3W86A

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with sh-1-96
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with SH-1-96
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Dihydroorotate dehydrogenase (fumarate)
total genus 104
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2013-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w86A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w86A01
5G1YA 3PF3A 3NA8A 2E5CA 4CLMA 1SFLA 4ZQPA 1YTKA 4UTUA 3TFXA 3QMRA 4UR7A 4FNUA 4UNLA 3GXPA 5EBUA 4NJJA 1IXQA 3L65A 1A50A 3KRUA 3LOTA 3MJYA 3TK7A 3W86A 2XN1A 3EWUA 1W5NA 3TU9A 1TIMA 4Q4KA 2UV8G 4XTDA 5DY2A 4YCOA 3M7WA 1IIGA 3L0KA 5GVJA 5CSSA 5D38A 1KFEA 3F1QA 2X1RA 3FOKA 3MP4A 3LCGA 5J5DA 1QO5A 3W2UA 3KOFA 1K8ZA 2WKJA 2B0MA 1Q45A 4BI7A 2DZTA 3P7YA 2V8ZA 3S1VA 2ZZ3A 3HMJG 1LRNA 4DF1A 5K7JA 4OQVA 1OF8A 4N9DA 5AYXA 2QJIA 4WOQA 3M41A 4EIVA 3FYPA 4MVAA 5AHIA 1ZFJA 1H5YA 3NM1A 3GDMA 5C55A 3B04A 4PEKA 3MYOA 3O1NA 3A22A 3TQKA 1K3UA 3MO7A 1NF0A 2W0UA 3QW3A 3LRKA 3TE9A 3C6CA 1WXJA 3G1SA 5D2VA 1H7WA 3A23A 1W31A 3OBKA 4O13A 4POCA 5D2YA 2GUUA 5KSWA 3CLMA 3NR0A 3P8IA 4BFAA 4YMZA 4GC4A 1Z41A 1H61A 5HR7A 1O60A 4ZQRA 1VCVA 2EKCA 3CIXA 3THAA 5FI8A 3MHGA 3NQ8A 1QAPA 1B4EA 3ELFA 1L6WA 3IVUA 2Y62A 5L9FA 4N4PA 2TSYA 2ZZ1A 1EP2A 4PFMA 3SY5A 4DO4A 3M47A 1LRTA 2WNZA 3NQGA 3U2OA 3NPVA 4UTWA 1DORA 2YR1A 1R46A 3STEA 1G7UA 5TIMA 4HNTA 5G5IA 3KXQA 1K7EA 5I3FA 1SW0A 2J9YA 1L6SA 3LXAA 2J9ZA 3BLFA 2A85A 4ORIA 3PG8A 1DOSA 1OVDA 3KRZA 1AW1A 2CLFA 3F4NA 2ZRUA 3TUUA 3F4WA 2A0NA 1QMLA 3A21A 2H8XA 3S1UA 3TKFA 1M7PA 2R8WA 3NOEA 1KM3A 1FWWA 4IMEA 1ML1A 3LHVA 3LGEA 4DPPA 1SW7A 4ADUA 5DCDA 1JCJA 2QJHA 4NJIA 3BG5A 4O50A 1PHWA 3GZ3A 1KV5A 5C6MA 3KVJA 3TXVA 1LTDA 2JGQA 2YGYA 3QH2A 5AYZA 2NUXA 3P61A 3NM3A 4NT0A 3NYZA 2ISWA 1K8XA 4JD4A 3PG9A 5CPNA 4R34A 1JJKA 3BG9A 5I3JA 1SFJA 2J6XA 5AFDA 3GB6A 1IXOA 3P80A 1K7FA 4X2RA 3TAKA 3M44A 1P1XA 4N9BA 3QFEA 3EXRA 1KFCA 2EGZA 5CPMA 4Y9AA 3EKZA 1TV7A 3W7OA 1EB3A 1O5KA 3PBWA 3PWAA 3W72A 1OYCA 2VFIA 1ALDA 1RD5A 2DZSA 1DKWA 2Z1BA 3QPZA 4YLWA 1I8JA 4JEQA 1Q6LA 3LCFA 4IOTA 4AWUA 3FKKA 3P67A 4N4QA 4ZQMA 4MLJA 1TTIA 2DZWA 5LNUA 1UJPA 3WFAA 4UFKA 1HFBA 1YDOA 4RJEA 2ZA2A 1F5ZA 2C14A 4UTTC 3VNDA 2FB3A 1Z42A 1YYAA 1SUXA 3DHDA 3CWOX 2RDUA 2VEMA 3S5ZA 1G69A 1H51A 4OGZA 3E96A 4Z1BA 2DU2A 4PODA 2KZHA 2FIQA 1Q6OA 4O10A 4O1AA 3W7GA 3IVSA 2NLIA 1OABA 2VFHA 3W07A 1KLZA 4ZMGA 3M1ZA 4C1KA 3B03A 5SWUA 3W7CA 3DAQA 4QNWA 3QM3A 1R2TA 2J9XA 1EUNA 3WJYA 4XZ9A 4DBDA 4JTKA 4TO8A 4Z08A 3PUEA 2CLEA 4UTMA 1V5XA 2GVGA 1BWKA 2V5BA 3PB0A 3GR7A 1OX5A 3TROA 2VELA 4O0KA 3MBFA 2XN0A 2FJKA 2A6LA 2XFWA 3TR2A 2QCCA 1H7RA 1YPFA 1LCOA 1JRCA 3NXFA 1TRIA 3KX6A 1E51A 1ZAJA 4QITA 4WY0B 4GUJA 1OFPA 2RDWA 4TMCA 1MO0A 2V30A 1WYIA 3UWWA 3PSWA 4OWGA 1JRBA 3HGOA 5I3KA 1D9EA 1TMHA 4HNUA 1ZCOA 4X3ZA 1K02A 3L9CA 3HOJA 4B5NA 1TPFA 4M19A 3W70A 1PE1A 1LLWA 1GT8A 3USBA 2J27A 1FDJA 2ISSA 1CW2A 1ZY9A 5D2WA 5AC6A 5C2XA 1QPOA 3E12A 2EHHA 2CZDA 1YDVA 2FLIA 3DFQA 2AAMA 2Y7FA 3CB8A 1ZAHA 1N7KA 2ZDRA 4XKYB 3UPBA 1TPEA 1FWRA 3GVGA 4CCDA 3FIGA 2FFCA 3HGSA 2QCEA 3KVMA 3BLEA 3ZWTA 3W3OA 3M9YA 3O6YX 4CQ8A 3SR7A 3W7PA 1D3HA 1VLWA 3LHUA 4YCPA 5G4EA 3GLCA 4DEFA 4MYAA 2X1TA 3DXIA 4OHQA 1SZNA 1F7BA 4UFJA 2Y89A 4CQAA 1ZENA 3W7RA 5T26A 1DQWA 3CEUA 4O54A 4UTHA 4M6PA 3O6DA 3HPSA 1HG3A 2WOQA 1A5CA 4JTGA 2Y61A 5EPDA 4L4LA 1X1ZA 1XXXA 2FPTA 3UWZA 3LRLA 4MPQA 5G2IA 3UXDA 4AMAA 1FCVA 4LNYA 1JQXA 4UTKA 4QSHA 3EX1A 3LV6A 1G4SA 3QW4B 2ZTJA 5IBXC 3E49A 1QPNA 5BNKA 4UFMA 4GJ1A 3B4UA 4QQ3A 1TQJA 1N8FA 4HSNA 4MUZA 4BWLA 3QF0A 1O5XA 1OJXA 3O05A 3C2FA 1LOQA 1RZMA 4MJZA 3CT7A 1LOSA 3EWXA 3FJ6A 3T40A 4UFIA 3P82A 1DV7A 3N14A 1T0OA 1UBSA 1W5MA 3N2XA 1RQEA 3EEGA 3TXZA 3GX9A 1M7OA 1LBLA 1KFBA 1UASA 4Y8FA 5DCBA 2YCEA 4QJ1A 5AHEA 2DJLA 4KWWA 3T4CA 4LC8A 1GYNA 3V1PA 2ZZ6A 1LRQA 1DHPA 2H6RA 3PSVA 1MXSA 3OIXA 2RDTA 4IPJA 3HG5A 4DO6A 1PCWA 3PUOA 1H50A 5C54A 1FX6A 2QKFA 3SECA 2CLKA 3F03K 3CHVA 4O53A 1VYPX 4D2JA 3WK0A 3NL5A 5D32A 3PBYA 1ICSA 4LY8A 3CEPA 5HMSA 1P5BA 2PE4A 3QMSA 2OJPA 4NU7A 4QM1A 2A7RA 2X2GA 4O28A 2VFDA 2A2IA 4JTLA 3C2EA 3BO9A 4K6AA 1QPRA 1ZAIA 2NUYA 3AO0A 1OFOA 4IQLA 2QUUA 3W71A 2ZRYA 5K9XA 5CGQA 5BRBA 1DBTA 4CNNA 4DXVA 1JCLA 3MWAA 5F2IA 2CW6A 3L2IA 1OFAA 4LS1A 3PY2A 1TPWA 5A5WA 1O95A 3N19B 2NV1A 4WQ6A 2ZBTA 2ZRZA 1TPC1 2XN2A 1YXYA 3SI9A 1S5TA 4FNPA 1JVNA 4LRTA 2A1YA 3DGRA 1OFBA 3W1UA 3D0CA 1AL8A 3OVPA 4N6FA 4R33A 1EWDA 3NO5A 3N2MA 4IGHA 5U4NA 2DP3A 4NJGA 5J5RA 1UCWA 2GQAA 2YW3A 5D03A 3VE7A 3DFPA 3N9RA 5CG7A 1KM4A 3W75A 1VPXA 2Q8ZA 3OHIA 3EKLA 3PM6A 3LERA 2BWGA 3HPZA 4PL2A 3NZRA 3MP3A 3STGA 3HQ1A 3W85A 5G1TA 3MI6A 5MHBA 1GTEA 3Q2DA 2WSRA 4EF9A 1BKSA 1VR6A 3SIZA 3DFOA 3M16A 1FWNA 1XFBA 1DJNA 1W3IA 4LV4A 4AVFA 5AHLA 2D73A 2BTMA 5DELA 3VFLA 3TJXA 2CLMA 1SQ7A 3NDOA 2I14A 3EXSA 2YFNA 3W1RA 3YPIA 2VXNA 2TRSA 3C0JA 4KKXA 1SO4A 2OT1A 4N6EA 2H3DA 5D33A 2RFGA 3P84A 2PCQA 3W7DA 4YL2A 4ADSA 3A5FA 1KW1A 5LGZA 3R8RA 5LKYA 3SGUA 3FA5A 3DFTA 4UIOA 5E93A 3WJXA 3KHJA 2YDAA 1G67A 2QCDA 4GBUA 3LM7A 3AJXA 3QYQA 4KFOA 4A2RA 4EVZA 3UYCA 5DY3A 1MSSA 1TPUA 1XUUA 1EP1A 2FB2A 3PAJA 1VH7A 1LM1A 3WK1A 3I65A 1JUKA 4BWLC 3GAKA 1W3TA 2WV8A 4JY8A 2DORA 3DI1A 4CCCA 3ZFHA 1LDCA 3E02A 1OFDA 3KRSA 4IXHA 5AHNA 3G8RA 2ZZ4A 2HMCA 3PUDA 4IPIA 1EWEA 1H1YA 3TH6A 3W1XA 3CIWA 4RZ6A 1WV2A 3DENA 2CZFA 4JX6A 1GQNA 4JYFA 3ABOA 4LVGA 1PL9A 4K38A 2I1OA 1GVFA 4UTWC 1GG1A 2CLOA 4BI6A 1TPDA 1H63A 5HWNA 4GUFA 3ABRA 1EUAA 3V75A 2Y7GA 5AC7A 3C61A 5K4XA 3JS3A 4UXDA 4K36A 2JGYA 4QISA 1R47A 1QWGA 4CQ9A 3B05A 4E0CA 2ZZ2A 5TQLA 2P1FA 5HR6A 4U28A 3QQ0A 3L68A 1SO5A 3OVQA 3ZS4A 3EX2A 2V81A 4RZ4A 4UMBA 4O1CA 2QCHA 3G3MA 2QEZA 2Q3OA 4WOZA 3NVTA 3DKJA 3SGZA 4NQ1A 1JUBA 4IX0A 2HS6A 3B0PA 1W54A 4WZHA 4MIMA 4GFSA 4RX0A 4J9JA 5LNRA 3S0CA 2O7SA 4IMDA 1W3NA 4H3DA 5I3IA 1UUOA 1VCGA 2VKZG 5U7SA 5G4WA 3LXBA 3LRMA 4WUIA 4Z1DA 2ZZ5A 4WXZA 2BZNA 1VS1A 5D09A 1DL3A 4YWIA 3HJZA 2BXVA 2Y7EA 2F84A 2ZCGA 4TR9A 2DZXA 4I7VA 5DXYA 1AL7A 5DLCA 1DVJA 2YSWA 3NQ7A 2YW4A 1I2NA 1XM3A 1GVRA 1KM1A 3L67A 2QAPA 3DFSA 5I3GA 1XDMA 3S42A 2JKAA 3W2KA 2HSAA 2V2DA 1F76A 4LRSA 5K9CA 2GJNA 3S8HA 2FPYA 3NQ2A 3UY8A 2GVLA 3MUXA 3H54A 2ZFAA 4ADTA 1KFJA 1PS9A 1TRDA 3LV5A 3M0ZA 4JTSA 4NJKA 3M43A 3WK3A 3LCXA 3QEZA 3EXTA 1VLIA 4LT9A 1R2SA 2I9EA 4G1KA 3UWVA 3KAOA 2E77A 3QMTA 4ALDA 2GPTA 1OHLA 1ME7A 1NVMA 1KLYA 3N73A 4XWUA 1RQBA 4XBKA 4HIBA 3W1NA 1HO4A 3UWYA 4GUHA 3TC7A 3W7IA 1P0KA 1XCFA 2CFFA 2ISVA 3HG3A 3W7LA 1JCNA 4ZQOA 3C8FA 3LBMA 4UTTA 3VI2A 2Y85A 1ZHAA 1S3HA 5HQEA 5K4ZA 2V82A 2WSQA 1WAUA 4BR1A 3TW6A 2FQIA 2E5DA 3W22A 1PV8A 5IM51 1TO3A 2B4GA 1R30A 1J4EA 1U83A 3DI0A 1VGAA 1I2QA 2E09A 2A21A 4PA8A 2R94A 1KM2A 3C4UA 2NV2A 4DQWA 4DPQA 3M6YA 2R14A 2V5LA 4O19A 2DJXA 2X30A 5BW6A 5KZMA 1Y0EA 3TMLA 3W23A 3EB2A 3O06A 2PRLA 3LCHA 2VEPA 3WK2A 3RU6A 2E5BA 3L5MA 3QZEA 4ML9A 1GEQA 4GUIA 3TSBA 3ZWSA 3ZR4A 3MHUA 1D3GA 1OF6A 1S5WA 1VZWA 1VQTA 3G0SA 4AH7A 2FTPA 2ZRVA 1Q3NA 1F74A 1OX6A 4JDBA 4K7YA 4WX2A 4E2BA 2C13A 4Q33A 1KM5A 2PRHA 2BLEA 3NZ1A 5G2HA 4UC5A 3W2MA 2QCDB 5CZSA 1FXPA 4LUIA 3BW3A 5I3HA 4ZQCA 1P4CA 1NF7A 2FDSA 3OVRA 3NL2A 4MY9A 2B7NA 2YXGA 3CPRA 3TDFA 1F6PA 3WJWA 1YXCA 4UUIA 3S6DA 1AW2A 5KMYA 5LHEA 4GUGA 1PVNA 1YPIA 3RFAA 1H7XA 3G18A 4GRSA 4M6QA 3LHZA 1JCYA 2R91A 2HS8A 5IBXA 1MEHA 4HHPA 1FBAA 4LC6A 2VEKA 4DF0A 2P0OA 1DQXA 3W2NA 4TU1A 1G7VA 4RZ5A 1SO3A 1QNVA 3NEVA 3MYPA 4Z1CA 3W1MA 5AOUA 4A21A 2DZVA 4O0ZA 1K7XA 3W7NA 4H4IA 1XBVA 5EY5A 5K9DA 2CLIA 3M5XA 3R5EA 5AHFA 2CZEA 2QUTA 3ATYA 2Y7DA 3DFNA 4A3UA 4OV9A 1G4TA 5DXXA 1TV8A 3U8GA 3C2OA 1OYAA 3IGXA 4EF8A 5CZ0A 1TV5A 3VKJA 1LLZA 3WJZA 1I4NA 1W1ZA 1XBZA 2QCMA 3STCA 1TB3A 3OA3A 4LTSA 3NQ6A 3LCIA 5D02A 1YADA 4FNSA 2O7QA 5DBUA 4K7VA 3I7SA 5LZLA 3IIOA 3O8AA 4DO5A 3INPA 4MZ1A 1LORA 3G1XA 5LNWA 2OCZA 4R7JA 1B3OA 1V7YA 4PCFA 3ANYA 2VC6A 4H6KA 4PL1A 3MI2A 1JCMP 4UMCA 2X1SA 5H2ZA 3CQ0A 1W5PA 1HL2A 5D2TA 1TSIA 3G1VA 2QDHA 5FF2A 3TNOA 2ZYFA 2G97A 2VENA 3HG2A 3STFA 3OEXA 4GWEA 1GZGA 2P10A 5LSMA 1EP3A 3CM4A 1A5AA 1GOXA 2NUWA 1GG0A 3HBLA 4WY0A 1LOLA 3IGUA 1KFKA 5CKSA 4RXGA 3UQNA 4TX9A 4CNOA 1W37A 4HNNA 4RCXA 4XTIA 3C56A 2GVJA 2B7PA 2OT0A 4HN4A 1MEIA 1B9BA 3S5NA 1H7NA 1FCBA 4UTLA 3GDRA 2X1UA 2QUVA 4JX4A 1WBJA 3U6WA 5EMUA 3G1FA 3PBVA 1EIXA 2B7QA 5F2MA 1ICQA 2IQTA 2WPBA 3P5YA 1AW5A 5BMXA 5LHFA 3GDLA 1VHNA 3TQ0A 3UXAA 2C6QA 3C2VA 3LI0A 1RPXA 1VC4A 2NXIA 1H1ZA 4N9EA 4JTFA 4FO4A 2QCLA 4FXSA 3W7QA 2WNNA 3M5ZA 3NPWA 3DKLA 3GNDA 4IUOA 3CWNA 1H60A 1M5WA 2ZQ0A 1Z44A 3EX4A 4IMGA 5FESA 4O1BA 1FUYA 1JUEA 3NGJA 3G24A 1TPB1 2YPIA 4JIPA 3ABSA 1TREA 5FEWA 1G4EA 3I7RA 3UD6A 5F1VA 3W1TA 4Y90A 4X22A 5AHMA 2W79A 1B57A 1THFD 3RLVA 4XBSA 3IIPA 4HNVA 4FX7A 4LS2A 3LDVA 4BF9A 5D04C 3Q58A 3H55A 2Q8LA 3CTLA 1TJRA 3LX9A 4GE8A 3ABQA 2Z6JA 2CWNA 3BGGA 2ZRXA 5D30A 1UUMA 4UMAA 4IX2A 3RMJA 3DHFA 2BSLA 3NQMA 4M5PA 3LLFA 3FKRA 5AN7A 2VFFA 2BX7A 1MEWA 4AF0B 1X1OA 2H8ZA 3FYOA 1GVQA 3HF3A 2OX1A 1RV8A 5KTLA 5EKYA 3KFTA 3LCWA 4HKPA 3ATZA 3NL3A 4JYDA 2E6DA 3L5LA 3W83A 3TIMA 4ZVJA 1LROA 5ABTA 1TJPA 2WO5A 4DELA 2QCFA 3NQFA 1KV8A 4JY9A 3NPXA 2B7OA 3QQ1A 1C29A 1KM0A 1WDWA 4RV8A 1ZJIA 3FJLA 2NX3A 4I7WA 3P5ZA 3G0UA 3B06A 4JIQA 3TA6A 3L0GA 4QAIA 4RR4A 4NX0A 1QOQA 4O16A 4ZL1A 1AG1O 4O57A 3Q94A 1VCFA 2CU0A 1SW3A 1KTBA 3UPWA 1I45A 3NPUA 3TV8A 4S2BA 4ZZ9A 1LZOA 1TTPA 1QPQA 2JK2A 4O1DA 2VOMA 5FF0A 3JR2A 2RKXA 3EX6A 4K37A 2F7FA 5FEPA 4NX5A 4MYXA 4NZFA 3TFCA 1RR2A 6TIMA 3T44A 1AK5A 1CX9A 1YTEA 4A29A 3QSRA 1KTCA 4P2VA 2DZUA 1T99A 5EA9A 3IIVA 4JX5A 3HPXA 2TPSA 3W76A 1FCUA 2CZ5A 2Z6IA 2J24A 3FFSA 3BVJA 4PTNA 2PC4A 4NNCA 1S5VA 4HPXA 5K3VA 2AQWA 1SU5A 3NQVA 1EA0A 2G96A 3UWQA 5KZDA 4FF7A 4A22A 1H62A 4E2DA 2PURA 3S1XA 1QO2A 4MKNA 4TIMA 2ZZ7A 4FNTA 3T7VA 4Z0SA 6ALDA 1KM6A 1P0NA 1NSJA 3R2GA 4FHAA 3GXNA 1XBXA 1FCQA 2EAWA 3GK0A 1GPWA 5D05A 3PULA 4MLRA 4KFNA 3K30A 1C9DA 3BK0A 1FWSA 4W9TA 4O14A 3LHWA 2V0TA 1QDSA 4JTEA 1X6UA 3A24A 3GR8A 1X7FA 3TJLA 1L6YA 3GXTA 4O11A 3FS2A 1W5QA 2Y70A 2HTMA 3PBUA 1KTNA 4JTJA 5AYYA 3DZ1A 5E0KA 4EOUA 4LOCA 1K8YA 3LHYA 3S9YA 4XKYA 3LXCA 3PR2A 3IV3A 4U4MA 2QAFA 3TQVA 4A2SA 4O15A 3B0VC 3G22A 1WX0A 1F05A 3LTYA 3G1DA 4I9AA 1FDZA 3UWUA 1GYLA 3MI3A 1WQ5A 3C3NA 2WJZA 4MJMA 4JXCA 3L66A 3W2LA 2DZPA 3LB0A 3G3DA 4FNQA 4IXXA 5FF3A 3HO8A 3GIYA 3P74A 4O17A 1R2RA 2C0AA 4NNAA 4ORMA 2C16A 4NNBA 3P8JA 1H7PA 1GJPA 3BLIA 2ALDA 4O18A 5TBOA 3W73A 2A5HA 4AHPA 1XDLA 4UCGA 2GQ8A 3LCLA 3NG3A 3KVKA 5AC8A 5LNSA 3E9AA 2GJLA 4OE7A 2GQ9A 4ZQNA 5FF4A 3CC1A 1OX4B 3EWBX 2CLHA 2A6NA 3MMTA 4IMFA 3QC3A 4JS3A 3RLUA 3BPWA 4YXGA 2QCNA 4LS0A 2YX0A 4CCEA 4NZJA 5LNVA 3W7EA 3G1YA 2V9DA 3IIZA 5E1QA 4MFDA 1DJQA 3MP5A 1OX4A 1KA9F 2C1HA 1X8FA 4O8RA 1SPQA 4S2CA 4JTTA 4EWND 4FXRA 1I2RA 4MY1A 4UTJA 3L5AA 3IVTA 3SJ3A 5L6UA 1H7OA 1W5OA 3MHFA 2V2HA 4NXKA 4LV9A 1KBJA 3HG4A 1VYRA 2EF9A 4NXSA 1RVGA 3JRKA 2VFEA 1SR9A 1QR7A 1OFRA 3G8EA 3T78A 5HNRA 4PH6A 2JBMA 1CI1A 1L9WA 1FY6A 4TMBA 4GNJA 4JICA 1XI3A 5BOOA 3VCRA 3B0UX 1JR1A 5KINA 1MZHA 3N3MA 5HWJA 1F73A 4QNEA 1NFBA 3TCEA 5KZEA 2NX1A 5D37A 3UZ5A 2H90A 3G1HA 3TMQA 2QR6A 4XUGA 4AHQA 3EWZA 1LBMA 2E68A 1EX5A 4P61A 2C3ZA 4JN6A 4AHOA 1JULA 2NWSA 5FEZA 1VHCA 5F2GA 1TTQA 3W1PA 2WNQA 3RNDA 2TYSA 1ADOA 1VRDA 3M5VA 3O6CA 1IF2A 2QJGA 3VE9A 2Z0IA 4AAJA 2NXHA 1N55A 2AGKA 1AMKA 4FEZA 4LU0A 4NVTA 1WOBA 3W7KA 2E6YA 1OK6A 3MBDA 2FPVA 5DCEA 1SZGA 3S5YA 3HGJA 1W56A 3W6YA 3DBPA 1PHQA 4NJHA 4WJEA 5F1UA 1IXNA 4LUJA 2NWRA 3TSMA 3UY7A 1J2WA 1NAL1 4O52A 1UB3A 1JCXA 3BARA 1I2OA 1OYBA 4AWSA 4K8EA 3MW7A 4KWVA 4N2YA 1W8SA 2J88A 3O16A 3L21A 1WBHA 4JYEA 4Z1AA 5G2WA 4JTHA 2OZ0A 5H91A 1VJIA 4K8HA 4RKAA 3W1QA 2C15A 4RXFA 1SSDA 4NUWA 3M5YA 1SO6A 4JGDA 3P60A 1TYGA 5DBTA 3IGSA 3EWWA 1Q6QA 4LWWA 4JNMA 5K2ZA 3BG3A 4UFHA 5BMWA 3SW6A 4MY8A 3W7JA 4Q32A 3QSTA 2CLLA 3N9SA 3I68A 1Q6RA 2Y88A 2RHGA 4QIUA 3C52A 3DU0A 1ME9A 5HWMA 5HJLA 3SZ8A 4JTIA 3T55A 3H53A 3W1AA 1YDNA 3W9ZA 4I7UA 1RQHA 3EWYA 1WOAA 2A4AA 1U5JA 2PRMA 1TCDA 3PB2A 1ZNNA 4FX8A 3THQA 5C5YA 1OFQA 3E0IA 1O94A 2JKEA 3HGRA 4LW7A 3RK8A 4FB7A 1G4PA 2WQPA 2E6FA 3W7HA 1J5TA 2Z2UA 1OFEA 3QPYA 1M6JA 3NQAA 5F2LA 1HO1A 4KFPA 3QRHA 2ABBA 1ZALA 5A8GA 3P81A 4IWWA 3NQEA 2OMAA 2QDGA 4M6VA 3GYEA 3A9IA 1EEPA 5FF7A 3OG3A 1F2JA 4MFEA 3W84A 1O4UA 3TC6A 4MOZA 4HSOA 1GVSA 4Z0JA 2G5WA 5F4XA 1NEYA 3BW4A 1PCKA 4BK9A 1TPH1 4FNRA 4Y96A 5F4SA 5CPLA 3NL6A 4M7TA 5F4WA 3GNNA 4JDYA 5AB3A 4AEOA 4AF0A 4ONVA 4O4WA 3BV4A 4WXYA 3QJAA 1XL9A 4Y6GA 4JR5A 2Y6ZA 2ZA3A 4N9CA 2V2CA 1GWJA 1EPXA 4N02A 4E38A 1I2PA 4UFLA 2ZA1A 1BTMA 1T96A 2NXGA 3NAVA 3EX3A 2NX9A 3L0NA 1YTDA 4UNKA 2YYTA 3PC0A 4DBEA 4RLIA 3W88A 2VEIA 3W1LA 3R12A 1ME8A 1VYSX 1HUVA 3I7QA 5EYWA 1JQVA 5CZJA 1L2UA 4M7SA 1XBYA 2NZLA 3NQCA 5HUOA 3LTSA 4JTUA 3LLDA 3G1AA 4RK8A 4CNPA 3G0XA 2C18A 1QCWA 3CU2A 4LVFA 5CZTA 3KVLA 4UR8A 4WD0A 4WY0F 1TPVA 3IIXA 3NQDA 3R13A 1HTIA 2E6AA 2H3BA 3WJSA 4OBTA 2VFGA 2LLEA 3LBCA 2WSYA 3GDKA 3LHTA 4X9SA 1SZEA 4HPJA 3BGJA 1BEUA 1K03A 2G95A 5LGXA 2QCGA 3TAOA 3N34A 5DN1A 1LYXA 1LBFA 4S1FA 1FWTA 3UZJA 4LVBA 4BI5A 4IJBA 1F6KA 1YLVA 1C8VA 5HUPA 1FXQA 4MZYA 1KFLA 3C2RA 4OT7A 2YYUA 4MZ8A 1XKYA 2C19A 4FIQA 2ATMA 1KBIA 5D2XA 3TSDA 1Z48A 3A5VA 3R89A 4AB4A 1GVOA 1A5BA 2EPHA 3GAYA 3W2JA 1IIHA 5CSRA 4IMCA 3B8DA 3DH7A 3BW2A 2RH9A 3P62A 3O63A 1FDYA 4O12A 1QFEA 2A7NA 1XUZA 3PS7A 1OG0A 2ZRWA 1YXDA 2TMDA 4C1LA 3FEMA 3SFKA 3O07A 3W74A 4DF2A 1SZFA 3PVFA 2JKPA 4AXKA 2YFOA 3W87A 1IGSA 5CPOA 4K39A 2A7PA 2GOUA 3UNDA 8TIMA 1OK4A 4HT3A 1BWLA 2YZRA 1T8XA 3HIJA 3W7MA 4OU1A 4R53A 4UTIA 3S1WA 3HB9A 3RF9A 3IEBA 2Q3RA 4XQ6A 3SSJA 4AWTA 5EL1A 1PIIA 1LP6A 2W6RA 4GXMA 4ICNA 3Q37A 1IXPA 3LTPA 1B4KA 2ATSA 3GKFA 2ABAA 3LI1A 5HULA 3I6RA 1QOPA 1FQ0A 4O4VA 1A53A 3TW7A 1WA3A 3TX9A 1TQXA 3O15A 4L4MA 1W0MA 4LVAA 3GDTA 4FIRA 3IRDA 2X16A 1A5SA 4PC8A 3S5OA 3GKAA 1ONRA 4LVDA 5KITA 5FEXA 1GTHA 2E1DA 1SSGA 1ICPA 2ZTKA 2QF7A 1TTJA 1G6CA 5HINA 4OV4A 2Y63A 4FX6M 3FLUA 7TIMA 1XC4A 3NNTA
chains in the Genus database with same CATH superfamily
1KBBA 5D4YA 9RUBA 2AL2B 2CBVA 2ZX5A 3VNZA 4S3EA 5CBJA 1KC7A 4FNUA 2PDJA 1E3ZA 4NJJA 4IHCA 3LEPA 3W86A 3WG6A 3RYSA 3TU9A 2WPGA 1E9LA 5DY2A 4F3HA 5CSSA 5D38A 1KFEA 2X1RA 1QO5A 3W2UA 4GO8A 1GK8A 3V5FA 1K8ZA 3B0XA 4BI7A 2DZTA 3IK2A 4QDMA 1U22A 2OODA 2V8ZA 2OSYA 4KQNA 3BDKA 3QC0A 2ZZ3A 4DF1A 3M0IA 4F0LA 5K7JA 3WLMA 1MUMA 4WOQA 3GY1A 4EANA 4AYSA 1ZFJA 4OECA 3GDMA 1DIKA 3OTRA 3TQKA 4KEVA 3LRKA 5JIPA 4BQ5A 3SCRA 4BF7A 3OIHA 4ZENA 4PRTA 4O13A 2GUUA 4NL1A 5HMEA 1BQGA 4LEQA 4US5D 4A05A 4J3XA 2OKTA 4ZQRA 3ARUA 3R11A 3THAA 4B4HA 3OLEA 4W8BA 3NQ8A 2Z2AA 2PWGA 1QAPA 3WX7A 4GIEA 4M51A 1EP2A 4PFMA 3SY5A 1UWAA 2E7FA 1A4LA 1WDQA 2BV9A 4WEVX 1Q6CA 4GYFA 1TWZA 1SW0A 2VRKA 3ZR6A 3I3BA 4NHVA 1QK0A 1W6TA 4ORIA 1MXGA 4PMYA 5ABEA 2GFTA 3KRZA 1XDJA 1XGZA 1DTNA 3A21A 2H8XA 4GHRA 3UBPC 1EJSC 2BXYA 2R8WA 3UG5A 2VP8A 1SW7A 2IPWA 1QT1A 2NW0A 3B9NA 1EZ2A 4F2TA 1BYCA 3BG5A 1KV5A 1CGTA 3TXVA 3E6EA 3QH2A 2NUXA 3WDQA 1WE5A 3P61A 4Q7NA 3LYEA 3PBMA 2UWFA 1UKTA 4NT0A 4G8TA 1QW8A 2QIIA 2WHJA 2ISWA 4LJ3A 2WMJA 3EOOA 4ZA0A 1JJKA 5AFDA 1Y7VA 3GB6A 1XQKA 1YQ2A 4AC7C 3P3BA 2REQB 4X2RA 1ITCA 4LUYA 2Q6ZA 1UD8A 3PZGA 5M3WA 1TV7A 1R3YA 1L6FA 3KBNA 3W7OA 3OQ8A 3WBXA 4RNFA 4ICMA 3UZWA 4C65A 4YVVA 1CXLA 1DKWA 4YLWA 1VPYA 4LCQA 1NFGA 3LCFA 4X0NA 1W2PA 4HHHA 4N4QA 2DZWA 4UFKA 1HFBA 1YDOA 2F8QA 3L7RA 4GINA 4G6CA 2WJEA 1YYAA 1SUXA 4TUFA 1VJSA 5JQ9A 3CWOX 2VEMA 3S5ZA 2PFHA 4OGZA 2PGRA 4GJJA 3PANA 1J01A 2KZHA 3BSHA 4REQA 4O1AA 3W7GA 4FLRA 1A5KC 4HK6A 2GWNA 3W07A 4AZ7A 4HZ6A 4G56A 3U5YA 1V8EA 3IJ8A 3DAQA 2XGZA 2FYMA 1EUNA 1KCXA 3WJYA 4XZ9A 4KH2A 4XZNX 3SCTA 3PUEA 2CLEA 3ES7A 4MSSA 4E4FA 3EMCA 3OLDA 3GR7A 1OX5A 4GISA 2FJKA 5GJPA 1A49A 2ZXBA 1H7RA 1LCOA 1H11A 1ADDA 1JRCA 1JFXA 2RDWA 5IRPA 2V30A 1GQJA 1K77A 1WYIA 3SRHA 3EOEA 1EGVA 1OT1A 3PSWA 3VD9A 4JCLA 3BLOA 2OXNA 1MQPA 3UG3A 3L9CA 4TX6A 4GKTA 4B5NA 4AFYA 1TPFA 4TV6A 1LLWA 2JIEA 2ISSA 2JF6A 5AC6A 5C2XA 5CCZA 1OINA 4CN6A 1HP5A 2GDUA 3V0UA 1M01A 4QE5A 5A2AA 2EG6A 3DFQA 1ZAHA 1EEXA 3WNNA 1EBGA 2DH3A 1CB7B 5I3DA 3KVMA 3BLEA 3ZWTA 2VHLA 4CQ8A 3FXYA 1RK5A 1NJJA 1F4AA 3A4JA 1VLWA 1NDZA 4L56A 4ZTYA 3R8GA 2BOGX 4PGLA 4EWJA 3R8HA 2H9AA 1SZNA 1F7BA 2DH2A 4L5ZA 2Y8UA 4BKNA 1R6WA 3POCA 3HPSA 2ASHA 2WOQA 4V2XA 4HA4A 5EPDA 2FPTA 4XO6A 3LRLA 4MPQA 5G2IA 4AMAA 1FCVA 4XISA 1W9XA 4NYYA 4UTKA 4UB9A 3EX1A 1G4SA 3QW4B 1TJ1A 1NOUA 1QPNA 4OKDA 4XB3A 3WNOA 4LGXA 3AQUA 1BTCA 4MUZA 4BWLA 3FJ4A 4NRRA 1FTXA 1LOQA 2Y8VA 2WZMA 5DMLA 1WDPA 3RM8A 1K8CA 1W3LA 1LOSA 3EWXA 3FJ6A 4DHGA 1Q66A 3PFRA 1DV7A 4KPLA 3N14A 4J3ZA 3PJTA 1PXGA 3VK5A 4EACA 1W5MA 1RQEA 3GTXA 4KF1A 4QJ1A 4ZOCA 4H8HA 4WLCA 5AHEA 3T8QA 4KWWA 4LC8A 1GYNA 3ZLHA 1CLVA 6A3HA 3N9KA 1LRQA 3SUVA 1JPKA 1MXSA 1QI5A 3T08A 2RDTA 2DQWA 3QHOA 1I75A 3T42A 3OYZA 1XLCA 3CHVA 3SN0A 2PDQA 2WC7A 4I5UA 4ES4A 3BE7A 1QWKA 3WLPA 3CEPA 3ZMRA 4TOQA 3ZVHB 1P5BA 3QMSA 2OJPA 3FNDA 1JZ3A 4O28A 2A2IA 4JTLA 4W87A 1UD3A 4Q3MA 1IT8A 2Z1VA 3BO9A 1ZAIA 1EQPA 4Y9NA 5FJPA 2WLZA 2VOTA 3M0XA 3UW6A 2GGEA 5ABFA 3MSGA 5CGQA 3T0AA 4CNNA 2A3EA 5KZ6A 1DJXA 3MWAA 5CZKA 3L2IA 1OFAA 4LAUA 1MYRA 5A5WA 2OO6A 1FWBC 2ZBTA 1ZS2A 1TPC1 1R7OA 5FJTA 3SI9A 4C91A 4ZOEA 1CXEA 1IYXA 3CAWA 3BOXA 4NP7A 3RITA 3VZZA 3EBVA 3ZT5A 3DERA 1EWDA 4DXKA 1NQ6A 3N2MA 1JDFA 4PEEA 4PMJA 3VIMA 2GQAA 1Q2SA 2YW3A 1P48A 1E9IA 3DFPA 4KMQA 3WLJA 4FLQA 3PM6A 2Q8ZA 1DWAM 2W5FA 3IANA 2D1ZA 4HJWA 4F9DA 1RJQA 3HPZA 1W3JA 5FJRA 1BXBA 3NZRA 3STGA 3HQ1A 2RJHA 2QNEA 5MHBA 3TTEA 2Z28A 3IAPA 5CGMA 2WSRA 1S2AA 4LV4A 4AVFA 1E5NA 7XIMA 2BTMA 3VFLA 2CLMA 2I14A 2J25A 1XSIA 3Q65A 4EPKA 2TRSA 1Y5WA 4GI4A 1FWHC 2OT1A 4P8UA 4WJ8A 2H3DA 2RFGA 4V27A 3VKAA 2O92A 4JIIX 4ADSA 4GVIA 3SEPA 3AXKA 3L23A 5E93A 1CT5A 1OZQA 3SB0A 2QCDA 4GBUA 1W17A 3LM7A 7PTDA 4Q7BA 3SUUA 4A2RA 4EVZA 1A5OC 2GZXA 5EMLA 1TPUA 5DMYA 4MB1A 2FB2A 1VH7A 3WK1A 4BWLC 1XG4A 3A9BA 5FOOA 2IPFA 1C7SA 4JY8A 1W1B1 1A5LC 1LDCA 1E6PA 4DJFD 1OFDA 4IXHA 5AHNA 1X6NA 2ZZ4A 3PUDA 3W1XA 3DENA 2CZFA 3MKKA 3TVAA 3TJIA 4IGMA 4K38A 4UTWC 4WDXA 5M03A 3PZQA 3ARXA 1J2BA 1H63A 5HWNA 3ZXWA 1VEMA 1KR1A 1V51A 1R3VA 1OGSA 2AOSA 2VZSA 3JS3A 4UXDA 4F40A 3DECA 2VD8A 4P5UA 3B05A 2C8NA 5F7UA 2P1FA 1V3JA 1E71M 3N1AA 1SO5A 3OVQA 1C90A 2V81A 3JU2A 4O1CA 1HNYA 3CAKA 8CGTA 4WOZA 3S2MA 3LQGA 4U2ZA 4LUSB 1ZUAX 3B0PA 4YWSA 2PBOA 1WNOA 4H6QA 4R9OA 4AD5A 1XS2A 2IKHA 1RH9A 4PUUA 4RX0A 4J9JA 5LNRA 2VCBA 4JTRA 4FLSA 3FCPA 3QFWA 2YCIX 1UUOA 2VKZG 5G4WA 3E3HA 4DWSA 3LRMA 2CC0A 5EMJA 1KKOA 3DN5A 5A3HA 1XR2A 2BZNA 1G01A 3HJZA 2BXVA 1YPXA 2ZCGA 2VZUA 1AL7A 3MCOA 2YW4A 2ACUA 4IGSA 2QAPA 3MWCA 2HPMA 4OIFA 3VXGA 5I3GA 3BC9A 4ZR8A 2UY2A 1J0JA 4ZO8A 2XFRA 3QKZA 1ODZA 3FSUA 2XYLA 2FPYA 1RAKA 3UY8A 4GO9A 3H54A 3GZAA 3TZFA 1KFJA 3OZPA 4U5IA 3S5SA 3LV5A 4JTSA 3ARVA 2EKGA 3EXTA 4QBXA 1VLIA 4F0RA 3KWXA 4ALDA 4C6PA 2OX4A 4LB4A 3NZPA 4UQEA 1H5VA 1VIZA 3N73A 2C91A 5H1WA 3GC2A 3UWYA 4GUHA 3R7MA 4DI8A 3TC7A 3W7IA 1P0KA 2VCAA 3AIBA 3FA3A 1QHPA 1T7LA 1WCGA 4IH3A 3CB3A 3C8FA 4RE3A 1AJZA 1V3MA 3N12A 1ZHAA 4ZO7A 1S3HA 1I60A 1KGXA 3E5PA 4GH3A 1FHUA 2V82A 4LSBA 1Q8AA 2E5DA 3N2BA 2B4GA 1GHSA 1N82A 1R30A 3IUHA 4IFRA 1ECEA 1I2QA 2WAGA 5AECA 1KM2A 3BUVA 2X41A 2I57A 5TAOA 2V5LA 4J7RA 6XIMA 4O19A 2DJXA 3TOYA 5BW6A 2VJXA 2OSXA 3LSCA 3WQPA 3W23A 4ZXLA 3WK2A 3L5MA 1GEQA 1CTNA 1PDZA 4GBDA 3OA5A 1P0DA 4QG9A 1V93A 3ZR4A 1OF6A 1JPMA 3KBJA 4C6MA 4F2BA 3APTA 4JDBA 4K7YA 3VIIA 4KWSA 3FEQA 3WF0A 2PRHA 3W2MA 2QCDB 3AMDA 3BAYA 1NIUA 5I0DA 2J8GA 5JVLA 4JZ5A 3BW3A 4ZQCA 3NDYA 1P4CA 3D3FA 1NF7A 2DZBA 1UUQA 3UESA 3OVRA 3VMOA 1GEHA 1Q6DA 4X60A 2B7NA 3EA3A 4H9XA 1PO9A 1UR2A 4TXEA 4U3AA 1H1NA 2HQAA 1ZJHA 1AW2A 1JCTA 4IIHA 3E74A 2VGFA 3WKZA 1H7XA 1PZ1A 3O0KA 4B90A 1QI2A 3AYSA 2HS8A 5CBBA 1DQXA 4AUBA 1HX0A 3VA8A 2J7GA 2PODA 5AOUA 1OCNA 1C8QA 4O0ZA 1K7XA 4A4AA 3W7NA 4M1RA 2ZX7A 4H4IA 2QVHA 1T5AA 3CAQA 5K9DA 3R5EA 4Z17A 3ATYA 2AL2A 4A3UA 2WMKA 2PSNA 5DXXA 1W1A1 1E4NA 5CZ0A 3T6CA 4PTDA 3CV2A 3VKJA 4PMNA 1SMDA 4OJYA 1XC6A 1XBZA 2QCMA 3ITGA 1XYMA 1LUCB 4UOZA 2GK1B 2QUNA 4CU8A 1BG4A 1R9YA 3I7SA 3IIOA 2BY3A 2PZ0A 3PNUA 3S2LA 1LORA 3G1XA 1ITUA 3ITYA 5LNWA 4US6A 4WSJA 2XPKA 1KRAC 4J40A 2WKGA 1JGMA 1H09A 2E0PA 3GIPA 4UMCA 1QNPA 1FWJC 1W5PA 5TNVA 4EE9A 3AU2A 1XISA 2QDHA 3TNOA 4HCDA 3ZO9A 3VM5A 3AROA 2J79A 4DBSA 4ZCWA 3HG2A 5LSMA 1LL4A 1GOXA 3CM4A 2NUWA 3BZGA 3VIJA 1UKOA 3H2MA 2FKPA 4I6VA 1GONA 3N4AA 4RXGA 4TX9A 2HK1A 1K9DA 3WD0A 2I5GA 3GVVA 3C56A 2G3FA 1V3LA 2GVJA 3OZOA 1JYNA 2F38A 4DVOA 3URNA 1B9BA 5FJIA 5M2FX 3K4AA 1H7NA 2DFAA 3GDRA 3RXZA 4JQ4A 4ACYA 2E1WA 2C7FA 4G5DA 1EIXA 4FPSA 4GJIA 2Y4SA 2F9RA 1UBPC 1QBBA 3P5YA 1AW5A 5LHFA 2PTXA 3KLKA 3C2VA 2OWCA 3THUA 3UA3A 1KWKA 4FXSA 3KW3A 4JTCA 1Q6EA 3WF1A 5AVNA 1VIWA 3QPEA 3M5ZA 3LSBA 3CWNA 1H60A 4DM2A 1Z44A 4IMGA 5FESA 2V5KA 3NJ3A 4O1BA 5D9MA 1JUEA 2GL5A 3G24A 1TELA 5CJMA 1W1TA 1A5MC 1TREA 5I24A 4R3UA 4LF1A 5FEWA 3CMFA 4X22A 5AHMA 2W79A 3KTXA 1THFD 1JDEA 3RLVA 4XBSA 3JZEA 4C6DA 5ECUA 3GO2A 4FX7A 3LMZA 2DV0A 4AXNA 4I5RA 1TJRA 2Z6JA 3BAIA 3HQOA 4PE8A 4WJXA 2ZRXA 2FGLA 2RJGA 3JW7A 1VBUA 3KM8A 1EO7A 4M5PA 3LLFA 1OWQA 5AN7A 3UXIA 2PGWA 4FF5A 1IR2A 1GVQA 1NM9A 1UMLA 1TX0A 2OX1A 3BGAA 5KTLA 2PDGA 4W8LA 3L5LA 3TIMA 4H2CA 1E6SM 1DJIA 3BSMA 2PI6A 1LROA 5BXPA 4MMWA 2A3LA 1LG2A 1TKKA 3ZZ1A 3LZ3A 4FZIA 4V1YA 3FJLA 2NX3A 5FL1A 1TVNA 3GTFA 1UKQA 4QAIA 4NX0A 4O16A 4O57A 1UWIA 3Q94A 5LIXX 2V69A 3WDIA 4ZZ9A 3AXMA 1IR1A 3AXHA 1QPQA 2VZTA 1C7TA 4QQUA 4Q7IA 5FEPA 2CITA 4NX5A 4ZBCA 4MYXA 1RR2A 3QZ6A 6TIMA 4JNYA 4GVHA 4PCPA 4HOWA 5C70A 3W25A 1YTEA 4A29A 2PGFA 4P2VA 4LBUA 3LY0A 2D2GA 4MADA 5EA9A 4XIAA 1YBQB 2R24A 2Z6IA 3BVJA 2PC4A 4XK2A 1SU5A 2SFPA 3E1F1 4GCAA 3UWQA 4D6CA 1H62A 2PURA 5FSEC 4MKNA 2ZZ7A 1UP2A 4X9YA 4QAWA 4JPGA 1XBXA 1FCQA 1WZAA 1KGUA 3KZSA 1WUEA 1LQ0A 3OODA 1BFNA 4KETA 3K30A 4GK8A 3BAXA 3BK0A 2V0TA 1QDSA 1RCQA 3CZGA 4DUWA 1X7FA 3TJLA 4EK7A 1L6YA 2OLAA 2QJJA 3GXTA 3PZTA 1BYDA 3EPNA 3ARQA 4REQB 4NZCA 3PBUA 5AYYA 4JTDA 3DZ1A 4Y9PA 1RA5A 4LOCA 3LHYA 3S9YA 1XIMA 3WF3A 3BQ5A 3PR2A 1WPCA 4L1GA 1NY1A 4JFWA 4QE4A 1B30A 2BY2A 2FZDA 3G22A 2YXOA 3G1DA 1QBAA 4PUNA 3MZNA 3C3NA 4JXCA 1K70A 3BOFA 1R0MA 3G3DA 3LB0A 4E4PA 4MNKA 3P74A 4U31A 5JH1A 2YL5A 1B2YA 2FZ9A 1CCWB 3TTOA 1XLJA 3BLIA 4PYSA 3EA2A 4L6DA 4O18A 1UR0A 1WZKA 1PJ9A 4AHPA 2CBIA 3H2CA 3CHFA 1MW0A 2GQ8A 3EB4A 3LCLA 5DT7A 1UIPA 3KVKA 1B9ZA 2EPKX 3APGA 5FF4A 4RPQA 4GD0A 2ADAA 1GOOA 3WLKX 1HGYA 3MMTA 3LPPA 3DC0A 4J3SA 2VDGA 1EFZA 5CLWA 3W7EA 2BOEX 2VM8A 4PUWA 1U2YA 1J8VA 3PJWA 2C1HA 3UG8A 3GM8A 1SPQA 1I2RA 3EDFA 5LA1A 1XICA 4LY4A 3STPA 1QNRA 3MHFA 3K13A 5EBAA 4NXKA 1DPMA 3RPMA 4IPPA 3SN4A 1P7TA 3R0DA 1DE6A 4NXSA 1RVGA 1PWLA 4PUJA 4J2PA 1SR9A 1S2VA 5HNRA 3T9PA 3EDDA 1ZB5A 3HN3A 1L9WA 4J3TA 3URBA 2HROA 3BCDA 5FJJA 5BOOA 1TCMA 4XZHA 1XIFA 5HWJA 2WJDA 3CUGA 1DXEA 1QPKA 3UF9A 3N04A 4HNOA 3G1HA 3TMQA 2QR6A 4YNGA 2E68A 2WCGA 3CTTA 3QGVA 4JN6A 4AHOA 1JULA 4U33A 1JAEA 3GU1A 5F2GA 3GG8A 1CXIA 2WNQA 1DP0A 3PN8A 1UJQA 1X98A 3M5VA 1IF2A 3VNKA 1P43A 5HPOA 2GGGA 2WNWA 3B8WA 3UPMA 4D9PA 2I5QA 2AGKA 1AMKA 4FEZA 2WHLA 4W5ZA 4LU0A 5I02A 3I6EA 2V67A 4NVTA 2B31A 5HNNA 1EX1A 3MBDA 1RD6A 2FPVA 1EXBA 1SZGA 3WFZA 1W56A 3DBPA 4WJEA 3UY7A 3IJLA 4O52A 3BARA 3QYSA 4ZXOA 1JYVA 4K8EA 1DWGM 4ZOAA 1F8IA 1UR1A 4ZB0A 2DVTA 4HOZA 4JKMA 5I03A 3GC4A 2BS9A 4AZ6A 3SRDA 3WEOA 4JTHA 3F2DA 3TYEA 5EMMA 3RDKA 2WK2A 3QHNA 2HZGA 3U5UA 1SSDA 1HXJA 1E3XA 4NUWA 1JZ4A 1W2VA 5IOBA 1AH4A 3DCPA 4PMZA 3IGSA 5K2ZA 3BG3A 4U2YA 4UFHA 5BMWA 3UA4A 4ZSUA 3I68A 3CH9A 1Q6RA 4A6GA 1XPGA 1E1EA 5A6SA 2HK0A 4IZGA 3GTNA 4GA8A 3T55A 5FAGA 1YDNA 3WH5A 4I7UA 4LB3A 3DHPA 1U5JA 2PRMA 1TCDA 3PB2A 2PLMA 5C5YA 1A4MA 4PR4A 4O1FA 4D6IA 5CG0A 2IUZA 3HGRA 3S6TA 3RK8A 5ECVA 1J5TA 2W66A 1OFEA 3QPYA 1M6JA 4F0MA 5I00A 4V28A 1ZALA 2XUCA 2WMGA 3P81A 1XLEA 1ITXA 1CDGA 1X7IA 1XCWA 1CGWA 3L4VA 1EJTC 2QDGA 4B5WA 3GYEA 4Q8OA 5A69A 4MFEA 3TC6A 5JU6A 3WDHA 1GVSA 5F4XA 3BW4A 1J12A 1PCKA 4BK9A 1GZ1A 3M0MA 1BF6A 1CZ1A 5F4SA 5F4WA 5CPTA 5AB3A 3WFLA 1X39A 4AF0A 1QI4A 3BV4A 4WXYA 1XIJA 4B9ZA 1CLKA 2Y6ZA 2AL1A 1PTDA 3WDRA 1EPXA 4N02A 4E38A 1I2PA 2VT0A 3V0TA 2Z25A 5JMUA 3UFYA 2IQDA 2WC4A 2D0HA 3NAVA 3L0NA 1EDGA 1XFCA 3PC0A 4AIOA 3W88A 3OU8A 1RK6A 2HWGA 3RAOA 2VEIA 1RBLA 3W1LA 3T0CA 3R12A 1VYSX 5EYWA 1JQVA 2V38A 4FA3A 1V6TA 3NQCA 1VJZA 5HUOA 4U5KA 2C18A 1QCWA 3NZGA 1MFVA 4WD0A 1YBQA 1I1WA 3R13A 2E6AA 2BOFX 3AWNA 3ZQ9A 2GJXA 2WSYA 2J7EA 2HPIA 1ODUA 2WWCA 1SZEA 1VKFA 3BGJA 3AS2A 3HJEA 1UOKA 1P6CA 5A6KA 3RN6A 1B54A 3FYYA 3TA9A 3URAA 4IJBA 1J18A 3AMGA 3WQ8A 3CO8A 1AODA 3NSMA 1JZ5A 1LLOA 3GBDA 2YYUA 1EOKA 4DJEC 3VZXA 5FJUA 2G4FA 3BJFA 4FIQA 3E0FA 5D2XA 2GDVA 3ECQA 1Z48A 4C60A 2W92A 2EPHA 1LQ2A 3UZZA 4B3ZA 3S2NA 2QGYA 4IMCA 4DJFA 1NWRA 3BW2A 3WENA 3P62A 1XCXA 1I9CB 1F3XA 3HQNA 1XUZA 2ZVRA 2ZRWA 3LMYA 3NSNA 3CQKA 5LIUX 1OC6A 3FEMA 1FH7A 4MUPA 2I9UA 2VUYA 1JD7A 1SZFA 1SJBA 3V7PA 3WH9A 5IFPA 2FZMA 4LAKA 5CSUA 1GW1A 2OEKA 3PZ9A 4W7WA 3B4YA 8TIMA 4G7EB 1BWLA 1T41A 4H9VA 1T8XA 2QT3A 1P7TB 4HHLA 4UTIA 5A6AA 3HB9A 4R88A 4XQ6A 4L80A 4DY1A 1LP6A 1ZCCA 3W28A 4GXMA 1OD0A 1IXPA 1KRCC 1NWTA 3AWOA 3OOQA 3LI1A 2D2HA 7A3HA 1D8CA 1QOPA 1FQ0A 1WA3A 3AIVA 3TX9A 3O15A 4GZIA 2Q01A 1GOMA 4FOJA 3S2CA 1W0MA 3WQ4A 4LVAA 4FIRA 4JIEA 4D72A 1A5SA 4MWAE 3GKAA 3REQA 3EWCA 2VX6A 3S9IA 2E1DA 3HA1A 4HVXA 1E9ZB 2QF7A 2Z1KA 4ROQA 1B3ZA 3FLUA 1AMYA 3NNTA 5G1YA 3XISA 1XQLA 1UR4A 1SFLA 3CGTA 1YMYA 4UQAA 3HM7A 3DEQA 2PDPA 2D2JA 4CU7A 3GXPA 3QGAC 1IXQA 1MUCA 1L8PA 1A50A 4M0XA 3MJYA 4BJHA 2Y5EA 3WQDA 3WH6A 3EWUA 2UV8G 3A4AA 2YXXA 4YCOA 3L0KA 1A80A 3QV6A 4UTFA 3MP4A 1Q45A 2UY4A 5A2BA 2PP0A 1LRNA 1W3KA 4QGCA 3VDCA 2IXUA 1H2JA 4H8NA 4OQVA 3LG3A 3H7RA 1REQA 1EXPA 2VC9A 5AHIA 2V5CA 1ITQA 3QOKA 3B04A 4PEKA 1K3UA 3QW3A 1GKRA 4WSKA 4OOZA 3C6CA 4D6FA 1WXJA 1B5TA 6PTDA 5ABFB 1H7WA 3OBKA 5D2YA 3VIPA 3P8IA 5C9RA 4YMZA 1GQKA 4R5EA 3URQA 4GC4A 4IG2B 3GQYA 2XSXA 5G4HC 2EKCA 4KIRA 5FI8A 3MHGA 1GOIA 3G6MA 1L6WA 2BXZA 3M46A 2Y62A 5L9FA 4N4PA 4TQTA 4DO4A 3M47A 1LRTA 4LANA 4UTWA 4DJDD 1R46A 3STEA 1G7UA 5TIMA 4HNTA 2YKKA 5G5IA 5I3FA 1YNQA 4NZ4A 2FHCA 1YHTA 3CT2A 3LXAA 1E72M 1LUCA 3E0LA 2A85A 2ZXQA 4RDZA 4H9MA 1DOSA 2ZRUA 4DAIA 3F4WA 3EZ4A 3UYIA 1XIBA 3NOEA 1KM3A 1FWWA 4IMEA 3TQPA 3PPGA 3LHVA 3LGEA 4DPPA 4EAMA 5DCDA 4QG8A 1ELSA 1PHWA 5M1TA 3ZT6A 5XINA 5C6MA 3GH5A 1XRVA 1LTDA 1B0IA 2JGQA 2PDNA 1CECA 3VO0A 1VFUA 2XDFA 1MDLA 1VBGA 2PB1A 3PG9A 5CPNA 3H8AA 1S2TA 4R34A 4JFVA 3BG9A 1SFJA 2J6XA 3P80A 1K7FA 3QV9A 1UWQA 1O6IA 1B31A 3QFEA 1XLKA 3EXRA 4W7VA 5FD0A 5CPMA 1EYEA 3KS5A 2D3LA 1O5KA 4TTUA 3OQEA 2BHYA 1O5QA 3RPTA 1RD5A 3H26A 2DZSA 3K8LA 2Z1BA 3QPZA 4D6HA 1I8JA 1E1CA 1XWYA 4H8VA 1GOQA 1M04A 4AWUA 5LNUA 1UJPA 2FB3A 1VPQA 5FAJA 4RNJA 2Q8XA 3UG4A 4IIBA 1G69A 3SUTA 3E96A 5HQMA 1JZ2A 3RO6A 2NVDA 3VNJA 4PODA 2FIQA 3PPCA 3ABXA 3IVSA 4ENLA 4C1KA 3M4HA 5SWUA 3W7CA 1RJPA 3EAUA 2HNHA 1KR0A 3SUWA 3QM3A 4GYKA 2J9XA 3ES8A 4DBDA 1BXNA 3GVWA 4JTKA 4H6RA 4WDWA 4AEEA 1WB0A 4NI3A 4UTMA 1V5XA 4XG1A 3UR8A 4C6JA 4F79A 1UA3A 3PAOA 2WBKA 1GOWA 1BHGA 3PZOA 1UROA 3KP1A 4O0KA 2A6LA 6ENLA 2XFWA 4M24A 4H41A 1PKYA 1R3QA 3TR2A 4PMXA 2RDXA 3MCMA 6XIAA 4A3YA 3BOLA 4QITA 5EU9A 4WY0B 4W88A 1V7AA 3OLIA 3EB3A 3SCQA 2C71A 3UWWA 4PBEA 4OWGA 3HGOA 3MUIA 1D9EA 3VGEA 1UOZA 5BU6A 4X3ZA 1K02A 3XINA 3HOJA 4S23A 4HSHA 3MV01 1F07A 3USBA 2J27A 1OGGA 4QRNA 4LALA 3V3WA 4PB5A 3RO8A 1RY0A 3OJGA 3RUBL 1S2UA 2ZDRA 2HXUA 3UPBA 1TPEA 1FWRA 3E38A 2FFCA 3FIGA 3HGSA 2QCEA 3G77A 4P7LA 3W3OA 1H3GA 1JPDX 1XINA 1JPHA 2AMGA 1D3HA 2OFJA 3JUGA 2E8YA 4YCPA 2X1TA 1EO5A 4UFJA 3DIPA 4JFTA 1SMAA 1TIWA 3O6DA 4L9XA 4JTGA 1OZMA 3AYVA 4L4LA 2QJMA 1ZBVA 4YJ5A 4ZE4A 2YBTA 1RHCA 3UXDA 3QR1A 2BY1A 2ZTJA 1HKJA 2Q09A 4KERA 4D6JA 1NDVA 3VX1A 4QQ3A 1OC7A 1DEDA 1QHOA 3KLLA 1BSIA 1O5XA 3REQB 3O05A 1WKDA 2XIMA 4KCWA 3CT7A 3EDKA 3SCWA 1UR3M 3IAQA 3M0LA 1U1HA 1UBSA 3EEGA 3GX9A 1UASA 4Y8FA 1XLGA 2CERA 3SIMA 3UZXA 4ERGA 2DJLA 1KXQA 2IKJA 3C0SA 2PWHA 3CV6A 3BAJA 2RUSA 2BVYA 2PDHA 5DEZA 4DO6A 4F4RA 1PCWA 4LEFA 1H50A 5C54A 5BRPA 3L2LA 1FX6A 1HF6A 1RSCA 1A3WA 1VYPX 4GXPA 4D2JA 3XIMA 3WK0A 3PBYA 4LY8A 5HMSA 1PYMA 2PE4A 4QJ3B 4DZHA 3CIVA 4QM1A 4MKVA 2X2GA 3C2EA 1V79A 4K6AA 1LQAA 1QPRA 5CPQA 4DXXA 3AO0A 1OFOA 4IQLA 3W71A 3SGGA 4GMEA 2ZRYA 4MG4A 5K9XA 2XZ7A 5F2IA 2CW6A 3C5QA 3PY2A 3N19B 3A3HA 5A6MA 4HK5A 1U1UA 4GYJA 5A1AA 1XX1A 1F3TA 5H8PA 4FNPA 1JVNA 3AYTA 1OFBA 3T05A 1IHIA 1IEWA 1AL8A 1QTWA 3WCZA 2DDXA 1NQKA 3OVPA 3WUGA 1G94A 3N25A 3QR3A 2G3NA 3FY1A 2JF7A 4EKJA 1XIEA 4CVWA 1UZHA 4NJGA 5J5RA 4M29A 4GVGA 3K8KA 3VE7A 2XJ7A 3C0QA 1DJHA 3N9RA 3OHMB 2ALRA 5CG7A 1KM4A 4WSHA 2ZUSA 1FP9A 1EHAA 4FI4A 3MCNA 3QY6A 1WUFA 4A8LA 2HVOA 4B5UA 4LBSA 3W85A 4H7VA 1Y5VA 2VYOA 5G1TA 4ZTXA 3WQOA 1LWHA 4Q6XA 4EF9A 2NQ5A 6TAAA 4IUGA 3N11A 3DFOA 3VC5A 4YTSA 1EJ7L 2IS7A 2D73A 3VKBA 7TAAA 5DELA 3W82A 1SQ7A 1GW9A 4S3FA 4P8WA 4GI8A 1RVKA 4KKXA 1SO4A 4N6EA 5GQBA 2PDIA 4MM1A 1JEZA 3W7DA 1KW1A 2PBGA 1NP0A 3B9AA 1TV4A 5XIMA 3FA5A 3DFTA 3SGUA 3WJXA 3M07A 1MW2A 4KFOA 1HIZA 3UYCA 5DY3A 4IJRA 4M56A 1TZZA 2GSHA 1EP1A 3M64A 2L5HA 1A0DA 5E70A 1LM1A 4JTQA 4LXFA 5C2CA 1W3TA 3ZVHA 3CUJA 4CCCA 2EPOA 5J8LA 3E02A 4AZCA 3OBAA 2HMCA 1ZBKA 2VX4A 2FZ8A 3QKEA 1WV2A 4HNLA 1GQNA 4JYFA 3ABOA 4LVGA 1PL9A 3DDMA 2I1OA 1TUFA 3GHRA 4QLLA 3Q67A 4BI6A 1JL8A 1MQRA 3ABRA 1EUAA 4UCFA 4OTKA 2X42A 5K4XA 3M0KA 1QWGA 2HISA 3FA4A 4KBXA 4LYRA 1TVLA 5A8QA 2ZZ2A 2PDYA 5HR6A 1WKEA 4U28A 4K1GA 3SQSA 5I79A 2AQOA 2VX5A 3N17A 4OUIA 3IGHX 2HRWA 4RZ4A 1WO2A 4UMBA 3WMCA 2P8CA 3USZA 2DUZA 1IGWA 2QCHA 1ENUA 2Q3OA 1DWJM 3NVTA 4NQ1A 4IX0A 1R8LA 3F5LA 1ISZA 3T1GA 2W67A 3MUCA 2XSAA 5BOFA 2O7SA 4MJ2A 2VC7A 3IJ9A 1X1NA 4H3DA 4ATLA 4PMUA 1VCGA 3LXBA 1TV3A 4B5SA 3THCA 2ZZ5A 3AFBA 2KAUC 4C5YA 4IL0A 3WLOA 3R25A 2F84A 1DVJA 1EJRC 1I2NA 2WZEA 3A3WA 3L67A 2OEJA 1U30A 5K9CA 3SRFA 3NQ2A 5H8MA 2ZFAA 1PS9A 2PMQA 1TRDA 2XU2A 3M0ZA 1ISWA 4NJKA 4YTTA 3M43A 5FACA 1EGZA 1C91A 1R2SA 4G1KA 3UWVA 3QMTA 1XJBA 3B40A 1W1YA 3GDBA 1OHLA 2BGSA 4K3ZA 4XWUA 4ERAA 3VGFA 4I9TA 1T40A 1HO4A 2W4XA 2ZDSA 3T2QA 5BOEA 1NFPA 3B9EA 3FHAA 2CFFA 3W6LA 4ZQOA 3ITXA 5FKYA 3BL3A 2DSWA 3QV8A 3CUXA 4H1ZA 1HW6A 4C6QA 5KEZA 3FDGA 4QSFA 5HQEA 1BWVA 5K4ZA 2XFFA 3TW6A 3F4CA 3A4XA 3ITTA 5MKGA 5IM51 1TO3A 1UKSA 3OYXA 3GNPA 3VNMA 4LAMA 2E09A 1XSJA 2R94A 4H9YA 4Q8TA 1TX2A 4DQWA 4DPQA 3M6YA 2D3NA 4DJFC 2X30A 1OEPA 4TVCA 1Y0EA 3CV1A 3TMLA 4L7ZA 3LCHA 2PWVA 2VEPA 3IV8A 5BCAA 2E5BA 4HK7A 3QZEA 3UEQA 3ARRA 1W9UA 4Q4MA 4GUIA 2J8TA 2R6OA 4FR1A 4QLKA 1WZLA 1D3GA 1VZWA 1VQTA 4LYKA 2FTPA 3AS0A 3NO3A 4UOJA 3GFZA 4CNSA 1Q3NA 2P53A 2C13A 2VWSA 2BLEA 4UC5A 2YDSA 5CZSA 3FV9A 2WCAA 4GY1A 5I3HA 1IT0A 4KEUA 1M1BA 3GG7A 1AZ2A 3SCVA 2YXGA 3CPRA 4B5XA 2DEPA 1YXCA 4UUIA 5JUVA 5LA2A 5LHEA 4WRHA 1J10A 3SCNA 1PUDA 3RFAA 2EEXA 3G18A 3UCDA 4HA0A 1MEHA 1GORA 7ODCA 4Q4OA 2OQLA 4DF0A 2P0OA 5GJMA 4A8RA 1R86A 1VRXA 3W2NA 1VFLA 3Q45A 2E9MA 4RZ5A 3WSUA 4DYJA 2GK1A 1PKMA 3TTYA 1I1XA 3MYPA 2DIKA 3W1MA 1BRLB 2WB5A 4C6LA 4RNHA 2CHOA 5A6JA 1XBVA 4G2DA 2DW7A 2CZEA 3MZ2A 2QUTA 3I3DA 2XGBA 3U7BA 1G4TA 4QR6A 3U8GA 4EF8A 3GUGA 3H4XA 3WJZA 1I4NA 1XD0A 2GDQA 3STCA 1ONEA 2OGJA 3VCNA 2YL6A 5D02A 1ZGDA 4RNIA 1E9YB 4MPKA 2E3ZA 3CL8A 1R38A 3AIRA 3AAMA 3INPA 4MZ1A 5EB8A 2YA0A 3ERPA 2OZTA 4R7JA 3P0WA 3BCJA 2PTWA 1E56A 1B3OA 1IZJA 2GYIA 4PCFA 3SCUA 1IWBA 2VC6A 1E4LA 2VRQA 3KL5A 3QZAA 4IGNA 1SYTA 2D2OA 3CQ0A 1N8IA 5D2TA 1TSIA 4LX4A 4H7ZA 4X2PA 3STFA 2P10A 3WNMA 2GUYA 3MV11 4C6OA 3FHQA 1GG0A 2DGAA 3HBLA 1RPKA 2KX9A 3VX0A 2XINA 3WELA 1UD4A 1KO0A 1UWUA 5CKSA 2QF8A 1TR1A 4H04A 3NQBA 2J62A 1W37A 1XH0A 4RCXA 4XTIA 2WSPA 2B7PA 2OT0A 1RBOB 4HN4A 1MEIA 1HJQA 4AG0A 2VZOA 1HJVA 3AJ7A 1QOXA 4BS0A 3NCOA 3WDPP 4JX4A 3U6WA 2GJXB 2C79A 3IPWA 3PBVA 3KP0A 3W81A 2B7QA 5HAOA 4JN8A 4AEFA 4B15A 1BGAA 2YA2A 5BMXA 2E28A 4Q8QA 1OM0A 3UXAA 3FGCB 3LI0A 1RPXA 3W4RA 3WBAA 3G5EA 1CENA 1OY0A 2NXIA 4S3KA 4JTFA 4FO4A 4BQ3A 3WUBA 2WNNA 3TYDA 4IUOA 1TMQA 1M5WA 2ZQ0A 4L4OA 1FUYA 3WQCA 2EPMX 5HMDA 2YPIA 4D6DA 1G4EA 2IW0A 3UD6A 3QTPA 1BAGA 3TCSA 3IIPA 1TR9A 2PTZA 4HNVA 4BF9A 5D04C 4DNMA 2EPNA 4ZO6A 1E73M 1V77A 3LX9A 3OZYA 1UWSA 3RX3A 2CIPA 2CWNA 4C6IA 5D30A 3N2CA 4Z2JA 2BSLA 3NQMA 2VFFA 2OELA 1VB9A 4MHBA 1AVAA 5D8ZA 1YKWA 2P50A 2JIWA 1FFQA 2VGIA 1EYWA 2NVCA 3SUSA 3QVQA 1RV8A 2OO0A 5EKYA 3ATZA 4NKCA 4JYDA 3NTYA 4UQCA 4ZVJA 3UCCA 2OYMA 3KRBA 2W63A 2WO5A 1XLHA 4L6HA 4TTGA 3GNRA 3NPXA 1HL9A 2B7OA 5A8NA 1GVYA 4TV5A 1ECQA 1DIOA 3O9NA 3MVTA 1GYMA 4JIQA 4RR4A 1H41A 4EPEC 3C86A 1QOQA 1AG1O 1VCFA 2I7GA 4N7QA 4DX3A 3S46A 1NOWA 5GNZA 1DJZA 4NSBA 4DN1A 3AHTA 1G9HA 1TTPA 4O1DA 1TUXA 2HBVA 3WD2A 1J93A 2F7FA 3VNYA 3T44A 1UYQA 1AK5A 1ZBCA 3QSRA 2DZUA 4KCVA 1TFVA 3WUFA 4HGXA 2GGHA 2HE5A 3W76A 3FFSA 2J24A 1S5VA 4HPXA 4S3GA 1EA0A 1OCJA 3WLLA 3WUEA 1M65A 4A22A 1BPLB 1C8YA 3S1XA 1QO2A 2ZE0A 2VL4A 3EYPA 6ALDA 5AZ0A 1KM6A 1P0NA 2D20A 5G1MA 3CHDA 3GXNA 3A6OA 2EAWA 4CGTA 1GPWA 4XSLA 2WC3A 4S38A 1C9DA 4WDTA 1QNOA 3ARWA 2J66A 1E6XM 4D6EA 4JTEA 3GR8A 3GU9A 3AHXA 2VCCA 3RHGA 3NVDA 4L1WA 1W5QA 2QPUA 1KGWA 3JVAA 1MW3A 3T0DA 3CHCA 1NWSA 2QUMA 2BP1A 1K8YA 3E2VA 1X38A 4XKYA 3LXCA 1SGJA 1LJYA 4U4MA 4UWMA 1WX0A 1F05A 1HN1A 1IEVA 1NARA 4O8AA 4KRTA 1GYLA 4MJMA 3UJEA 4Z1YA 1GZJA 3AOFA 3KL3A 3AYRA 2R1MA 3RU8X 2Z00A 6CGTA 5CJNA 2XSBA 2ZUMA 4NNBA 4GOAA 1H7PA 2OQHA 1GJPA 3IUDA 2WW5A 5REQB 1DIDA 3R58A 5T91A 1XRTA 4U3CA 2OB3A 2CHNA 4UCGA 3NG3A 3P6LA 3VMNA 3ZYZA 5LNSA 2GJLA 1XG3A 3AS1A 4URIA 4OE7A 1J0YA 2HJPA 4U10A 3NUKA 5CJ5A 1FA2A 4YXGA 2QCNA 2DSZA 4CCEA 5C7VA 4UQDA 3U7VA 2B81A 4MFDA 5BYWA 4B9YA 1ISYA 3R4IA 3WEZA 2XHYA 4PSPA 3AUOA 2E25A 2FTWA 3BANA 4MY1A 5JXQA 1RP9A 3SJ3A 4XVEA 1W5OA 3MQTA 1KQYA 2V2HA 4BQ4A 1L8NA 1OC5A 4F66A 4EPDC 4L4PA 3FJNA 2EF9A 6REQA 4S3DA 1V3KA 1QR7A 1OFRA 3O3RA 2JBMA 3U4AA 1CI1A 3KE0A 3F4DA 4GNJA 5DX7A 3OP2A 3UXKA 4AZ5A 2HVMA 4HCLA 3IJ7A 1SM9A 3TCEA 5KZEA 3RCMA 3UZ5A 1GKQA 3U2CA 2PF0A 2FVMA 1NELA 3ZJ6A 1EX5A 1J5SA 1X6LA 3B8SA 5FEZA 4B5TA 2VGGA 1TTQA 1AH3A 2TYSA 3LN3A 3O6CA 4PFHA 2Z0IA 1IQ8A 2NXHA 1GNXA 1N55A 4B16A 4B2DD 3F5JA 1XYZA 5A94A 1S1RA 2W9MA 3V0SA 3MUY1 1WOBA 3SFWA 3W7KA 2E6YA 3LNPA 4MNMA 2TODA 3TONA 3BJTA 2EPLX 3GXIA 3II1A 1B3YA 1QI0A 3QHMA 3S5YA 3T09A 2DZAA 1IXNA 4ZB2A 3TSMA 1I2OA 3MW7A 1UD2A 1W8SA 4IIDA 4GKLA 3O16A 3L21A 3PTDA 3GYCA 1PEZA 4DWSD 2P88A 3BH4A 3VUPA 1P0EA 3H12A 2EQDA 5H91A 4HMDA 2YDRA 5CLTA 3C8NA 5HJXA 1MXDA 3WL0A 3WDJA 5DBTA 1Q63A 4LWWA 3EWWA 1Q6QA 4A8IA 3N6HA 3HV9A 4MY8A 4Q32A 3VOFA 2ZUNA 5T8GA 3GS6A 2Y88A 2RHGA 4CUCA 5HBFA 3DU0A 5CAKA 2ZXAA 3W1AA 3BAKA 3H53A 3GG1A 3ARSA 2CZVA 3EWYA 3N15A 2CHRA 1ZNNA 3BJSA 4BEQA 1BVNP 1K6AA 1O94A 3WQVA 4JN7A 2UBPC 4DBUA 4FB7A 1TG7A 2Z2UA 1HO1A 4KFPA 3QRHA 2ABBA 3KCJA 5CEWA 1SR0A 4NIRA 4M81A 4IWWA 5I2UA 2RGLA 4M6VA 1UPMB 4O1EA 3A9IA 5FF7A 1F2JA 5LXXA 2G0WA 2BHZA 4HSOA 4B3KA 2WM0A 1NEYA 4P7OA 1O12A 2RGMA 3AU6A 3OGVA 3VGHA 4HA1A 4Y96A 3VKDA 3NL6A 3QV7A 1D2KA 4QCEA 4ONVA 4O4WA 1HKWA 1A0EA 2WKLA 4PTWA 1XL9A 2YCLB 3AHZA 4AC1X 2ZA3A 2F6UA 1ONXA 4HN8A 5BXRA 2V2CA 2C0HA 2PDLA 3O2LA 4QHRA 2ZA1A 4PMVA 2O55A 2CWXA 1BKHA 3EX3A 1HJWA 3WLIA 4DBEA 4RLIA 5HOSA 3CASA 2Y8KA 1GQIA 4ZSTA 1AQMA 3I7QA 4CKQA 1ZRQA 1XBYA 3VC6A 3G1AA 4CNPA 1JGIA 3H2NA 1E4MM 1V6UA 2WVSA 1HT6A 1QUMA 5CZTA 2XH4A 4UR8A 7REQB 4BCEA 2PU1A 1JNEA 4WIWA 2H3BA 8XIAA 4OBTA 2VFGA 4JHMA 5T9CE 3LHTA 3KBSA 3MDUA 1BEUA 1TWWA 2G95A 5LGXA 3TAOA 1LYXA 1LBFA 2XVNA 4DZ5A 2A3BA 4YTUA 4LPCA 4QS6A 3UZJA 4LVBA 3A47A 3MJMA 2XIJA 4BI5A 1CGXA 4OOUA 1F6KA 1R5YA 2W3ZA 4QP0A 4MZYA 4GI9A 1JDAA 4BY3A 1KFLA 1MDRA 4MZ8A 3GHUA 4XZWA 1MFUA 2A3HA 5A8PA 1PBGA 1LWJA 1KBIA 3TSDA 1HKMA 3A5VA 1GVOA 5AYIA 5IFTA 4P7QA 2ZX8A 3B8DA 3ARZA 1FDYA 3BV7A 1OG0A 4J3WA 9XIMA 1KQZA 3W26A 4NILA 3W74A 4AD0A 3PVFA 1C8XA 2QPXA 3L4ZA 2QDEA 1BLIA 3A64A 4TX8A 1YE4A 4ILSA 4HT3A 5LIKX 1D8WA 4OU1A 4R53A 3S1WA 3S2JA 1J0IA 2Q3RA 4D6GA 2FJUB 4DO7A 1PIIA 3VCCA 3EKGA 4AZGA 4ICNA 4MAVA 4PCTA 3Q37A 2O4MA 4B5VA 2X05A 1A5NC 4Y2WA 3I6RA 3TW7A 5D9NA 3ITCA 4L4MA 3GNOA 5CAHA 3IRDA 4PBFA 1PYFA 2WJFA 3GE7A 1JI1A 5FEXA 1RUSA 3CWHA 1GTHA 2XM2A 2Z26A 2ZTKA 4H8UA 1G6CA 5HINA 2OOFA 5MF5A 1EP3A 5M17A 3BLDA 2ZADA 5EFFA 3NA8A 2E5CA 4CLMA 1JPIA 2D23A 4H01A 4ZQPA 3VDAA 1J11A 3PTKA 4A3RA 3LPFA 3TFXA 4UR7A 2AMXA 4UNLA 5EBUA 2IQ0A 2WMFA 4H19A 3LOTA 3KRUA 1PTGA 3ANVA 1EF3A 3ZSTA 2XN1A 3WF4A 3GUWA 2QYGA 4P8VA 1RY8A 4XTDA 2GUBA 3ID7A 1IIGA 1DYSA 3FOKA 3G2GA 5J5DA 3KOFA 1XRFA 3P7YA 3GG0A 3HMJG 3A3XA 1TZ7A 1OF8A 4N9DA 1VEOA 1S2CA 2FVKA 5AYXA 3FYPA 1OSEA 4C6KA 4MVAA 2PWEA 3NM1A 1H5YA 4Z2IA 1NWUA 3TNBA 3A22A 4JEJA 1NF0A 3TE9A 3TYZA 4PTVA 3V5OA 5D2VA 2R1LA 1J6PA 5I78A 3A23A 1W31A 2O4QA 3VIGA 2PP1A 5BZAA 1TV2A 4C5ZA 1S38A 1Z41A 2ZE3A 3UETA 3KOZA 5CC7A 1H61A 4DJDA 1VCVA 1JNDA 3CIXA 2IPJA 7ENLA 1B4EA 1HGWA 3ELFA 1I0DA 3IVUA 4DUOA 2TSYA 2ZZ1A 2WNZA 3AICA 4ZB5A 1DORA 2PUZA 3KXQA 5ENLA 1K7EA 1LL7A 1L6SA 5FIPA 4RDVA 2J9ZA 3BLFA 2GSEA 4AW7A 1JDDA 1OVDA 2CLFA 5H8UA 3WD4A 3TUUA 4KIEA 2ZWYA 1WDSA 1BD0A 3IUIA 3S1UA 1JD9A 3TKFA 1ADSA 3C2YA 3NURA 4AWEA 5DRIA 1Z7AA 4ADUA 1XH2A 1JCJA 3TJ4A 2QJHA 1BQCA 1PKLA 1SVDA 4O50A 1KWGA 3WIJA 3GZ3A 4RE4A 3KBMA 2XIBA 4LUTA 4XSMA 2PF8A 5EMYA 4MWAD 3AIUA 4HMCA 1V0MA 2O56A 3NM3A 2J8FA 3OB8A 3NYDA 3NYZA 2OR2A 3V1HA 1E4IA 3L4YA 3PK7A 1T6MA 1K1DA 5C8BB 4FK9A 5AY7A 2FZBA 2BFGA 3GXFA 2QMJA 1KFCA 4H2HA 1F8MA 3R79A 5CC5A 2EGZA 4Y9AA 2PU0A 2POTA 1MMFA 1SJAA 4Y7EA 5LIYX 3GH7A 2PC8A 2PDUA 1EB3A 3PBWA 2VI0A 2VFIA 3R43A 3FKKA 3PWIA 4BQ2A 1I0BA 4KESA 1QJWA 1ZTVA 4B3LA 4RJEA 3UWEA 4XZLX 1YX1A 4UTTC 1VEPA 2QMKA 3DHDA 2RDUA 1GJWA 4FP1A 4Z1BA 3QY7A 3CUIA 1Q6OA 1DJYA 4GABA 2FGBA 3GTIA 2Z27A 2NLIA 1OABA 2VFHA 1KLZA 3M1ZA 3B03A 4UQ9A 4ZFCA 5I6SA 2R1PA 1V6YA 3IWPA 1R2TA 3CQHA 4Z08A 3SBFA 2GVGA 1QXLA 2V5BA 1GGOA 4KW2A 3HURA 4KCUA 3CZJA 5DQPA 4YYFA 1BGGA 3CZ8A 3GXMA 3H2EA 3NIYA 2CYGA 1VFSA 1UZ1A 1B3WA 3AIQA 2A79A 2QCCA 3KTCA 4I9JA 1YPFA 4GVFA 1D7KA 2ISDA 3FK4A 3KX6A 1E51A 1OFPA 4TMCA 1MO0A 4QROA 2Q71A 2EBNA 2E9LA 1XHGA 3A13A 5I3KA 1WKFA 1ZCOA 3THDA 4M19A 1JG9A 2E67A 3W70A 1BG9A 1GT8A 3WD1A 3SCSA 1CW2A 4O0QA 5D2WA 3KCLA 1OT2A 5FSDC 1QPOA 3E12A 2J78A 3DG3A 3OPSA 1W9PA 2EHHA 2X40A 1YDVA 4G9PA 5CQ1A 2AAMA 3HQPA 2Y7FA 3CB8A 1N7KA 4HTBA 1W8GA 4DUXA 3VU2A 2G3MA 4XKYB 4E3VA 1IEXA 1TJ0A 1H0GA 1Z9AA 2XTKA 4MWAB 3W7PA 3UP8A 4F0HA 3LHUA 4HCHA 5E0CA 5G4EA 1DIEA 7CGTA 4MYAA 3ZVIA 1QNQA 2AGTA 4CQAA 3VNLA 1Q7ZA 3W7RA 5T26A 3CEUA 4O54A 4UTHA 5E09A 4S39A 1HG3A 3H6OA 3U2EA 1ZP4A 2PTYA 4R9XA 1ESWA 1XXXA 3DG6A 4IIEA 3M0JA 3WBWA 1JQXA 4HNCA 1WDDA 2FMNA 5IBXC 4YPJA 1QW9A 2Z24A 4GJ1A 3EMZA 4JQAA 1N8FA 1LT7A 3NFUA 2BDQA 3QF0A 3ARTA 3C3UA 1EDQA 1KB3A 2BVDA 3C2FA 1RZMA 1C9WA 4MJZA 1K9FA 2ZUTA 2I5IA 1HKVA 2IMRA 3P82A 4F48A 1OBAA 3AUJA 3N2XA 3TXZA 1M7OA 4XD6A 1JIBA 4GFIA 3W27A 4JIRA 3HFYA 3T4CA 1POJA 2DQXA 2ZZ6A 3PSVA 4HD5A 3HG5A 1EC7A 2QKFA 3AALA 3W38A 3W6MA 1XLDA 1E0WA 4C1NA 1WAWA 3PZNA 3NL5A 4LF2A 2DW6A 2AKZA 3H22A 3MUAA 1TA3B 3V35A 5A8OA 4ZO9A 1NH6A 2CESA 3V36A 4YTRA 3RR4A 2CNCA 5HJYA 2G3JA 3EPMA 3QBUA 1OD8A 2I56A 1XYFA 3N2TA 2QUUA 2YL9A 1QRQA 3WLTA 5BRBA 4DXVA 2PDMA 4K8GA 3PUGA 3MS8A 4RL3A 1TPWA 1NDWA 1FH8A 1O95A 4WQ6A 3PZUA 1NDYA 2ZRZA 5B7ZA 4AYGA 2XN2A 1YXYA 3BLLA 1S5TA 1XLFA 1DJGA 1P0BA 2IPGA 4LRTA 2A1YA 3DGRA 3VNIA 3W1UA 1CGUA 3LU2A 2GSJA 3NOYA 4W7UA 2DSKA 1XYLA 3D0CA 4N6FA 4Q4RA 3G1RA 3NO5A 1FVPA 3VVGA 1FFRA 5U4NA 4MJ4A 2DP3A 1UCWA 5DMMA 1W91A 3L4TA 1GKPA 3PJUA 5A6TC 5LXEA 4XZBA 1PZ2A 2VMFA 3W75A 3D5HA 3LERA 5TD4A 2X1IA 2BWGA 4QJ5B 2YJQA 4PL2A 3GH4A 1Z69A 4JHZA 1POKA 1WP6A 2DSUA 3UNTA 1BKSA 1Q13A 4V33A 3M16A 4CD8A 3R6IA 1XFBA 2VZVA 1W3IA 4E2OA 4AVOA 3BICA 3TJXA 3NDOA 2Z1SA 4KWUA 3BQ6A 4JL1A 3UJRA 3WN6A 1KRMA 4YHGA 3QR0A 5A2CA 3P84A 2PCQA 3UJSA 1OCQA 1WKYA 3R8RA 3U9IA 1E1CB 4L61A 1J0HA 3S9ZA 4GGHA 4GY7A 2YDAA 1G67A 3AJXA 1SZRA 3WMBA 1KNWA 3OZMA 1MSSA 1XUUA 4HYVA 1QI3A 3PAJA 1LG1A 1FHVA 3I65A 1JUKA 4YHEA 3GAKA 4RZBA 4IIFA 1HP4A 2WV8A 4PB3A 3DI1A 3GVRA 5HATA 4IPIA 2WYSA 4PBGA 4RZ6A 1TPDA 1H4PA 1JDCA 3M0HA 2GGJA 2J6VA 4AX6A 4EP8C 2ZKMX 2Y24A 3GW0A 4CNUA 3V75A 2Y7GA 4C6NA 5AC7A 5I7GA 1CXKA 1NTHA 1V03A 4N0RA 4K36A 4QISA 1R47A 3ZR5A 2GVYA 5AC5A 3ZT7A 3BMWA 3L68A 1DWHM 2J7DA 4DYEA 3AHVA 3SAZA 2W61A 2QEZA 3K4WA 4PMRA 3M7SA 4DIAA 2QDDA 1E1FA 3SGZA 2NQHA 5I5RA 4AZCB 2YBVA 2XIIA 5C2GA 4DAFA 3B8UA 1DQUA 3R10A 4P7NA 2BHUA 4MIMA 3WEMA 1JYWA 1UP3A 3S0CA 2V3FA 3LQLA 1W3NA 2QGHA 4IF2A 2NT1A 5I3IA 3EOLA 3RGTA 3VOGA 4PTXA 5U7SA 1JF6A 1KFWA 1KKRA 2QIWA 1VS1A 3PZIA 4NI8A 1DL3A 1LT8A 2WMHA 1VBHA 4TR9A 1V08A 2DZXA 5DXYA 2ACRA 2YSWA 4QX4A 3NQ7A 4GCXA 3LUTA 3RM9A 1XM3A 3FAXA 2GQ3A 1VBRA 3DFSA 4B91A 1ONWA 1HJUA 3KOXA 2ISFA 3S42A 4H6EA 2JKAA 3W2KA 2V2DA 4LRSA 2GJNA 3S8HA 2HXTA 3BCFA 1D7FA 4PTMA 3N4FA 3TEVA 1U1JA 1Q2RA 3LCXA 4LQ1A 4UZSA 3WL1A 4LT9A 4Z2KA 2I9EA 1V0KA 5IDIA 1Y8BA 4OZOA 1NVMA 1KLYA 1XF0A 4HZMA 4HIBA 3W1NA 3HPAA 1FWFC 1FWEC 2ISVA