3W86A

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with sh-1-96
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Dihydroorotate dehydrogenase (fumarate)
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with SH-1-96
rcsb
source organism Trypanosoma cruzi
total genus 104
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2013-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w86A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w86A01
4PL1A 2H8XA 4JICA 4EWND 3MI2A 1A5SA 3SSJA 1SPQA 4O1AA 4K37A 4XKYA 2WNZA 1YDOA 3HG4A 5G2IA 1IXQA 1QFEA 2VFEA 4AF0A 5KMYA 2H3BA 5FF4A 2EF9A 1I2PA 4WQ6A 3TQ0A 4A22A 5I3JA 1J4EA 2X1SA 1K7EA 4IXHA 1TV5A 5CPLA 2QUVA 3DI0A 3PF3A 3EKLA 1Q6QA 4O57A 3IGXA 1N8FA 1SSGA 4BI7A 3NM1A 1R2SA 4UTTA 5IBXA 3W22A 3A22A 3LTYA 4LY8A 1SO6A 3LCLA 3OEXA 1GT8A 1VHNA 4EF8A 3S5OA 1R30A 2A7NA 2DZSA 1P4CA 3M5VA 3EWBX 3W2NA 3B05A 4GUHA 2RFGA 1T8XA 3PR2A 4JDYA 2VFGA 4NNCA 3UPWA 1DHPA 3NPXA 2VXNA 3LHZA 4CQ9A 3ZS4A 1I8JA 1WX0A 4O8RA 4HNTA 2V81A 3PAJA 2FPVA 2WKJA 3G8EA 3HG5A 5BMXA 1LOLA 3LERA 2WNNA 1KW1A 4PCFA 2EAWA 2Z0IA 1P0KA 2C13A 4LVDA 1FXQA 3C8FA 2WSQA 1PHQA 1TB3A 4IGHA 1KV5A 3MP5A 3A23A 3KHJA 1CI1A 3EEGA 3ABQA 1KFKA 4C1LA 1KBJA 1IGSA 4H6KA 3T44A 4BK9A 1EP1A 2O7QA 4NJKA 2DJXA 1QPNA 1TPVA 2ZRYA 1ICQA 1XM3A 3HPZA 1KTBA 3PBUA 2PRMA 3N9RA 1GVQA 3DKLA 1C8VA 3SGUA 1H63A 2Z6IA 1THFD 3BK0A 3MW7A 1W54A 1ZAHA 4K6AA 3UY7A 2Q8LA 4ZQOA 2EKCA 1F5ZA 4X3ZA 5A5WA 1XL9A 2NV1A 3W7PA 1YXCA 1X1OA 4UUIA 1DV7A 4UTLA 3WJSA 5G1YA 1GOXA 1NF7A 2BSLA 1XBZA 1GVFA 3W3OA 4DPQA 5LZLA 3OVQA 3NG3A 1Q45A 4UMAA 1XXXA 1WQ5A 1PS9A 1GTEA 3GR7A 3S8HA 1OYBA 1W5QA 3W7GA 1G4EA 1O60A 2QAPA 5LGZA 1GEQA 2NX9A 4M6PA 2OJPA 4DBEA 3OBKA 1UASA 4LC6A 3VCRA 4UR7A 5HWMA 4X22A 4FNUA 1TPFA 3NL3A 1UUMA 2CLLA 3CLMA 2I14A 4OT7A 1L6WA 3TROA 1IIHA 3KFTA 3LDVA 3EWWA 1PHWA 3KX6A 3Q58A 5D09A 4L4LA 5ABTA 2QCLA 4UTKA 5J5DA 3W7KA 3S1VA 2NX3A 5HINA 1BWLA 1GJPA 2P0OA 1RQEA 1L6SA 2RHGA 1BEUA 3LCIA 4MZ8A 1I2OA 2ZZ5A 4N4PA 2V30A 1TPUA 2WO5A 4YLWA 2YW3A 2YFOA 4M7TA 2V8ZA 4JGDA 3NQFA 3TX9A 2FB3A 3EB2A 1HO1A 5FF0A 1XI3A 3FYPA 5CKSA 3BLFA 2VOMA 1W56A 2TRSA 2A85A 2ZRXA 3GK0A 5U7SA 2YX0A 4HSNA 1M6JA 2BWGA 3L2IA 1C9DA 3MYOA 3PS7A 3PM6A 1NAL1 3S1WA 5AYXA 3OG3A 4LTSA 3UYCA 1H50A 4JTUA 1HUVA 2QF7A 3UWVA 3S0CA 5KTLA 2UV8G 5AN7A 4HPJA 5AC7A 4FHAA 3G0XA 3O6CA 4O14A 2CZDA 2GQ9A 3W7OA 3G3DA 1WOBA 4MLJA 4GRSA 5BOOA 3VI2A 3TR2A 1J2WA 1XKYA 3HF3A 4PTNA 3W2JA 4AWUA 3LCHA 3NNTA 2OMAA 2WV8A 4JIPA 4PODA 1ZFJA 1LM1A 1I45A 1K03A 1RPXA 3TXVA 1NSJA 4MLRA 4Q33A 1W8SA 1ZENA 3LX9A 4HT3A 4RZ6A 1YDVA 5CGQA 1F76A 1EP2A 5D30A 1AW5A 3NQCA 4K7YA 2J24A 4JTFA 5EY5A 4BFAA 4AVFA 5I3IA 3PY2A 2YDAA 3N9SA 1HG3A 2VFDA 4KWVA 5D05A 2QCHA 1W5PA 2OZ0A 1FY6A 4ORIA 2E5DA 2J9YA 2ZZ3A 4LVFA 4NZJA 1UCWA 4O28A 1GVOA 1A5AA 1H62A 2ZBTA 1KM4A 3FEMA 3EXRA 4K36A 1SSDA 3W75A 3UZ5A 1XUZA 1S3HA 1A5CA 1JULA 2OX1A 3H55A 3O1NA 5AYYA 1S5WA 1J5TA 4O13A 3VE7A 1RV8A 1DQXA 5HUOA 3PVFA 3UQNA 3HG3A 5GVJA 3TSMA 4CNPA 3W1UA 3KVMA 2QCNA 3LHWA 4JEQA 4JNMA 3F1QA 2H90A 3FKKA 4TIMA 4JTSA 1VS1A 3ABSA 4UFHA 1XUUA 1GTHA 3TAOA 4Z1AA 3O07A 2VEMA 5HQEA 1Q6OA 4XBSA 4FX7A 5I3HA 3HGSA 4I7VA 1KLZA 4LNYA 3W72A 3UWUA 2ZDRA 3C2OA 2YZRA 1RZMA 5HR7A 4I7WA 4NVTA 4B5NA 8TIMA 1OFDA 4IMDA 5D2XA 4OWGA 1ZAJA 2ZZ6A 1EEPA 1E51A 1XC4A 4H4IA 4OHQA 5HR6A 2NWSA 5D04C 4GUFA 4IX0A 1CX9A 3R89A 5AHLA 1AG1O 1PCWA 4U28A 4WY0B 2C3ZA 3NQAA 1HO4A 4GFSA 4LVGA 1LLZA 3F4WA 1H7RA 2PE4A 3O15A 3WJXA 3PSVA 4O12A 1Q6RA 3NVTA 3F03K 4JTIA 2WSYA 1VYSX 4MYAA 1JUKA 4MPQA 4U4MA 1QNVA 1GVSA 2YSWA 3M5XA 4N9DA 2ZZ7A 1TRDA 3P5YA 3V1PA 1VCGA 3C0JA 3S6DA 3MMTA 3G1YA 3W2UA 5D02A 3L66A 4ZMGA 3P81A 1IIGA 2AAMA 3I7RA 4O0ZA 1B9BA 3LB0A 1H1YA 5IM51 3NQ6A 2HTMA 2CZEA 4I7UA 4MJMA 3PC0A 2DZPA 2TSYA 3TFXA 3W1MA 3L0NA 2G95A 3LHVA 3IVUA 1YPIA 2QJHA 1WXJA 3G0SA 1TSIA 1DL3A 1GG1A 1M7PA 2A0NA 2KZHA 4NXSA 3DU0A 5FEWA 3DENA 3INPA 4Z1DA 4LW7A 4ZQCA 4JTKA 2VEKA 3L68A 4XTDA 3CEPA 3P62A 4UFKA 1OVDA 3GXTA 1B57A 3LI0A 4K7VA 3W1RA 5D2YA 2E77A 3R13A 2A2IA 2TYSA 1I2QA 5DN1A 4HKPA 4IQLA 3IIVA 3FFSA 4ADTA 5G2HA 1TV7A 1FQ0A 3TXZA 3N34A 3M5ZA 3W7RA 2CW6A 3UPBA 4M7SA 4FNPA 2V2DA 4OE7A 3QPZA 2E6YA 2NWRA 1XDMA 3FYOA 2E6FA 2ATMA 4Z0SA 2DZTA 5K4XA 4XZ9A 5AC8A 4JY8A 1Z42A 4QJ1A 3S1UA 4DF2A 5EPDA 3W6YA 3ZR4A 3C4UA 3QQ1A 3R8RA 2A6NA 2ZFAA 2C15A 5F2GA 2XN1A 3PULA 1TO3A 1N7KA 2OT1A 5D37A 5EMUA 3DAQA 5LNRA 2JKPA 1HL2A 3HO8A 3OVPA 4XUGA 2X2GA 4BWLC 1KM2A 1AL8A 1A5BA 1SFLA 4O1BA 3TV8A 1OFBA 3T4CA 3HBLA 1VJIA 3E96A 2GVGA 3QC3A 4RK8A 4BF9A 1Y0EA 1VGAA 2JBMA 2EHHA 1OJXA 1KFJA 3S5NA 3CU2A 3GKFA 5D32A 1YADA 2GOUA 1TPWA 3I6RA 1SUXA 3Q37A 4O1CA 4Z08A 3NL2A 3MJYA 1K7FA 3SECA 1TTPA 3CC1A 5AOUA 3IV3A 4AEOA 1W3NA 3KVLA 4LUJA 1UBSA 3FS2A 3L5MA 1SW3A 5F2LA 3B0UX 2ZA2A 3FIGA 5AHFA 3BW2A 3L65A 3C61A 2A7RA 4ZZ9A 3C2EA 3CIXA 5F1VA 3RMJA 2E6DA 4LRSA 5AC6A 4ADUA 1KM3A 4JTEA 3ZFHA 5EA9A 3SR7A 2VENA 3LRMA 3PBWA 4LV4A 3EX3A 3TJXA 3W9ZA 3W2MA 2FPYA 4N6FA 3W7LA 4NNAA 1QDSA 3MO7A 2CFFA 5KZMA 4UTJA 2WOQA 1ZNNA 1KV8A 2JGYA 4IMEA 3W1TA 3O63A 1Z48A 3C56A 4JTGA 4O54A 3WK2A 5HUPA 2DZUA 1O94A 3EX4A 3EX6A 3PUEA 4WZHA 4DO5A 3W1XA 1LRNA 3LCXA 2Y85A 3GAKA 3BW4A 4QIUA 1ADOA 1KFEA 4N2YA 2CLMA 3CM4A 1ZY9A 3VFLA 1SO5A 1FCUA 2FDSA 1W5OA 5LSMA 1FBAA 2NLIA 3N14A 3EWUA 3W1PA 4NJIA 1EP3A 4Q32A 3MHGA 3KVJA 1I2NA 4K38A 3QRHA 4BR1A 3OIXA 4DBDA 5KINA 5DCBA 3C3NA 1LYXA 4Q4KA 4LT9A 1ML1A 1KM1A 1WAUA 1I4NA 4S2BA 3BO9A 1AW1A 3W1AA 3NQ2A 4WJEA 3N19B 3NR0A 4OV4A 1TTJA 3ABOA 1XBVA 5I3GA 3GLCA 1X8FA 5G4EA 2BZNA 5F1UA 3TFCA 1L2UA 3QJAA 2B0MA 1OX6A 1KFCA 4JDBA 3GNDA 4PA8A 3LXBA 1CW2A 1TIMA 2X1UA 3WJZA 4MY8A 4ONVA 2YGYA 3GXPA 3S42A 3SZ8A 3NQDA 5HULA 3W7HA 3HQ1A 1OG0A 1VRDA 2X30A 1PE1A 3P67A 5K3VA 3T78A 3EXTA 4AHQA 1SU5A 1SO3A 3PG8A 1TYGA 4G1KA 4MJZA 4UTWC 4TMBA 1LRTA 3PB2A 3RF9A 1RQBA 3STFA 3TNOA 1ZAIA 3NPVA 3B04A 4X2RA 3STEA 3W1QA 2C6QA 4GE8A 5KZDA 4O53A 3P82A 1AMKA 2FQIA 3G3MA 5I3KA 2Y62A 1PV8A 3NEVA 1FWRA 3CPRA 4Z1BA 3W73A 4PC8A 2Y61A 4IWWA 4JTHA 2YFNA 3I65A 1UUOA 3BGJA 3P80A 3NDOA 2VELA 2HSAA 3L5LA 2FFCA 4FF7A 1IF2A 3DBPA 1SR9A 3W2LA 4E2BA 1MSSA 3BG5A 5HWJA 1OX4A 4QITA 3NL5A 1OX4B 1A53A 2PRHA 2BXVA 3LRKA 4DO6A 3W2KA 2J27A 4P2VA 4UFLA 2DZWA 5F4WA 1JQVA 1ZHAA 3PWAA 1T96A 2Z2UA 3DFPA 5DBTA 3LBCA 1TREA 4FO4A 4JD4A 1TQJA 2C16A 2HS6A 1TMHA 1QCWA 3PSWA 4FXRA 3P60A 3NQGA 3RNDA 3RFAA 4JIQA 2NUYA 4JS3A 1R2TA 5K4ZA 3A9IA 1RR2A 2OT0A 4FNSA 4ALDA 3N2XA 1P0NA 4O11A 4IJBA 1ME7A 4O10A 4AXKA 3B03A 3TC6A 4GWEA 1IXNA 1LTDA 1AL7A 1W5NA 3ATZA 4O16A 4ADSA 1C29A 1QO5A 4KFPA 3MP4A 4BI5A 3DHDA 2AGKA 5D38A 3I7SA 2DU2A 1H7WA 3SI9A 3W74A 2Y70A 3DKJA 4FB7A 1MZHA 1LLWA 3O8AA 4IXXA 3NQEA 3TMQA 1S5TA 3UZJA 3B06A 4UMCA 5L9FA 3W84A 5EYWA 3MWAA 3EX1A 3GZ3A 2ZZ4A 2ZA1A 4TR9A 1ZALA 1LBMA 4NJHA 4UTMA 3LRLA 4NT0A 3M16A 2GVJA 2FPTA 5KZEA 2E5CA 3BV4A 3HGOA 3NXFA 4RZ5A 2GJNA 4NX5A 4WXYA 2V5LA 2X1TA 2VFFA 4UNLA 4MZYA 3TC7A 5LHEA 3QQ0A 4NJGA 3W7CA 5BNKA 1YTDA 1MEIA 4GUGA 3KAOA 3M7WA 4UTUA 1AK5A 3THAA 3EWZA 3BW3A 2CLIA 2WJZA 2NXGA 4IUOA 1WBJA 5F4SA 3IGUA 1N55A 1VPXA 5U4NA 1VCFA 3U2OA 2C1HA 3STGA 4UFMA 4LS2A 3QW4B 4RX0A 5LNVA 1OHLA 1QPRA 2ZRZA 1QPOA 2FTPA 4M6VA 2ISSA 2DZXA 5DELA 3O05A 2PRLA 1ZCOA 4LRTA 3SIZA 5EBUA 2EPHA 2CLFA 4M5PA 3USBA 4K39A 1GPWA 4QM1A 3QH2A 3FJ6A 3O16A 2J6XA 1T99A 4ZL1A 3ELFA 1FWNA 3W85A 3YPIA 1T0OA 4JN6A 3BLEA 1K3UA 1VC4A 4KFOA 1FDJA 1H1ZA 5G5IA 1EPXA 1EIXA 3WK0A 1EA0A 2G5WA 5AHIA 1LROA 1R2RA 4YL2A 4CNOA 1XFBA 2Z6JA 5CG7A 2B4GA 1TPDA 1FX6A 3TUUA 1TCDA 5F4XA 2GQ8A 3GIYA 3TQKA 1MEWA 3O6YX 4QISA 3NL6A 1SZFA 3TDFA 3M47A 3R5EA 3P61A 3LI1A 1PVNA 3TSDA 3TW6A 1DORA 5K9DA 5DXXA 2ABAA 5E0KA 1F7BA 2WSRA 2G96A 1H51A 2Y7GA 2ZTKA 3NPWA 3ZWSA 3UY8A 1XCFA 1ALDA 4FNQA 5FF7A 1L9WA 3UXDA 4WY0A 3GR8A 4WXZA 2VC6A 1LBFA 1W1ZA 2NXIA 2JKEA 3W23A 4IPJA 4MKNA 3HIJA 4YMZA 3G1HA 2QCFA 2R94A 3WK1A 1LP6A 1OYCA 5G2WA 1JCLA 5DBUA 2ISVA 3G1VA 3W7NA 1KTNA 4BI6A 3TJLA 3T7VA 1O5XA 3PBYA 2QKFA 2ZRUA 3GKAA 3HOJA 2QEZA 1TQXA 1F73A 4AHPA 1X1ZA 4TO8A 3RLVA 4N9CA 1TPC1 5C6MA 3FKRA 2B7PA 2Y6ZA 3DXIA 3G1DA 4FIQA 4FX8A 2I1OA 2QCDB 3NZRA 2D73A 3U8GA 3W7IA 3BARA 4O4WA 3DI1A 2GPTA 5TQLA 1UJPA 4O17A 4JYFA 3CTLA 3KRSA 4N4QA 4DF1A 5G4WA 4DXVA 3NYZA 3STCA 1FXPA 5HMSA 2GJLA 1OFEA 1IXOA 2ZQ0A 4IMFA 1O95A 3HGRA 3QYQA 3HMJG 3KRUA 1Q3NA 4CCEA 6ALDA 1EB3A 1QMLA 5A8GA 3C2FA 1U83A 1O4UA 1ONRA 1ICPA 3LHYA 2GUUA 3B8DA 4NJJA 3GAYA 2V82A 1SW7A 5DY2A 2ZA3A 1H7OA 2QJIA 3GDMA 1PL9A 4UTTC 3W87A 5IBXC 3E12A 4GNJA 3QF0A 3EXSA 1W31A 5LKYA 3NQ7A 3IEBA 4UMBA 4O50A 2TPSA 1JRBA 4Y8FA 1OFPA 1DQWA 4NXKA 3N73A 2R8WA 4I9AA 4O19A 4PFMA 3G1SA 2O7SA 4CCDA 1SZNA 5F2IA 4RKAA 3TE9A 2NZLA 4IX2A 4ICNA 3S9YA 1K02A 2W79A 3C52A 2FB2A 1HTIA 4LV9A 1QAPA 4HPXA 5D03A 2NUWA 4M6QA 4JYDA 3P7YA 3T40A 4ML9A 4QSHA 1FUYA 1G6CA 2ZZ1A 1JQXA 4XTIA 4CQAA 1JCMP 4JYEA 1F6PA 1VLIA 2YPIA 3G24A 1JR1A 2QDGA 3LTPA 3TQVA 2PURA 3C2RA 4A29A 1F2JA 1VYRA 1OF6A 5EL1A 1VCVA 1JCJA 3LXCA 3GNNA 3NA8A 1WOAA 3D0CA 4POCA 2Q3RA 2Y89A 3W7EA 1X6UA 3E49A 2QJGA 3H53A 5BRBA 3E0IA 4NNBA 3QFEA 5CZTA 1ME9A 5CPMA 4IOTA 5DCDA 3TMLA 1TJPA 2A21A 4O4VA 1UB3A 1O5KA 2QDHA 4GJ1A 1RVGA 3T55A 1WDWA 1K7XA 3LOTA 2C19A 1YTKA 4MVAA 4MIMA 1YDNA 3L9CA 1SFJA 4OGZA 4RR4A 1QOQA 5LNUA 4NQ1A 1EX5A 5KITA 4QNEA 5K9CA 4YCOA 4WUIA 4RLIA 4EIVA 3M9YA 2WQPA 5MHBA 2QUTA 3Q2DA 3UXAA 3P8JA 2J88A 3HB9A 4DQWA 1OK6A 4GUJA 4HIBA 3EX2A 2B7OA 1Q6LA 4KFNA 1XBXA 3W7MA 2V9DA 2RH9A 1TJRA 4MOZA 3FA5A 5EKYA 2YR1A 1Z41A 4Y90A 3E9AA 3RU6A 3TCEA 4XKYB 5H91A 1JUBA 4UXDA 3B0VC 5K2ZA 3DZ1A 3HJZA 4AF0B 5FF3A 3SJ3A 3LCFA 4N9EA 4RXFA 2IQTA 4EOUA 1LORA 4KKXA 1JRCA 4KWWA 1TPEA 2CLOA 3SFKA 1F05A 4UNKA 2A7PA 4DF0A 1KM6A 3FJLA 2VFIA 2ZZ2A 1W3IA 3NGJA 3KVKA 5BMWA 5CZ0A 3A5FA 2QCMA 3G1FA 1VR6A 1U5JA 2NXHA 3LTSA 1G4TA 1W5MA 3MHUA 3I68A 2RDUA 3BG9A 3IIZA 3PB0A 5FEPA 3L0GA 1FDYA 2LLEA 3WK3A 3IRDA 4HSOA 1B3OA 3NOEA 2X1RA 2W6RA 1AW2A 4OU1A 1KBIA 3L67A 1LRQA 4NU7A 2E1DA 4RJEA 4E2DA 1YYAA 1ICSA 3TIMA 4QNWA 3LCWA 3W83A 5AB3A 2ISWA 1OK4A 4HNNA 4Y96A 2XN0A 3W07A 3M44A 4UTIA 3NQMA 1PCKA 3NAVA 1FWTA 3SGZA 2H3DA 1BKSA 4BWLA 3VE9A 2YXGA 5D33A 1KFBA 5F2MA 4AB4A 2ZTJA 1SW0A 5G1TA 1GG0A 4DO4A 3QZEA 1R46A 4MY9A 5HJLA 5CZSA 3G22A 4JXCA 4WD0A 4E38A 1YXYA 3GX9A 1YTEA 1KM5A 4H3DA 1LCOA 3C2VA 2P10A 3IIXA 4LVBA 3TU9A 4CLMA 4GXMA 5AYZA 1GVRA 3OVRA 3O06A 1B4KA 3CHVA 3PUOA 2YW4A 3W86A 3W70A 4IPIA 1QPQA 1G67A 4NZFA 2HS8A 4AWTA 5C2XA 4UIOA 1PIIA 5SWUA 1GYLA 2BLEA 3CWOX 1D3HA 1QR7A 4MUZA 5C5YA 1F6KA 3TK7A 2ABBA 4LWWA 3JS3A 2A1YA 3AJXA 3B4UA 3MBDA 3RK8A 2V2CA 5E1QA 1K8XA 3W76A 2VFHA 3G1XA 3R12A 3PUDA 3BPWA 4OBTA 2JK2A 3EWYA 4A21A 4UTHA 3A24A 3GB6A 3M1ZA 4HNUA 5AHEA 3QSTA 5J5RA 4AMAA 4R33A 5I3FA 2AQWA 1W3TA 5DY3A 3CWNA 4N9BA 3DFSA 3PG9A 2CLHA 2OCZA 4UC5A 2NX1A 2ATSA 1TPH1 3L0KA 4W9TA 4ZQMA 3LM7A 4R7JA 1JCYA 2WNQA 4O0KA 4LU0A 5E93A 3G1AA 3C6CA 4R53A 4JX5A 1JCXA 1TPB1 5LNWA 4FNTA 1SO4A 3N3MA 1FCVA 4DEFA 4GBUA 1DOSA 1ME8A 3M6YA 4HNVA 2H8ZA 5D2WA 1NVMA 5L6UA 1OFOA 4JX6A 3NZ1A 2XN2A 5FF2A 3M41A 1D3GA 3GVGA 4UFIA 3QMSA 1TRIA 1NF0A 2FJKA 3S1XA 4CQ8A 3GDKA 2CLKA 1G7VA 4RXGA 2J9ZA 3UWZA 3LHUA 3UWQA 3O6DA 2C0AA 3W7QA 1TTIA 4P61A 4FXSA 3QM3A 1YXDA 2V5BA 1BWKA 3B0PA 3LXAA 3MBFA 1WYIA 3LHTA 3KXQA 5LNSA 2VEPA 1QOPA 2GVLA 1K8YA 3I7QA 2VKZG 4JTLA 2E68A 2A5HA 3LBMA 4AHOA 5DCEA 3AO0A 3R2GA 3DHFA 3GDRA 1VLWA 5AHNA 3L21A 5K9XA 1LOSA 3BG3A 1OFRA 3QMTA 1P5BA 4PL2A 6TIMA 1MEHA 4YXGA 4K8EA 2A4AA 1DJQA 2BX7A 1VH7A 5H2ZA 7TIMA 4ORMA 3DFQA 3NPUA 4A3UA 2Y7EA 5FI8A 2R14A 5AFDA 3UD6A 4UR8A 2ZCGA 1FWWA 4JY9A 1OFQA 2RDTA 4Z0JA 3QSRA 2XFWA 3UWYA 2JKAA 4QAIA 1Z44A 3GDTA 2FIQA 2B7QA 4K8HA 5C55A 4OQVA 1QO2A 1H7XA 3NQ8A 3WJWA 3EWXA 3N2MA 1RD5A 4AH7A 4UTWA 4FIRA 4GUIA 5DLCA 3IVSA 5CPOA 1KLYA 1GZGA 1W37A 4A2RA 2NV2A 3G0UA 3K30A 4EF9A 1A50A 5CSSA 3LV5A 2FLIA 3VNDA 3NQVA 2TMDA 1G4PA 4NUWA 4D2JA 4XWUA 4LUIA 2Q8ZA 1SZEA 3M0ZA 4S2CA 2CLEA 4R34A 3WFAA 3DGRA 4XBKA 2WPBA 3ANYA 1LBLA 3VKJA 2QAFA 3EKZA 4IMGA 2X16A 3JR2A 3DFTA 1X7FA 4UCGA 3CQ0A 3M5YA 2DJLA 1WV2A 1KTCA 3H54A 1D9EA 2QCGA 3OA3A 1VZWA 4XQ6A 4S1FA 4JX4A 1OFAA 1B4EA 4JTTA 1DJNA 5TIMA 4J9JA 4O52A 1QWGA 1R47A 1KFLA 3MYPA 3HGJA 2Z1BA 1LOQA 3GDLA 4MY1A 3UNDA 4Y9AA 2EGZA 2F84A 2ZRVA 3WJYA 4LC8A 2F7FA 3MP3A 3ATYA 3W71A 2I9EA 4JR5A 2A6LA 3Q94A 3QMRA 4N6EA 2H6RA 1I2RA 1XDLA 4LS0A 1JUEA 1DKWA 3NM3A 2QR6A 2E5BA 3JRKA 3MI6A 3THQA 2E09A 4DELA 2CWNA 4Y6GA 5D2VA 1EUNA 1EUAA 1GQNA 1M7OA 3V75A 4O18A 5LGXA 5CSRA 5D2TA 3LLFA 1H7PA 3W1LA 3KRZA 1JVNA 3NO5A 3LGEA 4HN4A 3BVJA 3RLUA 3TA6A 3W7JA 2DZVA 2C14A 1G69A 4TMCA 3LV6A 1H61A 1JCNA 1H7NA 2R91A 3GXNA 4RCXA 1H5YA 3MUXA 1M5WA 5CPNA 5LHFA 1SZGA 2QCDA 1EWEA 1GYNA 3TAKA 3TW7A 1LDCA 2NUXA 3TH6A 3CT7A 1S5VA 3DFNA 4Z1CA 3P5ZA 4ZVJA 3E02A 1MO0A 4RV8A 4E0CA 3BGGA 1SQ7A 4MFDA 4FX6M 4IMCA 1TTQA 2ALDA 1VHCA 3HPSA 4MYXA 2B7NA 4LS1A 2RDWA 1FDZA 3PBVA 3A5VA 3IVTA 2Q3OA 1YLVA 1OX5A 1OYAA 3UWWA 3QPYA 4WY0F 4ZQPA 5BW6A 3P74A 1LZOA 1DBTA 4WX2A 5AHMA 5C54A 2PC4A 1YPFA 3W88A 5DXYA 2ZYFA 3DFOA 3BLIA 1V5XA 5FEXA 1GWJA 3TSBA 1RQHA 3ZWTA 3P84A 5TBOA 1K8ZA 5HWNA 1G7UA 1TV8A 1HFBA 4FNRA 1WA3A 5FEZA 3DH7A 1IXPA 4O15A 1H60A 4ZQRA 2J9XA 3W1NA 1KM0A 2QCEA 4FEZA 2W0UA 4L4MA 3LCGA 2YYUA 2BTMA 5CZJA 3GYEA 2Y7FA 4PH6A 5K7JA 4A2SA 1F74A 4ZQNA 4WOZA 3S5YA 3KOFA 4HHPA 4WOQA 2ZRWA 4MZ1A 3G18A 1XBYA 1W0MA 3G8RA 3OHIA 3F4NA 4DPPA 2E6AA 1OF8A 4RZ4A 2YYTA 4TU1A 4O1DA 1G4SA 1VQTA 2CZ5A 2GQAA 2Y7DA 4AWSA 1JJKA 4OV9A 4QQ3A 3S5ZA 2C18A 1P1XA 4MFEA 1MXSA 3MHFA 2JGQA 2G97A 2DP3A 3TKFA 4UFJA 4GC4A 3A21A 1FCQA 3LLDA 3IGSA 1EWDA 2CZFA 3FOKA 3ABRA 2QCCA 3W7DA 1VYPX 5FESA 3CIWA 3L5AA 2YCEA 1FCBA 1NFBA 2RKXA 3HG2A 4YCPA 3P8IA 4PEKA 4CCCA 2QUUA 5HNRA 4YWIA 3CEUA 4LOCA 4TX9A 4N02A 3FLUA 3IIPA 4X9SA 1NEYA 5T26A 4CNNA 3U6WA 2Y88A 3SW6A 3HPXA 1ZJIA 2VEIA 2Y63A 3MI3A 3CB8A 2CU0A 2PCQA 1OABA 1KA9F 1L6YA 1V7YA 3QEZA 1WBHA 4LVAA 5KSWA 4AAJA 2P1FA 4C1KA 2V2HA 1BTMA 3M43A 1DVJA 2HMCA 3QW3A 4JTJA 3SY5A 3IIOA 4M19A 1FWSA 2V0TA 2DORA 4EVZA 4NX0A
chains in the Genus database with same CATH superfamily
4JICA 3IV8A 5FSEC 4O1AA 4XKYA 1EHAA 3KDOA 4Q7NA 1YDOA 4XG1A 4Q22A 1QFEA 4M80A 1N8WA 4AF0A 1H11A 2MNRA 3UR8A 1Z32X 3PPFA 4B4FA 4WQ6A 3T42A 1K7EA 4C91A 1F4AA 3B8TA 4O57A 3IGXA 1MQPA 4P7NA 1Q85A 2ONEA 1IEWA 2PODA 1SSGA 4BY3A 4BI7A 3NM1A 4NASA 5ABHA 4GIAA 2DW7A 3DEQA 1TUXA 4OECA 5LA2A 3ARQA 1VHNA 1R30A 2DZSA 1P4CA 1FVPA 3EWBX 3ZR5A 4LYKA 3WQPA 3WNLA 3TJIA 1NFPA 4JDYA 4DNMA 2VFGA 4NNCA 4QXIA 4KWOA 2GDVA 2QW5A 2WKGA 3P6LA 3WLTA 4O8RA 4HNTA 3BV7A 1V02E 5GJMA 4GG9A 5ENLA 3ITTA 1KNWA 3PAJA 2DZBA 2WKJA 3G8EA 3HG5A 1R5YA 2OZ3A 2JALA 3VM5A 2WNNA 3HJEA 1XD0A 4FLOA 4Z2HA 2XJ7A 2EAWA 2Z0IA 3BQ6A 3GIPA 2W66A 4BKNA 3CHFA 4H8UA 4ZSUA 1FXQA 3C8FA 6XIAA 1TB3A 2J8GA 3A23A 4D6EA 4HD5A 1YBQB 2YCIX 3PBMA 1H3GA 1KFKA 4C1LA 1KBJA 4DUXA 5JU6A 5HK4A 1U30A 1FWBC 4DAFA 2DT3A 2DJXA 1QPNA 2ZRYA 5A69A 3C86A 3KE0A 1YMYA 2NT0A 2O9RA 5FJIA 2Y5JA 2Z6IA 2CZVA 1RD6A 1IEQA 2QDDA 3B0XA 1THFD 1ZAHA 4PBFA 3NDYA 4M3PA 2DT1A 1E4NA 1SFTA 3WMLA 2VL4A 4LB3A 1F5ZA 2PWUA 4PB4A 4X3ZA 1JPMA 4XAGA 3W7PA 1DV7A 3OP2A 4XD3A 6XIMA 5G1YA 1GOXA 1RLCL 1I75A 1IR2A 5LZLA 3N4FA 3OVQA 3NG3A 2DT0A 2UZ9A 1GVYA 4UMAA 1QI4A 1WQ5A 3H4WA 5CPQA 3FDKA 1G4EA 1E9LA 3WMCA 1GEQA 4M6PA 2V3GA 2WKLA 4DBEA 3OLGA 3OBKA 1UASA 1UKTA 4FNUA 1TPFA 1ZP4A 4R3UA 2CLLA 4OT7A 2XSBA 3UU0A 4CKQA 2QJMA 3KFTA 1QU4A 4IPLA 4LUTB 3KX6A 3Q58A 1YKWA 4HPNA 4KIRA 2XIJA 4HA3A 4AYGA 2QCLA 5CQ1A 2QQ6A 1JZ2A 2QYGA 1A5MC 2NX3A 4M1RA 3H70A 2RHGA 1O5QA 1B3YA 2ZZ5A 5BWAA 4KRTA 1QHPA 2YW3A 1XRFA 2JEPA 1E6SM 4QAWA 1UOZA 5FF0A 1XI3A 1GZJA 5CKSA 3THUA 3MCMA 2TRSA 3EOOA 1ADDA 1K70A 2ZRXA 5LIKX 2PGEA 1UQYA 3PZNA 4MDPA 3L2IA 1IEIA 3F4CA 3S46A 3CIVA 3L12A 5CBIA 3VD9A 1E72M 1H50A 4LGXA 5I0DA 1UWTA 1V93A 4O14A 3F5JA 2OYMA 4EAMA 2GQ9A 3ONBA 4MLJA 3T09A 2EPMX 3T07A 3CL6A 1BF6A 1J2WA 1V0MA 1EPVA 3QC0A 3W2JA 4J4KA 4CQCA 1QK2A 1LM1A 1PKNA 1RPXA 3TXVA 4JHOA 3ARSA 1NSJA 4MLRA 4FLQA 4Q33A 4RZ6A 5D30A 3VAVA 2OPJA 3NQCA 3CV2A 4PUWA 1JYWA 3WDJA 4EAYA 2X05A 1PB0A 4AVFA 4D6FA 1OCNA 2YDAA 3N9SA 1HG3A 1NP2A 5I5RA 2OVLA 3CAQA 1HX0A 3O9NA 2OZ0A 2WSKA 3ARRA 2GGHA 2E5DA 4LVFA 3LLXA 3FVDA 4GMEA 3UT0A 1A5AA 1H62A 2DQXA 3CYVA 4HNCA 3UZ5A 1S3HA 5M3WA 4DBSA 2OX1A 5AYYA 4E8GA 1ZZMA 1J5TA 3BJTA 4O13A 3VE7A 1RCOB 2ZUTA 1RV8A 1S5MA 1FRBA 4D9PA 5IHRA 3TSMA 3RYSA 4W87A 3BLOA 4XZBA 2ZXDA 1XLIA 5IFTA 4ZODA 3WQFA 4GABA 1XLMA 4AZ5A 3ABSA 1XUUA 4ZENA 2WB5A 1CECA 5HQEA 1XICA 3PNUA 1R87A 3OQ8A 1V7AA 5DEZA 3UWUA 3OZYA 4G1NA 1XF0A 4B5NA 4IMDA 1HKMA 1ZAJA 1EEPA 3EB3A 2YBTA 2C91A 1LL6A 1UYQA 4Q4OA 3R89A 1RBAA 1Q2SA 3MPGA 4DJDC 1WZLA 2H9AA 1IQ8A 3OPSA 4LVGA 1VFOA 2J47A 3SN0A 1UIOA 1H5VA 4RV3A 3TN4A 2PDPA 1Q6RA 1B0IA 3F03K 1A3WA 3R11A 4JTIA 1LT7A 2WSYA 4GI6A 4G7EA 5E0CA 5C71A 2YZ5A 4MYAA 4B91A 2R82A 4MPQA 2QJJA 1W3KA 3VDGA 1Z3NA 3C0JA 4YS1A 2YCJA 3MMTA 3W2UA 4NG3A 1TZ9A 4W7VA 5D02A 3P81A 1IIGA 3WDQA 3I7RA 1B9BA 2ISFA 5IM51 3NFUA 3MT1A 3NQ6A 4HNOA 3H6OA 1W1YA 3IUDA 3L0NA 2G95A 8A3HA 2QJHA 3BLDA 4N7QA 4XO7A 1TSIA 4NXSA 1GG1A 2OODA 4TTGA 3DU0A 3DENA 3VNZA 4DWSD 1JNEA 3ZSTA 2V69A 2VEKA 3P62A 2DPEA 2E4TA 2GJRA 1LWIA 1B57A 5PTDA 2J25A 4K7VA 2O4MA 2J7DA 2WWCA 4AIBA 1I2QA 5DN1A 1XRSA 2MANA 2RGMA 1OC7A 4QCEA 2HNHA 2VOTA 3SQLA 1DWAM 3N34A 1TMLA 2KX9A 1UQZA 1AQHA 1PIGA 3WF0A 4AD5A 3IS4A 1UZDA 3DUGA 4Z0SA 1O12A 2DZTA 1UD6A 1IWPA 2HK0A 3BANA 3V18A 3DYOA 5A1AA 3W6YA 4QCFA 2OSWA 4DYEA 4GISA 1TO3A 3KUMA 4AZHA 4C6PA 4MG4A 3WBYA 2WANA 1E4IA 4Q8QA 4XUGA 4D6GA 4RNIA 2XG9A 3EOLA 4BWLC 4GGHA 1MDLA 1JFHA 3AS1A 3FSUA 4GCAA 2GVGA 3VNKA 4RK8A 1ECEA 1Y0EA 3CZJA 5BCAA 1KFJA 2PDLA 1RCXB 1VBHA 4FAMA 2PTYA 3I6RA 1SUXA 3Q37A 4RE2A 3U7BA 4QQUA 1XYAA 2OQHA 3S6TA 4WVXA 2GUBA 3QHNA 4TQTA 3WNPA 1Q6CA 4MNLA 3B0UX 3OLEA 3G6MA 5AHFA 3FIGA 3L65A 3QY8A 3C61A 2G0WA 2V67A 3C2EA 3RMJA 5AC6A 4ADUA 2EJAA 2RUSA 4QBXA 1KM3A 5AKQA 3STPA 5EA9A 3RR4A 5F7UA 1EO5A 3PBWA 4K68A 4AIEA 1M04A 3EX3A 4PBGA 1W6TA 1BLIA 5CBJA 4GPNA 3SQSA 4FALA 3C8NA 3MO7A 1L0PA 1DWHM 1ZCCA 5I00A 2CFFA 2XM1A 4H8NA 4XAYA 3U2CA 1ZNNA 1KV8A 2JFEX 2JGYA 1J0IA 4IMEA 3W1TA 3Q67A 2CBUA 3C56A 4JTGA 1MW2A 1RA5A 1ISXA 2PD9A 2GYIA 4GIYA 4L65A 1X8CA 4JIEA 1DPMA 3W1XA 4HZMA 1FOBA 2Y85A 3O2LA 4O1EA 4QIUA 1CYGA 1KFEA 2D0FA 2VTFA 3VFLA 4LAOA 2PZ0A 1JAKA 2NLIA 4W85A 3EWUA 4Q8PA 3N04A 3UFYA 3PZQA 2OSYA 4BR1A 3OIXA 2OYLA 4GY0A 3VX1A 2ZUWA 3GG0A 3NZPA 5H6HA 4IIGA 3LY0A 3UVIA 1I4NA 3LEPA 3NO3A 1OCJA 2QLYA 3N19B 2G3JA 2X09A 5G4EA 2WCAA 4JBRA 3QJAA 2GJXA 4BEUA 4TVDA 4ES4A 1F3TA 4PA8A 5A6LA 1KQZA 5FSDC 2Z26A 3WJZA 4MY8A 4QS6A 3GXPA 2IUZA 2Z28A 3SDOA 3T6CA 3P67A 1OWQA 4PMVA 2E25A 1A5OC 1X6NA 3BUVA 2OWWA 1TYGA 4UTWC 4MJZA 4TMBA 1LRTA 1X98A 5EB8A 3RF9A 1RQBA 2GFTA 1ZAIA 3TNOA 1E0WA 3PN8A 1I6NA 4GE8A 4GZ7A 1TVPA 4O53A 3P82A 3G3MA 2FZBA 1PV8A 3PZVA 1R3YA 1KCZA 3SRKA 3W73A 2Y61A 4IWWA 1TUFA 1QNRA 2HCVA 2YFNA 1VJZA 3PZUA 4KT2A 1ZJBA 4FF7A 3EDJA 4W8BA 4E2BA 5HWJA 3H2EA 1OX4A 4QITA 3NL5A 1A53A 2PRHA 3LRKA 4ECLA 1KWGA 2DZWA 1F8MA 3S6OA 4J3SA 2Z2UA 2BHUA 2YCLA 3DFPA 1TWIA 3LBCA 4FO4A 1TQJA 3CNYA 3P60A 5G4HC 3RNDA 4CUCA 1E43A 4JIQA 1HF6A 3KL5A 2X1IA 1RR2A 1SJCA 3AHVA 2BGQA 1TIWA 4O11A 4IJBA 2QV5A 3OA5A 5CJMA 1LTDA 4HSHA 1GQKA 1TG7A 3IPWA 4KFPA 4FOKA 4BI5A 1L6GA 2AGKA 3KBJA 1KBLA 3I7SA 4UQ9A 5JXQA 1E70M 2W27A 2Y70A 3DKJA 4J2MA 1VFTA 1NJJA 2GDQA 2BY3A 4IF2A 2ZZ4A 1I1WA 4M24A 2WCGA 3H22A 1PKMA 2FPTA 3BV4A 4RZ5A 2O92A 3F2BA 4NX5A 2ZXQA 4MZYA 1UC5A 5D9MA 3KRBA 3KBSA 5LHEA 2VI0A 1JDAA 1WZAA 1YTDA 4AUBA 4GUGA 3EWZA 2WJZA 4W93A 2NXGA 3QYSA 3BZGA 5D4YA 1W9UA 3U2OA 2WSPA 2AKMA 3QW4B 5LNVA 2ZE0A 3BAWA 3LZ3A 4HGXA 4TOQA 1CGWA 2XTKA 3HZ3A 2VM8A 4LAKA 5C7VA 1TWSA 1ZUAX 1P6WA 2F2KA 3L4ZA 5HNTA 2GSJA 4WDXA 3SO7A 3O16A 2J6XA 4AY1A 4HU3A 2VGFA 1FWNA 3YPIA 2PP0A 1T6MA 1TE1A 2PAJA 1O1HA 1TZ7A 1E6ZA 3AS3A 4AZBA 1EIXA 3F2CA 3FAWA 3R94A 5AHIA 3LZ5A 4AY8A 4HTBA 1Q63A 1XFBA 4O1FA 1VFSA 3DG3A 1TPDA 1FX6A 3TUUA 1TVLA 1S38A 1V4YA 3JVAA 5F4XA 4AYSA 1MEWA 4LEFA 2XIBA 3R5EA 3ANVA 3TDFA 1PVNA 4YWSA 3PJXA 5E0KA 1F7BA 2WSRA 2G96A 1W9BM 3DN5A 1H51A 2ZTKA 5FAGA 4LYQA 3ZWSA 3UY8A 1XCFA 1NY1A 3WFLA 4FNQA 1JF6A 2D3LA 3TWBA 2IXVA 3GR8A 2W63A 3VOCA 4MKNA 1W1ZA 4IPJA 3MKKA 3RX3A 1FH8A 3R7MA 2FGBA 1LP6A 1OYCA 5G2WA 1TV2A 3BSMA 1RSCA 2WC7A 2BY2A 1CIUA 1WDSA 1TJ0A 3G1VA 4CEUC 3TJLA 2X2YA 1HJUA 3SN1A 3T7VA 3S2LA 4I3GA 3VIPA 2D2HA 2QEZA 4XD4A 1TQXA 1X1ZA 4B5WA 1D3CA 3VNYA 4N9CA 5DT5A 3SB0A 3G1DA 4FX8A 3ZVHB 2BG5A 3A3HA 2QCDB 2VMFA 2D73A 4DJEC 3SAZA 4AZ7A 9RUBA 4O4WA 4JQ4A 3T2PA 4GKTA 4N4QA 4DXVA 4MDOA 3NYZA 1FXPA 5CGTA 5HMSA 2GJLA 3V0SA 2ALRA 1U1HA 2E9BA 3CMFA 3HMJG 3L23A 2GDUA 2AMGA 1S2WA 1EJVC 4B3ZA 4GIRA 1R9ZA 3EAUA 4C5ZA 2ZICA 1EJWC 3AS2A 4BHYA 2WNWA 4DZAA 4NJJA 1Z8AA 1Q7MA 3GAYA 7A3HA 4F8XA 1NDYA 4BS0A 3ID7A 3W87A 3E12A 3KBMA 4C1NA 1FWHC 3EXSA 1CXLA 2WM1A 5BU9A 4UMBA 4O50A 1OINA 1EBHA 1JRBA 1OFPA 3DESA 4NXKA 2R8WA 4A8NA 4UOQA 2A3LA 4RKAA 1CXFA 5MF5A 4ICNA 3S9YA 3B8IA 3RDKA 1JDDA 1U1JA 1K02A 2FVMA 4A35A 2ADAA 1WZKA 1QAPA 1G6CA 2ZZ1A 3M0LA 2OLHA 1L2QA 4Y8EA 4XTIA 4JYEA 1F6PA 1VLIA 3G24A 3LTPA 5ECUA 3NURA 1PIFA 3P3BA 1MMFA 1EZWA 2QZRA 3POHA 5B80A 4A29A 4PMQA 2FDMA 1S2UA 5IOBA 5LIXX 4H19A 3WLSA 2FGZA 1S3TC 2QJGA 4NAFB 3E0IA 3ALFA 4JL1A 1UWQA 4F2UA 5CZTA 3ZLFA 1ME9A 5CPMA 3AROA 2INFA 1O5KA 4GJ1A 2EJ1A 4W4QA 3T55A 3M07A 1SR0A 1YTKA 4MVAA 4OIFA 2P50A 5CLWA 3L9CA 4OGZA 1P0DA 3L4TA 3UZXA 4XVDA 4YCOA 4WUIA 4ENLA 1R38A 3M9YA 4LQ1A 4HU8A 4M51A 4F0LA 1OK6A 3OO2A 4GUJA 4HIBA 3EX2A 2HZGA 1LG1A 1Q6LA 1XBXA 3D5HA 3W7MA 1C8QA 3UBPC 2RH9A 1BWVA 4J27A 4MOZA 4L64A 3REQB 1DJIA 1YNPA 3RCMA 1HJQA 1C3FA 4W5UA 3CQKA 5H91A 1JUBA 4PUUA 2PC8A 2WYSA 2VDGA 3HJZA 1JYXA 4XO6A 4N9EA 1JRCA 1W3HA 1VEOA 3GRIA 1RAKA 4GBDA 2A7PA 3VNIA 1KM6A 3EMQA 4PMNA 4ZTXA 1Q6FA 4HHHA 4AVNA 4NI8A 1W3IA 2QF8A 4ACZA 3URAA 3NGJA 3KVKA 1IT7A 1KXHA 3A5FA 1GZ1A 3LTSA 1G4TA 3MHUA 3IIZA 3QZ6A 2HWGA 3L0GA 2BMBA 2ZUMA 1XKJA 1B3OA 4IQDA 3NOEA 2VD8A 2W6RA 1AW2A 4DY1A 1KBIA 2E1DA 1OT2A 2IS7A 4DI9A 1YYAA 4TX8A 3RN6A 3GU2A 3LCWA 3W83A 4NZ1A 2ISWA 3T81A 1HJVA 4A3HA 4B4HA 3W07A 2XN0A 1HGWA 3MY9A 1BKSA 4KS0A 3VE9A 4F2BA 1B3XA 4PRTA 3W27A 1NELA 5G1TA 4YNGA 3QZEA 3H26A 1E1CA 1W1PA 4XB3A 1E5NA 5AC5A 1WDQA 3RLGA 4E38A 3GX9A 1KM5A 3H4GA 3MV01 4LVBA 2PTXA 4Y7EA 2EQDA 3BAJA 1B4KA 3CHVA 3PZIA 3U3HA 3VIOA 4JQAA 4KBXA 3W86A 2IPFA 3V7PA 1QPQA 3BAIA 1ZL1A 5C2XA 1OY0A 1JDEA 3VKAA 4QP0A 1D3HA 4LCRA 1ITXA 3TW9A 3TK7A 1XLLA 3AJXA 3M4HA 1EEXA 2JK2A 1M68A 4DB7A 4UTHA 3GB6A 4Q3MA 5AHEA 4KETA 3IJQA 5I3FA 5MKGB 4ZFCA 5DY3A 3CWNA 3DFSA 3PG9A 5A6JA 2CLHA 4UC5A 4JTDA 4JCLA 4ZQMA 1JCYA 4CGTA 3TTEA 5E93A 3G1AA 2ZC8A 3N13A 1TPB1 2PDYA 3E1F1 3VKDA 1KXVA 3LSBA 1Z6KA 4DEFA 4GBUA 1ME8A 1XCXA 2H8ZA 5D2WA 4EXBA 3R0DA 4CN4A 2XN2A 5FF2A 1EJXC 1LJYA 3M41A 4UFIA 3S1XA 4DI8A 3GDKA 2CLKA 2WMIA 2J9ZA 3WUGA 2GQ3A 4K1GA 3UWQA 2R9RA 3W7QA 4P61A 4FXSA 2VZSA 3B0PA 3LK6A 3KXQA 1QOPA 2GVLA 2P8CA 3I7QA 3AS0A 5GNZA 2A5HA 1X1NA 5DCEA 5IDIA 4QS5A 1JAEA 1POKA 3N1AA 1LOSA 1OFRA 1BYAA 3USZA 3DIPA 3K1DA 5BU6A 4K8EA 3QFWA 1DJQA 2Y2WA 2ACRA 2BX7A 1VH7A 1GGOA 3FXYA 5AFDA 2DVTA 2BODX 4S23A 1FWWA 3FHQA 3PPHA 4Z0JA 3KWXA 2JKAA 4QAIA 3ABXA 1Q8JA 4B5TA 5C55A 4OQVA 1QO2A 3UG3A 3WY1A 1MFVA 3E2SA 3ITGA 3N2MA 1PTDA 3AIEA 1UPMB 2DY3A 3IVSA 3ZT5A 3AIVA 1VPQA 5FA5A 3QTGA 2NV2A 4AD3A 2AL2B 8XIMA 1SGJA 3K30A 5LIYX 3LV5A 2WZIA 1E1EA 1UH2A 2XM2A 4NUWA 3TJ4A 1EYEA 2I5QA 3HU7A 2HROA 4XBKA 3WLIA 1LBLA 3VKJA 2QAFA 1CXKA 1OZMA 2X16A 2XDFA 3DFTA 1X7FA 4OTKA 1Q8AA 4S3EA 4CN6A 3M5YA 2DJLA 2OR2A 1V6YA 9XIAA 1D9EA 1QNQA 1KRBC 1VZWA 1YQ2A 1B4EA 1EF3A 2PDWA 2AAAA 5JBDA 4J9JA 1R47A 1KFLA 1VFFA 1TV4A 3ZOAA 3MCOA 2OG9A 1JIBA 4W8LA 3B40A 2EGZA 2PGRA 3V35A 3SY1A 3EDEA 1NOWA 6A3HA 2A6LA 3Q94A 4Q7IA 3VINA 3GDBA 4AZ6A 4C7DA 3BJFA 3AYTA 2E5BA 3JRKA 4GQRA 3MI6A 3THQA 2E09A 4DELA 4C60A 5XIAA 3P0XA 3VNLA 3UGVA 4FK9A 4S3FA 4AZCA 3PHAA 2ZKMX 5EFFA 1MW3A 3OZPA 2E7FA 3QHMA 1H7PA 1JVNA 1Z9AA 1R0MA 2X0HA 3LGEA 5IXEA 2Q02A 3I3BA 4Q8NA 4EPKA 2D2OA 1EQPA 3E5PA 1XIEA 1G69A 1ZSXA 2QT3A 1EA9C 4GYPA 4H7ZA 2C1IA 4GVHA 5E9AA 1H5YA 3MUXA 1L8NA 2XFYA 3E0FA 2YL5A 5LHFA 4WHBA 3AU6A 1EWEA 1GYNA 1LDCA 2VUYA 4ERGA 3NTYA 4UQBA 4Q4QA 4UQDA 4ZVJA 2B31A 1H41A 4E0CA 4EACA 3PWIA 1SQ7A 4MFDA 5C2CA 3IAPA 2IPGA 4FX6M 3N6HA 4V2XA 4S3CA 2ALDA 3MUZ1 3EOSA 2RDWA 1FDZA 2F6KA 3PBVA 4GA8A 3T1GA 1DYSA 3BLPX 3UWWA 3QPYA 3RO6A 4F0RA 3P74A 5ABEA 4ROPA 4B3LA 2NQHA 1LZOA 5AHMA 5C54A 1GUVA 1GCYA 5DXYA 1KC7A 4MADA 3BLIA 1N2VA 4Z1YA 3TSBA 1OGSA 3LSCA 3LQGA 3FY1A 4NAEA 1K8ZA 3MZ2A 1CGTA 4IGMA 3DH7A 4KGJA 1IXPA 4HOWA 2XUCA 5LXXA 4ZQRA 3UCCA 3I3DA 1JFXA 3N2CA 3LCGA 2YYUA 4ZXLA 1D8CA 4IG2A 2YB1A 1EX1A 3GIQA 2WPGA 3GYEA 4GQGA 4L4PA 2VQTA 2JE8A 4A3RA 1F74A 1E3ZA 4ICCX 2ZRWA 4MZ1A 3G18A 2ISDA 5KETA 5RUBA 3F4NA 2J6VA 3VK5A 4CN1A 3ITCA 1VQTA 2CZ5A 3GXFA 4L1WA 2GQAA 4XK2A 5GQBA 4REQA 2REQB 1W3JA 4AWSA 1Z7AA 3GVRA 1P1MA 5I7GA 2D69A 1P1XA 4LXFA 1UR2A 3QKEA 2JGQA 3SCUA 3H4XA 2VVSA 3N17A 3TKFA 2E1WA 2OZTA 1XX1A 4PCNA 3AWNA 1FCQA 3S2CA 1EWDA 3GTFA 2QCCA 4QG9A 2PFHA 2XGZA 1FCBA 1NFBA 3HG2A 4YCPA 1UKSA 2GOKA 4CCCA 4OFCA 1GKPA 5HNRA 3CV6A 4H04A 4YWIA 4PMZA 4TX9A 3GNRA 1D8WA 1JD7A 1NEYA 2ZWZA 4C6IA 1A3XA 2FH6A 2Y63A 2YJQA 3MI3A 2E3ZA 1CLVA 1L6YA 4LVAA 3QEZA 2F38A 1JPDX 4C1KA 2HMCA 1R3TA 3QW3A 4CNTA 3CO8A 2V0TA 1ELSA 3BL3A 2DORA 3QGKC 1REQA 4DUVA 2HXTA 4PL1A 3R6IA 4A3YA 1A5SA 4PEEA 1E4MM 3BOXA 4AIUA 2F8QA 2NQ5A 1IXQA 1JCTA 3SY8A 3KL3A 4NY2A 3SUTA 5KMYA 3SUWA 1I2PA 3TQ0A 3WBAA 1JL8A 1TV5A 5CPLA 3BMWA 1S1PA 2QUVA 1QOXA 1Q6QA 2WCSA 5FL0A 4Z2KA 4JIIX 4NSBA 2PTZA 1UG6A 4K8GA 3WNKA 3VIJA 3A22A 4LY8A 4DXXA 1SO6A 3VMPA 2NSOA 4F79A 3M5VA 2ACQA 4MWAD 5CCZA 3VOIA 4GUHA 4RE3A 2I57A 2G3MA 2HEJA 3UPWA 3NPXA 2VXNA 2EPOA 1CLKA 4KEMA 4U33A 3U7VA 1IE7C 1I8JA 3GQYA 3MSRA 1GORA 4H9VA 2NQZA 3DC0A 2CESA 4HZ7A 4ZE5A 1BTCA 1GONA 2FPVA 5BMXA 5DMMA 3LERA 4PULA 3KS6A 1KW1A 4PCFA 2PLCA 1P0KA 4V27A 4ZR8A 4LVDA 1ZPTA 4IGHA 3AQUA 2PWVA 3HMCA 3MP5A 1W3LA 2Q01A 3CUHA 3MSDA 5HQLA 4DVOA 1IGSA 4H6KA 2ACSA 2Z2AA 3T44A 4BK9A 2O7QA 4LEQA 5AC4A 4NJKA 1NDVA 1TPVA 4GVGA 3FGCA 2EKGA 1XM3A 3HPZA 5ABFB 3PBUA 2PRMA 1GVQA 3GHSA 1FFQA 2ZIDA 4S3JA 3GM8A 1H63A 1HJWA 4QG6A 3SGUA 1KRCC 5CPSA 5TNVA 3MW7A 1W54A 3UY7A 4H2CA 4NF7A 2GUYA 1P7TB 2NV1A 3AXKA 1EJRC 1X1OA 2BSLA 3WN6A 3EOUA 2RJHA 2WMHA 1E5JA 1Q45A 2ASHA 1XXXA 1PS9A 4HK7A 3S8HA 2XU2A 2NX9A 5EMKA 2WC4A 2G3FA 4E4FA 4YHGA 3GW0A 4UR7A 5HWMA 5JBEA 3ZQ9A 4X22A 1H1NA 1UUMA 1QXLA 3CLMA 3O6AA 2I14A 3TROA 1OD0A 2DSKA 2VO5A 3PBGA 2HBXA 2Z25A 1QRQA 4UTKA 5J5DA 1CGUA 1BWLA 1GJPA 2P0OA 1RQEA 2XISA 3W02A 1BEUA 3LCIA 3CAKA 3KEHA 4N4PA 3DYMA 1E6QM 1AH0A 4YLWA 1WDRA 3CUGA 2PP1A 2V8ZA 3QTPA 3NQFA 1AMYA 4LSBA 3FYPA 1PKYA 3M0IA 3SQMA 2A85A 1A0EA 3BAKA 5U7SA 3WDRA 4HSNA 2Y24A 1M1BA 3H2AA 5I06A 1GW9A 3PS7A 3PM6A 1NAL1 4HTYA 3OG3A 3PZTA 4LTSA 1X39A 1PDYA 1HUVA 5HATA 3CH0A 1CGXA 5A6MA 3S2NA 1UH3A 3GNXA 4A4AA 3QV6A 3ES7A 3O6CA 4BJHA 2NQ9A 2CZDA 1M9HA 2ZOXA 3WLHA 5BOOA 1EXPA 4FI4A 5CC3A 4PTNA 1BXBA 2OMAA 4PODA 3KM8A 1XCWA 1TV3A 5M03A 4CD8A 4HT3A 1YDVA 1WCGA 5T8GA 1AW5A 2YA2A 4FR6A 4JTFA 5EY5A 4HJWA 4M1BA 4HPHA 2VFDA 2WHLA 4KWVA 1HJSA 2XIQA 2VT0A 1FA2A 1FY6A 1UPPA 5EMJA 4HYVA 4O28A 3FEMA 3EXRA 4K36A 1SSDA 1XUZA 1TJ1A 4F9JA 1JULA 4IUGA 5JBFA 1PWLA 3H55A 3O1NA 1AFSA 3URNA 2Y0FA 3L2MA 1R3QA 4OVXA 3PVFA 3CBWA 3AAMA 3CYJA 1XLFA 2QCNA 1PTAA 2J7CA 3LHWA 5KZ6A 4JEQA 4NRRA 4WJXA 2H90A 4IPPA 3V0TA 4LANA 5HAOA 4UFHA 1BXNA 1EOKA 3KTCA 3TAOA 4Z1AA 3O07A 1PEZA 1X6LA 4E4PA 5BXSA 3ARTA 3BICA 3HGSA 3PWGA 4PMUA 2O4QA 4LNYA 1BRLB 3KBWA 2PWDA 2ZDRA 4H7VA 2YZRA 2A3AA 4P7OA 2AMXA 4FOJA 4NVTA 2DSZA 5D2XA 1B3VA 3PUGA 1XC4A 4OHQA 2IMRA 5HR6A 1UKOA 4BQ3A 1GKQA 4IX0A 4LYRA 4QJ5B 1FKWA 1M53A 5AHLA 5M2FX 3LGDA 2PLKA 2V38A 3NQAA 1HO4A 3NDZA 2H9AB 3F4WA 4L9ZA 3AXXA 1H7RA 3RPTA 3LPPA 3NVTA 1DJXA 1VB9A 1XLHA 3JU2A 1JUKA 3IRSA 2FHFA 2YSWA 1GYMA 1HZYA 1EDTA 1EH9A 4YVVA 3S6DA 4PRRA 3MMWA 1BSLA 4LCSA 5I23A 4ZMGA 2FZ8A 1DXIA 3U48A 1UP3A 7TAAA 1H1YA 2PGFA 1P48A 4ZOBA 2HPIA 1QASA 3FX4A 4PUJA 5REQA 1I1XA 4P8WA 9XIMA 2VCCA 4RZBA 3I4EA 3G0SA 2A0NA 3UJFA 1TCMA 3HA1A 1XQLA 2PD5A 4JTKA 4XTDA 1E6PA 3UCQA 4UFKA 4XKMA 2ON3A 3GXTA 3LI0A 3W1RA 4C6CA 3FDGA 2WHJA 5H8PA 2TYSA 2CLPA 4HKPA 2CXEA 4IQLA 1RUSA 3FFSA 4ADTA 4H7CA 1KKRA 2WBGA 4B16A 1F8IA 3S9IA 4M7SA 4DZ5A 1E0VA 5A6BA 3QPZA 2E6YA 1QK0A 4CNSA 3FYOA 3N15A 3QR3A 3S2JA 2ATMA 4HJFA 3VC5A 5AC8A 5C8BB 3DHPA 4F0HA 2EG6A 3IANA 1F9CA 4UB9A 5EPDA 1AJZA 1SJBA 4I5UA 3WH8A 3CWHA 3C4UA 4QJ4B 3R8RA 2A6NA 2OOGA 2ZFAA 4H8VA 5CAHA 4EXAA 4YYCA 4H9MA 2WVUA 2DSWA 2XN1A 1FWEC 3GXIA 1JG9A 3PULA 2QUNA 1P6CA 1PJ9A 3DAQA 1CXIA 1HL2A 4LAUA 4LX4A 1X38A 2XFRA 2W5FA 1A5BA 4O1BA 2PDJA 1OFBA 3T4CA 3R10A 3QC3A 2O55A 4BF9A 1VGAA 2JBMA 4MNKA 3PFRA 2INZA 5HA7A 2EHHA 4UR9A 8CGTA 3S5NA 3GKFA 5D32A 3SCWA 2GOUA 4GNVA 2TAAA 1PWMA 2Z7KA 4EK7A 2VJXA 4DJDA 3ZO9A 3N18A 3HQPA 3ITLA 4O1CA 1K7FA 3OTRA 1RP8A 5I77A 5E70A 3IV3A 4AD0A 4AEOA 1W3NA 4JKMA 1XQKA 2ANUA 3D3FA 1SW3A 5F2LA 3U5UA 2CHOA 2ZA2A 3BW2A 5F1VA 3D6NA 2E6DA 4LRSA 3AWOA 1HN1A 3K8KA 3QY7A 3W9ZA 2YBVA 4MTVA 1EJTC 4IQEA 1QDSA 1V3JA 1OD8A 2BGSA 5JH1A 1CGYA 3QGVA 1NWRA 1MI3A 4X0NA 2C1GA 2WOQA 2YXXA 4PTMA 1XIIA 5JVLA 1VRXA 3WK2A 2CPUA 1ZLPA 2FKPA 1O94A 2CNCA 4DO5A 2PDCA 2Y8VA 1LRNA 3LCXA 5IRPA 1PO9A 1C7SA 5LA0A 5FJUA 3B9EA 3KL0A 4N2YA 3CM4A 2BGNE 3RGTA 3FV9A 2VX6A 2VC5A 3VM7A 4HN8A 3ZLGA 2FZDA 1EP3A 3AZSA 3KVJA 4K38A 3B9NA 3QRHA 3K2GA 4OKDA 4DBDA 4GH1A 1KM1A 4S2BA 2DQWA 2QVNA 4QSFA 3NQ2A 3SCNA 2XIIA 3GZAA 1FWIC 3NR0A 4OV4A 1YBQA 4QDMA 4KH2A 3WH9A 3GLCA 3T0AA 1X8FA 3A4AA 4K3ZA 3WLJA 1J6OA 5DT7A 2OSXA 3AMDA 3J7HA 3TFCA 2W67A 1DTUA 1KFCA 5CZKA 3QOMA 2X1UA 3DFYA 1YE4A 3S42A 1RCQA 4GYFA 3W7HA 3HQ1A 1B31A 1PE1A 4RDYA 1GOKA 1CGVA 3EXTA 8RUCA 4OBRA 1V51A 2QJNA 3PG8A 1OIMA 1RHCA 1BF2A 5BRQA 2G8ZA 4XZLX 3UNTA 1W1B1 4X2RA 3W1QA 1US2A 4GKLA 2C6QA 3N6JA 4D8AA 4FLSA 2E8YA 3A4XA 3HFTA 2CBJA 1AMKA 1XGEA 3F2DA 2AQVA 1G1YA 1R9YA 2UY2A 4IISA 1PSCA 4ZO8A 5CSYA 3TLQA 3BGJA 3P80A 3T0BA 1KBKA 1IF2A 1MUMA 3W2LA 3QV8A 4GQBA 3BG5A 1TKKA 4LUTA 1OX4B 1TFVA 3WMSA 3LQLA 3W2KA 4IT1A 4P2VA 2WJDA 3VVGA 3QQWA 2RJGA 4UFLA 4KCVA 4PMDA 4DXKA 1K9FA 1JQVA 3PWAA 1T96A 2P76A 1EKOA 3E38A 4I9JA 3GD6A 5DMYA 4UQCA 2CIPA 2HV5A 5DBTA 2HS6A 2C16A 3PSWA 3AMLA 2J7HA 3NQGA 3DGBA 4ZOCA 3KP0A 2P3EA 4JS3A 1R2TA 3AMCA 3NCOA 4Y9MA 4DZHA 4HCDA 3GVWA 4FNSA 5CC5A 5AY7A 4ERIA 2FVLA 1V3IA 1CTNA 4G8TA 4IM4A 3B03A 3TC6A 4LY4A 1IXNA 2PF8A 1AL7A 1W5NA 1FHUA 4GK8A 1FTXA 4O16A 2OQLA 3VIFA 3MP4A 4YPJA 4I9MA 5D38A 2BOGX 2PU0A 3SI9A 3W74A 4HU4A 3UXIA 1LLWA 3W6MA 3ITYA 3NQEA 4W7UA 4GYPC 3TMQA 4C6NA 3UZJA 4PMXA 4UMCA 1CWYA 4GOAA 3EX1A 1V3MA 2D3NA 5JH2A 1ESWA 4NJHA 4UTMA 3M16A 3MUCA 2GVJA 4MAZA 3AJ7A 4LB4A 2E5CA 3ARYA 3PNZA 3HGOA 3NXFA 4GH3A 4WXYA 4UNLA 4NJGA 4B9YA 4EPEC 5BNKA 1MEIA 2XHYA 4B2DA 3WUFA 4H9XA 1AK5A 3THAA 4JFSA 3BW3A 3VKKA 4AW7A 3NSNA 5F4SA 2PS2A 1JNDA 1G01A 3A4JA 5U4NA 4LS2A 4RE0A 1F3WA 1T5AA 4HK6A 4KQNA 1J18A 2Y5EA 2ZRZA 3LM3A 3KHDA 2ISSA 1A80A 2VC7A 4US5D 3O05A 2PRLA 3MSGA 3U2ZA 3SIZA 4M5PA 3USBA 1U22A 1POJA 4K39A 1ZBVA 3QH2A 1FFRA 1OGBA 1T99A 4LF2A 3T0TA 3WLQA 4JN6A 1VC4A 4KFOA 1H1ZA 4Z2IA 5G5IA 2FZ9A 4CCZA 3WK0A 2G5WA 1LROA 3VNMA 4E6MA 5CG7A 3KOZA 3GIYA 4C6OA 4ZO6A 4P8UA 3M7SA 3XISA 2PP3A 4QISA 3WLPA 1UD4A 3M47A 3LI1A 3TSDA 3TW6A 4D1IA 1RA0A 1GKRA 1US3A 1MRAA 2XH0A 3BCDA 2Z29A 3V1HA 4Q8MA 3MUY1 2IPWA 1WDPA 1HGYA 4WXZA 2VC6A 2JKEA 4YMZA 3G1HA 3WK1A 4HU0A 2GWNA 5DRCA 5DBUA 4TUFA 4FF5A 1KTNA 3WNOA 1WE5A 5CEWA 3PBYA 2ZRUA 4JTAA 3HOJA 1HL9A 3WSUA 1LL4A 1F73A 4AHPA 4ZSTA 3OLDA 3FKRA 3DXIA 4Y9PA 2I1OA 4XBJA 3H12A 3HV9A 3WQOA 1NOFA 1CPUA 4KF1A 1UJPA 4O17A 3CTLA 3KRSA 1XPYA 3VZZA 2P88A 2CKRA 5CXPA 3B97A 1XHGA 5DX7A 1XSKA 2ZQ0A 4L6DA 3LD5A 3UF9A 4IMFA 3HGRA 1BXCA 4IIEA 3QHOA 3KRUA 3UA4A 4CCEA 6ALDA 5A8GA 3C2FA 3OBAA 5FL1A 1TX0A 4HP5A 4JKKA 3EPMA 3LHYA 3B8DA 1CLXA 1QNOA 2JEQA 1PL9A 4GVFA 4F4RA 4GNJA 1JI2A 4C1NB 3VOFA 3WF2A 4PN2A 4FR1A 1W8GA 3K8LA 2TPSA 4Y8FA 2YBUA 1NM9A 5M5DA 4DM2A 4HMCA 1NOUA 3WUBA 3TE9A 2NZLA 3TYBA 1ODZA 3C0SA 3CUFA 2FB2A 1HTIA 4KEZA 4LV9A 2QS8A 4ZB0A 4HPXA 4M6QA 4JYDA 3P7YA 3TTOA 2J13A 4HHMA 3UW6A 4EX4A 3MWCA 4CQAA 1KXTA 1Q4WA 1UR3M 5A6TC 2YPIA 1JR1A 2QDGA 1EC7A 4PSPA 4IP5A 3VCNA 4CU6A 3EDDA 1W9XA 5C9WA 1VCVA 3H2CA 5C9UA 3LXCA 4PCPA 3GNNA 3NA8A 1C93A 1WOAA 3O0KA 4AX6A 1X6UA 3TQPA 1XYZA 2WW5A 1XGZA 3KCLA 3QFEA 2ZDSA 4J3TA 3TN3A 1UWUA 2CEQA 1TJPA 3FVMA 3B8SA 4AVOA 3RG6A 1UB3A 3TTYA 1DWIM 4C5YA 3WQEA 4J28A 4AEEA 2Z1VA 5A8MA 1K7XA 1H09A 4FMVA 2R1KA 2HQAA 2XVLA 3EB4A 4FA3A 1QOQA 1EX5A 4JFWA 1XIHA 4EIVA 3P8JA 4DQWA 2B7OA 2GK1B 2WVVA 3NUKA 1QNPA 4JIHA 4EE9A 1MZRA 3K5XA 2E40A 5IDZA 3E9AA 4HZ8A 3TCEA 1JZ3A 1EOMA 4UXDA 2GWGA 1JYNA 3NSXA 3DZ1A 3AXHA 1OADA 2QVHA 5FF3A 4B15A 3MVTA 4RXFA 2IQTA 1LORA 4GI4A 3GU9A 3OVGA 3VDBA 2Z1KA 1TPEA 3UJEA 1KFWA 3S3GA 3E2VA 4XV0A 3VIHA 4UNKA 2WWDA 1E15A 4C6QA 1VEMA 2VFIA 3T8QA 1S2VA 1W9VA 3T0CA 3LYEA 5BMWA 2QCMA 5FCZA 2O9OA 2NXHA 1H49A 3I68A 3MU7A 3IARA 1FDYA 3WK3A 3IRDA 3WD4A 4AD4A 2AL1A 3EA2A 4GQQA 2IKIA 1UH4A 4PCTA 1DIEA 4YU1A 3HM7A 4NU7A 4RJEA 1T7LA 4E2DA 3TIMA 2OO0A 1OK4A 1PAMA 4HNNA 2XVPA 3NQMA 2AQOA 1E40A 3GH4A 1RK6A 4NIRA 3VA8A 5ABGA 3Q4DA 2G4FA 3VDAA 3BE7A 1SW0A 1GG0A 1A47A 3G6LA 1HKKA 3CMGA 1R46A 4MY9A 1G0CA 5CZSA 5HJLA 4JXCA 4WD0A 3COTA 1YXYA 2DW6A 1LF1A 1AJ2A 1LCOA 3OJGA 1Z69A 2PEVA 4CLMA 5AYZA 2X41A 3O06A 3RX2A 1RH9A 2YW4A 1FWCC 2G50A 3H23A 1NWTA 2O9PA 1G67A 4UIOA 1PIIA 1VKFA 5SWUA 3VKCA 1GYLA 7ODCA 2J62A 4IZGA 3CWOX 4P7QA 2XH7A 2OB3A 4L7ZA 5C5YA 5A2BA 3THCA 3GTNA 3WD2A 1OEPA 1EIBA 1WO2A 4LWWA 3FK4A 3SIMA 3GC2A 5E1QA 4D6CA 3W76A 3G1XA 1ODUA 3WQ5A 4WK9A 3PUDA 1F3XA 3HQNA 3KZPA 2E67A 4A21A 3M1ZA 4HNUA 4GQ0A 3W4RA 5HQMA 3QSTA 4AMAA 7PTDA 1W3TA 4M56A 3BLKA 1SZRA 4QE5A 2OWCA 3LM7A 3IJ6A 2WNQA 4LU0A 1IT8A 2MUCA 3C6CA 1S2TA 1ONXA 4R53A 1MQRA 3E74A 4FNTA 3N3MA 1GOIA 1FCVA 1C7TA 1DOSA 3M6YA 1NVMA 1OFOA 1YNYA 1MRQA 3P0WA 3WELA 4JX6A 1D3GA 3GVGA 3LMZA 5I78A 3IJIA 1TRIA 1NF0A 4DJFA 2FJKA 2I16A 2GVYA 2PWHA 2WMIB 1NU5A 3AHZA 4JFVA 1YXDA 3E5BA 1BWKA 3LXAA 1WYIA 3LHTA 3GFXA 3AMKA 2NQJA 4LH8A 1K8YA 2VKZG 4JTLA 1ONWA 1VJSA 1VPYA 2PGWA 1J0HA 4AHOA 1NQKA 2FGLA 3AO0A 3CUZA 3R2GA 3UYIA 1NFGA 2D0HA 1GJUA 3BG3A 1J0ZA 4NP7A 1EBGA 1R7OA 1MEHA 4YXGA 3VGBA 3L4UA 3P14A 2A4AA 4LBUA 1V6VA 3VGDA 4ORMA 3DFQA 1H0GA 3VD5A 1OFQA 3A3WA 1I0BA 4AWEA 3QSRA 3UWYA 4XZIA 3GDTA 4K8HA 3WD0A 1AODA 1IV8A 1H7XA 3VXGA 5CGMA 1LQ0A 3RXZA 3TN6A 3EWXA 1TZZA 3ZSSA 1RD5A 1XWYA 4M0XA 5BXTA 4FIRA 3CHCA 3GNPA 3SCRA 1C8XA 4WSKA 4DX3A 1HNYA 1S1RA 1KLYA 1W37A 2EPLX 1VF8A 3G0UA 4EF9A 5CSSA 3VNDA 4GC3A 1G4PA 3M0ZA 2CLEA 4R34A 1R8LA 3WFAA 3WUEA 3BCFA 3EKZA 3D46A 1E0UA 4IMGA 1UMLA 3ITOA 4UCGA 3GVQA 1FHLA 1P43A 3KZSA 4KRZA 4QE4A 7ENLA 4B92A 2PWGA 1OFAA 3QVQA 4HB7A 4O52A 3SSZA 2Z1BA 3BSGA 4MWAE 4LCQA 2ZUSA 3MA8A 4MY1A 1QTWA 4Y9AA 2FFIA 2F84A 2DH3A 3MP3A 3W71A 3MC5A 3GG8A 1GOWA 4Z42C 3VZYA 4N6EA 4MWAC 4MNMA 4F66A 1DKWA 4Z2LA 4PUNA 2QR6A 3H2OA 1XH2A 2O0TA 4C90A 1PZ2A 1KQYA 3WEMA 5CSUA 4LBRA 1EUNA 1GQNA 4AZCB 3CHDA 3V75A 2QULA 5CSRA 3ERPA 3LLFA 3OG2A 3W1LA 2E28A 3RLUA 3TA6A 3SN4A 4B5VA 3RM4A 3TYUA 4TMCA 4KEUA 4IGSA 4QEHA 1E3XA 4ZBCA 1H61A 2R91A 3ZT6A 4RE4A 3ZVHA 3VMNA 2QCDA 3TAKA 1CENA 3TH6A 3TW7A 3CT7A 3DFNA 4Z1CA 4F48A 3P5ZA 1A5LC 1OCBA 5HNUA 4WKFA 2WJFA 3BGGA 3WEZA 4XD6A 3ZZ1A 4Q8VA 4GI8A 1TTQA 2JF6A 3FSTA 4WR3A 4MYXA 2B7NA 5HDRA 1JZ6A 1O5RA 3A5VA 3IVTA 2Q3OA 3VOGA 3CUJA 2PDBA 3AYSA 3U2EA 2JIEA 1YX1A 1VIZA 4ZQPA 3OBEA 1QI0A 5EGRA 4WX2A 4IFRA 1YPFA 3W88A 2PDNA 3WD3A 1V5XA 1UR1A 4B5XA 1GWJA 4Q4PA 4R5EA 1G7UA 4NAEB 1E6XM 1JDFA 4FNRA 1WA3A 1PXGA 3WKZA 1FHDA 1XYBA 5FEZA 2I7GA 5A8OA 3W26A 2J9XA 3OGRA 3W1NA 1FWDC 2QIWA 4C65A 4IG2B 1JPIA 2WHMA 4A2SA 3IACA 1LG2A 2Z7GA 4HHPA 1CNVA 4XZNX 3NXLA 2YYTA 4RZ4A 4DHGA 3R43A 5I02A 4B5UA 1YEYA 1VBJA 3EYPA 4REQB 1JJKA 4QQ3A 3S5ZA 4XAZA 3M0XA 4MFEA 1EL3A 1MXSA 3MHFA 4U31A 2D23A 2G97A 4YYFA 4E8DA 1ADSA 1EC9A 1HQTA 3A21A 2CZFA 3GG7A 3A9BA 1QW8A 1MUCA 2I56A 3FOKA 3SUVA 5FESA 2YCEA 4NAFA 3FJNA 4IMAA 3V3WA 1W9PA 4WRHA 1BG9A 1IZCA 3EOEA 3UJRA 4X9SA 2Y5SA 1C92A 2Y88A 3KOXA 2CU0A 2PCQA 2V6AA 2WAGA 3LENA 3LU2A 3EWDA 4HCLA 5KSWA 1QVBA 2P1FA 3MZNA 3G2GA 4NZ4A 1BTMA 2Z24A 3IIOA 5A95A 1FWSA 3H21A 3WL0A 4PUKA 3REQA 3XINA 3GO2A 2H8XA 4EWND 5XINA 3GVVA 3MI2A 1SPQA 1ENUA 2WNZA 3VGHA 1XYCA 4JPGA 2EF9A 1UWAA 5DMLA 2Y4SA 3L4WA 5I3JA 3GFZA 4ILSA 3CQHA 3CK5A 1J8VA 3O7UA 3EKLA 3VNJA 3H2MA 4L9YA 3QOKA 2GJPA 3CS2A 1GEHA 1N8FA 2PDFA 1EJSC 2BOEX 4J35A 3HTWA 4UTTA 1Q2RA 5IBXA 3EMCA 5IFPA 3W22A 4YVPA 4F3HA 3LTYA 2DGAA 3OEXA 4EF8A 5C2GA 1GHRA 2A7NA 5HOSA 1HT6A 1QNSA 4P7LA 2RFGA 1T8XA 3PR2A 1NTHA 3WQWA 3LHZA 4CQ9A 4G6CA 3ZS4A 5AYBA 3ITVA 3NGFA 2V81A 6REQB 4Q4MA 4JHMA 1CB7B 4IJCA 1JPHA 3WLOA 5BXPA 2C13A 2A3HA 1KV5A 1XRVA 3KHJA 1CI1A 1AD4A 5T9BG 3CV7A 1V0LA 4LAZA 4QLJA 4DJED 3R8GA 3GWQA 2IKGA 3Q65A 1RPKA 4X9YA 2Z00A 4G5DA 3SFWA 4A05A 3S1GA 1UIPA 1K9EA 3DKLA 3WF1A 5BOEA 5A8NA 2R1NA 1VFLA 1VBGA 4K6AA 3WNNA 2Q8LA 1OGGA 4NRSA 3VD4A 1KRAC 2EKCA 5A5WA 3GTIA 1XL9A 1BPLB 4D6HA 1YXCA 4L1GA 2VC9A 4EPDC 3WJSA 4IP4A 2VWSA 1QI3A 1EHNA 5MKGA 3GXDA 1GTEA 3GR7A 1W5QA 4OOUA 3W7GA 2QAPA 2OJPA 2OWXA 4PBEA 4JCMA 4B3KA 3QR0A 2YDSA 4IPNB 4WKHA 2IQ0A 4JFTA 1L6WA 1U2YA 3EWWA 1PHWA 1J9YA 3CAVA 2HVNA 3UESA 4L4LA 5ABTA 3E2QA 3W7KA 1MXGA 5HINA 4PTXA 1L6SA 3MANA 3VC6A 1I2OA 4LFYA 1YHTA 2WO5A 4R7OA 2WZMA 1B9ZA 4Q6JA 2YFOA 3FYYA 2FVKA 4JGDA 3N6QA 2Q71A 3TX9A 3DC8A 2FB3A 4G2DA 3EB2A 5ECVA 4KESA 1W56A 4NZCA 2FHBA 4MMWA 1M6JA 2BY1A 1BYBA 4XX6A 4J1OA 3S1WA 5AYXA 4JAWA 3W81A 3UYCA 1SFSA 4JTUA 2DUZA 2D0GA 3S0CA 3T4WA 5KTLA 3D47A 1JDCA 4R7WA 4HPJA 4JZ5A 4FHAA 3OZMA 4DBUA 1JGMA 1A4MA 1WOBA 4GRSA 3VI2A 4GXPA 3TR2A 4U2ZA 2OGYA 3BAYA 3HF3A 3LCHA 3NNTA 2WV8A 4JIPA 4DYJA 1ISWA 2BASA 1I45A 1K03A 7REQA 7CGTA 4Y9OA 4AZIA 1ZJHA 1W8SA 1ZENA 4Q7BA 3R4IA 1J11A 5CGQA 1E6NA 1F76A 1EP2A 2BDQA 1WP6A 1GQIA 4K7YA 4ZOEA 1XIGA 1TA3A 2W62A 5I3IA 1DJHA 4DAIA 2PCEA 3AC0A 3QV7A 4L61A 4S3AA 4OUIA 1W5PA 3BAXA 4ORIA 2J9YA 2ZZ3A 1KM4A 4GZIA 4IL2A 1A5CA 3N11A 4GHRA 1L8PA 3UJ2A 4X63A 1J5SA 2VX7A 2IXUA 4MM1A 1KXQA 3HV8A 4V15A 1ZB5A 1RY0A 2FTYA 5HUOA 3UQNA 4CNPA 1UA3A 2XWDA 3L7RA 3W1UA 1XH0A 4DWSA 2RDXA 4ERAA 3FKKA 3M0MA 4R27A 4BF7A 4TIMA 5A2CA 4JTSA 4UTFA 2QIIA 4GXWA 2VEMA 3RLHA 4GO8A 3BOLA 3MB9A 3AZRA 1CZ1A 3U9IA 4M82A 3ARVA 4EANA 3W72A 3M64A 3C2OA 5CC6A 1RZMA 1S46A 5HR7A 3S2MA 5BWFA 4AFYA 1JPKA 8TIMA 1ITCA 3CB3A 2ZZ6A 2NWSA 5D04C 4GUFA 2C0HA 3TYDA 3A64A 4WY0B 4GFSA 2CCRA 3RR1A 8XIAA 2Z2BA 3B4YA 2X8RA 3PSVA 4O12A 2YB4A 4GNKB 1HKIA 3VYLA 4YTUA 2PDIA 1FH9A 4F0KA 4KMQA 3HN3A 1Q13A 4N9DA 2Z1WA 1TRDA 2OGJA 3WIJA 3P5YA 3V1PA 4MKVA 2J66A 4W86A 3G1YA 3GH7A 4O0ZA 3TYEA 3NYDA 1J6PA 3DOPA 4MJMA 4I7UA 3AUOA 2BS9A 2DZPA 1M01A 2YDRA 2GVEA 2ZXBA 5REQB 3IVUA 1YPIA 2VEFA 4E4UA 3A4WA 2BBFA 1M7PA 3WQCA 4J3ZA 4LW7A 3RUBL 5A3HA 4ZQCA 3L68A 3CEPA 3IJ9A 3RRAA 1UC4A 2YKKA 1XYLA 3R13A 2A2IA 2QGHA 4IICA 3MKVA 2WHKA 3TC3A 1DE6A 4HA0A 1ITQA 2NSXA 5G2HA 1B90A 1FQ0A 1NARA 3M5ZA 3W7RA 3OHMB 2P3ZA 4TV5A 3UPBA 2V2DA 2RGLA 4XZMX 2PA6A 2E6FA 2IW0A 4EXQA 3URQA 3K46A 2CETA 2J75A 2ZWYA 3VUPA 4DLFA 3AXIA 1Q65A 2XFFA 5JIPA 4URIA 3MMDA 4H2HA 1Z42A 3S1UA 3SADA 1O7AA 5LXEA 1YDYA 2REQA 2Y8KA 2C15A 2V3EA 1UZHA 3IGHX 1NDZA 1N7KA 4GX8A 2OT1A 5EMUA 5LNRA 2IKJA 4XVEA 1J10A 2EPNA 4L80A 4E3TA 3DBNA 1AL8A 3HBLA 1PX8A 1R3VA 1VJIA 3E96A 3DX5A 4W89A 3OGSA 2FYMA 3BCJA 2GGGA 1OJXA 3FNDA 1AUSL 4ASTA 4RNJA 4H6EA 2VYOA 1YADA 4CVWA 5E5CA 1TPWA 3FA4A 5D8ZA 4MKSA 2XPKA 2HXUA 2OOFA 3WMBA 4Z08A 2J7GA 4IFKB 1TTPA 5AOUA 1AZ2A 3PZMA 3WD1A 1X97A 4LUJA 1UBSA 1V3HA 3L5MA 2WLZA 4LBSA 3DCPA 1BVZA 1RBOB 2QPUA 3CIXA 2V5JA 4I8DA 3CUXA 1F4HA 4EWJA 1AQFA 1FH7A 3H2NA 2VENA 3LRMA 1HJXA 4OUEA 3A13A 1AJ0A 3W2MA 2HDJA 3W7LA 2VGIA 4R9OA 4AC1X 2VDIA 4XAPA 3VGFA 3P2VA 4LUSB 4NKCA 4UTJA 1ECQA 2OO6A 1AH3A 3CH9A 3AIBA 2ZVRA 3O63A 3EPNA 1E4LA 4O54A 2WBKA 2DZUA 5JQ9A 3EX6A 1TWWA 4WZHA 1HVXA 5BROA 4E2OA 3EPOA 3SCQA 3GAKA 4DJFC 1UD8A 3GTHA 3A6OA 4X2PA 4AIOA 4J3VA 4GACA 1R7AA 4H6RA 1SO5A 1FCUA 2FDSA 1W5OA 1ISYA 5LSMA 1FBAA 1HP5A 4C6EA 3W1PA 4NJIA 4Q32A 3K4WA 1GOMA 1US0A 1XV8A 3DG6A 2J7EA 1UP0A 1KGXA 3GUWA 4C6DA 1LYXA 2DH2A 1ML1A 2L5HA 1WAUA 1QUMA 1W2PA 1B2YA 1WKYA 4WJEA 3C0QA 3N3TA 1TTJA 1E9YB 3N4EA 5I3GA 1R3WA 4D8LA 5F1UA 4QE1A 2B0MA 1OX6A 1UA7A 3DERA 2IPJA 4PMYA 1TIMA 3JZEA 1PDZA 4ONVA 2YGYA 5ABFA 3NQDA 3LG3A 2X30A 2HVMA 5K3VA 2Y8UA 4MGGA 1I0DA 2DVXA 1SU5A 1IGWA 2OEMA 4G1KA 3A47A 1P7TA 2UWFA 4ATDA 3EDFA 3STEA 4AX7A 3K4AA 5KZDA 3WEOA 2FQIA 5I3KA 2CHNA 4Z1BA 3CPRA 4PC8A 4JTHA 2Q8XA 3EMZA 3I65A 1UUOA 1MFUA 2XVKA 2VELA 3LNMA 3PJWA 3L5LA 3DBPA 1SR9A 2QPSA 1EDGA 1MSSA 4O8AA 3CL8A 4S39A 3ZJKA 2BXVA 4IIHA 4LAMA 4DO6A 3K13A 2J27A 2GLKA 3RU8X 4PTWA 1YPXA 4JIRA 2W4XA 2XSXA 4LPCA 5GJPA 1JF5A 1UD5A 3TN5A 1TREA 3N25A 5DQPA 4FXRA 4JEJA 4D6DA 3H7RA 3RFAA <