2IQDA

Crystal structure of aldose reductase complexed with lipoic acid
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
315
structure length
315
Chain Sequence
ASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Aldose reductase
publication title Structural and thermodynamic studies of simple aldose reductase-inhibitor complexes.
pubmed doi rcsb
source organism Homo sapiens
total genus 98
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2006-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2iqdA00
4JTQA 3FJNA 2IPGA 3V0UA 3O3RA 3LZ5A 1S1RA 3WBWA 4FALA 2DV0A 2FZ8A 1PYFA 1AH3A 2IKGA 3V36A 2HVNA 4ASTA 4XVDA 3Q67A 2IKJA 4LB3A 3LENA 3M64A 1Z8AA 3GUGA 2P5NA 4YU1A 3CV7A 2PDWA 3GHRA 3UFYA 5HNUA 2PDNA 2PDUA 2FVLA 4NKCA 1QRQA 5JH2A 2PZNA 1XF0A 2HV5A 2FZBA 2PD5A 4LAZA 3BURA 5M2FX 4RPQA 4WDXA 4WGHA 3UGRA 4QR6A 1EL3A 3R43A 2PDXA 1Z89A 2F2KA 2HDJA 2NVDA 1YE6A 2PDQA 1ZSXA 2PDCA 3LUTA 4JQ4A 1FRBA 3DOPA 2WZTA 3V35A 4L1XA 4GABA 1A80A 1MZRA 3GHSA 1IHIA 4XK2A 4F40A 1MI3A 3V0SA 1ZUAX 2PDYA 3R58A 3R8HA 3N6QA 2PDGA 4QBXA 3M0IA 3MB9A 1US0A 3LQGA 1C9WA 3C3UA 2VDGA 1XJBA 4XO6A 3LD5A 4GQ0A 4XVEA 3D3FA 4H7CA 1HW6A 2ISFA 1ZGDA 3LN3A 2FZ9A 2PDJA 2PF8A 4JTCA 4HBKA 2ACSA 4XAPA 5AZ1A 3ONCA 2I17A 1PZ1A 1SM9A 2IQ0A 1J96A 4YS1A 1R38A 2IPFA 3RX2A 2DUXA 2IQDA 1RALA 4WDWA 3S3GA 4IJRA 2FGBA 2BP1A 3EB4A 5LIXX 5HNTA 2PDPA 4Q7BA 3LEPA 1PWMA 3UYIA 4DBUA 1AFSA 1AZ2A 1JEZA 3BCJA 4EXBA 2ALRA 1T40A 2QXWA 4JQ1A 4JTAA 1HQTA 3COTA 3WBYA 1K8CA 3WBXA 1MRQA 3MC5A 1S2AA 2R24A 3RX3A 3U2CA 4PUUA 4PRRA 3R6IA 2HVOA 5JH1A 3CMFA 3BV7A 2R9RA 1LQAA 3G1RA 3CAVA 1ZQ5A 3BUVA 4JQ2A 5C7HA 1M9HA 2ACRA 1YNPA 2FZDA 4JIHA 1OG6A 4XZIA 2PDKA 4QX4A 4IJCA 4YVXA 4GACA 1X97A 3GHTA 4LBRA 5LIYX 3UWEA 2IPWA 5LIWX 4GIEA 3R7MA 4Q3MA 2I16A 1Q13A 4AUBA 4ZFCA 3LQLA 4OTKA 4PMJA 2HE8A 3F7JA 2NVCA 3GHUA 3VXGA 3Q65A 3N2TA 3FX4A 4L1WA 2HEJA 3LBOA 2PEVA 4FA3A 1T41A 5HA7A 4HMNA 4GA8A 3CV6A 3O0KA 3T42A 1X98A 1S2CA 2A79A 2F38A 2BGSA 1Z3NA 4GCAA 3UZWA 1EXBA 2PD9A 4PR4A 1VBJA 2ACUA 5LIKX 2PDHA 3R8GA 2IS7A 1LWIA 4ICCX 3UP8A 2IPJA 3ONBA 4PRTA 1RY8A 2BGQA 2AGTA 4IGSA 1XGDA 4XZLX 3EB3A 4JTDA 1AH0A 4YVPA 2HE5A 4FZIA 1X96A 3RX4A 4GQGA 4YVVA 3WCZA 2ACQA 2IKIA 1Z9AA 4XZHA 4JIRA 2J8TA 4LBSA 3H4GA 1GVEA 2PDMA 3H7RA 3CASA 4DBWA 3B3DA 4JQAA 1YE4A 4JQ3A 4JTRA 3M4HA 2DUZA 3LZ3A 2INZA 4R9OA 2IKHA 5KETA 3V0TA 2PDLA 1Q5MA 3UZZA 3NTYA 4H8NA 4LB4A 4XZNX 2INEA 4FAMA 4WDUA 3UZXA 4PUWA 1IEIA 3H7UA 3G5EA 5DANA 3UG8A 1EKOA 2PDIA 1AH4A 1UR3M 1PWLA 3QKZA 2CLPA 3DN5A 2WZMA 3LNMA 3P2VA 1AZ1A 1EF3A 2C91A 4MHBA 2PDFA 4G5DA 3CAQA 4DZ5A 1VP5A 3R94A 1ADSA 1S1PA 5AZ0A 4WDTA 1QWKA 2PDBA 4EXAA 4I5XA 3EAUA 1RY0A 1YNQA 4DBSA 4XO7A 2PFHA 3ERPA 4LAUA 4WRHA 5LIUX 1PZ0A 3KRBA 4XZMX 4QXIA 3WG6A 4WEVX 3UZYA 4JIIX
chains in the Genus database with same CATH superfamily
2O92A 3CIWA 3G1DA 4AIEA 3UR7A 1V6XA 3LGGA 3G2GA 1TV2A 1IYXA 3NA8A 4JFSA 1AL7A 1UZDA 4M24A 4CU6A 1P1MA 1XM3A 1JUEA 4OV9A 4FALA 2IKGA 4DRSA 3G1YA 1NDYA 2QPXA 4F9JA 3SI9A 2X7VA 3TJXA 4HVXA 5I3DA 1ITXA 3N14A 1W3LA 4UB9A 1YLVA 5CEWA 3GW0A 1JZ5A 5GJPA 3DH7A 4JNYA 3TYAA 3P3BA 4JX4A 1FKXA 3VIIA 3LXAA 5C9XA 5CC5A 1O66A 5D2VA 5BZAA 3NDZA 2QDGA 3SUVA 3JRKA 5CPTA 4I7UA 3QPZA 2NVDA 4OQVA 1Q6GA 1BKHA 2HRWA 3WF3A 3SQMA 3M0LA 1M68A 4L7ZA 3DOPA 3DU0A 4WSHA 5CZJA 1PYMA 2WZTA 1OC6A 2I57A 4DZAA 3CL8A 3GHSA 4RLIA 2OJPA 3RG6A 2TODA 3LA4A 4ATWA 3DFNA 3T0CA 3CZ8A 3EWUA 3IACA 4UFHA 2CZVA 3GD6A 2I5QA 5BXSA 3OLEA 1FH8A 4ENLA 1H49A 2YCKX 2DW6A 2RDTA 1TV4A 4CD7A 1F07A 4PUMA 1W1YA 2BWGA 1MQRA 3GVQA 2VDGA 2V0TA 3HZ3A 4GQ0A 1PIIA 4UTMA 1ZGDA 1C8QA 2WJDA 1OABA 4BEQA 4O50A 4L9YA 1RK6A 4W8LA 3F2DA 3MPGA 3KDOA 2XISA 3QN3A 1ZLPA 3JW7A 3WUBA 1T96A 3IUDA 1CGYA 4IMAA 2NT1A 2QV5A 1O5XA 2ZUVA 5FD0A 4N42A 3LEPA 3CQKA 1DOSA 4C1LA 1VHNA 4ZOCA 3UEQA 4UQAA 4IUOA 4RDVA 2XIOA 1K8CA 3WBXA 2H6RA 4ROPA 4AX7A 2VFFA 5BMWA 4MWAE 4NYYA 4HU0A 1E43A 2QR6A 3VPLA 2O9TA 1E3ZA 1OCJA 3APTA 1KCKA 4UTJA 3AXKA 1U30A 4IIFA 4KRUA 3F2CA 1JGIA 1QNPA 5FESA 4IMGA 3HPFA 3RMEA 3PTKA 3UETA 1E0XA 5ABGA 2NVAA 4S2BA 2C3ZA 3C8FA 1KFLA 4DWDA 1VRXA 3QMRA 3N12A 2ZUNA 4Q8TA 1CNVA 4QAWA 1GZJA 4TUFA 3SIMA 1XL9A 4MJ4A 1XLIA 4AHOA 3IGXA 5I5RA 3NQ8A 3O6DA 4AWUA 2CITA 4DI8A 2EPNA 3P84A 3THAA 4XWUA 1EUAA 3J7HA 3WLHA 2NXIA 3LSCA 2QGYA 3PTDA 2OLAA 1NH6A 3HJEA 2YCIX 3SEPA 3NQCA 4RL3A 4BQ3A 1TPWA 2DT2A 4W87A 1EJRC 2QJMA 3AHXA 4D71A 1AK5A 3GXMA 2OYKA 4OGZA 1XCWA 2ACUA 1KLYA 1OGBA 1MRAA 3B8VA 3AMKA 1MNSA 5DY3A 4PRTA 2Y8UA 4LVAA 3VOJA 3M6DA 2BGQA 4HSHA 2XIMA 2QF8A 2QIWA 3O6AA 1TTPA 4MYXA 3M1ZA 4AB4A 1IXQA 4B92A 2NQHA 3P62A 3NSXA 3GFYA 5C55A 4GQGA 3II1A 3CQ0A 2ZRUA 1YRRA 5CBBA 5F2GA 2PF0A 2QGHA 5D8WA 2OO6A 4MDOA 1DIKA 2YXOA 3PJWA 4JIPA 4IJBA 3K30A 1JXKA 4JGDA 4O8RA 1Q45A 2R1MA 1XLJA 2FHCA 3CU2A 2J13A 2Z24A 2UY5A 4TX6A 1HKMA 5B7ZA 2H9AA 1T5AA 4XSLA 3C0JA 2OG9A 2GJXB 4LVDA 3N2CA 3VOCA 4Y8FA 3TXZA 2J47A 3DERA 1JFHA 3ZFHA 3WF2A 2BY3A 4QG6A 4A8LA 1J0KA 3GUWA 3UG8A 6TAAA 5FF0A 4UQEA 1AH4A 4OIFA 1FWWA 1G1YA 1A0EA 4AZ7A 2VURA 1JZ7A 4HIBA 2CBUA 2ZDRA 4TTUA 1VYSX 3THDA 2OEMA 1RPKA 3MVTA 4IPNB 4C6PA 2ZBTA 2D23A 1O7AA 5A2BA 1VP5A 2D69A 1SJCA 3HURA 2V5CA 4DO5A 3I6TA 4ZXOA 1JCTA 2FYMA 4I5XA 1GOQA 3A3XA 1DHPA 3TKFA 3QPEA 4JS3A 2DY3A 4MVAA 3IK4A 4S23A 4BF9A 3B8TA 2EBNA 2DT0A 1GKRA 4JR5A 3WQCA 4UR8A 1EBHA 3JZEA 4KT2A 4UTUA 4ZCWA 2DIKA 3OQEA 5C6MA 1ZBVA 3GYCA 2V38A 1WB0A 3MMDA 1S3HA 2IPGA 2YJQA 4C5YA 2YCLB 5EMKA 1Q85A 3N2OA 1BYDA 4YYFA 1B3VA 4NJKA 3K4WA 5C5YA 2HMCA 1JRBA 4HPHA 1DWJM 3H70A 5JVLA 2LLEA 3FV9A 1OX4B 3C2FA 3CV7A 4MWAC 1OZQA 4UR9A 5K3VA 2QQ6A 4LC8A 4EPBC 1OFDA 3JU2A 5M3WA 4TIMA 1ODZA 4B9ZA 4LAZA 3QV7A 1RBAA 3WJXA 2OZ8A 3RO8A 3PPGA 3H2CA 7REQB 1D8CA 1HO1A 3VI2A 1QO2A 4LVGA 4GZEA 1H41A 3WD2A 2HDJA 2FH8A 5IOBA 3LUTA 4HOWA 5C9RA 3QC3A 4IMEA 5MKGA 1KQYA 4IP4A 2WSPA 5AYXA 4HA0A 5CXPA 1ISXA 1WKFA 3FVDA 5AHLA 1UR2A 3SCRA 2ABAA 1RA0A 4KFOA 2DZSA 4WR3A 1PUDA 1KM6A 2GUBA 4P7NA 3DG3A 3GG7A 1RQHA 3SUWA 3A3WA 3N6QA 1KKOA 1LP6A 1TWIA 3HGSA 4HGXA 1J6OA 4FXFA 1US0A 3DBNA 1AW1A 1XG4A 2VOMA 1S5VA 2CWXA 2XGIA 2XU2A 2X1IA 4L4LA 2J79A 3EZ4A 1DJZA 4I6VA 4ES4A 3GLCA 3W22A 5G2IA 3T78A 3KTSA 4Q33A 3N13A 1D2KA 3FYYA 4ADUA 1CENA 1YXYA 4QROA 1E9YB 5KZMA 3GNPA 1G7UA 3F4CA 1NM9A 2YYTA 1RQBA 4IQLA 4AX6A 4M29A 4GYKA 3BLPX 2B4GA 1O4UA 1KTBA 3K8MA 2VEGA 1A5LC 5F7UA 3DYMA 3KW3A 1Q4WA 1F8IA 4JTAA 4E8GA 2Z25A 5LGXA 1MRQA 2QUMA 1D3CA 2UY4A 1KR1A 4B5VA 5I02A 3PZVA 4M0XA 3W6MA 2H90A 3EX2A 1EZ2A 4PMQA 1SSGA 3GNRA 3VGEA 5GQBA 3LSBA 3W85A 1XH0A 3AOFA 1GVYA 4W7WA 2G8ZA 2P76A 3SR7A 1UWUA 3KTXA 1KFJA 4Z42C 2WC7A 4V28A 1ZFJA 4GUGA 3GHTA 3G0UA 1SFTA 4QNEA 3S6OA 4F2UA 5KITA 4RDWA 3CHVA 2VMFA 4PGLA 3MQTA 2J66A 1BGGA 1R46A 3VFCA 2CZFA 4TR9A 2AL1A 2ZRXA 3BH4A 3OHIA 4M7SA 3FJ4A 4NI8A 4DJEC 3VXGA 3LPFA 4O52A 4L1WA 1B4KA 1L6FA 3VIPA 2QT3A 3DHDA 3WNOA 4FA3A 3S42A 4DVOA 3BVJA 5REQB 1BVZA 3RLGA 1XRVA 1PHQA 2FPTA 2VC6A 3LHZA 1H4PA 3O0KA 1AD4A 3EA2A 2E8ZA 1E6PA 1JI2A 2FZNA 3HG2A 2CLKA 2F38A 1XR2A 2WOQA 1ICSA 3CUFA 2NWSA 2PD9A 1XP3A 1M7OA 4RCXA 3M5VA 2PDHA 1TUFA 2BS9A 1EJTC 2EAWA 5HAOA 4I9AA 1JL8A 4PMRA 5XIMA 4R5EA 1K7FA 3FKKA 1RJPA 3WNPA 1GNXA 1C93A 3ITTA 4GWEA 4IGHA 5CPQA 2FKPA 3C3NA 4PBGA 1W3HA 1X96A 2A3BA 1KFEA 4UFIA 2NUWA 3ABOA 5H2ZA 1WDPA 4W9TA 7XIMA 5G2HA 3L4VA 5U4NA 3DC8A 3RRAA 4R3UA 3LX9A 3TQVA 1GPWA 4J28A 4MY8A 3KS5A 2QAPA 2WHJA 3S8HA 4IISA 4UXDA 3ABXA 3KLLA 3E0LA 4H9ZA 2ANUA 4Q8WA 3RILA 4WOQA 1MXGA 4KMQA 4H8NA 4RE4A 1I4NA 1VB9A 1GKQA 1U2YA 4WDUA 1QW8A 1LYXA 4MNKA 2WCSA 2Q3RA 4R7WA 3B8WA 5KTLA 1IEIA 2VWTA 3TZFA 4TMBA 1WAUA 3QKZA 2DZTA 3LNMA 2WMFA 1VR6A 1CX9A 1DPMA 4LYRA 4N2YA 5IHRA 2C0HA 4ZXLA 3KBMA 3TWAA 1KKRA 4IZGA 5FJRA 3TTQA 3RHGA 4W93A 2XN2A 4K1WA 4ATLA 3R94A 3FJLA 1UD6A 4KWOA 3AAMA 5BCAA 3CV2A 3EOSA 4K8HA 1UA7A 4DPQA 3PZNA 4CCZA 3L4WA 3S2MA 1POJA 2NV1A 2B0MA 2FFIA 1ZS2A 4LX4A 3NVDA 1S3TC 1UZ1A 3M41A 4B2DA 4PFMA 3T9PA 1R9YA 1V0LA 1KXVA 1S2TA 4LT9A 4H9TA 4KF1A 2EHHA 2VGGA 3ITOA 5G4HC 1EYEA 3C2RA 1X8FA 4HN8A 3B9OA 2G97A 2OWXA 2G4FA 4UFLA 2R1KA 1D9EA 3BGGA 1Z8AA 4HA3A 1R7AA 1V3IA 3T2QA 2WZEA 5K7JA 1W2PA 4UR7A 5HATA 3PZIA 4CN1A 4WCJA 4DNMA 1B9BA 3RGTA 1L2UA 3SCWA 2BXVA 4CNOA 1UKOA 4MFDA 5A6AA 2NQJA 3MP5A 1Q3NA 2VOTA 2FQIA 2EKCA 2BY1A 1K9FA 4O16A 4QE1A 2WCAA 5BXPA 2PTWA 4H3DA 2QCMA 3M0VA 3EPNA 3W7CA 4FHAA 3C2YA 5F4SA 1X1NA 3PS7A 4ZO9A 5XIAA 4BJHA 1DXFA 2Q71A 1V3HA 1C8YA 5DMMA 1FWIC 4MMWA 2PP3A 5XINA 1ZUAX 1Z48A 5CQ1A 2BODX 3E49A 3SM0A 4BFAA 1UJQA 1J4EA 2WLZA 4TV6A 4XD5A 1ECEA 1EGMA 1J0IA 2CHRA 4R27A 3VMOA 3R8RA 3WLRA 1IEVA 3Q58A 2WJFA 4AZIA 1GOWA 1XSIA 5GNYA 4GHRA 3LCHA 1SM9A 3GC5A 3STCA 4AFYA 1IR1A 1IXOA 2ZX9A 2E9MA 1E1FA 1YXDA 1DYSA 1X7FA 1NP0A 2DGAA 5CBJA 3S3GA 1TPB1 3V3WA 4D9PA 3BANA 2BOEX 4KWSA 1BGAA 4AYSA 5LIXX 1B90A 2B81A 4GIAA 2XWEA 2Y2WA 4PB5A 3S2NA 1JEZA 5JXQA 4B5UA 4GFIA 1JFXA 4ML9A 2GGGA 3G3DA 2W66A 5AYIA 1GZGA 4ZA0A 2I9UA 3CUXA 3U2CA 1K9DA 2DFAA 4C6DA 2VD9A 5AHEA 5JH1A 3W84A 3FEQA 4IPJA 4J3UA 2HVMA 3WD0A 1G67A 2ZC1A 2VO5A 3IJIA 3W1UA 1H51A 1M04A 4DYJA 1EDGA 3URQA 4XV0A 1O5RA 2QCLA 3BLKA 1KM5A 3R25A 4WKHA 1T8QA 1IZKA 3W37A 4QDPA 1P0BA 1YW1A 1NAL1 1OFBA 2FDMA 3L23A 2IPWA 1ZY9A 2PMQA 4F79A 5CPNA 4CQAA 5BRQA 3MVIA 4R88A 2QPSA 3EDEA 3S6DA 1IT8A 2RUSA 1R3YA 4S3KA 3WLIA 1UWIA 2J8FA 3TOYA 3RFAA 3FY1A 2NVCA 3KWSA 5LA0A 4AH7A 2XVPA 2HEJA 2YLAA 1FVPA 3NPWA 2OX1A 1SR0A 1TVNA 4HYRA 2CLOA 3S47A 2BXYA 4HJFA 1TRIA 3GC4A 3BCDA 1JDFA 4GA8A 1OCQA 4QISA 2QZRA 4IM4A 1X98A 3GO2A 4KKXA 4QJ1A 5A69A 3G8RA 3CS2A 3N1AA 3MP4A 1F4HA 1TV7A 4D6GA 2BBFA 1Z3NA 1MVYA 1TMQA 4RV3A 3Q94A 3H4XA 3OODA 3VDAA 3F2BA 2CEQA 4UTTA 1H7WA 2XIJA 2G3FA 3VILA 1RY8A 5LA1A 2F6UA 4IGSA 2RKXA 3GFXA 2ATMA 2EPMX 4JTDA 1DP0A 3KL5A 3PUDA 2YBUA 3TXVA 1LROA 3AU6A 1AG1O 4P8UA 3E02A 4RJEA 2J88A 1YYAA 2X0HA 5HQLA 4NAFB 1DTUA 1DORA 1MW2A 3QGVA 4XAGA 5FCZA 1K8YA 1KD0A 3KCJA 6TIMA 2YB4A 4GINA 1PDYA 2OZTA 2CYGA 4LAKA 4IQDA 1KR0A 3AI0A 3RCMA 5CGQA 3GNNA 5FJOA 3LZ3A 1E70M 5FJJA 4UBPC 3WQGA 3UR2A 2JGYA 3CIVA 4I9TA 5E9AA 2JK2A 2Y63A 2OKOA 4E5TA 2WNZA 4DAIA 4L61A 2UY2A 3CAWA 5DLCA 3CUJA 5D02A 3L4YA 1YXCA 1K1DA 4GVHA 2D20A 1KWKA 2UWFA 3ZVHB 3M0YA 1JCYA 3K2GA 3GBDA 4GKLA 5B80A 1AZ1A 3UCDA 3UG5A 4GX9A 3L65A 3H2MA 3NM3A 1XIFA 2WMGA 2YDQA 4DAFA 3SDOA 3GTIA 1EF3A 3OLDA 3MSYA 3B06A 1R7OA 3K5XA 4MHBA 2ZX5A 2YL6A 5FOOA 2Y1HA 1E72M 3N18A 4WD0A 1EB3A 3RNDA 5C54A 1BG9A 2WC4A 4GC3A 3VMPA 2F6XA 3SCSA 3A12A 1HP4A 3ECQA 4ZQRA 4LF1A 3KWXA 2ZVRA 1RY0A 5GJNA 4GGBA 4RZ5A 2BZNA 4TX9A 1XD1A 4WVXA 3EX6A 1GJWA 3EDJA 5CBIA 1EFZA 3HGRA 4UTLA 3H6OA 4LPCA 3Q4DA 4WSKA 3CPRA 1VCGA 4LAMA 4EF8A 3VINA 5FACA 3BARA 1UZHA 4V27A 4EX4A 2YCLA 1GG1A 5D2YA 3DESA 5C0QA 1DQXA 4FO4A 3BC9A 1JQXA 3EX4A 2ON3A 2VEKA 3CZEA 3QTGA 1XFCA 2VX5A 1OWQA 4Z08A 3B0YA 3MKCA 2V63A 3OQ8A 4PCSA 4Z1DA 1OX4A 2O4QA 1P7TB 1WDDA 3HFYA 3PZMA 1J6PA 3UFYA 1A3XA 3CEPA 3RU8X 3ZM8A 3B40A 4HCLA 3SJNA 1GTEA 1UMYA 5T8GA 4RZ4A 5HMEA 5I3HA 3R2GA 7REQA 4P7QA 3W7JA 1UH3A 1K70A 3P5YA 2WZIA 3WNMA 4C90A 4IFKB 2X0YA 3DCPA 1FCUA 2W6RA 2PDXA 1Z89A 2PU0A 1EOKA 1FX6A 4B5WA 5DFAA 1DWIM 3IIOA 3OZYA 5IFTA 4XZ9A 3W71A 1SFSA 3W7NA 1FA2A 2J74A 2C79A 3EBVA 3HU7A 4GABA 1FP8A 2ZUUA 2BX7A 3GYEA 5BROA 3QVQA 4LNCA 3AXIA 1IWBA 1F73A 3ZWTA 4MGGA 3R58A 3RR4A 5IBXC 2VT0A 2PDGA 1LBLA 2VVNA 3OO2A 5G1MA 2RH9A 4QSFA 3A22A 2YXXA 1CXHA 4LCSA 3LQGA 1AMYA 4HPXA 4OWGA 4C91A 3HQNA 4XVEA 4TVUA 3AWOA 3QPYA 1LCOA 2Z6IA 2PWFA 1V6YA 4GYPA 4IQJA 3NQ7A 1TKKA 1N8WA 3EWDA 4O19A 1R38A 3RX2A 3WDRA 4Z2IA 2CZDA 2YB1A 4WDWA 1FWGC 3BSHA 2QCCA 3OPSA 3IS4A 3SBFA 3E0VA 3UD6A 1I1WA 3S4TA 2WW5A 2ZUTA 4M51A 3P0WA 3TAOA 1XYFA 5ABHA 4MAZA 1BKSA 2HROA 1V93A 1GOIA 3VNDA 3CMJA 2EF9A 4IX2A 4G8TA 3MC5A 1GUVA 3ZOAA 1QPNA 3CZLA 1V51A 3BL3A 1VJZA 1TPH1 3WQ5A 4F0LA 1EWEA 4B3LA 3I68A 4K38A 2XSAA 3BLFA 4FNUA 3DG6A 4NNAA 2VCCA 3AIWA 1QW7A 3KP1A 3E3HA 3QGKC 2BXZA 4AXNA 2GUUA 4JD4A 5GVJA 2YGYA 3B4YA 3T0AA 3RPMA 2PDKA 4O0ZA 1NFPA 4IJCA 3SRFA 4W88A 3NZRA 4DPPA 2R82A 5DBUA 1V6WA 4DWSA 1H50A 4GO9A 1LL4A 1B1YA 4W5UA 3MO4A 2Z7KA 1X1ZA 3P93A 1CXEA 1WNOA 2J27A 2E25A 3CZKA 3WNLA 2XM2A 1PCKA 1A3HA 4JNZA 1UUOA 4EOUA 3VKBA 3MWCA 2NQ5A 5JIWA 3VKAA 3AZRA 3GIPA 2QUNA 3K4DA 5REQA 3C2VA 4JX6A 1FTXA 3C5QA 4WGXA 1Y65A 5BNKA 1G4TA 2XTKA 1G0CA 1QHOA 3LRMA 1XC4A 1K4GA 1OFRA 1EA9C 3SY1A 3XINA 2DSWA 4FNPA 1MEWA 3ISIX 3PFMA 5HJYA 3LPOA 3TYCA 1MFUA 1TTQA 3N04A 3VD9A 3S1UA 1DXIA 4M6QA 4Y8EA 2QAFA 4A21A 1GVIA 4PMUA 3GZAA 3U4FA 1FWNA 3KCLA 1R47A 3M47A 1TZ7A 1QNOA 4LJ3A 3I4EA 4PTMA 3O15A 1BYAA 1TTJA 3LV6A 4M82A 1QAPA 2XN0A 2WJEA 4J27A 3W1AA 2OLSA 1K8XA 3VM7A 3V5FA 1RLDA 1HF6A 3NO3A 3N2XA 4XZHA 2V5DA 2JE8A 3EGJA 3WUFA 4JYFA 4ACZA 4H9MA 1BG4A 4DUOA 1HX0A 3B3DA 3EDDA 3G0SA 3PWGA 1K8ZA 1WBJA 3RCNA 2QF7A 1OBAA 1HKIA 3T0DA 1TFVA 2VEIA 2VCAA 1ZJAA 1J10A 3DYOA 1BHGA 1E0VA 1VZWA 4LB4A 1YDOA 3WLOA 4D1JA 4V33A 3L68A 3PN8A 3T2OA 1L6WA 3LG3A 2ZIDA 2VNCA 3A21A 4XAFA 2REQA 3SGUA 4WY0B 3SSZA 3QC0A 3P2VA 1XKJA 2O7QA 5TF0A 1VFOA 2ZRVA 4IGMA 4X22A 2EPOA 4O0KA 3S0CA 2PDFA 1PL9A 3VOFA 5AKQA 2ABBA 4N9BA 5HDRA 4HP5A 5AZ0A 3TFCA 3RLHA 1XISA 1IEXA 5D30A 4OV4A 4PTDA 4S38A 2EJAA 3W1TA 3U2OA 3OGSA 1F6PA 2GVJA 3NQMA 5A6TC 3PTMA 3BMXA 4ZOEA 2NZLA 1JYXA 3OYXA 1OK6A 4QXIA 4U3AA 4RW5A 4ZODA 1M3UA 4DYEA 4QIUA 1EOMA 4JTQA 1GKPA 3N4FA 1AUSL 3QKEA 1U5VA 4K36A 1IGSA 3O3RA 2DT3A 3QR1A 4B5XA 3IJQA 1W8SA 1AH3A 1V03A 3K4AA 1J8VA 2A6NA 3NQAA 3E2VA 1ISYA 2WC3A 4M1RA 2EQDA 1ZB5A 3MHFA 1XX1A 2UV8G 5ABFA 5HWMA 2HQAA 9CGTA 2AKMA 2J8GA 2PDNA 1EGZA 3FVMA 2YSWA 3KBJA 1HJVA 4RZ6A 2PD5A 3CTLA 1J18A 4H8VA 4Q8MA 2G3IA 3NL5A 3ATZA 3A5VA 3P60A 1EL3A 1LL6A 4AD3A 3MA8A 2YDRA 1R6WA 4NIRA 2CNCA 3D5HA 2VGFA 4IPLA 1ELSA 1EPVA 2EG6A 1CXIA 4S1FA 4Z0JA 4XISA 1ZL1A 3HM7A 4G7FA 4GK8A 1ZENA 2XGZA 4MYAA 1VLWA 4S3DA 3LHVA 3GG1A 1Q2SA 2Z1KA 1BTMA 5E0CA 2BHYA 3N9KA 4LYPA 4MNMA 4PMDA 1TE6A 3WZ0E 2DH2A 3T07A 1ITQA 1UR0A 3MB9A 2Y62A 1W9PA 4ALDA 4N6EA 2J7FA 1JYNA 4QLKA 3BJSA 2NSXA 1ISZA 4H7CA 5T9CE 2DQXA 3CTTA 5AC6A 1ZHAA 3MKVA 3W01A 3CHCA 4JTCA 2OEJA 2J6XA 1G4PA 4WUIA 3TNBA 2GOUA 3QMSA 5A5WA 3UWUA 3WMCA 3L21A 2O7SA 3K8LA 1T99A 5FKYA 2A21A 1CDGA 3D0CA 3DGBA 2FGBA 1XGZA 1BXBA 2XIBA 2XZ7A 1JYWA 1NDVA 1HFBA 3VDGA 3L67A 4HU4A 3L0NA 4EXBA 2JQXA 1BYCA 3STFA 1OFAA 3MBFA 1BQGA 2ZICA 4HT3A 4Q6XA 3URBA 1RCOB 3H54A 2AQVA 1VRDA 3NIYA 4IWWA 3OBEA 2PSNA 3NGJA 3W7OA 4HNTA 1WKYA 2W62A 4M6VA 5LXEA 3BV7A 3PPFA 2VDIA 2NLIA 3CAVA 1LL7A 4XIMA 4GY1A 3H2OA 4PMYA 4QCFA 3QV6A 4L64A 3W4RA 1B5TA 3STEA 3SRHA 4O4WA 2OOFA 1H62A 3TX9A 4HMDA 4QGCA 3W25A 4AD5A 3NZGA 3UWEA 3CV1A 4PC8A 2WPGA 4BF5A 2ZUMA 3M6YA 2FPVA 3F4NA 2ZTJA 3W29A 3UXKA 2HK0A 4H9UA 4RE3A 4KRTA 4UTKA 4A6GA 4I7WA 4ZFCA 2Y7FA 1P43A 1B3ZA 4PSRA 1KNWA 5IHSA 4UNLA 1BF6A 1Q2RA 2ZYFA 1I8JA 3E5PA 1MSSA 1WZKA 3TU9A 2J9YA 4IOTA 1ONRA 1JPIA 1I1XA 3TJLA 4G6CA 3UJFA 2YBVA 5D4YA 5MHBA 2WK2A 4B90A 2HXUA 4GZJA 3GC2A 4HMNA 1TWSA 4HPNA 4KRZA 4QAIA 5D32A 1FKWA 1FHLA 3SW6A 2WVSA 3N15A 1F2JA 1TR9A 3NEVA 3M0JA 5BW6A 4TU1A 3W53A 2IXVA 2NQLA 5AN7A 3MMUA 3EWYA 4K7VA 3TQPA 3HQ1A 6REQB 3O0FA 1YBQB 4ZB5A 3W1PA 2XH4A 2G50A 2NW0A 3NSNA 3TFXA 2E0PA 4N9CA 3E2RA 4C60A 3TSBA 4YTTA 5CZTA 1JDEA 4HNOA 1KTCA 4OOZA 4FZIA 1W9XA 3NL2A 3ARYA 4FLOA 5AHFA 3TOPA 4Q4MA 4KIEA 4BWLC 3OVGA 1R3WA 1UYQA 5CH9A 1Z42A 1XBYA 4LCQA 4WK9A 3WKZA 1SO4A 1MDRA 4KCWA 3UT0A 2WB5A 1LG2A 3ARUA 2RDUA 1QASA 3NJ3A 3H8AA 4C1NB 2Q09A 4U3CA 2XH0A 2PPGA 4JQAA 4NF7A 4FPSA 4A2RA 4YTUA 1X6NA 4JFVA 5HMSA 1DVJA 3VIFA 4C6JA 2IKHA 1OJXA 1JZ8A 4L9XA 1TYGA 2VWSA 4XBJA 4MWAD 1C9DA 3UZZA 4M81A 2DIJA 1VHCA 1P1XA 2HCVA 1RPXA 1JIBA 3IAPA 4AY1A 4R53A 3UPBA 4JICA 4AZCB 1DIEA 5DANA 3EEGA 2HNHA 1XLLA 4D6JA 4MM1A 4AZ6A 1J79A 2CLPA 3FAXA 3WJZA 3VZXA 1Z69A 2XFYA 5A6JA 1ZJIA 1S2WA 1CW2A 5HR6A 4O1AA 5FEXA 2Y85A 3W9ZA 1WXJA 1U1HA 2TYSA 1WXZA 5I79A 3A9IA 4RZBA 2OX4A 2XINA 1QNSA 3VUSA 3UJRA 4GLEA 1P48A 4DBSA 3TTSA 4YCPA 1UW9A 1ECQA 3O06A 4O54A 5AOUA 3PFRA 4F0RA 5C2GA 1XLCA 4XZMX 4TOQA 4XIAA 1RCQA 1MXSA 4BA0A 3VOIA 3MBDA 4DF1A 2DW7A 2CXGA 3GH7A 5I0DA 5A8NA 1W9UA 1M1BA 2DZXA 3LCFA 1K7EA 3A47A 3OGRA 1JCNA 3NXFA 4AYGA 4OFCA 1ESWA 3MUAA 1P7TA 5AC8A 8A3HA 2J25A 2VUYA 2PWUA 1H1ZA 4DUWA 2P5NA 1V0NA 5G4EA 3N4EA 1DJWA 1W1B1 5HNUA 1OD8A 2PU1A 1KRMA 1G9HA 5A6BA 3HPXA 5JH2A 4FLSA 4JN7A 2RHGA 2FB2A 4IFKA 3DFPA 3THUA 1F6YA 3W88A 4CNSA 2XFWA 1KGXA 4XZBA 2F2KA 3H2AA 3PG8A 1ZSXA 3KCOA 1E9ZB 5A8MA 1R8LA 3C2OA 4PCTA 1NTHA 4GQBA 1NOWA 1P5BA 2PTDA 2X2YA 1N55A 2YKKA 3WQ4A 1KTNA 5DBTA 3GM8A 1M41A 1YTEA 1ZALA 3CZGA 2GGIA 5EY5A 3TN5A 1TIWA 4R7OA 3GKAA 3EMCA 1U5JA 3WSUA 4XAZA 3USZA 3TC3A 2RFGA 4XTIA 1SZGA 5HXMA 3GK0A 4DZHA 3B0UX 1XI3A 3C2EA 1XXXA 1O94A 4JIQA 1UZ4A 4J9JA 3LN3A 1RA5A 3STGA 4DJED 4C6OA 3VGGA 1GTHA 3GNXA 4XX6A 7TIMA 1EJVC 3GIQA 5J5RA 2WZHA 1EJXC 3HG5A 3B4UA 4X0NA 2ZA1A 3AUJA 2DUXA 3GXNA 3W75A 3VM5A 4E2BA 1DWFM 6XIMA 2Z1WA 3UR5A 4E4UA 2JBMA 1X8CA 2BV9A 2DVTA 1TZZA 3IJDA 3WY1A 2ZX8A 1T40A 4A2SA 1F6KA 1XLMA 3WK0A 2Z2AA 1L6GA 1S2AA 3UA3A 4YNGA 2PRLA 8XIAA 3EX3A 5FEWA 4PUUA 4PUEA 4NILA 4FOKA 3URAA 1GVSA 2X41A 4BQ5A 1GCYA 2HTMA 3PK7A 3VX1A 3KM8A 3NFUA 2ZDSA 2W67A 4F2TA 3AIVA 2QMKA 1XPYA 1C7SA 1LLZA 5FL1A 3EMZA 3ZO9A 1NVMA 4WJ8A 1OG6A 2O9OA 1UQYA 1FWHC 2XHYA 1CGWA 2ZA3A 1VGAA 5AVHA 3NDYA 3VKJA 1DXEA 3HPAA 4DXKA 5I06A 5E6YA 1OC7A 3D47A 3M07A 3U2ZA 2YCEA 4QS6A 1THFD 5EBAA 4KFPA 1JPKA 4JFWA 3W73A 3BOFA 5ECVA 1XPGA 2VZSA 1YNYA 4OTKA 2J9ZA 5FF7A 4PMJA 3WJWA 5BRPA 1H09A 4XB3A 3FX4A 1A5SA 2JKPA 2JGQA 4IIHA 5KMYA 5AYYA 3U8GA 3PPCA 1V3LA 1J5TA 3NNTA 1SVDA 3JZUA 2CXEA 2PUZA 4ZB0A 7TAAA 4AWTA 2PGWA 1IF2A 3KP0A 3TC7A 1KCLA 5I09A 3SADA 2R1LA 1SO3A 1E6XM 1XLEA 5BU9A 3WQVA 1EXBA 3SGGA 1HNYA 3ELFA 1I0DA 3OZPA 4FXRA 4BKNA 5CPLA 3WO8A 2IS7A 3PB2A 5C70A 4NNCA 4Z1YA 1Q6CA 2WVVB 3AUOA 1CB7B 5CKSA 3S9ZA 2YPIA 4JTFA 3VIJA 5LNUA 3M46A 3DZ1A 2Y5SA 1TREA 4YL2A 5AY7A 1YHTA 3UGVA 5CC6A 2HZGA 1QHPA 4GJIA 5CC7A 3NAVA 3U5UA 3W00A 1QK0A 1LT7A 1QI5A 3TYUA 1OVDA 3U4AA 3RR1A 3TP4A 1QW9A 4GIRA 3R11A 3NYDA 4DJFC 1TIMA 4LS1A 3P0XA 2D0FA 4DBWA 1RBLA 4LGXA 3W7EA 4DNHA 1WKEA 1VD6A 2P53A 4AHQA 4AG0A 2OB3A 3M4HA 2OTDA 3PNUA 4CVUA 3CUGA 4J1OA 4LUSB 2ISWA 3VCRA 1ZP3A 4Y9MA 4RUBA 4AEFA 1E6RA 2OQHA 3P81A 1I75A 1Q7QA 3ABZA 3WDQA 3CQIA 4PUWA 4CEUC 1AW5A 4QRNA 2WSYA 2FGLA 1IE7C 2RAGA 4WY0A 3WD1A 1Q6EA 4AD0A 2Z26A 1PWLA 4RDZA 4H8UA 2A3HA 3W76A 3TA9A 1VBHA 3CT2A 1XYCA 4EE9A 1LRTA 3VOHA 3MSGA 1NDWA 2YL8A 4CKQA 3FGCB 1HJQA 2VQUA 2RDWA 3G6LA 4PODA 3M7SA 3T1GA 3VGFA 2CKSA 4P8VA 3EOUA 2XVLA 2JKEA 1UR1A 1G5AA 1TJPA 2WM0A 1QBBA 5IDZA 3ANYA 4DXVA 3TDFA 1IV8A 1A5BA 1E4NA 2X7WA 3PUOA 2G0WA 3SQSA 1IIHA 3L2IA 3C0QA 1XQKA 2V30A 2BG5A 3QLLA 4XAYA 1FQ0A 5I00A 1CYGA 3MCMA 6XIAA 1XV8A 3EOLA 3CWHA 3I3DA 4NZ4A 3QY6A 1EXPA 4EF9A 3BG3A 1TG7A 4LBUA 3O07A 4A22A 2V9DA 5KSWA 3CXOA 3WELA 3PWIA 2IKJA 3QV9A 4H00A 2ZA2A 3FA5A 3WNNA 1K9EA 2HBXA 3QZAA 4POCA 3REQB 1XS2A 2Z2UA 4YHEA 5H1WA 1YTDA 3U3HA 4M19A 5TNVA 4KW2A 4OBRA 2FB3A 3WF0A 4WDXA 3WDIA 3C56A 4DJDA 1HP5A 2SFPA 2Q02A 4E6MA 4IGNA 1W0MA 2DZAA 4ZTXA 3HV9A 5DT7A 5HQMA 4Y9OA 2CLMA 5GJMA 3CAKA 4A3RA 2X1UA 4NRSA 1QNQA 3LI0A 2W92A 1FOBA 2WKGA 2O4MA 1OQFA 3WLKX 3KUMA 3S46A 2ZZ2A 4GUJA 4XD3A 1XCFA 4QG8A 2JKAA 1KFKA 3K46A 2Z1VA 2C8NA 1PSCA 3HB9A 1GVOA 3JR2A 4GE8A 2BMBA 4MY9A 1E6SM 2ZZ1A 2XVNA 5CPSA 1DV7A 1VFFA 2DSVA 2DJLA 4D6CA 3SGZA 4QJ5B 4A05A 3MO7A 3NWRA 4C6KA 3H55A 1OYBA 3VKCA 4HNCA 2DSZA 4HZ8A 1NY1A 1VC4A 2WMIB 4D6FA 2PLKA 4WXYA 4NX0A 1L6SA 1UJPA 3RN6A 4KWWA 4Q7NA 1XIDA 1CXKA 5DMLA 3R12A 4A3HA 3GNOA 2YL9A 3ZJ6A 5I3KA 3BW4A 3W86A 3L4TA 4IF2A 2VRKA 4NZ3A 3PJXA 3M43A 2Q01A 3UG3A 5JQ9A 1HO4A 4Z0SA 1GVQA 4F66A 3GU2A 1PCWA 2FJUB 4I9JA 4H7VA 4TQTA 1M5WA 3VA8A 2QXWA 4HKPA 4Q7IA 2W91A 1JYVA 3DG7A 3L12A 2OQLA 3BK0A 4R34A 1TA3B 1XYAA 4JTHA 4MKVA 2V82A 5BWAA 4LALA 2Y7EA 2GK1B 1VS1A 1V7YA 4L9ZA 5C2CA 4NZ1A 3GVVA 3WEZA 3BUVA 5I7GA 3W7GA 3PVFA 3POCA 1KM1A 3EWZA 3VZZA 1YNPA 3S5SA 2OODA 2QEZA 4NXKA 2FJKA 1TR1A 4MTVA 4XZIA 1VYPX 3UVIA 6PTDA 4YVXA 3WFAA 1HUVA 4QE5A 2GPTA 2E67A 1LDCA 3NR0A 4S3JA 5LIYX 3BE7A 3WUEA 5AYBA 4M6PA 1WPCA 3R79A 1JR1A 3QHOA 4HTBA 1WE5A 3G8EA 3EA3A 4J3ZA 2B7OA 5DXYA 1TWZA 3CPGA 3DAQA 5A8OA 3H24A 3IANA 3Q65A 3N2TA 2CLIA 1VFSA 2ZQ0A 1BVNP 1C8VA 1XSJA 3EB2A 4IX0A 3TW7A 3RIKA 1B3WA 2WPBA 1NFGA 3ITYA 1EF2A 2VR4A 2HPMA 3L7RA 1PS9A 1I2PA 2YCJA 4LNYA 3DI0A 3XIMA 7ODCA 4ZQOA 2BY0A 2MNRA 3TV8A 2ZRWA 4E2VA 1RVGA 3FYPA 4GX8A 4LQ1A 4AMCA 3RPDA 1BFNA 3VNJA 1R87A 2ZRZA 3MWAA 1ZU8A 5FI8A 3VGDA 1JVNA 1LLOA 5F4WA 5FAJA 1WUFA 1BRLA 4ZOAA 4IIDA 3CHEA 4LUJA 5LIKX 3ITLA 1FWJC 4PMZA 4HNVA 4QG9A 4NZCA 4N4QA 4BQ2A 5K4ZA 4GO8A 5HR7A 4O1FA 4P7LA 4EVZA 4E2OA 2R91A 1CCWB 2E5CA 3G1SA 8RUCA 5EMLA 3NQGA 4JL1A 1MZHA 2A3EA 3WFZA 2ADAA 1PKMA 3A9BA 3PAJA 4NP7A 2E6FA 2YFOA 1LF1A 3GQYA 2V5JA 4CCEA 1BSIA 5KZ6A 2ZUWA 1UH4A 3N17A 5PTDA 4N0RA 2ACQA 4TX8A 5A8PA 4NG3A 4QM1A 3R4IA 4PCNA 4C1NA 3H4GA 2WKLA 1XLHA 1B3XA 3TQ0A 3E2SA 1WXYA 3W7PA 3TLQA 5LGZA 1JZ4A 3DGRA 4RXGA 3ZWSA 3APGA 3V75A 1EEPA 3KHJA 1W9DM 1J0JA 3IAQA 1NARA 3DIPA 4Q8PA 1M53A 3V0TA 1Q5MA 3NTYA 1L0PA 1PXGA 3UZXA 5K4XA 4AZCA 5SWUA 3KVKA 4XD6A 1W3KA 3SUTA 1XSKA 1ISVA 1PTGA 2VQTA 3OA3A 2FLIA 5T26A 2QUUA 3VMNA 5DCBA 2VGBA 4HCDA 2VENA 2R6OA 1TUXA 4KFNA 1CGTA 5K9DA 1UH2A 2JFEX 4RK8A 1Y7VA 1TVPA 1IXPA 2PURA 4GYFA 4K8GA 2VZUA 3OB8A 1J11A 1LOQA 2EPLX 4LFYA 2D73A 3OA5A 1UKTA 3AYSA 3QSRA 3EWXA 1NF0A 2VJXA 3WF4A 1WZAA 5E70A 1QWKA 2PTYA 1E71M 3OW1A 5IDIA 1YMYA 2C16A 3GH5A 4W84A 3RYSA 3TYDA 5LA2A 2BVWA 5I6SA 1R3RA 2PGEA 3BQ5A 3OEXA 3UNDA 1QI3A 3VDCA 3W27A 1E55A 3ERPA 5BU6A 1CLVA 1TX2A 3BZGA 1ONXA 3ZMRA 3S5NA 3KRBA 2F84A 3W1MA 3NVTA 4FSAA 1Z6KA 5G4WA 2G41A 3W72A 1Q7MA 4J35A 3N3TA 1FFRA 1W1A1 3W1XA 4GD0A 4Q4SA 1F05A 3WX7A 3V0UA 3OU8A 4HSNA 3UXDA 2QYGA 4CQBA 4J40A 4FR6A 1B4EA 4C6EA 1XIJA 2EPHA 2QDEA 3LI1A 4YTSA 2QLYA 1PJ9A 1PZ2A 1T0OA 1UMLA 1OFPA 5HQEA 3P74A 3LM3A 1ZCCA 1NOUA 4UZUA 1QR7A 2DVXA 3NO1A 4IQEA 3B9AA 3F03K 1FDYA 1VLIA 2GVEA 2VC9A 1PIFA 3FYOA 4C6BA 3RLVA 2HV5A 3WFLA 2GJLA 2Y61A 1UD4A 5I3GA 5G2WA 3AWNA 2W0UA 2D0GA 1Q6QA 3OVPA 2A3AA 1U33A 4D1IA 1Z32X 3SIZA 5L9FA 2C1HA 1H63A 3FS2A 1XWYA 2V3GA 1XW8A 3M0XA 2NUYA 1J01A 1QI4A 3STPA 1MZRA 2GYIA 1QTWA 3I10A 4XK2A 5K9XA 1UPPA 3UA4A 4K6AA 2DP3A 3U0HA 4HD5A 5CCZA 3WH7A 3PZTA 1ZAHA 5LSMA 1SW3A 3SZ8A 4O1CA 2Y6ZA 4FXSA 1PDZA 1TWDA 2PWEA 3R8HA 2B31A 4JEJA 1SZEA 3EA1A 2BY2A 1KA9F 3VIHA 2AL2A 3SSJA 2OSWA 3ZT6A 4O57A 1GGOA 4AU0A 1A0CA 5A3HA 3W7RA 4E8DA 2P8CA 1OFEA 4H83A 1YPIA 1E56A 3KRSA 4TVDA 5CAKA 1LZOA 1SJDA 3VCNA 1IQ8A 3QHMA 4AW7A 2VC5A 3LTPA 2XDFA 4Z17A 2V8ZA 1LUCB 3H21A 2YFNA 3ENLA 4NZ5A 1PIGA 4LVFA 1JNDA 4JKKA 1UOKA 3M9YA 3MHGA 1RJQA 3RLUA 1PWMA 3QLDA 3CH9A 1PPIA 1H5YA 3W81A 2QCFA 4AY8A 4PUNA 4K1GA 2YA1A 3PULA 3MMTA 4RKAA 1G69A 1PB0A 3E38A 1QUMA 2BHUA 3C8NA 1NELA 4E38A 2VVSA 5IXEA 3KRZA 3ZSTA 2HVOA 3CM4A 3BMWA 3VGHA 3GBEA 3AMLA 3G1RA 1PEZA 2Z1SA 1CECA 1NEYA 1TPC1 1W1PA 3HFTA 1P0DA 1CB2A 3W70A 4WKFA 2ACRA 3FJ6A 3GDLA 4DLMA 4QHRA 5DELA 1PTAA 1W1ZA 4LUTA 4TMCA 3S5OA 2V3EA 4GACA 4AD1A 5BXRA 3ARSA 1AQMA 2ZZ4A 1EJUC 3VNIA 1BPLB 1JGMA 2VRJA 3IRDA 3GG8A 3HV8A 7ENLA 1QBAA 1TMLA 3RITA 3K1GA 2VI0A 4GIEA 1QNVA 1GJPA 1Y8BA 3H26A 4X9YA 3HF3A 4B16A 4EP8C 4OJYA 2Y7DA 4MY1A 4M5PA 3PJTA 2OXNA 4QEHA 4F9DA 3N73A 2I5IA 1Q13A 4AUBA 4WLCA 4QP0A 3VD4A 1ODUA 3ZXWA 1NDZA 1XCXA 3TSMA 4CUCA 4DWSD 3WQFA 4PL2A 4US6A 4IG2B 4WSJA 3TK7A 1EIXA 2OOGA 1R9XA 3CMGA 1X39A 2V67A 2POTA 2KX9A 2JF7A 2ZZ3A 1H7RA 1I45A 2J7CA 1JD7A 1DQUA 3IIVA 4RW3A 3VOGA 3W7HA 4ILSA 3E0WA 4W7VA 4D6DA 4D8AA 1R3VA 3GWQA 2B7NA 1K9TA 3TR9A 2A79A 4I6KA 1H2JA 3TROA 3N9RA 2G37A 3UPWA 1ME8A 4MZ1A 1VBJA 1XLFA 8TIMA 4OT7A 5E93A 2XYLA 5CSSA 6ENLA 1TQXA 4M80A 3WK3A 3GW3A 5D9MA 3UP8A 4JYDA 5AFDA 1O60A 2PTXA 3QXBA 4I8DA 4F8XA 3MY9A 1XGDA 3W83A 4XZLX 4WY0F 1W3IA 3VIGA 2XFFA 4O1DA 3FDKA 1M01A 1HTIA 1XINA 3AHYA 2YA2A 4E4FA 3VKDA 1WO2A 3T55A 4OZOA 3W1LA 3W7LA 2ZX7A 5FEZA 3WQEA 3UQNA 4EAYA 3DXIA 5D2XA 5HPOA 4XBSA 4B3KA 1GVEA 2PE4A 2X16A 3KZPA 1C90A 2GJNA 1UIOA 3QYQA 4RNHA 1SFLA 1LBFA 3M7WA 1KW1A 4W89A 4HK7A 3WL1A 2AKZA 2D3NA 4U4MA 3FN9A 3KVMA 5A6KA 3N25A 4P7RA 1QK2A 3G1XA 3AMGA 1QOQA 3NQBA 4JIEA 1NWTA 3VX0A 3H7UA 2OPJA 3M44A 3WMLA 4O0QA 2G96A 1RP8A 2AOSA 4DF2A 4C6MA 4Y6GA 4KERA 2WZMA 4JCLA 2B7PA 3HBLA 2ZFAA 3FA4A 5CSUA 3FGCA 2FVKA 4E3VA 1YDNA 1LQ2A 1KBBA 4DF0A 4FNTA 1L6YA 1NFBA 3NZ1A 3CAQA 3B8UA 2W9MA 4OECA 3WYZA 2R1PA 3LHUA 3QFEA 1ADSA 1AODA 4WDTA 4LF2A 2D24A 5DRIA 2C18A 1W17A 2Z6JA 4AD4A 2XWDA 1RD5A 1WX0A 1YTKA 3N29A 5E5CA 4GZ7A 3BW2A 3PBVA 4UTWA 3VCCA 1F3WA 4JHOA 2VL4A 4JEQA 3LTYA 1SMAA 2A85A 1GWJA 3T40A 5LNSA 3BW3A 4WRHA 2OT0A 4DB7A 1ZBCA 1X38A 4PMNA 4JTSA 4KESA 4B5TA 3IIPA 5GNZA 1D3HA 2X09A 3G1FA 1YX1A 3LZ5A 1BD0A 1NIUA 1S1RA 4WZHA 3WBWA 1FHUA 5DRCA 1XLAA 1AJ0A 1PYFA 2OGJA 3MV11 4LB3A 3WEMA 3REQA 1QMLA 3LBCA 4CNPA 3H7VA 3UPMA 2Y5EA 5EGRA 4MWAB 4X3ZA 1ZZMA 3W38A 3PZGA 4EKJA 2PDUA 4RXFA 1QRQA 3H2FA 4FX8A 2PZNA 3WQ8A 3KBWA 3BURA 2FH6A 2ATSA 5FSDC 1V0KA 2H9AB 4PRWA 3I3BA 4NJGA 3GXDA 3WQWA 3R89A 3T05A 3UWWA 3VC6A 1OC5A 4Z2GA 2F7FA 3UW6A 3VFLA 2OKTA 2NX1A 1E1EA 4X63A 3MKKA 2ZKMX 3CHFA 3U9IA 4ZO8A 2A2IA 3PTQA 4WIWA 3SY5A 4O15A 3V0SA 3LGDA 1EC9A 4FR1A 1KCXA 4NU7A 2Q3OA 1S5NA 2OCZA 2BNJA 1TJ2A 4L65A 3EWBX 3PPHA 4AISA 3S1VA 3BG5A 2D3LA 4JTTA 3UF9A 3P8JA 3INPA 4O53A 4MIMA 4TO8A 3C3UA 4GQRA 3KFTA 2P3ZA 1VYRA 1ZBWA 2PWGA 2WMIA 3AXMA 3TMQA 3PBWA 4NUWA 2DIEA 3UVAA 4KGLA 3HOJA 2DDXA 3OVQA 2PDJA 4ERGA 3PUEA 4G9PA 2D22A 4GVIA 4LYQA 5A2AA 3QYSA 3L0GA 2W61A 4QDWA 1GEHA 1XDMA 4L80A 2C1GA 5HNTA 1YPXA 4KETA 4Q7BA 4N9DA 5TIMA 1EHNA 2G4JA 2CZ5A 1DEDA 4XUYA 2YDAA 1EP2A 2IXUA 3COTA 1TA3A 2V6AA 1VFUA 1K7XA 2WQPA 2ZZ5A 5D9PA 3CLWA 1CTNA 4EK7A 4P5UA 3KXQA 5E09A 4HPGA 4GBDA 3S1GA 5D9OA 1EWDA 4GPNA 3EXRA 4I7VA 3XISA 4US5D 1BWVA 1QXLA 3M5YA 2FZDA 3AZTA 4H19A 4NJJA 1E0WA 3DFSA 4S2CA 5CSYA 1Q8JA 3KBNA 3H2NA 3VC5A 4O28A 3MP3A 1K77A 4NAEA 2VC7A 2QS8A 2GJPA 4H1ZA 4MOZA 3OJGA 1OT1A 4IMFA 5CPMA 3CH0A 3GX9A 2VRQA 3FK4A 4GUFA 3VAVA 1FCBA 1AL8A 2VM8A 2INFA 2HS6A 2QUTA 8CGTA 3NOYA 1F7BA 3W23A 2L5HA 4XKMA 1WBHA 2DZUA 4DBDA 2PEVA 4DHGA 1W3NA 2VUNA 4JFUA 4OUEA 4NJHA 3GXPA 1D8WA 4UQDA 5EYWA 2VCBA 2VELA 3BSGA 3WLMA 4DLFA 3UJEA 3IWPA 4A4AA 1XLGA 3DUGA 1VCVA 4I5RA 4EPEC 1K3UA 4DZIA 3UZWA 4LYKA 2Q8LA 2G3NA 3KOFA 5AB3A 1EC7A 4KGJA 2X05A 4UTFA 3L5AA 1J5SA 4BF7A 1E4LA 4JKMA 4H6RA 2XN1A 5TD4A 3RK8A 1P0KA 4AXKA 1O6IA 4XG1A 4FI4A 1S46A 4AWEA 1RXOB 1LQ0A 5EMMA 1MO0A 3SFKA 1AQFA 2E1WA 2WMKA 3G1VA 1LOSA 5I78A 3BMVA 4JIRA 4F3HA 3OBKA 2J8TA 4H01A 2H8ZA 2WCGA 4WF7A 4ZQMA 3QQWA 2QV4A 2HSAA 3TN6A 5HWJA 3P61A 3CL7A 5IRPA 2PCEA 2ISSA 5FJTA 2WHLA 4GBUA 4MDPA 5EKYA 2I14A 1QPKA 4FF7A 5KETA 3ALFA 3AISA 3L2MA 4HU3A 4I5UA 1DQWA 4P2VA 3WLLA 4Q4KA 2ISDA 2JF6A 1OFQA 3RPTA 3UG4A 3VNZA 4LY8A 2DQWA 3OTRA 1M7PA 3W2UA 1TMHA 1O5QA 4KEUA 1UC4A 1TWWA 1QI0A 4CD4A 3U5YA 4FNRA 3ZR6A 4J3XA 1ITUA 3FW6A 3IJ7A 3T4WA 4HHMA 1E40A 2W27A 3LPGA 1UUQA 4CGTA 3HIJA 1LOLA 4DZ5A 3WEOA 3V1PA 3SN0A 1V77A 4YIWA 2C6QA 3DI1A 3EMQA 1SU5A 3EX1A 3R0KA 4JXCA 3GDBA 3OIXA 3EAUA 2Q6ZA 4HU8A 1TV8A 3PSVA 4UNIA 2PFHA 1ZTVA 4UQBA 2C14A 1OCBA 3UXLA 1VBRA 3W6YA 1KM4A 4M8UA 3GTHA 4MNJA 3B04A 2QCEA 3N2MA 3AIBA 4BZYA 1G4SA 4GJJA 2Z1XA 3BAWA 1MFVA 2GQ9A 5HNRA 3G0XA 1EX5A 1PV8A 3VKKA 2WVTA 2W5FA 3UXIA 3VIKA 5E9XA 3N2BA 1K4HA 1Q6LA 3LENA 3N19B 5C2XA 3A4JA 1VJIA 3IIXA 1B2YA 1XUUA 3GUGA 4WQ6A 1U5HA 4KWUA 3QBUA 4C6LA 1JCJA 5AYZA 3QW4B 2AAMA 1W2VA 4U5KA 3H22A 1CGUA 3FAWA 1BEUA 2EO7A 1VPXA 4TXEA 3GAYA 1R3SA 1F76A 2ZXAA 3PBYA 1XGEA 1DJGA 1W1VA 1H61A 1FBAA 1K6WA 1WDQA 4QDMA 1W9BM 5TAOA 4PMOA 1B54A 3G22A 1WOBA 4A3UA 1FRBA 1S2UA 6ALDA 2FMNA 3L9CA 5A6BD 2H3DA 3PBGA 1PTDA 4PA8A 1OZMA 5C9WA 3EEZA 2CU0A 1IHIA 2AQOA 3VDHA 3TVAA 3M16A 4GUIA 1BSLA 4EAMA 5ABTA 2BDQA 1JAEA 4UC5A 1GONA 2Z28A 3NG3A 3LLXA 4ZENA 2V5BA 3W1RA 2BVTA 4IMDA 4MB3A 2PDYA 2JIEA 2J78A 3O05A 2F2HA 1SJAA 1UD2A 5LXXA 3V16A 3QM3A 2X1RA 3KVLA 4UUIA 4DN1A 1FWAC 3URNA 1TELA 1P4CA 3LD5A 2FHBA 1W5QA 4QLJA 1J2WA 1XIEA 1W6TA 4MJZA 2YIHA 4G1KA 4AC7C 2NX3A 4HYVA 3VK5A 4PH6A 4XAPA 3DFQA 3O1NA 5D09A 4IXHA 3ARZA 3BOLA 4GKTA 1EDTA 2XIQA 2YYUA 4EXQA 1PHWA 3BDKA 2QCHA 4ZBCA 3GTNA 1PX3A 1MEHA 1BXNA 3QR3A 4UWMA 5I24A 1U1JA 2XM1A 1VFLA 2CLEA 2BP1A 3NXLA 4OU1A 5CG0A 1V8EA 3AYVA 3D46A 3SQLA 3CQJA 5F2MA 3TYZA 1DWHM 3IGHX 4DBUA 1S5WA 4J3TA 3ABRA 2GLKA 1AMKA 1KO0A 3LHYA 3AJXA 1GVRA 5FF3A 3VNLA 5G5IA 1QVBA 3W1QA 4NT0A 5HJLA 4QNWA 1EO7A 1N82A 3C61A 3KE0A 1EJ7L 4AWSA 3P14A 3AALA 2W79A 3R6IA 3BOXA 2JIWA 1KFBA 4PL1A 8XIMA 1ISWA 1UQZA 1CZ1A 3SRKA 5C7HA 4QTGA 2QJHA 3CUZA 4QE4A 4HK6A 4FIRA 1L8NA 2YR1A 3CPUA 2I5GA 3CJPA 3DDMA 4EWJA 2YLLA 2GJXA 5KINA 3WJSA 4DJFD 2VZVA 4C7DA 4CEXC 4OBTA 2D2GA 3Q45A 5EL1A 3UESA 2V69A 1V3KA 4Q3MA 1IZCA 1HVXA 2O0TA 4PFHA 2I16A 3BCFA 4V15A 1TPEA 2QCGA 1AJZA 1EYWA 5D03A 1KFWA 3F5JA 3MUCA 1RAKA 3A4AA 5CLTA 3TYBA 2G3MA 4IG2A 3E9AA 1Z41A 1QPRA 1WDWA 1FDZA 5ECUA 4D6IA 2CFFA 3FIGA 3LY0A 3I7SA 1RJRA 1DJXA 2P0IA 1JDCA 3BG9A 4GI8A 3V7PA 3RO6A 4JNMA 1T41A 5HA7A 4CNTA 2OELA 2J7HA 1TPUA 3NM1A 4KS0A 2CLFA 3CV6A 2P8BA 4ECLA 2X42A 4J3VA 3TA6A 1F9CA 1AQ0A 1E73M 1TV3A 3VZYA 4P61A 1O1ZA 4AAJA 3B8SA 5EBUA 3ID7A 4L6OA 3GSMA 3VE7A 1A5AA 4B3ZA 1SGJA 4PR4A 4K8EA 4M1BA 2DU2A 1GHRA 5HOSA 3WMSA 6A3HA 2VX7A 5CJ5A 3C0SA 3GVRA 4UTTC 3ALGA 2AGTA 4AHPA 1DWGM 3IARA 3UWQA 2E4TA 3NQVA 2ZXDA 1Q7ZA 5AC5A 4J3WA 1OGSA 2WAGA 5BOFA 4GRSA 4ORMA 1A3WA 4JTGA 2V81A 4LWWA 5A6SA 2WO5A 1JJKA 4LBSA 1WOAA 4J5NA 3MUZ1 2RGMA 1UUMA 3CASA 3LNPA 4JDYA 4RE0A 3JUGA 3A13A 2ZC8A 4JTRA 4AZBA 2HXTA 1D3GA 2DUZA 3CB3A 4V1XA 3FCPA 3IGUA 3ANUA 6CGTA 1V0MA 4Z2LA 2WNWA 1FWDC 4FXJA 1R2RA 1X6UA 2PZ0A 4L4MA 2FHFA 1IIGA 3IJ6A 4LAOA 3ARRA 3OG2A 3TONA 2HNEA 5HJXA 1PZ3A 1EKOA 2GJRA 5HINA 1HJXA 1XIIA 2X1TA 4D8ZA 4F0MA 2C15A 5KZEA 3WQOA 1E6ZA 3ARVA 3G6MA 3H2EA 1G4EA 2PLJA 1VFTA 1PE1A 5LNWA 3NQDA 4IP7A 1VEOA 1NSJA 4ROQA 2D1ZA 4BR1A 5FIPA 2DZBA 2IQTA 4HHPA 1OINA 1K02A 2KAUC 4KWVA 5LNRA 1KXTA 1YDVA 3MDUA 2Z4GA 4EXAA 4K68A 1QDSA 4NHVA 4HHLA 2VZOA 2P3EA 1VJSA 2WMJA 3F1QA 3TTOA 3BZJA 1R9ZA 2E09A 4LAUA 3DHFA 1ME7A 3NO5A 2KZHA 2X30A 4MPKA 1DE5A 1W1IE 3QR0A 2PODA 3DECA 2EEXA 3C86A 3PWAA 3RJXA 1W8GA 1V79A 4ZSTA 1OX6A 1B31A 5C9UA 1SZNA 1M65A 4CNUA 5A94A 3RM8A 2C19A 5I07A 3CWNA 3W2JA 3TEVA 4UIOA 4XVDA 3OOQA 4H4IA 2WJZA 4MWAA 1F61A 1E0TA 1VQTA 1EJWC 3P80A 2Z0IA 1XIHA 2YL5A 5DN1A 2PDWA 5AC4A 4KIRA 2CPUA 4D72A 2P50A 3A24A 4FK9A 4AQLA 2OSXA 3KTCA 3SN1A 3R13A 1BWLA 5L6UA 3UYCA 3E0FA 4B4HA 2ESCA 4GIYA 1MXDA 2WBKA 5CC3A 4EIVA 3R43A 3HJZA 3NEHA 1BTCA 3W28A 5M1TA 2ZXQA 4GI9A 4Z2JA 1E4MM 4ZE4A 4HB7A 1KXHA 1H11A 3WMBA 3S6TA 4JQ4A 1JZ6A 2O9PA 1TCDA 1ENUA 2VXNA 4IPIA 5DCDA 3U48A 1RUSA 1SR9A 4C6IA 3WDHA 2BVYA 3MYPA 4LH8A 2XVGA 5F2IA 1OX5A 1GVFA 3V5OA 4U33A 4DJDD 2PRHA 3ZSSA 3PY2A 2E5DA 4PBEA 5AVNA 1EQPA 4AEEA 3GFZA 4F0SA 1W56A 3U7VA 2ZCGA 3QTPA 4MG4A 2F9RA 2J7GA 1ONWA 3F4DA 1XD0A 1AA1B 3DEQA 3WH9A 1RBOB 4DBEA 1WA3A 4XO6A 4XTDA 4L6HA 3CGTA 2GWNA 1IXNA 1MMFA 2ISFA 1NQKA 2XIIA 3DFOA 3CK5A 1AW2A 3TIMA 4HBKA 3ONCA 1C92A 4ZVJA 3ZLHA 5CZ0A 3ATYA 4PTXA 1PZ1A 4GYPC 2WLYA 3G24A 4YS1A 1UWQA 4B9YA 1QI2A 3BGAA 2IQDA 3MU7A 2CHNA 5H6HA 4MLRA 3WL0A 2AGKA 1UBSA 2YOCA 4JYEA 2POZA 3EKGA 3EXTA 4HOZA 3LLFA 1I2NA 3BLDA 1W37A 5AHIA 3CYJA 2PA6A 4LEFA 1FH9A 2P10A 2XSBA 3MANA 1Q6FA 2Q8ZA 3ARXA 3MUXA 4HZ6A 1JQVA 3KL3A 4QS5A 2Z7GA 2X2GA 3A64A 4LTSA 3FA3A 2F6KA 1QPOA 1RD6A 4Y96A 2V68A 4IH3A 3LB0A 4JN6A 4MZ8A 3N4AA 4BI5A 5T9BG 1UC5A 3RM4A 2GUYA 1ZQ5A 3S83A 2ISVA 1WKDA 4G1NA 3HMCA 3IGSA 3ZQ9A 2V2CA 4PEKA 1SO5A 3R0UA 1P6CA 1A5CA 2VHLA 4S3BA 1JUKA 1UBPC 3KZSA 2A3CA 1G94A 4KH2A 2G95A 4X0VA 1WDRA 2GSEA 1AVAA 1H7NA 2IMRA 3TUUA 4DWSC 3AJ7A 4FLQA 3W0KA 1IZJA 4ZR8A 1JI1A 2C0AA 3HA1A 1W91A 4Z1CA 1O68A 1VPYA 4DJEA 4ZOBA 4XZWA 5D33A 5F1VA 4EANA 2A0NA 2BTMA 1SZFA 1WAWA 2WHKA 4L1GA 4U28A 1GOMA 4H9YA 3VO0A 5HUOA 3TCEA 3HPSA 2CBJA 3VDBA 2XG9A 1TO3A 1XLBA 4MB5A 2W63A 1KBIA 2TPSA 3M0HA 4D2JA 4REQB 3KHDA 3AXHA 3LXBA 2Q8XA 3RRXA 2WSKA 1XKYA 1UP0A 3FHQA 1HKVA 2OLHA 2PLMA 5JBEA 1XIGA 3BICA 3MJMA 1KBJA 3OP2A 4BK9A 1VIWA 3SRDA 1DKWA 4Y9NA 4KBXA 4N7QA 1YEYA 2OR2A 1RZMA 2VKZG 4GH1A 3IVUA 3KEHA 3OHMB 3ABSA 4KQNA 2QHAA 2QCDB 3ZLFA 3GDRA 2Y8VA 3U57A 5GPRA 1BWKA 3I65A 1HKKA 1OEPA 3T8LA 1H7PA 4KEMA 3H7RA 4U5IA 1GQIA 1B3OA 1JPMA 2GQAA 4XQ6A 5CJNA 3UXAA 1LJYA 4RX0A 2GZXA 1E3XA 5F1UA 5A8GA 4FP1A 1V7AA 4K2SA 3AS0A 2PDLA 4DI9A 4DWSB 1V6TA 4GY0A 4U10A 3W07A 1A5NC 5AECA 1SSDA 2YW4A 5GNXA 3MZNA 2OZ0A 4M6UA 9XIAA 3B05A 3GNDA 2DORA 3AROA 4HQVA 2PDIA 4BS0A 1EDQA 4X61A 3DFTA 4A35A 1ADOA 3DN5A 3VYLA 2W3ZA 2WM1A 3EYPA 4UMBA 3GR7A 1N8IA 1A0DA 1LLWA 2XH7A 3M0MA 1WUEA 1JD9A 2BASA 1PKNA 3IJLA 5I2UA 3EPOA 2D2OA 3BLIA 4Z1BA 1A4LA 4MSSA 3MJYA 4G7EB 3WN6A 1TTIA 3L4XA 3QZEA 1UWRA 1Q65A 3WLNA 3QOKA 2CETA 3TN4A 4ATDA 1BXCA 2FFCA 3MT1A 2XVKA 3E5BA 1XHGA 4RV8A 3T09A 1F3XA 2BFGA 4GY7A 2GOKA 3DHUA 4FMVA 1JCLA 3IK2A 4W8BA 1TB3A 1I60A 1DJYA 4JIIX 1OM0A 3AZSA 2IW0A 2FTPA 1E15A 3V36A 1XYLA 2QDDA 3GDTA 3Q67A 4MJ2A 4W85A 1UWAA 1D7FA 1ALDA 3QGAC 4Y7EA 4ACZB 4K39A 5I23A 3NPUA 3H12A 4O11A 1I2QA 4ZO6A 3ZZ1A 4O1EA 4GNJA 1W1TA 1XF0A 3IPWA 3OBAA 3ME3A 4IFRA 1FCQA 1F74A 1EP1A 1OYAA 3RDKA 2I56A 9XIMA 4H6QA 3SFWA 2UBPC 1E9LA 4IIGA 3ANVA 3TE9A 3MV01 3VNYA 2EG8A 5A1AA 1UD3A 1UPMB 2E6YA 2VEFA 3EKLA 3W7QA 4EPKA 4BHYA 1A80A 2UZ9A 1HJUA 2REQB 4F40A 5DEZA 3B0VC 4GI4A 3AIEA 1UA3A 5K9CA 4Y9AA 2BHZA 1XUZA 5D04C 3BAJA 1E1CB 5AC7A 4QITA 4M7TA 2OO0A 3BWWA 4HNNA 2OGYA 4PUDA 2GVGA 5I3IA 3NUKA 3OZOA 3M0ZA 4I90A 1UR8A 4S3FA 2O56A 5LZLA 1KRAC 3ZS4A 3MDWA 4GI6A 1KB3A 1YKWA 3O2LA 3TN3A 1A5MC 3PZOA 1EP3A 4K37A 4GNVA 5AZ1A 1OIFA 3SUSA 5BOOA 4I3GA 1EA0A 2I9EA 2IPFA 2D2HA 1HL9A 3NZQA 4UQCA 2DUAA 2VDHA 2PLCA 5DO8A 5BWFA 3P8IA 5DCEA 2PBOA 4R7JA 2NWRA 3LU2A 2BOGX 5CJMA 5KEZA 1IT7A 2WHMA 3S9YA 1UASA 3ITGA 3WBYA 5CZSA 3ARTA 3EDFA 3LLDA 3RX3A 2W4XA 3O16A 5IM51 1XRSA 5ABFB 3A3HA 3E6EA 4Q8OA 1YDYA 4NAFA 4HMEA 1POKA 3BV4A 1NJJA 5JMUA 1LWHA 2R9RA 4C65A 1NU5A 1KFCA 4MFEA 1TCMA 4IICA 1M7JA 1M6JA 4QEEA 3GH4A 5K2ZA 4EWND 1XRTA 4ZZ9A 1DHKA 2Y88A 4IIBA 2J24A 1V3MA 2VFGA 3DC0A 2V3DA 1ZNNA 2DZWA 2P0OA 2JEPA 1UROA 4LUYA 4O18A 4Q8VA 4R9XA 1ICPA 2EKGA 1ZPTA 4LV9A 5BXTA 3SAZA 1GOKA 3LRLA 3R1ZA 4LCRA 2GDQA 4DO7A 4Q8QA 2FZMA 3RMJA 1VCFA 4AZ5A 4HNLA 2ZTKA 3ZVHA 3LV5A 2HE8A 2HJPA 3BGJA 4HSOA 4U2ZA 4PEEA 2JALA 1XBVA 3PB0A 4MJMA 4GVFA 2ZZ6A 4HTYA 4DEFA 3LBMA 2Y0FA 4DQWA 1M7XA 4CQDA 3NL6A 4NXSA 4PYSA 4QJ3B 4OKDA 1XYMA 4HPJA 2AAAA 3USBA 3QZ6A 3EXSA 4IPPA 1MNZA 5J8LA 1FWBC 1TX0A 3NSMA 5G1TA 3ZVIA 4NRRA 3OGVA 4C7FA 2I1OA 1H5VA 3BAYA 4MAVA 3VD3A 4V2XA 3R0DA 4H41A 3R8GA 5BYWA 1LWIA 1DTNA 2EG7A 3UERA 4W5ZA 2QIIA 3GS6A 4GH3A 3AFBA 1Y5WA 4MKNA 4IMCA 3LMZA 1B0IA 4W4QA 4JZ5A 1NQ6A 1OADA 1GQNA 1AH0A 3IEBA 2HE5A 3FXGA 4GZIA 3R5EA 1I2RA 1E6QM 1QPQA 1FXQA 5HK4A 3TR2A 2PB1A 4GC4A 3BSMA 3EOOA 3ZIZA 1HT6A 2IKIA 2AMXA 4JPGA 3OVRA 1KCZA 4INFA 2A7NA 4D6HA 1ITCA 1HGYA 1J2BA 1NWRA 2JEQA 5I3JA 3P5ZA 1JULA 3N3MA 5JU6A 1WP6A 4AC1X 3KAOA 1NF7A 2J4GA 4YXGA 5LNVA 4AY7A 1O5KA 3WH8A 2XFRA 3QMTA 1WV2A 4CNNA 2GSHA 1L9WA 2VR5A 2X1SA 4ADSA 3WLQA 1IGWA 2J9XA 4IL2A 3DFYA 1VH7A 4NX5A 5LKYA 1E6NA 2GGEA 3GU9A 2CZEA 2Z1BA 3C52A 3TWBA 1OF6A 2WYSA 2FMOA 3WBEA 2O55A 1N2VA 2B7QA 2FGZA 5H8UA 2OYLA 1QCWA 2RGLA 2CW6A 4ZTYA 1GOOA 3ZLGA 3AU2A 3VUPA 5C7VA 1Q4NX 5A95A 2PI6A 3W7IA 1ZBKA 2ZX6A 3DX5A 3LPPA 1LBMA 4HN4A 4GNKB 2YBTA 1QU4A 1VFMA 3RJYA 1JUBA 1CXLA 4O4VA 5H91A 2D2JA 3PF3A 2HS8A 1KM0A 1PZ0A 2DT1A 4EACA 1ZJBA 2EJ1A 2C1IA 4WEVX 4ZFMA 1CGXA 3BQ6A 2PP1A 3H23A 3I3EA 1QOXA 2QNEA 3KVJA 3WLTA 3TNOA 3T0BA 1JDDA 1MQQA 3TSDA 1JAKA 4PCPA 1XDJA 4CD6A 3WD3A 2DV0A 1DE6A 1GYNA 4UNKA 1DJHA 3M64A 2BLEA 5FJPA 1F8MA 1VBGA 4CU7A 4JTJA 4B4FA 1VKFA 1Q6OA 1XFBA 4YJ5A 2NUXA 1R5YA 2GDUA 3MUY1 1L2QA 1S5MA 4XBKA 3LRKA 4NL1A 4H2HA 4WJXA 1KBLA 1UHVA 4W86A 2FZBA 1FHVA 1K6AA 1SW7A 3QEZA 3WF1A 5M5DA 4WGHA 4OBSA 1P0NA 1VBUA 4QR6A 4DYKA 1KM2A 3WH6A 2PDQA 3HN3A 3B97A 1XBXA 1A4MA 3LCGA 1TV5A 2P1FA 3KBSA 1OT2A 4AMAA 1IEWA 4H04A 3W74A 4URIA 3MYOA 4Q4QA 3L0KA 4Y2WA 1UR9A 1MW0A 4UQ9A 1UWTA 4Z2KA 3GY1A 1R0MA 2XSXA 5IBXA 2DVUA 3S2LA 4B91A 4YCOA 4MB1A 3W7DA 3AHZA 4C6NA 2DEPA 1H7XA 3P6LA 3PZUA 3UBPC 2QJIA 3LGEA 3M0IA 4QBXA 4ZE5A 2FIQA 4IL0A 3B8IA 4YHGA 4YWIA 1E4IA 1C9WA 1G6CA 1IWPA 2PRMA 1RVKA 1XJBA 1UKSA 3GE7A 3PHAA 3HQOA 3WQDA 3MUIA 1FY6A 3PP7A 1CLKA 3HPZA 1C91A 3ZT7A 2PF8A 2CKRA 1DWAM 4ZO7A 1KWGA 2GGHA 4FF5A 4BI7A 2I17A 5I03A 3HG4A 2A3LA 5FSEC 2BGNE 4AZHA 1A5OC 1JCMP 5C71A 4LOCA 3WDJA 2OMAA 5HPCA 4FB7A 5ABEA 1HXJA 4RNIA 1RQEA 2NXGA 5D05A 1GZ1A 3CUHA 3VVGA 2R1NA 1O12A 3DENA 5EMUA 3VIOA 5AHNA 1JXJA 4FOUA 3SCUA 1AFSA 3EWWA 3KLKA 2NLYA 2QW5A 4N6FA 1W31A 2E28A 3KS6A 3ZJKA 1LWJA 1UIPA 5EA9A 3G1AA 4BCEA 3ZJ7A 4IT1A 2BOFX 1TRDA 2FTWA 1EIBA 2TRSA 3B8DA 2E7FA 4KCTA 3ES8A 4X9SA 2PGRA 3DKJA 3DFHA 1BF2A 3L4UA 4OUIA 2VX4A 3V4BA 3W2MA 3ZR4A 3QF0A 1M9HA 4H9XA 4IIEA 3T2PA 3SN4A 1M03A 3WH5A 4QLLA 4JIHA 4CN6A 3CEUA 1Z44A 1OYCA 2WSQA 4FX6M 2WQDA 3AS3A 4Q22A 3UCCA 3SUUA 3NQFA 3ZYZA 3TC6A 4O1BA 3UWYA 4AIBA 2NXHA 3QJAA 4J4KA 4RE2A 4J3SA 3ITCA 4KEVA 4JY8A 2CESA 4F0KA 2DSUA 4JCMA 2XUCA 1HVQA 2GQ8A 3F7JA 5JIPA 2VFHA 2YXGA 3S5YA 3GHUA 2A7RA 3Q2DA 1TQJA 2PS2A 4NASA 5JBDA 3MI6A 4OE7A 3LBOA 1WYIA 3ORWA 3WDPP 1BLIA 3T0TA 1QHZA 2J62A 3UY7A 1RCXB 3QV8A 4LEQA 1V02E 3EKZA 3TH6A 1HGWA 3AIQA 3T44A 5LHFA 3N9SA 3CO8A 2P88A 4REQA 3PBUA 3T42A 2GDVA 1B3YA 5EFFA 1NWSA 3BAKA 1S2CA 9RUBA 1UKQA 2PGFA 1CBGA 1KGWA 2NQZA 1QOPA 4J7RA 1AQHA 4UMAA 1XH2A 4G56A 3SCOA 3PM6A 4PMXA 3MCNA 4ICCX 4ZB2A 4Q4PA 5FJIA 3SO7A 2G5WA 3E74A 2QJGA 5HUPA 2VP8A 1K03A 4IHCA 1V5XA 5LYRA 3WQ6A 3O6CA 5J5DA 2YX0A 3IUHA 3DYPA 2UY3A 2WMHA 1UD8A 4HZ7A 2QCDA 5G1YA 3CZJA 1RK5A 1RV8A 1LRNA 3GTXA 2HBVA 3DBPA 1N8FA 2R8WA 3WCZA 2ZADA 2J75A 3B0XA 4B2DD 1Z9AA 1P6BA 3JVAA 4MPQA 3LDVA 1MYRA 3CC1A 1XYBA 3VD7A 1W5MA 3WNKA 3T4CA 2QMJA 3UWVA 3W3OA 3N6HA 4AVNA 3FKRA 1FXPA 1KGUA 3AQUA 4R9OA 2QVNA 3KX6A 3VIMA 1D7KA 1GQLA 1H60A 3NOEA 3PZQA 5T91A 4A29A 2E3ZA 3NPVA 5A2CA 5IFPA 2WBGA 2INEA 4BQ4A 4GXWA 3B9DA 4TTGA 3LERA 1JF5A 3WLSA 2XZ9A 3LHTA 3GB6A 3ITVA 3AC0A 3LTSA 3D6NA 5C9ZA 3W87A 1YPFA 3L4ZA 4PTVA 5JBFA 3ES7A 3WBAA 1GYLA 4BI6A 4E0CA 2DZVA 1FWSA 3LM7A 3AICA 4RPPA 1OG0A 4QCEA 3OIHA 4GMEA 4S3AA 3EDKA 4LW7A 1KQZA 1RHCA 2NV2A 4FNSA 4NI3A 3GIYA 3MCOA 4EPDC 2VTFA 3D3AA 4G7EA 1V02A 2PDBA 1ZAIA 3TZNA 1YNQA 2ZZ7A 4HA1A 3VNKA 1F3TA 3RAOA 1OIMA 2J7EA 4NY2A 1J0YA 1A49A 4LY4A 5LIUX 3B0PA 4H8HA 4UFMA 3P67A 4ONVA 3UZYA 4DUXA 4U31A 1YADA 1WCGA 3SCPA 2ZXBA 3FJNA 4KCUA 3HO8A 3ICJA 4E8CA 1YQ2A 3FSUA 3MS8A 4ORIA 1R3TA 3TW6A 3AMCA 3SJ3A 2RJGA 4F2BA 4MB4A 2WWDA 3T8QA 3QQ1A 5HWNA 1XYZA 3E2QA 3EPMA 1G7VA 3ZT5A 3E1F1 3LHWA 1JRCA 2FVLA 3BAIA 2QCNA 2OFJA 2Y24A 1HL2A 1OSEA 5LHEA 4MNLA 3FFSA 4A8NA 3GDMA 1R2TA 3F5KA 3W2KA 3RCYA 4DJDC 5DY2A 2PDCA 3UCQA 2ZUSA 4JHMA 4TVCA 3RM9A 1MUMA 2O9RA 2CBIA 1J9YA 3W6LA 1Y5XA 1KV5A 1U1UA 4S3EA 2E40A 2CBVA 4LRSA 2Y7GA 5EU9A 2RJHA 2CLHA 5TBOA 4AF0B 1HIZA 1E1CA 5BMXA 4DY1A 5DF0A 3QY7A 1QWGA 3DHPA 5DX7A 1V4YA 5U7SA 4AD2A 1C29A 4Y90A 1U22A 1MWOA 3PJUA 4N9EA 1FFQA 1X7IA 1HL8A 3TJIA 4GGHA 1VENA 4JTEA 3CWOX 1NWUA 3L2LA 4TV5A 4XKYB 3GXTA 1E0UA 4NZJA 1J12A 2PC8A 1OCNA 3ABQA 3FLUA 3H4WA 3OLGA 1JCXA 4NVTA 2E9BA 2QUVA 1J96A 3V18A 3O9NA 3S1WA 3PUGA 1U83A 4UOJA 4O14A 1SMDA 2HISA 4J2PA 3S2JA 4ZL1A 1W5NA 1LTDA 6REQA 1YBQA 1XICA 1GQJA 3EB4A 3LOTA 3SY8A 4DO4A 1TJ0A 3UYIA 5M03A 2AMGA 3T6CA 1AZ2A 3SCTA 1WZMA 1B9ZA 1CPUA 1XG3A 3MI3A 3F5LA 3I6RA 1EUNA 4G2DA 5E6ZA 4B15A 4YMZA 4CQ9A 3LCIA 3ARPA 5H8MA 2GGJA 4WKAA 4Q32A 2D0HA 2ASHA 1ZRQA 1W5PA 2NX9A 4GG9A 3QH2A 4YTRA 5TQLA 2BVDA 1Z7AA 4JX5A 3GXIA 2J7BA 2X8RA 1H0GA 1XIBA 2MANA 3SB0A 5FEPA 1GJUA 3MMWA 2MUCA 3KOZA 3APYA 5LIWX 3E12A 1R3QA 3QW3A 4N4PA 3BXWA 4HYWA 2TAAA 2Z27A 4D8LA 1OGGA 4UOQA 5FL0A 3LQLA 4JL2A 2YZRA 3A6OA 1IT0A 1ICQA 4ML4A 3M5ZA 1KM3A 1R2SA 4MLJA 2XGBA 4CQCA 1US2A 2I7GA 3QHNA 3PC0A 1WZLA 2J77A 3THQA 4GYJA 4QSHA 1Q6DA 5EB8A 2XPKA 2J7DA 5D2WA 3RU6A 1I0BA 4DM2A 2E77A 2GFTA 3PSWA 2RDXA 1C7TA 4GCAA 1MW3A 1ZAJA 4DM1A 2OWWA 3TJ4A 1GYMA 1TPFA 4DIAA 1GW9A 4FLRA 3CLMA 3SCVA 2A7PA 3GU1A 2IPJA 1GEQA 2VEPA 1QATA 5DQPA 4RDYA 4US5A 3TTYA 1CIUA 1V6UA 4XSMA 1LORA 4YVPA 3POHA 2ICSA 1W9VA 5RUBA 4BWLA 4CN4A 4AEOA 3EOEA 4WX2A 3FSTA 1BAGA 3S2CA 3GAKA 4A8IA 4LS2A 3S5ZA 4L6DA 2R94A 4V1YA 4W7UA 4Z1AA 3DKLA 4AVFA 4H9VA 2PDMA 5EMJA 3THCA 4M3PA 3VNMA 1YE4A 3KL0A 4PSPA 1OD0A 3N34A 5E0FA 1S2VA 2INZA 1FWTA 4A3QA 4LANA 1SYTA 2ZVIA 3G77A 2OU4A 2WXDM 3K1DA 4IP5A 4L4PA 1GORA 3F4WA 4FAMA 1O95A 1W3TA 3K13A 1F5ZA 5F2LA 3A4XA 5D8ZA 4DX3A 1A47A 4Y9PA 3W02A 1LT8A 4CCCA 4NSBA 3TTEA 4MZYA 4NYUA 4OOUA 2VFIA 1REQB 1GPFA 2C91A 2PWHA 4ICMA 1F4AA 3P7YA 1FWRA 3BJFA 1A50A 1MDLA 1QO5A 1S1PA 1OK4A 4UMCA 4B5NA 1VIZA 3VGBA 1HKJA 4PN2A 3WJYA 4C6FA 3LCLA 2CHOA 1PX8A 2OSYA 4P7OA 1Q6RA 1Y5VA 1XQLA 3K8KA 4XO7A 1ADDA 5CPOA 1EPXA 3IIZA 3AO0A 1BRLB 3B9EA 1KRCC 1DIDA 3P82A 2A5HA 3T08A 1LG1A 4OVXA 1P6WA 2GWGA 1EEXA 3L5LA 3W82A 2HWGA 1SZRA 3WLJA 1L8PA 4GQQA 1MUWA