3W86A

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with sh-1-96
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (fumarate)
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with SH-1-96
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 104
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2013-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w86A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w86A01
3BLFA 2E1DA 4NXSA 3TIMA 1PE1A 1HFBA 2TSYA 4JTFA 1TQXA 1WX0A 1C29A 2Y89A 1TB3A 1OFBA 4GNJA 1Z44A 3QJAA 3TFCA 4UTKA 4WXYA 4O8RA 4FX6M 2WNZA 3R2GA 2A6LA 4ZMGA 4WXZA 4LVAA 1VCVA 3NM3A 1PCKA 5CZSA 1VQTA 3TC7A 3Q58A 1T0OA 3QQ1A 5G2HA 1PL9A 4N4QA 1XFBA 1XI3A 4JXCA 4ONVA 3TAKA 1UJPA 3EX1A 1SQ7A 1F6PA 4HKPA 4IXHA 3BW4A 1ICQA 2Z1BA 5HJLA 3R12A 3QC3A 3B0VC 2CZ5A 3CEUA 4K36A 1W5QA 5LZLA 3U6WA 1TREA 2RKXA 5EKYA 4YWIA 3MYOA 3LBMA 1DQXA 1GVRA 4S1FA 1FWTA 3I65A 3IIPA 3W71A 3QM3A 3NQ6A 1Q6OA 2ZRUA 3W2MA 4S2CA 5U4NA 3N9SA 3N34A 4NT0A 3A23A 2YYUA 1W37A 5D30A 3UWWA 3FEMA 3Q2DA 1DL3A 1KV5A 5D38A 2Z2UA 4CCDA 3RMJA 4UCGA 1GZGA 5BNKA 6TIMA 1VYSX 1YTKA 1NVMA 1JR1A 3TQVA 1LOQA 2QJIA 2VEIA 5G2IA 1N7KA 4LC8A 4DPPA 3NL5A 1V5XA 4LV4A 4POCA 2J9ZA 2F84A 2B7QA 2AGKA 5LNSA 5F1VA 1B4EA 5ABTA 1A5CA 4LS1A 4OHQA 3F4NA 3LCIA 4JY9A 1HUVA 3O1NA 4R33A 5KSWA 3B0PA 4M6VA 1JQXA 2Z0IA 3DXIA 4M7TA 2GQ8A 2O7SA 3GAYA 1RVGA 2C6QA 5LNRA 4MLRA 4XBSA 2NWRA 4AWTA 1SW3A 2VFFA 1WAUA 2CLFA 1XUUA 1B9BA 3JRKA 3W7JA 3M5YA 4NZJA 5LKYA 4MYXA 3HG4A 1LCOA 1TPEA 3I6RA 5AYYA 3BARA 1LORA 1V7YA 5AYZA 2HTMA 1EP2A 3NAVA 1KTNA 4O1DA 1G4SA 4PEKA 4PL2A 2DORA 3MP4A 1RD5A 3TE9A 5CPNA 1S5VA 3GXPA 4UMCA 2YPIA 1Q45A 4ICNA 4LTSA 4JTLA 3BV4A 3U2OA 5FEZA 4FXRA 2ATSA 3LCLA 3DFTA 2XN2A 1EP3A 5FF0A 1CX9A 2NWSA 1XDMA 4O12A 4WJEA 2NX1A 5I3JA 3FOKA 1GVQA 2DZSA 3WJXA 2VFIA 4UNKA 1AG1O 1I4NA 3TQ0A 3GNDA 1LTDA 3IIVA 1NEYA 1TV7A 1PIIA 3BW2A 3C8FA 2QEZA 4RKAA 3NZRA 4O4VA 5TBOA 1ICPA 3FKKA 1L6YA 3L68A 3LBCA 4GWEA 4FNPA 2ZA2A 3G3MA 4NNCA 2V0TA 3GKAA 3P62A 2ABBA 1AK5A 4JYDA 1KFJA 4K6AA 1WQ5A 1FQ0A 2ZZ7A 3MP3A 4RZ5A 3W7KA 4YMZA 1P5BA 3G1DA 4NUWA 1TMHA 3LCGA 3TSBA 4HPXA 4JTEA 5U7SA 4OGZA 5F2IA 3VI2A 1IXNA 4O17A 4O16A 3ABRA 3W7DA 1Q3NA 1KM0A 1HG3A 1KBIA 4O1AA 1TPDA 1D9EA 4FNSA 1W8SA 4O4WA 4KFOA 2FJKA 1TPVA 4AAJA 1A5BA 4PC8A 1GVFA 2R91A 1MO0A 1BEUA 4KFNA 3TC6A 4M19A 4HN4A 1FX6A 1ZY9A 3NXFA 4EOUA 1SZNA 2CW6A 1GG0A 2C3ZA 1LRNA 2OMAA 1YLVA 1G4TA 1KBJA 3WJYA 1W56A 3W6YA 3QF0A 5D2WA 5T26A 1XBZA 3QH2A 4Y8FA 3L2IA 1H60A 2ZZ3A 1SFJA 1RR2A 1GPWA 3M16A 3DH7A 3FLUA 2YW4A 2YZRA 3W76A 4UTMA 4J9JA 4QSHA 2X30A 1G7UA 2GPTA 2YSWA 4JGDA 1B4KA 2FPYA 2RDUA 1K7XA 1XM3A 4BFAA 1X8FA 3PUEA 2BSLA 2PC4A 3LCFA 3GYEA 5DY3A 2CLMA 1HO4A 4UFIA 4M6PA 5K3VA 2TRSA 2CU0A 4NVTA 3MBDA 5J5DA 3CT7A 1NF7A 4LW7A 5D2TA 1IGSA 2CLKA 3TJLA 1WA3A 4S2BA 3L5MA 2WOQA 1SR9A 2VFEA 4XKYB 1R30A 3BO9A 1ZCOA 3ZWTA 3BG5A 2ZRVA 1ONRA 1TO3A 1T99A 3Q37A 4BWLA 2PRMA 3HG2A 2C14A 3IIXA 1U83A 4JEQA 2CFFA 1A53A 3S1VA 2RHGA 3F1QA 2RH9A 2A7RA 3TCEA 3HG3A 1WYIA 4DBDA 3ABSA 1P0NA 1OJXA 1OF8A 3P8JA 5I3KA 1G4EA 4LUIA 3SR7A 1LLWA 3T44A 2H8ZA 3EWYA 4R7JA 1T8XA 5D09A 1W5MA 4DBEA 1UUOA 3IGXA 3WJZA 2V30A 3CEPA 3KAOA 4MZYA 2X16A 1KLYA 3PULA 3W7OA 1KFEA 3FJLA 1FUYA 1YYAA 5FF4A 3BW3A 5DCEA 3HMJG 4W9TA 2V2DA 4IX2A 1W54A 2FB3A 4N9DA 3QFEA 1K8XA 3G1FA 1ADOA 3PBWA 5L9FA 4DF1A 2Q8LA 3GDMA 4UTIA 4ZQCA 3B0UX 1GTHA 3UD6A 5TQLA 1TTPA 2ZRYA 5CZTA 7TIMA 2HS6A 4JY8A 4QITA 4GC4A 5AHMA 2WKJA 1L6SA 2ZRZA 4MFDA 4P2VA 2VEPA 1ME9A 4Y90A 4E0CA 3W7NA 1FXPA 5KINA 2B7PA 3HBLA 3HB9A 4IJBA 3FA5A 6ALDA 1Q6RA 3P8IA 4O19A 1XBYA 3S8HA 1TV8A 3O15A 5H2ZA 4O50A 1LBFA 4M5PA 3EXTA 1QWGA 4LRSA 3PY2A 4HIBA 1DJNA 2QUUA 3S6DA 4DO6A 3QZEA 3W7PA 4FO4A 2PCQA 3NQGA 4HHPA 4Z1BA 1DKWA 1RV8A 2P10A 4NU7A 4WOQA 5C5YA 5FEXA 2WQPA 3TXZA 5H91A 3HF3A 2XN1A 3V75A 1YDOA 2JGQA 3VCRA 3CB8A 3OEXA 4H3DA 3BLEA 3IVUA 3W70A 1DOSA 1FWRA 1H7PA 2QAFA 2F7FA 3W7EA 5HWJA 3VNDA 3MHFA 2QCDB 3G1SA 4BI6A 3RNDA 4LNYA 3OA3A 3NPUA 1O5XA 4MJMA 5I3IA 2HSAA 5CPOA 4QNEA 4I7UA 4C1LA 5AHNA 1XUZA 4K7YA 2Y88A 3P7YA 3DHDA 4AWUA 1KA9F 1QO5A 3LDVA 3WK2A 4HNVA 3C2RA 3A5FA 1H63A 4JS3A 5HINA 3FS2A 3BPWA 3CU2A 1VJIA 3LCWA 3MHGA 5D02A 1BTMA 3LV6A 1EX5A 4H6KA 1KFKA 1A5AA 1ZENA 4GUFA 2QKFA 3UWYA 4TU1A 2V9DA 1KFBA 2QAPA 1UBSA 2GQAA 2EAWA 1W3TA 3HPXA 3QW3A 5EBUA 2E68A 3TQKA 2CZDA 1P1XA 4YL2A 2A21A 2WSQA 3LV5A 3O8AA 4X9SA 1EA0A 2ZDRA 2C15A 3W7RA 1K8YA 3NPVA 1KM1A 3ZR4A 4ZQOA 1MEHA 1EUNA 1QPNA 3PC0A 1MZHA 1FY6A 3SZ8A 2BZNA 5HULA 3LOTA 3UNDA 2Y62A 5D33A 1O95A 1S5TA 4NXKA 3M0ZA 3ZFHA 3WK3A 3PVFA 3RFAA 1A5SA 3QSTA 1WDWA 2H8XA 3F4WA 4FX7A 3WJWA 2H6RA 3GDKA 2A6NA 1BWKA 2ZRXA 1H1YA 2VFDA 3IEBA 2A2IA 4GJ1A 3L21A 3UPBA 2B7NA 4OV9A 4ZQNA 3NNTA 5AC6A 3TROA 1AW1A 1QCWA 2QCFA 2NLIA 4UTTC 4PA8A 1FWWA 1YXCA 1F76A 2WJZA 5FF3A 2WPBA 3KVMA 2JKAA 5DELA 4DF2A 2WSYA 3CIWA 1NFBA 5K9XA 1X1ZA 3MMTA 3TAOA 4EIVA 4ZVJA 2H3BA 3CC1A 3STEA 1LOSA 3G8RA 3I7RA 1DVJA 1PHWA 1B57A 1TTIA 2PRHA 4KWWA 4OT7A 1GWJA 3L67A 4UTTA 1CW2A 1CI1A 1GVOA 3M5ZA 1ML1A 1DQWA 3NPXA 1Q6QA 3DBPA 1QPQA 3N19B 4RXFA 3G0UA 4OE7A 4JX5A 3FYPA 4IMGA 1TV5A 1OFAA 3W7MA 4JN6A 4PCFA 1EIXA 1JVNA 2WSRA 1NAL1 5BMWA 3R89A 3W7HA 1X7FA 1DORA 3TFXA 3TKFA 3CIXA 3OVPA 2WV8A 3DFNA 1G4PA 3H55A 5CSSA 3SGUA 2DZPA 2GJNA 3MI3A 1SO4A 3DFOA 2YGYA 4MKNA 4M6QA 4MYAA 5FI8A 1NSJA 3TSMA 3DFPA 1H62A 2YX0A 4X2RA 2X1UA 3MUXA 5HUOA 1ZAHA 1D3HA 3B4UA 3I7QA 4RV8A 2ISVA 4BR1A 4LVBA 1R47A 5K2ZA 4EF9A 4A3UA 1IXPA 3HOJA 5KZEA 1PCWA 5DCBA 3UPWA 1QAPA 2V81A 4UFHA 4UTJA 3GZ3A 1OK4A 2OCZA 3PB0A 1JRCA 2VEKA 1LM1A 2ALDA 3I68A 4YLWA 2OJPA 5LHEA 1H51A 3H53A 2RFGA 1W5PA 3INPA 1OX5A 4XTDA 1YTDA 1QO2A 3BLIA 4N6FA 2Y61A 2C13A 4Y96A 1W0MA 3QMTA 1KM3A 2DZUA 1EP1A 4HNTA 3TU9A 1U5JA 3MP5A 3S1XA 4I7VA 2V5LA 3PG9A 8TIMA 3KRSA 1SW7A 3E12A 3W9ZA 5HR7A 3G1VA 4MLJA 3ABOA 1OX4B 3H54A 2QCGA 4JTTA 1VPXA 3NM1A 1N55A 4JX6A 2QCCA 1SZFA 2D73A 4NZFA 1FCBA 4WOZA 1KFLA 3W86A 4AHQA 5LGXA 4MFEA 1MEIA 3TXVA 3W2JA 3QQ0A 1K02A 1Z41A 4ML9A 3JR2A 1YPFA 1M7OA 2WNNA 3P5ZA 2ZZ6A 1SSDA 3TMQA 1XXXA 2HS8A 2WO5A 1YXYA 2QCMA 2JGYA 5KTLA 4JTKA 4L4MA 1W1ZA 5E93A 2A7PA 1EWDA 1I8JA 3NQ7A 5HWMA 3KRZA 1IXQA 3W88A 3DI1A 1GT8A 2P0OA 2C18A 1LRQA 3TR2A 5D03A 4I7WA 4HSOA 2C1HA 4IQLA 4FF7A 4E2DA 3NA8A 1WOAA 5CGQA 3MO7A 3A21A 4K37A 3VKJA 2WNQA 4AHOA 1N8FA 1K03A 3LCHA 1VGAA 1H7OA 2V2CA 3NG3A 1FCQA 4JYFA 1MSSA 4AF0B 3LRMA 2V2HA 2I9EA 3MYPA 3EX4A 4JIQA 4CCCA 4N9EA 4TIMA 3R8RA 1QPOA 2A85A 3RK8A 4K39A 3O05A 5IBXA 2TPSA 1F7BA 2VOMA 3LTSA 1J2WA 2CLIA 3GVGA 4CLMA 3LB0A 2NUWA 1FDJA 5AYXA 1Z42A 2E6YA 2GVJA 1YXDA 3NQDA 3S1UA 4CNPA 3G1AA 3S5OA 1SZEA 4RZ4A 3SI9A 3LLFA 3IV3A 3ATYA 3NL6A 1KV8A 5K9CA 3W1LA 1DBTA 1EWEA 3W7GA 1P4CA 4GBUA 1LBLA 2B7OA 1H7NA 4UR7A 3STCA 2Q3OA 3G18A 1OFPA 3CPRA 1TJRA 4QISA 3LXCA 3OHIA 3ZS4A 1KTCA 4MPQA 4MIMA 4MOZA 3ANYA 4QM1A 1QPRA 3UZJA 1WXJA 3I7SA 4IX0A 1M7PA 3WK0A 3N9RA 5KZDA 3GR7A 4FX8A 5LGZA 3SFKA 3B8DA 2E6AA 1L2UA 4LVGA 4MVAA 4GUIA 3S5ZA 1FDYA 3GK0A 4EF8A 4ZZ9A 4CCEA 2V8ZA 4OV4A 2JBMA 1OABA 4K7VA 1GG1A 3QMRA 1BWLA 3O06A 4AEOA 3NQVA 1FCUA 5TIMA 2V82A 5D04C 5DBUA 1XKYA 2E5DA 1JULA 3P81A 1RPXA 4FEZA 5E1QA 5LNVA 3BK0A 3PG8A 3O16A 3STFA 4YCOA 3UXDA 2ISWA 4H4IA 4FNTA 3WJSA 3D0CA 1I2OA 2ZTKA 3S1WA 3GKFA 4AXKA 1EB3A 4IMEA 5KZMA 1JUBA 1LOLA 1RQBA 3P61A 1HL2A 2BTMA 5KITA 2QCEA 3P5YA 4PODA 4AVFA 3W1PA 3TJXA 4DF0A 1VS1A 3S0CA 4JYEA 5A8GA 3PBUA 5IM51 1ZALA 2PURA 3NQFA 4UUIA 5I3HA 5BW6A 4L4LA 2YYTA 4R34A 4CQAA 1G7VA 4DO4A 1LDCA 3IIOA 2YXGA 4BWLC 4GUGA 3N73A 1W5NA 5C54A 2JKEA 3N2MA 4DEFA 3LHTA 3UY8A 3IVTA 3MI6A 3USBA 3C2VA 3M44A 2YW3A 4LV9A 2ZTJA 4RJEA 3L5AA 2GUUA 2NUYA 3L0GA 5BMXA 2DZXA 1M6JA 3E02A 1KM2A 3T7VA 1SZGA 2E77A 5F1UA 3HGOA 3PBVA 5EYWA 3L65A 1YDVA 3TW7A 4XKYA 3C2OA 1VRDA 3W1TA 1H7RA 2QDHA 2Y63A 2J27A 2ZQ0A 4LC6A 3DI0A 4OQVA 4JIPA 4IUOA 2DJXA 3AJXA 3ABQA 1W3IA 4XQ6A 2Y85A 5DXXA 4MUZA 4UR8A 1Z48A 3W72A 2TYSA 4IXXA 5DCDA 4JTUA 4UTLA 3HGJA 4UFMA 3NQCA 3WFAA 5CSRA 2B4GA 3GDLA 2FLIA 4I9AA 1VLIA 1XBVA 2YFOA 3EWWA 4ZL1A 4D2JA 5LNWA 3S9YA 1JCXA 1FDZA 2NXGA 4MY1A 1QFEA 5LHFA 3LHUA 3E9AA 2VKZG 2NV2A 3JS3A 4A2SA 4G1KA 3LXAA 5AB3A 2W6RA 3E0IA 3PS7A 3GIYA 4QQ3A 1QDSA 4NJJA 3NQAA 3UZ5A 3HGSA 2G96A 1TYGA 5K4XA 2GVGA 1MEWA 1P0KA 3UWVA 1OF6A 1S3HA 1AL7A 2DP3A 3NPWA 5C2XA 2J88A 3PB2A 3UWZA 1G67A 3NEVA 1SFLA 2QJGA 2W79A 1AL8A 1TPWA 2EPHA 3LTPA 5D2VA 5FEPA 1TRDA 3W1MA 2ZZ2A 4JDYA 1FWNA 3CTLA 4IWWA 3MWAA 1JUEA 3VE9A 1H50A 1OX6A 1W31A 3F03K 3DU0A 2QCHA 4DQWA 2Q8ZA 4UTWA 2OX1A 5CPMA 2IQTA 4JTSA 3HGRA 2E6DA 1WOBA 4A2RA 1J4EA 1KTBA 2FPVA 3NL3A 4WY0B 5D05A 3QEZA 1KM6A 1K8ZA 4FB7A 4JTIA 3GNNA 5FESA 1PV8A 4UFLA 2G95A 3UQNA 2QCDA 3W1XA 4WUIA 3MI2A 1FWSA 4WY0A 2ABAA 4QJ1A 1H1ZA 2EKCA 3BGJA 3DAQA 2V5BA 3MW7A 3CWOX 1DJQA 4JR5A 3KVJA 5DLCA 1K7EA 3TDFA 5CKSA 2A0NA 2Y7DA 3C3NA 2A7NA 3DKLA 3TSDA 1SSGA 3FFSA 2A4AA 2O7QA 5FEWA 3DENA 4ALDA 3SGZA 3G0XA 1VC4A 1FXQA 4JD4A 3NQMA 1ZAIA 4GE8A 3C4UA 5A5WA 4Q4KA 3C2FA 3QRHA 5DBTA 1GTEA 2BX7A 5GVJA 5F4XA 5AC7A 3M47A 3EKZA 2ZYFA 3CWNA 3N2XA 4NJHA 4P61A 3M41A 2ZZ5A 3GB6A 4LY8A 5D37A 1TQJA 3THQA 2Y7GA 3PWAA 2FTPA 3OBKA 5C6MA 3RLVA 1OFDA 3SY5A 1LZOA 3M5XA 3NQ2A 4QAIA 1R46A 3W1UA 2Z6JA 1I2QA 3A5VA 4N6EA 1YADA 4Z1DA 5G1YA 5D32A 3M7WA 2A5HA 3G8EA 1GOXA 1I45A 5I3FA 2NXIA 2E5BA 3QSRA 1OFEA 1VCFA 2CLOA 2EF9A 4K38A 1H7WA 4FIRA 1W3NA 3EEGA 5K4ZA 3CHVA 3L0NA 4FNQA 2X1RA 2NZLA 1JCMP 3HPSA 5L6UA 2RDTA 2YR1A 3CLMA 4DPQA 3QPYA 3C52A 3E96A 2FDSA 1E51A 3UYCA 2FIQA 4TX9A 4O54A 1OFRA 1HTIA 1QR7A 3PSWA 3YPIA 3HO8A 1SO5A 3S5YA 2GVLA 5F2LA 3QMSA 3N14A 3G0SA 5K9DA 1EEPA 1PS9A 5G4WA 4AHPA 1BKSA 3C61A 4UMBA 3LERA 4LWWA 2XN0A 1I2RA 3UXAA 4ADTA 3G22A 5AHIA 2H90A 3B06A 1F05A 4CNNA 3OVQA 2PE4A 1L9WA 1JCNA 1JQVA 2E09A 2QUVA 1F73A 1I2PA 1SUXA 2BWGA 3LLDA 4UFJA 2ZA1A 2YCEA 3EWZA 5CPLA 5EA9A 3M1ZA 1OYCA 3T55A 4HPJA 3EXSA 1SO6A 4C1KA 1GYNA 3C0JA 3W84A 1SW0A 2VXNA 2NX9A 3P67A 4WZHA 1A50A 2BXVA 2EGZA 3FIGA 3HJZA 4GUJA 3V1PA 3LGEA 1ALDA 3BVJA 4O18A 3DKJA 1IF2A 3L66A 4AH7A 3O6CA 3BG9A 2CZFA 4FNRA 5C55A 1AW2A 3W7CA 3EWXA 3U8GA 1ZJIA 4WQ6A 1LYXA 1Y0EA 1K7FA 4ZQRA 3NQ8A 4N9CA 4RR4A 4EWND 3DHFA 3LI1A 3W87A 4O0KA 4LU0A 1IXOA 4M7SA 5EPDA 2DJLA 4TMBA 3Q94A 4N4PA 3DFQA 5EY5A 5HQEA 4HNNA 2VEMA 1WBHA 2YDAA 4KFPA 4X3ZA 2ISSA 2GQ9A 1OVDA 2VC6A 1JUKA 3THAA 2CZEA 2QCNA 4PL1A 3S42A 5G5IA 2TMDA 3KXQA 3TMLA 3P80A 3W1RA 1O94A 4IPIA 5DN1A 1G6CA 3BGGA 1VLWA 3IGSA 4GXMA 5F2MA 5F4WA 4WY0F 4O53A 1GJPA 3TA6A 2CWNA 1VCGA 5CG7A 5EL1A 4JDBA 2E5CA 3PM6A 4NX0A 4LUJA 1UCWA 3TUUA 3SSJA 1LLZA 3W23A 2CLHA 4TO8A 3NL2A 1OX4A 4Y9AA 2XFWA 4DELA 3MJYA 1THFD 3P82A 1KW1A 3L0KA 2VELA 3E49A 4UIOA 1IIHA 5FF7A 3LTYA 3EX2A 4JTJA 1VH7A 4ORIA 4RLIA 3VFLA 2BLEA 2NX3A 1TTQA 3C2EA 4E2BA 4MY9A 3CQ0A 1GQNA 3LI0A 4K8HA 3A9IA 5CZJA 1KM4A 1J5TA 3DZ1A 3QPZA 1VYPX 1TPH1 3GAKA 1SO3A 4CNOA 4WX2A 1T96A 5IBXC 3NO5A 2W0UA 3W2NA 2DZTA 3QW4B 4Z0JA 4O10A 5I3GA 4Q32A 3B04A 2QR6A 3KOFA 1UUMA 3TX9A 2FPTA 2CLEA 1UASA 1RQEA 3UWUA 2JKPA 4IGHA 1RQHA 4UNLA 3PUDA 1ICSA 4AF0A 3O6DA 3W2UA 5E0KA 3MBFA 5AHFA 4Z1CA 4NJKA 3TK7A 2NV1A 5AN7A 3IIZA 1H5YA 3L5LA 4O1CA 5HR6A 3IVSA 1WV2A 4O28A 2B0MA 1O5KA 3PBYA 4Q33A 3PF3A 1C8VA 4FXSA 4CQ8A 4AB4A 3GXNA 1WBJA 3M43A 4O1BA 4RXGA 3TV8A 4LVFA 2CLLA 4A21A 2QCLA 3AO0A 3NDOA 4WD0A 1OFOA 3A22A 3GR8A 1S5WA 3FKRA 3KFTA 3LX9A 4MZ1A 3W75A 4LOCA 2VFHA 3A24A 3K30A 3W73A 3OVRA 4BI7A 1TRIA 3HQ1A 2R94A 4O52A 3ZWSA 1X6UA 4HT3A 3KHJA 5G1TA 3W85A 3W83A 3T40A 2KZHA 5G2WA 4IPJA 4MJZA 1GEQA 4FIQA 1ZNNA 3W3OA 1R2TA 4LRTA 4UTHA 4RK8A 3P74A 1OYAA 1H7XA 1XC4A 2QF7A 1FCVA 3NOEA 4NNAA 4YXGA 3HPZA 3R5EA 5HMSA 1M5WA 1L6WA 3VE7A 2ZZ4A 1F74A 2ZA3A 4IMCA 5EMUA 1TIMA 3GX9A 3G3DA 2FQIA 1SPQA 3W07A 1H61A 3PR2A 5G4EA 4XBKA 3M5VA 1KFCA 3HIJA 4AWSA 3G1YA 4JTHA 3FJ6A 4O0ZA 2FB2A 5AFDA 2FFCA 4O57A 3EKLA 3M6YA 3CM4A 4N2YA 4KWVA 3STGA 3LHWA 5MHBA 1TPUA 2QDGA 1TPFA 5HUPA 4DXVA 1UB3A 3LHYA 4JTGA 4ADUA 4O15A 5KMYA 3NR0A 1GYLA 5BOOA 1JRBA 4UTUA 4XWUA 3UWQA 3PUOA 3EWUA 3GXTA 3TW6A 3R13A 4CQ9A 3SW6A 2C16A 1QOPA 3EWBX 4E38A 2J9XA 4TR9A 4UFKA 5K7JA 3WK1A 4MY8A 4A22A 4FNUA 3G1HA 4UXDA 4JX4A 4LVDA 4A29A 1OFQA 5BRBA 1TSIA 4QIUA 3C56A 1GVSA 2ATMA 4OBTA 5D2YA 1PHQA 1QOQA 2VFGA 4BI5A 1VHNA 2EHHA 3EB2A 1FBAA 2G5WA 1YTEA 2RDWA 2AQWA 1VR6A 5F2GA 4NQ1A 4DO5A 1VYRA 4NX5A 2NXHA 2X2GA 4PTNA 3IRDA 5LSMA 4GFSA 2LLEA 1YDNA 3W74A 3EXRA 3LHZA 5DXYA 4AMAA 4B5NA 3L9CA 4NJGA 3LXBA 4OWGA 3LRKA 2I14A 4JNMA 4Z0SA 4XUGA 3G24A 1O60A 2C19A 3M9YA 2DZWA 3PAJA 2PRLA 4BF9A 3IGUA 2QJHA 4UMAA 4NNBA 5LNUA 5HWNA 5CZ0A 1AW5A 3FYOA 3S5NA 1D3GA 1I2NA 4N9BA 4YCPA 4ORMA 1OG0A 3P84A 4X22A 3RLUA 4O14A 2Y7EA 1HO1A 1ME8A 2Y6ZA 1VZWA 3LM7A 2X1SA 3RU6A 1RZMA 1TTJA 2Y70A 1C9DA 1YPIA 1F2JA 4UTWC 2UV8G 1ZFJA 3LRLA 4KKXA 1O4UA 3W1AA 5J5RA 4ZQPA 1JCJA 2ZZ1A 5AHLA 1DV7A 1ZHAA 2E6FA 1Q6LA 3OG3A 1EUAA 4IMDA 2I1OA 1NF0A 4HNUA 5AOUA 5HNRA 3PSVA 3GDTA 3MHUA 3GLCA 4MZ8A 1ME7A 4RX0A 5DY2A 3KVKA 3TH6A 1TPC1 1QMLA 1SU5A 3NQEA 5FF2A 1XL9A 3W7IA 3ATZA 2JK2A 2G97A 3B03A 4FHAA 4QNWA 1JCYA 3DFSA 3QYQA 4OU1A 2YFNA 3LCXA 2AAMA 1ZAJA 3T78A 3W1NA 4K8EA 1X1OA 3NYZA 3TNOA 5AC8A 1LRTA 3NZ1A 4R53A 3LHVA 2J9YA 4BK9A 4Y6GA 1F6KA 4XZ9A 4LS2A 4N02A 3DGRA 2Q3RA 2J6XA 4ZQMA 4XTIA 4Z08A 3NVTA 3KVLA 1TPB1 3C6CA 4RCXA 2GJLA 5SWUA 4JICA 1TJPA 2ZFAA 4IMFA 2HMCA 2A1YA 3RF9A 4LS0A 4U4MA 1QNVA 4O13A 4Z1AA 3SIZA 1DHPA 1R2RA 4O11A 1OYBA 5F4SA 3P60A 3W7LA 1AMKA 3B05A 1OHLA 3W22A 4UC5A 1W5OA 1PVNA 2GOUA 3SJ3A 1KM5A 2OZ0A 4IOTA 5D2XA 4HSNA 1JJKA 2OT0A 3T4CA 3EX6A 3O07A 1XDLA 3SECA 3KRUA 1K3UA 2DU2A 4PFMA 2DZVA 2ZCGA 2H3DA 2NUXA 3KX6A 3BG3A 4ADSA 4EVZA 2P1FA 1VHCA 2R14A 1LBMA 2R8WA 1XCFA 1XBXA 2ZBTA 3W2LA 3G1XA 1R2SA 3N3MA 2Y7FA 2J24A 3EX3A 1KLZA 4RZ6A 3HG5A 1LROA 4LT9A 3GDRA 4U28A 5AHEA 1IIGA 2C0AA 2VENA 1JCLA 4GRSA 3W2KA 2QUTA 3OIXA 2Z6IA 2ZRWA 3NGJA 1EPXA 3O6YX 1TCDA 1B3OA 1G69A 4GUHA 1LP6A 3UY7A 3W1QA 4PH6A 2X1TA 3ELFA 4NJIA 1OK6A 2OT1A 4TMCA 3W7QA 1MXSA 3O63A 1F5ZA
chains in the Genus database with same CATH superfamily
2A3CA 3BLFA 3EWCA 1ONWA 1QT1A 3WQPA 4WKFA 5ABGA 4JTFA 5E0CA 1TQXA 4J3XA 3WSUA 1C29A 2Y89A 1TB3A 3M0XA 1UJQA 2ONEA 1HXJA 4V27A 3SCVA 5I79A 1G01A 2X42A 4ZMGA 3OW1A 4AWEA 3NM3A 2X41A 5CZSA 2PDIA 3VVGA 1PAMA 2D2GA 3EPOA 3T08A 3QQ1A 5I03A 1GJUA 1PL9A 5G2HA 1XI3A 1UJPA 4G56A 2NQZA 3TN3A 1VFLA 4GYPA 3VUPA 4IXHA 2OX4A 3NFUA 3QC3A 4W8AA 3N3TA 5LZLA 4MAZA 1TREA 2PS2A 5BWAA 3IIPA 2PTDA 4C90A 3QGAC 3QM3A 2DZBA 5C70A 1AJZA 1FWIC 5J8LA 2ZRUA 2VX6A 4DY1A 3LGDA 4GXWA 5U4NA 3N9SA 2VDIA 3SCNA 2XVNA 1W37A 3UWWA 3Q2DA 1X8CA 2GDUA 4PTDA 7REQB 1WNOA 2Z2UA 3ISIX 4UCGA 4UB9A 5D9PA 2QXWA 1RCXB 3TQVA 5G2IA 3SAZA 3EB4A 4LC8A 1NQ6A 4DPPA 2I16A 2F84A 4BCEA 2C7FA 3B0YA 2AGKA 2VYOA 3EA1A 3F4NA 4JY9A 4S3CA 5DEZA 3N04A 4JTRA 1JQXA 2OYKA 4AX6A 3GAYA 1RVGA 3WYZA 5LNRA 4MLRA 4XB3A 1B30A 4REQB 4KGJA 3CQJA 1WAUA 5RUBA 4JTDA 2P0IA 3N2BA 3M5YA 2YB1A 3I6RA 2OGJA 1GKQA 2OO6A 1V3IA 3NAVA 1GGOA 1RK5A 4O1DA 4RZBA 2XUCA 4DBUA 4PEKA 2F38A 2PB1A 3TE9A 5CGTA 2GSEA 1TVLA 1Z6KA 3BV4A 3FK4A 1UH2A 2YXXA 5FEZA 5A8MA 3WQEA 4XAZA 2VR2A 4QLLA 2ATSA 1BGAA 2IW0A 5EMLA 1EP3A 4ASTA 5FF0A 5A6LA 5ABFA 4JQ4A 4GIRA 3FOKA 3WQCA 3WD4A 1AG1O 4C7FA 4V1XA 2E40A 3GNDA 1TV7A 2DGAA 3AYTA 3KBMA 3TJIA 4RKAA 3NZRA 3PNZA 1QPKA 2FGZA 3L68A 3QLLA 3GE7A 3G3MA 4ZGYA 1CZ1A 4MF4A 3WELA 1N82A 3P62A 3LMYA 1ZBVA 1PZ2A 1OC5A 1A47A 1FQ0A 1WQ5A 3REQA 4CQBA 3IANA 1S1RA 4NUWA 1TMHA 2J4GA 3LCGA 3OZMA 4FAMA 4HPXA 3ANUA 4QRNA 4C1NB 4OGZA 1IXNA 3A4JA 3ABRA 3W7DA 1JDEA 3DYOA 1HG3A 3FCPA 1K9TA 2WSPA 2FJKA 5LA2A 1TPVA 3O0FA 5CC3A 2O9PA 1E0VA 3PFMA 1A5BA 4PC8A 3G1RA 4H9VA 4KFNA 3JVAA 3R0KA 1FP8A 1M53A 1ZY9A 3SCRA 2HNEA 4A4AA 1P0DA 5MF5A 4PRRA 3MPGA 2C3ZA 1YLVA 1R8LA 5HBFA 3W6YA 4YTQA 4U5IA 2ZX7A 4NF7A 5I0DA 2XU2A 4E8DA 3H2OA 1XH0A 5HNNA 4AZCA 3RYSA 1W1B1 5HXMA 1RR2A 1X7IA 1EZWA 4MWAB 1KBLA 2YZRA 3W76A 1MFUA 4Z2LA 4QSHA 5DO8A 3CT2A 2PDXA 3W37A 4TVUA 2Z4GA 1R5YA 1CGXA 2XJ7A 4EAYA 1R9XA 1AA1B 1NFGA 2X0HA 3PFRA 1TX0A 4PMZA 1AH0A 4GGHA 3CT7A 4LW7A 5D2TA 4FLRA 3S2MA 3G6MA 4GZ7A 4ES4A 4S2BA 2G37A 2BGNE 3CIVA 1BGGA 4QBXA 2YCIX 4JPGA 1V02A 4F66A 2ANUA 2J7CA 3V0UA 1A53A 3OIHA 3S1VA 1ITUA 3TCEA 2A7RA 2VZSA 3HG3A 3ABSA 3IS4A 4IM4A 5I3KA 2R1LA 1G4EA 4JNYA 4LUIA 4BS0A 1LLWA 5H1WA 1XYLA 2H8ZA 3K1GA 1PX4A 1FHDA 5D09A 4B2DA 1BXNA 1UUOA 5D9OA 3O7UA 4GY1A 1KFEA 3ZLHA 1YYAA 5DCEA 5JH2A 4A6GA 3E2RA 4N9DA 2ZUTA 3R6IA 4LAMA 1P48A 2Q8LA 1L2QA 1I1XA 3CL6A 3B0UX 1GTHA 3KS5A 3UD6A 4X0VA 1A5KC 2F2HA 4KW2A 5CPQA 3BMWA 1XX1A 4JY8A 4GC4A 4PMQA 2CBIA 5CG0A 4YVXA 1L6SA 2ZRZA 4MFDA 4P2VA 3W7NA 1FXPA 1XRFA 1CIUA 3HURA 2XGIA 1KR0A 4E4PA 3ZT6A 1HJQA 3BMVA 4RPPA 2OVLA 5H2ZA 4PTMA 4M5PA 1FFRA 1W1A1 1XYMA 4YN5A 4HIBA 3W81A 4DO6A 3S6DA 1VD6A 3QZEA 3W7PA 3L4WA 4HHPA 4A8LA 5JH1A 3UGRA 4ENLA 2WCGA 3VTRA 3TXZA 2OQLA 5H91A 4HJWA 2XN1A 3SN4A 3CB8A 1IZJA 1UKTA 3IVUA 4HA3A 3ARTA 3AYVA 2F7FA 3W7EA 3RR1A 1HJXA 1E70M 3D46A 5C9RA 1S39A 3BLOA 4MJMA 1TWWA 1LF1A 1BVWA 4Q8VA 4C1LA 4F0KA 3RILA 4C6JA 2Y88A 3P7YA 3GZAA 1VF8A 3DHDA 3M0YA 4AWUA 2GUYA 5HINA 2HV5A 1UR4A 1R3SA 4YYCA 3BQ5A 4ROPA 1KB3A 5D02A 1P7TB 1FA2A 3HV9A 4ECLA 1M03A 4CUCA 3IJ9A 4DUVA 1ZENA 2QKFA 3UWYA 1J11A 1UBSA 3CHCA 2GQAA 1ONXA 3VNKA 1W3TA 1X98A 3G77A 4LUSB 3S2CA 1P1XA 4GX8A 4YL2A 2WSQA 1KKRA 3IJ6A 1UD8A 3LV5A 1XIJA 1KGWA 3W7RA 3QY6A 1HJUA 3H12A 1ADSA 3T81A 5AC5A 5HULA 3E0VA 4M81A 2Y62A 4WDTA 5D33A 1O95A 3PK7A 1IQ8A 2EJAA 1TJ2A 3DCPA 4QAWA 3AS0A 4FX7A 2P3ZA 2VFDA 2EEXA 4OV9A 1E55A 2YZ5A 4HK5A 4HNLA 3SADA 2QCFA 4PA8A 1FWWA 8XIAA 2WJZA 2WPBA 2Y5EA 3KVMA 1E4LA 1V0MA 2JKAA 5DELA 2DVUA 1A0DA 4AD1A 1IEIA 1PXGA 4S23A 1XLLA 1X1ZA 1U5HA 3SCPA 1XIDA 3G8RA 3GTXA 2PRHA 3DOPA 1ML1A 1F61A 2TAAA 1GOIA 1QPQA 1XDJA 1TWSA 2DFAA 4XK2A 3WH5A 1PIGA 4JX5A 2HK1A 3N29A 3RN6A 1EXPA 1ZPTA 1Q85A 4C5YA 3UCDA 1JVNA 2WSRA 2XFFA 1T6MA 4Y9MA 1XH2A 1UWAA 3TWAA 4LBRA 3SGUA 3MI3A 4MYAA 1NSJA 3MUIA 1H62A 1ISWA 4X2RA 1J01A 2X1UA 4A8RA 1ZAHA 4DZIA 1D3HA 3B4UA 4P8XA 2ISVA 4MHBA 2CLPA 4HTYA 1PCWA 3KL5A 5H6HA 4UTJA 4FR6A 4QE1A 3GZ3A 5CEWA 1VJZA 4NIRA 2OCZA 3PB0A 2XVGA 3FJNA 3CZKA 2BY2A 3I68A 3KLKA 5LHEA 3H53A 3V5CA 1BXBA 1RCQA 4RDWA 3WLTA 2HXUA 4C6MA 4TV5A 2YL9A 3H2EA 4DM1A 5EBAA 1YW1A 3GC2A 1K8CA 1KM3A 3CV2A 4HNTA 3TU9A 1MUMA 1LG2A 3L4ZA 2DT3A 3EDFA 1SW7A 1E1CA 4MLJA 3UVIA 5I3DA 2QCGA 4JTTA 1VPXA 3VKDA 1N55A 1RBOB 2J66A 1H5VA 3POHA 1KFLA 1NDYA 3NSNA 4QROA 1V77A 1DTNA 2CWXA 3W2JA 4L1XA 4REQA 4ZXLA 1W9VA 3P5ZA 1SSDA 3IWPA 1LWJA 4NYUA 3TMQA 1XXXA 2HS8A 2DV0A 3UG8A 2QCMA 3URQA 4HA1A 4NAFB 5KTLA 5E93A 1EWDA 1BAGA 1I8JA 1F3EA 3FYYA 4CD6A 5D03A 4I7WA 4B9YA 2C1HA 2C0HA 1VRXA 3NO1A 3EOUA 4AIEA 1K03A 1VGAA 5A6TC 1H7OA 3IK2A 1E0XA 1MSSA 2WYSA 2V2HA 1W2VA 4PUUA 3RLHA 3R8RA 3GXMA 4ERIA 3APTA 4Z2HA 1ZP4A 4MB5A 4B9ZA 5IBXA 2TPSA 1OGGA 2VOMA 4Q7BA 1J2WA 3SUWA 1G9HA 2J7GA 3OVGA 1FDJA 4HYWA 5AYXA 4CNTA 1Z42A 1CGTA 3OJGA 3G1AA 3GNRA 3ZVHA 3C5QA 3TA9A 2GK1B 4H2HA 3LSBA 3SI9A 4RNFA 3IV3A 4NZ5A 3ANVA 3ATYA 1ITCA 1NWUA 3ZO9A 4WCJA 3TWBA 3W7GA 2EPLX 4PBFA 2B7OA 2DY3A 4GKTA 3CH9A 1TJRA 4C6EA 1KTCA 4MIMA 1B31A 5GJNA 4C1NA 2AGTA 2QGHA 3ANYA 3AS3A 1XGZA 4LB4A 2E0PA 4KT2A 4KEMA 3WKZA 3N9RA 1HJVA 1U22A 1V0LA 5KZDA 4FK9A 5LGZA 1CB2A 3ECQA 1LUCA 4MVAA 3THCA 4GYFA 1JF5A 3NZQA 3CO8A 2E8ZA 1F4HA 4ZZ9A 1BLIA 2V8ZA 1L8PA 1XLEA 5JBDA 1QNPA 1D7KA 4B15A 3L12A 2QPUA 4K7VA 4Q7IA 5CPTA 3T2QA 4AEOA 1FCUA 3QKZA 3P81A 1RPXA 1AODA 5E1QA 2R1KA 4LSBA 4Y9PA 3UXDA 2XGZA 1OIFA 4FNTA 3WIJA 4PYSA 3OZYA 2GSJA 1RQBA 3AYRA 2BTMA 2DIKA 2QCEA 3L4UA 1ELSA 3S0CA 1VS1A 4DRSA 4O1FA 1R0MA 3F5JA 3I4EA 4UUIA 5E0FA 3UBPC 1VPYA 3IPWA 4R34A 2R1NA 3H2AA 4DO4A 1VIZA 2YXGA 2VWTA 5E9AA 3A3WA 4GO9A 4ZOEA 3K5XA 3VCNA 2CBUA 2W66A 5BU9A 2PEVA 3C86A 3IVTA 3MI6A 3M44A 3GFZA 2YW3A 3VMNA 1US3A 2XVKA 2QNEA 2P3EA 1M6JA 2XIOA 1JGIA 1K70A 1KQYA 1JPIA 2AKZA 3M0LA 2YBVA 4LXFA 1VRDA 1REQB 2Y63A 1RCOB 2ZQ0A 2QVHA 4OQVA 4JIPA 4ZA0A 4RE4A 3O0KA 2FMOA 3BAYA 1W3IA 2W9MA 1JD9A 5CJ5A 2TYSA 2QIIA 1RP8A 3E3HA 3LG3A 3WLSA 3WFAA 3TNBA 5CSRA 2YJQA 2B4GA 4I9AA 3P0XA 3D47A 4GC3A 3T8LA 4D2JA 1B3VA 1JCXA 2NXGA 4DLFA 2OGYA 3LHUA 1OG6A 3E9AA 1H1NA 1J8VA 5BXRA 4A2SA 4HJFA 3E0IA 1B3YA 3GIYA 4NJJA 3NQAA 5GNYA 4UOQA 3T0AA 2GVGA 1CXKA 3SCSA 4V33A 1R6WA 4ZENA 1OF6A 3MS8A 4IGMA 1J5SA 1JZ2A 3PB2A 2D20A 1FVPA 1G67A 1SFLA 4MKSA 1QBBA 4YS1A 1TPWA 3QTPA 2EPHA 2PDUA 3UT0A 2WWCA 1MDLA 4GIAA 3W1MA 4YTUA 4FZIA 4BEUA 1NIUA 4H9XA 5A6AA 5FL1A 1RVKA 1GQKA 2L5HA 2WZMA 2GJRA 3IJ7A 1AMYA 1OX6A 2CBVA 3WF1A 4Q8PA 2ACQA 3KBNA 2QCHA 2Q8ZA 4UTWA 1DJIA 3KTXA 4UQ9A 1J4EA 2WZEA 3DC0A 1XCXA 4L80A 1KM6A 1WP6A 4J4KA 4QE4A 5FESA 2DVXA 2YB4A 2PDLA 4GVIA 5HJYA 4AD5A 4WY0A 2ABAA 4HYVA 4QJ1A 3UU0A 1MW0A 2POTA 1FHVA 3BGJA 3DAQA 4GI8A 1XSJA 1E9IA 2OQYA 2AQVA 3B9OA 4L5ZA 2A7NA 3DKLA 3FFSA 2A4AA 1JIBA 1K4HA 1QI4A 3N17A 1M7XA 3GH4A 1FXQA 4JD4A 3NQMA 5KZ6A 1C7SA 1TWZA 1P7TA 3QRHA 2JEPA 5DBTA 2OTDA 3ZSSA 2BX7A 4AVOA 1G0CA 5GVJA 5CBJA 1MW3A 3CWNA 2Z2AA 3N11A 4C6PA 3BURA 3N2XA 1W1YA 4LY8A 3THQA 3FDGA 1DWAM 2FTPA 3DHPA 1UQZA 1UH3A 3RLVA 4LUSA 1LZOA 3M5XA 1R46A 3E38A 4MKVA 3W1UA 1I2QA 2AL1A 1YADA 4Z1DA 5G1YA 1WKYA 2A5HA 1GOXA 3QQWA 3P2VA 2NXIA 2VQTA 3KP1A 3R43A 3RDKA 2CLOA 2QZRA 3EEZA 3K4DA 4K38A 1H7WA 4L4OA 4FIRA 3GU1A 6REQA 2WB5A 3M46A 1OCNA 1JPHA 2XIJA 1XLHA 4FNQA 4ILSA 4PRWA 4DPQA 1FWEC 3QPYA 4PUWA 5BXTA 1OFRA 1HTIA 5FJIA 1QR7A 5IDZA 3TN5A 4EP8C 3S5YA 4NASA 1E3ZA 3QMSA 3WBAA 1PS9A 1QK0A 5FJRA 1BYAA 3C61A 3T09A 5E9XA 2XN0A 4ADTA 3G22A 1X39A 4H00A 2PE4A 4GI9A 2WZTA 4LY4A 5EMYA 5B7ZA 1XRVA 1SUXA 4FA3A 2E25A 2UY3A 3LLDA 2C91A 4H83A 5CPLA 1JFHA 3M1ZA 1UOZA 5T8GA 3C0JA 1R3YA 3VNIA 3W84A 2QJNA 1SW0A 1FWHC 1HJSA 2ZADA 3MWCA 1ISYA 3EBVA 3ZJ8A 1XIMA 1O1ZA 3QV7A 4DJDC 3BVJA 3S2LA 3WH9A 4JTQA 3GU2A 4AH7A 4H6QA 2BHUA 2CZFA 2VRQA 1EC8A 4FNRA 2PDFA 2JIEA 4JHOA 3OOQA 1UH4A 5DMMA 1LYXA 1VFMA 1K7FA 2PBOA 4RR4A 4N9CA 4EWND 3LI1A 4Q6JA 3CMJA 2EJ1A 3RGTA 2QLYA 2ISSA 5I5RA 2VC6A 3THAA 3PJTA 2TMDA 1RH9A 4DJDD 3P80A 3W1RA 4NZCA 4MG4A 1O94A 2VZVA 1GNXA 3EDEA 3AMDA 5F4WA 1GJPA 2CWNA 5D9MA 3EOSA 3SSZA 2Y5JA 1UCWA 5FL0A 3TUUA 1LLZA 2CLHA 1MZRA 1TZZA 3CQIA 3PZGA 5JBEA 4G7FA 3MJYA 1XLJA 2VELA 4S3DA 1DXFA 5CCZA 4R85A 2VWSA 3LTYA 1WDRA 3EX2A 5C2GA 4JTJA 1W1PA 5IHRA 1HP4A 3AXXA 4RNIA 2HVOA 4E2BA 2PDQA 4LAUA 1I0DA 1UIOA 3UZZA 3WQOA 1J5TA 1H09A 3WQ5A 1PWLA 1XIFA 1VYPX 4NAFA 3VIMA 4WX2A 2AQOA 3W2NA 1OY0A 1A4LA 3POCA 5GNZA 2VI0A 4Z0JA 4O10A 2YKKA 2PWHA 4Q32A 3W4RA 1Y5VA 3KOFA 3TP4A 3HV8A 2FPTA 4E8CA 2REQB 5FSDC 2JKPA 5EFFA 2QGYA 1R3RA 3PWIA 3O6DA 3W2UA 4WRHA 3ITXA 3TK7A 3IIZA 4ZBCA 3CB3A 1WV2A 3FAWA 2B0MA 1M1BA 2GFTA 1GUVA 2MANA 3I4KA 3QR0A 4Q33A 4OBSA 3PF3A 2GVYA 3OLIA 4AB4A 3GXNA 3TC3A 3M0HA 3VXGA 3TV8A 3KOYA 1E3XA 4PMNA 2PC8A 2PTXA 2NW0A 4RW5A 3AO0A 3NDOA 4D6IA 1HKIA 2GK1A 1HGYA 1UHVA 4IIHA 2PDYA 3FKRA 4HPHA 4LOCA 3K30A 1CWYA 2EPOA 3OVRA 2PZNA 1QI2A 1M7JA 1X6UA 1EOMA 3KHJA 4R7OA 3H2CA 1UYQA 4GOAA 2KZHA 1KWKA 2PU0A 1IEQA 2IQDA 1A5OC 4HU3A 4AISA 2FGBA 4NZ4A 4RK8A 1MQRA 4IQEA 1H7XA 4IICA 1XC4A 3NOEA 4NI8A 1W9BM 3GXIA 1L6WA 1MQQA 3Q45A 1EGZA 1EJUC 1IR1A 1F74A 3ZQ9A 4GX9A 1WXZA 3ZR5A 3ME3A 5EMUA 2FQIA 4PMXA 1UBPC 2GGEA 3PR2A 3WLLA 5G4EA 4HPNA 5CGMA 2FFCA 3M6YA 4M0XA 4KWVA 1A80A 4ZSTA 3B8SA 2QDGA 3ZOAA 1TPFA 3M07A 5HUPA 4DXVA 3IV8A 3MY9A 3N2OA 3LQLA 5I7GA 4JTGA 4ADUA 3GU9A 3B8IA 5KMYA 2ZICA 4Q8NA 3GDBA 5DF0A 3KTSA 1TZ9A 3W00A 4MNJA 2A3BA 3PUOA 1BSLA 3EWUA 3V3WA 3TW6A 5C9XA 2C16A 1QOPA 1XGEA 4UFKA 3WK1A 4Q7NA 4A22A 3G1HA 4UXDA 2GDVA 1OFQA 2CXEA 1EHNA 1QNOA 3RCMA 1DJZA 3XINA 1VHNA 2EHHA 2G4JA 3CZJA 1SGJA 1YTEA 4C60A 5AVHA 2CHOA 1NWRA 3N13A 1B3XA 1UP0A 4PTNA 4C6BA 4OUEA 4GFSA 3BJSA 2VGIA 3LHZA 1REQA 3AMKA 3VPLA 3VD5A 2I14A 4JNMA 3BOFA 4PTXA 4XUGA 4XAGA 2Z27A 3SRKA 3BCDA 2FVMA 5M2FX 3VNMA 4JIRA 4LEFA 5HWNA 5BYWA 3PANA 2CNCA 3AROA 1D3GA 3QY7A 1XPYA 4WR3A 4ROQA 3OQEA 3MSRA 4ICMA 3UERA 2Y6ZA 3LNPA 5C2CA 3LM7A 4AQLA 4IFKA 1CGVA 1TTJA 3BJTA 3LS9A 3WL0A 4Q8QA 4ZE4A 3VO0A 4KKXA 3W1AA 2BG5A 3MC5A 4ZQPA 4Q8MA 4CGTA 3FHQA 3UESA 3SUUA 2I1OA 2EBNA 1DJYA 2INFA 1EGVA 4OUIA 2Z25A 3PSVA 2DQWA 3MHUA 1ME7A 4RX0A 1QMLA 3HTWA 3W7IA 3B03A 4FHAA 2PP0A 1JCYA 1L0PA 4OU1A 2AAMA 3U4AA 1E71M 2CIPA 4F40A 3TNOA 5AC8A 4X63A 1EKOA 1LRTA 3NZ1A 4GG9A 4OTKA 2YA2A 3LEPA 3LHVA 3NXLA 4PBGA 2J9YA 3TYBA 3WUGA 1E0UA 4X9YA 5XIMA 4LS2A 2WJDA 4N02A 3DGRA 4D8LA 2Y0FA 3UEQA 4OJYA 1K77A 4RE3A 1D2KA 1TPB1 4JQ1A 1J79A 3UYIA 1H2JA 1OD8A 3VGDA 3C6CA 4I90A 4RCXA 1UW9A 2WK2A 3CLWA 4U4MA 4IIFA 4NI3A 4YHGA 1DHPA 4AC7C 4O0QA 3CS2A 3PTMA 3P60A 3B05A 4UC5A 2YA1A 3SJ3A 5D2XA 2OT0A 3UVAA 2J7HA 1US0A 3O07A 4Y8EA 4ATDA 1EF3A 3T0TA 3KRUA 4PE8A 3CUJA 4U2YA 1HVQA 2DZVA 2H3DA 1DIDA 2P1FA 2R14A 2R8WA 1RJRA 5HPOA 1XCFA 2C71A 4WEVX 2YBUA 3C8NA 2J74A 4WHBA 3VUSA 4LAKA 1EA9C 3B8WA 2Y7FA 3N3MA 1MI3A 2J24A 4HCDA 3EX3A 4RZ6A 1LROA 1EDTA 1CT5A 2BVDA 3R11A 1OCQA 1AH4A 3IJ8A 1W3LA 1R86A 3E5PA 2G3FA 2OYLA 1E6NA 2QUTA 2Z6IA 3O9NA 1I9CB 1TCDA 3ARXA 1G69A 3N25A 4PUJA 1XD1A 3SRFA 2FJUB 4F48A 4L6OA 3QGKC 2C1IA 3XISA 3CPGA 1OC7A 1CLXA 3KDOA 5EMJA 4AD2A 1NJJA 1MDRA 1SFSA 1Z44A 4S3BA 1ZBCA 3SGGA 5A8NA 4FX6M 3JUGA 2WNZA 1IWPA 3R2GA 4MAVA 1XLCA 3UG4A 4RPQA 4KWOA 1NELA 4JBRA 3TC7A 3Q58A 4Q8WA 1XFBA 2PLJA 5LIXX 1FWGC 4ONVA 1KWGA 3H7VA 4HKPA 3RX3A 2Z1BA 3SM0A 3R12A 3B0VC 4HMCA 3CEUA 4K36A 2RKXA 5EKYA 1X6NA 1X96A 4MNKA 4DIAA 3AC0A 3VGBA 3W2MA 3CYJA 2WVUA 3J7HA 3FEMA 1UD6A 1KV5A 1PKLA 3RMJA 4NSBA 1YDYA 4CN6A 1NVMA 4JFUA 3CZLA 4GO8A 1LOQA 1XYZA 1OSEA 4LCQA 5FACA 1V5XA 4LV4A 2J9ZA 2B7QA 4KIEA 1Q7MA 5LNSA 1B4EA 1XLIA 4U3AA 1J96A 3R8GA 4KERA 1E4MM 1S2TA 2Z0IA 7CGTA 4M7TA 2GQ8A 2X0SA 1UUQA 2C6QA 3TYCA 2NWRA 2VCBA 2CLFA 1XUUA 1B9BA 4YVPA 3W7JA 2XWEA 5LKYA 8XIMA 3B9AA 5AYYA 1JZ4A 2SFPA 1EP2A 1KCZA 4DBSA 2ZE0A 3RO8A 3AFBA 3WDPP 2V3EA 1A0CA 1PTGA 1XG3A 4OFCA 3VM5A 1U2YA 1WDSA 3BCJA 1S5VA 4U5KA 1EJSC 3GXPA 4P7QA 3EB3A 5EMMA 4MDOA 2YPIA 4TXEA 1Q45A 3S5SA 3WF3A 4JTLA 3OZPA 1DJWA 2VC5A 4FXRA 4W8LA 1W9PA 1EQPA 3LCLA 2XN2A 4B92A 5JIWA 1NP0A 2NX1A 5I3JA 2D3LA 2REQA 1I4NA 3TQ0A 3KOZA 3RO6A 1LTDA 1NEYA 4F2UA 3BW2A 3DX5A 1DJGA 2DSZA 4E2VA 4KS0A 5TBOA 3VFCA 1ICPA 1QNQA 1A3XA 1L6YA 3CHEA 4J35A 2POZA 1PYMA 3SN1A 1Z7AA 1ISVA 1KFJA 1A3HA 1GOMA 3KBSA 3MP3A 4EE9A 2PTZA 4YMZA 1P5BA 1JDAA 3KBWA 1BRLA 2PWFA 4JTEA 5D8ZA 1NOFA 4MJ2A 4O17A 5I6SA 1KM0A 4O1AA 1ZZMA 3K1DA 1CNVA 2NVAA 3IJIA 1JPDX 2ZUWA 3NOYA 1MO0A 4DHGA 1BEUA 5A6KA 5LXXA 3BOXA 2GYIA 2V63A 5BOEA 2QDDA 1Z89A 4MB3A 2HCVA 2TODA 3AXMA 2CW6A 1X38A 4F0HA 1Y5XA 1GG0A 1KBJA 3QF0A 3RJXA 2UY5A 3GXDA 4IH3A 3OBAA 1XPGA 2P76A 5T26A 1ZL1A 3FEQA 2XG9A 1UOKA 2VJXA 1CB7B 3RUBL 2WC7A 4B4HA 4H6RA 3FLUA 3HPFA 3IJDA 3N6JA 4OZOA 1U1JA 3R25A 2WMGA 4WKHA 2PP3A 2GPTA 4DI8A 4J40A 1JAKA 1XM3A 4BFAA 1X8FA 2PC4A 1KXHA 3DESA 3GYEA 3B9DA 1UKQA 1HO4A 3GM8A 2CU0A 3AMCA 4GY7A 4RNJA 5J5DA 3VK5A 1IGSA 2PODA 2X09A 2QF8A 3CBWA 3WLKX 1BXCA 3UZWA 3GS6A 2GGHA 4N7QA 2VFEA 4XKYB 1R30A 3OTRA 3BO9A 1KC7A 3URNA 3BG5A 1TO3A 1KCLA 2PRMA 3HG2A 2C14A 1JGMA 3TTQA 1K9DA 4JEQA 2CFFA 4D6FA 4CVWA 2ZXBA 1V02E 3U5YA 3K46A 2RH9A 1K6WA 1P0NA 3P8JA 1KR1A 3SR7A 4ZFCA 3T44A 1GOWA 3TYAA 2UY4A 4L1WA 4NAEB 5IXEA 8RUCA 1F4AA 3KBVA 5IFPA 3F4VA 1JZ8A 4XD6A 4DYEA 3WJZA 1J93A 3QV8A 1JDCA 1M3UA 3KAOA 3H2FA 3HMJG 4W9TA 5EMKA 2OO0A 2FB3A 3R7MA 3WUBA 4DUXA 1UWIA 1O68A 3PBWA 3N4EA 2OEKA 3CHDA 4GIYA 5EB8A 4ZQCA 3APGA 1TTPA 4M3PA 4UQCA 1Q6GA 4QITA 2GZXA 3GFYA 4DUOA 2WLYA 4R3UA 4E0CA 4L7ZA 2B7PA 3HBLA 4IJBA 3B0XA 3FA5A 2PFHA 2G3JA 4CD4A 3O15A 2WC4A 1AQ0A 4S3EA 1LBFA 3DFYA 3LPFA 3ZT5A 4QHRA 4FO4A 1AFSA 1V3MA 2PCQA 4H8UA 4Z1BA 3DHUA 1LL7A 2P10A 1YNQA 4WOQA 3AAMA 5FEXA 1YDOA 2JGQA 1PWMA 2XIQA 1DOSA 1H7PA 2F2KA 1KGXA 1J12A 1UR1A 2YDQA 3NPUA 5T9BG 1OM0A 4GNKB 1Q66A 1WDQA 2YCLB 4CQDA 1R7AA 1UZDA 3SQSA 4HNVA 1FFQA 2PA6A 3A5FA 5XIAA 1S2VA 3CU2A 5CH9A 4JNZA 1SMAA 3MHGA 3WMCA 1EX5A 1KFKA 3H6OA 4HHLA 4J3SA 1KRCC 4PUKA 1KFBA 2OG9A 2QAPA 1T7LA 3LMZA 3E74A 3L23A 2CZDA 2BV9A 4X9SA 3PZTA 4GD0A 5FJOA 1K8YA 1KM1A 4P8WA 3ZR4A 5CXPA 3MSGA 4PSRA 1MEHA 3PC0A 1QPNA 4AD0A 1MZHA 3IAQA 1FY6A 3OBEA 9CGTA 2X40A 3LOTA 3UNDA 1NQKA 3VGFA 2ZX8A 2Z1XA 1DTUA 4OOUA 3ZFHA 2ZVIA 1PUDA 5ECUA 1A5SA 4UZUA 2H8XA 2OXNA 4ZODA 1GKRA 5I06A 3UG5A 4KCTA 2A2IA 3TN6A 1HIZA 3BC9A 2B7NA 3UPBA 4H9UA 3AIBA 1TV2A 1AW1A 2DH3A 1Q4WA 2MUCA 5FF3A 5HK4A 3H8AA 3WD1A 5K9XA 4K1WA 5LYRA 3MMTA 4DJED 4HCLA 3WQFA 2H3BA 5E5CA 3BAKA 3STEA 4AX7A 4DXKA 1OIMA 2BDQA 3M5ZA 3CTTA 5LA0A 1DQWA 1K1DA 3NPXA 3F7JA 3N19B 4RXFA 1XLKA 2OU4A 1HT6A 4A35A 2ALRA 2J7FA 1TV5A 3ONCA 3HN3A 5T91A 4NY2A 5C8BB 4PCFA 4W5ZA 1NAL1 3R89A 3W7HA 3RMEA 1EJWC 1FWCC 3TKFA 3WF2A 1DWHM 2WV8A 1G4PA 4V15A 2DZPA 1UWQA 2WZIA 3UJSA 3MJMA 1FKXA 2HPIA 4QE5A 3R4IA 8A3HA 1V3JA 3DFPA 4LBSA 2IKGA 1C3FA 3I7QA 3K8MA 4RV8A 4BR1A 4LVBA 5K2ZA 3CK5A 5KZEA 5DCBA 1US2A 3BL3A 4XAPA 3BAJA 4L6HA 3ZJKA 3ARQA 1H51A 1EQCA 1ONEA 2O92A 2VC9A 2YA0A 4XTDA 1UPPA 4NL1A 3C2YA 4DJDA 2Y61A 1W0MA 2ZOXA 1EP1A 4L4PA 3F4DA 2JF7A 1ENUA 3SRDA 4P7OA 4DWSC 2F9RA 3W9ZA 1AVAA 2O9RA 2VR5A 3CUHA 4WJ8A 3H54A 3NM1A 4JX6A 2QCCA 2NLYA 2WCAA 4NZFA 4WKAA 4RDVA 1FCBA 3LY0A 5LGXA 3OLGA 3AIWA 4CD8A 1HVXA 4JIHA 3CAQA 4Q8TA 1K02A 1Z41A 2WNNA 3QKEA 2ZZ6A 4H19A 4PMVA 3DC8A 4IG2B 2JGYA 2JIWA 3NQ7A 3W88A 3DI1A 2C18A 4AEEA 1LRQA 4HSOA 4FF7A 2XH7A 2PGWA 1UWUA 3MO7A 1A5MC 1F9CA 1CXHA 3LCHA 1RJQA 1RLCL 1U5VA 2DSUA 2WBGA 3L4YA 2E1WA 3IRSA 3K13A 1FCQA 1GHRA 5FJTA 4C91A 3U57A 4Q4QA 4B5UA 4JIQA 2OWCA 4N9EA 4OBRA 4TIMA 3EDDA 1Y65A 4K1GA 1CCWB 1F7BA 1TUFA 3BSHA 5CC7A 3DEQA 3NO3A 2NUWA 2E6YA 4P8UA 3PZQA 3S1UA 4H1ZA 4B5XA 2F6XA 3AS1A 1VEOA 1HF6A 1SZEA 1KRMA 2PWGA 3BWWA 3GY1A 2VQUA 1KV8A 3EA3A 3LU2A 5K9CA 1GJWA 1BD0A 4FOKA 3TYZA 3F2CA 3LUTA 5A8OA 2QJMA 5TNVA 1LBLA 1GVEA 2Q3OA 3IJLA 3OHIA 4MPQA 4J27A 4BQ4A 3LQGA 1WXJA 1QBAA 1M7PA 3PTKA 4J3WA 3GR7A 4JL1A 3RXZA 4HZ8A 3S5ZA 3UA3A 3QGVA 4EF8A 3NSMA 3VKBA 4C7GA 4CCEA 3WNNA 1BKHA 2Y4SA 1QI5A 4QCFA 5A6MA 3QR1A 2PTWA 2J7BA 1TUXA 3SJNA 1MNZA 1OABA 5BCAA 2FVKA 3FGCB 1I60A 4H01A 2IQ0A 5FJUA 1JULA 4LGXA 3FDKA 4MWAC 4FEZA 4C6KA 1V03A 3O16A 3GSMA 4HMDA 2VEFA 2XH4A 1JFXA 2ISWA 2IS7A 4DZHA 2HZGA 1FTXA 3WJSA 3D0CA 1UZ4A 4D8AA 3WH7A 2HBXA 3GKFA 2CETA 2YL8A 3P5YA 4Q4MA 4EAMA 1AQHA 3TJXA 4DF0A 2Y24A 1S3TC 5BW6A 3AHVA 1NP2A 1KRAC 4M51A 2F61A 5E6ZA 5XINA 3P14A 4CQAA 3V18A 3IIOA 3PUGA 4BWLC 3NIYA 2VGFA 4GUGA 3WF0A 3N73A 5C54A 1HZYA 2JKEA 1HX0A 1JZ7A 3C2VA 1K6AA 3AYSA 2J8FA 4RJEA 3L5AA 2O56A 2IKIA 4ACYA 2NUYA 3GO2A 3ALFA 3VZZA 1KM2A 5EYWA 3L65A 4XKYA 2HK0A 3WMLA 1VBJA 3MTWA 3GUGA 1DJHA 1H7RA 5I00A 2QDHA 2J27A 3V7PA 4LC6A 4H9YA 3MV11 2VZOA 1D8WA 1KXQA 4IUOA 4G5DA 2OQHA 3ABQA 2Y85A 2P8CA 5DXXA 4UR8A 4NAEA 4JTUA 4UTLA 3HGJA 1XLBA 2FH8A 4TTGA 3ITYA 4W88A 1DXIA 3GDLA 4Z1YA 2FLIA 4AVNA 1VLIA 1XBVA 2YFOA 1PDYA 2X05A 4ZL1A 5C9WA 5LNWA 5LIKX 4QP0A 1QFEA 3PJUA 2Q8XA 3ZVIA 1JYVA 2VKZG 4DAFA 3K8LA 1FP9A 5BROA 4G1KA 2NT1A 2VCCA 4J3UA 4U31A 3PS7A 1AQMA 3U3HA 2HPMA 1QDSA 4G7EB 3V0TA 3WNMA 3HGSA 1ADDA 2R9RA 1S3HA 1UWRA 3CASA 4Q8OA 2J88A 2JEQA 3UWZA 3T9PA 4DB7A 2EG8A 1WDDA 2W79A 3KWSA 5D2VA 1WB0A 4GABA 3MSDA 2NQLA 4M8UA 4QJ4B 4P7LA 3VE9A 3T2OA 3QYSA 3GIPA 4DQWA 2OX1A 1E56A 4ZO9A 5CPMA 1E72M 4JTSA 4A2RA 3GIQA 3H22A 3WEOA 3NL3A 3E0FA 2DIJA 5I2UA 3QEZA 4KQNA 1UIPA 1K8ZA 3AU6A 1U33A 3TR9A 4N0RA 3OU8A 3N1AA 4HA0A 4F8XA 3AXHA 3MI2A 3S3GA 4PN2A 1UR9A 6ENLA 4JR5A 2DUXA 2YCLA 1AD1A 1ZJAA 3C3NA 4H04A 2PDMA 3DENA 3SGZA 3E2VA 5CLWA 3MKVA 3W24A 1ZAIA 1TE1A 4Q4KA 3C2FA 1NFPA 1GTEA 4EXAA 3KLLA 5F4XA 3ABZA 1CGUA 3EKZA 5I77A 4QFUA 4P61A 4TV6A 2ZZ5A 3GB6A 1BF6A 1R9YA 5C6MA 1BG4A 4LFYA 4FALA 3VOJA 4QAIA 3UF9A 3RM4A 2Z6JA 2GJXB 3A5VA 3WF4A 5FCZA 3JW7A 2P50A 3M7WA 5A6JA 2OOFA 5A95A 3LA4A 5I3FA 3TLLA 2I5GA 1BFNA 1VCFA 1C93A 3QSRA 3BICA 3VMPA 4CU8A 1JPKA 2Q6ZA 5HMDA 1LL4A 3CHVA 2NV9A 2R1PA 3S9IA 1SM9A 3L0NA 3AQUA 5I24A 3HPSA 5L6UA 2RDTA 2YR1A 3CLMA 4F0RA 3GG8A 5BRPA 2GLKA 5AECA 5C9ZA 2FIQA 4TX9A 1YPXA 1KQZA 3PSWA 1UD2A 3YPIA 1I6NA 3QTGA 1GW1A 3WENA 3N14A 3G0SA 3T0CA 5A6SA 1TR1A 5G4WA 4GMEA 2OFJA 4FP1A 4UMBA 2OZ8A 3WBWA 2X7WA 2QUMA 3AJ7A 4JCLA 1J2BA 3D6NA 3UWEA 2BXYA 3F2DA 4LJ3A 3CZ8A 3OVQA 1EIBA 1L9WA 1JCNA 3CGTA 1R3VA 2E09A 2QUVA 1F73A 3WLHA 5E6YA 3EWZA 1AZ1A 4AW7A 1SO6A 3UJ2A 1GYNA 1LLOA 4GH1A 2VXNA 2NX9A 3P67A 3FV9A 2BXVA 2EGZA 3VC6A 3HJZA 4GZJA 3V1PA 1CYGA 1UWSA 1CECA 2HVMA 1IF2A 3P93A 3MT1A 3CNYA 1JG9A 3H4XA 1NWTA 3FVDA 2BHYA 1ZJIA 2NQ9A 3T4WA 1OC6A 4WQ6A 1W1TA 4BQ3A 4XISA 3I6TA 1GQLA 3EYPA 2DJLA 4TMBA 2OKTA 4N4PA 2WM1A 2VTFA 3DFQA 5ENLA 4ZO6A 4D1JA 4C6FA 2Z2BA 2BY3A 2QPXA 2XHYA 1OVDA 1JF6A 4I5XA 3RX4A 4TX6A 2CZEA 2QCNA 4PL1A 5G5IA 3KXQA 2UWFA 2V5KA 1Q4NX 3VIJA 4IPIA 1G6CA 3BGGA 3TONA 3JZUA 5F2MA 4WY0F 4NP7A 4DM2A 1J0HA 1PDZA 4MGGA 4JDBA 4C6DA 5HNUA 4BKNA 2XZ9A 3SSJA 3VIFA 1VFTA 2XFWA 4Q4SA 4DELA 4QDWA 4HHHA 1THFD 4QDMA 3VIKA 3E49A 1LG1A 2OSYA 1IIHA 4DWSB 1XW8A 4M24A 2XIIA 1VH7A 6XIAA 4RLIA 2BLEA 5HMFA 2NX3A 4GCAA 1HQTA 3C2EA 3OLEA 3UA4A 4ACZB 3CQ0A 1GQNA 4K8HA 3A9IA 1KM4A 3DZ1A 2VOTA 1XFCA 3QN3A 1XD0A 1F07A 1KFWA 2V67A 5FA5A 4CNOA 3FSUA 1V0KA 2J75A 4PBEA 3NO5A 2W27A 2DZTA 5F7UA 4DN1A 4XZIA 3EZ4A 3TX9A 1J0YA 3UWUA 4M1RA 3KM8A 3CO4A 3GWQA 2DH2A 1AQFA 2V68A 5E0KA 1IZCA 1B3WA 5AHFA 1DHKA 1H5YA 5HR6A 3AICA 2I17A 3E0WA 5CZKA 5DRCA 3TYDA 1GW9A 2VDHA 3ENLA 1WBJA 3M43A 4O1BA 2CLLA 2PF0A 4S38A 3WFLA 3SEPA 3A22A 4X61A 3A3HA 3GR8A 1S5WA 2VZUA 1UP3A 1UR0A 2HDJA 3AWNA 3LX9A 3W75A 1Q6CA 2D3NA 3QC0A 1ITXA 3ZWSA 1FWBC 4L56A 3EPNA 1ZUAX 3BAXA 3DECA 4IPJA 2VM8A 3AIUA 3B8UA 3E2SA 4FIQA 4BZYA 2XISA 4UTHA 4FS9A 3P74A 3UCQA 1TG7A 4RL3A 3R5EA 5HMSA 3NZPA 4D71A 2BP1A 3VE7A 1NH6A 1J6OA 4IMCA 1W32A 4GXPA 1TIMA 2HBVA 1JI1A 3OB8A 4LX4A 3GHUA 5ECVA 3SDOA 1E6PA 2J7EA 4XBKA 4LPCA 2VEGA 1KFCA 1O6IA 3HIJA 4AWSA 4JTHA 3BSGA 2PCEA 4QS6A 3CM4A 4GQGA 3A47A 5JVLA 3STGA 5I07A 1TPUA 1EO7A 1CTNA 2BVTA 1WXYA 2C79A 1UB3A 2UBPC 2I9UA 4JZ5A 4MUPA 4AZ6A 3VYLA 3BLKA 5BOOA 3LLXA 1JRBA 4U33A 5G4HC 4XWUA 2JF6A 1GVYA 2E67A 5EGRA 2Z7GA 1KNWA 4MB4A 5CAHA 3SW6A 4V1YA 3PPHA 5K7JA 4HGXA 1EL3A 3DUGA 1GZ1A 2YIHA 4FNUA 4FXFA 2OZTA 4MTVA 4JX4A 4LVDA 4LUTA 3ITOA 1TSIA 3RR4A 3ZIZA 4PR4A 3E1F1 2QMJA 4W86A 3LZ3A 5D2YA 1PHQA 2VFGA 4K2SA 3G5EA 3EB2A 1LJYA 2G5WA 4G1NA 2AQWA 4Z2IA 4HYRA 4QXIA 4GI6A 1VYRA 4NX5A 3V16A 2NXHA 3XIMA 1VEMA 4GGBA 2LLEA 3W74A 3E0LA 1WDPA 3UR2A 4E4UA 1MUWA 4NJGA 4B2DD 3L2LA 4MB1A 5BRQA 4RNHA 3OZOA 3ARYA 3GVVA 4Z0SA 2DZWA 1C8XA 2PRLA 3N9KA 4PCSA 4A8IA 4UMAA 1Z69A 1EOKA 1VFUA 1I2NA 3KRBA 4YCPA 2HROA 4ORMA 1OG0A 1RBLA 3RLUA 3VOFA 1UR2A 4E3TA 7A3HA 4R9XA 4O14A 2D2OA 1NTHA 3VDHA 3TZFA 1ISZA 1QI3A 1IEXA 3WDIA 1TVNA 1T5AA 4G7EA 2Y70A 3A9BA 3B9EA 2DT2A 1GPFA 4J7RA 1C9DA 4LUYA 1YPIA 5A2CA 2UV8G 1ZFJA 3LRLA 1O4UA 1JCJA 2ZZ1A 4AD3A 5AHLA 1DV7A 5HAOA 2PD9A 4XD5A 1EUAA 3F5LA 4Q22A 3NEHA 4Z17A 4IMDA 3WMSA 1NF0A 4HNUA 5HNRA 3GDTA 3GLCA 4MZ8A 1P0EA 3WLQA 2GSHA 3VX0A 1TPC1 3NQEA 3TN4A 2G97A 4QNWA 3QYQA 3LCXA 3OGRA 1XF0A 2V3GA 2ZXAA 1PTDA 3V4BA 3W1NA 3PZOA 5BU6A 1X1OA 3DG3A 3GH7A 3VDBA 4R53A 5M5DA 4W84A 2RJGA 1DE6A 4CD7A 1F6KA 1JPMA 3Q67A 3W27A 2Q3RA 3GBDA 9XIMA 4W7UA 3CWHA 3MUAA 4MSSA 2GJLA 3KCLA 2OLAA 5SWUA 1TJPA 4KBXA 1E4IA 1TX2A 4IMFA 2A1YA 1E1EA 4LS0A 4I9TA 1CXFA 1OYBA 3W7LA 5JXQA 1LL6A 3W22A 3SCUA 2WMIB 2XWDA 1W5OA 2GOUA 1V0NA 1KM5A 3RPMA 4HSNA 3AUOA 4DJFC 1XIGA 3SBFA 3C3UA 3ARUA 1XDLA 4IIGA 4HOZA 1K3UA 1C90A 1BYBA 3UZYA 4PTWA 2VRKA 2ZCGA 1KBBA 2NUXA 2ADAA 2PWUA 3KX6A 4EVZA 1O66A 3SUVA 1V3HA 4GK8A 4F4RA 2V5JA 2DSVA 2GJXA 3GH5A 2Q01A 4IIDA 1Q2SA 1KLZA 2A3AA 2E3ZA 2R82A 3QHMA 9RUBA 3ZT7A 2RDXA 2Z24A 2PZ0A 2G3IA 4LT9A 4PTVA 3GDRA 2QS8A 4XV0A 4DJFD 1IIGA 4PMUA 1HN1A 3H70A 4BQ2A 1JCLA 4GRSA 3W2KA 3RU8X 3I3BA 3A4AA 3VU2A 4DNHA 4XX6A 3ELFA 1PBGA 2OT1A 2YXOA 4TMCA 3W7QA 1MXSA 1E9ZB 4KRUA 1F5ZA 1N8WA 5HPCA 3TIMA 1PE1A 3Q65A 1DJXA 3DG7A 2TSYA 3AISA 1S2WA 2BGSA 1R38A 3MV01 2ACRA 1E0WA 4P7RA 1OFBA 1C9WA 4AYSA 3RPDA 4WXYA 4O8RA 1PKMA 3IUIA 3M0IA 1TR9A 2BMBA 1C8QA 2A3EA 1VCVA 2W61A 2P8BA 3ORWA 4AG0A 2PDHA 1T0OA 6CGTA 4PMOA 2CHRA 3TAKA 3EX1A 1SQ7A 3PPGA 4IQJA 1F6PA 3GNOA 3TQPA 3NTYA 4F2BA 4D6CA 2DSWA 2CZ5A 3H23A 4JEJA 3U6WA 3LBMA 1DQXA 4IIEA 4JIIX 3UJFA 1FWTA 5FOOA 2XIBA 3VABA 3W71A 1B3ZA 1E9YB 3NQ6A 4CN4A 4E5TA 1Q6OA 1ODUA 1SZRA 3VC5A 1RLDA 1W9UA 4NT0A 3CQKA 1Y5WA 2YYUA 2DVTA 1VKFA 1DL3A 3S6OA 7TAAA 3FA4A 1RY0A 1J18A 4XAYA 1GZGA 3EAUA 1R9ZA 1VYSX 1YTKA 2VRJA 2VEIA 3S6TA 1N7KA 1PYFA 3NL5A 5GPRA 7REQA 4POCA 3SB0A 2G0WA 4ZEPA 5F1VA 4JL2A 5ABTA 3HFTA 4LS1A 4OHQA 3E6EA 3LCIA 3UETA 1HUVA 1ODZA 4R33A 1PEZA 3DXIA 1MYRA 1GOOA 1J6PA 3KL3A 4IF2A 4ATLA 1JZ6A 4PMYA 4XBSA 1SW3A 2VFFA 4QLKA 1DXEA 4LYRA 3M6DA 1W17A 2CESA 1LCOA 3GG7A 3MUY1 4H8VA 1M68A 1LORA 2HTMA 4DWSA 1GVIA 4CN1A 3W38A 4A3RA 1G4SA 4AU0A 1NWSA 2WLZA 1QNSA 4PL2A 4WSKA 4ACZA 3MP4A 5CPNA 4AEFA 4UMCA 1AH3A 4L64A 4PCNA 3Q4DA 1UZ1A 4ICNA 4LTSA 3VGEA 3VKAA 1BSIA 3U2OA 1TE6A 3MZNA 3E2QA 3DFTA 1TVPA 1WO2A 1E43A 1RP9A 2FTYA 4O12A 1Q65A 2A3HA 1GVQA 2DZSA 3QZAA 3ARVA 3KCJA 1JI2A 3R0DA 3IIVA 1OINA 4IISA 2QEZA 3FA3A 3N2TA 4O4VA 1XH1A 3CAKA 3TTOA 3WLPA 3REQB 3FKKA 3U2ZA 5JQ9A 4FNPA 2ZA2A 4NNCA 4I6KA 1XRSA 3GKAA 2J47A 4HMEA 1AK5A 4JYDA 4K6AA 1OWQA 3SY1A 4XZNX 2ZZ7A 4RZ5A 2Q09A 1XRTA 3GFXA 6A3HA 3NURA 3TSBA 1UG6A 1B90A 1V6WA 3ZLFA 1GORA 4D9PA 3AHZA 5U7SA 3RITA 1MWOA 2GQ3A 3PBGA 4WSHA 3VI2A 3T05A 5FIPA 5TAOA 1KBIA 4LCSA 4KFOA 4GZEA 3GHRA 4AAJA 4B5TA 1PKNA 2PLCA 1GVFA 3TC6A 3AHYA 3PJXA 4WIWA 4M19A 1GYMA 1BVZA 1E40A 2DPEA 5FAJA 4EOUA 1SZNA 3CUXA 3WJYA 1YIXA 2X7VA 4GLEA 1H0GA 2XFYA 2CXGA 4HNCA 3E5BA 5JUVA 1NOWA 4AXNA 8CGTA 4IFOA 2ZX9A 2BODX 3S47A 4H7VA 3QH2A 3WQVA 2ZXDA 5I09A 1H60A 2O4QA 2ZZ3A 3AWOA 1GPWA 1U1HA 2QIWA 1LT7A 3M16A 4D6GA 2YW4A 3N15A 4L9XA 1DIKA 3BAWA 1S2AA 4QQUA 2R1MA 2X30A 1G7UA 2YSWA 4G8TA 4MWAA 4JGDA 4QEHA 1B4KA 2FPYA 4CVUA 4HP5A 3S46A 1K7XA 4C5ZA 2DSKA 1IGWA 2CLMA 4DLMA 2PDGA 3LZ5A 5REQB 4JOMA 2ZX6A 5K3VA 2TRSA 3AXKA 2Z29A 3MBDA 4IPPA 1NF7A 4HK6A 4KWUA 1SR9A 3ZWTA 3BZGA 3LENA 2ZRVA 3SRHA 3PHAA 3VOIA 4FMVA 1ONRA 1ESWA 3CUGA 1T99A 4BWLA 5B7YA 3IIXA 1U83A 3UXIA 5DX7A 2YDSA 1TA3B 3SIMA 3MU7A 2RHGA 1UC4A 3WLOA 4J5NA 1WYIA 7ODCA 5HQLA 4M80A 1OF8A 4FLSA 4W4QA 4ZOCA 4NG3A 4ZFMA 2XSXA 1T8XA 2VCAA 1E1FA 1UQYA 3IGXA 2V30A 4HN8A 1I1WA 2ZWYA 3L4VA 3V1HA 1YHTA 1KLYA 3PULA 2VDGA 1FUYA 3I3DA 4WF7A 5FF4A 4IX2A 3QFEA 1S5MA 2BVWA 3GDMA 1TV4A 1JD7A 1CLVA 4Q4PA 2O4MA 5A8PA 4HQVA 5TQLA 1Q7ZA 3VDAA 3KOWA 5CZTA 7TIMA 1BYDA 2HS6A 3CH0A 1YBQB 3U7VA 2VEPA 1ME9A 4GNVA 4Y90A 5KINA 3MMDA 1FWJC 3P8IA 4YU1A 2R24A 3BJFA 3S8HA 5DT5A 3WN6A 1TV8A 1RXOB 3AALA 2R6OA 2E7FA 3EXTA 1QWGA 3PY2A 1DJNA 3RRAA 1VBRA 1JXJA 2CC0A 3NQGA 5C5YA 3HF3A 1Y7VA 3IJQA 3VKKA 3V75A 3VCRA 3WUFA 1E5NA 3BLEA 1FWRA 4IZGA 5HWJA 3MHFA 2YOCA 2QCDB 4B5SA 3RNDA 4LNYA 3OA3A 1XCWA 5I3IA 3A12A 5M17A 4I7UA 2GDQA 3L4TA 4K7YA 2PDWA 4NYYA 2O55A 5DMLA 3NSXA 2VMFA 3LCWA 2Z1WA 3LD5A 4H6KA 2CBJA 4NZ3A 2VUYA 4GUFA 1P6BA 4TU1A 1B2YA 1I75A 4US5D 1DYSA 3BUVA 3T1GA 5PTDA 3WQ8A 2E68A 3TQKA 4C6LA 2WMIA 3S2JA 3O8AA 2G41A 4TX8A 3WUEA 2C15A 3KS6A 1EUNA 2QPSA 1NARA 5AY7A 3SZ8A 2BZNA 2PDPA 1EC7A 2ACUA 4NXKA 4WGXA 4AY8A 1YMYA 2OEMA 3RFAA 3QSTA 1DQUA 3F4WA 3WJWA 2H6RA 3GDKA 2A6NA 1BWKA 2Z28A 5DT7A 4LANA 2XTKA 3IEBA 4GJ1A 2ISDA 2PTYA 3NNTA 1EJXC 3APYA 2OPJA 2PGEA 2P5NA 3D5HA 1M9HA 2Z1SA 1VPQA 4DF2A 3MO4A 3CIWA 1LQAA 1NFBA 2O9OA 4HHMA 2OWXA 1XJBA 3UR8A 1XQKA 5A69A 4CEUC 1CXIA 3FXYA 4ZVJA 3CC1A 1BF2A 3I7RA 1DVJA 1PHWA 1B57A 3LGGA 1QHOA 4GZIA 4KRTA 4JFSA 4OT7A 3KZPA 2IKHA 1CW2A 1UKPA 1CI1A 1GVOA 3SUSA 4UTTA 3LPGA 3RM8A 1HKWA 4TVCA 4Q6XA 4GVHA 5H8PA 3G0UA 1H0IA 4IMGA 3W7MA 2DEPA 1UKOA 4JN6A 1EIXA 5BMWA 1QVBA 1DORA 1RD6A 4F0MA 4LALA 3OVPA 4HB7A 3H55A 5CSSA 3TOPA 3UR5A 1IT8A 2GJNA 4XD4A 1SO4A 4MKNA 4RE0A 5FI8A 4NHVA 3TSMA 2YX0A 3CAWA 4I9JA 2NT0A 4AZIA 3OG2A 2XZ7A 1IE7C 2Y8UA 1O1HA 4EF9A 3HOJA 3M0JA 2PLMA 2EPKX 4ZOBA 1G1YA 1J0JA 2V81A 3ZLGA 4UFHA 4UTFA 3WEZA 3RX2A 1OK4A 3BDKA 3OODA 2VEKA 3K4WA 2NSXA 3H4WA 2EPMX 1LM1A 2ALDA 2J62A 4PUMA 2OJPA 1W5PA 4L6DA 1OX5A 2GGGA 2VL4A 4W87A 2GUBA 1QO2A 3MVIA 3BLIA 1BVNP 4N6FA 2J7DA 1W91A 2C13A 3S83A 4Y96A 1E1CB 5DMYA 2DZUA 4MNLA 1EBHA 3NUKA 3VIOA 1MQPA 4ZXOA 2CKSA 2JQXA 1M01A 2J79A 3PG9A 4S3GA 3NZGA 3KRSA 5ABHA 1EFZA 3G1VA 3ABOA 1OX4B 2BY1A 4DZAA 3RCNA 4C6IA 4EKJA 3TVAA 5BZAA 1CENA 3GNPA 4P5UA 2Y8VA 4WOZA 1V51A 3W86A 3VX1A 1NY1A 4AHQA 2OLSA 1MEIA 1V7AA 2OOGA 1BTCA 1AJ0A 3JR2A 4Q3MA 1YPFA 1Q6DA 4GQ0A 2XYLA 1GCYA 1GHSA 3W6MA 1Q6EA 1YXYA 3L4XA 3OQ8A 4L4MA 4R7WA 3SQMA 2A7PA 1W3KA 5HWMA 1V4YA 2P0OA 3KRZA 3VNZA 4B3LA 3QY8A 3T8QA 1WOAA 3VKJA 4K37A 2WNQA 1EXBA 1N8FA 5BWFA 3MMWA 1EEXA 1E0TA 2V2CA 3NG3A 2V38A 3WMBA 4AF0B 3LRMA 3BZJA 1D3CA 5FJPA 2P53A 3FVMA 4HOWA 4HZ6A 3EX4A 3S2NA 4D6HA 2A85A 3KCOA 4K39A 3O05A 3ZVHB 4IT1A 1QWKA 2NVCA 3R79A 1M65A 3GVGA 4IHCA 4XVDA 3S9ZA 2FGLA 4CNSA 2DW7A 2GVJA 1YXDA 3BOLA 2FTWA 3LLFA 3QZ6A 4ZB5A 1EGMA 4C6CA 4KCWA 4RE2A 1ECEA 1EWEA 1BWVA 3BTNA