2IQDA

Crystal structure of aldose reductase complexed with lipoic acid
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
315
structure length
315
Chain Sequence
b'ASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldose reductase
publication title Structural and thermodynamic studies of simple aldose reductase-inhibitor complexes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 98
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2006-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2iqdA00
1QRQA 4XZMX 4IJRA 3GHTA 2CLPA 2F38A 2ACRA 5JH2A 3G1RA 1SM9A 3M0IA 2PDXA 3COTA 3UP8A 2WZMA 1ZGDA 4GIEA 3EB4A 4QX4A 3WBXA 2INEA 1ZUAX 2PDLA 2NVDA 1ZQ5A 1M9HA 4XVEA 3WCZA 2DUXA 2P5NA 3R58A 3WG6A 3UFYA 2BP1A 2ACQA 3G5EA 2PF8A 3R43A 3RX4A 2IKJA 4I5XA 3GHSA 3V35A 1HQTA 1Z89A 4FAMA 4EXAA 5LIKX 4FZIA 3LQLA 4JTDA 1YNPA 1C9WA 4XO7A 1X96A 2PZNA 2ACUA 2AGTA 2PDYA 1EL3A 2PDCA 3LUTA 4HBKA 4DZ5A 4WDXA 3FX4A 4PR4A 4GACA 4XO6A 1T41A 2HE8A 3CV7A 3RX3A 1YE6A 3BURA 3H7UA 2IPFA 2FZ9A 2HDJA 4JTCA 4QR6A 2ALRA 3V0SA 3RX2A 5AZ1A 4WEVX 3R8GA 3M4HA 1LQAA 4JTRA 4XZIA 2IKGA 2PDIA 1X98A 2FVLA 1R38A 3BCJA 4LAZA 5LIXX 1AZ1A 3LD5A 1X97A 4YVXA 3V0TA 2ISFA 2PEVA 4AUBA 3O3RA 2HV5A 2NVCA 2PDGA 4LBRA 3D3FA 3UG8A 3NTYA 2PDHA 3ERPA 4QXIA 2PDNA 2C91A 3R8HA 4JQ1A 4XZHA 1QWKA 3DN5A 3H4GA 5LIUX 5AZ0A 1VBJA 1YE4A 4XK2A 3Q67A 4ZFCA 5C7HA 2PDBA 3T42A 2F2KA 4PMJA 5LIWX 3N2TA 2R24A 5HNUA 1PYFA 4Q7BA 3LZ3A 1AH4A 4RPQA 4GQGA 4JQ2A 1IEIA 4L1XA 1ZSXA 5HNTA 3CAVA 4QBXA 1MRQA 4JQAA 1HW6A 3UGRA 1Q5MA 4DBUA 1VP5A 2ACSA 3FJNA 2BGSA 4JTAA 2DUZA 4WDWA 2I16A 2PDMA 4H8NA 1T40A 3B3DA 3KRBA 4NKCA 3LNMA 4GA8A 1J96A 1XF0A 2PDFA 4Q3MA 3LENA 1XJBA 4FA3A 4PUWA 1US0A 4EXBA 4JQ4A 1AH3A 2PD5A 4JIRA 3LN3A 2IQDA 4XZLX 3C3UA 3LEPA 2HVNA 2PDWA 1AH0A 3EB3A 4JIIX 1RY0A 3UZWA 4PRTA 2HE5A 2IPWA 1EKOA 4L1WA 3R6IA 1RALA 3WBYA 2I17A 1XGDA 2INZA 2IPGA 4HMNA 4GABA 2FZBA 3O0KA 3Q65A 4FALA 3F7JA 4JTQA 5M2FX 4WDTA 4XVDA 2WZTA 1PZ1A 1Z8AA 3BV7A 5LIYX 3UZXA 1PWMA 2A79A 2R9RA 3CASA 3VXGA 4DBSA 2HVOA 1S1PA 4MHBA 2BGQA 1AZ2A 4OTKA 1ADSA 4XAPA 2VDGA 1JEZA 2PD9A 3LQGA 4YS1A 4PRRA 2PFHA 2PDKA 3H7RA 1OG6A 1YNQA 1MI3A 1S1RA 3LBOA 2IPJA 4LB3A 2IKIA 4IJCA 4JIHA 1GVEA 3V0UA 3ONBA 1EXBA 4DBWA 4H7CA 5JH1A 4GCAA 4F40A 2IQ0A 2PDJA 1MZRA 1RY8A 4WRHA 3UYIA 3EAUA 3CV6A 1Z3NA 3LZ5A 4JQ3A 3GHRA 3QKZA 3UZYA 3WBWA 4YU1A 4G5DA 1PZ0A 2DV0A 1Z9AA 4YVPA 1S2CA 3CAQA 4LBSA 3CMFA 3GUGA 1IHIA 1UR3M 1Q13A 1K8CA 5KETA 1FRBA 4XZNX 4YVVA 3UWEA 3MB9A 4ICCX 2PDUA 1LWIA 3M64A 4LAUA 4ASTA 2IKHA 2PDPA 3R94A 2FZDA 5HA7A 3P2VA 4WGHA 2FZ8A 1EF3A 1PWLA 3U2CA 1S2AA 5DANA 3MC5A 3V36A 3R7MA 3N6QA 4PUUA 3GHUA 3ONCA 1A80A 2IS7A 1AFSA 3UZZA 2PDQA 3BUVA 4LB4A 2J8TA 2QXWA 2HEJA 4R9OA 2FGBA 3S3GA 4WDUA 4IGSA 3DOPA 4GQ0A
chains in the Genus database with same CATH superfamily
1E9ZB 4GYFA 1S2VA 3WQFA 3U2EA 5D09A 4O12A 1JL8A 2BX7A 2ACRA 1KO0A 3SSJA 4HOZA 3B40A 3G1RA 3UJ2A 5C6MA 3M0IA 3PFMA 3P67A 3VDCA 3COTA 3KLKA 2VGGA 3UP8A 3CXOA 3DU0A 5AN7A 1KM0A 3CQHA 4IXXA 4B90A 2F9RA 2PWGA 3MQTA 3GQYA 3N2XA 2P76A 2OJPA 1AUSL 1SO6A 1HJWA 1US3A 3ALGA 4J3VA 2Z29A 4FIRA 4ACYA 4Y9MA 1BTMA 3SAZA 2AL1A 2CLHA 4P2VA 3GHSA 1FFQA 5CQ1A 2Y5SA 4OE7A 4KS0A 2C7FA 3LPOA 1XV8A 1EP1A 4RE3A 3GSMA 3M7SA 1A47A 1RPKA 1TTQA 4QNEA 3GIPA 4PZVA 4UNIA 4IIBA 5J8LA 1GZJA 3IGXA 4OOZA 3CMJA 4CQCA 2DGAA 3PY2A 4K8GA 6ALDA 1HF6A 2GQ3A 3GDBA 4Z2HA 2HDJA 4JTCA 1UG6A 3P84A 1R9XA 1OCJA 1X1NA 2OKTA 4TVUA 4B5NA 1V0KA 3QH2A 4AVOA 3PTKA 1SW3A 1G6CA 1QNQA 3IIXA 1MYRA 1X98A 1V4YA 2CC0A 4W5ZA 3RLHA 3HOJA 1IF2A 1FKWA 2R1NA 1W3KA 2XH2A 4FB7A 1UWQA 5RUBA 4DO6A 2WBKA 2XJ7A 2TODA 4C7FA 3UG8A 3CT2A 1TUXA 2AGKA 3UR5A 2J25A 5HR7A 4CD7A 3VOCA 3BMWA 1GVIA 4G7EB 1ZPTA 2V5LA 1MNSA 4RZ5A 4K37A 5I03A 4R88A 2VGBA 1NFPA 1QUMA 2PODA 1DWIM 4DPPA 4GVIA 3WJZA 2V5DA 3U9IA 2PURA 1MZHA 4Q8VA 2EGZA 2VCAA 1QR7A 2CLLA 2DY3A 2XTKA 1FHVA 1GG0A 3TCSA 3O06A 1XDMA 4ZR8A 4LNYA 1ZLPA 4D6HA 3CWHA 5G4EA 4ZL1A 4ERAA 5C8BB 4ATWA 3WQ5A 3KE0A 1BD0A 1K9DA 4GUHA 4KRTA 2VO5A 1G0CA 1KB3A 3AALA 4JX4A 1JPIA 4U4MA 1QXLA 1CWYA 3PWIA 4FXFA 1RV8A 1A4MA 1NQ6A 3MSRA 2WJZA 1JCTA 3MS8A 3MDWA 4CKQA 1FQ0A 1MDLA 2V5KA 3NG3A 1DJQA 4UXDA 4GA8A 2EPNA 4C6LA 4O50A 1FXQA 4P8VA 1RJPA 3SUTA 1FXPA 3DIPA 2DP3A 4H9TA 4GYPC 4Z1CA 5G1MA 1N8FA 1MXDA 2HK0A 3IACA 4W88A 1H2JA 1M5WA 1NOWA 3BSGA 3IUIA 4MTVA 3NQDA 1X8CA 1CXIA 3QW4B 3LRLA 3PP7A 2CW6A 4S38A 5IFPA 3EWYA 4RPPA 1GQNA 5DBUA 4NG3A 3SQLA 3VIIA 4PSPA 1KTBA 4IWWA 3P93A 4LS1A 1H0GA 2JALA 1JF5A 1Q6DA 2D3LA 4MJZA 3OA3A 4PBFA 4D1JA 3W7JA 3MVTA 3UZXA 1C93A 4Z1YA 2QF8A 4QDMA 3ZLGA 1A0EA 3CL8A 2RJGA 4QIUA 4HK6A 3DFQA 4O18A 4B92A 5H2ZA 2BGQA 2NZLA 4P7QA 1UR2A 2FKPA 3USZA 2PMQA 4XAPA 1GOKA 3UBPC 1LP6A 3BAIA 1J0ZA 5AVHA 4HMCA 2CBIA 5KZMA 1FVPA 1MI3A 4IFKB 2BXZA 5HMDA 3BAKA 3TJLA 3GIQA 2A0NA 2CXEA 4Z2GA 1KRMA 3LV6A 1J2BA 4EANA 2DSUA 4PULA 2ISVA 3V18A 1TWSA 5HULA 2GDQA 3W1AA 4MNLA 1UMYA 1K4HA 3TNOA 1UR4A 2DZVA 3THDA 5FF7A 2YPIA 3H26A 4NRSA 2PRLA 1K02A 5EMKA 4W86A 3PF3A 4DO4A 4NJKA 3FVMA 3W0KA 3ZWSA 3AZTA 2Q8LA 3C2FA 1LWIA 4QROA 5I7GA 1RHCA 4HMDA 4DAIA 1PIGA 5E0KA 2YFNA 3VC6A 3PPGA 4JL1A 1TPDA 1UHVA 1Q7QA 1TIWA 2OR2A 3RLGA 2AQWA 3MWCA 4US5A 4JICA 3DFSA 2AKMA 3CTTA 4I3GA 1DWHM 2Y4SA 1XLIA 1MVYA 4H6QA 3MHGA 4LT9A 4C6BA 3F2CA 4J27A 2Z7KA 3NL3A 1VPQA 2Q6ZA 3VIFA 1QW8A 4QM1A 3QGKC 2OSWA 4WY0F 2HEJA 1FWIC 4XD5A 4K1GA 2XIQA 4QCFA 1XFCA 3TA9A 1R8LA 3A4JA 1UB3A 2WYSA 1QW9A 2FMOA 4MYAA 4GQ0A 2QV5A 2ONEA 3EWUA 4FHAA 3NQVA 4XZMX 3IIPA 4J3SA 2F38A 1ODZA 4GUIA 5JQ9A 1ZS2A 1EHNA 4LVBA 1WBHA 3FN9A 4DYJA 1EJRC 3HURA 3ZMRA 4XKMA 3E96A 3AYVA 4A3RA 5A69A 3QOMA 2WMIA 4M6VA 1E4NA 4WHBA 3IAPA 2RDTA 3FJLA 4ZVJA 3W22A 2YX0A 2IQTA 3B0XA 3NYDA 3R58A 4K38A 2I9UA 1F8IA 2QW5A 3PNZA 4HSHA 2ACQA 4OGZA 3THAA 2AL2B 2YOCA 2QDHA 4QG9A 3RX4A 1PO9A 1MNZA 4JOMA 4BKNA 3TUUA 1YXCA 4GIAA 1FH7A 2WC3A 3KRSA 3VIKA 1X96A 3PPFA 3V1PA 3E2VA 3TTSA 3KS5A 2HS6A 5CGTA 4BQ3A 4E2OA 3GLCA 3CIWA 1F3EA 4ES4A 3N29A 1S5MA 3R8RA 3SN0A 2Q01A 4AEEA 3KRZA 3LMZA 1K4GA 1G69A 3N2MA 5DF0A 4DVOA 1ALDA 1O95A 4GCXA 1B2YA 3AI0A 4RUBA 2ZX9A 3N13A 1LQAA 3VNIA 1O12A 2IKGA 1N55A 1TMQA 3S46A 4LUJA 1RJRA 4GHRA 3WKZA 4ZB0A 2ISFA 3W7QA 1P0EA 4HHHA 1Y5XA 1QPNA 2HZGA 4TV5A 2YIHA 1PAMA 1SPQA 5GJNA 5G5IA 1POJA 5JU6A 3MU7A 2XFYA 1A0DA 3PJTA 3SBFA 4Q8MA 1QWKA 2GGEA 2E67A 1UD6A 5FSDC 4UFHA 4L9YA 4YCOA 2FB3A 4CVWA 4DLMA 2CKSA 5I2UA 5LIWX 1QPKA 1YDNA 2HXUA 3PUGA 3FNDA 4ZQMA 4WCJA 1LOLA 3VFLA 3VDBA 4D6GA 3S2LA 3MP5A 1BG4A 4DM1A 5DQPA 3UETA 3XINA 1QBAA 3QBUA 1BSIA 1Q8AA 3B9AA 3U3HA 4Y9NA 2MANA 3MP4A 1VP5A 4MB5A 1QU4A 1NELA 3D6NA 2OYLA 3VGFA 1DHPA 2YYUA 1AJ0A 1RQEA 2JKEA 4L4PA 1UJPA 2CFFA 4AEOA 4P7LA 3H8AA 3KBWA 1QNPA 1AH3A 4LAMA 4RV3A 3SB0A 2XN0A 3H6OA 3I6TA 4JTTA 4XZLX 4AWEA 1I2QA 3OQEA 5MF5A 3ANYA 1GCYA 3ZJKA 3W76A 1AJ2A 3K4AA 3MUY1 3OGSA 1BFNA 1EX5A 4ML4A 4LVDA 1MO0A 2FHFA 4B5WA 2NT1A 4PRTA 2QEZA 4JEQA 3IS4A 2RHGA 2WXDM 3CQIA 2INZA 5JIPA 1AG1O 3E9AA 4OWGA 2J6VA 4AD0A 1V6UA 4O0QA 1MUMA 1DQXA 1L8NA 2VEPA 2WQDA 4E8DA 1TV2A 3BLOA 4WDTA 2TAAA 2X40A 5E70A 4IIFA 3BG3A 3G24A 1HZYA 2V81A 4YWSA 3O07A 3GW3A 2NQJA 2E68A 1HFBA 1JUEA 3EX6A 3K4DA 3IIZA 3J7HA 1GKPA 4V2XA 1NQKA 1X6LA 5CJMA 2I14A 1GTHA 5C2GA 1VR6A 4UMBA 1O5XA 2QYGA 4Y9OA 4O8AA 4R7OA 4DWSC 3V5OA 2J7DA 2Q3RA 3OLGA 1PVNA 4JN8A 3LCLA 1UKQA 2PI6A 3TTQA 1L6YA 1LUCB 5BWAA 4HN4A 3V0UA 1SR9A 1NY1A 3VKJA 4IOTA 2HISA 1UH2A 2EQDA 2WNNA 3H54A 4G2DA 4MB3A 3ZJ6A 5T91A 1S5NA 3EKGA 5H1WA 1OC6A 3SCSA 5LXXA 4MOZA 3LHVA 3PZGA 3L4XA 2BFGA 4FLQA 5C9RA 4GXWA 4CNUA 2WLYA 1Q6OA 4X2PA 2QCMA 3LPPA 4XSMA 3STEA 4RDYA 3W37A 5IRPA 3RILA 3NNTA 3LLDA 3MB9A 2FHBA 2RJHA 2WSQA 3ARRA 3EMCA 3VNZA 4XTDA 4BQ5A 1UWRA 4ASTA 2AQVA 2VFDA 1XDLA 2X1UA 1M65A 4PMRA 4KEMA 4D9PA 4LF2A 3LU2A 4YWIA 1X6UA 2QVHA 4LX4A 3I7QA 3P81A 5IFTA 1KV5A 1EIXA 2BOGX 3UF9A 3MC5A 1NDWA 1NWTA 3S8HA 4M6QA 1O66A 2GJNA 2QVNA 3V75A 3M0MA 4LOCA 4E4FA 4IIEA 4HU4A 3KCJA 1XLFA 3PANA 3USBA 4M82A 1V3KA 4DI9A 4EP8C 1NSJA 5F2MA 3L0GA 4AH7A 5CGMA 2F61A 4KIEA 1TA3B 1WV2A 3RCNA 2CLOA 2PBGA 4BCEA 1QRQA 3ZJ7A 2VEFA 3FKKA 1JCLA 2CEQA 1XPYA 5JH2A 2QJIA 3WD1A 3TQPA 1H0IA 3HG5A 1YQ2A 1XGEA 5HK4A 1JNEA 3EBVA 2WLZA 1KM2A 1E4MM 3IIVA 1HGYA 1M9HA 1QK2A 4I9AA 3H2EA 1H7NA 1XLGA 3JZEA 3FFSA 3B4YA 2GOKA 3C2YA 2C19A 4A2RA 3TWBA 3SFWA 2BP1A 1TA3A 7ODCA 1OT2A 5F1VA 4E8CA 3VIJA 4FSAA 1A3WA 1PCKA 5A95A 3PC0A 4C1NB 2VQTA 4YTSA 1ZL1A 3UJFA 1C9WA 3WN6A 4HA1A 2YCLB 2PCEA 4E3TA 4AZGA 2PZNA 3H4XA 1GYLA 1BWKA 4JHOA 3MJMA 1W5OA 4B9ZA 4MIMA 4CNPA 3GE7A 3NM1A 2YW4A 2C15A 2QUVA 4LYPA 4R27A 2B81A 2CLIA 2VM8A 3KDOA 3WQOA 4C6DA 4D1IA 5JIWA 3RMJA 5LXEA 3L5LA 3S1XA 1U83A 2GL5A 1WP6A 2NV1A 3NQ2A 4QR6A 2BVDA 2ZQ0A 1J6PA 4M56A 5A6MA 4WEVX 3XIMA 5TIMA 4LANA 5L9FA 4KQNA 1FH8A 4GYPA 5EBUA 4C1NA 4OV4A 3M46A 5A2BA 2DFAA 4E4PA 3RO6A 3APTA 3RNDA 2NVCA 4IPJA 1RXOB 4HHLA 4A05A 1J2WA 4PTVA 4NIRA 4HT3A 1XBZA 4FO4A 1H63A 2EG7A 2YL8A 1W9VA 4JD4A 2GQ8A 4GYKA 2QPUA 2QGYA 1FHDA 4H1ZA 1T8QA 1BLIA 1SFJA 5AZ0A 4TX6A 1WUFA 4IXHA 3CPGA 1BKHA 1S3TC 1NDZA 3HG4A 1TE1A 2Y7GA 3PNUA 3EDJA 4RXFA 1CIUA 4OVXA 2UV8G 5F2GA 4NJJA 4GC3A 1XIJA 3FKRA 4JNYA 3CT7A 4NAFB 4J3XA 1PYFA 5DCDA 1AH4A 5BU9A 2CWXA 4FLSA 3GS6A 1IEIA 2J7HA 2YA1A 2OKOA 1SZRA 1VFSA 1GW1A 3GXTA 1AA1B 5K2ZA 2XM2A 3I4KA 3EWBX 4BR1A 3WDRA 3POCA 4NHVA 2E09A 2Y63A 2YGYA 5M5DA 3LNMA 4MADA 2VDHA 1W5QA 5K9XA 1QAPA 3EMZA 4L56A 5E09A 1DQUA 3N4FA 4KCVA 3GVQA 3NPWA 3UPWA 2X42A 3FGCB 5CLTA 1Z7AA 3FHQA 4R33A 2HPIA 4HNLA 3OJGA 1JDEA 1AW1A 2VRJA 1TTIA 4D8LA 3L4ZA 3TJXA 1UQZA 2G3NA 2YB1A 3T55A 1DV7A 4W7WA 3QZEA 4NZFA 2HK1A 4O10A 1W3HA 3MI3A 2I17A 3ZSTA 3P62A 3S2MA 4JNZA 1VYRA 3W00A 2IPGA 1KCXA 2CXGA 1HO4A 3TEVA 4K39A 2GJLA 5CPQA 4GO8A 4WJ8A 3H7VA 3BK0A 4JTQA 4S3KA 5M2FX 3UXIA 2O55A 1VRDA 4GX9A 1MMFA 3W86A 3R0DA 2ZTKA 3NQCA 3GIYA 3CASA 2Z27A 1ZCOA 4H8VA 3N2BA 4CD8A 1AMYA 3NQAA 1JEZA 4LCSA 1UQYA 3JVAA 4H04A 1NIUA 4PRRA 3U7VA 3KM8A 3MT1A 3PAOA 2E25A 3I3DA 1OYAA 3KCLA 3WL1A 2IPJA 4EIVA 5EGRA 2E9BA 3IGSA 4JHZA 4F2UA 4UNLA 2EJ1A 4PMUA 1W8GA 3CL7A 4UIOA 4L4LA 4DXXA 4OZOA 1OFPA 2I1OA 2WNWA 1OX4B 1YPXA 2QCLA 3PBWA 5FIPA 3WH9A 2Y8VA 3GX9A 4PUKA 1AQHA 4CCZA 3OBAA 3VGBA 5LGXA 1LROA 2A6NA 4JQ3A 2GJXB 3DDMA 2XIOA 4MFEA 2WB5A 3NQGA 2YLAA 4J3UA 1ICPA 1TV3A 3GRIA 3K13A 4G5DA 3GUWA 1EC7A 5KZDA 3GXFA 3VNJA 3OYZA 2W63A 5FAJA 3QMTA 1NFGA 3B9DA 1DJIA 4KRZA 4JTKA 4FNQA 3UWEA 1BPLB 3ECQA 4PUDA 3K8MA 1XIGA 3Q2DA 1C7TA 2DORA 4YHEA 5D2TA 4QEHA 1PHWA 2RDXA 2PWHA 1OX4A 3VGGA 4IZGA 3M6DA 3VGEA 4WGHA 1WUEA 1ZAHA 2BHUA 1NDYA 2Y2WA 2OGJA 2GJXA 2BHZA 4HNVA 3M7WA 2Y61A 3F4CA 3G1DA 1A80A 5C70A 1ISWA 1ME9A 4F3HA 2D73A 2Z2UA 3TN4A 1KXVA 2C1IA 1LORA 2PU1A 4NF7A 2PWVA 1O5RA 1PSCA 4R9OA 3LXBA 4XD4A 3MUIA 4MLRA 1X1ZA 1VAHA 3DOPA 4O52A 1XSJA 3AMDA 1ISYA 5FJIA 1OWQA 4WIWA 3OP2A 3S1UA 3DGRA 1PTDA 2SFPA 1OCNA 1QHOA 3W83A 2W92A 3CM4A 1C8QA 3NVDA 4GIEA 4IP7A 1LL6A 5BOEA 1XIMA 1PTAA 3IEBA 2WQPA 2INEA 4ZO9A 2PGWA 3ZZ1A 1JCMP 3BLFA 3L2LA 3W9ZA 2EXOA 4GI4A 4XVEA 2P5NA 3VABA 3VZZA 1YXDA 4ONVA 4D8ZA 1XS2A 3T40A 2J7BA 1W3NA 4UBPC 1OBAA 5DMYA 3R43A 3U8GA 5I24A 2H90A 3TYCA 4ILSA 3WLNA 1RK6A 4B15A 1KQZA 1P4CA 2BY3A 3UR7A 1ZENA 2ZVIA 1FH9A 1E9YB 2J62A 1ONWA 3MI2A 2PDCA 1B57A 2D22A 3BAYA 1I2RA 4GOAA 5DT5A 4UCGA 1Q4NX 2F2HA 4PCTA 3RRAA 1NF0A 4M1BA 5ABGA 3G0UA 3OPSA 1KQYA 4HVXA 3UYCA 3BAJA 3ARSA 3R10A 1FWCC 1EZWA 4LYKA 2RH9A 1I9CB 2EKGA 3SO7A 2ABAA 4PB3A 2HMCA 1VZWA 3I6EA 1GQLA 3OIHA 3SADA 4GUGA 1X7FA 4XZIA 1POKA 3I10A 4KWOA 4MZYA 2FIQA 4DF2A 1G7UA 1KTCA 1FHLA 4R9XA 3MBDA 4YVXA 1UD5A 2FHCA 3AZSA 1KXQA 4IQJA 1UR1A 3VGHA 5DRIA 4AXKA 3LDVA 3EDDA 1B9BA 2ATSA 3BJFA 4N6EA 1FHUA 3NWRA 3MV01 2J75A 5TNVA 3H21A 2A7NA 3PR2A 1KCLA 5LNUA 4N0RA 3LM7A 4RL3A 1OJXA 1S2WA 2ZVRA 3TU9A 3UCDA 2E6AA 5TQLA 3EWZA 4TV6A 2QUUA 4CVUA 1HP4A 2ISWA 1XLEA 4GZIA 4O13A 2J77A 3O6YX 3W1QA 4ECLA 1UASA 1JG9A 1KXHA 1HT6A 5HNUA 3VKDA 1ZFJA 4R53A 1VQTA 1QT1A 4GH3A 4RPQA 1XLJA 1EOKA 4GG9A 4JQ2A 2ZZ2A 2WZHA 2VD9A 1KBIA 3ZVHB 1LL7A 1DWAM 1HJQA 4MVAA 4XTIA 2GZXA 1OADA 4DWSA 3DG7A 4LAKA 5DX7A 3E6EA 3W84A 9XIAA 3KHJA 4Z0SA 2JIWA 4U3CA 2AAMA 3QR0A 3ZYZA 2RAGA 3IJQA 3QYQA 1EEPA 2OVLA 3SEPA 2DUAA 3W23A 3MSYA 1YEYA 1E6SM 1JRCA 1XH1A 1DJNA 3ABQA 1EHAA 3EKLA 1Q2RA 1RK5A 1OX6A 2G3IA 4EXBA 3GNPA 3UW6A 4ZMGA 4CNTA 2I5GA 2WV8A 2D0GA 3CHDA 3N11A 3ISIX 2CPUA 4NNCA 3VNYA 3DERA 2ZCGA 3ZVHA 3VOGA 1XD1A 1T8XA 1BRLB 1R3SA 1RY0A 4DBDA 3BGGA 1H7RA 6CGTA 3W88A 3LPGA 1PHQA 5FEXA 3JR2A 3SGZA 5DY2A 3DKLA 5IM51 4KW2A 4M7SA 2HJPA 5A94A 2Z28A 4HMNA 4BI5A 1MFUA 2OQYA 3WDPP 3L23A 1GUVA 3WQ4A 3APGA 2BY0A 4Q7IA 4AZCB 4MB1A 2OOFA 4YJ5A 1FCBA 3MPGA 1NM9A 4BF9A 3LXAA 3WLHA 4D6IA 1VFTA 1E0UA 4RZBA 1EJWC 1KRBC 1S1PA 1XG4A 4CNNA 1GEHA 4Q33A 1SZNA 4JFSA 2VDGA 3AS0A 3THCA 1UZ1A 1LZOA 2V5CA 3LLFA 3RDKA 1PEZA 2QCEA 3WH6A 3QV7A 4ML9A 2NWRA 3W1TA 4Y6GA 2DT0A 3NO3A 3OG3A 4DB7A 1MEWA 3PPCA 3PUOA 2XU2A 2WC7A 3C3NA 2CERA 4DO5A 2ZRXA 3KUMA 3TN6A 3KRUA 5DY3A 4B5SA 2V5BA 1IXNA 3W6LA 3CGTA 1UWIA 4H9VA 2EO7A 3A21A 2GYIA 1TV7A 4ZXLA 2Z1XA 1V7YA 3WLKX 3KOZA 1GTEA 4DBEA 2GK1B 5FEWA 2PTYA 4CLMA 2B7NA 2G3MA 2A7PA 1VHCA 4DEFA 4Q32A 1PTGA 4TVDA 5AKQA 3QSRA 3CZLA 1E4IA 3WUEA 3JRKA 4PL1A 1SO3A 1TX2A 3DYPA 4NZ5A 2UY2A 5HA7A 3M16A 1VCVA 4HQVA 1T6MA 1PZ2A 6REQA 4MWAB 2ZC8A 4Q8UA 1V6VA 1XYAA 1TREA 4JS3A 5I6SA 4U31A 3GD6A 4ZO8A 2DIEA 1R85A 2ZX8A 3RR4A 3LCGA 3GHUA 4OIFA 3L7RA 3VD4A 1L0PA 1AK5A 3VE9A 3Q45A 1HJUA 3RG6A 3MUAA 1EDGA 1RCOB 4Q8TA 3N2OA 2QUMA 4P5UA 2J8TA 4UFJA 4M5PA 1XLKA 1I2PA 3O63A 4O1FA 3L21A 4RZ4A 2BV9A 1FOBA 2W3ZA 1I60A 4PEEA 1A5SA 3P7YA 1SR0A 1VFLA 1EX1A 1TIMA 3URQA 2DZXA 3B8VA 3CAWA 4PA8A 2YDAA 1OIFA 1G4SA 3MMDA 4QCEA 3L65A 4Q8NA 2O9TA 4KFNA 3G1SA 3KWXA 5AB3A 3QPZA 2ISDA 4D8AA 4QX4A 1EA0A 1EJUC 4X60A 3TZNA 4N9BA 3UZJA 3UR8A 5E9XA 1GKQA 3CUXA 3TC7A 4H6EA 3SCRA 3KBVA 2ZXAA 2PAJA 3RJYA 3PK7A 5BXRA 1JJKA 2ZE3A 1R3WA 1GJUA 3T05A 1Z89A 1RVKA 4FAMA 4EXAA 3KW3A 3NO1A 5IDIA 4QS6A 2YL6A 4AVFA 4J35A 3T0CA 2E6DA 4A8LA 3KBMA 3UG4A 2EF9A 3WFLA 1XR2A 4U2YA 1BVNP 3TQ0A 4HK7A 4HPHA 2PBOA 4N2YA 4N9EA 4GVHA 1OX5A 3WD2A 2IPFA 4ZSTA 3VCRA 5HWNA 1MQPA 3OVPA 3U5YA 4J3ZA 2DVXA 2Z0IA 2NT0A 4GZJA 1XFBA 3WFZA 4WOZA 3FA4A 1H3GA 4WX2A 4AIBA 2ZXBA 1JZ5A 1WQ5A 1UA7A 2Z1VA 1JPKA 1TUFA 4EF8A 4EAMA 4A22A 2EPMX 1W9XA 3DYOA 1R2TA 1XBXA 4HHPA 4XWUA 1I4NA 4MZ8A 4S3AA 5FJUA 1TPEA 3MTWA 4R5EA 1DIEA 5HBFA 1OD8A 2DSKA 2Y8UA 2HV5A 2WNZA 1VGAA 3PZTA 3M5YA 1RQBA 3WLIA 2ON3A 2QIWA 1ICQA 4YXGA 3RHGA 1QASA 2QF7A 3QC0A 2PDNA 4C1LA 1LBFA 6ENLA 3KL5A 3DN5A 1D7KA 3FYOA 3H23A 4WR3A 3ARYA 3UT0A 3SRKA 3R5EA 3QV9A 5AYYA 3W70A 1JDDA 1LWJA 1EUNA 3QFEA 4O0KA 1VBUA 3VD9A 2D2GA 2ZX6A 1HGWA 3GC2A 4G6CA 2DH2A 3R13A 4FMVA 1OG0A 1VPYA 3OGRA 4J3TA 1W5MA 1MRQA 4XIAA 3D46A 2PTZA 3HTWA 3FJNA 2XVPA 4JTAA 2YR1A 5AVNA 4WDWA 3KWSA 4QJ5B 2OO0A 1YRRA 4LVFA 1O68A 1QMLA 3E5BA 1EJXC 2VVSA 3APYA 3LENA 4UOQA 1QO5A 4UB9A 3V7PA 1P1MA 4PCFA 1PJ9A 4JIEA 4JQ4A 2VRQA 4IGNA 2CNCA 2PRHA 5BXSA 3B9NA 5HATA 2WJDA 4H19A 3G22A 3W25A 3HBLA 3T4CA 2QHAA 5E6ZA 5BMXA 3UNDA 2GGJA 4P8WA 2WO5A 1V6WA 4ORMA 2I56A 3LERA 1VPXA 3R89A 4Z2JA 5KTLA 3THQA 3GDMA 2EG8A 3LGDA 1Y0EA 4H4IA 1B3ZA 1J93A 3H2AA 4IMEA 1K6AA 3NDZA 2KX9A 4ZTYA 2PTWA 1K6WA 2Z00A 1SVDA 3W7KA 1GVOA 2VX6A 2A2IA 4UZUA 3LNPA 2OEMA 1EJ7L 1ISZA 5LIYX 1O4UA 5LA2A 2DT3A 4D6FA 1H09A 2A79A 2NQHA 3CO8A 2BBFA 2X0SA 3OZPA 3VXGA 2A3AA 4OTKA 4HU0A 3T0DA 3MVIA 1U22A 4O57A 4NQ1A 1AODA 4AD4A 1P7TA 3K1DA 1L9WA 2DJXA 4KT2A 3S5OA 3IIOA 4MSSA 1M68A 3AOFA 2WKLA 3LBOA 1TB3A 1IZJA 4IJCA 4JIHA 1SSGA 1IR1A 3PUEA 4K1WA 3F03K 4JKKA 4OKDA 4WY0B 2O0TA 4H7CA 1TPC1 5M1TA 2Z4GA 3YPIA 2JFEX 3HGJA 4PMZA 1RR2A 2WJFA 1KLZA 1CGTA 1JZ8A 4ZOBA 3WF3A 4NYUA 3SECA 4LUIA 7A3HA 4S1FA 2DV0A 4HZ8A 3W85A 3ZXWA 3AS1A 1EUAA 2OWCA 1YBQB 2EAWA 3N73A 1BQCA 4UQCA 1K8CA 4AY8A 3W1MA 3E3HA 1FRBA 3GU1A 4C6QA 1W1IE 1CI1A 1I2NA 5EBAA 2QV4A 1FWAC 2QDEA 3NZPA 3HA1A 4WY0A 4J2MA 3TYBA 3UU0A 4AD3A 1SJAA 1K1DA 2VP8A 1H41A 2XISA 3B9OA 2FZ8A 3V1HA 1HG3A 5K3VA 3KBNA 3HF3A 4HCLA 3BLKA 4J4KA 7XIMA 2OEJA 4Y9PA 1PB0A 1W6TA 4M6PA 4HOWA 1BSLA 2ZZ5A 1QOPA 4A21A 4F79A 1WAWA 3TYEA 3SI9A 4LB4A 5AY7A 3ARUA 2J47A 5T8GA 4QS5A 4H6RA 2JGYA 3BAXA 1C8VA 1S2TA 3LI1A 1Q65A 3W26A 4IPLA 3ZR5A 4IJRA 3BANA 3N34A 1JCXA 3GTNA 1VYSX 2ZX5A 5CZJA 4LUSA 3CAKA 2LLEA 3NGFA 1U1HA 4ZCWA 1QJWA 1Q45A 4GFIA 4JTJA 2E3ZA 5TAOA 2CZEA 5D30A 4JCLA 4O16A 3LRKA 3GH5A 3FDKA 3B0UX 4RNJA 4BEQA 4JXCA 5A5WA 3G5EA 2VCBA 4WJXA 1M7PA 2DJLA 3E2QA 3LBMA 2P88A 3EX3A 2ANUA 4OT7A 1XLMA 3AMCA 2ZX7A 4KCWA 4ENLA 3S5SA 1JRBA 2PRMA 5LHEA 1OCQA 2NXHA 1J11A 2XIBA 4XBJA 1OFAA 1U1JA 4HOXA 3W7DA 4AHOA 3EXSA 3MBFA 3FX4A 3U2ZA 3M0VA 3H53A 1UZHA 3N14A 2HE8A 3WQ8A 4PYSA 1KCKA 3CZ8A 2FZ9A 3TW6A 4K36A 5AHFA 1EBHA 5D2WA 1TQJA 3DFPA 3R8GA 1B4EA 3P8IA 3OEXA 3IK2A 3NCOA 3BCJA 3SJNA 4ZB5A 4A2SA 3PZVA 3LV5A 3DEQA 2Q8ZA 3SRHA 2Z1BA 4LBUA 4O14A 2B0MA 3NZGA 3SJ3A 4ALDA 1L6SA 4HSNA 4REQB 3LCFA 3PSVA 1TG7A 5EY5A 3L66A 3QQWA 2A21A 3BLDA 1G5AA 3N1AA 3CIXA 3VVGA 4RNHA 3TFXA 1QI4A 1MFVA 1FWSA 2PLMA 4EPDC 1WDSA 4JQ1A 3WNNA 4URIA 2WM1A 5I5RA 1M41A 1GEQA 3WBEA 8TIMA 2AOSA 2BHYA 4IX0A 4EAYA 1CXLA 2I5QA 2I7GA 2ZUMA 1ICSA 1XC4A 1F9CA 1E6PA 4DM2A 3SCQA 1XLBA 1XLHA 4Y9AA 1GPFA 3M07A 3E49A 3WFAA 3CHVA 3LZ3A 3HQ1A 3MKVA 5BRPA 3KBJA 4GQGA 4ADSA 3CH0A 4JX6A 1D3CA 4GGBA 5HNTA 4ZOEA 2HWGA 4QP0A 4EWND 1J0JA 3TYUA 4JEJA 4IMDA 2QGHA 2QJMA 3SUWA 3IRSA 4WSHA 1TWDA 4QGCA 3AUOA 3RN6A 4H8NA 3VOFA 2WZEA 1ZBCA 4AZ7A 1VH7A 4Z1BA 2POTA 3IPWA 5CPTA 5CC6A 1NFBA 3CNYA 1ODUA 4QRNA 5D33A 5D9MA 2PCQA 4ZE4A 4P7OA 1TWZA 1US0A 3HQNA 3LCXA 5AFDA 4JIRA 3LN3A 2R1KA 5CSUA 1RJQA 1NJJA 3CHCA 5C0QA 3S2JA 3OVGA 3TH6A 3A47A 2ZUVA 4QFUA 1GPWA 3C2VA 7PTDA 4Z2KA 3BL3A 1UR8A 4MM1A 4GMEA 3IWPA 4L1WA 3MSDA 1NH6A 1UZ4A 1KM5A 3S4TA 2WHLA 3PBUA 1ADOA 1SZGA 4PCPA 3WENA 4IL0A 4GJJA 1KKRA 4JTHA 3AJ7A 2VC5A 4GINA 1WDPA 1YKWA 3LSBA 3C2EA 3WLMA 1QNOA 1K8YA 3MMTA 3IVUA 2DZAA 1S38A 3GAYA 2BVWA 4OUIA 3FSTA 5ABEA 1MQQA 2E0PA 1N8IA 1VFOA 5I02A 1OFEA 5E93A 2WM0A 3B0VC 2GJPA 2PDKA 1F6YA 3SIMA 1GORA 1S1RA 1VF8A 4JTGA 1H61A 2WSPA 3L2IA 4HPJA 4IGMA 4QAWA 2V3EA 1PZ3A 3PTQA 3QM3A 2PGEA 1WDRA 3GYEA 3DFOA 1EXBA 3WK0A 3W6MA 3PG8A 1E5JA 2E5BA 1FWWA 3IJ9A 1JCNA 2W6RA 2DW7A 4UTMA 2QCGA 4LEQA 1W31A 2G3FA 4WRHA 4WD0A 3KTXA 1UD3A 2YA2A 2CZDA 2J7FA 1JZ2A 2QJGA 3NOYA 1E5NA 4RE0A 2NVAA 3ZLHA 1FWBC 2FQIA 4KRUA 3NQEA 3FA5A 4V33A 2QULA 1J6OA 2QCCA 2ZZ6A 3RPTA 1GYMA 2IKHA 1ITQA 1XUZA 1FUYA 5AC5A 3AIBA 3P2VA 1XXXA 3TMLA 4AZIA 4Z08A 6XIMA 3M43A 1DYSA 5JVLA 3W7OA 1G9HA 3SN1A 3TW7A 1KWGA 3IVTA 3HPAA 1WA3A 2ZADA 4C5ZA 3SY1A 3MUXA 3VYLA 4HU3A 5GQBA 4B5VA 4W8BA 2D1ZA 2R1LA 1UUMA 4LAOA 3QY7A 2G50A 5SWUA 1E55A 3LHYA 2ZWYA 3NO5A 3VIOA 1CX9A 1XINA 1SW0A 3TA6A 3EDEA 4HA3A 3G77A 2XZ7A 4HNNA 4HCHA 3DG6A 1C29A 3NPUA 4XZWA 1BYAA 1XYCA 4UTJA 5BXTA 2HXTA 2PWFA 1D9EA 2W91A 3KZSA 4W4QA 3ZR6A 3BCDA 3LA4A 1WKDA 4CN1A 2JBMA 3WK3A 5F2LA 3REQA 1GVSA 1IE7C 2JE8A 1ZUAX 3TVAA 4EPKA 3PAJA 4B3LA 2H3DA 4N7QA 4MY9A 5H91A 1A5CA 2WCAA 1AW2A 4I8DA 1WXJA 4Q4OA 3OQ8A 4L7ZA 5C71A 4PUEA 5D8WA 3BJTA 3BZGA 1VFFA 2OYKA 4LCQA 4DJDD 4I5XA 2CLFA 2ZYFA 3R4IA 1JNDA 1EGZA 4QQUA 1FWEC 4F0HA 4UTUA 3DFYA 1YNPA 2PWEA 2EPOA 2CBJA 4RZ6A 2VGIA 1G1YA 4U10A 1LOSA 3M0JA 5AYZA 5F4SA 3NJ3A 1BYCA 4MY8A 1QNSA 3U48A 2XVNA 4PR4A 5A8QA 3M1ZA 4AVNA 1VBRA 4JTEA 4I5UA 4PB4A 5B7ZA 1JXKA 3P5ZA 3MKCA 1XUUA 2CLEA 3AIUA 5AYIA 2ALRA 3TIMA 1J5SA 2YXXA 1QHPA 3W81A 3PM6A 4IQLA 3G6MA 4AMCA 1V3IA 4NAEA 1A5LC 2BXYA 1CGUA 1I75A 1B54A 5IDZA 3UPBA 1KM3A 3GNDA 4UCFA 5HXMA 3EPMA 3LD5A 2HNHA 1H7XA 3GDTA 3UWWA 5FEZA 3EX2A 4C6CA 2X7WA 1IZKA 2FDMA 2DSVA 1RH9A 3GG8A 3O2LA 5AHLA 3W71A 3URBA 3G18A 1XRSA 5I00A 5DO8A 3LGEA 4O11A 4IFOA 4H9MA 4PMNA 2F6XA 3ABZA 4QE5A 5A8PA 3O0FA 2UWFA 2C6QA 1IXQA 3TV8A 2W62A 2P8BA 1TFVA 5LIUX 5M3WA 5HJYA 5C7HA 2PDBA 1VLWA 4F48A 5H6HA 1G94A 1WZKA 3QFWA 3DUGA 1QW7A 3CYJA 3TSDA 3WLSA 3RM4A 1G67A 4DUXA 3WMSA 3FDGA 3N4AA 3T2PA 1AL8A 3AYRA 4I5RA 4OBTA 4FF7A 3WDJA 3VE7A 3HV8A 3UWUA 1OGGA 4A8NA 2OEKA 2GQAA 2QUTA 2D2HA 3KDNA 3EA3A 1HKWA 3QRHA 4UQDA 1UWTA 3OA5A 2A3BA 3W4RA 1MUWA 4IM4A 4XBSA 3PZMA 4E2DA 1HTIA 2GUYA 4QLLA 1JZ4A 1O5KA 1EPXA 3M0XA 4Z1AA 3T0AA 1XH0A 4NKCA 3DHPA 3WJXA 2P3EA 1V0LA 4US6A 2BY2A 1GOXA 4Q3MA 5GNYA 1XJBA 2WBGA 4FA3A 3N17A 4ATLA 2WPGA 2ZRUA 1R0MA 3OLEA 4IG2A 4D6CA 4OECA 1JAEA 2A7RA 3GVGA 2XGIA 5GJPA 4M0XA 1UPPA 2OG9A 3VD3A 4B3ZA 2HVNA 1TV5A 1TV4A 3LTYA 4DY1A 3WQPA 4B3KA 3S5NA 2XSAA 1E0XA 1E73M 2IPWA 2VFHA 1DXFA 5BNKA 2EKCA 4W7VA 1NP2A 4I9MA 3LCHA 1OC5A 2YZRA 3OZOA 4M7TA 1WXZA 2NX3A 3NZQA 2IMRA 5KEZA 3FV9A 2ZUUA 1GOWA 3MUZ1 4W84A 4PSRA 4ZODA 2XFWA 1HO1A 3VINA 4QSHA 1C90A 4Q8OA 3B8IA 1Z44A 1WKYA 4XKYA 3CQKA 1Z48A 1HIZA 5B80A 1SFTA 5DCEA 3ELFA 3EDFA 4ACZB 4AIOA 4WOQA 3OOQA 1PKYA 4MUZA 2HVMA 1I1WA 3EX1A 4H2HA 1R47A 3H7RA 4KEVA 3CZKA 3OHMB 1KM1A 1RQHA 1A3HA 3WEOA 1V3HA 2YJQA 3GDLA 3QR1A 2Q02A 4NNAA 1T99A 4JFUA 1AQMA 4CU6A 2ZXDA 3WIJA 4XAFA 3KXQA 5XINA 1XQLA 1XW8A 3IUHA 1M3UA 1NU5A 3DFTA 4HYRA 3ONBA 4XIMA 3AMKA 2PC4A 2F8QA 3W1LA 4BA0A 2WK2A 1OF8A 3P3BA 4F40A 4Y90A 3S47A 1TPUA 3U0HA 4K7YA 1RY8A 4XISA 4GYJA 3WELA 1EZ2A 2J8FA 4BEUA 2OYMA 3GHRA 3GO2A 3A4AA 4NUWA 1BGAA 2WMKA 3DXIA 3QKZA 4ACZA 5AHMA 1VEMA 4LALA 4G1KA 3CEUA 1R46A 3LMYA 3ITLA 4FOKA 1SU5A 5DRCA 3MCNA 4G56A 4RW5A 1S5VA 3TE9A 3AHVA 1T7LA 3E5PA 1CEOA 1IV8A 1HVQA 1VIZA 2UBPC 4RV8A 3W02A 2CIPA 2EHHA 2G4FA 5HMSA 2W79A 1TKKA 1W17A 3CU2A 4FNRA 4DYEA 3LGGA 2I57A 4ADTA 1GHRA 3FW6A 3SIZA 2DZPA 3OODA 4I8YA 4C6JA 5CLWA 1Q6RA 5I3KA 4L6OA 3T08A 1R9ZA 2J78A 2RDWA 3WNLA 4JN6A 3M0YA 4LRSA 3R7MA 1RD5A 2FB2A 1EF2A 1XH2A 1NDVA 3T81A 3L12A 1EDTA 3ME3A 1OK4A 3RMEA 1J79A 1KFJA 3BUVA 3TN3A 1UOZA 3JU2A 2JIEA 3ZT5A 2P53A 2ZUTA 3RO8A 3NZ1A 1P6WA 4EKJA 3MZ2A 1KA9F 4WF7A 3H22A 2ZUNA 4C65A 1FDYA 4GH1A 4UFIA 2FVMA 3GHTA 2C16A 4BI7A 3L0KA 4HZ6A 4UR9A 1K03A 7REQB 3PHAA 1TR1A 4KEZA 1UC5A 1K3UA 2X0HA 5CSYA 1R3RA 4PN2A 3OB8A 3AROA 1KNWA 4N4QA 3VTRA 5LKYA 2G41A 2CBUA 1PX3A 2PLCA 1XCWA 3OZMA 2BTMA 3R2GA 4NYYA 4V1XA 2RUSA 3IANA 4O1DA 5DCBA 4ATDA 2TPSA 4QDPA 3UFYA 3PZ9A 2XIIA 4QE4A 1X8FA 3RUBL 2YW3A 2CHNA 4G7EA 2RGLA 1Q6GA 3NYZA 2BVYA 1QK0A 3OVRA 2V67A 4NJIA 3VC5A 4C91A 1XRVA 1S5WA 7REQA 3TXVA 3T6CA 2OQHA 3SRFA 4DF0A 1OVDA 4OU1A 4J5NA 2PWUA 4MWAD 4HBKA 1C7SA 3IJLA 1KFBA 3DKJA 5F4WA 3QLLA 4L1GA 5B7YA 5LGZA 3UWVA 3RX3A 3BURA 3ZT6A 1HP5A 2G97A 3C0SA 2YL5A 3O6AA 4RE2A 4AHPA 3Q4DA 3R25A 4KMQA 3LS9A 1DIKA 3TONA 2BS9A 3L4VA 3QZ6A 2L5HA 4AZHA 3SW6A 3K5XA 3F2BA 1QVBA 3QR3A 3N15A 4M29A 2B7PA 2C0HA 4LWWA 1QPRA 3R12A 1XICA 1JZ6A 3EB2A 2BOFX 1QFEA 1Z42A 1ZY9A 3TOYA 4M24A 2WAGA 3GXNA 1CNVA 2DW6A 1ZBKA 5IHSA 1QI5A 4Q8QA 3NEVA 5CBBA 4YPJA 3SGGA 1B4KA 1SZFA 1TQXA 3OIXA 1RBAA 4DPQA 3Q67A 4IX2A 1WXYA 3GG7A 5AOUA 1UP3A 1UWAA 2ZXQA 3MMWA 4PMJA 3QV8A 1I1XA 5AYBA 3V4BA 1G4EA 4E4UA 1LG2A 4NX5A 2E1DA 1J10A 3NIYA 4AYSA 5I09A 1WCGA 3A9IA 4DWDA 3BGJA 3RPMA 3DI1A 3AZRA 3PB2A 2WHMA 3WJWA 1VFUA 3W1UA 4QJ1A 1BKSA 1DKWA 1QTWA 4R34A 1SJDA 2FPYA 2GJRA 5GNXA 3OBKA 4FXRA 2YKKA 4NZCA 1C91A 3VOJA 4ZQOA 1XYFA 5AC8A 3AXMA 3WLRA 4E5TA 2DUZA 2FFIA 5T9BG 4XAYA 3WQEA 3HPSA 2ZC1A 4YTTA 2TMDA 1GVRA 1J96A 3PVFA 2GGGA 4GNVA 2NUXA 1R2SA 3RM9A 4OQVA 4Z2IA 3EMQA 4PUWA 3UY8A 1A5NC 4IFKA 3E0IA 1E6XM 2I9EA 3DX5A 3LEPA 5BU6A 3EKZA 4INFA 1L6WA 3OGVA 2CKRA 4X9SA 4BI6A 5A6LA 3ARWA 2NQ9A 1HKMA 4EX4A 1FWNA 2VMFA 1XYZA 2HE5A 4IT1A 2YDRA 2W66A 1F6KA 9XIMA 4HPNA 3SCVA 2VWTA 3VPLA 5G2IA 1K7FA 4NJGA 4HKPA 2QR6A 1R7AA 3RRXA 3EOEA 3PZNA 3T2OA 4IIGA 3HPZA 3IUDA 1W3TA 4FALA 4V15A 3P6LA 1YNYA 2GUUA 3T8QA 2C18A 4WKFA 2VRKA 1SQ7A 5HQMA 2VCCA 2DPEA 1Q6FA 4ORIA 1E0WA 4DBSA 4JTUA 3C56A 1AZ2A 2ZRVA 1PPIA 2EG6A 4B4HA 1VJIA 3QXBA 4O1AA 3A4XA 2NQLA 4GISA 3ITYA 2BGNE 1YNQA 1ZRQA 5DELA 4IGHA 1XBYA 4RE4A 1L2UA 4TIMA 1FCVA 5CSSA 4LRTA 1W3LA 1WKEA 1DJHA 4A4AA 3QW3A 3FCPA 1EQPA 2R91A 3PJWA 4WLCA 5FKYA 2PDJA 1F8MA 2GUBA 1JZ7A 1W37A 1PS9A 1Q2SA 4ZZ9A 3UYIA 4IH3A 3FEQA 2A3CA 4S39A 3RPDA 4J40A 3NQ6A 5DXXA 5D38A 4ZOCA 3UA3A 2VJXA 5ABTA 1E3XA 1E3ZA 1S2CA 5FJOA 4XX6A 5HPOA 1RBOB 3GXDA 1BG9A 1W1A1 4XZNX 4AD5A 4PUNA 3DECA 4C5YA 3ZWTA 5LNSA 4PMDA 4F66A 3KHDA 1HVXA 1NF7A 3HQPA 4S3CA 1SZEA 3ITOA 3HU7A 1W3JA 4O4VA 4AZ5A 1S2AA 3ABXA 2VGFA 3KTSA 4DJDC 2FZMA 1KM4A 1XCFA 3VNLA 1W2PA 2AL2A 2IS7A 3KBSA 1YHTA 2E8ZA 4LPCA 4FOUA 3WF1A 1CLVA 2XGBA 5CZTA 3EDKA 5DMMA 2D2JA 3KVLA 1DIOA 1E9IA 4GO9A 3BVJA 5H8MA 1YW1A 3R11A 2VX5A 1XRTA 1JCYA 4IGSA 3WLLA 3ANUA 1E0VA 3A64A 1IGSA 2VX7A 1BXNA 3VMNA 1RSCA 4L6DA 5CEWA 2REQB 3ZIZA 4QLJA 4HA0A 4QJ3B 3F5KA 4UC5A 1P43A 4DAFA 2J9XA 3O6DA 5BXPA 1FWFC 3BARA 3N04A 3PB0A 1GKRA 4MPKA 2YDQA 3M47A 1FWRA 4IHCA 2BG5A 4AG0A 3W7MA 1E4LA 2GPTA 3GKAA 3B9EA 4GIYA 1DTNA 4Q8WA 3TFCA 4X0VA 4ZBCA 1CT5A 2J9YA 1TJ0A 4LU0A 3SUVA 5JBFA 3VGDA 4RX0A 2E40A 2XH4A 3VUPA 3ABRA 1W9PA 3UY7A 4ZENA 5C2XA 1XGZA 2CBVA 2Y24A 2E7FA 1EL3A 4D71A 3OTRA 6TIMA 2NQZA 1UKSA 2Z1SA 1XRFA 1N82A 2JKAA 4JAWA 3WUFA 1SJBA 1M7XA 1KFCA 4ROPA 5I0DA 2ZA2A 4MNJA 3UJRA 2VURA 5E5CA 3ABOA 1DBTA 3AS3A 3OW1A 4H83A 4NX0A 3WLQA 1XG3A 2FPVA 1V7AA 4GZ7A 4C60A 4ZB2A 5T26A 1G7VA 2E28A 1O6IA 2CZFA 4YTRA 1D8CA 5HOSA 2E9MA 5CC5A 1PIIA 1TJ2A 1X97A 1QI2A 3TQVA 1DL3A 1YPIA 2PEVA 3V0TA 4A8IA 4UTHA 1BVWA 3HJEA 1K9EA 2C13A 2H9AB 2WVTA 3GU2A 3E38A 3V5CA 2VZSA 4HIBA 3T07A 5LA1A 3MWAA 1JD7A 1EOMA 4PGLA 4MF4A 1JZ3A 1IR2A 5FI8A 3TKFA 3TP4A 3N9RA 3I7SA 4XBKA 5IBXC 2X30A 4Q4RA 3C2RA 2J7CA 2CESA 3ZJ8A 3W24A 4EOUA 2YDSA 2Z24A 1WDDA 5EB8A 3AIQA 4U33A 2FH6A 1GNXA 1YX1A 4ERGA 5A2CA 2A4AA 2Z1WA 4DYKA 4PMVA 2CZVA 1H7PA 4Y8FA 3VCNA 1FFRA 2OGYA 2CYGA 4Q7BA 3VFCA 1MDRA 1PE1A 4PC8A 3TLLA 3S1VA 2H9AA 2QT3A 4DJFD 1EFZA 3GXPA 4N9CA 3K8LA 3HFYA 4JQAA 1BEUA 4POCA 2XGZA 3WMBA 2VNCA 2O9RA 1KFEA 4B5XA 1VENA 4BWLC 3O6CA 1ITXA 3G1AA 3W7RA 3HO8A 4MAZA 2D0FA 2R82A 4LVAA 5AC7A 4E0CA 3C0JA 4AZBA 3P74A 2YXGA 1M7OA 3C2OA 2G37A 4NU7A 1HL8A 3MI6A 1W9UA 4QAIA 6A3HA 2XINA 1J12A 3AYSA 2OX4A 1EWDA 2R8WA 1AH0A 1QBBA 4Q6JA 1LUCA 5LSMA 1ZJIA 2F7FA 3LB0A 4O1CA 4PBGA 1DXIA 2QJHA 4KERA 4NXKA 3L4YA 1EB3A 3UD6A 1KTNA 1SMAA 2TYSA 4U2ZA 2O4MA 4ZOAA 5DMNA 1RALA 3W2NA 8A3HA 1XC6A 3GTXA 2P0OA 4L80A 1B5TA 1ADDA 4KWWA 1TWWA 3W29A 1FX6A 2ZE0A 1GOIA 1CGWA 3BAWA 3WNKA 4C7GA 2E6YA 4H7VA 4W85A 2ZUSA 1Q63A 2H8XA 3F4WA 4JTFA 2J4GA 4LY4A 3W1XA 3GR4A 2D2OA 4UMAA 3HMJG 4G9PA 1SGJA 4IL2A 4M51A 3C52A 3D3AA 4J7RA 3KX6A 4EXQA 3G1HA 5CPNA 3TYDA 4HD5A 2ISSA 2R94A 1DEDA 2OSYA 1LRNA 1Z69A 5EKYA 3RLVA 1GVQA 4FX6M 1E15A 1N8WA 4HJFA 1L8PA 1P0NA 3OZYA 5D02A 2WVVB 2PUZA 3UGVA 3Q94A 3WQ6A 4JKMA 2XDFA 3L5MA 4GI6A 2ZRYA 5U7SA 4Z1DA 2VT0A 5HPCA 2WSRA 3LCIA 1MZRA 2BSLA 4C90A 3MYPA 2Z6JA 2WHKA 1WZLA 3WNPA 2XG9A 5FJJA 5DT7A 4MJ4A 2E9LA 1YDYA 3WBWA 2BWGA 3VOIA 3CHEA 1PL9A 4JIQA 1Z9AA 3WK2A 2QCHA 1BF6A 2OSXA 3CAQA 1LL4A 3GUGA 1UR3M 3QOKA 4LV9A 3VIHA 5K9DA 3LHUA 3EXRA 1KBLA 4HCDA 3MCMA 3W2UA 5KETA 3K46A 1ZJBA 2ESCA 1JGIA 3A13A 4RJEA 2WVVA 3A24A 3ARPA 1XI3A 3WL0A 3GK0A 2B7QA 4DX3A 4YHGA 3QZAA 3R94A 1ISXA 1JI2A 3GVVA 3EXTA 3K1GA 4A29A 2GWNA 3T44A 1S5TA 1TRDA 3AXKA 4KBXA 1WDQA 3ARQA 1ITUA 1WX0A 4JY9A 4PUUA 1GZGA 3ONCA 4CQBA 4GQRA 4NILA 1TZ9A 1YMYA 5FCZA 4UZSA 4OHQA 2YCLA 2VENA 3IJDA 1IEQA 3WQVA 3STPA 1UOKA 1XLCA 1XBVA 2IW0A 3P80A 4MWAC 3EA1A 4B2DD 1R3TA 3S2CA 4ADUA 3CZJA 2DU2A 2J7GA 2GVEA 5DEZA 1OSEA 3URNA 2CLPA 1QI0A 4LYQA 1IEXA 4L6HA 4AHQA 2GVLA 3L4WA 4CU7A 4QLKA 3EWXA 2E5CA 1IIHA 2OMAA 3WH5A 4JYEA 5EMLA 2W0UA 3EOLA 3AWNA 5BROA 1YTDA 1V3LA 2G4JA 4O54A 2ZIDA 3C0QA 1I6NA 2DUXA 3DENA 3TXZA 4ZQNA 1V79A 3IGHX 2EJAA 4UTFA 1KR1A 1LQ0A 3B05A 1TCDA 1B0IA 2PF8A 4JPGA 3EWCA 3V35A 3FS2A 3FHAA 3LLXA 3GFZA 4GFSA 4FZIA 1EH9A 4YLWA 3GFYA 3S9IA 1RAKA 1JDFA 5E9AA 4HP5A 5A6AA 3WQWA 4CQ9A 2JEQA 3BJSA 4QE1A 4DZ5A 2NW0A 2FH8A 2CITA 1TPWA 2XFRA 3HM7A 2XWDA 3GH4A 1J0YA 3CV7A 2NLYA 2VOMA 4NAFA 4ZO6A 5I3HA 3Q58A 3KVJA 1BQGA 3CYVA 4DZAA 3KCOA 3WUGA 1W56A 1JF6A 1PKLA 1ISVA 2PDIA 2ZUWA 5CH9A 3VOHA 2P50A 3F1QA 1AZ1A 2POZA 1FWGC 1KGUA 4GQQA 1QCWA 1OFQA 3QHMA 2Q3OA 3ES7A 1XLDA 5A6KA 4LBRA 2YCIX 3D3FA 3VIGA 2NV9A 2OZ8A 3AIVA 3SZ8A 5MKGB 3G3DA 4W87A 2W67A 3BO9A 1FKXA 3AICA 1M1BA 3WH8A 3FGCA 3LX9A 4N4PA 4S3BA 4C6EA 3LTPA 1OK6A 5HWJA 1JUBA 2W5FA 4ZFCA 3AWOA 4L4MA 1EPVA 3T42A 3DYMA 4KWUA 2QZRA 1IIGA 3W2MA 4C6OA 1DP0A 2YA0A 3UEQA 4F9DA 4ZA0A 3LG3A 1FBAA 3T4WA 3CV1A 3WMLA 3S0CA 1B31A 4DELA 4LH8A 2QJJA 4X3ZA 4X2RA 3CC1A 3DZ1A 4P61A 1TPB1 5JMUA 5MKGA 1OGBA 1P0DA 5CSRA 4IIHA 9RUBA 3Q37A 4D6DA 2CU0A 2O92A 2C71A 2G95A 1AJZA 1OY0A 1ELSA 2V3FA 1XF0A 1PKNA 5BOFA 4PE8A 1AMKA 4KGJA 1OCBA 3TROA 1ZALA 5FSEC 1W9DM 1MW2A 2WKJA 4JR5A 4HPXA 3JZUA 2NV2A 2J13A 3C3UA 2GVYA 2VTFA 1HJSA 5D2YA 3WQCA 2OCZA 4WVXA 1CXKA 5A6TC 5FEPA 2WVUA 4MKNA 1GWJA 2OZ0A 1A53A 1F07A 2WC4A 1DXEA 3A6OA 3NURA 1R5YA 1VHNA 1QDSA 1YYAA 3STFA 4Q4MA 2PP1A 5BW6A 4RDWA 3DFHA 2OWWA 2R1MA 3C8NA 2Q09A 4GABA 3UXAA 1UP0A 3ALFA 3I4EA 4UTIA 4DJED 3WDIA 5E0FA 4PTMA 4DJDA 3TDFA 1Q66A 2Y6ZA 1E1EA 3C6CA 3DBNA 1PWMA 4PCSA 2R9RA 3CUHA 4DNMA 1NARA 2HVOA 4GXPA 1G01A 4TX8A 1A5UA 4YIWA 3SUSA 3WLJA 2ZFAA 3LRMA 1PX4A 4A3YA 2DSWA 4ZTXA 1XLAA 4DF1A 3P14A 1T96A 4ZGYA 2IKIA 3ZFHA 4B4FA 2GQ9A 4ZE5A 2VC7A 4M80A 4JY8A 5EPDA 4MB4A 1DJZA 1W91A 1J8VA 3G1XA 1DIDA 3VDGA 3MYOA 4DUOA 3BW4A 4WK9A 1Y5WA 4LEFA 4GD0A 3QKEA 3QLDA 4MLJA 1LT7A 4I90A 1J5TA 3NSNA 3D0CA 2FPTA 3NXFA 3L5AA 4E38A 4CNOA 4YU1A 3M0LA 3ARZA 5GNZA 3W2KA 3L4TA 2V63A 3UWZA 3KL3A 3MV11 1MUCA 3B97A 1KR0A 3TTOA 3DC8A 5K4XA 1NWSA 2Y5JA 1Y8BA 4WGXA 4F2TA 2FZDA 3CPRA 3W87A 1QO2A 4UQEA 3W2JA 5U4NA 2R14A 3NL5A 4HYWA 1V0NA 1GYNA 3SY8A 2YCJA 1EF3A 5LNRA 3UWQA 3G1VA 4KWVA 2Y62A 3WF0A 1FWDC 1QNVA 1DWGM 5G1YA 2Z2AA 3N6QA 2EBNA 2Y7DA 4W89A 2DZWA 3UWYA 4Q4QA 1HKKA 3WF2A 4UFMA 3QPYA 2QMKA 1THFD 4JDYA 4H3DA 5HMEA 1EYWA 1EQCA 2BODX 3F2DA 2FGBA 3CLWA 1HN1A 2PTDA 3FAXA 1IQ8A 3IJ8A 3SCNA 4B91A 2NQ5A 4XUGA 4HA4A 1GOMA 3GNXA 3BLLA 5LNVA 3DGBA 1SM9A 4QEEA 2ADAA 2FTPA 2VHLA 4EVZA 1J0HA 1KWKA 3HGSA 1TMHA 5IBXA 2GFTA 3EB4A 2IUZA 4IJBA 4H00A 2PDLA 4GXMA 1ZNNA 2GVGA 3PTDA 1I45A 2E1WA 3W7LA 4WJEA 1GGOA 3BDKA 4FF5A 4Q4SA 1Q6QA 4IQEA 2FJKA 5CPLA 2XH0A 4UNKA 3H2CA 3T09A 1JXJA 4O53A 5DXYA 1W1YA 3BZJA 2FTYA 4S23A 2ZA1A 5LIKX 1Z41A 1ZU8A 4JTDA 2Z26A 5JBDA 1N7KA 4XO7A 4HNCA 2PDYA 1ZB5A 5GVJA 3GVWA 4PTXA 3CEPA 5A8NA 1Q8JA 3M0KA 3BMVA 2OU4A 1V0MA 3FYPA 1LLWA 3LHTA 3QGAC 1CLXA 1FA2A 1PUDA 4BWLA 1QPOA 4LYRA 2VR5A 1KC7A 3V0SA 4DN1A 1US2A 4GC4A 1LCOA 2B31A 4XUYA 3CPUA 4DJFC 1I0DA 4JTRA 3WK1A 2PP0A 2WMIB 3CUIA 3W7EA 5EMJA 2J8GA 5I3IA 2VEKA 4ZQCA 4XD3A 2WW5A 4MY1A 2PF0A 1WB0A 3GXMA 4ZFMA 1XSKA 1H5VA 1EC8A 2Y70A 2PDGA 4WKAA 1J0IA 1KD0A 2PSNA 5CPOA 3G1YA 4UTWC 7TAAA 4E3VA 4Q8PA 4BS0A 3MUCA 1YADA 3DBPA 4TX9A 4J28A 5CPMA 2GSJA 4O4WA 3ABSA 3UVAA 3G8EA 2CETA 4BHYA 2UY3A 4IUOA 4S3GA 5AC6A 3RF9A 1YE4A 4GY0A 1CGYA 3S9YA 4M3PA 2O7QA 1BRLA 5FF3A 3CQJA 3AHYA 4C6IA 4NNBA 5BOOA 3NL6A 1TCMA 2R24A 2Z6IA 3NUKA 4OOUA 1WBJA 3JW7A 3T2QA 5FA5A 2GDUA 3A3WA 4EE9A 3CAVA 1PBGA 3UGRA 1WE5A 2CHOA 2WCSA 4AZCA 4CEXC 4AYGA 2YL9A 5FL1A 4Y8EA 2I16A 5BRBA 4ICMA 1OABA 3B3DA 1DOSA 4XB3A 4PRWA 3UPMA 3T9PA 1AD1A 1U5JA 3PWAA 4GKTA 1O1HA 2P8CA 4KETA 3GR7A 1V03A 2QDGA 2XN1A 3TOPA 1HUVA 4RDZA 1QPQA 2X0YA 2OZ3A 5AHEA 3VKBA 3EX4A 2IQDA 1SMDA 3BICA 4WXZA 4AB4A 3AAMA 4AF0B 1ZP4A 2PGRA 5FD0A 5I07A 2HNEA 3LHZA 4GKLA 3EB3A 4JIIX 1E6RA 4LUYA 4RR4A 3LCWA 4L5ZA 3TNBA 1UBSA 4FNPA 4IMFA 4PUJA 3TYAA 5F4XA 2VUNA 1S46A 4F0KA 4A3UA 1E40A 3WLTA 2QMJA 3VDAA 4I7VA 5FAGA 3Q65A 2GK1A 4I6KA 2C79A 5EFDA 4FLRA 3TAKA 1IYXA 5M03A 1R7OA 5TF0A 3CIVA 1OM0A 2OLHA 5FF0A 3TWAA 2QAPA 3FLUA 4AF0A 3N12A 3F5LA 3ID7A 3QMRA 4AIEA 2OODA 2H6RA 2PD9A 4MWAA 1RP8A 4YS1A 5LA0A 1XL9A 1OD0A 1SFSA 3TC3A 1UYQA 3EPOA 4CCCA 2VZVA 3AJXA 5A8GA 1CB2A 3SR7A 1WPCA 3WEMA 3M5XA 4V28A 1MW0A 1XHGA 4H8UA 3AMLA 1FDZA 4MG4A 6TAAA 1LLOA 1OYBA 4XV0A 3UJSA 3GB6A 1JFXA 1QATA 5ABFB 4A6GA 1GJWA 4FOJA 3SCUA 5DN1A 2BDQA 2QUNA 1KBKA 1Z3NA 3LZ5A 4CD4A 2ZZ1A 4YMZA 4N02A 4FK9A 3FOKA 4PB5A 3S42A 3AHZA 3WQDA 3PBYA 2UY4A 3ARVA 4OFCA 4LBSA 5HJLA 1D8WA 3CMFA 4PCNA 4LTSA 2QJNA 3W07A 1YTEA 1RCXB 4YVVA 5HQLA 3CO4A 1DJXA 3KZPA 5D8ZA 5C9WA 2WWCA 3GM8A 3M64A 5ECUA 3MO7A 1LYXA 4AD2A 2W61A 1TPVA 3TCEA 2PDPA 3W82A 3RAOA 4E2VA 1AL7A 1EBGA 4F2BA 1F4AA 1JI1A 3N6JA 3NQFA 1R30A 3MW7A 4HHMA 5ABFA 2OT0A 2YFOA 1GJPA 1JR1A 5F2IA 1GVYA 3QVQA 4W8AA 2V30A 5FF4A 2MUCA 3OVQA 3PZIA 4P7NA 4GI9A 3ITXA 3MHFA 3RU8X 4DLFA 1HXJA 1F3TA 4KFOA 1CGXA 3NQ8A 4GE8A 5FJRA 4P8UA 4I7UA 2DZSA 3VX1A 3HB9A 3W3OA 4BZYA 1NWRA 3PBGA 4FNUA 4LQ1A 3PULA 3E12A 4LNCA 1KFLA 3BXWA 1FTXA 3GW0A 1QNRA 1H7OA 2NXGA 1VC4A 4ERIA 5HJXA 1Q6EA 3PZQA 1EGMA 4LUTB 2WZMA 3GAKA 2VOTA 3S1GA 2ZZ4A 1ZGDA 2J74A 3I3BA 3TK7A 3QHOA 1OYCA 1IT0A 4LW7A 3K30A 2WCGA 2WSKA 1F61A 3ICJA 2CCRA 3G3MA 3LOTA 2GSHA 2Y1HA 3WCZA 1UA3A 1Y5VA 3PJUA 3WG6A 1JFHA 4YYFA 1LT8A 2WANA 5HNRA 3MA8A 1A5MC 4D6EA 3UNTA 4H8HA 1JIBA 5FOOA 5F7UA 3E74A 2XSXA 4LUTA 3L0NA 3QJAA 3THUA 1ZZMA 2PC8A 2O56A 5D9NA 1DQWA 3UERA 4GPNA 2BY1A 5A8OA 2PTXA 1LQ2A 4MWAE 4IUGA 1K7XA 4PTNA 3BOLA 4JFTA 1W5NA 3DHDA 1RLDA 3PFRA 3C86A 3RX2A 3QMSA 1Q7MA 1VS1A 1KV8A 3M4HA 4I6VA 1VFHA 3UESA 4A35A 1H62A 4LAZA 2P3ZA 1FDJA 4F9JA 2JF6A 1K8XA 2ALDA 1UUQA 2D24A 4UFKA 4H01A 2X16A 3A5VA 4HN8A 4MNKA 4GQBA 1CECA 2EPLX 1RA5A 1DVJA 4S2BA 3M41A 1CTNA 3N9KA 3A9BA 5C5YA 3LSCA 4LGXA 1TVLA 3VX0A 5CC7A 5HMFA 3W53A 3AIWA 1PIFA 3HV9A 2Y7EA 4HMEA 2X1RA 7ENLA 5CAKA 2J9ZA 5I3DA 2PU0A 1XYBA 4B9YA 3HN3A 1CXEA 3E02A 2B7OA 3HG3A 4GBUA 4G7FA 4CGTA 3LBCA 1K9TA 1TX0A 1RVGA 3DHUA 5AHNA 1H50A 1XKJA 3VMOA 4UTTC 4TU1A 2E6FA 3DHFA 2V82A 4OJYA 1BWLA 4DO7A 4RNFA 3VMPA 5FF2A 4DJEC 1W1PA 3T8LA 1XIBA 3K2GA 1ONRA 3QY6A 4WXYA 3WJYA 1W9BM 2PLKA 1XM3A 5FL0A 1OF6A 3GG0A 8XIMA 1M53A 3WO8A 3LTSA 3ZM8A 5HNNA 1UD8A 4IFRA 3BOXA 4QNWA 3RIKA 2A3EA 2WKGA 3W7PA 5DMLA 3RGTA 1EJTC 1HJVA 1K8ZA 4RDVA 1UZDA 1EYEA 3JUGA 4DZHA 3TAOA 3IRDA 1ZJHA 3T0TA 3L68A 3GTIA 5C9ZA 2NX9A 2GDVA 1ME7A 3DH7A 4K68A 2QQ6A 2TRSA 3GXIA 2HCVA 1CGVA 3WJSA 1UIOA 1ONXA 4IMCA 5PTDA 5IXEA 2D0HA 4Q22A 4A8RA 3IVSA 2QPSA 3O16A 1EKOA 3QYSA 3V3WA 2BB0A 5A6BD 3UR2A 3UXKA 3KEHA 2VFEA 3DAQA 1JPHA 1EEXA 4DXVA 2JQXA 1M03A 3HPFA 2FZBA 3GBDA 1E9LA 4K8HA 1BTCA 1Z6KA 3CV2A 3F7JA 1YBQA 3S1WA 1P0KA 2X1SA 4FXJA 1DWJM 1Z8AA 4ZQPA 4LXFA 2JKPA 1KXTA 4K7VA 4FNSA 3WZ0E 4MHBA 1X7IA 2XZ9A 1A5AA 1A50A 4QITA 4HSOA 3SFKA 4LY8A 1EP2A 3WLPA 2PFHA 1W1B1 1OG6A 2QCNA 5EL1A 3BW3A 3C5QA 4JFWA 4LB3A 3ZT7A 3GNOA 3RYSA 1E51A 4GIRA 2I5IA 3AIRA 3KLLA 3U4AA 1E1FA 4GCAA 3CB8A 1R3QA 4OUEA 1NOFA 4NY2A 1OZQA 1WOBA 5T9CE 3SN4A 2YCEA 2NWSA 4LC6A 3EAUA 3CV6A 1SO4A 2VFIA 1KBBA 1RD6A 3HQOA 4QJ4B 1D3HA 1V93A 1EC9A 1RCQA 4RK8A 3O7UA 1M04A 1GZ1A 1JPDX 3CTLA 3U6WA 1IHIA 5I3FA 1XIIA 3B04A 1AW5A 2VXNA 2CLKA 2EEXA 1JDCA 1TJRA 3AYTA 4QISA 1EXPA 4YL2A 5XIMA 5BWFA 3PJXA 2OLSA 2ZOXA 2WMGA 4QSFA 4JTSA 2A5HA 3U57A 2W27A 1XDJA 4C1KA 1R9YA 5I79A 4MUPA 4U28A 5AHIA 3BMXA 4G1NA 1MRAA 5LYRA 2XN2A 4IMGA 2JEPA 2VWSA 3S2NA 4GVGA 2FMNA 3IJ6A 1AFSA 1Y7VA 1A0CA 1D7FA 4DJFA 3MMUA 2QCDB 5A1AA 2VZUA 1RPXA 2OPJA 1J0KA 2Y89A 1ZHAA 3INPA 2X1TA 4NI8A 3BPWA 1HL9A 1FCQA 2XIMA 2E77A 4JIPA 3RLUA 5D04C 4FNTA 3AUJA 4Y96A 1XIEA 1TV8A 3CWOX 2VL4A 4UTWA 4DZIA 3N6HA 1QOQA 1WNOA 2OELA 3L4UA 2IXUA 3WD0A 2V0TA 4AMAA 4Z0JA 1ZBWA 4F0MA 1NOUA 1H4PA 4JN7A 3WBXA 1UP2A 3BW2A 4K8EA 4M19A 2WZIA 1VEOA 4XD6A 1JGMA 2QCDA 4REQA 3TJ4A 1B1YA 4W9TA 4CN4A 1TR9A 3CLMA 1OT1A 5HANA 4XAZA 4JGDA 3TSBA 3TQKA 3S6OA 5CBIA 4HU8A 1U5HA 5C9UA 1SO5A 1BAGA 1ZJAA 1M7JA 1OC7A 4P7RA 4Y7EA 3HGOA 2FJUB 1J9YA 2AGTA 4E8GA 3NEHA 4KCUA 4AXNA 3NAVA 1OFRA 2E5DA 4XG1A 1W5PA 2J6XA 3WSUA 5K7JA 1YTKA 4GACA 1K70A 4FP1A 3MY9A 1JVNA 3FAWA 3SURA 3ENLA 4UOZA 1UC4A 1TVNA 1WKFA 5JUVA 2C8NA 1UKPA 5H8UA 1RBLA 3TX9A 1WDWA 3LHWA 1TVPA 2VD8A 5CXPA 3BQ6A 5I3GA 4CUCA 1U33A 3KOXA 1R87A 4F0RA 2DEPA 1XSIA 1V3JA 4W93A 3VU2A 4PL2A 4AAJA 1R86A 4V1YA 3AFBA 3BTNA 3VA8A 2PDHA 2XUCA 5D2VA 1WOAA 4QXIA 3CMGA 4YYCA 3E0FA 4J2PA 4J3WA 1QI3A 1D3GA 3K8KA 3NSXA 2X1IA 3G6LA 1GQKA 1HKJA 3N2CA 3W2LA 1GQJA 2XM1A 3W1RA 3N4EA 3AC0A 3UG3A 3H2FA 4QG6A 1W32A 5KZ6A 2DT1A 1XKYA 2DDXA 3ARTA 2HBXA 3BC9A 4OBSA 2NXIA 3PTMA 2OX1A 5REQB 3N2TA 8XIAA 3SY5A 1K7EA 3EZ4A 3F4VA 2ZZ7A 1YDVA 1KCZA 2Y88A 1ZBVA 3B8WA 2GGHA 5TBOA 4C7DA 1XQKA 4TMBA 2A85A 1WZMA 3W72A 4K3ZA 2QPXA 1EJVC 1E56A 4JHMA 4LVGA 1VIWA 1TTJA 3HJZA 4Y2WA 3GDRA 2PZ0A 4QBXA 5I23A 2VR2A 2HRWA 1JPMA 1XX1A 2H8ZA 1VJSA 3ORWA 2ZRZA 1T0OA 4NL1A 4GVFA 5A6SA 4HTBA 1JYXA 2YXOA 4C6NA 5DBTA 2C14A 3H2NA 3NQMA 1T40A 2ZDRA 4E6MA 3I6RA 3AO0A 5DLCA 4KF1A 1H1NA 1V6XA 5D37A 3QQ1A 2G0WA 3VM7A 1U2YA 1B3OA 2PDFA 2RDUA 2OFJA 4L9XA 5REQA 3P5YA 4B2DA 3B06A 2DIJA 1XD0A 4GUJA 5A3HA 1C8YA 3EWWA 2PD5A 3O05A 1O7AA 2XH7A 4WZHA 1UKOA 2WWDA 1L6FA 3SGUA 1XIFA 2X2GA 3EGJA 4DIAA 1WAUA 1WYIA 3BG9A 4LS0A 3QN3A 3W73A 4LF1A 3L9CA 1RUSA 1WO2A 3F4DA 4MGGA 1ENUA 5KINA 1E71M 1F05A 3GH7A 4F0LA 3QPEA 3AS2A 1LBLA 4DWSB 4D2JA 1H7WA 4LFYA 4XVDA 3N3TA 2A3LA 1CXHA 4AX7A 5C54A 5ENLA 1MW1A 1ZCCA 5CG0A 5LZLA 1H60A 4RCXA 2VDIA 2HSAA 1A5OC 2PB1A 3ZQ9A 4PH6A 2DZTA 4MFDA 3M6YA 4B16A 1ONEA 1TE6A 1KM6A 1LJYA 1CXFA 2VKZG 3UA4A 3HG2A 3EEZA 3NOEA 3AU2A 4MNMA 2YCKX 1PDYA 3MDUA 3VDHA 2VFGA 1GQIA 4BQ2A 2C0AA 2W4XA 1VJZA 1IWBA 3KFTA 4HNUA 2UZ9A 2X2YA 1UWUA 1CB7B 1LF1A 4GRSA 3CH9A 3U5UA 5JH1A 3CUJA 4NASA 4X63A 2G3JA 4Q4KA 4AWUA 3GNRA 3TSMA 3GC5A 1OEPA 5H8PA 3QF0A 2V3DA 3QTPA 3KP0A 4HZMA 3B8DA 2V8ZA 3E0LA 2Y8KA 4DUWA 3AXIA 2MNRA 1GONA 1BGGA 1DJYA 5AC4A 1F76A 4B5TA 4M81A 3K4WA 2WJEA 1HL2A 3ITGA 4ICCX 1Q3NA 1DWFM 4AC7C 1XCXA 4AQLA 5LHFA 1KBJA 3NPVA 3NSMA 3WNOA 5EU9A 2W9MA 3OBEA 1QHZA 5IHRA 3A3HA 5BCAA 3W6YA 4O15A 1V02A 1V77A 2RKXA 5K4ZA 5LNWA 4P8XA 3GZ3A 3NR0A 2X7VA 1EDQA 2XSBA 1GHSA 4U3AA 3I7RA 1X6NA 2AMGA 3M0ZA 3I3EA 4HPGA 4ZO7A 2XVLA 3KP1A 1KRAC 2BNJA 3G0SA 1UW9A 3BSMA 4W8LA 3LM3A 2HPMA 1AVAA 2F84A 3TZFA 3KVMA 5F1UA 4CEUC 2RFGA 1E1CB 4JKLA 4GZEA 3U7BA 2B4GA 1SW7A 3CZEA 3H70A 3WNMA 3WD4A 2C1GA 1L2QA 1IGWA 3ZR4A 1TELA 2FZNA 4GUFA 3WD3A 3MANA 4UR8A 2GVJA 3VAVA 1FP8A 1GOOA 2C1HA 3GTHA 1JULA 5CJNA 1FWTA 2PDXA 3N19B 3QY8A 3PBVA 1TPH1 5TD4A 1CW2A 1PX8A 4JCMA 2NVDA 5I3JA 4EPEC 2OB3A 6REQB 1E1CA 3UVIA 2QAFA 5JBEA 1BXBA 1BVZA 1A5BA 4LC8A 3CBWA 3IAQA 2IKJA 7TIMA 4YNGA 1TTPA 4G8TA 2R6OA 4NZ1A 5AYXA 3LQLA 4UTTA 4TQTA 4FI4A 4X61A 1DJGA 4DJEA 4UFLA 1KKOA 3WUBA 1HKIA 2INFA 1DHKA 3W74A 3HFTA 5HWMA 3P0XA 4WDXA 3SCWA 3HGRA 4L4OA 2Y5EA 4XO6A 4GLEA 4O17A 3CL6A 3GBEA 1TZ7A 2GOUA 2DZUA 3IJ7A 1V3MA 3WYZA 5AZ1A 1U1UA 3TYZA 4KFPA 1OHLA 3BWWA 1H11A 2XYLA 4ICNA 4DNHA 1R38A 1JAKA 4KESA 5A6JA 5LIXX 3FEMA 2FLIA 5CC3A 2NUWA 2ZA3A 4ZXOA 3SSZA 5D9OA 2V5JA 3XISA 2OO6A 4GJIA 4IPIA 4UOJA 1F73A 5KSWA 3M44A 2CHRA 5MHBA 1X38A 3M0HA 2EPKX 5DFAA 4XZHA 5HDRA 2VEGA 3T7VA 1YIXA 4XK2A 4OBRA 4GY1A 1JD9A 2Q71A 2F2KA 1EIBA 3E0VA 3S6TA 4US5D 4DRSA 2YBTA 3MHUA 1V02E 3PBMA 1DTUA 3BLPX 1V6TA 3WMCA 3STCA 2VEMA 3S9ZA 3AMGA 5EMYA 2FGLA 4FX7A 3E1F1 4MDOA 4KIRA 1ZTVA 4PMYA 3IK4A 1ZSXA 3GKFA 3ITTA 2YBUA 1NP0A 1V8EA 1B3YA 1HW6A 1UKTA 1Q5MA 4DBUA 3NFUA 4CQAA 1B90A 1VFMA 3UCQA 4MPQA 3EA2A 3B0PA 5XIAA 2BASA 2NLIA 4UR7A 2WNQA 1Y65A 3V16A 5J5RA 5KITA 4IICA 1HKVA 2VR4A 2F6UA 2J66A 4GBDA 4KH2A 3EWDA 1TSIA 1S39A 5C9XA 4PMOA 4MJMA 3W7CA 5I78A 1C9DA 1OZMA 3R1ZA 2OWXA 2PDWA 1Q4WA 3SCPA 3PN8A 3M9YA 1RZMA 2DIKA 5I06A 3DFNA 1B30A 1UUOA 1FWJC 1F74A 5CKSA 4QHRA 1W1ZA 3CQ0A 4TMCA 2VQUA 4Z2LA 4CN6A 3QV6A 2QCFA 1B3VA 4CQDA 3A3XA 3FK4A 3FSUA 4BFAA 1KLYA 3ZLFA 2WZTA 4NXSA 1V5XA 4ZQRA 3JS3A 4C6PA 4O28A 1BXCA 3CB3A 1SFLA 3FXGA 3C0LA 3SCTA 2G96A 3LPFA 1KFWA 4H9YA 2YSWA 4U5KA 2A1YA 2X8RA 3RCYA 3VNKA 1HX0A 2OOGA 3PSWA 1ECQA 3BOFA 3HIJA 3HPXA 3OLDA 1OINA 1XYLA 4NJHA 3UZ5A 2YYTA 3IARA 5KMYA 8CGTA 1LG1A 4J9JA 3PUDA 1RLCL 2IQ0A 2PGFA 4X9YA 1R6WA 2BVTA 5FESA 4FS9A 4TXEA 3BH4A 4UQAA 5D2XA 1AQFA 1P6CA 5D32A 1CPUA 1CYGA 3HZ3A 3ATZA 4UQBA 4L61A 5CPSA 4AISA 1F5ZA 2VELA 4PTDA 3O9NA 1Q7ZA 3DCPA 4PMXA 1K77A 2O9PA 1UH4A 1DE5A 1VLIA 5HUOA 2GLKA 5BZAA 3RXZA 4V27A 9CGTA 4PBEA 3UJEA 1ZP3A 1AQ0A 5KZEA 3QTGA 3RCMA 1J4EA 3BLIA 4H7ZA 3FYYA 4MAVA 1CDGA 3H2OA 1KFKA 2PA6A 3CZGA 4M8UA 3V5FA 1ZAJA 3R0KA 3U2OA 1E70M 4JL2A 4KWSA 2OQLA 1P7TB 2VZTA 3LYEA 3IV3A 2QNEA 3IV8A 1PWLA 1GOQA 2AMXA 1TRIA 2F6KA 4Q4PA 3BGAA 5C2CA 2VYOA 3W01A 1EO7A 4EWJA 2CLMA 5L6UA 1E6ZA 4HNTA 2FFCA 2VUYA 3STGA 1TWIA 3NVTA 4F8XA 2VFFA 3ITCA 3GR8A 2PDQA 1W8SA 3PG9A 2TSYA 2WOQA 1AD4A 1VEPA 3W27A 3ARXA 2OLAA 3E0WA 4WDUA 1I8JA 1OFBA 2NSXA 2OZTA 2EPHA 1NEYA 5C55A 4FXSA 1CZ1A 3A12A 3OLIA 3CHFA 1A49A 3HMCA 4DHGA 3S5ZA 4MJ2A 3NZRA 1V51A 1A5KC 4PEKA 1JQXA 1P6BA 4B5UA 4DI8A 4AWSA 1P5BA 2JF7A 4NP7A 4WQ6A 3N9SA 1ZQ5A 2OXNA 1DJWA 4TO8A 4UWMA 1ML1A 1JDAA 1P48A 1TMLA 3U4FA 1CBGA 1E6NA 1A3XA 3M5VA 3WY1A 4LSBA 3LI0A 3WF4A 3EEGA 3GNNA 4Q7NA 4CD6A 1WZAA 3VD7A 3B03A 4ZSUA 4CD5A 3S83A 4X0NA 3DC0A 3KVKA 3MKKA 1LWHA 3O1NA 2WPBA 2Z7GA 6PTDA 3FJ6A 2WMHA 1VYPX 4PUMA 4R7WA 5EFFA 5CZSA 3LUTA 4HTYA 5E1QA 3KL0A 3O8AA 1U30A 1T41A 4FR6A 4R7JA 1YE6A 3H7UA 2RGMA 5D4YA 1DPMA 3I68A 4IF2A 4QDWA 4AWTA 4LUSB 1F6PA 3POHA 1SSDA 4IPNB 1EP3A 2FTWA