5J5DA

Crystal structure of dihydrodipicolinate synthase from mycobacterium tuberculosis in complex with alpha-ketopimelic acid
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
297
structure length
297
Chain Sequence
VGFDVAARLGTLLTAMVTPFSGDGSLDTATAARLANHLVDQGCDGLVVSGTTGESPTTTDGEKIELLRAVLEAVGDRARVIAGAGTYDTAHSIRLAKACAAEGAHGLLVVTPYYSKPPQRGLQAHFTAVADATELPMLLYDIPGRSAVPIEPDTIRALASHPNIVGVKDAKADLHSGAQIMADTGLAYYSGDDALNLPWLAMGATGFISVIAHLAAGQLRELLSAFGSGDIATARKINIAVAPLCNAMSRLGGVTLSKAGLRLQGIDVGDPRLPQVAATPEQIDALAADMRAASVLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords 4-hydroxy-tetrahydrodipicolinate synthase
publication title Inhibition of Mycobacterium tuberculosis dihydrodipicolinate synthase by alpha-ketopimelic acid and its other structural analogues
pubmed doi rcsb
source organism Mycobacterium tuberculosis h37rv
total genus 113
structure length 297
sequence length 297
ec nomenclature ec 4.3.3.7: 4-hydroxy-tetrahydrodipicolinate synthase.
pdb deposition date 2016-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5j5dA00
3LBCA 3WK2A 4BWLA 3ABOA 2A4AA 2DZXA 4L4MA 2GJNA 4UTHA 1PCWA 1KLYA 4M7SA 2CLHA 3C2OA 3BW2A 2ZZ6A 1WOBA 1ZCOA 4PCFA 4UFLA 5T26A 1XBXA 3TNOA 2X30A 1S5TA 1LBMA 2ATMA 4BI6A 5LNUA 3BARA 3FKRA 3KX6A 3TROA 3W2NA 2HMCA 1WA3A 2P10A 4MYAA 5C5YA 5DBUA 3R5EA 2V2DA 2JK2A 3VNDA 5J5RA 4IQLA 3LTPA 3TW7A 1JCYA 2BX7A 3QH2A 1SO4A 1Q6RA 4OGZA 3CU2A 3KVJA 3RLUA 3LLDA 5FF0A 2QJHA 2YX0A 3LHUA 3DFOA 1LRQA 3W2UA 3W7GA 1LLWA 2QDHA 3K30A 3N73A 3G1VA 2CLMA 5KITA 4HT3A 1X8FA 1RVGA 1W3IA 2YFNA 3LDVA 1FXQA 2GOUA 3FKKA 3DFTA 3Q2DA 3NYZA 1JRBA 3TJXA 1FCVA 2ZRUA 2Q8LA 1D9EA 3I7SA 1JUKA 4WOQA 3W84A 3LRMA 1FCQA 4MY9A 2BLEA 4RV8A 3ELFA 4ZMGA 4YLWA 4WQ6A 5LHEA 3TJLA 4M7TA 4I7VA 3L67A 3C0JA 3DKJA 1M7OA 4FNTA 3UQNA 3SSJA 1VH7A 2CU0A 3BVJA 1B4KA 2FPVA 3C3NA 2X16A 3M5ZA 4YMZA 4GE8A 2ISWA 3MHUA 4LRTA 1OG0A 3FYOA 5CKSA 1L6WA 3HOJA 3GVGA 3LM7A 2EPHA 3VI2A 5FEXA 3ZFHA 2QJGA 2GVLA 5AHEA 5DBTA 3QM3A 2R94A 4LVAA 1O5KA 1O60A 3W7MA 3E0IA 2X2GA 4NJJA 3D0CA 3EWWA 1DORA 2DJLA 1GVRA 5DY3A 3TK7A 3IVUA 1QPOA 2ABAA 3QYQA 1XXXA 1OFAA 5G5IA 4OE7A 4UFIA 1KFJA 3OBKA 1QPRA 2NV1A 3PSVA 3SIZA 4N02A 4EOUA 1HL2A 3LGEA 3SI9A 1TJPA 4KWVA 5HJLA 2YDAA 3TXVA 1TPC1 5LNWA 5LGXA 1AW1A 4Y96A 1IGSA 4K7YA 4MJMA 1TIMA 1K02A 2CFFA 4HN4A 4M6QA 4ZL1A 3GXPA 2NXGA 1RQBA 2H90A 3L2IA 3NQVA 3UXAA 3PUEA 4GUJA 4GUFA 5H2ZA 4GUIA 3B04A 3AO0A 3OVQA 5AYYA 1H7NA 2B7PA 2ZTKA 4LRSA 3R12A 3A9IA 3W7PA 2I1OA 1G7UA 3BGJA 3QSTA 5AHNA 5F4SA 2V82A 3M0ZA 4A2SA 3HIJA 3W7OA 4GUHA 3LERA 1W8SA 3R8RA 3LHTA 5HUPA 1A50A 5LZLA 4JN6A 4JTTA 1YPIA 1ALDA 3KRUA 4FNUA 2ZRWA 1AL7A 4HIBA 1W5QA 2CLIA 2G96A 4O1CA 3GNDA 2NV2A 3DU0A 1WV2A 3NGJA 4WXZA 3LI0A 4UNKA 2J88A 4NNCA 1TTJA 1R2SA 4O16A 3PBUA 2E5DA 1S5WA 3BO9A 4UCGA 2Y7EA 3P74A 1JUEA 4LT9A 3YPIA 3KVMA 5HWJA 3C6CA 2ZZ7A 3L65A 4O54A 4FX7A 2A6LA 1IIGA 1XDMA 1WBJA 5AHIA 5D04C 3GDRA 5FF2A 3NL6A 3EWUA 1PL9A 3W9ZA 1QWGA 1ZFJA 2QUTA 2QCCA 1KV5A 1TO3A 1G69A 2QCFA 2VEMA 3T78A 1QOQA 1CX9A 3BG9A 2QDGA 1KFBA 4O13A 5HR6A 1YDOA 4IUOA 4O1DA 3P7YA 4FX6M 4QIUA 1KW1A 1KA9F 1OHLA 3QQ1A 3NDOA 1UUMA 3B06A 3F03K 3W1NA 5D09A 5LGZA 2ABBA 3EWZA 4GRSA 3DBPA 1C8VA 2DP3A 5IBXA 2BTMA 2V8ZA 4BI5A 1SZNA 1ICQA 3DFQA 4XBKA 4IMCA 3QEZA 3P61A 1TSIA 3WK0A 1TB3A 3RU6A 3PVFA 1F73A 1YXDA 1OYBA 1MSSA 3QPYA 5EBUA 4ZQMA 3UWVA 3M47A 1YPFA 1OABA 4JXCA 2W6RA 1L6SA 4U4MA 3CT7A 2C18A 2Y7FA 1V5XA 2BZNA 1MZHA 4TR9A 3TV8A 3LCIA 1THFD 5AC6A 4ALDA 4E0CA 4IMEA 4LTSA 1YDNA 3L9CA 5CPOA 2FQIA 3LTSA 4IXXA 1MEHA 2WKJA 5KMYA 1DL3A 4NZJA 3P62A 4NJGA 3G0SA 4O50A 1WXJA 3IV3A 1P0NA 1TTIA 3NQ7A 3GR7A 3A21A 5FF7A 5D30A 5DLCA 2IQTA 1EP1A 3STGA 1A5SA 1F6KA 2YPIA 4NVTA 3MHGA 3P67A 4WUIA 4JNMA 3VFLA 1I2QA 1A5CA 1MO0A 2TPSA 3MI6A 8TIMA 3PS7A 1R30A 3S42A 3UPWA 3NQ6A 4K7VA 1KM0A 1LROA 5BMWA 3QZEA 5K7JA 4CNPA 2R91A 3W7CA 2DU2A 4H3DA 4N6EA 3A24A 3W7NA 4FB7A 4R7JA 1PIIA 1LRTA 3M6YA 3W22A 1YTKA 4X22A 1TPEA 3R89A 3TQKA 3TSBA 3TA6A 4OWGA 1SUXA 1GQNA 4AXKA 1O94A 2ZRZA 3NQEA 1O4UA 1VS1A 3OVRA 4DO6A 1BKSA 2JKPA 2V81A 2I14A 1KBIA 4LC8A 1HUVA 3W1PA 1P5BA 5CSRA 1HO1A 1Z44A 2A7NA 1OF6A 1FBAA 1CI1A 2ATSA 1U5JA 1JCMP 1HO4A 3NNTA 3HMJG 1VR6A 1JCNA 4ZQOA 4KFNA 3DHDA 4KKXA 1R46A 4AH7A 3C2FA 2J24A 5CPLA 4ZQCA 3ZS4A 3G8EA 4IXHA 4JS3A 4NXSA 2NUYA 3UXDA 4AHOA 2HSAA 3T4CA 2VFGA 1EB3A 3Q37A 4QNEA 3DGRA 4JIPA 2G95A 2ZZ2A 4JGDA 4FO4A 3LB0A 5DY2A 2CLOA 4AHQA 2E77A 2HS6A 3A5FA 1W5MA 3W72A 5EMUA 3NQ2A 4O1AA 5KINA 1Q3NA 5EYWA 1K8ZA 2P1FA 5EY5A 4LS0A 1AK5A 1IXNA 2DZUA 3MJYA 5K9DA 3P8JA 4UFMA 1ADOA 3CQ0A 5FEZA 1ZENA 5KTLA 4O57A 2F7FA 2X1UA 1KFKA 4NXKA 1VRDA 3NQAA 3TSMA 5TBOA 1L6YA 3W75A 7TIMA 1VHNA 3H54A 4TMCA 3DXIA 2NWRA 4UMBA 3TQ0A 3CM4A 1A53A 5TIMA 2VEPA 3G22A 3HGJA 4QNWA 4MZ8A 4HKPA 1TMHA 2B7OA 2YSWA 5FEPA 2FDSA 1GVSA 1P0KA 1K8YA 4AF0A 2NX3A 5D2WA 2DZVA 3HBLA 1FWSA 3BW4A 5CPMA 2C13A 2O7SA 4D2JA 1DHPA 1K7XA 4R33A 1KFLA 2X1SA 1OFRA 3QFEA 1W56A 1YYAA 5G4EA 3UD6A 3HPXA 5F4XA 3NL2A 1H7XA 4AB4A 4K8EA 2QCEA 4RJEA 2FB2A 3KVLA 3QMTA 2WO5A 4JTLA 3TC7A 3U6WA 1LTDA 1YDVA 2ZTJA 4YCPA 5G1TA 1W1ZA 3P5YA 4O8RA 3TMQA 1QNVA 3NQMA 2A85A 2VENA 3CHVA 4Z1BA 3EWBX 4OV4A 4PFMA 4UTTC 3THAA 3EWYA 3PBVA 3L66A 2A7PA 5FF4A 4QISA 3SZ8A 2Q3RA 3BK0A 3W85A 1N7KA 5J5DA 5BOOA 4CCDA 4CNNA 1H1YA 1P1XA 3SJ3A 4N9BA 1VC4A 3SGZA 3LCFA 3N2MA 2YR1A 1LLZA 2VELA 4LUIA 4PL2A 3WK3A 4UC5A 4FHAA 3AJXA 3TAKA 3UWZA 5EA9A 2ZRXA 1MEIA 4FXRA 1I2NA 3LXBA 1QPNA 5FF3A 2JKAA 1JR1A 3M1ZA 4NT0A 3WFAA 4HNVA 4K6AA 3TAOA 2G97A 1K7FA 1GOXA 3GKFA 4HNNA 4FNRA 2NZLA 4L4LA 4MKNA 4TMBA 5D02A 3W7LA 2J27A 4K8HA 3MW7A 1R2RA 2H8XA 1TTPA 1W3TA 1KLZA 5G2HA 5U7SA 3NOEA 4KFOA 1V7YA 3ABQA 4WX2A 3Q94A 4MIMA 1XCFA 3G1FA 1YADA 3GAYA 1I2RA 4DF1A 2GQ9A 1VQTA 4N4QA 4O18A 3L0KA 5D38A 3G0UA 5E93A 3DKLA 2GUUA 3GNNA 4P61A 3UPBA 3INPA 1NF0A 4AWTA 3PC0A 4XQ6A 4N9DA 1PS9A 3GLCA 2EF9A 4PC8A 1JQVA 1W5PA 5G4WA 2V0TA 1I4NA 3G0XA 3W3OA 2LLEA 3W71A 5AYZA 4AF0B 1T96A 1TPFA 4LOCA 1IF2A 1KV8A 3MUXA 5EPDA 3KFTA 1QO5A 5HUOA 3UWYA 1Y0EA 3KRZA 4O4VA 1G4SA 3M5YA 4DQWA 4GJ1A 1OX5A 4EVZA 5FESA 2H3BA 2FIQA 4JTFA 3G1YA 4ICNA 1G6CA 3NPUA 1HG3A 2VFHA 2ZA1A 1YXYA 4OQVA 4QJ1A 1B4EA 4KWWA 3W73A 1I8JA 5F4WA 4IMFA 1ZNNA 3T44A 2TYSA 1KM6A 3EX6A 4UIOA 5H91A 1H62A 5CPNA 3BGGA 1QMLA 2EHHA 5CZJA 2ZYFA 3IEBA 3NO5A 1TJRA 4I7WA 3EKLA 1OVDA 1UBSA 2YZRA 2VEIA 1D3GA 3B0VC 4N2YA 4O12A 4DELA 5G2WA 4H4IA 5U4NA 5FEWA 5K2ZA 1HTIA 4W9TA 5AFDA 3EXSA 4AAJA 1EUAA 4QM1A 4RKAA 3N3MA 2KZHA 3T55A 4Z0SA 1SU5A 3NR0A 2A0NA 5HINA 2J9YA 3CEPA 2WNZA 3T7VA 3E12A 1VCVA 1NSJA 1PE1A 1P4CA 3H53A 1EUNA 5AC8A 1H7PA 3NQCA 1SO6A 1I2OA 4FX8A 4MFEA 3NPWA 3WJZA 3IGXA 3N34A 1TV8A 3W23A 3ZWSA 3NQFA 4ZQRA 3V1PA 1H7WA 1N8FA 2OZ0A 4ZQNA 1EP2A 1ZJIA 2A1YA 2C0AA 3U8GA 1FDJA 3HG2A 1IXOA 3M5VA 2V2CA 1SZEA 3HGOA 3TFXA 3TC6A 4OBTA 4RCXA 3W07A 2C6QA 2ISSA 1XUZA 2E09A 3CLMA 2P0OA 1BWKA 1LOLA 3LCWA 3HJZA 3WJXA 1XC4A 3PG8A 2NX1A 4FNSA 3C2VA 2E6YA 3MI3A 2I9EA 3FIGA 3QSRA 1MXSA 4YCOA 5KZMA 2E6DA 3CTLA 4JTJA 3I6RA 5AHMA 5DN1A 4WXYA 2DZTA 3DFSA 3NM3A 2Y88A 2Z6JA 1KM1A 3DENA 1ONRA 3W1XA 4X3ZA 2HS8A 4MOZA 5EL1A 5I3GA 4FNPA 5IM51 3FA5A 4DBDA 5AC7A 3F4WA 1OF8A 2J9XA 2WV8A 2E6AA 1TV5A 2Q8ZA 4LS1A 3UY7A 3N9SA 4HPXA 5LHFA 2XFWA 3NVTA 4BWLC 1DVJA 5K4XA 1SR9A 2ZBTA 3KRSA 3DZ1A 3O8AA 3BG5A 4TIMA 3MP4A 2B4GA 3EWXA 3M41A 4NJIA 3CWNA 4MPQA 4CCEA 2D73A 3P82A 4UTMA 2QCGA 4CQ8A 2CZ5A 2QUVA 4UFJA 4BF9A 2BSLA 4O53A 5L6UA 3UZ5A 1SFJA 1M5WA 3PBWA 5AOUA 1GZGA 3N9RA 2QKFA 4A2RA 1FWRA 4UMCA 5AN7A 5I3KA 3W76A 4LUJA 3S8HA 3GDKA 1JULA 1VLWA 1FDYA 1XUUA 4GXMA 3G1DA 1OYCA 3W88A 4JY9A 5D37A 2YXGA 4LWWA 1X1ZA 1XBYA 3OIXA 1ZALA 3CIWA 3UY8A 3W1LA 3GDMA 2XN0A 3FJLA 1GPWA 1C29A 3PAJA 5BMXA 1W54A 1RQEA 1SSGA 1H50A 1TRIA 3B4UA 4O0ZA 4RZ6A 3WK1A 1KM2A 4O1BA 5DXYA 2WSQA 4QITA 1S3HA 2WSRA 3PSWA 4NUWA 3RK8A 2E1DA 1NF7A 1QPQA 4RK8A 4UTTA 4AWSA 3B0UX 3GIYA 2WSYA 4MLRA 1ML1A 2C1HA 3EXRA 1LYXA 3EX2A 3LX9A 5TQLA 2YFOA 3CB8A 2CW6A 1B57A 4ADSA 2DORA 3BLFA 3SECA 3NQGA 2RDWA 4DPPA 3N2XA 4EF8A 3TR2A 4UTUA 4CCCA 1SO3A 3LHYA 1TQXA 3O6CA 1VYSX 4JEQA 1NAL1 3MO7A 3UWQA 4C1LA 2Z0IA 1BWLA 4H6KA 1XFBA 1LP6A 4E38A 4NNBA 3I65A 3TQVA 3ZR4A 4UFHA 2NXIA 5LNSA 1WOAA 2A5HA 3IIOA 1B3OA 4Z1CA 1TV7A 4P2VA 3GYEA 4UFKA 1I2PA 1DOSA 5DXXA 3DHFA 1M7PA 3EEGA 4Z1DA 3DFPA 3C8FA 2PCQA 3LI1A 3QC3A 4WOZA 2Y6ZA 4IJBA 2V2HA 5ABTA 1RR2A 1X6UA 5BNKA 3FYPA 4O28A 1RV8A 2NWSA 4DXVA 4CQ9A 1H60A 2H3DA 1EWEA 1EWDA 2ALDA 3CEUA 1FWNA 3HF3A 3VKJA 2C3ZA 1LOQA 4LNYA 5AYXA 4G1KA 3S5OA 4PODA 3WJYA 2GVGA 3TW6A 1LZOA 3PWAA 1UUOA 4DEFA 3SY5A 2QF7A 2AGKA 4E2DA 4IPJA 5FI8A 1YTDA 3RF9A 1JCXA 3JRKA 1T99A 3KVKA 2RH9A 2OCZA 3OVPA 2DJXA 3IRDA 5KZEA 3W7EA 4GFSA 1KBJA 2Z1BA 5D2XA 4QAIA 1KTNA 1VZWA 3GR8A 4JTEA 3RNDA 1W5OA 2Y70A 2YW4A 1OFDA 3O07A 3P84A 4IGHA 4Y6GA 1TPDA 3LHWA 1X1OA 4YWIA 5HR7A 3G18A 4B5NA 5DCBA 1UASA 5E0KA 4Z08A 2NUWA 4ADTA 1E51A 3EKZA 4M5PA 3GDTA 3PY2A 3UWUA 5C2XA 3MBDA 1EA0A 2HTMA 3TFCA 1KM4A 2W0UA 1KFCA 5D32A 5K4ZA 1F74A 3GK0A 3P8IA 2Y61A 2JBMA 1FY6A 1ME7A 4R53A 4MJZA 4XWUA 4JTHA 1G67A 1SZFA 4JIQA 4XZ9A 2RFGA 4UTKA 2ZZ5A 1Z48A 2GQ8A 1JCJA 4A29A 4XKYB 3I7RA 5LNRA 3WJWA 1F2JA 3HG4A 1H63A 4O10A 2G5WA 1RQHA 3UZJA 1GTHA 2GJLA 4GBUA 3G1SA 4UTLA 1L2UA 1VHCA 3QPZA 3DH7A 1QOPA 4JTGA 1F5ZA 3IIZA 2A6NA 1XM3A 4IOTA 3LV6A 1R47A 1K7EA 4NJHA 2CWNA 4C1KA 1GG0A 4NJKA 3LHZA 2B0MA 2PRLA 3HB9A 1JVNA 1OFEA 4K38A 1JJKA 3PF3A 2VFIA 3BPWA 1GYNA 2V5BA 2E5CA 4A3UA 3W7RA 4QQ3A 3M9YA 5CSSA 1NFBA 4ML9A 1N55A 3W87A 1QO2A 2H8ZA 5F2LA 3NZRA 1H5YA 1CW2A 3PBYA 3E96A 2ZA3A 2QCNA 4O14A 4PH6A 1RD5A 2E6FA 3ANYA 1SO5A 5K9CA 5DCDA 2A7RA 1TPVA 4FF7A 4Y9AA 4IX2A 3GX9A 5AHFA 1XKYA 2X1TA 3G8RA 1YXCA 3NPXA 1G4EA 4IMGA 1U83A 5A5WA 5AB3A 1G7VA 1VCGA 4LVBA 2Y89A 3A22A 1GT8A 1ICSA 3NA8A 4JTSA 3NQDA 1VJIA 3L0NA 1RZMA 1OX4B 4RXGA 3GB6A 4IMDA 1VYPX 2CZEA 2Z2UA 3W1TA 4POCA 1LCOA 3HPZA 3LBMA 4Q32A 1FCBA 2OT1A 1SQ7A 1ZAIA 3NL5A 4RZ4A 2PC4A 1D3HA 2ZDRA 4O19A 4N6FA 1VCFA 5D2VA 3IVTA 1Q6LA 3S1XA 2WOQA 5AHLA 4LVFA 4ONVA 1G4TA 5MHBA 5BW6A 1F6PA 3PG9A 1QFEA 1X7FA 1NVMA 3P5ZA 4Q4KA 5I3JA 3GDLA 1XDLA 2WPBA 3KAOA 3PB0A 3NM1A 3STCA 1DJNA 3KHJA 1SW0A 5F2GA 5DCEA 1OFPA 2ZFAA 3TUUA 3O15A 1UJPA 1GEQA 4TO8A 1T8XA 1SW7A 1ZAHA 4NNAA 1B9BA 3HGSA 4ADUA 4RR4A 4S2BA 1S5VA 1VYRA 3MP5A 3HQ1A 3QMRA 1ME9A 4MYXA 4Z1AA 4NZFA 4IX0A 3FLUA 3Q58A 1AG1O 4HHPA 3S5ZA 3RMJA 5G2IA 5LSMA 4NX5A 5LNVA 3SW6A 1QAPA 1TPB1 2UV8G 2BWGA 2QCDB 3L5AA 3R2GA 3ABSA 3W7KA 1A5BA 2R8WA 1GYLA 3BLIA 3DI1A 4YL2A 3O16A 4JX4A 4EF9A 3S9YA 2Y62A 2R14A 4PL1A 1QR7A 1TPWA 3L21A 1O5XA 1OK6A 3LRKA 3OEXA 1EP3A 3UNDA 1IIHA 1SFLA 3O6DA 1VGAA 2ZCGA 3FS2A 2QR6A 1K8XA 3G1XA 3M5XA 1F05A 3DI0A 3TKFA 3NZ1A 3ZWTA 2Y7DA 4HNUA 4LC6A 4Y90A 3FFSA 4EIVA 1WX0A 1OFBA 4CNOA 3MI2A 4LVGA 1LRNA 3S1UA 2V9DA 4MZYA 1VLIA 1H7OA 5F1VA 1R2TA 1L9WA 1TREA 1TRDA 4O52A 2YGYA 3MMTA 5F1UA 1GVQA 1QDSA 2QCLA 4AVFA 4OV9A 1BEUA 3EXTA 3P60A 4XTIA 6TIMA 3IIPA 1W5NA 1GJPA 2OX1A 3M44A 4WY0A 4RX0A 2PRHA 4A21A 1FX6A 4OU1A 5EKYA 2V5LA 4ZZ9A 1C9DA 3QQ0A 3JR2A 4JYFA 4AWUA 5C6MA 4UTWC 3M43A 1DV7A 3ATZA 4WZHA 3C56A 3N14A 4JYDA 4A22A 4NX0A 3BV4A 2GQAA 4JYEA 2DZPA 1JUBA 5E1QA 5HWMA 3TE9A 1SSDA 2DZSA 3TIMA 3CWOX 1WBHA 1LORA 3LCXA 3GAKA 1FWTA 5HQEA 3PUOA 2BXVA 1LDCA 1LM1A 2FTPA 3USBA 4DO4A 2ZA2A 2CLEA 4ZVJA 4JY8A 2QCMA 3B0PA 4OT7A 3W1AA 3W7HA 1FXPA 1T0OA 3CC1A 3W7QA 4HNTA 2E68A 4MY1A 1AW2A 4BFAA 4JD4A 4LV4A 2EKCA 3QF0A 1JRCA 1MEWA 4MLJA 1Z41A 1PCKA 3E02A 2FFCA 4BR1A 4DPQA 4O11A 4UNLA 3W6YA 3O63A 3OG3A 1IXQA 3G3DA 2QUUA 5C55A 2CLFA 3S6DA 3W7IA 4E2BA 4KFPA 4LY8A 1YTEA 3EX4A 2C14A 5CZTA 5BRBA 3W1RA 3L5LA 3S1WA 3NAVA 2A21A 5I3HA 3UYCA 2FB3A 3W2MA 3WJSA 3QRHA 1PHQA 1BTMA 2H6RA 3W2LA 1H51A 1DQWA 1W0MA 4N9EA 2WNQA 2TRSA 3PM6A 5HNRA 1Z42A 1ZHAA 2RKXA 3R13A 3W2JA 3M16A 3MP3A 4J9JA 3TU9A 5HWNA 4Y8FA 2NLIA 2NXHA 4JR5A 3HG3A 1KTBA 1GWJA 3QMSA 2CLLA 4TX9A 4UUIA 2XN1A 1H1ZA 4AMAA 1O95A 3ATYA 3PR2A 5F2IA 2YYTA 1KM3A 3TX9A 2A2IA 2ZRVA 4GWEA 3GKAA 1TPH1 4K39A 5I3IA 5D2TA 1TTQA 2TSYA 3LHVA 3LCLA 3QW4B 3QW3A 2Y63A 3LTYA 2C19A 2RHGA 4RXFA 2C15A 2FJKA 3VCRA 1WDWA 3LCHA 1TYGA 2VEKA 3C2EA 1J2WA 2FLIA 2Y7GA 5C54A 3P80A 3E9AA 3TXZA 5KSWA 1AL8A 3CPRA 4UR8A 2WQPA 5D33A 3FOKA 3SR7A 3IIXA 4DF0A 4M19A 4R34A 4FNQA 2JKEA 1GTEA 1A5AA 4FIRA 2Y85A 1F76A 4XKYA 4QSHA 1TPUA 1K3UA 4X2RA 3JS3A 1DQXA 3RLVA 4O15A 1KM5A 3KOFA 3S5NA 3L68A 4O17A 3DAQA 4ORIA 4CLMA 4Z0JA 1SZGA 3GZ3A 3W1MA 4FIQA 4UXDA 4S2CA 3E49A 1HFBA 3W83A 3W74A 5LKYA 4XTDA 1OJXA 4BI7A 4WY0B 4FEZA 2RDTA 5CZSA 1K03A 2QCHA 1YLVA 2QAPA 3A5VA 4PEKA 3GXNA 2EAWA 2FPTA 1M6JA 5KZDA 2YW3A 4U28A 3MHFA 1UCWA 4GC4A 2GPTA 2JGYA 4IWWA 3IGUA 3S0CA 1W37A 3HGRA 3L5MA 4I9AA 4LU0A 1KFEA 1QCWA 1IXPA 1F7BA 4Q33A 3QJAA 4RZ5A 3C4UA 4M6VA 1FDZA 3UWWA 1KTCA 2B7NA 3LXCA 2J6XA 3TMLA 2WNNA 4YXGA 4JTUA 2NUXA 4OHQA 3IIVA 1FUYA 4AHPA 4XBSA 3TDFA 1LOSA 3L0GA 2PURA 4MFDA 4JX6A 5K3VA 4NQ1A 1XBVA 1ICPA 3I7QA 2VFEA 2X1RA 4JICA 4K36A 2VXNA 3FEMA 3G3MA 1DKWA 4ORMA 1TCDA 2ISVA 1OX4A 2YYUA 2W79A 2B7QA 4GNJA 1G4PA 2QAFA 3T40A 3BG3A 1XL9A 3M7WA 4MZ1A 4JDBA 1LBLA 1AW5A 3STFA 2VFFA 3SFKA 2XN2A 1Q6QA 2J9ZA 2WJZA 4AEOA 2OT0A 3EX3A 3V75A 4JX5A 3GXTA 3IVSA 1JCLA 3CIXA 4DBEA 1GVOA 3IGSA 1H7RA 2VFDA 4N9CA 4S1FA 3PB2A 1EEPA 1OFQA 3U2OA 3PUDA 3TH6A 2AAMA 3ABRA 3NEVA 3MYPA 2FPYA 2AQWA 3F1QA 4MY8A 2O7QA 3STEA 3BLEA 3TSDA 2C16A 1OX6A 4TU1A 3B03A 4K37A 2CZFA 4LW7A 3O05A 4O0KA 5CZ0A 5I3FA 5D03A 1ZY9A 2ZQ0A 5HMSA 2ZRYA 5CGQA 5D2YA 4WJEA 3NQ8A 3B8DA 1WYIA 5GVJA 3W2KA 1OK4A 3B05A 2PE4A 1WQ5A 2NX9A 3W1QA 1TQJA 4X9SA 4UTJA 5DELA 2F84A 3G1AA 3SGUA 1WAUA 1PV8A 3MBFA 3EB2A 3G1HA 5F2MA 3C61A 2ZZ3A 4PA8A 3MYOA 2EGZA 2QCDA 4LVDA 1EIXA 1I45A 3VE7A 3OA3A 4MUZA 4DF2A 3LV5A 3FJ6A 4UMAA 1GG1A 3G24A 3O6YX 4O4WA 1GVFA 3W7DA 5K9XA 3LRLA 4LV9A 1SPQA 1NEYA 2VKZG 3S1VA 1EX5A 1EPXA 5HULA 6ALDA 5CG7A 2GVJA 1DJQA 4WY0F 1J5TA 3EX1A 2CLKA 1FWWA 3MWAA 4PTNA 3LLFA 4IPIA 4HSOA 4UTWA 4I7UA 1FQ0A 1OFOA 4NU7A 5G1YA 3RFAA 1JQXA 1W3NA 2JGQA 1J4EA 3W86A 1FCUA 1DBTA 1XBZA 5IBXC 3A23A 2YCEA 3TCEA 3C2RA 3S5YA 2Q3OA 4MVAA 3HO8A 4M6PA 3THQA 3HG5A 2VOMA 4DO5A 3BW3A 3O1NA 3N19B 1H61A 2ZZ1A 1ME8A 3OHIA 1Q6OA 4GUGA 3W1UA 3LCGA 5D05A 3LOTA 3C52A 3NG3A 2QJIA 4FXSA 4N4PA 3LXAA 3NL3A 3NPVA 1W31A 4UTIA 4WD0A 1XI3A 4JDYA 1PVNA 4CQAA 4JTIA 2RDUA 1Q45A 5SWUA 2TMDA 1PHWA 3I68A 4HSNA 2E5BA 1UB3A 3P81A 1VPXA 3NXFA 2VC6A 4UR7A 2OMAA 4LS2A 1ZAJA 1RPXA 3O06A 4ZQPA 2Z6IA 3KXQA 2DZWA 3DFNA 3H55A 3F4NA 3PULA 3W70A 3VE9A 2PRMA 3HPSA 1LBFA 5A8GA 4RLIA 4HPJA 3W7JA 4JTKA 2ZZ4A 4BK9A 1SW3A 1OYAA 4EWND 2V30A 5L9FA 1AMKA 2QEZA 2OJPA 4XUGA 2CZDA
chains in the Genus database with same CATH superfamily
2A4AA 1HNYA 5ECUA 4CEXC 2EG8A 4B2DD 1V6WA 3TTQA 4DUOA 3ABZA 2ZZ6A 4GZEA 1MUWA 1ZCOA 4PCFA 4XZHA 1XH1A 1XBXA 1EXPA 4P5UA 1EBGA 1KO0A 3IJDA 4GQ0A 1R85A 4JKMA 5EMLA 2A3AA 3TW9A 2XVNA 4Z2GA 1WA3A 1FWCC 3ALGA 1MNZA 3N11A 4IQLA 3OZMA 4ROQA 4CD5A 2W91A 1JCYA 1G1YA 4B90A 2E9LA 2HXTA 1Q6RA 1YNYA 4OGZA 5GJNA 3PZGA 5FF0A 3GVWA 1UD8A 2CITA 2G4JA 1MFVA 2NQ5A 1LLWA 3K30A 3OODA 3N73A 3G1VA 1W3IA 3TLQA 3A4WA 3KLLA 1VPQA 3DFTA 2SFPA 1RP9A 3Q2DA 1CB2A 2WCGA 4I5UA 3CH9A 1D9EA 3I7SA 4A3HA 5JIPA 2BY2A 4PGLA 3KCLA 3LRMA 1FCQA 3EWDA 4DJFA 2BLEA 1TCMA 4ZMGA 4HTBA 3TJLA 1JZ2A 2NVDA 3DKJA 1ELSA 1VH7A 3KHDA 1JFXA 4DNMA 4ZXOA 3WNMA 2X16A 4YMZA 4MWAA 3WNPA 2ISWA 4LBSA 4Q8PA 3FNDA 4HHMA 5CKSA 1L6WA 4D1JA 2EPHA 1QNRA 5AHEA 3QM3A 2R94A 1O5KA 2EPMX 3L2LA 2REQA 3FY1A 3R4IA 1GVRA 1PAMA 3ARPA 3IVUA 4L4OA 4Q8TA 1OFAA 4R3UA 4WKHA 1E73M 1KFJA 3FSTA 1XH0A 4H83A 3R0KA 3SUTA 1Q6FA 2BMBA 1ZLPA 1K77A 4RW3A 2AKZA 3EOSA 3DFHA 3N9KA 3DC0A 4G2DA 4MAZA 2ZX9A 4D6GA 3WQCA 1IEQA 4HN4A 1XD1A 4TV6A 2NXGA 1MNSA 1JPDX 1UA3A 3NQVA 3UXAA 4GUJA 1GUVA 1JG9A 5H2ZA 4GFIA 3B04A 4RDVA 3GSMA 3AO0A 2RGLA 1YBQB 2XYLA 3NJ3A 3CAVA 2I1OA 3BGJA 3SDOA 5F4SA 1FWIC 1WCGA 2WJDA 3AQUA 1WKEA 3CPUA 1N8WA 3UG5A 4LPCA 1BSIA 3NSMA 2VNCA 1DPMA 1ALDA 2VJXA 2ZRWA 3GQYA 3KBMA 4UR9A 1E5NA 3FAWA 1WV2A 3NGJA 4PMNA 2XM1A 4NNCA 4IPPA 4O16A 3EDDA 3BO9A 2P76A 3P74A 5IOBA 3W25A 3QTGA 5LXXA 2O4QA 5HWJA 4AYSA 3BTNA 3C6CA 3L65A 4BHYA 3AOFA 2EKGA 2DT0A 1XDMA 1WBJA 3K13A 1ZJBA 5HMDA 1GZ1A 3ZJKA 1PL9A 3QTPA 1FA2A 1QWGA 1ZFJA 2QCCA 1ZUAX 2OLAA 2QT3A 1TO3A 4S3AA 3T78A 1PKNA 2HEJA 3U4AA 1X96A 1CX9A 1KFBA 4P8XA 5REQB 4ZTYA 1YDOA 3ZXWA 2V5KA 1TR1A 4HA3A 3F03K 3WQ8A 5LXEA 3L4VA 3DBPA 2DP3A 1MW3A 3EOUA 5IBXA 1TWSA 1ICQA 3DFQA 5FJPA 5LA0A 2OZTA 3WK0A 3MUAA 2D2OA 4KS0A 1OYBA 1MSSA 1MUMA 1YPFA 4XAFA 2J79A 3DN5A 1L6SA 5CPSA 2C18A 1ZZMA 2PGWA 2CLPA 4HQVA 1MZHA 3TV8A 3MKKA 3AIEA 3WUBA 3BCDA 4U5IA 1RVKA 4ALDA 4LTSA 2FQIA 4L80A 4HA1A 4Q4QA 2WKJA 1DTUA 4LYPA 3CHFA 1TA3A 3EZ4A 3B0YA 3GH4A 2DEPA 3GD6A 4NZJA 4AC7C 2VCCA 3NQ7A 1M01A 4NL1A 5ENLA 5FF7A 2IQTA 1TZ7A 1Q6EA 2R82A 2FDMA 3NTYA 2YCKX 4LXFA 4V1XA 4XO7A 1R7OA 3RCMA 1CWYA 3BAWA 4GIYA 3VYLA 1A5CA 5CH9A 1J0KA 1ZS2A 5CGMA 4HA4A 3NQ6A 3TTEA 1IR1A 1ISYA 1KM0A 3QZEA 3OO2A 5GNZA 3VGGA 4CKQA 3W7NA 1EX1A 3CL6A 3CWHA 1YTKA 4X22A 3U5YA 4KW2A 1ISWA 5D9PA 1VS1A 1XYLA 1GW1A 2VTFA 1UR1A 4BJHA 3E2SA 1HUVA 3WNOA 3W1PA 1Z44A 1FBAA 4XKMA 2EQDA 4AD1A 3B9EA 2C8NA 1JCNA 4ZQOA 1KRBC 3ZS4A 4IXHA 3F4CA 3ZOAA 1R3SA 1DJXA 4NXSA 2NUYA 3UXDA 4UQ9A 4AHOA 3T0AA 3N6HA 1EB3A 3DGRA 1DE5A 4L9XA 4A3QA 3C86A 2CLOA 3GM8A 5G4HC 1FWHC 3W72A 2INFA 5EMUA 3NQ2A 2VX4A 3S6OA 4KEMA 1W1IE 3TZNA 3FHQA 1K8ZA 5EY5A 4LS0A 4E3VA 2DZUA 3M6DA 4MAVA 4UFMA 3D6NA 3CQ0A 4B4FA 1VBUA 5KTLA 1U1HA 1KNWA 2PCEA 3TSMA 4WKFA 1L6YA 4TMCA 4PSRA 3WLLA 2DSZA 1UMYA 4UMBA 1JGMA 2VQUA 4YU1A 4QBXA 3O7UA 5D9NA 4MZ8A 2YSWA 3LPPA 1H41A 4XVDA 4XUYA 4MWAD 4XZBA 4AF0A 3U3HA 5D2WA 3WNNA 2HWGA 1XYBA 1QASA 2C13A 2OVLA 1DWIM 3TTOA 1VEPA 3QFEA 3VCCA 4CD7A 5G4EA 5F4XA 3ARQA 3FDKA 4K8EA 1J0IA 5C7VA 2FH6A 2NQLA 2FB2A 2FTYA 3V0SA 1MDRA 2PZNA 2WXDM 3KVLA 3V35A 1ADDA 1YDVA 1LUCA 2VDIA 2AAAA 1PZ1A 3IJ8A 4M80A 3P2VA 4O8RA 3QV7A 4Y9NA 3TN3A 4LAZA 8CGTA 3CHVA 4QEHA 1WZKA 4Z1BA 4E4PA 1WXZA 1IT0A 4UTTC 5CC5A 5FJJA 3KL3A 3MT1A 2A7PA 3SZ8A 1XYCA 2Q3RA 3W85A 5J04A 4J28A 1UH2A 2ZUUA 2PWVA 2GSEA 4CCDA 4EPDC 4H9XA 3VKDA 1REQB 1JPKA 3SJ3A 3E0VA 4N9BA 4JIEA 3SGZA 2Z1XA 2YR1A 1LLZA 2E28A 3WK3A 4L65A 1X1NA 2FHFA 4UC5A 3TAKA 4GGHA 1ZBKA 3L4UA 4FPSA 5EA9A 3WLKX 3LENA 3SADA 1YMYA 3GNPA 1EDTA 1HL9A 4DNHA 4D71A 1HVXA 3AXMA 1JR1A 3WQEA 4K2SA 4AD3A 3WFAA 2QIIA 5H8UA 7ENLA 3GNOA 4AIEA 3TAOA 2G97A 4AX6A 1VF8A 3S2NA 4HNNA 1IE7C 5I5RA 1DWHM 4FNRA 5M03A 2NZLA 4AX7A 4TMBA 3W7LA 1R2RA 2CNCA 1ZTVA 3ZSSA 2OKTA 3KCOA 4H8HA 1XIMA 5G2HA 3NOEA 1V7YA 1FH7A 3G1FA 4WLCA 3AWNA 9XIMA 4N4QA 3SEPA 3CUFA 2PDKA 1PKMA 5E93A 1UZ1A 3DKLA 3UP8A 5M2FX 4P61A 1JNDA 3OLEA 1V0NA 2WKLA 1XV8A 2GDVA 4LEQA 4PC8A 1JQVA 2PA6A 3OYXA 4S3CA 3GG8A 1M41A 3VIPA 1CNVA 1KV8A 3WD4A 1Z9AA 1QO5A 4S3DA 4H9UA 1AZ1A 5HUOA 1Y0EA 3OG2A 1G4SA 3M5YA 2XH7A 4A4AA 5FESA 4JTFA 3G1YA 4XO6A 1ZB5A 3OQEA 1YXYA 4OQVA 3ZT7A 3W73A 1GKQA 1I75A 1NWTA 3CT2A 1KM6A 4G7FA 4IH3A 5H91A 1YX1A 3BGGA 2EHHA 3IEBA 2BGNE 3R0UA 3KM8A 2YZRA 4DELA 4ROPA 5AFDA 1SJBA 3NZGA 2CXGA 2KZHA 1CLXA 4AZ5A 3PFRA 1SU5A 3NR0A 5HINA 3M64A 2J9YA 2J74A 3CEPA 3T7VA 3HV8A 5FSEC 3M7SA 1HW6A 4N7QA 3ITYA 4KETA 3NQCA 4A8LA 4MFEA 1JNEA 1ONXA 5JXQA 3Q65A 1V6TA 4HHLA 1DJHA 4ZXLA 3W23A 3NQFA 5H8PA 2E1WA 4IG2B 4KEVA 2GLKA 5JBEA 1E40A 5E6ZA 2A1YA 4M56A 1E43A 3HG2A 3GE7A 2YA0A 2D69A 4REQB 1V02A 2V2CA 1SZEA 4V33A 1SR0A 3E74A 5MKGA 4G6CA 1JD7A 1UD4A 1W9XA 2WQDA 2Q71A 1IT7A 1LOLA 3HJZA 2AMGA 3S5SA 4FNSA 3C2VA 3MI3A 1E1CB 2GVYA 3E0FA 4KWOA 5I77A 4PZVA 2Z6JA 5HQLA 1IZCA 1KBLA 4J35A 3VD4A 3BQ5A 3TR9A 3Q45A 5I3GA 4WVXA 4B9YA 2J9XA 3H26A 4NZ1A 4JQ3A 1VD6A 5LHFA 3UJSA 1PSCA 4GZIA 2CYGA 1SR9A 1AA1B 3ONBA 3WH7A 3BJFA 4NI8A 3RJYA 2QYGA 2EEXA 1VIZA 4TIMA 3MP4A 4WDTA 1E0WA 1SFTA 2D73A 2BY3A 1BVNP 1X97A 5BRPA 2BOFX 2WAGA 2WZIA 3TOPA 3E3HA 2BSLA 4QX4A 3AUJA 3PBMA 1SFJA 4FOJA 2J7EA 1M5WA 3TWAA 3OTRA 1UHVA 1GZGA 2QKFA 3NXLA 4UMCA 3UT0A 3KTSA 1EHAA 5FJOA 2P0IA 3VDHA 3B8UA 4PRRA 5D37A 2YXGA 5AZ1A 1ZALA 3CIWA 5T9BG 5C8BB 4IFKA 1C29A 1RQEA 1SSGA 1TRIA 1A0CA 5A8PA 3L4ZA 4LAUA 3IAQA 2YL8A 3PSWA 1E6NA 3BAYA 4AWSA 2Z1SA 1BF2A 2XSAA 3G77A 2C1HA 1KXVA 4QR6A 3EX2A 5TQLA 4PTWA 3K5XA 2YFOA 3CB8A 2CW6A 3L4TA 1B57A 4ADSA 4GYPA 1TV2A 1NIUA 3L23A 4DPPA 4X0VA 4I8DA 3N2XA 2IXVA 1F61A 3TR2A 3N4AA 3G6MA 3OW1A 4PUKA 1SO3A 2ZWYA 4PB5A 4JHZA 3K2GA 1BWLA 2DIJA 4H6KA 4B4HA 4E38A 2A3CA 1LQAA 3SCNA 1WOAA 4C90A 1QATA 2PZ0A 3QZ6A 4DJEA 2OWXA 5DMNA 5HBFA 1JAKA 3T08A 1J93A 4FALA 3TOYA 1DJWA 3VNJA 2J4GA 4TUFA 1M7PA 1WZMA 4OZOA 4Z1DA 3C8FA 4DBSA 4QE5A 1NDYA 2UY5A 3WF0A 2Y6ZA 5HOSA 4Q7NA 1VAHA 2BOGX 2D2GA 3H70A 4IIFA 2O9TA 2PWEA 1XDJA 3FYPA 5I79A 1BLIA 3AHTA 2NWSA 4HOXA 2H3DA 1E1EA 1S2AA 4QLLA 4UZSA 1E9YB 3HF3A 3VKJA 1ISXA 2QVNA 2OQLA 3QV8A 3BH4A 1BVZA 3IK2A 2QF7A 3SCSA 1EJUC 5FI8A 3RF9A 4NKCA 3DCPA 1UKPA 2RH9A 1M7XA 3IRDA 3W7EA 4GFSA 1KBJA 2Z1BA 5D2XA 2D22A 5C71A 2QV4A 4QAIA 1KTNA 4JTEA 1PYMA 4HK7A 4Y6GA 1X1OA 2IUZA 4YWIA 5AY7A 2VRJA 5HR7A 3GIPA 3CMGA 2NUWA 4M5PA 3UWUA 1EA0A 1LT7A 2Z1KA 2HTMA 4PTVA 5GJMA 1PUDA 4V27A 5K4ZA 2KAUC 5DFAA 1UPMB 2JBMA 4R53A 4MJZA 3H2NA 4JTHA 1SZFA 2QVHA 5LNRA 2D3NA 1N82A 4WIWA 2A3HA 3CGTA 1H63A 3DESA 3LS9A 3FVMA 1QHZA 1US0A 3SJNA 1GVEA 2FYMA 4GBUA 3G1SA 3SUSA 4UTLA 4K68A 3H2OA 3DH7A 4L1XA 4X63A 1EYEA 2A6NA 1R47A 2GK1B 3MKCA 4FA3A 2CWNA 3EA2A 4NJKA 1OGGA 1R3VA 2POZA 3HB9A 1OFEA 3O0FA 4UQBA 3L4YA 3BPWA 1GYNA 2V5BA 5CSSA 2D2HA 3I3EA 2XVKA 1H5YA 1CW2A 1PKYA 4S3BA 3QKEA 1TE1A 1Q66A 4GI6A 4NAEA 3R10A 1VIWA 1CEOA 3T2PA 2A7RA 1AMYA 5BXSA 3VOIA 3GIQA 3GX9A 5HQMA 3AYRA 1XKYA 2X1TA 2Z24A 5A6BA 1JZ7A 3GVVA 1YXCA 3NPXA 4MADA 2ZVRA 2YA2A 4LBUA 1G7VA 3VPLA 3RMEA 3WH8A 1ICSA 2HPIA 3NQDA 3I6EA 1VYPX 2Z2UA 3B9NA 3WDRA 4POCA 2VC9A 2OT1A 1ZAIA 1B3XA 1WKDA 3W81A 2ZDRA 4O19A 4YNGA 1GOKA 6XIMA 1T8QA 1QBBA 5AHLA 2WVTA 4ONVA 2Q09A 5BW6A 4R7OA 4NF7A 4AXNA 2XZ9A 3RUBL 5I3JA 4GJIA 3CV1A 1SW0A 3PPGA 3FGCB 1SW7A 5LIKX 2PU1A 4HA0A 4HGXA 2CZVA 3VGEA 3VIMA 3WUEA 3QMRA 1X98A 4CEUC 5I2UA 4NILA 1FHDA 3TYBA 4PTMA 3VD5A 3FLUA 4HHPA 3S5ZA 3RMJA 4E2OA 4Q8QA 3A12A 5LIXX 1TPB1 4MDOA 3XISA 2BWGA 4K1WA 2QCDB 3L5AA 4ZB2A 2NQZA 3D3AA 1A5BA 3GHRA 4H7VA 3WLTA 2WB5A 4TOQA 3BLIA 3DI1A 3O16A 1PZ0A 3IJ9A 3FX4A 3L21A 3UNDA 2ZIDA 3O6DA 1S2CA 4HJFA 4PEEA 2QR6A 1K8XA 3G1XA 1J0YA 4QROA 5CC7A 1UP3A 4GY0A 4ZBCA 1OSEA 4LB4A 4CNOA 1LRNA 4EPBC 3S1UA 1V08A 4DIAA 4X9YA 1R2TA 3SN4A 2WHJA 2WM0A 5F1UA 2QCLA 4AVFA 4OV9A 1BEUA 4J3SA 3GDBA 2V5DA 3P60A 1OADA 3UPMA 1WXYA 2IMRA 4RX0A 2PRHA 4A21A 3W00A 5EKYA 2J7BA 2OOGA 1S1RA 1DV7A 3ATZA 1XWYA 3BV4A 4JFWA 4ASTA 4WCJA 1SSDA 4LYKA 4AY1A 2A3LA 3E5BA 3U9IA 3OPSA 5TAOA 4H00A 3USBA 5CBBA 1DYSA 3B0PA 4OT7A 4U5KA 1RPKA 2DT3A 4U3CA 3CC1A 3W7QA 4IGSA 3NWRA 3NO1A 4JD4A 4LV4A 3PJUA 1OIMA 1JRCA 1MEWA 3POCA 1V3HA 7A3HA 3GHTA 4NHVA 4LCQA 2IKIA 4UNLA 4TTGA 3G3DA 2QUUA 2XHYA 2Q02A 3KS6A 4OKDA 3L7RA 4LY8A 1YTEA 2C14A 3S1WA 3A6OA 4DN1A 4Q8UA 1AVAA 3OGVA 3W2MA 4M0XA 2FH8A 3QRHA 1NDZA 2XVLA 1M53A 4DX3A 1P7TA 3W2LA 1Q85A 4JHOA 5AC5A 2WNQA 1EJTC 5I24A 2XU2A 2Z2AA 1TG7A 4UWMA 3W2JA 3TU9A 3BJTA 3C2YA 3U5UA 2D24A 4JKLA 1DXFA 3TC3A 3HG3A 3V5FA 4AMCA 3QMSA 1W9DM 1H1ZA 1AJZA 2FMOA 1UROA 2WNWA 2YYTA 4IGNA 4FOKA 2A2IA 4W5UA 1ITCA 4GWEA 5DT5A 3BV7A 3WSUA 4F3HA 1TTQA 2DPEA 3LCLA 3QW4B 3WKZA 2Y63A 3WQGA 2Q6ZA 1V6YA 3QVQA 2C19A 3HPFA 3RDKA 2RHGA 3TONA 1P0BA 4Q7BA 3B9AA 3C2EA 5C54A 2VVNA 1LLOA 3UGVA 1B31A 2XWDA 4DF0A 4M19A 4R34A 4H19A 4NYUA 3ARZA 3TQPA 4FNQA 2Y85A 4GZJA 4QSHA 2PWUA 1K3UA 1CB7B 3M0LA 4QXIA 4QSFA 2BVYA 3ES7A 1KM5A 3WMCA 3DBNA 3P93A 1FHUA 1C9WA 2QJNA 4Y9OA 4Z0JA 2BS9A 3W1MA 4S2CA 1HFBA 1Q4WA 3V5OA 4MWAB 3LG3A 3FA4A 3VX1A 4WY0B 2XINA 1E3ZA 1UR9A 4AYGA 4E5TA 1YLVA 3I10A 5DO8A 3P0XA 3MHFA 3KLKA 4DJFC 4C6QA 2GPTA 1FFQA 2JGYA 2WJFA 4IQJA 2XIOA 2OWWA 4C6IA 1UMLA 3SAZA 1JFHA 3UJFA 4M81A 1SVDA 1G9HA 4YVXA 3C4UA 3UWWA 4LB3A 3VNLA 3LXCA 3WLJA 4GQBA 4JTUA 3AZRA 1HKMA 2Y24A 3AC0A 3UZWA 3AMGA 4B5TA 4J3XA 2R1KA 3TDFA 1R6WA 2PURA 4MFDA 4JX6A 4NQ1A 1NU5A 1S46A 3K4DA 3EMCA 1TCDA 2O0TA 2W79A 3F5JA 4ZODA 3WQ6A 1XL9A 1GOQA 1RJRA 1WPCA 1DTNA 3GVQA 1Q6QA 2WJZA 2YDRA 4B9ZA 2EG7A 3EX3A 4JX5A 3CIXA 4DBEA 1GVOA 2B81A 3IGSA 1QT1A 1CZ1A 1KGXA 3CL8A 4BF5A 1TWIA 4PFHA 4C6OA 1ZRQA 4J3ZA 1W9BM 4MY8A 1E4LA 1M65A 3H8AA 4CUCA 3MV01 2J7FA 2E7FA 2QNEA 1W3LA 4LW7A 1YIXA 1DP0A 1V93A 2UWFA 5HMSA 1WYIA 5A8QA 1OK4A 1NWUA 4HCLA 3QHNA 4Z42C 4F0LA 3W27A 3G1HA 5F2MA 4YTQA 4PA8A 6CGTA 1AZ2A 1EDGA 1L8NA 1IEXA 4MUZA 1M68A 3S6TA 3QLDA 4DF2A 4XAYA 4XZNX 3OVGA 1GG1A 4DYEA 1MQQA 2RAGA 4NRSA 5K9XA 4L64A 1EX5A 6ALDA 3RJXA 1DJQA 4PTNA 4ZSUA 1JEZA 3VDCA 3KE0A 4I7UA 2YL6A 3SB0A 2WLYA 4QS6A 1JQXA 2XH0A 1I1WA 2JGQA 3E38A 1WDDA 1DJZA 4WSKA 1US3A 2FMNA 3VUSA 3CHEA 3HN3A 2Y2WA 4OIFA 1FCUA 3MKVA 3QN3A 1XBZA 4ZO8A 5IBXC 4ZFMA 3WQOA 2DVTA 3S5YA 2XIIA 5DRCA 3HO8A 4M6PA 3HG5A 1XLBA 4DO5A 3BW3A 1H61A 1OZMA 1Q6GA 2MANA 1FWGC 4GUGA 4GLEA 2PP3A 4FXSA 3F2BA 4N4PA 3N04A 3WLPA 6XIAA 1VJSA 1NP0A 2V3FA 1JDCA 1TVNA 3PWGA 4GG9A 4WD0A 5FJIA 3SRKA 4CQAA 4JTIA 2YB4A 2XH2A 3ALFA 4YJ5A 4N0RA 4GIAA 1EJWC 3EDJA 2BXYA 4XD6A 4TTUA 3E0LA 3P81A 4NI3A 1BSLA 3LZ3A 4JNZA 4UR7A 2OMAA 4LS2A 1RPXA 2JE8A 4ZQPA 3UA3A 1WDSA 3KXQA 3SRHA 4MGGA 3C0QA 1Q6DA 5D8ZA 2XGIA 3H55A 2UY4A 3W70A 3VE9A 2ZDSA 3HPSA 3G5EA 1T7LA 3B8SA 4JTKA 2DQWA 3AHYA 1KR0A 3TEVA 4EWND 1SW3A 2CBIA 1RLCL 1YBQA 5L9FA 2CZDA 3IUIA 4LEFA 4BWLA 1UZDA 4L4MA 4UTHA 2D0FA 1B54A 2OQYA 3AXHA 2CLHA 3BW2A 1HGWA 1WOBA 2C1IA 2QDDA 3I3BA 3HMCA 2X30A 1S5TA 2ATMA 2GJRA 4AZCA 3FKRA 3KX6A 3TROA 3W2NA 1RCQA 2V5JA 3M0VA 1BWVA 4JFSA 5I6SA 3IARA 5C5YA 3R5EA 3VNDA 1IZJA 2E0PA 2J77A 5J5RA 3LTPA 2DUAA 3UJRA 2PD9A 3QH2A 4EXBA 3SCRA 2GJXB 4AUBA 4H9TA 2EXOA 2PDJA 2V3EA 4OBRA 2QJHA 2YX0A 3LHUA 2CERA 4U2YA 1UKQA 1E3XA 4BQ4A 3VILA 1LRQA 2WC3A 3UVAA 4ZOEA 1EJ7L 1UH4A 2CLMA 5KITA 3COTA 1UWAA 1V4YA 4MMWA 2Z26A 1L6GA 1JRBA 3ARSA 2PDIA 2Q8LA 3JZUA 4WOQA 4MY9A 4RV8A 4WQ6A 2VZTA 1JDFA 1KQYA 4B5SA 2E8YA 3SSJA 4LNCA 3ITGA 4G1NA 4QAWA 2CU0A 1W1YA 3FHAA 3BVJA 2FPVA 3C3NA 3K1DA 4GE8A 1UR8A 3MHUA 1OG0A 3CASA 4H9ZA 4J3UA 3WG6A 2CCRA 4AIUA 2RUSA 3MZNA 5FEXA 3ZFHA 2QJGA 1LUCB 2GVLA 3U4FA 2A3BA 5HJYA 4B92A 3RYSA 3SURA 3R0DA 4Q8MA 4BCEA 3LN3A 1E5JA 3W7MA 4A3RA 4CU8A 3E0IA 3D0CA 4PCPA 1DORA 2E67A 5DY3A 2ABAA 5G5IA 4OE7A 4Z1YA 2HRWA 1JPHA 1KFWA 3OBKA 4HZ6A 3HTWA 3B3DA 3SI9A 1TJPA 2ZX6A 4KWVA 3QY6A 1VEMA 5LGXA 3N15A 4MJMA 1S2VA 1K02A 3UA4A 1E9IA 3OOQA 3GXPA 2H90A 4H8UA 3L2IA 4UCFA 4EKJA 1CDGA 3OVQA 4M6UA 5AYYA 2ZTKA 4LRSA 5IFPA 2FVMA 3R12A 1OGBA 1OT2A 2HBXA 1G7UA 4DM2A 3QSTA 2F2HA 3O2LA 1OCQA 3GG0A 2C79A 1CIUA 3LERA 1JDEA 1V7AA 3LHTA 2I5IA 1VBRA 4JTTA 2ESCA 3KRUA 4FNUA 1AL7A 4HIBA 2ZXAA 3KBVA 3EDEA 4DI9A 4EANA 3GNDA 3WH9A 4MWAE 4WXZA 3FJ4A 4UNKA 3TCSA 4WJ8A 2J88A 4D9PA 1R2SA 1CXEA 3PBUA 1IV8A 1CGTA 3O9NA 4UCGA 1QI2A 4LT9A 3LPGA 3CZGA 2ZZ7A 4O54A 3EWCA 1KV5A 1EJSC 2QCFA 3CO4A 1QOQA 3BLLA 4HPGA 2QDGA 4G5DA 5HR6A 2ON3A 1NFPA 1OHLA 2EBNA 3BCJA 1UUMA 3B06A 3W1NA 2ABBA 3EWZA 5ABEA 4JTAA 1JZ8A 1C8VA 2BTMA 2V8ZA 3DIPA 4NSBA 5E5CA 4IMCA 3QEZA 3B9DA 1BXCA 5EMYA 1BVWA 4FMVA 1OABA 1XIHA 2BODX 2W6RA 2XFYA 1B5TA 2WVUA 4U4MA 4DWSA 2QUNA 1V5XA 2WM1A 4TR9A 1D8CA 3EOEA 5CBIA 3LA4A 4L7ZA 3L9CA 1SJDA 1S3TC 3EOLA 4IPLA 3DFYA 2O9OA 3BUVA 1FP9A 3ECQA 4NJGA 3MUZ1 2PDLA 4E2VA 1JDAA 3WQVA 4C6NA 1JZ6A 1UZHA 2HJPA 5DLCA 1CYGA 1KQZA 3USZA 1EP1A 3V5CA 1A5SA 1F6KA 2YPIA 2FGZA 4F0HA 3MHGA 1X6LA 2G4FA 3CQJA 1I2QA 1MWOA 3UF9A 3RITA 3ORWA 1R30A 3BLKA 5I00A 4C6KA 5C9ZA 1NOFA 5K7JA 4CNPA 5JBDA 3W7CA 1KCKA 3A24A 2X7WA 4FB7A 4CNTA 4R7JA 1RA5A 1C8XA 1UKTA 2XFRA 3R89A 4D1IA 1QVBA 1W1B1 4Q3MA 3TQKA 1Q13A 2GDUA 5BROA 3R25A 1SUXA 1GQNA 2BHZA 1XQKA 4AXKA 4I6KA 3R94A 3U57A 1REQA 3NQEA 5I03A 4AZIA 2BG5A 5MKGB 1BKSA 2JKPA 3WFZA 5HMFA 2PTYA 4CGTA 2I14A 4US5A 3PPCA 3UXKA 3W53A 2VX6A 1U5JA 1HO4A 1AFSA 3HMJG 5C7HA 1VR6A 3DHDA 3IACA 5CPLA 2FZ9A 2QZRA 3I4EA 3WQPA 3T4CA 2P5NA 4JIPA 3M0YA 1W1A1 2ZZ2A 1FWAC 4JGDA 4UBPC 2F6KA 1AUSL 2BGQA 1XSJA 4ZB0A 3VM7A 3MCNA 3LB0A 4AHQA 4QJ3B 3QY8A 1DEDA 4L9ZA 3MCMA 4DUVA 3AMCA 3GFXA 4GNVA 1XCWA 2GUBA 4F8XA 3MJYA 2PBOA 4L1WA 5EBAA 3VNYA 3BANA 3UJEA 3P8JA 4ZFCA 5FEZA 4A8NA 2F7FA 4CVWA 4S3GA 4XIAA 5FOOA 1KFKA 4NXKA 1VRDA 3W26A 3W75A 1EIBA 1VHNA 3DXIA 2NWRA 3TQ0A 1CT5A 3CM4A 1GONA 5TIMA 2VEPA 3G22A 3GRIA 2GYIA 3HGJA 3PTMA 3WF4A 5FEPA 4AEFA 1GVSA 4L6DA 1LWJA 3AHZA 1J12A 5DT7A 3D3FA 4IFKB 2NX3A 2DZVA 3B0XA 5CSYA 3T0DA 1M03A 1AD1A 1R3TA 1MDLA 2O7SA 1K7XA 5AYIA 3UD6A 3HPXA 1H7XA 2WHKA 2Y5SA 3E0WA 2QCEA 4A35A 3QMTA 4JTLA 2WO5A 5FJTA 3TC7A 3F2CA 3OB8A 4QCEA 1KR1A 2ZTJA 4YCPA 4ICCX 5G1TA 3P5YA 3WBXA 1PTDA 5TF0A 3EPMA 3VZXA 2G41A 2PAJA 3OGSA 3SCQA 3NQMA 4LUYA 1TV3A 4DBWA 1HL8A 1WNOA 2BHUA 3AS0A 3THAA 4MNLA 3EWYA 3WLOA 3SN0A 3VD9A 3T07A 2EG6A 3N25A 1XKJA 1V0MA 3W6MA 1C7SA 3N2OA 4DZ5A 3H7VA 1B3VA 1EQCA 4F9DA 1UUQA 1TJ1A 4G9PA 1PBGA 3RO6A 2GGGA 3CL7A 3N2MA 4HU4A 2VELA 2W5FA 4FHAA 3AJXA 3VK5A 5CEWA 1NWRA 4FXRA 4DJEC 3LXBA 2J78A 1B0IA 4DO7A 3W24A 4REQA 4W8AA 4NT0A 4C1NB 1IEWA 4K6AA 2PDUA 4J4KA 4MPKA 2J25A 3BAIA 5ECVA 3V4BA 4E4FA 1KC7A 3ZYZA 1K7FA 2R9RA 2Y8KA 1MI3A 1Y7VA 5E70A 1ECQA 2DSKA 2VCAA 1GOOA 2JQXA 4NZCA 1W3TA 2BVTA 4K3ZA 1KLZA 1XHGA 3SQLA 1SJAA 2VZSA 1RK5A 4WDWA 4D6IA 3Q94A 4MIMA 1XCFA 2BHYA 2HVNA 3GAYA 3TYEA 2GQ9A 3PNZA 1HXJA 4RNJA 3UPBA 2HE8A 4HPHA 2X2YA 2Z7KA 4DLMA 4N9DA 1PS9A 1WDPA 4GVHA 4F2TA 3GLCA 2Q8XA 1QNPA 4F2UA 4DY1A 2WMIB 2PGFA 2VWSA 3QR3A 3GXIA 1TPFA 4DWSD 1F3XA 2HK1A 3OZPA 1OX5A 2H3BA 1S39A 1HG3A 2VFHA 4ZE4A 4OFCA 4KWWA 1O12A 2FZ8A 1RAKA 3WF1A 3GG1A 3HJEA 3EX6A 2G3MA 1QMLA 2ZYFA 3QZAA 1TUFA 1TJRA 1J2BA 2WBKA 2XSBA 2QUMA 1XH2A 2VL4A 3CHCA 1UBSA 2VEIA 1D3GA 1VFMA 2NVAA 4B5WA 4O12A 2O9PA 2PWHA 1XLLA 4WKAA 4W9TA 1CGVA 4JQAA 1EUAA 4QM1A 1GW9A 3BL3A 3MWCA 1K9TA 3T55A 1NFGA 4Z0SA 1ECEA 2V69A 4A6GA 1VCVA 3ES8A 1PE1A 1JXKA 1P4CA 3H53A 2W63A 2YIHA 4QCFA 3WLIA 1EUNA 4PTXA 3VC5A 1I2OA 2BV9A 4H01A 1EZ2A 3N34A 1TV8A 5BRQA 3U7VA 3AS2A 3ZWSA 4ZQRA 3V1PA 3PZ9A 4PUWA 1CXKA 2OZ0A 1EP2A 4ZSTA 2QDEA 3E2RA 1GKPA 3THDA 4AVNA 2CHNA 4X60A 3TC6A 4RCXA 3W07A 2C6QA 4R9OA 3JUGA 3C5QA 3CLMA 1EA9C 4KCUA 2VRQA 3GBDA 1UWRA 2E6YA 3UESA 3FIGA 1GVIA 4UOJA 1MXSA 3VKKA 2E6DA 3CTLA 3GC2A 3I6RA 5AHMA 5DN1A 1Q5MA 3NM3A 4EPEC 3DENA 4NAFB 1GPFA 3N6QA 2VZUA 3AXKA 3VO0A 2WZTA 2Y4SA 5FKYA 4MOZA 4D8ZA 4H6EA 3ZZ1A 2OGJA 4BQ5A 5AC7A 1OF8A 2WV8A 1V3JA 2KX9A 3VGHA 2Q8ZA 3UY7A 3KW3A 4XV0A 3N9SA 2XFWA 2V6AA 5K4XA 3HQNA 3KRSA 1V3MA 4I5XA 3BG5A 1Z32X 4QGCA 4ZCWA 2BOEX 3EWXA 3M41A 4MB3A 1TV4A 2ZOXA 1NWSA 3CWNA 3EB4A 2QCGA 2DW7A 2CZ5A 3S9IA 3GY1A 2YLAA 4BF9A 4O53A 1QU4A 3ZT6A 3GYCA 1EOKA 4DJDA 1WP6A 4E8CA 1AH4A 3N9RA 1WZAA 3TN4A 4A2RA 5AN7A 1TWZA 3W76A 2E3ZA 1AODA 4DXXA 2WYSA 1V6XA 1XUUA 4GXMA 3G1DA 4PR4A 4JY9A 3CZKA 3R43A 2W4XA 1V02E 3EKGA 3GDMA 2XN0A 3FJLA 2OZ3A 3PAJA 1W54A 1H11A 2WSQA 4QITA 3UEQA 1XISA 4RK8A 2GK1A 3WUGA 4AZ7A 4Q22A 3GIYA 4C6LA 3DEQA 4MLRA 4URIA 5HPCA 2Y8UA 4AC1X 1S2TA 2V38A 4DZIA 2VQTA 3BLFA 1B3ZA 2RDWA 4X61A 4EF8A 1W8GA 4GXWA 4I9MA 1XLMA 3LHYA 3O6CA 1AQHA 1Z69A 4JEQA 1NAL1 3MO7A 3UWQA 1UWQA 1LP6A 4NNBA 3I65A 3TQVA 2NXIA 1GNXA 2CKRA 1U5HA 3VIGA 1B3OA 4Z1CA 3QR1A 3TYZA 3N4EA 3XIMA 2PPGA 3O0KA 2JF7A 3ENLA 4C6EA 1J0ZA 1BHGA 1KKOA 4FK9A 1W91A 4GJJA 1CTNA 3LI1A 2BVWA 4GH3A 4WOZA 4IJBA 1A5KC 1RR2A 4AY8A 5A6KA 3CHDA 3DYOA 2FZNA 3IJ7A 2AL2A 3K4WA 2XUCA 4DXVA 4CQ9A 1H60A 2VGFA 3R8HA 2ALDA 4PE8A 3CEUA 4H7CA 1LOQA 1HJUA 4LNYA 3S5OA 3WBAA 2OZ8A 3R7MA 3TW6A 3PWAA 1RJQA 4XZLX 2QPSA 3DYPA 5A3HA 2AGKA 1PTAA 2R1LA 1T99A 4IJCA 2OX4A 4XD5A 3SUUA 3AZSA 5KZEA 2ZADA 3FGCA 3HFYA 5BXPA 3MVTA 2Y70A 1OFDA 2PLMA 3P84A 1VB9A 1E1FA 2PDHA 4FXJA 5DCBA 1UASA 2NVCA 5E0KA 1RLDA 2PGRA 1E51A 3AYSA 3GH7A 1WUEA 3MBDA 3UZZA 4V2XA 1WB0A 5D32A 3SM0A 2HK0A 1F74A 2G3JA 2PBGA 3P8IA 4J40A 2Y61A 3CZEA 1ME7A 1R87A 1JXJA 1G67A 4JIQA 4XZ9A 2RFGA 1OINA 2WJEA 2ZZ5A 3GXFA 5H1WA 2GQ8A 1JCJA 3LMYA 1TX2A 1VRXA 1EEXA 3WJWA 4Q4SA 1F2JA 1UC5A 5TNVA 1QXLA 3S2LA 2G5WA 3UZJA 1G94A 4LUTA 3R6IA 5PTDA 2R1PA 1QOPA 4JTGA 3IIZA 3OLDA 3BOFA 4W4QA 5A1AA 2O56A 3LV6A 1K7EA 4C1KA 2TODA 2VD9A 5E9AA 1JVNA 4J3VA 4K38A 2VFIA 1JCTA 4JFTA 3GZAA 3ZVHA 1Z89A 3M9YA 3OZYA 3IS4A 1NFBA 1KWGA 1N55A 3W87A 2Y5EA 1QO2A 2XDFA 1UKOA 5F2LA 2X0SA 3PBYA 3A3HA 2F6XA 3GNRA 3IJIA 4YTTA 2YDSA 5LA1A 4FOUA 1RD5A 2WHLA 1SO5A 5K9CA 4NASA 4FF7A 1BYCA 4P7QA 4Y9AA 3IK4A 5D8WA 5AHFA 2POTA 1G4EA 4IMGA 3VIHA 4KEZA 4LF2A 1MQPA 3ARWA 4LVBA 3ZQ9A 2Y89A 4MNMA 1GT8A 4ACZA 3N13A 1VJIA 3L0NA 2YCIX 4RXGA 4C6PA 1CXFA 3W1TA 1YQ2A 4ZO9A 1LCOA 5JMUA 4GA8A 4LBRA 1HJSA 1EPVA 2C1GA 1XGEA 4RZ4A 1D3HA 4GYJA 1VCFA 2HNEA 3RXZA 3P0WA 4P7OA 1RH9A 4JBRA 4LVFA 1LT8A 3ITLA 4K1GA 2XGBA 3T42A 1XLCA 3PZQA 2D0HA 4Q4KA 3AZTA 2W67A 3GDLA 2WPBA 3PB0A 1J5SA 3MUY1 4OBSA 1KWKA 1ODUA 4JN7A 3KHJA 4NZ3A 1AJ2A 3NEHA 1OFPA 1UZ4A 2ZFAA 2BASA 4J2PA 3SUWA 5I23A 5JVLA 3TUUA 1H2JA 2R24A 4ZENA 3S2CA 4XBJA 4HJWA 1K6WA 2Z1VA 3VMOA 3KEHA 4NNAA 5HJXA 3UETA 2V63A 1S5VA 1VYRA 3HQ1A 2QHAA 2CHOA 4KCWA 3FXGA 4AD5A 1EO5A 3Q58A 2HCVA 2QGYA 2JEPA 1QAPA 3WL0A 2G3IA 3EAUA 3R2GA 3NYDA 4H2HA 4KRTA 4GHRA 4DJDD 1QK2A 1K6AA 2R14A 1TPWA 3T09A 3AXIA 1K9DA 3FEQA 4IP7A 4D6JA 4H2CA 2PEVA 3LRKA 3OEXA 1EP3A 2QULA 1IIHA 2QW5A 2ZCGA 2X09A 4P8UA 3DI0A 1A4MA 1H5VA 4EIVA 2DGAA 3MI2A 3SRDA 3VIOA 2V9DA 4MSSA 1OD8A 5F1VA 4JFVA 1L9WA 1TRDA 2YGYA 5CJNA 1GVQA 1QDSA 2VR4A 5XIMA 2GL5A 4XTIA 3QGAC 3CYJA 4WY0A 2GGJA 1FX6A 4OU1A 2V5LA 3G6LA 4MJ2A 4HCDA 2D23A 4AWUA 2FVKA 4LX4A 2GDQA 3N14A 3LLXA 4QG6A 4NX0A 1IEVA 4JYEA 3AYTA 2HVMA 1R7AA 1V77A 1WBHA 4NP7A 4IQDA 4PB4A 1MQRA 2JEQA 3SCTA 5CG0A 4EP8C 2WVVB 1CBGA 2GUYA 2CXEA 1LDCA 1LM1A 2FTPA 4DO4A 2CLEA 4JY8A 2QCMA 3GG7A 5CC3A 3W1AA 1KCZA 4BFAA 4HYWA 3QF0A 4LSBA 3KBJA 2QV5A 1PCKA 3E02A 5I0DA 1V8EA 4TXEA 4BR1A 4DPQA 2X0YA 4YYCA 3OG3A 1IXQA 2CLFA 1QHPA 4XG1A 2XISA 1CXLA 2J7HA 4KFPA 4QE4A 1IR2A 4QJ4B 3L5LA 3UG8A 1GGOA 3H4WA 1DXEA 3NAVA 2XZ7A 4IUGA 1ITXA 3WD1A 3WJSA 1V0KA 2WK2A 1GQIA 1BTMA 3GUWA 5HDRA 1RBOB 2H6RA 3VDBA 5CGTA 4GABA 3BMXA 3SFWA 1DQWA 4N9EA 7REQA 2RKXA 3M16A 4J9JA 4AZCB 1XG4A 1UW9A 4XISA 4JR5A 1BXBA 5FD0A 2F38A 4M29A 3RRXA 5F2IA 3EPOA 1KM3A 2J7GA 2ZRVA 3GKAA 1TPH1 3B8TA 1BF6A 3N4FA 5I3IA 2TSYA 4MKSA 4GK8A 4LY4A 4XB3A 1W3JA 3MUCA 3POHA 5AVHA 4JZ5A 3TVAA 5XIAA 4PMQA 2XTKA 2FTWA 3MJMA 3LCHA 1TYGA 2Y7GA 3P80A 1XRTA 3CPRA 3SR7A 4XZWA 4LGXA 3KWSA 5KZ6A 4GISA 5HNTA 1F76A 4XKYA 3HU7A 1R9XA 4A05A 2FKPA 4O17A 3K46A 2I5QA 3BMWA 3ZSTA 4PBFA 3NDYA 3M0JA 4TX6A 2XSXA 3E49A 4CU7A 4JHMA 1PB0A 4XTDA 4M82A 1GQKA 3SUVA 5E0CA 2RDTA 4BA0A 5CZSA 1PPIA 1K03A 2DV0A 2VGGA 2IPWA 3A5VA 4PEKA 2IPFA 4EPKA 3GXNA 2EAWA 2JF6A 3M4HA 2YW3A 2PFHA 3BMVA 4GC4A 2ZUMA 5E09A 4AG0A 1W37A 4Q8VA 3HGRA 3L5MA 2QQ6A 3WQWA 5IDIA 1A80A 4J7RA 1QCWA 3DG7A 3GUGA 1IXPA 5C9WA 1F7BA 1BGAA 1WDQA 4RZ5A 3TNBA 4M6VA 2B7NA 3FAXA 3ZJ8A 2PF0A 2PDMA 2QF8A 4R9XA 2WMHA 4HU3A 4XBSA 5BXRA 5K3VA 1YHTA 1XJBA 3I7QA 2VFEA 2X1RA 1PWLA 3FEMA 4J1OA 1X8CA 4GNJA 1G4PA 1KCLA 4B5UA 3BG3A 3M7WA 4MZ1A 3H7RA 1LF1A 3TLLA 4KIRA 1ADSA 3OZOA 3TTYA 1LBLA 2VFFA 3SFKA 3ID7A 1UD3A 2OT0A 5EFFA 2PP1A 4LYQA 3BAXA 1TJ2A 1WE5A 1D2KA 4EK7A 4N9CA 4S1FA 3V18A 1OFQA 1DE6A 3U2OA 2CBJA 3ZLFA 1O5QA 3NEVA 2AQWA 3F1QA 3QGKC 1XX1A 2O7QA 3VDGA 2VEFA 2C16A 1OX6A 4TU1A 3UFYA 2NSXA 1J11A 1ISZA 1ZGDA 2QXWA 4ZO7A 1SM9A 5D03A 4D72A 3G2GA 1ZY9A 1YE6A 3OBEA 1UP2A 2INZA 4IIDA 1WQ5A 1OB0A 3CIVA 4DLFA 1WAUA 3MBFA 3EB2A 2G37A 4PMVA 2I7GA 3VGDA 2EGZA 1FKWA 2GJXA 4GH1A 3LV5A 1MRQA 3A47A 1C93A 1C7TA 3G24A 3APGA 3D46A 4AD2A 1SPQA 2HISA 4AD0A 2VKZG 5HULA 5CG7A 2GVEA 4IL2A 4WY0F 1J5TA 2NSOA 3ZLGA 2X1IA 1FWWA 3MWAA 4QG8A 3B9OA 3K8LA 3UCQA 2P88A 5JUVA 1FQ0A 1I0BA 4PRTA 4D8AA 3RFAA 3VX0A 2ZC8A 1Q4NX 1GHRA 4DWSB 3LQLA 3GU2A 1XPGA 4QQUA 4IICA 1DBTA 2NQJA 3A23A 2YCEA 3TCEA 3C2RA 2Q3OA 2R1NA 3VINA 5CXPA 4G7EA 3DGBA 3RHGA 2JIEA 3N19B 3WNKA 2PDQA 3OHIA 1Q6OA 2BY0A 1DWGM 1XYAA 3W1UA 4S3KA 4ZO6A 3JU2A 5D05A 4P7NA 4QE1A 2IPJA 4I6VA 3VUPA 4G56A 1FFRA 2QMJA 1JAEA 3NPVA 3B40A 1AH3A 1QW8A 3RPMA 3QYSA 1XI3A 4JDYA 5ABFA 1NH6A 3AUOA 3AS1A 5SWUA 2TMDA 1PHWA 4PUDA 3WBEA 1VPXA 3NXFA 3W0KA 2DQXA 2Z6IA 4DYJA 3DFNA 3F5LA 3F4NA 3BZGA 3SSZA 3GW3A 1T5AA 1RUSA 4JTQA 1LBFA 4TVUA 1UQYA 4FLQA 1XSIA 2YDQA 1AMKA 2QEZA 4XUGA 3WF3A 3ABOA 3VZZA 2DZXA 2GJNA 1QJWA 3D47A 5LIYX 3VCNA 2OLHA 1UWTA 1ZU8A 3URQA 2WHMA 5T26A 3UR2A 4JL1A 3SO7A 4QDWA 3V0TA 4DHGA 1F07A 2BP1A 4YIWA 2VDGA 2I16A 4CQBA 5T8GA 2HMCA 1EJXC 1QHOA 4MYAA 2P3ZA 2BBFA 4V1YA 3PP7A 3VMNA 3LK6A 5DBUA 1QRQA 1JD9A 3ARUA 5HNUA 7ODCA 1NOWA 3KVJA 4CNSA 2IKHA 2YBTA 4UQEA 1E9LA 1UD6A 1VP5A 3QBUA 4Q8NA 4TVDA 3WH6A 3WMLA 4Z2IA 3W7GA 4HT3A 1RVGA 2YFNA 1FXQA 2GOUA 3FKKA 5I06A 1A5OC 2J66A 3NYZA 1ZBVA 2G50A 3TJXA 1FCVA 2ZRUA 4YS1A 1EF3A 3W84A 1BQGA 3CJPA 4H1ZA 3HFTA 5LHEA 4M7TA 2AQOA 3UQNA 1M7OA 1XS2A 1O1HA 3ITTA 1Q8AA 4TVCA 3EDKA 3UW6A 3OHMB 3FYOA 3WD0A 3NVDA 1QI0A 3LM7A 1VEOA 3T05A 3FW6A 1T6MA 4GPNA 1FWDC 3VI2A 1E56A 3RPDA 1B3WA 1J0HA 4LVAA 1UD2A 1GOIA 3M07A 3RM8A 3LNMA 2I57A 2XIQA 4LCSA 2DJLA 3PTKA 4R85A 4GI9A 1VKFA 3R58A 5IHRA 1QPRA 2NV1A 4N02A 4EOUA 4IQEA 1HL2A 5A2AA 3PUGA 2WZMA 2YDAA 1BFNA 1JZ3A 5LNWA 3RIKA 1AW1A 2ZUSA 2NW0A 3GW0A 2VT0A 3KP0A 4K7YA 3L4XA 4JIHA 1FRBA 4M6QA 3KOWA 4ZL1A 4C91A 2W66A 3GFYA 4Q4MA 2OKOA 3PUEA 1IWAA 1VBHA 2A3EA 4YHEA 4GUIA 1OM0A 4F2BA 1H7NA 2ZXQA 3ARXA 3UZXA 3A9IA 1QK0A 1US2A 2V82A 4A2SA 4BEQA 3W7OA 1VPYA 4GUHA 3R8RA 5HUPA 5LZLA 4DM1A 2F9RA 3UXIA 2G96A 5CZKA 3BSMA 2YJQA 1O68A 1GOWA 2OO6A 3KWXA 3ARRA 2V3GA 5KEZA 5AKQA 1Q65A 1OC5A 2Y7EA 1JUEA 3M0HA 3RR1A 3YPIA 3KVMA 1NY1A 4E8GA 3SY8A 4FX7A 3FV9A 2A6LA 1WKYA 5AHIA 3AFBA 3GDRA 3L12A 3EWUA 4XAZA 3W9ZA 5H8MA 1UR3M 4M24A 2YB1A 2Z4GA 3WDJA 2EO7A 2QUTA 3BURA 1PO9A 1S5NA 1J79A 3WUFA 4AISA 1OT1A 3BG9A 5A2CA 4KCTA 4O13A 4IUOA 1GCYA 2Z25A 1KA9F 3RCNA 6PTDA 1XR2A 5LGZA 5D09A 2R6OA 3CUXA 3NZPA 4BI5A 4J3WA 2WMKA 1TR9A 4JCLA 3IUDA 1D7FA 1TB3A 3RU6A 3PVFA 5JH2A 3ZM8A 3UGRA 3QPYA 5EBUA 4ZQMA 1QW9A 3DUGA 2Y7FA 1IZKA 4Q4PA 2BZNA 1XLEA 5AC6A 3W38A 4E0CA 1YDNA 5CPOA 3KZPA 2QPUA 3NUKA 3LTSA 1MEHA 1AD4A 4A8RA 5KMYA 1DL3A 1TMLA 4O1EA 1JZ4A 3IV3A 1KXQA 1P0NA 1TTIA 4DAFA 3VD3A 3GR7A 3RX2A 4UB9A 4XD4A 1PZ3A 5C2GA 3N2CA 1AJ0A 3CAWA 3STGA 4NVTA 4H9VA 3MSYA 4GVGA 3BE7A 3P67A 4WUIA 4E4UA 3ZMRA 4JNMA 2VDHA 1MO0A 2TPSA 3MI6A 8TIMA 5GJPA 4OJYA 3VZYA 3GNXA 3PPHA 1LROA 2FHCA 5BMWA 4S3EA 2ISDA 2YL9A 4LH8A 3SY1A 2P8CA 1EJRC 4H3DA 4C7FA 3WYZA 4QJ5B 4GGBA 3M6YA 3W22A 1TPEA 3WF2A 3KTCA 1IHIA 3TA6A 4OWGA 3H22A 1TIWA 4XX6A 1ZSXA 2ZRZA 4PMRA 3UWEA 1HIZA 4PMYA 4KRUA 5I02A 3RO8A 4LC8A 1SZRA 3S3GA 3PJXA 1HO1A 2A7NA 4GCXA 2ATSA 3CUJA 3PTDA 1JCMP 1LWHA 3PWIA 3NNTA 1E0XA 1DIOA 4KKXA 4AH7A 2J24A 4ZQCA 4C1NA 3NDZA 4JS3A 3B8IA 3MQTA 2HSAA 2OB3A 3Q37A 2G95A 2VYOA 4Z2HA 4PMDA 2OFJA 2HQAA 4KIEA 4PMXA 1IT8A 4FO4A 2E77A 1W5MA 3H24A 2ADAA 3H4GA 2WZEA 3ME3A 2ZE3A 5EYWA 4JEJA 3NSXA 1AK5A 5K9DA 4YTRA 1DWAM 3CK5A 1TWDA 5CQ1A 4O1FA 4I5RA 4M3PA 3CQHA 5TBOA 3RN6A 7TIMA 3H54A 6REQB 4IM4A 3MSDA 4W89A 4GI8A 1A53A 1UKSA 2RDXA 1UR4A 4YTSA 2FDSA 1KRAC 2WMIA 2IS7A 1A5NC 3RX3A 1O6IA 1FWJC 3ARYA 4IIGA 2WZHA 4HBKA 3HBLA 3BW4A 4ICMA 1NQKA 5CPMA 2WWDA 4R33A 2RGMA 3AICA 2HNHA 1GQJA 1OFRA 1HVQA 3LQGA 1E4NA 3NL2A 4AB4A 4L6HA 4RJEA 4AIBA 3TJIA 1TKKA 3F4DA 3AIBA 1UIOA 3U6WA 1LTDA 3BJSA 2VO5A 4PMOA 3TMQA 4HTYA 4ATDA 1QNVA 4QHRA 1NM9A 3WEOA 3QPEA 1VENA 2A85A 3UERA 5JBFA 1EGVA 1EO7A 1LL4A 3EWBX 3PN8A 2VGBA 4PFMA 3CZ8A 2NQ9A 3DDMA 1GVYA 1B1YA 4GOAA 4AY7A 4GCAA 2DZBA 4OOUA 4KGLA 5A8NA 3TN6A 2C91A 1HN1A 3BK0A 4A8IA 4INFA 2ZE0A 3B8WA 4LUSA 5BOOA 2O92A 3RRAA 4P7RA 4CNNA 1H1YA 2XM2A 2I9UA 4NY2A 1VC4A 4CU6A 4GQQA 4S23A 2YA1A 1NTHA 3VOHA 3UWZA 4EWJA 1SGJA 4EXAA 2AL2B 1I2NA 1DJYA 1QPNA 1E6QM 2JKAA 1KBBA 1IGWA 1XYZA 4HNVA 4B3LA 2FFIA 1AQMA 4OVXA 2VM8A 3Q4DA 3V7PA 1GOXA 3VOGA 4B91A 1E6ZA 4YTUA 3O3RA 3ABXA 3MB9A 4MKNA 5D02A 2J27A 2J8FA 1EGZA 4XSMA 3B8VA 1LG1A 2H8XA 3AIUA 1TTPA 5C0QA 4NAFA 3HQOA 3UG3A 3ABQA 1OGSA 3W28A 4C65A 4WX2A 3BAKA 1ONWA 3KBSA 1YADA 1OCNA 1KXHA 4DF1A 2Q01A 1VQTA 2BNJA 2TAAA 2HV5A 4QDMA 2I5GA 3GVRA 1EJVC 5D38A 2ZUWA 1A3WA 3G0UA 4KQNA 3VTRA 3VIIA 2NV9A 1I6NA 3BDKA 1PIGA 2DDXA 1J6PA 3INPA 1NF0A 4IGMA 3PC0A 5FSDC 3LPOA 4XQ6A 1QNOA 1JF5A 3PK7A 2HROA 1TE6A 2EF9A 3WFLA 1W5PA 4BQ2A 5G4WA 1I4NA 3G0XA 3W3OA 5EB8A 1IWPA 5AYZA 1T96A 5EU9A 3C3UA 2DVUA 1E55A 3KFTA 4LUTB 4NZ5A 5EPDA 3VFCA 4KEUA 2UY3A 3KRZA 4O4VA 3SCUA 4RE4A 1DWFM 2FIQA 4ICNA 1G6CA 3HV9A 3NPUA 5E0FA 2ZA1A 1B4EA 4WR3A 1DIDA 4L4PA 5F4WA 3VU2A 1ZNNA 3LY0A 3SIMA 3T44A 3PJWA 3ZVHB 4UIOA 5HATA 3T81A 5CZJA 2HVOA 2PF8A 5FAGA 3RILA 5CLTA 4YN5A 4I7WA 3EKLA 1R3QA 4N2YA 1O1ZA 3GU1A 5U4NA 3QOMA 1FWBC 1D8WA 5FEWA 5K2ZA 4UQAA 1HTIA 1YEYA 3VAVA 3EXSA 4AAJA 3WY1A 3N3MA 3PPFA 2WBGA 1HGYA 4L6OA 4L61A 3QKZA 4HCHA 2WNZA 2X05A 1NSJA 4ACZB 5AC8A 1H7PA 3MO4A 4AIOA 1SO6A 4P8WA 4FX8A 2YLLA 3WJZA 2CBVA 2XIJA 1H7WA 4GQRA 1A3XA 4D6CA 1ZJIA 3N6JA 3AHVA 2C0AA 3U8GA 3LU2A 1FDJA 1IXOA 1B30A 5H6HA 5A6TC 1HF6A 3GHSA 1IEIA 2P0OA 3LCWA 3WJXA 3PG8A 4FSAA 1QNQA 3QSRA 4H6RA 3GC5A 2PMQA 4JTJA 4Q6JA 1XP3A 3QXBA 4WXYA 3DFSA 1KM1A 1BG9A 1K8CA 3VM5A 1ONRA 1V6VA 5A6JA 1I1XA 4X3ZA 2HS8A 3A3XA 4WJXA 2FGLA 3FA5A 5AZ0A 2VX7A 4EX4A 4I8YA 4ERIA 4CD6A 3T0CA 1QI4A 2ZBTA 1PJ9A 3DZ1A 3N29A 1ENUA 3O8AA 1V6UA 2VX5A 4WRHA 1I0DA 5M3WA 1I9CB 3P82A 4UTMA 3RLHA 2NLYA 2QUVA 1L8PA 1IYXA 1XLIA 2ZKMX 5FL0A 4W7VA 4DAIA 5M1TA 5CPQA 3UZ5A 2PD5A 3PBWA 2F8QA 4FR6A 2PDWA 1FWRA 4WDXA 5CJMA 4RPQA 4Q4RA 2E25A 1PX3A 1JULA 4PB3A 1VLWA 1FDYA 1HJVA 1OYCA 2PWDA 1XBYA 3OIXA 3CYVA 1XLFA 5BMXA 3R1ZA 4JAWA 1H50A 3IJLA 4O0ZA 3A9BA