3O8AA

Crystal structure of plasmodium falciparum dihydroorotate dehydrogenase bound with novel inhibitor genz667348
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
375
structure length
375
Chain Sequence
YNPEFFLYDIFLKFCLKYIDGEICHDLFLLLGKYNILPYDTSNDSIYACTNIKHLDFINPFGVAAGFDKNGVCIDSILKLGFSFIEIGTITPRGQTGNAKPRIFRDVESRSIINSCGFNNMGCDKVTENLILFRKRQEEDKLLSKHIVGVSIGKNKDTVNIVDDLKYCINKIGRYADYIAINVSSPNTPGLRDNQEAGKLKNIILSVKEEIDNLEKNNIMNDEFLWFNTTKKKPLVFVKLAPDLNQEQKKEIADVLLETNIDGMIISNTTTQINDIKSFENKKGGVSGAKLKDISTKFICEMYNYTNKQIPIIASGGIFSGLDALEKIEAGASVCQLYSCLVFNGMKSAVQIKRELNHLLYQRGYYNLKEAIGRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel inhibitors of Plasmodium falciparum dihydroorotate dehydrogenase with anti-malarial activity in the mouse model.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
molecule keywords Dihydroorotate dehydrogenase homolog, mitochondrial
total genus 148
structure length 375
sequence length 375
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2010-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3o8aA00
1OJXA 3TX9A 1GG0A 1M6JA 2VFEA 3DAQA 3NZ1A 4UFKA 3ATYA 3PVFA 4NUWA 4O1BA 3RU6A 3CU2A 2P10A 3WJWA 5G1TA 1QOQA 3NPXA 3STCA 2NV2A 2YDAA 5DY2A 1AK5A 3KRUA 1IXOA 1LDCA 1LZOA 4RZ5A 5K4ZA 1PE1A 5HINA 4NJGA 4H4IA 3P61A 1FWNA 5D2YA 5LSMA 1H7RA 2ISVA 3O6CA 4RCXA 4O17A 1H7NA 3CWOX 3HG5A 4LUJA 3PBWA 2VKZG 1VLIA 1QO5A 4XTIA 2CZDA 2E6YA 3IGSA 1OG0A 3IGUA 2AQWA 1HL2A 3NQMA 1JRCA 3OVRA 4HHPA 3GB6A 5IM51 3NO5A 4IUOA 1FQ0A 1ZHAA 3W1PA 3G18A 3NM1A 4Q33A 3MW7A 1BWLA 2NUXA 2QJGA 3DXIA 1TPH1 1UUOA 1DQXA 1RR2A 3VNDA 3TH6A 2ZZ1A 4KFPA 1Z48A 4HPXA 2WV8A 3HGJA 2QCDB 1D3HA 4FX7A 4O1CA 2A2IA 3EB2A 4MZ8A 4O28A 1QO2A 3N3MA 4Z1DA 5BNKA 2E6AA 1EP3A 1QCWA 3W7GA 4GUFA 4O10A 3BW4A 4AWUA 3C2EA 4GUIA 5EPDA 3W1UA 1OFAA 1AMKA 3IIPA 2QDGA 4WXZA 2A6LA 4DF2A 2WKJA 4GFSA 3GXPA 2RKXA 3W7MA 2CLFA 4UFLA 2R8WA 4AF0A 1FDZA 1XBXA 4X2RA 3QMSA 1ICSA 3LHUA 3NVTA 1ZAHA 3MYOA 5AHEA 2I9EA 1JCYA 1EB3A 1LP6A 5A8GA 3DFTA 3O63A 3L21A 1SW7A 1OABA 5I3HA 3M43A 1G67A 1FXPA 1TMHA 2ATSA 4HPJA 4EIVA 3G8EA 4N9DA 4FB7A 3QM3A 1TV7A 1B4EA 4JTGA 1GWJA 1ZJIA 1FCQA 4M6PA 3HF3A 2P1FA 3T40A 3S42A 3EWUA 1FXQA 4YCPA 1JQXA 1UCWA 5BW6A 1GVOA 1KM5A 1S5WA 2YX0A 1B4KA 1V5XA 4ADTA 3G1HA 1MEWA 3GKAA 1DJQA 1H1YA 3B04A 1WA3A 3FJ6A 4FO4A 3DFOA 1RVGA 1ZALA 3LLFA 2NWRA 3GK0A 4N9CA 3WJZA 5G5IA 1N55A 1FWSA 4WX2A 1JUKA 2ZDRA 4ZQNA 1XDMA 5K9DA 2V2DA 1UUMA 2X16A 2DZSA 5C6MA 4BWLA 5F4WA 5DBTA 2QEZA 3PC0A 1P5BA 1WBJA 4LVFA 3EX4A 1TJPA 4GC4A 4M6QA 4IMCA 2YFNA 2X1SA 3EX1A 1X8FA 5LNSA 1HFBA 3T44A 2FIQA 4K8EA 3HO8A 5GVJA 3BLIA 3S5NA 4B5NA 3UNDA 5DN1A 3GIYA 1OFRA 5K4XA 5K9CA 2X1RA 3MHFA 2RDUA 5LNUA 2C1HA 4JTEA 1IXPA 2J9YA 1W54A 4LWWA 4WQ6A 3W6YA 1AW5A 2J27A 3HG3A 3MWAA 1RQHA 2WNNA 3NGJA 1KFJA 4YXGA 3KVJA 3TC7A 3BG3A 4JR5A 4OT7A 1SW0A 1WOBA 2ISSA 3IIOA 2Y6ZA 1R2TA 1DQWA 4XKYA 1MSSA 5FESA 3MP3A 2H8XA 1AW2A 5FF2A 3H53A 3IGXA 1DBTA 4MIMA 2Y7FA 1GJPA 1H60A 1SO4A 4JTJA 5DXYA 1BEUA 1PV8A 2XFWA 3NG3A 2NUYA 3KXQA 4FXSA 1XUZA 1UASA 4IWWA 5G2WA 3C2OA 4JN6A 1LYXA 1EUAA 3PUOA 4CCEA 2QCCA 3M5XA 4A22A 3S6DA 1EUNA 4GRSA 1EPXA 1ZNNA 2CZ5A 4AHOA 3DZ1A 4H3DA 3B0VC 2WSQA 4BI5A 1VCFA 3VE9A 4UTTC 3LTYA 1HO4A 4KFOA 3E02A 4G1KA 4GNJA 4YCOA 1A53A 1XBYA 4IX0A 3OA3A 4P61A 4GUHA 1JCLA 4UFJA 1LLZA 3MI6A 4DPQA 3W1AA 3MBDA 2BXVA 4ICNA 4IMEA 3DGRA 3NQVA 3PBVA 3O6DA 3FYOA 3S9YA 4IMGA 5FEZA 3L2IA 3ELFA 2BTMA 1OFPA 1YDOA 3W1LA 1O94A 5DCDA 1KV5A 2C0AA 4QM1A 1KM1A 3G3MA 4M5PA 1IF2A 3C0JA 5LGXA 4CQ9A 1TJRA 4C1LA 4UTIA 3UWWA 1GVSA 1HG3A 4JTSA 3T4CA 3RLUA 1Q45A 2NXHA 4AB4A 2TSYA 3P8JA 2ZZ2A 4KKXA 4PC8A 1VYRA 2I14A 1ZFJA 3C52A 3STFA 4O8RA 2O7SA 3NQDA 1X1OA 3B03A 3PUEA 1SO3A 1N7KA 2CLEA 1ALDA 4LC8A 5LHFA 3TNOA 2JK2A 1XCFA 3BG9A 1HUVA 4XKYB 3L9CA 2OJPA 3NOEA 3S1XA 5KZDA 3G0SA 4HSOA 5U4NA 3E96A 1OYAA 1KFLA 1JUEA 1QAPA 1XKYA 3O07A 5IBXC 4NXSA 2DU2A 1K3UA 3O06A 1NAL1 4O57A 1SW3A 2FPVA 4YMZA 3L0GA 4MJZA 3FYPA 1KM3A 4HIBA 2YR1A 1J4EA 2JKEA 4UR7A 3NPVA 4Z0SA 2YZRA 1KTBA 2ZRUA 1GYNA 5D32A 3W7RA 3KVMA 1DJNA 3W2KA 2HSAA 1XI3A 3MBFA 1QPNA 2CLKA 5F4SA 5DLCA 3UPBA 1HO1A 4ADUA 4PODA 3GDKA 3M16A 1WOAA 3GAKA 5AOUA 1GVQA 4MLJA 3UWZA 4DO5A 8TIMA 2EPHA 5H2ZA 4XUGA 3FS2A 4AWSA 3LXBA 3W1QA 5EMUA 3ZS4A 4Z0JA 4CCCA 3EWXA 3GNDA 3GYEA 5AC6A 3WK3A 1YXDA 1ADOA 4IMFA 5KITA 5D2TA 4LW7A 3LTPA 4O4VA 1QOPA 1K02A 1R46A 3BLFA 4HNUA 4XWUA 1JVNA 1UJPA 1X1ZA 2A5HA 3PBUA 2E68A 1VYSX 5D37A 1F7BA 4XZ9A 3TAKA 2FPYA 3LI0A 1S5TA 4FNSA 3EEGA 3G3DA 4X9SA 1G4PA 2DZUA 5HUPA 3R12A 2DORA 4OBTA 1Q3NA 3N19B 2QJHA 1EA0A 4D2JA 3QC3A 4RXFA 4ZMGA 3HGRA 4N4PA 1M7PA 3W7KA 4HN4A 5I3JA 5EY5A 1OX6A 4PCFA 2CU0A 4FNQA 3MUXA 3A23A 3IRDA 1P0NA 2E5BA 4ZL1A 3DENA 3WJXA 1W3NA 4MY8A 1FCVA 3M5VA 3TR2A 1SZNA 5AFDA 3NXFA 3SY5A 5DY3A 2YW3A 4UFIA 2EGZA 3A21A 1KBIA 2E6FA 3T7VA 2PC4A 1G7VA 3HBLA 1FCBA 2C3ZA 3I7SA 3G1FA 1H50A 1OVDA 3LCFA 3N9SA 4HNTA 2Y7DA 2GQ8A 2Y88A 5T26A 3BPWA 3TQ0A 2WOQA 5I3IA 5CGQA 4E38A 3DH7A 3WFAA 2I1OA 3FLUA 2GVGA 3OG3A 3CWNA 4BI7A 3C8FA 4PFMA 3E9AA 5L6UA 1NFBA 4ZQPA 3W7QA 2A1YA 3SECA 1IXQA 1C8VA 1TQXA 4GE8A 1JR1A 4TR9A 4K8HA 4FX8A 1I8JA 3M6YA 5C5YA 4J9JA 4R33A 2ISWA 3KFTA 2UV8G 2C19A 3B8DA 4FNPA 4FEZA 4LUIA 3I68A 3EX3A 3G0XA 3G1XA 1XDLA 3NAVA 5I3KA 1TPFA 3TE9A 5FF4A 3TCEA 3CB8A 3NL2A 2ABBA 2NXIA 1ME9A 3KOFA 3C56A 2Y61A 1QR7A 2WSRA 1YLVA 5ABTA 4E2DA 4JY9A 3W9ZA 1LROA 5CPMA 2CW6A 2B0MA 4JTUA 1NEYA 1NF7A 1XM3A 5F2LA 2G95A 2RHGA 3ABQA 3Q94A 3VFLA 1GQNA 1JRBA 1DVJA 5F2GA 5D02A 3L68A 3WJSA 1K8XA 4GWEA 3BG5A 1VH7A 4L4LA 4QIUA 4UUIA 1AL8A 2H90A 3DHDA 3KHJA 2JKPA 1B57A 1LTDA 4JGDA 4MFEA 1QDSA 5F2IA 3JS3A 3VE7A 3TXVA 3EXSA 2A0NA 3P5YA 4KWVA 1DKWA 4O16A 4K7VA 1KM6A 2NWSA 1LORA 4IXXA 1L9WA 3GKFA 3NQ6A 2NXGA 2ZBTA 3LRKA 1RZMA 3SSJA 1YTKA 5KZEA 1I45A 3KRSA 3PM6A 1TPUA 3DKJA 4RV8A 4Y8FA 3TQVA 3W7EA 3HPSA 2FQIA 1XL9A 1OFBA 2ZTJA 7TIMA 1EEPA 1F05A 2QCEA 4UNLA 2GJLA 2Y7EA 4W9TA 4Y90A 2NX1A 4UIOA 1G69A 4O4WA 3TXZA 2GVJA 1XUUA 3BGJA 3SIZA 1H51A 3BV4A 5D2XA 1I2PA 1TCDA 1NF0A 4CCDA 4TIMA 3W07A 4AHQA 1MEHA 4JTKA 3FIGA 2ALDA 4JX5A 1IIHA 1O4UA 1KFCA 2QCFA 3QW4B 1Y0EA 1R2RA 3F4WA 3CQ0A 3PULA 1P4CA 1PHWA 2EF9A 1E51A 3NL6A 4LV9A 1TREA 4U4MA 3M9YA 2FTPA 3BO9A 2VFHA 2VELA 3W2JA 3MHUA 3NPWA 3PG9A 1OK6A 4O52A 1RD5A 1YDVA 2E1DA 2AAMA 2BLEA 1SUXA 1FX6A 4R53A 2DZTA 1VR6A 3CLMA 2Z0IA 3LCWA 1VQTA 3PS7A 5KTLA 5FI8A 3CC1A 4OV4A 4OHQA 2WSYA 1G4SA 1VCGA 1LRTA 3W1RA 3W7CA 4DXVA 2KZHA 4O54A 3QFEA 3O8AA 2NV1A 2ZCGA 4IPJA 1H7PA 3A22A 4CNNA 2Q8ZA 5D38A 2GQ9A 3BARA 1OF6A 1FWWA 3GR8A 2C14A 3BK0A 2CLIA 2Y70A 2Z1BA 3C61A 4O14A 3B05A 3C3NA 3NQ7A 1SQ7A 3M5ZA 2ZZ3A 2CWNA 3LBMA 2C13A 3RF9A 5D33A 3STEA 3P8IA 3LTSA 4CNOA 3DHFA 3PF3A 3M1ZA 5CPOA 1PIIA 1LBFA 3IEBA 1ME7A 2R14A 3USBA 3CT7A 3L5AA 3TK7A 5SWUA 1F5ZA 4PL2A 4UTJA 2ZZ5A 3QPYA 3U6WA 4QSHA 1PL9A 4MY9A 3P5ZA 5AYYA 2LLEA 4EOUA 4A29A 1SZEA 2J6XA 3HB9A 2A7PA 4CLMA 1PCWA 5HQEA 5EL1A 1OX4B 1VGAA 1X7FA 4OGZA 1LOLA 2OZ0A 3VCRA 4WOZA 3LB0A 3LGEA 4RR4A 4Z1AA 3BVJA 2WQPA 3QRHA 2QCLA 4NZJA 5HWJA 1DHPA 4WY0A 4JDYA 3C2RA 5LNRA 3W85A 2VXNA 4ZQMA 1TPWA 2QCHA 1EP1A 1SZGA 4UFMA 4DQWA 4QISA 1T0OA 1OF8A 4S1FA 3UY8A 1C9DA 3W2MA 3W2NA 1LBMA 1OK4A 1F74A 1K8YA 3DBPA 1FCUA 2F7FA 2FLIA 5L9FA 1I2OA 3HGOA 3M44A 5LNWA 5G4WA 3THAA 2VENA 3N34A 3HIJA 3TFCA 1QPRA 4AWTA 4NX0A 3INPA 4RJEA 3LCGA 2X2GA 5E93A 4PA8A 1R30A 5FF7A 1J5TA 1OX4A 3LRMA 3TMQA 3VKJA 1K7XA 2Q3RA 1DOSA 1OX5A 1TIMA 3GVGA 3HQ1A 4N4QA 2RDWA 3L5MA 1GT8A 1RV8A 1W56A 2QUVA 2H3BA 3MHGA 4PTNA 1VLWA 2A4AA 3ZFHA 2BWGA 1KLZA 3EX6A 3TW6A 1YDNA 3R2GA 1KFEA 5AHLA 1FY6A 1CI1A 4UMAA 4NJHA 4RZ6A 2QAFA 2EHHA 5HWNA 3L67A 1JQVA 3C2VA 1JCJA 3A9IA 2E77A 1ZAIA 3TJLA 3HG4A 4NVTA 3MI3A 3TSMA 1W5OA 4GUGA 4X3ZA 1M7OA 1YTDA 2A6NA 4JY8A 1NVMA 4UTKA 4AF0B 3UPWA 1Q6QA 3DU0A 4ZZ9A 1OYCA 3W84A 1YYAA 3W7DA 3P82A 3QYQA 2WO5A 2R91A 3PB2A 3QSRA 2Y89A 3M41A 5C55A 2ZTKA 2VFFA 5D03A 4XQ6A 3FKKA 4M7TA 5IBXA 2Z2UA 1Z41A 4PH6A 3LCIA 4QNEA 3NM3A 2G96A 4JYFA 1R2SA 2PURA 3PSVA 3LXCA 3H55A 5H91A 3GR7A 5EYWA 2DJLA 2NLIA 5AHIA 5AHMA 1L6YA 1GYLA 3G8RA 3QPZA 4AH7A 2C6QA 2GJNA 5DXXA 3N9RA 4UR8A 3W3OA 1K8ZA 5EBUA 5J5DA 3TV8A 5F2MA 3W7JA 3TA6A 2PE4A 2YW4A 4FIRA 4LRTA 2YCEA 4TX9A 3IIZA 1TTPA 3W73A 2FDSA 3OIXA 4OWGA 3SZ8A 2XN0A 3LV6A 5CZTA 3QZEA 5HNRA 3L0NA 3OHIA 4OQVA 1YPIA 2GOUA 1WXJA 1LCOA 5CZJA 2B7OA 3CIXA 2QR6A 3NQEA 4CNPA 1CW2A 2ZRVA 2ZZ7A 1H5YA 1KM4A 1BWKA 1H7WA 3CEUA 1L2UA 1XFBA 2C18A 2VFDA 1KFBA 2VEPA 4NNBA 3Q58A 2CFFA 4JYEA 3S1UA 3E12A 5AHFA 4JDBA 3DFNA 4NT0A 1WBHA 4JICA 3ATZA 1GPWA 4O0ZA 3LV5A 2QCDA 4UTWC 2PRMA 1JJKA 4N02A 3EWWA 3LHZA 5FEXA 2E6DA 3GXNA 4QJ1A 1W3TA 5CSSA 4KFNA 5D09A 3HPXA 2TPSA 3W72A 3KVKA 1VYPX 3MJYA 3TDFA 3P74A 3FJLA 6ALDA 5LGZA 3EXTA 1WDWA 2WJZA 3S0CA 2QDHA 1W31A 1SSDA 3W22A 2YFOA 1L6SA 3C4UA 1N8FA 3F4NA 5F1VA 3S5ZA 1V7YA 4HSNA 1JULA 4FXRA 4LOCA 2FB2A 3PR2A 3L5LA 4TU1A 5HUOA 4NU7A 1TV5A 3UY7A 4GUJA 4WJEA 3GX9A 5DELA 1G6CA 1A5CA 2XN2A 3KX6A 3L65A 3G22A 4RZ4A 4HT3A 1H1ZA 1U5JA 2W6RA 5D2WA 1I2NA 1TPEA 1TV8A 4S2BA 3GNNA 1QNVA 3NA8A 2WNQA 4MYAA 3YPIA 3EXRA 4BFAA 5KINA 3RFAA 1JCXA 1C29A 1SU5A 1FUYA 2OCZA 4IX2A 1XBVA 3TW7A 3QMRA 1T96A 2WPBA 5AB3A 1ONRA 3D0CA 5CPNA 5DCBA 5FEWA 1W5NA 2A21A 1VHCA 3QEZA 3EWZA 4IPIA 5E1QA 1VJIA 4LV4A 2QCNA 4UC5A 2ZRYA 5F1UA 3S8HA 1UB3A 1ZAJA 1W1ZA 3LHTA 1SSGA 3LI1A 3Q2DA 5G4EA 2TRSA 3NQGA 3OBKA 4TMCA 1VZWA 1LRNA 5LZLA 3OEXA 1B3OA 3CM4A 4Z1BA 3P62A 3UWUA 3G1YA 5F4XA 1A5SA 3M0ZA 3UZ5A 3UYCA 5D04C 3NQ8A 3PWAA 4ORMA 1YPFA 3N14A 4UMBA 1TTIA 4EF8A 2ABAA 3NQAA 4Y96A 2DJXA 2QAPA 3CPRA 4JTHA 3DFSA 3M5YA 4AXKA 2ZYFA 1TO3A 3WK2A 4GXMA 4RXGA 4Y9AA 3QSTA 1LRQA 1ML1A 5EKYA 3SGZA 3MO7A 4NX5A 3W7OA 2F84A 1A5AA 4O53A 1S3HA 2R94A 4DPPA 2PRLA 1TPDA 3TAOA 1F2JA 1TSIA 1O5KA 3O16A 1F6PA 4O13A 2NX9A 3ZWSA 2Z6IA 3QMTA 1TQJA 4X22A 4DF0A 1K03A 3AJXA 3NL5A 4NJKA 3DFPA 2C16A 2ZRZA 5CKSA 4UFHA 1W0MA 2YPIA 4POCA 2Y62A 1JCNA 3R89A 3STGA 1GZGA 2X30A 3P80A 1OHLA 3B4UA 2QF7A 4OE7A 3W83A 2J24A 2Y85A 1GEQA 1U83A 4ADSA 4JX6A 5AC7A 4IQLA 3UWQA 4UTTA 2ATMA 1OFDA 1SPQA 3I6RA 3FOKA 3S1WA 1PCKA 2H8ZA 1W5QA 2TYSA 5CSRA 4JX4A 4UTUA 4UCGA 3HMJG 3IV3A 1MO0A 2V82A 3F03K 4H6KA 1ME8A 2CLLA 2J9ZA 1WV2A 5HMSA 5BMWA 2FPTA 1IGSA 5EA9A 2EAWA 3P60A 4FNUA 4YLWA 1DV7A 4EVZA 3A5FA 1KFKA 1SO6A 3IVUA 3NEVA 4M7SA 3W88A 3TU9A 4AVFA 4WOQA 4IMDA 4TMBA 2GPTA 4S2CA 3ANYA 3C6CA 1UBSA 4ORIA 5I3GA 4Z08A 4Y6GA 1JCMP 1FDJA 2B7NA 4JNMA 3B0PA 1YXYA 4I7WA 2DZXA 4BK9A 1WX0A 4LS0A 3EKLA 3PUDA 3JRKA 3LCXA 2HS8A 2XN1A 2V2CA 3B06A 4O15A 1IIGA 1OFQA 1WQ5A 3R8RA 1EWEA 3W71A 1VC4A 4XTDA 1AG1O 2OMAA 2AGKA 4IOTA 1XBZA 1RQEA 4FNTA 4QITA 1GVFA 2BX7A 4K36A 4RKAA 3GDRA 2NUWA 3SR7A 5AN7A 2ZRXA 2V0TA 2JBMA 1H62A 3UZJA 2B7PA 2W79A 4ZQCA 3LOTA 4P2VA 4E0CA 4OU1A 1GVRA 3Q37A 4JIPA 4MYXA 1EX5A 4IJBA 1ICQA 2A7RA 5TQLA 1SFJA 2E5DA 4XBKA 4IXHA 4WUIA 1P1XA 3QH2A 2CZFA 2J88A 3CIWA 3L0KA 3TQKA 4O18A 4ONVA 4EWND 4NNAA 5TIMA 4HKPA 4Q32A 4I9AA 2VEIA 2BSLA 3HG2A 2CLMA 3QQ1A 1A50A 2QUUA 3WK1A 1B9BA 3O1NA 4UMCA 4O12A 5E0KA 3W76A 3FFSA 2Q3OA 4KWWA 1KLYA 3R13A 4UTLA 1T8XA 2Z6JA 4ZQOA 4MUZA 1H7XA 1TRDA 2OT0A 1QFEA 3LCLA 3O6YX 1SZFA 2JGQA 4AAJA 4FX6M 2W0UA 1TB3A 4LT9A 3BGGA 1R47A 5AHNA 2RH9A 4DELA 3DI1A 5D05A 4M19A 3LX9A 5HJLA 1W8SA 2HS6A 3W2UA 3PB0A 2V5BA 1K7FA 3P81A 2QJIA 3EX2A 2VFGA 3R5EA 3PBYA 5HULA 1D9EA 3T78A 4A2SA 2C15A 4TO8A 2FB3A 3W86A 5K2ZA 1Q6LA 3P67A 3N73A 3GAYA 2E5CA 3DI0A 1RQBA 3FA5A 1RPXA 5G2HA 4WY0B 1Q6RA 2DP3A 1XXXA 4JTTA 3E0IA 3SI9A 1TYGA 3OVQA 5MHBA 4NJIA 2B7QA 2PCQA 3LDVA 4BWLC 1I4NA 3G1AA 1DORA 3N2MA 1O5XA 4FF7A 3CEPA 2CLHA 1S5VA 4IGHA 5K3VA 4JTIA 4WD0A 4DBDA 3ZR4A 2GQAA 1AW1A 1NSJA 3M47A 3HGSA 4DF1A 2CLOA 3F1QA 2V8ZA 3SGUA 1J2WA 1PHQA 3TROA 3NNTA 1W3IA 3EWYA 4K7YA 3FKRA 4C1KA 2RDTA 1TRIA 3W74A 2DZWA 4YWIA 3RLVA 4L4MA 2YSWA 3LBCA 3WJYA 1WYIA 3GLCA 4JS3A 2FJKA 1FDYA 4GBUA 4FNRA 2ZFAA 4N6FA 3LHWA 1SFLA 4JD4A 1OYBA 1BKSA 1LLWA 1VRDA 1SR9A 4E2BA 2PRHA 2NX3A 4JIQA 4R34A 5HWMA 3A24A 4LY8A 3TUUA 1FBAA 1EIXA 3NZRA 3TMLA 2ZZ4A 3KAOA 4NXKA 1X6UA 4LVDA 4UNKA 1MZHA 3O05A 5LKYA 1QMLA 3W1MA 3LRLA 3MP4A 3W70A 1G4TA 3W87A 4UTMA 3VI2A 5D2VA 3NPUA 5KZMA 4A3UA 2A85A 2J9XA 2Q8LA 3LHYA 2Y7GA 2HTMA 3A5VA 3RK8A 1W37A 1PS9A 1KM0A 5CPLA 1VS1A 1TPVA 3W1NA 3I7RA 4JTLA 3BW2A 1GTHA 2ZA1A 2O7QA 3TC6A 2YGYA 5AC8A 4MY1A 5J5RA 2V2HA 3IIVA 1BTMA 4LTSA 4BI6A 3G0UA 2GUUA 3P7YA 4LVAA 1GG1A 4K37A 4O1DA 3S1VA 3PAJA 3W7IA 3NR0A 4MJMA 2VEKA 1QPOA 3P84A 3W75A 5CG7A 4CQ8A 1VPXA 2OX1A 3ABSA 3L66A 4NJJA 4HNVA 5HR7A 5A5WA 1IXNA 1GTEA 4O1AA 4ZQRA 4O0KA 2QUTA 3C2FA 1OFEA 4MZ1A 4K6AA 4UTHA 3LERA 3THQA 1MXSA 4JYDA 2OT1A 3W1XA 1VCVA 2GVLA 1LOSA 4LVBA 3NQCA 4OV9A 4U28A 4UXDA 4LRSA 3IVSA 4MPQA 4PEKA 1I2QA 1WAUA 3S5OA 4NNCA 5U7SA 2QCMA 5TBOA 3GDLA 2BZNA 2ZA2A 3IIXA 4RLIA 5LHEA 5K9XA 4NQ1A 3H54A 4R7JA 2DZVA 4WZHA 5DBUA 1MEIA 3WK0A 2WNZA 1H63A 3RNDA 1TPC1 3I65A 3B0UX 1Z44A 3NQFA 2JKAA 2X1UA 3UXDA 3GZ3A 3SJ3A 5C2XA 1JUBA 4DO4A 3DFQA 3G1SA 3UXAA 3MMTA 3I7QA 2B4GA 3U2OA 4EF9A 4BF9A 1H7OA 4DO6A 2CZEA 4JXCA 4LS1A 1KV8A 3W7PA 4DBEA 3ABRA 5G1YA 4O11A 1ICPA 3PG8A 6TIMA 4UTWA 3T55A 1D3GA 4MZYA 2QCGA 1QWGA 3OVPA 4QAIA 1M5WA 3UWYA 1FWTA 1LM1A 4MLRA 4AEOA 3GDTA 3MI2A 1W5PA 5D30A 3RMJA 4FIQA 3AO0A 2V9DA 3O15A 3QW3A 4WY0F 4PL1A 1DL3A 1ZENA 4RX0A 3V1PA 3QJAA 3S5YA 4CQAA 1Q6OA 1I2RA 3EWBX 4DEFA 5I3FA 1F6KA 3N2XA 1F76A 5FF3A 2H6RA 3EKZA 2YXGA 3CHVA 4O19A 1L6WA 3V75A 2Y63A 1O60A 3TFXA 4O50A 5FF0A 4XBSA 5BMXA 5FEPA 3BLEA 3NDOA 2DZPA 2A7NA 2VFIA 3UD6A 2EKCA 3IVTA 4WXYA 5CZSA 3W7HA 2G97A 3FEMA 4LVGA 1KBJA 2V81A 3MP5A 4N2YA 1FWRA 2FFCA 3K30A 4LC6A 1LOQA 2V30A 3W7LA 2G5WA 1QPQA 3LM7A 4MOZA 4I7UA 4ML9A 3KRZA 2RFGA 4YL2A 3M7WA 3JR2A 5LNVA 3G24A 3LXAA 5AYXA 1TPB1 1G7UA 3W2LA 3HPZA 4LU0A 3GXTA 4BR1A 3W7NA 2YYUA 4A2RA 3QQ0A 3TSDA 1G4EA 1K7EA 3MYPA 2ZRWA 2E09A 4K39A 2H3DA 4HNNA 3UQNA 1AL7A 1HTIA 3ABOA 1THFD 1YADA 3TJXA 2P0OA 4LS2A 4LNYA 4NZFA 5K7JA 4M6VA 1KM2A 4ZVJA 4AMAA 3E49A 4N9BA 1TTQA 4K38A 3G1DA 1GOXA 1O95A 3SW6A 3TKFA 3NQ2A 1VHNA 4Z1CA 1KA9F 5AYZA 4QNWA 3U8GA 3NL3A 1PVNA 5BOOA 3GDMA 4FHAA 5DCEA 1KTNA 3BW3A 3SFKA 1W5MA 1Z42A 5HR6A 4GJ1A 2NZLA 1F73A 2D73A 4N6EA 4MVAA 5BRBA 1CX9A 1SO5A 4MKNA 3TIMA 2QKFA 1OFOA 1YXCA 3NYZA 1KTCA 2V5LA 1EP2A 4I7VA 1TTJA 3ZWTA 2HMCA 5KMYA 4Q4KA 3UWVA 3PSWA 3W1TA 3LHVA 4MFDA 1A5BA 5CZ0A 2VEMA 1ZCOA 4ALDA 3G1VA 5G2IA 1ZY9A 2ZQ0A 3KVLA 1YTEA 1KW1A 3LLDA 3DKLA 5C54A 2IQTA 2VC6A 4A21A 3HOJA 4RK8A 2JGYA 1EWDA 1P0KA 4N9EA 2VOMA 1LBLA 2ZA3A 4QQ3A 3CTLA 3W23A 2ZZ6A 3HJZA 4JTFA 4JEQA 3LCHA 3PY2A 1XC4A 2TMDA 2YYTA 2X1TA 1H61A 3TSBA 3QF0A 5KSWA 1T99A 4AHPA
chains in the Genus database with same CATH superfamily
3CK5A 1OJXA 2WVSA 2YCKX 3TX9A 3MMDA 4I5UA 3PPFA 9RUBA 4B5UA 1I1XA 4A8LA 3NZ1A 3AWNA 3T6CA 2JALA 3CQHA 2NLYA 3BAJA 3RU6A 3CU2A 2P10A 1ZP4A 1R7AA 5G1TA 1QOQA 3T05A 5DY2A 4MPKA 3L4TA 3BZGA 3ARWA 5EMJA 2R1MA 1JG9A 4BQ5A 2VQTA 2REQB 5LSMA 1H7RA 1P6CA 1DE6A 1GVIA 3O6CA 1BPLB 1PX8A 3WENA 1FKWA 4LUJA 3FGCA 2VKZG 1KXHA 1VLIA 3H2EA 3VIPA 4HOZA 1CBGA 2OQLA 3I10A 3V18A 1POJA 4FA3A 1OG0A 2AQWA 1GQKA 1Q4WA 1K6AA 3KWXA 1LWIA 1CGWA 3OVRA 3MSRA 4IUOA 4FOJA 4UQ9A 3N2OA 4Q33A 1S5NA 3MW7A 5H8PA 4CEUC 2QJGA 1VFMA 1DQXA 1SZRA 2G4FA 3UW6A 3VNDA 4ZE5A 3MJMA 4DXKA 3POCA 4FX7A 5LXXA 2A2IA 3EB2A 4MZ8A 1DYSA 3B8UA 5KEZA 2ZKMX 1Q8AA 4C6KA 5H8MA 2PA6A 3C2EA 1E6RA 4PUNA 2RKXA 1E3ZA 4V15A 3MV01 2CLFA 4W7UA 3NZGA 1W1TA 1XBXA 3LHUA 5AHEA 1JCYA 1E40A 4G9PA 2NQ9A 2WVUA 3EOEA 1OABA 5I3HA 1V3LA 1TMHA 1FXPA 1NWRA 4J3VA 3G8EA 2WCGA 1HP4A 4X9YA 1ZJIA 3HF3A 8A3HA 3A3HA 3T40A 5FJPA 1J6OA 3EWUA 1CTNA 3E2RA 4AZHA 3OBAA 1KKRA 4KRTA 5CPQA 1WA3A 4FO4A 2BHZA 1WUFA 4GQBA 5A6KA 2OKOA 4N9CA 5E6ZA 4M82A 3KEHA 1N55A 3ZJ6A 5K9DA 4O8AA 3OLDA 4DUWA 4BWLA 1Z6KA 3V35A 4QCFA 1P5BA 2EPLX 3ICJA 1WBJA 4M6QA 3AUOA 2D20A 1GZJA 3WF2A 4WDXA 1X8FA 1QASA 5LNSA 4K8EA 3HO8A 4WKHA 3BLIA 1JZ5A 3S5NA 3CH9A 3O2LA 1HIZA 2A3LA 3UNDA 5DN1A 2UY5A 3GIYA 2X1RA 4LF2A 2J9YA 1W54A 4JEJA 4S3KA 4RE2A 3SY1A 3RCYA 1LG2A 3BG3A 1ZJHA 2VC7A 3WH7A 4MSSA 3VUPA 2ISSA 4B90A 1EF3A 1R2TA 4MJ2A 3S5SA 4XVEA 2VJXA 1ZTVA 4LCSA 1HJVA 2G8ZA 4MIMA 2FDMA 2Y7FA 3SO7A 3B97A 4JTJA 2O4QA 3LPFA 1JI1A 2PDQA 4WK9A 3C2OA 1EUAA 3E38A 4A22A 3SAZA 4IM4A 1ZNNA 2CZ5A 4GGHA 2QMKA 4H3DA 2WSQA 2V6AA 3VE9A 3AMKA 3SUVA 2X05A 1KRBC 1E6PA 3VCCA 4E4PA 5IFTA 3TJIA 3BURA 4GNJA 1XRSA 4H6EA 3OA3A 1LLZA 5C2GA 1OIMA 2YA0A 4PFHA 1VBJA 3DGRA 4IMEA 2IXUA 2Y5JA 2NT0A 4GA8A 4GH1A 5FEZA 1ZBWA 3AYSA 3ELFA 1AD1A 3NURA 1OFPA 2XVPA 3N13A 4QM1A 3RAOA 3GTXA 4IGSA 3BAXA 3C0JA 3FHQA 4KERA 4C1LA 4HPNA 1HG3A 1PZ1A 3T4CA 1Q45A 4AY7A 3EMCA 4PC8A 2XIOA 1EGVA 1O6IA 2I14A 4G7FA 1ONEA 4O8RA 1XRVA 5CPSA 2CC0A 3G5EA 3N15A 1Q5MA 4H7ZA 4DUOA 1RALA 4LC8A 3MDWA 4IGNA 3TNOA 2XU2A 2JK2A 3BG9A 3PAOA 1YRRA 4XKYB 3DFYA 3UJ2A 4LUSA 4HSOA 3E96A 1P0DA 1OYAA 3GHUA 1QAPA 3AUJA 1PB0A 5MKGB 2DDXA 1FWEC 2INZA 5IBXC 2DU2A 1K3UA 1IWAA 1B31A 2OEKA 3L0GA 3FYPA 4FS9A 4S3GA 1KM3A 2YR1A 5FJRA 2NVCA 2Q02A 2IPGA 3SFWA 2YZRA 5A1AA 1E72M 1XYMA 2DSZA 4Q7BA 1XCWA 3W7RA 4UWMA 2PP3A 1KBBA 2HSAA 1XI3A 2XWDA 1NFPA 1ISWA 1HVXA 1KXTA 5CPTA 1AODA 3GDKA 1WOAA 3PZGA 3GAKA 5AOUA 8XIMA 3W37A 2I5QA 1ZU8A 1W9DM 3VM5A 5H2ZA 2YBVA 3VIKA 1QTWA 3KL0A 1ZGDA 1EO5A 3PPCA 1RK5A 1UZ4A 3KS6A 3PK7A 2WVVA 2YCIX 1K70A 3N18A 1ADOA 4IMFA 5KITA 5D2TA 1W1IE 4O4VA 1E15A 3BLFA 2YBTA 4XWUA 1JVNA 2OLSA 2A5HA 3PBUA 5XIMA 3VKBA 3FDKA 4JQ1A 3WBYA 1D3CA 3N2BA 1FRBA 2FPYA 1CXHA 3UVIA 3LI0A 4FNSA 2VX5A 2VL4A 2YL8A 1FTXA 4X9SA 3S47A 3GD6A 1XLLA 2IMRA 4XD5A 1U1HA 1Q3NA 4C5ZA 1RXOB 4V1XA 3QFWA 1EA0A 4D2JA 1I1WA 2C7FA 3AIVA 3APTA 5I2UA 4NP7A 3W7KA 1FA2A 4HN4A 2B81A 1BSIA 4R7WA 4PMZA 2E5BA 3DG3A 3T1GA 3WBWA 4MY8A 4PRTA 3TR2A 4XAZA 3BCJA 4J40A 1Y5VA 1J0YA 4ASTA 3CYJA 2YW3A 4UFIA 2E9MA 3WBXA 4MWAD 3V36A 3AOFA 3O6AA 2VYOA 3HBLA 4PR4A 4H9YA 1W32A 2WAGA 3EDEA 3KP1A 3N9SA 2AKMA 1JFXA 1F61A 3VYLA 3QOMA 3UR2A 3WFAA 1OY0A 1P48A 3OG3A 2HVOA 4RPPA 2VM8A 3CWNA 4BI7A 2WNWA 5HMFA 5L6UA 3TLQA 4ZQPA 5HNNA 4L56A 1IXQA 1C8VA 3PWIA 4IP7A 2ADAA 4GE8A 3GS6A 1M65A 3ENLA 1EJTC 3L4VA 1B2YA 2PDXA 3BAIA 3GWQA 3AU2A 4FEZA 3R43A 4LUIA 3I68A 1XDLA 4NYUA 1JD9A 3UJEA 1TPFA 2ZE3A 3TE9A 3CB8A 3D3FA 5BRQA 1FWCC 3WD4A 3KOFA 1C7TA 1O66A 2Y61A 1QR7A 1NOUA 2WSRA 4IG2B 1U2YA 3EEZA 4GVGA 3RX4A 3E0VA 1DXFA 3NDYA 3EA2A 2DIKA 3KP0A 1A80A 3DX5A 3AAMA 3ABQA 3Q94A 4XISA 1IEVA 4MJ4A 1QHPA 4QIUA 4UUIA 3AIRA 1TVNA 3M64A 3KHJA 2BB0A 2KX9A 1B3VA 2GSEA 4C6EA 1GQIA 1UZ1A 3VE7A 3WUFA 1I9CB 2R1KA 2E8YA 3BSGA 3P5YA 1LWJA 1MFVA 4K7VA 1E0VA 4CN6A 1VBGA 4MNLA 4X60A 1CGYA 2XZ9A 3QR3A 3RIKA 2D0GA 2DEPA 3SSJA 5HJYA 4HA3A 1JYNA 1I45A 4AZBA 5A3HA 5C9ZA 1XLMA 2ZTJA 1OFBA 4E2OA 2E9LA 2NX1A 3LEPA 2Y8VA 4ZB0A 3TXZA 3FDGA 2J62A 1H51A 3BV4A 5D2XA 4AZ6A 4B4HA 1PSCA 1VIZA 1TCDA 1NF0A 3FAWA 1US2A 1E6XM 1YBQA 2ALDA 5A6BD 4JX5A 1O4UA 1KFCA 3WLLA 3V5FA 3GSMA 3I4EA 4J27A 4ZOBA 3AIQA 4AZGA 4DJED 4IISA 2EF9A 3NL6A 4U4MA 1XW8A 2QVHA 3UP8A 3NPWA 3WLIA 1DTUA 3N2CA 4AD2A 2BLEA 1QW8A 3KBWA 3H4WA 3CC1A 3RJXA 3VNYA 4Q4SA 2PLMA 1KO0A 3GHTA 3QGAC 3UJSA 2ZCGA 4B15A 3E2QA 1O1HA 2GQ9A 1XPGA 4LBSA 3UA4A 3IJLA 2Z1BA 4MB1A 4CGTA 4O14A 3B05A 3C3NA 3WLHA 4D6JA 2JIWA 3GIPA 1SQ7A 2QDDA 2C13A 4W86A 3LTSA 2VRKA 2VURA 1ME7A 3MSDA 3CT7A 3ARYA 3SBFA 4Q4MA 1XIEA 1KKOA 4D6FA 3NSXA 1R3SA 3H7UA 2LLEA 3F7JA 1SZEA 3HB9A 2A7PA 4CLMA 5BZAA 3VMOA 3FJNA 3HURA 4QR6A 3E5BA 5EL1A 1ELSA 1VGAA 4WOZA 2JE8A 5CLWA 3LMZA 4RR4A 4GY0A 3BVJA 4HBKA 2NW0A 1TE6A 4Q22A 4C7FA 1DHPA 4P7OA 1IQ8A 4ERIA 4JL1A 1CXIA 3DGBA 1QK0A 1QNPA 1XD0A 3I3BA 3AZSA 3W85A 4HP5A 1EP1A 2YL5A 4UFMA 2Z2BA 3GHRA 1YW1A 1T0OA 3UY8A 3LYEA 4QG6A 3W2MA 1YMYA 4JBRA 1OK4A 3WDJA 3BICA 3VOFA 2FLIA 5L9FA 4JQ2A 3P2VA 3RRXA 5G4WA 3N34A 3HIJA 3TWBA 4AWTA 3EKGA 3INPA 1PTDA 4PA8A 4B5TA 1J5TA 4GYPA 1K7XA 3GH4A 1DOSA 1OX5A 3L5MA 2OSYA 3ZT7A 1NWTA 4GCAA 2H3BA 1UWUA 2A4AA 5J04A 2BWGA 5ABEA 3TW6A 1W9BM 1CPUA 1YDNA 4UMAA 2Z29A 4NJHA 2PTYA 4CEXC 2AMXA 3BSHA 1V02E 3L67A 2HBXA 2E77A 3U7VA 2WMIB 4IGMA 1V3HA 1BGAA 2ANUA 3TSMA 1PKYA 4X3ZA 2A6NA 1YTDA 2NT1A 3ONBA 1JI2A 3RPDA 1XLHA 3QYQA 3QSRA 1H0GA 2Y89A 3VNIA 2VFFA 4XQ6A 3FKKA 4AISA 3S2NA 3UVAA 4QNEA 5CG0A 3VXGA 2FZBA 1XGDA 2NLIA 1GYLA 3G8RA 1RLDA 1GK8A 2QV5A 3GTFA 1HGWA 2GJNA 3SEPA 4CVWA 1CLVA 4L7ZA 4JKLA 4QROA 3GE7A 1V51A 5BOFA 3BXWA 5AC5A 3TA6A 3MUCA 4FIRA 1RBAA 1Q63A 3ARQA 4NKCA 3O3RA 1TTPA 3W73A 2GJPA 3CHFA 2FDSA 5CBIA 2EXOA 3EMZA 2PGEA 5A8OA 4HU3A 3BAKA 1ODZA 3TLLA 1J5SA 1IEWA 3MVTA 2ZRVA 4K68A 4DBSA 4FK9A 5M1TA 4I5RA 5CAKA 1NOFA 3HV9A 1H7WA 2HXUA 1PZ3A 2VEPA 1WBHA 2R1NA 3LV5A 2QCDA 3EBVA 2PRMA 3MUAA 1JJKA 2DIJA 3LHZA 4QJ1A 3T07A 4KPLA 3KOWA 1EHAA 2TPSA 1E73M 1R7OA 1TFVA 2Z1KA 1GOKA 3ZVHA 3FJLA 1UROA 3S0CA 1SSDA 3ITCA 5F1VA 1JYWA 4PRRA 5M2FX 2BG5A 4N42A 2GJXB 1V7YA 3B8VA 4HSNA 1XG4A 4FXRA 1FWBC 1XR2A 1UWQA 4TU1A 3ZSTA 1O5QA 4AEEA 4G6CA 4NU7A 1X1NA 2B31A 2E4TA 4GUJA 4PMXA 1BRLA 4JHMA 5BCAA 4F79A 4S2BA 1UR2A 1DIOA 1QNVA 2WNQA 1AQFA 5DO8A 4HU8A 3LGGA 5KINA 1JCXA 1SU5A 3Q45A 3GHSA 5EGRA 2R24A 1XBVA 3R1ZA 3TW7A 1WDQA 1GVEA 2OWCA 4US5A 3SB0A 1ONRA 3GH5A 3KCLA 1PWMA 4L5ZA 3EWZA 5E1QA 2OLHA 4LV4A 2XGZA 4UC5A 2ZRYA 3MMUA 4ZSUA 3LHTA 1CZ1A 2TRSA 3NQGA 3OBKA 4TMCA 2I17A 5LZLA 1AH3A 4NHVA 1TVLA 5BWAA 4FOUA 4Q7IA 2POZA 3M0ZA 5A6MA 3UYCA 5D04C 4IFRA 4ORMA 3N14A 4PTMA 4TOQA 2GOKA 2ABAA 3W82A 4QJ4B 2PWVA 2DJXA 1B3ZA 3CPRA 1TCMA 3M5YA 4PEEA 2ZYFA 4YTSA 3SGZA 1JEZA 3MO7A 2X7VA 2GUYA 2RJGA 2VUNA 3QV7A 5I6SA 2R1PA 2R94A 4R5EA 1F2JA 1O5KA 4WF7A 1UPPA 4IIDA 1F6PA 2ZXDA 3N11A 3ZJ8A 3WBAA 4LCQA 3CUFA 1S5MA 2J13A 2C16A 4H9MA 4MADA 1E71M 1PYMA 5CKSA 8RUCA 5FJTA 3ZT6A 2Y62A 1JCNA 2OOFA 2V3EA 3GFXA 1VFSA 1OHLA 5IHRA 1ITCA 3N2TA 1OBAA 4AZ5A 4DUXA 3CUXA 1UKPA 1A3WA 4C7DA 1AFSA 3OBEA 3T09A 1SPQA 3K2GA 4WIWA 3WG6A 2AOSA 1W5QA 5M3WA 4JX4A 3HMJG 1UH3A 4J2MA 2WHLA 3TTYA 2J9ZA 1PKMA 3FW6A 1CYGA 5EA9A 4Y9NA 3H8AA 3FCPA 3VMPA 3A5FA 1SO6A 3NEVA 4M7SA 4W4QA 3TU9A 1LWHA 4IMDA 3ANYA 4ORIA 4HTYA 1F6YA 2B7NA 5JH1A 4GZ7A 1YXYA 3MZ2A 4L6HA 1UJQA 4MKVA 2DIEA 2EJ1A 3AMGA 4W7WA 2G3IA 3IUDA 3JRKA 4O15A 1IIGA 5C9RA 3SCUA 4CU7A 3W71A 2OMAA 2XH7A 3Q65A 3W27A 8CGTA 4Q8NA 3GDRA 4H9UA 5AN7A 4A35A 2BY3A 2BASA 1VKFA 2W79A 2A3BA 3TNBA 3LOTA 5LA0A 3BC9A 4DI9A 1WP6A 4JIPA 4MYXA 1JGMA 4IJBA 1ICQA 4B2DD 5TQLA 4S3DA 4WUIA 3R4IA 1BAGA 2PUZA 4ZSTA 3CT2A 2QXWA 3BSMA 4C6JA 2PDKA 4HKPA 1BD0A 1ADSA 3N1AA 3LG3A 1V0KA 4KS0A 1UMYA 1XLKA 4O12A 4KWWA 3R13A 3S2MA 1NDYA 1T8XA 4KEMA 1GKRA 3DERA 4ZQOA 4KGLA 3XIMA 1H7XA 1TRDA 2OT0A 1NJJA 2G3JA 1GQJA 2JGQA 3IRSA 4AAJA 5ECUA 3KDOA 4RZBA 2BGQA 4RE4A 4TTUA 5AHNA 3VOIA 1S2CA 3C5QA 4M19A 4D8LA 5HJLA 4AQLA 2XUCA 2JEPA 3ITOA 4DNHA 3VOHA 4KCUA 2WCAA 3P81A 3WH6A 2E40A 4EWJA 4ZOAA 1QBBA 3R5EA 3PBYA 2WZTA 4W8AA 1O5RA 1OM0A 1OINA 1Q6LA 3N73A 3FEQA 3GAYA 2V67A 2R6OA 2FYMA 1RQBA 4DZHA 4RV3A 2DP3A 1HJSA 4JTTA 3OVQA 5MHBA 4I5XA 3ZT5A 2B7QA 2VGFA 3M07A 5AECA 2EEXA 3G1AA 2O55A 5LIYX 5K3VA 2QJMA 1EJXC 1NDZA 2PGWA 4DBDA 2GQAA 2ZX9A 1AW1A 1L8PA 3HGSA 1VAHA 2D3LA 4DF1A 3F1QA 2QHAA 1PHQA 3FGCB 3U57A 3TROA 4GY7A 4K7YA 3Q4DA 4C1KA 1DP0A 2DZWA 4RPQA 1D7KA 3WJYA 4H2HA 4JS3A 1RJPA 2BV9A 2ACRA 1A3XA 3IJ8A 1Z69A 1EJRC 2PRHA 1IZKA 3QY8A 5HWMA 1FBAA 3NZRA 1EZWA 3WELA 3TYCA 1V77A 3QZAA 2Q01A 5LKYA 3BE7A 3MP4A 1G4TA 3W87A 4UTMA 3VI2A 1XH1A 3VGGA 4A3UA 1HXJA 2J9XA 3KWSA 2Q8LA 3OU8A 1E0WA 4AIOA 3HPFA 1PS9A 1KM0A 3W1NA 1VS1A 1YDYA 1UQZA 4ZFMA 1GTHA 1TKKA 2O7QA 4QJ5B 1D8CA 2V2HA 1BTMA 3AZTA 1FH9A 4LTSA 4PUMA 1UP3A 4KCTA 4D6IA 4F3HA 3PTKA 4AEFA 4DZAA 1GG1A 4K37A 4O1DA 2BDQA 2PODA 3NR0A 3W75A 2X7WA 4NJJA 3M7SA 4HNVA 5HR7A 1TR9A 4O1AA 1GTEA 4YN5A 1VFHA 4ZOCA 1UW9A 2VGBA 4O0KA 3W38A 3RO6A 1OFEA 4MZ1A 4GXPA 4K6AA 2PU1A 5IOBA 4UTHA 1YHTA 2OQHA 4JYDA 1UD2A 3CQIA 1VFLA 4LVBA 3BOXA 1V3MA 1Q4NX 4PEKA 3IVSA 3WLOA 4NNCA 3OVGA 3USZA 5TBOA 2OGYA 4CD8A 2ZA2A 3SRFA 3MU7A 3OP2A 4NQ1A 5E09A 4WZHA 2W3ZA 4ROPA 1JAKA 3VX1A 3RPMA 3I65A 2NSOA 1JD7A 3KW3A 3OZPA 3LSCA 3GO2A 1JF5A 3K13A 2BP1A 1JUBA 1EDQA 1U5VA 5GNYA 2O4MA 1H7OA 2HNEA 1PZ0A 3IS4A 4JN7A 3THCA 3WUGA 1ICPA 3PG8A 2VX4A 4O1EA 4MZYA 5DQPA 5MF5A 4QAIA 3UWYA 1FWTA 4ES4A 3AXKA 3ANVA 2ZVIA 4ZXLA 3O15A 5CC6A 3PTQA 4PL1A 1ZENA 3V1PA 1T8QA 3S5YA 4F0RA 4F0HA 1Q6OA 2H9AB 5FAGA 2VGGA 3N2XA 3RPTA 5FF3A 2OFJA 4UTFA 2YXGA 3CHVA 2Y0FA 3IUHA 3V75A 3V0UA 3WD2A 5FF0A 5BMXA 5FEPA 1V79A 2A7NA 2EKCA 3B0XA 1E0UA 2UBPC 2G97A 4ZB2A 3H2NA 3PUGA 1WE5A 1XIMA 4N2YA 1K1DA 2FFCA 3K30A 1JYVA 4XZIA 3E6EA 3KRZA 3JR2A 5LNVA 4DWSA 1TPB1 3UCCA 4LU0A 3WQGA 2XZ7A 1K9DA 1HJUA 1EGMA 1S38A 1G4EA 3BLKA 1J2BA 1EX1A 4K39A 1XSJA 1UOKA 1WB0A 1AL7A 3ABOA 1YADA 4GFIA 4JAWA 4LS2A 1FHUA 1LUCA 5K7JA 4M1RA 3W28A 5DF0A 1CB7B 1TTQA 4K38A 1GOXA 2W9MA 5I09A 1EJSC 1IWPA 2G0WA 4QNWA 5FA5A 1WKEA 1G1YA 5EFDA 1PVNA 1BYBA 3BJTA 4DZIA 5BRPA 1XP3A 1KTNA 5FACA 1M7JA 1YEYA 5HR6A 2QGYA 3UG3A 2NZLA 2D73A 2ZVRA 1QI3A 3GG1A 3TIMA 5H1WA 1FOBA 3L2LA 2EPNA 7PTDA 4DUVA 3II1A 1ZPTA 4I7VA 4W85A 1OWQA 5CEWA 4Q4KA 4DJDA 1S46A 3UWVA 1X6LA 3WUBA 2WVTA 3WF4A 1A5BA 3VOJA 4LYQA 1J0ZA 2FJUB 5FSDC 1ZY9A 4XZBA 4B5XA 1QW9A 4TX6A 4XB3A 1UKTA 3LLDA 7TAAA 3TN4A 3H24A 1W1B1 2PWGA 1TIWA 4AC1X 3W23A 3T2OA 1VJSA 4JEQA 1IR2A 1GUVA 3WEOA 2X1TA 3TSBA 4QG9A 1XCXA 1BVZA 4Q4OA 1GG0A 3CZLA 4Q8PA 4AX7A 3UWEA 3T81A 4OZOA 4FXJA 2V69A 4UFKA 3PVFA 3PHAA 2PWDA 4XIAA 4LYKA 1E1FA 2V5KA 3UZYA 4L65A 3TA9A 2NV2A 2YDAA 2VT0A 1AK5A 3OG2A 1OCJA 1IXOA 4XZLX 4RZ5A 3V16A 5K4ZA 4S3EA 4GJJA 1HQTA 4H4IA 1KCLA 2XWEA 3GXDA 1V08A 2ISVA 5E9XA 1AQMA 4HMEA 1H7NA 1N2VA 2J7GA 3PBWA 4X0VA 1PAMA 3DFHA 4DB7A 2VD9A 3KZPA 1Q7ZA 3WMLA 1J8VA 3S6OA 4MWAE 4JTDA 1HL2A 4D1JA 4UR9A 3UETA 4HHPA 3W02A 3PJUA 3PNUA 3K1GA 3DC8A 3W1PA 3G18A 1JDEA 1WDRA 4UQAA 1LJYA 4QS6A 1UUOA 1ZB5A 1UR0A 1TWDA 3SN1A 1H0IA 2GDUA 1XIIA 4XIMA 4HPXA 2WV8A 3HGJA 4U33A 4O1CA 2HV5A 3KTSA 1RBOB 3FY1A 4Z1DA 3TTOA 1QCWA 1QNSA 3BLDA 3W7GA 4GUFA 2DW7A 4AWUA 3QBUA 4NILA 4GUIA 1OFAA 3RUBL 1AMKA 2A6LA 4Q6JA 1OGGA 1ONXA 2DVTA 2WKJA 1UG6A 3GXPA 3W7MA 1UC5A 2EQDA 1MZRA 3RJYA 2R8WA 3CH0A 4X2RA 4E8GA 1ICSA 4IMAA 3GUWA 4YTRA 1EB3A 3EDFA 3C3UA 4IL2A 4F4RA 1XIFA 3RCMA 1FWIC 1SW7A 4XAYA 4PUKA 2Z2AA 3M43A 1UR9A 4G8TA 4FB7A 5AVNA 1EGZA 3QM3A 3V4BA 1B4EA 4JTGA 4GVIA 3DYMA 3HFYA 4HQVA 4PTWA 1GWJA 2FZMA 4M6PA 3WQOA 1A5UA 1JQXA 2C1GA 3D5HA 3L4UA 3A9BA 4PULA 1MEWA 4ZB5A 1REQB 3B04A 1PZ2A 2YLAA 1ZLPA 4WDUA 1DE5A 1RVGA 3LLFA 3AQUA 1UC4A 5D8WA 5LXEA 3WJZA 4LYRA 5G5IA 3LPOA 2ZDRA 5CSUA 1XDMA 1MMFA 2V2DA 3VDCA 4QLKA 2W91A 2DZSA 4FZIA 4LAKA 3LM3A 1R5YA 5F4WA 5KZ6A 2WMFA 4IJCA 2A3EA 1VJZA 2VP8A 5DRIA 4DWSC 1XRFA 4H2CA 2X1SA 4A8IA 1GOWA 3VO0A 3T44A 5JBFA 1TWZA 3T0DA 1MUMA 1CNVA 3OOQA 4B5NA 1UUQA 4MDPA 5IHSA 1QHOA 1RCOB 5K9CA 2AQVA 4XZWA 2C1HA 4JTEA 3HFTA 4LWWA 3W6YA 1AW5A 4P7QA 1QRQA 4WSJA 3CJPA 3SSZA 1E1CB 2Z1VA 2OELA 4QP0A 1E1CA 5D9PA 3I4KA 1WOBA 2INFA 2YA2A 3IIOA 3PJTA 4NY2A 2VUYA 3O9NA 1DQWA 2J79A 3PZMA 1MSSA 5FF2A 1TG7A 3H53A 1W3KA 1J93A 4TXEA 3T0AA 3JVAA 3WSUA 2CXGA 1EQPA 3HJEA 5DXYA 1BEUA 3WD1A 1PV8A 3NG3A 2D2GA 3KXQA 1XUZA 3AXMA 2WM1A 4TX8A 1JPMA 4IWWA 1JZ3A 4JN6A 2IKIA 1LYXA 4CCEA 2QCCA 3M5XA 2HXTA 4BY3A 2D0HA 3S6DA 4IFKB 3DZ1A 3GZAA 3BTNA 4EANA 2Z1WA 3WQVA 1KRMA 3UXKA 4BI5A 3VZZA 3F2CA 1HO4A 2QUMA 4KFOA 5FJJA 3LGDA 1T41A 2RGMA 3RO8A 5EFFA 1B5TA 1Q2SA 4L1WA 4P61A 1DIKA 4GUHA 4UFJA 3M0VA 5HXMA 3W1AA 1H49A 1W8GA 3FYOA 4IMGA 2YL9A 3L2IA 3RILA 5E5CA 1P1MA 2F6UA 2WJFA 1AA1B 1YDOA 3CV1A 3LD5A 3CAWA 1BRLB 1KV5A 2C0AA 4Z2KA 4JFTA 1EQCA 4A3HA 1IF2A 4NSBA 2EO7A 3PBGA 1TJRA 1BXNA 1ZJAA 1V6WA 4YTQA 3UWWA 4P8VA 2ZE0A 1JPIA 3QPEA 2NVAA 5B80A 4AB4A 1QOXA 3P8JA 2DT1A 1VYRA 3SCSA 3GUGA 3STFA 3NEHA 1V4YA 3B03A 3N04A 1C91A 4FLOA 5T9CE 1PPIA 1E5JA 1N7KA 2CLEA 1ALDA 5LHFA 3W6MA 4Q8UA 1J12A 1MQPA 3R8GA 5IDZA 1RPKA 3L9CA 2VNCA 1YNQA 4IIEA 3UZXA 5KZDA 3APGA 3G0SA 5U4NA 4JNZA 5EMYA 3T8QA 1XLAA 4Y9OA 2YKKA 3W0KA 4NXSA 2PF8A 3QN3A 3O06A 4O57A 2Y5SA 4MJZA 4JFVA 4M29A 1J4EA 2Z24A 4UQCA 4UR7A 3B9EA 1SM9A 2ZRUA 1KR1A 4AVNA 1WAWA 5E0CA 1QPNA 1SJAA 3CPGA 5F4SA 5DLCA 3WLTA 3VUSA 1A0CA 4WSKA 4RUBA 1C7SA 3GFZA 1GVQA 1PJ9A 3MDUA 5C70A 3WF1A 8TIMA 1V8EA 3SCRA 4XUGA 2ESCA 4AWSA 3B9OA 4S3FA 1I0BA 2EJAA 3LXBA 4GX8A 3ZS4A 4IT1A 3NQBA 4F0SA 3EWXA 2XFFA 3GYEA 1XWYA 4GBDA 4MAVA 4X2PA 5A94A 4D71A 3SURA 5KETA 1WXYA 4LANA 1R46A 1K02A 4HNUA 5A69A 2P76A 1UJPA 4YIWA 1EJUC 3G77A 4KGJA 3TAKA 1ISZA 4GNVA 2RUSA 2OZ8A 3JU2A 3G3DA 4QDMA 1G4PA 2DZUA 1EPVA 2DORA 4OBTA 3N19B 3WN6A 2FH8A 3WH5A 3QC3A 5DT7A 3HGRA 4YWSA 5AYIA 1MYRA 3MT1A 3MUY1 5EY5A 1G01A 2VD8A 3PZQA 2CU0A 4FNQA 3MUXA 3A23A 2YOCA 1P0NA 3SQMA 3KLKA 1QK2A 1HKKA 3AS2A 3SUTA 4EAMA 2P5NA 1EO7A 1R0MA 2E1WA 3CZGA 2VR5A 2J78A 4PMVA 4GX9A 3SCWA 2QIIA 3V1HA 2YJQA 1JPDX 3LN3A 3T7VA 1G7VA 1FCBA 1GCYA 5C0QA 4XZHA 1H50A 3S2LA 2Y7DA 3BPWA 1ZCCA 3UPMA 2WLYA 5I3IA 3WMSA 4U3AA 5CGQA 4E38A 4H00A 3DH7A 2YDRA 2GVGA 1IEQA 4DNMA 4P7LA 5I02A 3C8FA 5JIWA 3I6TA 3KRBA 5A6SA 1TQXA 3MCNA 4K8HA 2JFEX 1GOOA 3AXXA 1HL8A 2C19A 4FNPA 2WHMA 3HN3A 3BANA 1XGEA 3EOUA 3H12A 4LBRA 3OO2A 3G1XA 3UR7A 4L61A 5FF4A 3CIVA 3NL2A 2ABBA 4YYFA 1ME9A 4ZR8A 1WDPA 4GC3A 5ABTA 4JY9A 3WO8A 5CPMA 2CW6A 2P8BA 1NEYA 2XJ7A 1OGSA 4PUUA 1M68A 1AMYA 1BTCA 1VBUA 3W29A 3L68A 1OC6A 1K8XA 2ZUNA 5BROA 4GWEA 1AL8A 4H9XA 4ZTXA 5D9NA 5F2IA 2NSXA 3IK4A 2VWSA 2SFPA 2XIQA 2A0NA 4AMCA 3FAXA 3ECQA 2I5GA 1LORA 1XLJA 3GW0A 4WSHA 3GIQA 1RZMA 1PKLA 2XIIA 3PM6A 1W91A 3DKJA 3GNRA 3W7EA 1M01A 1IT7A 1Q65A 3VVGA 3WD0A 1XL9A 1J96A 4JQAA 7TIMA 3H26A 1B3XA 2CEQA 2QCEA 3OW1A 2Y7EA 1FP9A 4DYJA 4LUYA 1G69A 2XIMA 4PBGA 2GVJA 1XUUA 3BGJA 3SIZA 5C2CA 4CU8A 2P50A 1QWKA 1I2PA 3MO4A 3PZOA 2AGTA 4AHQA 1A3HA 3IPWA 1QT1A 2IPWA 1DWGM 3K8MA 4GYFA 4DIAA 1XIGA 1YNPA 3CMFA 3PULA 4CD6A 1U1UA 1PHWA 1PUDA 1E51A 4INFA 4AXNA 2FTPA 4YVVA 2VHLA 2VELA 4Q7NA 1OK6A 1ISYA 4IPNB 1RD5A 1W9UA 4LALA 2HROA 1NP2A 2E1DA 2AAMA 2DSUA 2BODX 2XISA 4R53A 3PS7A 5FI8A 3AU6A 4OHQA 1TJ0A 4DXVA 2KZHA 2PZ0A 4O54A 2CITA 4ZENA 1HW6A 1WKDA 2BY0A 5LIWX 3O8AA 1RSCA 1K6WA 3E1F1 3WEMA 4HJWA 2VEGA 4G7EA 4IPJA 3A22A 4CNNA 1H11A 3BARA 3RM9A 1M9HA 2EBNA 4RDZA 4L9XA 1OF6A 1FWWA 1VPYA 3BK0A 2Y70A 1AD4A 4L4PA 3RF9A 3P8IA 4CQCA 4Y9PA 3M1ZA 4GGBA 1PIIA 1LBFA 3S3GA 1Q6DA 1EZ2A 3IK2A 2OSWA 1F5ZA 1SJBA 1MW2A 1BWVA 1V0MA 3P5ZA 4EOUA 4QCEA 4A29A 3F5KA 3U5YA 3AS1A 4PMDA 1HX0A 1PIFA 4N0RA 3ZO9A 4AY8A 1TA3A 1X7FA 2XGBA 3AIWA 1MW0A 3LGEA 2QYGA 1IWBA 5I0DA 3QRHA 1LF1A 4QSFA 3H7RA 3SRHA 4WY0A 4LUTA 2G50A 3I3EA 1P6WA 3VKDA 1ADDA 3C2RA 1DIDA 3NYDA 4ZQMA 1TPWA 2DT0A 1J01A 2V5CA 2E0PA 4MNMA 1UD8A 4C6BA 3O0FA 1OF8A 3OGVA 1R86A 2FZNA 4XAGA 1LBMA 3DBPA 4I6KA 4LAOA 3T08A 1I2OA 3N6HA 3HGOA 5GJNA 2RGLA 4XSLA 3CBWA 4RJEA 3LCGA 2X2GA 2MANA 4H8VA 3R6IA 2GK1B 3ARZA 3HQ1A 1GT8A 2TODA 1WDDA 5AC4A 2FVKA 3RR1A 3MHGA 4PTNA 3CNYA 3PBMA 1KLZA 3EX6A 1EBGA 3UF9A 2O56A 1CI1A 2YA1A 3LQGA 4P5UA 1UYQA 4RZ6A 2QAFA 3TR9A 2EHHA 1JQVA 1JCJA 1VFFA 3W00A 2W61A 2V5DA 1RY8A 1GKQA 4J3XA 2BHUA 4LUSB 4NVTA 5E70A 3N3TA 4GUGA 1UA3A 3UR5A 1M7OA 1NVMA 3CXOA 2F8QA 4NRRA 1Q6QA 3DU0A 2BVTA 3W84A 3WFZA 2PDCA 4E6MA 2R91A 3PB2A 3TYAA 3M41A 5D8ZA 5C55A 4GQGA 1MVYA 4LSBA 4M7TA 1Z41A 1HJWA 1S2UA 4JYFA 1R2SA 3H55A 5LA1A 5EYWA 2DJLA 5AHIA 4LB4A 1JXJA 2GGHA 3DG7A 4QDWA 4OUEA 4HA1A 3WDQA 5DXXA 2WC7A 1K8ZA 5EBUA 4EXQA 5J5DA 2PDPA 4ILSA 3W7JA 2PPGA 2YW4A 4J2PA 4TX9A 4GVHA 1DWAM 3BAYA 3V3WA 2X1IA 2WMKA 3CMGA 3R10A 1HN1A 3WL1A 4OQVA 1YPIA 2GOUA 3TCSA 4NRSA 2YCLB 4IQDA 5LIKX 2QS8A 3NQEA 5CC3A 5CLTA 4BJHA 3VM7A 1EYWA 4DX3A 1CW2A 3EOSA 5BXTA 2ZZ7A 1DJXA 4P7NA 1H5YA 3CZKA 3DUGA 1BWKA 1J11A 5MKGA 3MTWA 1F3TA 3ANUA 3QY6A 1KFBA 4NNBA 1R8LA 3WUEA 5TNVA 3U7BA 3FSUA 2W92A 1PBGA 1IV8A 1GPWA 4O0ZA 3WDPP 1JDCA 4N02A 3EWWA 2E6DA 1UKSA 3GXNA 3PZNA 1EDGA 2J4GA 4ZOEA 5D09A 3HPXA 3W72A 2CBVA 1QXLA 1I0DA 4ZEPA 3NSMA 1S1PA 2CYGA 1SFSA 6ALDA 2V5JA 5LGZA 2XIBA 1W31A 1XFCA 3D3AA 3MCOA 4MUPA 2YFOA 3K5XA 1N8FA 3S5ZA 3LS9A 2P53A 3VGHA 3L5LA 3FX4A 3AHTA 5HUOA 3LA4A 3CUHA 4A05A 1S2AA 3WDRA 1A5CA 4AYGA 2XN2A 4PTXA 3L65A 4HT3A 1H1ZA 1TPEA 1TV8A 1RA0A 3TYUA 3GNNA 3RR4A 1XYBA 2YIHA 1RK6A 2OYMA 4BHYA 1OQFA 3WBEA 2OCZA 4IX2A 2OODA 1JL8A 5I5RA 1C8QA 5AB3A 4QE5A 4MWAC 3D0CA 5CJ5A 1SVDA 1HKVA 3HTWA 2JEQA 3DCPA 4NL1A 1H5VA 1W1A1 3LBOA 5F1UA 1UB3A 1ZAJA 1W1ZA 2OO6A 1SSGA 3KCJA 5G4EA 1LRNA 4R88A 1RUSA 3P62A 1KRCC 3G1RA 1A5SA 3KHDA 1OGBA 3NQAA 4CN1A 5IDIA 4Y96A 3KBSA 3WLRA 2IW0A 3DFSA 4KCWA 3LZ5A 1PIGA 1YKWA 1RAKA 2OEMA 1LRQA 1ML1A 1RD6A 2JF6A 2EG6A 3DECA 3MKCA 2F84A 4XZNX 4NIRA 2Y2WA 2ZUSA 3TOPA 4GO8A 1TPDA 3O16A 3AZRA 4O13A 3QZ6A 2WCSA 4H7VA 5HPOA 3ZWSA 2Z6IA 4S3BA 4NJKA 3ZJKA 1W0MA 2YPIA 2FGBA 2WANA 4BQ2A 4WR3A 3NVDA 4LF1A 1BVWA 4JIEA 1US0A 3SGGA 1GZGA 2XVNA 3B4UA 2QF7A 3JW7A 1W2VA 1W3JA 2J24A 3WYZA 1GEQA 1U83A 1WUEA 2GDVA 4ADSA 3VDAA 3UWQA 1RP9A 2Z27A 4QS5A 3RMEA 4D8ZA 3S1WA 1PCKA 3SQSA 4AD1A 2H8ZA 2TYSA 4RE0A 4AIEA 1G0CA 3D6NA 1MO0A 1HP5A 2V82A 1KBLA 4FP1A 1QI4A 1UWTA 1VENA 1UOZA 2FPTA 2X0SA 3UU0A 3WQ8A 4UZSA 3P60A 2IS7A 3TWAA 1L6FA 3T2QA 2YDQA 1JIBA 4EVZA 4FOKA 1KFKA 3IVUA 4UBPC 4B92A 1SGJA 4QBXA 1C9WA 4S2CA 2HPIA 5I00A 4RNIA 1H3GA 3WQCA 1UBSA 3HQOA 3LSBA 3J7HA 4Z08A 3B0PA 4AUBA 1A4MA 1WX0A 5M17A 1IGWA 3EKLA 3GU1A 1SYTA 5I7GA 2V2CA 3ZIZA 4JTQA 1OFQA 1WQ5A 3E0WA 3R8RA 1VC4A 4H19A 1AG1O 1EA9C 4HZ6A 2AGKA 1DPMA 1XBZA 5G4HC 1XLDA 4QITA 4RKAA 4K36A 4CD5A 3HQPA 2ZRXA 2V0TA 2PGFA 3UZJA 4W7VA 4JN8A 4E0CA 2GSHA 4OU1A 1GVRA 1HGYA 2CKSA 2X41A 2HE8A 1GGOA 3WQEA 4DBWA 4XBKA 3LU2A 3ONCA 3QH2A 2CZFA 3C0LA 2NQ5A 3CIWA 3L0KA 2VC9A 3TQKA 4O18A 2JF7A 3KL3A 4H9TA 4DN1A 3QLLA 4I9AA 2VEIA 2CLMA 3QQ1A 1A50A 5I07A 2QUUA 3WK1A 4UMCA 3W76A 3FFSA 2Z6JA 4HCHA 4E8DA 1W9XA 4FXFA 4Q8WA 1SZFA 3UBPC 1M41A 3B9DA 4LT9A 3MY9A 5JBDA 2NQHA 3LX9A 1W8SA 2XYLA 2HS6A 2BVYA 2OR2A 2V5BA 1K7FA 2QJIA 5LIXX 1FKXA 2V63A 3QY7A 2VFGA 3ORWA 5HULA 2ZX6A 4A2SA 2FB3A 5K2ZA 1FWDC 2QVNA 3EAUA 2XSBA 1OC7A 4C6PA 3CWHA 1RPXA 5G2HA 4WY0B 1Q6RA 2PDLA 2D1ZA 2PDHA 3WNNA 1NOWA 1RJQA 3BJSA 3DOPA 2PCQA 4S3JA 3LDVA 4BWLC 4IHCA 1MW3A 3OLIA 4BCEA 3N2MA 1O5XA 3WMCA 2GVYA 1REQA 4LX4A 4IGHA 1PDYA 4JTIA 4ICMA 4JFUA 4OOZA 1KGUA 1NSJA 3M47A 9XIMA 5EMKA 2V8ZA 1J2WA 3N29A 3VABA 3EWYA 2RDTA 2ZC1A 3W74A 3KS5A 4AD3A 3WD3A 2CBJA 4NZ5A 1HJXA 1X8CA 3GLCA 4J3TA 1FDYA 4K8GA 1XH0A 1B1YA 3W25A 4JD4A 1BHGA 1OYBA 3G6LA 1JAEA 1SR9A 5A8QA 2NX3A 4JIQA 2FH6A 3TUUA 4ECLA 4C6DA 1UA7A 4V27A 1ISVA 1X6UA 4LVDA 2J75A 6XIAA 3O05A 1QMLA 2VO5A 3LRLA 5HANA 3WDHA 4HYVA 1N82A 3WIJA 2ZUWA 3TYZA 4GQRA 3WL0A 3NPUA 2GUBA 4MNKA 1JF6A 4OKDA 4ZCWA 2ICSA 2Z00A 1O7AA 1CXEA 2Y7GA 4HHHA 3L4ZA 3S9ZA 4JTLA 3BW2A 4C60A 4JL2A 2YGYA 5J5RA 3B9NA 4BI6A 3G0UA 1DWHM 4WKAA 2GUUA 2Q6ZA 2VZUA 1XDJA 1EBHA 3ITGA 4QRNA 3PAJA 3P84A 2OX1A 1B9ZA 3ABSA 2YBUA 3CS2A 1CXFA 4HD5A 5A5WA 3QXBA 3VDHA 1X98A 1NFGA 4O0QA 1JDFA 1FWJC 4KESA 5IFPA 1HJQA 1NM9A 2F6XA 4CU6A 4UXDA 3B40A 4CVUA 3BCFA 1NWUA 5U7SA 4PRWA 3IJIA 2BZNA 4CQDA 3DESA 3H54A 1XLGA 2VR4A 4R7JA 1GOIA 4F0LA 3WDIA 2WNZA 1H63A 1I75A 1TWIA 1Z44A 5CAHA 4GIAA 3QGVA 4S38A 4CNSA 3U2OA 1R9YA 4BF9A 2GVEA 4DO6A 3P6LA 4JXCA 1KV8A 3ABRA 6TIMA 3OVPA 2ZXQA 1M5WA 2ZUUA 2QV4A 3U4FA 2BOEX 3DYPA 3PTDA 3GDTA 5D30A 3RMJA 1GW1A 4FIQA 1OD8A 4F2UA 1DL3A 4RX0A 4E3VA 5CJNA 1XH2A 1S2WA 2W27A 1I2RA 2XINA 5TF0A 3MKVA 3ERPA 3EKZA 5XINA 3S9IA 1V0NA 4O19A 2FHBA 1L6WA 1EH9A 1R6WA 3TFXA 3SM0A 2BNJA 3VIFA 3W6LA 1RP8A 2FTWA 2OYKA 3PJWA 2FHCA 2Y5EA 3NDOA 2VFIA 4WXYA 4NI3A 4LVGA 4GOAA 1LQ0A 1KBJA 3MP5A 1UIOA 4GYJA 4MDOA 3AIBA 3M4HA 5DFAA 2EPOA 3MB9A 3SN4A 1YQ2A 2G5WA 1QPQA 2RFGA 3AHZA 3BQ5A 3NO3A 3W2LA 2V3FA 3GXTA 2WBGA 3W7NA 3U9IA 3U0HA 1V0LA 4BF5A 4QTGA 2PD9A 3NCOA 3MYPA 2ZRWA 4AVOA 4KETA 3B8SA 2H3DA 4HNNA 1HTIA 4MWAA 5A2BA 4A3RA 2IQDA 4G2DA 3VNKA 5CBBA 1H2JA 4AMAA 3E49A 4N9BA 2DUXA 1E1EA 4O1FA 3SW6A 5HA7A 3TKFA 3NQ2A 4JFSA 4IQJA 4Z1CA 1BFNA 3WKZA 1KA9F 3R79A 3NL3A 4L1XA 5BOOA 3RLGA 1CXLA 2OLAA 3EA1A 4KH2A 1PDZA 2QUNA 7A3HA 3PWGA 1Z42A 4YU1A 1F73A 2XG9A 3UCDA 1XRTA 3QR1A 4GACA 4MKNA 3ZLFA 1GONA 3CTTA 3EOLA 1DJGA 1TTJA 3ZWTA 2O9OA 3QHNA 4PMQA 4LCRA 4RDYA 3PSWA 4XG1A 3W1TA 2HNHA 2G3FA 2VEMA 4H8UA 2CESA 4GZEA 2ZXAA 4WGXA 5G2IA 3KVLA 4J28A 1YTEA 4ACYA 4PB5A 2PI6A 2VVSA 1H41A 3H4GA 1ISXA 4HGXA 3QVQA 5A6TC 4YYCA 2NQJA 3CZEA 1NQKA 4Y7EA 1P0KA 2P0IA 4HHMA 2ZA3A 4QQ3A 3CTLA 2YLLA 3P0XA 1TJ1A 4JFWA 1JZ4A 2ISFA 2TMDA 2PBOA 3QF0A 2PS2A 4B5WA 1T99A 3MSYA 2J66A 3FA4A 1D2KA 1M6JA 4J7RA 5C71A 2VZSA 3DAQA 1MRQA 4X0NA 2HBVA 4O1BA 4NUWA 4A8RA 3NPXA 3STCA 3V0TA 1LDCA 3L4XA 5HINA 4NJGA 1GKPA 3KTXA 1R3VA 3P61A 5FJUA 1FWNA 3U2ZA 2OPJA 4KBXA 4XKMA 2WMGA 4E3TA 2BVDA 1VP5A 5FL1A 2G3MA 1PYFA 2YB1A 3CWOX 3HG5A 3D46A 5HNUA 1SJCA 1HKJA 1SMDA 3ITXA 1FHLA 4B3ZA 2BXYA 2E6YA 3RRAA 3IGSA 3IGUA 2KAUC 1Q7QA 1W1VA 3GVWA 2FZ9A 1BSLA 4B16A 4U2ZA 1V93A 4EXBA 4L9ZA 1E4NA 4E5TA 3ARVA 1ITXA 1FQ0A 1Z8AA 3NM1A 1M53A 3TW9A 4FR1A 3WLSA 4S3CA 2NUXA 1FVPA 1TPH1 2DVUA 3FXYA 2OVLA 1RR2A 1TMLA 4GH3A 5H6HA 2ZZ1A 3UXIA 2AAAA 4KFPA 2GWGA 3N17A 4W8LA 1E70M 3VCNA 3S83A 1KXVA 1QO2A 1ZBCA 3N3MA 2E6AA 4WJ8A 2QW5A 2OTDA 4O10A 3SDOA 4P8UA 4NYYA 4XX6A 1RBLA 4WXZA 4DF2A 1MQRA 2UY3A 6XIMA 2GWNA 3DDMA 4UFLA 4GCXA 4KWUA 1FDZA 3QMSA 4QX4A 3GQYA 1VIWA 5GQBA 3NVTA 3H21A 1ZAHA 3VINA 3B8WA 4HHLA 3O63A 3L21A 4EKJA 3GC4A 1VD6A 3M0LA 2ATSA 3TEVA 4EIVA 1TV7A 1NWSA 1Z3NA 3QGKC 1FCQA 5C7VA 2P1FA 3S42A 3WNKA 4J3WA 4CN4A 4YCPA 3E0FA 1KXQA 5BW6A 1S5WA 1B4KA 2WW5A 4MM1A 3G1HA 2FTYA 3FYYA 3UCQA 1KQYA 3MUIA 3S1GA 1H1YA 3CUGA 3FJ6A 1FHDA 3AROA 1C92A 1E4MM 2NWRA 3GK0A 1EYEA 4GO9A 4XAPA 3GBEA 1FWSA 1DJWA 1C8YA 3EPMA 2PTZA 4HN8A 1TZZA 3GXIA 5JU6A 2CIPA 2FGLA 4NZCA 3PC0A 1XF0A 4JHOA 1A5OC 4LVFA 4J3UA 3EX4A 1TJPA 2X42A 4H8NA 4IMCA 4AD0A 6CGTA 1AUSL 3EOOA 1HFBA 2I56A 2FIQA 4U3CA 2PTDA 2DZBA 1R9XA 1Z89A 5GVJA 1BF6A 2HVMA 4ZO8A 5HDRA 4LFYA 3UZWA 3MZNA 5K4XA 2BY1A 2J25A 3MHFA 5LNUA 3VGDA 1XLBA 4WQ6A 4TQTA 2J27A 3HG3A 2WNNA 2HPMA 3NGJA 1KFJA 1E9ZB 2A3CA 3TC7A 1EXBA 1W3HA 1IT0A 1F3WA 4L4OA 4JTRA 3ZVHB 4YJ5A 4XKYA 3MP3A 2H8XA 1DBTA 1A47A 3ZJ7A 1UD6A 3STPA 1HL9A 2I7GA 3EDKA 1WPCA 4RDWA 1V02A 2NQLA 3AJ7A 2WBKA 4I9MA 2NUYA 4FXSA 1B30A 3COTA 2EG7A 1MXDA 4DY1A 4GRSA 1GZ1A 1KNWA 3GRIA 3S46A 2HE5A 4A6GA 2PSNA 1VCFA 3TZNA 4UTTC 3LTYA 4WLCA 1TA3B 5BXPA 3REQB 2Z1SA 1A53A 3QYSA 3VNJA 3AXIA 4IX0A 1JFHA 1YE4A 1JCLA 1R3RA 4LAUA 7XIMA 3CV2A 3P0WA 1XIBA 4KWOA 4M0XA 3T2PA 4Z17A 4HSHA 2FVMA 3B8TA 2PF0A 3IARA 1AVAA 2BTMA 4H41A 1LL7A 2WQDA 3W1LA 5PTDA 5DCDA 4HOWA 1OB0A 3G3MA 4M5PA 3GC5A 4UTIA 1GVSA 1NELA 3H4XA 4JTSA 3MV11 3RLUA 3OHMB 1TUFA 2VWTA 4S3AA 5JMUA 3WX7A 4DAFA 2NXHA 2TSYA 2ZZ2A 4IG2A 4AD5A 1TV3A 2RDXA 1ZFJA 3C52A 1JYXA 2WHJA 5CCZA 3ITLA 1X1OA 1SO3A 4M1BA 3T0CA 5CQ1A 1UZHA 2UY4A 4B3LA 1UWRA 3DN5A 3CAVA 1XCFA 1HUVA 3NOEA 2IUZA 4LEFA 1KFLA 3KBNA 1JUEA 3O07A 1QJWA 1R38A 1NAL1 2C91A 1U1JA 1PWLA 2FPVA 4YMZA 3AYTA 4LY4A 4A4AA 1T40A 4HIBA 2W66A 2JKEA 5DX7A 1AQHA 1B0IA 3E3HA 5CH9A 1VEOA 2C0HA 2F38A 3ES8A 3NZPA 1KTBA 3W2KA 2Z4GA 4NASA 4PYSA 3UPBA 7ENLA 2XH2A 1W3LA 4PODA 3GTHA 4K1WA 4QXIA 3RHGA 4MLJA 1OC5A 3UWZA 4DO5A 3PFMA 1TV4A 2VX7A 3P14A 4GNKB 5BXRA 2OXNA 1YXDA 4LW7A 3LTPA 3LUTA 2C79A 4DM1A 1XLCA 4CNUA 5I03A 1OT2A 1VYSX 4XZ9A 5A8MA 1B90A 3AHYA 4J1OA 1PX4A 4ATDA 3EEGA 3UT0A 1J18A 4BQ4A 4MHBA 3THDA 5HUPA 3UGVA 3ZSSA 4DRSA 1C3FA 4PSPA 1J0KA 4AWEA 2QJHA 2PMQA 4I8DA 4JCMA 3QKEA 1S1RA 4LAMA 2DVXA 2D23A 3PANA 1OZQA 4N4PA 1M7PA 3WF3A 4Z42C 2CPUA 2X0YA 3AALA 5I3JA 1EEXA 1OX6A 2BGSA 4GLEA 3WFLA 5A2AA 3IRDA 5HMDA 3VIIA 4ZL1A 5JUVA 1DJIA 2JQXA 2HISA 4NZ1A 2FMNA 4Y8EA 2O92A 2VEFA 2VCCA 1W3NA 4HCLA 3M5VA 1SZNA 3SY5A 2EGZA 3A21A 4ZO6A 3N4AA 4H01A 2E6FA 2PC4A 1XG3A 2W5FA 1GQLA 1T5AA 3WMBA 1A4LA 3G1FA 3BOLA 3M0XA 2GQ8A 5T26A 3TQ0A 2WOQA 4Y9MA 3R58A 1XD1A 3VIHA 3E9AA 4KF1A 1L6GA 1NFBA 3W7QA 2A1YA 2IKJA 1DWJM 4LQ1A 1ZRQA 3CZJA 4TR9A 3UNTA 4LJ3A 4FX8A 1XS2A 5FL0A 5C5YA 2GQ3A 4PN2A 2ISWA 1X7IA 3KFTA 2UV8G 1OADA 4K1GA 1YE6A 3DYOA 3EX3A 3G0XA 3VPLA 2ALRA 4DI8A 5I3KA 3TCEA 3GG0A 3T0TA 1UH4A 4JTCA 3SUWA 2PDUA 2D69A 4NAEA 3C56A 3WF0A 4U10A 1F4AA 3IAQA 3W9ZA 1LROA 2CBUA 3GH7A 4HZ8A 4JTUA 1XM3A 1NF7A 1TWWA 4NZ3A 5FKYA 1H09A 4C5YA 1GQNA 1GW9A 1ZBKA 5F2GA 3WJSA 4GZIA 4JNYA 1KB3A 3H22A 2YXOA 3BG5A 1ITQA 1VH7A 2H90A 3DHDA 5C7HA 1XV8A 5BYWA 3L7RA 3BGAA 1B57A 3CUZA 1LTDA 3B0YA 3FA3A 4BQ3A 3TXVA 3EXSA 3V7PA 2R9RA 1DKWA 1PTGA 2D0FA 4G5DA 1KM6A 2NWSA 4J3SA 3UESA 1XYLA 4IXXA 1DWFM 2HK0A 3NZQA 1RY0A 5GNZA 2HK1A 3NQ6A 2NXGA 2ZBTA 3LRKA 4S39A 4NZ4A 2VMFA 2GGJA 3WEZA 4JPGA 1IE7C 5KZEA 1E43A 5EBAA 2EG8A 4Y8FA 3TQVA 3A4AA 3H6OA 3TTEA 3HPSA 4TVUA 3VK5A 3H2AA 2HDJA 4UNLA 4DZ5A 2DQWA 4Y90A 2XPKA 2GYIA 4O4WA 1Q6GA 4ICCX 3QV6A 2OO0A 3XISA 4IIGA 4XD4A 3TJ4A 3LLXA 3A4WA 3PZTA 2WM0A 3VDGA 1KFWA 4LNCA 2IQ0A 2D22A 1TZ9A 3EYPA 3W07A 1MEHA 4JTKA 1VFOA 1IIHA 2QCFA 5DEZA 1UWSA 2EKGA 1R2RA 2PD5A 3EPOA 3AHXA 4W84A 3M6DA 1P7TA 3P3BA 3AC0A 4D9PA 4OBRA 4LV9A 4ERGA 1WXZA 5JXQA 3BO9A 4I3GA 2VFHA 3MHUA 2PFHA 3VAVA 1A0DA 2QJJA 1YDVA 4MNJA 1W1PA 4DJEC 4AY1A 1FX6A 2P3ZA 3CLMA 2DQXA 4J3ZA 1BYCA 1MNSA 4OV4A 1G4SA 4AZ7A 1VCGA 3W1RA 2W4XA 2IPFA 3WLJA 1QBAA 4HCDA 2WSPA 3P93A 3PPGA 3IJDA 5ABGA 2NV1A 3F5JA 3QV8A 4WGHA 1H7PA 2E7FA 1SFTA 4HZMA 2Q8ZA 4OIFA 2Z7GA 3GR8A 4Q8QA 2CLIA 3M5ZA 1KBKA 2ZZ3A 1OT1A 5C8BB 3H2MA 2DUAA 1Q2RA 4CNOA 4KMQA 3DHFA 2HRWA 1XX1A 3C0QA 4GINA 1JZ6A 1ECQA 5EU9A 4PUDA 2J8TA 3OB8A 2O9RA 2MNRA 3USBA 3TK7A 4AG0A 3UG8A 1K8CA 2BOGX 2WWCA 4UTJA 3VD9A 2ZZ5A 3QR0A 2CERA 3QPYA 3U6WA 4QSHA 2AL2A 1PL9A 4MY9A 2J6XA 3UR8A 2OB3A 1FH7A 4HMDA 2FGZA 3DHUA 1TMQA 1PCWA 5HQEA 1VB9A 4B91A 1UR4A 1XIDA 4D6DA 3QOKA 4R85A 4Z1AA 4NZJA 4DVOA 1PTAA 3WNLA 1UD4A 3KOZA 4NF7A 1DHKA 3NFUA 5A6JA</