4YVPA

Crystal structure of akr1c1 complexed with glibenclamide
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
318
structure length
318
Chain Sequence
QCVKLNDGHFMPVLGFGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAVEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Aldo-keto reductase family 1 member C1
publication title In vitro inhibition of AKR1Cs by sulphonylureas and the structural basis
pubmed doi rcsb
source organism Homo sapiens
total genus 115
structure length 318
sequence length 318
chains with identical sequence B
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2015-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4yvpA00
2FZBA 4GCAA 3N6QA 1AZ1A 1AH4A 5AZ1A 2FVLA 2FZ9A 4DZ5A 4H8NA 3LN3A 4ZFCA 2ACQA 3V36A 1J96A 1S2CA 3LENA 3UZZA 4PR4A 2IPJA 4G5DA 4RPQA 1ADSA 1FRBA 2INEA 4NKCA 2PDKA 4Q3MA 3UYIA 4WDUA 4OTKA 2ACSA 3BCJA 2A79A 4FA3A 2PDQA 1OG6A 3RX3A 4QBXA 3LEPA 2R24A 3G5EA 1X98A 3O0KA 1VP5A 1YE6A 3V0UA 2HDJA 2PDYA 4WDWA 1S1RA 3D3FA 3WBWA 2ISFA 3O3RA 1JEZA 2FZ8A 1T41A 5M2FX 3UZWA 1IEIA 4YU1A 2VDGA 4XZLX 4XAPA 3MB9A 4JQ4A 2DV0A 1S2AA 4DBSA 2BGSA 3R8GA 1AH0A 1X97A 4XZHA 2IPFA 1SM9A 2PDFA 5JH2A 3M64A 4GQGA 4PRRA 1US0A 3BV7A 2PZNA 2IKHA 1YNPA 4JIHA 4HBKA 5LIWX 4XO7A 4F40A 4JIIX 4JTDA 3CV7A 3R58A 4EXAA 2F2KA 4JQ2A 1Q13A 5C7HA 5HA7A 3GHUA 1M9HA 2PDHA 2I16A 3T42A 3UZXA 4JTQA 1YNQA 4XVEA 3N2TA 1EKOA 3LUTA 2C91A 4WRHA 4DBUA 3R8HA 4QX4A 4XZIA 1ZGDA 3MC5A 3UP8A 3BURA 5HNTA 1PWMA 1R38A 3R7MA 4QR6A 3UWEA 3LD5A 3S3GA 3GHRA 4YVPA 4LBRA 3M0IA 4FZIA 2ACUA 1QRQA 4XK2A 3V35A 3G1RA 3WBYA 3P2VA 3ONCA 1EF3A 2PDUA 2R9RA 1RY0A 2I17A 3RX2A 3UG8A 2PDWA 1IHIA 2DUXA 5LIYX 1YE4A 2PF8A 3R43A 4LBSA 3H7RA 4GQ0A 4DBWA 1GVEA 1HQTA 4LAZA 2BGQA 2FGBA 1AZ2A 3R94A 5LIXX 2PDJA 1QWKA 2QXWA 1T40A 4ICCX 4EXBA 1Z89A 1Z9AA 3ONBA 2PDXA 3LNMA 4H7CA 3V0TA 1Z8AA 2ALRA 2J8TA 2HE8A 4XZMX 1LQAA 2PDGA 3CASA 3KRBA 1ZUAX 1AH3A 3RX4A 3V0SA 2PDLA 1Q5MA 4YS1A 2PDIA 4PUWA 1RALA 1ZSXA 2HVNA 3ERPA 3H7UA 4GA8A 3WG6A 2ACRA 5AZ0A 3UZYA 3BUVA 4JIRA 2IS7A 3UGRA 4PMJA 3EAUA 2DUZA 3GUGA 2IKIA 4WGHA 2PDCA 3NTYA 4L1XA 3LQLA 1MZRA 2NVCA 3VXGA 1XGDA 1PWLA 1XJBA 1EXBA 4ASTA 3R6IA 3M4HA 3FJNA 3Q67A 3LZ3A 5HNUA 1C9WA 3WCZA 2IPGA 2IQDA 1ZQ5A 3CAQA 4HMNA 3QKZA 2WZMA 1MI3A 4WDTA 3F7JA 1XF0A 4GACA 1Z3NA 2HE5A 3LQGA 4LAUA 1AFSA 1S1PA 4JQ3A 4LB4A 2BP1A 2FZDA 5LIUX 5DANA 4GIEA 3B3DA 2WZTA 2CLPA 3H4GA 5LIKX 3LZ5A 3DOPA 4JTCA 4Q7BA 4FALA 1K8CA 5KETA 2PDPA 4JQ1A 3COTA 3FX4A 4MHBA 2HEJA 1EL3A 2PDBA 3CMFA 3C3UA 1A80A 4JQAA 1PYFA 3U2CA 2NVDA 2PD9A 4JTAA 3CV6A 4XO6A 3WBXA 4L1WA 1PZ1A 2IKGA 4LB3A 3GHSA 4PUUA 4WDXA 4YVXA 3EB3A 4FAMA 1MRQA 3GHTA 4GABA 1X96A 4YVVA 2F38A 2IQ0A 4I5XA 2AGTA 4PRTA 2PDMA 4XZNX 3CAVA 2PFHA 4IJRA 1UR3M 2IPWA 1VBJA 4XVDA 4AUBA 3EB4A 4QXIA 2INZA 3DN5A 1LWIA 2PEVA 3UFYA 3Q65A 1RY8A 4IGSA 2IKJA 4IJCA 2P5NA 4R9OA 4WEVX 1PZ0A 2PDNA 3LBOA 2HVOA 1HW6A 2PD5A 4JTRA 2HV5A 5JH1A
chains in the Genus database with same CATH superfamily
1XM3A 1J2BA 3UCQA 3DGBA 3PZQA 4OVXA 2I9UA 1ONEA 3EWXA 3BMWA 3S2JA 3TQKA 3TMLA 3RMEA 1LROA 3PUGA 1WZMA 4ZQPA 4WUIA 3F4NA 2QCNA 4H6QA 3W73A 4AQLA 2BODX 1ONXA 1R9YA 1I8JA 4A8NA 1P1MA 3WMBA 2WSRA 1MDLA 4BEUA 3FYPA 2YLLA 1OC5A 3QTPA 3TN3A 3E02A 1DPMA 3FAWA 3GG8A 1BXCA 3UY7A 8A3HA 1EYWA 3BCJA 1A0EA 3GYEA 4BQ4A 4D8AA 2DW7A 3MJYA 1SJCA 1ZJHA 1PHWA 4P8UA 5EY5A 1JZ5A 1QNRA 4LUIA 3ITYA 3O0KA 2WJEA 3H2NA 3NQ7A 4HOXA 1FH7A 5F2LA 3FCPA 4XISA 2HCVA 2Z26A 2P0IA 1BEUA 4GPNA 2WNNA 1OX4A 5CGQA 4MZ8A 5RUBA 3M0KA 4AY1A 3STEA 1OFAA 2X16A 3UERA 3N6HA 3VUPA 5F4SA 3SY8A 3O7UA 2XINA 1D8WA 1OM0A 1US3A 5HQMA 3BV4A 1BD0A 3PPGA 4UTWC 3TUUA 1GVYA 3SI9A 1QR7A 4LS0A 2OMAA 5JH2A 2A2IA 3QQ1A 5FL1A 3P3BA 2CZEA 2Y7DA 4FS9A 4OECA 2WZIA 4HSOA 3H2FA 2E8ZA 3BCDA 3KLKA 3C61A 9XIMA 3CUIA 3P82A 4PN2A 2FHFA 5DRCA 5LA2A 1SO6A 4XV0A 1EIBA 1N8IA 3R58A 4UTHA 2F2KA 1ME9A 2A6LA 1V7YA 3GAYA 1FH9A 4HT3A 2Y7EA 1TMQA 1JGMA 1HVXA 3CUXA 3QRHA 1GPWA 1QPKA 1TR1A 3W82A 2OOFA 2GJLA 3KCJA 1R5YA 4AVNA 2XVNA 5A6LA 4CEUC 4H9MA 1S2UA 3LI1A 4W7WA 1DWHM 4DF0A 1H49A 2FB3A 1C29A 2PDUA 2Q01A 3TVAA 1LQ2A 1HXJA 1BF6A 1UKTA 3KX6A 3DUGA 3IANA 4GLEA 4I5RA 5FSEC 1W9PA 2Y0FA 3HV8A 5HPOA 3AUJA 3WK0A 2VT0A 2BGQA 4ZO9A 4X2PA 3QGAC 3H2AA 1WAWA 2REQB 1PE1A 1DP0A 3ATYA 1QU4A 1GOOA 3O6YX 2C0HA 1P7TA 3MSGA 1I2PA 4XZMX 3PVFA 4W84A 1JCJA 2J9YA 4L80A 3HMJG 4HU0A 3CWOX 1PPIA 3I7QA 2J66A 1FUYA 1W32A 3A3HA 3VMPA 1L6WA 3XINA 3VKCA 3RCYA 3GFZA 3VOGA 6REQA 3NDZA 2V67A 1XINA 1W1ZA 3BPWA 3MUZ1 1FWNA 4DWSB 3V18A 2IS7A 1VYPX 3NQAA 4M51A 3VD7A 1VFSA 4RV8A 5AOUA 1XLIA 4N6EA 5JIWA 2VFDA 1J2WA 4L1XA 4E8DA 5AC4A 1MZRA 3ZOAA 2NUWA 1XJBA 1HKKA 5IFPA 3R1ZA 4IXXA 3FJNA 1WDQA 1W56A 2VTFA 2IPGA 3WL1A 1TJPA 3F03K 2XIMA 1J6PA 3RCMA 5JU6A 3EA2A 3M7WA 3AJ7A 3LYEA 2E5BA 3II1A 5D9NA 3OZYA 4MAVA 4O1DA 3OEXA 3TC6A 4J9JA 4DYEA 1N82A 4FLSA 2HQAA 3GDKA 2QYGA 3GE7A 4OKDA 3LZ5A 3DOPA 4XKMA 4O28A 2CWXA 3TFXA 3WDJA 2CETA 2DSZA 3C0JA 1QI2A 4GZJA 3U2CA 4Q4OA 4UTTA 3VIPA 1YPXA 1D7FA 4MKVA 3B8TA 5KZDA 4F2BA 3NVTA 4Y90A 1CXHA 1IXQA 1VQTA 1FX6A 1TSIA 3NQ6A 1V3KA 2OQHA 3QLDA 5DCDA 3IJQA 3EMQA 1I60A 3TA9A 1SFSA 4PBEA 1JPIA 1XLAA 3KHDA 3ZIZA 3DCPA 4LUJA 4X0VA 1GZ1A 5D9PA 4J1OA 4IQLA 4MSSA 4B5SA 5LGZA 1X6NA 1SO5A 5IOBA 4FPSA 3ES7A 4PZVA 4W5ZA 1LQ0A 1HT6A 3HGOA 1TQXA 1UZHA 3QV9A 1TRDA 7CGTA 1XGZA 3OO2A 4LFYA 1JL8A 2YL9A 4JNYA 5ABTA 3WDIA 3OVGA 3HMCA 1W1B1 1W1VA 2HVMA 1QHOA 1SVDA 7ENLA 4LEQA 3NPWA 1DXFA 4R9OA 3WH7A 4PMVA 1UCWA 3WH8A 1KBLA 3W1QA 1PKMA 3WF1A 3MP5A 2WC7A 1EA9C 5C9XA 2ZX9A 4NXSA 1XYMA 4H4IA 3CL8A 2XVLA 3GR7A 3SZ8A 3ABXA 4OIFA 1A5CA 1UB3A 1REQA 4JHOA 1J18A 5FEZA 4JKKA 4JDBA 3W7IA 3DIPA 3FOKA 4IOTA 1JDFA 1JJKA 1ZP3A 4R88A 2ACQA 1TPC1 4CD8A 3EXTA 5HWJA 4MWAC 1LTDA 4C60A 1VAHA 2G3FA 5J04A 1ZAHA 4ZTXA 4GINA 4Q4QA 3OOQA 1L6YA 2VI0A 3A4WA 5FIPA 4DZIA 4N9DA 3ARZA 1PJ9A 3MYPA 4JFTA 3BARA 3RMJA 1QI0A 4PE8A 4PTWA 3GXDA 3MYOA 1FVPA 2BY0A 4JIEA 3C52A 1E0UA 4KWSA 1FWWA 2WPGA 2UY3A 2GGHA 3DERA 2DSUA 1W5OA 4LSBA 1VP5A 3WX7A 1MXGA 3V0UA 3IUDA 3M41A 1J01A 4XQ6A 3ZT7A 3V16A 3IACA 1NVMA 3C6CA 1KLYA 1KM0A 1E43A 3E49A 4GVGA 4KQNA 3BLEA 3LI0A 3TKFA 4DHGA 1JEZA 1RHCA 3L66A 5F2MA 2HS6A 3TA6A 4F0SA 4K7YA 4GZEA 3WZ0E 3ZR4A 1WUEA 2E6DA 2ZA3A 3HG3A 2OEKA 4JQ4A 4G6CA 2OB3A 1P1XA 1ZHAA 3C2FA 3BLFA 5H6HA 5E5CA 1O5XA 4PRRA 1V03A 4RNFA 4AHPA 1TTPA 1Q6OA 1HN1A 1UA3A 1RJQA 4W88A 8CGTA 5F1VA 1Q66A 3OLEA 1B2YA 3OYZA 5BOFA 2D2OA 2HXTA 3S8HA 3F2BA 5IDZA 4PUEA 3ABZA 1Q6DA 3W88A 3MSRA 3B06A 1VYSX 1B0IA 1BXNA 3HQOA 1EKOA 2ZZ3A 1EJWC 2ISWA 3NG3A 2VEMA 3FLUA 3R8HA 4HOZA 3S47A 1RQEA 1A3WA 3MW7A 4CN1A 1HKJA 4XZIA 3RM4A 4GNVA 3TWBA 1NFGA 1VJSA 3SJNA 1S3TC 1DJZA 2ZRXA 1JCTA 4DXVA 4R33A 3HOJA 3CT7A 2F61A 1EZ2A 1Q8JA 4O1CA 3GU9A 1CCWB 4AZGA 4JTEA 4JXCA 2BVDA 2G37A 2Z1WA 3L4XA 1R9XA 2R9RA 3IPWA 3MO7A 1RY0A 3RX2A 4MJZA 1NOUA 1D7KA 4H9UA 3CO8A 1PTDA 3TEVA 3VGHA 1PTGA 2PF8A 2E4TA 3KTXA 3W75A 4JIPA 2J88A 1EX5A 3LRLA 3L5LA 4F3HA 1CT5A 2PU1A 1UA7A 3UPBA 1R3RA 1TWIA 4NJHA 2VUNA 3CMGA 4ZO7A 4EE9A 3BLOA 3ZJ6A 3GR4A 1YPIA 4UFHA 3KBNA 2OTDA 1JVNA 1B3OA 4LNCA 3EOSA 3FHAA 1QXLA 1O68A 2FIQA 3IIVA 4LQ1A 2QHAA 3DYPA 2PURA 3WLLA 3IGHX 3QHNA 2BLEA 3T6CA 3H23A 2FVMA 4JPGA 2I5GA 2OEJA 1E6XM 1HKVA 4DWSA 4CUCA 3G8RA 4GI6A 1H50A 2MNRA 2FMOA 2ZUNA 3S1WA 4W8LA 1JI1A 1XCWA 3QKEA 1Q2RA 5CZSA 1M7JA 2GJXB 2NXHA 3H53A 3BQ6A 3DHDA 1XYAA 1SZNA 1AK5A 2I7GA 2V5CA 3WQEA 3VDHA 3AFBA 3L0KA 2BDQA 1KFKA 2QV4A 3PFMA 4MF4A 3R6IA 2DSKA 1UWSA 2ODOA 3NO5A 2QMKA 5K9XA 3BC9A 2C13A 3I6TA 2O7QA 2E67A 2VJXA 4S3AA 4WLCA 2F6XA 1A5KC 1GUVA 5D2WA 3L4WA 2AQOA 4YWIA 2WZMA 4NP7A 1F3XA 4S2BA 1BTMA 1H61A 3L2MA 4H9VA 1E5NA 1XLBA 4MLRA 1S1PA 1A49A 3DYMA 5LIKX 2WCSA 1ZCCA 4FALA 1K8CA 2PDPA 3QHMA 4D1JA 3POCA 1QNVA 2ZKMX 2ZUTA 3GH7A 3B04A 1THFD 1UH4A 4MADA 4N4QA 4GIRA 4H1ZA 1PSCA 1JXJA 2J8GA 1DXEA 1VJZA 3ZR6A 4JTAA 3O8AA 2CZFA 1EWEA 1M68A 1YW1A 4PL1A 4QITA 4HGXA 3ABSA 1U1UA 3F5JA 3VGGA 4MB4A 1FOBA 3WH9A 1K77A 3A13A 5E93A 2FH6A 4XX6A 2XVKA 4HYVA 4LF2A 2PDMA 1VBRA 4C6DA 4AVFA 1A5OC 2DW6A 3GH4A 4UQEA 3W1AA 4M7TA 1OGBA 3T4CA 2VOMA 2GVYA 1U2YA 1XYLA 3NURA 1UZDA 3VINA 1W3IA 4S38A 4X22A 1F9CA 3ME3A 5IBXC 1XISA 5C54A 2QKFA 4JFSA 1EJVC 5D32A 3OQEA 1BYBA 2OKTA 3THAA 2VXNA 3E2SA 2Z2AA 1VPQA 2PDNA 4BCEA 4CVWA 1KRBC 3NDYA 2C0AA 2ZXBA 1GKRA 3NL3A 2P8CA 3T44A 1E1FA 3GXIA 5M3WA 3DFQA 3DXIA 3W7QA 3BOLA 5A8MA 4H8VA 3CYVA 1K7FA 1U30A 4FXRA 4GGHA 4DNMA 5HR7A 3UBPC 4HSNA 1UWRA 4NAEA 3PSVA 1CLVA 2DH2A 3B0UX 4BI6A 4HZ8A 4B2DA 3NYZA 2KZHA 4LGXA 3VTRA 2VYOA 1KBBA 1OCBA 4C5ZA 5LNSA 5IDIA 4BKNA 5AC8A 3G1FA 4OGZA 4ZSTA 3VNDA 1DIOA 1K8YA 4ZE4A 3CJPA 4JFWA 2DZPA 1XBYA 1OSEA 4YTSA 2JFEX 3HG2A 1UZ1A 3GG0A 4Z2LA 4P61A 3AROA 3GS6A 3VKDA 2BNJA 3RX3A 1LJYA 1KRMA 2JEPA 3HGJA 3PJWA 4RE2A 2GVGA 1O1HA 1B30A 4HCHA 5DX7A 2O55A 3S6TA 1DYSA 5E09A 1UWAA 2PGRA 1WPCA 1S5NA 4FX6M 4S3BA 1A53A 1LOQA 2Y8UA 2QUNA 2J7CA 1F6YA 1XLFA 2V5LA 1HF6A 1DQWA 4RDWA 1BWKA 3UXLA 5I78A 3BG3A 3CTLA 1PIFA 2DP3A 3HV9A 3DFHA 1RBAA 1GZGA 1OG0A 1C9DA 1DOSA 2Z0IA 2BASA 5I3JA 3LDVA 4DRSA 3MHGA 1XPGA 3F4VA 4GXMA 3EDKA 6TAAA 3A6OA 1TG7A 3CAKA 4ECLA 1F74A 2QF8A 1KBIA 3BAKA 3O15A 3LK6A 4A8LA 3ZXWA 3FS2A 1ZCOA 1DJWA 2UY2A 4ML4A 5FD0A 3PG9A 1EO5A 3OVQA 5CZTA 5GNYA 4C6NA 4JTDA 3E2QA 2V82A 1ISXA 3GNOA 4TO8A 5C7HA 3QXBA 5HAOA 3G1DA 1E71M 4F4RA 3ORWA 6XIAA 2E8YA 2YCEA 2D0GA 3N2TA 2X09A 2JEQA 4F0KA 2E40A 1MQPA 4J3VA 4ILSA 1F3EA 4UTFA 1ZGDA 5CPNA 4CNNA 1WDDA 4ZXLA 3BURA 4HZ6A 3QGVA 5DT5A 5ABGA 1Q6EA 3GWQA 1XDJA 1JPKA 4X3ZA 1UKQA 4GUHA 1KLZA 2Q71A 3N34A 2ZICA 1TZZA 1DWGM 3QC3A 2PWGA 4M24A 4L61A 2RFGA 3WBEA 2ZTKA 3RPDA 2CLFA 4IH3A 4R53A 1PB0A 3LCLA 4M5PA 4GBUA 2QV5A 4TUFA 2OFJA 5CH9A 5K9CA 2E9BA 2E09A 4PCSA 2Y8KA 4AAJA 1R30A 4ACYA 4FB7A 3MCNA 2GVJA 3WJWA 4QDWA 2WK2A 2DSWA 2VNCA 2ESCA 4K36A 4K37A 5AHNA 1TUFA 1FA2A 2QCDB 1CXKA 3LSBA 2XUCA 4E38A 1HKMA 2ZZ1A 3QH2A 2WMGA 3KRBA 2GJXA 2Z28A 1AQMA 3MU7A 4GVHA 2WVVB 3ARWA 2PDLA 3DKLA 2VKZG 2UY4A 2A7PA 2A3HA 4RNIA 3AMCA 2HRWA 1AJ2A 3VK5A 3RFAA 1CDGA 3FYYA 3VGBA 3AMDA 3G1XA 3KBMA 5AZ0A 1M3UA 3EMCA 4CD5A 3UXKA 2GZXA 4UFLA 2CHNA 3SN4A 2IKIA 4C1KA 2DDXA 4C6IA 2FTWA 3NQBA 1ZZMA 3VXGA 3LCGA 5M17A 5I03A 1RD5A 1VFLA 2UBPC 1B5TA 3TV8A 3RM9A 1Q6CA 4BF7A 3L4VA 3WLQA 4GOAA 3AS1A 8TIMA 3EWZA 2OCZA 4S3GA 1S3HA 1U5JA 3QKZA 2GWNA 1HKIA 4WDTA 5A6AA 2CERA 5CPMA 4GO8A 3JZUA 3B97A 2XWDA 3CU2A 5ENLA 5C9RA 1QASA 3LQGA 1LLOA 3WUEA 3P74A 1AFSA 3XISA 4EX4A 1XD1A 2NSOA 1RCQA 1TV3A 1E6ZA 4O1EA 3WEMA 1H7XA 1PKYA 4N6FA 4JQ1A 3GC5A 3VIMA 3CZLA 2GGIA 3EOEA 4F0RA 3P5YA 4ADTA 2D2GA 3CZJA 3ZWTA 2NVDA 3ZO9A 3UQNA 4ZCWA 3FEMA 1WXJA 3SCSA 4EWJA 3SSJA 4DUVA 2YR1A 1WOBA 2Y63A 2E0PA 4LY8A 2ZC1A 3SUTA 1BSLA 3GAKA 3E5BA 1FKXA 3B05A 1B3XA 4I6KA 4DJEC 1X38A 1A50A 4Z1YA 2XSXA 3UA3A 1O12A 5BRQA 1E6NA 3SRDA 2XN0A 4KFPA 1P5BA 4H7ZA 4I5XA 3U6WA 1V02A 2AGTA 3P14A 3KL5A 3P67A 4B4FA 1WKYA 1DE5A 3HZ3A 4FNSA 1JR1A 3C2OA 4XD4A 3RPTA 1ADOA 3FVDA 2AMXA 2CKRA 4XVDA 3CHVA 4AUBA 1FKWA 3CLMA 4O19A 3JRKA 1BWVA 1AG1O 3S46A 5CQ1A 4YWSA 5FESA 1U1HA 3ZS4A 1I2RA 4L5ZA 3QMSA 3C4UA 3HA1A 1BVNP 4AC1X 2Q3RA 5LHFA 2O4QA 2QJIA 4IWWA 3CIVA 1AW2A 4N9CA 2J78A 3T8QA 3QMRA 3IJ7A 2VDHA 3T2OA 2PMQA 2W5FA 1KXVA 4KW2A 3NQ8A 4KWVA 2AL1A 3WQOA 3FFSA 4P7LA 4YMZA 4CNSA 1HW6A 4UMBA 4KRTA 1IIHA 1M7PA 1HGWA 3W7CA 1FWIC 2VL4A 3UPWA 4DPPA 4Q8TA 4LC6A 1RXOB 2TYSA 2VZUA 4TTUA 4ERAA 4XIMA 4AD3A 3WH5A 2OSXA 1EEPA 4CN4A 1UWQA 3UD6A 4EANA 5BMWA 4X2RA 1JDCA 3VOCA 1AQFA 2CLHA 2ALDA 3KRSA 4CCZA 2XZ9A 2B7NA 4PR4A 1M65A 4PMYA 3WQVA 1EX1A 1IEVA 4OBTA 1UR8A 3O07A 1ADSA 4JN7A 4NF7A 4NZFA 3H8AA 5AVNA 2QZRA 4ZTYA 3A12A 3UVAA 4IMGA 2EJ1A 4Q7IA 3FA3A 1VEOA 2DJXA 5FAGA 1UWUA 5D30A 4CCCA 3B9DA 2P3EA 3ITLA 3KL3A 4NYYA 3W7KA 3E3HA 4V2XA 1OG6A 1QVBA 1XC6A 4QBXA 2Q8LA 3TSMA 4JBRA 4G9PA 2NW0A 2ZZ7A 3B8SA 4H8HA 3VM5A 1OF6A 3N25A 4PFMA 4NJJA 5JXQA 5LZLA 4JYDA 2OODA 3F1QA 4QFUA 3VI2A 1W2VA 5XIMA 1TTJA 2VOTA 1I2QA 3PZGA 2VZVA 3RRAA 2WZEA 3G3DA 4GY1A 3WUFA 4IFOA 1QO5A 2ZRUA 1EC8A 1V08A 3WLRA 1YIXA 2NT0A 2DQWA 2FGLA 4XBJA 4IPPA 4MB5A 1SFTA 2GQ3A 4IMFA 4QG9A 2R1MA 3NSXA 2A21A 3R8GA 4CU6A 4J3WA 2D0FA 4TX6A 4XZHA 2J9XA 2IPFA 3MUCA 3QR1A 1Q7ZA 4JFUA 2IW0A 1T96A 1R9ZA 1OHLA 1TX2A 3M64A 3W1NA 4DI9A 3LHZA 2ZUSA 3NEHA 1TPWA 4GJJA 2ZQ0A 1XDLA 1L8NA 4XO7A 1QK0A 1JYXA 1BSIA 2P10A 4BK9A 4PCPA 2WQPA 1R2RA 3CH9A 3GKAA 1B57A 1EWDA 1R87A 5BRPA 4OUEA 1J0HA 3GHUA 3MI6A 3S9IA 3KOXA 3OGSA 2OQLA 4GO9A 3NXLA 1IXNA 1EJ7L 3M16A 3NEVA 4QJ5B 5HANA 2JF7A 3S6OA 4GGBA 4DWSD 1POJA 2QF7A 3NFUA 2C15A 3KVLA 3MC5A 3PB2A 1TPVA 2HXUA 2FPVA 4W87A 4KMQA 5HUOA 1SMDA 3TW7A 4QR6A 5EMMA 2OOGA 2QMJA 2ANUA 2X8RA 4L4MA 3W6MA 4MGGA 4B92A 4FOKA 3KOZA 3VKKA 4BEQA 3QTGA 4OV4A 4AB4A 1VBUA 2XIQA 2NV2A 1EFZA 3HO8A 2DH3A 2VD9A 3F4DA 3NQMA 3BJSA 3K2GA 3B0PA 1V51A 3U5UA 4KCWA 2W91A 2FGBA 2QCDA 2H6RA 4HA3A 2PDJA 2R14A 4L4OA 3IGSA 3GC4A 5CLWA 4ZQRA 3O06A 1NTHA 3IWPA 2VC9A 4H8UA 5ABFB 1MXSA 2J7GA 2XH2A 4KGLA 1NOFA 4AFYA 3N3MA 3PZNA 4KIEA 2R82A 3LB0A 5EU9A 1OK4A 3GVGA 4PMXA 2YX0A 3IK2A 1P0EA 4QTGA 3EMZA 4DO7A 1UPMB 5HMFA 2HBVA 3STPA 4MDOA 3IGXA 3GUGA 5D4YA 3MCMA 2PU0A 1AW1A 1E9LA 3EPMA 1RLCL 2E1DA 4JTJA 4ERGA 3ZFHA 5AC5A 3CXOA 3VABA 1KM4A 3V5OA 5LA0A 2WMHA 1F73A 1NOWA 1XPYA 5J8LA 3M7SA 1RQBA 4UCGA 1MI3A 4BWLC 2P76A 2WANA 3CB3A 3DHPA 5FF2A 5REQB 3MCOA 1T8QA 1FXPA 2G3MA 1AVAA 1FCBA 1OT1A 4YNGA 2Q8ZA 4ZOAA 2R1LA 2YB4A 2EG7A 3C0SA 4GVFA 2C18A 3CO4A 4Q8UA 5I07A 4JTFA 3U7VA 2D2HA 1JZ7A 1S38A 1EA0A 1J5SA 4AYSA 3H55A 3MVIA 3W38A 4GH1A 3JW7A 3TTSA 2QDGA 1TO3A 1MQRA 2G4JA 3CZEA 1FY6A 1Q85A 1XYFA 3EB3A 4YVXA 1A3HA 2FJKA 2J7HA 3WENA 1JCYA 1ME7A 4JTLA 3SN0A 4ENLA 4CLMA 1TA3A 1PCWA 5A3HA 1MRAA 4DEFA 3PFRA 1IGSA 4GI9A 5G1MA 2PFHA 3SIZA 4B2DD 4DNHA 2IXUA 2WLYA 1KGWA 2YDRA 1ZALA 1IZCA 1E51A 2WSKA 2AGKA 1B31A 2A7RA 1IT7A 3KW3A 1V3JA 3KOFA 2YJQA 4OHQA 2Z4GA 5LSMA 1EEXA 3IJ6A 1VS1A 4DYJA 2OX4A 4ZMGA 4HCDA 3VNMA 1ZAIA 3NPUA 3ARVA 4RNJA 3LCHA 4MNMA 1IT8A 1CPUA 1C8QA 3CZKA 1RBOB 4D9PA 3SFKA 3M0HA 4BI7A 1MW0A 4LW7A 2PUZA 3AMLA 1XIGA 4ZODA 1L6SA 1EDTA 3CTTA 3UZJA 2D23A 3LXCA 3GD6A 5CJNA 2BV9A 3C2EA 2ZRYA 1Y5XA 5F4WA 2YIHA 1CGVA 3ARUA 4O0ZA 4WCJA 1KCKA 1ZENA 3KS6A 4GY7A 3SGUA 5KEZA 3A22A 1IGWA 3LA4A 1SW3A 3TLLA 3K1DA 4IP7A 4XKYB 4GNKB 4Z1DA 4TXEA 3THCA 1TTIA 3LS9A 3C0QA 3GXPA 2VRQA 5AHIA 1UG6A 3RITA 4Q4SA 1E55A 1P6WA 3VNKA 4GX9A 4U28A 4RZ5A 3TQ0A 3M9YA 2WXDM 4MFEA 5CC3A 4UZUA 2X1SA 1LBFA 3GR8A 2YBVA 1LOSA 3DFTA 3W01A 3P93A 1SZFA 2QUMA 3MTWA 3PNZA 4KKXA 5FEWA 1PZ2A 1UOZA 2DZVA 1I75A 4K1WA 3AHTA 2OWCA 3FA4A 3RJYA 1EGVA 5I77A 1LYXA 1T41A 3LBMA 3DFOA 3IIZA 3OG2A 2FVKA 1GQJA 4DUXA 3PTDA 4YPJA 1G5AA 2H90A 4XAPA 4JX5A 4N9EA 3T40A 2VQUA 4GD0A 5CSSA 2C16A 4JEJA 3CHEA 5CPQA 5SWUA 3K8MA 4EOUA 1NAL1 3REQA 4D1IA 4FIRA 4DJFA 5AC6A 1X97A 1TZ7A 4JHMA 3CM4A 4WKAA 4F0LA 4QJ1A 4XZBA 4R7JA 1I45A 2B31A 2ADAA 3E0FA 2XIIA 1R8LA 3BZJA 3EXRA 1RCXB 5BU9A 1DEDA 4AZ5A 4R34A 1LF1A 4HBKA 1QOPA 3NZQA 3THQA 4JD4A 4EXQA 1S2TA 2WSPA 4O1BA 1RPKA 4DXKA 3AWNA 3T7VA 3LGGA 4RDVA 3PBMA 1YTDA 3EPNA 1M7XA 3KS5A 5DELA 3TLQA 1GOIA 2D3NA 3OLIA 2YL8A 3WQWA 3MPGA 4UMCA 4ZB5A 1F6KA 2J7BA 4R5EA 1E40A 1XRTA 2B0MA 1ZJAA 2ZBTA 4MVAA 2NWRA 3ARQA 3S2MA 4DJDA 1T7LA 2QGHA 3VIIA 3QJAA 1KR1A 1H7WA 2W92A 3C8FA 3VAVA 4F0MA 1J10A 3ANVA 3S3GA 3QZEA 1SJDA 3RDKA 1XBVA 2IXVA 2X30A 6TIMA 2VZTA 3OHIA 4A21A 3WQFA 2AOSA 2EPOA 2D22A 4E6MA 1QNOA 1TKKA 4J3UA 2X0YA 3VGDA 4DBWA 5ABFA 4I5UA 4LVBA 2DY3A 3R79A 1TCDA 1NFBA 5LIXX 1X6UA 4CQCA 1RVGA 3QOKA 1PDYA 1Q7QA 3JS3A 4QG6A 1MW1A 2KAUC 3BW4A 3CQ0A 4IMCA 4PB5A 3UJSA 3H2OA 4HYRA 3DZ1A 3PJXA 1U5HA 2WHLA 4O0QA 3G2GA 3EX6A 5FF0A 3NYDA 4AY7A 3JZEA 5DLCA 2EF9A 4OV9A 2EJAA 2FPTA 2PP1A 5G1TA 1ZBCA 2FDMA 2V9DA 2ISSA 1EP1A 3NGFA 3G0XA 3NZ1A 3UXAA 5A6TC 4HN8A 3WG6A 5CPOA 3FJ6A 4TVDA 3UZYA 3UGRA 4PMJA 4LUYA 3TYCA 4KWOA 2PDCA 2H9AB 2BY1A 3GDMA 1TV7A 1JYVA 3LY0A 3KBWA 3SCNA 1DJIA 1KXQA 1AQHA 4M19A 4JICA 1UC4A 1GTHA 1LCOA 2NLIA 4I9AA 1F8IA 3FNDA 3GVWA 1A5SA 2MUCA 1V3LA 3RJXA 3W3OA 2ZX5A 3QY6A 5REQA 1FWGC 4NAFB 4PULA 3UG3A 2YOCA 1M53A 1XF0A 1OCQA 4HIBA 2VFGA 3M44A 1GJPA 3UA4A 4K8HA 4GVIA 1R86A 4UTKA 5K4ZA 3PJTA 4GX8A 4C6FA 4L6OA 3NQCA 1QHZA 2EEXA 3RR1A 4IMDA 3GDTA 4Q7BA 3URBA 3VZZA 4E0CA 4L65A 4MUPA 3FX4A 4HU4A 1EL3A 4LVDA 4Z1CA 1A5UA 4G7FA 3MWCA 3C3UA 1F7BA 3WLIA 3VCCA 3LX9A 2ZA1A 2DIJA 4HPNA 2WMKA 4LUSB 1UC5A 1C8XA 4GIAA 3V75A 1BRLB 2WVSA 1JZ2A 6ALDA 4NJKA 4LB3A 4RNHA 1WQ5A 3ARTA 2DQXA 1DXIA 2FLIA 3GHTA 3AXMA 3HFYA 3LCFA 1OFBA 1UJQA 3W2NA 1NM9A 4Y9AA 3IJ8A 4YTQA 4PL2A 4E8GA 1H5YA 1MMFA 4MNJA 3LV6A 4EP8C 4J7RA 4JTHA 3LOTA 4V15A 2PTYA 2BY3A 3UNDA 3TE9A 1TVPA 4QSHA 3IVTA 1VRDA 5AVHA 1RQHA 2NQ9A 3M5YA 1O7AA 3E1F1 3EWCA 4G7EB 2QR6A 1QCWA 1R2TA 2V63A 4CKQA 1FWDC 2CXEA 1QPOA 3BCFA 3RO6A 4IUGA 3URAA 4KCVA 1WXYA 3EDFA 1J0ZA 2GOKA 4KPLA 2IMRA 2P5NA 4I6VA 5CJ5A 5HK4A 3TYBA 3E2VA 4GYPA 4OJYA 4AMCA 3CIXA 4ATLA 1N55A 3KXQA 4IP5A 3DEQA 3T55A 3OODA 4UTWA 3UJ2A 1GQIA 4GIYA 1L6FA 5C2CA 4FF5A 3ARSA 4LU0A 2FVLA 3I6EA 5GJPA 1TPB1 1F07A 4GI4A 5IM51 1NF0A 4B5UA 4JDYA 4DO5A 1T8XA 2D69A 2WCAA 4XKYA 3PBYA 3UWVA 1J96A 1JCNA 5D05A 4YIWA 2GJPA 1GONA 3W9ZA 3A24A 3DYOA 1BVZA 4OWGA 3AHXA 3FSUA 4RPQA 2QLYA 5C7VA 2ZVIA 1M1BA 5EKYA 3ABQA 2C1GA 4GWEA 2A7NA 5DBUA 2CC0A 3GDBA 5IHRA 3WLPA 4FA3A 3DX5A 3XIMA 5K2ZA 4JX6A 4GCXA 2WBKA 2JBMA 3E6EA 3RLHA 1HJVA 4LV9A 2VVNA 1XWYA 1XV8A 5AY7A 1LT7A 2QJNA 1S1RA 2QCEA 3W87A 2A6NA 1VENA 4DBDA 7TAAA 3J7HA 3TW9A 4MJMA 4OQVA 3UZWA 4LANA 3CUHA 4TTGA 3GLCA 2NXIA 3MT1A 2BTMA 4JKLA 5F1UA 3P81A 1IR1A 4REQB 5FJUA 4O50A 4P8XA 1UKSA 5I06A 1XS2A 3D6NA 5IHSA 2BGSA 3LNPA 5A6BA 1JD9A 1KCLA 3APYA 2PWHA 4BHYA 4A29A 1GGOA 4JN6A 2P50A 3TX9A 4GQGA 2R91A 1GQNA 4JYEA 1HP4A 1VEPA 1YQ2A 1WBJA 4MPQA 4NRRA 1OF8A 4I7VA 1IZJA 2XPKA 1KBKA 3S4TA 2HSAA 5BWAA 5LIWX 2O0TA 3N17A 4KEZA 2X7WA 3VNIA 1NP0A 3VFCA 2GYIA 2TAAA 4NUWA 1WV2A 3OGVA 1N8FA 5FACA 3EKGA 1M9HA 3W26A 2FPYA 4HNLA 4U5IA 4Q4RA 2H8XA 4HPHA 1XRSA 4UTTC 3S83A 2VO5A 4FX7A 3DC0A 4A35A 3OBKA 1MFVA 1E15A 3N4EA 3SDOA 2BXZA 1V4YA 3LERA 4WKHA 3RLVA 1W17A 5DT7A 4P7QA 4B5WA 3W83A 1SGJA 1SYTA 1XIJA 1PIGA 2H3DA 4GYFA 2QQ6A 3EXSA 4UC5A 1E1CB 3T09A 3UG8A 4O54A 1BKSA 1WP6A 1IHIA 2DUXA 1CGXA 4IF2A 5F2IA 3IUHA 3NR0A 2ATSA 4Z42C 1JCLA 1NY1A 3H7RA 1R2SA 4PUNA 1GVEA 4LYKA 4WXYA 4XAYA 2PLMA 1E6SM 2GDVA 2J25A 3M6YA 3S1UA 1Q6FA 3OYXA 4US6A 4S3DA 3MZ2A 3W29A 2DVXA 3B8IA 4AZ7A 2ZUUA 5HJYA 1CWYA 1YKWA 2J8TA 5CZJA 2YPIA 3A4JA 4EKJA 3ZT5A 3V0SA 4LAKA 3VE9A 1AA1B 3BAYA 2PDIA 3CEUA 4DN1A 1S46A 2QCFA 2H9AA 4FXFA 3VIOA 4GA8A 2XVPA 2GUBA 3K8LA 1XUZA 3MKKA 4PMNA 3QN3A 1GOWA 1KO0A 4WGHA 4CD4A 5HDRA 2NVCA 1W5MA 3BK0A 3DAQA 4NAFA 3PM6A 1PUDA 4AWTA 3Q67A 2PRHA 4WXZA 3SRFA 3OG3A 3QR0A 4HMNA 1ZB5A 4D6JA 3OGRA 3GBEA 4MY9A 5CKSA 1ZFJA 2NQLA 3WDQA 3LLXA 4UB9A 1Z3NA 1NQKA 1WOAA 4M6VA 1I2OA 2X05A 3UJEA 2OYKA 4PUMA 2DT2A 2WWCA 1PAMA 4RZ4A 3VE7A 2FFCA 4LUSA 1VFFA 3W1UA 3S5YA 1HGYA 2HEJA 1SFLA 2ON3A 3H4XA 4CQBA 4RXGA 4XIAA 1E4LA 2Z1SA 2Y70A 4DAFA 1OB0A 2XN1A 3OTRA 3O05A 1ENUA 3HU7A 2QJGA 3EBVA 3TW6A 3FW6A 4GK8A 4MWAA 4S3FA 1PZ1A 1W9VA 4J3SA 1EHAA 3MMWA 3GVRA 2WYSA 1EB3A 3KWSA 1TPUA 1BYAA 1J11A 5JBEA 4Z17A 2Y2WA 1GEHA 4A3HA 4FNPA 1QNQA 1DTNA 1TVLA 5BWFA 3G1HA 3CYJA 1ONWA 4NI8A 3WD4A 2V5BA 2RAGA 2VHLA 5E0CA 3TOYA 2VEKA 3BG9A 1CGYA 2C14A 2O7SA 3GKFA 2ZFAA 2INZA 4J3XA 2PWDA 3RCNA 1OX4B 1ICPA 4B9YA 2NLYA 2CBIA 3WN6A 3KEHA 3BXWA 1ELSA 1GVRA 3QLLA 3AUOA 3W22A 3DFPA 3F4WA 1IQ8A 3WQCA 3FSTA 1CGUA 3O63A 3NL5A 3WFLA 4I7WA 2ZUVA 2GK1B 1XD0A 1Y65A 4AXKA 5E0KA 3WYZA 1KB3A 4HHHA 4XAGA 2NX9A 5U4NA 2H8ZA 1VZWA 3JR2A 3MBFA 5LNUA 3GM8A 1TV4A 4GCAA 4PB4A 3W72A 5B80A 2A4AA 4IFRA 3P8JA 4U2ZA 2QPUA 3GB6A 3ECQA 1C3FA 1KWKA 3MDUA 1E0VA 2FQIA 4I8DA 4LYQA 1EP2A 3LXAA 4S3EA 1NP2A 4G5DA 4DJFD 2WKLA 1WA3A 2XGZA 4JKMA 9CGTA 5I24A 4HCLA 1LRNA 3DH7A 2RGLA 4NKCA 2F2HA 3OVRA 1V93A 2PC8A 4BI5A 4GFIA 1R0MA 4AF0B 2ZUMA 2FMNA 2XHYA 2PWFA 3FN9A 2YA1A 4ICMA 1A5NC 1BGGA 2WCGA 1EUAA 2X1IA 1QUMA 1CW2A 1HTIA 3M0XA 1W1A1 3IVUA 1KM5A 4MM1A 1J0IA 4XSMA 4DYKA 3WNKA 2YCKX 3G0SA 4RXFA 4HPGA 3TXVA 3O1NA 1YDNA 4REQA 4Z1AA 2BXVA 2WNQA 1TPFA 3VD3A 3TTYA 1D9EA 3BGAA 3TK7A 4QE5A 4CCDA 4QISA 1LDCA 5BNKA 2QW5A 4F2UA 1H62A 3OLDA 4HA1A 2PWVA 3QY7A 1QJWA 4J2PA 1H7PA 5C70A 1U83A 4IHCA 4UTLA 5G2WA 4D2JA 4RLIA 1FCUA 3TQPA 1F8MA 1YTKA 3T9PA 3VGEA 4EF9A 3MMDA 5I3IA 1H2JA 5ECVA 1MEWA 1UP3A 1YNPA 3FA5A 3U2EA 1XIEA 1LLZA 3LU2A 1JD7A 3A9BA 4NJIA 6REQB 3GU1A 5TAOA 2WOQA 4EXAA 3TR2A 1HKWA 1TPEA 2D1ZA 2VRJA 4WSKA 4FX8A 2HBXA 6ENLA 1YNQA 4DZHA 4Z08A 5C55A 4KH2A 2GDQA 4PGLA 1W9DM 3FKKA 4WRHA 1C91A 3B4UA 3GO2A 1EJRC 1ODUA 5D33A 1X1OA 3SBFA 3N4FA 3AXIA 4ZENA 1E1CA 3HIJA 4TIMA 5A6JA 4DUWA 4JEQA 1CEOA 3C86A 4ZB2A 2RDXA 1WYIA 4OOZA 3C8NA 3P2VA 1TV5A 2E77A 3A64A 3SQSA 1WKFA 3BVJA 4W93A 3AZRA 3UZ5A 3T78A 4ZXOA 4EPBC 1OZQA 3L5AA 4YYFA 2QGYA 3P8IA 3D0CA 5CPLA 4GQ0A 3GRIA 2Q8XA 2GJNA 3P62A 5HMDA 1XCFA 1E56A 7ODCA 1RK5A 2HTMA 2PPGA 3GNPA 3WNPA 4UZSA 2VC6A 5AHEA 3CC1A 1KRAC 4M80A 3ONBA 2WWDA 1GVIA 3U7BA 3QYSA 4QSFA 3DGRA 4CNPA 1NF7A 2ZE3A 4ZO8A 3NOYA 2ZYFA 2O56A 3T0DA 2DORA 5DMNA 4RR4A 1AL8A 4PH6A 2BX7A 1CIUA 3SCQA 3UU0A 4JCMA 3ALGA 2C6QA 3LTSA 1JUBA 1LP6A 3WMLA 2Y88A 1A47A 2NX3A 3U5YA 3EWYA 3BUVA 3OVPA 4JIRA 2CESA 1UKOA 3VDBA 4O4WA 1K3UA 2YKKA 4Q8MA 3BLIA 5C9ZA 1ZL1A 3NTYA 1AODA 2HK0A 3URQA 1HO1A 1XYBA 3MV01 3SGZA 3NZGA 3H24A 3ZM8A 4U2YA 4V1XA 3FIGA 4LYPA 4RE3A 4Y9OA 2J24A 2QDHA 2WHKA 3VOIA 1ZQ5A 3CPUA 1F2JA 3I6RA 4M0XA 6CGTA 1UHVA 1X39A 3TZNA 5E6YA 2OQYA 1JFXA 2PGFA 2YGYA 4H2HA 2PWUA 2V2HA 3RLGA 3MUXA 4NRSA 1U22A 7TIMA 1ZBWA 1UKPA 1ADDA 5LNRA 1KBJA 1GWJA 3UCCA 4GC4A 1JF6A 3QZ6A 2BP1A 2V8ZA 4GIEA 5I3DA 3V4BA 3PBWA 1V6TA 4JTCA 3BQ5A 1REQB 2YZ5A 3VKAA 2BXYA 5AB3A 1MUMA 1VFTA 1RZMA 3GSMA 2FKPA 4HVXA 3H2EA 1XR2A 4YTUA 5KTLA 5A2CA 3EA3A 1P6CA 3WBAA 1EXPA 2X1RA 3VOJA 3AOFA 5A94A 4Q4KA 1EJUC 5A8QA 2OLSA 3MHFA 1MUWA 4UOJA 2B7OA 1MWOA 3UW6A 1EP3A 2E6AA 3KZSA 3R13A 1DJNA 3L4ZA 3AJXA 5PTDA 4GABA 5D8ZA 4H01A 1IIGA 3KDOA 3N11A 1J9YA 5C8BB 1YEYA 4IPIA 3UPMA 4DY1A 3CAVA 2OLHA 2HNHA 3B8VA 2I14A 4CGTA 1XG3A 3ZJ8A 2P53A 3KHJA 1LLWA 2WMIB 3GTIA 1QFEA 4QE4A 1WZKA 4QS6A 2BOGX 2RDUA 4Z2GA 4O52A 2GK1A 1XKJA 2A3CA 3QPZA 2ZX7A 4PODA 3A23A 2AL2A 1QTWA 3EKLA 3WY1A 4B91A 3RXZA 3SQMA 3WQPA 4CQDA 1E9YB 1F3TA 4IIHA 2C8NA 4QQUA 4WEVX 3I10A 4C1NA 5AFDA 2UY5A 3BGGA 1Q4NX 2X7VA 2WLZA 3GU2A 4LAMA 2B7QA 3IK4A 3T1GA 1UD8A 3TIMA 3S1XA 1TTQA 1DV7A 4IL0A 3BJFA 3S5OA 2POZA 2VQTA 4D6FA 1AH4A 1W2PA 1QOXA 2XJ7A 4L9ZA 3OBEA 3EWUA 4ZQOA 3SUSA 1SW7A 3WKZA 1JZ3A 1QBBA 2QEZA 2RHGA 5A6BD 4KT2A 2G3NA 2BVTA 3KZPA 4AF0A 2DEPA 1UR4A 1GT8A 4PCNA 2JKPA 2WAGA 4PUKA 1O66A 3QZAA 2PDKA 5L6UA 3W7MA 4Q3MA 4B5NA 5D2VA 2WVUA 2HMCA 4PMDA 3GYCA 4CQAA 4B15A 3EOUA 3W02A 3W7RA 5E70A 3APTA 2XFWA 3N2BA 1TV8A 4XTDA 1XLGA 4J27A 3R0KA 1P6BA 2D20A 1CZ1A 3BL3A 4S23A 3TSBA 4N02A 7REQB 2VM8A 4C7GA 4NHVA 1EGMA 5A1AA 1QK2A 3E9AA 1IEIA 1UW9A 2EPNA 2VDGA 3FDKA 1OY0A 2DIKA 4M29A 1EOKA 3PBVA 2X0SA 4O18A 2G41A 1UR9A 2VGGA 2OWWA 4WX2A 3DG3A 1ZBVA 3VKBA 1BLIA 2BVYA 3N9KA 5D9OA 3VNLA 1UIOA 3KRZA 4A3UA 4FXJA 1ZS2A 4MWAE 2VC7A 4B3KA 3TP4A 2XFYA 2J75A 3AIWA 3LMYA 1OZMA 4L1GA 1Q3NA 3W4RA 4A3YA 4X63A 1TJ1A 4C7DA 2Z6JA 5AYBA 3CLWA 5KMYA 1VRXA 1FQ0A 3GNNA 2WM0A 1BYDA 2YFNA 4DVOA 5D38A 3TTEA 4A8RA 4B3ZA 3N18A 1QPRA 3H7VA 3EX3A 1L0PA 5AYZA 4ORMA 3PAJA 3T2PA 1E0WA 2AQVA 3GTNA 4WGXA 3T81A 1GHRA 2EO7A 3E96A 3RK8A 3R7MA 3LGEA 3KCOA 3UEQA 1BHGA 2VX5A 1W54A 4W86A 4YVPA 1OD0A 5DN1A 4GH3A 4NZ1A 2XGIA 1TREA 3T8LA 3EX2A 4ZO6A 3HF3A 3WMCA 3AO0A 4PMRA 4S1FA 4AEFA 5LIYX 1KCZA 4D6GA 3CHCA 2VFFA 4LBSA 3AMKA 3VIGA 2AAAA 1WKDA 5FJOA 1IXPA 2A3EA 5CC5A 1AZ2A 1UROA 2CLLA 1ECQA 5H1WA 4TVUA 1OYAA 1T40A 1DWJM 2J62A 4FLRA 4ICCX 3QHOA 3TQVA 3NPVA 1Q8AA 2HJPA 3RF9A 5MKGB 1GQLA 2GLKA 3V0TA 1JGIA 2ALRA 1MXDA 3N14A 2V68A 1AW5A 1CX9A 2OELA 1U1JA 4FXSA 5CZKA 1XLHA 3CQHA 2WMFA 1KR0A 1XIMA 3QPEA 1FWAC 4JTSA 2PE4A 4DJEA 3ARYA 4GYKA 1UD2A 1R85A 4PUWA 4MKNA 3LLFA 4WF7A 2BFGA 2C79A 3ITOA 1W3JA 4YHEA 1AMKA 2PRMA 4MWAD 3A21A 1C7TA 2QCCA 1K02A 3S2LA 4XSLA 2XFRA 1LUCA 4AZCB 1LRQA 3WF3A 3BG5A 1CB7B 4H6EA 5FJJA 4IX2A 3AYSA 2XZ7A 4K6AA 4UUIA 3MUY1 3M0ZA 3PZUA 4FNQA 2O9PA 5HNUA 2QULA 3MZNA 4DO6A 1TX0A 3CAQA 4H6RA 3LM7A 2PSNA 2G3IA 3V3WA 2X42A 4B5XA 2QCMA 4HKPA 2OR2A 3VIJA 1FDZA 4WK9A 1RCOB 2OVLA 2V0TA 5D09A 3IJLA 3DI0A 1L6GA 4IISA 4LWWA 2CLPA 2J9ZA 4C90A 1E4IA 3TYEA 3T0AA 1LWHA 5FOOA 1MEIA 3RR4A 4HZ7A 1PL9A 1T6MA 3WMSA 2X2YA 2ZZ5A 3MI3A 4FIQA 1B9BA 4WY0F 5D02A 4GRSA 4NAEB 4OOUA 1PYFA 3SADA 2I1OA 2VEPA 1PEZA 3EPOA 1EHNA 1NWRA 4XO6A 3WBXA 4P2VA 5A5WA 5HWNA 3DG7A 3OHMB 3S6DA 4GUIA 4F8XA 2QPSA 4W8AA 4MUZA 5FL0A 3L2LA 5BXSA 1F6PA 3LGDA 2NVAA 2OZ3A 1H1NA 1KWGA 4Q6XA 2WMIA 1UUQA 3PULA 3MA8A 2Y5SA 4NYUA 2TODA 1XLJA 5EMJA 5TD4A 3SCVA 3W7HA 2GJRA 1VLWA 3BH4A 1ICSA 3AHYA 4AD5A 1C92A 1OVDA 1G9HA 1N7KA 1H09A 4OUIA 5JUVA 4KGJA 2PBGA 1ISWA 4ZVJA 4CNOA 3TYUA 3H26A 1E9IA 2YA0A 4DM1A 2E9LA 2A5HA 3HJEA 1FHUA 4YHGA 5GQBA 2OXNA 4HMCA 1IF2A 1EZWA 1TMLA 1O6IA 1KV8A 3W74A 5I3GA 4ZA0A 2PTZA 2G0WA 1TJ0A 3Q2DA 4UOQA 2SFPA 4W5UA 3STCA 1AZ1A 2Y24A 3SCPA 3W1TA 4QJ4B 2D2JA 1VFUA 3WQ6A 4MJ4A 4WKFA 4ZFCA 1IR2A 3EDDA 1W3NA 2V3GA 3QBUA 4HNUA 1S2CA 2ATMA 1NSJA 1YXDA 4ADSA 1KV5A 1KGUA 1KKOA 3GK0A 3R10A 1TVNA 5DFAA 4G8TA 1XRFA 2DVUA 3M0LA 4OTKA 2WMJA 3VCNA 3CPGA 7REQA 1CECA 3PB0A 2XIOA 3CS2A 2BOFX 1VLIA 1IEWA 5BOOA 4F66A 2R24A 5A8GA 1X98A 4H6KA 1HNYA 3GG1A 3VZXA 2EPKX 2PDYA 3BAWA 5H8PA 4ACZA 3D3FA 1XSKA 4YCOA 3NIYA 1JIBA 1E6QM 4NZ3A 3W7PA 3O3RA 3IEBA 1B4KA 2QUVA 4TOQA 4IGHA 2FZ8A 2EXOA 1DVJA 3CBWA 3W7EA 3BLDA 3VIFA 1K9EA 3VNYA 1ZBKA 5CG7A 2J13A 2DZXA 1I4NA 2QNEA 3OW1A 4HQVA 3N13A 4CNUA 1W9XA 3BW3A 5T9BG 4FNUA 4KCTA 4GZIA 3FXGA 1L9WA 2VGBA 1AQ0A 1B4EA 3INPA 2XWEA 3VD4A 1DQUA 4UQ9A 3IIOA 2PZNA 4HPXA 5CC7A 1DWIM 5K4XA 3S9ZA 3AU2A 3NL6A 2PAJA 3Q4DA 3THUA 4K7VA 5HWMA 1SUXA 1SW0A 1DWAM 2XTKA 1VF8A 4QG8A 1WBHA 2BWGA 2VZOA 5KZ6A 1JCXA 5FA5A 3UG5A 2PDHA 4V27A 5HXMA 4ZQMA 2V3DA 1RVKA 3OB8A 4XVEA 5HJXA 4LPCA 2YW4A 2QIIA 4NSBA 4X9SA 3HGSA 1IE7C 2ZOXA 4Z2HA 4B90A 3BAIA 3VC5A 1H3GA 4WSHA 1VIWA 2Y6ZA 3PC0A 4JYFA 3QF0A 1DL3A 2O9TA 3UWEA 3LD5A 2CU0A 4DWDA 1H60A 3VU2A 2E1WA 4M82A 4OFCA 4O1AA 4BWLA 4HZMA 1GOKA 3UWYA 1YE4A 2P0OA 2Y8VA 3A9IA 1W6TA 5MKGA 3DFYA 3CQIA 1GK8A 5BZAA 4WJ8A 1I9CB 3CZ8A 4AMAA 2HS8A 3BOFA 1MQQA 1RSCA 5U7SA 4JTTA 1ITUA 3TC7A 3IV8A 2GFTA 4KETA 5I02A 5I09A 1NWTA 4F0HA 1RJPA 5FI8A 5I3HA 3B8DA 2I57A 1LL4A 2HE8A 4HA0A 4PEEA 4Y2WA 1EH9A 3SCWA 3DHFA 1ZUAX 1TIMA 1J5TA 1JF5A 4BQ2A 2VX6A 2QDEA 5DMYA 3WD1A 5CJMA 4AZBA 1BYCA 1Y5WA 4KERA 1RALA 4AZCA 3BSMA 1W8GA 2Z27A 2BS9A 1ZSXA 3PR2A 2CLKA 3CK5A 3W24A 3CUGA 1QW7A 3HQNA 3EDJA 4ZE5A 3SQLA 2Z25A 4JX4A 2V38A 3W2UA 3QM3A 1G6CA 4J2MA 1TPH1 3E0VA 3PJUA 4CU7A 4NZCA 3GH5A 5KZEA 2OG9A 1F4AA 5I0DA 1N8WA 2CHRA 4LF1A 2R1PA 2GVEA 3NCOA 3PZIA 4GFSA 3L21A 1MW3A 2YL5A 2GGJA 4K1GA 2Q02A 2HE5A 1OINA 4AXNA 5M03A 4N2YA 4HJFA 1EC7A 3WEOA 3E0WA 4LB4A 1J79A 5DANA 4ATWA 3K4DA 4HMDA 4HSHA 2J8FA 3BE7A 5L9FA 5CLTA 3COTA 4QNEA 4JL1A 4HB7A 1GQKA 2VZSA 1V8EA 1Y5VA 2DVTA 3CZGA 3AS2A 3CL6A 2PD9A 4GQQA 1A0DA 2XN2A 3D47A 4RKAA 2BBFA 1RH9A 5JBFA 5C5YA 5HNNA 3TONA 5CPTA 1LL7A 5TIMA 4Q22A 1ITXA 1W9BM 4FAMA 3VPLA 3OJGA 1UYQA 2ZXDA 1KFWA 1X7FA 3T2QA 2BMBA 1GPFA 1T5AA 4RZBA 1QPNA 2NQJA 4QNWA 3C2VA 1VBHA 3CV1A 2EGZA 2EG8A 4IJRA 3TH6A 1VCVA 3LSCA 3MMUA 1WUFA 5D37A 4IIBA 1OX5A 2EPMX 3C5QA 1WCGA 1V6WA 3IIXA 3WEZA 1G94A 3MO4A 2QS8A 3W70A 1MSSA 1PIIA 4O1FA 3ALFA 4AW7A 3NM1A 3ZLFA 5E6ZA 4TMCA 2QCHA 3G6LA 4LS2A 2F8QA 2X2GA 4DJDC 1UQYA 4WY0A 3O2LA 1PZ0A 1H7OA 5A6KA 4GG9A 4MJ2A 3DC8A 4HK7A 4F9DA 4UFJA 4IIEA 1L8PA 3CH0A 3TU9A 3IJ9A 1XH1A 1A4LA 1T0OA 1M5WA 3TTOA 2ZWYA 3QQWA 2G5WA 3QPYA 2W3ZA 3UF9A 4JS3A 1E5JA 5HMEA 4PSRA 3S1GA 1BG4A 2O9RA 3USBA 3K5XA 1XL9A 4Y7EA 4HNOA 1G67A 1R7AA 2D24A 2DZBA 4YYCA 1EC9A 1ZJBA 2QAPA 1CGWA 1YMYA 4AD1A 3GG7A 4N42A 1V6XA 4GKTA 1JQVA 1Y8BA 3RAOA 4IL2A 4Q4MA 3V7PA 2BB0A 5LHEA 3LHWA 3BAJA 2WB5A 2ACSA 4IGNA 1UP2A 3BANA 1SSDA 2NSXA 1J12A 4R3UA 2P1FA 4S2CA 2F6UA 3PAOA 3CT2A 2W62A 2HDJA 3AIRA 4C65A 4XD6A 4XD3A 2E7FA 2J7EA 1NFPA 4ZZ9A 1TE6A 2NQZA 5HQEA 4H3DA 3HFTA 1JAKA 1Q2SA 1OJXA 3QR3A 4U4MA 4GHRA 4J3ZA 2JGQA 4ML9A 5I7GA 2DV0A 3LV5A 4DBSA 2ISDA 5T8GA 3BLLA 4NL1A 4EK7A 3STFA 1YBQB 3QYQA 2PLJA 5KITA 2RDWA 4DQWA 2PDFA 3GIPA 4D8LA 3W7DA 3W85A 1PV8A 3GXFA 3WQDA 4JIHA 5A2AA 4HNCA 3P61A 1FTXA 2V30A 4IT1A 1O5KA 3G3MA 3HPSA 3NZRA 4YTRA 4R85A 4NG3A 1VIZA 1OQFA 2EPHA 3PHAA 4M7SA 1R3TA 2TSYA 1Y7VA 1P0NA 3H22A 4MNLA 4ICNA 1FWTA 4UQAA 4JHZA 3S5NA 3SUVA 4DJED 2NWSA 4NILA 3U2ZA 3U48A 4S3KA 1YDOA 1G01A 2GPTA 3MV11 3A3XA 4MIMA 2OZ8A 3K4WA 1CLKA 1QRQA 3G1RA 1M6JA 2A3LA 3OIXA 8XIAA 3GXMA 4DX3A 3EZ4A 4D6EA 2YL6A 2PDWA 5HNRA 4POCA 4MY8A 3HURA 3VKJA 1DTUA 4Q6JA 4AZIA 1KTNA 4MZYA 1W1YA 2PBOA 4TX8A 1ITCA 4INFA 4W89A 4PUJA 4LVFA 4IFKA 3HPAA 2PP3A 3FEQA 2UV8G 1EJXC 2BG5A 3LHYA 3CV2A 3QVQA 4GJ1A 1GCYA 5CEWA 3SFWA 1HZYA 1E4NA 3KVMA 4KRZA 4NT0A 4H7CA 1Z8AA 2XM2A 4Z1BA 1YYAA 5BOEA 3SM0A 1FWHC 4GYPC 4ORIA 2DJLA 3QMTA 3G6MA 1NDVA 4EPEC 2ZCGA 1SR9A 1X1ZA 4LAOA 1WKEA 3N9SA 4MKSA 3W7JA 5AYXA 1K7XA 3PPCA 3V5CA 1YXCA 5JQ9A 3F4CA 1TA3B 3Q45A 3EWBX 2PF0A 4K2SA 1KCXA 2NXGA 1KW1A 3H7UA 3GZ3A 1PXGA 3NDOA 2J79A 1C93A 4WJEA 5C2XA 5CSUA 5M5DA 4BY3A 2VWSA 3NL2A 1RV8A 1XUUA 1AL7A 1XGDA 1KFBA 1CGTA 2QAFA 3THDA 2YW3A 4X60A 3L0GA 3VILA 3M4HA 2BY2A 3QW4B 3Q94A 3VYLA 1C9WA 3UETA 2XVGA 3KBJA 5A6SA 4DF1A 1S39A 1XIDA 4GBDA 3EWWA 3ITGA 3WELA 3WD3A 4QQ3A 3I3DA 3MKVA 1K03A 3HPZA 4X9YA 1HP5A 4U3CA 1UMLA 1K70A 3MDWA 4E4FA 4Q7NA 5HUPA 5LIUX 3G22A 3W7OA 4L9XA 3WK2A 4XTIA 3OLGA 5B7YA 4BF5A 1W1IE 1IV8A 3AYRA 4I9MA 5JMUA 5K3VA 3VGFA 5DQPA 2W66A 3AHZA 3PTQA 1JG9A 1XX1A 3QW3A 3WLMA 4LUTA 5TBOA 3H2CA 4AH7A 3KP0A 2IUZA 4W85A 1KA9F 1ALDA 1H1ZA 1DJYA 4UMAA 2CBVA 3B8WA 4HTBA 3OP2A 4JTIA 1VYRA 3FGCB 4LNYA 1P4CA 2Z7GA 4FEZA 1K6WA 4AEEA 1DJXA 4RDZA 2OLAA 5C2GA 1ISYA 1GVOA 3ZZ1A 4LY4A 1I0DA 4MZ1A 1VBJA 2J4GA 1MFUA 3P6LA 3R8RA 2BZNA 3SGGA 1XLLA 1XP3A 2OGJA 2OO0A 2G3JA 1KM6A 1F61A 4DLMA 2R8WA 4MOZA 5FSDC 5EMLA 2BHZA 1UBPC 3MQTA 3R89A 3L5MA 4IJCA 5CC6A 5JVLA 2E3ZA 1JYNA 1CXFA 2PS2A 1GG0A 1XLCA 2YZRA 3L68A 3CEPA 3I65A 5A6MA 5CGMA 2D0HA 2HVOA 3TOPA 2PD5A 3REQB 1JI2A 1G4PA 1OGSA 4JY9A 4ZEPA 1OIFA 4TU1A 1XRVA 3QFWA 4PRWA 3GY1A 3DG6A 9XIAA 2FZBA 4HD5A 3WO8A 3TCEA 3N6QA 4A4AA 2TPSA 3Q37A 5T9CE 2OT0A 3EB2A 3KAOA 3RM8A 3KRUA 3QSRA 3MVTA 3N1AA 4ALDA 3TYZA 3ARRA 3ZJKA 4FLOA 3LLDA 4U10A 1YHTA 1JXKA 5HOSA 3B9AA 4E5TA 2ZX8A 5EMKA 3T0BA 3UVIA 2V3EA 2E6FA 2ZIDA 1R6WA 5LXXA 5CGTA 3WNNA 1DKWA 4UTIA 2INEA 3PK7A 1TE1A 1D3GA 1V7AA 1FFQA 5GNZA 3NA8A 5AN7A 3M1ZA 3LEPA 1J0KA 1A5AA 3ITCA 5EB8A 3RPMA 1GKQA 2TRSA 2OX1A 2FHCA 3TNBA 4UFKA 1KQZA 3B9EA 1HJQA 3WLJA 3TN6A 3TDFA 5ECUA 3LPFA 3VD9A 3HJZA 2A85A 4IPJA 3N29A 1ZY9A 1IWBA 1MEHA 4KEVA 4C6KA 2OYLA 4C1LA 4RV3A 4FO4A 1YBQA 5F4XA 5FAJA 3GDLA 4NXKA 1IEQA 1XYCA 3N12A 3IUIA 4K8GA 4IQDA 3MB9A 1NJJA 2X41A 1OCJA 3T07A 1CTNA 1BQGA 4O11A 1FBAA 1XC4A 2OSWA 4O8AA 2C71A 1XLMA 2BOEX 1WE5A 2Y5JA 2ABBA 4QAWA 1D8CA 7A3HA 1QNPA 2IKHA 3AZTA 3YPIA 1XXXA 4EAYA 2YSWA 4C6QA 4ZQCA 2I5QA 3ID7A 3PBGA 1XH2A 3I3EA 2PC4A 1OC6A 5DO8A 4QEEA 1GYNA 3AYTA 4X0NA 4JQ2A 1Q13A 3M5VA 3BMVA 3ZVIA 3AIEA 1JULA 2I16A 5AHMA 3W1MA 2YYTA 3BW2A 1LOLA 5G4HC 4DAIA 2ZRZA 3L12A 2Y5EA 3D46A 4QLKA 2V2CA 2PCEA 1LG2A 4HPJA 4QX4A 1H51A 4C6JA 5HNTA 2DSVA 1QBAA 4Q4PA 1IYXA 1JZ4A 1PBGA 1TJ2A 1BXBA 1C7SA 4UXDA 1XDMA 1FWEC 3W6YA 4FZIA 3WJSA 4RCXA 3LHUA 3N2OA 5BROA 1JNEA 3A4XA 2XSBA 1H4PA 4Q33A 1TWZA 4I9JA 3WLKX 2NX1A 8XIMA 2EHHA 4GC3A 2OT1A 2QIWA 3HG5A 1V0MA 3U0HA 1BTCA 4YJ5A 4YCPA 4LAZA 1TWDA 3R94A 4HN4A 2R6OA 3SURA 2FB2A 2QXWA 2J7FA 2YXOA 4D8ZA 2WQDA 2RH9A 3FY1A 2FH8A 1UQZA 2DIEA 4AYGA 1MNZA 4ERIA 1HVQA 2XGBA 3H21A 1O5RA 1K8XA 5DXXA 3EWDA 4CQ8A 4O12A 3ISIX 1W1TA 4FR1A 3CNYA 4K68A 1AH3A 5GNXA 3RX4A 1BQCA 2ZVRA 4XBKA 1G1YA 2DU2A 5A2BA 5FEPA 2NV1A 1Q5MA 5I23A 3WSUA 3M46A 3PG8A 2R1NA 4CNTA 1BG9A 1FCVA 2DFAA 2NV9A 3FJLA 1AUSL 3P84A 3M6DA 1JPMA 3H12A 1K4HA 3TXZA 4CN6A 2WJFA 1QNSA 3HGRA 3I4EA 3W71A 4RUBA 3LQLA 4F48A 4DELA 1J0JA 3ZSSA 1D2KA 2E68A 2FTYA 2VR4A 4QCEA 3V1PA 1YDVA 3M0YA 1TMHA 3AIVA 4MAZA 1I1XA 3PP7A 5HINA 4FNRA 4HMEA 3P0WA 3VDAA 2VDIA 1KM3A 1GTEA 2GWGA 2ABAA 4LJ3A 4DO4A 4GJIA 5GPRA 4GZ7A 4HU8A 4E3VA 1RAKA 3TNOA 3ZSTA 1PKNA 2H3BA 2VFEA 3SRHA 3VNZA 4RJEA 4IXHA 1EQPA 3GUWA 1GKPA 5KETA 5MF5A 4XAFA 4HJWA 1GEQA 2RKXA 1KNWA 3POHA 2JQXA 2REQA 4H2CA 1UR1A 3S9YA 2GQ8A 5D2TA 3LG3A 4H83A 2R94A 3FGCA 3WLOA 1A0CA 1O95A 3HB9A 5E1QA 4A2SA 4A2RA 1EIXA 2WVTA 3TMQA 4KIRA 4AEOA 1E4MM 2OWXA 2E5CA 2FFIA 2ZE0A 3U4FA 3BWWA 3VDGA 3ITXA 1QPQA 4PB3A 2CZ5A 5AHFA 4I3GA 3G1AA 4XD5A 1MO0A 4FR6A 1RP9A 1IXOA 1G0CA 1RPXA 2CITA 1B3ZA 1J8VA 4O8RA 3VX0A 1GNXA 1O60A 1HO4A 2Y7FA 1Q4WA 3DN5A 5C9WA 2VMFA 1LWIA 3ZYZA 4M81A 3UFYA 4TV5A 3PANA 3DKJA 4A6GA 1RY8A 1CI1A 1CLXA 1V0NA 4IGSA 3TFCA 1BGAA 3QSTA 1EPVA 4N9BA 1DJGA 2ASHA 4EPDC 9RUBA 4M6PA 3AWOA 2XISA 2WJZA 1VHNA 3GX9A 1E6RA 3ABOA 4QRNA 2ISVA 3MI2A 3IAQA 1I0BA 4LX4A 3W76A 3AIUA 5FF4A 1JFHA 2Z6IA 1MNSA 5JH1A 2ZZ4A 1FWCC 3EGJA 1QI4A 1L2QA 4JTKA 1PX8A 3SCOA 1O4UA 4QLJA 4W4QA 2QDDA 3ZMRA 4LVAA 4CEXC 4IICA 7XIMA 3MBDA 3BMXA 4H9ZA 2HK1A 5DMMA 3VNJA 1PDZA 2KX9A 5H2ZA 1B3WA 4GXPA 1E0XA 4PYSA 2PGEA 4NIRA 4R7WA 2IPJA 3W1LA 3ES8A 4UQCA 4DPQA 2C7FA 1XIIA 3APGA 4HYWA 4MNKA 4QP0A 2ZUWA 3LHTA 4AIOA 1FRBA 3AC0A 4UFIA 4A3RA 3MSDA 1XG4A 1B9ZA 3UYIA 5BXRA 3PY2A 3OA3A 3KM8A 3IGUA 3W1XA 1VCGA 4M1BA 2A79A 2E9MA 3WQ5A 2PDQA 1N2VA 2A0NA 3W37A 3ZVHB 2CNCA 3DFSA 4QCFA 1X8CA 3PF3A 4D71A 1LT8A 5C0QA 3QGKC 2YCJA 1GG1A 1TB3A 3S0CA 3W2JA 4DF2A 4FK9A 5CBIA 2WNWA 1WDSA 2YDSA 4DUOA 2G8ZA 4QAIA 1H11A 2G4FA 2ISFA 3ARXA 3UWQA 4D6HA 1KM2A 1T99A 2JE8A 2VFIA 1WDWA 1U5VA 2ZWZA 4HHLA 4KCUA 4IMAA 1QATA 3GZAA 3GXNA 4TX9A 2J6XA 3TC3A 4C7FA 1EPXA 2Z1XA 1KGXA 4ZBCA 2HPMA 2Z1VA 2J6VA 1H5VA 2GQAA 3PUOA 4Q8NA 2ZA2A 5EBUA 1JPHA 1RBLA 2CLIA 1CB2A 4YN5A 3M5XA 1VBGA 1XIBA 1Q6LA 1YDYA 4L4PA 4JIIX 4C6MA 4O17A 5D8WA 1M04A 3KLLA 4BF9A 5HA7A 1Z42A 4GKLA 3PPFA 4PEKA 4CCEA 2EPLX 5FJPA 4MYAA 3W84A 1DJQA 2CIPA 4PTMA 1P48A 3DBNA 3LUTA 4HNTA 4W7UA 5F2GA 4L6DA 5KZMA 4O16A 5E9XA 3AMGA 4HTYA 3E12A 3VCRA 3GDRA 1UD5A 1S5WA 3ELFA 3GNDA 2AQWA 1UBSA 5LXEA 1KFCA 2PTDA 4CD6A 4OU1A 1QAPA 3R4IA 3H54A 4L9YA 5AHLA 3GHRA 5LGXA 2CEQA 4JN8A 4RW3A 1EJTC 4Z0SA 1HIZA 1ZP4A 5C71A 3S42A 3SEPA 3UJRA 2A1YA 4N0RA 2I17A 1RD6A 1I1WA 4TV6A 1PZ3A 1KD0A 3NQ2A 4GUJA 3R43A 1Q6QA 4XB3A 4Y6GA 4RZ6A 4FOJA 4M1RA 1W3HA 1W3KA 4AY8A 4UR9A 4H41A 4U5KA 1OADA 5LA1A 1EYEA 1KXTA 3RN6A 1V79A 3CIWA 4KWUA 5XIAA 3LHVA 2VCCA 4FMVA 2CWNA 2Q6ZA 4CU8A 2Z7KA 3H70A 4MWAB 1BF2A 1ONRA 1LBLA 1VFHA 3LCIA 1W3LA 4ATDA 4EF8A 1LQAA 4GMEA 2O9OA 1XKYA 3CASA 3OIHA 1W8SA 4BS0A 3G0UA 3G18A 4UQBA 4MFDA 1ZU8A 1M03A 2ZZ6A 2HISA 4KBXA 1HX0A 1PCKA 2ZADA 5CAKA 2GSEA 4IQEA 3ERPA 3W7LA 3PZVA 3ITVA 4ROPA 2WM1A 2CW6A 3WFZA 2GL5A 1XIFA 4BQ5A 3P7YA 3K4AA 4O57A 3FYOA 4J40A 2XIJA 4US5A 3W6LA 2VEFA 2ICSA 1A4MA 4AU0A 4E4PA 3W81A 2WSYA 1K7EA 1BWLA 2RDTA 3F7JA 1EO7A 3FK4A 3M47A 4GACA 1GOQA 3W86A 4Q8PA 4H9TA 2PLCA 3WQ4A 1CYGA 3O6AA 1SJAA 1KC7A 2Z1BA 3F5KA 4XUGA 1JRBA 5KINA 4NU7A 4O10A 1BFNA 1XLEA 1UH2A 4JQAA 3JVAA 3WNLA 3VOFA 2J77A 3WD0A 1F5ZA 2WSQA 3CB8A 2Y61A 1GYLA 4U31A 3A5FA 1A3XA 3RHGA 3BLPX 5E0FA 1VB9A 4Z0JA 2I9EA 4QEHA 1K9FA 5FJIA 2VUYA 5DY3A 3NAVA 2QJJA 1E6PA 3DENA 1R3VA 1X96A 2QVNA 2JALA 2WKJA 1TZ9A 3WF2A 1DQXA 2YFOA 4JCLA 1J4EA 2VURA 3L4TA 2XYLA 1YTEA 3RO8A 2CPUA 3AQUA 1SZEA 3S5ZA 5C9UA 3PNUA 3P60A 1GHSA 3B0XA 5G2HA 3L0NA 7PTDA 3L2IA 3RLUA 1JZ6A 5EFFA 2IQTA 2VR5A 3Q65A 4IZGA 3AZSA 1PTAA 1XYZA 1JCMP 4WZHA 1M01A 3QEZA 1GW9A 3OU8A 5GJMA 3AS3A 4PFHA 1JDAA 2Y62A 3RILA 4LOCA 1TQJA 4IM4A 4UNIA 2W79A 4LXFA 3DESA 4MB3A 3N2XA 3H2MA 4NX5A 1MUCA 4DB7A 2FDSA 3UCDA 1IZKA 3MUIA 4ADUA 5I00A 3AU6A 2QJMA 2G95A 2CHOA 4WHBA 4PTVA 1V0KA 2Y85A 4C6EA 2CZDA 4QDMA 1VEMA 5I3KA 3TJXA 3F2DA 3ZVHA 1SO4A 3EYPA 2J47A 1KTCA 3LMZA 4C6BA 5HPCA 5K9DA 2DZTA 2C3ZA 5AYIA 4CQ9A 3LPPA 3LCWA 3S2NA 1SSGA 3SRKA 4GQBA 1UUMA 4F2TA 3GVQA 4NJGA 4F9JA 2YCLB 4UFMA 3JUGA 4GISA 3KFTA 4J5NA 2W0UA 2PP0A 2PCQA 3R2GA 3UT0A 1YXYA 2J74A 1OIMA 4UTMA 1QW8A 1TR9A 4WSJA 5I6SA 3PBUA 2OKOA 3R12A 1F05A 3LPGA 5D2YA 1XBZA 1EDGA 1J93A 4XZLX 1VR6A 2XDFA 3I68A 4AHOA 3TJLA 3SCTA 4PCFA 1YADA 2UWFA 2EAWA 2FGZA 4MY1A 4E2DA 3UXDA 5CBJA 5CG0A 3L9CA 2B4GA 4HOWA 4W8BA 1R3YA 3K8KA 4WQ6A 5DMLA 4WIWA 4ZSUA 4AX7A 1US0A 3KCLA 2JK2A 2G96A 2XSAA 4PCTA 1CXIA 3OA5A 4RE4A 1Q6GA 4YL2A 3PSWA 1LRTA 5LKYA 3M0JA 2CXGA 4UNLA 1DORA 1GJWA 3GW3A 4QS5A 3SR7A 1FH8A 2F7FA 1LL6A 3KUMA 2J7DA 3V1HA 3GIQA 2Q09A 3T42A 3UXIA 1R3WA 1WDRA 5T26A 1TUXA 4PMUA 2VELA 1JUEA 4I8YA 3E0LA 4PMZA 2C91A 4Z2KA 1F3WA 2E28A 1XSIA 3UP8A 2DGAA 2ZTJA 3BTNA 1IWPA 2YBTA 2LLEA 4R9XA 1QI3A 3W00A 4UOZA 5HULA 3B4YA 4LBRA 1PO9A 3UYCA 2RJHA 3N15A 2RJGA 1WO2A 3UR5A 3AIQA 1ISVA 3T05A 6XIMA 1GVQA 1FWFC 2DPEA 3N9RA 4AIBA 3E38A 1JUKA 4YTTA 4L64A 1DBTA 5EBAA 4K8EA 4GQRA 4N7QA 1HQTA 4YXGA 3RG6A 2VX4A 4H9XA 4JNZA 4EXBA 2HROA 3RRXA 3R0UA 1Z9AA 1EUNA 3L4UA 4FI4A 1V3MA 4LV4A 5D03A 5EPDA 4KFNA 5LNVA 1G69A 2BHUA 2YLAA 2PDGA 4FNTA 3HN3A 1SQ7A 1NELA 5G4EA 1UMYA 4UNKA 1ZNNA 3PZ9A 3B9NA 1ICQA 4M56A 4YS1A 3EOOA 1ML1A 5AECA 2GGGA 3KE0A 3KVKA 1GOXA 2WC3A 3VA8A 3PUEA 1G4SA 2DUAA 1Q45A 4GNJA 2FZNA 5IXEA 2G50A 4I7UA 3VZYA 2AKMA 3EOLA 3G1YA 5CPSA 3SY1A 3UY8A 1FHLA 2Z29A 3WUGA 1EBHA 1EXBA 1S2WA 4ASTA 2AL2B 5D9MA 3C3NA 4KS0A 2ZRWA 3I7SA 3BICA 3LZ3A 3M5ZA 3KVJA 1GOMA 1KXHA 2XU2A 4ROQA 4GUFA 3IJDA 2IQDA 3WD2A 5F7UA 3H6OA 5CZ0A 4C1NB 1I2NA 3DHUA 4E8CA 1QOQA 4LAUA 4AVOA 4JQ3A 4LALA 3HQPA 3TN4A 1HL8A 1ZPTA 2DZAA 1RP8A 1WDPA 3B3DA 2WZTA 3UNTA 2VR2A 4IIDA 4M6UA 4Y9NA 3GTHA 4BA0A 1V0LA 4Q8VA 1YRRA 1TWWA 2I56A 4I9TA 3VMNA 4NZ5A 1AD4A 3NSMA 1RA5A 1NDYA 1FDJA 4Y9MA 1W31A 2F9RA 4C5YA 1DWFM 3E0IA 5FJRA 1PVNA 2PZ0A 4DWSC 2L5HA 1R3QA 1O94A 2V6AA 2WVVA 1MRQA 3U3HA 3EX1A 3BZGA 3U57A 2DZSA 2WHJA 4AZ6A 2J27A 3C0LA 4QM1A 3W23A 1MDRA 1OWQA 1OYBA 2PA6A 3SCUA 4BZYA 4TR9A 4W7VA 1GYMA 1XLDA 1AD1A 4B4HA 4DXXA 4MTVA 1MZHA 3OPSA 5BMXA 1QDSA 1JZ8A 3WK1A 3WDPP 1U33A 1ME8A 1S5VA 1DHPA 1D3HA 3G24A 2GVLA 2ONEA 1TYGA 5BW6A 4V33A 4LCQA 4NY2A 4HA4A 2IKJA 3WQ8A 3E5PA 5IFTA 3ANUA 3HPFA 4LTSA 1Y0EA 2JKEA 3NOEA 3S5SA 2P8BA 5C6MA 4C6LA 3G1SA 3L7RA 4JTRA 4WJXA 2HV5A 3RNDA 1HJXA 3FXYA 3IRDA 3ZJ7A 5AYYA 1IT0A 1OGGA 4ES4A 4ONVA 5FEXA 3VUSA 4FLQA 2HNEA 3IVSA 1W5QA 4QDPA 1W91A 5AZ1A 3WUBA 2FZ9A 2VWTA 2D73A 4JZ5A 3VDCA 3W07A 3GVVA 1OEPA 4H8NA 4UTJA 3PWGA 4JNMA 3TZFA 4MB1A 1POKA 1KKRA 4JR5A 1GVFA 3CQJA 3LENA 4P7OA 3NQGA 1GJUA 3WF4A 5BRBA 3WDHA 1Z32X 2CYGA 3WK3A 1RA0A 1LZOA 3N4AA 2PLKA 8RUCA 3SSZA 4Z2IA 1JDDA 2OZ0A 1OBAA 2YCLA 1HL9A 1DIKA 4WVXA 4B16A 1VGAA 1K6AA 4J3TA 4AIUA 4AWUA 3HBLA 2PRLA 3CHDA 2QT3A 3BAXA 3SW6A 3G8EA 3KWXA 3I3BA 1CBGA 1YE6A 4K39A 4Q8WA 1XICA 1FHDA 4C6CA 1UD6A 4BR1A 4G2DA 3NVDA 3OZOA 1FDYA 4B3LA 3WJXA 4AD2A 3T0TA 5EMYA 3SB0A 1W37A 2DT1A 3AICA 5I2UA 1UIPA 5BCAA 4R27A 4PTXA 3TAOA 4EACA 1BKHA 2RGMA 5BYWA 3W25A 5I3FA 1CNVA 4G1KA 3IRSA 2INFA 1UD3A 3NO3A 1AH0A 3PPHA 3TCSA 1WB0A 1OFQA 1XQLA 4QE1A 3HQ1A 2R1KA 2GUUA 5BU6A 2HZGA 3N3TA 3DI1A 4Q8OA 1E73M 3URNA 4BFAA 3ITTA 4JIQA 2FJUB 3D5HA 1KFLA 2WW5A 4XG1A 3A3WA 3CPRA 3NQEA 4F40A 2QPXA 1UH3A 1PS9A 3MSYA 4YLWA 4CVUA 4LT9A 1TJRA 4Y9PA 1B54A 2OU4A 1TIWA 2FTPA 2PTXA 4PTNA 1LUCB 4IPNB 3KTCA 4RX0A 5IBXA 1F76A 4O53A 1PYMA 2F6KA 4DBUA 5LNWA 4U33A 5HATA 3NPXA 1RR2A 5D04C 1FWJC 1R38A 1UR2A 1Z41A 2TMDA 4AZHA 2ACUA 4G56A 1V6YA 1AJ0A 3NZPA 2NQ5A 1XI3A 2QVHA 4AX6A 2B7PA 3QC0A 3CWHA 1KRCC 1OD8A 3E2RA 2CLMA 4HNNA 4US5D 2ZXQA 4L4LA 2GSHA 4IIGA 4RE0A 2ZZ2A 1HJUA 3W2MA 1MW2A 2WKGA 2FZMA 3RUBL 3HTWA 3SUWA 1UUOA 4EAMA 2Z2UA 4P8WA 2PDXA 4GUGA 4TQTA 3R5EA 4JOMA 5EMUA 1IWAA 3SO7A 1HJWA 3N6JA 3HM7A 1H63A 4K38A 1VHCA 1OK6A 3AHVA 4NASA 3CWNA 1XLKA 1B1YA 3ATZA 1FWSA 3VO0A 5AKQA 4NZ4A 3Q58A 1JYWA 4URIA 5A69A 5FCZA 1OFOA 3UR2A 3IV3A 1FWRA 2HVNA 1V6UA 1NH6A 1FXQA 3O9NA 3EA1A 1R3SA 1P0DA 3GQYA 1XQKA 3I7RA 4JTUA 3B03A 3BGJA 2W27A 4PUDA 1K9DA 3UGVA 4IP4A 3PTKA 1C8YA 3DFNA 1J6OA 1V02E 3WF0A 1FP8A 4Y8EA 2OPJA 2DT3A 3WJZA 1P0BA 2HWGA 3GFYA 4KRUA 3CHFA 3PZTA 1H7RA 3IARA 5A8OA 2OYMA 1G4EA 1AMYA 3QY8A 1LWJA 2Z2BA 4NNAA 2QCLA 3EKZA 3KBSA 1QHPA 2OSYA 3B9OA 3M0MA 2JGYA 5BXTA 4Q8QA 3WLHA 1OABA 5B7ZA 2Q3OA 1Q63A 3AALA 4HHPA 4PMOA 4V28A 2WJDA 3FKRA 3AAMA 1H41A 1A80A 4XUYA 4AG0A 1EBGA 4ZFMA 3PZMA 1YPFA 5TF0A 1VJIA 4IUOA 3CV6A 2V5DA 5JBDA 1R7OA 1PX4A 4IG2B 5G4WA 2XM1A 5D2XA 2E6YA 4AHQA 4J4KA 2W63A 2VEIA 2YBUA 4NVTA 4XZWA 4EWND 3SAZA 4FSAA 5MHBA 4DBEA 3ZLHA 4H04A 5J5RA 2E25A 3RU6A 2F38A 4MDPA 2MANA 5HBFA 1HUVA 4PRTA 4UCFA 2X1UA 1JAEA 3USZA 4XZNX 4O4VA 5DCEA 1XH0A 3AIBA 5CXPA 4IQJA 1RK6A 2X1TA 3W27A 2JF6A 4ACZB 4W9TA 3HG4A 4H7VA 2YXXA 1K9TA 3QQ0A 3TAKA 2CFFA 4PC8A 2G97A 5KSWA 2GQ9A 1GORA 4TVCA 3UESA 1NWSA 3SIMA 4JY8A 1NDWA 4N4PA 1JDEA 4A8IA 3R0DA 2JIEA 5EGRA 5HJLA 2XH7A 1HL2A 5DF0A 2VFHA 1RUSA 5H8MA 4LRSA 3NGJA 3WNOA 1Z44A 3L65A 2XFFA 5GVJA 5BXPA 3CGTA 1UJPA 3BJTA 3E74A 3SCRA 3UZZA 1WZLA 5FF3A 4KESA 4RPPA 5E9AA 1OC7A 4FHAA 4LBUA 3R11A