3W86A

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with sh-1-96
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
313
structure length
313
Chain Sequence
b'MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (fumarate)
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with SH-1-96
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 104
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2013-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w86A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w86A01
4CNOA 3I6RA 1GQNA 4HIBA 4JICA 1F73A 3G1FA 5F4SA 4IOTA 3UZ5A 1HTIA 4O52A 4ZL1A 1HFBA 1W0MA 2YCEA 1SZFA 3Q94A 3BLFA 3DKLA 3NQEA 3LXBA 1TPDA 2B7OA 1JUKA 3ZWSA 5IM51 3I68A 3P60A 1R47A 2A0NA 2FPVA 2C15A 5E93A 2ZA1A 3THQA 4DO6A 1H7XA 4IMGA 3W7KA 5TQLA 4DF1A 3TW6A 2Z1BA 1LDCA 4AMAA 1J2WA 3BK0A 5I3IA 1KFEA 2GJNA 1KFCA 3T40A 1T8XA 4YMZA 4PL2A 1H7PA 3HPSA 3VNDA 2A2IA 3O63A 2J6XA 3PF3A 4YL2A 5F1UA 1DVJA 1ML1A 5J5DA 2AQWA 1ZJIA 4YCOA 5HINA 1B3OA 1ONRA 3A9IA 5IBXC 3G1HA 1LP6A 2A85A 1NSJA 5CSRA 4WQ6A 4UNKA 1QPQA 1G6CA 4E2DA 1JJKA 4O54A 1H7RA 2ZYFA 3CWOX 1HL2A 2JKAA 1LLZA 3P61A 2QCHA 4IXXA 3UXAA 4UR8A 1MXSA 1WQ5A 3LRLA 3TQKA 5AHMA 3P82A 3G3DA 1B4KA 2B0MA 1WOBA 5FEPA 1HG3A 4RZ4A 1KFBA 5CZJA 4YXGA 3A5VA 1UASA 4WD0A 1DV7A 2OMAA 5K9DA 1EP2A 3HPZA 3NQFA 3UWWA 5LNWA 3THAA 4JYDA 1ALDA 1OF8A 3NL3A 4QQ3A 2VFEA 3EKLA 1HO4A 1AL8A 3B03A 3IGUA 3OVPA 1TJRA 4LW7A 1UUOA 3EWXA 2A5HA 3HOJA 2F84A 1ZAJA 3TUUA 4POCA 2PCQA 3NPVA 4NZFA 1XL9A 1I2OA 5K4XA 4WJEA 3DFOA 4NT0A 4LV9A 1OYAA 3B05A 2AAMA 1ICQA 4O10A 3EXTA 3MP5A 1JUBA 3STGA 2YYTA 3WK0A 1W5QA 2X1UA 2TSYA 3MMTA 4O1DA 2E6YA 4OT7A 3QW3A 1ICSA 3VE9A 4N6FA 4UTLA 3FKKA 4HNTA 2FB3A 5AC8A 2QF7A 3KVJA 4JTIA 2VEPA 4LNYA 3S5ZA 3W72A 1WBJA 3L0KA 3MHFA 3UXDA 2VC6A 1A5CA 4NX5A 1B4EA 1DBTA 2ZRUA 2E1DA 3I7SA 3LLFA 3NNTA 1VCFA 4IQLA 3TU9A 5BMWA 1VHCA 3E9AA 1TPH1 3PSVA 4CCDA 2OT0A 5G1YA 4ADSA 1OJXA 4WUIA 4BK9A 1LCOA 1KTBA 3OVRA 1EUAA 2WKJA 2C14A 3W7RA 3W7CA 3TQVA 2HTMA 1O5XA 2TPSA 3DAQA 5J5RA 2ISWA 1W5NA 1I2PA 4JNMA 5D37A 2FDSA 1G4PA 3BV4A 4JTJA 1OYBA 4MYXA 3BW3A 4LY8A 4FNRA 1TV7A 3PWAA 2Y89A 2O7QA 3G0SA 2X1RA 3TNOA 3C56A 5AOUA 4AVFA 1M7PA 4O1BA 2I14A 5HUPA 4MOZA 4D2JA 3A23A 5I3HA 2ZA3A 4I7UA 2YDAA 2WSRA 3GKFA 4ZQMA 1LBLA 5BOOA 4O4WA 3L5LA 1W31A 3L0GA 4O57A 4XUGA 1Q3NA 4RZ5A 1D9EA 3MYPA 4TU1A 2QUTA 4A2SA 4R33A 2DZWA 4FNQA 1FCUA 4DO5A 3MO7A 3C3NA 5C6MA 3P84A 3IV3A 1EWEA 1AW1A 1K7XA 1NEYA 5LGZA 2Z6IA 3LV5A 3O6DA 2VEIA 3ABRA 4QSHA 4JTUA 3N73A 3MHUA 4XTDA 1VGAA 5HWNA 3CEPA 5A5WA 3C2RA 1JUEA 2ZTKA 4XTIA 5D03A 5HNRA 1ZAIA 4KFOA 3HG2A 4ADTA 3SJ3A 4FF7A 4IMCA 2QUVA 5LZLA 1Q6OA 4O53A 5F2MA 3HJZA 3QM3A 3OEXA 2VFIA 2VFDA 2A7NA 5G2HA 1LYXA 3G8RA 3W85A 2P10A 1JRCA 1H5YA 3W7DA 2RH9A 4UNLA 4N2YA 3N3MA 1H63A 3EWZA 1VYSX 3BPWA 1W5OA 4PA8A 4X2RA 4N4QA 1F7BA 4NNCA 3GDKA 1WOAA 4NJHA 3HG4A 4UFHA 4XKYB 4MY1A 1FWNA 4Z1DA 4I7VA 3PSWA 3IVUA 2YGYA 3W87A 5DXYA 2Q3RA 4UTWA 2ZZ5A 1SO3A 1KLZA 1F5ZA 3G8EA 2H3BA 4R34A 1K8YA 5D2XA 1QPNA 4K36A 1OX4A 3O8AA 1B57A 3SY5A 3GAYA 2QDGA 1IXQA 2ZRVA 3RMJA 4ZQCA 4P61A 3GDMA 1RPXA 3W86A 3GZ3A 2D73A 3AJXA 1YADA 3MUXA 2C1HA 1FXQA 1D3HA 2DZXA 3S8HA 5AHIA 1YTDA 4LVGA 3M1ZA 3P5ZA 4OE7A 3P62A 4AAJA 3TCEA 3OA3A 1ZENA 4IMFA 3LHZA 3CM4A 3TA6A 4OWGA 2H3DA 1JCMP 4UFIA 1TPC1 1TTPA 2VELA 3PM6A 1WDWA 1O60A 1X1OA 1VS1A 1H7WA 3TH6A 3UY8A 5AHLA 2CLEA 1KM4A 2E6FA 2CZDA 4PEKA 4TO8A 1KTCA 3G3MA 2Y7EA 1A5BA 3UPWA 1TIMA 2CLIA 3RNDA 3EXRA 7TIMA 3GXPA 3LXCA 4N9BA 5D30A 3E96A 3LTYA 2DJXA 5G2WA 3GKAA 2C13A 3SIZA 3W88A 4DO4A 4FXSA 5CKSA 1YLVA 4Y6GA 4MFDA 4UTUA 3L5MA 4UCGA 4WY0B 1SU5A 1I45A 3PC0A 4ZQRA 1LBMA 1SW7A 2PC4A 3PUEA 2GQ9A 1GOXA 3EEGA 1ICPA 1C29A 1VLWA 1W37A 4DQWA 3A22A 4K6AA 4A29A 3BGJA 5DN1A 4O0KA 5IBXA 4O13A 3CC1A 1F6KA 1FDZA 1VRDA 2A7RA 2Z0IA 3BGGA 3TJXA 5CZ0A 3NPUA 2C19A 4A21A 2CU0A 1F6PA 5LNSA 4FHAA 4MJMA 3U8GA 3W7PA 2E6AA 4HT3A 1RQEA 1G4SA 3LXAA 1YXCA 2G96A 2QUUA 1TTIA 1FWWA 4DXVA 5LHEA 2UV8G 1K02A 3L21A 4O0ZA 2OJPA 3HIJA 1GG1A 5EKYA 1T0OA 4AWSA 3S0CA 2Z6JA 4NZJA 5U7SA 1VHNA 1JCXA 4NJKA 1GPWA 2TRSA 2CLKA 1IF2A 1G7VA 3HPXA 4H4IA 4FNUA 3LLDA 1I2RA 3W6YA 4JDYA 4TIMA 1LROA 3TMLA 4I9AA 3OHIA 3MBFA 2A7PA 2YX0A 5D2YA 3MI2A 3ABSA 3NR0A 3ZR4A 3MI3A 3NQ2A 3LRKA 1GVRA 2BWGA 2E68A 2DZVA 3QPYA 5ABTA 2CWNA 2RDUA 2QCDB 1M6JA 1H50A 4X9SA 4LVFA 5FEXA 1YXYA 3IRDA 3W1PA 2NLIA 2PRLA 3W23A 1OK4A 4AF0A 2CLLA 3W1RA 2ZFAA 4ADUA 1KM0A 3TFXA 4EF9A 2XN0A 2Y6ZA 1ZY9A 2VXNA 4UC5A 2NV2A 3ZFHA 1FY6A 1SZNA 4O12A 4BF9A 3W7MA 4MLJA 5D05A 4Y8FA 3UD6A 1R30A 4ICNA 2QDHA 3G1VA 3QMSA 2J24A 3O06A 3W3OA 4IWWA 2V30A 5G4EA 4JY8A 3CLMA 1EP1A 1NF0A 5I3JA 1GZGA 1W5MA 3OIXA 5BNKA 3E12A 5C55A 4JTGA 3N9RA 4FXRA 1KM2A 4JTFA 1BWKA 4A22A 1DJNA 1Y0EA 1NAL1 3GYEA 3PG9A 3LTSA 2VENA 3P67A 3G1DA 1XUZA 3QJAA 4PL1A 1SQ7A 3DGRA 4CCCA 1JQVA 1ZALA 3GB6A 3BLIA 3P7YA 2V9DA 3DFQA 5BW6A 1SO6A 3NQMA 1LTDA 2NX3A 4M7SA 1LM1A 3S1UA 3H53A 1TPVA 2J9ZA 4CQ9A 3MBDA 3UY7A 4MY8A 3LCWA 5K9CA 4UUIA 1J5TA 5D38A 5G1TA 2NXGA 4WOQA 3GNDA 2C16A 2ZRZA 3PS7A 4C1KA 5LNRA 5KZDA 4IPJA 3V75A 1FCQA 4IGHA 4ONVA 1AW2A 4FO4A 3RK8A 3WK2A 3C6CA 3HGJA 3LRMA 3EXSA 3ATYA 3A24A 4M6VA 2QCFA 3R2GA 4Y96A 3T7VA 1AK5A 1TRDA 4LC6A 1GG0A 3ELFA 5AHEA 4DPQA 5AC7A 4O1AA 5DCEA 2CW6A 2PE4A 2FJKA 3Q58A 4FNTA 4Z1BA 4OV9A 3DI1A 2DZSA 3IIXA 4X3ZA 2Q8ZA 3C52A 4NU7A 2OX1A 2GJLA 5AHNA 3G1YA 3HMJG 3RU6A 3DI0A 4KKXA 4MZYA 3W2LA 4FIQA 2EKCA 1XDLA 3DFTA 3A21A 1SUXA 1C9DA 4NUWA 4JTHA 4Z1CA 3UWQA 3KRZA 5FI8A 1GWJA 5I3KA 3T4CA 4YCPA 3FLUA 4K38A 4HNVA 3KX6A 2ABBA 4KFNA 1EUNA 1IXOA 1OVDA 2W0UA 2CZFA 3H55A 5EMUA 1B9BA 1F74A 5D04C 3T55A 4DF0A 4CCEA 4KWVA 1UUMA 1YTKA 2C6QA 5CPMA 4NNAA 3LX9A 1KFKA 5DCBA 3INPA 1DQWA 1TPB1 1FDYA 1JCLA 2QJIA 1K8ZA 2EHHA 3CQ0A 4UTKA 4LRTA 1U5JA 1JRBA 5FESA 4QIUA 2A1YA 4M5PA 3JRKA 5HR6A 1Z42A 2V82A 1X7FA 1QFEA 4DPPA 1OX5A 3SW6A 4O11A 3WJYA 2EPHA 4AH7A 4K7VA 1XC4A 1W56A 2Y62A 1TSIA 4UTJA 4W9TA 2ATSA 4M7TA 1UCWA 3W1NA 1QNVA 4XBKA 3QMRA 3W75A 3DH7A 4OHQA 4Z1AA 2ZZ7A 4LS0A 1CI1A 3QSTA 4LWWA 4UFKA 1P1XA 1UBSA 4GUGA 2GVLA 4MZ1A 4GWEA 2C3ZA 3NQCA 2X2GA 1S3HA 2R8WA 4AHOA 3HG3A 3G1SA 3GK0A 1JQXA 4OQVA 5KINA 4QJ1A 2ISVA 5HJLA 3P81A 1TJPA 3G24A 1ME9A 3TFCA 3W7LA 1VJIA 4QAIA 1CX9A 1QWGA 5AHFA 1IGSA 2I9EA 2BXVA 5CPLA 1BWLA 1XUUA 5FF7A 3IIVA 3W2NA 1DL3A 1YDVA 5I3FA 2J9YA 3R5EA 3QFEA 3HO8A 1Z41A 3LCGA 1L9WA 1I4NA 3FOKA 2Z2UA 1FQ0A 4UFJA 2BLEA 3TX9A 2H90A 1N8FA 4X22A 1GTHA 1S5VA 1W8SA 4RK8A 5DBUA 1XBXA 4UIOA 2GQ8A 2OT1A 2QCLA 2NUWA 3BW2A 1S5TA 1GVFA 4HKPA 1YXDA 3C2EA 2HMCA 4M6QA 4O19A 5DBTA 1OX6A 3LCFA 3C0JA 3I65A 1H60A 3KFTA 3HBLA 3M47A 4NXSA 3UNDA 1LOQA 1VCVA 5AYZA 3W7GA 1X6UA 2EAWA 1WBHA 3EX2A 1H7NA 4MY9A 3TJLA 4UMCA 4Z08A 3UWZA 3LERA 3QRHA 5AN7A 4BWLA 1GYLA 3NA8A 5FF3A 2CZ5A 2ZRYA 4MPQA 5HMSA 1ZAHA 5F4XA 1N55A 3F03K 5F2LA 3DU0A 4LRSA 3EB2A 1OK6A 1WAUA 1DJQA 3IEBA 1A5SA 1K03A 3MHGA 3SGZA 4TMCA 1VPXA 2FB2A 1KBJA 4J9JA 4Q33A 3TC6A 4WZHA 4EIVA 3B4UA 2ZZ3A 1I2NA 3LHYA 4UTMA 2YFOA 2IQTA 2FQIA 4A2RA 4Q32A 3B06A 1ME7A 1P0NA 2ZBTA 3ZS4A 1ZNNA 4JX5A 4GRSA 3TROA 1TMHA 4RZ6A 4JIQA 2VEKA 3FKRA 1TV5A 3NZ1A 4O14A 3M5VA 1GVOA 1RZMA 4LUJA 3GNNA 2HSAA 3BVJA 4MIMA 1V5XA 1EIXA 1O4UA 4O50A 1MSSA 3HGSA 1LOLA 4NJIA 2Y70A 5KSWA 5CSSA 5CZTA 1T96A 3M5ZA 3NQ6A 2QJGA 3NQGA 4IXHA 3NXFA 4UFMA 3HGOA 1NVMA 4EF8A 1KV5A 3AO0A 2QCCA 3P5YA 5EYWA 5K2ZA 4JN6A 4AXKA 3W7QA 1P5BA 3PBYA 1TQXA 1LRNA 4HPJA 5AC6A 4CLMA 4PCFA 2WJZA 5EY5A 3FEMA 3S1WA 1TPEA 1FXPA 3H54A 4Y90A 1W1ZA 6TIMA 4ZVJA 3S1XA 4GUFA 1KFJA 1Q6LA 2WNZA 4O8RA 1G67A 4K37A 3M9YA 3UPBA 2NUXA 3KVKA 2B7NA 5I3GA 2FIQA 3W1XA 1ZHAA 3KHJA 4QNWA 3LHVA 1WXJA 3G1AA 1R2SA 4JIPA 1VQTA 2G97A 1JULA 5CPNA 4IJBA 5DLCA 5DY3A 2VFGA 2WNNA 2WO5A 4AF0B 1H61A 2W79A 1RR2A 3LI1A 2J27A 1TREA 4WXYA 1QO2A 4LT9A 3P8JA 4ML9A 4MLRA 1OFBA 3ATZA 3TXVA 1LRTA 2CLFA 4JX6A 3S5YA 1EB3A 4PFMA 3TAOA 4KWWA 3P74A 4ZZ9A 2BSLA 3NM3A 3G0XA 2NX1A 3SFKA 4N4PA 3NM1A 1YYAA 1YDOA 3F4WA 3PUDA 1G4TA 1S5WA 4R53A 1RD5A 3NQVA 4EOUA 1FWTA 2C18A 2FPYA 3N34A 3W73A 3S42A 3PR2A 3QZEA 2RKXA 3M7WA 5D33A 4QM1A 3N2MA 3KVMA 1WV2A 2YW3A 1FDJA 3HB9A 3EWUA 1K7EA 3W2MA 2A21A 3RFAA 2JGYA 3LM7A 3NQDA 1EX5A 2FLIA 3M16A 1O95A 4G1KA 3PBVA 1SO5A 5BMXA 3GDRA 2DU2A 3CIWA 1QOPA 2P1FA 3NYZA 3SI9A 4CQAA 1XCFA 5FF4A 3KAOA 4FIRA 3PB2A 1KA9F 3DFSA 1DQXA 2V8ZA 1SFLA 5C5YA 4RX0A 4XQ6A 1VH7A 2R94A 1PCKA 5CGQA 1OF6A 2WQPA 4Y9AA 1SR9A 3F4NA 1SSGA 4HPXA 5H91A 3TSBA 4E38A 1R2RA 1TCDA 5L6UA 4JD4A 1XI3A 3C2VA 1TV8A 4IX0A 2B7PA 3PUOA 4Z0SA 4QNEA 3RF9A 3FIGA 5CPOA 3VI2A 3P80A 3DZ1A 3O07A 3L9CA 3KVLA 5KITA 3LOTA 3LHTA 2PRHA 1MEIA 3W2JA 1BTMA 3MP3A 5D2VA 3NDOA 1Q6QA 4N6EA 3SECA 3SZ8A 4JDBA 3QQ0A 3UQNA 1XDMA 3NQ7A 4C1LA 3NO5A 1OFAA 2Q3OA 3LHUA 2GUUA 3EWYA 1JCNA 2QAPA 5LKYA 4AHPA 3GXTA 4AHQA 2G95A 2R91A 2Q8LA 1Z48A 3B0PA 4XWUA 1TB3A 3NL6A 2ZRWA 3TAKA 3C2FA 2ZRXA 4E2BA 2QCGA 2RFGA 2KZHA 2PURA 4O1CA 4LTSA 8TIMA 3STEA 2XFWA 3E02A 3W1LA 3NL5A 4XKYA 3LCLA 2X30A 3MI6A 2AGKA 2H8XA 4GNJA 4RR4A 3O6CA 3MYOA 2QKFA 2YFNA 4ALDA 4JX4A 3QC3A 3LGEA 1VCGA 2GOUA 4FX7A 5G2IA 1AL7A 3T44A 2ISSA 3MJYA 1I8JA 3DKJA 5EL1A 1WX0A 1ADOA 3L0NA 2VEMA 3MP4A 3IIOA 1GEQA 1AW5A 1EEPA 1LOSA 3CWNA 4O17A 5FF2A 1GYNA 1M7OA 5F1VA 4MFEA 4H6KA 5T26A 1IIGA 3NAVA 3M5XA 4H3DA 1W54A 2TYSA 2TMDA 4O18A 5K3VA 3KRUA 1VYPX 2E5BA 3OG3A 1W3IA 3Q37A 2OCZA 2ZZ2A 3VFLA 2ZZ6A 3EX3A 3NGJA 3STFA 3C4UA 1V7YA 1LORA 5HQEA 1BEUA 3GIYA 1MEWA 1O94A 4UTWC 4FNSA 1W3TA 1XKYA 1H62A 2Y61A 3W7JA 2WOQA 4JTTA 3QYQA 2ZA2A 2V5LA 3FS2A 5H2ZA 5K9XA 5K7JA 3TW7A 1W5PA 1OG0A 1M5WA 2J88A 3FFSA 2GQAA 4RXFA 3PVFA 1FWSA 3NPXA 5EBUA 3NVTA 4OV4A 2YYUA 3W71A 5LHFA 4Z0JA 3B04A 2F7FA 3M41A 1A53A 3NPWA 2Y7GA 3QMTA 1DKWA 4RXGA 3KRSA 3VKJA 3M0ZA 3C2OA 5KZEA 4UTHA 2ZCGA 5DELA 3UWYA 3UYCA 3TSDA 4CQ8A 5FEZA 4FNPA 2FTPA 2PRMA 3FYOA 1JCJA 3UWUA 1UB3A 2H8ZA 5F2GA 3TE9A 1OHLA 4B5NA 3YPIA 3PB0A 3SGUA 1A50A 1FCVA 4RKAA 1FCBA 1PIIA 5C2XA 2DJLA 3TK7A 2C0AA 2ZDRA 2YZRA 3QF0A 2GPTA 4N9CA 2EF9A 4DF2A 3MWAA 3STCA 5L9FA 2Y85A 1KBIA 2HS8A 2VFHA 2RDTA 4FEZA 4GXMA 3I7QA 2BX7A 3RLVA 1ZCOA 4LOCA 4CNPA 2NX9A 3M6YA 4OU1A 1L6WA 2DP3A 4QISA 1HUVA 3R89A 1AMKA 2QEZA 4NXKA 5HUOA 2BZNA 5DCDA 5HWJA 4GFSA 4RLIA 5AB3A 5LSMA 4IPIA 3R8RA 4S1FA 5A8GA 4O16A 1NF7A 3U2OA 1SW3A 3GR8A 3M5YA 4LVAA 2ZTJA 2YPIA 2QCDA 3CIXA 4GUJA 4ORMA 1G4EA 4GBUA 3L67A 1ME8A 3GR7A 2V5BA 5CZSA 1QPOA 2JKPA 5F4WA 1HO1A 2BTMA 1GTEA 2RDWA 4EVZA 4ZMGA 1H51A 1FX6A 1EP3A 2CLHA 1KV8A 4DBDA 4KFPA 3LCHA 3W22A 3NOEA 3W2KA 1KM6A 3NQ8A 4DEFA 4NVTA 3FA5A 4JTSA 3GAKA 3TC7A 1H1ZA 3N14A 3G0UA 2B7QA 4AWUA 3B0UX 1MO0A 4PC8A 4BI5A 2R14A 1JCYA 4UTTC 3ABOA 4HSOA 1PS9A 3W2UA 4RCXA 3WFAA 3OBKA 3NL2A 3BO9A 5G4WA 4AEOA 1OX4B 1OABA 1N7KA 2I1OA 3IVSA 4MYAA 4M6PA 2WNQA 1Z44A 3O1NA 4UMBA 1RQBA 3HF3A 3QPZA 3LCIA 3N9SA 1TPFA 4LS2A 3S6DA 2E6DA 4NNBA 2JK2A 1PL9A 3PY2A 3U6WA 2YXGA 5D02A 3P8IA 4L4LA 4HNUA 1QR7A 2YR1A 6ALDA 4MKNA 5FEWA 1IXPA 1LRQA 3O16A 1KTNA 1TYGA 2V81A 1YPIA 3LB0A 4IMEA 5DXXA 4JS3A 4FX8A 1A5AA 3B8DA 3GLCA 5KZMA 4HN4A 1LBFA 1CW2A 4CNNA 2A6NA 1K8XA 4AWTA 3NZRA 3SSJA 3CPRA 4ZQPA 4R7JA 3LTPA 3QSRA 3G18A 1TRIA 3IGXA 1SZEA 1WYIA 1YPFA 3TKFA 1RVGA 5KMYA 2CZEA 5EPDA 3WK3A 1G7UA 1ZFJA 2XN1A 1LZOA 5LGXA 4JGDA 5AYYA 3N19B 2ALDA 4RV8A 4O28A 2CLMA 5HWMA 3FJLA 1PE1A 2QCEA 1J4EA 5E0KA 4K7YA 3GVGA 2JGQA 4U4MA 2NV1A 2QAFA 4E0CA 2ABAA 1F76A 3Q2DA 4BI6A 4L4MA 1WA3A 3USBA 3ANYA 3W1AA 1OYCA 4LV4A 3RLUA 4JR5A 5AFDA 3WJWA 3KXQA 2E09A 2NWRA 1XBYA 4JXCA 4MZ8A 2GVGA 3WJSA 3B0VC 3TXZA 1KM5A 3W76A 1TQJA 1GVQA 2WSQA 4XBSA 3DENA 4BR1A 4UTIA 2GVJA 1PHQA 5E1QA 3DFPA 1PCWA 4TX9A 2QJHA 5U4NA 5D2TA 3DBPA 3EX6A 3IIPA 4DELA 3EWBX 3PBWA 2NXHA 1SPQA 4GUHA 3CT7A 3W83A 2CLOA 3FJ6A 4GUIA 5BRBA 1X8FA 3TR2A 2J9XA 1I2QA 4UR7A 3ZWTA 3DHDA 3W1QA 1FBAA 3DXIA 4M19A 4S2BA 1DHPA 5MHBA 4IMDA 1PV8A 2E5DA 3TV8A 5FF0A 3JR2A 3L2IA 5D09A 4HHPA 1SFJA 3S9YA 3A5FA 3PG8A 2NXIA 1KM1A 1F2JA 4HSNA 1P0KA 1EWDA 4FB7A 2ZQ0A 1DORA 3OVQA 2DZTA 3BG9A 3GDLA 4RJEA 3VCRA 3L5AA 3L68A 2NZLA 3W7EA 4N9DA 2WV8A 3LV6A 1THFD 3W1TA 2VKZG 5DY2A 4PODA 4FX6M 1NFBA 1L6YA 5EA9A 1H1YA 4JYFA 3I7RA 5HR7A 2A4AA 1F05A 4JTKA 3R13A 1IXNA 3NEVA 4UXDA 1AG1O 3R12A 4K39A 4QITA 3K30A 3QQ1A 3F1QA 3DFNA 2P0OA 4LU0A 3PAJA 2QR6A 1PVNA 5D32A 1L6SA 2Y7FA 2V0TA 3G22A 5HULA 2X1TA 3WJZA 3EWWA 2FFCA 4XZ9A 4LUIA 3LHWA 1KLYA 4BI7A 1T99A 1H7OA 1QPRA 1OFRA 4LVBA 1FUYA 5TBOA 4OBTA 2FPTA 1XFBA 2JKEA 3EX1A 4P2VA 3W84A 1QOQA 4UMAA 1X1ZA 3UWVA 1OFQA 2DORA 5D2WA 2VFFA 2YSWA 3QW4B 4IUOA 5AYXA 3D0CA 3HG5A 2WSYA 4ZQNA 4O15A 5CG7A 3EX4A 5TIMA 4NX0A 2E5CA 2DZPA 2O7SA 3JS3A 4GJ1A 3M44A 3W9ZA 4JTLA 1VR6A 1O5KA 3W1UA 3QEZA 4JEQA 2WPBA 1R46A 1DOSA 4JY9A 3S1VA 4LVDA 1XM3A 2ATMA 2G5WA 5KTLA 2E77A 3S5NA 4YLWA 1SW0A 1RV8A 3CU2A 2XN2A 3M43A 1GT8A 2A6LA 3TQ0A 1Q45A 1OFEA 1K7FA 3W7IA 3GDTA 3N2XA 3CTLA 4GC4A 1G69A 3PBUA 4PTNA 3IVTA 3W1MA 4BWLC 4NJJA 4TR9A 1JVNA 2B4GA 1UJPA 3W7HA 2YW4A 1VLIA 1SO4A 3S5OA 2ZZ1A 4HNNA 4ZQOA 1LLWA 1TTQA 3BG3A 2V2CA 3LCXA 2V2DA 3BARA 4JYEA 4I7WA 3UZJA 2W6RA 1TO3A 4AB4A 2ZZ4A 3TMQA 2EGZA 5G5IA 3W7NA 2HS6A 4MVAA 3TIMA 3W7OA 3C8FA 1GJPA 3HGRA 1SSDA 2RHGA 1R2TA 2CFFA 3MW7A 1QMLA 3IIZA 1TTJA 4UFLA 2NWSA 4Q4KA 2V2HA 3CHVA 4ORIA 2LLEA 3LDVA 1D3GA 1BKSA 1IIHA 1OFDA 5K4ZA 4TMBA 2QCNA 4MUZA 1XBVA 4LC8A 4N9EA 3PULA 4K8HA 4MJZA 3V1PA 3WJXA 3KOFA 5LNUA 1JR1A 4UTTA 5GVJA 2OZ0A 3G1XA 1MEHA 2Y7DA 1OFOA 1QAPA 3EKZA 3CEUA 4NQ1A 4WOZA 5F2IA 3E49A 1FWRA 3BLEA 3IGSA 1L2UA 1TPWA 1PHWA 1KM3A 3L65A 4JTEA 2H6RA 3ABQA 3DHFA 4NJGA 2JBMA 4U28A 3GX9A 2NUYA 1EA0A 4WY0F 3LBCA 1TPUA 3LI0A 4YWIA 1XBZA 1RQHA 3L66A 1W3NA 4DBEA 3TDFA 3FYPA 3NQAA 2DZUA 1VC4A 3SR7A 3W07A 4A3UA 4BFAA 1KW1A 1GVSA 4PH6A 1Q6RA 5LNVA 3GXNA 2QCMA 1QDSA 3WK1A 5SWUA 1K3UA 4EWND 3BG5A 1EPXA 3BW4A 1VYRA 1YTEA 4OGZA 3W70A 4S2CA 3C61A 1U83A 1YDNA 4WXZA 3HQ1A 4O4VA 1C8VA 1QCWA 1OFPA 3TSMA 2Y88A 3O15A 3O05A 1VZWA 1SZGA 4GE8A 1E51A 1QO5A 3QH2A 5C54A 1XXXA 3NG3A 3VE7A 4LS1A 3CB8A 3W74A 2VOMA 3E0IA 1KFLA 2X16A 4IX2A 4WX2A 3LBMA 4WY0A 1P4CA 2X1SA 4K8EA 3O6YX 4N02A 1MZHA 2Y63A 3T78A
chains in the Genus database with same CATH superfamily
1FWEC 2VGFA 1XLLA 5CSUA 1XD1A 3BLFA 2B7OA 2E8ZA 5IM51 3P60A 1R47A 3GWQA 1K9EA 2VC5A 2C15A 5E93A 4DO6A 1OCJA 1EHAA 1GHRA 1XR2A 4L80A 2Z1BA 5FSEC 1V3MA 1B0IA 3GTFA 4DRSA 1T8XA 2WBKA 2XTKA 3O63A 1CXKA 1TWSA 2ACSA 3S47A 2AQWA 4HCHA 1B3OA 1ONRA 3F4DA 3G1HA 1LP6A 5CSRA 4WQ6A 1R85A 1QPQA 1G6CA 4E2DA 2V5KA 1V6XA 1VFUA 2P8BA 2HK0A 4CGTA 1JNDA 3BOFA 4XIAA 5CGMA 1HL2A 5ENLA 3GZAA 2QCHA 3RX4A 4QG6A 3ES8A 1HGWA 4NRRA 1XSIA 3HZ3A 1J18A 2WCAA 3PZTA 1HQTA 2ZADA 2AL2A 3AMGA 3CAVA 3A5VA 3IJ6A 4YPJA 1DV7A 5FJJA 3UWWA 3VKBA 3EKLA 5C9ZA 4PUDA 1HO4A 2XIBA 3B03A 3SN0A 4OBSA 3IGUA 2X0HA 5DRCA 2VNCA 3S46A 4DO7A 1GVYA 5FOOA 1QNSA 3GNOA 4F4RA 3AYVA 5A69A 5K4XA 3DFOA 4NT0A 5I77A 3B05A 4XZMX 2IPWA 3EXTA 1ITCA 3MP5A 4C91A 3FK4A 3WLHA 2YYTA 5F7UA 1KGXA 2WVUA 2WSKA 2TSYA 1QHPA 3RM9A 1GK8A 5GQBA 2PDXA 4UTLA 3FA3A 3LM3A 3S5ZA 3MHFA 4YTTA 3IV8A 3SN1A 1B4EA 3WCZA 4LB4A 3UBPC 3LLFA 5BMWA 1VHCA 3E9AA 3PSVA 2OT0A 5G1YA 1F3TA 3VPLA 1BG4A 4WUIA 1KQYA 4BK9A 1LCOA 1KTBA 2PWFA 4YTQA 2HTMA 4GGBA 1JDEA 2G3NA 4BQ4A 1QNRA 4YWSA 1NP0A 2ZIDA 3WNKA 3UYIA 3TYCA 2FDSA 3WQ5A 4MYXA 3QV6A 3WLIA 3KUMA 5AC5A 2X1RA 2NSXA 4AUBA 1EFZA 4AZBA 1M7PA 3UJRA 1XFCA 4QDMA 2WSRA 1LBLA 4W8AA 5BOOA 3GM8A 2ZICA 4O4WA 5LXEA 1E71M 1D9EA 4H9VA 4QAWA 4RZ5A 4A2SA 3V0UA 4MF4A 4KRZA 4IIFA 3P84A 1K7XA 1EZWA 5A6SA 2QULA 1UWTA 2GOKA 3CH9A 4QSFA 3MHUA 1WPCA 3CEPA 4KRTA 3SRHA 3ZT5A 3A47A 3C2RA 2ZTKA 5HNRA 2Z29A 4KFOA 2WC3A 2JEPA 4ADTA 1PKNA 3DCPA 5LZLA 1UR1A 5F2MA 4Q7NA 1TV2A 4CD8A 1M65A 1B1YA 2J78A 1LYXA 3G8RA 3C0LA 1E6SM 1JRCA 3LS9A 4R7OA 3FN9A 3W7DA 3RYSA 4UNLA 4HTBA 3N3MA 4GPNA 3EMCA 4TVDA 1CIUA 4PA8A 3UR8A 3VGDA 3CPGA 4LGXA 2GDVA 3V1HA 3HG4A 3RLHA 1NJJA 5TNVA 3AMDA 3ITXA 4Z1DA 4I7VA 3UG8A 2YGYA 3WMSA 3OW1A 3N6JA 3FAWA 1F8IA 3W0KA 4UTWA 1RCQA 1SO3A 2OLSA 3O0FA 1EOMA 2VX5A 1G1YA 5D2XA 2ALRA 3RU8X 1B57A 4B5UA 4EXAA 3GAYA 1A0DA 2PTXA 2XIMA 3U3HA 3GDMA 5H8UA 3GZ3A 2BY1A 4WF7A 1V51A 1JPKA 4B5WA 2VC7A 5D8WA 1D3HA 1ZLPA 1YTDA 1KCLA 1XINA 4NZ3A 4IPNB 4OE7A 3U5YA 3LSCA 1DWFM 3TCEA 4AW7A 3MSGA 4IMFA 3LHZA 1Q6GA 3CYVA 2O0TA 5D9PA 3TA6A 2DUZA 1JCMP 4UFIA 1MDLA 2VELA 4TXEA 2BVWA 1O60A 4AC7C 1CLVA 4M6UA 3TH6A 5JH2A 1SJAA 3NSNA 4A8NA 4OOUA 2CLEA 1NU5A 2CKSA 4UBPC 2Y7EA 2OXNA 1A5BA 1WKDA 3GD6A 1VP5A 3GXPA 4ZCWA 3UP8A 1KBBA 2CXGA 4OTKA 3E96A 4RDVA 3SIZA 1V02E 5ECUA 3UJSA 1XF0A 3LYEA 3WLSA 3PC0A 2EG6A 1ESWA 1LBMA 4IGMA 3EEGA 1V93A 3IARA 3KHDA 1ICPA 1VLWA 4G7EB 4K6AA 3S6OA 4IQJA 4QP0A 2YA1A 1XP3A 3G6MA 4UOQA 2A7RA 3ZLGA 2C19A 3MT1A 5LNSA 4FHAA 2ZX6A 4HK7A 5BYWA 1HW6A 4GG9A 3MDUA 1FWWA 5LHEA 2CPUA 5E9AA 1OGSA 2OQYA 3UGRA 3IJ8A 1T0OA 3DC0A 4YU1A 2R1NA 3P0WA 4QRNA 1JCXA 3ZVHA 2HBXA 3T6CA 3RRAA 2PFHA 4ZOEA 3U2EA 3WQWA 2G3FA 4J3VA 3AROA 1SZRA 4HOZA 3T2PA 4J2PA 1I2RA 1JPDX 4TIMA 3AALA 2JFEX 4L1WA 3KOYA 2YX0A 2XVPA 3MI2A 7XIMA 1JZ3A 1IWBA 5ABTA 1BYAA 5AVNA 1H0GA 1Q65A 3ITCA 4ATDA 3W1RA 2ZFAA 1KM0A 3AHTA 1WZLA 5BROA 1C8QA 4DJDD 2VXNA 4BF9A 1DXFA 3ZFHA 1SZNA 1R86A 4L9ZA 3PHAA 3CQIA 1O1HA 5AY7A 4C6KA 4FP1A 4ICNA 3KW3A 1UWIA 4JY8A 1UYQA 1UA3A 1QW9A 5C8BB 4JTGA 3N9RA 3V5CA 3VKAA 1Y0EA 5DO8A 1EGZA 3GYEA 3SURA 3C5QA 3PG9A 4CN1A 2VENA 1UWQA 3G1DA 1B30A 3QJAA 4PL1A 1JQVA 3P6LA 3GNXA 3UXKA 2NX3A 1A47A 1LM1A 3S1UA 1K6WA 2YZ5A 2WHKA 5JBDA 1IZKA 3E6EA 3H53A 2J9ZA 4CQ9A 2WNWA 3S5SA 3E3HA 3MBDA 2OLHA 3WUEA 3FGCB 4XX6A 2W4XA 2PP3A 1N2VA 3LCWA 3B0XA 1YX1A 4D1JA 3AZTA 3AFBA 3NUKA 4WOQA 3GNDA 1GQKA 4REQA 1W1B1 3VOIA 3CTTA 3IGHX 5FAJA 3CPUA 3AYRA 3VGBA 3EXSA 5AZ1A 1BYCA 4M6VA 2QCFA 3T7VA 5AC7A 1J93A 4L6DA 3PTDA 4OV9A 3DI1A 2Q8ZA 1UP2A 3FVMA 3DI0A 4MZYA 3CHDA 4NUWA 3WH6A 3WQVA 3UWQA 2FGLA 3KRZA 4YCPA 2OEMA 2ABBA 1IXOA 4GY1A 5EMUA 1B9BA 1F74A 1ISZA 3WD1A 3VDBA 4CCEA 1YTKA 2C6QA 2CIPA 3LX9A 1KFKA 1KB3A 1E43A 3CQ0A 1PX4A 1OY0A 2A1YA 1W91A 2CETA 4DJEA 4GIAA 5HR6A 1Z42A 1QFEA 3SQLA 3SW6A 3EOUA 2ZUWA 3MUIA 4PMZA 3QY8A 4IPLA 4K7VA 2AOSA 1W56A 3RITA 2FZNA 4MNLA 2ATSA 1XYMA 3SRDA 3ES7A 4LS0A 1G0CA 4UFKA 3VIHA 4HTYA 2NQLA 1KRBC 4GWEA 1XRTA 4HVXA 1C90A 1E1EA 1VBGA 4ZOBA 3NO3A 3T0TA 3KOZA 2E25A 4LNCA 4B3ZA 3DERA 3EOOA 3HG3A 3QC0A 2UBPC 3GRIA 1VPQA 1MNZA 2VX6A 3H70A 4K2SA 3ITVA 1IGSA 2BXVA 5CPLA 3GG0A 5FF7A 3W2NA 1YDVA 5I3FA 2J9YA 4M3PA 1HT6A 1YEYA 3W02A 2C71A 4RE0A 2ZWZA 1K6AA 1H49A 3APYA 1FQ0A 2BY0A 4OBRA 3ECQA 4QROA 3CZ8A 4JCMA 1N8FA 4RK8A 1S5VA 1MXDA 1XYZA 4C6PA 2CXEA 3KS5A 3CH0A 2OT1A 3AS0A 4ERIA 1GVFA 1TZ7A 4ZE4A 1EGVA 2VR4A 1OX6A 3C0JA 3MUZ1 1RK6A 3UNDA 1VCVA 3W7GA 1UA7A 1LT7A 4UMCA 1M01A 2H9AA 4BJHA 1EYEA 3UWZA 3LERA 4HU8A 1ZP3A 1VJSA 1XWYA 4Q7IA 1CCWB 3SCRA 3VO0A 1GYLA 5CGTA 3TTEA 5FF3A 2ZRYA 5HMSA 5BWFA 4MHBA 5F2LA 1XQKA 3G1RA 5M17A 3NQBA 2VUYA 2DT1A 4NI3A 2BOFX 1JCTA 4PMOA 2GK1A 4Q33A 2AQVA 3KCOA 4KIRA 4EIVA 1I2NA 2ONEA 1LWHA 3SADA 4WRHA 5I7GA 1LF1A 1QW7A 4DJFD 1NOUA 3SBFA 1VIZA 3W6MA 3HV9A 2VEKA 5LIXX 3NZ1A 1S2VA 3WEZA 2DUAA 4LUJA 1QPKA 3EWDA 1AQ0A 4MIMA 3M46A 1GZ1A 5KSWA 2QJGA 5TD4A 3ABZA 4IFKA 4UFMA 3HGOA 1NVMA 4AD5A 3P5YA 4TQTA 4S38A 4HPJA 1LRNA 5AC6A 9XIMA 3CBWA 5LA1A 3I6EA 6XIAA 2J7BA 1HVQA 3S1XA 1UQZA 3MKKA 2WNZA 2I16A 3KVKA 1UKTA 5I3GA 2FIQA 4QNWA 1S5NA 1GORA 2R1KA 4JIPA 2EPKX 2VFGA 1E9LA 4AX6A 1RR2A 2BV9A 4WXYA 2IW0A 1ZPTA 4FR1A 2ZX5A 4Y9OA 3P8JA 1WUFA 4MLRA 1ZZMA 3UF9A 2C8NA 2V5CA 4XAYA 2CLFA 4JX6A 1EB3A 2OU4A 1UG6A 4PFMA 4KWWA 2PP0A 3NM3A 3WMLA 3SFKA 4D6EA 3NSXA 3GE7A 2GZXA 5H8PA 4MB3A 4H2HA 2R9RA 3N34A 1A3WA 4C7DA 3BZGA 5I03A 3TTQA 2Q71A 2YW3A 5HDRA 1DIDA 2VD9A 4NG3A 1OBAA 2VEFA 5CPQA 5BMXA 2P1FA 1FH7A 3BAYA 2D0GA 4J27A 2RUSA 5FF4A 4CCZA 4W8BA 1JI2A 1V3LA 1FP9A 3PB2A 3DFSA 1BVWA 4REQB 2V8ZA 4B90A 3ARVA 3GH7A 4XQ6A 3ZSTA 4GQBA 4GISA 3URBA 3TSBA 1AMYA 4XIMA 1XIDA 1XI3A 1CXEA 3T0CA 1QU4A 3EDEA 2B7PA 1Z32X 4GCXA 3PUOA 5ABEA 3RF9A 3CUFA 1J10A 5CPOA 3LHTA 1HKJA 3MP3A 4KGJA 2BY2A 3NDOA 4IQDA 3BCDA 1OGBA 3SZ8A 4PMQA 3QQ0A 4AY7A 4L7ZA 1PWMA 2RJHA 1OFAA 2Q3OA 4GINA 3EWYA 3QHOA 4AHPA 2I56A 2PLCA 1IEQA 2HJPA 1Z48A 2YXOA 3B0PA 3NL6A 4GYPA 1CWYA 3TAKA 2ZRXA 4EP8C 2IMRA 2YKKA 2O9OA 5LIKX 2KZHA 2PURA 3N12A 3STEA 3VX0A 2XFWA 3W1LA 1VENA 3LCLA 3ARRA 1J79A 2ZX7A 1V79A 3PP7A 3NSMA 3H6OA 4JX4A 4KS0A 1AL7A 1DJIA 1DWIM 2ISSA 3DKJA 3EBVA 1NDZA 5EGRA 2VEMA 3M6DA 4XZBA 3CZLA 4JQ4A 4H6EA 1MW0A 5HJXA 1EX1A 1E55A 1LJYA 2I9UA 3FV9A 1VKFA 4H6KA 3GVRA 5I24A 1V6YA 3MKCA 5CPSA 3M5XA 3TW9A 3KRUA 4H9XA 1AZ2A 2Q02A 3OPSA 4W84A 1XIMA 3EX3A 3STFA 1SJBA 3C4UA 3UJ2A 5HQEA 5IDIA 3GIYA 1LLOA 1J01A 5E6ZA 1NOWA 4DIAA 4FNSA 1XKYA 2QPXA 3W7JA 4K1WA 1W1VA 1E15A 4X61A 4IL2A 3PNUA 4MPKA 4IIBA 3N6QA 1OG0A 1M5WA 1Q63A 3RHGA 2BDQA 4J40A 1FWSA 3UGVA 4AC1X 1RAKA 3CUHA 4AVNA 4OV4A 2FHBA 5I79A 3KRBA 3W71A 3VDHA 3SCSA 4PFHA 4WJXA 5G1MA 2Y7GA 1DKWA 1SFTA 1W17A 2PDNA 3C2OA 3TYEA 3UWYA 3UYCA 3HV8A 4FNPA 4OUIA 2PRMA 4UR9A 4GI4A 4HU3A 3E1F1 1OHLA 4B5NA 3TC3A 3V4BA 1OIFA 3NGFA 3GU9A 4G9PA 3SGUA 1A50A 5GPRA 1FCVA 4DNHA 4OFCA 3P2VA 2BMBA 4JTDA 3OYZA 1CXHA 2NT1A 1GOOA 3Q45A 1TKKA 1J0IA 1M04A 2REQB 5BRQA 2C0AA 4GVFA 3CUGA 2QV5A 2YZRA 2ZDRA 3WQFA 2GPTA 3D46A 2WC7A 2ZDSA 1JDFA 2GWGA 3ONBA 1A4LA 4DF2A 3E2SA 3MWAA 1UH2A 1U1JA 4CVUA 4GY7A 5L9FA 1TIWA 2VFHA 4ZO7A 5CJNA 1BQGA 2YDSA 3LSBA 3RLVA 3FA4A 3M6YA 1QNQA 5I5RA 4C6FA 1RH9A 3H4WA 4JHMA 4QISA 3OJGA 3HN3A 1KO0A 1LG2A 3PJWA 1AMKA 2QMKA 5DCDA 5HBFA 1JL8A 5EMKA 2OKTA 4DLFA 3UR5A 4FXFA 1E1FA 4LVAA 3QR0A 4GUJA 1G4EA 4UTFA 3M0MA 4KCVA 2V5BA 3PFRA 4DWSC 4X0VA 1OADA 2WKLA 4ZTYA 4IFKB 1F8MA 2CLHA 2WMJA 3WDIA 3DG6A 3DGBA 1RCOB 3W22A 2O9TA 4FSAA 3TP4A 3B9DA 4PSRA 3CUJA 3BQ6A 3N14A 4IIHA 3G0UA 1MO0A 1A80A 3AIUA 2R14A 4F2TA 1JCYA 1FP8A 4HSOA 2NV9A 1W2PA 4RCXA 4W7WA 3OZOA 3BO9A 3TZNA 2POTA 1O5QA 1RJQA 2HVMA 2I1OA 4MYAA 3GH5A 4M6PA 3FYYA 2WNQA 2OZ8A 4HCDA 4UNIA 4H1ZA 2O9PA 4Q8PA 4B3KA 2X1IA 3S2JA 2BS9A 3LCIA 4LS2A 1EL3A 2OTDA 4M51A 4JTAA 4B5TA 1QR7A 6ALDA 5HQLA 4MKNA 2PPGA 3VNIA 1FHVA 2QXWA 1YPIA 2XPKA 5DXXA 4JS3A 3APGA 1HN1A 1B2YA 3CZEA 3N6HA 4JFSA 1DWAM 4EWJA 1GOIA 3QR3A 4IF2A 4RNIA 4AWTA 1CGTA 3NZRA 3SSJA 3MZ2A 1BLIA 2WMKA 5D9NA 1CPUA 3K8KA 4NYYA 1LL7A 1SZEA 3BQ5A 3UA4A 1YPFA 2X42A 2HRWA 1TA3A 1RVGA 3T0AA 5EPDA 3WK3A 5LGXA 1LZOA 5D9OA 4RV8A 3JZUA 1SVDA 1J4EA 3PANA 5E0KA 5CBJA 3N1AA 4H8NA 4DYJA 4K7YA 4U4MA 2QAFA 2ABAA 4KCWA 4BI6A 4L4MA 1DJXA 4HNLA 2HCVA 5DFAA 1OYCA 1OC7A 3KXQA 3WBEA 3AU2A 3TONA 2CCRA 4GHRA 2NWRA 1WNOA 3WJSA 3B0VC 3TXZA 3W76A 2WSQA 4XBSA 3K13A 1NDVA 4UTIA 1PHQA 1E1CA 2V69A 4TX9A 5U4NA 3ZM8A 2KAUC 4I9TA 3QY6A 4UQAA 4DELA 3EWBX 3TZFA 4HYWA 1DE6A 4D1IA 5C7VA 2CLOA 4PRWA 4HA4A 3FJ6A 3TR2A 1I2QA 4JL1A 3GYCA 3ZWTA 5T9BG 5MHBA 3VZYA 1QI5A 2W63A 4H01A 1AH3A 2FZMA 5D09A 4H7ZA 3PG8A 4HSNA 1P0KA 2ZQ0A 4RL3A 2PTZA 4A3RA 4U33A 1YHTA 3AWNA 2DZTA 3L68A 4DUXA 3W28A 4N9DA 3RCMA 3W1TA 5DY2A 3EMZA 4FX6M 4HP5A 3DYMA 4LBRA 4JYFA 1F05A 3R13A 2Z1XA 4XV0A 2YCIX 3OLIA 3QGVA 4PCPA 4W7UA 1KCZA 1UD3A 1KBKA 5E70A 3K30A 5LA2A 4HA3A 4MG4A 3DFNA 3LU2A 5FL1A 2ZC8A 4PBEA 4C6CA 5A6BD 2J79A 5ABGA 2Y4SA 3PAJA 1PVNA 4AYGA 4CNUA 5D32A 4PTVA 1L6SA 1B3ZA 3L4TA 4I9JA 5KZ6A 1XLEA 4V33A 3EWWA 2XHYA 4I5XA 1H7OA 1OFRA 3VIIA 5TBOA 3M0IA 4P8WA 7REQA 3SUWA 3WQ4A 1NDYA 1MUMA 3UWVA 2DORA 1LQAA 5M2FX 3QW4B 5AYXA 2WSYA 4KGLA 4ZQNA 2WCGA 5TIMA 4NX0A 1O5KA 3ZXWA 1R46A 3S1VA 4LVDA 1JAEA 4AZCB 1NWRA 2HBVA 2DIEA 2IXVA 2EO7A 3CU2A 2D23A 1DJHA 4EE9A 1XD0A 3TQ0A 4ZO8A 5IFTA 3HMCA 3CTLA 4PTNA 3PBUA 4LYQA 4BWLC 3QOKA 1LL4A 1JVNA 3A3HA 2B4GA 1ONXA 2YW4A 1VLIA 1Q66A 4G6CA 2AAAA 3LQLA 4HOXA 1HF6A 1HJUA 2ICSA 2W9MA 4XVEA 3BG3A 3ISIX 2WVSA 3UZJA 2W6RA 3TMQA 5G5IA 1WE5A 5M1TA 1IT7A 2OB3A 4B9YA 4CU7A 4JNZA 2P50A 2XWEA 5DMNA 2O4QA 4JFVA 1R2TA 2CFFA 1XPYA 4HGXA 3I10A 3VNKA 3QPEA 2Z24A 1UZ1A 4Q4KA 3AQUA 1UOZA 2WC4A 4I90A 4I5UA 6CGTA 1BKSA 1DP0A 3IJDA 1OFDA 1HKWA 1V77A 1JFHA 3PULA 3SQMA 1PYMA 2ISFA 3M0JA 3WJXA 1X7IA 1ITXA 2WQDA 1F07A 4F8XA 4UTTA 3SIMA 1BFNA 4HD5A 1RVKA 4XISA 1QAPA 2XVKA 3COTA 4NQ1A 4HMEA 1PIFA 4PMVA 3BOLA 1Y8BA 4WOZA 3E49A 3IGSA 2DW7A 2PTWA 2XDFA 1SR0A 1VJZA 2YB1A 4HA1A 4KWUA 5DT5A 3EWCA 5BU9A 3GX9A 2PGFA 1J8VA 3GTHA 1ODZA 1TPUA 3VIJA 3TDFA 4NL1A 2GL5A 1KW1A 2YLAA 4NAEB 5LYRA 4PH6A 4JTQA 1Q6RA 3GXNA 3PBMA 1C93A 3H2CA 3WK1A 5C2CA 3BG5A 4B16A 1EPXA 3GHUA 4OGZA 1ODUA 4RV3A 3C61A 4DZ5A 4DBSA 1C8VA 5EMYA 2PUZA 1OFPA 2WMHA 3O05A 4JIIX 4QG9A 5EMJA 3AI0A 3QH2A 4RDZA 1XXXA 4ZO6A 4NIRA 1PKMA 3EB3A 5DANA 3E0IA 1L8PA 2XSXA 1HNYA 2X16A 4WY0A 4I9MA 1XG3A 2PD5A 1MZHA 2VZOA 5IHSA 2Y63A 3I6RA 4HIBA 1UHVA 1HJVA 1GJWA 1HTIA 3OB8A 2YA0A 4ZL1A 3ZT7A 1HFBA 1GVEA 2J13A 2GJPA 2P76A 1SZFA 3NWRA 3Q94A 1IT8A 1I6NA 1DWHM 3LXBA 4WKHA 3ZWSA 4JQAA 5IOBA 1ZS2A 1TA3B 2X05A 2ZA1A 3THQA 1FTXA 1XRFA 3T05A 2XVLA 3VFCA 1LDCA 5I3IA 3URAA 3IK2A 2D24A 2GJNA 1S46A 2V38A 3HPSA 4QS6A 4O1EA 2A2IA 3PF3A 1PBGA 5J5DA 1H1NA 4DUOA 4ROQA 3WLPA 2I5GA 3A9IA 1SMAA 1OT2A 1T5AA 4J1OA 4JFUA 1XLDA 1ONWA 1NIUA 1RBOB 4A3QA 4DAFA 2XSBA 4QTGA 1LLZA 4BZYA 1EJTC 3BJTA 3WEOA 1KKRA 3UESA 1C91A 2B0MA 1ZJBA 4YXGA 4N7QA 1W6TA 3GC5A 4RDYA 3NQFA 3DYPA 4J3WA 2XGBA 3MKVA 1ZSXA 3VINA 1SJDA 1OINA 1L2QA 4FOJA 3F5KA 3ALFA 4Z2GA 1H11A 3TUUA 4ZO9A 3NPVA 2ZUSA 4NZFA 4PMJA 2VGIA 1XL9A 1I2OA 1OYAA 1C7SA 2PDWA 3AHXA 1ECEA 3M0YA 2F38A 3WK0A 4Q4SA 3D3FA 5HOSA 3MMTA 2E6YA 3VE9A 3FKKA 4WIWA 3IUDA 5REQA 2Z00A 4CU8A 1KR0A 3L0KA 2VC6A 1A5CA 4A35A 1DBTA 4GJIA 1A5KC 2VYOA 3P0XA 3TU9A 1FH9A 1AFSA 3OVGA 3A3WA 1ADDA 4ADSA 5JMUA 1OJXA 2J7GA 1D7FA 2W5FA 1GOWA 3F7JA 2RGLA 2VZTA 2VM8A 3NFUA 3TQVA 1UROA 3MCNA 5C0QA 3W38A 1O6IA 1XG4A 2HISA 2O9RA 3CV7A 1J9YA 4MM1A 5D37A 1G4PA 5IDZA 3VDGA 2Y89A 1J2BA 4JQ1A 1S1RA 2E7FA 2O7QA 4EAMA 5AOUA 4HNOA 3XISA 4O1BA 2YIHA 5HUPA 4MOZA 3A23A 2ZA3A 4I7UA 3UW6A 4MGGA 3L0GA 3BMXA 4RPPA 4O57A 1Q3NA 3MYPA 3TJIA 4R33A 3UCQA 3CV2A 4FNQA 1FCUA 2GDQA 4DO5A 2DVUA 3C3NA 5C6MA 3VOFA 4M1RA 3IV3A 1AW1A 2Y24A 3KTCA 4TTUA 5LGZA 3LV5A 3KBWA 3R4IA 3WLKX 4QSHA 4JTUA 3N73A 4D6GA 4XTDA 2PWGA 3URQA 3B8UA 5A5WA 1JUEA 4FLQA 4DM2A 3QBUA 2PLMA 3QZ6A 3NCOA 2NLYA 3V3WA 1Q6OA 4O53A 3QM3A 5IRPA 1RY0A 2VFIA 1W8GA 2VFDA 3GG1A 2ZXQA 4LBSA 1NP2A 3IJQA 3PFMA 3QV8A 1GOMA 1GVIA 1LQ2A 5BCAA 4INFA 1IT0A 3W85A 1ISYA 3EA2A 4N2YA 3OZMA 4FF5A 4S3CA 3HQNA 1W5OA 3V7PA 3GIQA 2JEQA 4NNCA 1WO2A 3SSZA 4QLJA 3GXIA 3SRKA 3RR4A 1S39A 4NRSA 4LYKA 1YKWA 2VL4A 2J47A 3PSWA 1H4PA 4XD4A 3WDHA 3IVUA 3WBWA 1MFVA 2FGZA 2Q3RA 1OEPA 2PDKA 1DYSA 3QTPA 2YBUA 3MUY1 1KLZA 1F5ZA 1IEWA 2AQOA 4R34A 1K8YA 2WM0A 1FWAC 1OX4A 3VIKA 1V0LA 1E4LA 3O8AA 1IXQA 1GOQA 1YQ2A 3HQPA 1RPXA 3W86A 2D73A 1YADA 4GZEA 3AHZA 3S8HA 5AHIA 2UY4A 1HL9A 3M1ZA 3P5ZA 3B97A 4LYRA 2WM1A 3P62A 2QZRA 2OLAA 4E3TA 1ZENA 3MS8A 2V67A 3WD2A 3PM6A 4IM4A 1VPYA 1X1OA 3SCVA 1IHIA 3WNNA 3ARQA 1H7WA 4OIFA 5CAKA 1KM4A 2E6FA 2CZDA 4IG2A 2CLIA 4MWAE 1F3EA 1F3XA 1XGDA 2C0HA 1R3SA 1A3XA 3BCFA 2BOGX 2DJXA 4Z17A 3GKAA 4XK2A 4DO4A 2PBGA 3MA8A 3B9NA 1XW8A 4Y6GA 4AG0A 4UTUA 2E4TA 4R9OA 1BRLA 1Q2RA 4WY0B 4LH8A 4ZQRA 3PUEA 3QY7A 1WDDA 4B2DD 4DQWA 2DVTA 3A22A 5DN1A 4JKMA 1OT1A 4O13A 3CC1A 1HP5A 3AMLA 2WZIA 3PTKA 4S3FA 2PB1A 1VRDA 1GNXA 2ZX9A 3BAIA 1MQPA 1F6PA 4IIGA 4J2MA 2WANA 4MJMA 3U8GA 2C79A 4GIRA 4HT3A 2R1PA 1MW3A 3R25A 4CNTA 2FH8A 2QUUA 1JNEA 4WR3A 1TTIA 1UD4A 4I8YA 1K02A 4O0ZA 2V3GA 2POZA 4D72A 3KS6A 3G6LA 3MQTA 3UPMA 4NJKA 1W3JA 4R3UA 2CLKA 2VX4A 4FNUA 4C6LA 2Y8VA 2CERA 3W6YA 1VIWA 4JDYA 3TMLA 4GZ7A 3ENLA 3GHSA 3OHIA 3MBFA 3ZR4A 2YOCA 3BAXA 1WB0A 3R8GA 1R3QA 3MI3A 1REQA 1XGEA 2E68A 2DZVA 3SM0A 1R9ZA 2QCDB 1YXYA 3QN3A 4IIEA 1HIZA 2PRLA 3GTIA 3PZVA 2D2OA 2OYMA 4D6FA 4QR6A 4ADUA 1RP8A 3TFXA 1AVAA 1JZ8A 1MRAA 3S2NA 1V0KA 2NV2A 1WDQA 3W7MA 4MLJA 2QDDA 3NYDA 3UD6A 1JFXA 3G1VA 2J24A 3W3OA 1WCGA 3DESA 1EP1A 1NF0A 2QDEA 2DIJA 5I3JA 1GZGA 1W5MA 3OIXA 1IYXA 5C55A 3W82A 3EYPA 4FXRA 3WEMA 3SUTA 2G50A 1KM2A 1BWKA 4A22A 1NAL1 2J74A 4W86A 1S2TA 3LA4A 1XUZA 1SQ7A 1ZALA 4GD0A 3W81A 1EIBA 1LTDA 3Q67A 5A2AA 4IP7A 5I0DA 1UBPC 4B5SA 5CSYA 3OQ8A 2XIQA 2O56A 1MDRA 2WB5A 1J5TA 2G4JA 2VDGA 2ZRZA 3PS7A 4U3AA 5LNRA 5KZDA 1A4MA 3T8QA 2FJUB 4IGHA 1F4HA 5D4YA 4IMAA 3MVIA 1KFWA 4RW5A 4BCEA 3MV01 4OUEA 3ZMRA 3R2GA 1W9UA 4I6KA 1AK5A 1TRDA 5AHEA 2J75A 3WSUA 4RE2A 3BSMA 1OM0A 2FJKA 3QKZA 1PKYA 3CGTA 1BSLA 3QZAA 4NU7A 2OX1A 2GJLA 2VMFA 2PWDA 4KKXA 3DFTA 1SUXA 4JTHA 4S3DA 1R0MA 5DF0A 5FI8A 2R1LA 2BFGA 2Y8UA 4JL2A 4H04A 3QLDA 3TWBA 3MSRA 4RDWA 2G3JA 4L4OA 6A3HA 4NNAA 4GYFA 1SJCA 3PJTA 5DCBA 1QNOA 4IHCA 3KTXA 2QJIA 1XSKA 2QUNA 2EHHA 4UTKA 3CB3A 4EXBA 4W87A 4EPEC 1JZ5A 3AWOA 1POKA 2EPHA 4C5YA 2CC0A 2PU1A 2Y8KA 4UTJA 3FEQA 4M7TA 4GVHA 3W1NA 4XBKA 3W75A 4GNVA 4OHQA 3GS6A 5FJIA 1RP9A 2IPGA 4GYPC 1MW1A 3QSTA 2D2JA 4CUCA 2PEVA 1CB2A 1SM9A 1UBSA 4PTWA 4C1NA 1E3XA 1ENUA 3VCNA 2YCJA 1UR8A 2R8WA 4AHOA 3CMJA 3CZKA 4H6QA 3EMQA 4MJ2A 5KINA 4QJ1A 4DJDA 1W1TA 3GDBA 3W7LA 1VJIA 4LUTB 2NVDA 1DL3A 3BE7A 3IACA 3VD4A 3R5EA 3LCGA 4DYKA 3FOKA 3R1ZA 2HVOA 4UFJA 3AXIA 4OVXA 2BLEA 5IFPA 4X22A 7CGTA 1E70M 3V0TA 1CENA 4Q7BA 4UIOA 4HHMA 2NUWA 3KTSA 8RUCA 3BW2A 4KBXA 1S5TA 4HKPA 5KEZA 4M6QA 3BOXA 3I65A 3HBLA 3M47A 4NXSA 1LOQA 5AYZA 2CBIA 5LIUX 2CNCA 3TJLA 4WK9A 3J7HA 4Z08A 5C9WA 3BLLA 3UVIA 2ZUUA 1UD2A 1PDZA 3N13A 5FKYA 2CZ5A 4MPQA 1ZAHA 4GO8A 2BXZA 3BGAA 3CUZA 1N55A 3F03K 1EEXA 3DU0A 3N3TA 2DH2A 1E56A 1WAUA 1DJQA 3WLTA 1K03A 3SGZA 3MDWA 1KBJA 1TVLA 2ZZ3A 4JQ2A 4UTMA 2DGAA 4Y9NA 4KWSA 4W85A 6ENLA 3PPGA 1P0NA 2PTDA 5JH1A 3ZS4A 1ZNNA 3VOJA 4JX5A 3DYOA 3TROA 4P7OA 1TMHA 3KP0A 4AD0A 3VMOA 3FKRA 4YN5A 2EPNA 2Y2WA 4H19A 3BAJA 5BU6A 1RZMA 1FVPA 4JEJA 1KD0A 2CBJA 9XIAA 1BXCA 5EMLA 3M64A 1V5XA 1O4UA 3CXOA 3HGSA 4UQCA 4NJIA 2GGHA 3TYUA 4FAMA 4FK9A 1UH4A 5CSSA 1T96A 3NQ6A 2YLLA 3AIWA 1VFTA 2DSVA 5I09A 1EJRC 1EJXC 1FWBC 4CN6A 1XIHA 4DXXA 4AXKA 1ZP4A 2P3ZA 3PBYA 4EACA 4HA0A 4DN1A 4Q22A 2J77A 5EY5A 4HB7A 4O8AA 1TPEA 1DIKA 1W1ZA 2Q8XA 1XH0A 1KBLA 2F2KA 1KGWA 1MQQA 3AIBA 4KEMA 5FJPA 4O8RA 2WHMA 3M9YA 3T81A 3AJ7A 2NUXA 1TE1A 1GW9A 3MPGA 1WXJA 3T2OA 2OR2A 4CEXC 5DLCA 4IJBA 4CU6A 3EB4A 1QO2A 3AAMA 4HZ8A 2IUZA 1S38A 3S5YA 2YL9A 4GXWA 1I9CB 3VOCA 2BSLA 2MANA 5A6KA 4LY4A 2GUYA 5DQPA 3F4WA 1G4TA 4AD1A 4R53A 3NQVA 1FWTA 3PK7A 2C18A 3E0LA 1RJPA 2VUNA 3PR2A 2ZE3A 4CD4A 4F9DA 1BWVA 4Q6JA 1UC5A 5D33A 3N2MA 2FGBA 4HZMA 3N9KA 2CYGA 1FKXA 3W2MA 2A21A 3NTYA 2JGYA 1EX5A 2FLIA 4BHYA 1CYGA 3WNMA 1HP4A 1QK0A 1WKFA 3GDRA 4LX4A 3IUHA 3NYZA 1QOPA 4GKTA 4CQAA 4WKAA 4FIRA 3WLOA 1UMLA 4EAYA 3IANA 4RX0A 2BGSA 1SR9A 3F4NA 1SSGA 4W5UA 1R2RA 3OLDA 4KCUA 3C2VA 4B4FA 4L9YA 3MWCA 4QNEA 3HU7A 5CZKA 5D9MA 2B31A 3FIGA 1Z8AA 1WZKA 1E6ZA 1XIBA 4J5NA 2ZKMX 4ZSUA 3DFYA 1X97A 3LOTA 4K3ZA 2PRHA 1EKOA 4AEEA 3W2JA 4G2DA 2VGGA 3M0LA 4J28A 4AEFA 3VA8A 3SECA 5M5DA 2ZX8A 4GQGA 4DJFA 3NO5A 3ZYZA 2GUUA 3VXGA 2QAPA 3NZPA 4XB3A 1OC6A 1PWLA 1XX1A 2OGJA 3UR2A 1Z7AA 2VTFA 1ISXA 4E2BA 5IHRA 2E1WA 4O1CA 1XIIA 3NL5A 1W32A 3OYXA 2AGKA 4PMDA 4RR4A 4B92A 4H9MA 1EBGA 1IE7C 3A4AA 3QC3A 1VCGA 2OEKA 4FX7A 5G2IA 1M3UA 1O68A 2VJXA 3QOMA 7PTDA 2XFRA 3KLKA 3VILA 1ADOA 1P7TA 3L0NA 3PJXA 2JQXA 3RPTA 1GEQA 2DSZA 2BOEX 2A3CA 1AW5A 1EEPA 1NQKA 1LOSA 3CWNA 5FF2A 1GYNA 3GC2A 5F1VA 4CQBA 1M9HA 1XKJA 2J4GA 1DJGA 1HKKA 2PDLA 1W54A 3WIJA 3MU7A 2E5BA 3OG3A 1EDTA 3DEQA 3VGGA 1F6YA 3EGJA 3Q37A 2YCLB 2OCZA 4TTGA 3LPGA 1MEWA 3ZT6A 1W9BM 3W24A 3AHVA 3RCNA 1XLCA 3K8MA 4Y8EA 5TF0A 1NFGA 1EDQA 2WMGA 2XUCA 2V5LA 3EDFA 5H2ZA 1E4NA 5CBIA 3TW7A 2BXYA 2BP1A 4AD2A 4PUNA 2GQAA 2OWCA 3RLGA 2QIIA 3UWEA 2A79A 4OECA 5DX7A 3BLKA 1W1IE 1TZZA 2XZ9A 5LHFA 3B04A 2BHYA 2F7FA 4RXGA 3VKJA 3LD5A 3M0ZA 1RPKA 5KZEA 4UTHA 5DELA 3MZNA 3TSDA 5FEZA 2ZC1A 5LIYX 2NQ5A 4G7EA 3FYOA 5BXTA 3ARYA 3B8SA 2CEQA 4U10A 3YPIA 3PB0A 4C6JA 3GTNA 2HPIA 1A5MC 2E9LA 3IS4A 3UZZA 2DT2A 1EO7A 2YBVA 5C2XA 3TK7A 4IJRA 3QF0A 4R5EA 2KX9A 3VYLA 3I3DA 1IGWA 2EF9A 4W4QA 3B8VA 1FOBA 3WD0A 4BF5A 2Y85A 1KBIA 2RDTA 1E3ZA 4ES4A 3I7QA 2BX7A 4LOCA 2Z2AA 4Q8TA 2NX9A 1Q8AA 3E2RA 4X63A 1EHNA 1I0DA 1QI2A 2VDIA 1MWOA 3L4UA 1ZBVA 4KWOA 4MDOA 7ODCA 1AJ2A 3DHPA 4A8LA 4EANA 5HWJA 3U4AA 4GFSA 2YL6A 4RLIA 1E4MM 3H22A 3VGFA 3CUIA 5MF5A 4IPIA 3R8RA 3HPAA 5A8GA 3B8WA 1SW3A 1XLGA 3GR8A 3MV11 3TNBA 1M7JA 2YPIA 3OLEA 3BMWA 1B3XA 3L67A 3GR7A 1ISVA 3UXLA 2W92A 3R0KA 1HKIA 1FX6A 1ZBKA 2PDBA 2ANUA 4KFPA 2D3LA 4Q4QA 1KM6A 1Q6DA 4C7GA 2Z1KA 1HJWA 4X0NA 2QMJA 2B7QA 1E6PA 2QQ6A 1BKHA 4BI5A 1M41A 3QR1A 3H7VA 4UTTC 2D2GA 2HQAA 4PZVA 1PS9A 1LG1A 3BV7A 5AVHA 4Z2IA 1XLKA 3NL2A 3T8LA 4V27A 1OABA 1VF8A 3AS3A 1AQHA 2GYIA 3QXBA 3RCYA 2O92A 3HF3A 3OLGA 1UW9A 1RLDA 1TPFA 3FGCA 1HZYA 1T7LA 4GCAA 3S6DA 2E6DA 4MWAB 2JK2A 1JIBA 1PL9A 5EU9A 2GJRA 3LMYA 3R10A 5D02A 3G5EA 1QBBA 4YYFA 5FEWA 2OX4A 5CC6A 2V81A 1GKPA 2D0HA 3B8DA 2PDJA 4WLCA 3CYJA 3TOYA 1J0ZA 2ZUTA 3F4VA 1JXKA 3MCMA 4QCEA 1BPLB 1EYWA 1TRIA 4BEUA 3U57A 3AC0A 3DUGA 2XN1A 3ZLFA 2F61A 2CLMA 5A6JA 1PE1A 4DAIA 1GUVA 4JNYA 2VCAA 3MMDA 1XIJA 3QV7A 1P0EA 3USBA 2X09A 2ZUVA 4AIBA 3ANYA 2XGZA 5HNTA 3WJWA 1JYWA 2E09A 1XYAA 1XBYA 1NELA 1PPIA 2GVGA 3VNZA 3STPA 5A8PA 5FD0A 4H7CA 3GXDA 3D6NA 3SRFA 2GVJA 2WHJA 2QJHA 5D2TA 3FJ4A 3DBPA 2PLKA 3PBWA 4LSBA 1K1DA 3W83A 3CT7A 3UERA 4YTRA 1ZJHA 1UH3A 3GHTA 4D8ZA 3OGRA 2BNJA 2V5DA 4UR7A 4U3CA 4GOAA 1TE6A 1DHPA 3ALGA 1UPPA 4E2VA 2XH7A 2PDCA 2QGHA 3TV8A 3TN6A 5A95A 3AXHA 4V1XA 2NXIA 2QNEA 2DW6A 1DORA 4YVVA 3OVQA 4AIOA 3VC5A 3CO4A 3VCRA 1E5JA 3L5AA 2NZLA 3PPCA 3W7EA 4QFUA 3OBEA 3ZQ9A 1X1NA 3AS1A 1OB0A 4W88A 3SY8A 1E9ZB 4PODA 4E4FA 3ARTA 3B9EA 5EA9A 1FWGC 1WZAA 5A6TC 5FJTA 5JBFA 2A4AA 5HR7A 1P7TB 4JTKA 2DV0A 1IXNA 4UXDA 3R12A 3FX4A 4H00A 4BY3A 1XH1A 4URIA 4W8LA 2DY3A 3BLDA 3JUGA 7A3HA 3GVWA 4V28A 2Y7FA 5HULA 1Y5WA 3BMVA 4C60A 2D69A 3LHWA 2DDXA 2JIEA 4BI7A 1T99A 3VM7A 4FLOA 3GXMA 2Z2BA 3H2FA 4LVBA 3PWIA 3WY1A 4XKMA 1FUYA 2FPTA 1XFBA 3EOLA 3W84A 3WLLA 4FPSA 2D20A 1TJ2A 1XYFA 2NQZA 2DSKA 4Z2LA 1TVPA 1FRBA 4S39A 5CG7A 2BHZA 3VX1A 2O7SA 3JS3A 4KRUA 3W9ZA 4H41A 1WKEA 3QEZA 1UWAA 2WPBA 1NQ6A 3SUVA 1QRQA 1XM3A 4LJ3A 2E77A 2P88A 5PTDA 4X2PA 4ZR8A 1T40A 1OFEA 3W7IA 4JIRA 5DMLA 1Q4WA 1G69A 4L64A 4TOQA 4YS1A 1JYNA 2FVLA 3EPNA 3OOQA 3CL7A 4NJJA 4TR9A 2I5QA 5BRPA 4ZGYA 1KKOA 4Q8NA 3ME3A 4WJ8A 4YVXA 4ZQOA 2DUXA 2PDGA 1VFOA 2X40A 4JYEA 2C7FA 2Z1SA 1TO3A 2ZZ4A 3W53A 3O9NA 4MB1A 1V08A 2GLKA 3U48A 3W7OA 1SSDA 3POHA 4B91A 2RHGA 4B5VA 4Q8WA 4YIWA 1DXEA 3RX3A 4XSLA 1JYXA 2LLEA 4GMEA 4HN8A 1K9TA 2WHLA 1D3GA 2WZTA 1IIHA 4MUZA 4LC8A 4GZJA 3DG7A 3GW0A 3KOFA 2Z1VA 1JR1A 2P0IA 5GVJA 1M68A 2P5NA 1PDYA 2FKPA 3CEUA 2PGRA 3RPDA 3TA9A 3RJXA 1GQIA 1JXJA 3BLEA 3I3BA 4XAZA 1PHWA 3L65A 2H6RA 3N4AA 1QTWA 2QPSA 3ANUA 1EA0A 1GHSA 4DZHA 4WY0F 1XCWA 4IH3A 4YWIA 1NFPA 3CV1A 1XBZA 4FS9A 2CBVA 2INEA 1B54A 3KL5A 3PZNA 1R6WA 1W3NA 5FA5A 4DBEA 4YTSA 1D3CA 4QE4A 1VC4A 1UPMB 3SR7A 3VIMA 4A3UA 2CLPA 4BFAA 5LNVA 3OBAA 1KWGA 3DX5A 5SWUA 1B3WA 1K3UA 4JKLA 1VYRA 3W70A 4S2CA 4AVOA 1YDNA 4WXZA 2PSNA 1QCWA 3TSMA 4XVDA 5A6BA 1E51A 2VCBA 3SEPA 3VE7A 3CB8A 3N17A 3UG4A 2VOMA 1LUCA 4WX2A 3LBMA 2X1SA 4GO9A 4XZHA 2NW0A 3T78A 1VFFA 4CNOA 1QVBA 5HK4A 4JICA 1F73A 2X7WA 4IOTA 5F4SA 3UZ5A 5FJRA 4O52A 1W0MA 1OG6A 2YCEA 4D8AA 1WZMA 3MB9A 1P6WA 3NQEA 1TPDA 3EOSA 1DIOA 2XG9A 1DXIA 4P8UA 2A0NA 2FPVA 3O2LA 5FACA 1H7XA 3W7KA 3TW6A 4AMAA 4IGSA 1J2WA 1JDCA 1KFEA 1B3VA 4PL2A 1H7PA 5M3WA 1Y65A 3SCTA 2J6XA 4YL2A 1DVJA 1ML1A 1HXJA 2YCKX 4YCOA 3CHFA 1YIXA 2INFA 1NSJA 1TMLA 4UNKA 2R1MA 4D6IA 3KL3A 4O54A 2BVDA 3ANVA 2G8ZA 3CWOX 4ACZB 4US6A 4FI4A 3SCUA 3VKDA 2JKAA 2G37A 4GH1A 3P61A 4IXXA 1RLCL 1MXSA 3LRLA 5AHMA 3L4XA 4R85A 3P82A 4HMNA 2DSUA 1WOBA 5FEPA 1HG3A 3LGDA 3PNZA 1KFBA 1S2CA 5CZJA 1R3TA 4WDUA 4JHOA 1UASA 4WD0A 5C71A 1EP2A 5FJOA 1ALDA 1OF8A 2VFEA 1E0VA 3M4HA 1VAHA 3KDNA 2QUMA 1UP3A 1AL8A 5GJNA 1TJRA 4PMYA 3UZWA 1W9VA 1UUOA 3EWXA 4YJ5A 2A5HA 3HOJA 4CEUC 1EOKA 4U31A 2F84A 1ZAJA 4H83A 3VD3A 2XWDA 3OHMB 4POCA 4IIDA 3MSYA 3KLLA 2HDJA 3GU2A 3GTXA 5AYIA 4H9YA 4UQDA 3TTYA 3WQGA 5HPCA 2AAMA 4O10A 1JUBA 2YB4A 4MWAD 4HHLA 3STGA 2IKIA 4NYUA 3LLXA 4OT7A 3QW3A 1ICSA 4N6FA 1HGYA 3GU1A 4HNTA 2FB3A 2QF7A 1XYLA 3KVJA 2FVMA 2VEPA 4LNYA 3UXDA 3W72A 1WBJA 1QJWA 1TFVA 5LXXA 4QDPA 2E1DA 5H8MA 3NNTA 1VCFA 3GNPA 3WMBA 2WSPA 3LZ5A 3Q65A 4CCDA 4CD6A 1Y7VA 2IPJA 2WJDA 1EUAA 1QI4A 1U33A 2C14A 1PYFA 2W61A 3W7RA 3HTWA 1O5XA 2TPSA 3I4KA 3DAQA 4NF7A 4QG8A 2CWXA 1W5NA 3QTGA 3C3UA 3ZIZA 1TWDA 4NAFA 4EX4A 4JTJA 1OYBA 3BW3A 4F0RA 3CASA 4P7RA 4DB7A 3G0SA 3TNOA 3C56A 3PAOA 4AVFA 2GQ3A 1PJ9A 1DE5A 3URNA 5I3HA 4H7VA 3PTQA 1MI3A 4H6RA 2REQA 2YDAA 3U4FA 1NTHA 2C91A 1W31A 3IWPA 4TU1A 3PZQA 1IV8A 1DWGM 2WWDA 3FHQA 2Z6IA 2BHUA 2PWHA 4AMCA 2J66A 1E9IA 1GZJA 3ABRA 3CNYA 4CNSA 2OOFA 2UWFA 1XLBA 1Q6CA 1VGAA 3PZGA 3WLRA 2Z25A 4QBXA 1BGAA 5D03A 2I7GA 1ZAIA 4MKSA 4J3ZA 3SJ3A 5MKGA 3QYSA 4FF7A 4R9XA 2QUVA 2PODA 1OZQA 1JD9A 3KZPA 2DQWA 4MB4A 4L61A 3KL0A 4DX3A 1V3HA 5G2HA 3DG3A 1QNPA 1E0TA 1Z69A 3FVDA 4MJ4A 4RNFA 3WQDA 3K4WA 2P10A 1GKRA 1H5YA 4P5UA 4GI8A 2OYLA 2F6KA 3P3BA 4UWMA 3R94A 1H63A 3BPWA 2DPEA 2WVTA 4X2RA 4ATLA 4N4QA 1R87A 4A3HA 5I00A 4NJHA 4HYRA 4UFHA 4XKYB 1TWWA 4MKVA 1E5NA 1YE6A 4GVIA 3W87A 5DXYA 3VNYA 3LG3A 3H2AA 1GJUA 3EDDA 2I17A 3G77A 3ZJKA 4H8UA 4K36A 5AC4A 1R9YA 2YDRA 3N18A 2QDGA 3BH4A 4P61A 3ZOAA 4W93A 3QLLA 2J6VA 3TN4A 3VDCA 3MUXA 2C1HA 3IAPA 1FXQA 1VEPA 4HHHA 3RAOA 2DZXA 1UIPA 2NSOA 2PWVA 2F6XA 3N2OA 3NOYA 4AYSA 3WD3A 4AAJA 3OA3A 3JU2A 3CM4A 3WN6A 2W27A 2FMNA 2H3DA 1U1HA 1TWIA 1TPC1 1V02A 1WDWA 1YPXA 1DQUA 1DWJM 4IJCA 3WF3A 3UY8A 4PEKA 4TO8A 4TVUA 1KTCA 3W29A 5HNUA 3UPWA 1J11A 3CMFA 3EXRA 7TIMA 5KETA 4NZ5A 2E3ZA 5D30A 1KWKA 1EJVC 5G2WA 4ERAA 2VZVA 3BC9A 4ZSTA 1YLVA 3AIEA 1P0DA 3BL3A 1J0HA 2BY3A 4DBWA 3L5MA 3II1A 2OWWA 1LUCB 2R82A 4UCGA 1GCYA 2PC4A 1SW7A 2GQ9A 3CK5A 1GOXA 1W37A 3VVGA 1FFQA 3UNTA 2XIIA 4AWEA 5IBXA 1F6KA 3H23A 1JD7A 2V3FA 1XIFA 4KMQA 1HKMA 2X0YA 1XH2A 4MTVA 5FCZA 3TJXA 5CZ0A 3NPUA 4PR4A 4A21A 2CU0A 2FDMA 2E6AA 3NURA 1M53A 1RQEA 3T9PA 3ITTA 2HXTA 1YXCA 3LXAA 2G96A 4F3HA 4DXVA 2UV8G 5BOFA 2E67A 4D8LA 3ITGA 1L8NA 2OJPA 4AZIA 5EKYA 3TTOA 4AWSA 4NZJA 4NZ1A 1VHNA 3WH5A 1GPWA 2TRSA 4M1BA 1EQPA 1IF2A 8XIMA 1SFSA 5FL0A 3VIFA 1G7VA 3HPXA 4H4IA 2G4FA 2P53A 3LLDA 2J7FA 4I9AA 1Q85A 4LAKA 4D9PA 2OKOA 3ABSA 1YBQA 4PUUA 3CAWA 4RUBA 5B7YA 3NQ2A 1PAMA 1XICA 1PZ0A 2CWNA 2I5IA 3B4YA 1H50A 4HSHA 1NH6A 1UZDA 4LVFA 1PZ2A 3IRDA 2NLIA 1J6PA 3WF2A 2CLLA 1XYCA 3WDPP 3VMNA 2XN0A 2Y6ZA 1KGUA 3TWAA 1UKSA 3SQSA 2VT0A 2HZGA 3QMSA 3O06A 4IWWA 5LA0A 3ORWA 4DXKA 3H2EA 1ZUAX 3E12A 4JTFA 4XD5A 4F0HA 3I3EA 2PDMA 3LTSA 3LGGA 1ELSA 3VU2A 3F4CA 3DGRA 4E8CA 3BLIA 3P7YA 3N11A 4JZ5A 2WVVA 2GSEA 2FZ8A 3NQMA 4M7SA 4LFYA 3MC5A 1KQZA 1Q6FA 5CLWA 1EF2A 1R3WA 1TPVA 3BLPX 4C7FA 1UD5A 3ZJ7A 3AU6A 1KXHA 1UC4A 2FMOA 5C2GA 5K9CA 5D38A 4F0MA 4E8DA 2C16A 3AXKA 3A13A 3VAVA 1IR1A 1EA9C 3V75A 1AW2A 4FO4A 3WK2A 3HGJA 3A24A 3QV9A 4AZCA 4ZFCA 3E5BA 4LC6A 4ML4A 1GG0A 3ELFA 4DPQA 4NAFB 3Q58A 1ZJAA 3E0VA 2DZSA 3IIXA 4X3ZA 3GFZA 2E0PA 3G1YA 2VVSA 1X98A 3KBNA 1J0KA 1KXQA 5JIWA 3HMJG 3RU6A 3WNOA 4ZEPA 3TTSA 2WJEA 1XDLA 3MJMA 4B2DA 4Z1CA 1BXNA 4D6HA 4LAUA 5I3KA 3AXMA 4K38A 4HNVA 1DEDA 4KFNA 1EUNA 3EKGA 3HFTA 1NDWA 1Z89A 1OVDA 2W0UA 1IEVA 2CZFA 4M80A 3KDOA 1E6XM 3GBDA 1TWZA 3T55A 2WKGA 1UUMA 4CQCA 5CPMA 2VURA 2VDHA 2WMIA 4LYPA 4A8IA 1HJSA 4B9ZA 2VR5A 3OIHA 1K8ZA 1PX8A 5FESA 4QIUA 3JRKA 2PDQA 2QVNA 2L5HA 1X7FA 3ZR5A 5MKGB 5CC5A 4DPPA 1R3YA 1DJZA 3EDJA 3WJYA 2A3BA 3CMGA 2PF0A 5HXMA 4DJFC 1XC4A 2Y62A 1TSIA 3MANA 5HAOA 1S2AA 1UCWA 5CJMA 1QNVA 1WUEA 3FNDA 3DH7A 4Z1AA 4MMWA 4LWWA 1P1XA 3WFLA 4PMXA 4GUGA 2GVLA 4MZ1A 2IS7A 3GFXA 3AIVA 2F8QA 3F5LA 4WDWA 3OZYA 2C3ZA 2WYSA 1YNYA 4LALA 2X2GA 1UZHA 1POJA 3BZJA 5A8NA 5BXSA 1NOFA 3GK0A 4H2CA 5HNNA 3L4VA 4NAEA 2ISVA 5HJLA 3P81A 1TJPA 2PDHA 3TFCA 3B3DA 3UETA 4GVGA 1QWGA 2DSWA 1H09A 2I9EA 1BWLA 2FHFA 1XUUA 3IIVA 2DZAA 4WSJA 4AZ7A 1QASA 3QFEA 1E0UA 1CXIA 1L9WA 1I4NA 1U5HA 2QF8A 1VFLA 3LK6A 1W3HA 5DBUA 1S2UA 1XBXA 2VQUA 1Q13A 3THDA 3WUFA 1RY8A 4ATWA 5IXEA 1ZTVA 2Y5SA 5D8ZA 1XLJA 2HMCA 3VIPA 5DBTA 2D3NA 3LCFA 2XISA 1TZ9A 2V6AA 5XINA 1WBHA 2J8GA 4IFRA 1H7NA 4MY9A 1AD4A 3WQOA 3B9OA 3NO1A 4NY2A 4BWLA 3V0SA 1PO9A 4LUSB 4U2ZA 1N8IA 4LRSA 4XZWA 4IT1A 4HPHA 1A5SA 1GKQA 4TMCA 1VPXA 4PCNA 4NZCA 5A2BA 4QQUA 5FIPA 2YFOA 2IQTA 4A2RA 3B06A 2D2HA 1ME7A 1Z3NA 2J62A 3B8TA 1P1MA 1MUCA 4G1NA 4RZ6A 4JIQA 4V15A 4C6EA 1TV5A 1XLMA 3M5VA 3NDYA 3GNNA 2PAJA 1DHKA 2HSAA 3BVJA 3RM8A 1PX3A 1XHGA 1LOLA 4LEQA 4ZXOA 2Y70A 5CZTA 2JALA 3M5ZA 3NQGA 1XJBA 4DWSB 4TX6A 3NXFA 4K1GA 4MAVA 3DHUA 2OODA 4EF8A 4L5ZA 1KV5A 4F0LA 1QT1A 1W3KA 3WBYA 2YL8A 4JN6A 3UT0A 4CLMA 2BVYA 3TLQA 2VWTA 3FEMA 4C6MA 3S1WA 2V68A 4B4HA 1YBQB 3LPOA 4GUFA 1KFJA 4WCJA 5BWAA 1Q6LA 1G67A 3T42A 4EPDC 4K37A 3UPBA 2UY3A 2B7NA 4HK5A 1CGYA 1ZHAA 3KHJA 3LHVA 3CAQA 3G1AA 2XJ7A 1R2SA 2G97A 5DY3A 1AH0A 2MNRA 3BICA 2WO5A 1D8CA 2W66A 3OTRA 3TOPA 2QYGA 4ML9A 3L7RA 1MMFA 4F79A 2VRKA 1OFBA 3ATZA 3HQOA 3TXVA 1LRTA 3WUBA 3TAOA 3P74A 3G0XA 4KERA 2NX1A 3BJFA 4N4PA 4OOZA 3NM1A 3PUDA 1HKVA 4OZOA 2NQ9A 1S5WA 1RD5A 1EF3A 3LNMA 3VD9A