4JDYA

Crystal structure of rv2606c
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
264
structure length
264
Chain Sequence
TARVKRGMAEMLKGGVIMDVVTPEQARIAEGAGAVAVMALERVPADIRAQGGVSRMSDPDMIEGIIAAVTIPVMAKVRIGHFVEAQILQTLGVDYIDESEVLTPADYAHHIDKWNFTVPFVCGATNLGEALRRISEGAAMIRSKGEAGTGDVSNATTHMRAIGGEIRRLTSMSEDELFVAAKELQAPYELVAEVARAGKLPVTLFTAGGIATPADAAMMMQLGAEGVFVGSGIFKSGAPEHRAAAIVKATTFFDDPDVLAKVSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pyridoxal biosynthesis lyase PdxS
publication title Crystal structure of Mycobacterium tuberculosis Rv2606c: a pyridoxal biosynthesis lyase
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Lyase
total genus 85
structure length 264
sequence length 264
chains with identical sequence B, C
ec nomenclature ec 4.3.3.6: Pyridoxal 5'-phosphate synthase (glutamine hydrolyzing).
pdb deposition date 2013-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01680 SOR_SNZ SOR/SNZ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4jdyA00
1PVNA 3TSBA 5FF2A 2CW6A 3VCRA 2GPTA 3NPXA 4WOZA 1T8XA 3A21A 3W7QA 4H4IA 4CQ8A 3TAOA 3W75A 4CNNA 1UUOA 3O16A 4JEQA 3GDRA 5BMWA 4FNUA 4K39A 2HSAA 1W8SA 3HG3A 3LTSA 4ADTA 1P1XA 3I7SA 2FLIA 3E96A 4AHOA 3W1MA 3UWYA 4UTUA 1FDJA 1VQTA 1XUZA 1P4CA 1R46A 1TPFA 1SW3A 3OVQA 4ALDA 4JDYA 2G5WA 1HL2A 4JTLA 4K7YA 1QNVA 3LRMA 2JKPA 2NXGA 1B3OA 4O19A 2ABAA 4RX0A 1P0KA 3S5NA 2J6XA 1I2NA 3NQ2A 3W7JA 2VEPA 2V9DA 1BKSA 3IIVA 5FEXA 2ZRVA 3W1TA 1U5JA 3N73A 4QITA 2CZ5A 3ZFHA 1B9BA 1ZJIA 3Q37A 1FWSA 1WX0A 1AMKA 1SSGA 1Z42A 3DHDA 4LOCA 3QW3A 2PCQA 3W7HA 1Q6OA 2Y61A 3PR2A 3ZWSA 2X1SA 2OMAA 3GVGA 1P5BA 4RV8A 1ZFJA 3W7PA 2B7PA 2KZHA 3UXDA 3OBKA 1WQ5A 4LVAA 1H63A 3PG9A 3LBCA 1THFD 3FJ6A 4FNRA 4YXGA 3W1LA 1JCLA 3QJAA 2GOUA 3P60A 1KW1A 3HGRA 3M5ZA 2QCDB 3M7WA 3GYEA 4UR7A 2E6AA 3TJXA 1LOLA 4TIMA 1OFPA 4RZ6A 1FXPA 3I68A 1XDMA 5BMXA 2ZFAA 2TRSA 2PRMA 3IV3A 2C18A 2Y7GA 3F4NA 2FPVA 1G7VA 3O07A 4XZ9A 3DBPA 3G24A 3P82A 3L5LA 4DO5A 2C3ZA 3IGXA 3PF3A 1X1ZA 2QDHA 3PM6A 3GDKA 4HSOA 2NXHA 5KSWA 1VHCA 1AL7A 3MI2A 1TTIA 3H54A 4DF1A 2IQTA 5CGQA 4YWIA 3QM3A 3LCLA 5HWMA 2QCLA 3MYOA 3W6YA 5L9FA 1TTJA 4FEZA 4UUIA 3CT7A 3PULA 5D03A 3EXSA 1MZHA 3W86A 3L5AA 2Y63A 2HMCA 3CIXA 4K38A 1PV8A 1TPUA 5F2IA 2V30A 4Q4KA 1SZEA 4LT9A 3G1DA 3GLCA 5KZMA 4QAIA 1VCGA 1R2TA 4AVFA 5K9XA 5BW6A 4AXKA 1L2UA 2ZRWA 1ZY9A 2ZRUA 3G1YA 4JTIA 4LUJA 3PSVA 3NZ1A 3SI9A 1WAUA 1W5OA 3E0IA 2RH9A 4ONVA 4BFAA 3LHZA 1YDVA 1Q6QA 1LLWA 2OZ0A 2DZXA 3EWWA 1FUYA 4R33A 3PUEA 4HNTA 2R91A 2VEIA 3L0KA 1SO4A 5I3HA 2FFCA 3GXTA 3TDFA 2H8XA 1L9WA 2YFNA 5C55A 4JY9A 3NPVA 3P5YA 3UPBA 1TMHA 1O5KA 3NQGA 1GWJA 1N7KA 1O5XA 3B04A 1K3UA 1EP1A 2E09A 5BRBA 1GT8A 3KX6A 2A7PA 2E5CA 4NJKA 2ZTKA 3QZEA 5FI8A 3FS2A 4O28A 2Z6JA 4K7VA 4LS0A 3TCEA 3S5ZA 2QDGA 4NZJA 1KFBA 2ZRXA 3INPA 1TJRA 5CZSA 2A85A 2R14A 1I2RA 3L21A 1M6JA 4N9EA 2Q8LA 3N2XA 3PUOA 4JX4A 4E2DA 1A5SA 5D2VA 2R94A 4EF9A 3HJZA 3PWAA 5AHMA 3DFSA 1ICQA 2ZA3A 2JKAA 5EPDA 3T4CA 2TPSA 4PA8A 4TU1A 1RQEA 3T40A 1XUUA 4HHPA 3ZR4A 3H53A 4FX6M 3RF9A 3MYPA 4ZZ9A 5F4WA 3THAA 4LC8A 4MIMA 5AYZA 4G1KA 1G7UA 2CLOA 4UFHA 1TREA 2FB2A 5CKSA 1W31A 2UV8G 3O6YX 4FXSA 2ZDRA 3LRLA 3CIWA 4Y9AA 3MJYA 4NJGA 1F73A 4QIUA 1R2RA 1ALDA 4IMDA 1F6PA 2JKEA 2TSYA 1SFJA 4RZ5A 3TROA 1OFOA 2CZFA 1ZHAA 1UJPA 4ZQNA 5FESA 3FLUA 2I9EA 2NLIA 4AEOA 4HN4A 4NXKA 1KM0A 4LS2A 4ZVJA 3G3DA 1VS1A 1P0NA 4LC6A 3O1NA 1OYCA 3IIOA 2EF9A 3SZ8A 3RMJA 3TIMA 5H2ZA 2AQWA 3O6DA 3P61A 1OFQA 1HO1A 3P8JA 3QF0A 1PCWA 2QJGA 5AN7A 1XXXA 3KXQA 4OT7A 1QMLA 1SUXA 5F4XA 1FDYA 4J9JA 2F7FA 2X1RA 5KMYA 4BI6A 5FF3A 4IX0A 3TQ0A 3TE9A 1FCVA 4UTLA 5HUPA 1W5NA 1EPXA 2E5DA 3EWZA 2A6NA 4UMAA 5DXYA 4EOUA 1N8FA 4WY0F 2ATMA 2NZLA 3S5YA 1LRQA 1QR7A 3DH7A 4R34A 4K8HA 1IXPA 3C2OA 2P0OA 1GVFA 4O10A 4E0CA 4JDBA 4CLMA 5D37A 3HGOA 1O94A 3USBA 1KFEA 1OX6A 5EL1A 3TQKA 1JULA 2CU0A 4A22A 1GVSA 6ALDA 2CLIA 3HPXA 1F74A 3FKKA 1OFBA 3S1WA 4XQ6A 3OHIA 2B7NA 3OG3A 5I3FA 2WSQA 3NEVA 3IEBA 3W3OA 3DI0A 3DHFA 4I7VA 1KV5A 3GXNA 4O52A 4UIOA 5D32A 3MP5A 5G4EA 3WK0A 3ELFA 4PCFA 5EBUA 4WD0A 4JTFA 4QSHA 3W23A 1G69A 2E6YA 2X16A 4BR1A 1OHLA 4MYXA 3O8AA 4IWWA 3E12A 4Y6GA 2JGYA 4OQVA 3N3MA 2RDTA 4N02A 1GYLA 3SSJA 1TRDA 3IIXA 1ZALA 1OFRA 1TYGA 2V5BA 1F5ZA 3PY2A 4JXCA 3TJLA 2X30A 3TFXA 1V5XA 1GVOA 3UD6A 3LXCA 3BW4A 2H3BA 1MEWA 2D73A 5LHFA 1EP2A 1W37A 4O1BA 5I3JA 3NGJA 1K7EA 5FEPA 3W88A 4UNLA 2GVGA 3UZJA 3L0NA 2DORA 3W7IA 2BSLA 2WPBA 3SJ3A 5IBXC 5CZTA 3N34A 1SO5A 3B8DA 3EWYA 5LSMA 4TO8A 4JICA 4IJBA 2PRLA 3TQVA 5E0KA 1PE1A 2BLEA 4BK9A 3G0SA 3P84A 5HQEA 3NL5A 3FEMA 3NDOA 4FNSA 4NQ1A 2ZZ4A 1J2WA 1OX4A 4HSNA 1DHPA 1KFJA 3TW7A 4N9CA 3M5YA 2EPHA 3CEUA 1VH7A 3M41A 1TB3A 5DELA 4LY8A 1TV7A 3THQA 2VELA 1ZCOA 5D2WA 3WJXA 1KTCA 3KRZA 3W2JA 2W79A 3T78A 4OU1A 4ZQMA 3SGUA 3V1PA 4AB4A 2ZZ1A 4M6VA 1VYPX 1NF7A 5I3GA 3GB6A 1XC4A 4JYDA 1QWGA 2ZQ0A 1WBJA 1TQJA 1XI3A 1LOQA 3C3NA 3EX3A 1K7XA 2Z1BA 4TX9A 1WBHA 4MFDA 4MOZA 3W1RA 4U28A 3DI1A 3WJWA 2H6RA 5HJLA 5CG7A 4IMFA 2NX3A 4JX5A 2ISVA 4UTKA 1G6CA 4NX5A 4DELA 4MUZA 3UY8A 4UFIA 1DVJA 4IMCA 2WSRA 5AHLA 3K30A 1QOQA 2P10A 4NT0A 3TK7A 5LHEA 1KM5A 2V82A 4M6PA 1YPIA 1RPXA 3NAVA 2EKCA 3B4UA 3GAKA 4WUIA 3W7CA 1I2OA 3P62A 3JRKA 1PIIA 5A5WA 1RV8A 3NNTA 4N6EA 3M43A 1XFBA 4M7TA 3O63A 2H90A 1SR9A 2YYUA 2A0NA 3TMQA 3UNDA 4FHAA 3LHVA 1JQXA 3A5FA 3ABQA 3P5ZA 3QPYA 4IPJA 2WOQA 1XKYA 4PH6A 4DPPA 4XUGA 1W5MA 5EY5A 1H51A 5AYXA 3F03K 3W71A 4MZ8A 3F4WA 1UB3A 1H50A 3C2VA 3HMJG 3NL2A 3NO5A 2DJXA 4O4VA 1I8JA 2VFEA 1TTQA 1ME8A 1IIHA 1F76A 1RZMA 4NJIA 2BXVA 3TAKA 4O1CA 4ADSA 1S5WA 2I1OA 3A23A 4DBEA 4K8EA 3LLDA 2QJIA 4XKYB 1FBAA 4A3UA 3CM4A 5AC6A 4FB7A 1XDLA 4NJJA 1PHQA 1KM1A 3STCA 3LCGA 3UWUA 2GVLA 4TMBA 3M47A 1LCOA 1NAL1 5G4WA 4BI5A 2NX9A 1M7PA 2XN0A 3HF3A 3QMTA 8TIMA 3NR0A 3WFAA 2WO5A 3SECA 2Z0IA 3HGJA 2HS6A 4JR5A 4PODA 3MI3A 3ZS4A 3G8RA 3I7QA 2OT1A 2VFDA 5K4ZA 1VHNA 1LP6A 5EA9A 3C2FA 4Q33A 2QCEA 1AW5A 4TR9A 4XKYA 4O4WA 3TXZA 1FX6A 2W6RA 1VYRA 3GK0A 1KBIA 4BF9A 1UBSA 3G1AA 4O13A 3LI0A 1XBXA 2YCEA 3GAYA 4RK8A 3LTYA 2QCNA 1HO4A 3LTPA 3LHTA 5AB3A 4CNOA 3C2EA 1KA9F 1H61A 2Z6IA 1QDSA 2YYTA 3PAJA 2A6LA 1H5YA 4JTSA 2VFIA 3MP3A 2OT0A 3SIZA 4MY8A 1WDWA 3CHVA 3BV4A 3NPUA 3P74A 3JS3A 3W1UA 1KV8A 2QKFA 1G4PA 1K7FA 4NXSA 5G1YA 2ATSA 3HG2A 1VR6A 2E5BA 3W1XA 1TPC1 3T44A 3EXTA 3WK2A 3GIYA 3A22A 4O1AA 1VPXA 3E9AA 2VEMA 4N4QA 3DGRA 4GE8A 3DFOA 4B5NA 2BX7A 3S1VA 3QFEA 3ATYA 1IXOA 3HOJA 4ZQRA 3S9YA 3PB2A 2Y7EA 4IGHA 5EYWA 2FPYA 3S1XA 4TMCA 4QNEA 3TC7A 2VKZG 2QCFA 1QPOA 3KHJA 5LNSA 4GUJA 5DCDA 3W9ZA 5SWUA 4KFPA 3W07A 3DU0A 1SZNA 4DO4A 1KLYA 1Z44A 2P1FA 1TJPA 2C16A 1F05A 1I2PA 5J5DA 4DF0A 5LNUA 1TRIA 1WOBA 3EWBX 3W76A 5IBXA 4K36A 1YYAA 4WXYA 3IVSA 4LWWA 1XL9A 3TU9A 4MLJA 4MY1A 4UFLA 2CLFA 3OVPA 4GUGA 1W56A 1KM2A 1JUEA 4AWSA 1YADA 4ADUA 2XN1A 4O12A 2TYSA 2AAMA 3UXAA 5LGXA 2BZNA 3I7RA 1QPRA 3EWUA 4FO4A 4A2RA 3U6WA 2Y85A 3DFTA 3ZWTA 4PFMA 3TNOA 4JD4A 1VLIA 5DN1A 4S1FA 4Z0SA 1LOSA 3PBUA 1LTDA 2WNNA 3DFPA 2E68A 3BPWA 2CLLA 1QOPA 3L2IA 4Z08A 5D2TA 1OG0A 2LLEA 3S0CA 4NUWA 1JVNA 1KTNA 4JX6A 3HB9A 3B06A 2VFGA 1RQBA 4OWGA 1GZGA 4X22A 5LKYA 4L4LA 5F2MA 1NEYA 3UPWA 3ABOA 4NU7A 3TA6A 3SW6A 5HWNA 1JCJA 3PS7A 1JRBA 2QAPA 4QM1A 5D04C 1X8FA 2W0UA 4O53A 3QSTA 2Z2UA 1TO3A 2NUWA 2ISSA 4GUIA 4HT3A 3M9YA 1D3HA 1Z41A 4NX0A 3JR2A 3S6DA 1H62A 2YFOA 3BGGA 3M16A 3L66A 1NF0A 3LHWA 4GRSA 2G96A 4PL1A 3NQEA 4PL2A 3N14A 3TSMA 5H91A 2J9XA 3M6YA 3QMRA 3GXPA 1JCYA 3NQ7A 3G1XA 4O50A 3I65A 2QUTA 2YPIA 4O0ZA 3Q2DA 2NUYA 3CWNA 3LX9A 3NPWA 3O6CA 1ICPA 1ZAJA 4WOQA 4YMZA 5AC7A 3T7VA 3W85A 5HULA 3DFQA 3QRHA 4LNYA 2QEZA 3CLMA 1W1ZA 4UTMA 3NQ8A 2H3DA 1I2QA 3PUDA 3GDTA 3BLIA 3VNDA 1GTHA 4A21A 3W7RA 4BI7A 1DORA 4OV4A 1RVGA 3SFKA 1EUAA 3C0JA 3LHYA 5LZLA 2PC4A 4H3DA 3UY7A 2WSYA 1H60A 3A24A 4GFSA 1TQXA 3MI6A 1OX5A 5CZ0A 1OK6A 3W72A 3HPSA 2YGYA 1XBVA 3GDLA 3GNNA 2E77A 3DKJA 1Q45A 1QO5A 5HWJA 4H6KA 4OGZA 5TIMA 1DQWA 2ZRYA 5F4SA 3B03A 1DV7A 3SGZA 3BK0A 2QR6A 4M7SA 1XM3A 4ZQOA 5E93A 3UYCA 2DU2A 3W2UA 2VENA 1Z48A 1TPB1 2EHHA 1M5WA 3W83A 1DBTA 1WA3A 2RHGA 3TKFA 2C13A 3Q94A 4MJZA 4HPXA 1WOAA 3HGSA 3TMLA 2Y89A 2JGQA 1E51A 3FKRA 3OVRA 4DF2A 5DCEA 4UTTC 1ZNNA 2C0AA 3MHGA 5G2IA 3PSWA 1HFBA 4UC5A 1O95A 1RR2A 1XBYA 4FIRA 3PB0A 4MLRA 3KFTA 1B4KA 1ME9A 4HIBA 1UASA 1KLZA 2GVJA 3OA3A 1ONRA 2B7QA 1KM3A 3O15A 5I3IA 2QAFA 4AWTA 4JS3A 3MP4A 2Y88A 3YPIA 3E02A 3W7MA 4CCDA 3G1VA 3L68A 2WJZA 2H8ZA 5CPNA 4HNNA 3DKLA 2GQ8A 3IIPA 3NL6A 1SZGA 2V2HA 1H7WA 3P7YA 2HTMA 1GQNA 3W7LA 4OHQA 1QCWA 4CCEA 4FNQA 3MBFA 4M6QA 4KWWA 4FX7A 1LYXA 2V2CA 3L67A 3M5VA 4O18A 2ABBA 5FF0A 3ANYA 1YLVA 5F2GA 4R7JA 3DZ1A 3N9RA 2NUXA 2J9ZA 5AOUA 1LBFA 2C6QA 4GJ1A 2C19A 1YPFA 3S42A 5D2XA 1LORA 4PTNA 2DZWA 4P2VA 5D02A 3C61A 1GVQA 3QMSA 5FF4A 4MJMA 3UWQA 4QISA 1VRDA 1OX4B 3EB2A 1LDCA 4Z1DA 4UCGA 5AHNA 1D3GA 4NNCA 1JCNA 4IOTA 2QCHA 3LERA 1QPQA 2GJLA 1S5TA 2RKXA 1A5AA 4C1KA 4CCCA 3MBDA 5HR6A 2WKJA 3TX9A 1K8YA 1VCFA 1FDZA 2VFHA 5AHFA 1LZOA 2WNQA 1TPH1 4N6FA 4R53A 2A4AA 5C54A 1K02A 6TIMA 1QFEA 1H7XA 2PE4A 2HS8A 3RNDA 1KTBA 2TMDA 1TTPA 2CLKA 3KAOA 3MMTA 1TSIA 4XBSA 4D2JA 4CQ9A 3W7OA 4JTHA 4Y8FA 3UWZA 3LCFA 2O7QA 4IUOA 3HQ1A 1SO3A 3D0CA 3GNDA 3CPRA 4A29A 1C29A 2FQIA 1NFBA 2I14A 3BARA 3C8FA 1TV8A 4M19A 1JCMP 4NNBA 2A1YA 1GOXA 4XTIA 4UTWC 5GVJA 4X9SA 3GZ3A 4S2BA 1TPVA 1YDOA 1G4TA 3HO8A 1FY6A 5FF7A 3W7NA 3M5XA 3NA8A 1JR1A 4WX2A 4RKAA 2RFGA 4UTHA 3N2MA 2BTMA 2QCMA 1C8VA 3BLFA 1OF6A 3RLVA 4JTKA 2E1DA 3OEXA 5T26A 3KRUA 3TSDA 2C1HA 3TC6A 1A50A 2EAWA 3G1FA 4WY0A 1OK4A 3B05A 3DXIA 1OYBA 3AO0A 4OV9A 1T0OA 2ZYFA 1VCVA 3VE7A 1Q3NA 1H7NA 4LRSA 1C9DA 4NNAA 1R47A 2WQPA 2G95A 3EX6A 1TCDA 5KZDA 3UQNA 3NQAA 1IXQA 4KFNA 5DY2A 3W1AA 1A5BA 3KVMA 1PL9A 3N19B 5E1QA 3WJSA 4MFEA 1FWTA 4I7WA 4BWLA 4JTGA 4UFJA 1OVDA 3NXFA 3W2LA 1W3TA 1MSSA 4DXVA 4DO6A 3H55A 3MHUA 1EB3A 3BVJA 1T96A 3W70A 2VOMA 1KFLA 1I4NA 1EWEA 3C4UA 3KOFA 4XWUA 3MHFA 3W2MA 4GBUA 3B0UX 2DZUA 5G2HA 4JTUA 4RJEA 2DP3A 4JIQA 3PG8A 4O15A 1EWDA 1A53A 3NVTA 1DL3A 4AHQA 5G1TA 4Z1AA 5HMSA 5F1UA 5LNWA 3SR7A 5KINA 4WQ6A 1Y0EA 5DY3A 3AJXA 1PS9A 3FA5A 3G18A 4KWVA 3UWWA 1EP3A 3W7GA 2X2GA 4DBDA 2A7RA 4LVFA 4O57A 3NM1A 3A5VA 3IGUA 1EA0A 2FIQA 3EKLA 2Q8ZA 1EIXA 3O05A 4N9BA 1GEQA 5K4XA 4I7UA 3LI1A 3R13A 5D05A 4FX8A 3C56A 3W73A 2VFFA 4NZFA 1YXDA 3W1NA 4AMAA 2CLHA 1SPQA 1HG3A 5K2ZA 2J24A 5CPLA 3B0PA 2EGZA 2Y62A 2YW3A 3PBWA 4MPQA 4HKPA 4OBTA 4UTTA 3CEPA 3NM3A 2YDAA 1B4EA 3NQVA 5C6MA 4RCXA 4AHPA 3QPZA 1M7OA 1SZFA 1G4EA 1TPWA 2QUUA 4L4MA 1JCXA 2V2DA 4JN6A 3V75A 3LCXA 3NL3A 1YTKA 5F2LA 1F7BA 1GYNA 3IVTA 3G0UA 2JBMA 2QUVA 4RLIA 4UXDA 3DAQA 1I45A 1OJXA 1GG1A 3L65A 2J88A 4LTSA 5FEZA 4Z1CA 3TUUA 1LRNA 3RU6A 2PURA 4NVTA 3P81A 4X3ZA 2GQAA 3W7KA 3F1QA 2B0MA 3DFNA 4O8RA 3CU2A 3BG5A 4IXHA 2VEKA 4W9TA 3MW7A 3RK8A 4WXZA 3GX9A 3LOTA 5TQLA 2CLMA 3EKZA 1H7RA 1DQXA 2ZTJA 3R12A 3M0ZA 1WXJA 2JK2A 4KKXA 3FJLA 4OE7A 4IMGA 4K6AA 4JY8A 1LROA 1CX9A 3TH6A 3G8EA 3M44A 1FXQA 2WNZA 1SFLA 2FPTA 4IMEA 4ZQPA 2R8WA 4LVGA 3R89A 1JJKA 3L9CA 3PC0A 3G3MA 3WJZA 1VLWA 1TV5A 2DZTA 1V7YA 3RFAA 2YXGA 1G67A 3NYZA 2J27A 5DXXA 3MO7A 4RXGA 3R8RA 4UMCA 1EEPA 4MY9A 1KM6A 5A8GA 2XN2A 3FYPA 4O16A 3IGSA 4JTJA 5C5YA 3BGJA 2QCDA 5CPOA 1LBMA 2CWNA 3CQ0A 2E6DA 4M5PA 1DKWA 4GWEA 4LUIA 1TPDA 2ISWA 1VGAA 4GC4A 5D30A 2QF7A 2VXNA 4X2RA 4Y96A 1DJQA 3GDMA 5I3KA 3HIJA 3LGEA 5DBTA 3G1HA 3TW6A 2YW4A 1YXCA 3EWXA 1XCFA 3W7DA 4O14A 3HG4A 2C14A 4O54A 1K8ZA 4YL2A 3WJYA 4U4MA 3LRKA 3IIZA 4JYFA 5CSSA 4MVAA 2V81A 4LW7A 1FCQA 3LBMA 3DENA 3BG3A 3U8GA 4MYAA 1SW7A 2NWRA 2ZZ2A 3BG9A 2WV8A 1YDNA 5LNRA 3W2NA 4UTWA 1BEUA 3SY5A 1A5CA 4DPQA 3QSRA 1AK5A 4N9DA 5J5RA 4UR8A 5IM51 1PCKA 1W5PA 5C2XA 2OJPA 1FWWA 3KRSA 3W2KA 1T99A 3P67A 5AFDA 2Y7FA 4XTDA 2ZRZA 2ZZ7A 4GUHA 1YTEA 4QQ3A 4WZHA 4O0KA 2ZA2A 4YCPA 5FEWA 4LV9A 2YSWA 3G22A 3LV6A 3FFSA 1TPEA 1SU5A 5LGZA 2X1TA 3W7EA 4Z1BA 3T55A 3TR2A 1MXSA 1OF8A 4BWLC 4JNMA 3W1PA 3QW4B 1X1OA 3QYQA 3LCWA 1H1ZA 1ADOA 2Q3OA 2ZZ5A 1S3HA 3FOKA 3A9IA 3NQDA 4EWND 4LS1A 1DJNA 3E49A 4UTIA 3KVLA 3M1ZA 5ABTA 5K7JA 3S5OA 4PEKA 3NG3A 2FJKA 4DQWA 3VE9A 1GJPA 2DJLA 1OYAA 1AW2A 5EKYA 3NOEA 3BO9A 3NQ6A 1VYSX 3ATZA 4MZYA 1ME7A 3MUXA 4JTTA 2ZZ6A 4S2CA 4EF8A 3LLFA 3W74A 3R2GA 4CNPA 3LM7A 3RLUA 1K8XA 5HINA 1MO0A 1EUNA 5MHBA 2VC6A 3LHUA 2ZA1A 1RQHA 1ML1A 2C15A 3S1UA 4GNJA 2DZSA 3G1SA 5AHEA 1W54A 1EX5A 2RDWA 3EX4A 3PBYA 5CZJA 1ZENA 2OX1A 1SO6A 5HUOA 5U4NA 1BTMA 1HUVA 4FXRA 1S5VA 3TXVA 1H1YA 1FQ0A 5D38A 1OFEA 1CI1A 3I6RA 4AWUA 2ZCGA 3O06A 1SSDA 2PRHA 3STEA 3STFA 2RDUA 2Y7DA 4HNVA 2Y6ZA 2QCCA 5HNRA 2NXIA 2NWSA 2FDSA 4IQLA 1K03A 4GUFA 5DCBA 5AHIA 4ORMA 1BWKA 2Y70A 1X7FA 2O7SA 2A2IA 5K9CA 4RR4A 1LM1A 3EX1A 4YLWA 4LVBA 4JIPA 1IF2A 1Q6LA 2CZEA 4HNUA 1KBJA 2B7OA 5D09A 1ZAHA 2ZBTA 4UFKA 2YZRA 3LV5A 2B4GA 2QJHA 1G4SA 2V8ZA 4GXMA 5KZEA 3BW2A 4IXXA 3W1QA 2J9YA 1IGSA 1JUKA 3NQMA 3FIGA 1QPNA 2OCZA 3EEGA 5L6UA 4HPJA 1F2JA 4ZMGA 2DZPA 3P8IA 3KVJA 1O4UA 3KVKA 4N2YA 5LNVA 4C1LA 4MKNA 1SW0A 5BOOA 5F1VA 5TBOA 2NV1A 2XFWA 3GR8A 4IX2A 1MEHA 4ZQCA 3LB0A 1ICSA 7TIMA 1F6KA 1IXNA 4LV4A 1AL8A 4FNTA 3EX2A 5KITA 3P80A 2ZZ3A 4Z0JA 4ML9A 1R30A 1QO2A 2CLEA 4EVZA 3GKFA 2CZDA 2F84A 1J5TA 4KFOA 3PBVA 4AAJA 1Q6RA 1OFDA 4ICNA 3LCIA 1LRTA 4FF7A 3EXRA 4RXFA 5D2YA 3W87A 4UFMA 3CTLA 4Q32A 1HTIA 1YXYA 3PVFA 1GTEA 1B57A 1JQVA 3ABRA 4YCOA 4N4PA 2NV2A 3VFLA 1OABA 4UMBA 4LRTA 4E38A 3BLEA 1SQ7A 2V0TA 1D9EA 1NSJA 4RZ4A 4WJEA 3GKAA 4DEFA 4JGDA 3QEZA 3WK3A 1NVMA 1KFCA 1L6WA 3LCHA 4ZL1A 5EMUA 2GUUA 4JYEA 1H7OA 3CC1A 4O17A 3R5EA 3VI2A 1W3IA 3B0VC 1QAPA 1UUMA 2E6FA 1X6UA 4NJHA 2AGKA 1ZAIA 2X1UA 3NZRA 4FIQA 5U7SA 3NQFA 1W5QA 4QJ1A 3W22A 1GPWA 4O11A 1L6YA 1O60A 1WYIA 3QC3A 2YX0A 1FCBA 5DLCA 5CSRA 4WY0B 1U83A 5BNKA 2Q3RA 4AF0B 5G2WA 2G97A 3UZ5A 1W0MA 4O1DA 4K37A 4POCA 5K3VA 2BWGA 3L5MA 4UNKA 1DOSA 3ABSA 3FYOA 3TFCA 3HPZA 3QH2A 1RD5A 3LXAA 5CPMA 3L0GA 5AYYA 4QNWA 1CW2A 2YR1A 2QCGA 2FB3A 1GG0A 4IPIA 2GQ9A 5K9DA 5KTLA 3HBLA 1FWRA 1AG1O 5HR7A 5D33A 1GVRA 1PHWA 1JRCA 1KM4A 3W84A 1MEIA 2A21A 4A2SA 4AF0A 4LVDA 1IIGA 1AW1A 1JUBA 3VKJA 2NX1A 1N55A 3U2OA 1WV2A 1FCUA 1XBZA 3C6CA 1BWLA 3BW3A 3CWOX 3MWAA 4XBKA 5G5IA 1J4EA 4E2BA 4I9AA 3CB8A 1VC4A 3C2RA 3GR7A 4CQAA 1VZWA 1UCWA 3TV8A 1W3NA 2ALDA 3N9SA 1LBLA 1R2SA 4FNPA 3HG5A 3Q58A 3UWVA 3IRDA 3G0XA 4AH7A 4UTJA 1VJIA 4ORIA 1LLZA 3IVUA 2A7NA 1H7PA 4MZ1A 1KFKA 2A5HA 2CFFA 5DBUA 1TIMA 5AC8A 2GJNA 3NQCA 4JTEA 4PC8A 1L6SA 3QQ1A 4Y90A 3WK1A 3C52A 4EIVA 3S8HA 3LDVA 3LXBA 4LU0A 2V5LA 3QQ0A 3STGA 1OFAA 4P61A 3OIXA 1FWNA 2FTPA 1YTDA 2DZVA
chains in the Genus database with same CATH superfamily
7REQB 2J75A 4NYYA 3ZT5A 2CW6A 3NPXA 1Q2SA 2FHFA 2WM1A 4HMNA 4H4IA 3W75A 1UUOA 3MKKA 2W62A 3VIOA 4CQDA 4K39A 1KRBC 2VEFA 3HG3A 3VVGA 1V3JA 4AHOA 3H2AA 3ZOAA 2D0FA 1VQTA 3SCSA 1R46A 5A95A 3TTYA 3NO1A 5ABHA 2B31A 1M7XA 1HL2A 1HKVA 2WXDM 2FVMA 2WHLA 3LRMA 3WLSA 1B3OA 1EHAA 2QPUA 3IAPA 1EJUC 3SADA 2WJEA 4LY4A 4I90A 3BAYA 1O5QA 2YB4A 4F9JA 4IQDA 1D8CA 5CH9A 4HHHA 3W7JA 2V9DA 1BKSA 2Z1SA 2BGQA 1O7AA 3SQSA 1U5JA 2O4QA 1U5HA 3N73A 1KQYA 4GCAA 5GNXA 1Z42A 4PCPA 3QW3A 2D2GA 3QTGA 1K9DA 2X1SA 2OMAA 2VX7A 1WNOA 2X7WA 1R9YA 1QNSA 2Y0FA 3RN6A 4F4RA 4LVAA 4AQLA 2I5GA 3KOXA 5IOBA 1THFD 4YXGA 3PZQA 1JCLA 3K8MA 4HCDA 3P60A 1KW1A 3HGRA 3MS8A 3M5ZA 3CUZA 4MNLA 2HVOA 1GQJA 3ZMRA 4W89A 4D6EA 1ONEA 3CK5A 4DXXA 1UA3A 1OFPA 4RZ6A 4RNJA 3I68A 1XDMA 1OT2A 5BMXA 2ZFAA 2TRSA 3CHEA 1PBGA 2Y7GA 4XZ9A 4Z17A 5FL1A 4JTAA 1AZ1A 3IGXA 4QE4A 1BD0A 1V6TA 4QSFA 1ZBVA 2RJGA 1V0NA 3H23A 4GO9A 1AL7A 3MI2A 3H54A 2WZEA 2XVNA 4HA0A 2J7DA 5CGQA 3LCLA 3LN3A 3CT7A 4H6EA 3WQOA 1FKWA 4KWUA 4GOAA 5DMLA 5D03A 3C2YA 4E5TA 3W86A 3CPGA 2CHRA 3VIPA 1REQA 3H2CA 1PV8A 2XGIA 5F2IA 3MSDA 3TN4A 2V30A 6A3HA 1NARA 4LT9A 3GLCA 1U1HA 1RAKA 1EOKA 1VCGA 2JF6A 1JZ5A 5K9XA 4AXKA 2ZRWA 2DQXA 1XH2A 4ONVA 1UZ1A 2HVMA 1ZU8A 1LLWA 3KCLA 4KEZA 2OZ0A 3GBDA 4TVUA 1EYWA 3M07A 2VEIA 5E09A 3GXTA 1BFNA 1L9WA 3ITGA 4GNKB 4IFOA 1K4GA 1VP5A 3O0KA 1N7KA 3B04A 1K3UA 2PD5A 4GIEA 3T1GA 2J8GA 3ITCA 3TWBA 4ACZA 2XFFA 3WLKX 2ZTKA 3QZEA 1J8VA 1DJIA 4O28A 2Z6JA 4LS0A 2VDGA 4NZJA 3F5JA 1KFBA 4ERIA 3INPA 3U7BA 1M6JA 4N9EA 2XSAA 4U31A 1VBHA 1A5SA 1R85A 1NIUA 5D2VA 2R94A 2OQYA 3DFSA 4XX6A 1UZDA 2WMIB 2ZA3A 3FK4A 1RQEA 3CJPA 2VTFA 5FJOA 2V3DA 1VFHA 1Q7MA 3ZR4A 3KEHA 3GTHA 1EBGA 1E0TA 4ZZ9A 5F4WA 1OC6A 2QUMA 4L9XA 3FSUA 3ENLA 4NZ4A 3WQVA 2O55A 3BWWA 3CXOA 2ZDRA 4WGHA 2ZIDA 1KB3A 1ALDA 3AHZA 1F6PA 4PSPA 4US5A 3SQLA 1SFJA 4MWAD 4RZ5A 1UJPA 3W37A 1B1YA 3TR9A 1M3UA 4AEOA 2OPJA 2VVNA 3MWCA 3CGTA 2W63A 1P0NA 1ZPTA 1OYCA 3IIOA 5H2ZA 1GPFA 2AQWA 1TZZA 3E3HA 3O6DA 3P61A 3PBMA 3Q67A 1R9XA 4ZSUA 1TE6A 3DEQA 4J3TA 3KXQA 3OYXA 1QMLA 5F4XA 4YYCA 4PTXA 3ARSA 4IX0A 5HMDA 1FCVA 1L8NA 3NIYA 4XZHA 3UR8A 1W5NA 3LNMA 2PZNA 3WLLA 3ONCA 1N8FA 4PUDA 4Q22A 2NZLA 3S5YA 3MJMA 2OODA 2CCRA 4K8HA 3HMCA 3MSRA 1JEZA 3N17A 1GVFA 1VB9A 1ZB5A 3HGOA 5MKGB 5H1WA 3ARRA 5A8NA 2BOEX 1KFEA 4F0HA 1JULA 3EDKA 4A22A 2HQAA 4EAMA 4GLEA 3SAZA 4RE4A 2OB3A 4D6DA 3OG3A 4Z2HA 2Q09A 4ZO7A 2WSQA 2QT3A 3DHFA 5CQ1A 1DQUA 1KV5A 2R1LA 2XIOA 1RJQA 5G4EA 1ZS2A 1HKWA 2PLCA 4KF1A 5BCAA 1G69A 2E6YA 3CAWA 3VYLA 3O8AA 1M1BA 4V28A 4IH3A 4Y6GA 2XVLA 1AVAA 3SSJA 2IMRA 1VFOA 3EB4A 2VEGA 3MZNA 4MPKA 1UA7A 1EOMA 1MW1A 1ZALA 3TJLA 4GK8A 4XISA 3TFXA 4PYSA 1YRRA 2J13A 3BW4A 5EU9A 2H3BA 2QDDA 1MEWA 1Y65A 5LHFA 2Z27A 4O1BA 5I3JA 1KKRA 2ADAA 1K6AA 4FOUA 1KRAC 2DORA 2BSLA 3CV7A 2DUAA 1SO5A 1UUQA 3ABZA 4JICA 3D5HA 2PRLA 3CQJA 4DWSA 1V0LA 3G0SA 2BB0A 3FEMA 3K1DA 2WW5A 2ZZ4A 1J2WA 1OX4A 1DHPA 2Q8XA 4PUKA 4KIEA 4LAOA 3TW7A 4N9CA 5M2FX 1TB3A 2E28A 5LIWX 4KS0A 3BAKA 3WJXA 1KTCA 3KRZA 4EKJA 4DBUA 3B3DA 3U7VA 3BLLA 8XIAA 4W93A 1J9YA 3SGUA 3WH6A 3V1PA 5GNYA 5I3GA 1SFSA 2ZQ0A 1QHPA 3C3NA 3EX3A 1K7XA 3VUPA 4DJFC 4JN8A 3WNOA 2Y4SA 3TP4A 1XQLA 3UWEA 4HVXA 4U28A 3DI1A 5HJLA 4IMFA 4JX5A 4HNLA 3DYPA 4NZ1A 4C60A 5F7UA 1DVJA 4IMCA 2WSRA 5AHLA 4AC7C 3HA1A 2P10A 1LWIA 4ES4A 5LHEA 4YHEA 5HOSA 2BHYA 2P88A 4JIRA 2GJXB 1OEPA 3T0CA 3W7CA 5DMNA 1XD0A 5JMUA 1PXGA 4A8NA 5A5WA 1CGTA 1RV8A 3E2RA 1E0XA 3GXMA 2XVKA 3M43A 3O63A 1SR9A 1XYBA 4FHAA 4LBUA 1QI5A 3VKDA 1JQXA 3QPYA 4FLRA 1XKYA 4PH6A 2WBKA 4KCVA 3PTKA 1OCQA 2JFEX 1LL4A 3F03K 3V36A 3H7VA 4J40A 1V8EA 5E9XA 5E9AA 5E6YA 2PUZA 1TWDA 1ME8A 3SEPA 4AD3A 2YKKA 4V2XA 1S5WA 2GGEA 1JPKA 1Q85A 3LLDA 2QJIA 4XKYB 1FBAA 4A3UA 2PGRA 1Q6EA 1PHQA 4XZLX 1KM1A 4HB7A 2GVLA 2IKIA 1MNZA 1LCOA 4IIFA 4MM1A 4PTMA 1Y5VA 8TIMA 2ZDSA 4ZODA 1VEOA 3WQ6A 4E3VA 1A0DA 1OGBA 2J8FA 3MI3A 3ZS4A 3G8RA 2VFDA 2PDQA 4KW2A 1BQCA 3TVAA 2VC7A 3GXDA 3L4YA 2HVNA 4Q33A 1NWSA 4HU0A 1UIOA 3V7PA 2VR2A 1VYRA 3GK0A 1ISVA 1E55A 1UBSA 3G1AA 5BXPA 4O13A 4YNGA 5BXSA 1HO4A 1QNRA 1HQTA 4GXPA 1KA9F 3EBVA 3WH9A 5C7VA 3PAJA 3VZXA 1H5YA 3BC9A 2VZTA 1W9PA 3A4JA 3SIZA 1RSCA 1UR9A 3BV4A 3P74A 3PFRA 4YN5A 1GYMA 1KCZA 5A2CA 1LUCA 1G4PA 5G1YA 4H8VA 2ATSA 1CZ1A 1REQB 3WF2A 1BG9A 4J4KA 1AFSA 4O1AA 5CLWA 1VPXA 3E9AA 2VEMA 4N4QA 4B5NA 1EA9C 4K1GA 1W6TA 1IXOA 1I1WA 2UY5A 2WC3A 3UGVA 4EP8C 3I4KA 4IGHA 2FPYA 4JBRA 1TJ0A 2WVVA 4QNEA 3SY1A 3TC7A 4JTCA 3V35A 1QPOA 3GG8A 1E71M 3BMXA 1KLYA 1POJA 1Z44A 4P8VA 3RJYA 1XRFA 3IV8A 2CETA 2C16A 2ZOXA 4DF0A 1LQAA 1TRIA 3EWBX 3O6AA 3W76A 3E0LA 3VX1A 2JEQA 4WXYA 1TJ1A 3TU9A 5H8PA 2INEA 4ACZB 3EPMA 3OVPA 1W56A 3GTFA 3MU7A 2QIWA 1JG9A 4JQ4A 4AWSA 3LUTA 3PPHA 4I5RA 4V27A 3RRXA 2AAMA 3VOHA 3E1F1 4IPLA 2FH6A 3W53A 4A3YA 4Z2IA 5LGXA 4GQQA 5KEZA 1A0EA 1L8PA 1KCXA 4FO4A 4A2RA 2Y85A 4G9PA 4PFMA 1VD6A 3HV9A 1AQMA 5LIUX 3PBUA 1P6CA 1LTDA 3DFPA 5CGTA 3BLOA 3BPWA 4ACYA 3L2IA 2LLEA 3S0CA 3CMJA 3SCUA 4NUWA 2CHOA 1P0BA 4LANA 3B06A 4ICMA 5LKYA 1GZGA 2XYLA 3VM7A 4CU8A 2OGJA 1IZJA 3G2GA 3AZRA 1UC4A 3TA6A 3SW6A 3T0BA 3I10A 3EPOA 3TONA 2C79A 3CAQA 2Y8VA 1JZ7A 3BCDA 5CZKA 2X0YA 3QSTA 1TO3A 1V6WA 4GUIA 4W5ZA 2GGJA 1GQLA 2R1NA 3LENA 1Z41A 3A47A 1H62A 1ZZMA 3GSMA 4PL2A 2QULA 2Z4GA 3NQEA 4PL1A 1X97A 3NDYA 5PTDA 3EKGA 2J9XA 3GXPA 4O50A 3UJSA 2QUTA 2YPIA 1TZ9A 3CWNA 1ZAJA 2PP0A 1B54A 4YMZA 3OJGA 4Y7EA 1P1MA 2CBVA 2G4FA 3P0XA 2H3DA 2PDBA 4CN1A 4GX9A 4PB4A 3W7RA 2PTYA 1NU5A 4BI7A 2ODOA 4OV4A 2GOKA 2VCCA 4P7LA 3AMDA 1EUAA 5BOEA 3LHYA 4B4FA 4GFSA 1R3WA 3MV11 1OX5A 5CZ0A 1C7SA 1DE5A 3DKJA 5GJPA 5TIMA 2ZRYA 1O1HA 3QR0A 1Z8AA 2PU1A 2OSXA 4GFIA 2TODA 1Q13A 3B8IA 4LNCA 2J7EA 3FJNA 2DU2A 1OINA 5D9NA 1T41A 3W2UA 2VHLA 1B90A 2RHGA 3VDCA 3TKFA 4MJZA 4HPXA 4MWAE 4OBRA 3N04A 2Y89A 3NURA 1IE7C 1QUMA 2C0AA 3MHGA 5A6BD 3PSWA 1IT7A 2BHUA 1BYAA 4FIRA 1QHZA 3KFTA 4HIBA 3OA3A 1ONRA 1KM3A 4HPNA 2YIHA 2VDIA 3UZWA 2Y88A 4I9TA 3AHTA 4XKMA 1AA1B 3U57A 3V4BA 5CPTA 3G1VA 3EMCA 3L68A 3KCJA 3KTSA 3M7SA 3IIPA 2AOSA 4G5DA 1E5NA 2Z00A 1H7WA 3AROA 1XS2A 2HTMA 4D6FA 4R27A 4CCEA 4KWWA 4FX7A 2W3ZA 4RPPA 3M5VA 3TZNA 2ABBA 4AYSA 3KP0A 5FF0A 4C6CA 1YLVA 4EPDC 2FGBA 1A4MA 3C0SA 2NUXA 1U5VA 5AOUA 3LLXA 3QV8A 3MZ2A 3GIPA 4H2HA 3VD5A 1YPFA 3G6LA 4PTNA 4DWSB 4RZBA 2W4XA 5CSUA 2OWWA 4XB3A 1WB0A 4MJMA 3W00A 4B3KA 4HYRA 1OX4B 3T8LA 3MDUA 2IKJA 1UJQA 4Q8VA 1MUMA 1W1VA 3LERA 3UG4A 4C1KA 5HR6A 2YJQA 4NRRA 3RPMA 4ZTYA 5D4YA 1I6NA 4AC1X 4CQBA 5I77A 4WDXA 2F61A 4N6FA 5C54A 1K02A 1FH9A 1QASA 5G1MA 3AHXA 4LYQA 3CO4A 1R87A 1MQRA 4DLMA 3R4IA 3DYMA 1Q8JA 2WKGA 1OBAA 4PBEA 1KD0A 3MMTA 1TSIA 2QGHA 4D2JA 1EBHA 1SMDA 4JTHA 5XIMA 1MW3A 3Q45A 3UWZA 4IUOA 1B3XA 4PMRA 5AC5A 3CPRA 3ARZA 3GU2A 2FQIA 1NFBA 1UP2A 2I14A 4ZCWA 5I2UA 1S2UA 1JCMP 3H70A 2DV0A 2A1YA 4INFA 4X9SA 5AZ1A 3ITXA 1TPVA 1YDOA 3M5XA 3AZSA 3NA8A 3BGAA 4PEEA 4L7ZA 2Z1KA 5TF0A 1EJWC 2BTMA 1C8VA 3MDWA 3CHCA 3BLFA 4MWAA 3W6LA 1NOFA 3OEXA 2IPWA 1UD6A 3BAIA 2EAWA 3B05A 2PSNA 1OYBA 3AO0A 4OV9A 3LY0A 1FHDA 2ZYFA 3VE7A 3NO3A 3GQYA 2X8RA 1HKJA 3WLJA 5KZDA 1TCDA 1CEOA 4XIAA 3TQPA 1IXQA 5DY2A 5LA0A 1JD9A 2PTDA 4F79A 3TJ4A 3VKKA 1JFHA 2BG5A 3FEQA 1VPQA 1BLIA 2XUCA 4HZ8A 4HMCA 1F07A 1EB3A 2PP3A 4MB3A 3APYA 4KIRA 4AMCA 3KW3A 1EWEA 2W5FA 3KOFA 1P0EA 3UYIA 4GBUA 3B0UX 2DZUA 5G2HA 4JTUA 1SVDA 4JIQA 4Z42C 1YNPA 4O15A 3KZPA 1A53A 3RRAA 3NVTA 4AHQA 2OEMA 5G1TA 3EPNA 4HK6A 3REQB 5HMSA 5LNWA 1XSJA 4BKNA 4B5VA 1RBOB 5DMYA 2GSHA 1Y0EA 3WBWA 3EZ4A 1X6NA 4B15A 3FA5A 3R58A 2YBUA 1PSCA 5M17A 2A7RA 4LVFA 3GG0A 4O57A 5DT5A 3T09A 4S3DA 3IGUA 4DYKA 4LYRA 1GOKA 1EIXA 3O05A 3N3TA 3GXIA 4WDWA 3MCNA 4GZEA 1A5MC 3UPMA 3ARWA 4AW7A 2G37A 1XLCA 3WD3A 5FCZA 2IPGA 4FX8A 3MY9A 3W73A 1XIEA 4A6GA 1HP4A 4IFKA 1LUCB 2J24A 5CPLA 3RLHA 3B0PA 2Y62A 2JQXA 2DGAA 3CEPA 3NM3A 4C5YA 4DNHA 2YDAA 4DJED 4RCXA 1R9ZA 1RUSA 1XH0A 3D46A 4K2SA 2QUUA 1LWJA 1JCXA 2WMKA 4IHCA 1GYNA 1W1A1 3IVTA 4RLIA 2PWFA 1U1UA 5FKYA 4M81A 2XM2A 1DWAM 3SURA 5FEZA 4Z1CA 1HT6A 2WVVB 4NAEA 2ZC8A 3XISA 2ZUNA 4NVTA 2INFA 3F1QA 2B0MA 3AXXA 4JTRA 4U2YA 5EB8A 3OW1A 3VNYA 1KKOA 4WXZA 3LOTA 1QK0A 5TQLA 1H7RA 4AG0A 3AS0A 3R12A 3LPFA 3R79A 2CXGA 2UWFA 2XZ9A 3BOLA 2AMGA 1CBGA 4K6AA 3GH5A 4W84A 3PJWA 4IIHA 4C7GA 3EOLA 1W17A 1XLBA 1WZKA 1R3TA 3TNBA 1GW1A 2DIKA 1MW0A 3ARXA 2DSUA 2DZTA 1V7YA 2YXGA 1AQHA 3AIEA 5GJMA 5HAOA 4C7DA 3MO7A 2Q71A 5I07A 4O16A 3IGSA 1E40A 3B9NA 4IM4A 4GWEA 1D7FA 3UBPC 2VXNA 5A6LA 1CGVA 5AYBA 5I3KA 3HIJA 4AY7A 3ALFA 3EWXA 1I75A 3HG4A 4F0KA 2DVXA 1K8ZA 3WJYA 1A0CA 3SO7A 4W7UA 5CSSA 2V81A 4LW7A 1QNPA 3BAWA 3BG3A 3ITVA 2WV8A 4ZE5A 5LNRA 4LB3A 4UTWA 4DPQA 4GINA 4UR8A 1JI1A 2CBUA 3WLPA 4F0SA 1PCKA 1W5PA 2C1GA 3W2KA 4KBXA 4B5XA 2Y7FA 4XTDA 2ZRZA 2ZZ7A 4I6VA 1TJ2A 4LCRA 1JDDA 4YCPA 1MQQA 2J7CA 1OC5A 3FFSA 3FVDA 4D6CA 3W7EA 3UA4A 5CXPA 4TV5A 4MB5A 1JYNA 3W1PA 1XIJA 3QW4B 1X1OA 1R0MA 3LCWA 3PP7A 2ZX6A 4CVUA 2WCSA 4PMZA 3VOCA 3FOKA 1PO9A 3NQDA 4PB5A 3EWCA 3KVLA 4KT2A 5IFPA 4MF4A 2QLYA 5K7JA 2FJKA 3VE9A 2JF7A 3UU0A 1AW2A 2E9LA 3WY1A 3NSMA 3PZTA 1ITUA 1JNEA 2WCGA 4I9JA 3WNPA 1XYMA 3WKZA 5B7ZA 2ZZ6A 4S2CA 4EF8A 3TTOA 4B5UA 3RLUA 1K8XA 5HINA 5AVHA 4XAPA 1EUNA 1DIOA 5AHEA 4AZCA 1W54A 2RDWA 3BMVA 2OX1A 5CJNA 1H0IA 3QKEA 4ZOEA 3UETA 5HUOA 4P7NA 1JYXA 4PMXA 1S5VA 4DIAA 3TXVA 2VX5A 1YMYA 3AWOA 3S6TA 4M8UA 5FACA 1FQ0A 1ENUA 4AWUA 1HX0A 3STFA 3RIKA 2Y7DA 1NWTA 2J8TA 1ZJAA 2FDSA 1A4LA 1K03A 1DXFA 2DT1A 3ZVHA 2XISA 5AHIA 3BANA 2P50A 1BWKA 3EDFA 4ORMA 3SJNA 4H9MA 1XX1A 2YOCA 3EX1A 4UCFA 3VIMA 3EOOA 1KBJA 3K4DA 1JDAA 4B5WA 2V8ZA 2HISA 1NDVA 3VNIA 1Q6GA 3W1QA 2J9YA 1IGSA 4UWMA 4C65A 2FKPA 3F2DA 2PAJA 4ZMGA 2DZPA 4KRUA 3P8IA 3KVKA 3U48A 4N2YA 5LNVA 5F1VA 2NV1A 2XFWA 3DFYA 3GR8A 3MUAA 4OKDA 3CZ8A 1ICSA 4GJJA 4FSAA 1F6KA 1IXNA 2J74A 2NVDA 1AL8A 3EX2A 4XVDA 4HPHA 3P80A 1K9TA 2ZZ3A 3WLNA 4Z0JA 1R30A 4EVZA 3GKFA 4HYWA 4CD8A 1E15A 1FHLA 1UH3A 3SCQA 3J7HA 1GZ1A 3FAXA 1Q6RA 1DPMA 4GC3A 3NOYA 3EAUA 2L5HA 4GGBA 4FF7A 2EPOA 3EXRA 4KGLA 4BQ3A 2J79A 2PWHA 2IKHA 5I06A 3WLHA 3CTLA 3N4FA 3PVFA 4EACA 1GTEA 1B57A 5AZ0A 3GUWA 3ABRA 3QFWA 4JNYA 5DO8A 4K68A 2PGWA 4NY2A 4E38A 3BLEA 2XVPA 4ZSTA 1SQ7A 4RZ4A 4WJEA 1I9CB 2G3NA 1KFCA 1IEXA 4FOJA 1SZRA 1AH3A 3QHOA 3R5EA 4AIOA 3KP1A 4MWAB 4FIQA 3NSNA 5U7SA 2PDWA 3NZQA 1O60A 1WYIA 2YX0A 3UG3A 2DSWA 5C8BB 5FSEC 1U83A 2PB1A 4QEHA 1J0HA 3CNYA 5I78A 2G41A 1BF6A 2XIBA 3OBAA 3S46A 2G97A 2IXVA 2VC9A 4MDOA 4K37A 4UNKA 3TFCA 3HPZA 1UPPA 3QH2A 1RD5A 4PTDA 1E1CA 1MRAA 1G0CA 3DIPA 2F38A 5AYYA 2VZSA 1S39A 1UG6A 3BJFA 5HDRA 3GE7A 5C0QA 4J28A 4HK5A 3T08A 2B81A 3CBWA 5KTLA 3AYRA 4P8XA 2PLMA 7A3HA 1AG1O 1QWKA 5LXEA 5D33A 4JCLA 1PHWA 2W9MA 1IWPA 1ZJBA 1IIGA 1BGAA 1N55A 4XSLA 4KCUA 4H04A 5BROA 3C6CA 1PYMA 3BH4A 2C71A 1XIIA 2Z7GA 1J4EA 3CB8A 3M0MA 1VC4A 3VNJA 1NWUA 3C2RA 4N7QA 1UCWA 3GVQA 2BBFA 3N9SA 1R2SA 3IRDA 1MQPA 4UTJA 4ENLA 2VT0A 3SB0A 2P3ZA 3IVUA 3GNRA 5A6BA 2QPSA 1H7PA 1KFKA 3ICJA 3UFYA 3ITTA 3KL0A 3PAOA 5AC8A 5IHSA 2GJNA 3NQCA 5I24A 4PC8A 1L6SA 3LG3A 3GVVA 5E0CA 3FGCA 4HNCA 3S8HA 3MCOA 1NOWA 2G8ZA 1HGYA 2V5LA 2CYGA 1HN1A 4X9YA 4IFKB 3OIXA 1IV8A 3KRBA 4M6UA 4DJFD 5FIPA 2GPTA 1TMQA 4AXNA 4WOZA 5I00A 4IJCA 2J47A 1T8XA 3AS2A 4DRSA 3CL7A 4CNUA 4YPJA 4G6CA 3S2NA 3GDRA 2VZVA 4FPSA 5BMWA 4FNUA 1DWFM 2HSAA 1W8SA 1P1XA 3WIJA 3I7SA 3LK6A 4UBPC 1DIEA 2F6KA 3UWYA 1R3VA 2HRWA 2D20A 4ALDA 5FOOA 2G5WA 4NAEB 2BODX 4JTLA 1Q63A 2JKPA 2VR5A 3LNPA 2KX9A 1EHNA 4LALA 4IPPA 2ABAA 1RJRA 4LCQA 2DT3A 4L6OA 1I2NA 2PF0A 1OWQA 1UW9A 5FEXA 5C9WA 4YTTA 3W1TA 2CZ5A 2VUYA 1V08A 1B9BA 1WX0A 4H8NA 1AMKA 2RUSA 3DHDA 4F0RA 2P53A 3PR2A 2GGIA 3CHFA 4HCLA 1KGXA 4YVVA 5IRPA 1ZFJA 2BP1A 5I02A 4C6IA 1X7IA 4Q3MA 2Z24A 3UG8A 4BS0A 3PG9A 3AS1A 3RCNA 1DJZA 4B4HA 3OYZA 4DNMA 4CEXC 4XV0A 2ACUA 3GYEA 2WLZA 2Z1XA 2E6AA 3AMLA 1NELA 4YVPA 5BRPA 3N25A 4TIMA 1EZ2A 3E0VA 2D3LA 1LT7A 2R1MA 3RMEA 1JDEA 1WPCA 5EMKA 2C18A 3QOKA 4IL2A 1G7VA 4E4PA 4OOUA 1EF3A 2GK1B 3DBPA 3G24A 3ZT7A 6PTDA 1C8QA 2C3ZA 2XINA 1OY0A 1X1ZA 3GDKA 4E2VA 2NXHA 3LA4A 1ZSXA 4IGSA 1TTIA 3QR1A 1OD8A 3AQUA 2XH7A 1OT1A 3PZOA 1XLIA 1M9HA 1ZTVA 2E9MA 4FK9A 4LAMA 2PCEA 1QRQA 3GTNA 1JF5A 1DP0A 4L9ZA 4CGTA 4GMEA 3H12A 3UF9A 1TPUA 3LMZA 2EJAA 1SZEA 3H7RA 2UBPC 4OUEA 4P7QA 4DBWA 3TZFA 1XYAA 3EDDA 5BW6A 4XD3A 1L2UA 1Z7AA 5I6SA 1EJXC 2ZRUA 3G1YA 4JTIA 4CU6A 1DWGM 3VGEA 4JKKA 3TWAA 3VU2A 1UMYA 4K8GA 3SI9A 3E0IA 4BFAA 1L0PA 3WBAA 2R24A 2VGGA 3AU6A 2CKRA 3SGGA 3EWWA 2FMOA 1MVYA 3MTWA 2YXXA 4HNTA 2R91A 3ZT6A 4PUJA 3N2OA 1ADSA 2PTXA 2G3FA 4QHRA 1WKFA 2H8XA 4HCHA 3THDA 1TMHA 2H9AA 1O5KA 3D3FA 5KETA 1O5XA 3KHDA 3K46A 4L1WA 5BRBA 4LFYA 2E5CA 4JL1A 1PX4A 4A05A 4MNMA 4K7VA 3S5ZA 3EMQA 4GVFA 2V63A 1QW8A 1J01A 1NP0A 3L21A 1IHIA 4AZCB 2PWGA 5CAKA 5C71A 3RX2A 4EF9A 3HJZA 2Z1WA 3CMGA 5BWFA 4JPGA 4UOZA 1W3HA 1ICQA 4I8YA 1EJTC 1VFUA 4LBSA 2Y24A 3HU7A 3T40A 4AZBA 4C7FA 3BSGA 2PBOA 3TLLA 3H53A 2V5KA 4H83A 4WIWA 4S3KA 4AD5A 4LC8A 2MANA 5AYZA 4Q8WA 3DOPA 5C2CA 2CLOA 4DJEA 5FJTA 2VRKA 4FXSA 4QG9A 3LRLA 3CIWA 3MJYA 3BQ6A 1QK2A 2BY2A 2FZ9A 4NJGA 1F73A 4IMDA 5H6HA 2TSYA 3B9OA 3O7UA 3TROA 4G8TA 2E0PA 3KTXA 1SJDA 4E3TA 3L12A 1IEWA 4NXKA 3T07A 2QUNA 2X7VA 1CGUA 4LS2A 5DX7A 1PWMA 4DZ5A 3RMJA 1VJSA 1OFQA 1HO1A 3P8JA 5I09A 3I3EA 2JE8A 4UTFA 4OT7A 2C8NA 1XP3A 2A3AA 1SUXA 2F7FA 1AQFA 2ZX5A 3NYDA 2ZUMA 2WC4A 5KMYA 5FF3A 3TQ0A 3TN6A 3URBA 1ITXA 1UQZA 1BSIA 2E5DA 3SCTA 4R7WA 5GJNA 4UMAA 5DXYA 3TYZA 1Z89A 4YHGA 4FS9A 2R1PA 4R34A 4C6FA 1HKKA 4WDUA 3RM4A 1E72M 3KBMA 4JFTA 5D37A 1JPMA 3LS9A 3ZIZA 1IYXA 1OX6A 3FA4A 1GVSA 4LBRA 1AQ0A 2BDQA 3ZLGA 2POTA 1F74A 3CIVA 3FKKA 1K9EA 1OFBA 4Q8QA 5JQ9A 4XQ6A 3OHIA 2VJXA 3KZSA 3IEBA 2WYSA 2BY3A 4C5ZA 3GXNA 1AJZA 4BHYA 3CV1A 3PBGA 1P48A 1ZGDA 2F6XA 3RHGA 3V5OA 4WD0A 4CEUC 2V68A 3TTQA 3W23A 4W7VA 3RLGA 4G7FA 2GUYA 2RDTA 1GYLA 3KOZA 3DDMA 3SCVA 3AC0A 4ROQA 4JXCA 3PY2A 1V5XA 4PSRA 5HMEA 3WQ5A 5A8PA 3M0JA 3R10A 3W38A 4KWSA 3NWRA 1S1PA 2D73A 3PZIA 1VAHA 5A94A 3NGJA 1V3MA 4QJ3B 4UNLA 3UZJA 3W7IA 4FZIA 5IBXC 1I0DA 4P5UA 1E56A 4K3ZA 3EWYA 5LSMA 3SRHA 4IJBA 1FWAC 5M3WA 2Y2WA 5E0KA 3TQVA 4WJ8A 2BLEA 4OZOA 1UKSA 3P84A 5HQEA 4XAGA 4FNSA 2V5JA 4NQ1A 1CXEA 4B5TA 3M5YA 3CEUA 3M41A 4B3LA 4Q4MA 3SBFA 4DM2A 1A3XA 3GG7A 3WLRA 1F6YA 1ZCOA 1HW6A 3FA3A 4NHVA 1GORA 3T78A 1XFCA 2X41A 4HOWA 4AB4A 1VYPX 3GB6A 1QWGA 4F40A 4TVDA 1XI3A 1IT8A 1W9VA 3IPWA 2Z1BA 4TX9A 1WBHA 4MOZA 1TX2A 2SFPA 4HYVA 2Z2AA 1GUVA 1EDTA 2DZAA 2IUZA 1LF1A 5G4HC 3CPUA 1KGWA 5CG7A 3S5SA 2NX3A 1CIUA 2ISVA 4UTKA 2J7GA 3CS2A 4Z2KA 3FGCB 4DELA 2XZ7A 4L6DA 4D9PA 4ECLA 3K30A 1QOQA 2BV9A 3GC4A 1E9YB 3TK7A 1H41A 3GWQA 2OZ3A 4M6PA 1YPIA 1E6RA 1F3EA 1V7AA 1J11A 3JRKA 1PIIA 3RM8A 4PRTA 3NNTA 2VCBA 3PNZA 4N6EA 2H90A 3UNDA 3KBNA 1IWBA 2DQWA 3ABQA 4L9YA 2WOQA 2WKLA 3PPGA 1U1JA 4XUGA 4CD4A 4XO7A 1W5MA 5EY5A 4YYFA 1X98A 1H51A 5AYXA 4IICA 4QGCA 4MZ8A 2OGYA 1SFTA 4FALA 3F4WA 2CERA 2D24A 3HMJG 2VNCA 4JTQA 2DJXA 4O4VA 1WDDA 4HGXA 1I8JA 2VFEA 3SCNA 1XHGA 2D2HA 1F76A 1RZMA 3L4UA 3AZTA 1GKPA 2QVNA 5T9CE 1POKA 3CM4A 1PIGA 4FB7A 1J96A 1OM0A 3TYAA 4Q6JA 3EMZA 2YDRA 3U2CA 1Z3NA 4Q4OA 1UKPA 4RNFA 2PDXA 1EJRC 3WDJA 4BI5A 3AIRA 3ERPA 3QMTA 2QJMA 3NR0A 3S47A 4PMVA 3HGJA 3VNLA 4QTGA 4JR5A 1UYQA 4PODA 4ZBCA 1PDZA 4H7ZA 3AIUA 3WLIA 5HA7A 1VHNA 2JALA 2QCEA 3IANA 1AW5A 4O0QA 4JIEA 3TXZA 1ONXA 3PTDA 3N6QA 2P0IA 3LI0A 1UZ4A 3EA2A 1M65A 3GG1A 4QXIA 3GAYA 3VDAA 3WLTA 2VRQA 2CESA 3K5XA 5IFTA 1KXTA 4J2MA 4CNOA 1CTNA 1M7JA 2BVWA 2IKGA 1H61A 4AFYA 1YE6A 2YYTA 4UQAA 2PC8A 4GISA 4JTSA 4MG4A 1US0A 1WDWA 3MUZ1 3NPUA 3FHAA 2QJJA 1KV8A 2QKFA 1QOXA 4NXSA 3HG2A 1VR6A 2E5BA 2VD9A 1TPC1 1QU4A 3GIYA 3VIHA 2VGFA 2BX7A 3FXYA 3HOJA 3S9YA 1IGWA 3FV9A 3PJUA 4Q8UA 5EYWA 4IJRA 1KR1A 2QCFA 4KEVA 1XH1A 2Y8UA 2QJNA 3B0XA 5DCDA 3TEVA 1N2VA 3W9ZA 2ICSA 3W07A 5HPOA 1BTCA 3VNKA 5EMLA 3QQWA 2EJ1A 3QY7A 1RXOB 7PTDA 3VK5A 1I2PA 1Q6FA 4IGNA 3W82A 3O9NA 2D23A 3UR7A 1YYAA 3FSTA 4WHBA 1FWFC 1P43A 2J62A 4MLJA 3ZO9A 5ECUA 3W28A 4UFLA 1TVNA 2CLFA 4GUGA 4NF7A 2PDYA 2GGGA 1IZKA 4Q7IA 5HQMA 3OBEA 4ADUA 1S46A 3I3DA 4AEFA 1RHCA 1ISXA 3UXAA 4PB3A 3I7RA 1RK5A 3KLKA 3GM8A 1FWJC 2QF8A 4JOMA 3U6WA 3DFTA 3ZWTA 3M6DA 4S38A 4JKLA 2FH8A 1DJWA 4S1FA 1EX1A 1JDFA 1I60A 4HHMA 1QOPA 1MXGA 4Z08A 5D2TA 4QRNA 3LMYA 4LUSA 5HBFA 1GVIA 1KTNA 4H1ZA 3HB9A 3B8TA 1KC7A 3UPWA 3GU1A 3V5FA 3NZPA 4W4QA 2PDMA 4DJFA 4ZXOA 3NFUA 3PS7A 1JRBA 5D04C 1X8FA 2W0UA 1RD6A 2NUWA 5XINA 1HL8A 3QC0A 3M9YA 1DJXA 2VGIA 5DRIA 3S6DA 2YFOA 3HFTA 4UNIA 3BGGA 4R9XA 3LHWA 3TSMA 4D71A 4PUUA 2WVUA 4HD5A 3M6YA 2VDHA 1JCYA 4W85A 1XC6A 1EXBA 4WOQA 5DQPA 4OUIA 4QE1A 3PPFA 4LNYA 2QEZA 2R9RA 1FWGC 1W1ZA 3RU8X 1UKTA 5HNNA 3PUDA 4PMYA 2OSWA 1DORA 2RGLA 2PC4A 4H3DA 3BZGA 3UY7A 1TQXA 1RH9A 3U9IA 4PN2A 1XF0A 4HP5A 1V93A 3UXKA 1C91A 3DCPA 3EA3A 3HPSA 1XBVA 3GDLA 1F9CA 3DBNA 4CVWA 1Q45A 4QAWA 2NQZA 1ITQA 1WKYA 1PZ1A 4YJ5A 4U10A 5DEZA 3B03A 3SGZA 2POZA 3WQFA 3OOQA 1LJYA 3UYCA 4GO8A 3H4GA 2DH3A 1JAKA 2VENA 2BY0A 1G94A 3Q94A 5REQA 1WOAA 3TMLA 3U0HA 2GJPA 1E51A 3FKRA 5DCEA 1KBKA 3PJTA 4UTTC 1OGSA 1ZNNA 1W9XA 2D22A 2WMFA 4XZMX 5G2IA 3AFBA 1GZJA 3ARTA 1O95A 3PB0A 3O0FA 4QLLA 2DVUA 3H2NA 2B7QA 1W1B1 4GI4A 3DN5A 1UOKA 4V33A 3JZEA 4AWTA 1H11A 5BRQA 5FJIA 3MP4A 3E02A 2OX4A 3W7MA 4CCDA 2BNJA 3M0KA 3IK2A 3VDBA 1BVWA 5CPNA 3ZSTA 3WG6A 2GQ8A 3ZSSA 2OEKA 1SZGA 2ZXQA 2V2HA 5D9PA 3FNDA 4LUTA 1J0YA 1GQNA 1QCWA 4FNQA 3WUGA 3MBFA 4M6QA 1XYLA 4DZIA 3EDJA 3C8NA 1LYXA 2V2CA 3L67A 4G7EA 3CUJA 3ANYA 5F2GA 3DECA 3N9RA 5A6MA 1JXKA 4CKQA 1ZP4A 4IIGA 1YIXA 4PMDA 2YCIX 2PODA 1E0VA 2C19A 3W4RA 3HZ3A 5D2XA 1LORA 2ZKMX 2OTDA 5D02A 3C61A 3QMSA 5E6ZA 1QVBA 2EQDA 2BS9A 3UWQA 1VRDA 3EB2A 4QFUA 4UCGA 5AHNA 1XPYA 3DG3A 2WQDA 4PFHA 4IOTA 2QCHA 4MUPA 1S5TA 3C0LA 2FZ8A 2CEQA 1N8WA 3MBDA 4UOJA 3TX9A 1VCFA 3IJ7A 2Z29A 5AC4A 4R53A 4C91A 2A4AA 3GR4A 3VGDA 6TIMA 5ABFB 3EYPA 1H7XA 3IS4A 3KOWA 4AEEA 7CGTA 1QI3A 2PD9A 2P3EA 1KTBA 1BYCA 3P93A 4XZIA 5E5CA 2FGZA 4R7OA 4XD6A 4GBDA 4AWEA 3LCFA 4LQ1A 3D0CA 4A29A 2XIQA 3QLLA 3M0XA 1NTHA 2WK2A 1PJ9A 1NJJA 2OU4A 2WB5A 1P7TA 3AWNA 3GD6A 1TV8A 4M19A 4NNBA 2YBVA 3UJEA 4S2BA 3RPDA 3HO8A 1FY6A 1JR1A 4WX2A 4RKAA 1J6OA 4UTHA 3N2MA 4ZR8A 2DPEA 1OQFA 4FF5A 3S2MA 4TV6A 3E38A 3K1GA 1A5KC 4ZEPA 1CECA 2XU2A 1TA3B 2FZMA 3G1FA 4AIEA 1OK4A 3OGRA 3H8AA 3FHQA 3U4AA 4RE3A 1JZ2A 3R6IA 2V6AA 4LRSA 3QV7A 2GVYA 4NNAA 1VJZA 4ZGYA 2G95A 3EX6A 1GVYA 4WEVX 3PHAA 1A5BA 4UZSA 4QG6A 4JTGA 4UFJA 4WSHA 1W3TA 3DERA 1MSSA 1TCMA 4X2PA 4DO6A 4DXVA 2O0TA 2VOMA 1KFLA 2IPJA 2HNEA 3KBJA 4QS5A 2G50A 4XWUA 1DTNA 1K9FA 3AYSA 1XWYA 2DP3A 4HU8A 5F1UA 2VX6A 4GVHA 5KINA 1YPXA 2DIEA 2CWXA 4H9TA 2WWCA 1NDYA 3UWWA 5HPCA 5CLTA 4DY1A 3W7GA 1LL6A 3PZUA 2BVTA 4XO6A 1UPMB 2FIQA 1I0BA 1XW8A 1UBPC 4N9BA 4JQAA 2UZ9A 4LF2A 1PKLA 1UD8A 4URIA 2PTWA 1GOOA 3THCA 3BV7A 3R13A 5D05A 3C56A 5EBAA 1XRSA 1YXDA 1SPQA 3LM3A 4EANA 5K2ZA 2YW3A 3KWXA 4ZOCA 5I23A 4HKPA 4GH3A 3V0UA 3NQVA 3S83A 5C6MA 5JH2A 5CC7A 1EZWA 4RUBA 3EOSA 4E8CA 1HJWA 4DAFA 3V75A 2CZVA 4DXKA 3R1ZA 1YTKA 3AIBA 2OOFA 3F5LA 3GZAA 1OJXA 2J88A 1LRNA 5FJJA 3RU6A 4X3ZA 3A3WA 4L5ZA 3CU2A 3BG5A 4FR6A 4IXHA 4PRRA 2VEKA 3MW7A 3GX9A 2ZTJA 4Q8NA 3M0ZA 2PDFA 4DO7A 2DSZA 5I3DA 1JI2A 3P3BA 4ATLA 3TH6A 1KFWA 3G8EA 1MUWA 3M44A 1FXQA 4ZTXA 4C6JA 1J18A 2R82A 2GUBA 3FDGA 5A8OA 1CENA 1JJKA 2J66A 3QVQA 2XWEA 4R3UA 3G3MA 2BGNE 4FA3A 2PDCA 1G67A 3NYZA 4KPLA 4A3RA 4GI9A 3R8RA 4UMCA 1EEPA 3FYPA 4I5XA 3VZYA 1J2BA 1F3WA 2CWNA 4N42A 4NASA 1DKWA 9RUBA 3SQMA 4LUSB 2ISWA 1VGAA 4GC4A 1EH9A 1V3KA 4X2RA 4UZUA 5CC3A 3WL1A 1B5TA 3QPEA 1GKQA 1RP8A 3G1HA 3TW6A 2HK0A 1YXCA 4YIWA 1XCFA 4D8ZA 4O14A 1RY8A 2C14A 1O68A 4D6IA 3QGKC 4JIHA 3GHUA 3V3WA 1J0IA 2GJRA 4KH2A 1FVPA 4MNJA 3DENA 1RBLA 1YDYA 4MYAA 2NWRA 3O2LA 4AISA 2C91A 3A3HA 3W2NA 3GHTA 3QGAC 1BEUA 4X63A 3QSRA 3MMUA 4N9DA 1VEMA 2XIJA 1XISA 2ZXAA 2FYMA 2E3ZA 3FJ4A 4Q8PA 2Y1HA 4S3JA 5CBJA 4AIUA 3P67A 3QYSA 5AFDA 3R11A 3NTYA 4KCTA 4O0KA 4J3ZA 5A1AA 4AZIA 4F66A 3OPSA 5DMMA 3P0WA 5FEWA 1SU5A 3ORWA 5RUBA 2X1TA 4M1RA 4LAUA 3T55A 4Q8OA 3TR2A 1OF8A 3GC5A 5A69A 1MFUA 2I7GA 4JNMA 1MW2A 3CO8A 1GQIA 2OQLA 2X0SA 2TAAA 5FJUA 4B91A 1A3WA 4PMUA 1FWDC 4ICCX 3CTTA 3U5YA 3S5OA 3NG3A 1OYAA 4LCSA 3NOEA 1C7TA 2HROA 1QHOA 4CN4A 3GC2A 1ME7A 2XGBA 4I5UA 3LLFA 3W74A 1E6XM 1MO0A 4TTUA 1J5SA 1DEDA 3CZEA 5REQB 3B9DA 2DZSA 1YHTA 1H5VA 3PBYA 1EQPA 1ZENA 4H01A 2NQHA 1AODA 3PNUA 4NL1A 1KXQA 1UOZA 2INZA 4JHOA 3W81A 1GVEA 3LZ5A 1NDWA 3UP8A 1H1YA 1MYRA 2D69A 2NQLA 3I6RA 1SSDA 2PRHA 3STEA 2RDUA 4HNVA 2Y6ZA 5HNRA 2HBXA 4GUFA 4HTYA 2Y70A 2PPGA 4J3XA 1X7FA 5K9CA 4GA8A 4LUTB 1E5JA 3ANVA 1OIFA 2CNCA 1IF2A 4F2BA 5D09A 1ZAHA 3H6OA 4UFKA 2YZRA 3BW2A 4IXXA 3NQMA 3DESA 3M0LA 5FAJA 4Q7BA 3L7RA 4GVIA 1UP0A 4V1XA 2PWVA 1O4UA 4KQNA 1OD0A 1LL7A 2IQ0A 1MMFA 3JZUA 3WD0A 4LX4A 1XIHA 3O3RA 6REQA 1UR4A 4KGJA 3ARQA 5KITA 4YVXA 3EA1A 2CZDA 1J5TA 2XDFA 2C1IA 1KRMA 1JGMA 1KBBA 3WBXA 1E4LA 1BRLB 3GXFA 1OFDA 4DUVA 3NXLA 2AAAA 4ICNA 2WC7A 4UQEA 3VCNA 4QR6A 3HPFA 5HNTA 3RXZA 1O6IA 4ZO9A 3WH5A 1J6PA 4RE0A 4V1YA 3W87A 3W02A 2GSEA 4Y9NA 1MZRA 1TIWA 4BEUA 1YW1A 3KS6A 1EKOA 3VOGA 4RW5A 2OWCA 1US2A 3PZ9A 4UMBA 4LRTA 1V3LA 4HJFA 1NSJA 4KCWA 3IACA 4M51A 3GKAA 1F4HA 3QEZA 3WK3A 4ASTA 2UY4A 3UZZA 5EMUA 3U2EA 1WCGA 4JYEA 3UGRA 1E43A 1H7OA 1QAPA 3R25A 1W9BM 4BCEA 4PMNA 3HQPA 2X1UA 3NZRA 2YCLB 2PDHA 3QC3A 1X38A 1FCBA 2D2JA 1CLKA 3WEOA 5BNKA 2Z7KA 4MB4A 3UESA 4AF0B 3TN5A 3WDPP 2NV9A 3UZ5A 3PZGA 4O1DA 4IG2A 4POCA 3FYOA 1LQ2A 1E6PA 3LXAA 4ATWA 5CPMA 3K4WA 3L0GA 1L2QA 1OC7A 2CITA 3RPTA 1XKJA 2FB3A 2GQ9A 1YNQA 3I3BA 1GGOA 1NY1A 1C92A 3HBLA 2ZUSA 1FWRA 3A12A 1LG1A 3UW6A 3AHYA 4QEEA 1JRCA 1KM4A 1MEIA 5CGMA 3R0UA 2OR2A 2OLSA 2CC0A 1JUBA 1CLVA 3VKJA 1VFFA 4HSHA 3BLKA 3U2OA 4REQA 4HTBA 1BWLA 3CWOX 1UC5A 1CCWB 5G5IA 3PZMA 4I9AA 4GIYA 2ISDA 3SM0A 3GR7A 1XYFA 1W3NA 2ALDA 2ZWYA 2XTKA 3UWVA 1K6WA 4AH7A 5CJ5A 5EGRA 1LLZA 5I79A 1R5YA 3ANUA 2CFFA 1DWJM 3K8LA 4PMOA 1WP6A 4JTEA 4PZVA 4Y90A 1YQ2A 3L4VA 3C52A 4NAFA 3LDVA 4PUMA 1HNYA 3QHMA 1XINA 4H7CA 3STGA 3N2TA 1OFAA 1FWNA 1TWIA 2FTPA 3VNZA 3CH9A 1PVNA 1X1NA 3TSBA 3VOIA 5FF2A 3VCRA 1BWVA 3AHVA 3A21A 5A2AA 3W7QA 4EAYA 1M01A 5LYRA 3L4ZA 3CZKA 3TAOA 4CNNA 1QBAA 4JEQA 3ZVIA 1AH0A 3LTSA 2EKGA 2FLIA 3E96A 3BURA 4AD2A 4QQUA 3STPA 1CDGA 3WQGA 1QTWA 4UTUA 1FDJA 9CGTA 1XUZA 3WL0A 3AJ7A 1SW3A 1A5NC 2YL8A 4JDYA 2WANA 1ZQ5A 3ES8A 2PWEA 1WO2A 2XH2A 3WMCA 3AMCA 1W3JA 4K7YA 1QNVA 2NXGA 3OB8A 4H7VA 2A3CA 1S38A 4RX0A 1P0KA 1NM9A 1WUEA 6CGTA 1V6XA 1TWZA 3NQ2A 2NVCA 1UWQA 2VEPA 3IIVA 2Z28A 3N6HA 2ZRVA 4D8AA 3E5BA 4QITA 3ZFHA 3AUOA 3Q37A 4JTDA 1FWSA 4J35A 5EFDA 2DUZA 1SSGA 5DANA 3PK7A 4LOCA 4JN7A 3GUGA 4WK9A 2J77A 3ZWSA 1XLEA 1IZCA 3FN9A 2B7PA 2KZHA 1E3XA 2CIPA 1H63A 2Y5JA 2EPNA 3VIFA 2OO0A 3QJAA 5LA2A 2GOUA 4XAFA 3BL3A 1TG7A 3EWDA 3M7WA 4RPQA 4UR7A 4J1OA 5AYIA 1W8GA 2DZBA 2OVLA 1EC8A 3VCCA 1FXPA 3N6JA 3VM5A 4JHMA 1WZLA 2XG9A 2PRMA 3IV3A 2OSYA 3AUJA 3F4NA 2FPVA 2D0HA 3L5LA 4DO5A 1J93A 8RUCA 3PF3A 4ZO8A 3PM6A 1ZRQA 4NIRA 1H09A 1VHCA 2FDMA 3QM3A 2QCLA 3W6YA 5L9FA 2PMQA 1TTJA 4QS6A 2E25A 3EXSA 3TTSA 1ESWA 2Y63A 2HMCA 1AD1A 3CIXA 5A6SA 1EDGA 4MAVA 2OFJA 5CEWA 1UQYA 4GQGA 2VWTA 2VUNA 1W1PA 2GGHA 3G1DA 6ENLA 4QAIA 1SGJA 4F2TA 1R7OA 1HF6A 3AAMA 4AVFA 1XGZA 2PDPA 2WNWA 3H4XA 4NRSA 3N12A 3PSVA 4ZA0A 2OLHA 1E73M 4DX3A 2RH9A 4DLFA 5JVLA 4GABA 4FXFA 3LHZA 1YDVA 4QE5A 1Q6QA 2EG8A 1R8LA 2DZXA 1FUYA 3H22A 3WF4A 3L0KA 3MVIA 4U2ZA 5BXTA 1SO4A 1A5OC 5I3HA 2FFCA 4HPGA 2YFNA 1GK8A 4JY9A 5C55A 3P5YA 1A80A 3DGBA 3UPBA 4H6QA 4C6NA 4Z2LA 3NQGA 1NDZA 3RG6A 3Q65A 1PX8A 1KGUA 1EP1A 3CZGA 4BY3A 2E09A 4EPEC 2WWDA 2EO7A 5FI8A 1H0GA 1M04A 4C90A 1QJWA 5ABEA 3CUFA 2QDGA 1M03A 1ZBKA 5CZSA 2A85A 1I2RA 3N2XA 1XLJA 4HJWA 1U30A 4E2DA 2GZXA 2BXZA 3IGHX 1EO5A 5DT7A 5EPDA 3B8UA 3II1A 3GBEA 4PA8A 4TU1A 4AU0A 5CSYA 4HHPA 3L2LA 3UG5A 4FX6M 4KETA 2VC5A 2NSOA 3RF9A 4AZHA 1MNSA 3THAA 2YDQA 2F2HA 4FAMA 1G7UA 3URAA 4I8DA 3GY1A 2FB2A 5CKSA 3O6YX 2UV8G 2AMXA 3ZJ7A 1R2RA 2JKEA 2QV5A 2NSXA 3DG6A 1OFOA 2CZFA 1ZHAA 4ZQNA 1EFZA 3GTIA 3FLUA 2V3FA 4H41A 5CCZA 2NLIA 4HN4A 9XIAA 1KM0A 4ZVJA 3G3DA 4IQEA 4LC6A 4HQVA 1BXNA 1Z6KA 3SZ8A 3S9ZA 2CLPA 5DRCA 3QF0A 4L65A 1PCWA 5AN7A 1XXXA 4C6KA 1GNXA 4A8LA 4NSBA 4DVOA 1U2YA 3WD1A 3AXMA 3TE9A 3T2QA 2QGYA 1EPXA 2VZUA 2A6NA 1R3QA 2E1WA 1QR7A 2OG9A 2V67A 2NQ9A 1IXPA 1U33A 2P0OA 3C2OA 3KL3A 4E0CA 1PTGA 1AMYA 4NKCA 2EBNA 1O94A 3USBA 3H2MA 1Y5WA 4QBXA 1XYCA 4WCJA 2ZC1A 2HJPA 1O5RA 3POCA 3QR3A 4HNOA 4OTKA 3S1WA 4KESA 3NEVA 3DI0A 4I7VA 3MV01 3AOFA 3SUTA 2E8ZA 4HHLA 4UIOA 5D32A 3MP5A 1UD2A 3WK0A 5HJXA 4PCFA 5EBUA 3B8WA 1XG3A 3E2VA 3SCRA 1W3KA 3V5CA 2NT1A 3MUY1 4MYXA 1WE5A 2HNHA 4Y9MA 1H49A 1O12A 4OQVA 3N3MA 2PEVA 4N02A 5CBBA 1D7KA 2W27A 4Q4QA 1OFRA 3TW9A 2MUCA 3ZR5A 3WNMA 1GVOA 2BFGA 4D72A 4LJ3A 3TA9A 1PTAA 2O9RA 3VIIA 3FDKA 4J3WA 3KBWA 1K7EA 4HN8A 1UR1A 1BSLA 3V0TA 2X0HA 4AY1A 2GVGA 3SJ3A 4CN6A 1ZJHA 2ZVIA 5CZTA 3N34A 4GVGA 3B8DA 2X09A 2I5IA 4TO8A 1PE1A 3GDBA 4BK9A 4AVNA 2XSXA 3NDOA 3COTA 4HSNA 2QMKA 5FA5A 1HJQA 2BGSA 4REQB 2CBJA 1TUXA 1VH7A 4LY8A 1TV7A 2VELA 4IT1A 5D2WA 2GVEA 3AXKA 1KCKA 5I03A 3W2JA 3WQDA 5C9UA 2BVYA 4OU1A 1V02E 1XC4A 1WBJA 1TQJA 1XLKA 3QY8A 1T8QA 1DTUA 2F6UA 3FCPA 4HU3A 3PTQA 1YNYA 3WMSA 4NX5A 3VMPA 3SCOA 4MUZA 3UY8A 4UFIA 3GH7A 4NAFB 1HVQA 4US6A 3NDZA 4PGLA 2VMFA 1JYWA 2V82A 2FHBA 1RPXA 3NAVA 2EKCA 4NI3A 3B4UA 3V0SA 1F3TA 1I2OA 3MVTA 3P62A 4RDYA 4L56A 2P5NA 4M7TA 5GPRA 1OZQA 3UR2A 2BVDA 3T8QA 3A5FA 3P5ZA 5DFAA 4JIIX 1E9IA 1LG2A 4DPPA 2VOTA 3OIHA 3E0WA 1XSKA 2ZX9A 3U3HA 3W71A 3CMFA 4W8LA 4PCSA 1UB3A 1H50A 1GKRA 5TAOA 3SUSA 2A3HA 2GJXA 3NO5A 4OECA 2WHJA 2DSVA 4JFWA 3NGFA 1QXLA 1X96A 3BXWA 1TR9A 1IIHA 4NJIA 2BXVA 5BWAA 4ADSA 4DBEA 4PMJA 4HMEA 4UB9A 1XDLA 3TYDA 3UXLA 3STCA 3LCGA 5DF0A 4TMBA 4Z2GA 1RY0A 2NX9A 1M7PA 2XN0A 3HF3A 1EGMA 3SECA 1KWKA 4GKTA 2Z0IA 2HS6A 3GTXA 4RDVA 2DH2A 1MRQA 4RNIA 1S3TC 3I7QA 2YXOA 1JCTA 3W29A 5BYWA 1PZ0A 1CPUA 1LP6A 5EA9A 4XKYA 4B2DD 4DJDC 4O4WA 3VKCA 1FX6A 3ZLHA 2W6RA 1UROA 4AZGA 1KBIA 3AIWA 4BF9A 5I5RA 2D2OA 2YCEA 2FGLA 3LTYA 2J4GA 1WUFA 2WHMA 5AB3A 3TYUA 2G3MA 3C2EA 1QDSA 2VI0A 2GLKA 3UCDA 4IISA 2VFIA 3C0QA 1V02A 4GYPC 3R7MA 2QNEA 3WX7A 3JUGA 4MY8A 3CHVA 4C6DA 3K2GA 3QV9A 5HXMA 1XD1A 2O92A 3TN3A 1XCWA 1K7FA 4ZXLA 3P14A 4GH1A 1GJUA 3W1XA 2IPFA 3EXTA 3A22A 1HJXA 3H4WA 2HBVA 4PUNA 3BE7A 3TYEA 3N29A 4ZQRA 3URNA 3PN8A 1VF8A 3OQEA 2Y7EA 1G9HA 1EO7A 2PLKA 5JIWA 4F48A 3SSZA 2OYLA 2PGFA 2VKZG 3AYVA 4O8AA 4GUJA 3HQOA 2YL6A 5H8MA 4EPKA 1DIDA 4A8IA 1QW7A 1OCBA 1TJPA 3KM8A 1LT8A 3IJ8A 5J5DA 5LNUA 1WOBA 4NZ5A 5IBXA 4LWWA 1XL9A 4LSBA 1JUEA 3CAVA 3GFXA 5CBIA 4O12A 2TYSA 3IJQA 3U4FA 2BZNA 1A5UA 1E4NA 1OCNA 2J78A 4CQCA 1QPRA 3EWUA 3TLQA 4Q4PA 2ZVRA 3IUDA 3TNOA 2WHKA 1VLIA 4Z0SA 2WNNA 1H3GA 1XRVA 2E68A 3ARPA 4QJ4B 1XLLA 1VIWA 1XRTA 2HXUA 2W67A 4JX6A 2VFGA 4X22A 4OWGA 4L4LA 1NEYA 4M82A 4D1JA 1ISYA 3ABOA 4GY1A 5C9ZA 3VZZA 2WSPA 3WF3A 4QM1A