3W86A

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with sh-1-96
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (fumarate)
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with SH-1-96
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 104
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2013-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w86A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w86A01
4YXGA 3LI1A 3W1QA 1GJPA 2Z1BA 1Z41A 3DFSA 4O53A 4JIPA 4C1LA 1QO2A 3LBMA 3W1AA 4HKPA 2Z0IA 3W7QA 1KBJA 1HUVA 2VFFA 2H8ZA 3H55A 3ABRA 4MYXA 3IV3A 2QDHA 2FIQA 1LOQA 3DZ1A 3MP3A 4O13A 4DQWA 4GWEA 1ML1A 1RD5A 3NQAA 1VH7A 4GUFA 4PTNA 4MJMA 1LRTA 2DP3A 2X1RA 4NVTA 4JR5A 4OV9A 1KFJA 1H7PA 1TREA 3GKFA 3NPXA 3W2JA 5C5YA 1ZCOA 1UASA 2ZZ2A 3TW6A 5DCEA 3O15A 3RMJA 4WX2A 3TSDA 4AWTA 2FB3A 2CZEA 1KV5A 1DBTA 1JCXA 4FNRA 4QJ1A 4ZQPA 1WXJA 1YYAA 5DBUA 2NWRA 3KVJA 4AHPA 1F05A 4KFNA 2H3DA 1U5JA 4JTHA 4M6PA 3GDKA 3W7GA 2C3ZA 1KFKA 3GLCA 4BFAA 2VXNA 4CNNA 1W3IA 4XZ9A 3TK7A 4LC6A 1ME9A 1W5QA 3HBLA 4H6KA 2F7FA 1TJRA 5MHBA 1JUBA 2DORA 4UFHA 3MW7A 1VGAA 2WSYA 1Z48A 2ZFAA 2RH9A 3TQKA 2W6RA 1H61A 3M44A 1U83A 1JQVA 4ORMA 4NXKA 4CCEA 4LTSA 3W2MA 4O1CA 5G1TA 1I45A 4ZVJA 5HR7A 4UTTA 1FY6A 3GX9A 2FDSA 1ZAIA 2QUTA 4QQ3A 4MKNA 2ZZ3A 4FX6M 3W73A 1M5WA 1Q6LA 1KTNA 3KOFA 2JKEA 1OYCA 4Z1CA 4GUHA 1NVMA 1C8VA 1I8JA 3LOTA 3LDVA 3ATZA 1FXQA 2YZRA 5DELA 1O5XA 1TPC1 3GNDA 3P5YA 4O11A 2O7SA 1OFOA 3FIGA 4N9EA 3UQNA 1MEIA 4UTTC 3QEZA 3IGSA 2RDUA 4IQLA 4JTKA 4UFIA 5HINA 3WFAA 4NZJA 1VZWA 4E0CA 1K02A 3EWZA 3THAA 3QQ1A 3T40A 3C61A 2B7NA 1FX6A 4FXSA 4ZQRA 4OT7A 3HF3A 1F6KA 3RFAA 1C29A 1RQBA 3E96A 1OJXA 4UNLA 2OT0A 3A21A 4LS0A 5I3HA 3B8DA 5D03A 3LHVA 4NZFA 1S5WA 2QUVA 4QISA 1M7OA 1XDLA 2GPTA 4NJIA 1EP1A 1YDVA 4IMEA 4LVFA 1N7KA 5IBXC 2RHGA 4IMDA 3T4CA 3BK0A 1JRCA 2Y7EA 4IXHA 2E09A 3IVTA 5D2WA 3ANYA 4IMGA 4ZMGA 3WJYA 3EB2A 1SFLA 5D04C 4Y90A 5AYYA 1RR2A 1ME7A 5EBUA 4YWIA 3CT7A 2VFGA 1NEYA 5SWUA 4HNUA 1WBHA 3QJAA 4M19A 3VFLA 3DH7A 1VHCA 1HFBA 4O18A 1SZNA 3LCXA 4LWWA 3L66A 5HQEA 1YXCA 3PWAA 2YW3A 2R14A 3NOEA 1IIGA 4NNBA 1T0OA 4Z08A 2A1YA 3M5YA 3HG3A 4IX2A 4JTLA 5AN7A 5FEPA 4UFKA 4ALDA 4O15A 5C2XA 2Y63A 4O1AA 4NJKA 3B4UA 2QCDB 4N9DA 2QCFA 4O52A 3CWNA 3G1VA 3CEPA 3VI2A 4X3ZA 5EY5A 4AAJA 5HUOA 4XKYB 4O28A 3BLEA 3W7JA 2Y88A 5TBOA 2GQ9A 3NGJA 3G18A 3OVQA 4LY8A 5D2XA 4CLMA 3NNTA 3Q94A 1VYSX 1F5ZA 1G67A 3CU2A 2C19A 4RV8A 1BTMA 3FEMA 4Y9AA 4PH6A 3TJXA 2AGKA 2V81A 3EWXA 4ICNA 1TV5A 3T7VA 3FYPA 3QQ0A 4IPIA 5FEZA 3HMJG 1LTDA 3M43A 3W7RA 3TMLA 4UTMA 2C13A 3W88A 1IF2A 2E6FA 1OFEA 3OBKA 5EL1A 5D2TA 4HIBA 1LOLA 3NQVA 2CFFA 4DELA 3P5ZA 5DXXA 1ZENA 3G3DA 2ZA3A 3PUOA 1ICSA 2BXVA 3S1WA 4ML9A 5HNRA 2E6DA 2VEIA 3TSBA 3NO5A 2NX9A 2WO5A 3TNOA 1TTPA 2JKAA 3MO7A 4XQ6A 1V5XA 3EWYA 4AHQA 3UWVA 3S0CA 1GVQA 3HGRA 1QPOA 3I7SA 2VFEA 1VCGA 4ZQCA 3P62A 4LOCA 3W1UA 5C55A 2PC4A 2QCEA 2TYSA 3UZJA 5F1VA 3DFQA 4O4VA 4M7SA 5I3JA 2Y62A 3WJWA 1G7UA 2BLEA 4JEQA 5AC8A 2ZRYA 1GVRA 4IX0A 1VHNA 1Y0EA 4IJBA 2Z6JA 3O07A 3NQGA 1TO3A 3S5YA 3B0UX 3WJZA 4JS3A 3W75A 1KBIA 3F4WA 5LHEA 3W83A 1TSIA 2ZZ6A 2WNNA 3D0CA 4RJEA 1R2RA 3TJLA 1MSSA 3MYOA 4WOZA 4JX6A 3U2OA 3ZWTA 3LCFA 1I4NA 4JD4A 1JQXA 2QJGA 1SPQA 3O6CA 3VNDA 1ZHAA 3HG5A 2PCQA 4Q33A 2ISSA 2EHHA 3B03A 1XUZA 4HNNA 3GAKA 2NX3A 1QPNA 2YPIA 2ABBA 1PVNA 3PG9A 4MYAA 5G4EA 2FB2A 4MZ8A 3BW3A 2EF9A 3HG2A 2ZYFA 4EOUA 5F2MA 3LERA 2YYUA 2FPTA 3NL3A 1IXNA 1K3UA 4N2YA 4OHQA 3EX3A 3LHTA 5BNKA 4UTWA 3G0UA 4OWGA 3LI0A 4GBUA 4NT0A 4DF2A 1OFAA 1Z42A 2Q8ZA 3LCIA 1JCLA 3EX2A 1ZAHA 3W3OA 2OZ0A 2A7NA 1W5PA 4HNTA 1W1ZA 2NUWA 1TIMA 1TPDA 5HWNA 4M5PA 2X1SA 5D05A 5K2ZA 4HPJA 4UFJA 3IVSA 2DZXA 4D2JA 1VRDA 2JGYA 4MVAA 3WJXA 3NZ1A 3PS7A 5HUPA 1G7VA 4JYEA 1YDOA 3SGZA 1Q6RA 3ZWSA 3CLMA 1IGSA 1ALDA 3UPBA 2ZRZA 2ZRVA 5E1QA 4JIQA 1KM3A 1FWRA 3ZS4A 2PRMA 3B0PA 7TIMA 1H7WA 2H3BA 2HTMA 4TIMA 1THFD 1A5BA 1DVJA 1H1YA 4WY0F 1W0MA 3CWOX 3W7DA 2YW4A 3EWUA 3EXRA 1NF0A 3KVMA 3H53A 4MUZA 3EWBX 3TC6A 1GOXA 4FNUA 1VPXA 3FFSA 3LBCA 3LRLA 3NM1A 4BR1A 1IIHA 3EX6A 2TRSA 3TFXA 2AAMA 4A2RA 4K8HA 3HPZA 3MMTA 3DFPA 3PUEA 4BWLA 1T99A 4WXZA 3LB0A 1TPEA 1TJPA 2QKFA 3P67A 3A22A 2LLEA 1PL9A 4DEFA 2WSRA 1FDZA 2QJHA 1EIXA 4CQ8A 3HGSA 1B4EA 1FDYA 1ICPA 2GQAA 1PV8A 1RV8A 2ZDRA 5HJLA 3NDOA 3DKJA 3T55A 2EPHA 4OV4A 1EUNA 2NWSA 5AHIA 1XXXA 2F84A 1QFEA 3C6CA 2P0OA 1IXQA 2VEPA 3L0NA 4ADUA 2DZSA 4LUJA 4OU1A 3MHUA 3P81A 2YFOA 3WK3A 3HQ1A 1AL7A 2QCHA 5K9DA 1FUYA 4UUIA 2H6RA 5CZ0A 3P7YA 1VCVA 1DQWA 3BW2A 4FNQA 4O10A 5LKYA 1LP6A 4BWLC 4Z1AA 4NNCA 4YLWA 4FB7A 1R2SA 1OHLA 3HO8A 3V75A 3O6DA 2R8WA 4UMBA 3O63A 4AHOA 3I6RA 4JDBA 5DBTA 3BW4A 3LCGA 3NZRA 3PB0A 2CLHA 3IIXA 1OABA 5CZTA 2V5BA 1GYLA 3TC7A 4N6EA 4YCOA 3G8RA 5C6MA 3W1MA 4GUIA 4A21A 3LGEA 3G0SA 3WK2A 4LVAA 2UV8G 2A6NA 3G0XA 3KRSA 1SW3A 4Y6GA 2ZA2A 1KM4A 5G1YA 1PHQA 5LGXA 5E0KA 3M5XA 3GDTA 1WOAA 1MEHA 3USBA 3CHVA 1TB3A 3DU0A 2HSAA 1QDSA 3TW7A 1VYPX 1HO1A 4YL2A 3N14A 3LCHA 3R8RA 3S1VA 4QITA 4EWND 1W5NA 4R34A 5FEXA 2NZLA 1OF8A 3BG5A 4K7YA 1SW0A 1RVGA 3THQA 3BG3A 3QMTA 2YX0A 2QCDA 2DZVA 3S42A 2A21A 4ZZ9A 4LV9A 4O4WA 3LHZA 3PBYA 4S2CA 1WDWA 2OJPA 3L67A 4XKYA 3TQVA 2H8XA 4ONVA 2GJNA 5K7JA 2CLKA 4NJHA 1TCDA 1T8XA 1TTIA 2NV1A 3KHJA 3QC3A 1EWEA 4UTLA 3G1FA 4AB4A 3N19B 3OEXA 5TIMA 4A29A 2ATMA 2Y7GA 4JTSA 3RK8A 3HG4A 4RZ6A 3ABOA 3M5ZA 1H51A 4FIQA 3QM3A 3C2FA 1SZFA 4O54A 3MI6A 3GXPA 3R89A 3N9RA 3UWQA 3HOJA 1VC4A 4LVDA 4NNAA 1DJQA 3N3MA 5HR6A 3GB6A 3QH2A 4JTTA 4I9AA 3HB9A 1D3GA 3GDMA 1X1ZA 5HWMA 3W2KA 3BLFA 4A3UA 3QPZA 4BF9A 5FF3A 3B05A 3CB8A 3GIYA 2CU0A 1TRDA 2O7QA 4NX5A 8TIMA 2DU2A 2YGYA 2Z6IA 3PSWA 4W9TA 4JX5A 1TV7A 1B3OA 4GJ1A 2B7QA 2DZPA 3O8AA 2WV8A 3P82A 4IMCA 2X1UA 5G2WA 3TXZA 3MI3A 4WXYA 5ABTA 5A8GA 1Q3NA 3NPVA 1GEQA 1H1ZA 3MHGA 3TIMA 1JR1A 1TMHA 3C52A 1FDJA 3N9SA 3L65A 3W2NA 1FCQA 2AQWA 4ZQOA 3BGGA 1V7YA 1BWLA 4IPJA 4A22A 1I2NA 2V5LA 4Q32A 1VLWA 1VJIA 1O95A 3IGUA 1GTEA 3P61A 3NQ6A 4XTDA 5IBXA 4CCDA 3OG3A 1UCWA 1FXPA 4ADSA 1W3TA 3A23A 3M6YA 4QIUA 2YSWA 1NF7A 1LOSA 4PEKA 3SIZA 2YFNA 4JTFA 4K8EA 1K8XA 1LBLA 1P0KA 1R46A 1XDMA 3QRHA 3LCLA 1KM1A 2FQIA 1GPWA 2J9ZA 2B0MA 3C3NA 3W74A 1XCFA 4UXDA 3C56A 2QCCA 4N6FA 3TE9A 4TMCA 3LXAA 4PL2A 2E6YA 1LRQA 1G4EA 3GXNA 4KFPA 4UIOA 4XUGA 1UB3A 2EGZA 4BI7A 4MY1A 3C2VA 2G96A 4MLJA 1SR9A 1EA0A 1LRNA 3R5EA 3N73A 1QPQA 3ZFHA 1XM3A 2C6QA 3P8JA 1GTHA 3PM6A 1A5SA 2QUUA 3CC1A 5HWJA 5LZLA 5D02A 3IEBA 2WKJA 1GT8A 2V82A 4AVFA 4JY8A 3SFKA 2V0TA 3N34A 4LV4A 1ME8A 1ZJIA 1SU5A 1ZALA 4JDYA 4B5NA 3S9YA 4O50A 5K3VA 3G22A 4PODA 4NU7A 3W76A 4KWVA 4EVZA 5EKYA 1A5CA 1SSGA 2P10A 3E49A 1K8YA 4WJEA 3GNNA 1KM6A 5KMYA 4JTGA 2A7PA 1UUMA 1L9WA 3OA3A 4KKXA 3GAYA 3TSMA 1OFDA 2XFWA 3NL5A 1JJKA 2CLFA 5EA9A 4QNWA 2DZTA 1R30A 3W23A 1SZGA 2Q8LA 5FEWA 1B57A 4DXVA 2XN2A 2WPBA 3I68A 5H2ZA 3KXQA 3TKFA 2VFHA 1KFCA 3P8IA 1J5TA 3E12A 4S2BA 3O16A 1S5VA 2C14A 3W87A 3W1PA 3O6YX 4LNYA 3UY7A 2QCNA 2QR6A 3LTPA 3NPUA 1H7OA 3STFA 1UBSA 4RK8A 1JVNA 1OVDA 2V9DA 4HPXA 2DZUA 2ZRWA 5D38A 2CLLA 3NQFA 3IVUA 2YXGA 4M7TA 1DHPA 3W72A 1UUOA 2GQ8A 5DN1A 3TH6A 1S3HA 2I9EA 2E5DA 3F03K 2ZA1A 5FI8A 1DV7A 3W86A 1G6CA 4U28A 1DKWA 1AK5A 1KA9F 4I7VA 1C9DA 5EMUA 3W7MA 1TTQA 4JTEA 2NUYA 3EXSA 5DCDA 4I7UA 2PURA 2XN1A 3QYQA 3AO0A 2A4AA 3NL2A 2C15A 4WD0A 5CSSA 4PA8A 4TX9A 4RZ4A 1L2UA 3LHUA 4JTJA 3M41A 1Q6OA 4MFDA 4PC8A 5CPLA 4CNOA 4O8RA 1JCNA 4LW7A 5AHLA 2NXIA 1TPUA 4FF7A 4GXMA 1FWNA 2NV2A 1L6SA 2E5CA 3NM3A 3BGJA 1BWKA 3DBPA 3BVJA 3DAQA 1KM5A 1H7RA 2E68A 3TU9A 3HGOA 2QCLA 3EX4A 1YXYA 4GRSA 3NQEA 1LROA 2W0UA 3W85A 2A2IA 3CQ0A 1SO4A 3QSRA 1FCVA 3G24A 5D2YA 3TR2A 2Q3OA 1G4TA 1QNVA 4CQAA 1KFEA 2DJXA 3L0KA 2EKCA 1N55A 4WQ6A 1W5MA 2FPVA 4N4PA 3L5AA 2V2CA 5AYZA 3VCRA 3MBFA 3TROA 3DENA 1YXDA 5H91A 1G4PA 4QNEA 4AF0B 3NAVA 3OVRA 3TUUA 3LV5A 1H5YA 2VFIA 3FKKA 1T96A 1EEPA 1VQTA 2I14A 2ABAA 1GG1A 4O12A 1QO5A 1EPXA 3P60A 4J9JA 3S5NA 2VEMA 1F76A 3IRDA 3LRMA 3QW4B 3YPIA 4CQ9A 1OF6A 1VR6A 1OX4B 2G5WA 2I1OA 2VFDA 1RPXA 2X16A 3PR2A 3TAKA 1MZHA 3W7NA 1WV2A 2BZNA 3PBWA 4JTUA 3V1PA 3R12A 4GE8A 2HS8A 2E5BA 3A24A 4DF0A 3P74A 1M6JA 3NQ8A 4UFMA 3R13A 1A5AA 1IXPA 4LRTA 3MJYA 1ZNNA 5KITA 4DF1A 5L9FA 4K6AA 4M6QA 1OG0A 2J27A 3DGRA 1PCKA 2WNZA 1TQXA 3INPA 4JN6A 2YYTA 1H62A 2QAPA 1AMKA 5GVJA 3Q37A 1X8FA 5CGQA 1RQHA 1HL2A 3DI0A 3W7KA 3ZR4A 5BRBA 2J6XA 2ZBTA 2X1TA 5TQLA 4BI6A 3CIXA 5U4NA 1JCYA 3WK1A 3QZEA 1VYRA 3CIWA 3W6YA 1LM1A 3G1AA 4OQVA 1NFBA 2ZQ0A 4E2DA 2ZTJA 2R91A 5LNVA 5F1UA 3DXIA 4MY8A 1TV8A 1A53A 5G4WA 1EP3A 4OE7A 1YTEA 2ZCGA 5LGZA 3DHDA 3DI1A 3LXCA 4JYDA 1QOPA 5IM51 3F1QA 5F4SA 1HO4A 1I2PA 3FA5A 4TR9A 4IXXA 1YLVA 2V2DA 5AC7A 4LUIA 1H60A 5K9XA 2PRHA 2Y85A 4FEZA 4K37A 4NX0A 1XBZA 5E93A 3M16A 4CCCA 2D73A 4UR8A 4POCA 1ZFJA 4AWUA 3FJLA 1ZY9A 3UNDA 5I3IA 1DQXA 5LHFA 5FF7A 1WYIA 1QAPA 1X6UA 5F4WA 4MOZA 3GXTA 2TPSA 2VELA 2X2GA 2C0AA 2FLIA 2R94A 3NA8A 3UD6A 1XI3A 4WZHA 1GWJA 5G2HA 1XBVA 1BKSA 4Z0SA 3HIJA 3JS3A 4Y8FA 5KTLA 1KLYA 4L4LA 1QOQA 1SO6A 1VLIA 3NEVA 4UMCA 5DY2A 1W8SA 2CLOA 3NG3A 4H4IA 1X7FA 1YPIA 2VEKA 3TAOA 4UTJA 3E02A 1KM0A 5KZEA 2A85A 2GVLA 2Y70A 3W70A 1YADA 3BPWA 3JR2A 4HN4A 1AW1A 4C1KA 4X22A 2CLMA 3IIPA 5D09A 4BK9A 3B0VC 1O60A 4O1DA 3C2OA 2CW6A 1WAUA 1P5BA 3RNDA 5LNRA 2CZ5A 3TDFA 4XTIA 2Y6ZA 1LORA 3TFCA 2Z2UA 3DHFA 1FBAA 4RX0A 4YCPA 4K36A 4UNKA 4O1BA 1I2RA 1D3HA 1Z44A 3CTLA 3EKZA 5I3GA 2ZRXA 1LBMA 5G2IA 3GR7A 2YDAA 3L68A 4UC5A 2Y7DA 4M6VA 4DPQA 1GVSA 2CLEA 1HG3A 4UFLA 2BX7A 2CZDA 3KRZA 3W1XA 4IOTA 2NXGA 2QEZA 4N4QA 4YMZA 3STCA 5CPNA 3MUXA 1LLZA 5AYXA 2OMAA 3Q58A 5FESA 4FX7A 3PY2A 1EWDA 1JCJA 3LM7A 1P0NA 4XBKA 2RFGA 3KFTA 1DOSA 2FFCA 1PHWA 2CZFA 3W1RA 3L5MA 3LHYA 4UCGA 1H50A 4LVGA 2YCEA 3LTYA 1WOBA 4RLIA 3KRUA 5AOUA 4AEOA 3TQ0A 3W2LA 1BEUA 2A6LA 4I7WA 1LCOA 3LLFA 3G1XA 5CPOA 3PAJA 5FF4A 1RQEA 1W54A 3L0GA 4ZL1A 2QJIA 5K9CA 4LVBA 2V8ZA 1W31A 1GVFA 1TQJA 1XL9A 3NQDA 1CX9A 1ZAJA 2HS6A 3SGUA 5F2GA 3KAOA 5C54A 2VENA 3NQ2A 5U7SA 3HJZA 3C0JA 1OX5A 3MWAA 2ZZ4A 3NQMA 2ATSA 5CZJA 3TX9A 1OK6A 4R7JA 2V30A 1SW7A 3W7OA 1K7XA 3W7EA 3M7WA 4FX8A 4R53A 5D37A 1F6PA 1KV8A 2P1FA 1F73A 4MZ1A 3UPWA 3VE7A 3OVPA 1H7XA 3O05A 2PE4A 3EKLA 4S1FA 4O19A 3GZ3A 1FCUA 5CPMA 5AHEA 4N9BA 3W9ZA 3L5LA 4ZQMA 2TSYA 3NR0A 3T78A 4LU0A 3LX9A 4WY0B 1DORA 4Q4KA 1W37A 5HMSA 1H63A 4N02A 4UTIA 2GVJA 2RDTA 1HTIA 1KLZA 2B4GA 1PE1A 4R33A 1A50A 1ICQA 5A5WA 3W07A 1OFQA 1ONRA 2WNQA 3O1NA 1MEWA 3AJXA 3U6WA 2ZZ1A 4K38A 3B04A 1JUKA 2ISVA 1AL8A 1QMLA 2Y7FA 1TYGA 2G95A 1IXOA 3HPXA 3SI9A 2G97A 4MFEA 4P61A 5AFDA 5K4ZA 3RF9A 4EIVA 4AF0A 3E0IA 1XBXA 2E1DA 1GQNA 4FIRA 3VKJA 5I3KA 5BOOA 1E51A 1QWGA 1S5TA 3FLUA 1SZEA 3S6DA 3BARA 1TPH1 3T44A 2QDGA 2BTMA 5D32A 3PF3A 5EYWA 3S5ZA 2JK2A 4RKAA 2FTPA 1TRIA 1B9BA 1OYBA 4HHPA 2Y61A 1AW5A 5CZSA 4QSHA 3FKRA 1GVOA 1ADOA 2J24A 1QPRA 4FHAA 3I7RA 3QF0A 3MP4A 4HSNA 1K7FA 4NJGA 1JCMP 3EX1A 3KVKA 1OX4A 1EP2A 4ADTA 4MIMA 4LS2A 3PVFA 4QAIA 2ALDA 4GC4A 5KZDA 1F2JA 5T26A 4PL1A 3A9IA 1NSJA 5EPDA 2NX1A 3UWWA 2IQTA 3EWWA 3WJSA 2J9XA 1LZOA 1YTKA 4RXFA 3SZ8A 4FXRA 2WSQA 5DCBA 3IIZA 3C2RA 2ZTKA 4DBDA 3E9AA 4NQ1A 1FWWA 3VE9A 3LV6A 5LSMA 3W71A 3JRKA 4JNMA 4RZ5A 3G8EA 3M0ZA 5CKSA 4TU1A 4IMFA 3UWUA 4EF9A 5CG7A 4AMAA 3W22A 1P1XA 4H3DA 1I2OA 2V2HA 1LLWA 3IIVA 1L6WA 2EAWA 2ISWA 3SJ3A 3TA6A 3GYEA 4KWWA 1GZGA 1WBJA 1L6YA 5AHFA 5F4XA 4EF8A 3CM4A 2NLIA 2JKPA 1F74A 3BG9A 1O5KA 1PS9A 2CLIA 4LS1A 5KINA 3HGJA 1QCWA 2PRLA 1XUUA 4LT9A 3GKAA 2DZWA 4U4MA 1XBYA 1W3NA 3KVLA 4RXGA 1W5OA 3OIXA 3W7IA 5F2LA 3L21A 2E77A 4L4MA 3TCEA 4MPQA 2C16A 4UR7A 3C8FA 1AG1O 1DJNA 2FJKA 2OCZA 5FF2A 1XFBA 2VC6A 4O0KA 3G3MA 3B06A 2BSLA 3F4NA 4DO5A 3NPWA 1K7EA 1K03A 2RKXA 3NL6A 3TMQA 3PB2A 5BW6A 4GNJA 3MHFA 4GUGA 3N2MA 2J88A 2Y89A 3R2GA 2C18A 3RLVA 5LNWA 4O0ZA 1OX6A 2OT1A 3P84A 2WJZA 3S8HA 2GUUA 4XWUA 4RCXA 3UZ5A 2KZHA 2A7RA 4LC8A 3W84A 1LYXA 2J9YA 1O4UA 1N8FA 3PC0A 3DKLA 1GG0A 1P4CA 2A5HA 3LXBA 5DXYA 4NJJA 3A5VA 3UXDA 3GR8A 3EXTA 3C2EA 4P2VA 3OHIA 3LTSA 1SO3A 3PULA 3W1LA 4IGHA 1R47A 2VOMA 4FNSA 3W1NA 5AHNA 1PCWA 3STGA 3L9CA 4WUIA 3UWYA 5LNSA 5L6UA 2C1HA 3A5FA 4TMBA 5BMWA 5AB3A 3BO9A 5KSWA 4TO8A 4O57A 2GJLA 3ATYA 3QPYA 5AHMA 3GDLA 3RLUA 3KX6A 3RU6A 3S1UA 3STEA 1LDCA 1W56A 5G5IA 1G69A 3PG8A 1PIIA 4X2RA 3H54A 3O06A 3QMSA 3QW3A 1OYAA 1XKYA 4JXCA 2ZZ7A 1YPFA 1TPFA 4NUWA 4DO6A 3G1DA 3MI2A 4BI5A 1TTJA 1YTDA 3ABQA 3M1ZA 3NVTA 2X30A 3BV4A 3FYOA 4MLRA 1SUXA 2TMDA 4ORIA 4MY9A 1QR7A 3EEGA 4UMAA 4FNTA 3P80A 3DFTA 2QAFA 1JUEA 4MZYA 4K7VA 2E6AA 1XC4A 1KTBA 3ELFA 2XN0A 5J5DA 3MYPA 1GYNA 3UWZA 2RDWA 1H7NA 3NYZA 3G1HA 4Z1DA 1G4SA 5CSRA 4JGDA 4E38A 1DL3A 5FF0A 1FWTA 3BLIA 2HMCA 2JBMA 1TPVA 4MJZA 4E2BA 3LCWA 3S5OA 1WX0A 5F2IA 3UYCA 5AC6A 2QF7A 3LLDA 4HSOA 1VCFA 3LRKA 4GUJA 4XBSA 4NXSA 1D9EA 1SQ7A 4FNPA 3QFEA 3UY8A 1OFBA 3SW6A 3NQ7A 3MBDA 5LNUA 4QM1A 1WA3A 1RZMA 3PUDA 4UTWC 4DBEA 1WQ5A 4UTUA 2ZRUA 4Z1BA 3CPRA 2B7PA 4OGZA 4JX4A 4O16A 2NXHA 3G1SA 4O17A 2GOUA 3DFNA 1JULA 1VS1A 3SSJA 4Y96A 1F7BA 4X9SA 3WK0A 5HULA 1TPWA 3QMRA 3L2IA 2W79A 3QSTA 6TIMA 3PBUA 1UJPA 2OX1A 3PSVA 4Z0JA 3SY5A 5BMXA 3M9YA 1MO0A 4LRSA 4DPPA 2GVGA 4ZQNA 4KFOA 1SFJA 1FQ0A 2QCGA 4HNVA 3W1TA 5DY3A 3W7LA 3SECA 3CEUA 1EX5A 3W7PA 1CW2A 1FWSA 1KTCA 1NAL1 1X1OA 3K30A 4UTKA 4K39A 2QCMA 3TV8A 3FS2A 1J4EA 3LHWA 3M47A 4OBTA 4G1KA 4CNPA 4AXKA 3W2UA 4UTHA 2WOQA 4IWWA 4RR4A 1O94A 4AWSA 3Q2DA 1Q45A 3GVGA 2ZZ5A 3NXFA 3W7HA 2B7OA 4FO4A 4JY9A 3W7CA 4O14A 4N9CA 4WY0A 3I7QA 1KM2A 2A0NA 4PFMA 3U8GA 5KZMA 3GDRA 1TPB1 1OK4A 3TXVA 2DJLA 1R2TA 1KFBA 4AH7A 4JYFA 3MP5A 6ALDA 3M5VA 3UXAA 3G1YA 1EB3A 1M7PA 2CWNA 5J5RA 4DO4A 1MXSA 3C4UA 5D33A 5D30A 1I2QA 4JTIA 3FJ6A 3S1XA 2BWGA 2Q3RA 1SO5A 3IGXA 3DFOA 5DLCA 3IIOA 3SR7A 4HT3A 3ABSA 2JGQA 1Q6QA 5K4XA 3N2XA 1OFRA 4JICA 4PCFA 1B4KA 1EUAA 2NUXA 2H90A 1JRBA 1AW2A 2WQPA 2VKZG 1K8ZA 3PBVA 2YR1A 5I3FA 2FPYA 1LBFA 1OFPA 1KW1A 3NQCA 4GFSA 4IUOA 1FCBA 3I65A 3FOKA 1KFLA 1CI1A 3GK0A 5D2VA 1J2WA 3HPSA 1YDNA 4WOQA 4A2SA 1SSDA
chains in the Genus database with same CATH superfamily
1S5MA 3PTQA 4PB5A 4R5EA 4IP4A 1TWSA 1GVEA 1GJPA 1Z41A 4C1LA 4JIPA 2PU0A 1E1EA 3URBA 3LBMA 3W1AA 1KBJA 4DLFA 3EOEA 3I3BA 3THDA 3ABRA 4R88A 3B0YA 4O8AA 2Q71A 2QVNA 3IV3A 2DDXA 1LOQA 2V3GA 1E5JA 4HPGA 4D6DA 3VNMA 4H9YA 1VH7A 3V36A 1NWUA 2X1RA 4JR5A 3NUKA 4NZ3A 3THUA 1P0DA 1VB9A 3MQTA 4JFWA 3W2JA 5C5YA 3GWQA 2UY5A 5DCEA 1IEWA 3O15A 3EDFA 1GKRA 2HNHA 4GGBA 1U22A 4I3GA 3TSDA 3VGHA 4FNRA 2HNEA 3GU1A 1WXJA 1HX0A 1YYAA 2NWRA 1XIEA 3KVJA 3K2GA 1UW9A 4AHPA 5A8PA 3UZWA 2H3DA 3AS1A 4JTHA 3WLIA 3GDKA 4BFAA 2VXNA 3PPCA 1EJVC 3GIPA 4CNNA 3BXWA 4HTBA 3TK7A 3KS6A 1EYWA 2FTWA 3QTPA 2QJNA 2WSYA 4PMDA 4LXFA 3VX0A 2W6RA 3M44A 4JTCA 5CBBA 1CT5A 3OLDA 4QLLA 3H70A 3W2MA 3D5HA 2QUTA 4MKNA 3CZEA 3SEPA 5I3DA 4FX6M 3W73A 1CLKA 4H1ZA 3QZ6A 1J6OA 5EFFA 2HRWA 4IFKB 1W1YA 1PYFA 1FXQA 5DELA 4Y9NA 2PSNA 3W0KA 2GJXB 2DVTA 5HJXA 3UQNA 2XFYA 1CGTA 4MWAE 2VO5A 3FK4A 5HINA 2Z2AA 3WD0A 3T40A 1JPIA 5EMLA 3CASA 4OT7A 3G6MA 2QMJA 1TA3A 1RQBA 2FZ8A 3E96A 4AU0A 4W5UA 2OT0A 1WDQA 3A21A 5AVNA 5D03A 3LHVA 2QUVA 1C91A 5AC5A 1B54A 5D8ZA 1XIJA 2FGZA 1N2VA 4NJIA 1EP1A 4IMEA 1A4MA 5IBXC 3BLDA 3WDRA 5LA2A 1VFOA 1KXQA 4IMDA 3T4CA 1M53A 1JRCA 1ITUA 2E09A 4XD4A 4UQDA 4MGGA 4L80A 4H9TA 1J96A 4GY0A 2CHNA 5EBUA 1HNYA 4Q8VA 3UT0A 5SWUA 4HNUA 4M19A 1QUMA 4L5ZA 1VHCA 2C8NA 1YNPA 1UH4A 3LCXA 5HQEA 1YXCA 3SCNA 3PWAA 2YW3A 1NM9A 2R14A 2VNCA 1JF5A 4RE3A 3M5YA 4YVPA 3SCTA 3HG3A 4JTLA 4H7VA 5F7UA 4DJED 5T9CE 4NJKA 3ZVIA 3B4UA 3H2NA 2QCFA 3TC3A 4U2YA 4IT1A 4AAJA 1UD4A 4XKYB 4WVXA 4O28A 3MMUA 5TBOA 3G18A 1G67A 4WJXA 2BY3A 1TUFA 5MKGA 2ZOXA 4WHBA 1TV5A 4JCMA 2PGFA 1V4YA 3M43A 4OECA 4AZIA 4UTMA 2C13A 3ME3A 4XZBA 3R6IA 5A6JA 4P8UA 4M8UA 5EL1A 1V0MA 1RY8A 1NELA 3A3XA 3H7RA 5D2TA 4P7QA 4GGHA 1CGYA 1MVYA 2CHOA 2J4GA 1XW8A 2QDDA 2G4JA 4MSSA 4NAEB 1UOKA 3NO5A 2NX9A 1JZ2A 1PIFA 3TNOA 1QATA 1Q2RA 2JEPA 2NQZA 3CH0A 4RPPA 2HXTA 3UWVA 2QV4A 1TV3A 3HGRA 3AMDA 3VOJA 1VCGA 2OZ8A 1VBUA 4LOCA 3QLLA 3WLJA 1Q65A 2PC4A 3GY1A 1U1HA 3DFQA 5I3JA 1A0CA 1R9ZA 2Y62A 3AC0A 2XHYA 5AC8A 5FAJA 2HZGA 4IX0A 3UYIA 1J79A 1B3VA 3V18A 1K9DA 1ZZMA 3GFXA 1TJ0A 5ABGA 2WM0A 1TSIA 1R2RA 3TJLA 1LQ0A 3KL3A 1A5MC 3T0DA 1RPKA 1BD0A 3KOWA 3SUTA 3O6CA 1WKDA 1SM9A 4KEMA 1R3SA 2EHHA 4HNNA 3GAKA 1J5SA 3WNKA 4GVFA 3PTMA 3RX4A 1LL6A 5G4EA 1DTUA 3KM8A 4IGMA 4MZ8A 1F3XA 4DWSC 1XYBA 3NL3A 1IXNA 4N2YA 2E67A 2QIIA 3OTRA 5KETA 3AWNA 4GBUA 4NT0A 1V6VA 1Z42A 4UTFA 1Q7ZA 3SCUA 3IK2A 3DFYA 2WBKA 4Q7IA 4MADA 2ZDSA 1W5PA 3R94A 4HNTA 3ALGA 1DJGA 3LG3A 3TZFA 4PMOA 1JI1A 5T9BG 5HWNA 3EBVA 2VMFA 3FDGA 4I8YA 5I77A 5K2ZA 3VNYA 5FIPA 2DZXA 2J7HA 1VP5A 4E4FA 4MVAA 1NDWA 4EACA 2QDEA 4NF7A 1GOWA 1VF8A 1UWAA 2UY3A 3TJIA 4Q4RA 4RW3A 4PTWA 1YDOA 3SGZA 3ZWSA 2CHRA 3CLMA 2FYMA 1JNDA 3BOFA 1W3HA 2OQHA 1IGSA 1W1PA 3UPBA 4AZHA 2J8FA 3ZS4A 3B0PA 7TIMA 3O0FA 1EZWA 5BWAA 1E73M 4ZOBA 1W0MA 3CWOX 1IEXA 4CEXC 1U5HA 3EXRA 1RBOB 4CNUA 3QOMA 3B4YA 4LYKA 1IT0A 3LRLA 2O9OA 5FL0A 3TFXA 2INZA 2AAMA 1HT6A 2J79A 4GQBA 4BWLA 4WXZA 1CLXA 1XDJA 2NQLA 2XISA 3OQ8A 2LLEA 2QVHA 2WSRA 3VD4A 3RPTA 1EIXA 1XYZA 4CQ8A 1JDEA 1M68A 4NI3A 1B4EA 1FWBC 1XIBA 2GQAA 1RV8A 5HJLA 3ISIX 1PO9A 1U2YA 2NWSA 3L0NA 3WQ6A 4LUJA 1UZDA 4KH2A 2YFOA 3EYPA 3CYVA 5CZ0A 4O10A 5LKYA 3FN9A 3F4DA 5DFAA 2WCSA 4ERAA 2EG8A 4FXJA 1OHLA 3V75A 4UMBA 3T8QA 5DBTA 2EPLX 4M0XA 3H2OA 4HZ8A 1OABA 3GTHA 1KCXA 1GYLA 4S3GA 3T2OA 3W1MA 4GUIA 3O9NA 1B3XA 2X8RA 4YTUA 4GXPA 4EPKA 2FH6A 3ABXA 3G0XA 2O92A 5D4YA 2OYLA 1TWIA 2FVLA 4PMVA 3SY8A 1GORA 4AD5A 3M5XA 1B3YA 3MPGA 3DU0A 4XIAA 1QDSA 3TW7A 4JQ3A 4GKTA 3MUIA 3VNKA 4C6MA 3WMSA 3ARSA 1PX4A 4FLSA 4UQAA 4YTTA 4LV9A 5C8BB 2VR4A 4XKMA 3VDHA 5K7JA 4DYJA 1KCLA 1T41A 4ZE5A 1KRAC 2NV1A 4RE4A 2D3LA 3OEXA 3CT2A 2ATMA 5BROA 3RK8A 4FIQA 3NDYA 3C2FA 3TNBA 2WHKA 3HV8A 3N9RA 1RCOB 3LSBA 2PB1A 5A94A 2PWEA 1ENUA 4HCHA 4JTTA 4INFA 3ABZA 4I9AA 3HB9A 3A3WA 3GDMA 4RW5A 1X1ZA 1KQYA 2YA1A 1OIMA 5LIKX 4C7FA 4BF9A 2VCAA 5G1MA 1Q6GA 5FF3A 3GIYA 2GK1B 2O7QA 3ARXA 2YGYA 2FTYA 4W9TA 1EL3A 3ZZ1A 5HPOA 3VK5A 3O8AA 1GOMA 2WV8A 4IMCA 3WQEA 4DUXA 1FOBA 4H19A 1VEMA 3EEZA 1MW2A 4ZOEA 2AL2A 4WXYA 1F3TA 5A8GA 3R8HA 4B3ZA 3VIFA 3NPVA 1GEQA 1IZCA 1HJXA 2PGWA 4HK7A 1TMHA 3OGVA 1FDJA 3LGGA 3N9SA 2VX4A 5AY7A 3BGGA 1V7YA 1ISVA 2VWSA 1J0YA 4GI4A 4A22A 4LGXA 2V5LA 3E38A 4XTDA 4YVVA 3PTDA 1E56A 4ADSA 1W3TA 3S46A 2IKHA 1NF7A 2PEVA 3U2EA 5KZ6A 1ESWA 3SIZA 1A4LA 2VRKA 4E8CA 1LBLA 1P0KA 1KXTA 1F8IA 1CEOA 1TUXA 3QRHA 1PWLA 1KGUA 3PK7A 2J9ZA 4K1GA 3C56A 2QCCA 1AODA 1G4EA 3OZYA 1VRXA 4XUGA 5CPQA 2EGZA 3V3WA 7REQA 4AYGA 3K5XA 2G96A 5J8LA 4MLJA 1EA0A 1LRNA 4UOQA 3N73A 1ZBWA 1XM3A 2BVDA 3DHPA 1I0DA 3FGCB 2Q01A 3PM6A 1A5SA 4GJIA 5HWJA 2VZVA 3KTXA 3K13A 3H8AA 5LZLA 2DT3A 4PTDA 2J7BA 4AVFA 3CAQA 3OJGA 1UHVA 4FOUA 4O50A 3W76A 1EPVA 4H01A 2QPUA 4EVZA 3AMLA 4D9PA 3AS2A 1K8YA 2CKSA 2BGNE 3OA3A 4KKXA 4NYYA 1JYNA 3ITXA 1O66A 3ANVA 2CLFA 1EJRC 1R6WA 1SZGA 2WWCA 3W4RA 3WH7A 3HU7A 4FOJA 4ZEPA 1K4GA 3BZGA 4DXVA 2EPKX 2EPNA 2IXVA 1SVDA 3ZSSA 3MSRA 4S2BA 3VNLA 1BWVA 4X0VA 2C14A 3C0LA 1S39A 2QCNA 3GHSA 1L6FA 3LTPA 3E5PA 4W7VA 2CERA 4PMZA 2PA6A 4HPXA 2ZRWA 5D38A 3NQFA 4M7TA 4QG8A 3BAIA 2WMIB 3H26A 5DMMA 4Q4PA 5EB8A 4HOZA 1V02A 4GLEA 3H21A 1G6CA 5EMUA 2J25A 5H1WA 4JTEA 4I7UA 2PURA 3HTWA 4LBRA 2XVPA 3AO0A 4PMNA 2A4AA 2PDJA 2C15A 3GUGA 4P8WA 5CSSA 5CSYA 2ZIDA 4RZ4A 5PTDA 1EC8A 3LUTA 1H4PA 3W6MA 1M1BA 2F2HA 3M41A 1Q6OA 1NARA 4MFDA 4JKMA 3KE0A 3BLKA 1UR1A 2Y5SA 4LW7A 5AHLA 4FF7A 5H6HA 2E9BA 4KRUA 1BWKA 1E6QM 1UC4A 3EPOA 2PDGA 1OG6A 2E68A 3MV11 2WZMA 1DQUA 3M0LA 1E6XM 4GRSA 3BSGA 4C1NA 4FA3A 3QSRA 1FCVA 4F40A 4MNLA 4GIYA 1G4TA 3TTYA 5IHSA 3PBMA 1OSEA 4NRSA 2Q09A 4US5A 4N4PA 3F5JA 5AYZA 1CGUA 3OO2A 4GYPC 3V7PA 2HK0A 4DJDD 2D0FA 4N7QA 4WDTA 2D3NA 3CZJA 3NAVA 5BWFA 1XLMA 1EQPA 3CO8A 4B16A 2EKGA 4JFSA 4AY7A 4ICCX 3GD6A 4B15A 3ZQ9A 4O12A 4Q4MA 1EPXA 4HU4A 4LYPA 1EJ7L 2VEMA 4DM2A 2G50A 3IRDA 1GNXA 2WMKA 3RJYA 4IIDA 1KGXA 1ELSA 2I1OA 2D0GA 3FA4A 3QHNA 4XD3A 4U31A 1WV2A 3V1PA 2HS8A 3A24A 3N4AA 1G01A 5TAOA 3REQB 2BFGA 4UFMA 1FKWA 4LFYA 4J3UA 3R13A 1A5AA 1IXPA 1ZNNA 1R3WA 5L9FA 4QXIA 4K6AA 2J27A 4QG6A 2PFHA 4JN6A 2YYTA 5CJNA 3PZMA 1NP2A 5CGQA 3DI0A 3CL7A 4C6KA 3CK5A 3Q4DA 2VEFA 3UU0A 2JQXA 5A6SA 5TQLA 4J3SA 3CIXA 5U4NA 4ATWA 1J9YA 4TXEA 2Y4SA 1IYXA 2INFA 2IW0A 3QFWA 3QZEA 3FA3A 4PUMA 4GYKA 3GBDA 4OQVA 2BOEX 4E2DA 2YDSA 2R91A 4BF5A 1XLJA 3QGAC 3OZPA 2ZUUA 3WQFA 4PZVA 4ZOCA 1XG3A 3TA9A 3KCLA 1I9CB 2PWVA 3TQPA 1XLKA 1YTEA 3P93A 3RLGA 3OOQA 4TR9A 1KXHA 5K9XA 4FEZA 1XPGA 4CCCA 1MYRA 4UR8A 4LAOA 3UNDA 5I3IA 1D7KA 2AAAA 1DQXA 1ISYA 1W6TA 1WYIA 3EMCA 2FLIA 4NSBA 3UD6A 3N9KA 4WZHA 1BGGA 2CYGA 4Z0SA 3LNPA 4L9ZA 1SO6A 4XISA 3BE7A 4ZR8A 3LN3A 3WDJA 3KOZA 3TN4A 3VOHA 3ES8A 3NG3A 1A3WA 1XHGA 4TTGA 5C2CA 4YTSA 4MTVA 5HXMA 2VEGA 2GVLA 1OZQA 1ZJAA 1RH9A 2XIQA 3BPWA 3OB8A 3QPEA 3GVQA 4GJJA 4C6PA 3UPMA 3SCWA 3TN3A 4X22A 3WEZA 3DIPA 3B8IA 1CB2A 3LYEA 3WH9A 1JPMA 3APGA 1XJBA 4DZ5A 3EDJA 2CW6A 2PDWA 1WAUA 1P5BA 3M0XA 3RNDA 5EFDA 4WIWA 1LG1A 4Q4QA 3G77A 2OOGA 2X09A 1K4HA 3OA5A 3NEHA 4K36A 4O1BA 1I2RA 5EGRA 3ITLA 2PD5A 3T42A 2ZRXA 5G2IA 2Y7DA 3MY9A 4DPQA 2PF8A 1GVSA 3R4IA 2CLEA 2CZDA 3K8LA 3W1XA 4N4QA 4REQA 1EF2A 5CPNA 4EPDC 1ZJBA 5AYXA 2OMAA 5FESA 4FX7A 3PY2A 4IL2A 4QJ3B 5GNYA 1ONEA 4PTVA 2FFCA 3AAMA 4W8LA 2CZFA 4MDPA 3EWCA 3HQPA 3II1A 5E6YA 3L5MA 3MKVA 3ARRA 2BGQA 4ZE4A 2QT3A 4RLIA 2SFPA 1IQ8A 3VC6A 3W2LA 4NZ1A 3VMNA 3BJFA 3LLFA 5EU9A 3PAJA 5FF4A 1E0VA 2OELA 4XB3A 6PTDA 3GM8A 1TE1A 2EBNA 3VIJA 4JIRA 3VTRA 2ALRA 5K9CA 3UGRA 4CD4A 4ROQA 2XTKA 2V8ZA 4LVBA 1Q7QA 4DO7A 1AJZA 3WLKX 1TQJA 1RD6A 3CH9A 1CX9A 5JBEA 2PTZA 3V35A 1ECEA 1JXJA 1PDYA 5HNUA 2OSYA 4DHGA 3C0JA 2J77A 1QNQA 1YE4A 3TX9A 3OLIA 2PLMA 4DWDA 3WNLA 4H7ZA 2QW5A 3M7WA 3VIIA 2CIPA 5D37A 1F6PA 2WKLA 1RP8A 4MZ1A 3UPWA 1JD9A 1TVNA 2BXZA 4PRTA 4MNJA 5C2GA 2XFRA 4F48A 3O05A 2MANA 5AHEA 1HKIA 4LNCA 3LX9A 3CAVA 5HMSA 4N02A 3ITVA 2RDTA 4G7FA 2B31A 4R33A 5JVLA 3ERPA 4G8TA 3M0KA 3IUIA 3L4TA 5E09A 1XLAA 2ZZ1A 4IQJA 1JUKA 2GSEA 1A0EA 1TFVA 1UJQA 1QMLA 2Y7FA 1TYGA 3CV7A 3SI9A 3AS0A 3CMGA 3TYUA 1A5NC 2V38A 1XBXA 1EF3A 4XZMX 3CZLA 2ASHA 4FIRA 5TF0A 1PXGA 1EJWC 1S5TA 3FLUA 3LK6A 3S6DA 2YXXA 1TPH1 2WMJA 2C71A 3H4XA 1QVBA 4RZBA 2JK2A 1Q6DA 1OYBA 2Y61A 4F0RA 4QSHA 3VNJA 1ADOA 4B5VA 3MP4A 3EB4A 1QW7A 1PB0A 3GUWA 4LS2A 4GCAA 4GC4A 3N6QA 2ZE3A 1XG4A 2XH0A 3QXBA 4PL1A 3CQIA 4MG4A 3UWWA 2IQTA 3N1AA 4NKCA 2J9XA 4E2VA 1LZOA 3K8MA 3BMWA 3WEMA 4RXFA 1W9VA 5DMNA 1NTHA 4FXRA 2WSQA 2ZTKA 4JL2A 5DT5A 3E9AA 1FWWA 4P5UA 2QQ6A 1RBLA 5LSMA 3W71A 4RZ5A 5HQLA 5CKSA 3M0ZA 1E71M 4IMFA 4H3DA 1I2OA 1LLWA 2EAWA 2FZDA 2ISWA 3ARPA 3WNMA 1VFMA 1DHKA 4KPLA 5F4XA 2R9RA 5ABFA 3OBEA 2A3AA 1MW3A 2E0PA 2PDYA 3BG9A 3QLDA 3RR1A 4LS1A 3RAOA 4Q7BA 4W7UA 4GKLA 2YB1A 5HPCA 1PBGA 3AU2A 2DZWA 1DPMA 4U4MA 1L8NA 1XBYA 3RLHA 1W3NA 3ARTA 1E15A 1UD8A 3OIXA 3PJWA 1OGGA 4L4MA 3TCEA 2Y8VA 2C16A 1Z9AA 3C8FA 3WMBA 5FD0A 1ITXA 2VC6A 3T2QA 1RUSA 3ORWA 4ZO7A 4DO5A 3IACA 2HJPA 2QGYA 5FJIA 3MO4A 1K03A 5AZ0A 3NL6A 3TMQA 1R5YA 2XDFA 4JTQA 3SUWA 5BW6A 1JYXA 4GNJA 3L12A 5C9XA 4GUGA 1HJUA 1E6ZA 1BKHA 3EPMA 3W53A 4LX4A 3FJNA 2C18A 4KGJA 5LNWA 3P84A 2WJZA 3S8HA 1A5KC 2GUUA 3UZ5A 4AZCB 4HYWA 4X0NA 3OLGA 1O4UA 1R87A 4XIMA 3PC0A 3LXBA 1P4CA 5DXYA 3ZT5A 3RITA 4DXXA 2PP3A 3BCJA 1E1CA 3L4UA 4X61A 3PULA 3W1LA 1UD5A 1YDYA 1DWGM 2VC5A 3M0VA 3SCOA 2G41A 4WUIA 5L6UA 4TMBA 5AB3A 3GC4A 2PTYA 3KTCA 4O57A 3QPYA 3UG5A 4RV3A 3RLUA 4HU0A 3NSNA 1Q4NX 3H2FA 1U1UA 4J7RA 3S1UA 1BYBA 4XX6A 1W56A 4X2RA 3H54A 3QMSA 1HKWA 2E4TA 4JXCA 2ZZ7A 4NUWA 4DO6A 2PBOA 1XRVA 1TVPA 1TTJA 3ABQA 3M1ZA 2X30A 3ZVHA 3BV4A 3VCNA 3F5LA 1DJIA 4HK6A 4H00A 3A12A 4UMAA 5BXRA 5CGMA 1XYCA 1OC7A 2WMHA 3DFTA 4TOQA 1JUEA 1XSKA 4MZYA 4DJFC 4P7OA 5J5DA 3MYPA 3SCVA 1V8EA 2RDWA 3UWZA 1H7NA 3NYZA 3G1HA 4L1GA 4E38A 2Y2WA 1DL3A 3HPFA 4LCSA 3SSZA 2J62A 3S1GA 1VJSA 1JDCA 1EEXA 4IISA 2JBMA 3BAJA 4JOMA 3KOYA 2WVVA 4OVXA 1VCFA 3ZJ6A 1SQ7A 3TTEA 1OFBA 3MBDA 1WA3A 4UTWC 3AFBA 4A05A 4DBEA 4UTUA 3GFZA 4O16A 3AZTA 1TIWA 1DE5A 3GTFA 3EWDA 3WD4A 3UR8A 1VS1A 3I4KA 4Y96A 1F7BA 4X9SA 3UWEA 1JG9A 1TPWA 2IXUA 4FLRA 4ILSA 4LCRA 3QSTA 2PC8A 2PI6A 3PBUA 3U3HA 2Q02A 4ZCWA 3AYTA 3T09A 2OX1A 1LG2A 3SY5A 1LT8A 5JIPA 1FWCC 1MO0A 2R6OA 2J7EA 2X05A 5DY3A 4AZ5A 4X9YA 1ZU8A 1BG4A 2DW7A 3PPFA 3BCDA 3M6DA 3VZXA 1UR9A 3M47A 5EBAA 3WYZA 4I6VA 3LZ5A 1B30A 4NRRA 1CENA 3Q2DA 4S3JA 1QOXA 4ACZA 4FO4A 3OYZA 4JY9A 4Z2IA 4N9CA 4PRRA 4DBSA 3SRFA 1OC5A 2VX6A 3SQSA 3U8GA 1RJPA 1RJRA 1OK4A 3TXVA 1R2TA 1ISXA 1XICA 4TTUA 3G1YA 4A8RA 4J2MA 1KKRA 4AZ7A 4MUPA 3UVAA 5BU9A 1EB3A 3O7UA 5J5RA 4DO4A 2OGYA 3C4UA 4C90A 1R86A 2OKTA 2ESCA 2Q3RA 4Q7NA 1OBAA 1ZTVA 3HURA 1P7TA 3CTTA 2RJGA 3RIKA 3IIOA 3SR7A 1KBLA 3TYCA 1ZB5A 1EZ2A 3VGGA 1TVLA 3KL5A 4PCFA 4Y9OA 3HMCA 3A47A 3WNNA 4PSPA 5I3FA 1POJA 2PDNA 4YU1A 2X7WA 3R58A 1KW1A 4JQ1A 4TVUA 1UMYA 3UJFA 3P0WA 2REQB 2DT2A 3VA8A 3GK0A 2D1ZA 3HPSA 1KR0A 1KRMA 5C71A 2BODX 2P3EA 3HM7A 1SSDA 1W2PA 5A3HA 3W1QA 2VQTA 3LBOA 1E4IA 3GSMA 4HKPA 1E4LA 1HUVA 5I09A 4A4AA 3H55A 4U10A 2G4FA 1J0ZA 3VO0A 3LU2A 2QDHA 1DXEA 3AMGA 5FJJA 4V28A 2ZX6A 3NIYA 3MP3A 1U5VA 3VMPA 1ML1A 4RE2A 2FGBA 1LRTA 4U3AA 3QR1A 4UR9A 2HVMA 5M17A 3V4BA 3NPXA 4L6OA 4LUSB 2BHYA 2WWDA 3K1GA 4AWTA 4GZ7A 1EO5A 4UQEA 2FB3A 3LENA 2CZEA 1KV5A 1KR1A 1GW9A 1GK8A 2X2YA 2PD9A 4ZQPA 3U7BA 3A4JA 3AI0A 1UA3A 3RJXA 3LM3A 4M6PA 1V0LA 2J7FA 2YBUA 5A8OA 3S6OA 4B92A 4C6LA 1B0IA 5D9MA 1NQ6A 4GH3A 3PANA 1W5QA 4H6KA 2F7FA 3DUGA 2VTFA 5I78A 1JUBA 5DMYA 3UFYA 3SADA 1M7XA 4UZSA 6XIAA 4MKSA 5C70A 1H2JA 3TQKA 2OG9A 1UZHA 4KGLA 4WJ8A 3PZNA 4CCEA 5G1TA 1UUQA 4UTTA 1FY6A 4S3EA 2VDIA 3AHTA 3MT1A 4Z2GA 1G9HA 1Q6LA 1KTNA 2R1NA 3KOFA 3K4WA 3PTKA 1FH7A 1MNZA 4YTQA 4Z1CA 4QGCA 3LDVA 1C8VA 1I8JA 1Z89A 4B91A 4JFVA 1TPC1 3QHMA 3P5YA 4O11A 2O7SA 1ODZA 4HNLA 4C6CA 1OFOA 1UMLA 4XK2A 3PJTA 4LAKA 2ON3A 1MEIA 4QDMA 2Z1KA 3QEZA 4JTKA 4IQLA 4UFIA 1VZWA 1K9TA 4E0CA 2WHJA 4L9XA 1K02A 3OGRA 1E9YB 5E5CA 1OC6A 2OWXA 1AD4A 1D2KA 4WKHA 4UNLA 3NSMA 4XUYA 2Z27A 2VP8A 1YW1A 1M7OA 1XDLA 1YDVA 1N7KA 1V6UA 1MMFA 3H4WA 4GNKB 1YNYA 3ANYA 4JTRA 3F2DA 1MZRA 3WJYA 2BHZA 2PTXA 2A3BA 3ARWA 3WBYA 4GFIA 1RR2A 3CMJA 3TYDA 4YWIA 2QZRA 1NEYA 3QJAA 1EFZA 3K4AA 1GOIA 4O18A 5AVHA 5LIYX 2ZX8A 4OBRA 2HPIA 3UCDA 2A1YA 4IX2A 5AN7A 4UFKA 1EA9C 3WCZA 3JZEA 4GI6A 4ALDA 5C2XA 4FZIA 4N9DA 4IIHA 3CEPA 3VI2A 4QDWA 5HUOA 1ONWA 4GZJA 1UWUA 2GQ9A 2AKZA 1V0KA 3UG8A 6CGTA 4FXFA 3OVQA 2BASA 3CL8A 3Q94A 1VYSX 3IPWA 5EMJA 4RV8A 4HOWA 4BA0A 1BTMA 2WAGA 3TJXA 2AGKA 2V81A 3BAWA 3T7VA 3DFHA 1QHZA 3QQ0A 2P3ZA 3HMJG 1S2TA 3V0UA 3QGKC 1XGEA 4AD2A 1GHRA 1OFEA 3F2BA 5EMMA 3A13A 1GQLA 1LOLA 3NQVA 3B97A 2J13A 3N25A 2C0HA 2ZA3A 3PUOA 1RAKA 4GVGA 3GVVA 3HV9A 4ZGYA 2VEIA 4O1EA 3GO2A 4FR1A 3RO8A 2VR2A 3E0FA 5A2AA 1TTPA 1PIGA 2JKAA 2UY2A 3MO7A 1XCXA 4XQ6A 4CN4A 1V5XA 4AHQA 1PPIA 1KCKA 1UP0A 3W1UA 5C55A 2QCEA 3UZJA 4GYJA 4O4VA 3WQPA 1FFRA 2BLEA 4HQVA 2ZRYA 1GVRA 3CUHA 1POKA 1NY1A 3VDAA 1Y0EA 3P0XA 3NQGA 5I24A 5LIWX 3S5YA 2BV9A 1JD7A 3F4WA 1EIBA 5ABEA 5LHEA 2ZZ6A 3VIHA 2WNNA 2GOKA 1IT7A 5ABHA 1E4MM 4YNGA 4HB7A 4WOZA 4JX6A 1I4NA 4GZIA 2QJGA 2X0YA 2XIMA 1ZHAA 3DERA 3DYPA 3HG5A 2PCQA 1GZ1A 1KGWA 4JNZA 2IKIA 5HATA 4DJEC 1XUZA 4H2CA 4L7ZA 3K8KA 1PUDA 1PVNA 2ABBA 3PG9A 1QK0A 1TJ2A 4EPEC 3IWPA 4YWSA 5F2MA 1W91A 1K3UA 4OHQA 2HXUA 1WPCA 3EX3A 3G0UA 3H6OA 4OWGA 4DX3A 3WFZA 3PZIA 1OFAA 1JCLA 5GJMA 3PFRA 1BVWA 2P8BA 6REQA 6XIMA 1TIMA 1TPDA 4HK5A 4M5PA 1MQQA 1D8WA 3QBUA 4F8XA 4D6IA 4QE1A 4XVDA 4CN6A 4D2JA 3HPAA 1SJDA 4H8UA 3WJXA 1HW6A 4DI8A 4IQEA 3PS7A 1KC7A 4XG1A 4JYEA 4XAPA 4V27A 2GWNA 3NWRA 4A3YA 3UR7A 2FMNA 2HDJA 4C5ZA 1ALDA 3TN6A 4JIQA 4M29A 1KM3A 1OCJA 4HP5A 1H7WA 3AZRA 3GU2A 4TIMA 3PBGA 1IT8A 3URNA 1DVJA 4PMJA 3VGDA 4QLJA 4PCNA 3S4TA 1EHNA 3FAWA 2OZ3A 5GJPA 3KVMA 3H53A 1UKPA 4MUZA 3ITYA 1J18A 2J6VA 3FFSA 3NM1A 4BR1A 3EX6A 2CWXA 2OQLA 3XINA 2TRSA 3BQ5A 4K8HA 3DFPA 3NOYA 1T99A 1ZLPA 4XSMA 2D2HA 1DP0A 3SB0A 3P67A 3A22A 1UA7A 3MTWA 4EKJA 3WLLA 2W63A 2BS9A 3M0MA 2F84A 3C6CA 3CHDA 1QW8A 1WDDA 2VI0A 4OU1A 3P81A 4C6EA 3WQ5A 4DUWA 5BZAA 2P8CA 5K9DA 1FUYA 4I5UA 3WKZA 2GDVA 3BW2A 4BWLC 3M0JA 2C79A 4RUBA 4NNCA 4XZNX 2IKJA 2D23A 3SURA 2WYSA 4ML4A 1QI2A 3I6RA 1CPUA 5FCZA 3PB0A 1RK5A 3FXGA 2CLHA 3IIXA 5DRCA 4URIA 3TC7A 4JQ2A 1JZ5A 3G8RA 2H9AA 5C6MA 2A79A 3ITGA 4ZO6A 3LGEA 3GH5A 3G0SA 3BANA 1LL4A 4LVAA 1PKMA 2UV8G 2ZA2A 2XINA 2O0TA 3GG7A 1KM4A 4AD4A 4LUYA 1US0A 1PHQA 4AX7A 5E0KA 3LQLA 4MWAA 2CKRA 4C6DA 3GDTA 3NDZA 4UB9A 3EMZA 4JHZA 1AVAA 1IZKA 4D6GA 3LPGA 4YL2A 3LCHA 5CCZA 3S1VA 5DRIA 4G5DA 4J5NA 4U3CA 1W5NA 2XVNA 5FEXA 1OF8A 1OZMA 3BG5A 4ZA0A 4K7YA 1SW0A 3THQA 1D7FA 3DGBA 3BG3A 2YX0A 1EOKA 4JEJA 2QCDA 3S42A 2XJ7A 4FPSA 4OUIA 1UPMB 3LHZA 2CEQA 2D24A 4KF1A 4ONVA 4ERIA 3AHVA 4FOKA 1VPYA 3B9DA 4NJHA 1EDQA 1XR2A 4NAFA 2UY4A 3KHJA 2WCAA 4UTLA 3G1FA 3N19B 1V6TA 3N18A 3T0CA 1YQ2A 4H8VA 5TIMA 1UOZA 4A29A 5I23A 3UJ2A 3HG4A 4L6DA 1PTAA 1H51A 1W9DM 2XGBA 4DLMA 3CQHA 3GXPA 3OHMB 3R89A 1QXLA 2VD8A 3R10A 3I3DA 3SUSA 5H8UA 4IP7A 4Q8TA 4LVDA 4PGLA 2GSJA 1DJZA 2B81A 4Z1YA 3N4FA 3GB6A 2XIJA 1D3GA 3GNOA 3ALFA 4KCWA 3CZ8A 4KCTA 2BGSA 4S38A 3W2KA 3MU7A 2DFAA 3BLFA 4A3UA 3PN8A 1IEIA 5CC5A 4EP8C 3B05A 2CU0A 8TIMA 1TV7A 2BOGX 2DZPA 1MNSA 2X1UA 1NP0A 4BS0A 1KQZA 3TOYA 2J7CA 1LWJA 4J4KA 3OYXA 3MHGA 3E0WA 3TIMA 1E9LA 1LF1A 2XVLA 3W2NA 2AQWA 3VGEA 4ZQOA 3R43A 1Q6EA 4MB3A 3GQYA 1BWLA 1UWQA 1I2NA 1VBJA 4Q32A 1N8IA 3IGUA 3U4FA 4JIEA 1S46A 5IBXA 4CCDA 4UWMA 3CAWA 1UCWA 2GUBA 4QIUA 1CXLA 3CUJA 4JTDA 5DX7A 1L2QA 4J3TA 3GDBA 1EHAA 1R46A 1EGVA 3LCLA 1XYLA 1GPWA 1HJSA 4UXDA 3BICA 2PU1A 3LXAA 3VDGA 3BSHA 4D8AA 3GXNA 4KFPA 4E4UA 1OY0A 1WZMA 3UEQA 4AEEA 3R5EA 3ZFHA 2BY2A 3SCQA 3NQBA 3P8JA 1GTHA 2ACRA 2AKMA 1B5TA 3CC1A 2GDQA 1OM0A 1HP5A 3IEBA 2WKJA 1GT8A 4UOJA 1EH9A 2PLCA 2V82A 4G7EB 3WQ4A 3SFKA 1DJHA 3BAYA 3U48A 1SU5A 3WUBA 4DAIA 3L4WA 1QI4A 3G22A 5EKYA 1A5CA 1SSGA 2P10A 3E49A 3UR5A 1KM6A 2A3HA 1F9CA 3FHAA 4JTGA 2GGIA 1W1VA 5JXQA 3N29A 3S2LA 2DZTA 3WNOA 1R30A 4DRSA 4NAFB 4B5WA 3UP8A 4AISA 2WPBA 1V7AA 2WZEA 5H2ZA 4GVIA 3P8IA 4V33A 1J5TA 3E1F1 4QSFA 1P43A 1V3HA 3STPA 4XAGA 3UGVA 3W87A 3QV9A 4CGTA 1XKJA 2QR6A 3STFA 3M4HA 4RK8A 3S2CA 3CO4A 3MJMA 2CLLA 2DVUA 1DHPA 5LYRA 3WMLA 1XC6A 4ECLA 1UUOA 5DN1A 1JGIA 4LAUA 1PZ0A 3PPHA 1FWFC 1AK5A 1C9DA 4GBDA 2ZUVA 1AH0A 2AOSA 3ENLA 3SUUA 1TWDA 1WKFA 3WNPA 4WD0A 4TX9A 2OQYA 1HL9A 1BXBA 3LY0A 4ERGA 1XLIA 2PF0A 3BGAA 1TPUA 3QZAA 2NV2A 3NM3A 3BGJA 3DBPA 1X7IA 2HK1A 1WXZA 1H7RA 2QCLA 2FZ9A 4C6JA 3NQEA 3W85A 1OB0A 4BY3A 4PRWA 4G2DA 3W82A 5D2YA 3VOGA 3CV1A 3L0KA 2DJXA 4UZUA 4DWSA 4WQ6A 1W5MA 2FPVA 5HNNA 2IPGA 3L5AA 3AROA 3QN3A 3DENA 3W00A 2WMGA 2NVDA 3AQUA 3QY8A 4AF0B 4LUTA 2NQJA 2ONEA 3T08A 3U5UA 4QTGA 1E5NA 3FKKA 1ZSXA 1T96A 1EEPA 1VQTA 2I14A 1GG1A 2PDMA 4AIUA 1QO5A 4J9JA 3S5NA 1BTCA 1F76A 4KWOA 3B9EA 3LRMA 1IE7C 3YPIA 3IAPA 4LPCA 1OF6A 2WVSA 1OX4B 4Q4SA 3EA1A 1RPXA 3H4GA 2BZNA 4JTUA 2OU4A 4L6HA 1V03A 2E5BA 4DF0A 3B8WA 4J1OA 4F0HA 3FVDA 3FYYA 1J12A 3CV2A 4DVOA 3AWOA 4XO7A 1HKJA 4F9JA 2BNJA 4OIFA 5HK4A 3MJYA 5KITA 1QBAA 3CHFA 4B3KA 3S6TA 4DY1A 3U2CA 1OG0A 3I6EA 1IV8A 3ONBA 1PCKA 4MDOA 1TQXA 3W01A 1AMKA 3R0DA 3EDDA 3Q37A 1X8FA 4CD6A 7PTDA 1HL2A 1S5NA 1C9WA 2J6XA 3TR9A 1R9XA 3EZ4A 4BI6A 4EXBA 3S2NA 4NZCA 2Z26A 5E6ZA 3JW7A 1VYRA 3W6YA 1FP8A 4HNCA 1LM1A 5XIMA 3G1AA 4NZ5A 3BH4A 3BLOA 1TV2A 3UXLA 5LNVA 1EQCA 3USZA 5G4WA 4U5KA 4OE7A 1VFHA 4GX9A 3PHAA 3SGGA 3LXCA 1R8LA 1XLEA 3F1QA 5F4SA 5D9PA 1YLVA 2Y85A 3VIPA 4NX0A 1XBZA 4WSJA 1EJUC 1ECQA 4GNVA 3CHCA 2YOCA 1ZFJA 3FJLA 1ZY9A 4E3TA 1CBGA 5LHFA 5HBFA 2VQUA 4KMQA 5F4WA 3GXTA 4CU6A 2YL8A 2VZUA 1XI3A 1GWJA 2OVLA 5G2HA 2Z4GA 1LJYA 1BKSA 3JS3A 5KTLA 3FV9A 1KLYA 1W8SA 2CLOA 4H4IA 1FVPA 4Q4OA 1T6MA 1YPIA 4D6HA 3WLTA 3TAOA 4UTJA 4X63A 1VENA 3W70A 1UR2A 1YADA 4NL1A 1X98A 1RHCA 2CLMA 3IIPA 4BK9A 3MANA 3N17A 1P1MA 2WMFA 3G5EA 2INEA 3PPGA 2PWDA 3E0VA 3IV8A 1NWRA 4XTIA 2Y6ZA 4OFCA 1LORA 4IQDA 2Z2UA 4LANA 3DHFA 1FBAA 4RX0A 1J0HA 1WKEA 2FDMA 3LZ3A 3QR3A 3KBJA 1Z44A 1Z6KA 4KW2A 3WQGA 5FAGA 3GR7A 3L68A 1FKXA 4M6VA 1F8MA 5CSUA 3KP1A 1HG3A 5A2CA 3AZSA 1GQIA 3KRZA 4IOTA 2I56A 1XV8A 4YMZA 4G1NA 3MUXA 3UZYA 3R8GA 3V5CA 4KWSA 4RNJA 4KIEA 3EA3A 5FACA 1JCJA 1MUMA 3DDMA 1P0NA 3QV7A 4O0QA 1CGXA 2YZ5A 3KFTA 2VHLA 4BEQA 1QTWA 2F8QA 2PLKA 1OCQA 3W1RA 2VRQA 3BAKA 3CPUA 4I9TA 1VPQA 1E6PA 4UCGA 1DYSA 3AICA 2YBTA 2YCEA 3KRUA 5IXEA 1XWYA 2BMBA 3H2CA 2A6LA 1BEUA 3B9OA 4D6FA 1UD3A 1FWJC 3G1XA 4B5XA 4AXNA 2GGJA 2BB0A 1C90A 4HA0A 4TQTA 4QHRA 1TZ9A 4GX8A 4LQ1A 2OX4A 4K8GA 4AZ6A 2G8ZA 1W31A 3NQDA 1GOQA 2HCVA 2PWFA 3SGUA 2NSOA 1E72M 5F2GA 3KAOA 5U7SA 1OCNA 3NQMA 1O68A 2VX5A 2MUCA 2HBXA 4R7JA 2V30A 3W7EA 3B8SA 3MVIA 4FAMA 4R53A 3CHEA 2F6UA 4EXAA 2P1FA 1F73A 1K70A 1E40A 1OGSA 3VE7A 3AIBA 4V1XA 5KEZA 1AQHA 5BXTA 1ZPTA 3GZ3A 5CPMA 2OO0A 4N9BA 3L5LA 2TSYA 1JXKA 4A6GA 4WY0B 4HYRA 4Q4KA 2BY1A 3VNIA 4UTIA 2DSVA 9CGTA 4PMRA 4A3QA 2WNQA 3T1GA 5CXPA 3ZM8A 1QNRA 5LA1A 2ISVA 4QEEA 1S38A 3UW6A 2VCBA 2G95A 3UR2A 1IXOA 2PDXA 1WB0A 4G9PA 4DM1A 3E0IA 3BTNA 2PODA 3SDOA 5BOOA 3U7VA 1GKPA 3T44A 1EO7A 2BTMA 2XGIA 2YJQA 3V1HA 4C65A 3PF3A 5HOSA 2FTPA 1TRIA 1B9BA 4HHPA 5CZSA 1SGJA 1CCWB 2YA2A 3I10A 4CNTA 4PULA 3MZ2A 1QPRA 4FHAA 3WH8A 2D69A 2XH4A 3I7RA 4LB4A 2CC0A 1US3A 1VFFA 1EP2A 3IJ8A 2ALDA 3OZOA 2W92A 2IUZA 1ONXA 1NSJA 5EPDA 1RCQA 3EWWA 5BU6A 3SZ8A 2ZX5A 3IIZA 5AZ1A 3S47A 1RA0A 1CTNA 4M3PA 1WDPA 3GXIA 4D6JA 1XQLA 4ZO8A 3O6AA 4AY8A 1P1XA 4AIOA 4PTXA 3SJ3A 3GYEA 4KWWA 2E9MA 1KCZA 1M7JA 2ZXAA 4EF8A 2FZMA 2NLIA 4FS9A 1PS9A 5KINA 3HGJA 4EX4A 1QCWA 3IJQA 4ZB5A 3WL1A 1GQKA 4LT9A 3DECA 3ARQA 4WDXA 1ISWA 2PDIA 3VDCA 1AFSA 3HN3A 5F2LA 3L21A 1PYMA 3BOLA 4DUVA 1AG1O 1E0XA 4S3KA 2OCZA 1CGWA 5FF2A 1XFBA 4LCQA 1RA5A 3O0KA 4HZ6A 1Z69A 2BSLA 1BXNA 1RLCL 3F4NA 3VPLA 4GQGA 3KRBA 4K3ZA 5H8PA 1FWIC 1F4HA 1OD0A 2PLJA 4PEEA 1HJVA 2WC4A 2Q6ZA 2V67A 3ID7A 2X0SA 3E2QA 2J88A 1TELA 3E2RA 2QS8A 4GYPA 3W02A 4Z42C 4O0ZA 1NJJA 2A7RA 3UA3A 1VBRA 3MSYA 1LYXA 1ZL1A 1N8FA 3C3UA 2XFFA 2WQDA 3KBVA 3LNMA 4PMUA 2DZAA 1WDSA 3FCPA 3A5VA 3EXTA 3C2EA 3KBSA 3WF4A 3AYVA 5BOFA 3AIUA 3QQWA 3NZGA 3L9CA 1BF6A 3QVQA 2YL5A 4TO8A 2GJLA 3G1RA 3ONCA 4FI4A 1L8PA 3VABA 3GDLA 3SCPA 3KX6A 5I79A 3RN6A 4PUDA 3KP0A 1TA3B 1LDCA 1O1ZA 3QY6A 4BZYA 4MKVA 3PG8A 5CC6A 1WDRA 2PWGA 1XKYA 1JZ3A 3G1DA 3MI2A 1V3MA 2RAGA 3NVTA 1O12A 4PUJA 2JF7A 3FYOA 2TMDA 4ORIA 1QR7A 3EEGA 3VINA 3DYOA 1UR4A 3UCQA 5CAHA 2QAFA 3K1DA 3E6EA 1KTBA 3ELFA 3WH5A 1GYNA 2PTWA 1LQ2A 1G4SA 1WZAA 3QKEA 3IJ6A 3VKCA 3WMCA 5FF0A 1TPVA 5CBJA 4E2BA 1BHGA 5EMYA 3S5OA 1WX0A 3UYCA 5AC6A 3IARA 5A6BA 2QF7A 3LLDA 2IPWA 3N2TA 5FJOA 4XBSA 3VD9A 1D9EA 2ZADA 3QFEA 3UY8A 2YCKX 3SW6A 3NQ7A 2Z7KA 1ZP4A 1XLHA 4Y9PA 3M7SA 2ZRUA 5HMDA 3MVTA 5FJUA 4X60A 4JX4A 1RLDA 4RPQA 3U0HA 3DFNA 2HISA 3WK0A 1WXYA 3PNUA 3L2IA 3UZZA 3MV01 6TIMA 5MKGB 1KWKA 1HQTA 4Q6JA 1XD1A 3M9YA 4LRSA 4DPPA 3FJ4A 4J40A 4S3FA 1SFJA 1FQ0A 4HNVA 8RUCA 3W1TA 3W7LA 3SECA 3W7PA 1KTCA 1NAL1 4C6BA 2WJFA 1X1OA 1W9UA 3K30A 4UTKA 3V5FA 2QCMA 2X42A 4AXKA 4CU8A 2WOQA 2DPEA 5E9AA 1HXJA 4YPJA 3GVGA 1NH6A 4GIEA 1IGWA 3W7CA 4O14A 1UPPA 3ZJ7A 3U57A 3VAVA 2YB4A 1KM2A 3DOPA 1REQA 1KBBA 3GDRA 1Q4WA 3PZVA 2E40A 3MP5A 6ALDA 4R7OA 2POTA 5I02A 3TJ4A 3M5VA 3UXAA 3O2LA 1HJWA 4HNOA 4EK7A 1UP2A 1M7PA 2CWNA 2PWUA 2NQ9A 1MXSA 4OOZA 5D30A 4JTIA 4H7CA 5JH1A 4R9XA 4ATLA 1O7AA 2DGAA 3AUOA 3N2OA 5DLCA 2ZUTA 1S2VA 1T5AA 3HJEA 4HT3A 4JICA 1EUAA 3EMQA 2H90A 2VKZG 1K8ZA 3PBVA 4L56A 3VM7A 3WZ0E 3MWCA 2WZTA 2FPYA 1OGBA 1OFPA 4P7NA 3HFTA 1FCBA 4CD5A 4ZFMA 5XIAA 3FOKA 4LF1A 2KAUC 1OT1A 4BHYA 4WOQA 1VBGA 2YLAA 1GEHA 7ODCA 4YXGA 3LI1A 5E0FA 2Z1BA 5C9RA 3DFSA 3EDEA 4O53A 3JU2A 3B8TA 1KWGA 2UZ9A 2OTDA 5IRPA 1XIFA 2VFFA 4AD0A 3FY1A 2FIQA 7TAAA 3DZ1A 4O13A 4MJ2A 4DQWA 3VMOA 3MUAA 4PTNA 2PDPA 5T91A 3VC5A 4MJMA 1IR1A 4NVTA 1Y5WA 4IG2A 3WDPP 2A3LA 4OV9A 2DH2A 1KFJA 1H7PA 1X8CA 1TREA 2PDCA 3GKFA 2OOFA 5BOEA 1UASA 3L2LA 4XO6A 1KBKA 3GW3A 3RMJA 1EXBA 3R0KA 4WX2A 3IJDA 3T9PA 1JCXA 3WUFA 4QJ1A 3S9ZA 5FOOA 5DBUA 3ZR5A 1RY0A 2DUXA 3W37A 1MXGA 1P6BA 2C3ZA 1KFKA 1IHIA 2PTDA 2PP0A 1J6PA 5MF5A 4XZ9A 1J10A 4IH3A 3IJ9A 2WM1A 1ME9A 2GVYA 3HBLA 1PKLA 3FX4A 1HJQA 2BOFX 4H04A 2O4QA 1E43A 2DORA 1W1B1 3MMDA 1FHDA 4UNIA 4AD3A 3CBWA 1JQVA 4ORMA 4NXKA 4I9JA 4ZVJA 2G3IA 3C2YA 1GKQA 4HU3A 5LXXA 4JBRA 2JFEX 3MDWA 3V0SA 1EDTA 1M5WA 1JCTA 3R11A 3ZT6A 1PKNA 4JQAA 1XRTA 1A49A 2ZXQA 1C8YA 1SYTA 3SBFA 1OYCA 3P2VA 2V5DA 1W2VA 3LOTA 1B9ZA 3ATZA 4TX8A 2YZRA 1ZQ5A 1J93A 4KS0A 3RUBL 4E8DA 3AU6A 3AIRA 3MUZ1 4IL0A 1BRLA 3FIGA 4N9EA 1E3ZA 4QRNA 4QROA 4UTTC 2EPOA 4R85A 5A69A 3IGSA 3WFAA 1WO2A 3QQ1A 5BYWA 4FXSA 1F4AA 2ISFA 1JL8A 2VCCA 3HF3A 4LYRA 1OJXA 1S1PA 3PFMA 4M80A 3RCYA 4LS0A 5I3HA 4OOUA 3B8DA 4KRTA 4NZFA 4XAYA 5AC4A 2P50A 2GPTA 4PBEA 3GXDA 2WC7A 2WB5A 3IVTA 1JI2A 4IMGA 1JDDA 4ZMGA 1SFLA 2V3EA 4ZSUA 5BRPA 2ACSA 3KCJA 5AYYA 3A4WA 2VFGA 2X41A 3DH7A 1UKOA 2CXGA 1B31A 2P88A 3MKKA 5A2BA 1IIGA 1T0OA 4ICMA 2PDFA 4Z08A 2YKKA 5FJPA 1DIDA 4Z2KA 4G56A 2VD9A 3IUDA 5FEPA 4YHGA 4O15A 1WNOA 2HBVA 4AUBA 5FSDC 1YHTA 2VZSA 4O52A 2V5CA 3KBMA 4Z2LA 4US5D 5CAKA 1V3IA 3BLEA 3WDHA 2Z28A 3NGJA 2E3ZA 4LY8A 5JBDA 4M6UA 3CU2A 1F07A 1B3WA 4HHHA 4GABA 1ITQA 2C19A 4RL3A 1RBAA 2FJUB 1JAKA 3RDKA 3FEMA 4WLCA 4Y9AA 3EWXA 1QRQA 2TAAA 2ZX7A 3FYPA 5IOBA 4IPIA 4WDWA 5FEZA 1LTDA 3W88A 1XH1A 3UJEA 3E3HA 5CLWA 3OBKA 3W27A 4DELA 2RDXA 4J2PA 3G3DA 2QUMA 2BXVA 3S1WA 4ZB2A 5HNRA 3AXMA 1P0BA 1WZKA 2WO5A 1CGVA 4TUFA 3L7RA 2P53A 4BQ3A 5CG0A 3NTYA 3EWYA 3AJ7A 2AL2B 3S0CA 4XAZA 1GVQA 1V79A 2CNCA 4RDVA 3I7SA 3DC0A 4ZQCA 1EXPA 1RSCA 3BCFA 5BXSA 1W1IE 4DXKA 1TMLA 3WLQA 3H22A 1G5AA 3TYZA 4M7SA 4JQ4A 3MSGA 1G7UA 2FHFA 1VHNA 2PBGA 2Z6JA 3O07A 3DX5A 2NVCA 4QG9A 4CN1A 3B0UX 3W75A 2EPMX 4Q8WA 1K9EA 4IUGA 1Z7AA 3W83A 1SJAA 2DSZA 3D0CA 2BXYA 4PUEA 3LEPA 1MSSA 2QMKA 3MYOA 3GHTA 5I03A 5D8WA 5GJNA 1XLCA 1CXKA 1SPQA 1S2WA 3H23A 3KLLA 4GVHA 3ZLGA 1XLLA 2ISSA 1B1YA 4QS6A 1UR0A 3GNPA 1PTDA 7REQB 1SJCA 4QCFA 2C1GA 3MKCA 1W9BM 2YCIX 4GH1A 2OFJA 1QPNA 2YPIA 4J3WA 5DANA 1ZGDA 2BDQA 1JZ7A 1CYGA 3L23A 3HG2A 1XIDA 4EOUA 2YYUA 3LERA 2FPTA 1FWAC 4UTWA 1Y7VA 4AMCA 3BMXA 4DF2A 2Q8ZA 2V63A 4YYFA 3EX2A 3NZPA 4PR4A 1AJ0A 2D0HA 3W3OA 2OZ0A 2A7NA 2XZ7A 1CWYA 3EAUA 2F6KA 4BJHA 3VIOA 1VJZA 2X1SA 4WR3A 2O9RA 4KT2A 4S3CA 3DESA 1WZLA 1XGZA 1I60A 4HA1A 1WAWA 4W4QA 4HPJA 2QUNA 4XD6A 1VRDA 2FVMA 2JGYA 2QPXA 1GZJA 3BQ6A 5HUPA 1G7VA 6ENLA 2NT0A 4B2DD 2X7VA 3Q67A 2ZRZA 3SQLA 1FWRA 4I5XA 4DBWA 3HZ3A 2H3BA 2HTMA 3RPDA 4MNKA 3GXFA 4GISA 4EAYA 2NVAA 1E0TA 4DYKA 3VIMA 1A5BA 3GH4A 2DSWA 4NI8A 3I6TA 1E6SM 2AGTA 2FH8A 1SMDA 2OLHA 4ZODA 1NF0A 4D72A 4NZ4A 3EWBX 3TC6A 1GOXA 2PGRA 4N0RA 3R1ZA 1VPXA 3LBCA 1PSCA 2XWDA 1IIHA 1TX2A 3RX2A 8XIMA 4TV5A 3PUEA 3B3DA 1TJPA 3D6NA 1S2CA 3L2MA 1PL9A 4JPGA 2QJHA 1BSLA 3GHRA 3HGSA 1FDYA 4P7RA 2R1KA 1ICPA 4Z2HA 1PV8A 1KRBC 3NDOA 3DKJA 4OV4A 1EUNA 2OYMA 2ZX9A 4IFKA 5AHIA 1HIZA 1QFEA 4HMNA 1IXQA 3AIVA 2GJXA 2DZSA 3MHUA 2ODOA 2ZUMA 1X39A 3SY1A 3WK3A 3NURA 3HQ1A 4UUIA 2H6RA 3P7YA 1VCVA 3GVWA 1TMQA 3BJTA 1ZJHA 4FMVA 4V15A 1QI0A 4YLWA 1R2SA 5A6LA 3HO8A 4C1NB 3O6DA 3O63A 4KETA 4JDBA 2AMGA 3LCGA 3CNYA 1U30A 1ITCA 3GG0A 4QE4A 2VVNA 3AXKA 4N6EA 4YCOA 5I00A 4B2DA 3A9BA 4A21A 5HAOA 4DBUA 4AVOA 3SRDA 2A6NA 3KRSA 1SW3A 4Y6GA 3RM8A 3DN5A 1UWSA 5FA5A 3LPPA 4ZBCA 5LGXA 3FVMA 2FVKA 3ITOA 4PB3A 4PN2A 1UIOA 2ZVIA 1VFLA 3E2SA 3USBA 3WLHA 1UR8A 1TB3A 1X97A 3CHVA 1K6WA 2HSAA 1HO1A 4ZXOA 3HA1A 5HANA 3CL6A 1MXDA 4IHCA 4GC3A 2OYKA 3LSCA 3BLLA 3OODA 3QMTA 3RMEA 2A21A 3P14A 2VGFA 3PBYA 4S2CA 4MWAC 2PUZA 1WDWA 2OPJA 4XKYA 3TQVA 4PUNA 2CLKA 3WDIA 4CU7A 3CYJA 4KRZA 5M2FX 1T8XA 1TTIA 5A95A 1EWEA 1T40A 3H2AA 3SN4A 2Y7GA 4JTSA 1J0IA 1JGMA 4RZ6A 3ABOA 4JKLA 5FL1A 4AC7C 3MI6A 3UWQA 3HOJA 1VC4A 4NNAA 1DJQA 3CUZA 1MWOA 3N4EA 4WKFA 2CBJA 3ZT7A 3CIVA 4R7WA 4CQDA 1GHSA 3CB8A 3C86A 1TRDA 5CGTA 2Z6IA 1QNSA 4JX5A 4NAEA 1FA2A 1B3OA 4GJ1A 2B7QA 3AISA 1J0KA 5AYIA 4R27A 1PX3A 4GHRA 3HQOA 4HMEA 1YEYA 3MI3A 2PWHA 3U2ZA 1YRRA 3DC8A 5ABTA 1Q3NA 3WUEA 4QE5A 3AS3A 3WBAA 4I9MA 5XINA 2QIWA 2PCEA 1H5VA 3C52A 1PDZA 3QKZA 2BBFA 4LYQA 1PZ1A 2HVOA 2OXNA 2YCJA 1VJIA 3RYSA 1O95A 4ZO9A 3P61A 3NQ6A 3VKKA 4HSHA 1FXPA 1FWGC 3A23A 3M6YA 3ARYA 1BPLB 2WLZA 4WCJA 4MB4A 4CNSA 2YFNA 4JTFA 1K8XA 2EXOA 1XDMA 1XD0A 2XSXA 1EJTC 1KM1A 2GQ3A 1BYCA 2B0MA 1XCFA 3W74A 4GI9A 1M65A 4PL2A 1FH8A 3FSUA 1UB3A 2VR5A 2RGMA 4PMYA 4PMXA 3C2VA 1G1YA 3D3AA 1QPQA 2C6QA 3LA4A 2JE8A 4ZXLA 1UD6A 1C8QA 1E1FA 2J66A 4Q8OA 3CAKA 2Z25A 1XF0A 2GJRA 5TD4A 1IR2A 3I3EA 4LV4A 4B90A 1ZJIA 1XRFA 1ZALA 1AUSL 4JDYA 4B5NA 3S9YA 1UKTA 5K3VA 4PODA 1XS2A 4REQB 2CESA 1I6NA 1V3JA 4JCLA 3KZSA 2XWEA 3GAYA 1UD2A 1JJKA 4GOAA 3TLQA 5EA9A 3W23A 4F3HA 1Z8AA 2G3NA 5FEWA 3HFYA 2VRJA 1B57A 3I68A 3TKFA 3NCOA 4GI8A 3RG6A 3E12A 1XSIA 1JDFA 3Q65A 3F4VA 1NOUA 1S5VA 4M56A 3W1PA