4JDYA

Crystal structure of rv2606c
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
264
structure length
264
Chain Sequence
b'TARVKRGMAEMLKGGVIMDVVTPEQARIAEGAGAVAVMALERVPADIRAQGGVSRMSDPDMIEGIIAAVTIPVMAKVRIGHFVEAQILQTLGVDYIDESEVLTPADYAHHIDKWNFTVPFVCGATNLGEALRRISEGAAMIRSKGEAGTGDVSNATTHMRAIGGEIRRLTSMSEDELFVAAKELQAPYELVAEVARAGKLPVTLFTAGGIATPADAAMMMQLGAEGVFVGSGIFKSGAPEHRAAAIVKATTFFDDPDVLAKVSR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pyridoxal biosynthesis lyase PdxS
publication title Crystal structure of Mycobacterium tuberculosis Rv2606c: a pyridoxal biosynthesis lyase
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Lyase
total genus 85
structure length 264
sequence length 264
chains with identical sequence B, C
ec nomenclature ec 4.3.3.6: Pyridoxal 5'-phosphate synthase (glutamine hydrolyzing).
pdb deposition date 2013-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01680 SOR_SNZ SOR/SNZ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4jdyA00
1WV2A 1K7EA 5E1QA 3QMTA 4R33A 1XKYA 3E12A 2PE4A 5D2XA 2Q3RA 1FUYA 4ZQPA 1EP3A 3PSVA 5FEPA 2F7FA 1OX4A 2ISVA 2J6XA 4R7JA 2WPBA 2R8WA 1MEIA 1KM5A 3GX9A 4H3DA 1JUKA 3W84A 2XN0A 2ZZ1A 3O16A 5EPDA 5BRBA 1ZJIA 1EUAA 3B06A 4I7WA 4I7VA 4NVTA 3BLIA 2QF7A 4GUHA 2PC4A 2QCDA 4Y9AA 1TREA 1MO0A 1G4PA 3ZR4A 4LRTA 4UFIA 1LBMA 1OFEA 1L6YA 3JS3A 3S8HA 1T0OA 2PCQA 2PRMA 1C8VA 1D9EA 5CG7A 3NGJA 3GDTA 3LTYA 1AG1O 5KTLA 3PBVA 1S3HA 3G3MA 3W75A 1WX0A 4YXGA 1NSJA 3H54A 3TNOA 1GG0A 3B05A 2R94A 2V30A 1LCOA 3O63A 3R5EA 3T55A 3GNNA 3LI0A 1TPB1 2OCZA 2VKZG 3I6RA 2J9ZA 4Y96A 4NZFA 3ABQA 5D30A 1YTEA 3W22A 3QC3A 4MZYA 1OABA 3CM4A 4YWIA 1VHNA 3C61A 3DU0A 3OVPA 3LXBA 2NWSA 3EX6A 2Q8LA 2DZUA 5L6UA 4TMBA 2OZ0A 1QO5A 3YPIA 3PBWA 4O54A 2JBMA 4L4LA 2BZNA 1U83A 1C9DA 3PG8A 1A53A 4GUIA 3MJYA 2C13A 5LGZA 1SQ7A 2Z1BA 3O6DA 1TO3A 3WJZA 3GR7A 2Y7GA 3G1VA 4K8HA 2ZRZA 2QDGA 1ALDA 5D2YA 4O14A 3C56A 4HIBA 4WZHA 5CPMA 1KM1A 7TIMA 5K9DA 1G4TA 1IXQA 1OVDA 4LY8A 1H7XA 3P61A 1UASA 4LV9A 2VFHA 4UNKA 3BARA 1EUNA 4JTTA 5EY5A 4RR4A 3GXTA 1B4KA 4X2RA 4LWWA 3G3DA 3STFA 3O07A 1JCYA 1L6WA 4EWND 4R34A 5LKYA 3EEGA 3TIMA 4O4VA 4NQ1A 2V81A 3G1SA 2G95A 3W2MA 2VXNA 3MP3A 2OT0A 3OEXA 2NX1A 4DBDA 1YLVA 1GQNA 1RV8A 4JTHA 5D38A 3I7QA 3G18A 4PEKA 3DXIA 3EX3A 2A2IA 5I3IA 3CIXA 1XM3A 4ZL1A 2NUXA 2ZZ7A 5EA9A 6TIMA 5K7JA 4K38A 3E9AA 2YCEA 1HFBA 3EWBX 3W2JA 1G4SA 4TIMA 1XXXA 2ISSA 4LNYA 1T8XA 2CLEA 3OHIA 4NX0A 3NQ6A 3W7JA 3S6DA 4GC4A 1KFKA 5LHEA 3TR2A 1QFEA 4ALDA 4UXDA 3MI6A 1QPQA 3NR0A 2ZTJA 2GJNA 1EP2A 1W5OA 2E6AA 4PH6A 4RCXA 4JY8A 3W2KA 5BW6A 5G4EA 1LRTA 2E5DA 3TFXA 3AO0A 3QM3A 3WK2A 4NJIA 3W7LA 1PE1A 1XL9A 2NX9A 1DHPA 1NF7A 3PBYA 3PR2A 5C2XA 1TQXA 5LSMA 4HKPA 3HJZA 3EWUA 5FF3A 1W1ZA 1GOXA 3JR2A 4JTLA 3HQ1A 3ZS4A 1H62A 4HN4A 1SPQA 2QCFA 4WUIA 4UFHA 1QO2A 3A23A 5G2WA 4MYXA 1K8ZA 3CB8A 3FEMA 3VFLA 1ZENA 3NQFA 2QEZA 3KVJA 4MY1A 4PODA 2C15A 1DORA 2G5WA 2AGKA 1WBJA 1RZMA 5LNWA 2WV8A 1J4EA 1O4UA 3A5FA 1QAPA 3OG3A 1B3OA 3G1HA 4MZ1A 3FJ6A 2Y88A 1TJRA 4CNOA 3NQ7A 4JX5A 3W7IA 1AL7A 3MYPA 2VFDA 3PB2A 4GRSA 4QNWA 3KHJA 1VYRA 3LV6A 3LDVA 1KLZA 4C1LA 2NLIA 2BXVA 1H7NA 2HS8A 1VCVA 3BPWA 4DF1A 1O60A 1Q6RA 5F2LA 4FX6M 5HUPA 3TA6A 1G6CA 1H61A 1OFOA 4GE8A 3W2LA 1JULA 1MEHA 2CLOA 3GAYA 1I2QA 4Y8FA 3ATZA 4BWLC 3SY5A 4KWWA 5HR6A 1SO5A 4MLRA 4IGHA 5HJLA 4CCDA 1I2NA 5DCBA 4EF8A 5C54A 1Z48A 3MI3A 1TPH1 3W9ZA 1JJKA 1QDSA 1O94A 1K8YA 4JXCA 2RKXA 3GAKA 3EXSA 1QWGA 2ZRVA 1P0NA 4IMFA 2CLLA 4E38A 3CTLA 2I9EA 1VZWA 5IM51 3W7PA 2ABAA 1R47A 3NL3A 1SFJA 3MP4A 4XUGA 5K9CA 4O1DA 1LBFA 1OYBA 2H8ZA 3IIOA 4O52A 4JR5A 5C6MA 1ICSA 3GK0A 5HWNA 3W2NA 4WXZA 4NXKA 4O1BA 3UZJA 4A21A 1I4NA 3TW6A 3S1VA 5L9FA 2TMDA 4Z0SA 4QAIA 1R2RA 4L4MA 3F1QA 3TX9A 2ZZ3A 1W31A 1XUZA 2CW6A 3UWWA 3KXQA 4BFAA 1SW7A 2GVGA 4IX2A 3TXZA 3C2VA 1TTJA 3HG2A 4N6FA 4IX0A 3BG5A 5C5YA 5KSWA 3NXFA 3FFSA 1H7RA 2DZXA 5CPNA 2QAFA 4WQ6A 1H60A 1KV8A 1VLWA 4O12A 1DJQA 3GXNA 1FBAA 1LOLA 1UB3A 4XKYB 1H7OA 3FA5A 2B0MA 1ONRA 3PSWA 1OK4A 3BGJA 2NZLA 3WJWA 4UTIA 4ZQMA 3B8DA 5FI8A 3T78A 1K3UA 3C8FA 1B4EA 4POCA 3NM1A 2ISWA 2TRSA 2VOMA 4MYAA 4O4WA 3MBFA 2CZFA 3EWXA 4EVZA 4BWLA 5LNSA 2A85A 1TPUA 4XZ9A 2J9XA 4JTSA 1JVNA 3T40A 4UTUA 4UMBA 3TQVA 1AL8A 3W88A 4HNTA 1ZAHA 4JYDA 5AC6A 4K7VA 1KBIA 3DHDA 1YPIA 3I7SA 4NXSA 2QDHA 1R2SA 3N9RA 3W7MA 1J2WA 1FWTA 3S9YA 1G7VA 4PL1A 2CLKA 1LDCA 4QQ3A 3USBA 3PBUA 1GVRA 3TCEA 2A7RA 1RQHA 3N14A 5J5RA 2ZCGA 3WK1A 3W7KA 1VQTA 5AB3A 1B9BA 1FCQA 1LRQA 3TQKA 4CQ8A 1QPOA 3FJLA 5TBOA 4FIQA 3OVQA 1GVSA 1LM1A 3HGOA 4FXRA 1MZHA 5CZJA 1FWWA 4UFJA 3NL6A 4XQ6A 4CCCA 1SZEA 2HMCA 3KVKA 1F5ZA 1YXCA 2YYUA 2V2HA 2IQTA 1Q6OA 3F4WA 1G69A 2XFWA 3MUXA 3LHYA 4XBKA 1QOQA 3HO8A 3BW2A 3EWYA 3GNDA 3HOJA 3LRLA 2VEMA 1MXSA 1WXJA 1HUVA 3LLDA 3AJXA 3IEBA 1YDOA 1WOAA 1DBTA 3G1YA 4TU1A 3UXAA 3VI2A 4QJ1A 5D2VA 3M0ZA 1YXYA 3LRKA 2GVLA 3LHUA 2RDWA 1VYPX 3LXAA 3MP5A 2OMAA 2HTMA 1OK6A 5AHEA 4M6PA 4UTJA 1BKSA 1DOSA 4O18A 5AC7A 1XI3A 2PRLA 1LBLA 4O8RA 3IVTA 1CX9A 3PC0A 2YFNA 1TPDA 5AC8A 3STEA 1JUBA 2E6FA 2YGYA 4OT7A 1PVNA 2WKJA 1M7OA 3M43A 2YYTA 3N34A 3NNTA 1K8XA 3PVFA 1Q6LA 5FESA 4WOQA 3E02A 2OT1A 3ZWSA 1TIMA 3LCGA 5BMWA 2B7NA 3P7YA 4MJZA 1YDNA 3TW7A 4OQVA 3HGRA 1V5XA 3FKRA 2V0TA 3KX6A 3BGGA 4WY0B 4NUWA 2CZ5A 3IIVA 3UY8A 2EGZA 5FF0A 1VS1A 4AF0A 2NV1A 3WK0A 3M47A 4AMAA 3TV8A 4HSOA 5AHMA 3WJSA 4LOCA 2QCCA 2W79A 1FCBA 5HUOA 1TPWA 3W1NA 2QCLA 3A9IA 1SUXA 1ZAJA 3SJ3A 4AEOA 4LVDA 1BEUA 3BV4A 2ATSA 3BG3A 4JS3A 3ELFA 1HO4A 2CZDA 5D05A 1OFRA 1F7BA 3W7CA 4LUJA 2WJZA 3M5VA 2CLMA 3S5YA 4AHQA 4P61A 2VEIA 3M6YA 1KA9F 4LW7A 1SR9A 3W73A 1NF0A 2QR6A 4OWGA 3FS2A 3DH7A 3W86A 3RU6A 3VKJA 5LNRA 3NPXA 3ZFHA 3G1XA 5K4ZA 1KTCA 3QRHA 4YLWA 3PM6A 4XWUA 1GYLA 4MOZA 1VLIA 2PRHA 1P4CA 2ZA3A 4I9AA 3TC6A 3C2RA 3ABSA 3QMRA 5FF2A 3MMTA 3S5NA 1NEYA 3W2UA 2VFEA 4IWWA 4XTIA 3TSDA 3GKAA 1SO3A 1UJPA 3LI1A 1IXPA 4UR8A 1EEPA 1UUMA 4X3ZA 3M5YA 2X16A 4MLJA 1EIXA 5K9XA 1W37A 2FIQA 5G2IA 3IGSA 3LX9A 4FXSA 5KZEA 4OV9A 3UNDA 2QCEA 1MEWA 4UUIA 2NXIA 1X1OA 1SW3A 1XUUA 2C14A 3CHVA 3GDMA 3NPUA 3G0SA 3HF3A 1WQ5A 1A5AA 1YTDA 3LLFA 4LU0A 3UYCA 1I2PA 2O7QA 3N9SA 1HL2A 2FDSA 5HR7A 4IXHA 5K2ZA 4M5PA 5G5IA 2X2GA 2VELA 1RQEA 2CFFA 3A5VA 3W7DA 3TAKA 1TJPA 3TK7A 3ATYA 4JD4A 5LZLA 3N3MA 4YMZA 2RHGA 2ZDRA 2E68A 3NA8A 3G1DA 2JKEA 3L5LA 3MW7A 4MY9A 1X8FA 1Z44A 2GUUA 4ZQCA 3DFNA 2E6YA 3T7VA 1RD5A 1LLZA 2EKCA 3BVJA 3W76A 1TYGA 2BX7A 1G67A 3DFTA 2C18A 3TH6A 1DQXA 1LLWA 3W23A 4NJHA 4N9EA 1TV8A 4FNQA 1ML1A 4NZJA 3CWOX 2QUTA 4ZQRA 4FX8A 1L2UA 1JRCA 5CPLA 3CWNA 1SO4A 4M7TA 3R89A 5ABTA 5KMYA 1L9WA 4DEFA 1RPXA 3KAOA 3HG3A 4U28A 1F2JA 2FPVA 5GVJA 2FLIA 4UNLA 2C0AA 3TMLA 4A3UA 3GKFA 3CEUA 4FNPA 3THAA 1CI1A 4FHAA 5DN1A 1THFD 3H55A 4P2VA 4DF2A 1YTKA 5D33A 1GYNA 1E51A 3DKJA 1K7XA 4LS2A 1FWSA 2GJLA 2E1DA 2Y6ZA 3SFKA 5TIMA 4FNSA 1D3GA 4JTGA 1TRIA 3O1NA 5I3JA 4JYFA 4KWVA 2ALDA 3W7RA 4UMCA 1LOSA 5DY3A 3I7RA 1JCJA 2ZZ5A 4KFOA 3DFOA 1JCXA 4S2CA 2WSYA 1LZOA 3EKZA 3L0KA 3PUDA 3NVTA 2Y85A 4MJMA 3OVRA 1R2TA 3W72A 4EF9A 3WFAA 2DORA 1LORA 3Q37A 1BTMA 3PS7A 1FDZA 1AMKA 3KFTA 5HMSA 1W56A 3A22A 3M1ZA 4CNNA 3HB9A 5J5DA 4RZ6A 5CZTA 1GTHA 1GVOA 3IGXA 2VFFA 4X22A 3N19B 2X1RA 1S5WA 3UWVA 2E77A 1XCFA 2FFCA 5CGQA 3W83A 3ANYA 4WJEA 3DHFA 2C3ZA 4JY9A 4M7SA 1M7PA 5K4XA 1JCLA 5CKSA 3TE9A 1GTEA 4U4MA 3LTPA 3M5ZA 2YSWA 4A29A 3TROA 2FQIA 3O6YX 3LBMA 3QJAA 1O5KA 3TMQA 5F2IA 1OJXA 3B4UA 2W0UA 3NPVA 3U6WA 1EP1A 1FDYA 2I14A 1DL3A 4UFKA 2P1FA 2P0OA 1DJNA 1A5CA 3G1AA 3NL2A 2EF9A 5G1TA 1EX5A 3QQ0A 4HSNA 4ZQNA 3STCA 5SWUA 1A50A 4O13A 3NQEA 3IV3A 3UPWA 1H7PA 3CC1A 2VC6A 3QMSA 3NQAA 1OX6A 1XBVA 4LT9A 1EWDA 4JN6A 5AOUA 3GDLA 4PCFA 2EPHA 3TKFA 8TIMA 3W1PA 3EB2A 2FB3A 3SGZA 3RLUA 4UTMA 4PFMA 1H7WA 3RK8A 3HG4A 1TTQA 4E2BA 2RDUA 3LERA 4RLIA 5FF4A 6ALDA 3SSJA 1WYIA 4MUZA 1L6SA 3P60A 1KM2A 1UUOA 3W1UA 5EL1A 3BK0A 3MHUA 4AWTA 1TCDA 4IMDA 4OU1A 3P8IA 3DI0A 4K39A 4RXFA 2GQAA 3N2MA 1VCFA 4QITA 1KLYA 4CQ9A 4TR9A 4LVAA 1SW0A 5F1VA 2WNNA 3DENA 1OFPA 4BK9A 3C3NA 4JYEA 1T96A 3KVLA 5D2WA 2YPIA 1ME9A 3CEPA 4K36A 3BG9A 2ZYFA 2JKPA 2V9DA 3W70A 2WSQA 4AXKA 4RJEA 4GXMA 4PL2A 4NX5A 1JQVA 4QM1A 4QSHA 1QR7A 4S1FA 4UTWC 1W54A 3BW4A 3SI9A 1SZFA 3LCHA 4LUIA 3LB0A 3UWZA 1MSSA 1TSIA 2ZQ0A 1A5BA 3R13A 4IMGA 4IPIA 4JEQA 2DZWA 2YW4A 4ADTA 4FEZA 1GVFA 1K03A 2WNQA 2Y63A 3G1FA 3IIPA 5AHFA 2ZA1A 1NAL1 4O57A 2W6RA 2CZEA 1PL9A 1O95A 1QCWA 2YR1A 3U2OA 5CPOA 3EWWA 4LVFA 1FWRA 3NOEA 4RZ5A 3IIZA 1XBYA 3OIXA 1XDLA 3QW3A 4NNCA 4MIMA 3SGUA 5H2ZA 2X1TA 2X1SA 5D37A 3KOFA 2F84A 4M19A 4Q32A 1TPEA 3QPZA 3MO7A 1FXQA 3EXRA 3GLCA 1ME7A 2UV8G 1HTIA 1OX4B 1QPRA 3FYOA 4G1KA 2CLFA 4UR7A 1EB3A 5G1YA 2Y7EA 3DGRA 1ADOA 5EKYA 2KZHA 3M7WA 2JKAA 1JUEA 4Z08A 1LOQA 4HNUA 4K6AA 3HPSA 3SZ8A 3G24A 3FLUA 1XDMA 3QQ1A 3UXDA 4WY0F 2QCDB 4ZVJA 1DKWA 2A6NA 2V5LA 5DCDA 3UZ5A 3KRUA 2ZA2A 1UBSA 5BNKA 1F73A 2QCNA 1SSGA 3THQA 3GR8A 2RH9A 4K7YA 5EMUA 1QOPA 2YZRA 5U7SA 2CWNA 3W7NA 4Y90A 3C4UA 4O0ZA 1GJPA 5U4NA 2E6DA 1IXNA 3R12A 1LYXA 1TV7A 3DFSA 2DZTA 3I65A 5LGXA 3S5ZA 3JRKA 3W85A 3S1XA 3Q58A 1ZAIA 1HG3A 3NZ1A 4UTWA 4AWSA 3QF0A 1VPXA 1VGAA 2JGQA 3L2IA 1PHWA 4UFLA 3RFAA 4PC8A 1W5PA 3LM7A 4RZ4A 3W1LA 3QZEA 3S5OA 3QW4B 3LCLA 2TPSA 4OV4A 1ZHAA 2VFIA 2FPTA 1YYAA 2NWRA 4FX7A 3G22A 1D3HA 2E09A 2XN1A 4Q4KA 4IMCA 1VCGA 4J9JA 3INPA 3HGJA 5FF7A 1F6PA 4UMAA 3CT7A 4DO6A 1H5YA 1W3TA 4BF9A 4DO4A 4FNUA 3BLFA 3T44A 1IGSA 3W1RA 3OA3A 3NZRA 1U5JA 1FCUA 1TQJA 4CQAA 2E5CA 3P67A 1V7YA 3SW6A 4RV8A 2V2DA 5HINA 3I68A 3LBCA 4IOTA 3UQNA 1N7KA 5FEWA 4WXYA 3DAQA 3W1QA 3LCXA 4OHQA 3FIGA 4JTJA 1WA3A 3TXVA 3L0GA 1EPXA 3TFCA 4LC6A 4LVGA 3TSMA 4HPJA 1I45A 5AYZA 2WO5A 5FEZA 1P0KA 4FNTA 1FXPA 3Q2DA 2R14A 1X7FA 1IF2A 2Y62A 4IUOA 1C29A 4OBTA 1PCWA 3SECA 3TJXA 2H8XA 2ZTKA 4M6QA 4FB7A 1OG0A 3DFQA 4H4IA 2Q8ZA 2QJIA 1YXDA 1K7FA 3W7EA 2QCMA 2BWGA 3TAOA 1QNVA 4DELA 3L67A 3LGEA 1OF6A 3L0NA 4ZMGA 5DXYA 2YXGA 3EXTA 2B7OA 4XKYA 2A0NA 2ZZ6A 3HPZA 4ADUA 2A5HA 1PS9A 2EHHA 4O1AA 1AW1A 1OFBA 4MVAA 3ZWTA 1BWKA 1YDVA 4E0CA 1J5TA 4DPQA 3W7HA 2Z6IA 3IVUA 1XBXA 1WAUA 4DQWA 4O28A 1VHCA 1KTNA 1JQXA 2X30A 1F6KA 1GWJA 3NAVA 3DZ1A 3P5ZA 5D2TA 3DI1A 1TTIA 3S1UA 3P81A 1W3NA 4MY8A 1GT8A 3L5AA 3IRDA 4AH7A 2CLHA 4UTLA 3PG9A 4QNEA 4JNMA 3LHZA 2YX0A 3G8RA 2ABBA 4CLMA 5D02A 5LHFA 5BMXA 5DBUA 5F4WA 2DJXA 4EIVA 1OFAA 4QISA 1KFCA 3HMJG 2C1HA 2DJLA 2J24A 2GPTA 4GBUA 3VE7A 1AK5A 1W5NA 5DLCA 4C1KA 2J88A 3M16A 2JGYA 2EAWA 4O50A 4IQLA 3W6YA 2TYSA 1KM6A 3PB0A 2E5BA 3CU2A 3L65A 2Q3OA 2QUVA 3H53A 2JK2A 1KFEA 2DU2A 1JCMP 4LS0A 3VCRA 4DPPA 4K8EA 3TQ0A 4DXVA 1ZFJA 4Z1CA 2D73A 3LTSA 1QPNA 4Z1AA 1TRDA 2Z6JA 4GNJA 4DO5A 3LCWA 1KTBA 2QCHA 1SFLA 3UPBA 5DY2A 3CIWA 3PUOA 5KZDA 1W5MA 3FYPA 3P5YA 4BR1A 4JTEA 4I7UA 1PHQA 3NG3A 3HG5A 4MZ8A 3LV5A 3NQ8A 5CSSA 1TPFA 2QJGA 5KITA 1R46A 4R53A 4IXXA 2Y70A 2A21A 2C6QA 3LHTA 5IBXC 2A6LA 4O11A 3M44A 1KFBA 1H1ZA 1RQBA 4NJKA 4N9CA 1JCNA 4JICA 2LLEA 5D09A 4A2SA 4Q33A 2ZZ4A 3B03A 4ZQOA 4NNBA 1KM0A 1SO6A 4TMCA 3GDRA 3QPYA 1OYAA 3V75A 2Y89A 4JX4A 1ZNNA 4ORMA 2OX1A 3C52A 3NO5A 4GWEA 4YCPA 2R91A 1N8FA 1KW1A 3RF9A 2VFGA 2A7PA 3M5XA 1FDJA 4W9TA 3MI2A 5I3FA 4A2RA 2X1UA 4WY0A 4NT0A 3GXPA 3P82A 1VYSX 4AHPA 3W3OA 1IIGA 4JTFA 2VENA 2DZSA 3OBKA 3A21A 2FB2A 2NXGA 4ADSA 3WJYA 1Q45A 2QKFA 3QFEA 4FO4A 4BI6A 1S5TA 2DP3A 1F05A 2V5BA 3HPXA 4HPXA 1W3IA 3QSTA 1KFLA 3CPRA 4Y6GA 1NFBA 4M6VA 3KVMA 2DZVA 4UTHA 2I1OA 5DCEA 3C6CA 3W7GA 4BI5A 3FOKA 3O05A 2V2CA 3EX4A 4S2BA 1K02A 2YFOA 3UWQA 3L9CA 1VJIA 4N9BA 1VR6A 3N2XA 2NUWA 3O8AA 3CQ0A 4GJ1A 3TUUA 3RMJA 1OFDA 2H90A 4RXGA 3N73A 2NX3A 3IVSA 3W1XA 3MHGA 4N4QA 3W1TA 1EWEA 1W0MA 3MHFA 3W7QA 5F2GA 4DBEA 3UD6A 5D32A 3GIYA 3STGA 4K37A 3B0VC 1OYCA 1KBJA 3B04A 4O1CA 1GPWA 4KFNA 1DV7A 4UC5A 1P5BA 3L21A 3BW3A 4LRSA 1KFJA 4N6EA 5LNVA 2QJHA 1Q6QA 2ZRWA 4TO8A 3DFPA 4AWUA 5IBXA 4AHOA 2Z0IA 2H3BA 3MWAA 2NV2A 3TSBA 5KZMA 3SIZA 2QUUA 3EX1A 1B57A 2G97A 3NDOA 4ZZ9A 3L5MA 3W7OA 3EKLA 5CZ0A 3FKKA 1OX5A 4AAJA 4H6KA 5F2MA 1KM4A 4A22A 3LRMA 1WBHA 5AHLA 4IMEA 2PURA 1CW2A 3T4CA 4YCOA 3P74A 2CLIA 1SZGA 1GEQA 2WOQA 4RK8A 1H51A 3LCIA 4N4PA 4HT3A 1OFQA 5D04C 3A24A 3S0CA 1WOBA 4N9DA 3B0UX 4HNNA 3C2EA 1ICPA 4GUJA 1X6UA 1SZNA 1YADA 3LHWA 3HGSA 3V1PA 3NQ2A 3PAJA 4WOZA 4N02A 2RFGA 3NYZA 5C55A 3F03K 5T26A 3W74A 4UTTC 3NQDA 4D2JA 1H63A 2GOUA 1W8SA 4Z1DA 1PIIA 4GUGA 3DBPA 3NQCA 3GVGA 3QYQA 4CNPA 3NQMA 3SR7A 4X9SA 3PY2A 1NVMA 5F4XA 3BLEA 2J9YA 5G4WA 1O5XA 2FTPA 3E0IA 1Z41A 3HIJA 5E93A 4WD0A 2J27A 1I8JA 4HHPA 1KV5A 3Q94A 1DVJA 2C16A 1RR2A 4ICNA 4LVBA 4Z1BA 3GB6A 4FIRA 1IIHA 2Y61A 4B5NA 1XBZA 1GZGA 4TX9A 1P1XA 1T99A 3QH2A 1M5WA 3L68A 2WSRA 4JDYA 4PTNA 3W87A 4JIPA 4KFPA 3C0JA 5H91A 3EX2A 4BI7A 3VNDA 5AYYA 4O10A 2BTMA 2AAMA 4ML9A 3VE9A 3R2GA 2RDTA 2ZRXA 3G0UA 3W1AA 4FNRA 3PWAA 5DXXA 3UWYA 1SU5A 1TB3A 1G4EA 5AHIA 4MFDA 4O16A 4CCEA 2C19A 1ZY9A 3CLMA 3W1MA 2YW3A 3GDKA 1R30A 2H3DA 4O15A 1LTDA 3KRSA 1IXOA 2ZRUA 1TTPA 2QCGA 3S42A 5FEXA 4YL2A 5EBUA 4LV4A 5EYWA 5I3HA 2VEKA 3TC7A 3GYEA 3O06A 1LP6A 4GFSA 3LXCA 4ONVA 4JTKA 2FJKA 1A5SA 3C2FA 3LOTA 3P84A 4UIOA 1FWNA 4LTSA 1TMHA 4AF0B 3MBDA 5F4SA 4XBSA 2YDAA 1VRDA 2GVJA 4PA8A 1PV8A 2VEPA 3LCFA 4UTTA 5HNRA 3D0CA 1OHLA 3C2OA 3NPWA 1DQWA 3PUEA 4N2YA 3PF3A 2HS6A 5MHBA 2QAPA 2A1YA 3B0PA 1RVGA 4OGZA 4UCGA 1TV5A 4FF7A 1FY6A 1ZALA 1GVQA 2P10A 4EOUA 3R8RA 1FQ0A 4AB4A 2NUYA 5F1UA 3TJLA 1SSDA 1I2RA 2CU0A 4HNVA 3E49A 4KKXA 1EA0A 3W07A 3ABRA 5AN7A 4ORIA 2DZPA 5I3KA 3MYOA 1ZCOA 1H50A 3LHVA 3HBLA 3NL5A 5E0KA 1H1YA 1WDWA 3S1WA 3KRZA 2ATMA 3F4NA 2Y7FA 3G8EA 5HWMA 1Z42A 2A7NA 4RKAA 5G2HA 2GQ9A 1LROA 1FCVA 3M9YA 4NU7A 5HWJA 5DELA 2O7SA 3IIXA 4DF0A 4GUFA 5HQEA 2B4GA 4JTUA 3O6CA 3K30A 4QIUA 4JIQA 1F74A 1W5QA 5AFDA 1VH7A 5HULA 4NJGA 2ZBTA 2WQPA 2Z2UA 5LNUA 5BOOA 1I2OA 2B7QA 4E2DA 1JR1A 5CSRA 4NNAA 3WK3A 4Z0JA 4WX2A 3GZ3A 2V8ZA 3NEVA 1TPC1 3RNDA 2H6RA 1BWLA 1Q3NA 2GQ8A 2HSAA 2V82A 3WJXA 2BSLA 3G0XA 2ZFAA 1UCWA 3NQGA 1Y0EA 3E96A 3O15A 4UFMA 3EWZA 1S5VA 2FPYA 2Y7DA 3QEZA 4NJJA 3UY7A 1ME8A 2OJPA 3IGUA 4MKNA 3NQVA 2A4AA 1PCKA 3RLVA 5AYXA 3P80A 4RX0A 3PULA 1VC4A 2XN2A 4JDBA 4AVFA 1ICQA 1F76A 1G7UA 2TSYA 3BO9A 3U8GA 5K3VA 1M6JA 4O17A 3L66A 4MPQA 5A5WA 1KM3A 2NXHA 3M41A 5D03A 2WNZA 3TU9A 1QMLA 1XFBA 4JTIA 4O0KA 3UWUA 2BLEA 4JX6A 1JRBA 1HO1A 4LS1A 2ZRYA 1YPFA 4IJBA 3P62A 5KINA 4OE7A 4JGDA 4O53A 2B7PA 4LC8A 1AW5A 2AQWA 1OF8A 1GG1A 3TDFA 5DBTA 1AW2A 1XC4A 5I3GA 5TQLA 4IPJA 2G96A 5CZSA 1FX6A 3ABOA 3DKLA 4O19A 3P8JA 1TPVA 2ZZ2A 4XTDA 1X1ZA 5AHNA 3QSRA 1N55A 3NM3A 4MFEA 4UTKA 5A8GA 3W71A 1LRNA
chains in the Genus database with same CATH superfamily
4B5VA 5E1QA 9XIAA 4LH8A 3QMTA 1I60A 4DBUA 4ZQPA 4FP1A 4AZBA 2F7FA 1OX4A 4S38A 1L8PA 2J6XA 2PF8A 4V28A 5B7YA 3VOGA 1V6WA 4GFIA 2OYKA 2XN0A 2ZZ1A 2A3AA 4ACZA 1ZJIA 4ZTXA 3B06A 1X6LA 3Q67A 4GUHA 3MU7A 2QCDA 2CZVA 4QDPA 1TREA 1G4PA 1BKHA 3KWXA 4KF1A 3OZOA 1C8VA 1D9EA 4C6LA 3F5JA 4GXPA 1IWPA 1S3HA 3W75A 3H54A 2QGYA 2CERA 4DO7A 4PUKA 4GMEA 1Q85A 4Q4OA 2OZ3A 3QC3A 4MZYA 1YHTA 2VGFA 1AH0A 1S2UA 1Q2SA 4REQB 1PKLA 2NWSA 3EX6A 2Q8LA 1VJZA 4B5UA 4TMBA 1EJRC 3YPIA 5BRPA 3PBWA 2OO6A 3SJNA 1I1XA 1C9DA 2GSJA 1A53A 1PO9A 3EA2A 1O5QA 2C13A 2WQDA 3PPGA 5T91A 3ENLA 3WJZA 3GR7A 4QTGA 3G1VA 5FJTA 5D2YA 4O14A 1WP6A 2D0HA 3C56A 4WZHA 2VD9A 2NQJA 3B97A 5I03A 7TIMA 5I02A 1DYSA 4ICCX 1H7XA 1UASA 1VIWA 4UNKA 3BARA 3WD4A 1EA9C 3GHTA 1SYTA 4GQBA 2E4TA 3WQ8A 4RR4A 4H9UA 3TN4A 3G3DA 4XAFA 1E0TA 3O07A 4TQTA 4F0MA 4B5XA 1XQKA 3GVVA 4R34A 4KETA 4GI9A 1GVYA 3DBNA 3V18A 5HATA 2V81A 3G1SA 2G95A 3OEXA 2XPKA 2NVAA 2IXVA 1YLVA 4JTHA 2D2GA 1JGIA 3G18A 3GG0A 5HNNA 5T8GA 2ZZ7A 3DEQA 5EA9A 5K7JA 2YCEA 4ZR8A 3W2JA 1W9UA 2OYMA 4TIMA 2OQLA 4PMJA 1Q6DA 1EF2A 3QGKC 2FZMA 2Z26A 1PEZA 4ALDA 4GKLA 1HVQA 4D8ZA 1QPQA 2ZTJA 4RCXA 2NT0A 3MMDA 1O66A 3KOWA 2WLYA 3N17A 1IEWA 2E5DA 4ZO8A 4DHGA 3LY0A 4K68A 1KD0A 4NJIA 1PE1A 4YTTA 4W4QA 5LXEA 2CWXA 1NF7A 3MJMA 3PR2A 4HKPA 3EYPA 5FF3A 1GOXA 4JTLA 3HQ1A 1H62A 4O0QA 1PXGA 2QCFA 1IQ8A 5A8OA 3A23A 3WQDA 4FI4A 1M7XA 4ZOAA 2MNRA 5C9UA 3TONA 1MRQA 3PK7A 1CT5A 3QV8A 1WBJA 4KIRA 1NY1A 3ZT6A 3E0WA 3A5FA 1QAPA 4GINA 1B3OA 3G1HA 3FJ6A 3FA4A 5HBFA 4MMWA 5CJ5A 5AZ1A 4GRSA 5G1MA 1VYRA 1PZ1A 3ITYA 2PBOA 3AXXA 2EPMX 2BXVA 2HNEA 2PTWA 3MSGA 4IP4A 4EXBA 2VZSA 5F2LA 1Y8BA 5HUPA 5CJMA 4GE8A 4J40A 1I2QA 1RLCL 3ATZA 4BWLC 4OZOA 5HR6A 1SO5A 1BYCA 4GIAA 5HJLA 1P7TB 5M1TA 1JZ8A 4EF8A 5C54A 3MI3A 5EB8A 3TWBA 4RNIA 2QVNA 1QDSA 3ARYA 3S9ZA 2X1IA 3EXSA 1QWGA 4FAMA 1SMDA 3CTLA 4DWSC 3N4AA 1XIDA 2GL5A 1QI5A 3FJNA 1OYBA 2GDQA 1LUCB 4EWJA 1AH3A 1MNZA 5EMYA 5C6MA 2BG5A 3C0SA 4S3FA 3GK0A 2GJXB 3W2NA 2CPUA 1E5NA 3UZJA 1I4NA 1BG9A 1SZRA 5L9FA 4UQBA 3EDKA 3TX9A 2ACSA 3SQLA 4RDYA 1NWUA 1XYBA 2CW6A 2A79A 4E8CA 4EKJA 3UWWA 2INZA 3C2VA 5M5DA 1TTJA 2EPKX 3HG2A 3SUSA 4AD2A 2HISA 3BG5A 2XINA 4W7UA 1RHCA 1XRTA 1ZUAX 5HPOA 2PCEA 1IEXA 1MW0A 2ADAA 4V2XA 1VLWA 4O12A 1FBAA 4S3DA 4XKYB 1I9CB 4HVXA 4MM1A 3OQEA 1OK4A 3WJWA 4UTIA 4ZQMA 4ZCWA 5EMLA 4E8DA 4PSPA 1EL3A 3VNLA 4POCA 4JTDA 1E70M 2ISWA 1NOUA 2YCKX 3APGA 4MYAA 1CYGA 1EO7A 2VGBA 5CCZA 4XZ9A 1TA3A 3DDMA 4JTSA 4ZBCA 1JZ5A 4F2BA 3TQVA 3N6QA 3QGVA 5AC6A 1E1FA 3I7SA 3FN9A 2QDHA 1FWIC 1R2SA 3N9RA 3W7MA 1ONEA 4RZBA 4QQ3A 2CLKA 2ONEA 3UG4A 3USBA 4C6KA 3VIIA 3XINA 3L4UA 3TCEA 2WMIA 2KAUC 3N14A 5AECA 5J5RA 2PDUA 5A6LA 1XIFA 4KQNA 1CGWA 1LM1A 1UYQA 4B9ZA 4HZ7A 1P6CA 2DEPA 4UFJA 4XQ6A 3A6OA 2AMXA 1Y7VA 4GQGA 1G9HA 2HMCA 3AWNA 3UWEA 2WKGA 3HPFA 3F4WA 1G69A 3W01A 3URQA 5A8NA 1DIKA 1GK8A 4AZCB 1NFPA 1UR8A 4JPGA 3GC2A 1HUVA 4PGLA 3WQ5A 3OBAA 3LLDA 4WGHA 1WOAA 1I0BA 1E3ZA 4TU1A 1LQ0A 3KBNA 2OOGA 2RDWA 1VYPX 3AIRA 3CGTA 3N1AA 1UR0A 3S47A 2FVMA 3V7PA 3A47A 4D6IA 4O18A 4KMQA 1E4LA 3BAKA 4AEEA 4LCSA 1DXIA 3IVTA 3AS1A 1CX9A 3GFZA 1TPDA 5AC8A 4NG3A 1V03A 2FZNA 3T8LA 2XIJA 4AD1A 1JDDA 1P48A 4I6VA 3SUUA 2FFIA 1Q6LA 5XINA 1XX1A 3KCLA 4GC3A 1TIMA 3O9NA 5BMWA 3CLWA 2FYMA 3P7YA 3PZGA 1YBQA 3TW7A 2VUYA 1V5XA 4GY7A 4KEZA 4IH3A 4EAMA 5A2AA 2CZ5A 4D6DA 3HM7A 2EGZA 2V3EA 1I75A 4QJ3B 4DY1A 2VCAA 1UD2A 1FRBA 4AF0A 2NV1A 1OCQA 5LA1A 2ISDA 4ZGYA 3QR1A 3E6EA 3EZ4A 1B90A 4LUTA 2QCCA 1FCBA 3V35A 1TPWA 4AEOA 3BMXA 1BEUA 2HV5A 1UD5A 4Z2HA 1HO4A 2CZDA 2SFPA 4HHHA 1F7BA 1ZZMA 3BV7A 5FSDC 3S5YA 4AHQA 2VEIA 3M6YA 1KA9F 3HURA 3VM7A 4QJ4B 4LW7A 1SR9A 1WCGA 3T9PA 1NF0A 2QR6A 3FS2A 3DIPA 4QJ5B 4LBUA 1X6NA 3RPDA 1JF5A 2VURA 4HN8A 4IIHA 4YWSA 1TUFA 1US2A 4AIBA 5JIWA 3OU8A 4XD3A 3UA4A 1K9EA 4F66A 2PRHA 4I9AA 4QDWA 3ABSA 3S6OA 1KR1A 3S2JA 3VGGA 4WEVX 3OBEA 5JH1A 4IWWA 1UJPA 3PFRA 3CMJA 2WPGA 1IXPA 4UR8A 1UUMA 4X3ZA 2X16A 4NZ5A 5K9XA 5G2IA 7PTDA 3LX9A 3UBPC 4OV9A 3UNDA 2OX4A 3WF3A 4DNHA 3OODA 1XUUA 3CHVA 3T81A 6XIMA 1WQ5A 1ISYA 3T4WA 4Q22A 4C6IA 1YTDA 4JN8A 4JFTA 3AMCA 4WHBA 1ELSA 1HL2A 2NLYA 1AQHA 5K2ZA 2QGHA 5HMDA 1R86A 3TAKA 4KW2A 3GH7A 3BAWA 3NA8A 2ZDRA 2E68A 1NP0A 2DZBA 3K8KA 2GUUA 3T7VA 1YIXA 1XIHA 3GSMA 4RV3A 4TV6A 2BX7A 2OSYA 3DFTA 1GVIA 2OEMA 4HK7A 4IG2B 3DUGA 3C0LA 3CWOX 4ZQRA 4WKHA 3FYYA 3CWNA 3R89A 1GOKA 2GDVA 4NAFB 4DEFA 3LZ3A 3ZJ6A 1AQFA 3JZUA 1F2JA 3AUOA 4UNLA 2C0AA 3TMLA 1J01A 1UKQA 3THAA 1THFD 9CGTA 1JAKA 4NZ4A 1OBAA 2CKSA 2QQ6A 1XS2A 3WF0A 4BQ5A 1GYNA 1XRSA 4GI8A 1E51A 4HZMA 2XGZA 3S3GA 3FA3A 3APYA 1BXBA 4JTGA 2EJAA 4KWVA 4JHOA 3W7RA 1E4MM 2CHNA 3I7RA 1JCJA 1Z6KA 2ZZ5A 4AX7A 2BNJA 3CUJA 3CK5A 5DRIA 5A69A 2IKHA 2HK0A 4S2CA 2WSYA 3PUDA 3NVTA 2Y85A 2Z1VA 1UP2A 3CO4A 3CAVA 2E9BA 1BTMA 3PS7A 1S39A 1TWWA 3UVIA 4CNNA 2YOCA 4YJ5A 2NSOA 1R3QA 3KTXA 4DJEA 3IGXA 4WDUA 4J3XA 3SCRA 1R87A 3N19B 2X1RA 1S5MA 4CGTA 2E77A 3W83A 2WNWA 4LFYA 3BQ5A 1PX4A 2WCGA 1PZ3A 3F4CA 4M7SA 1M7PA 4E2VA 2TODA 1A49A 1WXYA 4W85A 4IIFA 3QY6A 4A29A 4PBGA 2IPGA 3O6YX 2CHOA 1E1CB 1M41A 4E3VA 3UW6A 3U6WA 1VBHA 3V3WA 2P1FA 1DJNA 3KP1A 3NL2A 4L6HA 2G3NA 4HSNA 3G1RA 3STCA 1XLLA 4AY8A 1US0A 3GVWA 1V0NA 2NT1A 2Y8VA 4J4KA 4LAMA 2EPNA 3VNMA 1XBVA 2EPHA 5I78A 2PDNA 1E5JA 1PYMA 4KCVA 4UTMA 3RK8A 4PULA 2GGIA 4E2BA 2QXWA 2WC4A 4F2TA 4D6HA 1WYIA 4MUZA 4NP7A 1MYRA 1E6PA 4PMOA 3P60A 3L2MA 4XZNX 1UUOA 2PSNA 4BEQA 4ZXLA 1VCFA 1C93A 2Y2WA 4KCTA 3BTNA 2FZ9A 5F1VA 4WCJA 3CS2A 3VK5A 3VMNA 1V3LA 1FP9A 1OFPA 3GFXA 4FF5A 4BK9A 3SEPA 1TZ9A 3KVLA 2YPIA 3CEPA 3B8UA 2WSQA 4RJEA 4GXMA 1Q4WA 3QV6A 3BW4A 4LUIA 3LB0A 2QS8A 3U2CA 1P6WA 1A0EA 2PF0A 2DZWA 1K6AA 4FEZA 1GVFA 2XG9A 2AKMA 2ZA1A 1O95A 4AYSA 3NOEA 3PN8A 2BOFX 4WF7A 2AAAA 3RRXA 1OY0A 6REQB 4DM2A 2X1TA 4F9JA 2F84A 2O9PA 4GXWA 5C7HA 1FXQA 3GLCA 1ME7A 1JZ7A 4HB7A 5CSUA 3IUDA 4O1FA 1HTIA 1QPRA 1HJVA 4UBPC 4ATWA 4UZSA 4M24A 1GVEA 1ADOA 1N2VA 2C8NA 3BLDA 4LBSA 1M9HA 1LOQA 3W81A 3COTA 3ZJ8A 3HPSA 3SZ8A 2PDKA 3W0KA 1XDMA 4WY0F 2W92A 1V79A 3QGAC 2R1MA 3O6AA 2A6NA 5M2FX 5DCDA 4MKSA 3PZUA 1UG6A 3KRUA 4E3TA 5CAKA 3BE7A 4ZO7A 3S2LA 2QCNA 1ITXA 1SSGA 1ECQA 4Y90A 4P8WA 2E6DA 4RDWA 4U3AA 3R12A 1LYXA 3V5CA 3WDJA 1F3EA 3QTGA 1UZHA 3M0IA 1EXBA 3NZ1A 1VPXA 2PTYA 1VGAA 2FH8A 2JGQA 1PHWA 4X61A 4RZ4A 4G9PA 3ARZA 5DEZA 1QI4A 1EJSC 2NWRA 1YYAA 4UTFA 1GPFA 3G22A 1VCGA 4J9JA 2J8GA 2D23A 1TKKA 4CD7A 1H5YA 1P7TA 1W3TA 4HZ8A 3UGVA 1EDQA 4L80A 2FMOA 3T44A 5CBJA 3AUJA 3M0YA 3K1GA 2WMKA 2XZ7A 2E5CA 3P67A 5ABHA 1DE5A 1UR3M 3UF9A 3BCJA 4RV8A 2JALA 3I68A 1M04A 4XZLX 3DAQA 3IJ7A 4W86A 4DUWA 1FHUA 4JTJA 2BGNE 1EPXA 1JYXA 1LUCA 4LC6A 3MS8A 3BICA 3PJXA 5FEZA 4FNTA 1FXPA 1X7FA 4RE0A 2WMGA 4IUOA 1P1MA 3TJXA 4CD6A 3FDGA 4M6QA 5BXRA 4IIBA 1OG0A 1VRXA 3FXYA 1YXDA 1ESWA 4MAZA 3CL8A 5CGMA 3W38A 3F2BA 1K9TA 1Q6CA 3L67A 1DPMA 4YTUA 2XSXA 5M17A 3WBYA 5I06A 2GWGA 2RUSA 3B0XA 4XBJA 4XKYA 3HFTA 2G50A 4Z2GA 4HA0A 4ADUA 3CZGA 1PS9A 2FZBA 1AW1A 1OFBA 1YDVA 5CC6A 2Z6IA 4Q4PA 1V77A 3LPOA 3UR7A 2BVYA 1J79A 4C6EA 2Z2BA 4O28A 3MQTA 4OTKA 2CBIA 1XD1A 4B2DA 1LL6A 4MY8A 3IRDA 2CLHA 4UTLA 2Z7GA 1LG2A 3A3HA 2YX0A 3G8RA 2ABBA 5BMXA 4B5SA 2GGHA 3B40A 4U2YA 4EIVA 4G5DA 4FS9A 2PC8A 4CN4A 2GPTA 1OQFA 4GBUA 3VE7A 1AJ2A 1X98A 2XWDA 2JGYA 3AWOA 3GH5A 3SN4A 2EAWA 1XLMA 4IQLA 3N2BA 1MFUA 2TYSA 1HGYA 2E5BA 2E3ZA 1V7AA 1U22A 2QUVA 2WLZA 3H53A 1JYWA 3OA5A 4CQDA 2DU2A 4XK2A 1B9ZA 4AZCA 4LS0A 3VCRA 1UP0A 3PZNA 4NIRA 4DUOA 4DXVA 1ZFJA 1QPNA 4MF4A 4AZ5A 3TCSA 4XD6A 4DJEC 1JDFA 1EQPA 4NI3A 4ZE4A 3BXWA 3LCWA 2DVTA 2G4JA 4NRSA 5KZDA 1ZBCA 2VRKA 4AUBA 3UCCA 1W5MA 3P5YA 1LL7A 5BCAA 4I7UA 1PHQA 1E40A 1VPYA 1WDRA 2J7GA 5IFTA 5CSSA 1TPFA 4GVFA 4YIWA 2QJGA 5JU6A 5KITA 4LUSB 1UKSA 3KLLA 4PR4A 8XIAA 2A21A 5C70A 4GQQA 4DUVA 1H1ZA 1JCNA 3TYAA 2GJPA 4JICA 5D09A 3B03A 1CZ1A 4TMCA 4D6FA 4JL1A 1XINA 3RG6A 3OVGA 4JX4A 1R9YA 3C52A 4J3UA 4YCPA 2R91A 3RF9A 3M5XA 2J25A 1A4LA 5I3FA 2GUYA 4A2RA 1V02A 2E9LA 2WAGA 1VYSX 3P82A 4KPLA 4AHPA 2VENA 2I57A 3BLKA 3BH4A 1W91A 3VD3A 1Q45A 1C91A 3QFEA 4FO4A 1S1RA 2AL2A 3H4WA 1MXDA 1S5TA 3MWCA 3MMWA 1NWTA 1VBGA 1EGMA 3E5BA 1ZBKA 1BXNA 1PX3A 2Z27A 2VRQA 2DZVA 1IWAA 3GTNA 2I1OA 1TX2A 3QOMA 3GG1A 5A8QA 3EX4A 1V8EA 3R10A 1KC7A 1VJIA 4S3EA 2WBKA 3OTRA 3O8AA 3RMJA 1OFDA 4RXGA 1XYFA 4MHBA 3A13A 1AFSA 4OBRA 3VFCA 3W1XA 3MHGA 4TV5A 3W7QA 2G0WA 1PWMA 5T9CE 1OYCA 3B04A 3F2DA 4I6KA 4EK7A 3G77A 1P5BA 3L21A 3BW3A 4LRSA 4TTGA 4JKLA 1EPVA 1CWYA 4EAYA 1MXGA 2H3BA 2EG7A 4FXJA 4HU3A 2QUUA 3EX1A 3W27A 4W7VA 5LIYX 4X2PA 4MJ2A 1HL9A 3AXHA 1V6TA 3CIVA 4RPPA 4ZENA 5I7GA 4A22A 2PURA 2BMBA 1KCXA 1CW2A 4HPHA 1GEQA 4DXXA 3TA9A 1H51A 1EBHA 3R6IA 1OFQA 3S0CA 3WQGA 4N9DA 3B0UX 1KBBA 3ITTA 1ICPA 1OD8A 4MNJA 4GUJA 3M0VA 1BFNA 1X6UA 4DJDA 1CXHA 4PCPA 3NQ2A 3M7SA 2BXZA 4N02A 5BWAA 3WQEA 3VD7A 4X0VA 3NQDA 2GOUA 2Z00A 3THDA 1TX0A 1VENA 3DBPA 4GZJA 1MQRA 4RPQA 2W62A 3QYQA 2ZC8A 3NQMA 1K4GA 2GFTA 3PY2A 3DGBA 5F4XA 3E0IA 1Z41A 2GGJA 2J27A 1I8JA 1RALA 3Q94A 4Y9NA 4ICNA 4Z1BA 1UWTA 3L4WA 1X38A 2BVDA 1HF6A 2D2OA 3E2VA 2JEPA 3FY1A 2OYLA 1P1XA 3QH2A 3GYCA 3WLPA 4JQ2A 1MW3A 5H6HA 2D3NA 3EX2A 2PDGA 2A3EA 1JZ2A 5A3HA 1W3LA 1UOKA 5DXXA 2ZUUA 4GX8A 1TB3A 5LIWX 4Q4MA 5I0DA 1ZBVA 4H9VA 2C19A 4NAEA 2H3DA 3AYTA 3KRSA 2ZRUA 1TTPA 3U48A 2QCGA 3TEVA 3O0FA 1R3VA 1T40A 4YL2A 5EBUA 1UIOA 4HGXA 1LP6A 3ID7A 4ONVA 4DWSD 1A5SA 3C2FA 1LLOA 3P84A 5FJPA 1FWNA 3MBDA 2YDAA 1LF1A 1S1PA 2J8FA 4QXIA 2GVJA 3Q4DA 3LCFA 1UA7A 3C2OA 4Z1YA 5I6SA 3PUEA 3RPMA 2G41A 4P8UA 2HS6A 3K4WA 2Q71A 4YTRA 3M64A 4MWAC 3DECA 3WLTA 1FY6A 4NSBA 1GVQA 2OZ8A 3M0LA 4HOZA 4AB4A 3B9NA 4PCNA 3WY1A 2X2YA 1SM9A 4AIOA 4ERGA 3E49A 3ABRA 5AN7A 5I3KA 3FV9A 3LHVA 3RX3A 4XISA 3S1WA 1D8CA 2DSZA 2GGGA 3WLQA 4F2UA 2PLMA 4RKAA 2OU4A 3CAQA 3R0UA 1G5AA 1LROA 1FCVA 5HWJA 1XLDA 2PWVA 4U31A 2DT1A 1W9DM 3CL7A 4GUFA 1IZJA 1DWFM 1TIWA 4F0RA 3O6CA 4GY1A 4JNZA 3WDRA 4GO9A 2ACRA 5AFDA 3WKZA 1VH7A 4OBSA 3WMLA 2V67A 2Z24A 1QNSA 4GOAA 3WK3A 4WX2A 1HKJA 3OZYA 3NEVA 1JL8A 2H6RA 1L6FA 3LN3A 1E9LA 2PDFA 2HSAA 1NOWA 1B0IA 2V82A 3AROA 1DWHM 2QVHA 3NQGA 2FZDA 4UFMA 2G3IA 1ME8A 5EU9A 4PCSA 1KGWA 4RNFA 1KGXA 4B4FA 4RX0A 1TR9A 3L4TA 3TJIA 4AIEA 4V15A 1F76A 3MV11 1G7UA 4NL1A 1M6JA 2VWTA 4O17A 1DWIM 2WNZA 3TU9A 1QMLA 3GXFA 1AUSL 3A9BA 5AKQA 5KINA 2ZXDA 4Z2LA 4OE7A 4N42A 1LWIA 2AQWA 5A6BA 2VX4A 1KKRA 4XZWA 3TDFA 1CCWB 3I10A 4PUUA 3DKLA 1IT8A 3GNPA 1JFXA 2DY3A 2VCBA 3QSRA 3NIYA 1DJZA 5HPCA 2NSXA 4UTKA 1MI3A 4LANA 1WV2A 3GVRA 4MNMA 2EO7A 4M80A 1FUYA 4PTWA 1HQTA 1FFQA 5FEPA 2GVEA 3H2MA 1XLBA 3AIEA 2WPBA 2R8WA 1MEIA 7A3HA 2X0YA 1KM5A 3GX9A 3GIPA 1UP3A 5E6YA 3W84A 3DN5A 2Z2AA 1ENUA 3O16A 1EUAA 3AIWA 2YDRA 2PC4A 1Z9AA 3VA8A 3V0SA 4UFIA 1Q7MA 4PSRA 1LBMA 4A8RA 2RJGA 4GVIA 3GXMA 3VILA 4HU8A 1XGEA 2HROA 1L6YA 3JS3A 3S8HA 2PCQA 2PRMA 2J75A 4ATDA 2XH7A 1NH6A 4XZIA 3NGJA 2EPOA 2WZHA 4MB4A 1XJBA 1K70A 2OG9A 4PMDA 3BMWA 2J77A 3TNOA 2P53A 1GG0A 1W1IE 1Q7QA 2O9OA 4BCEA 3VVGA 4FXFA 2XH4A 4GZ7A 1CXKA 3R5EA 3GNNA 1E71M 4QLJA 4ROPA 1KKOA 3EGJA 3LI0A 4V27A 1POJA 2C71A 2VKZG 5J8LA 1WKDA 2J9ZA 2VEFA 3QR0A 5CG0A 4NZFA 3HTWA 4L1GA 1EKOA 3W22A 4IF2A 3GNXA 1OABA 4S23A 4YWIA 4EXQA 1CTNA 1S2AA 4EACA 3LXBA 3IJQA 2FH6A 2XH0A 4PTVA 3T0AA 2D0FA 3OLIA 1H41A 1RA5A 1U83A 3PG8A 4Y9PA 3OZMA 3XISA 4GUIA 3MJYA 1E4IA 1W1A1 4G56A 1U33A 1V3KA 1GUVA 3W26A 1GKPA 2QDGA 1ALDA 1WZKA 5CBBA 1V3HA 1F3XA 4LF2A 2PD9A 3JVAA 1UH3A 5CPMA 3S2NA 3NUKA 1HJXA 2QZRA 3AAMA 2O55A 1YPXA 2F61A 5K9DA 1A5LC 5DFAA 1WDSA 3SGGA 1EUNA 4KS0A 3GHSA 5HQLA 3LPGA 2VX7A 1R3SA 3GQYA 3IV8A 1JCYA 3OGSA 3QVQA 1L6WA 1U30A 3IRSA 3ME3A 5LKYA 4CN1A 3EEGA 3TIMA 4I5UA 4NQ1A 5HJXA 3EEZA 4DJDC 2J7CA 3ICJA 2OT0A 4JFVA 1HW6A 2PTZA 3E2SA 4IJCA 1GOMA 5D9MA 1TMLA 2PP0A 1BPLB 3VD9A 2A2IA 1XW8A 3CIXA 4ZL1A 1E9YB 3UJSA 3E9AA 2J7DA 1G4SA 4KH2A 3WYZA 3ZSTA 1T8XA 4U2ZA 4NX0A 4ZE5A 1NELA 4GC4A 3GH4A 5FJOA 1FWAC 1EP2A 4C6DA 3WH6A 5FL1A 2D0GA 2XWEA 3MSRA 4A3QA 3H6OA 4JY8A 4NKCA 5BW6A 3NEHA 5E70A 3WK2A 2DFAA 3IWPA 4WIWA 1DHPA 2WHKA 1WB0A 1R3YA 2DVUA 1ZQ5A 2V68A 5LSMA 3EWUA 3JR2A 4PEEA 2VI0A 3PPCA 5KZ6A 3QQWA 1MW1A 5HMEA 3D5HA 1US3A 4GYJA 1K8ZA 4H2HA 3QKZA 3CB8A 2QEZA 4NYYA 2DT3A 4JKKA 2WVVA 4MY1A 3IANA 2AMGA 3PJTA 3TYUA 1BWVA 2BHYA 1Y5XA 5GJNA 3HQOA 1GOWA 4HU4A 4X9YA 5A6JA 2J66A 4JX5A 2XM1A 3MYPA 2B81A 1HKWA 3WNPA 3B8VA 3H70A 3PB2A 3OLEA 3ZJ7A 3POHA 3EDJA 3EB3A 5HANA 4C1LA 2UY4A 3GO2A 4GH3A 2DSWA 1JYVA 1RCOB 2IPJA 2Y1HA 3L2LA 3PTKA 2PAJA 1H61A 3W2LA 4B91A 4G8TA 5JXQA 3ARXA 4I8DA 2PU1A 1U5HA 3ONBA 4IGHA 5DCBA 3FX4A 1V6VA 1TPH1 3W9ZA 5I77A 3ZLGA 1HXJA 3GAKA 2GDUA 1A47A 4DAFA 2WSPA 3P3BA 1AA1B 2CLLA 5D9OA 3URNA 5IM51 3W7PA 2CLPA 1VFSA 1MZRA 1E6QM 1R47A 3WO8A 1S2TA 4M51A 4UB9A 5K9CA 1AZ1A 3IIOA 3A4AA 4O52A 2PD5A 1ICSA 4S3CA 4HTBA 4I5RA 3N3TA 3POCA 3TW6A 3S1VA 4B3KA 4GI6A 2TMDA 4Z0SA 1JPHA 2I5QA 2Z1KA 1UA3A 1XUZA 3BAXA 4BFAA 1SW7A 2GVGA 4C6JA 3E5PA 4IX0A 3NXFA 1LQ2A 3AFBA 1H0IA 4LYQA 1TV3A 2QAFA 3WG6A 4WQ6A 2DH3A 4F48A 4CNTA 4HA3A 1LOLA 1H7OA 2PTDA 4IFRA 2PDIA 3PSWA 4PRRA 2ZUNA 3QPEA 3B8DA 2ZADA 3UCDA 3NZQA 3CAWA 3LZ5A 1B4EA 4QCFA 4GGHA 1MFVA 3FSUA 4QE5A 4EVZA 3EWXA 4H00A 5LNSA 4CKQA 4UTUA 4L6DA 1XIEA 3SUVA 1AL8A 1TG7A 3A64A 4JYDA 4K7VA 1KBIA 2VCCA 1YPIA 5GNXA 1NWRA 5CJNA 1J2WA 1FWTA 1G7VA 3DX5A 3SRDA 2VOTA 3M0XA 2WMFA 3RITA 3W7KA 2NV9A 1B9BA 1PBGA 1FCQA 2CNCA 4CQ8A 3HZ3A 1GVSA 5HJYA 1Z89A 1X8CA 3HGOA 3C8NA 1Z32X 2EG8A 4CCCA 1BAGA 3KVKA 3U2ZA 4P8XA 1F5ZA 1YXCA 2YYUA 4JIHA 3ZVIA 1Q6OA 2R1LA 2GWNA 1Z8AA 1VPQA 3EWYA 4M81A 3HOJA 2W61A 4HMEA 3KBMA 4CVWA 1DBTA 1YEYA 2FDMA 3G1YA 3UXAA 4GIRA 2WHLA 5D2VA 3M0ZA 1YXYA 3VU2A 3MKCA 1G1YA 3LRKA 4CEXC 3MP5A 2X05A 2FVLA 2HTMA 2GGEA 5EGRA 2V5JA 5AHEA 2I16A 4M6PA 4CN6A 4UTJA 1PTAA 1DOSA 3NFUA 3IUIA 3FAWA 1F8MA 4H6EA 1PIGA 2O56A 3MT1A 4JTCA 4ZTYA 2WKJA 1O68A 1CLVA 1M7OA 4HPGA 2ZXAA 5FESA 4HNCA 4AY7A 1JYNA 2B7NA 4MJZA 1YDNA 3LLXA 4N0RA 3HGRA 3EOUA 1ISVA 3IIVA 1XYLA 2PGFA 4UOQA 3VMPA 1EEXA 3FSTA 2WWDA 2XVGA 3HMCA 4F0SA 4HTYA 2ZWZA 3LENA 1ZU8A 3M47A 1DQUA 1EJWC 1AODA 5TNVA 3ECQA 3SURA 4LOCA 1VEPA 1FWDC 2VNCA 5HUOA 3GXIA 3W1NA 2X40A 2Z25A 1JD7A 1D3CA 3ELFA 3V36A 5D05A 1OFRA 4XVEA 3WUBA 3FK4A 2J4GA 2G4FA 3M5VA 4E4UA 1H49A 3VNZA 1UKPA 5CXPA 1XG4A 3W73A 5HDRA 3RU6A 5IDIA 4L9ZA 4DAIA 4XG1A 3ZFHA 2OO0A 1BLIA 5K4ZA 2IKGA 3QRHA 2UWFA 4YLWA 5A6SA 3L12A 2JIWA 1CXEA 4MOZA 1VLIA 8XIMA 4LAUA 5ABFB 3TC6A 3C2RA 1J9YA 1B31A 2YL9A 2JE8A 1Z69A 3MMTA 1NEYA 3VC5A 2W9MA 3WQ4A 3V5OA 1UH2A 2Z7KA 4JFWA 3TSDA 3AIVA 3BOLA 2R9RA 1W37A 1EFZA 2D2JA 1HIZA 2DQXA 3IGSA 4FXSA 1Y5VA 2QCEA 4M3PA 3WLLA 2NXIA 1SW3A 1J6PA 2DUZA 4ZOEA 3NPUA 5I2UA 3VIMA 1XR2A 3LLFA 4LU0A 1I2PA 3VOFA 1JI2A 1XGDA 3N9SA 3PZIA 4Q6XA 2FDSA 4Q4RA 3W7DA 1RQEA 1TJPA 4IFOA 4KRUA 2CESA 2Z1SA 3ATYA 5FACA 3N3MA 5LZLA 5GNZA 4K3ZA 4Y9MA 1K4HA 3UZZA 3QY7A 1J11A 3MW7A 4O1EA 1X8FA 4ZQCA 4DI9A 1LLZA 2EKCA 2BY1A 1M68A 4YVVA 1TYGA 2C18A 1DQXA 1QHPA 4ZB0A 3W23A 3REQB 1QJWA 2WM1A 4FNQA 3QLLA 2QUTA 3WNNA 1IR1A 1SO4A 2ISFA 1L9WA 1Q13A 3HG3A 4U28A 3O0KA 4DJED 5GVJA 2R1NA 3GKFA 1MUMA 4JOMA 5G4HC 4FNPA 3IUHA 5DN1A 2VWSA 4QGCA 1EYEA 3S9IA 3H55A 4P2VA 3S1GA 1YTKA 3RU8X 1AZ2A 3PZ9A 4MWAE 3GU2A 2GJLA 2Y8UA 1PDYA 4FNSA 4YN5A 1VFOA 2XIOA 5I3JA 1A3WA 4JYFA 1MW2A 2ALDA 2WBGA 1LOSA 5DY3A 4AX6A 4LEFA 1OC7A 3DFOA 4B5TA 1JCXA 4DLFA 3EKZA 2CEQA 4D6CA 3O7UA 4MJMA 4AC7C 4L6OA 4EF9A 3EMCA 1AH4A 2DORA 3ZOAA 1HKKA 3M1ZA 3SCQA 1H1NA 3TLQA 2O9RA 5CZTA 1GTHA 1GVOA 1OC6A 1EDTA 2VFFA 4C91A 3D3AA 3L4ZA 2NVDA 1F3TA 2F2KA 1S5WA 3GTHA 5CGQA 3WBEA 2R6OA 1SJBA 1O7AA 2C3ZA 4JY9A 3GIQA 1ZGDA 4V1XA 3GD6A 5K4XA 1YE4A 5CKSA 3M5ZA 2YBTA 3H2AA 4PUDA 3TMQA 1VEMA 4P8VA 3EPMA 2AL1A 3B4UA 3PAOA 1UC5A 4W8BA 7CGTA 2JQXA 1DL3A 1A5CA 1UZDA 2EF9A 4OVXA 5G1TA 2I9UA 1EX5A 1LWHA 1NARA 3QQ0A 3ZR6A 4DJFA 1DTUA 2P8BA 3ITLA 3DERA 3UYIA 4D8AA 3IV3A 3CC1A 2AOSA 3LU2A 2VC6A 5BXSA 4LB3A 2HRWA 1EWDA 4JN6A 4LF1A 3GDLA 4PCFA 1DJIA 3VKKA 1GEHA 1GORA 2FB3A 1A3HA 1LQAA 3B8WA 1W9PA 4S3KA 4PFMA 4WSHA 4C5ZA 3HG4A 2JIEA 4B3LA 4L61A 2RDUA 2NQLA 3KUMA 3CQKA 3XIMA 3ZVHB 3FXGA 1KM2A 3PFMA 3GBEA 1E9ZB 4GKTA 3AS0A 5EL1A 1KWKA 3N11A 1JDCA 4IQEA 1TCDA 4IMDA 3P8IA 3DI0A 3QC0A 4RXFA 1HN1A 2YCLB 1KLYA 4GD0A 4TR9A 4LVAA 2WNNA 2BOGX 3FAXA 3SBFA 2PODA 3C3NA 1O12A 1T96A 4BHYA 2YKKA 1F9CA 4UQAA 2VDIA 4K36A 1W3KA 4KRZA 1W2VA 1JAEA 2ZYFA 2JKPA 1CGXA 2XYLA 4QM1A 1W54A 3LCHA 4W93A 1MSSA 1TSIA 1O1HA 1PZ2A 3KL0A 2X7VA 4J1OA 3R13A 2E67A 4IMGA 5AYBA 3P14A 2OTDA 4A3RA 3QV7A 1REQB 2Y63A 1UKOA 4MTVA 2WMJA 3VKDA 1NAL1 2CZEA 3U2OA 3EWWA 1FWRA 1N8WA 1CLKA 2HNHA 2KX9A 1XBYA 3NDZA 3QW3A 5H2ZA 2PWGA 1TPEA 3QPZA 5IHRA 1RA0A 4LXFA 3DYMA 2CLFA 1PKYA 2Y7EA 3DGRA 4QAWA 2OLAA 2YDQA 2KZHA 3E38A 3FVMA 3G24A 3BAJA 3QQ1A 4S39A 4ZVJA 1AQMA 2OEJA 1QBBA 3VXGA 4Q8VA 2BASA 4PB4A 2ZA2A 3NZGA 3GR8A 5A6MA 4K7YA 3C2YA 2VTFA 1GJPA 3V5FA 3UPMA 1VP5A 2HE8A 3DFSA 3CMGA 3BLPX 3QYSA 1OM0A 1LWJA 4PTXA 2D1ZA 4UQCA 3S1XA 2DSKA 1ZAIA 4UTWA 4MGGA 5A2BA 1CB7B 2ZOXA 2QJMA 4MWAD 2QUMA 4PC8A 3LM7A 3B3DA 4JIIX 4AZIA 3S5OA 3QW4B 3CUXA 3O3RA 2TPSA 2WCSA 1ZHAA 3VOHA 1H3GA 3VZXA 2NQ9A 1C90A 4DO6A 3CT7A 1CNVA 4DO4A 4FNUA 1NDWA 1UKTA 2VQTA 1BYBA 3R7MA 1CECA 5E9AA 3SCOA 4A8NA 1TQJA 4CQAA 2QPUA 1IZCA 1T5AA 1VEOA 4KESA 1VIZA 3SW6A 2W91A 3LBCA 3N2CA 3VZZA 4AQLA 3ZLHA 4OHQA 3TXVA 4PMZA 1RVKA 5CLWA 4LVGA 1E6NA 5LYRA 1QATA 1I45A 1DJXA 2WO5A 4FLRA 4C6MA 1B3ZA 4ZEPA 3VGEA 1IZKA 4GQ0A 2XVPA 3JUGA 3SECA 2POTA 3TC3A 1H2JA 3WH7A 4GHRA 3CASA 4W7WA 4FLSA 4H4IA 2Q8ZA 1QW9A 1K7FA 1VFUA 4R3UA 1BVNP 2BWGA 3K13A 1FKWA 4H83A 5E09A 5DRCA 3LGEA 1OF6A 1XPYA 5DXYA 5C8BB 3AOFA 1NOFA 2A3CA 2CHRA 4CNSA 2A0NA 2ZZ6A 2A5HA 1B54A 3LD5A 4NZCA 3MSYA 3RILA 3DG6A 1PYFA 2C79A 3FHQA 3W7HA 3IVUA 3I4EA 4IFKB 1NU5A 4DX3A 1VHCA 1JQXA 2X30A 1D7KA 1UR1A 1SFSA 3DZ1A 3UG3A 5D2TA 3DI1A 1M7JA 5AY7A 1I1WA 1KGUA 2YA0A 3P81A 1GT8A 1FWGC 4E4FA 3SO7A 3PWGA 3PG9A 3LHZA 2D22A 1WPCA 4CLMA 5D02A 5F4WA 3FGCA 2X8RA 3VYLA 3WLMA 1OFAA 4I9MA 4QISA 3ZXWA 3HMJG 4WVXA 2C1HA 1Q4NX 4K8GA 1J12A 4B4HA 4HHMA 1TZ7A 3AYRA 2XTKA 4RDVA 1AK5A 2P5NA 4C1KA 4A8IA 4AISA 1J10A 2J88A 8RUCA 1OCBA 3WLRA 4Q8QA 5CEWA 3CU2A 2WSKA 2VDHA 2Q3OA 3IK2A 1V3JA 1KFEA 4DPPA 1KXHA 5CQ1A 2VC9A 1ONXA 5TD4A 5CZKA 4X0NA 3AMGA 3AZTA 4Z1CA 4Z1AA 4QS5A 3ALFA 4YPJA 4GNJA 4JQ4A 2V5DA 2R1PA 1FHDA 4ZFMA 3PZTA 2QCHA 3G6MA 1W1PA 5DY2A 2YL8A 1KFWA 4JEJA 1TE1A 3BCFA 3GUGA 3F4DA 2BDQA 4NRRA 1B3XA 3LV5A 3VIKA 2HQAA 4IJRA 1ZJAA 1QPKA 3LHTA 5IBXC 2A6LA 3M44A 1Q65A 3KL5A 1NQ6A 5CPTA 1CXFA 3CL6A 2LLEA 3I4KA 3LMZA 4C5YA 2ZZ4A 3KL3A 1KM0A 4AIUA 1SO6A 1RAKA 3GUWA 2Y89A 5FJIA 1BRLA 4ORMA 2OX1A 2CIPA 2PTXA 3NO5A 3AHYA 4DJFC 3NSXA 2VFGA 4W9TA 4H1ZA 4MDPA 3PZVA 2FGLA 3CBWA 5I24A 3OBKA 3A21A 2D20A 1XIJA 4GA8A 3WJYA 2QKFA 4H9XA 4J5NA 2REQB 1F61A 3HPXA 1H11A 4GYPA 1NFBA 4M6VA 3CAKA 5DCEA 3C6CA 3W7GA 3SN1A 3HV9A 2E28A 3ABZA 3UWQA 1YKWA 4JTRA 2OEKA 2ZX7A 3DFHA 2NUWA 3TUUA 1ISWA 1TJ0A 1IYXA 3SN0A 4FMVA 3SY8A 3OYXA 3VIGA 3MHFA 2VC5A 3MSDA 7REQA 4AW7A 3UD6A 2XSBA 4DJDD 1SR0A 5D32A 3STGA 4GI4A 3WD0A 4O1CA 1GPWA 4KFNA 2GLKA 1DV7A 3EA1A 1TWDA 3UU0A 2XVNA 3SCPA 2WCAA 4N6EA 5LNVA 3MUIA 1GKRA 3GG8A 4TO8A 1R6WA 3DFPA 4AWUA 4XZBA 5ABFA 3TSBA 5KZMA 1TELA 4IT1A 4Q7IA 1UQZA 3W7OA 1DJWA 4AAJA 4CU8A 1OCNA 3LRMA 4IMEA 1V6XA 1A5OC 1PDZA 4J3VA 1SZGA 3NJ3A 3LCIA 4DWSB 4HT3A 3T6CA 3VCNA 1WOBA 1QWKA 1CXIA 3TYBA 4PTDA 1SZNA 4MAVA 3WFLA 4ZSTA 3UERA 3HGSA 4DZ5A 2F38A 4WOZA 4I3GA 4HMCA 5C55A 1DIDA 4UTTC 1H0GA 3H2CA 4HZ6A 3NVDA 3SSZA 4R85A 4P5UA 3NSNA 4GUGA 3GVGA 3VGBA 2WVSA 4CNPA 3SR7A 1ZB5A 4XZMX 2J9YA 5G4WA 2WVTA 4H9YA 1O5XA 2VYOA 3AXIA 4WD0A 4HHPA 1KV5A 3REQA 4H8HA 4G2DA 4LVBA 1ZJHA 1F4HA 3N29A 4FIRA 1DE6A 1VF8A 4TX9A 1YW1A 5FD0A 2WSRA 2WZEA 4JDYA 4WKFA 3THCA 4FOJA 5DANA 1FFRA 2PDJA 3CHCA 3TVAA 3VNDA 5AYYA 2YJQA 4ML9A 3VE9A 1HKMA 3R2GA 2ALRA 3ARUA 3SQMA 2IQDA 1W3JA 5FJUA 2ZRXA 3G0UA 3KTCA 3UWYA 1SU5A 5AHIA 4MFDA 4AWEA 1BSIA 3WH8A 1YMYA 1CB2A 3ARTA 1ZY9A 3CLMA 2YW3A 1FH7A 3GDKA 1BGGA 1PSCA 1EHAA 5REQA 2J7FA 1IT7A 3HFYA 5MKGB 3RM4A 3PHAA 4K1WA 3Q45A 5I3HA 1EJUC 3LXCA 3VNIA 3H4XA 4JFSA 1WAWA 1W3HA 3LSCA 4EE9A 3L4VA 3I6EA 4J7RA 5EMKA 1V3IA 4PA8A 2VEPA 5HNRA 3D0CA 5JVLA 4PE8A 2GVYA 4N2YA 4FLOA 3EOLA 5AC4A 5C71A 2DSUA 4J3TA 3RJXA 3AMKA 2XFFA 4UCGA 3UR8A 3P0XA 4FF7A 4FZIA 1ZALA 2P10A 1SMAA 3LNPA 4EOUA 3EDDA 1FH8A 1CGTA 1I2RA 2CU0A 2DT0A 4HNVA 3BUVA 3W07A 4ICMA 4D6JA 3MYOA 4UOJA 2IW0A 3HBLA 3NL5A 1WDWA 1PZ0A 4JQ1A 4GPNA 3RX2A 5HWMA 1M03A 2A7NA 5G2HA 2AKZA 2V3FA 5E5CA 5DMLA 3TOPA 1FHLA 1O6IA 5HQEA 3GU9A 4YU1A 3ZJKA 4IP7A 4JIQA 3MANA 5ECVA 1OEPA 5XIAA 5LNUA 3FNDA 4TOQA 3N9KA 3CZKA 5BOOA 2B7QA 4EXAA 4E2DA 1JR1A 5CSRA 5A6BD 4L4PA 4NNAA 1HX0A 2OXNA 3AYSA 3IJLA 2PDMA 2V8ZA 4J2MA 2UY5A 4GJIA 1UWRA 3RNDA 3HA1A 2XFYA 1Q3NA 3T2OA 2GK1A 3WJXA 1UCWA 5IRPA 2A3BA 2BV9A 4KEUA 2Y7DA 2FPYA 1I0DA 4M0XA 3W24A 1RK5A 1OZMA 3TTSA 5CH9A 4MKNA 1CIUA 3UVAA 3RLVA 2E1WA 3P80A 4KWUA 5M03A 4LB4A 1W1YA 2XN2A 4JDBA 3MMUA 4M1BA 3BJFA 5I23A 1VD6A 1BVZA 3ALGA 5K3VA 1PJ9A 4PBEA 5A5WA 2W3ZA 2NXHA 1XFBA 3VDHA 4O0KA 3UWUA 3I3EA 4ZSUA 1YPFA 5CC3A 3CUFA 3B0YA 4EPDC 1JDEA 2BGSA 2D69A 4AD4A 1AW2A 1XC4A 2R82A 5I3GA 1VBRA 3AS3A 5TQLA 4W5ZA 4HMNA 1E3XA 2H9AB 3ABOA 3MCNA 3ITGA 1TPVA 3UJ2A 4MDOA 4MFEA 5C9WA 5HNUA 1W9BM 3S83A 1KRMA 1KQYA 2V3DA 3W29A 1UWAA 1K7EA 4BA0A 8CGTA 5D2XA 2Q3RA 3PSVA 5DMMA 2ISVA 3P6LA 3T8QA 2CKRA 4I9TA 1V4YA 5EPDA 2WKLA 3PJUA 4I7WA 1R8LA 3ABXA 2QF7A 5BRQA 1GOQA 3PNUA 3TZFA 4A6GA 4Y9AA 1MO0A 3ZR4A 3WDIA 1H4PA 5I09A 1T0OA 3KRBA 2ZX8A 1ZTVA 3GDTA 1F07A 3KWSA 2BGQA 3LTYA 1AG1O 5KTLA 3PBVA 3G3MA 4RDZA 1WX0A 1S3TC 1UHVA 3BDKA 4YXGA 4RW3A 1UROA 5IDZA 3PBGA 2V30A 2ZKMX 4H8VA 1LCOA 3O63A 1OCJA 4GYPC 2BP1A 3WLNA 3EWCA 4WDXA 1UH4A 3I6RA 1C7TA 3VIFA 5DF0A 2J8TA 1YTEA 4W5UA 2PDLA 3TJ4A 3IJDA 1VHNA 3C61A 3VD5A 3OVPA 5EMJA 2XIIA 5C9XA 4CEUC 1TUXA 1QNRA 5L6UA 1QO5A 1E15A 4O54A 1XRVA 2VP8A 1GQJA 3CUGA 3H22A 2Z1BA 1TO3A 1O1ZA 1PTGA 2Y7GA 1QNOA 4K8HA 2ZRZA 1XWYA 1EJ7L 1PKNA 1RBLA 4QE4A 3CHFA 4HIBA 4KWOA 2G3FA 1HP5A 2Q02A 3BANA 1J0ZA 4BS0A 1Q6FA 4LV9A 3VOJA 2VFHA 3NYDA 3S4TA 3T2PA 4JTTA 2PWDA 3GXTA 2J7EA 4FR1A 1J93A 3U2EA 4KRTA 4X2RA 2EEXA 3STFA 2ZIDA 4EWND 1XISA 3ZSSA 4ZA0A 4O4VA 2DDXA 3KE0A 2VVSA 1M53A 4AZ7A 3MP3A 1X97A 2NX1A 3CH9A 4DBDA 1QBAA 5CPQA 1GQNA 1RV8A 3VCCA 5D38A 3I7QA 3J7HA 4QBXA 2DQWA 5I3IA 2NQZA 2PDXA 1XM3A 3STPA 3WUEA 4C7FA 1OC5A 4K38A 4XUYA 3EWBX 1XLHA 1EH9A 2ISSA 3S46A 2CLEA 3OHIA 1ITUA 4PBFA 3TYZA 4Q7NA 1KFKA 3AISA 5LHEA 3S2CA 3NR0A 1W5OA 4F0LA 4PH6A 4PMYA 5C2CA 4EPBC 2OB3A 1MQQA 4MSSA 3QM3A 2ZX6A 3W7LA 1ZRQA 2NX9A 3PBYA 4D6EA 5C2XA 1TQXA 3HJZA 3CYVA 1W1ZA 1B2YA 2PDCA 4JQAA 3ZS4A 4QP0A 4US5D 8A3HA 4UFHA 1QO2A 5G2WA 4MYXA 1BG4A 2PI6A 3UJFA 3FEMA 3KDOA 1ZENA 3NQFA 4QEEA 1WE5A 2OODA 1UIPA 2C15A 1DORA 2G5WA 4H6RA 3OZPA 4X60A 1QRQA 3Q65A 4IICA 4AD5A 5LNWA 2IKIA 2IMRA 3AYVA 3OG3A 3ERPA 4S3BA 2QW5A 4CNOA 4REQA 3NQ7A 3GTIA 1AL7A 1WDQA 3WQFA 3CJPA 1XICA 1YNYA 3KHJA 3WD2A 3LV6A 1HVXA 5BYWA 2W66A 3N4FA 2NLIA 5FCZA 4I9JA 4L1XA 1H7NA 1UUQA 2HS8A 4FA3A 3PTQA 4QLLA 2XJ7A 3BPWA 1IEIA 1O60A 1Q6RA 4DF1A 4FX6M 1QHOA 3UXKA 3TA6A 2J79A 1G6CA 2FGBA 1OFOA 1MEHA 2CLOA 3KTSA 3TN5A 1BYAA 3SY5A 4KWWA 1XLKA 3ISIX 1I2NA 3GDBA 1Z48A 4CD4A 1GOOA 1EC8A 3I3DA 2PDBA 3DHUA 3IJ8A 1O94A 1K8YA 2E9MA 3ITVA 3KW3A 4PMVA 1JPIA 2BY2A 2ZRVA 4IMFA 4XAZA 1VFFA 4E38A 4WK9A 2I9EA 3PZQA 3JU2A 4QHRA 3SCNA 2GUBA 3WZ0E 2EBNA 4HYVA 1ZPTA 4XUGA 4O1DA 4WLCA 5GNYA 1MDRA 3G2GA 4DYEA 4CUCA 1TMQA 3AHVA 4JR5A 5BZAA 4U3CA 4PTMA 5HWNA 3UP8A 3EKGA 3L4YA 4QAIA 1R2RA 3WNKA 1YBQB 4FR6A 3KXQA 3TXZA 4IX2A 1VFTA 4N6FA 4CD5A 5C5YA 5KSWA 1NWSA 2YA2A 3AHXA 1C8XA 2DZXA 5CPNA 4PRTA 3U9IA 1DJQA 3GXNA 1U2YA 1UB3A 4PMUA 1TVLA 2ZVIA 5FI8A 1G94A 1K3UA 1QK2A 1AD4A 3U3HA 3C8FA 3TN6A 4L1WA 3NM1A 3MUAA 4NI8A 3MKVA 4R9OA 3VKCA 2TRSA 2VOMA 4O4WA 3PANA 3V0TA 2B31A 4L9YA 4BWLA 1TPUA 2J9XA 3RRAA 3T40A 3KP0A 3W02A 1XGZA 4UMBA 3W88A 1FWJC 1ZSXA 1ZAHA 1E0VA 1CBGA 3DHDA 4NXSA 5E6ZA 3WNLA 1OIMA 3H12A 2PU0A 3GWQA 4PL1A 1LDCA 1P0DA 1RQHA 1FTXA 4DWSA 2ZCGA 5AB3A 1LRQA 3LMYA 4IL0A 2HDJA 5TBOA 4FIQA 2CETA 2HE5A 4FXRA 4DNMA 1MZHA 4C6CA 1ZL1A 3NL6A 1GQIA 2V2HA 3UXIA 1R0MA 3SFWA 4F4RA 4R27A 2XU2A 2Q6ZA 3MPGA 2XFWA 4XBKA 4ATLA 5FOOA 4TX6A 3HO8A 1QVBA 4FOUA 3GNDA 3U0HA 1JFHA 3LRLA 3NTYA 4ZO6A 2OLSA 3T42A 1WXJA 1U1JA 3OGRA 4C6BA 4W84A 2Y24A 4ZODA 3D6NA 2GVLA 3LHUA 2EPLX 3LXAA 4FOKA 2OMAA 3WLOA 2VX5A 3MCMA 1OK6A 4JNYA 4TVDA 1XSIA 3VPLA 2ZUSA 3LK6A 3FW6A 1XI3A 3G6LA 1LBLA 2VMFA 4Q4SA 2VVNA 1WUEA 2FTWA 3PC0A 2UBPC 3I3BA 2E6FA 3AXMA 2YGYA 4OT7A 4PUJA 1PVNA 1GZJA 3BOXA 2QDEA 2YYTA 3N34A 3WH5A 2GJXA 2OSWA 3E02A 3ZWSA 3LCGA 1GZ1A 5JBFA 1PPIA 3U57A 3CQJA 1XG3A 3WDHA 1KRCC 5MKGA 4NUWA 1XCXA 2DT2A 3QR3A 1ITCA 1VS1A 4IMAA 3LG3A 4HK5A 4WR3A 2OQYA 2P50A 4Y9OA 3WK0A 3EOSA 2DUAA 4AMAA 5EBAA 2PGWA 4HSOA 3TV8A 4K1GA 5AHMA 1BF2A 2ICSA 3GBDA 1SUXA 1ZAJA 4GG9A 3KS5A 3W4RA 4GABA 4P7QA 1POKA 1MWOA 2PA6A 4DYKA 4WSJA 2ATSA 4JS3A 4MB5A 4P7NA 3VDAA 3OB8A 3W7CA 3B9AA 1LJYA 3NURA 2CLMA 4P61A 4ECLA 1C7SA 1RSCA 1B3YA 3E2RA 2IUZA 4HPNA 1EJVC 4OFCA 3DH7A 5FL0A 2BBFA 5JBDA 4H6QA 1M1BA 4XWUA 1P4CA 2ZA3A 3LUTA 1RPKA 4G7EB 3QMRA 3EB4A 5FF2A 3S5NA 3W2UA 3VMOA 2VFEA 1HZYA 3E2QA 2QNEA 1WKFA 3GKAA 4JFUA 3WMBA 1KO0A 1E56A 2GSEA 4KCUA 3M5YA 1E43A 5C9RA 3CQHA 5KZEA 4INFA 4QE1A 3ARWA 1KBKA 3OO2A 2C14A 1TV4A 3OLGA 2P3ZA 3ZM8A 3H4GA 3ZT7A 2XGBA 5A6TC 3B9EA 3R1ZA 2VC7A 2O7QA 4KGJA 1VKFA 3W25A 1E55A 1X1NA 5ABGA 3CZLA 3GW0A 1OADA 4M5PA 2WC7A 3UG8A 5KEZA 2X2GA 3A5VA 3TK7A 2W63A 4J2PA 1AQ0A 5E0FA 4YMZA 1XP3A 3G1DA 3L5LA 3DFNA 3BJTA 2Y8KA 4OUIA 1G67A 4LJ3A 4ZOCA 3G5EA 3UEQA 1E73M 4NJHA 4N9EA 1ADDA 4NZJA 4FX8A 2Y5EA 1JRCA 4M7TA 3FCPA 1RPXA 4HU0A 2FLIA 2H9AA 4A3UA 3PBMA 1Q5MA 1IEVA 1CI1A 4FHAA 4DZAA 2BB0A 2RGLA 2YBUA 3CUIA 3DKJA 1NDVA 1KXVA 1K7XA 4LS2A 3VGDA 3WQ6A 3VX0A 3KOXA 3SFKA 3TZNA 4LAZA 5TIMA 1PIFA 2OWWA 1TRIA 3O1NA 4QG8A 4A3HA 2V5CA 1GJUA 2CBVA 4B90A 1WXZA 2Z4GA 4U5IA 1LZOA 3L0KA 3OVRA 3K46A 3W72A 3K1DA 1LORA 3Q37A 3KFTA 1AMKA 3KOYA 4DJFD 5HMSA 1W56A 3MO4A 7ODCA 4PYSA 1FWFC 4GVHA 3KBVA 4BQ3A 3DHPA 2EKGA 3ES8A 4GACA 2FFCA 1ONWA 1WNOA 1QW7A 3ANYA 4WJEA 4F79A 3WF1A 1Y65A 1RXOB 2DIJA 4YHGA 3H2OA 1JCLA 1E0XA 4A4AA 3TE9A 3KZSA 3IGHX 3VDBA 1WKYA 3LBMA 4ML4A 4HYWA 1CXLA 1OJXA 2BHUA 2C91A 2W0UA 3NPVA 1FDYA 2CBJA 2I14A 2HVNA 4MB3A 2YLLA 4BJHA 2P0OA 3G1AA 1EGZA 2XUCA 3II1A 4P7OA 2YIHA 1NFGA 1ADSA 1YX1A 3GXDA 1V51A 3HPAA 4ZQNA 5SWUA 1JI1A 3UFYA 3C5QA 1H7PA 4Q4QA 3QMSA 1OX6A 3VNKA 4DYJA 1C92A 1D7FA 2X0SA 5AOUA 4JHZA 3GM8A 4PMRA 3K8LA 3R11A 3EB2A 4Q8OA 1QXLA 1B5TA 3AQUA 1TTQA 1OZQA 3LERA 3NO1A 3ANVA 6ALDA 3SSJA 4GX9A 3V0UA 3R94A 3OHMB 2VRJA 3ITCA 4AFYA 4ERAA 2OOFA 5LIKX 4B5WA 5FKYA 1Q8JA 1AJ0A 1P43A 1D8WA 1KXTA 3ARVA 3RIKA 3MHUA 4Z42C 2WC3A 3U4AA 3CPGA 4K39A 1ZCCA 2GQAA 4IG2A 5C2GA 2F6KA 3WNMA 4QITA 4CQ9A 1E6SM 3S5SA 1M65A 1OB0A 5FAJA 3DENA 4NAFA 5H8MA 4PN2A <