4YVPA

Crystal structure of akr1c1 complexed with glibenclamide
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
318
structure length
318
Chain Sequence
QCVKLNDGHFMPVLGFGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAVEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C1
publication title In vitro inhibition of AKR1Cs by sulphonylureas and the structural basis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 115
structure length 318
sequence length 318
chains with identical sequence B
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2015-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4yvpA00
1X96A 3LQGA 3F7JA 3CMFA 3WBXA 2I17A 2IS7A 4QXIA 4WDUA 1LQAA 4DZ5A 5C7HA 1YE6A 1AZ1A 2ACUA 4DBSA 3MC5A 5LIYX 1AH4A 3LN3A 1ZQ5A 5JH2A 3M4HA 3O3RA 3V0SA 1PWLA 1R38A 2PDHA 1US0A 4PRRA 4YVVA 1S1RA 3UZZA 2IKHA 3UZYA 4GIEA 3WBWA 5LIKX 2ACRA 3LUTA 3R94A 2INEA 2IPJA 2ALRA 3V36A 2VDGA 4Q3MA 1ZUAX 1XGDA 2IPGA 4ICCX 5HA7A 4FAMA 1HQTA 4PRTA 3UZWA 4JIRA 3G5EA 3ONCA 4JIHA 4LB3A 3UP8A 5LIXX 4XZNX 1PZ0A 1Z9AA 1S2CA 2PDFA 2PDNA 3BV7A 2PDMA 4WGHA 3LD5A 3R58A 1Q13A 2IQDA 1EL3A 1S1PA 1SM9A 2F2KA 2R9RA 3UG8A 3P2VA 1HW6A 2PDGA 2PD9A 4XAPA 1X98A 1OG6A 4AUBA 4JTRA 1MI3A 4G5DA 3BUVA 1YE4A 2PD5A 1XF0A 4YS1A 1EF3A 2FVLA 1T40A 1X97A 1IEIA 2CLPA 1PWMA 4L1WA 2HE8A 4QX4A 1Q5MA 2NVDA 2HE5A 2QXWA 4HBKA 4XO7A 2BGSA 4LAUA 2IKGA 4LB4A 4WEVX 2IKIA 1J96A 2IPFA 2DV0A 4FALA 4IJCA 3FJNA 4GQGA 3LEPA 1RY8A 2HV5A 4OTKA 3VXGA 4PR4A 1QWKA 2ACQA 1AH3A 2PDWA 3UYIA 1GVEA 5M2FX 4GA8A 3D3FA 4YU1A 5HNUA 3EB3A 2IQ0A 3R8GA 2PEVA 4XVEA 3R43A 4EXBA 3DN5A 2PF8A 3V35A 2FZBA 1ZGDA 1QRQA 1VBJA 4JQAA 4ZFCA 1ZSXA 3H7UA 3COTA 4I5XA 2PDPA 4XVDA 4JIIX 2HVOA 2DUZA 4EXAA 2FGBA 1Z3NA 3N2TA 3CV6A 4JQ3A 3UFYA 2HDJA 1MZRA 2HEJA 1JEZA 3V0TA 4GACA 4R9OA 2P5NA 4Q7BA 3GHRA 2DUXA 1Z8AA 3M0IA 3Q65A 4JTQA 3ONBA 2AGTA 4IJRA 4QR6A 2PDYA 2PDLA 1K8CA 4YVPA 4LBRA 4FZIA 4H8NA 2PZNA 4YVXA 3RX4A 4IGSA 2HVNA 3MB9A 1XJBA 1Z89A 1C9WA 3FX4A 2NVCA 4JQ2A 4JTAA 4NKCA 2PDXA 2IPWA 4PUUA 4WDWA 1AZ2A 3LZ3A 3BCJA 4XK2A 4MHBA 4WDXA 3LZ5A 5AZ0A 2C91A 3N6QA 3LENA 3BURA 2PDIA 3B3DA 2ISFA 2WZMA 4LBSA 3GHSA 5DANA 3UZXA 3LQLA 3LBOA 3WBYA 1YNQA 2BP1A 1IHIA 2INZA 3RX2A 2PFHA 4PMJA 3KRBA 2R24A 3CV7A 3V0UA 5LIUX 3WCZA 4GABA 4FA3A 2PDQA 1AFSA 2WZTA 1FRBA 2F38A 1ADSA 4GCAA 4XZIA 3C3UA 3T42A 1T41A 4JQ1A 5JH1A 3GUGA 2IKJA 1A80A 3WG6A 4WDTA 3H4GA 2FZ9A 4XZLX 4XZHA 1PZ1A 3U2CA 5AZ1A 1AH0A 3R7MA 3GHUA 3S3GA 1EXBA 2PDUA 1S2AA 4DBWA 3GHTA 4F40A 2ACSA 3NTYA 4XO6A 3R8HA 3UWEA 1RALA 4H7CA 5LIWX 4LAZA 2A79A 2I16A 4WRHA 2J8TA 3LNMA 3EAUA 3H7RA 4JQ4A 3CASA 3ERPA 4PUWA 3UGRA 1MRQA 1RY0A 3RX3A 1LWIA 2FZDA 4DBUA 4RPQA 3EB4A 4XZMX 2BGQA 4JTDA 2PDKA 1EKOA 4ASTA 2FZ8A 3O0KA 2PDBA 3DOPA 3G1RA 5HNTA 2PDJA 3QKZA 1PYFA 1M9HA 2PDCA 4GQ0A 3M64A 1UR3M 4HMNA 1YNPA 1VP5A 4JTCA 4L1XA 5KETA 4QBXA 3CAVA 3Q67A 3R6IA 3CAQA
chains in the Genus database with same CATH superfamily
2GVYA 4B4HA 3S6TA 4E4FA 5LNSA 5HMFA 4H9TA 1C92A 3I65A 1TPDA 3KCLA 1IXPA 3GKAA 2CLFA 1W1PA 1VYSX 2E40A 4B5VA 1B90A 2X42A 4V1YA 3A4WA 2POTA 5E6ZA 3CLMA 1W91A 3VIPA 2J7FA 3WF1A 1W17A 5E0CA 3WNPA 4ZEPA 3SADA 1R3TA 4N0RA 4JD4A 1MQPA 3N2XA 2UZ9A 3WD3A 3NQDA 4AHOA 4LNCA 2ZCGA 4BI7A 5DBTA 1QI4A 3CU2A 3CEUA 1NVMA 3N3MA 2VZSA 4JIHA 3ZVHB 3LBCA 4IT1A 4MKSA 5A6TC 3W4RA 2DT0A 1ISYA 3AFBA 4PCTA 2PDFA 2Y89A 5FSEC 3LLXA 1E4MM 3HB9A 3SN1A 3H53A 2V2DA 1ONWA 3UW6A 3FCPA 4X22A 1SM9A 1XH2A 3REQB 4HYRA 4LAOA 1XI3A 3NGJA 2J24A 2ZX8A 1VBUA 3BK0A 5JQ9A 4K2SA 3FIGA 1RLDA 4J3WA 1XP3A 2RFGA 4HSOA 3S42A 2WSKA 4AEOA 2MNRA 3IPWA 3GG7A 2G37A 4MWAA 1XV8A 1OC6A 5KTLA 3STPA 1ITCA 2Z28A 2GGGA 3PG8A 5CSUA 3FFSA 1NSJA 4LAUA 4LXFA 4B15A 1B9BA 3GU9A 3FXGA 2JGYA 4UFJA 1PHWA 3A47A 3WQVA 6PTDA 1OC5A 3CUXA 2WM1A 1FBAA 1JL8A 1WKFA 3WLJA 1TRDA 1O7AA 3PZNA 3SM0A 4GI8A 3M0KA 4MIMA 5DFAA 3QN3A 4F48A 2ZDRA 4GYJA 3NDZA 2CZFA 3GH7A 3UYIA 3EOEA 1JZ3A 1L2QA 1AMYA 1EJRC 4B9YA 1B5TA 4ZOCA 1TIWA 3RM9A 3S4TA 1AA1B 2W67A 2DW6A 3GG8A 3PTKA 5KITA 1K9TA 1G5AA 3OVGA 3A23A 3QFWA 5D2VA 4ZL1A 5XIAA 1ENUA 3KBJA 4OOUA 1KV8A 2FHFA 2ATMA 1W2VA 3RDKA 2ALDA 5ENLA 3EDEA 1MW2A 1XM3A 4EF8A 2YDQA 4I8DA 3GC4A 1Q2RA 1IWAA 1UMYA 4OT7A 1MZRA 4BFAA 3V0TA 3PN8A 1PKYA 4QDPA 4DIAA 1QNPA 1S5VA 3KHDA 1WV2A 3POHA 2VZOA 1L6WA 4KCUA 1XLFA 2OYKA 2WZIA 3CJPA 2BVTA 4RXGA 2FQIA 3UZJA 3OZPA 3GR8A 2QKFA 1TUXA 3M6DA 3VMPA 4US6A 2A85A 1FWCC 4XTDA 1BVZA 1GPFA 4JTKA 5EYWA 3C0QA 1NH6A 1TMQA 4NIRA 1V6UA 3SUUA 3HGRA 5E1QA 4LUYA 3CQIA 3AIVA 3H4XA 3ZLFA 4Q7NA 4MLJA 2GJXB 3VM7A 2PDXA 1CZ1A 5I0DA 1POKA 4F2BA 2Z26A 5D9PA 2NX9A 3NQMA 3BICA 3WJYA 2WHMA 1L6GA 5AFDA 4NVTA 2HNHA 1W31A 3MKCA 4D1JA 2BZNA 1NP2A 5GNZA 4IP4A 3PZIA 4XZWA 1I75A 4MYAA 3BURA 3QFEA 5CSSA 2QCLA 5G2HA 2PDIA 1BVWA 4Z42C 4B16A 2NQHA 4LVFA 5LHFA 1DKWA 3QH2A 4Y90A 1V0LA 1QOPA 1IHIA 1A5BA 2E6FA 3TXVA 3U6WA 2INZA 3N17A 1WX0A 1QJWA 3QZAA 3UR7A 4Y2WA 3V0UA 1TKKA 3WQDA 2W9MA 3UEQA 1M7OA 1OX4A 2XISA 1VEMA 2I5IA 4NT0A 4C5ZA 3ABRA 2R1KA 4J3SA 3IV8A 4GCAA 2Q3OA 1Z7AA 3GE7A 1BF2A 4JFUA 2I9UA 1WBHA 3KBWA 2JALA 5TD4A 1EH9A 1YLVA 1WDSA 3BARA 1NQ6A 1PZ1A 5BYWA 3GXNA 3R7MA 4IPLA 1KBJA 1ZBWA 1E4IA 1VJSA 3HOJA 4DBWA 4HU4A 3FVMA 1ZP3A 1NFGA 1QT1A 5AVHA 3C56A 3HQNA 1RCOB 1O5XA 3JU2A 4ZZ9A 4IPIA 1C7SA 2AL2A 3EX6A 4O4VA 1KCZA 3CUJA 1XBYA 3EAUA 3N9KA 4DJED 2ZXBA 4MZ1A 4Y7EA 3CASA 2VWSA 2QR6A 2C16A 3RMJA 1RY0A 4A3HA 9XIAA 4QFUA 1MWOA 2ZTJA 1IE7C 2ZE0A 3EOSA 1NJJA 2YSWA 4FX7A 3UJFA 2QEZA 2Y5JA 2QCNA 2OLAA 3BQ5A 4CD4A 5DMNA 5HNTA 1H1NA 3GIQA 2E9MA 2OJPA 2YFOA 5AYXA 3ARVA 2BWGA 3E0VA 1UG6A 3NPUA 1H62A 3ZS4A 3RFAA 5MKGA 4S3FA 4E38A 5HMDA 4JYEA 4XKYB 1QAPA 3IIZA 2CBIA 4WHBA 5FCZA 1XYCA 4JTSA 1FP8A 3R2GA 1HL8A 1E1FA 3BG9A 3VCCA 3CH9A 4PYSA 3DX5A 3VGGA 3B0XA 3VD4A 1WOAA 1XSKA 5HQEA 1AQMA 4RK8A 2V63A 4O19A 3E2QA 1J0YA 4GXMA 1PIGA 1W32A 1J18A 4ZOBA 2OR2A 2CC0A 3CEPA 3RLUA 1FH8A 2PLJA 3TOYA 1GOXA 1UW9A 2Z6JA 2VX5A 1G0CA 1C93A 1SSDA 4MJ4A 1U5VA 4EX4A 1OJXA 2WKGA 1UQZA 1A49A 3MCMA 1K1DA 1S1RA 4TX8A 3EX1A 2WMKA 4OV9A 5G4WA 1GW9A 3OJGA 1DV7A 3U2ZA 2ALRA 2PGWA 2BY1A 1EC7A 1ECQA 4O8RA 2A6LA 3RPTA 2OZTA 3BW4A 4PRTA 1QPKA 4JIRA 3G5EA 4QDMA 1VB9A 2BXZA 2PZ0A 2YBVA 4QSFA 1SO4A 2HS6A 1RR2A 1MEWA 3ZVIA 2WB5A 4PA8A 3GTXA 4IMGA 4LYRA 3C2YA 2DQWA 2GOUA 3DG3A 1NDZA 5A2CA 3WQCA 3UXDA 1R85A 1TELA 1C7TA 1DIDA 5CQ1A 2Z1WA 4WD0A 2JIWA 3PS7A 1TPC1 2G95A 2VEIA 3KBNA 4M80A 3W7KA 3AC0A 1AG1O 2GVJA 4Y9MA 1OYAA 3W7GA 2OYLA 4KFPA 1E3ZA 2YKKA 3M5YA 3VOCA 2DIKA 1LG1A 3TA6A 4HB7A 4F0LA 1XCXA 3TSDA 4L6HA 1XLHA 1CPUA 3TJLA 3F5LA 2HE8A 1N8WA 4XAZA 4OVXA 1UPMB 4W85A 2IKGA 1N2VA 3SRDA 2D69A 2ZRXA 5FJIA 3VMNA 1VBRA 2IPFA 4P7NA 1K02A 1OF6A 2GVGA 1Z48A 1H1ZA 3ZT7A 2TRSA 3VKAA 1CCWB 2HV5A 4UTTC 4DNHA 4KCVA 4B3KA 4DM1A 4JTJA 3TA9A 3SQMA 2C79A 2VT0A 1EC8A 2E77A 3PZMA 1GHRA 3IVUA 2Z1KA 1EIXA 4ES4A 3W72A 5KZDA 4MVAA 2VNCA 1ONXA 1W1YA 2DSUA 4PC8A 3EB3A 1LQ0A 1AL7A 1IT0A 1FFQA 4UBPC 3CWHA 2ZTKA 1HJWA 1V6VA 4NX5A 2AMXA 1SVDA 4LS1A 2NUYA 1QNQA 2FZBA 1ZGDA 4LH8A 3NQBA 2B7NA 4HKPA 2WSQA 1MYRA 1H09A 5BMXA 4A8RA 4IXHA 1S46A 4MMWA 1YTKA 3TYEA 4U28A 5BU6A 1KXVA 4W7WA 4EXAA 1J4EA 4C7FA 5A6BD 4IL2A 2NX1A 4ZSTA 3ATZA 1XDLA 3RO6A 2DZSA 4W93A 1M03A 3W7OA 3BGGA 2Y7FA 4DWSB 1WO2A 1T5AA 1UWAA 3QW3A 2Z1VA 2QUTA 2FTYA 4UQDA 1J5TA 4HD5A 3TONA 4OJYA 4AZHA 2V3EA 4EWJA 4RXFA 4IICA 1VBGA 1BXBA 3GVRA 1K9DA 4L9ZA 4CNTA 8XIMA 4M51A 2OQYA 4U5KA 3DZ1A 3JW7A 3AO0A 4LUIA 2C71A 2NVCA 5FJPA 3EXSA 1QI0A 1REQB 2B31A 3J7HA 4AZ5A 2XVGA 4L56A 1A5OC 2ZRVA 3DDMA 3EDJA 2VURA 4NYYA 3K8LA 1JCNA 3UYCA 1QU4A 3AHZA 3UPWA 1EJVC 1Z6KA 4DAIA 2ISFA 1OWQA 1PSCA 1MXSA 5CGMA 3QHOA 2A3BA 3TFCA 4IJBA 1IWPA 3MYOA 4BKNA 3EX4A 2I5GA 2OU4A 3FVDA 4CUCA 4O1AA 2R1PA 3WDQA 1TR1A 1RQEA 3B4YA 2C18A 4LC8A 4DZAA 2QGYA 3PZQA 2O7QA 1XIJA 4M6QA 4GVIA 3ZLHA 2QAPA 1OEPA 3E6EA 5A8GA 3GDRA 1XSIA 3NPVA 3AHVA 4JQ1A 3IUIA 3C86A 4G1NA 3K1DA 1OD0A 4MB3A 1ME8A 4KRZA 3U2CA 3FY1A 3WL1A 2V3GA 4QJ4B 5IHSA 5D32A 3NZPA 4ZE5A 4D8AA 4F40A 1DPMA 1US2A 3NL3A 3VOFA 4GKLA 3KOXA 3RLVA 5FF4A 1TJ1A 1V79A 4N4PA 4QRNA 1E6PA 4DBEA 5FF0A 4Z2GA 2QCDB 4B2DA 3W7LA 1TR9A 4U2YA 2RJGA 1G4PA 2EQDA 1IEXA 2C6QA 1JYVA 4PB5A 4U33A 3SIMA 4XZMX 3W7NA 1LL4A 2D24A 1SMAA 2QJMA 3BGAA 2V8ZA 3HQPA 1XLAA 3DOPA 5I06A 3QVQA 5JVLA 4HPHA 5GPRA 2QUUA 3AZSA 3SUTA 2PWDA 1JQXA 3IIVA 4UOZA 4LQ1A 1VGAA 5DBUA 5IBXC 4INFA 4M0XA 4LU0A 2G3NA 3O8AA 1CXFA 2CHRA 4MM1A 2F8QA 2GPTA 4AY1A 2X1TA 3E0WA 3WBXA 5HR7A 2B7QA 2ZYFA 3W1XA 1PVNA 1JI2A 1AUSL 3KTSA 1QXLA 1XSJA 3W3OA 4O10A 3L2LA 3A3HA 1WCGA 4XSLA 1ZB5A 3USZA 2R1NA 1I4NA 5HPOA 2V38A 4GY0A 4DUOA 3PP7A 3NJ3A 4Q4QA 1R38A 4PRRA 2C19A 3E2SA 3VDGA 1JQVA 2CU0A 4MUZA 3CMGA 4AX7A 4FMVA 1HT6A 1TPWA 4J3UA 1J0KA 4F79A 1E71M 5T9BG 4D6IA 4J3XA 2VDGA 1W0MA 4DJDA 1DEDA 4FF5A 3QOMA 1FWFC 4F0MA 2BS9A 2YXGA 3MUZ1 4ICCX 2A3HA 2EF9A 5BOEA 5GJNA 1UH3A 4TMBA 1BWKA 4AIBA 4BY3A 3CT2A 3LI1A 1V0NA 5BXPA 2PDNA 1K8XA 4MWAB 3BV7A 1KW1A 4KKXA 2PCEA 1H50A 4KBXA 3SZ8A 1ELSA 4Q4OA 3L5AA 5A6AA 3PB2A 5CZSA 4AD3A 2QIWA 4Z2KA 3HG5A 3AMDA 1LZOA 3G1SA 3M6YA 2CHOA 2I1OA 3WLIA 2YCJA 4O1EA 2JBMA 3W85A 5I3HA 1EO7A 3APGA 5TIMA 5LGXA 3V5CA 1O95A 3NDYA 1PZ2A 1YE4A 3RLGA 1O5RA 3PJWA 1XF0A 1G9HA 3VOGA 1T40A 4IZGA 5EMLA 1Z42A 3QTPA 1ODZA 3FJLA 3HG2A 2WNNA 5AHFA 3VM5A 2BOFX 4HU8A 3DFOA 1E0VA 2HBVA 3S2MA 1WDDA 3M5XA 1TVLA 2Y1HA 4N7QA 4EF9A 4GBDA 2FIQA 2XHYA 3ALFA 5CPQA 3WQPA 3QC3A 3S6DA 3F4VA 2A6NA 3G3DA 3C2VA 5FL1A 3GRIA 4GLEA 4YCOA 3DI1A 1CXIA 4S3GA 4PL2A 2ZZ6A 1XCFA 3LI0A 3BCDA 8XIAA 1IYXA 1RBLA 3ZJ6A 3OIHA 3LM3A 2WJFA 1JZ2A 3VXGA 2VZTA 3AROA 3WJSA 4DO4A 1QWKA 4LYKA 3MKVA 2UY5A 3VDAA 1ME7A 1WXJA 2PWGA 3L4WA 4YTRA 4PUDA 5EMJA 1H0GA 1PKLA 3TR2A 3HM7A 5HNUA 3MO4A 2XJ7A 2VGBA 2CKSA 1HO1A 1X39A 1OM0A 2FVMA 2E09A 3QRHA 1SFSA 3SGGA 1ONEA 1L8PA 3G2GA 4Q33A 1BG4A 1UR0A 1IV8A 1U1JA 4C6CA 1A53A 3CHCA 2DVUA 5G2WA 3EKZA 3CNYA 5LGZA 4GC4A 4J40A 3VTRA 1KR1A 3SFWA 1JYWA 1UASA 3BMWA 1FXQA 3CUFA 1MVYA 4TV5A 3E3HA 1XLKA 2FLIA 4J4KA 1LJYA 4ACYA 4GI9A 3T55A 1GTEA 3OA5A 4PUMA 3BL3A 4WXZA 4Q7IA 1CGUA 1WZMA 1IZCA 2XINA 2WXDM 4WIWA 3ZR4A 1XC4A 1FWBC 5HOSA 3N34A 1W56A 3TUUA 3T4WA 2AGTA 1EQCA 1V93A 2Z00A 4H7ZA 1UH2A 1GYMA 3JZUA 1VPYA 2J7DA 3PSVA 3KM8A 1MFUA 3OBAA 1Q6FA 4X60A 1PDYA 1XISA 4HSNA 1Y65A 1JVNA 3RX4A 3U57A 1GJWA 1MXDA 2GQAA 3W7JA 3WX7A 3UWZA 4O28A 4Q6JA 1THFD 4Q8TA 3MP4A 1OX4B 1QCWA 3S47A 3C2RA 2P0IA 3NA8A 2DPEA 4PRWA 3SR7A 4CNUA 4AEFA 1FWWA 3JRKA 5C71A 3LRLA 4LBSA 3UZXA 3BMVA 1SZRA 3KP1A 3LCIA 4H8HA 2VX4A 1YRRA 1M04A 4HNUA 1KGUA 2ZRUA 2BVDA 3EWCA 2FMNA 4NF7A 4H9UA 3PAOA 1LRTA 3PBWA 3VGHA 3SN4A 2AL2B 4GABA 1XLGA 2Y63A 3UG4A 4S23A 4QQUA 4N9EA 4K7YA 5FACA 2WNQA 4MB1A 3GC2A 3C3UA 4XZIA 2J7EA 3T42A 2UY3A 1NM9A 3QTGA 4FNUA 5BRQA 3ENLA 4AW7A 1JDFA 3TTQA 4H83A 4AF0A 4O12A 1ZCCA 1XLDA 1KGWA 3DG6A 1RCXB 1YKWA 4LAKA 2V9DA 4O1FA 4YTUA 2BHYA 1RJPA 2GLKA 1YYAA 3WQ5A 1G69A 2CXEA 1CECA 2X41A 3UNTA 4H4IA 4UFHA 2X05A 3WLHA 1F3WA 3RPDA 1Q7QA 4LBUA 3WEOA 5FF7A 4MZ8A 1JZ5A 3M07A 1W3LA 1S2TA 1FCQA 1ZAJA 5D02A 3MUCA 1CGTA 4R85A 3BLOA 4ZCWA 2OSWA 3B04A 2CLLA 3VZXA 1C8YA 3OODA 1BAGA 1YHTA 3EEZA 1DWGM 3M9YA 2TMDA 2WSPA 3G18A 4OFCA 1XWYA 3AUOA 4I6VA 3VGDA 3RR1A 3MSRA 4L61A 1KFWA 3FA5A 4IUOA 4XUGA 5D4YA 4ORMA 4AIUA 5LA0A 1DIKA 3W7PA 4UR8A 2DJLA 3VDBA 3AU2A 3V18A 3SCQA 4N02A 3CHEA 3N15A 4H2CA 1KFJA 1JUEA 4ADUA 4IP5A 3VK5A 4JICA 4JYDA 2DT1A 3T0CA 2YGYA 3LCLA 1QTWA 4IFKA 3GAKA 1G94A 1BEUA 4E2OA 2O56A 6XIMA 4C1NA 3SEPA 2QJIA 1EWDA 3LGGA 3MA8A 1YE6A 4MLRA 3B03A 4YN5A 1V8EA 3OGSA 4FOKA 4GGBA 4B3LA 3IV3A 4DHGA 1L9WA 3W70A 4D9PA 2C7FA 2V5LA 3CUGA 1AW2A 4LY4A 2CEQA 2IKHA 2GWGA 3UA3A 4UFLA 4OWGA 3WBWA 1AODA 5LIKX 1FP9A 4H8VA 4DQWA 5MHBA 1KNWA 1SO3A 3L4VA 4LUJA 3LERA 4NAEA 4Q3MA 2DT2A 4PBGA 1F73A 3TYCA 1UA3A 5FF3A 3KHJA 3QV7A 4FAMA 2E5CA 4A2SA 3N2MA 1O66A 4U4MA 4AZBA 2Y7DA 1XYBA 3UP8A 3VDHA 3LHWA 4UTJA 1TSIA 4GCXA 4MPKA 1Z9AA 1VZWA 3M0JA 2CLHA 2QMJA 3K1GA 1GEHA 3V75A 3T6CA 3MVIA 2JEPA 1FDZA 1PIIA 2FYMA 2O9TA 2W27A 5HANA 2PODA 3NUKA 4AYGA 3CUIA 1DQUA 1E3XA 1CXLA 4JKKA 3THAA 3U5YA 4ATDA 3OO2A 3UJRA 4B5SA 3I68A 3DYOA 4Z0SA 2J13A 3N19B 1IT7A 2FGLA 1DBTA 4DLFA 3MJYA 3BUVA 3W6LA 2X40A 2C3ZA 4AVNA 4A4AA 3FAXA 2ZC8A 4JFSA 1RBAA 5FOOA 1CDGA 4C7GA 3MCOA 1FCBA 4WKFA 3T2QA 3TV8A 3VAVA 1GOKA 3VUSA 1PB0A 2IW0A 4Q8OA 4DWDA 3EWZA 3LPPA 2VGFA 4Z2LA 3VVGA 3WBEA 4B4FA 2ONEA 2O4MA 3WMBA 5HQLA 3ARQA 2Q8ZA 3FJNA 3N6JA 4Q8NA 4BK9A 1VHCA 1L6SA 2F7FA 4XV0A 1QVBA 2BFGA 2XM2A 5JUVA 3WD1A 2Z2BA 4J3TA 4XUYA 4P7LA 2Y0FA 4K8EA 5M2FX 4DPQA 3S9IA 4YU1A 3QHMA 1R9XA 2WSYA 3CZ8A 1ICSA 3FA3A 1UBSA 3GZ3A 1ONRA 3KP0A 2WWDA 3CB3A 5A6KA 5PTDA 1EJSC 2W91A 3HG3A 4EP8C 4URIA 2DQXA 4AD4A 4Y9OA 8RUCA 1E6RA 3NQ6A 5B7ZA 5KEZA 4EPBC 5FEZA 4NNBA 1EP2A 4CU8A 1NDWA 1PBGA 4XQ6A 4R7OA 2G3JA 4Y9PA 2XUCA 1F5ZA 4PSPA 4K36A 2V5CA 4FI4A 4JY9A 2CESA 4ATWA 5GNYA 3SGZA 4C6EA 4IJRA 1JYNA 1XS2A 3WD4A 2CLEA 4W86A 3THDA 4YVPA 1UWTA 2Y2WA 3BJTA 3PTMA 1LL7A 2ZE3A 4GIYA 3G22A 4IM4A 4UTUA 4AB4A 1L8NA 4YVXA 4O14A 1XYZA 1H5VA 1W1TA 1ZBKA 4Q8PA 4H04A 3UU0A 2NSOA 2XFRA 1FDYA 4HP5A 3PZOA 4NILA 3VO0A 3G24A 1TWIA 4HHMA 3UWQA 4MG4A 2MANA 2G3FA 4LVAA 2BB0A 2PMQA 1TWDA 3MUY1 4GUFA 5FJUA 4WDXA 3W24A 3I6RA 1KBIA 3IACA 4Q4MA 4ZO9A 3WNKA 2XH2A 1F3EA 3QPZA 3LBOA 1G01A 1YNQA 3AU6A 1BWVA 5C8BB 4QP0A 1W3IA 3BAXA 3W71A 1MUCA 4AWUA 3RCNA 4MYXA 5IXEA 1JZ8A 1NOFA 3T9PA 2VP8A 4GYPC 4UTIA 4N4QA 3HO8A 2VELA 4G1KA 4M56A 4TVCA 3F2CA 3UPMA 3DGBA 1DWAM 1T8XA 2NXIA 3ZJKA 1OFRA 1ADSA 3RITA 3BSMA 4AYSA 2HXTA 1WOBA 2DZXA 4JTGA 2OWCA 3NVDA 1AQFA 2W79A 4HN4A 2YLLA 1NWTA 1CT5A 4LY8A 1TQJA 1V6YA 1IF2A 1W9XA 3WJXA 4RDYA 4CKQA 1TA3A 1UKTA 1AH0A 3EYPA 1X8CA 1UWQA 1M7JA 4E4UA 5D37A 5FAJA 2VO5A 1S2AA 4B5XA 2WMIA 4L4MA 1D9EA 4E8GA 4KEVA 4O53A 3R8HA 1KM0A 4YLWA 3HPXA 3MZ2A 4CLMA 2EG8A 4RE3A 2HMCA 3EEGA 5C9WA 3NO3A 1Q7MA 4PTMA 4JQ4A 3O0FA 4QJ5B 3VNMA 4KETA 5EU9A 1CYGA 2CLMA 2HROA 3EB4A 4JY8A 4UFIA 2X1SA 3W1UA 2O92A 3ABZA 1PCWA 5H91A 3HG4A 1HX0A 3PR2A 3GU1A 1GVIA 3RJYA 3ITCA 1DQXA 4GQ0A 3BW2A 3IJ6A 4K8GA 3B0YA 1EJXC 5CGTA 1EHNA 5J5DA 4IIDA 4TVDA 1EP1A 3YPIA 1EB3A 3ITOA 1H7RA 3DFHA 3LDVA 3L0NA 1KTNA 5KETA 4FP1A 1E43A 1A5UA 1PAMA 1UC4A 4MY1A 1H7WA 3MANA 2ZFAA 4H3DA 4DWSD 3MVTA 3S8HA 2PP0A 3QMRA 4UCFA 5H8PA 3QLLA 4GXWA 1KM4A 3R13A 4O50A 1KM5A 2BMBA 1QHZA 1VH7A 2QUMA 3R25A 1QWGA 2VCBA 1RUSA 5D05A 5D2TA 4HVXA 3AJXA 4Y8EA 4P8VA 4JN6A 3WLSA 2EKGA 3UZZA 2Y85A 1HP5A 5A2BA 4WX2A 1J5SA 2G41A 1LDCA 1A3XA 1EF2A 3Q2DA 4JTLA 3M16A 2Z1SA 3GNDA 1C29A 1XGDA 1R0MA 3PG9A 3VNJA 1GJUA 2VYOA 2Y7GA 3P60A 4HN8A 4HNNA 4D72A 3SY5A 2XZ9A 5CXPA 4KCWA 5AC6A 4XZNX 4FR6A 1ZS2A 3TOPA 3KL3A 2QF7A 3HFYA 2G97A 5I00A 2KZHA 2QS8A 4PTXA 5BXTA 1LBMA 2EPHA 3BLLA 5HNNA 3TIMA 1XR2A 1U33A 2FZMA 3ES7A 2WM0A 5ABEA 2R9RA 3NYZA 4JYFA 2QDGA 3NXLA 3WNNA 3T2PA 2HS8A 1PIFA 1YEYA 4M6VA 4EE9A 3N29A 4UTLA 1NAL1 3SO7A 3NPXA 3CL7A 3E5PA 7ENLA 3WK2A 2DVXA 1ZLPA 4W88A 3VOHA 2YBUA 3SW6A 4GZ7A 1IWBA 1TV2A 4L1WA 4KS0A 3RCMA 4JTUA 5I3FA 3CQ0A 4BQ3A 1G1YA 3N11A 3AOFA 3M0ZA 3ORWA 3WUEA 1F05A 4RKAA 1YXCA 3GNXA 5F2IA 4LB4A 4UNKA 5I78A 1UIOA 3LTSA 1UD8A 4UWMA 3ATYA 2DUAA 2CXGA 4KFOA 4EPKA 3FOKA 4MUPA 4HTBA 4PB4A 3T0DA 4GQGA 3THUA 1WAWA 4B5WA 3ZO9A 2JK2A 4WSHA 5BROA 4A8IA 3TROA 4W8AA 1MQRA 3UG5A 3AXIA 4FHAA 2J9YA 4QITA 3XIMA 5CZ0A 1F61A 3W7IA 5HUOA 3P62A 1QATA 3A3WA 3MHUA 1AQHA 4PL1A 5U4NA 1QMLA 1XYLA 2VEFA 4RL3A 4H9MA 1QO2A 4QLKA 2FH6A 4CCDA 3RU6A 4NY2A 1TV5A 4N9DA 1ZSXA 2Z0IA 1BKHA 3BLKA 9XIMA 1XUUA 1HG3A 4XVDA 1XLIA 5I03A 4PN2A 2EPKX 4DB7A 3IAQA 3WSUA 2GDQA 2PC4A 4GH1A 2PRLA 3VIJA 2HDJA 4X9SA 3N4FA 3N1AA 3WNMA 3M0YA 3TYUA 1GG1A 3CPRA 4MTVA 3BC9A 3EXRA 4UC5A 4PMDA 3FEQA 3Q65A 3K46A 3A4XA 3ONBA 3AIUA 1OC7A 3U0HA 3O6CA 4XX6A 2VRJA 1OK4A 2X1IA 2AOSA 3PZVA 3KX6A 2PDLA 4DXXA 4RW3A 5HNRA 1JGMA 2WMHA 3MZNA 2WCSA 5FIPA 5J8LA 2QUVA 1XPYA 4V33A 5A8PA 1HO4A 1ZJHA 4GNVA 3GH5A 1BLIA 2ZUMA 4FIRA 4UOQA 1MZHA 2HVNA 2GQ9A 3OA3A 5E09A 2G96A 3EB2A 3WQOA 3TW7A 2CIPA 2ZC1A 4HTYA 2R8WA 3KLLA 3N25A 4DI9A 3UJ2A 1Y5XA 4MHBA 5AN7A 1MFVA 2ZX7A 3BAJA 3LRMA 2AL1A 2PTYA 4MWAD 4DVOA 1GOWA 4QSHA 2OQHA 4F66A 1NEYA 4FSAA 5DANA 4FX8A 4TQTA 5DEZA 1AJ2A 4AF0B 3L5LA 1EDQA 3P8IA 3B06A 1JRBA 3KS5A 1GVOA 5CZTA 4CVWA 2XGZA 3N9RA 3KBVA 4YXGA 4WJ8A 1V3JA 3SURA 3ALGA 4O8AA 1OY0A 1XLBA 3C3NA 2TYSA 2X2GA 3PPCA 4EACA 3M44A 4NXKA 3II1A 3T78A 2GK1A 4O17A 1N8FA 5CPTA 5ABTA 2YCEA 3SCOA 4M19A 2DFAA 4TX9A 2WZTA 3RPMA 2F38A 2VFGA 3SSJA 3I6TA 4LTSA 3GUGA 1H4PA 1KB3A 3B9EA 2VFHA 5BXRA 4JTHA 1V0MA 3IGSA 4XIAA 4A29A 1PCKA 3ZSTA 1L2UA 3GTHA 4EK7A 2CBUA 1OSEA 1CGVA 1QNOA 4H1ZA 5GJPA 4CNSA 2P53A 2ATSA 2VVNA 1Y0EA 2VFEA 4CU7A 4RUBA 3Q45A 3MW7A 3BWWA 4KGLA 3IJQA 4GO8A 2ZIDA 2BNJA 4DYEA 1O68A 1C8XA 4ZA0A 3W25A 3H7RA 5G1YA 4Q4KA 3B9AA 4PMYA 2EPLX 2VWTA 3OOQA 3T0BA 4UQCA 4DBUA 4E8CA 1OFQA 4GG9A 5G4EA 4IFKB 2ZQ0A 3LLFA 1H3GA 3G1DA 1UWIA 3BH4A 3VX1A 1C91A 1T99A 4CNNA 4PUEA 4C1NB 3TAKA 2HPMA 1SU5A 1MW3A 4AWEA 3L23A 1F6YA 2QNEA 3VGEA 3P81A 5D2XA 3L68A 2VEPA 3BANA 2XSBA 5B7YA 2CYGA 4NJKA 5I3KA 1VP5A 1M7PA 1TB3A 1U83A 5CZJA 2BGNE 5K9DA 1FA2A 1XL9A 1IR2A 4NAEB 3SY1A 3TJ4A 4GFSA 4ML4A 3WF2A 4NZ4A 1JXKA 4PMQA 1A3HA 3EMCA 4QG9A 3MO7A 2QIIA 4QE4A 4C6PA 1TJPA 3U5UA 3QGAC 1TJ0A 4AHQA 1AH4A 1XBVA 4XWUA 4G9PA 3VC6A 1NTHA 4NJJA 3OW1A 4NZ3A 4DO5A 3BOXA 4CNOA 1DIEA 1V3HA 4TO8A 3O15A 3UZYA 1XKJA 3N04A 2WVSA 1FKXA 2PTZA 3MHFA 4HIBA 4U3AA 1QK0A 2ZKMX 3VGBA 4ZMGA 1VCVA 2HPIA 3OTRA 4Z1BA 4O4WA 4PMZA 4QHRA 1WDPA 2WPGA 3HTWA 2A1YA 1OB0A 4WGHA 2EEXA 1M68A 1XLLA 2RH9A 2AAMA 5H8UA 2QLYA 1IXNA 4M7SA 1S1PA 3B8TA 3K5XA 3GWQA 3TMQA 2VX6A 2EAWA 1U1UA 1JCTA 4S39A 3W6YA 1IT8A 3W7CA 3WD0A 3CPUA 2Q8XA 1AK5A 3HPSA 2UBPC 1LROA 1UKOA 1RP9A 2VC6A 3L67A 3LG3A 1CEOA 1LT7A 3OHIA 2NQLA 3PSWA 1IEIA 4HJWA 1KFBA 1EPVA 1PWMA 2IQTA 3WLOA 2A21A 2NVDA 4UTFA 2PWHA 4KERA 2OO0A 1OYCA 4IQEA 3CPGA 3SDOA 1N55A 3DC0A 3D0CA 3QBUA 3PK7A 3PWGA 2OEMA 1VFUA 2PGRA 3KVLA 4FX6M 3ABOA 3SCRA 2HCVA 3AYSA 2YZRA 3UNDA 1Q6EA 3URNA 3FSUA 1R3SA 2XG9A 2A5HA 2EXOA 2ZUTA 3HFTA 1VLIA 1B4EA 1K6WA 1NDVA 3DU0A 2RDXA 2X16A 4REQA 5LNRA 2ZXDA 2E3ZA 2YW3A 1TPFA 4O16A 3I4KA 3R43A 1PX4A 3V35A 3S2CA 3IEBA 1H41A 1VBJA 1RVGA 4K6AA 3D3AA 3QF0A 1LOLA 3Q4DA 2PDPA 4GH3A 1FWNA 4E0CA 2ON3A 5A3HA 3N4EA 5LZLA 2NLIA 2QJJA 1L6YA 2ISWA 3CV6A 5RUBA 2QYGA 4JQ3A 3HJEA 1I0BA 2G5WA 3BLFA 3MUXA 4IMDA 1KD0A 1R3YA 4PCSA 1Z8AA 1EEPA 4KF1A 4U31A 3KUMA 2XU2A 2ZXAA 4A2RA 4UTWA 4E6MA 3ZYZA 3VI2A 4Z1CA 3KTXA 1W3HA 4GZEA 4BS0A 3WQGA 1WPCA 4NX0A 1GQNA 1H63A 2DSZA 4ROPA 1B57A 1GOIA 3PJUA 1SFTA 4DN1A 1Z89A 4YCPA 4JTAA 1B3VA 1DHPA 3KE0A 1AZ2A 3ELFA 3SCWA 4HU0A 3OLEA 3QR0A 2BHZA 1E9YB 1XLJA 1I2PA 3T0TA 4AU0A 4BF7A 1J10A 1UKPA 2QT3A 3FKRA 4HNCA 5HK4A 2QUNA 1V6TA 2ZZ7A 3W2JA 1TA3B 3UGVA 2H3BA 1JPKA 3MPGA 1AVAA 1KKRA 1GKPA 3CXOA 1FTXA 2DIJA 2WMIB 1E51A 4C6FA 5I2UA 1GONA 4QLLA 2FZNA 3CZGA 3SECA 3FXYA 3LSCA 3S1GA 5HWMA 4AQLA 2XIBA 3H2CA 5AC4A 3QYSA 3TJXA 4ROQA 4F0SA 1FRBA 1J6PA 3TW6A 3AZRA 4UMCA 3O6YX 4KWOA 1TX2A 1RPKA 3FN9A 3VFLA 4ZSUA 4DJEA 4B91A 4DWSC 3FHQA 1BQGA 2C1GA 3IJLA 3WO8A 3AIWA 1LRNA 1J6OA 5LHEA 3M43A 1OD8A 3U7BA 4I9JA 3TNBA 4GK8A 4Z1YA 1TJRA 4A3RA 5A8MA 4DJFA 1HKJA 4EPDC 4DY1A 4RV8A 4HK5A 4LAZA 4WRHA 4IMAA 1I8JA 3RG6A 4D71A 4O11A 1DTUA 4V27A 1U22A 4L80A 2GSJA 3DUGA 3H4WA 2NV1A 2PP1A 6XIAA 4X2RA 2Z7KA 1O1ZA 2QJNA 4PUKA 2A3CA 3VIIA 3GUWA 4DI8A 3VNLA 3KWXA 3L65A 2NT1A 3W82A 3KCJA 2V6AA 1OIMA 4FLRA 4IXXA 3S46A 3W75A 4TMCA 1WKDA 1EPXA 4ZENA 2VUNA 2DW7A 1KXQA 4FNTA 4TUFA 2ZADA 3UWUA 3SCVA 2QCCA 3VCNA 1XRFA 1HKVA 1RD5A 4S3EA 1QPOA 3CZKA 3AUJA 2OTDA 5D04C 5CC7A 3DAQA 1JF6A 4JR5A 1BTCA 3HN3A 4XZ9A 3IAPA 4ZQCA 5K2ZA 4M6UA 2WJEA 3LENA 4M1RA 7PTDA 3S5NA 1ITQA 3KFTA 1PDZA 2ZUSA 1SJCA 3G1FA 5GNXA 1F8IA 4IPPA 2R94A 2B0MA 1QBAA 2ACUA 4PMRA 4EVZA 3IJIA 3LCWA 3PANA 1ZNNA 1N82A 3RGTA 1ZQ5A 5L9FA 4QJ1A 4UXDA 3W02A 4GO9A 1PWLA 3R10A 3THCA 2PDHA 4PEEA 1LUCA 2XIMA 1NY1A 3PF3A 4LYQA 5D03A 2QVHA 3RO8A 4ALDA 1GNXA 1FVPA 1RP8A 2DSKA 1FWIC 4EANA 3AXKA 3B9DA 3BPWA 4NZJA 4L7ZA 3AALA 3EKGA 3ARRA 3LCFA 1E56A 3W1NA 1GTHA 5I6SA 2ZA2A 5JBDA 3E38A 1P7TA 3GDTA 4JN8A 1AQ0A 4ZODA 5C2CA 4U2ZA 4I8YA 4HZ7A 3STEA 3WIJA 3F2BA 3O2LA 2YXXA 4MDOA 1UIPA 1WZAA 1POJA 1H60A 3IJ8A 3W2UA 1WKYA 1MEHA 2ZX9A 1X98A 3HGOA 4FB7A 1UCWA 4AY7A 3AS0A 3SJ3A 1EF3A 4B2DD 5CLWA 1MMFA 3KWSA 3CO8A 1Q66A 4MFDA 2VOTA 3UBPC 4K68A 4KWWA 5LNWA 1OCQA 3L4UA 5D8ZA 3WELA 4F4RA 1Y7VA 1HJUA 1OGSA 4Q8MA 3QQ1A 3UR8A 4WXYA 4Z17A 2ESCA 3T7VA 3TFXA 2VR2A 1J2WA 4LCSA 1MW1A 4M3PA 5IOBA 3F4DA 4D6DA 2VEMA 2V5BA 3V16A 1J96A 4QISA 1G4TA 1SJDA 4EKJA 3PFMA 3S6OA 1GZ1A 4DYKA 4QTGA 1XFBA 1DIOA 4YMZA 3TWAA 2WK2A 3GY1A 3SIZA 3KL5A 4ZO6A 4FK9A 4IMEA 4GA8A 1FWTA 2ISVA 3G77A 3D3FA 1RQBA 1OFDA 1OQFA 3RR4A 3SY8A 4CN1A 2C15A 4XZBA 2VZVA 1ISZA 3SRKA 1P5BA 5JIWA 4MWAC 3BO9A 3V5OA 5LXXA 3R12A 4UQ9A 2E7FA 2ZUUA 4GKTA 3CO4A 4M24A 1CXHA 2CWNA 4YWIA 1DJYA 5DO8A 3WYZA 2DUZA 3UT0A 1TV8A 2X09A 2NXHA 2QCHA 3DERA 3UERA 3AYTA 4JCMA 3A12A 3C0LA 3QOKA 4DJDD 1K9FA 3PTQA 3NFUA 5HMEA 5T26A 3MKKA 2B7OA 2GVLA 3RN6A 2XN0A 1DORA 4QR6A 2X0HA 1Q6DA 3PB0A 4IOTA 1ZAIA 3P74A 2DSWA 1OGGA 3P80A 3AHYA 4GRSA 4H8NA 4HNOA 2R91A 3VIHA 2NZLA 3NL6A 4BZYA 1SFLA 4IGSA 1V3LA 3BDKA 1XBXA 3WBAA 1PZ3A 4N6FA 1JPIA 1WUEA 5AHMA 4JGDA 4LFYA 1YDNA 1DJQA 1MQQA 1S2VA 4NJIA 2DZUA 1ZALA 3NXFA 1SJAA 3GVWA 3GW3A 1FFRA 1GQIA 3NZQA 2R14A 5CEWA 2FJKA 4C6MA 2GK1B 1OCBA 2VDIA 4BF9A 1PJ9A 3PJTA 4GVFA 4ZQPA 3W1AA 4US5A 5HUPA 3PZUA 4JX5A 1V02A 4KMQA 3CL8A 3LHVA 3L4TA 1K3UA 3IVSA 2OEKA 3B3DA 1FHDA 2DZPA 1F2JA 2YJQA 5M17A 2LLEA 4CQ9A 2Y4SA 4M6PA 1JG9A 2GJLA 3ARWA 4PUJA 3PPGA 3WH8A 4YIWA 3CV7A 1CLXA 4AZ6A 1RCQA 3UETA 1HJXA 3F1QA 1QASA 3ZZ1A 1CB7B 2ZRWA 4FA3A 3MJMA 3EOUA 3WY1A 4ADSA 3GVVA 3KS6A 5GJMA 3VD7A 2QDHA 3GW0A 3MYPA 5BWAA 1K9EA 2HQAA 2WHJA 1OCJA 1W3KA 1OZQA 4Q4PA 3W2LA 3ARSA 2FFIA 1LORA 1EHAA 1DYSA 3AYRA 2C1IA 5I7GA 2P10A 5H1WA 3BG5A 1GEQA 3CQKA 5B80A 4GD0A 4IL0A 3FAWA 5HJXA 4ZTYA 2GWNA 3UVIA 4FNQA 5EFFA 4AAJA 1SQ7A 4GZIA 2X7VA 3LNMA 3QY6A 3EX2A 4OBTA 3RYSA 2W66A 4MOZA 3SFKA 4I9MA 3W7HA 3ZMRA 1X6UA 4F9DA 1X38A 1FWEC 3GLCA 1BD0A 1UOKA 3AMKA 4JTDA 2RJHA 5BRPA 3R0KA 1PE1A 3ARTA 1ZENA 2QZRA 3LSBA 4PMOA 2PDJA 4O54A 3G6LA 3WKZA 3TQ0A 4G7FA 1ITXA 4EWND 4P8XA 2QAFA 3M64A 1J0JA 2W4XA 3I4EA 2WCAA 1P0NA 2OZ8A 1EGMA 1MDLA 4HMNA 2ZZ3A 3P0XA 2V5KA 2QPSA 2IXUA 2WVUA 1KBLA 4D8ZA 3CIWA 1LRQA 3LA4A 2OCZA 3ITTA 3WQEA 5I24A 1EUAA 4TXEA 3WDIA 4C6OA 4QXIA 2JKPA 1E73M 1FCVA 4Y9AA 2P3EA 2PU1A 5A1AA 4GNKB 1OFAA 6ENLA 2WKLA 3C8NA 3LHYA 2Y7EA 2J6XA 1A0DA 1GG0A 3TEVA 4XBKA 2PGEA 4JEQA 2FFCA 3GG1A 4JXCA 4ERAA 1H5YA 1H2JA 3PWIA 3W2MA 3H2OA 3CYVA 1CIUA 1YTEA 1ZBVA 5HJLA 1R3QA 4L65A 3B0UX 1B0IA 4FXSA 1XW8A 2CCRA 1EP3A 1JPMA 1NIUA 3GXIA 3GFXA 3EXTA 4ZTXA 7TIMA 1WA3A 3C4UA 1O6IA 5D9NA 1T96A 3ARYA 3B0PA 5EL1A 4DM2A 3WF3A 2X2YA 1CXKA 1F07A 3T07A 3WLKX 2A4AA 2P8CA 1V7YA 2F9RA 4AZCA 4F2TA 1GUVA 1V3MA 2VCAA 3GXDA 4RDZA 1CI1A 3OVQA 5T9CE 4C60A 2WOQA 3R58A 1A5MC 3LCHA 3RAOA 4AEEA 3UWWA 1Q13A 5BU9A 4C6BA 3R89A 1J0ZA 2XFYA 2I14A 4O1CA 1HW6A 4I7VA 1XHGA 2GGHA 4ICNA 2ZUNA 3T40A 3NL5A 3B8DA 2PGFA 4ERGA 2ZICA 3AIBA 1ZU8A 5KZMA 2JEQA 3OG2A 3L0GA 1JFHA 3GU2A 4AIOA 3NEHA 2FB2A 1EDGA 4D6EA 1G4SA 2J27A 2F6UA 5A94A 4TVUA 1WE5A 3GNPA 4W7UA 4REQB 4GFIA 3W81A 2VENA 3DBNA 3TLQA 2EPNA 2VFDA 1KM6A 4F9JA 2CBVA 3BSGA 3FYOA 3RHGA 3RXZA 3S5YA 3W7QA 4D6HA 2WHKA 2B7PA 2D0GA 2XVKA 1OK6A 2ACQA 4UMBA 1YMYA 4MB5A 5CKSA 3TP4A 3MCNA 4W87A 1FHVA 3DYPA 3GNNA 3N2OA 3TR9A 3HF3A 3E2VA 4BA0A 3HMCA 1EA0A 4XVEA 5C2XA 5KSWA 1B31A 1OG0A 3TSMA 1SZEA 2OPJA 1P43A 1JD9A 3W7EA 2PF8A 3QV8A 4XG1A 1R3VA 1V6WA 3GC5A 4IWWA 4K8HA 2HSAA 1HJQA 4R27A 2BX7A 3COTA 4Z0JA 3E12A 2DSVA 4QEEA 4GHRA 2VMFA 1O5QA 5EGRA 2VGIA 4UZUA 2JKAA 4MWAE 1JNEA 2FGBA 1Z3NA 5I3GA 4WGXA 1V0KA 4J3ZA 2B4GA 2WAGA 1OINA 3AHXA 5C9XA 1QPQA 3NSNA 3KBMA 1VJZA 3E1F1 1FX6A 2BY3A 3QMTA 2VRKA 4JTQA 1HVXA 4HJFA 2W3ZA 3VDCA 1BSLA 5HAOA 4XD4A 1DXEA 3AWOA 4QEHA 3MBFA 1TPH1 3NCOA 2VHLA 4YHEA 2QGHA 2HWGA 2RDTA 2VKZG 2NQJA 1OHLA 4MNLA 1F4AA 1QW9A 2VD8A 1XJBA 2E28A 3BLEA 4LS0A 1S38A 4NKCA 3IUHA 5LSMA 4H9VA 2JF6A 5CJNA 3LHZA 3HPAA 3FK4A 2BV9A 2GGIA 1R3WA 1J0HA 4L6OA 5CSYA 1HGYA 1UC5A 2EJAA 3UVAA 4JEJA 3P0WA 3W7RA 4S3JA 3VFCA 3BV4A 4CQ8A 4H7VA 3TE9A 2NQZA 1EYWA 3AIEA 1QBBA 3RF9A 1FWRA 3BCFA 1TREA 1O12A 3DKJA 4WK9A 3WLNA 1P6BA 1JDAA 1Y5VA 1UD4A 5AB3A 4GC3A 3DC8A 1XX1A 1P0BA 1I60A 1T41A 3TYDA 3P14A 4GY1A 2XPKA 2TODA 1JPHA 1G6CA 3LS9A 4DZHA 4L4LA 1LCOA 1VPQA 3P5ZA 2D2HA 3GHUA 3DFYA 3AI0A 4J2MA 1E40A 5D9OA 2A3EA 4PCFA 5LKYA 1B2YA 1OIFA 2E6DA 1EYEA 1UWUA 2ZZ4A 2WCGA 5EMUA 4HA4A 3LGDA 2G0WA 4RE4A 2HNEA 2FVKA 1OYBA 5AECA 4MKVA 5CGQA 4DBDA 4GQQA 3QEZA 3ERPA 4OIFA 1HKWA 5FESA 4HHHA 1AJ0A 4ENLA 3B8WA 4D6GA 4MSSA 5FEXA 1DHKA 4XSMA 3TQPA 4H9ZA 3KLKA 1NARA 4W8LA 2YA2A 1U1HA 1Q6LA 2H8ZA 5H2ZA 1X6NA 5I07A 3C2FA 1OCNA 1TV7A 2X30A 1ODUA 3LXAA 4B5NA 1VRXA 1I0DA 3IJ9A 3AS3A 4RR4A 3O07A 3NQFA 5KINA 3L4YA 1PX3A 5FKYA 3QKEA 3W6MA 3S1UA 2VR5A 4FO4A 5BCAA 2E5BA 3WDJA 1EA9C 3R5EA 4A3YA 2C8NA 2CLIA 1LLWA 2CZVA 5XIMA 4E8DA 2NT0A 3QV6A 3EDKA 4WDUA 1UR1A 5FEWA 5A6LA 1AZ1A 9RUBA 4UIOA 3LN3A 2Q02A 1BXNA 2OKOA 3NAVA 3OU8A 1J01A 4QCEA 2WNWA 3LB0A 1P7TB 4GI4A 5J04A 4HGXA 1B3OA 1LL6A 3ITVA 5I3IA 2NWSA 3BMXA 1WXZA 5K3VA 3QQ0A 3UCDA 2V67A 1M7XA 4K38A 2V3DA 3WLLA 4JIPA 5C9ZA 1XICA 1A5NC 1EBHA 2OO6A 3CUHA 3CTTA 4WJEA 3ARXA 4LB3A 4KGJA 3UY7A 2JE8A 1WBJA 3GK0A 4ICMA 1SO5A 4XBSA 4ZVJA 1S2CA 4AVOA 4BEQA 1UMLA 5K9XA 3O05A 4FNRA 3W9ZA 3LD5A 3SI9A 3GR7A 3HIJA 4UQEA 1HNYA 2Z1BA 4PTWA 1EL3A 3GS6A 3ZT5A 5DT7A 1R9ZA 1JZ4A 4HSHA 4XAPA 4FOJA 2WQDA 5K4XA 3U48A 3RMEA 4CNPA 1NWUA 1GCYA 2PD5A 1UJQA 1UD5A 3MWCA 4DJDC 4O1DA 2OT0A 1LWHA 4MDPA 3URBA 1ZJIA 3K4DA 3UG3A 3GSMA 5D8WA 1HF6A 3URAA 1ZJAA 3WLTA 4HA1A 4HBKA 4XO7A 4EAMA 2ZZ2A 4S3CA 4DXVA 1HN1A 2KX9A 3MDWA 2A2IA 2YXOA 4RV3A 3DECA 1TWWA 4I5UA 3VU2A 4D1IA 5ECVA 1WDQA 5DRCA 4HOZA 2ZUVA 1UKQA 4OTKA 1DJIA 3KBSA 4HHPA 5C6MA 2WBKA 3NQAA 1G67A 4Q4RA 3BQ6A 3ZLGA 4BJHA 1RV8A 3WDRA 1GVEA 4DYJA 4J2PA 4WCJA 2CLKA 4A6GA 3TZFA 2GL5A 3BJSA 3EMQA 4FF7A 3ANVA 3R8GA 4EXBA 1MDRA 4H6EA 1PKMA 3L2MA 2AKZA 2J79A 2XWEA 3QY7A 2WV8A 4FLSA 5FA5A 3GXMA 3C0JA 1Q63A 2WPBA 3A3XA 3NSMA 1J8VA 4E3TA 3LLDA 3SBFA 2QVNA 3I10A 3ICJA 3GVGA 1C90A 1QK2A 2WZHA 1ZTVA 3G1YA 2G3IA 1Q3NA 1EZ2A 3RM8A 1XD1A 2ZZ1A 5FJOA 3TCSA 4JTEA 5DCDA 3CBWA 1RH9A 3OP2A 3O9NA 1TWZA 5DCBA 2D73A 4ATLA 4AMAA 4Q7BA 3GHRA 3UJEA 2QDEA 1CENA 3R1ZA 1TWSA 2OOFA 5D2YA 3GH4A 2SFPA 1YX1A 4H9YA 3ISIX 1RK6A 3R11A 5G5IA 1DP0A 1MSSA 2HTMA 2L5HA 2XTKA 4FZIA 1IR1A 3CL6A 2OZ0A 1FWGC 3EOOA 3EWYA 4B5UA 4X3ZA 3OZYA 1NDYA 2V0TA 2B81A 1X7FA 3GKFA 4IP7A 5E0FA 1KTCA 4OHQA 2VC5A 1P6WA 2YA1A 1KV5A 3LZ3A 3NM1A 2GDUA 3ZSSA 4CQDA 4GISA 4N2YA 3W2KA 1I45A 1IZKA 3OPSA 3V5FA 1QOXA 4DRSA 4MNJA 1CLVA 4O57A 4W84A 4G8TA 1P0EA 2GZXA 1TVNA 1H7PA 4GYFA 2WZEA 2WZMA 2WVVA 3LQLA 4P2VA 1ZY9A 3P84A 1R47A 3EDDA 1MW0A 1R30A 4GUHA 2PFHA 1E0TA 2X7WA 4FLOA 2G4FA 4GZJA 3HPZA 1WQ5A 3I3BA 3AIRA 1EC9A 2I57A 2YOCA 4C65A 4ZQOA 2BXYA 5CAKA 5HULA 5CBJA 4Q4SA 1VIWA 1AFSA 1SFJA 3TC6A 3UPBA 3DHFA 1R8LA 1GGOA 2DJXA 1JCXA 1UP2A 3UXIA 2PWVA 2DVTA 1P0KA 1S5MA 4HCDA 1US3A 3TSBA 4CCZA 4TOQA 1I9CB 1J79A 1SW0A 1ISWA 3E2RA 1RXOB 2OSXA 2WLZA 3ABSA 1FH9A 2ACSA 3KW3A 4H19A 4XO6A 4ZO7A 4YTTA 4BCEA 1W6TA 1RPXA 2Z4GA 4KQNA 3KOFA 1XD0A 1HKKA 1Z44A 2V82A 5CJMA 1NELA 1VIZA 5HDRA 2HZGA 2Q3RA 4ZXOA 4M7TA 1HIZA 3WENA 2ZWYA 4XAFA 4NZ1A 1QFEA 3PZGA 2W62A 2FZ8A 3KZPA 2V68A 1B3WA 4FPSA 4XAYA 2J7HA 2CZ5A 4JPGA 1PYFA 3QSRA 4AIEA 6TAAA 5F4WA 1W9BM 1UR8A 3ZWTA 1I1WA 2PTDA 1HJSA 5DT5A 4XAGA 4JTCA 2WC4A 1VFTA 2YBTA 3V1HA 4QBXA 2OSYA 3N2BA 4XD3A 5F2MA 5U7SA 3WF0A 4AH7A 1UOZA 4GUJA 1AL8A 2NW0A 3S5ZA 3TU9A 4DZ5A 5A6SA 5C7HA 4TU1A 5GQBA 2GQ3A 2ZBTA 4I9TA 3TJIA 1UPPA 2CWXA 4QQ3A 2AQVA 3P8JA 5K4ZA 3JVAA 4AZCB 1P4CA 1TX0A 1W5NA 2ACRA 5CC5A 1JR1A 4BF5A 2WW5A 1TUFA 1ZUAX 1QNVA 4IF2A 4AHPA 4V2XA 1ADOA 1K4HA 2GUUA 5E70A 3CWOX 4GIRA 5FAGA 3E5BA 3ONCA 3IANA 3D46A 5CG7A 3S9YA 1UYQA 1BTMA 1QW8A 3RJXA 2D2GA 3VCRA 2Q09A 3FSTA 3DKLA 4LEFA 2CZDA 5AYIA 4LALA 3W22A 2CZEA 5E93A 2EPMX 3A5VA 1R7AA 1V51A 1M41A 4F2UA 1K77A 2YB4A 3BG3A 2QDDA 4QROA 2IQDA 4E2VA 2Z2AA 5AHNA 4LVDA 3K2GA 2AAAA 1SZNA 2XIOA 3WN6A 4H8UA 3IARA 5LYRA 3T81A 5A8QA 1GQLA 2VFFA 3WQWA 2PBGA 3EWBX 3E0IA 4JTTA 1FHUA 3ARZA 6A3HA 5F2GA 2H6RA 4WLCA 5CBIA 1V6XA 4YHGA 1K8ZA 2E0PA 2NV9A 1H51A 4PMUA 2QXWA 4LRTA 5AYBA 3PAJA 4AZIA 2ADAA 3ZOAA 1CX9A 4EXQA 1YTDA 2ABBA 1K8YA 1XCWA 3MUAA 3PULA 3THQA 4IJCA 5HMSA 3BOLA 3A9IA 4IQDA 3CZJA 1QPNA 3G8EA 3PNUA 3IIPA 4X0VA 4QAIA 3W1TA 1TJ2A 4IMCA 3GTFA 2FPVA 5F2LA 4UQBA 2BODX 4DELA 1I6NA 3RRXA 4GJJA 4LWWA 2H90A 3W53A 5IHRA 2IQ0A 3KRUA 3PUOA 2ZA1A 3USBA 1DWIM 4UQAA 1KCLA 5REQA 1P1MA 3XINA 2J7CA 1R2RA 5BXSA 1M53A 4JQAA 4S3AA 4MNMA 1VFSA 2OYMA 3OVPA 4IISA 1RA0A 2W6RA 1E9IA 3T09A 1BF6A 1UZ4A 1Z41A 3TQVA 1PYMA 1OADA 3N2TA 3B0VC 1Q2SA 4NG3A 3GTNA 3L12A 5EFDA 2CNCA 1XIHA 3A6OA 1HVQA 1EBGA 4A21A 3MI6A 4UOJA 2HBXA 1E70M 1E1CA 2DUXA 3V7PA 2BHUA 4PZVA 5DX7A 8CGTA 1TTQA 2EGZA 5I5RA 3RRAA 5MKGB 3GTIA 3VE7A 4MJ2A 3UWVA 4U10A 5M03A 1ZBCA 2OGJA 1K8CA 4FEZA 4GQBA 4QNWA 5C54A 1YDOA 2PZNA 4GINA 1JXJA 3AMLA 2QV5A 2D3LA 1Z69A 3A4JA 1XIIA 4XBJA 5C0QA 1XG4A 2YCIX 1KQZA 4KESA 4NZCA 3OQEA 5JBFA 2DZWA 1W9DM 1FDJA 1RVKA 1VFOA 4IX0A 1K4GA 2EO7A 4QJ3B 1VPXA 3WJZA 4RE2A 1JRCA 1MEIA 4HOWA 1LYXA 3EDFA 3VOIA 2Y8VA 3OLDA 3EBVA 6REQA 4J35A 3NO5A 4BWLA 2VRQA 4QCFA 3C6CA 3SCTA 1BXCA 3S2LA 4Z2IA 1XQKA 5C70A 4N9BA 2TAAA 4JS3A 5FJTA 1WB0A 1JGIA 4PMJA 3QZEA 1D7FA 3VX0A 4HZ8A 1XLMA 4O15A 2WHLA 3N3TA 1G7UA 4WOQA 5DCEA 4AFYA 4JHZA 3WCZA 1DVJA 1R6WA 2FPTA 3A9BA 2YB1A 1VFFA 4Y96A 1LF1A 2XVPA 2E1WA 1UWRA 4IPJA 3EPMA 4P8WA 3W2NA 3M41A 5IRPA 4M1BA 3GM8A 1TTPA 1B1YA 1OABA 3DHUA 4UCGA 1VR6A 3FHAA 1GOOA 1SUXA 1TE6A 1H0IA 2VEKA 5DMYA 3VKKA 3PZ9A 4PBFA 4MY8A 3R0UA 1LOSA 4D6FA 1JUKA 1YQ2A 1F6PA 4ZGYA 3OVRA 4H6RA 5BOOA 3CHDA 1VC4A 3GZAA 4C6IA 1F74A 4PE8A 4LYPA 4KWSA 2WANA 2I16A 1B3ZA 5G4HC 1IGSA 2J8TA 2BG5A 4UR9A 1VJIA 3C61A 3KTCA 4M81A 1TRIA 1SR0A 2FTWA 2RDUA 4DUXA 2YZ5A 3OLIA 3BAYA 3D47A 3WZ0E 5M5DA 1V3KA 2EHHA 3GYCA 4OECA 2DDXA 3U8GA 1H11A 1WP6A 3M0LA 2WLYA 3NQGA 4LV9A 5FSDC 1JUBA 1JCMP 1EOKA 2CKRA 3OGRA 4GX8A 4K7VA 4ZB0A 4IX2A 1SR9A 1HJVA 3NNTA 3T8QA 2DZBA 2D0FA 3CHFA 3G1VA 4RE0A 1PX8A 1JDDA 1S5WA 1XLCA 5TQLA 1OBAA 3F5KA 5KZEA 1S2WA 3MS8A 3QPYA 1H7XA 2FKPA 4C6NA 2I17A 3MHGA 3IVTA 4MY9A 4CD8A 4YTSA 3OIXA 1JF5A 4J27A 1W37A 2QPXA 1W9UA 2PLKA 3U9IA 2PLMA 3CUZA 3MC5A 2NX3A 1KXTA 3PVFA 1E4LA 5CG0A 1AMKA 3O3RA 4DO7A 4YVVA 3MV01 5C9RA 5IFPA 5AHEA 1XKYA 4NRSA 3GIPA 3TX9A 3L4XA 3BLDA 3AMGA 2INEA 2E8ZA 4CEXC 4CN6A 3LBMA 5K9CA 1UZDA 3M0MA 3QXBA 2IPGA 4TTGA 3CQJA 3WUFA 3VKDA 3VIKA 3S0CA 6CGTA 1R7OA 3UZWA 2BVYA 3WMCA 3AS1A 4NI8A 3L4ZA 4LVBA 5AKQA 5E9AA 1FWSA 3WUGA 2OVLA 4IQJA 3ITLA 3SUSA 2FGZA 3S1XA 4LVGA 3U7VA 3VYLA 4ZQRA 2Y8UA 3W73A 1RBOB 4L5ZA 1XYMA 3AHTA 1IXQA 3QGVA 4IH3A 3T0AA 3N6HA 3UG8A 1XGEA 4W5ZA 3MSDA 3RU8X 4DJFD 2Y24A 1JZ7A 3U2OA 1QW7A 4LV4A 5FEPA 2IXVA 4QNEA 1KRAC 1Q8JA 3V1PA 1E72M 3VPLA 3UR2A 2POZA 2P0OA 5LXEA 2R1MA 3CZEA 4UR7A 4HU3A 4LUTA 3W1RA 2OMAA 4XD6A 2FJUB 3AICA 3LYEA 3EMZA 1I2OA 4JX4A 1H7OA 3MU7A 2E67A 3WFLA 4DF1A 2DIEA 1GVSA 2WC3A 1MXGA 4I9AA 3POCA 1KM3A 3GR4A 3PFRA 2Q6ZA 1GVQA 4X2PA 2XZ7A 3ZIZA 3RLHA 4FOUA 1W9PA 3WD2A 3LMZA 4K37A 2NWRA 2NQ5A 4QE1A 3RIKA 4E2BA 2TSYA 7REQA 4V1XA 1I2NA 4H01A 2J88A 4AWSA 2J9XA 5DN1A 4U5IA 1S2UA 4GXPA 4NHVA 2FH8A 3C2OA 1EJWC 5T8GA 1E5JA 1KWGA 2RUSA 3UQNA 1JEZA 4J5NA 4ZQNA 1A0EA 2DZVA 4R9OA 1F9CA 4TR9A 1OF8A 1BYBA 2PLCA 2XIQA 5TBOA 1IIHA 2C0HA 3KEHA 2UV8G 3QQWA 2J4GA 2PU0A 4UB9A 3OZMA 3N13A 5FD0A 1HFBA 2PRHA 2H9AA 2REQA 3WNLA 2V81A 3JS3A 3TMLA 2WVVB 3NEVA 4NQ1A 4IIHA 1A0CA 1GKRA 4HMCA 2OLHA 4C6KA 1GJPA 2CBJA 4JQ2A 2CLOA 3S9ZA 4WUIA 4H6KA 3GDMA 3GDBA 1C9DA 5BNKA 4PUUA 4OUIA 4GVHA 5EBAA 3T44A 1VBHA 3GX9A 3LPFA 2W5FA 1PKNA 2XH4A 3I7SA 4GPNA 4HMEA 3FDGA 2YCKX 3KOWA 3W7DA 2ANUA 1FOBA 2VD9A 4RPPA 9CGTA 2OG9A 3GAYA 3GHSA 3VD3A 2XVNA 4EAYA 1X1OA 2UY4A 1B4KA 2VGGA 5D30A 1OT1A 2WO5A 3L5MA 3LPOA 3ZWSA 4UNIA 1W1B1 1KLYA 2OB3A 4LF1A 5G1TA 4IIGA 4MF4A 4C7DA 3VNKA 2DORA 3NQ2A 5CPOA 1O1HA 2XFFA 3TN6A 1GZGA 2PDQA 3TK7A 3VOJA 2D1ZA 4GOAA 3NDOA 1A5CA 4JNZA 1DL3A 4KIEA 3R79A 3PC0A 1I2QA 1D2KA 5JXQA 4MADA 1SO6A 1G7VA 5FJJA 1UHVA 1TCDA 5IM51 4GBUA 4NAFA 4B92A 2ZXQA 3NQVA 3F4NA 2A79A 5TF0A 3UESA 1DOSA 3H22A 3TN4A 3WFZA 5D09A 5AYYA 2EBNA 4IG2A 2QMKA 4O0QA 3U3HA 3B05A 2FB3A 4RPQA 2BGQA 3FJ4A 3BW3A 5JMUA 1GOQA 1GW1A 3U2EA 3U4FA 3HZ3A 1UWSA 3D6NA 4MAVA 1JYXA 1L0PA 4B90A 5J5RA 2D2JA 1WDRA 3HGJA 4HNLA 1E6SM 4YYCA 3P7YA 1YNYA 2HVMA 4AC7C 3W07A 5EMYA 1XXXA 3VABA 1E6XM 3GXFA 3VMOA 5C9UA 3CV1A 4GJ1A 3MWAA 4LSBA 2V5DA 4W9TA 2YCLA 2XN1A 4UTHA 1MO0A 5DELA 3M5ZA 2PBOA 3OQ8A 3APYA 3F7JA 4AMCA 1BQCA 4O1BA 4XD5A 1QDSA 1ZHAA 4WSJA 1LT8A 4X9YA 2NLYA 4MAZA 3DXIA 3LPGA 4V15A 2YYTA 1A3WA 1A4LA 1VFMA 3FJ6A 4WJXA 4DBSA 1BG9A 1M1BA 3S2JA 4US5D 4M8UA 3I7QA 2V5JA 4O13A 7TAAA 1N8IA 2AQWA 7CGTA 1Y5WA 3WH7A 1M3UA 2HJPA 5AC7A 1XC6A 3O6AA 2ZRYA 4AY8A 4L4OA 4DZIA 1LG2A 4M29A 5I3DA 1Q85A 1SPQA 2J75A 4G7EA 1NWRA 1PEZA 3NM3A 4ZOAA 4I90A 3UCCA 1EJUC 5AHLA 4Q8QA 1JAKA 4ECLA 4TX6A 1JFXA 1TPEA 5LIXX 3ITXA 5D2WA 2QCMA 1TPB1 3NOYA 4LCQA 1FKWA 3PBYA 1JZ6A 5HWNA 1LLOA 3W37A 1ISXA 4JKMA 2YL6A 2PSNA 4AC1X 3SAZA 3O16A 3GXPA 1TZ7A 4X63A 3NIYA 4XIMA 4UTTA 1HGWA 3GFZA 1DQWA 1GVYA 1Q6OA 4HNTA 5JIPA 3K4WA 1E0WA 5A5WA 4ONVA 4GGHA 3EPOA 3HURA 1DXFA 2ZZ5A 3HBLA 7A3HA 3H21A 4JFTA 3NL2A 4CD6A 2Y6ZA 2E9LA 3BLPX 3CHVA 4NRRA 2Y62A 4PUNA 3CYJA 3HA1A 2CLPA 2PTXA 1EJ7L 1CTNA 3N4AA 5FF2A 3IWPA 3TYAA 3B97A 3WQ4A 1UD3A 3LGEA 1JULA 3P3BA 2BGSA 1A5LC 4O0KA 1FWAC 3RILA 4Z08A 4GYKA 2IKIA 1UR9A 3W74A 3EX3A 5REQB 4A8LA 2X1RA 1GPWA 1DJXA 2J9ZA 1CGYA 3IK4A 1SZFA 3P67A 1Q4NX 1RY8A 3DIPA 3W76A 4WSKA 1RLCL 4AXKA 3K8KA 3H23A 3CAKA 3TH6A 1GT8A 1VCGA 1AH3A 4C5YA 1BGGA 1A47A 3TCEA 3VC5A 3RUBL 3C0SA 1JDCA 4HNVA 3BAIA 4FNSA 3B8IA 3W23A 1UH4A 5A2AA 1KO0A 1E1CB 3NYDA 1VRDA 4PGLA 1EOMA 1R2TA 4J28A 4QG6A 3U4AA 2PC8A 2UWFA 2XIIA 3TVAA 4ACZA 1PUDA 2I56A 4O18A 5DY3A 4BI6A 1QRQA 5AOUA 2VR4A 4ZFCA 2H3DA 2ZUWA 3VKBA 3G1XA 4I5XA 1R87A 4HT3A 3BAKA 1X1NA 2HVOA 3I3EA 5D33A 1IQ8A 1E5NA 2GUBA 3AXHA 1AJZA 3W86A 3IIOA 3ZJ8A 3MSYA 4JX6A 1QI5A 3Q94A 1QPRA 1DE5A 1AD4A 1F6KA 4HPGA 3DBPA 2YA0A 5HJYA 2GGJA 1ZPTA 3VZYA 4C1LA 1XRTA 2QCEA 4JZ5A 4FIQA 4LAMA 3MTWA 2E25A 4S3KA 3AWNA 1T7LA 1J12A 1XH0A 1U30A 3GNRA 3A21A 3H8AA 3H24A 4L1GA 3TXZA 6REQB 2NQ9A 4H2HA 1XGZA 1JI1A 4ML9A 5DLCA 3MB9A 1W1VA 3IGXA 1QOQA 7XIMA 2WVTA 1B54A 2ISSA 1K7FA 3LXCA 3FGCA 2CPUA 4S3DA 1NQKA 2GFTA 1S3TC 1WZLA 2YFNA 1KM2A 4XK2A 3IRDA 1SGJA 2E1DA 5XINA 1ITUA 5C55A 1UR2A 3NURA 3OHMB 3VUPA 1XRSA 2C91A 2GYIA 5I77A 1PO9A 4Y8FA 4P7QA 3CIXA 3PTDA 1K03A 3QGKC 4PMVA 3WF4A 4RNIA 4PTNA 1ZRQA 2BP1A 3N12A 5AYZA 3KVKA 1TCMA 4R33A 5T91A 2D2OA 3TC7A 4UTWC 4GWEA 2ZX6A 3KRBA 3OYZA 1VS1A 3OZOA 3KAOA 4C6QA 3N73A 3BSHA 4JL2A 3SCNA 2PUZA 4NL1A 4JCLA 5A8NA 5DQPA 1XIBA 1M01A 1PHQA 3UY8A 3F03K 3WG6A 3ZJ7A 1TMHA 2WJDA 4PCPA 3Q58A 1W3TA 1ZCOA 2YIHA 1VEPA 2A0NA 3ID7A 3S83A 5IBXA 1M5WA 3S1VA 3GD6A 4CQBA 2QJHA 1IZJA 4ZB2A 1EUNA 3EZ4A 1M65A 4D2JA 3NO1A 3UWEA 2DU2A 1RALA 4A35A 5LIWX 3S2NA 1UUMA 4KT2A 3W7MA 2JIEA 4AD1A 2QV4A 4DUVA 1YIXA 4JHMA 1LWIA 3SUWA 3B4UA 1WKEA 4X61A 4EPEC 1TZZA 3WMLA 1D7KA 5F7UA 1IGWA 2I9EA 3G1RA 4ZXLA 4TTUA 4A05A 3CM4A 3V3WA 4G6CA 4MJZA 4DJEC 1TIMA 5CSRA 4HHLA 4QLJA 4ERIA 4GI6A 3BGJA 1UR3M 1FHLA 4PODA 4J9JA 2HRWA 3CLWA 4GIAA 2TPSA 3MT1A 3P6LA 2E6YA 4DJFC 3W0KA 2O9PA 1EGVA 2XSXA 3T2OA 1X96A 4H41A 1KFCA 2IS7A 3HJZA 3LHUA 3R0DA 2V30A 4IIBA 1DE6A 3CZLA 3GXTA 3MQTA 4QG8A 2YLAA 1BRLA 5EMMA 3ZFHA 3C8FA 1S5NA 3EWXA 1T6MA 2KAUC 2J7GA 5JH2A 4L9XA 4NNAA 1HL2A 1HKIA 1KCXA 5ECUA 3JR2A 1QO5A 4MFEA 3TTSA 5D9MA 2GJPA 3NZGA 4FXJA 4FXFA 1V5XA 4GIEA 2E5DA 4IGNA 5GVJA 1QNRA 5G2IA 5AY7A 2W0UA 4AD0A 4NJGA 1UD2A 3VGFA 1CGWA 3FKKA 4KRTA 4LUSA 3DYMA 3VINA 5TNVA 1Y8BA 3V4BA 2GUYA 2EJ1A 4OUEA 2WMFA 1F7BA 1HQTA 4GX9A 1XFCA 3B40A 2PPGA 3TN5A 5F1VA 4MJMA 4AG0A 1FWDC 4YNGA 3JUGA 5C2GA 1YBQA 1G4EA 3W27A 3AISA 4C1KA 4RZ4A 3L9CA 4TV6A 4R5EA 2OWWA 3CAWA 1K70A 2QCGA 3MSGA 4LUTB 1E9ZB 4RJEA 2R1LA 1FUYA 1SJBA 2OXNA 1NOWA 3L0KA 1VHNA 4JFVA 3VD5A 1CXEA 2PD9A 5EBUA 3MUIA 2Z27A 2BOGX 4WVXA 1JIBA 1MI3A 2FPYA 4WQ6A 3NZ1A 3INPA 3W00A 3IGUA 4C6JA 3TC3A 2P3ZA 4LW7A 1TZ9A 4L64A 4JDYA 3T4CA 1NOUA 2WKJA 4QS5A 5H6HA 2R82A 3AXXA 2VVSA 3CGTA 2RGLA 1UJPA 3SSZA 5CPSA 4WEVX 1VYRA 3OGVA 3QY8A 3ZR5A 3G3MA 3VA8A 3CIVA 7REQB 2W61A 3VIFA 5DY2A 3BZJA 5CJ5A 3SCPA 3LXBA 1P0DA 1RZMA 3MMDA 5ABGA 3B9OA 1GVRA 1W1A1 3W88A 1EO5A 1LOQA 1F3XA 1CNVA 3DFQA 1GORA 1UKSA 3C5QA 3CMJA 3MV11 5DF0A 2WWCA 2OX1A 3RK8A 3ABQA 2DP3A 1XUZA 1KM1A 1H61A 1X6LA 2JFEX 3BVJA 4OGZA 5HXMA 2WNZA 1FWJC 1XIDA 5LA1A 1VENA 5DMLA 4GVGA 2PCQA 3EWDA 1YPXA 3HGSA 1TG7A 1XH1A 4RX0A 2OELA 1ME9A 2BY2A 1NWSA 2H9AB 2REQB 1J11A 1KWKA 1DTNA 4JIIX 2ISDA 2F84A 2Q01A 1O5KA 3WDPP 5F1UA 4RZ6A 2P8BA 1SZGA 3WH6A 3UFYA 3TWBA 4RDWA 3DENA 4LOCA 4DNMA 5BOFA 2VCCA 4HOXA 2OODA 2MUCA 5ABFA 2HISA 4V28A 3DFSA 4DUWA 2E9BA 4RZBA 8A3HA 2VEGA 4Q32A 1Q7ZA 3UJSA 3SB0A 3H2FA 1I2RA 1TQXA 5DXXA 5HPCA 2QCFA 3E96A 3FYPA 3VKJA 4R9XA 2DH3A 2ZVRA 3CB8A 1IEQA 2E8YA 4LC6A 4NP7A 1A4MA 1LQ2A 5BRBA 2Y61A 3TZNA 3BAWA 1HP4A 4KH2A 3MI2A 4IFOA 1YW1A 1JJKA 3E9AA 2VC9A 3HQ1A 3FS2A 4W7VA 3ITGA 2EG7A 4LF2A 2V69A 4JN7A 1W8SA 2O4QA 3CV2A 4PH6A 3ABXA 4XTIA 3AJ7A 3IRSA 3NG3A 2I7GA 1XQLA 4PB3A 3W29A 3ZM8A 1E6ZA 2D0HA 1ISVA 3G6MA 5M3WA 5DMMA 2P50A 1TMLA 2VXNA 2QULA 3L21A 3IUDA 2BVWA 3WBYA 4CGTA 1EGZA 4NAFB 3NR0A 3RX2A 3LCGA 1Q45A 3EOLA 1DJGA 4A8NA 2R24A 4KWVA 4BQ2A 1OX6A 2OFJA 4K3ZA 1BGAA 1FQ0A 4WY0A 4GUGA 5LIUX 4NI3A 5BWFA 4RNJA 1RSCA 2RAGA 1E1EA 4IG2B 4B3ZA 5JH1A 1UUQA 3FA4A 1BPLB 4WDTA 1J2BA 4OE7A 3EWUA 3A64A 1W3NA 4XZHA 1NU5A 4JIEA 2GSHA 3S3GA 1PPIA 1BHGA 2PDUA 2V3FA 1QUMA 2UY2A 3NGFA 1ICPA 5A6JA 2YDAA 2WSRA 5EPDA 4RLIA 4ZB5A 2FTPA 2PF0A 1OFOA 3LRKA 3PBMA 3CTLA 2ZOXA 2V2HA 4NZ5A 1XIMA 4A3QA 3B8SA 1R3RA 4PUWA 3UXLA 2YCLB 4P61A 2DH2A 1KA9F 4JKLA 4R3UA 2PDKA 3LTYA 1EKOA 4QM1A 4ASTA 1XYFA 2DY3A 3M7WA 3VILA 1DWHM 3UXKA 1GWJA 2QPUA 3ITYA 4IQLA 4Y9NA 3IJ7A 2YDRA 3QLDA 1SW3A 2Q8LA 2HK1A 4Z1AA 5A8OA 3EKLA 3IS4A 3N14A 4ZO8A 3BJFA 1YNPA 2QF8A 2J8GA 1EX5A 2D20A 3WH9A 1RD6A 2YPIA 3WFAA 2GJNA 3ECQA 5A6MA 4KFNA 4H6QA 3R6IA 3HV9A 3LQGA 4G7EB 4I5RA 1VCFA 4AXNA 2AQOA 4IGMA 1KFKA 1K7XA 3C52A 3FNDA 1JPDX 5DXYA 1KC7A 2ZA3A 3NQ7A 3GDLA 5AVNA 4LGXA 3R4IA 5LIYX 3SJNA 2BOEX 2OOGA 3XISA 4K1WA 3P5YA 1PV8A 5EB8A 2Z7GA 3V0SA 3FEMA 5AC5A 1GK8A 1Q6RA 1US0A 5IDIA 1EQPA 2XN2A 2BXVA 5A6BA 3H70A 2A7RA 3R94A 4F0HA 3A13A 3V36A 1OVDA 1PTDA 3F4CA 1GQJA 4CQAA 4LPCA 1L6FA 1A5SA 5HA7A 2VJXA 1MUMA 1KQYA 2P1FA 2XVLA 2YX0A 4HZMA 3TAOA 3RCYA 4KCTA 2BDQA 2PB1A 1MNZA 4R88A 4WR3A 5L6UA 1BVNP 3KOYA 3SCSA 2C1HA 3MP5A 1F8MA 4KEUA 4ZBCA 5E0KA 4B9ZA 4AD5A 3KRZA 2OWXA 1Q4WA 3NPWA 3IJDA 3W1LA 2DT3A 1KGXA 2F2KA 3S1WA 1FH7A 1LTDA 4Q8WA 3TKFA 5IDZA 3P2VA 3ZQ9A 5JBEA 3WK0A 2Y88A 1XIEA 3QC0A 1VLWA 3ES8A 1OG6A 4RCXA 5EMKA 2VOMA 1Z32X 2Z6IA 4G5DA 3OLGA 4LANA 2VTFA 4Q8UA 2CETA 1EIBA 1TPVA 4KEZA 3K13A 1SW7A 4H9XA 2VFIA 3EGJA 2V2CA 2XSAA 3TTOA 1HTIA 3H55A 4QE5A 2E6AA 1E6NA 2OT1A 2O9RA 1E4NA 1BYDA 3DESA 5CPNA 4ACZB 4F8XA 3T1GA 4BHYA 5CZKA 1AW5A 1JAEA 4FALA 1PL9A 4OBSA 3AS2A 3N18A 4UTKA 1RJRA 1Q8AA 3KDNA 4D8LA 1W9VA 3EWWA 3EPNA 3QJAA 2BLEA 4W5UA 2JF7A 1VFLA 3PM6A 2J74A 1CLKA 3W26A 2GVEA 1KBBA 1UZ1A 3UR5A 2RGMA 3I7RA 1W2PA 1P1XA 1U2YA 3CK5A 4PEKA 3OYXA 2PEVA 3PJXA 4O0ZA 1VF8A 5C5YA 3QM3A 3DN5A 1E15A 3F4WA 1X8FA 2GGEA 2YYUA 2YW4A 3SN0A 1RJQA 1EWEA 1DWJM 1OX5A 1CWYA 5IFTA 2A3AA 1YPFA 4A22A 4J3VA 3H54A 3WQ8A 3FLUA 3NQEA 1FXPA 2ABAA 4DX3A 1RA5A 5CH9A 2X1UA 4UFMA 1C3FA 2HEJA 1JDEA 2HXUA 2J25A 5KMYA 3FGCB 4KPLA 1Q65A 3M0IA 4QDWA 2J6VA 3PNZA 1B9ZA 3MDUA 4G56A 3Q37A 2RDWA 2W63A 1U5JA 4QS6A 1PTGA 1Q6QA 3M1ZA 4YTQA 4LBRA 5KZ6A 4GYPA 1D3CA 3AAMA 3SCUA 2OZ3A 2PS2A 3T05A 2OKTA 4QGCA 3QW4B 4HA0A 2INFA 1C9WA 3TN3A 5EA9A 2BTMA 3TDFA 4FLQA 4UUIA 5F4XA 4L9YA 6ALDA 3H7VA 2Z1XA 1O4UA 3G8RA 4WDWA 3WLRA 4GQRA 4F3HA 1W5MA 3H2AA 1EEXA 2FDMA 3VNIA 3NWRA 3ARPA 2XDFA 4PTDA 1XDJA 1TPUA 1TVPA 3LZ5A 4OU1A 1T8QA 5AZ0A 3N6QA 4JAWA 5E6YA 3VIGA 1A5KC 5EY5A 5HATA 3UZ5A 3M7SA 4P7RA 1S3HA 4LX4A 3M0XA 3G0UA 3UA4A 1R46A 3STFA 1CGXA 3LV6A 4NYUA 3W1PA 2A7NA 3O7UA 3NOEA 3QV9A 3DFTA 3QR1A 3G1HA 1S5TA 2YL5A 1HXJA 5JU6A 1A5AA 2RKXA 4LJ3A 1KLZA 3W87A 3CH0A 2YL9A 2C14A 4PTVA 2YR1A 1ZFJA 1W8GA 3LMYA 3H4GA 2FZ9A 1DJNA 2BBFA 5TAOA 3E74A 5K7JA 4L4PA 1EZWA 3CS2A 3WJWA 3CQHA 2WMJA 5F4SA 4QIUA 3OEXA 1UP0A 3GHTA 2DGAA 4TIMA 4QAWA 1KBKA 1ZAHA 3PHAA 1C8VA 3ZT6A 5I3JA 1GVFA 4RW5A 2YL8A 2OX4A 4MPQA 3GFYA 4S38A 1H7NA 1V02E 4F0RA 3FW6A 3KZSA 4HZ6A 3UGRA 1MRQA 1VQTA 3DH7A 3NVTA 2FZDA 1TTIA 1XBZA 4CU6A 3G0SA 3EA3A 1KKOA 4M82A 1TO3A 4FR1A 2PURA 3O0KA 3TW9A 4LCRA 4OV4A 4GNJA 2EG6A 4O52A 1BYAA 3STCA 4RNHA 4Z1DA 1KFEA 3LK6A 4DLMA 2E4TA 1BRLB 1P48A 3AZTA 4FNPA 4LT9A 2EPOA 2FHBA 1K6AA 3GVQA 4S2CA 2PE4A 3A4AA 4C6LA 3TLLA 2J66A 4JDBA