5J5DA

Crystal structure of dihydrodipicolinate synthase from mycobacterium tuberculosis in complex with alpha-ketopimelic acid
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
297
structure length
297
Chain Sequence
VGFDVAARLGTLLTAMVTPFSGDGSLDTATAARLANHLVDQGCDGLVVSGTTGESPTTTDGEKIELLRAVLEAVGDRARVIAGAGTYDTAHSIRLAKACAAEGAHGLLVVTPYYSKPPQRGLQAHFTAVADATELPMLLYDIPGRSAVPIEPDTIRALASHPNIVGVKDAKADLHSGAQIMADTGLAYYSGDDALNLPWLAMGATGFISVIAHLAAGQLRELLSAFGSGDIATARKINIAVAPLCNAMSRLGGVTLSKAGLRLQGIDVGDPRLPQVAATPEQIDALAADMRAASVLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-hydroxy-tetrahydrodipicolinate synthase
publication title Inhibition of Mycobacterium tuberculosis dihydrodipicolinate synthase by alpha-ketopimelic acid and its other structural analogues
pubmed doi rcsb
source organism Mycobacterium tuberculosis h37rv
molecule tags Lyase
total genus 113
structure length 297
sequence length 297
ec nomenclature ec 4.3.3.7: 4-hydroxy-tetrahydrodipicolinate synthase.
pdb deposition date 2016-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5j5dA00
4TU1A 1N55A 5DY2A 4N2YA 4A22A 3S6DA 1JQVA 5BMWA 1HL2A 3BG3A 4HIBA 4K7YA 3LCIA 2VEIA 3O16A 1NEYA 1F05A 3KOFA 3QC3A 4TMCA 2QF7A 2GQAA 5LGZA 4UFMA 4K38A 5G2HA 1GYNA 1MO0A 4UMBA 1KBJA 3W83A 5I3GA 4LVBA 2YPIA 1QAPA 5FEZA 1M6JA 1TTJA 3W9ZA 4AHPA 4FO4A 4QITA 4IQLA 1A50A 4MJMA 1EP1A 1F7BA 2FQIA 2J88A 2YSWA 1W5PA 3L2IA 1K8ZA 3P62A 5AHLA 2YCEA 1WX0A 3EB2A 3HF3A 4E0CA 2V5LA 2A7PA 1CX9A 3IV3A 3W87A 3L0NA 1PL9A 4OWGA 4RCXA 1M7PA 3QYQA 1IXNA 5FEXA 5LNWA 4JXCA 2Y7DA 3VE9A 3N14A 2Q8ZA 1OYBA 3UQNA 3EWYA 1VYRA 3FEMA 3IIVA 2YXGA 3NQDA 1MXSA 4N9EA 3T7VA 3W7OA 1MEIA 4RX0A 4HNUA 4JDBA 1NF7A 1PE1A 3W7RA 2J24A 3HO8A 3G24A 3LDVA 4EF8A 3MYPA 1L6SA 4JX5A 2CLMA 1JCYA 2B4GA 2ZTKA 3PUDA 5D2XA 4CCDA 1FDZA 1P0NA 3SIZA 4KWVA 2NV2A 1LZOA 1NF0A 2CLKA 5AHMA 3LM7A 1Z48A 3HIJA 1PVNA 1TCDA 2ZA1A 2A4AA 1H7OA 2ISSA 3F4WA 4LVDA 4O11A 2CLHA 1F2JA 1TPC1 4YCOA 3UXAA 3NGJA 5HR7A 1VYPX 3SGUA 1TJRA 3N2MA 1YTDA 2R94A 4JTJA 1W3NA 2W79A 4HSOA 4PCFA 4UFKA 4KKXA 4DXVA 1Z41A 5I3HA 1SFJA 3TA6A 3QMTA 2YYUA 1WBJA 4HNVA 3KFTA 3OIXA 3SECA 1SZEA 2FB3A 3RNDA 3PB0A 3UNDA 3EWWA 5HUOA 1PS9A 1JUKA 4ONVA 3MI6A 1GQNA 5EKYA 4LVFA 3W7GA 1KFBA 3G1XA 4PC8A 1SR9A 3W76A 3TJLA 1RQBA 5LKYA 2JBMA 4O10A 4FHAA 3M16A 3FFSA 4ZZ9A 2ZRZA 1HO1A 2VKZG 2HS6A 4ZQRA 3S42A 4DEFA 1G4SA 1KFEA 3STFA 4MJZA 3OVQA 3PULA 2C19A 4S2CA 2B0MA 2ZRXA 3TMLA 5EA9A 1H51A 4GUHA 4GFSA 5LHFA 3LXCA 3G1AA 1VHCA 3GXPA 4UC5A 4Y96A 1ADOA 5I3JA 4O1BA 4Z0JA 2R14A 3KAOA 1WBHA 1XM3A 1LOQA 2VXNA 3BO9A 1ZJIA 1G4EA 5AC7A 2FPVA 1XI3A 3LHUA 4B5NA 5DCBA 3DKLA 3PUOA 3B8DA 1J2WA 2Y62A 4AWUA 3T40A 3WK2A 1LRNA 4PH6A 5E93A 1L6WA 3S5ZA 4O1CA 2JKAA 5EBUA 3UWWA 2C3ZA 4MUZA 3LXAA 3R2GA 1W5NA 4I7VA 1QOPA 3EKLA 2G95A 2Y7FA 2EHHA 4QAIA 3S5YA 3TXVA 4ORMA 4RZ4A 2OCZA 3P5ZA 3LOTA 4MLJA 4WD0A 4Z1BA 1W54A 5BRBA 1SSGA 3DHDA 1FWWA 3S1UA 1RVGA 1QWGA 1K03A 2WJZA 4M6PA 3FOKA 1JCJA 1JCXA 2ZA3A 3TR2A 4JIPA 1ME8A 4ML9A 1GVQA 4DF1A 3KRSA 1OK4A 3DXIA 3PAJA 1WOAA 2V8ZA 2NWRA 3FJLA 1AW5A 2DZXA 3BGJA 3GKAA 2W6RA 4DBDA 2ABBA 3RLVA 1EB3A 1ICSA 3W7JA 1D3GA 4PL1A 5L9FA 5AC8A 1OX4B 4AXKA 1OFRA 5G4EA 4NZJA 3H55A 1QDSA 3W1NA 4RKAA 4DO4A 4HT3A 4OBTA 5HWNA 4OT7A 2H3DA 1X6UA 1YXDA 3GR8A 3S1XA 3TC6A 3CPRA 2HMCA 3UZ5A 1ZFJA 3E96A 2TSYA 3SJ3A 1B4EA 4BI5A 2ZRYA 3TNOA 3FJ6A 3THAA 1TTQA 3W2KA 4WUIA 1OFEA 3MHUA 3DZ1A 3W7QA 2BWGA 1SZFA 1TQXA 1FXPA 2P0OA 1VLIA 4WY0F 4A2SA 2NUWA 5HULA 4DF2A 2A7RA 1DJNA 2ZYFA 2QEZA 3T78A 2E6YA 3DFNA 4Y9AA 1DQWA 1TPB1 2FLIA 1TRDA 3GVGA 1YXCA 3CEUA 2LLEA 3NZ1A 4UTWC 1WDWA 4OV9A 2ABAA 3QMRA 3DFOA 2A0NA 3C52A 3GDTA 3PSWA 1ICPA 3W7IA 1TPDA 4UTUA 4UXDA 5FEPA 1JULA 4UTWA 3NXFA 2CLLA 4DQWA 5K9DA 2NZLA 2H3BA 1KV5A 2E6DA 2RHGA 5HMSA 2YR1A 1DQXA 1AK5A 3NPVA 2E5DA 1AL8A 1G4TA 1Z42A 2E77A 3TW6A 2B7NA 3NQ8A 3G18A 7TIMA 1IF2A 2X30A 2DZPA 2QUTA 3M41A 1W0MA 5KZMA 3DFPA 4UTJA 3ABSA 4YLWA 1W56A 3HJZA 4ADTA 1EUNA 4BR1A 4C1KA 3MBFA 2CFFA 4CNOA 1E51A 3L0KA 4N6FA 2CLFA 3G1HA 3R8RA 4M5PA 4XZ9A 2WNNA 1I2PA 1YTKA 4OV4A 4XKYB 5D33A 5HNRA 4JY9A 1C8VA 4GWEA 4UFLA 5KINA 1QNVA 1K02A 4NJGA 5IM51 1RV8A 3WJZA 4FEZA 4NT0A 3A5VA 3UWZA 4BF9A 2DZTA 4UIOA 4MPQA 4K36A 5D2TA 3UWQA 3RMJA 3TFCA 1FBAA 1ONRA 2NLIA 4MY1A 1Q6QA 3BGGA 1G67A 4O0ZA 2YDAA 3CB8A 2Q3RA 2V82A 3P60A 1PIIA 3K30A 1SO3A 2ZCGA 2E6AA 1BTMA 2C15A 4LV9A 2GVJA 1TTPA 4YXGA 3B05A 3L0GA 3UWYA 1OABA 1F73A 1ICQA 3W84A 3W07A 1XBXA 1OG0A 1W5MA 3EXTA 2OMAA 3DFTA 3W2NA 2FDSA 3IGSA 4Z1AA 2A6LA 1O95A 4UFJA 3W2JA 4XBSA 2QJGA 3STEA 3LTYA 3GAKA 2A1YA 1ML1A 2DJLA 2FPYA 1TTIA 4LOCA 4LS0A 2A5HA 5H91A 1GVOA 5CPNA 4FX7A 5CKSA 3W88A 3U8GA 3I68A 3DH7A 3C2FA 1YDNA 2DU2A 2ZZ4A 3N2XA 1LM1A 1LDCA 3LCLA 5F1VA 1VZWA 3LHZA 3IEBA 4OHQA 3RU6A 1FCQA 4S2BA 5AC6A 3NVTA 1R30A 1OX6A 3GZ3A 3NL3A 5BOOA 2YX0A 2TYSA 2ZTJA 1SO4A 3LCFA 1KBIA 4Z08A 5FF4A 3NQFA 4DPPA 4JTTA 3ZFHA 3S1VA 4GUIA 1KM4A 3HMJG 3FLUA 4BFAA 1GWJA 2BZNA 4TX9A 4A29A 3L9CA 1LRQA 3PF3A 3NYZA 2DZVA 3E12A 5HINA 1ZCOA 2J9XA 3RFAA 2C6QA 5LHEA 2C16A 4LW7A 4K7VA 1TO3A 5EYWA 1ALDA 3TV8A 3VNDA 1OYCA 2YZRA 1FDJA 5F4WA 3C2RA 3MWAA 5DN1A 2HSAA 4FNRA 3W1AA 3G22A 2D73A 1WAUA 3TCEA 1W3IA 4LWWA 3GB6A 1K7XA 2Z1BA 3P80A 3W1UA 1S5VA 3BLEA 1HFBA 1VQTA 1FCUA 2X16A 2A7NA 2XN1A 4RV8A 2UV8G 4FNSA 3OBKA 5AHFA 1KTNA 2E5BA 2QCLA 3QPZA 5I3IA 2DZWA 3GAYA 3MO7A 4O8RA 1UCWA 1VH7A 2B7PA 2P10A 3PY2A 3N3MA 1OX5A 1UUMA 3TUUA 1L6YA 3TXZA 3CU2A 4JICA 3MMTA 2G97A 3W23A 5DCEA 1G69A 3O6CA 2H90A 3NQ7A 3P67A 3GXTA 2NX3A 3B03A 4UCGA 3PBYA 5FESA 2NUXA 3O06A 4A21A 2V0TA 1ME9A 4LC6A 4UFIA 4P2VA 1XUUA 1KFKA 1DORA 3FIGA 3M5YA 4NXSA 1YXYA 3B04A 2JGYA 3C4UA 3T44A 1OF6A 3I7QA 5EL1A 5HR6A 5T26A 4HHPA 5A5WA 5GVJA 3UYCA 2F7FA 3LLFA 2NUYA 2E5CA 1RQHA 1JJKA 2DP3A 2E68A 4HKPA 3UY8A 3W1XA 1LYXA 3MHGA 4NVTA 3PBWA 4IWWA 5G4WA 3KRUA 2RFGA 3LCWA 1L2UA 4FX6M 3E49A 1TPVA 1LLZA 1O60A 2VFHA 2YFNA 4HNTA 2HS8A 3P81A 1C9DA 4JYEA 3MUXA 2IQTA 1KLYA 4XBKA 1PV8A 1RD5A 2TMDA 4LTSA 4AMAA 3A21A 1KW1A 3O05A 1TMHA 4ZQCA 5C6MA 1YDVA 3MP5A 4X2RA 2CZEA 1T8XA 4I7UA 2A21A 2NXIA 2V81A 4Z1CA 3I65A 3HBLA 1G4PA 4MZYA 1S5TA 1X8FA 5HUPA 2QCMA 1LBFA 3W7EA 1SW0A 1GTEA 2R91A 3ABQA 3KXQA 3IVTA 1ZALA 3S5OA 1KLZA 1EA0A 1TB3A 2WKJA 3KHJA 4AHQA 1D9EA 3T4CA 2ISWA 2GVGA 1H7WA 3OHIA 3Q2DA 5I3KA 4MOZA 1EIXA 1SO5A 4FIRA 1N8FA 1KM2A 3W2UA 3PSVA 5K3VA 4I7WA 4EIVA 5K4ZA 1TYGA 3QH2A 1KA9F 2ALDA 1AG1O 3NEVA 1GVSA 3HPXA 1R2TA 1H60A 3THQA 1OJXA 3DHFA 3O63A 4N4PA 1IGSA 5CZSA 5G1YA 3NZRA 3L21A 4L4LA 4WOZA 2QCDB 1KFCA 2QDGA 1A5CA 3I7RA 3TH6A 2FIQA 5D37A 3STGA 3R89A 5D09A 4LRSA 4IUOA 2VFIA 3SW6A 1RR2A 2G5WA 1U83A 3R5EA 2QJHA 4FNPA 5DBUA 1W37A 2X1SA 3OG3A 1I45A 3GYEA 2VFDA 4OQVA 5DBTA 1X1ZA 1KTCA 5FF2A 1SFLA 5HQEA 3LCXA 1EP2A 2WV8A 4JGDA 4MZ1A 4EVZA 3VFLA 3BARA 1T99A 3UY7A 3MYOA 4QNEA 5AYYA 1XDLA 2A6NA 4P61A 4HPXA 1J4EA 2C0AA 4CCEA 5A8GA 3LHWA 3W72A 4PTNA 3FKRA 1R47A 4UNKA 2RDTA 3I6RA 3W7KA 1LP6A 3GK0A 4XQ6A 3N9SA 2CLIA 4H6KA 1PCWA 2EF9A 3LERA 1TV8A 1SSDA 3ZWTA 3EWUA 4K37A 5AYZA 3W7NA 3TSMA 4GUFA 1K7EA 2EPHA 1B3OA 3USBA 5D30A 3C8FA 4ZQPA 4PFMA 3ABRA 1GVRA 5CSRA 1QPNA 3TMQA 2FPTA 3MJYA 3UPWA 2WOQA 3A23A 1VGAA 5G5IA 5LSMA 3O6YX 3WK0A 4LUIA 3LTSA 3NQEA 4IXHA 1JCLA 1K8XA 4LY8A 1EP3A 1V7YA 1VJIA 4CLMA 3LXBA 1X7FA 3L5AA 3NQ2A 3PG8A 3W1PA 4NXKA 4KFNA 3W7PA 3N9RA 3G1YA 1LBLA 1UASA 4AHOA 1Q6LA 1TPWA 1AW1A 1QPRA 2JGQA 1XBVA 3G0XA 4JTFA 1DL3A 5J5DA 2X1UA 3VKJA 5DXYA 2VFFA 1OYAA 5K9XA 3W1MA 4N02A 1R2SA 1D3HA 2AGKA 1KTBA 3ANYA 3U2OA 1ZAIA 2Z2UA 4Y90A 1IIHA 4R53A 3TROA 5FF7A 5ABTA 3E02A 4L4MA 2FB2A 1Q45A 2OZ0A 1JUEA 1OVDA 3NQVA 3C61A 1K3UA 2NXGA 1I2RA 2WO5A 3IIZA 4ICNA 3L67A 2OX1A 2XFWA 1YPIA 3GNNA 3HG4A 3BPWA 3EWXA 2ZA2A 1H50A 3F03K 1KFLA 3RF9A 1H7XA 1M7OA 2QCHA 2RDWA 4PEKA 4ADSA 4TO8A 3CEPA 3ABOA 2CZDA 3V1PA 4AF0A 4E38A 4FXSA 3FYOA 2FFCA 1VYSX 3MP3A 1ZHAA 1VR6A 3FA5A 1FWNA 4GBUA 4O1DA 5LGXA 1EWDA 1IXPA 4Q4KA 2I1OA 5CZTA 3NQAA 3LCHA 5KZEA 4C1LA 1OFOA 2QUUA 4N6EA 1ME7A 3UWVA 5AYXA 3QM3A 3CT7A 4YWIA 2I9EA 1OHLA 3PR2A 2RKXA 2AAMA 3DI0A 1VS1A 3B4UA 1JCNA 1L9WA 3RK8A 3A24A 1EEPA 3BG5A 4H4IA 1TV5A 4O13A 5FF3A 3RLUA 3IGXA 3R12A 5KZDA 4TIMA 4A2RA 3Q94A 1W1ZA 4LVGA 2VEMA 2V2CA 3NO5A 3W85A 1UBSA 2QAFA 5CSSA 1OFQA 4O1AA 2NX9A 3M5VA 4R7JA 3TKFA 5TQLA 4NJIA 1RZMA 1LBMA 4YCPA 1XKYA 4RR4A 2QJIA 5KMYA 2WSQA 3UWUA 3M43A 2OT0A 3LRLA 3QZEA 4JIQA 3R13A 4O15A 3G0UA 4LUJA 2A2IA 1P5BA 3NL2A 3Q37A 4JTUA 3BW3A 4JYFA 3TE9A 5IBXC 3UXDA 3EX4A 4D2JA 3LBMA 1W3TA 4JTHA 2I14A 3LHVA 4POCA 3TIMA 3F4NA 3TQVA 4JX4A 3NL6A 4O0KA 5IBXA 3C6CA 4JN6A 5C5YA 1F74A 1WXJA 2QCNA 2WNZA 3HPSA 5SWUA 3W1TA 3EKZA 2WNQA 2VELA 3SR7A 3LCGA 5HWMA 3PM6A 1P4CA 3B06A 3G1VA 3S8HA 3INPA 4WY0B 4Z0SA 5J5RA 2PRLA 3S1WA 1KM0A 5LNSA 4NNCA 2O7SA 1OF8A 2C13A 3EX6A 1UJPA 2O7QA 1ZAJA 2ZRWA 3ATZA 1B4KA 4O4WA 2ZZ5A 5LZLA 3DU0A 4OGZA 4OU1A 2TRSA 1I2QA 1RPXA 2X2GA 2PCQA 3TC7A 4FNTA 5F1UA 2QAPA 1XL9A 3W7DA 4K6AA 3G3MA 1WOBA 5AHNA 4LC8A 4N4QA 2NX1A 2WQPA 1BEUA 4UTHA 5I3FA 1VCFA 2YW3A 5F2GA 3BVJA 1H1ZA 4UTMA 1KFJA 3L5MA 3WJWA 3S9YA 4QM1A 3TU9A 3NQCA 4XUGA 1GZGA 3B0PA 3WJXA 1TPFA 3A5FA 5C55A 4U4MA 1XXXA 2EGZA 4NNBA 4M7SA 1PCKA 1DVJA 4XWUA 5H2ZA 2HTMA 2FJKA 3TW7A 4AH7A 4J9JA 5AOUA 1VCVA 4R34A 5AHEA 2OJPA 3N34A 5LNVA 4WQ6A 4BI7A 4QSHA 3O1NA 3DKJA 3CIWA 3H54A 2Q8LA 4FIQA 2Q3OA 1JUBA 3GNDA 1GVFA 1O5KA 3TQKA 3MW7A 4PODA 3WK1A 1A5BA 5CG7A 2H6RA 2Y7EA 3EEGA 4EWND 2WSYA 4O14A 1X1OA 4DF0A 1OFAA 5E0KA 1CW2A 3WJYA 1VRDA 3KX6A 4NX5A 1P1XA 1G6CA 2EAWA 3HGSA 1OFPA 1V5XA 3NQGA 5CGQA 1DKWA 3ELFA 1FCVA 5K9CA 4UTTC 4H3DA 4NQ1A 3MHFA 3EXSA 3IVSA 2ZRUA 1OFDA 2J27A 4LU0A 2QCEA 3EWZA 2WSRA 4UTTA 4FX8A 2CZ5A 4LS1A 4LVAA 4IPIA 3BG9A 4IMDA 4BK9A 4ZL1A 1WQ5A 3KRZA 3SGZA 3WFAA 1FX6A 2W0UA 3W1QA 4UTIA 4YMZA 2PRMA 3CM4A 1B57A 4N9DA 2R8WA 3TFXA 5BMXA 1GG1A 5DELA 5D05A 2YFOA 2CU0A 1H7RA 1AW2A 1GYLA 2Y61A 2XN0A 1BWKA 3SY5A 3CIXA 1YYAA 3OVPA 2EKCA 4NZFA 3W74A 5K7JA 1ZNNA 1O4UA 3CQ0A 2NV1A 2ATSA 3WJSA 2YW4A 3A9IA 4O28A 4AWSA 4FB7A 1H5YA 4UTKA 1F5ZA 4X22A 3GKFA 4N9BA 2C18A 1LOLA 3UD6A 3C56A 3W1RA 3S5NA 3QEZA 3GR7A 5HWJA 3JRKA 5K2ZA 4ZMGA 1TREA 2Y89A 3PS7A 4LNYA 4QJ1A 1BWLA 4MY9A 3TJXA 3EX2A 1C29A 1F6PA 4ZVJA 3HOJA 1M5WA 2ATMA 4JTKA 3CTLA 3FS2A 1W31A 3G0SA 1H7NA 3L66A 5TIMA 4DO5A 1VCGA 5CPLA 1EWEA 1QPQA 3AJXA 1R46A 1TSIA 3QJAA 1NVMA 3W22A 3H53A 3F1QA 2C1HA 8TIMA 2Z6JA 2Y7GA 3PC0A 4O54A 3CHVA 4MZ8A 2DJXA 2ZZ1A 4X3ZA 3NG3A 4O50A 1JRBA 3NPXA 4PA8A 2YGYA 1WA3A 6TIMA 3M47A 4AWTA 1NFBA 2CLOA 1RQEA 4AEOA 3P84A 1SUXA 4Y8FA 1LTDA 4JTEA 4WXYA 2GPTA 4O57A 4BI6A 3LLDA 1VLWA 4O19A 1DHPA 5EY5A 1XFBA 2PRHA 2ZDRA 1TV7A 3G1FA 3V75A 2QCCA 5AN7A 3O07A 3LRKA 4X9SA 2QDHA 1W5OA 4MYAA 2V2HA 3C0JA 1SZNA 1YLVA 1GG0A 4DBEA 3W73A 1LORA 4O53A 4TMBA 2NXHA 4IMEA 4DO6A 5BNKA 4YL2A 3TAOA 1DOSA 3LX9A 1HO4A 3TQ0A 4MYXA 3IVUA 2X1RA 4Q32A 4LS2A 2A85A 2VEKA 1JRCA 1TPH1 2VFEA 1TPEA 1SQ7A 2VENA 1OFBA 4GUJA 5CPOA 3P5YA 4LT9A 4JTIA 1H1YA 1W8SA 2J6XA 1AMKA 3UZJA 3WK3A 2B7OA 2BLEA 3W6YA 5C2XA 4IJBA 3GLCA 2J9ZA 3BLFA 4JTLA 1JR1A 3LV6A 4FXRA 3C2EA 3HPZA 1H63A 1FUYA 3STCA 4NUWA 1VC4A 5FF0A 1UUOA 4ALDA 1MEWA 3QPYA 3ZS4A 3DGRA 1F6KA 1GJPA 3W7MA 3DENA 3W70A 1BKSA 1SW7A 1NSJA 3PVFA 2Y88A 3Q58A 4AVFA 4IXXA 2VFGA 1HUVA 1GT8A 1OX4A 3M44A 3I7SA 1XBZA 4M6QA 4Q33A 3S0CA 3B0UX 3PB2A 1PHWA 5CPMA 3EX1A 4AB4A 4UNLA 5DLCA 5C54A 3BW2A 2CLEA 5G2WA 2P1FA 4FNUA 4CCCA 2GOUA 4IMGA 1QCWA 3PWAA 3SZ8A 1THFD 2V2DA 4BWLC 1ZENA 2H8XA 4QQ3A 2DZSA 5DXXA 1PHQA 2ZZ6A 3LI1A 1MEHA 4RXGA 1IXOA 4MKNA 3QF0A 1J5TA 4GE8A 4BWLA 4JDYA 2OT1A 5D2VA 3O6DA 3LBCA 1QO2A 1HG3A 2CZFA 4WX2A 5KSWA 1GPWA 1JCMP 2Y70A 5D32A 2B7QA 2ZZ2A 4M19A 3E9AA 5LNUA 4QIUA 3KVLA 1SO6A 1YPFA 5CZ0A 1AL7A 3C2OA 4HNNA 1WYIA 3ATYA 4UTLA 3TDFA 3M9YA 2ZFAA 3VI2A 1U5JA 4RZ5A 4ZQMA 5G2IA 5K4XA 4IMCA 3HG3A 3GDKA 3GDRA 1F76A 1XCFA 4QISA 3D0CA 1SZGA 3NQMA 3NPWA 4UFHA 4NU7A 4GUGA 3P61A 1LROA 4XTDA 1EUAA 5F2MA 3P8IA 4GXMA 4UMAA 3HGJA 4UR7A 5G1TA 2ZRVA 2E09A 2ISVA 1QMLA 4NNAA 5U7SA 5KITA 1NAL1 3HGRA 4XKYA 4O4VA 3CWNA 1FY6A 4IOTA 1KV8A 1I2OA 1T0OA 3CWOX 3QRHA 3BW4A 2PE4A 4QNWA 5F2LA 3OVRA 2VOMA 4KWWA 3O8AA 2G96A 3GX9A 1TJPA 3P74A 4MLRA 5F2IA 3M5ZA 3DBPA 1SW3A 4UR8A 3CLMA 1I8JA 2QUVA 3NM1A 2YYTA 3QSRA 4CQAA 3QQ1A 1S3HA 2RDUA 3LI0A 4HN4A 1K7FA 4WY0A 5BW6A 4CQ9A 1QO5A 4GC4A 4DPQA 5FEWA 2X1TA 3LB0A 3FKKA 5D2WA 3TAKA 2C14A 3GXNA 2QKFA 5FI8A 4EOUA 2ZZ3A 1FWRA 1B9BA 2E1DA 3HB9A 1WV2A 1DJQA 4O17A 3G3DA 4PL2A 4MVAA 2GUUA 3MI2A 3IRDA 4ADUA 3T55A 2BXVA 1Q6OA 5F4SA 3W7HA 2CW6A 2PURA 3G8EA 3IIPA 3G8RA 5D03A 3W86A 5AHIA 4JY8A 1FWSA 4K8EA 3NR0A 4OE7A 4CNPA 1JQXA 1QFEA 4JR5A 3GDLA 1JVNA 3M6YA 2CWNA 4KFOA 1YADA 2J9YA 3A22A 4NJJA 4E2DA 2GQ9A 4KFPA 1MSSA 4K8HA 4CNNA 3MI3A 1UB3A 3MP4A 4GRSA 2F84A 2WPBA 2ZBTA 4GJ1A 3P7YA 4RK8A 2GJLA 2QCGA 1G7VA 2Z0IA 4CQ8A 1FCBA 1TIMA 4DELA 1A53A 1GTHA 3HQ1A 6ALDA 3G1SA 1KM3A 3MBDA 4WJEA 3DI1A 3O15A 4IMFA 4RZ6A 2GJNA 1O94A 3UPBA 4G1KA 5D2YA 3W1LA 1YDOA 1K8YA 4WXZA 3IIXA 4FF7A 3KVKA 4NJKA 1A5SA 4RJEA 3HG2A 4JEQA 1HTIA 4K39A 1XDMA 3CC1A 4LV4A 4S1FA 1QPOA 1XUZA 4JTGA 4RXFA 5D02A 4M7TA 5DY3A 3NL5A 4JYDA 3P8JA 3HGOA 3NQ6A 1P0KA 2PC4A 2Y63A 4W9TA 1Q3NA 4AF0B 1DBTA 3GIYA 3DFQA 2QR6A 1LLWA 4HPJA 4Y6GA 1T96A 1GEQA 1GOXA 1MZHA 4JX6A 4XTIA 3DAQA 3FYPA 3LRMA 4JNMA 1I4NA 5CZJA 3W71A 3OEXA 4IX2A 2KZHA 1SU5A 2Z6IA 4JD4A 4R33A 1N7KA 3KVJA 4O52A 4GNJA 3W3OA 2Y85A 1LCOA 2E6FA 1R2RA 3M1ZA 2ZQ0A 3AO0A 2JKPA 3EXRA 1O5XA 3W7LA 3L65A 3QQ0A 3QW3A 5E1QA 5EPDA 4O18A 3NOEA 3B0VC 3G1DA 2GQ8A 3NNTA 2GVLA 4O16A 3PBVA 5KTLA 4ORIA 4WOQA 4MY8A 3W2LA 3JS3A 3SI9A 1QOQA 2JK2A 3TSBA 3QSTA 1G7UA 2DZUA 2VEPA 3EWBX 3N73A 5L6UA 2XN2A 2TPSA 4UMCA 4ZQOA 1KM6A 4EF9A 1KM5A 3W2MA 3VE7A 2JKEA 2RH9A 3L5LA 3P82A 1TRIA 3M5XA 3IIOA 1Y0EA 4RLIA 3JR2A 4O12A 4IX0A 1EPXA 3W75A 3E0IA 1DV7A 1SPQA 4WZHA 3QFEA 3TK7A 3BLIA 1XBYA 3U6WA 3ZR4A 3EX3A 4IGHA 2DORA 2VC6A 4MIMA 1H62A 4NX0A 2BSLA 1IIGA 2FTPA 5MHBA 3QMSA 3DFSA 2BX7A 1QR7A 3TX9A 1A5AA 3YPIA 4M6VA 1Q6RA 3PG9A 3W7CA 1TQJA 3M0ZA 4NJHA 1VPXA 4MFDA 2ZZ7A 4HSNA 1VHNA 2NWSA 4N9CA 2AQWA 3L68A 3NM3A 4AAJA 3LGEA 1ZY9A 4Z1DA 4LRTA 3GDMA 3C3NA 1S5WA 1EX5A 3ZWSA 3VCRA 3PBUA 4E2BA 1I2NA 1FQ0A 3NAVA 5HJLA 5D38A 3N19B 3C2VA 5AB3A 3LHYA 1OK6A 2BTMA 1XC4A 5DCDA 1YTEA 3IGUA 4U28A 3SSJA 1LOSA 2V30A 4MFEA 5TBOA 1KM1A 4IPJA 4JTSA 3BK0A 1FWTA 4TR9A 1H61A 3KVMA 5LNRA 3M7WA 4JS3A 3NDOA 4ZQNA 3LTPA 4UUIA 3NPUA 2H8ZA 3OA3A 1Z44A 2Y6ZA 4A3UA 5U4NA 3BV4A 2V5BA 3HG5A 3PUEA 1FDYA 5AFDA 1W5QA 3QW4B 3NA8A 1TPUA 2QCFA 3LHTA 5F4XA 1LRTA 3SFKA 1CI1A 1ZAHA 1IXQA 5EMUA 1H7PA 4FNQA 3LV5A 1FXQA 5D04C 3TSDA 2QCDA 2V9DA 4I9AA
chains in the Genus database with same CATH superfamily
3AOFA 4ERAA 1EKOA 2PCEA 5DY2A 3GNRA 4HIBA 3WQ8A 4JNZA 4TMCA 3QC3A 4PTWA 2QF7A 4LGXA 4UFMA 4K38A 7PTDA 3P14A 2QYGA 4UMBA 5CPTA 1MWOA 2DH3A 3AMKA 3UG4A 3N11A 4ENLA 4WVXA 4LVBA 1V03A 1RY8A 4E4FA 3M46A 4QITA 4JTRA 4IQLA 5AVHA 3QZ6A 2FQIA 3SGGA 3AALA 3PZIA 4FF5A 3P62A 2HCVA 1TFVA 3EB2A 4L80A 2A7PA 3L0NA 3PNUA 1IXNA 1HJXA 3NO3A 4GIEA 2Y7DA 1R86A 3RO8A 3NQDA 2YXGA 4RX0A 3GY1A 1A3XA 1ISXA 2Y5EA 3LDVA 4IGNA 1JCYA 4CCDA 1FDZA 1PDYA 2NV2A 1LZOA 2QPXA 3DECA 3R8HA 3PTDA 3HIJA 2WCSA 3RYSA 1JNDA 1I1WA 1XIJA 4GYJA 4B4HA 4QJ3B 4GZEA 3WLRA 1FHVA 4PMZA 3UXAA 3RHGA 3RILA 3NGJA 3S9ZA 1FWEC 1VYPX 3SGUA 3WQFA 3N2MA 3II1A 2R94A 1T6MA 2UY2A 3M0MA 1V93A 5HMFA 4IL2A 3QVQA 4PCFA 1Z41A 5I3HA 2ZUVA 4GPNA 1R9ZA 3QMTA 2YYUA 4HNVA 1C93A 1JDCA 2FB3A 4C1NB 3ARZA 3CAQA 3EKGA 4WJXA 4LVFA 4C6IA 3W7GA 4J3TA 5CSYA 4GLEA 3U2ZA 2X09A 3RM9A 3UCCA 1RQBA 3NSMA 2WM1A 3VKAA 1UP2A 3S42A 4DEFA 1KFEA 1HKWA 1E56A 3OVQA 1UOZA 3TMLA 2B0MA 1H51A 1KXQA 1PKLA 3G1AA 1XX1A 2CBVA 3HQPA 4Z0JA 3DHUA 2E9MA 3WNMA 4JFWA 1ZJIA 2FPVA 5EGRA 3LHUA 4KT2A 3IJ7A 3PUOA 4D8LA 4E3VA 2Y62A 4L9YA 4PH6A 1PTAA 3EAUA 2I56A 4NZ4A 1QHOA 1AUSL 4IIDA 1W17A 2CEQA 4O1CA 4DUVA 4MUZA 5EB8A 3EGJA 4QEEA 3MCMA 1RBLA 2G95A 4X63A 2VDIA 4QLLA 4ORMA 4RZ4A 4DJEC 4S3KA 3B9AA 2PDWA 3P5ZA 4Z1BA 1W54A 4LUTB 1SSGA 5TNVA 3S1UA 3VMOA 2BGQA 4L9ZA 1K03A 4MNLA 2WJZA 1OGSA 5M1TA 1ENUA 1GZ1A 3UZYA 5GNZA 1JCXA 2Y2WA 1EF2A 3GC2A 3WMCA 1GVQA 4DF1A 3KRSA 3DXIA 2REQA 3BH4A 4DBDA 2ABBA 4PL1A 4IP4A 4FXFA 4AXKA 3H55A 4DO4A 4CQBA 1ZSXA 3GTXA 1YXDA 5FSEC 3S1XA 1Q66A 3CPRA 1V8EA 3QY7A 1WDQA 4YYFA 4DJED 2YCJA 1PX3A 2EJAA 3SJ3A 1LG2A 2ZRYA 3LU2A 4QCEA 3NGFA 1Q8JA 3G6MA 3MHUA 3PWIA 1BF2A 3N1AA 1VLIA 4A2SA 2NUWA 5HULA 3UU0A 5I09A 2OGYA 2PZ0A 1IR2A 3CZGA 1Q6FA 1DTNA 1OT2A 2QEZA 3S2NA 3T78A 5IDZA 1DQWA 2P50A 4UTWC 4OV9A 4LUSB 4G6CA 2ACRA 1DWIM 4JCMA 3GH5A 3PSWA 2BY2A 1JNEA 2NT0A 1ICPA 1TPDA 1UWQA 4UXDA 1HJWA 2J7EA 3LNMA 3BLPX 4DQWA 1XR2A 2H3BA 1KV5A 2E6DA 2RHGA 5I2UA 4AXNA 3WD2A 1AK5A 3NPVA 2E5DA 1AL8A 3FY1A 2DT3A 1R3SA 2EG8A 2IQ0A 3TW6A 2B7NA 3PZTA 2DVTA 1ZJHA 4AZIA 4PUEA 4HN8A 1V3HA 2QUTA 5KZMA 4JKMA 1W56A 3HJZA 2PBOA 4INFA 3D46A 3CHFA 3G1HA 3L12A 3ARRA 1A0EA 1VFFA 4NHVA 2WNNA 3K4DA 4OV4A 5D33A 4JY9A 3IS4A 2D69A 4UFLA 5HPCA 4Q4PA 1GQIA 1K02A 3WN6A 2V5JA 3RPMA 3MC5A 3S83A 4NT0A 5HQMA 4BF9A 2DZTA 1TV2A 1PTDA 3RMJA 3VNIA 4NIRA 1V0MA 4O0ZA 4GYKA 3CB8A 3WNNA 4M3PA 3WLNA 3DHPA 1OGBA 1HXJA 1DWFM 5M3WA 2C15A 5JVLA 2ZICA 4LV9A 3TC3A 2GVJA 2PDCA 2PDJA 1FVPA 4FXJA 1OABA 1F73A 3L23A 1E0TA 1PIGA 3W07A 2DUXA 1TA3B 1DYSA 2X40A 1W5MA 2OMAA 3DFTA 4GNKB 1GOQA 1WAWA 2V3EA 3QTPA 3RR4A 3COTA 4AZ6A 3QHNA 2VT0A 3ABXA 5FJUA 1ML1A 2PWDA 4E2OA 1TTIA 4LOCA 3OBEA 4J4KA 5CPNA 5A2CA 3OZPA 1P6WA 3URAA 1UPMB 1MW2A 3I68A 3C2FA 3IV8A 2ZZ4A 1PDZA 5F1VA 4I5UA 2HVNA 1UD3A 3IEBA 4OHQA 1VB9A 5FKYA 1FCQA 5AC6A 5A95A 3NVTA 3GZ3A 2I5QA 3C5QA 4XAPA 2TYSA 2ZTJA 1J0HA 1SO4A 1KBIA 4Z2HA 3NQFA 4PFHA 1P7TB 4JHZA 2XGZA 4XAZA 4GUIA 1R38A 3LGGA 1VBRA 4BFAA 3LLXA 1UD8A 3KL0A 2OLHA 1TVLA 2R1NA 3VMNA 4H8VA 1RJPA 2D22A 4PMOA 4QXIA 3LNPA 2DZVA 5DF0A 5HINA 4TV6A 4DUXA 2C6QA 2GK1B 3P2VA 3HM7A 3CQKA 1H1NA 1TO3A 2HE5A 4GYPC 3VNDA 5DO8A 2YZRA 1P0DA 3WQOA 3WFLA 3WSUA 1JZ4A 2YDSA 3G22A 2X42A 1BTCA 2PWHA 4EX4A 2JF6A 1K7XA 3P80A 4JAWA 1OD8A 3GU2A 1FTXA 3EPMA 4DAIA 2UV8G 3XINA 3M7SA 5AHFA 5DRIA 3MO7A 2FDMA 1BYCA 3B40A 2B7PA 1KR0A 1J01A 3NTYA 3MCNA 1PKNA 1UUMA 3OLDA 6ENLA 3W23A 3NQ7A 3P67A 2NX3A 3B03A 4UCGA 4B2DA 2E40A 4GZJA 3Q45A 4V28A 4A05A 3PBYA 4P2VA 2W3ZA 1KFKA 1CCWB 2BASA 1YXYA 2JGYA 1UWTA 4HOXA 1EA9C 1NH6A 2PDGA 2DY3A 2QLYA 5T26A 4M81A 3UYCA 5HAOA 2QGHA 2E5CA 4BQ5A 5BCAA 4NVTA 2P3EA 2X0HA 3PZNA 2IUZA 3RUBL 4XZHA 3MCOA 4A3RA 1WDPA 1X39A 3E49A 3I4EA 2OQHA 2QQ6A 2OYKA 3GTIA 1UA7A 2Y8UA 2CESA 3BAJA 1B2YA 3MUXA 4XBKA 1PV8A 4XO7A 4ROQA 3ES8A 2QDEA 4LTSA 3A21A 4QDWA 3T08A 4QE1A 4M8UA 1EC8A 1KR1A 3A3WA 1PX8A 1YDVA 5ABFB 3FAWA 2EBNA 2V81A 3HBLA 4MZYA 2FYMA 5HUPA 1LBFA 4YVXA 1GTEA 4DM1A 3KXQA 3S5OA 3PN8A 4HP5A 5BWFA 3R1ZA 3CASA 4MPKA 4AHQA 2ZC1A 3TTOA 3T4CA 2ISWA 4QDMA 3OHIA 2DEPA 5I3KA 5C71A 1EIXA 3GM8A 4FIRA 4I7WA 3ITCA 3ALGA 3V5CA 1PEZA 1RVKA 4GA8A 1AG1O 1UZ1A 1GVSA 1H60A 1BWVA 3M0YA 1QHPA 3SAZA 5CZSA 2X7VA 5CCZA 3I7RA 3MSDA 5J04A 5D37A 4EACA 4XK2A 2VGGA 4ERGA 5D09A 3TLLA 2AL1A 3T8LA 1DPMA 3CZJA 4EXBA 3R5EA 2FVLA 2DQXA 3XISA 1UZDA 4PYSA 4XKMA 1W37A 1B3ZA 1CGXA 5CPQA 4RE2A 4OQVA 2GFTA 3DCPA 1KTCA 3GO2A 3TQPA 3WF1A 3WDIA 4MZ1A 2XIJA 1XSJA 3VFLA 2GQ3A 3BARA 3UJ2A 4Q7NA 3MYOA 4H8UA 2JF7A 3WBEA 4XD4A 5AYYA 4LPCA 2E4TA 5PTDA 4JQ2A 4P61A 3OGSA 4H7CA 5A6AA 1EJVC 1JCTA 1VPQA 1W3HA 1VD6A 2YOCA 3LHWA 3BAIA 4UNKA 2RDTA 1W8GA 3W7KA 5H1WA 3H2FA 3MKCA 3C0QA 2CLIA 4XZBA 4A3QA 4DZAA 3T0DA 4L4PA 4AYSA 1TV8A 4E8DA 4LF2A 5AYZA 4L9XA 1B3OA 3QY8A 1L6FA 1DIEA 5D30A 3S4TA 3FXYA 2WJFA 3MANA 5CSRA 3MJYA 3UPWA 3A23A 4W85A 1YPXA 1K8CA 1VGAA 5LSMA 4LUIA 1FHLA 2X0SA 4L56A 3RX3A 1K8XA 1HKJA 4MGGA 4FZIA 1EP3A 1V7YA 7CGTA 1KRMA 2YBUA 3LXBA 5GNYA 3W1PA 1QNRA 3N9RA 1UASA 4AHOA 3GTHA 3OHMB 4F48A 3RX2A 4Z2IA 1POJA 4F8XA 2YDRA 5J5DA 1MW0A 5D9OA 1M53A 2X1UA 4JHMA 3ALFA 1V7AA 2VQTA 5K9XA 2J25A 3CO4A 2G0WA 3W0KA 1V6WA 4N02A 1R2SA 4GXPA 2FH8A 2AMGA 3T1GA 4RW3A 3LN3A 1IYXA 4Y90A 4MKSA 3GNOA 1IIHA 4R53A 5CJNA 2OLAA 4BA0A 1SYTA 3CV6A 3NQVA 1NFGA 3C61A 1K6WA 1OC7A 1K3UA 1I2RA 2Z2AA 1FWJC 2OEKA 2WO5A 4ICNA 2OX1A 3WLLA 1CZ1A 2XFWA 3BPWA 2ZE0A 3BTNA 3UCQA 1TUXA 1UZ4A 3UWEA 2QCHA 2RDWA 4PEKA 4ADSA 3ABOA 2CPUA 4E38A 1HW6A 1MYRA 4S3FA 1WZLA 3FA5A 4EE9A 4O1DA 1EWDA 2CIPA 2I1OA 2ZXAA 3EPOA 2IXVA 2PLMA 3H21A 4JIEA 1XG3A 3L4VA 4N6EA 1ME7A 4NYYA 5AYXA 2I9EA 2RKXA 4GCXA 2BNJA 1VS1A 2BDQA 1JCNA 1X97A 3KP0A 4KWSA 3BAKA 3N18A 3RK8A 3A24A 3CB3A 1TV5A 1E6PA 2WAGA 5FF3A 4I8DA 2O9PA 1XRVA 1TX2A 2VEMA 1DQUA 1JI1A 2QAFA 3MUY1 1E9YB 1MDRA 4O1AA 3WF3A 3M5VA 1GCYA 4NJIA 1H41A 4R85A 1RZMA 5CC6A 4H41A 1XKYA 1T5AA 2WSQA 4PMXA 4O15A 3AYTA 1UD5A 4DRSA 3VNKA 5IBXC 1CTNA 2F2HA 3LBMA 4R7OA 3LHVA 4WDWA 1GPFA 4BF5A 4JX4A 2REQB 2CKSA 2BODX 3TN5A 2J7GA 2CXGA 3RR1A 3U4FA 3ITGA 4JN7A 2NT1A 3ARTA 1C3FA 2Z7GA 4J5NA 4M56A 3G1VA 4WY0B 3GUGA 2PRLA 4ICMA 5LNSA 1OF8A 3IK2A 3NQBA 3PPHA 1TCMA 2O7QA 3OP2A 2VJXA 2ZRWA 3D3FA 1ODZA 3ATZA 2J7HA 3UG5A 3EA2A 1ITUA 3DU0A 3MDUA 3GYCA 4OU1A 3HFYA 2FZBA 1X38A 8XIAA 2GWGA 3K8MA 3TC7A 2XPKA 4D9PA 4DUOA 1ZU8A 4YVVA 1REQA 1V6XA 3U57A 1J9YA 4K6AA 1BQCA 1FA2A 2VI0A 2O4MA 1JXJA 4Z2GA 3QTGA 1TZZA 1KFJA 3EOEA 3K8KA 2WLZA 3OO2A 3S46A 4HA0A 4C6BA 4Z2KA 2WMGA 1ITXA 1XG4A 4NZ5A 3OIHA 4B5WA 3R0KA 4XZIA 4HK6A 1ZLPA 4QP0A 1QASA 4R34A 5C2CA 3LYEA 3OG2A 1DWGM 1WPCA 3N34A 4NAFA 3KTCA 2KAUC 4C7DA 1DWJM 1I6NA 3W4RA 2PDLA 4WR3A 2V67A 1A0CA 1EGZA 1A5BA 1CBGA 2H6RA 3WNKA 3KBSA 1TVNA 4L6HA 4O14A 1OFAA 5CGMA 1P1XA 1E5JA 1G6CA 2JIEA 2EAWA 4RNIA 1IE7C 5FAJA 1UR3M 3F7JA 1XRFA 2VR4A 4E3TA 5BXTA 1QT1A 3GTFA 3UGVA 2VX7A 2G3NA 2B31A 3GG8A 1E6ZA 1OFDA 5HNUA 4TXEA 2HPMA 4W84A 1UYQA 5BZAA 3ES7A 2WSRA 4UTTA 5CBIA 4TX8A 3POHA 3GH7A 8A3HA 1SJDA 4KGLA 4ZL1A 4RW5A 1WQ5A 3W27A 4P7NA 3MUIA 5GJMA 5M2FX 3SURA 1B9ZA 3SO7A 3TFXA 2HNEA 5DELA 4ACYA 2YFOA 2CU0A 3I4KA 1I9CB 1KRBC 1AW2A 1CT5A 3MZ2A 2Y61A 4MWAA 3T0BA 5K7JA 3AFBA 3CQ0A 3WJSA 3TNBA 4H9ZA 4J2MA 4FB7A 3R6IA 1H5YA 3K1GA 4UBPC 1N82A 2BHZA 4N9BA 1T41A 3GVWA 3ICJA 3QEZA 4XD5A 1KNWA 4ZCWA 1HJSA 5K2ZA 4ZMGA 1TREA 1EQCA 5CXPA 4LNYA 4QR6A 3TJXA 5CGTA 3E74A 3HOJA 1QBAA 4AZBA 3BZJA 3ZLFA 5HBFA 2ICSA 4U5KA 1HKIA 3RJXA 4UQAA 4DO5A 2PDBA 1QPQA 4YTUA 1TSIA 2F6UA 3W22A 3VGFA 4Y9MA 2C71A 2E7FA 2ZIDA 4V15A 2C1HA 2WKLA 3CHVA 4JKLA 2W5FA 1MNZA 1CGWA 4X3ZA 1KB3A 1IZJA 4BQ3A 4PA8A 2YA2A 3CUZA 3M47A 5ABHA 1NFBA 4AEOA 1BD0A 3P84A 3T42A 4C6LA 1BXBA 1MW1A 4O57A 1S2VA 3LLDA 1VLWA 4EK7A 2E25A 2XIMA 4GX9A 3WLSA 4M29A 2PRHA 3ZT6A 2VRQA 5BWAA 1TV7A 3CLWA 3G1FA 3V75A 3VOCA 2QCCA 4X9SA 4XZMX 4DWDA 2V2HA 1E70M 2HDJA 4H83A 4TMBA 3H2MA 1OG6A 2DIJA 4JIHA 4YL2A 3RG6A 1PJ9A 4LFYA 3LX9A 3GRIA 2PDFA 4JKKA 4LS2A 1MZRA 3H2EA 4EPEC 1JRCA 2FFIA 3GFZA 2Z00A 1O68A 2FHFA 4MB1A 4K1GA 3IUIA 1AMKA 3UZJA 2BLEA 3W6YA 5C2XA 5E0CA 3GLCA 5FJTA 3GDBA 2OKOA 3LV6A 1LL6A 4L6DA 5I3DA 4NUWA 5I0DA 4LBRA 3W70A 3PVFA 4AVFA 4IXXA 1ISZA 1ONXA 4QX4A 2WHLA 3BC9A 4PCSA 2J7DA 5CPMA 1Y7VA 3XIMA 1GQKA 2OZ3A 3BW2A 1HKVA 4X0NA 1QPKA 1E40A 1HVXA 1QCWA 1HL9A 3BSMA 4B16A 2XWEA 3MTWA 1OC6A 1XYZA 1J96A 4BWLC 3B8TA 2GJPA 1Z69A 4HHHA 4MKNA 3QF0A 3BXWA 4GE8A 1VBJA 4GQ0A 3LZ5A 1TX0A 4JDYA 4QLKA 4WSJA 3O6DA 6PTDA 2WJEA 2B7QA 3GQYA 5LNUA 2QJJA 3KVLA 4G56A 1SO6A 1YPFA 4DY1A 1TWWA 4QFUA 3C2OA 4HNNA 3CWHA 3W02A 1M9HA 4CN4A 3VI2A 1UP0A 3WLMA 1ECQA 1OT1A 3O3RA 4IMCA 1E55A 3P3BA 3KOXA 3MUZ1 3I6TA 4UFHA 1EUAA 3P8IA 4GXMA 2XU2A 3HGJA 4HPGA 4Q6JA 2F8QA 2ISVA 3WLHA 1QMLA 4LCRA 4NNAA 2WQDA 1PO9A 4ZFMA 1NAL1 1I2OA 2VO5A 2J7FA 3TN3A 3AMDA 3BW4A 2PE4A 5TF0A 4J3VA 1M65A 1Q5MA 1IZCA 1KCLA 4F9JA 4DJDA 4MLRA 4AMCA 3SRDA 5DX7A 4HVXA 2ZX5A 4P8UA 1EJ7L 2YYTA 4I9TA 4TVUA 3MPGA 1QBBA 4J3XA 1XLMA 4CQAA 2J8TA 1S3HA 2WVVA 3LI0A 4HN4A 2WSKA 3VCCA 2YL5A 1QO5A 3AZTA 3PTKA 1S5MA 4GC4A 4F4RA 2WJDA 2QIIA 1V3LA 1YMYA 2EPMX 2Z26A 1C91A 3M6DA 2C14A 3URQA 2QKFA 2D3NA 4EOUA 2BGNE 3MV11 2Q6ZA 2E1DA 3FGCA 5FJIA 2J62A 2HXTA 1BPLB 5HJYA 2YL8A 2GUUA 2PEVA 4ADUA 2WNWA 3T55A 3V35A 2WVUA 4PSPA 3RCYA 2BXVA 1Q6OA 2G3IA 1X96A 3ZOAA 2J7BA 4ZSTA 3W86A 2EQDA 2EG7A 4DWSA 3ZZ1A 1XLLA 4QJ5B 2YLAA 3WLOA 1QFEA 2Z2BA 2CWNA 3B8UA 4LAZA 1VFMA 1E6XM 4E2DA 2XZ9A 2GQ9A 1NQKA 1ITQA 4KFPA 1KGXA 4K8HA 3RU8X 2C0HA 4GCAA 4CNNA 3MP4A 4GRSA 2WPBA 3HJEA 3P7YA 2YLLA 2GJLA 2GDQA 1YHTA 4CQ8A 1TIMA 1A53A 2QF8A 6ALDA 2RUSA 3MBDA 3GSMA 4L4OA 5EMYA 1OINA 3M07A 3SB0A 3SCSA 2RDXA 2GJNA 3UPBA 4C6KA 1YDOA 2PUZA 4RJEA 3BSHA 1HTIA 1XDMA 3AMCA 4MNJA 4S1FA 1XIBA 4JTGA 4FR6A 3HGOA 3DFQA 1XH0A 1PZ2A 2INZA 4GYFA 4HPJA 1H2JA 2OTDA 1GOXA 4WKAA 5JH1A 4JNMA 4K3ZA 3VD9A 3OEXA 2IXUA 3KVJA 4L1GA 5I06A 1R3TA 3MUAA 3LGDA 4GNJA 2Y85A 4EXQA 1W3JA 3EDJA 3EOOA 3M1ZA 3F4VA 2JKPA 4F79A 1O5XA 3L65A 3R25A 4BCEA 4O18A 1YE6A 4W86A 3FX4A 2GVLA 4O16A 2NLYA 2V3DA 1QOQA 3TSBA 3E0WA 2DZUA 2PZNA 1W2VA 3DG3A 3V7PA 1DP0A 1SJCA 1DIOA 3CIVA 1O12A 3W2MA 4H6QA 3VE7A 3IIOA 2FKPA 5TD4A 2Z4GA 2F61A 3GNPA 1OCNA 3W75A 4B3ZA 4GFIA 4NSBA 4DJFA 1G9HA 3TK7A 1UW9A 3BLIA 4GVGA 4FS9A 4OTKA 4IGHA 2VC6A 4AZHA 3N04A 1XLBA 4MUPA 3FSTA 1QR7A 2OSYA 4GO8A 4PB3A 3VMPA 1Q6RA 3PG9A 3M0ZA 1IEQA 5A6JA 1HKMA 4FSAA 1E0VA 3AXIA 3QLDA 1VHNA 4H01A 1XYLA 3VDAA 3GDMA 3C3NA 3VC5A 3P93A 1GONA 2W27A 3N25A 4E2BA 5ABGA 1REQB 3AIVA 3DERA 3NAVA 3ZLGA 3TEVA 1EF3A 3N19B 5AB3A 2QJNA 1OK6A 2BTMA 1YTEA 4D1IA 1KXTA 1KM1A 3R10A 3WY1A 4TR9A 2D2GA 2QS8A 3R11A 3LSBA 3LTPA 3R94A 3OA3A 1J8VA 4BF7A 1JPMA 3VIJA 3OU8A 3HG5A 3B97A 2NVDA 1XW8A 1W5QA 3QW4B 2QCFA 5F4XA 3SFKA 4QS6A 1J0KA 4FNQA 1SMAA 4NAFB 3W00A 3WLQA 4ZSUA 3TSDA 1E9IA 4AG0A 4I9AA 2YB4A 4TU1A 2VURA 2I57A 1Q2SA 4DN1A 2ZDSA 4N2YA 4A22A 3AYVA 1JQVA 4IPPA 3SY8A 3BG3A 1WNOA 4K7YA 3LCIA 3UR5A 3ZR6A 3KOFA 4DLMA 5G2HA 4XG1A 1GYNA 1MO0A 3RLHA 3W83A 1QAPA 5FEZA 1M6JA 2XIBA 4FO4A 4MTVA 5I5RA 1JDAA 5JBDA 1A50A 3O6AA 2PDUA 1TWSA 2YSWA 1W5PA 3L2IA 1RY0A 3FYYA 4PR4A 1E4MM 1WX0A 3HF3A 4FLQA 3KRBA 3NSNA 4XBJA 1CX9A 3IV3A 3W87A 3RDKA 1PL9A 4OWGA 4Y9OA 4ZBCA 3QYQA 3FHQA 2VM8A 4PUNA 2PWVA 2Q8ZA 1OYBA 1XS2A 2HBVA 4IG2A 1VYRA 4N9EA 3T7VA 1LL4A 4C5ZA 4KCWA 1B3VA 1NF7A 4WKFA 3T0TA 2J24A 3HO8A 3G24A 3H24A 4EF8A 1L6SA 4JX5A 4KWVA 1NF0A 2VYOA 1UKTA 3B9NA 2CLKA 2PU0A 3U48A 1VBHA 4EPKA 5CJ5A 1DJWA 1EL3A 2G3JA 4GO9A 3U5YA 2ZA1A 2FGZA 3V3WA 1H7OA 3F4WA 1J93A 2CLHA 4G5DA 3EOLA 4P8VA 1BHGA 2DPEA 2VZOA 1F2JA 1TPC1 4GBDA 3VDCA 4YCOA 1V51A 3NO1A 1TJRA 3OGVA 4JTJA 4X2PA 2BOEX 1TMQA 3SEPA 1NWSA 4HSOA 1JZ3A 3S2MA 3WBYA 4FOJA 5C70A 3U9IA 1GYMA 2ZOXA 1WBJA 5CH9A 3CNYA 3SECA 1SZEA 3CV7A 3MI6A 2FZ9A 1GQNA 2CBUA 1XIGA 3FN9A 4O10A 4E4UA 1A5MC 3JUGA 2OZ8A 3M16A 4ZZ9A 1DTUA 1HO1A 4YHEA 3KZPA 3MDWA 3STFA 1HJQA 3PULA 4S2CA 3CUXA 3PZMA 3O0KA 4GUHA 4ACZB 5LHFA 4X0VA 3WFZA 1NDZA 1NWTA 3LXCA 1VHCA 3GXPA 5I3JA 3UJEA 4W4QA 4D6CA 1NM9A 1E6NA 4IIGA 1WBHA 4H04A 1XM3A 4BEUA 1G4EA 4MF4A 3WDJA 1EFZA 1GKRA 1J2WA 5XIAA 4AWUA 3T40A 1LRNA 1MW3A 2BGSA 2OQYA 3K8LA 3FAXA 4WJ8A 5E93A 2CBIA 1JXKA 3E3HA 3S5ZA 2JKAA 5EBUA 3UWWA 7XIMA 1RUSA 1BGGA 3TJ4A 3ZSTA 3F2BA 4EP8C 3H23A 2Y7FA 3FCPA 1ONEA 4JIRA 5A2AA 3TLQA 3BAWA 3NDZA 1B3YA 2AKMA 2OCZA 3BUVA 4MNKA 2AL2A 3VFCA 1UR4A 3DHDA 3BLDA 1A5UA 1QWGA 4O1EA 3FJNA 3TWBA 5CAKA 1M68A 3KBMA 4A8IA 4NF7A 3FOKA 4ZFCA 4NRRA 2ZA3A 3APGA 1OBAA 1ME8A 5FJOA 3B9OA 1OK4A 3PAJA 2NVCA 2DZXA 3BGJA 2W6RA 4DXXA 1V77A 3RLVA 1EB3A 5JQ9A 1PX4A 3W7JA 1D3GA 1ZJBA 5AC8A 3E6EA 1HT6A 1E9ZB 4RKAA 3T2OA 3UNTA 1W9BM 1RBAA 1VIWA 4OT7A 5FACA 2H3DA 3GR8A 4PTVA 1ZFJA 4MWAE 3BOLA 5REQB 4S3EA 2WMIA 5AC5A 3LPPA 1B4EA 4G7EA 3BL3A 1JZ2A 1TTQA 2VZVA 2TODA 2XTKA 5EMMA 1OFEA 3DZ1A 2H9AA 3W7QA 3FNDA 1SZFA 1WXYA 2IMRA 2A7RA 1HX0A 2ZC8A 2OEMA 5CC3A 3V5OA 2ZYFA 1BVNP 3WQDA 2XZ7A 4Z17A 3DFNA 4Y9AA 2FLIA 1TRDA 1FWHC 3CEUA 2LLEA 2QMKA 2ABAA 2BHUA 2DFAA 4RNHA 1NY1A 2HV5A 3HURA 1I0DA 3NXFA 4RUBA 3VD7A 4RPQA 1IEIA 1AA1B 5HMSA 2YR1A 3EEZA 1LQ2A 3GG1A 3E2QA 1Z42A 1LJYA 2XSBA 1C90A 1OD0A 1IF2A 7TIMA 4NL1A 2FHBA 4ZA0A 2C1IA 3VDGA 3VIOA 9RUBA 1EUNA 4BR1A 3DDMA 1R7AA 1WKFA 4C1KA 2CFFA 4PMYA 3IJIA 3L0KA 2CLFA 5BU6A 1I2PA 1AH4A 1C8VA 4GWEA 1QNVA 4F0RA 3HFTA 1HJUA 4HB7A 2AOSA 3WJZA 3A5VA 3UWZA 2JEPA 2WVTA 3UWQA 4KWOA 3VC6A 3TFCA 1FBAA 1ONRA 4MY1A 1Q6QA 3WDHA 3BGGA 2YDAA 3FEQA 3ANVA 3VA8A 1CXLA 2WVVB 1SO3A 3WYZA 3I3BA 4LBSA 2VDHA 1BTMA 3WMLA 3BANA 1P6BA 4WDUA 1NTHA 1TTPA 5AECA 4TQTA 4IMAA 1TV4A 2EO7A 1EDGA 1ICQA 1X8CA 1OG0A 3EXTA 4YTSA 3FGCB 2FDSA 4Z1AA 1KKOA 1MQQA 2CITA 4LBUA 3W2JA 4ICCX 1PIFA 2VEGA 4Z42C 2FPYA 1EZWA 5FIPA 2A5HA 4E4PA 4EWJA 3GHRA 4CKQA 3W88A 1AQMA 2HPIA 2FHCA 2WMKA 4NZ3A 1F9CA 3T8QA 4DWSB 3FDGA 3N2XA 1LM1A 1WDRA 3AHTA 4ZOCA 3LCLA 1AQHA 1CLVA 3DX5A 3E1F1 3B8SA 3NL3A 1UJQA 5BOOA 2YX0A 5CLTA 1EC7A 5FF4A 1Q2RA 4PUKA 4YS1A 4Y7EA 4W7VA 3S1VA 1JAKA 1KM4A 3CUJA 4PBFA 3UF9A 3LY0A 3R58A 4US6A 1GQJA 3E12A 3RFAA 4QCFA 3U4AA 1W9PA 3TYUA 2CXEA 1F8MA 4KETA 2QHAA 2F6KA 1OYCA 1FKXA 5F4WA 1ADDA 1SR0A 3C2RA 1H0IA 4LEQA 1E4NA 3CV2A 2D73A 3DGBA 4KRTA 3REQA 3Q4DA 3N6HA 4C7FA 1S46A 2XN1A 4OFCA 4FNSA 3CZLA 4C6FA 3OBKA 2WXDM 3DBNA 1KTNA 2E5BA 3QPZA 5I3IA 2DZWA 2D0GA 2X2YA 1UCWA 3A12A 1IEWA 1MQRA 1QK2A 2UY4A 1J0YA 1O1HA 2P10A 2W4XA 2FZDA 3C8NA 2D0HA 2ZUUA 3TXZA 3PZGA 4JNYA 3CU2A 3GU9A 2G97A 5DCEA 3I6EA 1G69A 3O6CA 2H90A 5KEZA 1VFSA 1CXFA 4OECA 2ZX6A 3B8WA 5DT5A 1WB0A 2VWTA 4H8NA 1XUUA 1XYCA 3PJWA 3AIQA 2I7GA 3B04A 4IPNB 3T44A 3ITLA 3BQ6A 3I7QA 1MDLA 4HHPA 5A5WA 4C5YA 3VD3A 2F7FA 3TZFA 3LQLA 3OJGA 1FP9A 1J0ZA 3CZKA 1RQHA 2DP3A 2XM1A 3GH4A 1XIIA 2OELA 3K4WA 1HQTA 4N7QA 3PBWA 4WIWA 3AS3A 2GUBA 1TWZA 3B8IA 3B0XA 1LQAA 2FJUB 4HU0A 4FX6M 4XB3A 4ZE5A 2VFHA 4ZGYA 1C9DA 3B0YA 4HQVA 2AAAA 3S1GA 1RD5A 2J74A 3AZSA 2TMDA 4AMAA 2DSVA 2PTYA 1TMHA 1UWSA 3N29A 4ZQCA 1EJWC 2PDHA 3MP5A 4X2RA 2CZEA 4I7UA 5FOOA 2GJRA 3QY6A 3C3UA 4Z1CA 3ZJ7A 2QCMA 2RAGA 4H9XA 3W7EA 3CL8A 4PN2A 2E67A 2R91A 4PB4A 1KLZA 1Q4WA 2WKJA 3KHJA 2PP3A 4OZOA 3U7BA 1V0LA 2GVGA 2PLKA 1NP0A 4KW2A 1UP3A 1SO5A 1J0IA 1N8FA 1M04A 4M80A 4UQEA 1VFOA 3WENA 4JTAA 1E4IA 4YTRA 3IJDA 4EIVA 5K4ZA 2VC7A 4G9PA 4RE3A 1JYXA 5C8BB 3PBMA 4YVPA 3NEVA 1FOBA 5A8PA 5BU9A 4DZ5A 1B54A 1G5AA 4N4PA 3O2LA 5C9WA 3L21A 4WOZA 4Q4SA 1A5CA 4GIRA 3R89A 1BRLA 4LRSA 2W9MA 1V02A 3UG8A 1RR2A 2G5WA 2QJHA 1KWGA 2EPLX 3ZT5A 1E3XA 1YDYA 1UQYA 4IM4A 2OEJA 2G4JA 3ITTA 3OG3A 3VCNA 5DBTA 4O0QA 1X1ZA 5FJPA 4A6GA 3UEQA 5HQEA 2WV8A 3A3XA 3NYDA 5E9XA 3N3TA 3WUEA 3AHVA 4GJIA 4AEEA 3HMCA 4QNEA 1ZP4A 4IQJA 1XDLA 2C0AA 2J79A 1T40A 4S3JA 5BXPA 5A8GA 1XGZA 4GVHA 1TKKA 3BAXA 3DC0A 4AD5A 1RD6A 3N9SA 1OB0A 4H6KA 4C60A 2WHKA 2EF9A 3NXLA 2NQ9A 2XIIA 1VKFA 4IG2B 4HTYA 3VKDA 1AD1A 2VVNA 3TSMA 4GUFA 3SADA 3QV6A 4PBEA 1GVEA 4ZQPA 4S3DA 3ABRA 1QPNA 3K2GA 4IFRA 4IHCA 3LTSA 3A4AA 4IXHA 1I0BA 3VKCA 3VUPA 1JYWA 4HPHA 3JVAA 3L5AA 4GQBA 3NQ2A 1IT7A 3PG8A 4AC7C 4NXKA 3G1YA 1AW1A 1QPRA 1QNOA 2YXOA 4DIAA 4PZVA 4R3UA 1VBUA 4GGHA 5IHSA 2PGEA 2VFFA 5BXSA 2QNEA 3TP4A 1D3HA 4REQB 3AYSA 5A6BA 1ZAIA 2Z2UA 3IAQA 4MB5A 4AY1A 3VGEA 5FF7A 2VCAA 2QV4A 4L4MA 2FB2A 4AUBA 1Z3NA 1OVDA 5HATA 1YRRA 5A94A 5E6ZA 2NXGA 4PBGA 4M1BA 3IIZA 3L67A 3OW1A 1RH9A 4X9YA 3F03K 5EFDA 1KFLA 2ZUSA 5A1AA 1H7XA 2EKGA 1M7OA 4HU4A 3K46A 3ZVHB 3TN4A 1G1YA 3MP3A 3MA8A 5A8NA 4R88A 4UZUA 2O0TA 3EWDA 1KRAC 1JZ6A 4DZHA 3L2MA 5CZTA 2VC5A 3LCHA 2P76A 4JCLA 3UWVA 3QM3A 3CT7A 3DI0A 2AAMA 4TV5A 3S9IA 5HXMA 2BXZA 1UH4A 4US5D 3HTWA 3LZ3A 4H4IA 2GZXA 3RLUA 3PJUA 3R12A 3TTYA 3L4ZA 3Q94A 2V2CA 1HKKA 1RJRA 3NO5A 4ECLA 1OFQA 2QUMA 2NX9A 4ROPA 5E9AA 1Y8BA 1EJXC 1LBMA 4YCPA 3PP7A 4WF7A 4RR4A 5LIXX 2AL2B 3M43A 3WBXA 4L65A 3G0UA 4KEZA 4LUJA 3Q37A 2WK2A 4PMUA 1ISYA 3TE9A 1QNPA 3UXDA 1W3TA 3EWCA 4ZTXA 2I14A 4S3GA 3F4NA 4ZOAA 1YNPA 1PUDA 4GKTA 1S2AA 4AZ5A 4I8YA 1OEPA 2QCNA 2D2JA 3EA1A 3HPSA 5SWUA 6TAAA 1LT8A 3EKZA 3W1TA 2VELA 1AVAA 3B06A 2BV9A 2WMJA 2OYLA 5D4YA 3QGAC 3WL1A 3GUWA 3S8HA 3S1WA 4DHGA 4NYUA 3U0HA 2YB1A 3O0FA 3UA3A 2WMIB 1ZAJA 3BLLA 1PBGA 4ZODA 3TN6A 2ZZ5A 2PDXA 4I9JA 1FHDA 4G2DA 2TRSA 3VOJA 1A5NC 2GVEA 2PCQA 2VGIA 1WXZA 4P7QA 2IPGA 5F1UA 4D6JA 3W7DA 2XVPA 4N4QA 1UHVA 2YW3A 3QR3A 1VP5A 5FL0A 1L2QA 1XFCA 2QGYA 5DQPA 3L5MA 2HBXA 4ZB5A 4MB3A 1KFWA 1MRAA 1VFLA 4J3ZA 3NQCA 4HNCA 4KBXA 4XZLX 1TPFA 3A5FA 4JFTA 1U1UA 4H9UA 4U4MA 5C55A 3F4DA 1XXXA 5EMLA 2ZE3A 1PCKA 1DVJA 1JF5A 2HTMA 2FJKA 4GH1A 5GNXA 3VDBA 3MMWA 4J9JA 4Q8PA 3VZYA 4UB9A 4RNJA 5HMDA 3VM5A 1WZMA 3O1NA 4CVUA 3CIWA 1MRQA 2Q3OA 1JUBA 1GVFA 3MW7A 2CETA 2DZAA 3WK1A 4XSMA 4QG9A 2Y7EA 4DF0A 2WZTA 5E0KA 3PUGA 2NQZA 3RN6A 3KX6A 3QV8A 1V5XA 3NQGA 2IW0A 5CGQA 4H3DA 3MHFA 3IVSA 4HHMA 4ZB2A 3IJ8A 2J27A 4LU0A 2WC4A 4FA3A 4K1WA 1TZ9A 2I16A 3ZQ9A 1H11A 4LS1A 3ARUA 1L8PA 4IPIA 2IQDA 4F0SA 3SQMA 4BK9A 2BXYA 2XH0A 3SGZA 3WFAA 4PRRA 4MSSA 2W0UA 4UTIA 4HYRA 1VRXA 2FVMA 4HMCA 2PRMA 4U2ZA 5ABFA 1B57A 1JDDA 2R8WA 3H2NA 3N4AA 2QZRA 3OVGA 5BMXA 1GG1A 2YA1A 4QLJA 1DWAM 1H7RA 4R5EA 1TWIA 1BWKA 4NASA 1YYAA 4NZFA 1YNQA 1QVBA 2ATSA 3FVMA 2ZUTA 1A0DA 4U5IA 3F2CA 3A9IA 4O28A 4PEEA 4X22A 2PTXA 3TONA 3GKFA 4DBUA 3E5BA 1EH9A 3QR0A 3UD6A 4LCQA 4W7WA 3WNLA 2R1LA 3JRKA 3CAKA 2Y89A 5G4HC 3EX2A 2ATMA 3WELA 3T4WA 1W31A 3L66A 3T09A 1R9XA 1ZJAA 5CPLA 4CU8A 3AJXA 1G0CA 3KBWA 1R46A 3M0KA 1XISA 1NVMA 2F38A 3CMJA 1WCGA 2HXUA 3H53A 1MUMA 1ITCA 2Y7GA 3LK6A 1V0NA 4O54A 1L0PA 2FZNA 2MANA 3LG3A 4MZ8A 3NPXA 3CO8A 4LJ3A 4HD5A 1BVZA 4CD8A 4AWTA 2CLOA 1FWIC 1MNSA 3G77A 3REQB 4PMDA 4WXYA 2GPTA 2XH7A 4MDPA 4O19A 4KEUA 3BICA 3SBFA 3CUGA 1RPKA 4PMVA 3WX7A 1UWUA 4D8ZA 4JIIX 1LWHA 3OOQA 3MMDA 4RNFA 4KCVA 4WKHA 2VZSA 1CLXA 1EX1A 3TAOA 1DOSA 4FLSA 1CPUA 3TQ0A 3WQCA 4MYXA 5MKGA 3IVUA 2X1RA 2D20A 4Q32A 3RX4A 2A85A 2VEKA 1TPH1 2VHLA 2VFEA 3NCOA 4QROA 1SQ7A 4CQDA 1NU5A 1OFBA 3V0UA 4IICA 1V3KA 5CPOA 2ONEA 2FZ8A 7A3HA 8RUCA 1W8SA 2J6XA 1XD0A 2AGTA 4XIAA 2IPFA 4G7FA 3MSRA 5AC4A 4BJHA 1JR1A 5FF0A 1VC4A 1F8IA 2A3LA 4BKNA 1MEWA 3QPYA 3DGRA 3RIKA 1Q7QA 3GXIA 1KCZA 2X41A 1C8YA 3AYRA 3DENA 4XUYA 1BKSA 1GNXA 1DJXA 3ID7A 2Y88A 3O9NA 1HUVA 1ZB5A 2E8ZA 3HA1A 3S0CA 4Q33A 1BFNA 4YJ5A 1CEOA 4AB4A 4UNLA 3B3DA 5C54A 1ZP3A 1U33A 1NOFA 4ML4A 1VFUA 1XIFA 5HPOA 4HJFA 1JFXA 1EXBA 3VNZA 3WF4A 1EBHA 4DBWA 1THFD 9CGTA 3WF0A 4HGXA 2V2DA 4OOZA 5DMYA 1IWPA 1ZENA 2YBVA 3VU2A 5DXXA 1UKPA 3AISA 4Q8UA 3LI1A 4RXGA 5LIUX 1H4PA 2FGBA 4JQ3A 3WD1A 5D2VA 3GFXA 4FR1A 1QO2A 1GPWA 2WC3A 5CEWA 2ZZ2A 9XIAA 1B3WA 5E6YA 1AL7A 3ATYA 3WQ4A 3E0FA 3BDKA 1U5JA 2G50A 1FWAC 2Y8VA 5K4XA 1FRBA 3DYMA 3GDKA 1O66A 4QISA 3D0CA 1SZGA 2Y8KA 4NU7A 1HVQA 1NP2A 2CLPA 5F2MA 2VGBA 4UR7A 3KCLA 4NKCA 1YBQA 4RL3A 2D2OA 1BRLB 3CH9A 4G1NA 5U7SA 3HGRA 4YNGA 4XKYA 4J27A 4O4VA 3CWNA 4IOTA 4LAUA 1KV8A 3CWOX 5T9CE 5F2LA 2OKTA 2J8GA 1P48A 3FDKA 5HANA 3CH0A 4QE5A 3O8AA 4ZEPA 1TJPA 3P74A 1XP3A 2YCIX 3QXBA 4B92A 3CLMA 4K2SA 4B5TA 4QDPA 3QSRA 3QQ1A 3LPOA 1K7FA 4WY0A 3ABZA 4D6FA 1JG9A 5AKQA 1K1DA 1PYFA 1ADSA 4TTGA 5JMUA 4F3HA 1TR1A 1Q8AA 4HTBA 3LB0A 1IWAA 4MAZA 1J2BA 3TAKA 2WCGA 4CVWA 5IRPA 3GXNA 3RMEA 5FI8A 2OYMA 3L2LA 4A8LA 1FWRA 4P8XA 3OA5A 4XV0A 4GH3A 2YA0A 1DJQA 3TYDA 5BYWA 4PL2A 3LENA 5MF5A 4MVAA 1LUCA 4RDVA 3IRDA 1TVPA 2NSOA 4U31A 3G8RA 1GHSA 3SCWA 5AHIA 1XIDA 4JY8A 1J5SA 1YNYA 1J79A 3DESA 4H6RA 1UZHA 1W91A 1GVYA 1JVNA 3M6YA 2R1MA 3IPWA 2J9YA 4NJJA 4CQCA 4M82A 1RLCL 3TYCA 3UXLA 2ZBTA 5BRQA 5IFTA 2DW7A 1BYDA 2Z0IA 1TE6A 4QEHA 1FCBA 2BVDA 1V3IA 3W37A 4WJEA 3O15A 4S3BA 3CHEA 5D8ZA 3HPAA 4KCUA 3VIGA 4IL0A 3EDDA 1TJ1A 3GXFA 4WXZA 1XQLA 5E0FA 2XG9A 1Q4NX 4FF7A 3H7RA 3IACA 3G1RA 1D7KA 3HG2A 3T2QA 1Y5XA 3UPMA 2D24A 4IIEA 1QPOA 4W8BA 4RXFA 4GKLA 5D02A 4M7TA 2W67A 1TR9A 3NQ6A 1P0KA 2PC4A 2Y63A 1DBTA 4IH3A 1LLWA 4UQDA 1R87A 2PD5A 2PWUA 1GEQA 3IJQA 3W82A 3EB3A 3KBJA 1V0KA 4JX6A 4XTIA 3LRMA 1C7SA 3BMVA 2ZX8A 4XAGA 3W71A 4D72A 3TWAA 1KXHA 1UUQA 4B15A 4B3KA 1V79A 1AZ1A 5JIPA 1R2RA 2ZQ0A 2WMFA 4H00A 5E1QA 5EPDA 1NOWA 4WRHA 4LALA 2ANUA 3UETA 3C86A 1VFTA 3PBVA 4ORIA 1KBLA 3JS3A 2G37A 3SI9A 4HJWA 1N8WA 4F9DA 2YXXA 3SUTA 1G7UA 4UOZA 4WGHA 3BJSA 2XN2A 4ZOBA 4UMCA 4JL1A 2BY1A 1CWYA 2P3ZA 1KM5A 2J4GA 4PSRA 2OU4A 3P82A 1Q6GA 1PSCA 3BMXA 3H8AA 4IFOA 2ISFA 1J6OA 2E8YA 3VGDA 1DV7A 4MADA 1SPQA 3F5LA 3E2VA 1RBOB 3QGKC 3WH8A 4GI9A 2ODOA 3OB8A 3U6WA 3ZR4A 1JEZA 4AU0A 2DORA 4MIMA 5LA2A 4NX0A 3GG0A 2DIKA 2FTPA 5MHBA 1V08A 3DFSA 3TX9A 3YPIA 3QV9A 3H2OA 4F0LA 1SGJA 4M6VA 3W7CA 1S1PA 3WQWA 1UD6A 4NJHA 2ZZ7A 4HSNA 2QV5A 2Z1KA 5H6HA 4AAJA 3IJ9A 3LGEA 2O9OA 4JTDA 2OVLA 1EX5A 1FWGC 3KE0A 3VCRA 3MV01 3AJ7A 3PBUA 1E9LA 2POTA 2PDQA 2X05A 1M03A 2RJHA 1UC4A 3GVVA 3QHOA 2IPJA 1DJHA 4MFEA 1GORA 4IPJA 3BK0A 1H61A 3NWRA 4IIHA 4JS3A 3NDOA 2DGAA 1RLDA 2H8ZA 2ACUA 1Z44A 4GI6A 3U2CA 3TR9A 5U4NA 2V68A 3WUBA 2V5BA 1C8QA 2Y5SA 1FDYA 1GOMA 1XF0A 1TPUA 3VDHA 5AZ1A 2QW5A 4U3AA 4GK8A 2PAJA 4KH2A 2QCDA 2GSHA 2VUYA 2IKJA 5A6MA 2VRJA 4KF1A 5KETA 5BMWA 3SY1A 2WKGA 2VEIA 3HN3A 1F05A 5LGZA 2ESCA 4AD0A 3OZMA 2OSXA 1EPVA 3E0VA 1W1TA 1P0EA 5I3GA 3PFMA 1TTJA 3W9ZA 3KTXA 1DEDA 2NQJA 2OO6A 3KCJA 4JQ1A 3V36A 1UR9A 3SCNA 4NAEB 3FXGA 1ZBCA 2O56A 2ACQA 2Z7KA 3ZJKA 3LPFA 1M7PA 1M7JA 1S2UA 3OLGA 5A2BA 1LT7A 3N14A 4HA1A 4IIBA 4DO7A 3UQNA 1VIZA 3WH9A 2CWXA 3UYIA 3W7OA 1ZS2A 1MEIA 4Q8QA 1BYBA 1JPHA 4HNUA 4JDBA 4HMEA 2NW0A 3W7RA 3DOPA 1U5HA 2ZTKA 5D2XA 3PUDA 1F3WA 3UERA 3SIZA 2WHJA 3URBA 4C6MA 1ZZMA 1Q7MA 3LM7A 2CERA 2PS2A 3TA9A 1PVNA 4QGCA 1TCDA 1WDSA 2DUAA 2A4AA 2ISSA 1WUEA 4TOQA 4H1ZA 4HNLA 4FOUA 3SFWA 4H9MA 3VOGA 2UZ9A 5HA7A 4H9TA 4ZO8A 5HR7A 1I60A 4HZ7A 5I79A 2W79A 2VX6A 3ZXWA 4UFKA 7ODCA 3SCVA 4KKXA 4DXVA 2C79A 2I5GA 1SFJA 3TA6A 4FPSA 3KFTA 3OIXA 5IFPA 3RNDA 2J77A 3EWWA 1RHCA 1PS9A 1GW1A 4V27A 1J12A 5EKYA 5LXXA 1TV3A 1KFBA 1LLOA 3G1XA 1SR9A 4PC8A 5E70A 5LKYA 2JBMA 1E71M 1BXNA 1Q6EA 2WZIA 3FFSA 4GY0A 2ZRZA 5IOBA 2AKZA 4ZQRA 1IT0A 2ZADA 4Z1YA 4GJJA 5C9ZA 5JU6A 1IHIA 2C19A 4XAYA 5DFAA 5EA9A 4GFSA 2HROA 3ENLA 4Y96A 4UC5A 3NOYA 4ZO7A 2WZEA 4O1BA 5LIYX 3HQNA 1XJBA 4U33A 1ZQ5A 3KAOA 3BO9A 3E0LA 1V4YA 1XI3A 4DXKA 4P7RA 5DCBA 3DKLA 3R0UA 4B5UA 4YTTA 4HZ8A 3T6CA 1UD2A 3WK2A 2WCAA 1BKHA 4OOUA 5FCZA 5M5DA 1B0IA 1L6WA 2HK0A 4EXAA 2W62A 3LXAA 1X98A 3R2GA 1ODUA 5MKGB 1W5NA 1A49A 3EKLA 4Q8WA 2FMOA 3W28A 4QAIA 2Y4SA 3TXVA 1EGMA 1M01A 2DSUA 1RVGA 3BSGA 4DJEA 4GOAA 4M6PA 2OO0A 2UY3A 4IGMA 1OWQA 3TR2A 4JIPA 5BROA 2W91A 2NWRA 3FJLA 2V6AA 3SN0A 2A3HA 3SCOA 4EAMA 3W1NA 6REQA 1QDSA 2DW6A 4OBTA 5HWNA 4GD0A 1GOWA 4Y8EA 1CGYA 2HMCA 4HA4A 3TC6A 3UZ5A 3E96A 4CUCA 1PWLA 2TSYA 1QHZA 4BI5A 2HEJA 3TNOA 3WLPA 4OIFA 4RPPA 5A8QA 1NQ6A 1TQXA 2GDVA 4M1RA 3AICA 1XH2A 1DJNA 3AAMA 4E2VA 2E6YA 1XRTA 4NI8A 1RK5A 4JN8A 1WDWA 3NSXA 5CBJA 3DFOA 3ZIZA 1GW9A 3W7IA 4H2HA 4WDXA 3RM4A 5FEPA 4UTWA 2OWWA 2NV9A 2CLLA 4J1OA 3DYPA 2NZLA 4C91A 1DQXA 1NDVA 1Q65A 3BJTA 1CB2A 3ORWA 3WBAA 1G4TA 1LL7A 2ZKMX 3AIEA 3NQ8A 5LYRA 3ZJ6A 1PTGA 1DJYA 2X30A 3DFPA 3ABSA 4HA3A 4DYJA 2VD8A 1Q6CA 4WDTA 4YPJA 4EANA 1PZ3A 2FGLA 4F2TA 4CNOA 1YBQB 1E51A 2WYSA 2Q02A 4L1WA 5BXRA 3HU7A 4R9OA 4XKYB 5HNRA 6XIMA 3B4YA 1EC9A 5IM51 4CU6A 4FEZA 3W6MA 4UIOA 4IF2A 4MPQA 1S2WA 1G67A 2V82A 1PIIA 3CL6A 2P8BA 3AZRA 2E6AA 3ZVIA 2CNCA 2CYGA 4GC3A 1E4LA 4H6EA 4YXGA 3VNMA 1XYAA 3B05A 1XBXA 4F0KA 5I07A 3IGSA 4TVCA 4UFJA 3L4UA 4XZWA 2QJGA 5BOFA 3GAKA 1LUCB 1E73M 2DJLA 3SIMA 1HJVA 1XLEA 4LS0A 1GVOA 4PCPA 4FX7A 1R0MA 1GZJA 2OOFA 3DH7A 1YDNA 2VRKA 2DU2A 5LA0A 1LDCA 1M1BA 3LHZA 4S2BA 3VIFA 3QV7A 1S38A 1R30A 2VX4A 3VOFA 4PE8A 3V1HA 2PWEA 3LCFA 4Z08A 3IARA 4IUGA 4DPPA 1JZ7A 4L1XA 5B7YA 4UQCA 4KQNA 1GWJA 1OCQA 1KO0A 4J3UA 1KD0A 2DUZA 2HJPA 4A29A 2ISDA 1LRQA 4UNIA 3C0SA 2GDUA 3PF3A 3VOIA 1S5NA 2INFA 3SN1A 1PZ1A 2J9XA 5LHEA 3PZQA 4LW7A 4K7VA 1W9VA 4GQQA 1ALDA 3TV8A 4AFYA 3MWAA 4RE0A 3IWPA 3TCSA 4EPBC 5E09A 3CJPA 4GYPA 1J10A 3UR8A 1E0XA 2G3MA 1RA5A 3GIPA 4IISA 4LWWA 3GB6A 1UKQA 3W1UA 3BLEA 4BQ2A 1XLKA 1PXGA 1FCUA 2X16A 2A7NA 2WSPA 3LD5A 1E6RA 3LMZA 1QI2A 1XPGA 1KCXA 2QCLA 3UESA 3GAYA 2Z28A 4LYPA 2TAAA 1S2CA 3N3MA 4JZ5A 1V6TA 1L6YA 4IT1A 1J18A 3KDOA 4GVFA 3H2AA 2DSZA 1XGEA 4ZB0A 4C90A 1UKSA 2NUXA 3O06A 1JD9A 4A21A 2V0TA 1ME9A 2R6OA 1XSKA 2A3BA 4K68A 3FIGA 1ZBWA 4NXSA 3ZR5A 3IJ6A 4QHRA 1VEPA 5HR6A 5DANA 2PGFA 3UW6A 1NOUA 3LLFA 3ISIX 3RRXA 4HZMA 2NUYA 1J0JA 4GNVA 8CGTA 1HIZA 4B2DD 2D2HA 3SRKA 4DI9A 1LYXA 3NDYA 1UPPA 3ZO9A 5CAHA 3M0HA 5G4WA 4UOJA 3KRUA 5FAGA 5C9RA 1U1JA 3LCWA 3RPDA 1L2UA 1P6CA 2VR5A 2YFNA 1POKA 2HS8A 5I78A 3P81A 3VD5A 1KLYA 2XFYA 4PGLA 1AJZA 1PAMA 3WLJA 3UR7A 4C6PA 3O05A 4AIUA 3QR1A 3KZSA 2GL5A 4ACZA 4BHYA 3NVDA 1T8XA 4GMEA 2A21A 2NXIA 1G4PA 4O8AA 1K9EA 1X8FA 1Z32X 4E8GA 1ZALA 1EA0A 2HVMA 3MZNA 3VGHA 1H7WA 4MOZA 3OZOA 4AX6A 1KM2A 3FSUA 3PSVA 3CAVA 3WL0A 3ARQA 1XD1A 1TYGA 3QH2A 1R2TA 4IQDA 3THQA 3DHFA 1IGSA 1KBKA 4W8AA 2QCDB 1KFCA 2QDGA 3TH6A 1VPYA 4JTCA 4AW7A 1ZUAX 1Z7AA 1XIMA 1Y5WA 3SW6A 1F6YA 1U83A 2WMHA 4FNPA 3BJFA 1DJIA 4AD4A 1Z9AA 2X1SA 1I45A 3GYEA 2GUYA 3LCXA 4JGDA 4O1FA 5T8GA 1UMYA 3UZZA 4DYKA 1R3RA 3UY7A 5A3HA 2D1ZA 4HPXA 3GWQA 1J4EA 2O4QA 1BG4A 3LSCA 5FSDC 1S2TA 4D6GA 3W72A 1XRSA 3FKRA 1R47A 5REQA 1Y65A 3K5XA 5TAOA 1LP6A 4GINA 3GK0A 4XQ6A 3QOKA 2ZXDA 5BRPA 2FTWA 2GSEA 4LAOA 4LANA 4IFKA 1PCWA 3WBWA 3BCJA 1SSDA 3ZWTA 3EWUA 4K37A 3W7NA 1K7EA 4W88A 2ZVRA 3SCPA 2XVNA 4E6MA 1FHUA 5HJXA 3USBA 3C8FA 1BSLA 4PFMA 4KGJA 5CC5A 1P43A 3ARWA 3TMQA 2FPTA 6XIAA 5G5IA 5H8MA 3NQEA 1BYAA 3N2TA 1FP8A 4EKJA 1RCOB 4NI3A 1IR1A 1Q85A 3AS1A 1EYWA 3PZ9A 3DUGA 3H4XA 5CQ1A 1E1FA 5JBEA 4KFNA 2XJ7A 4JFSA 1LBLA 2PDYA 1TPWA 3AXHA 4IPLA 3D5HA 3G0XA 4JTFA 1QI5A 1DL3A 4CN6A 4Q4RA 1JZ8A 5EBAA 3VKJA 1OYAA 3W1MA 3UJRA 4B5SA 1KTBA 3ANYA 3U2OA 1F3EA 2EEXA 2R1PA 4OBSA 5FL1A 2V3GA 3TROA 3E02A 2BVTA 4AEFA 1W6TA 1JUEA 2IS7A 1WP6A 1RK6A 1E6QM 1YPIA 3V4BA 3HG4A 2ZA2A 1H50A 1UWAA 3RF9A 3TYAA 4PUDA 4I9MA 1JZ5A 4KERA 4TO8A 3CEPA 4KRZA 3GC5A 2CZDA 3CQJA