5EMMA

Crystal structure of prmt5:mep50 with compound 15 and sinefungin
Total Genus 200
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
200
sequence length
625
structure length
625
Chain Sequence
RVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Protein arginine N-methyltransferase 5
publication title Structure and Property Guided Design in the Identification of PRMT5 Tool Compound EPZ015666.
pubmed doi rcsb
source organism Homo sapiens
total genus 200
structure length 625
sequence length 625
ec nomenclature ec 2.1.1.320: Type II protein arginine methyltransferase.
pdb deposition date 2015-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05185 PRMT5 PRMT5 arginine-N-methyltransferase
A PF17285 PRMT5_TIM PRMT5 TIM barrel domain
A PF17286 PRMT5_C PRMT5 oligomerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 5emmA03
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 5emmA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5emmA02
3P2EA 1XLBA 1DL5A 3HNRA 5DRTA 2AN4A 5J8LA 2B25A 1AV6A 4GJJA 2ADMA 2YVLA 3HCFA 4ISCA 2N47A 2C7PA 3KQWA 3CNYA 4M37A 3NDIA 5EZSA 4DM3A 5EMMA 3M70A 1Z3CA 2C7RA 3AY0A 5HIJA 1QANA 3L23A 2G70A 1DE6A 2NQJA 1D2CA 3DR5A 2XYRA 3KCJA 4DQ0A 3BWMA 5K09A 1RI4A 4KDCA 4YTRA 2QE6A 5FHQA 1I9GA 5EVJA 3LHDA 1X19A 2ERCA 4HG2A 3UJ6A 3VNLA 4FP9A 4A6DA 3A4TA 4R6WA 4P7GA 3ERCA 1NBIA 1D8WA 1FP1D 1FP2A 3EGIA 4GOMD 1XYAA 1M6EX 2IBTA 3QZAA 4QVGA 4C04A 2Q02A 3KKZA 4PYMA 1PRYA 3IYLW 1XLMA 1RI1A 4QE1A 1XLLA 3M0MA 2PXXA 5EHIA 3G2QA 4YUVA 3FRHA 2P35A 2P41A 3C0SA 1L3CA 3H2BA 3O4FA 3TMAA 4C08A 1YZHA 5DSXA 3DLIA 4WVLA 1X1CA 2UZ4A 2QULA 3KBWA 2BR5A 4AZSA 4YTQA 5ICFA 5I7GA 1XLDA 1NV8A 4A8IA 3VSEA 2O07A 4R8SA 2PGXA 4YV0A 1XIBA 3FPEA 3KPWA 3MGGA 1UFKA 1XYBA 2QM3A 2GUBA 4KVZA 2I7CA 2IDKA 2YXLA 2ZZMA 3DLCA 2EJUA 2ONYA 2GLUA 4RTPA 3EMBA 3SGLA 4X60A 3DH0A 4R6XA 5GM2A 3SSOA 3HVHA 3HA5A 2HCVA 2VDUE 3LMZA 1VE3A 1XLEA 3QV2A 2ORED 3G2OA 3DP7A 3HEMA 1KPIA 3NMUF 1XXLA 3ELWA 1R8YA 2OB2A 2JHCA 4QQKA 4KW2A 5FA8A 3EGEA 1EIZA 5EIWA 1XYCA 1Q0TA 3LCVB 1WXXA 3LL7A 4FZVA 4OVXA 4EKIA 2OBFA 3ITVA 3OU2A 3G5LA 3FZGA 5XIMA 5CUQA 5E1DA 3CQKA 1TZ9A 1KR5A 4PIMA 5M5BA 7XIMA 2X7WA 1WXWA 4XSLA 1WY7A 3FTFA 1WS6A 1NW8A 3VC1A 1RJGA 2OB1A 3EVFA 3ER9A 3ITOA 2LD4A 4YMHA 4LWPA 1SUSA 3BGIA 2DULA 4ZB5A 3EVGA 2IFTA 5CCXA 2O06A 4ZTBA 3GXOA 3EVBA 1XDZA 3P8ZA 5K0FA 3JWGA 1P1CA 4AZWA 5HIKA 2I6GA 3REOA 3BANA 3KQYA 4HGXA 2ZFUA 2FCAA 2IH4A 3HCAA 3EVZA 2GLKA 1KYZA 3C0LA 3SVZA 3B7PA 3OZTA 1VP3A 4XISA 4X63A 3MAGA 4F84A 2GPYA 4A8RA 3EEOA 4GJIA 3LBFA 2ZW9A 3DMFA 3K6RA 3LCCA 4PYLA 3FTCA 1XP3A 3CQIA 2AOTB 2CL5A 3GJYA 4WXHA 5EQJB 1A0CA 1SG9A 4F85A 4MHTA 3C3YA 3V8VA 2AOVA 5EMKA 3HVJA 5EEHA 2FK7A 4HTFB 5K0JA 4X1OA 3PX3A 1L3IA 4GC5A 5DWQA 2Z6QA 2NQHA 1R18A 3CJTA 3A26A 3JWIA 2EG5A 3U0HA 3ELUA 4AUKA 4BLWA 4IWNA 3P9CA 2OZVA 4V0RA 4P7JA 3SM3A 4YV2A 1NW3A 2XYVA 3SSMA 5DXJA 1ZGAA 5JUWA 4YMGA 5EMLA 5K0EA 1VPTA 3GRUA 3PLAE 5FULA 4EQZA 2P3QA 4F86A 2WA1A 3AJDA 1XLIA 5T6BA 5BP7A 2EX4A 2ZTHA 3CC8A 2ZZNA 2BH2A 1XYLA 2OU4A 3LECA 3KWSA 3M4XA 1CLKA 3G5TA 4MIKA 5DXAA 2E5WA 2YR0A 3M6XA 3TLJA 5FWDA 3CJRA 4ZB2A 2G0WA 3Q87B 2OO3A 1YF3A 4AX8A 3DXZA 3MERA 1JSXA 4RTSA 1KYWA 1BOOA 4RVFA 1XLAA 2NNWB 2GA9A 3SX0A 5EEGA 4RX1A 4GLEA 5EMJA 2XISA 4EAYA 4PFHA 1R74A 1GW9A 1NBHA 1SUIA 1ORIA 2BM8A 5HIIA 1P1BA 3KBNA 3OU7A 1B42A 3N4AA 2PKWA 3UJDA 4CTJA 2NP6A 1DXIA 4KW7A 4PWYA 4PYJA 4CKCA 4W4QA 3WQOA 3KQTA 4DA4A 4YTUA 3OFKA 3THRA 5FADA 2NYUA 3CGGA 4HC4A 4ER6A 1KHHA 2NXNA 1Y8CA 2G4JA 5GM1A 5ICCA 2XINA 5DSTA 3GNXA 5D1NA 3FYDA 1SVUA 3T7RA 5CVDA 2NQ9A 2G1PA 4GF5A 3FYCA 3TRKA 4E31A 3A27A 3TOSA 3D2LA 3PFHA 3NTVA 2B2CA 1XDUA 3ELYA 3C6MA 3ELDA 4V0QA 5F2KA 5KQSA 3KCOA 4U7TB 4FS8A 1I60A 2BR4A 5DX1A 3I53A 4BY9E 5DX0A 3OBEA 4E2ZA 3R0QA 4RTMA 3BZJA 3R6TA 2FHPA 1XIIA 4QDJA 3HTXA 3IHTA 2G72A 1XIGA 1TW2A 4GC9A 1XCJA 4GEKA 3EVAA 4O29A 5CCBA 1MNZA 4HGZA 2GYIA 4K3ZA 3UJAA 3NW9A 2YUIA 5DX8A 3GRYA 2QYOA 3V97A 3P9IA 4X41A 4OA8A 5EHGA 4BLVA 2HR1A 1DIEA 3HM2A 5GP1A 3FUTA 1A0DA 2JH8A 1XIEA 3DBNA 3KCLA 3P2KA 1WZNA 2IP2A 2QRVA 3T7TA 5H02A 3DXYA 4ER7A 4QDPA 5G02A 2FPOA 3HCDA 3G2PA 3FUUA 3TPZA 2V7EA 4Y2HA 1XIJA 3K0BA 3CWHA 2WA2A 3TKAA 3B3JA 4FSXA 1ORHA 1BXCA 3XINA 4XIMA 1IXKA 1UIRA 1A0EA 5C1IA 2G8NA 3G88A 1VLMA 3NWEA 2R6ZA 3U3HA 2ZBPA 1XLKA 4CWAA 3HP7A 2H11A 4PONA 4PYNA 2I57A 4DCMA 3UU0A 3FUVA 2AR0A 1FJXA 3BUSA 4QE5A 5DTQA 3X0DA 3B89A 1DIDA 2YX1A 4QTUB 4XUCA 5LSAA 1RI5A 2GS9A 4J4KA 1OR8A 1NV9A 1HMYA 1YZ3A 3E05A 3I9FA 3AXTA 2BZGA 4ZB0A 1XJ5A 4K1GA 2AZTA 8XIAA 1QTWA 2HTEA 1JQDA 1HNNA 4U7PB 2GB4A 3DTNA 2XYQA 4RV9A 1XIHA 4HHMA 1XLCA 2QY6A 5K0CA 1KXZA 3R24A 4GOOD 4RWZA 3C6KA 5CM2Z 3UVAA 4FSDA 5DTMA 4E30A 5E8JA 2H1RA 4C05A 2ZDSA 1EAMA 3PTAA 1O54A 3QC0A 5FCDA 1N7IA 2Q41A 3KR9A 3WSTA 2AN5A 5HILA 3MB5A 4RTJA 4R8RA 3U81A 3SMQA 2V74B 3BZGA 2IPXA 2PXAA 3HA3A 5EC8A 1PJZA 3P2IA 1YUBA 1G38A 2IH2A 3VNMA 1ZG3A 3B3FA 3UJ8A 2K4MA 5HIMA 3E7PA 1QYRA 4PYKA 2AN3A 3PFGA 2O05A 2PJDA 4P58A 1YX1A 2KW5A 5IH3A 2ZIEA 3NGFA 3UXIA 2ZIGA 3KBVA 2ZWVA 3KR2A 4FR0A 5DRYA 1P39A 1VIDA 2AVDA 2OXTA 4E32A 3F4KA 1N7JA 1XIMA 4XCXA 4FGZA 1XLGA 2JHPA 2VDWA 1AQJA 4RTOA 3P71T 4YUYA 1L1EA 1T43A 3ITYA 5K0NA 4YUZA 4C4AA 3BWBA 1EJ0A 2C7OA 4H0NA 2P40A 4A8NA 1NKVA 4HH4A 3OCJA 2B9EA 3VNJA 8XIMA 2PX4A 2DPMA 1L3BA 3HA7A 2Y1WA 5K0LA 5K0GA 4CKBA 4DUOA 1INLA 3UJ9A 3BZBA 3A7DA 5GIOE 1H1DA 5T67A 5XIAA 3KPJA 3L8DA 5K05A 3IV6A 3SR4A 1XIDA 5FWAA 1WG8A 3KHKA 1XICA 5DTRA 4G56A 4YTTA 3UWPA 5CIYA 5B80A 4OQDA 3B3GA 6XIMA 3BWYA 4LWOA 1XISA 1AQIA 2VDVE 4M7RA 3PX2A 3UA4A 4P7FA 2NXJA 2FYTA 1X1BA 4PYOA 3VNKA 4LNCA 1G60A 5DM0A 2EJTA 4KDRA 3JWHA 2UYQA 2PSSA 4RYLA 3FPHA 4QDKA 3BKXA 1XLFA 4LECA 1XCLA 5E9WA 2P3LA 3PVCA 5DLYA 1XTPA 2HWKA 4OX9Y 5EZQA 1QZZA 4RTQA 1BC5A 1VQ1A 2AOUA 5K0BA 2G71A 4FT4A 4HGYA 4IKPA 4QQNA 4PINA 2HK1A 2VZ9A 4OBXA 3FPJA 1QAOA 3M6WA 2Z6UA 1UWVA 5C0OE 3KTCA 3C3PA 4BP1A 2I9KA 3RW9A 2ZULA 2I56A 1NW6A 1OADA 4RVHA 3XISA 4XUEA 3TM5A 5FUBA 2F8LA 3MTEA 4C03A 2P7HA 3P9KA 2PXCA 4PYQA 5C9ZA 3P6LA 3TQSA 4EVIA 1AF7A 4DZRA 1O9HA 4PNEA 4KRGA 3DXXA 4RSRA 3FUWA 4US6A 5KVAA 4A8LA 3P97A 4OQEA 1R8XA 4JXJA 2QUNA 3S68A 3KR1A 5B7ZA 3KQSA 10MHA 3CKKA 1ZGJA 2I62A 2AOXA 4CKEA 5AVNA 3FPGA 1S5MA 2NP7A 3AYTA 4A6EA 3EGVA 3AXSA 3G2MA 4YUXA 2PWYA 1D2HA 3KBJA 1KPHA 1DUSA 1MHTA 3GWZA 8MHTA 2GVEA 5KQRA 2IDJA 3FTEA 1JG4A 1RI3A 1VP9A 1VBFA 2WK1A 5LQCA 3HVKA 3GRRA 2Y1XA 3IEIA 1ZKDA 4YTSA 3VNIA 3SSNA 5BXYA 1MJFA 5DM4A 4P7KA 4MQ4A 4QVKA 3RODA 3TKYA 4EACA 3MHTA 5GOZA 4XSMA 3DMGA 2C7QA 3OZRA 3M0LA 3LX6A 5F2NA 4POOA 3E8SA 3LKZA 5JR3A 2CMHA 4YV1A 3KQQA 4RTKA 2PT6A 3IUHA 3EVCA 4GOLD 5GWXA 3PT9A 3G7UA 1U2ZA 5LR6A 3UJ7A 3TC3A 5MHTA 1O1HA 3KQMA 3UA3A 4E2WA 4IV8A 4ER5A 3OE5A 1FBNA 4E70A 5ERGB 4DMGA 5DPMA 2ZIFA 4QPPA 3LCUA 3OE4A 3P9NA 5FQOA 5K01A 2JG3A 4EKGA 3UJCA 3Q7EA 3IUDA 3GO4A 2XVMA 1RJEA 3BGVA 4AZTA 5D1HA 1KIAA 3GU3A 2YXDA 3SXJA 4AZVA 4C07A 2AVNA 4PIPA 1I6NA 3FVMA 1I1NA 5H6HA 3MTIA 5KYGA 4NECA 3QYSA 2P8JA 5ICGA 2BM9A 1QAMA 3CBGA 4BLUA 3M0HA 5CVJA 2ZLBA 2QW5A 2IBSA 1TW3A 4RTLA 2ZWAA 2XVAA 3M6UA 3ANXA 3A7EA 2XIMA 2VP3A 5T64A 1DE5A 2OKCA 1XLHA 1BKYA 1VL5A 2JH9A 3CCFA 5LQJA 3ITTA 1F38A 4B17A 3I58A 5HZMA 1YFJA 2NXCA 3KBSA 2GAFA 2QRVB 2CKDA 2HMYB 5B1SA 4OBWA 1M0EA 1YFLA 5EPEA 4RTRA 1IM8A 5LQNA 4QTTB 3G89A 2VS1A 5TNVA 3HCEA 3CQJA 5E9JA 4XUDA 2XBMA 3I64A 1JR4A 2IIPA 4FT2A 2EFJA 4HSGA 1G8AA 1ZHFA 1IY9A 2PWPA 4PGGA 1BXBA 5E8RA 5K8VA 1JG1A 2UYCA 5HFJA 2PT9A 4KIFA 2ZZKA 3OZSA 5DT2A 1QUMA 4YUWA 2O0LA 4BP3A 1G8SA 1DCTA 3IUIA 4XKMA 1ZQ9A 5LQUA 2J6VA 1RJFA 3R3HA 3MCTA 5E9QA 3HCCA 3ITLA 3KQVA 3KPUA 3KR0A 2O57A 2P1DA 2OY0A 5EGSA 5LQAA 1S5NA 3VYLA 3FUXA 2GH1A 1R00A 2B78A 1BHJA 4E3VA 4HHLA 3LBYA 1NW5A 2QUMA 1JG3A 3NWBA 2PX2A 5EOVA 3BWWA 3ID6C 5CD1A 4DCGA 6XIAA 3TVAA 1XVAA 2ZSUA 2JHAA 3MCZA 1FPQA 4M36A 5E1MA 5B7YA 2PV0A 1KP9A 1NW7A 2Z6AA 3ITXA 3GRZA 1YB2A 5P8WA 3AYVA 3QXBA 3OU6A 1JTFA 5KS2A 2FK8A 1SKMA 3UJBA 3BDKA 3THSA 3M0XA 4RTNA 4E2YA 3T7SA 4PCAA 3GDHA 3AALA 4GBED 3KBMA 1JG2A 4PCLA 3PS9A 2PX8A 4HRAA 3R9XB 4KWCA 5FTWA 4X61A 4PYIA 1EG2A 3C0KA 2OPBA 3NVMB 4L7VA 2A14A 3VYWA 2AS0A 2HK0A 3UZUA 3PB3A 5DM2A 2HNKA 1JSZA 1SQFA 4DF3A 3FRIA 2AOTA 1O9GA 5FHRA 3B5IA 5DM1A 1I4WA 3DMHA 4ER3A 3TM4A 4K6MA 3HCBA 4MWZA 5EG5A 3C0QA 3CQHA 3GGDA 1XINA 2UYHA 3EVEA 1R6AA 4HTFA 2YTZA 1Q0SA 3P14A 9XIMA 4HNOA 3LSTA 3M0VA 1MUWA 3DUWA 2CWWA 3ER8A 3NVKI 3NDJA 2JJQA 4DVOA 2ZBRA 9XIAA 3M0YA 5AVHA 2FRXA 2P7IA 2YQZA 5E1BA 3QOWA 2P3OA 5LQRA 3FPFA 3KU1A 3TFWA 4ZBCA 5XINA 4EK9A 1EJ6A 1X1AA 5F2OA 2CMGA 3O7WA 4Z2YA 3KQPA 5CVUA 4E33A 2ZCJA 1K77A 4XIAA 3LPMA 1TPYA 3UFBA 4GQBA 4ER0A 1G55A 3BT7A 4RVGA 5EIFA 4DKJA 1JQ3A 5LQKA 2UYOA 3BWCA 3EVDA 3XIMA 5ICEA 1RJDA 3MQ2A 1D2GA 3JU2A 3VC2A 2IGTA 1XDSA 4QPNA 2PY6A 4Y30A 4GOND 2ESRA 2ZVJA 1V39A 5E1OA 5K03A 3DULA 5BW4A 5GINE 5HEKA 5EKXA 1XYMA 4IV0A 2PLWA 3QOXA 2AOUB 2H00A 2R3SA 9MHTA 3AAMA 1EQAA 3TR6A 3DOUA 4R05A 5U4XA 3LGAA 3EEYA 3ORHA 3DX5A 5IKMA 3OPNA 1NT2A 5BW5A 3HVIA 1QAQA 3KPYA 3T0IA 5CVVA 3ME5A 3G8BA 3O31A 5HOQA 1NE2A 3I5UA 3UBTA 4OA5A 1SQGA 4PGHA 4KIGA 3LDGA 3G8AA 3LKDA 2X7VA 3BKWA 2B3TA 5E2AA 1G6Q1 3EPPA 3AWIA 3A25A 1JTEA 2NXEA 3M6VA 1QT1A 1RI2A 5H1WA 3GIWA 4LG1A 2HV9A 4RVDA 1XLJA 3KPVA 2PX5A 4CXMA 4Q7IA 3OFJA 1P91A 2IH5A 5EKUA 2YXEA 4QEHA 2AOWA 3JWJA 5GIPE 3RIEA 3GCZA 5FA5A 3GNLA 1M6YA 7MHTA 4CTKA 1XIFA 5CVEA 1F3LA 4PGLA 4ATNA 3E23A 2BR3A 1X1DA 2OYRA 4EMSA 4M38A 4QDWA 3EMDA 2ZVRA 3GRVA 3CVOA 3M33A 4GUAA 1N2XA 2PVCA 2ONZA 4QEEA 4QE4A 5E2BA 4E2XA 1KPGA 3NJRA 3BGDA 3LDUA 3CJQA 2ZBQA 3LDFA 1JQEA 4UOEA 5FQNA 4MTLA 3KQOA 3BXOA 4C06A 1L9KA 2PBFA 3FTDA
chains in the Genus database with same CATH superfamily
3HKEA 4CM6A 2F1OA 5EPUA 5AZ0A 3TEFA 2ZZ1A 1VJIA 2OZLB 5JRJA 1LPSA 4GJJA 5HR7A 2WINI 1PEDA 3ZI7A 3L6DA 3L0CA 2OBBA 1DO8A 1RQHA 4DM3A 4NZ9A 1GAXA 2AC7A 7CGTA 3M4HA 4LNUB 5IZ4A 3RKSA 3HCWA 4ECLA 4I55A 1KI6A 5EWJA 2XD4A 4EYQA 3WDLA 4RHEA 3VDGA 1TV8A 3MG9A 4WY0B 5C7OO 1EVYA 2J79A 3CEHA 5EMUA 3Q15C 4QOEA 3MPOA 3RSQA 1KEEA 3LY9A 4UZSA 3L4BC 1WZUA 4XJTA 2BCEA 3RPEA 3KJEA 5I2UA 4MV8A 9LDBA 3LPPA 3E9QA 3NASA 2JW5A 2R65A 1WZMA 4Y7EA 2CFOA 4JKIA 4EB6B 3QZAA 3EKZA 2BXZA 1E3WB 4CKQA 2XUOA 4PYMA 1E2DA 4M1MA 4MEAA 4AIEA 4QE1A 3E5PA 2AWNA 1NATA 4GP7A 3RSFA 2XN0A 3OPVA 4QG3A 3VR4D 4ERXA 4RMGA 5KU7A 4GL2A 3PEUA 4MS3A 4XZ3A 2ZRDA 4X20B 1L3CA 3TLCA 3QE3A 3S2JA 3PSHA 2DQYA 1V8EA 5JNWA 5LNWA 4IDPA 3D4OA 3JU3A 3PFCA 3W7DA 1UZDA 2XNDD 4WGGA 4OREX 2QUBA 3JQAA 1RTKA 2GGSA 3EFHA 4WDTA 4WXEA 5IARA 4OJMX 1CD5A 1WZIA 2AFIA 3GBVA 2Z4TA 3MCAA 2O07A 3QFEA 3M0EA 2VLIA 1TL7C 4Q1AA 4ADSA 1MX3A 5CJ2A 4LAOA 2PDYA 4IW3B 3RHTA 1VS1A 2BEUA 1KMNA 1WKBA 3IACA 1JKFA 1JDTA 3BSYA 5ENDA 2I7CA 2HXTA 2YXLA 3LT2A 2ZZMA 4NZYA 4TS4A 4DMCA 5JS1A 3BREA 1AQUA 2VDUE 5MKGB 4HAVA 2W79A 3ZCVA 1IHPA 3DMNA 3B40A 5LGZA 2CWXA 2GBFA 4CNTA 1VCOA 3GJ4A 1TQ8A 4XVRA 1HKMA 1W0JA 4KPUB 3DT9A 5BWCA 2IW3A 3BGWA 4MJXA 4BVHA 4IGHA 1B90A 1D2KA 4KN6A 5LKRA 4U5IA 3F9CA 1BDIA 1FQKA 3RKRA 4ZOAA 1YJBA 1XUZA 2Z2UA 2MANA 3G1RA 2NPFA 3LGXA 1OLSB 2JZNA 1N9GA 1RQEA 4DRXA 4RE4A 2JGQA 4PZCA 3BJEA 1OW3B 3UERA 2A9PA 5ISMA 1EC9A 3SEPA 2ZP1A 3H1TA 4RQBA 2ZUWA 2C4MA 4WGXA 3R5SA 5BOEA 2ZI9A 3ANYB 3OICA 4IRXA 2F6UA 1HZJA 3WBWA 4BFVA 4HQVA 1JQAA 4QDOA 3HP4A 3L92A 2IC5A 1H6CA 2GSWA 4GINA 4YRIA 4EZBA 1MI3A 3RR1A 2FCAA 1CJCA 1XNHA 3LU2A 3RRJA 1TEHA 1X6VA 3N8IA 4LC0A 4AUEA 4QULA 1RM3A 5IJWA 4H60A 1OVGA 4U7DA 1KZ6A 2H1CA 4XISA 1AG9A 4A8RA 2J0EA 2Z04A 1CXEA 1QG4A 4ZXOA 4RK8A 2ZUSA 4ND4A 5TGTA 3S5JA 3S4TA 2GBLA 3WO0A 1XJQA 1LL7A 3S2FA 4E4UA 1B3YA 4HVTA 4NEGA 3BG5A 2GO1A 4BQNA 2PAJA 3PYXA 1EB3A 2VGFA 4RX0A 4H3SA 3AXHA 4O4JB 1FFXB 5ULLA 4ATDA 1IBMB 4PF1A 4F56A 4GI3A 1LL6A 2Z5FA 1WXYA 1BWLA 2E82A 5KC8A 3VPAA 1F7UA 1G4PA 3E1GA 3B8WA 5FFNA 2NQHA 2BSAA 3QXJA 4GE0A 4UHKA 3UG6A 3D3EA 2WIDA 3WNNA 1DC5A 1YQUA 1LORA 1CXIA 5HRAA 5LYJF 2HLDA 2ZBUA 4K9LA 5DTIA 4I6EA 5JAHA 1R6UA 3WELA 1R9JA 5K0EA 4G5SA 4MR8B 2CITA 1H42A 2BM1A 2QWXA 3MJCA 1A5SB 3AUAA 4UU1A 4E08A 1UKZA 4MW7A 1XCXA 4IF6A 4CF7A 3RLFA 4BFSA 4Z4HA 3F1LA 2QXWA 2H85A 4XD6A 2VZSA 1WIWA 2JCGA 1NDZA 1I4TD 2OCIA 1OYYA 2Q5QA 1FNNA 5LYRA 1NYQA 5DXAA 1L7PA 3BIWA 3QJ5A 2BZNA 2I80A 3QGVA 2HRDA 4ZB2A 3LPGA 1DIHA 5LP1A 1JDBB 1G3MA 3ZLTA 1ZGZA 3KOXA 1MQPA 1BOOA 4TSFD 1E4IA 4RULA 2GUGA 3U7VA 3KOYA 1NN0A 3RFUA 1XLAA 4CCCA 1DAHA 5AP9A 4DPKA 3G77A 5HK8A 3LC2O 2PH1A 4ARVA 2WHRA 4IQGA 3EXIA 4DCOA 3AU9A 5EEGA 4EHIA 5SYMA 1D2EA 3G9QA 3WEZA 4ATLA 1Q6CA 1OBVA 5CG0A 2M9MA 5BU9A 4TL9A 4EYGA 1WP4A 1W88A 3O63A 3REQA 3L0NA 3JWPA 2Q2NA 3IILA 3TD6A 4GIEA 4ZT3A 5HIIA 2JLBA 3BE8A 1VSTA 2OHGA 2WCAA 4DXDA 4AURA 4YASA 3TSMA 3P2JA 3QZUA 2EKPA 3KXIA 4WDUA 5JJ5A 5F9HA 2HO5A 3ZWCA 3KCNA 2ZRPA 1GZDA 4ER6A 3KFXA 5T9CE 4B6SA 2ZRBA 3JTMA 1SSGA 3ZDAA 5BOFA 5LLTA 3ZHXA 1QE3A 4WIAA 4CT0A 4MTCA 5HR6A 3G9ZA 1XZGA 3B13B 3JR7A 4AL4A 3N8NA 3LCMA 4LCEA 1ECPA 3FYCA 4Q19A 2IY9A 3ZSSA 3PFHA 3ZU4A 4A27A 1PQ4A 1WDRA 5LZ4A 2FG6C 2QRQA 4NU8X 2I9UA 4YP9A 5JZOA 1VKNA 2DZXA 4RVUA 4M29A 4TGLA 5AM1A 4KXNA 3K0SA 5T91A 1ZPDA 3RWBA 3PZ9A 5JLAA 4PUMA 3AMDA 3K2BA 3HTXA 3GBSA 3J7HA 3DBLA 5K2ZA 3WUFA 1VMIA 4U5XA 3WRVA 2FR8C 3E3OA 2PBGA 1Z16A 2DJIA 5HJXA 3D1JA 2WLTA 3Q1KA 4F9DA 3FR7A 2WZCA 2ODWA 5C80A 1IZYA 2AQWA 2XUPA 3Q2IA 1OFTA 3FTQA 1ZNYA 5ITVA 3B6JA 3GF4A 1V96A 3RFXA 4IUGA 4ZYVA 4JCCA 2JC3A 1T36A 4RK5A 1GW1A 1YO6A 4NU0A 1G8JA 4MI6A 3DBNA 2NTVA 1O4VA 4LEFA 3DXYA 4HEA6 2XGZA 1F6KA 2YKGA 2YYTA 3BW2A 1HOXA 4RH1A 5D7NA 1GEEA 3ESDA 1ZRNA 4BEBA 1Q0QA 1UBTS 4L8LA 1HNXB 4FQ5A 4ZALA 5GONA 2YNMA 1LTKA 1I10A 3LT0A 2WAOA 2B30A 3LK7A 4US5A 2GD6A 3TCEA 1VLMA 2FWJA 2XD9A 4QT4A 2C29D 4R88A 4MPKA 4N7BA 1SHLA 5E6YA 3U7GA 3AJ9A 1ZBQA 4G1EB 4AVOA 3DBHB 5C18A 3VR3A 1N8FA 4NRRA 1YS1X 1EE1A 3GIPA 1NULA 2Z1KA 4JB0A 4EB0A 2ZJFA 3SF0A 3HBFA 4JYEA 2IHTA 3BUSA 4XYGA 2XCSB 4V1CI 3IQGX 2Y4SA 3KP0A 4JUAA 4EPKA 1OR8A 3L5LA 3PZMA 1YC5A 1HMYA 4AX4A 5DH9A 4B3BA 1LVUA 3OU8A 2GXSA 4WXZA 2H3EA 1BX3A 5BOOA 1XRSB 2XQVA 4J3JA 4J9JA 4C65A 4WDWA 5BUQA 3JD1A 1VF8A 3T05A 3M82A 2QAGA 4HVLA 3NCTA 4M1ZA 1QHHB 4QGFA 1CX9A 4PSVA 2MR5A 3ZY2A 1XIHA 1I7SB 2V6MA 2C2MA 2Q7XA 2VFIA 2FFHA 1RY8A 2JRCA 2NZLA 3X1WA 2QK4A 4TMBA 4Q03A 4BZQA 1MZRA 2D3NA 1GVIA 4U3AA 3L4YA 1E1QD 3KYDA 2O8EA 1UZUA 3RPMA 1VJ0A 2WIKA 2NZWA 2D0OB 5L3SA 1YR1A 2J4FA 2VAVA 3LOTA 4CR8A 4XSVA 4PCFA 2I17A 4R8RA 4IMFA 4DXVA 1X92A 3HBNA 1D3HA 5KX5A 3CG4A 1G18A 1WXZA 2FPTA 1G4UR 1UZAA 2IKSA 2C4UA 2Y5JA 3L9CA 2WMKA 4DUWA 1FEZA 2CSXA 1Z9BA 1NFBA 1ZNXA 2QVLA 1XLTC 2X41A 3ORSA 4L5JA 2YY7A 2XSZD 1ZJWA 4L4YA 3LLMA 4D9KA 4GVHA 5DF1A 2O5VA 4L6DA 4Q7EA 4Y0AA 2O2JA 3KR2A 4OI0A 5ALSA 3IUMA 3ZI0A 2A5YB 4LPKA 2VYOA 3HHPA 3RYTC 5A2AA 3E12A 5AW5A 5ALZA 3LHIA 2FVMA 5AC5A 4GECA 3W27A 2YYZA 1OU0A 4ETMA 4R9SA 3LENA 3CPHA 3GFSA 1TX0A 3S8MA 3EOEA 3IRSA 4HXEB 1TK3A 2AQ8A 3CO8A 5TPWA 4DYVA 3DMRA 1E1YA 2Q7OE 4YUZA 4C2AA 2QUHA 3EMZA 4HXFB 5T5QA 5G4WA 2YZGA 2EJ1A 4OHMA 4NJEA 1L7AA 3OCJA 1KQPA 1IC6A 4V0KA 4OTZA 1WRBA 5ELMA 2IXFA 2VJLA 1MZHA 1U4NA 1FX1A 3QY7A 3AZTA 1POKA 2R1MA 5EP1A 1JEZA 1INLA 1ZO8A 2CK3A 3R3ZA 3ZY4A 3GDRA 1F05A 1EIXA 3OIYA 3ZJ6A 1ZMRA 4UDNA 5EMNA 5HP4A 1YS6A 3WZLA 2CCGA 1VC4A 4BEQA 1A88A 3MVTA 3I9OA 1Y9EA 1UPMB 2CJXA 3ZLHA 1YKFA 5LN1A 3H2EA 1A4LA 1JVBA 4L80A 2Y1KA 2GVGA 3M34A 2VDVE 4MAVA 1YTEA 4XZBA 3TZNA 1H0IA 3CNOA 2FYTA 2VRBA 5DCLA 1E0DA 4FFSA 3A6LA 4UTNA 1TT5B 2PQ0A 3SC2A 1GNLA 1WB9A 1N7GA 4BKOA 4RUBA 4P35A 4ZRNA 4KB5A 1V9SA 2B7QA 3D3KA 4KUEA 2VFAA 5KYNA 1HDEA 1CDEA 2LP4Y 4I1SA 3LLXA 2CXEA 1UH3A 3GFRA 3R0DA 2X30A 1QR6A 2Z2KA 4RQAA 3M6WA 3KTFA 2Z6UA 4NI5A 2DU2A 1QHEA 4J0CA 6GPBA 1KDZA 2DUJA 2GEKA 1DBTA 2RHLA 1M6WA 4DSTA 1WW8A 1PYMA 4KGZA 3RE1A 5ENVA 3GLGB 2G3IA 2J4GA 2A78A 2NVOA 4CQ8A 2IOHA 3DU0A 2R6OA 3ILVA 2R2AA 3S1XA 1GITA 3SR7A 1U7TA 1THZA 5JADA 2A79A 4DZRA 1FLNA 4JSYA 5J2TF 1FE8A 1AHHA 4MUKA 1L5YA 3TAUA 1P77A 5AI9A 1RCQA 1LOSA 3NL6A 1LNZA 3AERA 2X1SA 5CCZA 1H6AA 3OBAA 3SCVA 4GWLA 2GILA 2C94A 1GFZA 1ZGJA 3BRWD 1Z0UA 4CKEA 4B45A 2GWRA 5BXQC 3DFFA 5ER9A 4JNMA 4JXZA 4O1EA 3ZV5A 3LI1A 2IITA 3G2MA 4YUXA 2A94A 3KBJA 5A71A 4HK5A 4IF2A 3MCUA 8MHTA 1AMNA 3ZNQA 4KFPA 2VHLA 1M8FA 4S3KA 3AYSA 2XR1A 1S2AA 4LKOA 4BJ6A 3ABZA 4C7FA 1XNGA 2ID8A 1H9CA 3PUJA 3U4CA 4Z4GA 2IXEA 3JQEA 2LPMA 3LV8A 2FLVA 1HBJA 1Z8DA 2X5KO 3MHTA 1IN6A 1UJQA 4D2IA 3B9NA 1M3UA 4F9GA 4MP3A 1U2SA 3LX6A 2C0CA 5FBRB 3V4LA 4J2OA 1G3RA 1JEYB 4PY2A 3N8KA 5GZ3A 2A35A 2V8OA 4RY9A 2I87A 1P2SA 3D59A 4HEA1 5IT0A 4LALA 3IODA 2O0MA 3O1HB 3IT1A 2BHUA 3HMQA 1PD0A 4H7EA 4ZHQF 1QC5A 2A9RA 3X1ZA 3TSOA 2YMLA 4CEUC 3FCYA 4K46A 4URVR 2ECOA 3ILYA 4C6QA 4ON9A 5CA0F 3UAVA 3LA8A 5FAKA 4ER5A 5EL0A 4YRRA 4OHRA 2R0QC 2W98A 1XZEA 2V58A 1LZLA 3ZE6A 4BTEA 3M47A 3DFZA 3HWWA 3OE4A 5A0TA 3A6PC 2PKCA 1VCVA 1TPEA 3AEQB 1T1IA 3AWDA 1XEAA 4EKGA 5ALOA 5H9VA 3V3TA 2PDJA 3D7MA 3HM7A 2Q5IA 2OFWA 4JN8A 3IVUA 2YFOA 4LX0A 3HPZA 1OT2A 1I0IA 2QJGA 4EWND 2I2AA 3TO5A 3OCUA 3D6TB 4ALIA 4C07A 3NFYA 4ZVRA 3NH6A 1QO7A 8ADHA 3TN5A 4E12A 4DCTA 4R33A 1KRHA 1VCGA 1T2CA 2ZXFA 5F5XA 3H2HA 3LHSA 5CAEA 1UQTA 2OCXA 1YVEI 1SCUA 4MDEA 4NCIA 2O2GA 3TN6A 2X8BA 3O15A 5DBFA 1YVDA 3FLUA 5BRNA 4NVRA 5TF4A 4GOXA 1W4ZA 3OWOA 1BWVA 1M2FA 3M6UA 3ZSTA 2A0NA 3VZZA 2XZTA 2DWUA 5AW1A 3PTDA 1C14A 2JH9A 1WMBA 5LQJA 3SE0A 2V54A 2AL7A 2OSXA 3R43A 1AMOA 2FTPA 3EA3A 5TPZA 4UPEA 2ZXDA 4CCZA 1Z62A 3VIPA 5G5IA 3PXUA 5B1SA 5DT9A 3STPA 2CV1A 4PLYA 4DXKA 2XGJA 4TMVA 3IRVA 1OSEA 1WD5A 3BLOA 3WOHA 4HDOB 5CLHA 4O1FA 5D86A 3HQ4O 2WMGA 4TV8A 2H59A 1XFCA 4W9MC 4JQYA 4DLFA 5AUNB 4LWZA 3WD3A 1MKYA 2VP5A 3CRNA 2QGNA 4HSGA 4NSBA 4F91B 4CKWB 1OX6A 1PL9A 2ZIDA 3PTKA 2EFCB 5A06A 4UCFA 5HQMA 5AK4A 1Q11A 3E4DA 1P29A 1C81A 4F72A 3NHLA 4MYCA 1IBSA 3G3EA 1SC4A 2Q2QA 3QPEA 4LCJA 4XAQA 1RFGE 1U2DA 2ZI7A 1KM5A 3HTWA 1S9DA 1THFD 3ITLA 1NY5A 3IVGA 2ZJZA 1E0UA 4O4HA 2V38A 1PVVA 5DXFA 3PPVA 2EW8A 3RIMA 2I3AA 4YJGA 3VR4A 3WIBA 4V33A 3ESXA 2YA2A 3HJEA 5IKOA 2B78A 1XMVA 4IFBA 3ARXA 4X9YA 4E3VA 4GUFA 1R2TA 4IJRA 1BJKA 2BEKA 4M9CA 1G20B 2I4MA 1NW5A 1K98A 1K63A 1T2AA 2X09A 1DTWB 1IDOA 4IXDA 1FDUA 3GUHA 4CCWA 3S1AA 2B61A 1QIMA 3DLPX 5ANRB 1MG5A 4NCXA 5C2GA 1RS0A 2VDHA 1ZXXA 5J40A 4H08A 1NMEA 3ITXA 3W7BA 2EXOA 2D5LA 1LFAA 2PBLA 5JAPA 3TQFA 3AYVA 3QIAA 4UUMA 3I62A 1V8ZA 4BAGA 2CLDX 2BFFB 3THSA 5JNSA 1WF6A 1XH0A 2O8DA 3HSYA 1U0FA 1OI7A 1VPVA 3KBOA 2OR3A 4YS6A 5I09A 2ISWA 2W48A 1MO3A 1ECBA 3N2IA 4UTMA 1C5KA 2WMYA 3QV1A 3NJ4A 4IOKA 1EXWA 1JQ5A 4AY5A 3ONFA 1UAAA 2YOHA 4J7CA 4AN1A 3B1ZA 1Z7BA 1TADA 4JT2A 3IQZA 3HLYA 5CZ0A 4H9MA 2Q6KA 1DEDA 2PUJA 1Y8BA 1LPOA 1ETHA 3M0KA 5CGQB 2QP4A 1QATA 8CGTA 4EHLA 2JD2A 2RHRA 1VJGA 4WY2A 2VEGA 5EE0A 4UTZA 4BR1A 4YCSA 3PDWA 4RF5A 2WMFA 3O73A 1PYOA 1T9BA 3DMHA 2C8LA 4R7WA 3KYBA 4BMCA 4GZ6A 4PMNA 1CRLA 4QUGA 4GMKA 2G1JA 4RPLA 1UFQA 1CWUA 1V8OA 3MZ2A 4HRXA 3LW8A 1AH0A 2Y6VA 2Q2VA 3RUPA 1IXZA 1OD6A 3FUCA 1B16A 1U9YA 1YE3A 4RW5A 1T2EA 3LYLA 3DAQA 2A3HA 4P4GA 5A5WA 3APGA 2AH5A 1I9CB 1NNI1 4C5AA 1YE5A 3FPFA 1CY1A 1XBYA 3QOMA 3TXVA 4D3SA 4Z2YA 5IDIA 1TUGA 2NX3A 1ZJBA 4NE7A 2Q0QA 1KXHA 4A03A 2X9GA 4NMMA 1F5NA 3POCA 3PSVA 1YZQA 1PIWA 3T52A 3EGJA 3GFXA 3V18A 4GRIA 3KJGA 1VHJA 1PDOA 3RF9A 1VRCA 2A9OA 1M75A 3E0LA 1GCOA 5CNMA 4YRMA 1DT5A 1RWVA 2AV6A 4ZK6A 2FE1A 4GVPA 5TVKA 1W44A 3UJRA 2PT7A 4F9EA 5K6RA 1Q63A 3H65A 2FH5B 1SD1A 2BNJA 3P32A 3AHGA 4XB2A 1FTWA 2AOUB 1LNQA 2C4VA 3DV0B 4KK3A 4Q21A 2P5UA 1O03A 3SIRA 2G04A 1T8PA 4EF5A 5ILQA 1SOUA 4WCFB 3BIJA 2CDCA 1LSJA 4UE2A 1TC2A 2FFAA 3PC4A 2HDJA 3OJLA 3KPYA 4YAWA 1LSSA 3EXRA 3WIEA 1DADA 4JN7A 4M54A 1XKTA 2YJTD 4QLOA 3G8BA 1M8GA 4ZZIA 5JS7A 4AY1A 1SQGA 2VDLB 3LKDA 1JSRA 5FBQB 3EIOA 4Y2SA 3C2YA 4AMYA 2LLEA 3GG0A 1VIAA 3K5HA 4GGPA 3PC0A 2IXUA 3N4FA 1M5TA 2W2PA 3QH2A 2HZ7A 1AQLA 1UP7A 1QFMA 1I6MA 2EGUA 4Y1FA 1WPXA 5JALA 4UNRA 3PBGA 3AUUA 1N2BA 1Q57A 2YLAA 1ZBKA 4XGIA 4CM9D 3WGTA 1F8MA 3I68A 2FMKA 2ROQA 3PBYA 3WA7A 1R3VA 2I99A 3DA8A 1UBSB 2GRAA 1VPQA 1Y0EA 4M38A 5F4ZA 5EYPA 3EFEA 4ND2A 1NRXA 3B4YA 1IZ8A 7GPBA 3VM6A 3OI7A 1OYWA 1ORDA 2OZLA 1PT9A 4RLFA 1DRWA 5IHSA 4MSSA 1K86A 2YWHA 2CLOA 2JKYA 1JI3A 3ZXIA 3OY7A 2TMGA 4H6EA 3S55A 4WA8A 4C7GA 1VZ2A 1W2HA 1RVV1 1ZU5A 3BD8A 1FNBA 4E88A 1FDVA 3K2IA 3FW1A 5AO9A 2QX4A 5FQNA 1W17A 4NRDA 1ATZA 2QPSA 3LEPA 4PBRA 2W37A 1YMYA 4S2BA 4WY0A 1DL5A 3Q45A 1RD4A 2CVQA 1C0EA 4O4IF 3A47A 4MVJA 2EJCA 4XIIA 3K6KA 1UM9B 4UEOA 4AKTA 5D02A 1FTGA 3P7YA 3M70A 3U4HA 2ETVA 4L7ZA 3JQ9C 4OJKA 3IQDB 3B2EA 2PM8A 3DE2X 4R2IA 3B6EA 3IPWA 1RJRA 4G5OA 3IT3A 3NP9A 4FYIA 4YCDA 4EB6A 5DU2A 2ZWYA 3DOJA 3KZSA 5FB3A 4A0HA 3GR6A 1E9FA 4OFCA 4W4TA 2W0MA 1MC1A 4AXXA 5FORA 3AYXB 2QS8A 5KEZA 5TDHA 2ERCA 4Q9LA 2FZ9A 3DBOB 1AB5A 4IIHA 4YRFA 4OLFA 1AW1A 1N8KA 3VZPA 1U6JA 3ERCA 1AQ6A 2VEKA 4YDRA 3WWEA 4F6CA 1HORA 6A3HA 2IBTA 5CC7A 3FHLA 4XRRA 3QEKA 4U63A 4GR4A 1PRYA 4PTLA 1FS5A 3WYDA 3VCRA 2M1ZA 1GG2A 2YFHA 3LCWA 1DCKA 2ZOSA 2XHYA 3CUHA 1R4AA 6ALDA 4A0FA 1Z6KA 4P3XA 4QFDA 3UH0A 2JVIA 1VBHA 2OOFA 2JB9A 3O4FA 4L6CA 4B5SA 4KMQA 1GRVA 3O7MA 1ZSXA 4CZ2A 3RC1A 4ZGYA 2VHEA 1ULHA 4QXQA 5KOJB 3RUAA 1UK6A 3FJNA 4HKPA 3CLKA 3O3NB 1AGRA 2B4KA 4DF2A 5I7RA 3GLIB 4UC5A 3ZW9A 4D8YA 3T9DA 4ZGGA 3U61B 2PUZA 3U49A 1VIZA 4O15A 2X6RA 4F12A 4ES6A 2C4NA 3MTDA 3S3GA 2IZ0A 1XYBA 4GJ1A 2WV7A 1XH2A 1YT5A 1Q13A 1E1CB 3A12A 2ONYA 3OKFA 2D13A 4FB7A 3IH5A 2WE8A 1S9HA 3GK0A 5JD6A 1OLSA 2F6KA 3TLXA 4HJXA 3E58A 3T5AA 3RXZA 5KYXB 4BGVA 1XEWX 5EU9A 5A69A 4OCZA 5JARA 5KWSA 5A5DA 4E8DA 1Z5NA 1V8FA 5IVKA 1WF3A 2VDRB 2QNBA 4E5SA 4GQAA 4RVSA 3WBXA 4UBLA 3NATA 3CPSA 4O12A 1OXSC 1Q8AA 5TS3A 3TSZA 4DY4A 5HGJA 2ACKA 2VK1A 3DHFA 2LCFA 1U5HA 1BVUA 5DP2A 1NAHA 5JD5A 2IT1A 2H5EA 3BXEA 1P7YA 3MRXA 1Z8HA 3VC1A 3WK1A 5FD0A 5ALTA 4DXXA 1A9RA 5K3EA 3W86A 3ER9A 4S1TA 3I65A 4RXFA 1EZZA 1NOIA 2VUHB 2XGIA 3JY6A 2X5JO 4JDPA 4CG1A 2IFTA 3E02A 2WJYA 2W4QA 2B6NA 3CCBA 1LUCA 3QX7A 6NULA 1HM5A 4EYOA 4QBIA 4I1IA 3JVIA 2FSSA 3OZOA 3B0VC 4LKRA 1BU5A 3K32A 4NY1A 1Q1ZA 5FEPA 3VNAA 4P80A 5HIKA 3JS3A 2D2EA 2VEDA 1S3TC 5ALUA 3NURA 4RY8A 3TRJA 1FFXA 3L1UA 1IR1A 4D4LA 1SUFA 2DW7A 5DYYA 3W3ZB 4MUBA 2JKAA 2AG8A 3VR6D 3EEOA 4CLDA 5CMLA 3M41A 4KNYA 1RXWA 1Z4OA 1JPKA 4Q32A 1PNOA 1QO5A 2WW5A 2BY3A 3UMCA 3PTMA 2XE6A 5LGXA 3FV9A 2DG2A 5KZMB 4FM9A 3E27A 4OKIA 2XMZA 3CQIA 2PRZA 4F2WA 4FOKA 4O63O 1E99A 1A0CA 4KGXA 3FTNA 2ADFA 1JPJA 4IJKA 5LB4A 3C74A 3H26A 3HVJA 2OSYA 3TJZA 1CKEA 1EXMA 3G2IA 4BFAA 3FVWA 4MVYA 1KVUA 3OO0A 1KOFA 1MOZA 1RLDA 4J4BA 3CVVA 1ONXA 1WXQA 4RKEA 4AF0B 3EQ6A 2IBMA 3MRTA 4RACA 1VHNA 3INNA 3VGEA 2Q8QA 4ERGA 3QVMA 1M2HA 1BQ4A 5CZSA 2AIRA 1Y1KE 3RVRA 2F6RA 3HFJA 1ZH8A 3O84A 3Q4DA 3GDMA 4NJHA 3OJEA 3D6FA 5DMNA 4IL2A 3KSRA 2VCYA 5IJXA 5K9DA 4M6WA 3B7GA 3PLAE 1QF7A 3A4JA 2GN1A 2ZUVA 5KZDA 1TD9A 3PA8A 5AJXA 3CC8A 2PEZA 1FNDA 1N2EA 3RSSA 5IFKA 3ZDFA 1CENA 3H7AA 3BAZA 4MS4A 2E5WA 4GOAA 1VMKA 1VECA 3ZW8A 2FSIA 1JXJA 2VJBA 1M1ZA 2G0WA 2VT3A 1W0KD 4IIFA 1GPLA 5G3YA 3HBJA 3MERA 1QI3A 2QIOA 2PL5A 4YLEA 3AB7A 4BVGA 3DL4A 3GA7A 1Z8AA 3UMMA 2HSAA 1QK0A 2GA9A 3SX0A 3D1LA 4K26A 1S3IA 1C9YA 3C7TA 3RT9A 1GW9A 1H4QA 2ETXA 1X3LA 1MT0A 4LC9A 4X6YA 2YCLB 1X38A 4EXQA 5IT9A 3L07A 3NYDA 3Q9NA 1V5WA 4CU6A 4OHOA 3ZGOA 4OV6B 1JHVA 3K2QA 4MWEA 5AVUA 3BGGA 5J4VA 3RC9A 2IXVA 4WESA 6PFKA 3C5HA 3C24A 4QGHA 1TQDA 2XPKA 2UYGA 1AKEA 1W96A 1KJYA 3DDNA 1TRKA 4BCBA 1UXHA 3CGGA 3QGKC 1QVWA 3CR8A 1VFNA 3W2EA 3N2CA 1PKEA 5MHBA 1ZGCA 5HM6A 1UWRA 2Y0PA 3ROTA 4GF5A 2B0MA 5JC8A 2BHTA 3VCCA 4FD3A 5ESDA 1S89A 4BX0A 3E9EA 4UFNA 2CU0A 5KC9A 5CVTA 3WO1A 3QKUA 2XZDA 1G0OA 1I60A 1KQ3A 4P2GA 1R3SA 2VG8A 5KUTA 4DIMA 4WE3A 1P2UA 2V7VA 4QP0A 1E5DA 3OBEA 3HY3A 3UXYA 4CR6A 4CT4B 4IDGA 1E6WA 4JC8A 3EQ2A 3KKOA 4LGMA 5I5GA 3IHTA 1KE1A 2K2WA 3AVXA 4GI2A 1K4KA 4RDHA 1KJWA 3GLGE 1P9RA 3R13A 4A92A 4QUBA 4DUZB 3CUVA 1WUIS 3LE8A 1SUPA 4MPTA 3I42A 4Q15A 1DE0A 3PNMA 2GYIA 4O10A 4KE7A 1JDDA 4XR9A 2VZ8A 3BIXA 4Q3DA 5K3CA 1KR1A 5A6BD 3GDOA 1PX0A 2SICE 3AF5A 2I5GA 4AIIA 4B2LA 4S39A 5KNBA 4U0KA 1JXOA 4JHXA 4L4PA 2Z1VA 3Q7SA 3ESCA 1WZNA 2P6PA 3WVNA 1XVIA 3AZOA 4FX5A 4G4JA 1FYVA 2FWRA 1HSZA 4X71A 1QYDA 2PMFA 3DBHA 4L5IA 1SZEA 2PA3A 1NRWA 4K3VA 3UR8A 4KWVA 4FQ8A 2WIBA 3NETA 3PI6A 4JVMA 5LNVA 4I81A 2PDKA 2V7EA 1V43A 1UJCA 2AJBA 1ANKA 3K0BA 1JW9B 4NOLA 1U8UA 1FXPA 5EJMA 3T3MB 1SXHA 3G0GA 3VNRA 1EWKA 4MB2A 1Z5UA 2HADA 3F5FA 1PFKA 3P9QA 1JB1A 3IUQA 1LC3A 5BNIA 4LHYA 2C91A 1CUVA 3IJQA 2QI9C 4MKFA 3BHJA 4BGEA 3O8CA 5I7OA 3HP7A 3L8EA 1K8YB 5HZGA 5GTDA 3SSZA 3VE9A 4MYUA 4NZ1A 4LA4A 4FFBB 4OYRA 1RAIA 3QU4A 2CUZA 2QVBA 2CVHA 5K7JA 4DEXA 2IZZA 3T9FA 4WFKA 2IQDA 4P93A 3VNYA 5BR7A 3ZE7A 1DIDA 2YX1A 4YV7A 3H8SA 5FEMA 5L6UA 3I0ZA 4TUFA 2G9UA 3S2NA 3LUFA 3GC5A 4EARA 4QPDA 3HG4A 1NV9A 3JRWA 3WKDA 3UH1A 3E05A 3I9FA 4AWBA 4GKAA 3HEBA 1Z4LA 3TA6A 4B5WA 1O3YA 2PCJA 5M17A 3ENVA 2O7SA 3QVKA 3ZGZA 4XASA 1NX9A 1BS9A 3KM0A 1N6RA 3HGOA 1HL9A 5K3FB 1Q4WA 3TF5A 4Y0VA 2HLPA 3H86A 4FLOA 3R76A 1V16B 4R1NA 5DGTA 1Q6RA 4XM2A 2C2KA 3UVAA 3HPAA 3FDZB 3NAMA 4Q6XA 5DBGA 1M2OA 3INPA 3WQFA 2ZXBA 5JROA 2DLNA 5FCDA 2AMJA 3KWFA 4PCVA 3AIWA 1D6NA 1O94C 3WSTA 4WK9A 1W35A 3WFLA 3TMYA 3BZGA 1O95D 3WMRA 1E9RA 4FOLA 1UJMA 3EPJA 3R0VA 1U0GA 2K4MA 4TLCA 1NP3A 3NBAA 4LAUA 2XFWA 5I7WA 4Z49A 4FNPA 5GVRA 4C3OB 3A04A 3CX3A 3KT8A 1Q1BA 1RC0A 1CBUA 1T8WA 2QTAA 1E9YB 2ZWVA 4DLBA 2OBXA 4YGYA 4DZAA 1MJGA 1EZWA 1I80A 4JYPA 2RAFA 3B8EA 4XCXA 1E3SA 1SK9A 4OMCA 5CA1A 1KMCA 1Y7HA 2VJCA 3VIGA 4JTUA 3KL0A 4B7UA 1UPFA 4HDMA 1W25A 3TSAA 3A3YA 4LF2A 1IZ7A 3N9RA 4X65B 2Y0EA 4JFUA 1C41A 3QEMB 3W72A 3SFWA 3DZCA 5RUBA 1E96A 2OK7A 3QVTA 2VC6A 1DJZA 2Z2IA 5THXA 1YGPA 3OT1B 4K6HA 2QTFA 3OUUA 4RF2A 5MF5A 4NJMB 3TB6A 5JNTA 4R0NA 3QK7A 3L05A 4PRWA 1CJBA 2RKWA 3NUZA 5XIAA 4M21A 4QUJA 5F9FA 4IIJB 3U2EA 4Z7OB 3HFRA 2VJMB 3AQUA 3L7MA 5KHAA 2ISDA 3IUEA 1F5SA 1G20E 2O6LA 4ZPJA 3L7YA 3QNWA 1YNOA 2LRHA 4AHQA 3JZUA 4LOHA 4NWIA 1X74A 3R5TA 3MEQA 4BI6A 5DHTA 3SJAA 3RUDA 3MSRA 5K8CA 2PSSA 1LQAA 1OMOA 4IBOA 4OQQA 1QAPA 2CLKB 1X9HA 3KTXA 2I78A 4PLHA 3GLGA 3WKEA 3HYCA 4MW6A 2H31A 4C2BA 3M6IA 5DBUA 2WOQA 2F3SA 4FMDF 3LOUA 2XB6A 3Q8MA 3EDJA 3I1YA 1JULA 5AKZA 2H2GA 2ZJAA 1D5WA 3I6RA 3PPCA 4BNGA 1ENUA 2XADA 2LW7A 5PGMA 2D59A 4OU4A 1EFRA 4Y1RA 2PLAA 3OZMA 2X0RA 4COKA 1SO4A 3SI7A 5BRQA 1IN1A 1O97C 1BAPA 3A1WA 2PXCA 5BV0A 1K5DA 3P82A 4RJ2A 5IX8A 1JPIA 3C3BA 3UF9A 3AJ7A 2GZ1A 1MQ9A 3WA6A 4JLPA 1Q7GA 1JFVA 3CLSD 1L4LA 2OHHA 3QM3A 2PDAA 2GBIA 1FA9A 3C1UA 4FE3A 4UMEA 1FFYA 3H87A 2NUBA 2OQLA 1OT3A 1SZRA 3FPGA 3W2KA 2NP7A 3ZV6A 3MSDA 3PP7A 2M98A 1AD2A 1CY2A 3L4SO 2R7KA 5BNKA 3RABA 2X5OA 2Q0SA 5B12A 4M0PA 2CLLA 3D7LA 2VXNA 4IVPA 4YO8A 4ALNA 1RI3A 5AK5A 3Q3GE 4OUEA 4R1TA 2WJ3A 2Y1XA 5HWMA 1DPFA 1D1TA 3ENKA 1HL7A 3DXFA 3G7SA 4UEWA 5GOZA 3N8DA 3ZVRA 3W0KA 4UPVA 2VTVA 1Q21A 4ZO6A 2R66A 3DLTA 3E8SA 4MR7A 4FE7A 1J2YA 5DRCA 1XAIA 2V6GA 2Z29A 4JB3A 3ZWAA 4CT5A 2GVZC 2JGJA 1U2GA 3G18A 3EUAA 1FXWA 3PNZA 2BONA 3H1EA 3RUFA 2WDPA 2DZPA 4ACBA 4ZFMA 2WVSA 4ZEXA 1E2MA 1DWIM 1E2GA 4FHAA 1G7TA 1RRMA 2CETA 4DMGA 3NSNA 4QPPA 2EW2A 3VV3A 4N54A 5A4DA 4B82A 1A98A 4CVNA 1HTIA 1CIUA 1GL6A 4P81A 2WAXA 2DEUA 1IZ0A 4CNOA 1VD6A 4XX0B 2JALA 3C86A 1KZ4A 4MUEA 4RD3A 4XWUA 2CFTA 3A22A 3TVYA 3W7EA 2ZT6A 4H1VA 1KYXA 2YXDA 2WJEA 2YDSA 1G4SA 1ZK2A 4QBHA 3OOQA 2XIQA 3UB2A 1Y6RA 1J8QA 2JAOA 1TWSA 3GJXC 1OZAA 2EKLA 3URQA 3PSWA 2BI8A 4DV1B 3DVLA 4MG4A 1YDEA 2GYYA 2RIRA 2HTFA 3N2GB 4HPWA 4LBRA 4A26A 2JNWA 3A3XA 3SPXA 4JS3A 3WP0A 3A14A 2VUTA 1LOLA 2FB2A 4JQCA 4GPIB 1E61A 1BWPA 1GL9B 1IYXA 3CUZA 3HWRA 1U28A 1J22A 1GJWA 3K16A 3VYRB 1AKRA 5K20A 3C3WA 3WN6A 3PC8C 1QK2A 1E2BA 4GA8A 3L0YA 3I9KA 5K8IA 1H61A 3U60B 4HV4A 5DM70 1XYFA 3SQDA 2WM8A 4MR9B 2D5BA 5ER6A 4RTRA 2VP0A 4DI9A 3RAEC 5A4JA 2OCAA 1LFDB 3EXSA 1R86A 3KVJA 2BISA 4WX2B 4QUIA 3OJGA 1K8XA 4XSHA 1ECQA 1P18A 5HMMA 3DL2A 3MJDA 1ZHFA 1DAIA 1XRQA 1JRCA 4EF6A 1P6BA 1XROA 4MPPA 2ZANA 2EQDA 4N47A 4B3JA 1TQ6A 2GARA 5IZCA 1RKBA 4CV1A 1Z0ZA 3B05A 3ARPA 3OBKA 3S6TA 3FJYA 1DCTA 3GRCA 3CC1A 2WU8A 2Z9DA 1G5AA 1FOBA 5DBOA 1GGJA 3OMLA 1ZU4A 2XRFA 1E3DA 1SIWA 1FNCA 1WOBA 1NQTA 1NUTA 1PJ3A 1OVDA 1J6UA 3K4AA 1QQ5A 5HNRA 3CRVA 1Q3NA 3M83A 1NQKA 1YS7A 3CE6A 2R1NA 3NWBA 1E64A 2CPUA 4NG4A 2H63A 3WLRA 4RA6A 1JJ7A 1IJFA 4MGKR 4NZZA 2R8PA 2WZIA 1ENYA 3A6EA 1H7NA 4COOA 5JMTA 4MZ1A 4NAHA 4MA0A 1QP0A 1ZUNB 1T15A 1E5NA 3L84A 3VKCA 3ATZA 2QJMA 3L8ZA 5KMGB 4FFLA 1NPDA 1NVGA 1A04A 2H1HA 3WZMA 1LDMA 2F64A 5CGQA 2QI9F 3IEMA 4YMZA 3E8MA 2EIHA 5CTAA 3MTQA 2OGZA 1T6ZA 2WIFA 1TTHA 1E92A 2X6QA 2ARKA 4ZJPA 3GDHA 3W6PA 5JYDA 3W05A 1EWRA 4IFEA 4ZI7A 1VG1A 4FDVA 4LVGA 5E0FA 3DFYA 1HSOA 4JP3A 2Z08A 4FINA 5FOWA 3DUGA 5FR1A 2LWIA 2VELA 3RJ9A 3RIXA 4NAFA 1BZYA 1X96A 4HY3A 1JL3A 4Q1BA 4M1RA 2BJHA 1KO5A 1E2PA 3GFZA 1OQFA 2NQZA 1C9EA 4N39A 1TYDE 2ZB8A 1QP4A 1BA3A 4LK2A 2ZZ6A 1KY4A 3EDMA 1GYPA 3ITDA 3PUOA 4LNAA 2ZQYA 4ZQBA 4PUUA 4QHSA 3IDZA 2W6IA 2OQIA 5EG5A 3E61A 3KRUA 4Y9TA 2X7XA 4CMEA 3GLIE 1E4YA 4PBSA 1R6AA 1VRVA 2Q29A 4TTSA 3KKLA 2VCBA 9XIMA 3A9IA 1B2LA 5B7GA 2HHCA 4HKTA 2DOKA 3EXTA 1I33A 2OQVA 3N9KA 3P5YA 2QRPA 4V39A 2X1MA 4JCMA 4TZKA 4GYKA 4R0MA 4DBUA 2DGAA 1Z06A 3AEKA 4S1FA 1BGWA 2ZBRA 4EXBA 1F9AA 4C7XA 1VFHA 3I4FA 2VQUA 4M9QA 3WRYA 4KU4A 3EWCA 5AHMA 1RU3A 3WGHA 4LYJA 1AG1O 2WZDA 3A4LA 1FMLA 3DEHA 2A4MA 4RXUA 4W89A 2RHGB 3MGAA 3FYTA 4AWEA 2YHIA 4GYYA 3FFWA 2FZEA 3LVQE 4PVCA 3AESA 1KI4A 4CR7A 2WB4A 2QRGA 1WPQA 2AFHB 1EB9A 3VR6A 1A8SA 1NVDA 5LSMA 3SX4A 4WOCA 2P5TB 1JQ3A 4NZNA 4BN5A 1S46A 5LQKA 3AHHA 1USGA 2XRZA 2UYOA 4YUAA 2VXCA 3SWWA 4FIDA 5ICEA 4RNFA 3T4EA 4QQUA 4CLXA 2YYYA 4CEJA 4WCFA 2VJYA 1ELOA 1ZH6A 1TQ2A 1JJKA 2FXIA 4P54A 4RMIA 3UB4A 5IN4A 1P19A 1ND5A 3GZNB 2SKCA 2DPLA 4IFKB 1Q16A 5EKXA 4MH0R 3ONCA 5JZ9A 4V0LA 4M8UA 5FI1B 1VG8A 3TMLA 2RJ3A 5AFSA 4JD5A 3R25A 1XAGA 1F5ZA 4UASA 3O07A 2J07A 4WJZA 3TEVA 4X8HA 2P9TA 3SJ7A 2E1DA 1JZ8A 4XM1A 5JSQA 1KY5A 2P69A 2CYAA 2QRUA 2BWGA 4EBFA 2DIKA 3V1KA 1TA3A 1HFJA 1CT5A 3N34A 3IJ9A 5LXEA 3TXAA 5A6SB 1HJQA 3WDPP 1GUZA 1E1EA 1SU6A 5LZ8A 2A0YA 4Q34A 3KKMA 3RUBL 3WMFA 1JLHA 1XA4A 2IV7A 4H4DA 1KBKA 4OBSA 2PH5A 2FWAA 2CLFB 4TXHA 4LG1A 1E9ZB 3AMGA 4XPIB 5BY2A 4NXMB 3VJMA 2H1VA 2GN6A 4ACZB 1CE8A 4D82A 1VA5A 1YRBA 3N15A 5BWFA 5AW2A 3LDHA 2YXEA 3ZCRA 4LXXA 3FJLA 1M03A 3THOA 2QV0A 2IS7A 3ZLBA 3KDSE 1T3TA 1F4AA 2VDKB 2JCSA 1NTHA 2O0TA 3OZ7A 3QTGA 3QY0A 2H6RA 2XUKA 5H9WA 1QSGA 3POHA 2RHTA 1C1XB 2RJOA 4ATNA 1N9KA 1XSEA 1I2PA 4L5YA 2HW8A 2VL7A 1J70A 5A9SA 5T3YA 4V0SA 5LYJB 1KZGB 3GRVA 2YSWA 4C4RA 5AKXA 1XEXB 1I2DA 1SWVA 3OTRA 3FYUA 1QNVA 2G4FA 2ONZA 4IG4A 3KJFA 3LN3A 3TLGB 3NJRA 1XKJA 4U3JA 3R10A 2E1PA 3PFBA 4EHBA 3T6CA 4LVUA 1M8JA 4Z08A 2V3DA 3HXLA 2XXJA 2G77B 3U7QB 4N3AA 1JUDA 2FPRA 3TXZA 3H4IA 3I12A 1AA1B 3R9IA 1TYBE 1WCGA 3V8QA 4AZ3A 1T2FA 1Z2EA 3FSJX 2YVLA 9ATCA 2QQ6A 1T4DA 2G3FA 3W1MA 5DN6D 4FDMA 1YRLA 2HREA 1YU9A 2Y8UA 1Z26A 2O3TA 1XDMA 3MWDA 3HVUA 3GZJA 4M83A 4F4RA 2G0TA 1NW9B 4TV9F 4WJ8A 3USES 2DT0A 3RVOA 5K3BA 4JYFA 1UOEA 2R6AA 5BV7A 1RFLA 2OV4A 1R3WA 3VC7A 3BAJA 3OTIA 1UH5A 1GJPA 3AUJB 2ZRWA 2QTZA 4G97A 4RV3A 5KITA 3GVRA 1M7XA 1DMSA 4NCJA 2XOKD 5AVZA 2RGCA 2WMNB 4PPQA 1X94A 4HG2A 3BXXA 2QMOA 1UA3A 1N1MA 4D02A 2Y92A 3OX4A 1FP2A 3CU2A 1K06A 3KXDA 1KM6A 1AUPA 2EBNA 1VDZA 2VPPA 1WOAA 4G9PA 3IPCA 3FYYA 2AI3A 3VA7A 4TT8A 1EXVA 1W29A 1Z08A 3GG9A 3EPNA 2AFVA 3FE2A 3B6KA 1KM2A 3Q8XB 1SW3A 3AHYA 1XL0A 2BL4A 3H2BA 5JI3E 2G4VA 2P3ZA 3KQKA 1A95A 4FILA 1AH4A 3OVGA 1NFGA 1J6PA 3TA9A 4OKDA 3ABQB 4CETA 3EXHB 2HMCA 3M46A 1S2UA 3BLEA 5A6LA 5CSSA 1PR2A 3AY7A 5C1BA 2E5DA 4LYPA 5H3LA 2NQTA 3FKSD 2PDCA 5T41A 4HDQB 2OHVA 1S1PA 3K13A 4XAYA 3B6MA 3BL5A 2ZRXA 2WF5A 1QB8A 1J79A 4IMRA 1QLJA 3H54A 1OHHA 5AKEA 1IG3A 2GUBA 1Y9ZA 1Q2XA 2Y4OA 2ISVA 2GESA 1L8PA 2B8JA 1I51A 2DR2A 3P2OA 3B8SA 3ZTTA 1UR9A 4N5NA 2WJJA 4RMHA 5JAOA 1K4YA 1J7KA 1T0JB 1XKYA 2PLNA 3Q6MA 4JNKA 1SFTA 2YZ2A 3W8FA 4F60A 1LBLA 1DHTA 4QX4A 1D2AA 5K6AC 1ADGA 5F4XA 4Q7LA 5CXUA 4Q7BA 3B4UA 4PN7A 2GRUA 4K8OA 5EIWA 3N9IA 3CLTC 4NX5A 1L4MA 2YW9A 3WGLA 5DNDA 4TV5A 4FN4A 4PCTA 3TLZA 1U0EA 7ADHA 3FZGA 1FHVA 3EODA 5XIMA 3A3KA 3X43A 2GPNA 2ZI4A 1HO3A 5G0TA 1ONEA 1GD1O 1SC3A 3CZPA 1C3EA 1G7RA 3KOZA 4UQOA 5G4KB 2PBZA 4C1KA 3CISA 4JELA 4LOCA 3VE7A 5C55A 3BDAA 1HXHA 3UATA 1PX2A 3C2QA 1ZB5A 2OHOA 1N1EA 1E6ZA 3F71A 3NCOA 3IGFA 1Z15A 3TYDA 2CXNA 5KZMA 1TTPB 2FFBA 1B8OA 3S5NA 2OX4A 3B1KA 1LI7A 3S1VA 4B6FA 2JEPA 3TG8A 3VINA 2GM9A 4QCEA 4QRNA 3PTLA 1JJBA 3G2LA 1IRXA 1ZENA 2Z26A 4D25A 5B58T 1VPYA 4F2HA 2CL6X 3QWIA 3I23A 1XZHA 4QSFA 1Z12A 3WYGA 4GR5A 1ECLA 3BSGA 1ENPA 2W0UA 1FBAA 1E20A 3ZDYB 4AEEA 2XTKA 8GPBA 4FIQA 4HB3A 1M5RA 3CNNA 4RBNA 4XTDA 4PC2A 4M0KA 3GJYA 4F79A 4OQMA 1OFUA 4PCUA 5AVVA 2FQIA 4CD7A 3S1LA 5KYKA 3A9UA 4V1CB 2Q07A 1DO2A 3HZRA 3I9MA 3UNDA 5K0JA 3PX3A 2WYWA 3P9SA 4B2YA 4UATA 1JKXA 1R18A 3SDZA 3WLAA 3CJTA 2QGFA 3HCNA 5LIXX 2ACVA 4QOFA 2EWVA 3CHCA 4BCCA 3O8BA 5AHKA 1QPBA 2ZYUX 4DELA 3QMPA 1RM0A 1IPHA 4M80A 1CUBA 3R1IA 2NZ8A 5B6JA 1JYWA 3K0FA 3T41A 4Q9DA 3GRUA 2VDOB 4O0LA 2E5BA 4UBPC 3R3WA 1GYRA 1LDYA 1EP9A 4HNGA 2QUJA 1OC2A 1O5RA 5ILOA 2ZZNA 3WWZA 4AD4A 2QXTA 3HLKA 2KAUC 4INZA 3E1F1 4TLEA 4R51A 1PD1A 1XSKA 2YCLA 1L4FA 1UPUA 2FUCA 4HOWA 3H8VA 4W84A 3SYRA 1MPTA 1G98A 3P0HA 3KJZA 1Z3IX 3ROKA 2VQ3A 3MC5A 1GXSA 1Y4UA 2IE0A 2WNNA 1NBAA 1U9IA 3CMGA 4H9YA 4H1UA 2BFDB 4D56A 1E6MA 3W2FA 5F3WB 2FMXA 1DYSA 2HGZA 5JD3A 1EHCA 4WK0B 1DUIA 3NWPA 3VHRA 4HI0E 2DUUA 1N5JA 2WBGA 3BMOA 4CLRB 4IXMA 5DT5A 3MHPA 5F2LA 1ULUA 3OKAA 4ZOLA 4LUSA 4IZHA 3ONNA 2JEQA 4XA8A 4ZVKA 1R6XA 2J30A 2DPYA 4PR0A 1VFLA 5DSZA 1ICPA 4U7HA 3TSYA 2WQ6A 2D0GA 4PCSA 2QENA 4BUJA 4KIEA 1X1TA 4DDUA 4E3TA 1XBZA 5E6UA 2QQ0A 3QP9A 1RHUA 2CBZA 3C7DB 1A0OA 2R96A 1N8SA 1I94B 4FFVA 1B23P 5CH3A 2E6FA 4X6LA 1KZ9A 3R3SA 3JUGA 4R54A 4OGGA 3UENA 3V4FA 4AMBA 1BTCA 2FE4A 4Y2JA 1UWLA 3ZVHB 5BQPA 4LN1A 4UXIA 3NQ41 5KYYB 6PTDA 5E0CA 4KSCA 1OWQA 3E3NA 3DZHA 4BU0A 4LE2A 3RD5A 4BO6A 4E2ZA 1NQ6A 2RH9A 3KHDA 1Y4AE 4AMZA 3U0BA 3WKZA 5AW0A 2OOGA 5DYNA 3ZWTA 1RBMA 3QWHA 1Q50A 3M5ZA 4KEMA 1MXDA 4GYJA 3SSJA 4DGQA 3JX9A 3IA7A 1PL8A 4IUYA 3CPRA 4YROA 5IM5A 4IUDS 1E58A 3M5VA 1DPMA 1IWOA 5J2TB 3BC9A 2WNZA 5LZLA 5TRTA 3MUEA 1H7RA 4LAMA 1TWWA 2Z8YA 3R0JA 1YHNA 1X0XA 2JH8A 1XQ6A 4D1JA 4Z7QB 4GP6A 4B8WA 3PZBA 3OPSA 3WD0A 4RIHA 1UPTA 1CT9A 1FRFS 2OLHA 1K8YA 3O83A 1MUUA 1DKMA 2QD2A 3GDLA 2P91A 4FFBA 4N9CA 1KH1A 5JMUA 1Q7EA 2O19A 1NOKA 3B3JA 4C2UA 5HKOA 1Z0KA 3PNVA 2Q8LA 4W9RA 3G88A 3DE1X 1UD8A 1YB1A 1FUYB 2R5NA 4G2TA 2WZEA 4RV5A 2ZBPA 3IVSA 4XARA 1E4EA 1TO6A 1E9CA 1KEVA 3I9JA 1LDBA 1WDMA 3TFOA 2H11A 1HVQA 2VJAA 4WBSA 4HLUC 2FETA 2JGMA 4H9VA 3PUDA 4IGEA 3UWUA 1FWIC 1NL3A 2HRZA 4ZZ9A 4DWSC 3D46A 4I9MA 1AH3A 4GKLA 2BEVB 5KWIA 3ZO9A 2QT3A 3U0VA 1UBNA 2X9QA 1T4CB 1MX1A 4ZHQB 3QVXA 5LSAA 3IQXA 3ZHOA 4DM4A 1EGZA 4P5UA 2G82A 3QGAC 5HK4A 3PC7A 3N2NA 5MN5A 3WFZA 2C04A 4V03A 3I8XA 5CA0B 3QYJA 1MTZA 1W4CA 2OG1A 1Y7VA 8RUCA 4TUYA 8XIAA 3N1AA 4GS5A 4OD0A 5I5RA 2IU3A 2GA8A 4N4AA 3K1DA 4L9YA 1JDPA 3IIMA 3NQCA 1JZ5A 4RD6A 1BKHA 2YWCA 2Q1WA 2AKMA 3P5SA 4W5NA 3NZRA 2NW0A 3R3VA 2AZDA 4XE5A 5IJ9B 1K4HA 2FZDA 2WO5A 1SCBA 1UBOS 3FCSB 4FSDA 5JBEA 4E30A 3DDSA 1MMFB 4C05A 2QTRA 2JFEX 1NURA 3I6ZA 3DYMA 5EJEA 5TNXA 4JLKA 2XNDA 4GZ7A 2VLBA 3L1HA 1ZU8A 2ILVA 2WSKA 3IMKA 4RTJA 4N6OA 2D23A 5BYBA 1C0KA 1T8YA 2VJPA 4B8YA 4EI8A 2Z5GA 3BVPA 2C1EA 3DO8A 3B3FA 2DR0A 1A3WA 4ZVPA 5HIMA 3LUTA 4L76A 3ZVLA 3GU2A 3WSWA 4MKRA 5H83A 4FX7A 3HO6A 1WB4A 1LUAA 3Q8KA 3TJXA 4AY4A 4R9XA 3H83A 3MA8A 3DTTA 1ZS2A 1IFXA 3N14A 2KW5A 1TUBA 5F35A 3TE7A 1SOWA 4NYYA 1Q66A 2QM7A 3E96A 1ZN7A 2PQ2A 1EFLA 2H4XA 3CAVA 3GXMA 4NJMA 1ZJJA 3DEQA 2LNDA 4RETA 5CJJA 1LEHA 5CDSA 3S81A 5AVSA 1TM2A 4KGLA 1O87A 1W4LA 1A1SA 4HAZA 2GN9A 2W67A 2P40A 1WDQA 4RJIA 1E69A 3OKCA 1BLIA 4FI4A 3AIOA 3SKVA 1QRUA 3VNJA 2BFCA 2GPBA 4L95C 1R3TA 2P0IA 3OYXA 3IP3A 4MO9A 2Z25A 4ENLA 4JL2A 4Y1GA 2HB6A 1BCSA 4HP5A 1G5IA 2F1IA 1YS2X 3A6DA 3KVOA 2C5LA 2GCIA 4D98A 4JYAB 1H1DA 2CLKA 3UYLA 1PBNA 2P4EA 2J7FA 3TE6A 2P6RA 3IV6A 3R8RA 4CI9A 2C8NA 3OODA 1WY5A 4QOSA 4YTTA 1O5XA 5CIYA 5B80A 3NKFA 3CURA 4TXEA 4KQKA 2LTAA 6XIMA 1SVKA 3V0TA 1VHCA 1RP8A 3V4ZA 3SFZA 3PX2A 1JE0A 1DVRA 2DWCA 2WYSA 2E9LA 4N0EA 3GRFA 1ZNWA 1XRMA 2UYQA 1XMXA 4XIGS 4BNNA 1MDFA 3MGCA 3MYPA 2P6UA 3GUCA 1XCLA 1ONSA 4W93A 4LFAB 2RSLA 2VHWA 3PVCA 1F3EA 1TKKA 2YIHA 1K6WA 4DYKA 3A13A 4LDZA 1XF1A 4YTEA 1M7OA 4QQ3A 5BN4A 1DHKA 1NXPA 3LTYA 1XPYA 4I7WA 2IIVA 4FOPA 3EVNA 3E7WA 1EX1A 5F4BA 5CNJA 3AS3A 1C30B 3C3PA 2Q6OA 4ZQHA 3RW9A 3ULKA 3UK6A 4FNSA 2X22A 3LD9A 5SY4A 5FPTA 3UXDA 1OWOA 3DVAA 1GSOA 4A6GA 5IYZF 1MENA 3EY9A 5C3UA 4K6KA 1J0BA 1KWKA 3DXXA 5ALYA 3DOEA 3E0FA 1PJTA 2ACWA 3CM4A 3UK2A 4LUCA 4OAQA 1J0ZA 1R8XA 2QUNA 4NYJQ 4L2IA 1KXTA 1U1UA 4QUAA 4Y9RA 4IDCA 3JD0A 4DG5A 4MMYB 4PNZA 1XWFA 1JPNA 2C59A 1PJLA 1NQVA 4A6EA 1JDSA 2VM8A 4L9ZA 4E1AA 4D71A 3DCPA 4HN9A 5A05A 2D3LA 2GVEA 1PGOA 2WK1A 3FOKA 1KP3A 3OIWA 1Y8RA 3LV6A 2QUIA 3DZKA 1NUUA 4WGHA 3F4LA 4TSFA 4XQ6A 2H51A 3TKYA 1QK5A 3QR0A 2JD1A 1VM6A 3MPUA 2I4OA 4ICNA 1K6XA 4WACA 3VH1A 3EGXB 5JR3A 2VT7A 2YLLA 2AFHE 4KVGA 4YV1A 3O4HA 3AETB 4W7WA 3W4RA 5GWXA 3KC2A 4I14A 1BXZA 1TPFA 4XZNX 4ZE5A 3FWYA 3GL9A 3LVRE 1PDVA 5MHTA 2PDUA 1KO8A 3L6CA 3E22B 3V33A 3KYJB 4UFHA 1POXA 1PHRA 1QHXA 4A8TA 1ESMA 2AEFA 3UXEA 4LNUA 1MWOA 2ZWZA 5JZVA 1YDHA 1ZP4A 1G5FA 3NCHA 1YI0A 1QVZA 3N3BC 3RS3A 2B1IA 4IG9A 1JR1A 2XY4A 3OPQA 2CESA 1YBMA 3VO2A 5HIAA 3NEJA 2ZSEA 3PBKA 2EBHX 3OP2A 1ICSA 3LYEA 4DV5B 4XFDA 1UP4A 3P8JA 4ORMA 4Z51A 3VAYA 3VR0A 2BM9A 4WK4B 3NNNA 4GY0A 3TW8B 3YPIA 3THCA 5J5DA 4HFJA 5IKEA 3USZA 5LOVF 5DELA 3SNHA 1G01A 2XMBA 4C6HA 4KAFA 1GFWA 1E3WA 5FJOA 4ZTUB 3QHNA 2XN2A 3PDHA 3S70A 2WHEA 3BHIA 4JJZA 3V4SA 3CCFA 5DNUA 3MVIA 3AY3A 4AJ1A 1GZJA 2RI6A 3U1VA 4OGWA 3MBKA 2C1GA 3K5WA 5FUMA 4X20A 3W85A 1RXCA 4GQIA 2KM1A 1XZNA 3WLIA 5SZJA 3C6XA 3CSSA 3BK0A 4FIZA 5HYVA 3SBEA 4JJGA 1V7YA 5B53A 1XRJA 2D4HA 4QTYA 3SY1A 2Z98A 2W6OA 3CQJA 3CF4G 2XBMA 3WY9A 1M9HA 3RM8A 4OE7A 3LLDA 2PDGA 4PC1A 2EFJA 1A4RA 1QBBA 2ORYA 1MQSA 2Y1GA 1HRDA 4DKXA 4UOQA 5CDFE 3WYEA 4R8KA 3OGSA 5M29A 4HX9A 3OZSA 1C1YA 3NRJA 3MJMA 2FN4A 4CODB 5MKGA 4G0XA 4UR9A 4XZ9A 2ZSAA 2VCCA 2IW0A 4XQEA 2NU8B 2YYUA 4ZGWA 4KPUA 5KINB 1QNQA 3VYLA 2X0IA 1J21A 4Q8MA 2HU7A 4PG8A 4O4IB 3KAJA 3Q7IA 5A6AA 3VIIA 2XH7A 1K66A 3FB1A 3MUIA 5DGHA 1MW9X 3B8TA 4EA7A 1V0NA 1KS9A 1EA9C 1QIFA 3QWFA 4OIMA 4FK9A 3EAUA 1FPQA 5JAIA 3ELBA 3URMA 2X1UA 3VIOA 1KP9A 2XPCA 5BWNA 4JJEA 5DF0A 2ZVIA 3VKDA 2Z6AA 4EVZA 2V7BA 4GI6A 4A36A 2YBDA 4G07A 4PBEA 1EG7A 4GGBA 3ENNA 3ANYA 4R9NA 4PGAA 1EGVB 3N86A 2JHGA 3M0XA 3MWAA 4J3ZA 1LNSA 4JVSB 4O13A 3IHKA 2O9OA 3VM5A 4I1VA 4A1FA 1HLGA 1E1QA 4H7KA 1GUFA 3IUJA 2CXGA 1BF6A 1HI9A 3SOPA 2Q1UA 4DO5A 3PS9A 1OE0A 2CEQA 4PANA 2I2FA 1GQNA 2UY3A 4R4JA 3OTQA 4X61A 1MGOA 2Y76A 3GIQA 1H8ED 2PT5A 4HJRA 3CKMA 3I6EA 1OLOA 4J16C 4ZDKA 1VYPX 3A4MA 2KLBA 4RDYA 3D6HA 3ND6A 2ZVDA 1BHSA 1QIGA 2IYXA 3DG3A 3W6NA 3MM4A 4FPXA 4Q6JA 4RK7A 5A3VA 2GR9A 4ME6A 1QONA 5CFZA 2EGGA 4Y3UA 3WDHA 4UR7A 1UKCA 3CS3A 4O4JA 1MH1A 5AT1A 4KIRA 3PGKA 2FJKA 3ZN2A 2XSZA 1Q0SA 1Z22A 2RHGA 2A9KA 1UJ5A 2VHTA 4IY1A 3MA0A 3HBAA 2H7CA 2ODNA 5EE3A 2IPLA 1GOTA 1UASA 3T3EA 3UJEA 1RPKA 1CV2A 2NGRA 1MUMA 4XQCA 2XZ7A 2A5DA 3HYNA 2AEMA 1A96A 4AUNA 3MV01 1GPUA 1W1WA 1SUDA 2YQZA 1M72A 3SU8A 3RC7A 4B4OA 3QUCA 1PG5A 1J8VA 1EHAA 4MR8A 1FFCA 3TLAA 3TFWA 1A5SA 4R9RA 3RFTA 4CNUA 5JCOC 4WTOA 3N6RA 2V5UA 2E9MA 4E33A 2PGJA 4O1DA 3O95A 4F38A 4JIPA 2H8KA 2V03A 3I73A 4IFKA 2VD9A 2NSXA 3EVDA 3NVAA 2FTYA 1PR4A 4NZJA 4HS4A 3KX2A 1J0EA 1EYEA 2W22A 4BHYA 2PY6A 3DEJA 1N9ZA 4DLVA 4QFUA 4DMKA 3UVEA 1WCYA 1D9ZA 2ZVJA 4P33A 2H8GA 2PC4A 1JFLA 4L4ZA 1XCMA 5EP2A 2AN9A 4AX7A 3RIHA 5CITA 1TJ5A 1TJYA 2QYTA 4KXXA 2R8RA 2P0YA 4EK7A 5D5PA 4QNNA 4F2TA 3TI7A 2IZ6A 3VMFA 3OOSA 1EFCA 4I3GA 1F0YA 4NG3A 3E70C 3NVDA 5LWHA 4Z4CA 4IWXA 1JECA 4YCLA 3G6MA 2D1FA 3N18A 4ACZA 3QH4A 3GEBA 2ZZ4A 3ME5A 4TVSA 1GJUA 2ONCA 4DAEA 2WVUA 5BW6B 5AJYA 4D96A 4JA0A 4OA5A 1Y6FA 3RR4A 3LDGA 5IM51 4UVDA 4A2WA 2R1VB 2OZ8A 2JFUA 3H53A 2MDTA 4G0YA 3TTXA 2J75A 4E1BA 2PF8A 2NXEA 3TCNA 2OO6A 4WJKB 2XW6A 1C1XA 4KQMA 2PDIA 5ADHA 3WJ1A 1QW7A 2GEFA 3QY9A 4I19A 2PG3A 4IRUB 1MZVA 5LYJA 4NBSA 2PX5A 1N5DA 5H82A 1W8DA 3WFAA 3O2NA 2G9NA 1SR0A 1IHIA 3LGGA 5KZ6A 3S5SA 4UCXA 2P2DA 1A47A 2AOWA 2R00A 5ICSA 5K6TA 2AMGA 3FSEA 3TLGA 1M7GA 2PDWA 1E73M 3FIJA 5THKA 1XIFA 3BRWA 3U7QA 3SQLA 1AY0A 2WHJA 1PNTA 2C58A 3WHKA 2JIQA 4BQQA 2HUPA 3Q4GA 3MJVA 1N6KA 3LPFA 5FLEX 2ZJ6A 5A4KA 4ND1A 1J1UA 1LPMA 1UBRS 2A59A 1K75A 2NTJA 1C3JA 1KYQA 5E2BA 3OQBA 3L40A 4Q4HB 4FGWA 2WTAA 2Z1NA 3AF2A 4J40A 3FAKA 4LYRA 3OP1A 3W77A 1UK8A 2XEDA 1Q6EA 1XLBA 3FY1A 5J8LA 1E4MM 2ADMA 1OGYA 4WSKA 1BMFD 3INTA 4M1TA 1ARZA 2FZNA 2OORC 1FCJA 1A3HA 3NOXA 4XD7D 5P21A 4O14A 3N29A 3AB3A 1D2CA 2VHJA 2VZEA 4X3OA 4TYNA 1GU0A 1WDTA 5KQLA 4HMOA 1VE1A 5FHQA 4B84A 1WKEA 3T61A 4PQGA 3QOFA 5INTA 2FQQA 2EFEB 2C7BA 1JLLB 2QMHA 7TIMA 1MAAA 1NZDA 2EG9A 3EWZA 3GDFA 4IL5A 2JFBA 1B1YA 5JBIA 4ZMBA 2C5BA 3IPLA 3AM3A 4P7GA 5EI5A 2QTLA 1C3XA 5H80A 2CF5A 3C6CA 3K2EA 3FIGA 3ABQA 3C98A 3EXHA 1GTRA 3C8DA 1UUQA 1J10A 2IYWA 3TD2A 5F7ZA 1ONPA 3OMWA 4Y2YA 1XLLA 1PX8A 3P20A 3WS7A 4NZ5A 1UPPA 1JPDX 4GRAA 2CNDA 1G2OA 1U2PA 1XRSA 5HZHA 3EWDA 4PSKA 4DCPA 2NV2B 3KP1A 1ABEA 3ZWYA 3LMKA 5FRDA 4A1OA 3R5EA 4PRLA 2W4MA 3GXIA 1QJCA 1QHHA 4RK6A 3ZUGA 4A3YA 1OUMA 1PFUA 3O7UA 4JPGA 4G89A 1XWIA 1E77A 3UESA 4QYWA 3NO5A 3HF3A 2F2HA 3URAA 1DAGA 1KDPA 3TLQA 2CWNA 2J7BA 3UN1A 2G0AA 2ZBDA