHA 4MYXA 1LP6A 1G4TA 3S1VA 2DJLA 3EWWA 1IGSA 1W3NA 1B9BA 4LVGA 1OK6A 2LLEA 4JTHA 2A2IA 1RQBA 2P10A 4GUHA 2X1RA 3DGRA 3E9AA 2QCGA 1FWWA 3T40A 3B03A 4ORMA 4O13A 2R14A 1TMHA 2QJHA 5D32A 2ZZ5A 1YDNA 2AAMA 4POCA 1AL7A 3EWZA 1XBZA 3LCHA 1OX6A 3NR0A 3DHDA 3M7WA 3U8GA 1HG3A 1EEPA 4DO6A 2WJZA 3G8RA 2E6DA 2ZRVA 3S5YA 4MYAA 3W1XA 2VFIA 3W87A 2E68A 1LOSA 2P1FA 1UBSA 1D3HA 4NX0A 3GR7A 1W1ZA 3CEPA 4MPQA 3GR8A 2ZZ2A 2H8XA 4UTTC 3GAYA 4DPQA 5AYXA 5EL1A 3IIZA 4O15A 3JR2A 1Q6OA 2VOMA 4CCCA 5D2TA 1LLZA 1MZHA 5FF2A 3DKJA 2V2HA 1QPOA 2X30A 3M5ZA 4WQ6A 3BV4A 4FNUA 4LVFA 4CQAA 2Y61A 3UPWA 3O06A 4O50A 2VKZG 3NQCA 3YPIA 3NAVA 3QW3A 1KTBA 2YW3A 5ABTA 2EKCA 1SZEA 2PURA 5U4NA 3H55A 1GQNA 3TJXA 5CZJA 1FY6A 4IMEA
chains in the Genus database with same CATH superfamily
2QUVA 1I75A 2GGJA 3TLLA 3WQCA 3TQPA 1NWRA 2VI0A 3VOJA 4H9UA 1TFVA 5LIUX 3GZ3A 3EOOA 1QWGA 4HTBA 3C8NA 2GK1A 1DJZA 3O6AA 1ICSA 1NARA 1M41A 4JTIA 1J0IA 4H2HA 2XH7A 3B0YA 2GDQA 1TTJA 3TLQA 2DIEA 3B9OA 1NEYA 1KM2A 3H2EA 2HDJA 1XW8A 4QNEA 3W85A 4XAYA 4UR7A 4IIEA 2ZE0A 3OVRA 5BRBA 3KOZA 3ZSTA 2X05A 4IPNB 1VEOA 4BI7A 3NPUA 4IXXA 1AH4A 4Q8QA 3VIOA 3G0XA 3EWDA 1Y8BA 3S9ZA 2CBJA 2OYMA 2V5CA 2YDRA 3UXDA 1TJ0A 1WNOA 2W67A 4KFNA 1K8YA 3S6TA 2Z6JA 1JDAA 1G69A 3U2EA 4GI9A 2OO6A 5DX7A 3DFNA 4UQCA 5IOBA 1J0ZA 3N9SA 3WLOA 4XZLX 4IM4A 4H9XA 4MIMA 1KCKA 2G3IA 2VQTA 4LSBA 3UWEA 2P53A 3P82A 1RR2A 1FWDC 2VJXA 1X39A 3LI0A 4GQ0A 4K7VA 3W7IA 1TG7A 1YRRA 1LRTA 3GC4A 5A5WA 3E3HA 2B7OA 4E8CA 2ISFA 3UY8A 1QBAA 3UXLA 4XZHA 1XIDA 4WGXA 5HUOA 4DI8A 1P0BA 1SO4A 3GC2A 1M7XA 4KEUA 5EMKA 1TZ9A 1NDVA 2X41A 1HL8A 3R2GA 2EG8A 4YTRA 3DFHA 4FSAA 4MWAE 1HL9A 4S3JA 3LRMA 4AZCA 1AK5A 2ZZ6A 5D9NA 3GH5A 2V81A 3GHUA 4ZXOA 1KBJA 3L0KA 3NL2A 3PPHA 4F0KA 3SN0A 1NQKA 2P0OA 2Y85A 3CL7A 4A3RA 1TPC1 4XVDA 1YTKA 1PVNA 1PSCA 1T40A 1TO3A 3HGSA 4LPCA 1K7EA 1NDZA 3GH4A 5I3KA 3FA3A 5C9UA 3QQ1A 1V6VA 4UTKA 2Z27A 3E0IA 2NQLA 4OUEA 3UP8A 4FLSA 3Q45A 1OGGA 3QPEA 1FA2A 3WDRA 4EPEC 1GYNA 1JD9A 3FW6A 3AYTA 3W7NA 5HMFA 1KXHA 1XRVA 3TV8A 3W24A 2GQ3A 4JZ5A 1Q6QA 3G1AA 3GXIA 1A80A 1UR0A 4HNLA 4PUKA 5HMDA 2ISDA 1E6XM 3BC9A 2J7DA 1Z69A 3IRDA 2QCDA 2BFGA 1J0HA 1FBAA 3RG6A 1A3WA 4IGSA 1FWRA 3DBNA 4LJ3A 1W1A1 1XWYA 3SI9A 4CLMA 1XUZA 3THCA 4JHZA 3N17A 3IK4A 2VC6A 3RMEA 4O1AA 1MEIA 4JN6A 3VOIA 4MB3A 1JYVA 3PFMA 3TNOA 3CUZA 3I6TA 1RJPA 1VEPA 1HJSA 1FXPA 4GZJA 4LXFA 1XFCA 2BX7A 4IMAA 2NV1A 4WDWA 4XTIA 4AHQA 1EC7A 1ME7A 1OT1A 1ZJHA 3UZJA 4NG3A 1DVJA 1PE1A 4DN1A 4M56A 1GW9A 4RV8A 1ISXA 1V02E 2GVEA 2QV5A 3M07A 5F2IA 3BXWA 4X60A 1HGYA 1AQHA 3BZGA 2V5BA 2DFAA 1UW9A 4GYPA 3U4FA 1M5WA 4KH2A 3S2NA 2I14A 1HNYA 3OJGA 3VI2A 4E5TA 4PMNA 2O7SA 3N3TA 3TTOA 4V15A 1SUXA 4KERA 1VRXA 2YCEA 4CCEA 4Y7EA 3PC0A 5C55A 1XLKA 2PGRA 3AICA 2Q3OA 1N82A 5MF5A 3TP4A 3SFWA 5KSWA 2DZXA 5BMXA 4ICCX 3LDVA 2NT0A 5K9XA 1VCFA 4CU8A 4J4KA 1TYGA 4TVCA 3WUFA 4CN1A 1T41A 4CNSA 4LU0A 5J04A 3W70A 4HNTA 3NM3A 3WG6A 3V5CA 1H1YA 2F38A 1K8XA 4QJ5B 4ADSA 3M0LA 2DGAA 3VD9A 4XK2A 3PWIA 1TE6A 4JTCA 1OIFA 4PUEA 3N18A 4J40A 3IJIA 3MUXA 3SIZA 4V33A 3HGJA 1BYDA 1Q85A 3DHFA 2XU2A 2WKGA 3WNNA 3GU2A 1VYPX 1W5NA 4IH3A 1DQXA 1L2UA 4IG2A 1B3ZA 3DCPA 4QE4A 5T26A 1GVQA 2OGYA 5TIMA 4HQVA 4ZQCA 3S5SA 2DH2A 2R1KA 1TRDA 2TAAA 3B0VC 4QS5A 3DDMA 1VAHA 2OWXA 1ITXA 1GTHA 4TUFA 1AW5A 4C7FA 2J9ZA 4BKNA 2G50A 5A1AA 1C3FA 1HUVA 2ZUTA 2Y4SA 1DIOA 4DJDD 3TR2A 3IGUA 3SJNA 2GQAA 5C6MA 1FP9A 1DJGA 1V0LA 5LNVA 3QR0A 3NVDA 4QIUA 3OTRA 1XIEA 3O05A 4LV9A 1UKSA 1XYBA 3WF2A 4ADTA 4P8VA 1QI3A 4LRTA 1XJBA 2GGIA 3LZ5A 4O4WA 3UPBA 4HIBA 2BBFA 1QHPA 1SZNA 4LAKA 3WEZA 1D9EA 2EPKX 4KWOA 3BG5A 5F1UA 4ICMA 1DWJM 3WBAA 3WY1A 2Z1VA 5FSDC 2QYGA 1VR6A 3HOJA 4DVOA 2QPUA 4OV9A 1X1OA 3WENA 3H12A 4XD3A 3CAQA 1WCGA 2A0NA 2WM0A 5AHEA 3CYVA 1R3SA 2NQJA 2PCEA 3OQ8A 4PUJA 1GNXA 1X1ZA 3OA3A 1ZAJA 3TXZA 3UG8A 1DJNA 1ODZA 6XIAA 5EGRA 2OZ3A 4WKAA 4AYGA 1OC6A 4FIRA 4EANA 5AC6A 1OCNA 4FF7A 2J8FA 2FVLA 4FXRA 1E0VA 1K7FA 4BR1A 2REQB 3GX9A 1UA3A 3AHVA 1KKOA 3ZXWA 4GCXA 3U2ZA 2PUZA 1OYBA 3RJYA 4PTDA 3FA4A 4N2YA 4MLJA 2PWUA 2OQYA 4NHVA 1B31A 4Y9OA 2PLJA 4B5WA 4LF1A 3B8SA 3SCRA 4QSHA 2YKKA 2C1IA 2XWDA 3OLEA 3M16A 4LBSA 4GC4A 5E5CA 1HO4A 1F05A 1VBUA 4Z08A 4CU7A 3D5HA 5EA9A 5C8BB 2QHAA 4U33A 3MP5A 3HV9A 4DYKA 3B0PA 2HV5A 3L66A 3UNDA 7ENLA 5D09A 4R33A 5KITA 4AD5A 1G9HA 8XIMA 1CW2A 1H1ZA 4PMOA 4L9XA 4XB3A 4IL2A 1BTMA 4YS1A 4F0HA 1ZSXA 2JEPA 2VR2A 3WK0A 2ZX8A 4ZL1A 3LU2A 4KBXA 4L6HA 1B9ZA 5HMSA 1KRCC 1S38A 1VKFA 3VNLA 1WX0A 3C2VA 3VUPA 5CEWA 2QJJA 1UWIA 4KETA 3MI3A 4UTMA 2JF6A 4HNNA 3W1QA 7CGTA 1EPXA 1EF3A 5JBEA 5I02A 1A53A 1OBAA 1F61A 2ESCA 3G1YA 4R7JA 4FNPA 1FWFC 2EKGA 1VYSX 1ZFJA 5IDIA 1BG9A 3USBA 1AL8A 2WANA 1H49A 4CQBA 2DT1A 4KF1A 4Z42C 1EA9C 4N9CA 3GTFA 3D3FA 2YDQA 2PP3A 1FWAC 3H7UA 5CAKA 5BCAA 3CIXA 3OO2A 4MJZA 3P5ZA 2QGYA 3C0JA 4B5VA 1VJSA 2NQ9A 4W9TA 4AZCB 1SZRA 3MVTA 4BQ5A 2VCBA 2XH2A 1OD8A 1DTUA 2POTA 2I56A 2CLKA 2FTPA 2FH6A 5F4SA 1S1RA 3T0BA 4GHRA 4UTUA 3BICA 3A21A 3UXKA 1XLMA 3HPXA 4H7VA 1PX8A 3GG8A 2F61A 2WMKA 4B5XA 2NLIA 3CPRA 1E0XA 3C8FA 2OLAA 4A2RA 4M80A 1TPUA 3PBVA 1FQ0A 4IUGA 3AWNA 3MYOA 4W7WA 3R13A 2QDEA 4DUOA 3WQOA 2HMCA 5A94A 3A13A 5M1TA 4WKFA 3UJ2A 5HQLA 4L4OA 2NSOA 4P5UA 3MWAA 1EBHA 3NEHA 4Q7BA 3LX9A 5A6JA 3GG0A 5JBDA 5JH1A 4O1DA 3W22A 4JQ1A 4B9ZA 1XCXA 4XUGA 3G1VA 4DJED 3GNRA 4LS0A 2QCDB 1OFAA 4AZGA 4NKCA 3ANYA 2YCLA 4H19A 2FZ8A 1DWHM 1TWDA 1H09A 2FKPA 4JIQA 2C16A 1DEDA 1TVNA 2OSXA 3O0FA 3SQLA 1EGVA 4WUIA 1KW1A 2EJ1A 4FO4A 1ICPA 3DYMA 5DQPA 5FF3A 1J10A 2OPJA 4DAFA 4AZ6A 4MTVA 4GO8A 4I7WA 3CQJA 4D6EA 3TK7A 1OVDA 5A95A 1R86A 4Z2LA 1KB3A 3R5EA 4WJXA 1B54A 1IGWA 3VD7A 2W62A 3ZJKA 2B31A 3WFAA 5RUBA 1H5YA 1YTDA 3L7RA 1IEIA 2J6XA 1OADA 4HZ6A 1XX1A 5CG7A 2GDUA 3SSJA 3NPXA 3NQMA 3NZPA 4ZTXA 3GXPA 1XG4A 3W1MA 2E09A 3D47A 1XLBA 2QVNA 7TIMA 4BHYA 3DKLA 2I5IA 4RZ6A 4DJEC 3PZOA 4ZENA 4BWLA 4JQ4A 3BZJA 2JQXA 3N3MA 2VM8A 2C79A 4YTSA 2OO0A 3UQNA 3QLDA 4MWAA 4DM2A 3EOEA 4G1KA 3E12A 2ACRA 1KFLA 1IZJA 1E1EA 1E51A 1HXJA 2PI6A 1W32A 2J66A 1UD6A 1E4MM 4J2PA 4Q8NA 3I7QA 3CXOA 2DZWA 2QW5A 4MFDA 3PTMA 3K1DA 4MDOA 1GZ1A 4GGBA 2VENA 3HO8A 2RKXA 4Y9AA 3KVJA 3OYZA 2FIQA 4MVAA 3H21A 1RUSA 4UOQA 4HU4A 2D22A 3CNYA 3NSNA 4Z2IA 1UC4A 3SM0A 4PMJA 2AQOA 4Y9PA 1S3HA 1WXYA 1EUNA 1DPMA 4D6JA 2R1LA 2GSHA 2DT3A 2CWNA 3VZXA 3TN3A 1G0CA 1FCVA 2OZ8A 2VEPA 3NYZA 3VO0A 2FZMA 1DXIA 1BKHA 1HP5A 4FOKA 4Z1DA 1CYGA 5HJXA 4UIOA 5HNUA 1AZ2A 1KBBA 3P93A 1AQ0A 4M1RA 3M6YA 1B3VA 4H6EA 5HOSA 4YXGA 3BJFA 4A2SA 3V0TA 1EP3A 3ITVA 1SW7A 1UUQA 1XLGA 3L2IA 4NRSA 4O14A 4QTGA 1WB0A 1HF6A 1MW1A 2Q8XA 3NQ2A 4YJ5A 3SY1A 1K9EA 1ZJBA 3KL0A 5A6LA 2C14A 2R1NA 2H8ZA 2NQZA 4MJ2A 1XGEA 3ISIX 3I4KA 5C2CA 4GXPA 3VINA 1GOMA 1JZ6A 1U22A 4F0MA 1E72M 4HJWA 4L56A 3KM8A 1AJ0A 2YZ5A 3QFEA 2QCCA 3L4YA 2NXGA 5HJYA 4H8VA 1Y5XA 2WNQA 3LGDA 1OCQA 1BEUA 2PWGA 1KM3A 1XLEA 3M46A 4XSMA 1Q63A 1FWSA 3KVMA 1J12A 4EKJA 3OVGA 6CGTA 1J79A 2W66A 3I68A 4AZHA 1XFBA 1W31A 4DHGA 4EX4A 1UQYA 4GYFA 3ARPA 1K4GA 3WLTA 2H3BA 1V02A 3R58A 2VR4A 4FIQA 1WZMA 4CGTA 2C8NA 1EO7A 3ZR4A 5AB3A 3P14A 1OJXA 5H6HA 3S46A 4W85A 4C90A 1B3XA 3PK7A 1QO2A 2FQIA 1SYTA 1DXFA 4IIHA 3PHAA 3FKRA 3ITGA 3UERA 1PKNA 3G1HA 4R88A 2Y63A 2E6YA 3W02A 4Q8UA 3WIJA 3FNDA 3AMKA 1OSEA 4HZMA 1NFBA 2EF9A 1GVRA 1OZQA 3GRIA 7PTDA 4B4HA 3ARRA 4M82A 4ZTYA 1A5KC 5G2WA 2QDGA 1G67A 5TQLA 3W1LA 5CPQA 1E9ZB 3O6DA 4BQ4A 6XIMA 4FOJA 4PEEA 2A7NA 2Y8UA 4IFRA 1UA7A 5XIAA 2DSWA 5B7YA 4HK7A 3SRKA 4HHPA 3RM9A 2OKOA 2C18A 4JYEA 1W56A 4GOAA 3M64A 5T9CE 4AXNA 1BQGA 3K2GA 4QQUA 3G5EA 1BRLA 4ATWA 1BXNA 4TQTA 2B7QA 3LCIA 3BWWA 1CI1A 2VRKA 2HWGA 1CLXA 2YA0A 2FPVA 4MOZA 3CPGA 1UMLA 4GVGA 3VKAA 1VBRA 3A4WA 5I0DA 2A3EA 4R85A 4S3KA 2WMJA 1OG0A 4KRZA 3LHZA 1VENA 2I9UA 4WOZA 3MV11 5AECA 5M2FX 1A5NC 3CIVA 2ZDSA 4KMQA 2ABAA 3RXZA 1TREA 1TVLA 3MB9A 4K3ZA 4XAFA 1YTEA 3W23A 1E6PA 4QGCA 5T9BG 5G1YA 2JALA 3TMQA 5G2IA 4ZFCA 4WD0A 3PBYA 1KLYA 3STGA 2W6RA 1O68A 1QPRA 3MMWA 3HN3A 2ZKMX 3R25A 3R79A 3LV5A 2DPEA 2ZTKA 3TC6A 1XV8A 9XIMA 3TOYA 4D6IA 4P7QA 1DKWA 3U0HA 2FGBA 3OZYA 4D6DA 4LW7A 1WUFA 4EWJA 4WJ8A 2J78A 4IMCA 4ZQNA 1JPHA 2PDPA 2C19A 3EDFA 3TE9A 4KFOA 1GVIA 1Z48A 1XBVA 4I7UA 2V5LA 1OM0A 3CQ0A 5CXPA 1NOWA 3LUTA 4UZSA 1TE1A 5CC7A 3UXIA 2IPGA 4IOTA 1H7OA 1ZJIA 2G3NA 3AU2A 4Z2KA 5E1QA 3GYCA 1H7RA 4PUNA 4R3UA 3KW3A 4ZZ9A 5D9MA 2H9AA 2ADAA 3A9BA 3OQEA 1OCBA 2ICSA 5FJIA 1R46A 3L23A 1ZNNA 2D0GA 1XYFA 5XINA 1UC5A 3EWYA 1O60A 3GXNA 1K3UA 1VBHA 2PDNA 3EA3A 3H4XA 4H6QA 3SBFA 3WL0A 1O5KA 4LY4A 4JNZA 1WA3A 3E2RA 2W4XA 1FHLA 1ZQ5A 3LLFA 3N2OA 3CZLA 2E1DA 2ZRZA 3B9NA 3MUAA 3T2QA 4XO6A 1NELA 4QXIA 4MUPA 1TA3A 5HA7A 3TU9A 1J0JA 1GWJA 1GK8A 3JW7A 3EAUA 8CGTA 3WFZA 3G0UA 3HF3A 3KVKA 3N2MA 4LBRA 1EHNA 3IWPA 4J7RA 2YCLB 3IAPA 1WAUA 3O1NA 1US3A 3AYRA 2JFEX 5CSRA 5AYYA 1ZL1A 3EX3A 4JAWA 4R9XA 1KM0A 1XI3A 4NX5A 2DIKA 3ZS4A 1F5ZA 4JD4A 4MZ8A 4AW7A 2PDHA 5LZLA 3VGDA 2ZADA 1KBIA 2I57A 1BVNP 3WEMA 2WCAA 3QPYA 4LY8A 3EX2A 1F3TA 2DT2A 2BY3A 1YDOA 2Z7KA 3LCLA 3NDOA 4O53A 1QU4A 3NQ6A 3EMZA 1LM1A 2JK2A 4UTJA 3IV3A 2VDIA 4H00A 4O0QA 1ZY9A 4DF0A 1T8XA 4UTHA 3H8AA 3QM3A 3TC3A 2DZVA 4JN8A 1G01A 1Z44A 4B5NA 4GUJA 1ZBCA 1ITQA 2G95A 4C91A 3ZT6A 3VXGA 4DUVA 3PUDA 3FJLA 4Y90A 1JUBA 2PGWA 4TV5A 3K4AA 4GQBA 4URIA 5FD0A 2NQHA 1V6TA 2E8YA 1JCYA 3A9IA 1HFBA 4OE7A 4WDTA 2XPKA 4MWAB 5BOFA 1EC8A 1GORA 3VX0A 3DGBA 5D9OA 4I8YA 1UD4A 2OYKA 3S1XA 3LNMA 2P3ZA 2AOSA 1V6UA 3OBEA 4JIEA 3Q67A 2WWDA 3GNDA 3VZYA 1WDPA 5C9WA 4CCDA 1GQLA 3CS2A 3T6CA 3S1GA 2YL9A 4TVUA 2WWCA 3HPFA 2Z26A 3BLIA 1Q6DA 3TN4A 1WQ5A 1A5BA 3GAKA 2E25A 1NJJA 2YFNA 4M3PA 3WD1A 5DRIA 3VE7A 1UCWA 2VUYA 2XIJA 1R9ZA 5C0QA 3AMDA 2I5GA 4HN8A 2HROA 3LMZA 1O95A 3W86A 3L2MA 4H6RA 5DFAA 3UR7A 1Q4WA 4DUXA 4JX4A 4QLJA 3HQOA 4JTQA 3KHDA 3OOQA 4LC6A 3M5YA 2J9YA 3BLDA 4QE5A 2VX7A 4CQ9A 4H9MA 3IS4A 2YBVA 4H04A 4AC1X 3EXSA 3QF0A 3WH5A 2Z2UA 3C52A 3BLFA 4G9PA 3G1RA 1XYZA 5BXSA 3UF9A 3TSDA 4JYDA 1V93A 2QJMA 2QCLA 4KCUA 4LQ1A 1W37A 1J5TA 3L2LA 3BL3A 3TJIA 3EX1A 2G41A 3OLIA 3MS8A 4CNNA 1BXCA 1BQCA 4BF5A 1SFLA 2UWFA 1SJBA 2I1OA 3GR4A 1J9YA 4IX0A 4CQCA 4WF7A 1W1IE 1H61A 1R85A 3QHOA 1E9LA 1R30A 4ACZA 1U2YA 4JCMA 1YIXA 3R89A 4UMBA 2YBTA 1QW7A 4U2YA 1E6SM 2P8BA 2DZAA 1ISZA 1RH9A 1ME9A 5DXXA 3DYOA 4JHMA 1KM4A 3AFBA 2VVSA 3K4WA 1MUWA 3MY9A 3NOYA 3VKDA 2Q02A 3WLQA 1LWJA 2CBIA 2ANUA 4GE8A 4JFSA 3ZWSA 1U33A 3LRLA 1AJZA 1YNYA 4HTYA 1ZU8A 3VNZA 3LPFA 3TYDA 3M0IA 1UHVA 3BCDA 5I09A 2W91A 3FHAA 3KWXA 3P60A 4G6CA 4WXYA 3N19B 3MYPA 3VGHA 1DWFM 2HPIA 2D69A 1MVYA 2PDWA 1I6NA 3UA3A 4DO4A 5KZEA 4B5UA 2PDFA 3ALFA 1S1PA 1NFGA 2VCAA 1P6CA 3EXRA 4K2SA 2Y62A 3TJLA 3PUEA 1LBFA 1EJXC 1UKPA 3THUA 2WNZA 3E6EA 1NDWA 4NAFB 1WKEA 3MMUA 2BP1A 4EVZA 2WAGA 2A3LA 3H7VA 3M0VA 4XX6A 5E0FA 3S6OA 5IXEA 2V2DA 1BRLB 1BGAA 4UXDA 1C8YA 1VFMA 3BLPX 3VNJA 4RR4A 3L4ZA 1FDJA 1EJTC 2Q09A 3BSHA 4F9JA 2HNEA 2PC4A 3LHTA 4NT0A 3N2TA 3HV8A 2BOGX 3RCNA 5I3JA 5PTDA 7ODCA 2QV4A 1TV7A 2NXIA 2WKJA 2YX0A 4C6LA 2YW4A 2WVVA 4B15A 3EWXA 2F2KA 4YYFA 5C71A 2QCMA 3DI1A 3TYEA 1YEYA 3LMYA 2HBXA 4TO8A 4Q4MA 2AMGA 4HHMA 2XM2A 3IJ7A 1FH7A 1RCOB 2XGZA 3ZVIA 1W9UA 5XIMA 4DBSA 2OR2A 1P6BA 2EPHA 1CZ1A 4HNCA 1UWAA 2DJLA 2FYMA 2OEKA 3BOLA 3OIHA 1OK6A 2LLEA 3GHTA 2A2IA 1RQBA 3BCFA 4GUHA 2X1RA 1DIDA 4I5RA 3RM8A 2QCGA 3TZNA 1U30A 3T4WA 3B03A 4O13A 3WMSA 2PS2A 5D32A 2ZZ5A 1TVPA 2WHJA 2WMFA 3WF1A 3LCHA 3U8GA 1TWZA 3CBWA 2ZUNA 1VBJA 1EEPA 4DO6A 3G8RA 2ZVIA 4DZIA 3ME3A 3EGJA 3IJQA 4MYAA 2ACUA 4U31A 2P3EA 3AIBA 1UH3A 3W87A 3VD5A 4NX0A 4HU3A 5HNTA 3JU2A 4R27A 2ZE3A 5AYXA 3BE7A 3IIZA 3QQWA 4AZ5A 2AGTA 1QVBA 2VOMA 3C2YA 3KCJA 3Q65A 3R10A 2CKSA 2J62A 1JAEA 1O7AA 1I0DA 1MZHA 1UP0A 5E0CA 2V2HA 1R3TA 3GFXA 5AC5A 1NY1A 1VEMA 2GJXA 1XYLA 4G2DA 3O06A 2FZBA 4PMQA 2EKCA 1D3CA 2PURA 5U4NA 3BLLA 4ASTA 1VD6A 5CZJA 1P1MA 1FY6A 4M29A 3GNXA 1W5OA 2A6LA 4TOQA 5IHRA 4LBUA 3BO9A 1QW9A 1JG9A 3RNDA 2VXNA 1XH2A 2V82A 4PBFA 4Z1BA 4EP8C 1SMDA 2V6AA 4AVFA 4E0CA 2X1IA 3EOLA 1R2SA 3R0KA 4HJFA 1JGIA 4BCEA 1HJXA 3OGRA 2CU0A 4LEFA 4ZSTA 2R82A 3BURA 1BAGA 2CLPA 2VZUA 1AZ1A 3S42A 1RHCA 4JIRA 1IXPA 4FK9A 4DWSB 2E8ZA 3CWHA 1JRBA 3LRKA 1IWBA 3W00A 4I7VA 3BARA 4P7LA 1BXBA 4E6MA 2VOTA 1VCVA 3CQHA 4CD5A 4O17A 1N8WA 1K1DA 4EAMA 3WD4A 3GG1A 1VBGA 3SW6A 2ZVRA 2NV9A 3B8DA 1W6TA 2E0PA 4FF5A 4L7ZA 1XRTA 1ZB5A 4Q8OA 1OF8A 5CSUA 2V63A 2E77A 3S6DA 3UJFA 3TN5A 4J3ZA 3ABXA 3BJTA 4HPHA 1XRSA 1WBJA 4J2MA 5J5RA 1TV4A 3IAQA 1CXHA 1JD7A 1UWSA 4DZAA 4U5IA 3P5YA 3WNLA 3HG3A 3UY7A 4JN7A 3ZZ1A 3RLUA 6PTDA 5FF7A 1SSDA 4RE2A 1RA5A 3L0NA 1GKQA 3KBNA 4WDXA 3UD6A 3AXXA 2DZSA 2C3ZA 1VLWA 3H23A 1A49A 4AWEA 4G1NA 4B5TA 3M7SA 2Z00A 1JCLA 3VIJA 1DE6A 4Y6GA 1OG6A 2VX4A 3JZUA 1KFEA 3AMCA 4GACA 3G1DA 5A6AA 3LXBA 4F3HA 4C60A 4NAEB 4GVFA 3DU0A 5U7SA 4W93A 1LYXA 1RBLA 5TAOA 2VEKA 4E2VA 5FL0A 1EJ7L 1LLWA 4CD8A 1QATA 3IRSA 4GRSA 2RGMA 1TJ2A 4S1FA 4OBRA 3VGEA 1LBLA 4BEUA 5DY3A 4C6EA 2PWFA 4C1NB 3KTXA 2V69A 3HG4A 2Y7EA 1QFEA 4Z2GA 2DQWA 5BWFA 3QMTA 2VEMA 3SRFA 2PDXA 1SO5A 2R8WA 5BZAA 1JNDA 2VC5A 4JNYA 4DXVA 2GJNA 1E9IA 4JTKA 2X42A 1W2PA 5HINA 2PRHA 1A5MC 1JXKA 1MYRA 1RK5A 1TUFA 2OQHA 4ACZB 1SFTA 4U5KA 4A22A 4Z1AA 3LK6A 5ABFB 4AYSA 3WJXA 5GJMA 3EX6A 3ZT7A 4QG6A 3U9IA 3I7RA 2WJDA 2E4TA 3BCJA 2FZ9A 2OJPA 2BTMA 5FJRA 5JXQA 1SSGA 1C8VA 1BKSA 4JY8A 3VKKA 4GBUA 1R0MA 2FTWA 4A3UA 1Q6CA 6TAAA 1MXDA 1WO2A 4NSBA 3JVAA 2CW6A 5TBOA 3GW0A 3AI0A 3W2JA 2BWGA 4IP7A 2YLAA 3EX4A 1ZBWA 1JZ2A 2X0YA 2PTWA 4E3VA 1VFOA 4MMWA 4JNMA 2EPLX 4KWVA 2INEA 3K30A 2PP1A 5A2CA 1MMFA 1XBXA 4WKHA 5BRQA 5A6BA 3GTNA 2BNJA 2QCNA 4EPBC 1BVZA 4IL0A 3W83A 4I9JA 1XC6A 1IEWA 3H2MA 2WZIA 2Q3RA 1TIWA 3EB4A 3H2OA 1K9FA 2E7FA 4J3VA 3P6LA 2BXZA 1WXZA 1JF5A 4I5XA 2PRLA 3IJLA 1U1UA 3F4NA 4DF1A 1TZZA 1AFSA 4RKAA 2WSPA 1PB0A 2FGZA 4YVXA 4M51A 1F3XA 2GVLA 5AC8A 4KGJA 2VURA 1QXLA 1J96A 1TPVA 3CU2A 1DJWA 2CLEA 3CT2A 4YMZA 4NJKA 4HHLA 4Y2WA 3BAYA 1N55A 1YADA 2WVVB 4INFA 3MSYA 5DLCA 1PCWA 4PCSA 4ERGA 3WK2A 3W1RA 3GD6A 1I2OA 3VIMA 4AG0A 1EJSC 3UWYA 3OVPA 4MB5A 4RNFA 1GVOA 1AMYA 4Y96A 3CZ8A 3FYOA 1MUMA 4AX7A 1GOWA 3K8LA 3UFYA 3E0FA 1SU5A 3POCA 3CB3A 4A21A 1A50A 3MU7A 3MHFA 1O5RA 4QLKA 1OB0A 1UR3M 1XYCA 1J0KA 2PDIA 3HG5A 3ITXA 1E73M 2HXTA 2VGFA 1WDDA 3WD0A 2ZC1A 1AJ2A 2WBKA 2IW0A 1AODA 3B8IA 3TW9A 3OGSA 1UZ1A 4KESA 3ZMRA 1W3JA 2FPTA 4HGXA 4WIWA 2GGGA 3T8LA 1OEPA 2G8ZA 2V67A 1VCGA 1EGZA 6A3HA 5HBFA 1IWAA 1XICA 3BQ5A 4S3EA 3WNMA 1D7FA 1JZ3A 2BY0A 3EOSA 3RILA 4AZ7A 5C9RA 1LBMA 2VYOA 3U2OA 4B3ZA 5CZTA 1OFDA 1R7OA 2XN2A 4HPNA 1REQB 1FVPA 3UESA 2HE5A 4ZOEA 3LOTA 5I3DA 1BD0A 4FMVA 3PVFA 3N04A 4JKLA 3SCPA 1PZ2A 3A6OA 4R9OA 3T08A 4KT2A 4S2BA 1X8FA 2NW0A 2YA2A 1JDCA 4J28A 1ZS2A 2BY1A 1KD0A 4JPGA 4KEMA 1E55A 1V6WA 2GJXB 4PRWA 1IZCA 3W1TA 4JR5A 4E4PA 3NA8A 1OX4B 5JQ9A 2B0MA 2DQXA 4AEOA 1WOBA 2VD8A 1EO5A 2VEIA 3O07A 4LUSA 2FB2A 4IF2A 2ZZ4A 3T0AA 4UFLA 4J1OA 4YVVA 4NZ3A 3B04A 1P4CA 2AAAA 3VUSA 4FLOA 4IJCA 4LOCA 5CKSA 2G3MA 4NIRA 4LWWA 4AWTA 4FPSA 5GNXA 1K77A 2D3LA 4KFPA 1BFNA 1QWKA 4MG4A 3CUJA 3ATZA 3W01A 1I2QA 3TFCA 1ISYA 2VHLA 1EZWA 3CMJA 1VJZA 1VS1A 3UCQA 5G4HC 3LPOA 2FTYA 3PS7A 4DO7A 5JVLA 3P62A 3W76A 1E5NA 2GZXA 2W5FA 1TPH1 1WXJA 1HJQA 2C0HA 1P48A 5A69A 3P81A 2V5DA 1IIHA 3W38A 4D8LA 3U7BA 2IQ0A 3N12A 4GX8A 3WLLA 1PHWA 4O1EA 2WZMA 4A4AA 5A8PA 1UD2A 5FJTA 4AEEA 4O19A 3S1WA 3BK0A 5L9FA 1I0BA 3PSWA 4BF7A 3SZ8A 2J88A 4Q32A 1OT2A 3HJZA 1FKWA 4ATDA 2XIMA 3W7LA 4ERIA 5FOOA 3VKJA 5MKGA 3SGUA 3K8KA 3ZLHA 2XH0A 4GFSA 1N2VA 1M1BA 3ABOA 3WQVA 2EBNA 3N11A 2VD9A 4OHQA 1VJIA 2PP0A 3F5JA 2ZYFA 3LQGA 2E9BA 4QDPA 3Q4DA 4MKNA 3AJ7A 2GFTA 3B4YA 3IGHX 4GO9A 1V3HA 1BYBA 2CXEA 1LRQA 4M6UA 3AS2A 2XIQA 3AXMA 5H8UA 4UTTA 4K37A 3A12A 1W9VA 5M3WA 1QNSA 1H62A 3NGJA 3KBVA 3PJTA 2OELA 2ZWZA 1E0TA 1TTQA 5CPOA 4ADUA 1XIFA 3T55A 1JULA 1W9PA 2ON3A 1GW1A 4BQ2A 2BGQA 4OV4A 3KOWA 2C91A 3KBSA 3QC3A 1JCNA 1FHDA 2A79A 2Q71A 3MDUA 2ALDA 1VQTA 3W75A 3KZSA 1OZMA 2ZCGA 2DU2A 3WX7A 1ELSA 3WLRA 2AL2B 4H8NA 4KW2A 1E6NA 2X09A 4D9PA 1LZOA 4ROPA 1VFUA 4RE4A 3TROA 4S2CA 2XGIA 3W1AA 4DIAA 4WR3A 3LA4A 4WY0B 1UWTA 1AW2A 5K4XA 3MT1A 2FZNA 5A8MA 4AH7A 3H26A 1POJA 4CQ8A 5K2ZA 3V18A 4PEKA 2HISA 2QDDA 1YYAA 4J3XA 3TMLA 1I1XA 4MY1A 1NSJA 3BPWA 2NUXA 5GVJA 3N13A 3A47A 3N29A 2GJLA 3LZ3A 2IQDA 3EXTA 1PTDA 5E6YA 4OBTA 1IEXA 5EPDA 2NX9A 1PX3A 3MKCA 2PEVA 3EPOA 4AHPA 5ABGA 3UZYA 2Z24A 2QMJA 3MP4A 1QNRA 5GNZA 3ARVA 3AROA 3SR7A 3TIMA 4TXEA 1E15A 3E0WA 4PMVA 4KPLA 1XGDA 1ALDA 2NVAA 3MKVA 1BVWA 1VB9A 2HNHA 4NJGA 3S47A 4X9YA 4W4QA 1GKPA 3S2CA 4DLMA 4FI4A 3GVGA 3TH6A 4AWUA 2Y7DA 5GPRA 3QKEA 1S2WA 2A21A 4GXMA 1H11A 1PZ3A 5KMYA 3KP0A 4IJBA 2PMQA 3G1XA 3B3DA 4C6JA 5HWNA 2QQ6A 2QPXA 5A3HA 1RJQA 4PGLA 4S3CA 4H01A 2QJGA 3M1ZA 3W7MA 3W7CA 2P0IA 2QF8A 4LS1A 3MW7A 4Z17A 3VDBA 4RDZA 3ITCA 2CZ5A 2ZRWA 2QMKA 3QPZA 2XSXA 2Q8ZA 3EKGA 4L65A 1GGOA 1XD1A 4S39A 4GUIA 2VFHA 1ICQA 4KWUA 2OWWA 5I06A 2GQ9A 3UJRA 2Y5JA 3EMCA 5AZ1A 2BHZA 4H6KA 2Z1KA 4X0NA 5DF0A 1KCXA 4MLRA 3WQ4A 2IKIA 2V68A 1N8FA 1M01A 3GLCA 5I6SA 4MUZA 1P0NA 4Q8TA 2J24A 1TPDA 3N4AA 1Q5MA 3MJMA 4I9MA 3GC5A 1M04A 1XUUA 2R1MA 2WSKA 4JGDA 4RDVA 1A4LA 3SN1A 1U1JA 3O6CA 4WHBA 4H3DA 3S5OA 4UNLA 2WXDM 3N14A 3T0TA 4DEFA 1SW3A 4M81A 4IQEA 1JJKA 3S9IA 2NXHA 1RVGA 2DZUA 3CK5A 1PX4A 3VIPA 4Q4KA 3WMLA 1GOQA 1G5AA 3MC5A 1W1VA 1QNVA 2PWEA 5D02A 3E49A 1G4SA 2WM1A 2EG7A 2Y7GA 5HANA 1B5TA 4EK7A 1TJ1A 3FK4A 3KLLA 4QJ4B 1DV7A 2ZIDA 3BANA 3F5LA 1Q45A 3NQVA 4JYFA 5LKYA 4N9BA 3UWWA 2P8CA 4I5UA 3PZVA 3CZEA 1SVDA 4MDPA 1PDYA 3ECQA 3IJ6A 4NJJA 5LA0A 3N9RA 5FAGA 3ITYA 4AB4A 2G37A 1QOXA 3LGGA 4V2XA 1M03A 2ODOA 1UJPA 3WDIA 1ZRQA 4JICA 1QI4A 3ABRA 2FMNA 4TU1A 3F4DA 3MZ2A 3CC1A 1KBLA 2BGNE 3A64A 4M24A 3R6IA 3LERA 1KXVA 5KEZA 1VHCA 4LV4A 3M0YA 3O8AA 1V3LA 3W53A 4A8LA 4EIVA 1B1YA 4QP0A 2XVNA 1I1WA 4N02A 3P7YA 3G6LA 3SRDA 4G56A 1HKWA 2D2HA 4GI6A 1AQMA 4L4PA 3GQYA 1VGAA 2HS6A 3GG7A 2YL8A 2FPYA 1QNQA 3TWAA 1LRNA 3QTPA 4L9YA 4NJHA 1F3EA 2TODA 4YWSA 1TMQA 3ELFA 3ANVA 3OZMA 3UVIA 1JQXA 3KBJA 4HOWA 3TSMA 2CLMA 2PB1A 4GIYA 4IIFA 3WDPP 3RLVA 5BROA 3FEMA 2O55A 5JIPA 4RE3A 3DHUA 3M6DA 4TV6A 1OX5A 4IQJA 1H5VA 1PZ0A 1YDVA 1SO3A 1VZWA 2VC9A 3WQEA 4I9AA 5ABHA 1CGYA 4HK5A 4EAYA 3TYUA 1XIHA 3G3DA 2WZHA 4UR8A 4UNIA 2OZTA 4ZOCA 3IV8A 4XUYA 3GDMA 3P74A 2RDTA 4TIMA 2CLLA 1A5UA 2QR6A 4LUIA 4IMGA 5T91A 1GOOA 3P0XA 3K5XA 1XRFA 3UW6A 1QOPA 3KZPA 4AUBA 4JTFA 4JS3A 1GT8A 4MM1A 1XLAA 2VEFA 3PWGA 4A6GA 4PCFA 3SIMA 1H7PA 5ABEA 1FUYA 4BQ3A 3WSUA 1XLHA 2RFGA 2XUCA 3UPMA 4QISA 1W54A 3VMNA 2J7EA 1W5MA 4WXZA 3W7EA 4H9TA 1LROA 1VPQA 3ARWA 5MKGB 2WYSA 4XZBA 4GNJA 1KM1A 3GTXA 4LCQA 3FJ4A 4PL1A 2DZTA 3QGVA 1N8IA 2D20A 1AD1A 4H41A 3DN5A 4NZJA 4JOMA 1PZ1A 2JIEA 1ME8A 2Z6IA 2HZGA 2FDMA 5D04C 3DHPA 2E1WA 2A3HA 4K1WA 4DNMA 4K8EA 1JPDX 5FF4A 1OFOA 1A5SA 5G1TA 2CHNA 2ATSA 4DF2A 4Y8FA 3WF3A 4B2DA 3B9EA 3F5KA 1S39A 2O9OA 3H2CA 4Z0JA 3C86A 3REQB 2NWRA 1SFSA 5LNWA 2ACSA 3G1SA 4W89A 1UZHA 2NSXA 1PV8A 2ZUMA 3EPNA 1B57A 2REQA 3CUXA 2JEQA 1C93A 1LQAA 2W79A 2XH4A 3F4CA 1HIZA 3VGFA 1GQJA 3MQTA 1W2VA 2ZZ1A 1PUDA 3BGAA 1L8PA 1FOBA 4Z2HA 1CBGA 4JEQA 3NUKA 3UZZA 1KWGA 3PM6A 2RDXA 1QPQA 2E6AA 1T99A 4UTWA 1FDYA 5KZMA 4LS2A 3A5VA 3EEZA 1WDRA 3BGJA 1WOAA 1QAPA 3B06A 5CLTA 3C2EA 4JX5A 1TSIA 3NO5A 4UCFA 4PR4A 2NX1A 3ZVHA 2QUMA 1ZP4A 5LXEA 4MNLA 4XZWA 3R8HA 1TCDA 3EWUA 1S2VA 1US0A 1JNEA 4XO7A 1GONA 5E0KA 1XSKA 4DBEA 1DWAM 4Q4RA 3RU8X 2E6FA 3LM7A 3CQIA 2X0HA 1EWDA 3AQUA 5AYZA 3TNBA 3BAIA 3I6EA 1YQ2A 1J18A 1YPXA 1FWGC 1XLIA 1KQYA 4CCZA 4FLRA 3PF3A 3XISA 1W5PA 1ODUA 4H7ZA 1HX0A 3LHYA 4ZQPA 4CNPA 4FXSA 1P6WA 2HVMA 3RX2A 3O6YX 4UNKA 4UQDA 4MY9A 2D1ZA 4RXFA 3BLKA 2GJRA 3C2FA 1VC4A 2H90A 1OFBA 4PTXA 4W86A 4F2BA 2C13A 3QW4B 1ZTVA 1O1ZA 1V77A 3KFTA 3TCSA 1PTAA 3QTGA 1B3WA 3NDYA 2R6OA 2VNCA 4JDBA 3TEVA 1R9XA 1J6PA 5TD4A 3L68A 2ZOXA 2DUXA 1IEVA 3S1UA 1TPWA 3GUGA 3JZEA 3ARZA 4ZOAA 4NILA 3IIVA 4HCLA 3B0XA 1FTXA 4JTJA 3DC8A 4A05A 4NYUA 5CPMA 1R2RA 2HK1A 3U5YA 3KCLA 1FWBC 1SFJA 2OX1A 3DXIA 3GWQA 3GVWA 5C2XA 3DG7A 3VIIA 3RLGA 3CL8A 3JRKA 2QCEA 2BVYA 4M0XA 4WY0F 1DIKA 4UBPC 3V4BA 1T0OA 2RUSA 2WSYA 5LNUA 5JU6A 1H0GA 2QEZA 4MHBA 5FACA 4GYPC 2YB4A 3SN4A 2Z25A 1Q8AA 3LI1A 4NZ4A 4V27A 3MZNA 4OJYA 1KCZA 5A2BA 4H9ZA 5I03A 5F4WA 2WHKA 1V3JA 3PP7A 5I00A 2ZBTA 2KAUC 3A3WA 3PY2A 5D05A 1EL3A 4H1ZA 1D8CA 3I6RA 5FESA 2DJXA 2O9RA 3B8TA 2DW7A 3QJAA 2NLYA 3MMTA 1MDRA 4MGGA 2IXVA 2KX9A 3QY6A 1C9WA 1V0MA 2CKRA 4GD0A 2YL5A 3Q94A 4A29A 1BYAA 3QBUA 1SJCA 2VELA 2RDUA 3RITA 3GHRA 2X2YA 5DT7A 1DHKA 2CESA 1JIBA 1BHGA 5F1VA 1RLDA 1XP3A 1TZ7A 4P61A 2O56A 4E38A 1RPKA 3DOPA 5LHFA 4J3SA 1KWKA 3QGAC 2ZZ3A 2OEMA 5GJPA 5HK4A 4JTUA 4E4FA 5HNNA 3R94A 1IT0A 5LHEA 3SSZA 1C29A 5CG0A 4RK8A 2O4MA 3SQSA 1M6JA 4YU1A 1NQ6A 2XM1A 4Y9NA 1ADOA 4M5PA 2OG9A 4ZQMA 1LT7A 3E0VA 3WYZA 2WVTA 7REQB 1CCWB 1NTHA 4HD5A 3R8GA 3AAMA 1EX1A 5DMMA 1ONWA 4ICNA 1HJVA 5M5DA 3PR2A 4CQDA 4F79A 3PJWA 4MZ1A 2X8RA 1DTNA 1V6YA 1KXQA 1JXJA 1XC4A 2WC7A 1M65A 1Q65A 1RP8A 3UG5A 2W0UA 4QITA 2QGHA 4IFKA 2E5DA 3UG3A 3W7GA 2W92A 2CZFA 4MNJA 5HXMA 4D72A 4PFMA 3NXFA 2PTDA 2XG9A 2QUNA 8RUCA 1CXKA 1RD6A 1XIGA 3HJEA 4DLFA 2CZDA 3PZMA 4C6PA 3AMGA 4RL3A 3G2GA 4PN2A 4NNAA 1PL9A 4Q7IA 3RR4A 4UFIA 3FXYA 5HAOA 3W2MA 4PUUA 1E3XA 3EWBX 3T07A 5CC5A 4S3GA 4HOZA 4H7CA 3VGGA 1SQ7A 4FOUA 3VOGA 4V1XA 3QLLA 3W7RA 1MEHA 1XLCA 3H4WA 5C54A 3BW4A 3UYIA 4MFEA 3V5OA 4RPPA 1Q2SA 1FP8A 4DXKA 5D03A 2E40A 5AYBA 4H2CA 1X97A 1F7BA 3IJDA 3BJSA 2ACQA 1Q66A 3GK0A 3QZEA 3W6MA 3SUUA 2PSNA 3RCYA 4LUYA 1W91A 4ES4A 2I5QA 2OKTA 4H4IA 4DXXA 4L5ZA 2V9DA 4NASA 1PKMA 2V5JA 1H50A 4KIRA 3ABQA 1M7JA 3EKLA 4O28A 4OZOA 3AALA 2Y5SA 3KRBA 1WE5A 4FX8A 3WD3A 1DOSA 4BEQA 1LP6A 1G4TA 1U5HA 1IGSA 1E1CB 1W3NA 4BS0A 3CTTA 1B9BA 3QVQA 2Y2WA 4JTHA 1HW6A 2CNCA 2P10A 1K9DA 1JCTA 4JTDA 3K13A 3VKBA 4JKKA 3KBWA 1CGXA 4GY7A 1E3ZA 1TMHA 2QJHA 2AAMA 5I2UA 3EWZA 1VFTA 3PZNA 3T2PA 3NCOA 4PFHA 1LL7A 2WJZA 4LGXA 1XHGA 2XIBA 4PTWA 3S5YA 3F2DA 3W1XA 4L1XA 3NTYA 3I3EA 4RNIA 1EYWA 1GZJA 2GDVA 5CC6A 2P1FA 1D3HA 3QV7A 3WBYA 5LIKX 1W1ZA 3CUIA 3QHMA 3AIRA 3BMVA 2XGBA 1J5SA 3GR8A 1XQLA 1XLFA 1RVKA 1GHSA 4S23A 5A8OA 5D2TA 3BSGA 4XAZA 3BOFA 3CH9A 4MKVA 3N15A 3DKJA 3KOYA 4CVWA 4B3LA 3M5ZA 3VIGA 1HQTA 2BODX 1X8CA 4US5A 4MAVA 3UPWA 2XFRA 2J25A 4O50A 4NY2A 1X1NA 3YPIA 3NAVA 1KTBA 1SZEA 1GQNA 1KQZA 4IMEA 1WDQA 3ZVHB 3SECA 2Z1WA 2CBVA 4Q4OA 4PMUA 4F40A 5FJJA 3MSGA 3L21A 2ISVA 3OIXA 3S4TA 1UR8A 4R7OA 3DZ1A 3SRHA 4QE1A 3NZGA 2AKMA 1EC9A 1UG6A 4C5YA 2XN0A 4IZGA 2PTXA 2XTKA 4DJFC 4F2TA 2DSKA 4RE0A 2VZSA 5FSEC 4BK9A 1CNVA 1WDWA 1ZCOA 1QOQA 4YTTA 1SJAA 4ZXLA 3DECA 3C0SA 2VZTA 1Z8AA 2CLIA 3HBLA 4IPIA 4O4VA 2QLYA 1KXTA 1E40A 1FH8A 4ZEPA 4MWAD 3TDFA 1TWSA 3WNKA 4W8BA 3ORWA 3DAQA 3C2OA 2WMGA 3MHGA 4GUGA 3NQ7A 3W1UA 2J7CA 2G5WA 4F0RA 4YN5A 5FIPA 4NQ1A 5C70A 3RMJA 2OQLA 2DEPA 1ZGDA 4B5SA 3NSMA 4DQWA 1RY8A 1F4HA 1TPB1 4S3BA 3SGGA 3PAOA 3RPTA 4XIAA 2HJPA 5LNRA 1E4IA 3GU1A 2YYUA 3MI2A 2R24A 3E38A 4DRSA 3W84A 2OOGA 3E2QA 4KIEA 1HVQA 3RO6A 1KGXA 3TWBA 5HNRA 1R2TA 3W88A 3FCPA 2ZRXA 2TPSA 1AUSL 2IS7A 4OQVA 3FDKA 3WBEA 1K9TA 1YXYA 1Z6KA 3ZJ8A 5BXRA 2TYSA 4P7NA 3BW3A 4BWLC 4GI8A 4C6FA 4WGHA 1V4YA 2IMRA 3BMXA 1XKJA 4MWAC 1YKWA 4PRTA 4DJFA 5D8WA 1HL2A 2ZFAA 5D4YA 4GZIA 3S8HA 1EA0A 4GIAA 4YLWA 2FB3A 3OODA 2INZA 4MAZA 2E3ZA 3C2RA 4N4PA 4X0VA 1W3HA 1R3QA 5A8NA 3L67A 4J3TA 2PDCA 4PYSA 2BZNA 4J3WA 4L61A 2I17A 5LGZA 4U2ZA 4UZUA 1XYAA 1X96A 3DFOA 4GC3A 2R9RA 1VIWA 3BAXA 4YHGA 3CZGA 3UG4A 1G4PA 3R8RA 2V5KA 3MUZ1 1R8LA 1GCYA 3HPSA 4KS0A 3URNA 1ONRA 3D3AA 3ZR6A 1KCLA 1NWUA 3BV7A 1CEOA 3C3UA 1ZZMA 4QJ3B 1ADSA 3IGSA 3S2LA 5I24A 1UR9A 3KS6A 4GX9A 4FZIA 5LIYX 1Q2RA 1UWRA 3IUDA 4L1GA 4D6GA 1HKJA 1JFXA 2WCSA 5CZKA 3NWRA 4QQ3A 4HOXA 4BA0A 2UY4A 3T81A 1UH4A 3WJWA 3AIVA 4JEJA 4WK9A 2G4FA 2HRWA 1F9CA 1LORA 1JI1A 3SCOA 4HA3A 1J4EA 2XIIA 3OHMB 2UBPC 3IIOA 1TV2A 1SMAA 5D9PA 3KLKA 5FEXA 1V51A 2X16A 3NYDA 2PFHA 2HCVA 3NQFA 1NVMA 4EPKA 3NXLA 3WZ0E 3AIQA 2QZRA 3GZAA 1EUAA 1BF2A 1PIFA 4R34A 1LJYA 2XWEA 4IFKB 5B7ZA 2GVGA 3T0DA 3ITLA 3M0XA 5AN7A 2WZTA 4GCAA 1NIUA 3BLEA 3ZOAA 4U28A 2JKPA 3FSUA 4HVXA 3VIHA 4MNMA 1KRBC 1R3VA 1UD5A 1WV2A 4ZO9A 4NJIA 1IT7A 1EBGA 3MKKA 1T7LA 3MVIA 3HPAA 3CHEA 4IUOA 1YW1A 3N73A 4IFOA 2YCJA 4LNCA 4QS6A 4EACA 4A8NA 1GG1A 2PD9A 2BY2A 3VKCA 4HNUA 3VD4A 1L8NA 5F2GA 4NNBA 5I77A 1E6QM 3NVTA 1A5OC 4C65A 1JCXA 5TNVA 1B4EA 1PYMA 3CV6A 1EDQA 4MNKA 2DVUA 1VH7A 5B80A 4PODA 2YDSA 1WP6A 3CIWA 2JE8A 1AG1O 1CXLA 4LH8A 2J7BA 1A4MA 4M7TA 2Y6ZA 2VRQA 1HP4A 4PTNA 3KRSA 1R38A 4GQRA 1OK4A 1GKRA 3TCEA 4I6KA 1S5TA 4LUTB 3EPMA 3M4HA 3MDWA 5F2MA 1W1YA 5F7UA 4QRNA 4WEVX 2DSZA 3QV9A 2VRJA 2NV2A 3RGTA 1S46A 1ZBVA 2YJQA 4DBUA 1MXGA 4WLCA 1SZFA 2Z1XA 1XIIA 2C1GA 1XIMA 4YWIA 3DESA 4ZB2A 4UMAA 3VCNA 1UPMB 1QW8A 4OU1A 2Y89A 4EXAA 4ZO6A 1NDYA 4GYKA 4MY8A 1AVAA 2JKAA 3R11A 4P7OA 3TN6A 1BG4A 1TCMA 5GNYA 4XAGA 2OEJA 1Y5VA 5T8GA 2EPOA 4AZBA 1LG2A 3NL6A 3R0DA 3EKZA 1EDGA 1D8WA 4ZVJA 3LV6A 3MV01 2GUBA 4HKPA 4MZYA 3VX1A 3KAOA 1OABA 2MNRA 4JTSA 4LF2A 4Q4SA 4ZBCA 3T0CA 1CB7B 3CZJA 1UH2A 1OF6A 1TX0A 3WO8A 1KA9F 4DUWA 1RCQA 1ZALA 4PSPA 2VFGA 3VFLA 4FNTA 1V6XA 4RV3A 1KRAC 1BPLB 2J9XA 1CGTA 1CGWA 5CSYA 4O12A 4HCDA 1ONXA 3CHDA 1TJPA 4F0SA 4G5DA 1W3IA 1MW0A 3ZJ7A 4JDYA 2ZA1A 1CLVA 2Z1BA 4EF9A 3VMOA 3LD5A 4WCJA 4HPJA 1M7OA 1QCWA 3POHA 4AY7A 1RQEA 2V3GA 3M0JA 4LC8A 4NAFA 3ARQA 5AKQA 4QJ1A 5BWAA 2DH3A 1TPEA 2Z7GA 2RAGA 1NM9A 2E67A 1EYEA 3BGGA 1PKYA 4DYEA 4B3KA 1OYCA 2PF0A 4HMNA 4GNKB 3P8JA 2CBUA 3AHZA 2EPNA 3URBA 3W71A 3LNPA 3AZTA 1QI0A 1FWNA 2SFPA 3MBFA 3VFCA 3VNDA 3PBMA 4LYPA 2GGHA 2VQUA 3A22A 2TRSA 3GKFA 3OYXA 4EXBA 1BWKA 1THFD 2WMIA 4GGHA 3UNTA 1GUVA 4F66A 2HPMA 1MNZA 7A3HA 1CWYA 2UY3A 2DZPA 3QSRA 2WQDA 4I3GA 5HATA 4WX2A 1TR9A 3NL3A 1E6RA 3QQ0A 2IPJA 3PPCA 5D2VA 2NVDA 2HK0A 4AU0A 1EWEA 3PFRA 4PC8A 2QUUA 4UFMA 2GSEA 1S2UA 2GYIA 4NXSA 4GVHA 5CAHA 1VF8A 4F4RA 4K8HA 4IP5A 2J8TA 3OHIA 1XD0A 4PUMA 1KV5A 4I6VA 1K6AA 4X22A 2PDLA 4WRHA 2WC3A 4N7QA 4EOUA 5I3GA 2DSUA 1S5NA 3UGVA 1XL9A 3VIFA 1CENA 4DBDA 3CZKA 5JMUA 3CV2A 3GDKA 3ZWTA 4CVUA 3VCRA 1WKDA 1O66A 4PCNA 3CWNA 5I5RA 1SPQA 2P50A 4TR9A 5E6ZA 1UJQA 3LXCA 1ZAIA 3J7HA 5CGMA 3FX4A 2X7WA 3SUTA 3HFTA 2YBUA 5LSMA 3RLHA 3UWQA 3H53A 4N42A 1XDLA 1QI5A 2Y70A 2O7QA 1UUMA 1XPYA 3NZRA 2J6VA 4Q8WA 1YPFA 1P7TA 4DWSC 1MQRA 2GSJA 3IGXA 3AIEA 3SGZA 3UCCA 1YLVA 4JTRA 3UVAA 3U3HA 4RNJA 3VDAA 1Q4NX 4NXKA 3W2LA 3TA9A 2CFFA 3RX3A 3HMJG 4M6QA 1QBBA 4IQLA 2ZX5A 1CXIA 2WCGA 3BH4A 3ZT5A 2YR1A 3NQ8A 2HVNA 1C7SA 3SCTA 1XSIA 4QG9A 1V08A 3VNMA 3WBWA 1LF1A 3GDRA 1RSCA 2WW5A 5HULA 2ZX9A 3ZM8A 2AL1A 1C8QA 3FYYA 3W6LA 2D2GA 2D2OA 2J47A 4EWND 2VGBA 4DBWA 3U6WA 3QEZA 3KL5A 2WVUA 3HPZA 2XDFA 2GLKA 3ES7A 4AY1A 1YXDA 1YMYA 5CZSA 2OT1A 2G96A 2G3JA 1OFRA 2WBGA 4XZ9A 1XH0A 2F8QA 4BF9A 2C0AA 3SY8A 1Q7ZA 3VNYA 1O5QA 3W07A 1F73A 3TAKA 4XZMX 5A6MA 2VDGA 1DJHA 3AHTA 2DDXA 3W25A 4ORIA 4CNOA 4DWSA 4H9YA 3OEXA 2P5NA 3M44A 1GPFA 1LUCA 4KEVA 4L4LA 2PDJA 1CX9A 4HN4A 4E2OA 2YPIA 1PIIA 4BFAA 1L0PA 1QMLA 1PBGA 2F9RA 2JKEA 4N9EA 3IK2A 1UBPC 4GPNA 4L1WA 3GVRA 1MO0A 3N4EA 3PBWA 3K1GA 1LDCA 5AZ0A 1B4KA 1QR7A 3VOHA 2J75A 4LAZA 2B7PA 1A5CA 1E0UA 2QULA 4QEEA 3S0CA 3W28A 3IACA 3RF9A 2E9LA 3V0UA 4JFWA 4LAUA 4O8RA 2OODA 3WEOA 3BVJA 1QHOA 2FFIA 2O9TA 4GI4A 3RM4A 3LY0A 3B4UA 5K9CA 3CLWA 5EKYA 2CIPA 5I3HA 3CL6A 3S9YA 1XIBA 4X2PA 1IQ8A 2HBVA 3QYQA 2VGIA 2D73A 5C9XA 2OTDA 3S3GA 1DP0A 2F84A 3WH7A 4GINA 2EEXA 3I3DA 3NQAA 1HKMA 4OOUA 2DW6A 1WBHA 4OFCA 3CUHA 2Y8VA 3QZ6A 3RDKA 1G94A 1F8IA 1QO5A 3USZA 2GUYA 2A5HA 2VTFA 3D46A 3UBPC 4HHHA 2YCIX 1X7IA 5BOEA 3OZOA 4O52A 4HZ7A 1IWPA 3EA2A 2XJ7A 3EWCA 4O10A 4NAEA 2CERA 4HPGA 3FEQA 5CPLA 4B16A 3WLKX 4PSRA 4E2DA 4D1IA 1EZ2A 4AQLA 3WUBA