4YVPA

Crystal structure of akr1c1 complexed with glibenclamide
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
318
structure length
318
Chain Sequence
QCVKLNDGHFMPVLGFGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAVEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C1
publication title In vitro inhibition of AKR1Cs by sulphonylureas and the structural basis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 115
structure length 318
sequence length 318
chains with identical sequence B
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2015-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4yvpA00
3UZYA 1IHIA 3COTA 4DBUA 1RY0A 3CASA 4JTDA 4HMNA 3WG6A 4G5DA 4JQ1A 1VP5A 4LAUA 5M2FX 2HEJA 2F38A 1Z89A 4L1XA 1PWMA 2DUXA 1MZRA 1J96A 4YS1A 4XZIA 3NTYA 3V0TA 2I17A 3GHUA 4GABA 2ACRA 4WRHA 1XGDA 1EXBA 3H7RA 2PDUA 1ZSXA 4FA3A 3N6QA 3UGRA 2WZMA 4YVPA 1RALA 4IJCA 5LIXX 1FRBA 4GIEA 4GCAA 4QBXA 1OG6A 3DOPA 4WDUA 2PFHA 2ALRA 2PDFA 3UZWA 3D3FA 2PDXA 3EB4A 2IKGA 4JTRA 4XVEA 1ADSA 3ERPA 2INZA 2FZ9A 2PDKA 2PDQA 4PR4A 3V0SA 3EAUA 5LIYX 4JQAA 3VXGA 2BP1A 1PZ1A 4WGHA 3CV7A 3FX4A 4LB3A 1YNQA 2PDBA 2VDGA 1HW6A 5LIUX 1PWLA 3LD5A 2BGSA 3EB3A 3UWEA 4JQ3A 5C7HA 1T41A 2HE5A 4H7CA 5JH1A 5HNUA 4JTAA 4PUWA 3R94A 2HV5A 2IPJA 3N2TA 5DANA 4JTQA 2IPFA 2ISFA 4QXIA 2PDMA 4ASTA 2HE8A 4EXBA 4JQ4A 4ZFCA 1S1PA 4LBRA 1R38A 3BURA 2PDHA 1GVEA 2PZNA 3U2CA 4QX4A 4JIRA 1S2CA 4XZMX 4DZ5A 3WBWA 5KETA 3H7UA 2PDPA 5LIWX 2HVNA 3BCJA 1VBJA 2FZBA 1Z8AA 4Q3MA 2NVDA 3M64A 4EXAA 5HA7A 3C3UA 3LZ5A 4I5XA 2PDYA 3CAVA 4PUUA 3R8HA 3M4HA 1Q13A 3P2VA 4MHBA 3O0KA 3T42A 1YE6A 2PDLA 3BV7A 3S3GA 1YNPA 1AH0A 3G1RA 1Z9AA 1C9WA 4H8NA 3GHRA 3H4GA 3LENA 3GHTA 1EL3A 3F7JA 3O3RA 1QWKA 1X96A 2AGTA 2IQ0A 5LIKX 3LUTA 2ACUA 1RY8A 3LZ3A 3WCZA 1PZ0A 3MC5A 3UFYA 4LB4A 1XF0A 4XO7A 4HBKA 2P5NA 3B3DA 4WDWA 2WZTA 1HQTA 2ACQA 2IS7A 1ZGDA 1X98A 1Z3NA 2IKIA 2IKHA 2PDWA 4DBWA 1SM9A 3FJNA 3LQGA 4YVXA 2PDCA 1X97A 3WBXA 2PEVA 3G5EA 4IGSA 5AZ0A 2BGQA 3CV6A 1MRQA 1PYFA 3UYIA 4JTCA 4JIHA 2IQDA 1EKOA 4XZHA 1ZQ5A 1AH3A 2FGBA 3LBOA 4XZLX 4GA8A 3V36A 4FAMA 3KRBA 4JIIX 1AFSA 4JQ2A 4AUBA 1LQAA 3R7MA 1Q5MA 3UG8A 4XZNX 4GACA 3UZZA 4R9OA 3WBYA 4LBSA 3GHSA 3R43A 4YU1A 2IPGA 2IPWA 3UZXA 1AZ1A 2CLPA 2DUZA 3Q67A 4Q7BA 2ACSA 3DN5A 2FZDA 1MI3A 3UP8A 4DBSA 4F40A 2I16A 3CMFA 2QXWA 4YVVA 4PRRA 2PDIA 4WDXA 1AH4A 3R8GA 1AZ2A 4PRTA 5HNTA 3ONCA 3V0UA 4XVDA 5AZ1A 1S2AA 3V35A 3BUVA 3R58A 1K8CA 1T40A 3LQLA 3QKZA 2F2KA 2PDJA 2A79A 2PDNA 4QR6A 1S1RA 1XJBA 2HVOA 2R9RA 4PMJA 4WEVX 4OTKA 4GQGA 4ICCX 1US0A 3M0IA 2FVLA 3RX4A 4NKCA 3ONBA 1ZUAX 3LNMA 2DV0A 5JH2A 2HDJA 4XK2A 1LWIA 4GQ0A 2C91A 2J8TA 1EF3A 2PF8A 3Q65A 3LEPA 4WDTA 3RX3A 1M9HA 2R24A 4XO6A 2PDGA 4XAPA 3RX2A 1QRQA 2INEA 4RPQA 2IKJA 3MB9A 2PD5A 3CAQA 3LN3A 2PD9A 2NVCA 2FZ8A 3GUGA 1A80A 4IJRA 1UR3M 4FZIA 4LAZA 1JEZA 4FALA 3R6IA 1YE4A 1IEIA 4L1WA
chains in the Genus database with same CATH superfamily
4O1BA 1EH9A 4MLJA 4TXEA 4JTTA 1EX5A 1UWTA 1NP2A 2W6RA 9XIMA 2DVXA 3RN6A 4DJDC 2GYIA 4XUYA 3WG6A 3M7SA 2Y24A 3QPYA 3SCPA 3O1NA 2DIKA 3RO8A 3MV01 1GQIA 2P88A 2ANUA 3I4KA 1PBGA 4CU6A 2PWUA 1BWKA 3C3NA 4GO9A 4GUIA 2UBPC 4NZ1A 1JGMA 1DTUA 1F74A 3SADA 3VKBA 1GJPA 1Y5XA 2VC9A 3TK7A 4NX5A 1GYMA 4ZO6A 3DBPA 3N6QA 3G0UA 5CPLA 3UJ2A 3WEZA 5A8PA 2GQ9A 4DNMA 3TAKA 3SRKA 4C6KA 1TZZA 3ISIX 3UJSA 5I5RA 4OJYA 5EFDA 5FF4A 1XI3A 3WZ0E 3AZRA 2XU2A 3GDRA 3G1VA 1O60A 4BK9A 3F4DA 4AEOA 1M1BA 3ID7A 1MXSA 3OGVA 2EEXA 3EB4A 3UG3A 4LC8A 1HL2A 3QR1A 4P8WA 3T0TA 3AYVA 3FV9A 1GQLA 3NCOA 3GW0A 2WW5A 1RA5A 2BOGX 2WKLA 3M0JA 3W2MA 4LYPA 1KM5A 3T2QA 4G8TA 3WH6A 3DFYA 5HWJA 1LUCB 4I9AA 3T9PA 1A47A 3U7BA 4UR8A 3KVLA 2VR2A 4Y2WA 4Y9AA 4M80A 1ZAIA 2HE5A 1A50A 5HMFA 4X60A 3QYQA 3NUKA 2OZTA 2A3CA 2FIQA 3ABZA 4FX6M 3MI3A 5DANA 3ZLFA 1HN1A 3H55A 3PZTA 3YPIA 3ARUA 2BXYA 3QFWA 2VTFA 1JDDA 1BG4A 3WFAA 4Z1YA 1WCGA 1SFSA 2QUMA 2WSRA 3VDAA 2A1YA 1YDYA 3CEPA 3V16A 4JIQA 4LVAA 3IJLA 1EYEA 4GNJA 3K30A 1J2BA 4JYEA 3GY1A 5HQLA 1LLOA 3TTEA 1J01A 1VHNA 4UNKA 3ORWA 2NVDA 1F05A 1QHOA 4HNCA 1ZBCA 1C8QA 3VKKA 5AC8A 1K4HA 3RU8X 3R0UA 2YFNA 2EPNA 4WXZA 1PDZA 1DXFA 1ZAJA 3FA5A 4I5XA 3Q2DA 2Y0FA 2WC4A 1CGXA 3LNPA 3AQUA 3T4CA 4Q8UA 4O0ZA 3P2VA 4HOZA 2O9TA 4PCTA 2EF9A 1OK6A 3S3GA 3OVRA 1EXPA 3PS7A 1W0MA 3NYZA 3S5SA 3RLUA 3E2VA 1E6XM 2OGJA 1AW2A 3R2GA 3TTSA 4EWJA 3KWXA 3B8SA 3RITA 3S1GA 3QKEA 5AHFA 3CAKA 1POKA 3PBYA 3UJEA 3AZSA 3DXIA 3GLCA 1VKFA 2DT2A 3LZ3A 1PZ0A 1Z7AA 3LBCA 4TX8A 1ITXA 1KCKA 4ORMA 1VIZA 4UXDA 3FJ4A 2ZZ3A 5BROA 3SY1A 3CNYA 1TJRA 3KLLA 2WZTA 2PGWA 5BWFA 3EDDA 4HHMA 1KTBA 1P0DA 2IKIA 4D2JA 4IT1A 4KF1A 4ECLA 1DV7A 2G0WA 1VFMA 3GTXA 1V4YA 1WE5A 3FKRA 4S38A 3UNDA 3GX9A 4MYAA 2J66A 2X16A 2GFTA 3IK2A 5E9XA 1XX1A 5A8QA 3L65A 4HA0A 3BJFA 2DPEA 4I6VA 3LBOA 3LYEA 4IMEA 4QG9A 3DG3A 4UTIA 2J9XA 4GKLA 3V3WA 4CKQA 3OVGA 5LA0A 3ABXA 3NPUA 4UTJA 2Y88A 4N6FA 3NSMA 4JTFA 2V69A 4LUJA 3DC8A 3HGOA 1RH9A 1PO9A 3ECQA 1GOWA 1P1XA 3KS6A 2E4TA 4BEQA 4AY1A 4DRSA 3A4WA 3W1RA 2HTMA 4YU1A 4B4FA 4QDWA 4OGZA 5C9UA 1MDLA 1EJ7L 1HG3A 1PVNA 1WDQA 1HJSA 4Y8FA 4NT0A 2OQYA 5I6SA 3CMFA 4LXFA 3W7JA 1MXDA 1TYGA 2E6FA 2J7CA 3R8GA 4B2DA 3EX4A 3OJGA 3KBWA 4B5WA 4JIPA 3KZSA 7CGTA 3W1PA 1K3UA 1OJXA 3CHEA 2W0UA 3RR4A 5HXMA 4FF5A 3W23A 3W81A 1KGWA 1BF6A 4HZMA 1DJXA 1S1RA 2ZZ5A 2R9RA 2QW5A 3R11A 5HK4A 3UNTA 4GQGA 4QJ5B 2HBXA 3C0SA 2DZTA 3AICA 3F2CA 3M0ZA 4NIRA 4OE7A 3OA3A 4O16A 5A6LA 3WH5A 3UXIA 1JUKA 2ZC1A 2ZRXA 1QATA 3W6LA 3ZJ7A 2QPUA 1YDNA 2C91A 5D4YA 3HO8A 2B7NA 3PZ9A 1GVYA 1UKPA 1NOUA 5C0QA 1EJRC 3AHZA 3TFCA 4PA8A 2OWXA 5TAOA 1JI1A 1ZRQA 1QOPA 1ZCOA 3LGGA 1GVQA 2EKCA 4J3ZA 4PTXA 3TZNA 2Y85A 5LNVA 5I3FA 4C6LA 4DB7A 2OB3A 3UF9A 3PANA 1UR3M 3VOHA 1JEZA 4Q8MA 3DFTA 4DNHA 3G0XA 4WOQA 1P6WA 4BQ3A 3KBSA 1UQZA 4ACZA 1PTDA 4F8XA 3BAJA 4PFHA 1VP5A 4RV3A 3T6CA 2VEKA 4HHHA 3M0VA 3K2GA 4UR7A 2F38A 2V3GA 4FI4A 1VEPA 1B54A 3HJZA 3L4TA 2QV4A 4GABA 1IZCA 1RJPA 3ITYA 7REQA 1XQKA 4ZBCA 1U1UA 4UTHA 4O0QA 4MADA 1O94A 4R7OA 2Y7EA 3NXFA 4L9XA 1V77A 2VCCA 4FLOA 2J7HA 2Z7GA 3T0BA 4LT9A 2Y8KA 4EANA 1PX4A 3PM6A 3P14A 4Z0JA 1M03A 3EMCA 3UD6A 4LYQA 2X09A 4CQAA 1CXIA 2O7SA 2PA6A 2PFHA 5D05A 1Z48A 2YPIA 2YXGA 1PPIA 1E9IA 1KQZA 3A64A 3PFMA 2P3ZA 3KZPA 1WZAA 1Z41A 3VE7A 3PB0A 4MIMA 4HCDA 4ZENA 4DJFD 3T0AA 4DQWA 4O54A 4BJHA 2UY4A 2A7NA 3WK2A 3BSGA 3MI2A 1POJA 2EJ1A 2D2OA 4NYUA 4MKNA 5FJJA 1JZ3A 2J6VA 2E6AA 4U5KA 3RFAA 4GK8A 3WJZA 1R3SA 4H9UA 1OB0A 4FXFA 1H50A 1PWLA 3LD5A 1V79A 1G69A 3WF4A 3UWEA 3N9SA 3UR8A 2FPTA 1OYCA 5C7HA 4DZIA 5CZ0A 1PV8A 4QDPA 1K7EA 3WDIA 3C2FA 1LG2A 3G3DA 3RMEA 4FEZA 3IV8A 4HZ7A 3SUUA 3WH7A 1M3UA 4S3DA 4QXIA 3E2QA 3GVWA 3MMTA 3TKFA 4XD3A 3RPDA 4DIAA 4UTTC 3VNYA 1TZ9A 3CWHA 5G2IA 4D1JA 3BURA 4RJEA 1E43A 1UUOA 1UIPA 8XIMA 1UR2A 3EA2A 3H7UA 2QQ6A 3AYTA 4KETA 1F4AA 3S0CA 6ENLA 1MW2A 3GXNA 3E6EA 1BQGA 1TPB1 3S1WA 2YFOA 4BY3A 1HKMA 3OU8A 4K37A 3ARVA 2P8CA 4YTQA 3W75A 1EDTA 3B0VC 4H3DA 5A2CA 4ZQCA 1KWKA 4DYKA 4ZB2A 3B0XA 3RO6A 3CMGA 2OXNA 2WMGA 3T44A 3A4AA 4LYRA 1P43A 4Y96A 1UG6A 4ZXOA 3R89A 2AQWA 1W5NA 2YDSA 3DAQA 1XGZA 3KX6A 1XINA 3W07A 3WMBA 3HMJG 1NSJA 2YW3A 1FWGC 3QZ6A 4I7VA 1N8FA 3NQMA 3ZJ6A 4UFIA 1ZNNA 2J24A 2ZTKA 3AMDA 2Z4GA 3LUTA 1M7JA 3H12A 2ZTJA 3RCMA 3VGBA 4DJFA 3QLDA 1CX9A 3PJXA 2Y62A 4DO7A 1TO3A 2VDHA 1CDGA 2Z1VA 4RPPA 4PRWA 4FPSA 4JR5A 5FI8A 1MQRA 4QJ3B 4EK7A 5LXXA 1Z3NA 1RK6A 5E70A 4NZJA 3MZNA 4NSBA 2VQTA 4KRUA 4MMWA 4UQDA 1ZJIA 1HO4A 3CZLA 2YZ5A 4F0SA 1OG0A 5CZSA 3W1AA 5CJ5A 3DYPA 4JXCA 4B5SA 1GEHA 3CV6A 1MRQA 3H24A 4GZJA 3HPAA 2WQDA 1M5WA 1VEMA 1EKOA 4BF9A 2V5DA 3KUMA 4A2SA 1KFLA 3SCUA 4CCEA 1UUMA 1Q7QA 2G96A 3EXRA 1I1WA 3LCFA 3G3MA 1OFBA 4E2DA 5K9XA 1XLBA 5CPQA 4DJEC 1R3WA 2J9YA 3AJ7A 3H54A 2XGZA 1FWAC 3SBFA 5A6SA 5H8PA 3VYLA 2JGYA 3RM9A 1MW1A 4UWMA 1SZFA 4I5UA 4ML4A 4CNPA 1DXEA 2A5HA 1YXYA 2X1UA 3B06A 3C2EA 3CUHA 3NZQA 4WJ8A 3EX2A 1AH4A 1NFBA 2XPKA 5D04C 2CLIA 2VOMA 3OLDA 1VHCA 3D47A 3IVTA 5CSYA 2OZ8A 1OC7A 2DP3A 1BVWA 2XG9A 1SO3A 1E9YB 4QSFA 1Y65A 3LQLA 4LUIA 4UTFA 2NZLA 3B0YA 3DIPA 4PC8A 3DDMA 4E8GA 3B03A 3JZEA 3EX6A 3BAYA 1WZKA 5H1WA 3VMPA 3NJ3A 4MPKA 3A3XA 1LJYA 2F7FA 1EC9A 5IDZA 2XGBA 3PBGA 2Y63A 2WVTA 4OQVA 2A3AA 2E8ZA 2XWEA 3W6YA 3I3BA 3UWWA 2Q8XA 3FJ6A 1LWIA 3VIFA 3BG3A 3MU7A 1HL9A 1CWYA 4Q8PA 2X1RA 2QIIA 4ERGA 4ACZB 4JZ5A 5I24A 1QRQA 5I3IA 4AWTA 2E9LA 1VB9A 2FFIA 4K39A 1SYTA 5CC5A 1SU5A 3LCXA 4ZQPA 1E4MM 5J8LA 4UUIA 1A80A 1PKNA 2DZXA 4IIDA 4XSMA 2R6OA 2J74A 1TVPA 1XDMA 3R6IA 3WUGA 4KCTA 1UJQA 1Z42A 4CQ8A 1IHIA 4AD3A 1XIDA 3L4WA 3C6CA 4QSHA 2NUYA 4FO4A 7REQB 3N3MA 2OX4A 3DG7A 2G97A 2FTPA 2YCIX 1W54A 1W5QA 1CLXA 3MP4A 3ZJ8A 3MZ2A 1YX1A 3TN6A 2VEIA 5ABFA 3JZUA 2GUUA 5LNUA 8TIMA 4KFNA 2INFA 2GK1A 1XYCA 3TC6A 3N6JA 4Q8VA 3PTDA 2OSXA 1JXKA 1HJQA 1O12A 1RHCA 2JQXA 3C61A 1I2RA 2CXGA 2POTA 1ME7A 4GYPC 1ZPTA 3NDYA 2AMXA 5D9PA 4PSPA 5AY7A 1PTGA 4E8DA 2VNCA 5AECA 1JDAA 2RFGA 3KVJA 3NQVA 2QVHA 3BXWA 3BQ6A 2OQLA 3NOEA 4I9MA 2P10A 1FDZA 2BMBA 2CHOA 1VFTA 1P0NA 4HPNA 3VA8A 1WBJA 1NFGA 1GKRA 3DBNA 4OBTA 3F4WA 4MOZA 4GGHA 4DZHA 4MAZA 2OOFA 4LS2A 1G5AA 4K2SA 2DH2A 3WF1A 1BXNA 3DH7A 3QHNA 4KWOA 1EO7A 3D46A 2EJAA 4GXPA 1HF6A 4YHGA 3VZYA 1QHZA 1WXYA 3D6NA 1CW2A 3P8IA 3CYVA 5T9CE 3QMRA 1E71M 3FJLA 1WUEA 1TJ0A 4E4UA 4AEEA 3FIGA 2JKEA 1H7OA 4LB3A 5DBUA 2BVTA 3ZT7A 1UKOA 2Q71A 1H4PA 3B40A 3VM5A 4XV0A 3WH8A 4JQ3A 4WSJA 3WD3A 4CCZA 3PZQA 3E0LA 1R87A 2RDTA 1W3IA 2HV5A 4H8UA 1XRTA 4HA3A 5E0KA 1CECA 1A5KC 1ISVA 3WFZA 3KP1A 5AVHA 1FCVA 4GISA 5D2WA 1UZHA 3BANA 1HGWA 2QHAA 1ME9A 3S5YA 1THFD 3TXZA 4D6JA 5LSMA 4GI4A 3OHMB 4QX4A 2A6NA 4ERAA 3R4IA 3T78A 4IL2A 1DJZA 2XFFA 5A2AA 3ELFA 1SW7A 2D2JA 5C9ZA 4U2ZA 4JKKA 5F2GA 2QJHA 1JYNA 2PCQA 4WLCA 3VZXA 1B3OA 4EPKA 2FYMA 4OWGA 3ZQ9A 3SCSA 1JZ6A 5HQMA 2OLAA 4JTSA 2R8WA 1OX5A 2PI6A 1E5NA 1Q4WA 2WOQA 1GW1A 3PPGA 1DWFM 2C3ZA 4IWWA 1MNSA 1XIMA 1RD5A 3CTTA 1SJBA 1E3XA 5CBJA 4O0KA 3NVDA 1EDGA 4AH7A 3E2RA 1GHSA 1TQXA 1QPNA 3O3RA 3B8TA 5U4NA 2VP8A 4DUXA 1UR0A 5BXSA 2HWGA 3AIBA 1BYBA 2VFGA 4PTDA 4LAKA 4UOJA 2VX7A 2E1DA 1AW1A 4DUWA 4A6GA 2VD8A 1XF0A 2R1NA 4LOCA 3N4FA 1OX4B 1ML1A 3B3DA 3ALFA 4WDWA 1ZJHA 3N6HA 3STGA 4D71A 5I02A 2GOUA 3MSYA 4TX6A 3W7NA 5CSRA 1A5MC 5LNWA 2DVTA 3M07A 4XIMA 4XAZA 1RVKA 3NZGA 3G5EA 1H7NA 2XH4A 2QS8A 3GE7A 3W7GA 3UYIA 3OPSA 5D2YA 3PN8A 3HOJA 4AZ6A 2VZOA 4MJ4A 3TW9A 4LJ3A 5KMYA 2ZUUA 2X30A 1TREA 1A5CA 3PBMA 3TX9A 1R3QA 5AHNA 3AFBA 3LXBA 2X42A 3KTCA 1SZEA 3Q94A 1G7VA 2ZRZA 1QFEA 3MSGA 4AISA 4CNSA 3UG8A 2YSWA 4HVXA 3NG3A 2NXHA 3KRSA 4YL2A 3P0XA 3USBA 3Q67A 3DN5A 1R2RA 5AKQA 1RZMA 1Q45A 1F8IA 1O1ZA 3K8KA 3ITOA 5CSUA 5I3GA 1DHPA 3H4WA 3TQ0A 2ZFAA 4CNNA 3BOLA 5BOEA 2XZ7A 3N2XA 1YLVA 1IEQA 1F8MA 3GAYA 2HNEA 2F61A 1ZL1A 1S5WA 2OEKA 1NEYA 1I1XA 3SY8A 1KKOA 1S2WA 4V28A 1HUVA 3DCPA 1ISYA 3WNLA 3O63A 4X3ZA 4DJDA 1W1TA 1VPQA 3A3HA 1QUMA 1OYBA 1VCGA 4XX6A 5AHMA 3EA3A 1JFXA 3N13A 1IGSA 1EOKA 4Q33A 1E15A 5KEZA 2E40A 1GWJA 2CLMA 4KMQA 4F9JA 3NQ7A 1GQKA 4GQ0A 3I6EA 1K9TA 4M3PA 1HTIA 4KRZA 3W53A 1MFUA 4C6DA 3MY9A 3GU2A 4AMCA 3RX2A 1MEWA 4CGTA 4E6MA 3LN3A 4V15A 1FA2A 3R5EA 3FOKA 3GVGA 4B92A 3CL7A 4O28A 5ABFB 1MUMA 1GTEA 1JYVA 2PCEA 5L6UA 3BOXA 2PE4A 1XLGA 3QRHA 2GK1B 2AAMA 2NWRA 2ZRYA 4TQTA 3HQOA 3I6RA 3LGDA 4WF7A 2YOCA 3DECA 3IPWA 3CPGA 3OYZA 2WJEA 1IGWA 4LS0A 1U1JA 1RBLA 2HEJA 3CUGA 4RDZA 1K8ZA 4GE8A 3W7CA 1Q63A 1L6GA 1FWTA 5KZDA 4J3SA 5JBEA 4JIEA 1DWGM 1VF8A 1HGYA 5ABEA 1KR1A 1J0JA 2DZSA 3MTWA 5F1UA 3HPXA 2WCSA 5TF0A 5A6BA 1YIXA 1KFBA 4PMDA 3G1DA 1PEZA 3DX5A 2VDIA 2W63A 4MDPA 2WB5A 3CK5A 4PBEA 4H9YA 3G1YA 3IJIA 3DOPA 3AJXA 1W1IE 2GGEA 3D3FA 1AJ2A 3VGEA 3QC3A 2HZGA 1UPPA 1OQFA 1K8YA 3FW6A 4QRNA 1TTJA 3W71A 4L61A 1LL7A 4K68A 4NRRA 1XC6A 4PR4A 3V0SA 4JFWA 2CLHA 4ZL1A 1V3JA 4D6FA 2AQOA 3SIMA 1SFJA 4A2RA 3L4XA 1CZ1A 1G9HA 3PUOA 4X0NA 5H6HA 4LRSA 1S5TA 1R9ZA 3W02A 1HKIA 1SZGA 3NEHA 4V33A 4F0KA 1IWPA 3LM3A 3QV7A 2XZ9A 4GI9A 2PTZA 3KBMA 1EGMA 4CLMA 4UQCA 4E38A 1RCOB 3QC0A 1JDCA 3T7VA 4R5EA 3OGSA 1JRCA 4WY0F 3WN6A 1RVGA 4NI3A 4X2PA 1S1PA 2QJMA 3PWGA 1UWQA 4IFOA 3URQA 3TYDA 3VNZA 4IHCA 3E5PA 3IJ8A 3GH7A 3ITGA 1A4MA 2W91A 4JIRA 3GIPA 2Z24A 2FDSA 1U5JA 1ZENA 2FHFA 1X1NA 1FKXA 4MTVA 3GTIA 4V1XA 3F4NA 2C19A 3G1XA 3U48A 3TEVA 3DYMA 3GG7A 3SZ8A 2JKPA 2NX1A 3RJXA 3PR2A 3UZ5A 4O12A 2CXEA 3NQ6A 2XN2A 3A4XA 3HGSA 5D9MA 5FAGA 1NDWA 2P50A 3SFWA 3IUHA 1H0GA 3QGAC 4XKMA 4ZFMA 3TROA 3M4HA 4MHBA 4CD4A 2W62A 4URIA 3EPOA 4BI6A 1KO0A 3MVTA 3E49A 1WP6A 1WA3A 1FCQA 6A3HA 3GHTA 3G24A 2D23A 4NJHA 1A3WA 4PMZA 3N29A 6TIMA 1HKWA 1MFVA 3RU6A 2V5CA 5D37A 3GVRA 4GI6A 2O55A 4MNKA 1XM3A 3GFYA 3MHGA 1EX1A 2UWFA 3DHPA 2OR2A 2TMDA 3LXCA 1X8CA 1JR1A 4UQEA 3CTLA 2GVJA 4H9TA 4BQ2A 5T9BG 1C8VA 1W1YA 2J25A 4BQ5A 2QJJA 1NOWA 4ICMA 3W76A 3S2LA 4QE5A 3K4WA 4GJ1A 1W9DM 5AB3A 3FJNA 3RMJA 1JD7A 4C6IA 1EEPA 3WLQA 1KGXA 3ATZA 3W4RA 4AF0A 1WV2A 4LC6A 4JIHA 1ZHAA 2R82A 4PB4A 1JPDX 1OSEA 4XZHA 5KZ6A 4B16A 1WDRA 4AD5A 5FEWA 1TE1A 3KEHA 1X1OA 1WOBA 4O14A 4HZ8A 3GTFA 2QCDA 4CN4A 1UBPC 5I3DA 3I6TA 5DX7A 1NWTA 4LVGA 3TP4A 3XISA 1A0EA 4RLIA 1I45A 3TR2A 2JE8A 2E1WA 4RX0A 5EA9A 1EHNA 4DO5A 4EIVA 5KZEA 3MPGA 3C86A 6ALDA 1WX0A 4C1KA 1CT5A 4KW2A 2DUZA 4Q7BA 3TLLA 1QW7A 3ITLA 4TMCA 4RZ6A 2YCKX 2CERA 3Q37A 1EJSC 4JEQA 1QMLA 4Y7EA 1YKWA 5AYYA 1F3EA 4KS0A 2GDQA 3HGJA 4DM1A 2C16A 4B3ZA 4PCNA 4E4FA 2V3DA 4NX0A 2NQLA 4RE0A 1G7UA 4LUYA 4C91A 4AIUA 2PODA 2V6AA 2WSQA 4RE2A 3BLEA 1IWAA 3VIPA 3VDCA 4OV4A 2P0IA 2VUNA 1J79A 1V6XA 4GINA 1B5TA 1KBIA 4OBRA 3VNLA 1TMLA 1VJIA 1TWZA 3POCA 3T8QA 4OTKA 4E4PA 5DXXA 2NXGA 4M56A 3L23A 5CC3A 4QP0A 1JZ4A 4NKCA 4XD6A 4CD6A 2QEZA 2D69A 2HSAA 5JBFA 1E6QM 3OIHA 3L21A 5CQ1A 1VLWA 4GYKA 4PL2A 2HXUA 5IM51 8RUCA 4O8RA 3VNKA 3IJ9A 2EBNA 2J8TA 3IRSA 3LEPA 3BC9A 3WQ4A 1JJKA 3TN4A 3VZZA 1IXOA 2WCGA 3VD3A 3GC4A 3TJXA 1G4PA 4MYXA 3T40A 4CN6A 1S46A 5FEXA 3UBPC 2VXNA 3VM7A 1UIOA 4K38A 1FWCC 1D3HA 4CQBA 1E3ZA 1KWGA 3TE9A 2OT1A 1W9PA 4ZE5A 2UY2A 2ZUVA 3SO7A 4LU0A 3W2NA 4DXKA 3WLRA 1RY0A 3PPHA 4R88A 3R79A 3UWUA 4QDMA 1R3YA 4R27A 3DZ1A 5IXEA 1PKYA 4ZO7A 4Z2JA 4IMDA 2WZHA 4TUFA 1ODUA 1MXGA 1TMHA 2WHJA 1QOQA 1J0ZA 2ON3A 3CZEA 2YCJA 1W3TA 3DUGA 4W85A 1ICPA 3LRMA 1R3RA 4AVOA 3CQJA 1WXJA 2NV9A 3V18A 3TVAA 3AS0A 1HVQA 3LRKA 4JX5A 3MJYA 2BGNE 4CU7A 4ZSUA 2J47A 3CHVA 4XD4A 1N8WA 4MG4A 3PVFA 3MVIA 1UD6A 1HJVA 4UOZA 5A69A 4W8BA 2HRWA 3EYPA 1XBXA 4K8GA 3KVKA 2P3EA 1ISWA 3N11A 1U22A 1EJWC 1C7SA 4UTTA 1LDCA 3W28A 3UZWA 3CB8A 3W7QA 1WYIA 1J6PA 4LGXA 1JFHA 3ZYZA 1J10A 3LERA 4ZOCA 2I14A 2KZHA 5IFPA 5LIYX 3CO4A 4A29A 4Y9PA 4HKPA 3HJEA 2ZUWA 1QBAA 1FCUA 4HJFA 2FHBA 3VKCA 4WR3A 1ZJAA 2XIJA 2VRJA 1F3XA 3FX4A 3TA9A 3NPXA 1UOZA 3TCEA 3W00A 3H2AA 4N0RA 1PIIA 1J12A 2REQA 1DIDA 5SWUA 4W7UA 1H7PA 1TPDA 1QI0A 3M5XA 1FWIC 5CXPA 4WX2A 2DSZA 4PUEA 3O9NA 4G2DA 2J7FA 3WQOA 3G6MA 6REQA 2YBVA 2J62A 3FHQA 3WENA 3VIHA 3MUIA 4DLFA 1Q8JA 2HCVA 4ATWA 1EDQA 1H51A 2QPSA 2O9RA 4FB7A 3BLOA 1FHUA 3TV8A 4R53A 1Q7ZA 1GQNA 2FDMA 3A9IA 5A95A 3W86A 1V0LA 3GG8A 3R0DA 3ARRA 4MNLA 4B3KA 3MKVA 1EC8A 3BPWA 2HVNA 3S5OA 5JIWA 3M6DA 4FK9A 4WQ6A 2OYLA 1VBJA 2OO6A 1EP1A 2EPLX 5DBTA 2V8ZA 3EEZA 3PTQA 4AB4A 1YDVA 3GC5A 4B91A 4TX9A 1R7OA 3B4YA 5F4XA 1OABA 4UB9A 1IYXA 5GNYA 2HJPA 4ILSA 3OQ8A 3KW3A 4C6OA 3MWCA 3GXIA 4J7RA 3OA5A 4H1ZA 3WLTA 3SY5A 3WQ8A 3O2LA 3G8RA 4WZHA 2OFJA 5D9NA 1QWKA 4A35A 2Z0IA 3N2CA 1W1A1 4HPXA 4DJEA 2PU0A 4GXMA 1MW3A 1C8XA 3M41A 1TFVA 3NDOA 2WK2A 3GBDA 3UPMA 1ZP4A 3G1FA 4ENLA 1G0CA 4LB4A 2GQ3A 3TNOA 4AF0B 1G6CA 2P5NA 4KBXA 1SSGA 3C0JA 1V51A 1PKLA 2IS7A 2OEMA 2IMRA 2JEQA 1A49A 2OX1A 2PDWA 4EOUA 1OIFA 3EWXA 2QCDB 3BZGA 3VOCA 2MANA 2WLYA 1US3A 2ABAA 4CQCA 4ZQNA 3GD6A 2W79A 3LCLA 5FF2A 1UD4A 1XC4A 1KA9F 2OYKA 2Y7DA 4PMXA 3VMOA 3ALGA 5BXTA 1BWLA 4ZVJA 1AH3A 3AIWA 3EPNA 3ZWSA 4M6PA 1XIEA 3W7KA 4U3AA 4KGJA 3QZEA 3VINA 3FS2A 1AFSA 3LHVA 3SCTA 5HATA 1DPMA 3GR7A 1GZJA 3T0DA 4CQ9A 4LBSA 4TIMA 1C90A 1BSIA 2DT1A 1TA3A 4ROQA 2A6LA 1Y0EA 4UNLA 1FX6A 2ESCA 5FF7A 4Q4OA 3RG6A 3K46A 1BVZA 4M7TA 1X38A 2DQWA 4G56A 1XH0A 3U5UA 4AD4A 4XBJA 4XVDA 4A3QA 3UXKA 1CCWB 2MNRA 4JKLA 3W1MA 1JAKA 4QHRA 4EPBC 1ALDA 3QR3A 3KVMA 5BXPA 3ZIZA 3ARTA 2HK0A 1O66A 1SZNA 1TCDA 1ISZA 5ECVA 1KCZA 1XJBA 4NNBA 4WJEA 5M17A 4NAEB 2PGFA 3MBFA 4JFVA 2NSOA 1IR2A 1MQQA 4H6RA 3LM7A 1JXJA 3TLQA 1E6PA 1B0IA 2RUSA 1A5LC 4GUGA 4HTYA 2A3HA 3IVSA 1EBGA 4NU7A 3ZSSA 5CGMA 4B9ZA 4GD0A 2INEA 4GYPA 4QQ3A 3MO4A 2WSPA 1V3KA 3S2NA 1HZYA 5CKSA 1HX0A 2FTWA 2NVCA 3CQHA 1RV8A 4IJRA 3TW6A 3HFYA 3ZWTA 1UUQA 3TYZA 1M01A 1T5AA 5FKYA 5A8OA 5DRIA 1UJPA 1CXEA 3MHUA 3EDJA 2Y8VA 4NL1A 4AZIA 4HYVA 3SCWA 4HK5A 3T4WA 5AHIA 2E77A 4DELA 2OWWA 4KFOA 3SI9A 1PWMA 1XUUA 4D6DA 2YJQA 1FWEC 2DORA 3M5ZA 4MKSA 3SJNA 4X2RA 4GVHA 3VK5A 1HP5A 4HIBA 2H90A 3NL6A 4UQAA 3I7SA 3MDUA 5D2TA 3HQNA 1WUFA 2VGIA 4DF0A 5AOUA 2QCEA 3GNRA 1GPWA 4OFCA 1J18A 1N7KA 3JW7A 3UW6A 3VGDA 4KRTA 3SM0A 3TJ4A 1E4LA 2G50A 1FH8A 3TC7A 3L2MA 2YL6A 5CEWA 3S9YA 3LB0A 2VC5A 2ALRA 1NWRA 5A6AA 4IISA 1LBLA 3BGJA 5LXEA 4MM1A 3PUDA 3H2EA 3P60A 1J9YA 1LL6A 4PB3A 4MB5A 2REQB 1W9VA 1VBGA 3ABSA 4GZEA 3LHYA 1E1CA 2WJFA 3BMVA 4B5XA 4OT7A 5JU6A 5EPDA 1RLDA 3VXGA 4KESA 4M51A 4ML9A 3ARPA 5DT5A 4MWAD 1KV8A 2J27A 3WD0A 4RXFA 4J2PA 1YNQA 3N73A 1X1ZA 2PDBA 5LIUX 2CKRA 4M8UA 2BGSA 2D2HA 1XIFA 4ROPA 1T41A 3G8EA 4G1NA 5J04A 2JBMA 1NY1A 5JH1A 2C0AA 1E1EA 4GYFA 1M7XA 3QN3A 4RUBA 2ISFA 3SURA 3MHFA 4EWND 3B9NA 2XISA 5C9WA 3WY1A 3UVAA 1KM4A 1ITCA 1FDYA 3W1TA 4CEXC 2D22A 5H91A 4US6A 4NJIA 1ONXA 1A5BA 2H8XA 1EJVC 5C7VA 4E2OA 2V38A 2V5BA 3AUJA 4DJFC 1IV8A 3W3OA 2FZBA 3ARYA 1UR1A 3W1LA 1O1HA 3AIEA 1GONA 2BY2A 4P7QA 2OSWA 5HINA 2XN1A 2VZUA 4S2BA 3WEOA 2YA2A 4OZOA 4YPJA 2HROA 3DHDA 3NM3A 1W3LA 2O92A 5LNSA 3WQDA 2VT0A 4LCSA 1KFCA 1IT8A 3IAPA 3P62A 3UR7A 3WQEA 1WZLA 3AI0A 4AXKA 4W7WA 2B7QA 1F7BA 2ATMA 5AVNA 4D6EA 1DWAM 3TJLA 3WDRA 5A8MA 1O68A 4BF5A 3TSBA 5HJXA 4BHYA 4ZB0A 4XB3A 2DW7A 4FNQA 4Z17A 3AXMA 1E6ZA 5XINA 5FJPA 3KM8A 3S6OA 1MDRA 5JBDA 4O1FA 4MFDA 3E38A 1R46A 3WH9A 1HNYA 3WELA 1EFZA 2I1OA 2CZVA 3CUJA 4AC7C 3GIYA 5EKYA 1A5SA 4E0CA 4C6JA 4KEUA 5K9DA 2DIJA 4IPJA 4RNJA 3IVUA 2ABBA 1OC6A 3PK7A 2AQVA 4IG2A 2BG5A 1NOFA 5A6TC 1SM9A 4P5UA 4DWDA 1KCXA 3CT2A 1X97A 2YDAA 3VCCA 4TVCA 5D32A 4A22A 2Z29A 3KOWA 4MJZA 1XWYA 4QCFA 1TA3B 2H8ZA 3UZJA 5HMDA 4Y8EA 3MJMA 3WD4A 1RK5A 4KEMA 1XSJA 4HHPA 4IGHA 4GGBA 3VNMA 1UZDA 4IPPA 3UY8A 4FAMA 3RNDA 3CQKA 3CPRA 3NQAA 2CWXA 3CV2A 2QIWA 1LQAA 3R7MA 1F07A 4TVDA 5FSDC 1Q2SA 2WKJA 1PX8A 4C6NA 1FXPA 2IPGA 1FP9A 3U2OA 2NUWA 2W3ZA 2GWNA 2ACSA 1Y8BA 1OYAA 4Q4PA 1VRXA 4AW7A 2YCLA 3S1UA 4JTUA 4CN1A 4D8LA 1XDLA 4MFEA 3ANVA 3B0UX 3DI0A 1WZMA 4TU1A 5AZ1A 1PSCA 1FUYA 2EG6A 4XIAA 4AU0A 2BVWA 1JNEA 3BUVA 3GRIA 3PSVA 1MSSA 1OCQA 1Q6EA 2VVSA 1UH2A 4AYGA 2EQDA 3CWOX 3DKJA 5FCZA 2V63A 3UR2A 3CT7A 4JCMA 1LROA 1D9EA 2ISSA 1XFBA 3EMQA 2AL2A 3W25A 3WMLA 1SW0A 4I6KA 3BMXA 1XLEA 3QXBA 3VGFA 1WKDA 1QPRA 3G1AA 3NQCA 1SJDA 5LGXA 2G41A 2X7WA 2HISA 4IGMA 3VO0A 4I7WA 2P76A 2A85A 1QO2A 5C9RA 1NU5A 2B31A 3UJFA 2SFPA 1EF3A 1RPKA 1WDPA 3W2UA 3NQEA 3ZJKA 1NELA 3VI2A 2ISVA 4J28A 3EXTA 2GGJA 2VZVA 4M29A 3EXSA 3W2KA 1VYRA 1KV5A 3MMWA 3LCWA 4RPQA 3AU2A 3HPFA 1OFOA 1WO2A 2WZIA 2PD5A 3F4CA 3GUGA 2DW6A 2R91A 5CPOA 3STCA 3HPSA 3AU6A 2CNCA 2Z00A 3ES8A 1E0WA 4MDOA 3TYUA 4DLMA 1C3FA 1CXFA 2D0GA 3VPLA 4I3GA 3ZR6A 3WD2A 4O13A 3VE9A 4E3VA 3R10A 4DI8A 2PLMA 4S3AA 3MKKA 4L65A 1B4EA 4Q6XA 1NIUA 1Q4NX 4KWVA 2WSKA 3AIVA 4XTIA 3BQ5A 3S2JA 3D0CA 4G5DA 2Z6IA 3N2OA 2BNJA 3VU2A 4LAUA 1F4HA 3T81A 4FOUA 4M5PA 3BE7A 4BWLC 1Z89A 4TV5A 4I8YA 2ZKMX 1MZRA 4C60A 1QBBA 1W1B1 4LCQA 4XZIA 3F1QA 1L6FA 1I6NA 3GVQA 4BZYA 3EWUA 3KHDA 4HYRA 1V6YA 4NYYA 4IMAA 3EKZA 5DY2A 1JCXA 1TUFA 3HB9A 2QJNA 2EXOA 1F73A 4QNEA 1T8XA 3GG1A 1E1CB 3OTRA 5B7ZA 2J7EA 1DJGA 5D30A 4QM1A 4G7FA 5B7YA 3AHXA 4HSOA 5F2LA 1H41A 5AN7A 5C8BB 1V3LA 1DJIA 1RAKA 3SUWA 1WKFA 2ZC8A 3U6WA 1EBHA 2ZVIA 3VKDA 4QEHA 4H00A 1TR1A 1XP3A 3PP7A 4XAGA 2YGYA 4PTMA 5HNRA 3GK0A 2INZA 3L4UA 4JOMA 2TYSA 1E0XA 1U30A 2V3FA 4Z0SA 3F2DA 2CLKA 2AGKA 4ZQRA 2TSYA 4X22A 2POZA 3RYSA 3OO2A 3MS8A 1HW6A 4A3UA 2HS8A 4AY7A 1XLIA 3VD9A 3I3DA 4J3WA 1AQHA 3F2BA 3LI1A 1QOXA 1ENUA 1I2OA 3VIKA 1D8WA 3TOYA 3GZAA 1AL7A 2E9MA 2CZ5A 3LTPA 4JQ4A 5K2ZA 4LBRA 1OINA 5TQLA 3SCVA 4CD5A 4HCLA 2AOSA 3KE0A 5FD0A 1G01A 1DTNA 1XH2A 4PCFA 2E5DA 3NSXA 1F61A 1H09A 2NT1A 4WKAA 1CEOA 3VAVA 2F8QA 3U2ZA 3OIXA 2CLLA 3E12A 1QU4A 1EWDA 5E0CA 4H01A 4UZSA 4W5UA 3BWWA 4JDYA 1BLIA 4M82A 1XPGA 4DF2A 2VFEA 4CD8A 1MYRA 3OW1A 1L2QA 3PZGA 3W1UA 3GNDA 1SMDA 1WNOA 5HAOA 2QUUA 2X1TA 3O6YX 3I3EA 3L4YA 4LBUA 2H9AA 5G1MA 4Q4SA 4PMOA 3ZR5A 1Q6FA 4IGNA 5ECUA 4JAWA 1X6NA 4FHAA 3IIVA 2AGTA 3VGHA 4IG2B 5DCBA 5DRCA 1DEDA 4NHVA 1B9ZA 3N4EA 2JGQA 1SJAA 4TVUA 1M41A 4K6AA 3MMDA 1GHRA 3QM3A 4HBKA 4M0XA 4Z42C 3ARSA 3ZLHA 2ZVRA 1UD8A 3HFTA 2G4FA 3BH4A 1V0MA 4HU3A 3B97A 3UY7A 4UQ9A 1R6WA 4U10A 2DSVA 2NV2A 1NARA 2P1FA 1QTWA 2BOEX 1TPH1 2X1SA 4JNMA 2C15A 4TTGA 5BU6A 4UTUA 1K6WA 4JTIA 4HPGA 4B15A 4Z2IA 1XLKA 3POHA 5LA2A 1KM0A 1JCLA 3BAXA 3ZVHA 1K1DA 2GGIA 3UWYA 3BK0A 4ZOAA 2FKPA 2YCLB 4F66A 2ZA3A 3TYEA 3TONA 3V36A 2D24A 3OVPA 4PULA 4L1GA 1UW9A 4LEFA 5CPNA 2PTXA 2XSXA 2Y5SA 1W32A 1GPFA 3W6MA 2XH0A 3WBYA 1Z32X 2PURA 3B8UA 3FA4A 4ZO9A 2BHZA 2BY1A 5TNVA 2CBUA 1MI3A 2FZDA 4Q22A 4W89A 4DBSA 1DL3A 4FX8A 2YKKA 5IHSA 4AAJA 5DCEA 2AL2B 3OODA 5CPTA 1MO0A 3QQ1A 2CZDA 1AZ2A 1EIBA 1CXKA 2QJGA 3V0UA 1XLMA 2GDUA 1S2AA 2V0TA 1DQXA 4HSNA 4H41A 3HV8A 4L9YA 4UTKA 2DSUA 1DE6A 3QKZA 3EMZA 2VGGA 3S5ZA 3V4BA 3FAWA 3IGXA 1DORA 2HVOA 1I75A 2EPKX 3M9YA 4PMJA 4GY0A 1JIBA 2OKOA 1W3HA 2XVKA 5G5IA 3ITVA 3RX4A 1J0IA 1UR8A 1JPIA 5LGZA 3H8AA 1GEQA 5D02A 2QZRA 4MUPA 4B5UA 1KBLA 4Q4KA 5BWAA 4NQ1A 1H1YA 3KCJA 4GFSA 4ZZ9A 1VFUA 4TV6A 3NFUA 4LF1A 4YWSA 5D2VA 3P67A 3MP3A 3QQ0A 1M65A 3PB2A 5LKYA 3RILA 3OG2A 2EGZA 4JTGA 2BTMA 4MZYA 3SECA 2VELA 2YB1A 5E09A 3NZ1A 1H1NA 1A0CA 2ZQ0A 2GSEA 1KRBC 5K7JA 4XZWA 4HNOA 1AW5A 1X6LA 3NGJA 4HD5A 3UYCA 3AHYA 3UGVA 1LOQA 3SN4A 2PU1A 1M68A 2TAAA 3V5FA 4O10A 5M2FX 3ES7A 3P7YA 5D09A 3CL6A 2X1IA 3KDOA 4O17A 2AL1A 3A13A 4LTSA 1OGGA 4L1XA 4C6PA 1J96A 4I9TA 1JPMA 3EOUA 4JHZA 4WKFA 1E56A 3N17A 1A5OC 1RD6A 4CUCA 2FJKA 3UGRA 3PULA 3BSHA 3VIJA 2QT3A 2XFRA 4AIEA 1AJ0A 3LTSA 4Q7NA 1G4SA 1DKWA 3LBMA 1XRVA 5LIXX 4IL0A 2F9RA 3ZMRA 3D5HA 1PS9A 2DIEA 3IJQA 3AMCA 4GCAA 3NDZA 2VX6A 3KCLA 2ZXQA 2OLHA 4H2HA 5DCDA 2VEMA 3VCNA 4CQDA 1FVPA 4S3BA 3GUWA 1JQXA 4J5NA 1PJ9A 3TN3A 4U4MA 2WMJA 2FGZA 4JHOA 4QQUA 3ERPA 3UA3A 3BGAA 3EAUA 4BCEA 2J75A 3DG6A 3TW7A 4JQAA 4Q8NA 1XIJA 4O15A 2IXVA 4C6FA 3WSUA 2BP1A 5XIMA 3MI6A 1LRTA 3M6YA 3V75A 3U57A 3UR5A 1JCNA 4P8UA 5F2IA 3IUDA 4JTLA 3W7DA 3N9RA 4J3VA 1BXCA 3IIPA 4AEFA 3VDHA 1PB0A 2IPJA 4EACA 2JIEA 3JU2A 5JUVA 2V3EA 2WAGA 4KEZA 3DFHA 1CXHA 1BEUA 2BSLA 5DELA 4JNYA 3PAOA 4XAFA 2CBIA 1W56A 3TSMA 1A0DA 1KM3A 4C6MA 3SN1A 3LOTA 1BFNA 2NQ5A 4ZTXA 3VKAA 3DKLA 4DZ5A 2PZ0A 1UKQA 2NVAA 3WK3A 5ABGA 2X7VA 2PWDA 4UTWC 1OGBA 3RCNA 2H9AB 3C3UA 3TC3A 5DF0A 2QJIA 3F4VA 4JX6A 2ZWZA 2ZZ2A 4NRSA 4DBEA 4K36A 3GKAA 3NNTA 4EPEC 1T0OA 1LT7A 5FJRA 4WIWA 1H3GA 3LRLA 3GBEA 3UXLA 1AK5A 1XYBA 4H83A 4HYWA 3VGGA 4X63A 3PJTA 3VDGA 4HU8A 1TCMA 2QR6A 3TTOA 4JNZA 3F7JA 1TG7A 1J11A 4N7QA 1J5SA 4WKHA 1X96A 4W9TA 4GUJA 4GWEA 5LIKX 1B3WA 3N2BA 3WJYA 4XG1A 1L6SA 1ZALA 1BKSA 1VCVA 1QT1A 3MC5A 2ZA1A 1CXLA 2CITA 1NF7A 4Z1DA 3ZVHB 4KEVA 1K9EA 1IZJA 3WLMA 1LM1A 3SRHA 5EL1A 1NDVA 2XIOA 3OZMA 3LLXA 3WIJA 1VGAA 2OO0A 2QDHA 4LNCA 3MWAA 1C92A 3C56A 4U28A 2DZAA 5BNKA 3PUEA 4Z08A 2BGQA 5CC6A 2ISDA 3PNZA 1YADA 1ZQ5A 2X2GA 1TELA 2CKSA 2ZADA 4IIBA 4Y90A 1RJRA 5D9OA 1XSKA 3HPZA 2E25A 1BYAA 1UH3A 3B9DA 2AMGA 3P0WA 2WPBA 3DEQA 3STEA 3WLOA 1JF6A 3WEMA 5G4EA 1ZBWA 4XZNX 2R14A 5HUOA 4EXQA 1QCWA 2QDGA 2B7PA 1IXPA 3WLKX 4EE9A 2WNQA 4MJMA 3CZGA 2E7FA 4AXNA 4H8HA 3PFRA 4IUGA 5AHLA 1K02A 1QK0A 5C71A 1L0PA 4ZODA 3OOQA 3P84A 2QAFA 2I16A 2QXWA 3USZA 3E0FA 2OT0A 2G3JA 3OZPA 3A5VA 3W1QA 4S23A 1KBBA 1S5NA 3G22A 4HCHA 2DY3A 3BL3A 3KBJA 3H4XA 1ZBVA 3NOYA 4ADSA 4UMCA 1UHVA 1AA1B 1QPOA 3IIXA 3R58A 2PWFA 4U31A 4H9ZA 1OCJA 2DJXA 3ABQA 3K8MA 3QPEA 4CD7A 5IHRA 1G1YA 3P8JA 4DPPA 1E1FA 3AWNA 5CLTA 2GJNA 2Z1XA 5E93A 1QPKA 4L6HA 2YBUA 1JD9A 1ZBKA 3T05A 2PWGA 1U5HA 2PBOA 1HJXA 4H8VA 1LRNA 5BOOA 1NWSA 2PLKA 5CLWA 1B57A 4CCDA 3CB3A 1B2YA 3P82A 2WWCA 7A3HA 1EYWA 3QY8A 3CZ8A 4KCWA 1CNVA 3WQ5A 4FOJA 4MNMA 4KGLA 4TO8A 3VIIA 3TQPA 1PL9A 4GXWA 4M6VA 4DUVA 3NL2A 2BHUA 4EF8A 5C2GA 2O4QA 3OZYA 3DFOA 3WNKA 8A3HA 3GC2A 1WPCA 2J88A 4LAZA 1CTNA 2ZUNA 4QGCA 1CENA 2C1HA 4TR9A 4JBRA 4YWIA 3S5NA 4DBUA 3NQDA 3TH6A 1QPQA 3CASA 1T6MA 4RDVA 5A1AA 1V0NA 2YXXA 1VJSA 1K9FA 3AXIA 4YCPA 2ALDA 2DT0A 2P0OA 1W6TA 1K4GA 1E0TA 3LTYA 2PB1A 4MY9A 3WQGA 4KH2A 3CS2A 2EPMX 2Y5JA 4NI8A 3CH0A 1H7RA 1V6UA 1D2KA 5EYWA 3M46A 5D38A 1RALA 3CIXA 5EMMA 1RQHA 3DENA 4GBUA 1TJPA 4PMNA 4W84A 4GZIA 2NQ9A 5AC7A 4HA1A 4HB7A 1TWIA 2HQAA 5LYRA 3NVTA 1KXQA 1UP2A 2VX4A 4IIHA 1KGUA 4WDUA 4I9JA 4HSHA 5CZKA 3M43A 4GQRA 3LPFA 4K3ZA 2BODX 1SVDA 2XVLA 3PUGA 1P7TA 2BLEA 1QNOA 4V2XA 3PBUA 1S39A 3GXDA 1RXOB 1FWFC 3CM4A 4QISA 4M6UA 2ZX6A 3FY1A 2J7BA 2DZPA 3WQVA 3AROA 1Q6LA 4GH3A 3W7MA 3EOEA 3A24A 3A5FA 2ATSA 4H9MA 2QVNA 4MZ1A 2ZXAA 1NTHA 2CWNA 2QCFA 4MF4A 4F0HA 2GJLA 2RKXA 3EDFA 3PC0A 4NG3A 3SR7A 1O5QA 1ZCCA 2QUVA 1UMYA 3E3HA 3ARWA 4JTAA 1QW8A 1JZ5A 3T07A 3KTSA 1FCBA 1L6YA 1J4EA 4Z2LA 1OX4A 1UZ4A 4UZUA 1JPKA 4I8DA 1QASA 2RDUA 3QY6A 4AWSA 3A9BA 3OLGA 4EX4A 3MUCA 4Q8OA 2WBKA 5HJLA 2E5BA 4UFKA 3ABOA 1IR1A 2QKFA 3BV4A 2DSKA 4JS3A 3DYOA 3EOSA 4O1CA 4HZ6A 3VOJA 2Y8UA 3MANA 3L12A 4YYCA 1EGZA 3BCJA 2CYGA 3W74A 1ICSA 3W82A 3CZJA 1ITQA 1XGEA 1O5XA 5FJUA 4AVFA 5AYXA 3WLIA 2PS2A 3UPWA 3LHUA 1CI1A 2PAJA 4NNCA 5GVJA 3SAZA 4GPNA 1VRDA 3B9AA 4PUUA 4RV8A 3MBDA 2ZYFA 3ZR4A 4AZBA 3SCRA 1RBOB 3G1RA 1VFFA 5EFFA 1JNDA 3AYSA 3QF0A 1Z6KA 1DIOA 5HJYA 1DJQA 1FY6A 2E6YA 3BO9A 3UVIA 5A8NA 3R0KA 4HJWA 1JCMP 2YR1A 1FWBC 3I65A 4ES4A 5BRBA 2ZUSA 2ISWA 3W24A 3VOFA 1WAWA 1W1ZA 2ACUA 3ZFHA 3SCNA 1RY8A 2KAUC 3NA8A 2NLIA 5G2HA 3UFYA 3RUBL 1ZU8A 4AIBA 3D3AA 1MZHA 4YMZA 5HMSA 1HQTA 4S3JA 5ENLA 3RLHA 1CGWA 1ONRA 1CGYA 1DWHM 3QGVA 1HL8A 2GPTA 3LPGA 4C6BA 1KQYA 4RNFA 3GFXA 1IZKA 2RGMA 1K70A 4D6HA 3F5JA 5IBXC 3ICJA 3WQ6A 4NZ4A 1KFWA 1O7AA 2Z6JA 1XBZA 3W37A 3AWOA 1E73M 1LG1A 4V27A 1IQ8A 4JL2A 4IMGA 5TD4A 1KC7A 4OHQA 2BASA 4LYKA 5A6MA 3GTHA 4UOQA 1QNRA 2Y5EA 1FHLA 1YEYA 3RJYA 4GKTA 4HTBA 5I3JA 2PC4A 1R47A 4R9OA 4PBGA 3B05A 1AQFA 2X8RA 3U4AA 1O95A 3UZXA 3T2PA 5KZMA 3ZS4A 3U4FA 2ODOA 4C1LA 3VIOA 1GZGA 4N9DA 3KCOA 4B9YA 2EG7A 1VPYA 3S4TA 2V5JA 4PMVA 4OECA 1V02A 4H6KA 2FJUB 4AX6A 3N15A 1J0HA 2NUXA 3G77A 2V5LA 1FXQA 2BFGA 1T40A 2GGHA 3VX0A 1RP9A 3XIMA 4QR6A 3QMSA 4O4VA 1SQ7A 4RW5A 1EP3A 4P7OA 2V2DA 2Z7KA 3APTA 5HMEA 5GNXA 3GU1A 1M7PA 3RLGA 3DI1A 4RL3A 2QAPA 2OZ0A 3N3TA 2ZDSA 1GJWA 2PWHA 2OJPA 3E0IA 3IIZA 3O06A 1W5OA 1OT1A 3WNNA 4BWLA 2HBVA 1Y5WA 4AY8A 1SPQA 5JH2A 3IGHX 4B4HA 3C2VA 2PF8A 4YN5A 1ZFJA 4P7NA 1U1HA 2CW6A 3SGUA 1M9HA 3QW4B 2E68A 3P3BA 4LH8A 1TX2A 3OLIA 5LNRA 1WDDA 3TYCA 3A23A 4PYSA 3WO8A 1H1ZA 3MCNA 3WDQA 4FX7A 3MUXA 3URBA 3T2OA 3E96A 5H8UA 3FDGA 1YTEA 1AVAA 2A21A 3EX3A 2QMKA 1UYQA 1TQJA 4C1NA 2OKTA 1TV5A 4ACYA 2GDVA 1UBSA 5GNZA 1M04A 3UXDA 3W7HA 1EHAA 3A6OA 1Z69A 2ZX7A 4H2CA 3OYXA 2D3LA 4HU0A 2DUXA 2J78A 3LK6A 4ONVA 2C13A 3GHUA 4Q4RA 4W88A 2A4AA 4PE8A 3TU9A 1TE6A 2CHRA 1WDWA 2PGRA 7XIMA 5HANA 1XQLA 1V8EA 3GTNA 1QNSA 1V02E 4H7ZA 3ANUA 1YXDA 1I9CB 5HOSA 4EF9A 1P7TB 5G1YA 1S5VA 5HNNA 2QLYA 4EAMA 2MUCA 4JKMA 2D73A 4RDWA 5C54A 1I2NA 1NQ6A 4PFMA 5AYIA 3LU2A 1P6CA 5MKGA 1DXIA 3PPFA 4L9ZA 1W9BM 3K8LA 1ITUA 2WHLA 4HN8A 4M24A 2EO7A 2CEQA 1KFJA 3SW6A 4B3LA 1GZ1A 3LSCA 1S2TA 5DMYA 2FZ9A 4I90A 4KERA 4D72A 1OF8A 2VGFA 4ZQOA 1VD6A 4UTMA 1P1MA 1PZ1A 2BV9A 2R94A 1B3VA 2WMKA 3M1ZA 3CV7A 3F5LA 4KWSA 1A3HA 2W61A 1UWSA 4IPNB 5C70A 3TCSA 3WLHA 4IFRA 2V9DA 1WKYA 3NL5A 4IICA 1NWUA 4S39A 3UU0A 1NVMA 3N2TA 2R1PA 4JTQA 2G4JA 4A8RA 2CZFA 1KTNA 3W87A 1P5BA 3EKGA 2FMOA 3DFQA 1CIUA 4GQQA 4GQBA 4LAMA 4BI5A 1LQ2A 1GKPA 1V6VA 3SQLA 1GVEA 1B9BA 4QIUA 3JR2A 4F2BA 1PCWA 1XBYA 5BU9A 1QHPA 4WSKA 1LQ0A 3DU0A 4ZO8A 4CNOA 1XLJA 4LW7A 3AIUA 4GZ7A 2GVYA 1I2QA 3V1HA 3CWNA 5BRPA 2ZZ1A 4GH1A 1PUDA 3T09A 5LA1A 1VR6A 4H4IA 4MWAC 1XXXA 2OPJA 4BI7A 3ZLGA 2F6KA 1FHDA 2CHNA 3TAOA 3FAXA 2BZNA 2C1GA 3CAVA 1ISXA 4XSLA 1XS2A 2WYSA 4DAFA 4C6CA 1X7IA 1YNPA 2VRKA 1LF1A 1AH0A 2ZBTA 1J93A 1XYMA 2OGYA 1AJZA 5KTLA 3UG4A 1H5YA 3L0GA 1UD3A 3H4GA 1VFOA 4YIWA 2E9BA 4POCA 1C91A 1AQ0A 2X0YA 3TMLA 3BOFA 5BXRA 2QDDA 3IJ7A 2O9OA 3DC0A 1BYCA 3KBNA 1JULA 4HNLA 4L56A 1Y5VA 5FJOA 4JICA 3IANA 4PB5A 1D3CA 4EVZA 4F4RA 1BYDA 5I23A 3W72A 1GVOA 4J3TA 1MUCA 2R1KA 2AKMA 2ACQA 3KBVA 2HK1A 5FF0A 5U7SA 3WLLA 1JPHA 4H6EA 1GTHA 3FVDA 5REQA 5IOBA 3N1AA 4IXHA 1EPVA 3BDKA 3LHWA 4GX9A 4DWSD 2WNZA 4RK8A 1TSIA 3AXKA 3LQGA 1F9CA 4YVXA 1CPUA 4J2MA 3QYSA 3QHMA 3EBVA 4LVFA 4J9JA 4M19A 5AZ0A 3H23A 4LEQA 1B31A 1IT7A 2IQDA 3QW3A 5G1TA 4BS0A 1H11A 4IMFA 4INFA 3MP5A 1ECQA 2FGBA 3CBWA 1Q65A 1GJUA 1MEIA 1TTIA 3K1GA 4Q32A 3GNPA 2WHKA 1C9DA 1NM9A 4PCPA 2OLSA 2BHYA 1U2YA 2Q3OA 2PGEA 1PYMA 2ZX5A 2QGHA 5I00A 3NO1A 3P74A 1IIHA 4HNTA 1YBQA 2PLCA 3H6OA 1FQ0A 1BG9A 1B3ZA 5HULA 4LV9A 3PZIA 3WJXA 2FTYA 3H53A 4AFYA 1JYWA 3PF3A 4CNTA 4B2DD 3HQPA 4MZ8A 1V6WA 4PRRA 2A0NA 4A3HA 3L5AA 3TYAA 2DUAA 4DXXA 3ONCA 2HVMA 1PZ2A 5T26A 2WVSA 1OT2A 1V3HA 4GNKB 4P7LA 1ONWA 3CAWA 4RE4A 2FB2A 3ITTA 3B8WA 2PDJA 2A79A 4AG0A 4QG8A 4CEUC 1H61A 4EP8C 4ADTA 2FPVA 3O6DA 4JY9A 3VTRA 1OEPA 1XCWA 3MUZ1 1OM0A 4E2BA 3M0IA 3W73A 4YJ5A 4MNJA 1IEXA 1TPEA 2ZOXA 4UCGA 1ZUAX 3KL3A 3TMQA 3B8IA 1FWDC 1M7OA 3QSTA 4ZOBA 1TPFA 1KRCC 4HK7A 3Q65A 4NAFA 3CL8A 3AZTA 4WDTA 2OCZA 3RIKA 3CQIA 4O57A 4A3RA 2C7FA 6TAAA 4C1NB 1I4NA 3A21A 2IKJA 4DWSA 3FEQA 3UESA 3GNNA 3T1GA 1R2SA 3VILA 5HWNA 1GYNA 4QLKA 1NAL1 2D0HA 3LX9A 1HKVA 4QCEA 4NNAA 4S3KA 1YE4A 4N4QA 1EIXA 4B5VA 3TR9A 1K8XA 2RDWA 2RGLA 3LMYA 3TWBA 4YNGA 3WDJA 2UZ9A 3AHVA 3NL3A 2VHLA 5D2XA 2I5GA 1A4LA 4RDYA 4AZ7A 1QNPA 1TV3A 3VKJA 3CUZA 3LHZA 4NZ5A 4PUJA 3GU9A 3W01A 1B3XA 2DVUA 2A3LA 3KP0A 2ACRA 2H3DA 2O0TA 3WBAA 5MKGB 1HJUA 2Z2AA 5C5YA 1OX6A 4PTWA 3ARQA 2VC7A 1GQJA 2WM1A 1EJTC 3NPWA 1PX3A 2BXVA 2ASHA 3EB2A 3M0YA 1Q85A 1MRAA 1UWRA 4LV4A 1FRBA 4OIFA 4MVAA 3KTXA 2TODA 4GJIA 3GXMA 3WUFA 2E5CA 5LZLA 1PIGA 2NQZA 5GPRA 3O0FA 2A3EA 2PDFA 5I3KA 3UWQA 4OOUA 2F6XA 3C0QA 4IX2A 3VFLA 4JTRA 1D8CA 4IIGA 1BGAA 1R5YA 2QNEA 5FF3A 1BPLB 4HK6A 5AC5A 2PDKA 3F5KA 2PDQA 2ZZ6A 4K1WA 1NH6A 2X40A 4UTWA 1PDYA 1KTCA 3SSJA 1OY0A 1AMYA 3PG9A 2XINA 1UQYA 3PSWA 1F76A 3VD7A 3HU7A 4UFLA 2YL8A 1FTXA 4NJJA 3VD5A 1GVRA 1KFKA 1YXCA 1QK2A 3W7IA 3Q58A 5HNUA 4W5ZA 3OZOA 4A05A 5IDIA 2IPFA 1R7AA 2VZTA 4JTHA 2Y7GA 2F84A 3BTNA 3KOYA 5CZTA 2IW0A 2CBJA 2ZIDA 4NUWA 4WJXA 3SUTA 3RPTA 2FPYA 3W2LA 4LALA 3BAWA 2W92A 3GS6A 4BQ4A 3BAKA 2QGYA 2A7PA 2PZNA 3GB6A 2YX0A 4P61A 1S2CA 1E0UA 3NSNA 4MUZA 3SCQA 2QDEA 3O07A 4NJGA 5LIWX 4LNYA 1E9LA 1S3TC 4DHGA 3DHUA 4AMAA 5KSWA 2GLKA 3FFSA 1K77A 4C6QA 2AKZA 1JZ7A 2VD9A 4EXAA 2VR4A 1TZ7A 4KIRA 3EDEA 5I0DA 1S2UA 2EPHA 3P5YA 5ABTA 2J8GA 3UERA 4DYEA 5K4XA 2CLEA 2XM1A 3QR0A 1DE5A 1Q13A 1VFLA 1PIFA 1TVNA 3MMUA 4XISA 2GSHA 3KFTA 5EGRA 1TR9A 2EAWA 1XD0A 2VEPA 1SMAA 3IGUA 1C9WA 2Z1BA 5KITA 3L7RA 3M0HA 3QZAA 1VFSA 4HA4A 2ZE3A 3VX1A 3H2FA 1ECEA 5REQB 2DQXA 1N2VA 2DU2A 4N6EA 3B04A 4LX4A 2QCGA 4GMEA 5BCAA 3MCMA 2X2YA 4M1BA 4O53A 1EJXC 5B80A 2CLFA 3W27A 4FNUA 4LAOA 4ERIA 2QF7A 1GOOA 1R9YA 1HJWA 1GNXA 2NV1A 1DQWA 1OZQA 1YNYA 4G1KA 1OCBA 2FLIA 3FGCA 2W67A 4NAEA 1A5NC 1FWHC 4X0VA 5CBBA 1L6WA 2JK2A 1EC7A 5M03A 3WBXA 3EWZA 1YBQB 3MUAA 4R9XA 1J6OA 3BMWA 3AOFA 2EG8A 1GYLA 3ABRA 1KD0A 1BSLA 3IS4A 1EP2A 1A5UA 3RCYA 3H26A 3BW3A 4DUOA 4R85A 3S9ZA 4K7YA 4OV9A 4LWWA 1KLYA 3WDHA 3IGSA 1LWJA 4KFPA 5EMLA 4GACA 5AYBA 1XIGA 2O4MA 4V1YA 4YHEA 1UR4A 3GDBA 1FFRA 1ONEA 3EEGA 1OHLA 3R13A 3BLPX 1H49A 3AIRA 1XICA 4QNWA 1X8FA 4IMCA 5TBOA 3NQ8A 4J35A 4UQBA 2A7RA 4IF2A 2PDIA 3CV1A 3WNOA 5FOOA 2YB4A 2YBTA 1EUNA 3PY2A 3T8LA 5EBAA 2DZVA 2I5QA 3H2OA 5K4ZA 1IIGA 2PMQA 3STPA 3V7PA 2GJPA 2WSYA 3B9OA 2PDNA 5EY5A 1EO5A 4NAFB 1E9ZB 4F48A 1E0VA 2BBFA 1ZTVA 1TMQA 1XYAA 1US0A 4PMRA 1P48A 2GL5A 3CLMA 3C52A 4MPQA 4DWSB 4AHPA 2YIHA 4GO8A 2QYGA 4O1EA 4ZA0A 1JUEA 4UFJA 4YTTA 4HOXA 3QY7A 1F2JA 1JCJA 5CAHA 1BRLA 3W7OA 9XIAA 3RX3A 2PDGA 1TTPA 3N14A 3S42A 1W8SA 2VO5A 2FFCA 4KWUA 2OSYA 3UJRA 2VWSA 2YYUA 1SGJA 1XUZA 5CJMA 1VCFA 3MB9A 1VQTA 3E2SA 2PD9A 4N9EA 4C5YA 5GJNA 4XKYA 2XFWA 4FZIA 2HPMA 5F4SA 3H7VA 4KIEA 1IXNA 5FACA 3GH5A 3CXOA 4L1WA 3O7UA 4UFHA 3LS9A 3KAOA 1SR9A 5DN1A 3EA1A 2BY3A 1BAGA 2FHCA 3FCPA 3EOOA 2VEFA 3WK1A 3UG5A 1HXJA 1AD1A 5G4HC 4AQLA 2OEJA 3QHOA 4FNRA 4L80A 1VYSX 1QXLA 4N4PA 2JFEX 2Y2WA 2XYLA 1UKSA 1XG4A 5HQEA 3W84A 3SRDA 3W9ZA 4UR9A 4GUFA 3EOLA 1TPWA 3RHGA 1W3NA 3QFEA 4B5TA 4LSBA 2XFYA 3WJWA 2YCEA 1GKQA 2WC7A 2HNHA 1JGIA 1XCXA 1LLWA 1SSDA 2VGBA 1E6RA 4WCJA 3AIQA 3UQNA 4J27A 2PRHA 1H7WA 3ITXA 2GVGA 3LPOA 4D1IA 2WV8A 3JUGA 1VC4A 3GNOA 1JZ2A 3RDKA 5E6ZA 3TXVA 2J6XA 4QJ1A 4MSSA 4NXSA 3RM4A 1GOIA 3N12A 3RXZA 1K7FA 5AYZA 4M7SA 2P8BA 1OFDA 2DH3A 3NWRA 1TX0A 4GC3A 1X39A 2J9ZA 3FEMA 5BYWA 1RLCL 2NWSA 4WSHA 2CU0A 2GSJA 2Y61A 1N8IA 4HHLA 3VOGA 7ODCA 5CAKA 1Q6QA 1XW8A 4G7EA 3N34A 4WGHA 3NXLA 3S83A 4DX3A 4LY4A 3THUA 1AL8A 1DWJM 2VDGA 1KKRA 3KRZA 3UPBA 2WNNA 1AODA 4MJ2A 1P4CA 3BJTA 4B5NA 1Z44A 2JIWA 4H7CA 2VFFA 4PUWA 4NP7A 3R94A 5H8MA 2Y70A 4Q8WA 1XR2A 5I3HA 1KCLA 1BTCA 2XM2A 2Q8LA 2V67A 3LV6A 2WVVA 3GSMA 5T91A 1V3MA 1U83A 3HF3A 4LFYA 4K8HA 4O1DA 3W38A 5LHFA 1RCXB 3DHFA 4W87A 1KM1A 3KL0A 3U2CA 4RKAA 1YQ2A 5KETA 1Q8AA 3QQWA 2PDPA 2Q3RA 1XLHA 3FYPA 3TSDA 1D7FA 1P0EA 3GG0A 2ZDRA 4UC5A 1UH4A 4Z1BA 5CPSA 5GJPA 5A6JA 3L4ZA 1YRRA 2V2HA 2YZRA 4QE1A 5L9FA 1NP0A 4UCFA 1KXTA 1UMLA 3I7QA 4AVNA 2C71A 1CGTA 2G95A 5IBXA 4IZGA 1QJWA 2PUZA 3K1DA 5E5CA 5D8ZA 1SJCA 2CFFA 2QMJA 4ATLA 1HIZA 3O0KA 5D8WA 3IJDA 3T42A 1YE6A 1AG1O 3BV7A 1MEHA 4RZBA 4KPLA 3MT1A 1JUBA 4XBSA 1O5KA 3QVQA 1T99A 1KFEA 5E6YA 4S3GA 3M44A 3PBWA 3TN5A 3WDPP 4YTSA 4DZAA 1VEOA 2Y4SA 3FGCB 3VIMA 1VBHA 1Y7VA 1KRMA 1RR2A 5JMUA 3LCGA 3VC5A 3WCZA 4CNUA 4Z2HA 1Q3NA 5C6MA 2OG9A 3FDKA 2VMFA 3L2LA 2HXTA 1XFCA 1XIHA 3L5LA 3ME3A 3B8DA 5DXYA 2YLLA 3GVVA 1Q6OA 4HMEA 4XBKA 1YW1A 4D8AA 1YPIA 3LV5A 3RRAA 3AMGA 3N9KA 2Y1HA 4R7WA 4QAWA 4H19A 2ZZ4A 3ZT6A 1ZLPA 2PDCA 3P6LA 1GCYA 3OLEA 1DJWA 3QOMA 4LF2A 3SSZA 2ZZ7A 1XIBA 3FYOA 1TVLA 2Z2UA 2ADAA 2WXDM 5CJNA 4W4QA 1TJ2A 5I07A 2HPIA 1LLZA 2WM0A 5GJMA 3ZT5A 3GIQA 3LHTA 1GG1A 4HPJA 1OC5A 3GR4A 4ZMGA 1BVNP 2QULA 4HMDA 1LOSA 2WMIA 1DP0A 4N42A 1WXZA 3TIMA 3W26A 3V5OA 1AZ1A 1YMYA 4O18A 4Z1AA 5G4WA 1E6NA 2WC3A 3UWZA 4YYFA 2XTKA 3HQ1A 4F40A 5IRPA 3A4JA 3PG8A 1R8LA 3L67A 4JGDA 4GC4A 1GW9A 3IUIA 3L0KA 4PRTA 4ZCWA 1BQCA 3WQPA 5BW6A 3RR1A 2WBGA 3WQFA 1V3IA 1PTAA 5A6KA 3CIVA 4IPIA 1YTDA 4AZCA 4WOZA 2J8FA 3IWPA 3APGA 1SFTA 3JVAA 4ADUA 5C2CA 4DJDD 4NASA 3ZO9A 4HGXA 2NT0A 1BRLB 1QI3A 2PTYA 4JYFA 1MWOA 1QR7A 1QWGA 3WQWA 1ZY9A 2FH8A 1OF6A 1ZJBA 1O6IA 3ONBA 1LL4A 4XKYB 4LANA 3BCFA 4HMCA 3NQBA 4XK2A 2GQAA 1U5VA 2G8ZA 4AHQA 4XZBA 3OP2A 3THCA 4E8CA 2PPGA 3HA1A 3IV3A 4XAYA 4X9YA 4K8EA 5GQBA 2QUNA 5M1TA 3ZXWA 4XAPA 3OBKA 3HZ3A 1EQPA 5BMXA 2J77A 2V2CA 4NVTA 1XG3A 3ZZ1A 1VENA 2WKGA 3U3HA 2FZ8A 1RUSA 4JHMA 3OVQA 2V81A 2GQ8A 2Z1WA 1WOAA 3GYCA 5HUPA 2ZX8A 3ZVIA 3AS3A 5TIMA 1UOKA 4F2UA 1FWNA 3HM7A 1HKJA 4QS6A 4JYDA 3V1PA 2FH6A 3LI0A 3NURA 1XLCA 4IH3A 1X7FA 4DPQA 1OFQA 2Z1SA 1BHGA 3PPCA 3KL5A 4JQ1A 2GGGA 3IRDA 1UWAA 4Q6JA 1V03A 3K5XA 1E55A 1ZAHA 2BVYA 3WLPA 4L64A 1Q6RA 4YS1A 4RZ4A 3UCDA 5DQPA 1OGSA 1EQCA 4D8ZA 1HO1A 3KWSA 2W66A 4WRHA 1SUXA 5A6BD 2KX9A 1FH7A 3WMCA 3AHTA 1XGDA 1EXBA 3FXYA 1FKWA 4K1GA 4XZ9A 3VC6A 2VRQA 5BOFA 3CC1A 3I4EA 4IJCA 1O4UA 3NZRA 2QCNA 1I0DA 2C6QA 1S38A 4JTEA 1UCWA 4GIRA 1UB3A 1GUVA 1DQUA 1PAMA 3FHAA 4GIYA 4G7EB 1J0YA 4LS1A 4LVDA 3AALA 1RBAA 3C0LA 4JL1A 4GRSA 1R30A 2CC0A 3P61A 3MCOA 1S2VA 3S46A 2NLYA 4PUKA 3S47A 5DMMA 1AUSL 1LCOA 3M5VA 4XVEA 1ADSA 2PRMA 1K6AA 3FXGA 4PSRA 4OBSA 4WY0A 5T8GA 3CIWA 1LBMA 4N9CA 3W1XA 5E0FA 3H21A 1IE7C 3GKFA 2WVVB 2ZA2A 3LXAA 5EMYA 2Z26A 4MWAA 3GH4A 1HP4A 1OCNA 3KOZA 4PUNA 4Y6GA 2QUTA 5FJTA 2WPGA 1MVYA 2GVEA 3N04A 1DYSA 4O50A 2XVGA 1EF2A 1MNZA 3GQYA 4OU1A 4HNNA 1VH7A 1CGUA 3PJUA 1A3XA 4IQEA 3V5CA 2WVUA 4EXBA 2VEGA 1TUXA 5ABHA 3LA4A 1EWEA 3WF0A 2FVMA 1K7XA 2XSAA 4ZQMA 3EWCA 1R38A 4L6DA 3HN3A 4UIOA 2PDHA 3HBLA 1YPXA 1I0BA 4NJKA 3LCIA 3MA8A 1YHTA 1XSIA 3H2MA 4GLEA 4P8VA 1I2PA 4ZSTA 3A12A 1XLLA 2X0SA 3TNBA 1FDJA 2XH7A 5KINA 3WL1A 1GT8A 3FK4A 4MB4A 1E5JA 2Z27A 5CH9A 3GW3A 5K3VA 1YYAA 2BS9A 4CVWA 3PHAA 1C29A 5E9AA 1TV7A 2FQIA 3UETA 1G4TA 3W7LA 4NZCA 1TPC1 3G1SA 2OTDA 4PMYA 3VIGA 1GVSA 4H8NA 4RNHA 3M0MA 2WZEA 2OMAA 4BKNA 1JL8A 4UNIA 1EL3A 2B81A 2OWCA 3B4UA 4G9PA 2G3IA 4N2YA 2DJLA 1G67A 4L5ZA 2C79A 3EWBX 4GVFA 3VVGA 2XVNA 4FXSA 5DY3A 1B1YA 2YDRA 4CVUA 3WNPA 4XO7A 2NX9A 2YL5A 3M16A 1W37A 1EZWA 3DGRA 3KRUA 3KOXA 3MYOA 2O7QA 1JCYA 4D6IA 3IACA 4GVIA 1X98A 3VDBA 1VBUA 1UR9A 2PWVA 4MWAE 1UP0A 2QCLA 4S3CA 2RDXA 4DBWA 3N2MA 4F2TA 4IOTA 1UC5A 4AIOA 1MW0A 2XIQA 4I7UA 4FS9A 2VWTA 4PL1A 4JN6A 2WMIB 2VJXA 2YL9A 4BFAA 1ODZA 1CGVA 1L9WA 1XDJA 4EKJA 2Z25A 3NQGA 2PRLA 4XZLX 5JXQA 4HNUA 1KBJA 2V30A 3PTMA 3KRBA 1FFQA 4M81A 4E5TA 3PNUA 1TRIA 3R1ZA 1OVDA 4NXKA 3IARA 2YA1A 2YLAA 4OUEA 1ELSA 2CLOA 1UA3A 2XDFA 3GHSA 3R43A 4HU4A 4W7VA 3SQMA 2IUZA 2DGAA 3NZPA 4AZCB 4JTJA 1H62A 1KNWA 1R86A 2Q01A 4F79A 4MGGA 2D0FA 3TWAA 3C8FA 3EGJA 1EGVA 3TTQA 1E6SM 5FA5A 7ENLA 3UXAA 5HNTA 1DIKA 3BLFA 1OWQA 1HVXA 1HT6A 2D1ZA 3V35A 2ZRUA 2G3NA 5BZAA 3W29A 2W27A 1TWDA 1TIMA 4ALDA 4YLWA 1UWUA 4PTVA 3EWDA 2BY0A 1R0MA 2EHHA 3HG3A 4ICCX 4WXYA 2RHGA 4QG6A 3H22A 5CZJA 3CMJA 1XCFA 4DI9A 3VNDA 1XBVA 1PE1A 2CESA 3BARA 4F3HA 5H2ZA 1KXVA 4NZ3A 2DV0A 1TB3A 1I8JA 2ZE0A 3R12A 3TFXA 4DAIA 4GG9A 1HFBA 1B3YA 4A3YA 3I10A 1KB3A 2FMNA 3NIYA 1KLZA 3OG3A 1RQEA 4Q4MA 2FVKA 1SO6A 5D03A 1GVFA 4F0MA 5EMUA 3REQA 1GOQA 3AISA 1OD0A 2I56A 3C5QA 2W9MA 2GVLA 6CGTA 3CAQA 4A4AA 3RRXA 4LPCA 2ZCGA 4JDBA 3DFPA 1TV2A 4KKXA 4A8NA 1W91A 3SUSA 2BVDA 4QLLA 1W3KA 4JFUA 3COTA 1NDYA 7TAAA 3THQA 3M0KA 3OHIA 3ZSTA 1E51A 2JEPA 1OFRA 3NYDA 5FAJA 1WQ5A 2QV5A 1C93A 3PBVA 3NO5A 5HPCA 2BDQA 1IT0A 1UP3A 3NQ2A 4G6CA 5JQ9A 3L68A 4ZR8A 4H7VA 1IF2A 3BVJA 5F4WA 1SZRA 2I17A 2UY5A 1UC4A 4RW3A 1W2VA 1P0BA 3U5YA 3NEVA 3HG5A 1ZSXA 4GHRA 3E0VA 4FA3A 1JQVA 3GO2A 3L5MA 2OODA 3W2JA 2TPSA 2WJDA 3N25A 4JN8A 2CCRA 4UTLA 3NGFA 4JY8A 4LRTA 4R7JA 1EOMA 1WB0A 4K7VA 4WY0B 3FA3A 5EB8A 2ZUMA 2VR5A 2PP0A 1DJNA 1I60A 1OG6A 2HS6A 4QROA 1VBRA 3AAMA 4E2VA 1V93A 2QPXA 3W83A 4MWAB 2VFHA 4R3UA 1XKYA 2XN0A 4J3UA 3WKZA 1REQA 2VOTA 2O56A 3OBEA 1EB3A 5E1QA 3H2NA 1S5MA 1E40A 1SFLA 1IEWA 4FLRA 3VOIA 3NQFA 3T08A 5DEZA 1VAHA 2ICSA 1OBAA 3CHDA 4ATDA 4L4OA 3CPUA 4WHBA 3BSMA 4REQA 2X0HA 1XHGA 3BZJA 3GDKA 1AD4A 2GOKA 1UKTA 4PGLA 1H63A 4IP5A 1M6JA 1OD8A 4ASTA 2JF7A 3ZOAA 1R3TA 2J4GA 5DO8A 1R2TA 2JKAA 4ZFCA 1C7TA 4DF1A 1O5RA 3M7WA 1H2JA 1L2UA 3OBAA 1GG0A 3WLSA 3CQ0A 1JZ8A 2WLZA 5EMKA 3R8RA 1KW1A 4XZMX 5FEPA 3QLLA 2HMCA 3WF3A 3M0LA 2B7OA 3NR0A 5HDRA 1LP6A 2XUCA 1DIEA 4GOAA 1UROA 5I2UA 4MY8A 1WAUA 4JFTA 2C8NA 4Q3MA 3U2EA 5HA7A 2E0PA 4D6GA 2WMHA 3ZM8A 3LZ5A 3QMTA 1VLIA 2OELA 1LT8A 3AXHA 4N9BA 3SRFA 2PDYA 2GWGA 1JF5A 3E02A 4ZTYA 1LOLA 6XIMA 4UBPC 4YCOA 2I5IA 3S8HA 1JDEA 1P0KA 3IAQA 2PDLA 2L5HA 2B4GA 2J79A 4W86A 4DJED 1R85A 3U9IA 3QBUA 5I7GA 3M5YA 1VJZA 1W9XA 1W31A 1NJJA 4PN2A 3RPMA 2I9UA 2D20A 2WMFA 4C5ZA 4P8XA 2DZBA 4NY2A 1CYGA 2OZ3A 2Z2BA 5CPMA 2PWEA 3F03K 3GM8A 1LBFA 1UPMB 3UCQA 3MUY1 4TTUA 4JX4A 1W17A 2X41A 1IEVA 2DDXA 2E28A 1BWVA 4IQJA 3HV9A 4LUSA 4DVOA 1W2PA 3S1XA 1J5TA 1HKKA 1SW3A 4RCXA 4QITA 3CUXA 3K4AA 1U33A 1H60A 3KLKA 1XV8A 3EDKA 2WANA 4IJBA 4GA8A 2Y7FA 3BLKA 4AZ5A 1KM6A 3MSDA 4JIIX 4IIEA 4GYJA 5JVLA 1XISA 5HBFA 4DXVA 3K4DA 1OIMA 2Y6ZA 5J5RA 1DVJA 4Y9OA 1RPXA 3GXPA 3QV6A 4OVXA 2TRSA 1F3TA 4O52A 4JFSA 4AYSA 3URNA 4A8LA 1OFEA 3XINA 2EKGA 1N82A 2FGLA 4GY7A 2WO5A 3UP8A 1GOXA 1KXHA 3WF2A 2IXUA 1UASA 3OB8A 2E8YA 3ATYA 2NQHA 4YVVA 1OK4A 3DFSA 3G1HA 3LY0A 1MUWA 4Q8QA 5FESA 4IM4A 3LPPA 4LQ1A 4Q7IA 4WD0A 3SGGA 1DJHA 1W9UA 5M5DA 2UY3A 2DSWA 3HG4A 1LWHA 4DWSC 2XGIA 3BG5A 4QAIA 4BR1A 5D33A 2X05A 1FBAA 5HWMA 4JEJA 3CHFA 2BXZA 1VYPX 3UCCA 3BLIA 1J0KA 3REQB 4TMBA 2R1LA 1XYFA 4GNVA 3E9AA 3MV11 1F5ZA 5J5DA 3MKCA 4C90A 2BX7A 3N18A 3LNMA 4D6CA 2HDJA 1US2A 1GGOA 2OQHA 4AD0A 3MO7A 1GOMA 4H9XA 1L8PA 2WWDA 1FWWA 3HIJA 4MLRA 3DFNA 4MAVA 1DHKA 3EPMA 2YXOA 2Z28A 3MSRA 4LUTA 3TA6A 3WUEA 5I79A 4RNIA 4L7ZA 3HG2A 5CBIA 3E1F1 4ZOEA 1GVIA 2PF0A 4KT2A 3WFLA 1B4KA 4RZ5A 4IP4A 2VL4A 3RM8A 4AHOA 3B8VA 3IIOA 4FLQA 2V68A 3CLWA 2CETA 3UZYA 3L66A 4DBDA 5I78A 3AYRA 1FWRA 4IPLA 3EZ4A 2VVNA 8XIAA 4JTDA 3RK8A 1IXQA 4HMNA 3Q45A 4FOKA 3P80A 2BWGA 2XJ7A 4X9SA 4A21A 2VKZG 4NZFA 1XLAA 4FNTA 3Q4DA 4FIRA 1M53A 4DYJA 1G4EA 3HGRA 4HPHA 1ZS2A 4DO6A 3WLNA 4PUMA 3WMSA 3O6CA 2F2HA 4FNPA 3NPVA 3TZFA 3NTYA 4IP7A 4DY1A 4YTUA 4GFIA 2C1IA 2FZMA 1B30A 3CUFA 2Q09A 2FB3A 2PDUA 5BMWA 4IFKA 4AD2A 1XL9A 5CCZA 3S2MA 4RXGA