5EMMA

Crystal structure of prmt5:mep50 with compound 15 and sinefungin
Total Genus 200
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
200
sequence length
625
structure length
625
Chain Sequence
b'RVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein arginine N-methyltransferase 5
publication title Structure and Property Guided Design in the Identification of PRMT5 Tool Compound EPZ015666.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 200
structure length 625
sequence length 625
ec nomenclature ec 2.1.1.320: Type II protein arginine methyltransferase.
pdb deposition date 2015-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05185 PRMT5 PRMT5 arginine-N-methyltransferase
A PF17285 PRMT5_TIM PRMT5 TIM barrel domain
A PF17286 PRMT5_C PRMT5 oligomerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 5emmA03
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 5emmA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5emmA02
1KPIA 4XISA 4CKBA 3MCZA 3HEMA 1DIDA 3DR5A 6XIMA 1VLMA 1VE3A 5ICEA 5FQOA 3DBNA 5E8RA 5CCXA 3TKAA 3ME5A 2AN3A 4RTRA 4HGXA 1UWVA 1B42A 3TC3A 5CVDA 1AQJA 1SVUA 3KHKA 4ZBCA 2BR5A 2O05A 4YTTA 2PSSA 1K77A 2NQJA 3LPMA 1M6YA 2YUIA 4R8RA 3BXOA 4BLWA 4XUCA 1INLA 1HMYA 1AF7A 3HNRA 3G2MA 4YMGA 4RSRA 2PT9A 1UFKA 5DRTA 5CUQA 2PX8A 5IKMA 1WG8A 1TW2A 3VC2A 3GRYA 4CWAA 5MHTA 4K6MA 5FHQA 4KIGA 3BANA 4XUDA 3S68A 2GYIA 3DLIA 1Z3CA 4F86A 2HNKA 3LDFA 4BY9E 3R0QA 3DMFA 5H02A 1XXLA 2Q02A 4DKJA 3PTAA 3UJAA 3LCVB 4M38A 5EVJA 4LWOA 3PT9A 1MJFA 1XDUA 4KDCA 4HNOA 4FR0A 5DM4A 3OZRA 1NV9A 2XYQA 2ZVJA 2G1PA 1M6EX 3ITLA 5KVAA 2G72A 3HP7A 2Y1WA 5HOQA 3GNXA 1SUIA 4P58A 5EHIA 4QEEA 1T43A 2ZBPA 1G38A 2AR0A 3TM5A 3XISA 5B80A 1WZNA 4HC4A 1N7IA 3KPVA 5E9QA 3EGEA 4OA5A 5CVUA 5HEKA 1BXBA 1XLGA 4WXHA 2OKCA 2X7VA 3BT7A 2C7RA 2B9EA 4IV0A 5LQRA 1ZG3A 2IP2A 3KBVA 2Y1XA 5T6BA 1QT1A 3KPWA 2JHPA 2PXAA 1XLLA 2G70A 3DXZA 2IH5A 4YUVA 5HIMA 1G8SA 4FZVA 3M0LA 2CMHA 3OFKA 4QVGA 3OZTA 4KW2A 1JG4A 2AOWA 3E8SA 5HILA 4RTNA 3KBNA 2P7IA 1VP3A 3HVKA 2HMYB 2FK8A 3LDUA 3A26A 1XIEA 4DZRA 4DVOA 1QAOA 5DTMA 4E2XA 3C0KA 1SG9A 4K1GA 2FRXA 3N4AA 4E31A 2ZW9A 4GOMD 2WA2A 1M0EA 3U0HA 5F2KA 3M0YA 5K0LA 3UJCA 1XYBA 3JWHA 4V0RA 5LQAA 2I57A 1CLKA 4QTTB 4OX9Y 3NWBA 2PWPA 1NBHA 2OB1A 3SR4A 1R8XA 3KR0A 2ZCJA 3EVZA 3FPHA 5GP1A 3UBTA 2XVMA 4PGGA 3HCBA 5DLYA 3UJDA 3BWBA 1XLEA 3TQSA 5FULA 1SQGA 3DMGA 5K0FA 5K01A 4R8SA 2PWYA 4QEHA 3B3JA 7XIMA 2GLKA 4GC5A 3KBJA 3C0SA 3ER9A 1NW3A 2PY6A 2YXLA 4X1OA 1G8AA 4RWZA 3OE5A 3KCOA 4A6EA 3HCDA 1XLIA 3FPEA 5EEGA 3AWIA 4GQBA 4CTJA 4HGZA 9MHTA 2YQZA 7MHTA 3GRRA 3LBFA 3KQOA 3BWCA 1QAMA 2P3LA 4E70A 1XDSA 1DL5A 1DCTA 4IKPA 3LCCA 2AOTA 3VSEA 1EIZA 3L23A 1NW7A 2X7WA 2VDVE 2J6VA 5XINA 3VYWA 4F85A 4OQEA 3HCCA 3KTCA 4L7VA 4RV9A 3VNIA 4F84A 4RVFA 2OBFA 3AAMA 4P7GA 4P7JA 2EJUA 3VYLA 4E30A 3CJRA 4YUWA 3R6TA 2WA1A 3C0LA 4A8LA 3FTEA 3MAGA 2PX5A 1XYLA 5P8WA 4A8IA 1XIHA 3RIEA 5K03A 4PWYA 1XTPA 5EIFA 3CJQA 5CM2Z 4GBED 3ITTA 3DMHA 3EVBA 3PB3A 3CKKA 3AXTA 2BM9A 1XLJA 4OVXA 5F2OA 5DTQA 2NYUA 2HR1A 5CVJA 5FADA 2AVNA 2G8NA 1L3IA 3DULA 5LQCA 3IUIA 3RODA 1DXIA 3MCTA 3HCEA 4P7FA 3M0MA 4HTFA 1TPYA 3KQPA 5C1IA 5K0NA 2Z6AA 1D8WA 4M37A 5EGSA 4BP3A 1QAQA 3KQQA 3TMAA 3B3GA 1XLMA 3FYCA 1NW8A 5E1BA 2IH2A 1YZ3A 4QE1A 2PXCA 3IYLW 4PYMA 2ZTHA 3MGGA 1FP1D 4GOLD 2V7EA 1IY9A 2I6GA 4GJJA 3FTCA 2PX2A 4G56A 8MHTA 1I6NA 1JG2A 3THSA 2BZGA 2P8JA 5LQJA 3EVCA 2YTZA 2AOTB 3M70A 3ER8A 2XYRA 2IDJA 3WQOA 4PCAA 1KHHA 2AN4A 4PGHA 5D1HA 2OU4A 3BWYA 1AV6A 3G8BA 3VNJA 2H1RA 3P14A 5K0BA 2NXNA 2ZVRA 5FTWA 4MWZA 5BW5A 4RVDA 3KKZA 5CD1A 4MTLA 1PRYA 4YUXA 3K0BA 2QUMA 4ZB0A 3UFBA 2K4MA 3KWSA 1F3LA 1XYAA 1RI5A 2R3SA 5JUWA 1FBNA 1Q0TA 4HSGA 3M0HA 1VIDA 2NP6A 3G2OA 3IV6A 3GGDA 5K09A 10MHA 5F2NA 3GIWA 2EFJA 4QE4A 3I5UA 4PYKA 4FS8A 2NXCA 2JG3A 2P7HA 1IM8A 4QDJA 4C4AA 1RI4A 2GLUA 1F38A 3JWIA 3LGAA 5EMMA 1X19A 4EAYA 3MB5A 2I9KA 2ONYA 4HTFB 2ZFUA 3LCUA 1XJ5A 1ZKDA 3CWHA 1XIGA 4RTLA 1JR4A 4XIAA 4YV1A 3EGVA 5BW4A 3DOUA 4AZWA 1KR5A 4BLUA 5EPEA 4IV8A 4YUZA 2N47A 1XIDA 3PFGA 2H00A 1NW5A 4U7PB 4X63A 4C03A 3KPYA 2ZIFA 3CQIA 3I58A 1WY7A 1MUWA 2ZIEA 2P40A 3EVAA 2ZDSA 2AVDA 4EACA 3PFHA 4Z2YA 3LX6A 4X60A 2XISA 4FT2A 5DXAA 1XYCA 4QQNA 3TVAA 4ZB5A 3DXYA 4X41A 2XINA 2O06A 1JG3A 3NDJA 4PGLA 5EG5A 3KCJA 3L8DA 2ZZMA 3M6XA 3A7EA 1VQ1A 5BXYA 5KQRA 3ID6C 4BLVA 2YVLA 4E33A 4KRGA 3KQYA 3OU2A 2ADMA 3NTVA 4ER6A 3EVDA 1JQ3A 2FK7A 3TPZA 3LKDA 3EEOA 2LD4A 1I4WA 1RI3A 1ZHFA 2I62A 3FUUA 2O57A 3DTNA 3P8ZA 3DLCA 3HVIA 1EQAA 4YV2A 4KIFA 2PXXA 4ZB2A 2GA9A 4DCMA 3BKXA 3OZSA 2GVEA 1FP2A 2JHCA 3H2BA 4LNCA 1L9KA 3ORHA 3C3YA 4KDRA 3SSNA 4ER3A 2QM3A 2ESRA 4E2WA 4LG1A 3B7PA 1O9HA 2B25A 3QC0A 1JQEA 3KQTA 3CGGA 4XCXA 3FVMA 1A0DA 3IEIA 2NXJA 1EJ0A 5K0EA 5JR3A 3G88A 3EEYA 2AZTA 2HV9A 4R6XA 4DCGA 5EMLA 4GLEA 3SMQA 3BGVA 2QRVA 2PV0A 4YTUA 1KXZA 2YXDA 1NV8A 3LECA 2AOUA 3P9IA 2NQ9A 4DQ0A 1VL5A 2Q41A 5C0OE 3NW9A 3OPNA 2BR3A 5LQUA 4PINA 4AZVA 3UVAA 2HWKA 5K8VA 4FSDA 3FRHA 4YMHA 2BR4A 1SQFA 4Y30A 3EMBA 3GXOA 1R8YA 4HHLA 1XDZA 3P9KA 2FPOA 3EVGA 4QDKA 2VS1A 4GJIA 2FHPA 2GPYA 2YR0A 3FTDA 3C6KA 3P2IA 5D1NA 3REOA 3CQHA 2IFTA 4DA4A 3G2QA 3KBMA 4BP1A 3G5LA 4MIKA 2OB2A 1L1EA 2QE6A 2UYQA 4YTQA 4LECA 5XIMA 1RI1A 2IIPA 2HTEA 4RTSA 1G6Q1 3UJ8A 3HVJA 4RTJA 1YUBA 1FPQA 3MQ2A 4M36A 1R00A 4P7KA 4Q7IA 3HM2A 3TOSA 5ICGA 3EPPA 5FUBA 3MTIA 1WS6A 3KPJA 3G5TA 4EK9A 5K05A 2ZWVA 3LSTA 3LBYA 3TFWA 2FCAA 4C06A 4FP9A 4YTSA 2IH4A 1VBFA 4O29A 3R3HA 3KQSA 4CKCA 1UIRA 3KBSA 2QRVB 1P1BA 3DXXA 1P39A 4C05A 2ZZKA 2XVAA 1BKYA 1ZGJA 3KQVA 4RTOA 5XIAA 3FUWA 2AOUB 1NBIA 3NMUF 2OYRA 3X0DA 5CVEA 2NP7A 3AALA 4QPNA 4DMGA 1N2XA 3KCLA 5AVNA 5EQJB 2C7OA 5GIOE 3NJRA 3JWJA 3NVKI 3M6VA 2XYVA 3EMDA 1EG2A 1H1DA 3GDHA 4RTQA 3VC1A 2IDKA 3A27A 1XCJA 1RJEA 5KS2A 3GNLA 1X1CA 3C6MA 3ANXA 3CJTA 1XIMA 2NNWB 3T0IA 5FA5A 8XIMA 3ELWA 3Q7EA 1D2GA 3ITOA 2AN5A 1NKVA 3C3PA 2UYCA 2Z6QA 5EMKA 4POOA 3BZJA 1EJ6A 3HTXA 1YFJA 1XYMA 3MERA 3GWZA 4EKGA 1XIJA 3V97A 4CXMA 5EIWA 3UJBA 4ER5A 4QQKA 2IBTA 3NWEA 1KIAA 4PFHA 3G8AA 4RVGA 1TZ9A 3OFJA 2P3OA 5I7GA 3FYDA 3U3HA 4YTRA 3QZAA 3LKZA 5HIIA 2G71A 5HZMA 4GUAA 3UJ6A 2Z6UA 3Q87B 3P2KA 2CKDA 1NE2A 1U2ZA 3FZGA 1XISA 5H1WA 4AX8A 1BOOA 3I9FA 3GJYA 4B17A 1MHTA 4GOOD 2UZ4A 3GRVA 2YXEA 2ORED 3BGDA 3QYSA 1N7JA 4GC9A 3CVOA 5B1SA 4EMSA 2ZIGA 3BWWA 2NXEA 4Y2HA 1O9GA 2ZZNA 5GIPE 3ELDA 3EGIA 3BKWA 3IUDA 2DULA 4FT4A 4LWPA 5DSTA 1XLDA 4E32A 3QXBA 5E8JA 3M4XA 9XIMA 3FRIA 4E2YA 4RX1A 1DUSA 5E9WA 3MHTA 3GU3A 5K0CA 2GS9A 2CL5A 5DPMA 2VDWA 3KQWA 2JJQA 1G55A 4QDPA 4FGZA 1JTFA 5EZSA 1AQIA 5J8LA 2PGXA 1Y8CA 3UA3A 1QTWA 3SSMA 2QY6A 3I53A 2PVCA 1MNZA 5ICCA 2GH1A 4MHTA 4PIPA 2PX4A 1VPTA 3CC8A 1V39A 2IGTA 5EOVA 4GEKA 1XIFA 1I9GA 5DM1A 2ZBRA 5DRYA 1XINA 3FPJA 3KR2A 5K0GA 3NGFA 5C9ZA 2ZLBA 4QDWA 5KQSA 3E23A 2HK1A 4CKEA 5EMJA 2QUNA 2R6ZA 3QV2A 2XBMA 5FWAA 4MQ4A 4WVLA 4XSMA 5G02A 1KYWA 3JU2A 1WXXA 1YX1A 3IUHA 3V8VA 3B3FA 1ORIA 2IPXA 2YX1A 1D2HA 3BGIA 4R6WA 3RW9A 3O4FA 3AJDA 2OPBA 5AVHA 1JSXA 4C04A 4XSLA 3CQKA 3GCZA 5CIYA 1KPHA 2PLWA 3HVHA 3AYVA 5DWQA 2PJDA 4GOND 5IH3A 2G4JA 2BH2A 1RJDA 2JH9A 1SKMA 1I1NA 2AOXA 3WSTA 1JTEA 2ZWAA 3DUWA 4QVKA 5EEHA 3R24A 1DIEA 3ITXA 5GM1A 5K0JA 1BXCA 2EX4A 5HIJA 3PVCA 1RJFA 3E7PA 6XIAA 1XVAA 5H6HA 3FUVA 3PX2A 1KYZA 3QOWA 2I56A 4YV0A 1YZHA 1D2CA 2E5WA 3GRUA 2PKWA 5LQKA 1QYRA 1FJXA 5EHGA 2ZBQA 3UJ7A 3OU6A 1R74A 3EVEA 2XIMA 2UYHA 3UXIA 5E9JA 5BP7A 5E1MA 1DE6A 3B5IA 5DM2A 5E1OA 3IHTA 5HFJA 3VNMA 2QULA 1JSZA 4E3VA 3F4KA 3CQJA 2B78A 3A25A 3TM4A 1XICA 2AOVA 4OA8A 2AS0A 2ONZA 2QYOA 5E1DA 4PYNA 4W4QA 3KU1A 4AZTA 2A14A 1RI2A 2H11A 3I64A 1P1CA 3FPGA 4ZTBA 5LR6A 1R18A 4X61A 1BHJA 3AY0A 4R05A 4IWNA 3NVMB 3U81A 3UJ9A 4PYLA 1XLHA 4RTKA 3UU0A 3HCFA 3TLJA 3KR1A 3DX5A 2OY0A 3DP7A 3A7DA 3BZBA 3VNLA 4KW7A 1JG1A 4CTKA 4NECA 2ZSUA 1L3CA 1R6AA 2P35A 4C08A 5GOZA 1XIIA 4PCLA 5HIKA 2V74B 3M6WA 3LL7A 1ORHA 3D2LA 1X1DA 2VZ9A 1OR8A 1S5NA 2O0LA 3DH0A 5ERGB 1O54A 3FUXA 4H0NA 3UZUA 3ELUA 5CVVA 3K6RA 2GB4A 1O1HA 1SUSA 4DF3A 2QW5A 4PYJA 2G0WA 4ATNA 2PT6A 2KW5A 2DPMA 3VNKA 4A8RA 5CCBA 1YFLA 4K3ZA 1WXWA 3P9CA 1YF3A 1XCLA 1XLCA 2GAFA 4EKIA 3OU7A 3SVZA 4J4KA 2F8LA 1XIBA 1JQDA 3CNYA 5FCDA 5FHRA 3KBWA 4US6A 5FA8A 1I60A 4KVZA 2O07A 3EVFA 3CBGA 3KPUA 5B7YA 4V0QA 3ERCA 3PX3A 2P3QA 1NT2A 5EZQA 1QZZA 4DUOA 1NW6A 2JH8A 3PS9A 5T64A 3T7SA 1XLKA 3BZGA 3SSOA 3E05A 4XIMA 5DX0A 2OZVA 2WK1A 2UYOA 3G2PA 3ITYA 3UWPA 8XIAA 3HA3A 5KYGA 2P1DA 3P71T 3HA5A 3R9XB 3FPFA 5FWDA 4PIMA 1EAMA 5DX1A 2CMGA 4HHMA 3TKYA 3P2EA 4QTUB 2C7QA 5EC8A 1X1BA 1A0EA 3T7RA 4UOEA 3UA4A 1ZGAA 1XLFA 5E2AA 4OBXA 2VDUE 4RTMA 3LMZA 4PNEA 2EJTA 1QANA 3BDKA 3HA7A 2C7PA 3LDGA 3B89A 3SX0A 1S5MA 3GRZA 2HK0A 5B7ZA 5M5BA 4OBWA 5E2BA 1HNNA 3P6LA 4PYOA 1QUMA 5U4XA 4AUKA 5DTRA 2OO3A 5ICFA 4RYLA 2HCVA 4U7TB 3T7TA 2EG5A 4HH4A 3JWGA 2ERCA 5EKUA 4YUYA 3QOXA 3P97A 3OBEA 1Q0SA 3M0XA 5DSXA 5FQNA 2ZULA 4EQZA 4RVHA 2NQHA 1L3BA 1ZQ9A 3A4TA 3TRKA 3G7UA 4PYQA 3M33A 5T67A 9XIAA 5LQNA 2GUBA 1IXKA 4PYIA 4QE5A 3ELYA 3KQMA 4M7RA 4ISCA 3FUTA 1A0CA 1XP3A 2B3TA 3O7WA 1DE5A 4A6DA 1VP9A 3CCFA 5GM2A 3M6UA 4JXJA 4HRAA 3KR9A 2PBFA 4HG2A 1KP9A 3GO4A 1KPGA 3AXSA 5GWXA 3OE4A 3NDIA 2CWWA 1YB2A 3BUSA 3MTEA 1XLAA 3FTFA 4QPPA 4AZSA 3P9NA 4OQDA 2P41A 4DM3A 2B2CA 3HCAA 1XLBA 3O31A 2BM8A 3SGLA 1PJZA 4ER7A 3OCJA 3XINA 3SM3A 4HGYA 1GW9A 1RJGA 5EKXA 5TNVA 2JHAA 3G89A 3TR6A 2IBSA 3XIMA 4XUEA 4PONA 5DT2A 4A8NA 3SXJA 1BC5A 5DXJA 1X1AA 2VP3A 5DX8A 4RTPA 4FSXA 3AYTA 3C0QA 2I7CA 1TW3A 4KWCA 4EVIA 3THRA 4E2ZA 4GF5A 3LHDA 2OXTA 2FYTA 4ER0A 5GINE 1G60A 3M0VA 1OADA 3ITVA 5LSAA 4C07A 5DM0A 4XKMA 3BWMA 3PLAE 1P91A
chains in the Genus database with same CATH superfamily
1R6DA 4F9GA 3I1JA 5CBPA 4LNYA 4XISA 1M74A 2BASA 2F3QA 1I32A 5DWVA 1VLMA 2ORVA 4U39A 1F9EA 2AKYA 1QVWA 4QECA 1NZJA 3U2OA 2F4VB 4GKJB 4TTAA 4DDTA 3GY1A 4HZ6A 5I7SA 1CECA 3C1TA 1OX4A 3IODA 1BVWA 3KFTA 2R11A 4KYIB 5GJNA 2BIFA 4WN9A 4B8YA 1HETA 1FWJC 5I3DA 2GGGA 3Q2DA 1SZDA 3BXOA 1SW0A 3WYNA 1FFSA 1XFDA 1L6FA 5JARA 4GVLA 5E0FA 2GJPA 4NF7A 3S5ZA 4IIUA 1MV5A 1CBUA 4LRWA 3BMWA 4HFMA 1SIOA 3EGCA 2CDNA 4K9DA 4GQAA 4XIFA 3PXAA 3Q7IA 3UAGA 5C8YA 3E9NA 4KIGA 1SEPA 2IW1A 2QD4A 3MY9A 2RE8A 3U4FA 1QHZA 2EX0A 4D46A 2QQEA 3PPVA 4EKYA 4IX0A 3WELA 5CG2A 3D59A 1I2ZA 4MGZR 1H50A 1P9LA 1P0IA 3JUGA 1KEEB 2PMEA 4IQDA 1XDUA 3DJYA 4HN4B 4Q4MA 1CUAA 3VPLA 2YJ4A 4PCTA 4ZQBA 3I4KA 1OY1A 2HYIC 2DM6A 2AJCA 1AJ2A 2O1SA 2C3UA 1WOYA 4OI0A 2FHSA 2JEQA 4YEDA 2X58A 3GQVA 1E2DA 3TXAA 4I1VA 3VZRA 4V2XA 5BU6A 2JAXA 1MH1A 2PNJA 3CTMA 2WWCA 4R7GA 5TV2A 4RWEA 2VHJA 1GTL1 3GXMA 5A7HA 1E1LA 1GCGA 4MAAA 5GGYA 5T6BA 3CS3A 5ECGC 4UBNA 2VUNA 1PQWA 1PI3A 1U02A 4OKIA 2PKXA 3ZCXA 4OX9B 4LUJA 4YCLA 4F5EA 5CT9A 2VMFA 1LBTA 3KXQA 5JS1A 3ZIAA 4OFZA 3AG6A 3WL0A 1M03A 4IJRA 3QLUA 1W19A 1EHYA 2B4TO 1WDSA 2P77A 3HVKA 1OT2A 4YPOA 3K53A 2FYMA 5T9CE 4NX2A 1MXSA 4XKYA 3MUOA 3QFWA 4ZHQA 3FYOA 2Z4RA 3AM4A 3A28A 3W22A 2HQBA 3RARA 3SC4A 1TEZA 1U0JA 1U6IA 4L5CA 2C42A 4I3GA 4DLNA 3GL9A 2OHOA 1WB0A 4Z0HO 4B3IA 4XUYA 1WM1A 2BI8A 4XVQA 3KYJB 3CUZA 1SFLA 4QG6A 4O0LA 4E1AA 2XZPA 3GMDA 4F45A 3PGMA 3EULA 3QF4A 1E4NA 4Q8OA 2VC9A 4HZIA 1FCVA 5I9MA 1Z15A 3LC2O 3G1SA 3DC8A 4ENQA 3AR8A 1WXYA 3K16A 3RS4A 1KWGA 2Z26A 4C6JA 2GWGA 3OLDA 3LI0A 2TPSA 2ZVDA 5AIBA 5EXPA 4AO8A 5AKIA 4RHUA 2X8LA 3GEHA 1YBQA 5LYRA 4GLLA 3I61A 1QO0D 4MJ7A 2CZQA 2SNIE 4CL3A 5I3KA 3CUHA 4I3FA 5H9WA 3QU9A 3NBUA 1XTUA 3DZJA 1WW3A 4Y9DA 4J3VA 1CXKA 2WTMA 1E99A 3IIMA 3V1LA 2O9TA 1WABA 2Y76A 3HA2A 3D6JA 4X6LA 1JAHA 1R15A 1H60A 2MJLA 2VFHA 2QNRA 1AKRA 5L4NA 3TWOA 3HE3A 1YFKA 2VYOA 4JBXA 4N4AA 3W9YA 1POWA 2BUBA 3LGGA 1AQMA 2AN1A 4HAYA 2Q9BA 2QL9A 8RUCA 4RE0A 1XZNA 5E4TA 3VYLA 2RK4A 1QOQB 3MO4A 1GU1A 4DSAA 3W7LA 2C84A 1FHUA 1ZY2A 4EARA 3S2NA 1M6VA 3H5OA 4M1TA 3R8XA 1XYLA 4CKWB 1NATA 4CU2A 4ATLA 3AFGA 3LH5A 4ZREA 4MHOA 1PEAA 3AH8A 1ZN9A 4P92A 3O82A 5TEWA 1SYTA 1Y3AA 1UJQA 4KH0A 1C0PA 2P91A 5E5CA 4GBED 1DRVA 4GHRA 4HYWA 1H8HD 1W5NA 4PGFA 4MKFA 3W88A 1G5AA 1UXHA 3ILHA 3FAZA 3GBPA 4XFJA 5CVJA 5LIYX 3QBUA 7ENLA 5EJIA 5FADA 3AR4A 1PWLA 3FS2A 5HQLA 3I7SA 1LPNA 4DR5B 1C80A 2Y88A 2CT8A 4PO1A 3FDIA 5CEEA 2JFYA 5EA2A 3CASA 4JYFA 2P0OA 1JU3A 3RKSA 4LRYA 1OG6A 1Z29A 3LBMA 2O4CA 3W9BA 3RG8A 4RA6B 3PWIA 3RR2A 5EHXA 1C8VB 4B31A 5KWIA 4QUJA 1MNSA 1CR0A 1MSSA 4AP5A 2LTAA 1MX9A 1QI3A 1HR0B 4JA0A 1ZLXA 2FR8A 5CGQB 3SKVA 3OCZA 4JTIA 4R98A 5CIWA 2C6QA 2G96A 4IQLA 5GADl 3EKLA 2ZT8A 2PGLA 5L6UA 2YB4A 1ME8A 4NK5A 1TQ6A 3GMSA 1T10A 2BZGA 3H4VA 3QU2A 3N8NA 2GD6A 3G1FA 1E1CA 3TQ0A 1UIMA 4CVWA 5J2UF 4NVRA 1L4BA 1TOAA 1QQ6A 4KXUA 3ABSA 3TNLA 4FXSA 3F5MA 4C1KA 2VX6A 4E3TA 3G8BA 4OREX 3GH5A 3A4XA 1SBTA 3LHIA 1HKHA 3QUSA 1JKXA 4N3BA 2E9LA 3ZR6A 3LVQE 2JIWA 1NZFA 5FTWA 4LJ9A 1VC4A 3DVAA 5C7VA 4W9MC 4PU0A 3GR4A 4J2TA 3QPUA 2QQ5A 2RGCA 4DARA 4TQGA 1EQPA 4WDXA 3NPAA 3C7TA 3KWSA 3VDGA 2ZA3A 3W2NA 3GFFA 1A4UA 1ZD2P 3QMTA 2JKZA 4B3BA 3FCSB 1XI2A 2PGWA 4JZ5A 2J3KA 1K1EA 5JFOA 1JDCA 1P80A 5HKLA 4H6QA 1SO5A 3EOBI 1JXQA 4IZ6A 3HM7A 3R0XA 4D8WA 3BCJA 1HL8A 3QRHA 5I6DA 1FQ0A 4BXOB 4GRDA 1GVEA 5TQ2A 2VJYA 1TPDA 2Y9MB 2ONYA 4XAZA 4K8RB 3MQ4A 4N76A 3U4HA 2IXBA 3LRTA 1CGVA 3PQDA 4YAKA 3VFCA 1XEFA 3CUKA 3C16C 1DX9A 2X19A 1TX2A 2C98A 2WD7A 5JSKA 5KYNA 1FWBC 3GUVA 3O2JA 1V0NA 4TL7A 2NADA 4ZGWA 3D3FA 3E49A 5AI0A 2ZBEA 4TTTS 1TFVA 4XFDA 4IPTA 5FORA 3CQIA 3LMYA 1ZBKA 3NKVA 5GJWC 2VHVA 3EVAA 3LUFA 3VPGA 1SVSA 4FX8A 3G77A 4ZB5A 2O8CA 3LT0A 2XVKA 3WDQA 4I36A 1DRJA 2ODPA 4GDFA 4A7PA 1VQ1A 2ZX7A 1PVNA 3FZNA 4IJWA 5AHMA 2ADMA 3ESCA 4J0FA 2P8SA 3PNBA 4ECLA 1MB0A 1BGGA 4D6PA 4TTQA 2PQ0A 4B92A 3KJHA 2VNKA 3Q3CA 1SA0A 3TW0A 5EJ5A 4CQMB 3RADC 1ZHFA 2A8YA 3WVNA 3IMFA 3O95A 4NYJQ 1H69A 4G9EA 2J74A 5LP1A 1MQ9A 3K8KA 1EBUA 1TJ1A 2G06A 2HJHA 3DLCA 4IGFA 4JH0A 1KMHA 4C4OA 2JW5A 4DBZA 1QSGA 2Z1DA 1GAXA 1PL8A 1FXWA 4HMOA 4J1OA 3FA4A 3CNBA 2GVEA 4RVCA 5IU6A 2Z2XA 3RCYA 1ZVJA 4S1PA 2BM0A 4U2EA 2BOFX 1X7ZA 5C8DA 4KDRA 4O33A 4ZZ1A 2GSEA 4MJXA 1NI4A 1H63A 4QQ3A 2CW6A 1QH9A 3V4RA 1J7JA 3BSSA 4GG1A 3SQOA 5K0EA 3WF0A 1BKHA 4NJHA 4TVCA 4FFPA 2VENA 3CX3A 3RK4A 4EBFA 4D82A 4F2GA 1R4ZA 3KX2A 3EA5A 1NLFA 3D8NA 3FYSA 4F0SA 2W6CX 3MMDA 3EWWA 3LECA 3P9IA 1C8XA 1H62A 1U65A 2JF0A 3KEMA 4DSUA 1ZOLA 2ODOA 3JRXA 3EPNA 2QTVB 3OCWA 2V4MA 2XNDA 3OT1A 1OPRA 4TMXA 2W42A 2WV8A 1VPXA 3ZE9A 4GVIA 3PVFA 1N8IA 3QFHA 1C91A 3SS8A 2FJUB 4Q6BA 1KM6A 2Y0BA 3UAZA 4F9EA 1ECLA 5LKYA 2UAGA 5B6PA 2IPLA 2ZUEA 1B76A 4PCPA 2ZT6A 1PCKA 3BK1A 1MN6A 1JWLA 5BR8B 3UCQA 2FEPA 5AR1A 2C0PA 1LROA 4K1XA 3WLAA 1YR2A 3C5EA 3ORFA 1ZH2A 4LHWA 2QPTA 5JXGA 3WNNA 3E7DA 5BQXA 5M5DA 3SG0A 4H7ZA 1LPOA 1P7TB 1RR2A 3COTA 3X1DA 1CETA 3A2MA 3TSAA 1JZQA 3UZZA 2GFTA 3EIUA 4NAHA 1Q6CA 2FPWA 3QUTA 1PV8A 4AYSA 2R5FA 4M36A 2EFCB 3ACBA 5I8ZA 1JJVA 3RS7A 2QUJA 4ND7A 1RLDA 1E5LA 4U2KA 3PUEA 4MCHA 2XTMA 1DRWA 2FZ5A 3HRHA 4U7WA 3S3TA 3BJTA 3HURA 3TFWA 3NVTA 2Y0EA 1CW2A 3QFEA 1EDOA 2HSDA 3L7NA 2ZEJA 1B15A 5JD4A 4CL2A 4L50A 4IXHA 2WSSD 5KZMA 2A6PA 1G7UA 4HNVA 2OYRA 4DMCA 4MUMA 3P3BA 3CE9A 3W06A 5DGXA 4F66A 1VKNA 3H8JA 3LQRA 4IHCA 2B92A 4W5WA 5JYDA 3AJ8A 1QHYA 1HE3A 3V7PA 1NW9B 3TD2A 3MRVA 3QWFA 2RHJA 4NZ9A 1B54A 3A70A 3O73A 4CT4B 3RYSA 2QWXA 1JFXA 1OD6A 4BI6A 3K2EA 1PEKE 1BE0A 2WZBA 2QVCA 4F04A 1VFFA 3RGGA 8OHMA 3BXWA 3GLCA 1VKRA 4F8EA 1AL8A 1L4LA 2F2TA 4JIHA 3IT2A 4JYPA 3AV3A 1RVGA 4CQDA 3WGNA 1NJJA 1KFKA 4FYVA 2B8NA 2FEKA 8XIMA 2BGKA 4GH3A 3INTA 4KO3S 1JHZA 1VHDA 1NMYA 3L7YA 4MSSA 4IHJA 1KYIA 4ND5A 1BGAA 2VK1A 1EA9C 4RJLA 4DXKA 4RADA 1CNMA 2ZTUA 1Z2AA 2ZJBA 1J2BA 5BSTA 2D69A 2RHWA 4D4KA 1Z3NA 4INAA 1ZIPA 3OJOA 3WLMA 2WAGA 4AMUA 4KEUA 2ZSAA 3ABXA 2FWRA 2WPNA 4JHMA 1PX0A 1VSQA 2WWRA 2UVPB 4DLZA 3H1PA 1K0UA 3F5DA 5IG2A 4Y7DA 5HIIA 5BOFA 2ZYFA 1G8JA 4K9LA 3LJKA 2LCQA 1V2GA 2FZDA 3WB9A 3DPUA 1RY0A 2HF2A 2FWJA 2AC7A 1UOOA 2W2KB 5B7GA 2A5FA 4CMKA 5FSEC 4H1ZA 5C8XA 2VCYA 2B81A 1UPPA 2JC3A 4BZPA 3ARXA 4S1TA 1GQOA 5AIAA 4K6OA 4U10A 3G02A 1FRBA 3FG9A 2JFUA 1Y8AA 3HI6A 1VI2A 1E89A 3C7CB 4NZ1A 3L6OO 3LWDA 1NVXQ 4ORIA 5BWAA 1LM1A 1VBJA 3FOCA 3RQSA 5HNRA 1IOLA 2GDZA 1XZDA 3EGIA 3S7ZA 5E8JA 1LUCB 2AFHB 1J22A 4OQYA 1EJ2A 4IXDA 3VDNB 2R751 1NY1A 1E59A 4L5JA 3MHTA 3QK7A 4QG8A 4ZCMA 4Q4HA 2M6SA 3NHJA 3KQWA 2EQAA 3JQPA 4ENWA 4UUMA 3ZU2A 4HRVA 5J8LA 1OYWA 3GROA 1IHPA 3UA3A 4LDQA 3I05A 2QYHA 4IWWA 2PPGA 1VE1A 2GMWA 4F9FA 3ROXA 3ESZA 1DP4A 5DXYA 4QGAA 2IEZA 1BYUA 3W75A 3OQBA 1BWSA 1JZ3A 2EWMA 1XINA 5TXGA 2ZQ5A 3MNFA 1ZESA 2QMZA 3UJFA 2QTRA 4JTSA 5IDVA 5ALVA 5I4CA 2QRHA 4W6ZA 3ZV6A 3ZTWA 2UY5A 1Y80A 5YASA 1YZKA 4Z0PA 3ZY2A 3K20A 4U2FA 3HO1A 5EY5B 1MABA 1XC6A 3NHMA 1Q6OA 3GY0A 5J4HA 1FDYA 4GQIA 2W62A 1XTKA 1MAWA 5EP3A 3ESDA 4XQ0A 1L7BA 1KPHA 4L9RA 3PGKA 3CPHA 4R5MA 3S5JA 2AOXA 4J0DA 1JTEA 4B0OA 4LF4B 1UG6A 5IHRA 1UMCA 4IIBA 2F55A 5K0JA 4R0VA 4M6UA 4ZGYA 4L6CA 3WNLA 3KXPA 1N6OA 1DEAA 3VKAA 4BO2A 2F1IA 2LNDA 3QQWA 3BTNA 3SF8B 2CF6A 3PBMA 3DEJA 1V5XA 1Q7RA 1G3RA 1CDGA 3IQWA 3QOWA 2BEKA 2B1QA 3C8UA 4AY6A 2E4ZA 3LRPA 1O5IA 4MUIA 3CB8A 5SZIA 4KB5A 2A3CA 1G42A 3NURA 1ISVA 4QVIA 2OX1A 4P31A 2XIMA 3AJXA 2QUHA 1AA1B 3OZEA 3QELA 4NNBA 1WSAA 5KX5A 2PODA 3ANVA 3QUAA 3GLGE 4HTAA 4XWOA 1FYXA 1GARA 1AKYA 3F4KA 4Q03A 3VX4A 4M0XA 3TJ4A 4W7UA 2C4MA 3HZ3A 2QYOA 2E5CA 2AEFA 3JVAA 1PS8A 1QYVA 2ZS7A 3KS6A 4M6QA 4NH4A 3WGLA 2HSGA 3ECQA 2Q45A 3U81A 1MRQA 3QKTA 2WD8A 5BVGA 1WDWB 1OZAA 4Q4OA 3ZSTA 1M67A 3DCIA 3RIHA 2VEIA 3W71A 5JCOA 1BEUB 1XEXB 3WA6A 3VNLA 4E5TA 1LRQA 2XJ4A 4L0DA 2D00A 3VZSA 3RBXA 4X20B 4U8HA 1GGOA 5BMVA 1MX5A 4GUHA 1O6IA 1C30A 3CNLA 3I04A 1EZ1A 3T3GA 1GZGA 1VLIA 4XPIB 3LQKA 3ROGA 3UVIA 3CUXA 3OY2A 5ERXA 4DWSC 4OU1A 4QTZA 4Z2GA 3W8NA 2O0LA 4XB6B 1CJMA 1DT5A 1ZONA 4U33A 4I90A 2A33A 1TIPA 1JLKA 2OCLA 1ALDA 4TKVB 3ZW9A 4LYYA 1HJWA 3Q67A 3DE5X 1VI6A 3A4JA 3B1YA 3MW7A 1WBJB 5GOTA 3DI0A 3A3NA 2DQZA 3G59A 3K5IA 2QCDB 4YNBA 3HB4X 1TA9A 1BPLB 1TPWA 3QKSA 2YRWA 2WWVD 4G7FA 1BCSB 1GHSA 3GDTA 3SZGA 1ZP6A 1ZH0A 1E63A 1OJ7A 3ZJTA 1JQDA 1DPMA 1W9MA 4Q9IA 4EGAA 5TGTA 1YRQA 3AY6A 2ZXQA 4KBYA 1SPQA 3NNNA 4PTNA 2P3QA 4QAQA 1J99A 4N7RA 3PXEA 2PHZA 2PTYA 3HP1A 3BN3A 5KTKA 3ZO9A 3HY4A 3KL3A 4MB0A 4NMHA 2EPKX 1T26A 4B3JA 3G2PA 1MH9A 2P1DA 5IT0A 4X0EA 4HAOA 3HPQA 4GNJA 3AG5A 2YV2A 2X2PA 3UF9A 1NTRA 3CYFA 2EKLA 4V2UA 3P2EA 1OMOA 2VZOA 2G4CA 2YBUA 3PJXA 1W9HA 2UKDA 2A9KA 4Z8XA 4A23A 3D8UA 1SO8A 3O2QB 4HMNA 3PV0A 4HMEA 3I9NA 4NP6A 2WCAA 1QANA 2JBAA 3LM8A 4JDYA 1Q6FA 1QV6A 3S9IA 4PEEA 1RBQA 4Z0JA 1BCRA 2YWGA 1GOKA 3JQ6A 3N0RA 4G1MB 2JGNA 4Y2XA 2IEGA 1SOAA 3DR3A 3CWQA 4NARA 3NUGA 3DP9A 5U4XA 1QC5B 4QATA 3NG1A 2BGQA 1M83A 4DUGA 1V43A 3T7TA 4LAMA 1I2BA 2QJHA 2KBFA 2GHQA 5ADVA 5G53C 5HCIA 2R24A 3NBXX 5KKCA 2XUAA 2O2XA 3MGCA 4CM8B 1JDSA 3S8YA 4AH7A 4TMFA 3S4TA 2BKUA 2A3NA 3TYBA 1G41A 1STOA 3IJQA 3WIJA 4HFRA 4DWSD 2O5CA 4EG7A 3JR7A 2H59A 5AHKA 3PJDA 4KUEA 3TQOA 1Q6ZA 2W90A 4QE5A 4UAUA 3CWOX 4GVHA 4FNQA 1UDCA 4DW8A 3SIRA 1SZNA 3AR7A 3N86A 2W67A 2P50A 2XN0A 3HVUA 1UC4A 4EAMA 3KDOA 1LX6A 4HG2A 4L8FA 4R01A 3GFSA 3K3PA 3G5MA 4DYHA 1DJOA 1KPGA 2R1NA 2OUKA 4MFEA 3B8UA 1GM5A 1H7OA 1J42A 4F5ZA 1ZNZA 1JDJA 2NSJA 3CLWA 4RORA 4YHGA 3P5SA 1WB9A 1SC9A 2P9YA 4ETMA 4CF4A 3EGXA 2MINA 1C9YA 1V7CA 5JOQA 3KLPX 2OCGA 4NZFA 5AKXA 5DP2A 3MJYA 1VB3A 2C2MA 4Q1DA 5IAKA 4LNUA 3UWKA 4DBVO 4B3LA 3VOTA 3LXRA 5GQSA 4S3GA 4MMYB 5TNVA 2IYPA 3IOBA 2P2YA 1C50A 5I09A 4KAFA 5JUVA 3QG5A 3HY6A 1OAOA 5IS2A 1V4VA 3E22A 3HJEA 4R16A 3T4CA 5DTJA 3MDUA 3PNVA 4FSXA 3LCFA 2A4MA 2C5EA 2AQIA 2J75A 1TW3A 1Q2UA 3SRFA 3THRA 3VHQA 2WSQA 4AG6A 4GF5A 2IYOA 2OXTA 3GFRA 3QMSA 3KWJA 3DE6X 2MDTA 5AI4A 1YCHA 5FWXA 3K8MA 4CM6A 1B6RA 4YAUA 1TCCA 2B8JA 2Z6JA 3H21A 5JNSA 1WQ4A 1M2KA 1R3VA 5F2LA 2XQVA 5HTOA 1BKDR 3OTGA 2XODA 2G3YA 4G7EA 1K86A 4J5NA 1H5NA 2IUTA 4PBSA 1NP0A 2EQ5A 3KVOA 1XU9A 2PRJA 1GGEA 4ZPXA 4NY2A 3C2QA 1UWVA 5B2ZA 1AQJA 4YRPA 4UTTC 4AW9A 3GXPA 1S4QA 1SHZA 4L22A 4D8ZA 1ZCJA 3HHEA 2GDJA 4R8RA 1DGQA 5A62A 5JYCA 4O4WA 4BLWA 4R1MA 4IGAA 1PU2A 4Z1OA 3RJZA 3KYDA 3VO2A 4UCWA 2ZRHA 3QR1A 4O4IA 1PR3A 4FGJA 3B8WA 3FJLA 1TUGA 1FA2A 4N5NA 2Z8XA 3EY4A 5KZEA 3S27A 5HSGA 4FHDA 4OBEA 3LGEA 1F0YA 2DBQA 4ZD6A 3EDYA 1NWTA 4DCUA 2R1PA 3RCMA 1GOQA 1MW1A 4IQ4A 2I8CA 1Z4JA 1GUYA 5PTDA 4FGUA 1RP7A 5DELA 3R0QA 1N0VC 1PWHA 3VOSA 1LSJA 4ON9A 1LS1A 1PNRA 4GWKA 1V4NA 3QFFA 4R7WA 4I4TB 3EWUA 1P5HA 4UBLA 5BXRA 2ZVJA 1O0CA 2XKKA 3TTYA 3HXLA 4HV4A 4EB6B 2MIIA 3INPA 3X1YA 1U8XX 3FMOB 4EX4A 4UE3S 5EXTA 4FCCA 4FGKA 5TS3A 5REQB 1N7HA 2FEXA 4S04A 4PC3A 1BYCA 2X4GA 3AV0B 3A47A 4IMFA 2O2GA 2D2OA 4JIEA 3BH4A 1N6KA 4MNMA 3EPOA 3WMEA 4UB9A 3M07A 3DMTC 2BEWA 4FA3A 1P6XA 1R2TA 4P4LA 3NNTA 1S3FA 1JR2A 1FE8A 3DFQA 2PSHA 2ZOSA 4KV7A 3TP4A 3BXPA 3O9VA 2Q6IA 1KKMA 3PQFA 2GRUA 2LIVA 3ZZMA 2I7TA 1J1UA 4D6JA 4YP6A 1NQOA 1QK2A 4DVOA 5C2CA 1FH9A 1IQRA 4P7RA 1EDEA 3NJ8A 4I7VA 5L6LB 1P31A 2QW1A 2WQ6A 4ZFMA 9ABPA 2J6XA 1YBHA 3QR3A 4PX3A 1UOEA 3SEQA 5BVHB 1OIVA 2O0JA 1GTG1 3U7JA 2WVAA 3AX6A 2ZSDA 4FKMA 1OVDA 4E4UA 4QUEA 4TWAA 5LQAA 2BKAA 4WLEA 3T5DA 1M65A 1EU1A 3S42A 4NU0A 2QJFA 3QVXA 1S5TA 1DQXA 3GIQA 2OPHA 2IXDA 4D80A 5CB6A 1MRSA 3CLSC 3ZQ9A 2AL7A 4XDHA 2Y2UA 2OZKA 4N1AA 3EVZA 2J79A 2NTVA 4QNWA 3W2GA 2GPSA 3C85A 1TQHA 1WX0A 5LMUB 4WUIA 4V39A 4LYQA 3GGJA 1UMBA 1H5VA 4C0QC 3G0UA 4M56A 3D2BA 5J2TB 3PUOA 1NMXA 4ZJZA 1CVRA 3M44A 4ARSA 3HO6A 3GQBB 5K4XA 1BHO1 3B3QA 3CS2A 4V1CI 4QCEA 2LE0A 4GMXA 4J7UA 1Q8AA 1E1KA 2WLSA 5EE9A 4B4VA 1XLIA 2J7HA 2VC6A 3OTIA 2JCBA 1K0FA 2GCOB 4EK7A 4X9SA 3HSYA 2DFPA 1XRFA 1MD9A 4ZXPA 2ZB3A 4TX9A 3LBFA 1WPCA 3PLRA 2O3TA 1E72M 1ULBA 3VM7A 1XH0A 5LVAA 1OSEA 3GAKA 1NUQA 3W5DA 4I55F 1E5VA 2Y5JA 1XZPA 4JKYA 1IU9A 4LF2A 4OQEA 4JEUA 4WZBA 4LX4A 3TUUA 2X30A 3GFTA 3KRSA 2WMKA 4MI1A 2PE4A 2QN8A 4IFRA 4JVSB 1SBHA 4LKOA 3DCNA 5JNWA 1YIXA 1ZH6A 2JVJA 1V51A 1ZP4A 3T08A 3F73A 5T4HA 3V1MA 3NTXA 1LK5A 3GEBA 1K9DA 3C41J 3BLOA 2ZRGA 3H1FA 4J1QA 4D97A 1L5GB 3NPVA 1QTRA 4P93A 4AF0A 3P32A 4G1EB 1WF3A 2FG7C 1XTPA 1V6XA 1FCJA 4IQGA 3TL6A 4BEWA 3BW4A 3DMHA 3PB3A 1ZUWA 4HA0A 3G68A 3NAVA 4JTDA 4GKLA 1KJZA 3VH4A 3IGHX 3EZXA 1KZ4A 2D06A 2DQWA 1TVMA 2UZ3A 2X2FA 2E4AA 3FEMA 1Z07A 3F8SA 3UY7A 3SCVA 4LV5B 3HJCA 3RSZA 3HKCB 3OLVA 3CEPB 1W1A1 2BEUB 3G0OA 2YN2A 4WK2B 4YP0A 5C1IA 2CCJA 1JFFA 3KZCA 1OCBA 5KVCA 2OCBA 3CEUA 4LYGA 3WH5A 4NYIQ 3W4JA 4BO4A 2R6AA 5EGSA 4BO9A 2K2QB 2YKKA 4NYMR 3TLGA 1R8LA 4J27A 3Q3HA 3DCYA 4CIDA 4IKOA 5CB4A 3IDOA 2FP4A 3QJGA 3V33A 3CLSD 2ZTHA 2GGIA 1BH2A 4AX4A 1VMKA 4IXMA 4BZWA 3BD6A 3THSA 3DCPA 5ALKA 1X1RA 3EVCA 2PKEA 3AB8A 4M0DA 2QCLA 1REQA 4YCBA 1PE0A 1C1DB 2DFLA 1MPTA 3OEHD 4AQYB 3KHTA 4OE7A 1CEQA 4B84A 3NWRA 1KHHA 2RHCA 3PD0A 4PGHA 3DDSA 4MB2A 1RVKA 4MNKA 1AV6A 3MMSA 4Y98A 3JXEA 3OM0A 1R7RA 3IPCA 4WJ8A 4JI6B 4Y8FA 4MRNA 1SCAA 4FSHA 5HA5A 2NTNA 4KQXA 2ZVRA 1GKQA 4I55B 2MYNA 4OXQA 4XD4A 2WVVA 4BP9A 2BXZA 1NN0A 4N01A 3SC2A 3IA7A 2NQLA 1L6GA 1K6EA 4QP0A 5KWSA 1J0ZA 2K4MA 5EKDA 3W73A 4GW3A 3F4NA 4RM3A 4TGLA 1XYAA 3K9LA 5TAOA 4UHHA 4UVHA 2CSUA 2X16A 4JP8A 2VPQA 3F5SA 3QKIA 4L4RA 4XVCA 1I2PA 4Z0NA 4E4RA 2W5FA 2PRYA 1D6NA 3J80A 4TMCA 2VHCA 2VHUA 4EO7A 5K9DA 3VOIA 1WHTB 3LA4A 3PC6A 1C9NA 3R0ZA 1UWTA 2X4LA 2M6RA 3F1LA 3QVMA 1HO4A 1GZSA 4A8JB 2FNAA 4YAWA 1V5WA 1Y63A 4POAA 2WMNB 3RUBL 3WYZA 4M76B 2POTA 1QH1A 3S70A 4C4PA 4JNYA 4RKWA 3RH0A 3TNYA 3KEQA 2NZYA 3L8FA 4Q1AA 3DG3A 3R1ZA 3NOYA 2O7QA 1GFWA 3LA8A 2ZFUA 4C7BA 3FNRA 4C87A 2PWUA 3TN3A 2QRPA 2E9MA 1TCUA 3CHCA 5HUHA 3QX8A 5EPEA 2C16A 1AUSL 1E2QA 1FFCA 3GR7A 4WK6A 4U9IS 2N47A 4DF2A 1IWBB 2ZX5A 2D5IA 3V16A 2Z43A 2ZRDA 2VGGA 2OPJA 4ALMA 3OTQA 2CKSA 4W5UA 1L5YA 2GFIA 3TR9A 4CL0A 3NORA 3ABOB 3JATA 1P60A 5KMGB 4LOLA 3SDOA 1FMFA 3EXG1 2XE7A 3DWGA 5FOOA 5CZ0A 4DO6A 4NEHB 3T5GA 2W58A 2WUGA 1ZBVA 1EEPA 4CIWA 3QYQA 3L5AA 2RD2A 4RKAA 3ZR4A 3AF0A 3N2TA 2RGXA 5MFPA 5A3JA 1JQVA 3TPZA 3EDJA 3NM3A 4KXYA 2BDQA 1LNQA 1XAIA 4OGKA 3NB0A 4O1DA 4UMVA 5JY6A 3C98A 4TYNA 2PH7A 4KIEA 1A5CA 4RZXA 4X64B 2OG1A 5BQ5A 4DQUA 4P8VA 3P8ZA 1K4MA 3NRBA 2P6PA 1EQAA 1BH6A 4YLEA 2XVNA 2W6JA 3VU0A 3FNBA 4MWAA 4EB8A 1XL0A 4KNWA 5D2WA 4AJ4A 2WTAA 2ERXA 1YDMA 3T12A 4C7OA 1GQQA 1P3Y1 3I2YX 2FVLA 2BAGA 3M4ZA 1RPJA 5JAOA 2VSYA 1E71M 1MX1A 3ZLVA 1DJMA 4NUWA 4ZARA 1GRCA 1FTSA 3LUAA 4LS3A 3HN3A 4GMHA 1X38A 2NXJA 3AYRA 3D5TA 1O03A 3IE1A 4IIFA 2VEMA 4I8YA 2OLEA 4NCBA 3RFAA 2NMVA 3B9PA 1SR9A 4Y1EA 1CU1A 4JT8A 4EI7A 5IFLA 5FOQA 4DY1A 4D3ZA 2YXDA 5C18A 5K6RA 1UT5A 1CCWB 3LPGA 1KO1A 2CE7A 2Q41A 4RA9B 1TTPA 1JI1A 1U9YA 3TQRA 5LZ4A 2JJ1D 1CWUA 4PINA 3RBZA 2WYOA 2C0QA 1DXHA 2ODNA 4F71A 5D2CA 2Y2WA 1XHGA 3C74A 4N9BA 2OYKA 4BQQA 4IFOA 4XLTA 1DRUA 2V81A 1GAWA 4B7ZA 1J2WA 1HT6A 3I42A 5AOAA 1ENZA 2D3TA 1YJBA 2TMKA 1XMIA 4QWMA 1URPA 5CAKA 2VS1A 3V00A 2XQFA 1K8XB 1KMCA 2WYVA 5AVKA 3MYPA 5JI3E 3NC0C 1OD8A 4WZ6A 3THYA 1XFBA 1WLSA 2HLDD 4E5NA 5AUNB 3GJRA 1MGOA 4BP1A 4OJYA 3NHSA 3LLXA 1VZWA 4JC5A 4ETWA 3HRIA 4QUAA 2GN2A 3PK0A 4FDTA 3RK8A 3AIKA 1IBSA 4OO3A 3AXHA 3SRDA 3LCMA 4RD2A 1C90A 3V7NA 4AJLA 1NVMA 4PMZA 1E6LA 2FGKA 3G6MA 1CUBA 4KXNA 4PBEA 1EDZA 4Q3BA 1LCIA 4EF5A 3GC6A 1F8IA 2ID8A 1TV4A 1PYMA 3HYCA 4TV8F 1QHSA 3RTGA 3AQIA 5JBFA 4S1VA 3MV11 2ZJ3A 3DBHA 4XYBA 3JPYA 1EHNA 2R6CA 1I4OA 1JRLA 1I6MA 1T6BY 2DSWA 2WMIA 3T7VA 3JQRA 2BCEA 2VSOA 5KTOA 1DEOA 1KI1A 3UZJA 4YDSA 5L3SB 4AURA 1GDHA 3PA6A 3HXKA 2ZXUA 3DXXA 3CPUA 3BDAA 2B5VA 3DYOA 5K3AA 1JYFA 2GPWA 3AALA 2VT3A 3IAQA 1NMSA 3LMKA 1OOEA 1U5VA 3FDFA 3NJRA 4XOIA 1XSIA 1L2UA 3PHLA 1KFEB 1FC0A 3DOOA 2G88A 3IUNA 2REQA 2VPYA 5FEXA 3H2NA 5D84A 1NFPA 3B06A 2JATA 4DAIA 3GLUA 4ZI5A 4NENB 1XCJA 3FCAA 3FYPA 4RBNA 2ZXFA 1R2QA 2PDNA 2EJVA 3ZWCA 5BOEA 1VRCA 3PUZA 2W6NA 3NU1A 4M6WA 1ACMA 1A8SA 1TJ3A 3CJTA 1D2EA 3H7VA 4MUFA 2HHAA 1ABEA 3OJEA 1HE1C 5AJXA 5AFDA 2EBNA 1JJIA 4CMCA 2AJDA 3URMA 3ZU4A 2B6NA 3T07A 4RH1A 2PD4A 3LD5A 2AN5A 3RYIB 1UWUA 1NYRA 1SJCA 3AVOA 4XO7A 1FS5A 3RTBA 4KIJA 2W8BA 1Z8FA 1KFJB 3FUCA 4Y0AA 4B3MB 3GDFA 4QBTA 4NDAA 3V7YA 4DA7A 4KAJA 1IXPA 1POKA 3I9MA 4MS3A 1M34B 3JQ9C 3DV2A 1C8YA 5EJGA 1QHOA 4JIMA 2B1GA 2ZXEA 4KMOA 3LZ6A 3TL2A 2AXEA 4MR9B 3TUIC 3RRYA 1A8QA 4GO8A 1S46A 4OUDB 2VVSA 3K5WA 2F6XA 2DVUA 2MUCA 4ZDIA 4PL1A 3IEMA 1EGQA 3Q3GE 5GJCA 1E6WA 5F52A 1E3WB 2JLZA 4TV8B 1EVKA 3ZYCA 1XISA 4CKCB 3ZZNA 2X8RA 5F1OA 1JALA 4GSLA 1QIEA 1LJ8A 2OQLA 4X0NA 1BDBA 1ZICA 4Q3LA 1YVDA 1SVKA 4XO6A 1AMYA 1MU0A 3MCVA 2BGTA 3D6UA 4PRRA 2ZIGA 3U44B 3W2MA 5A3SA 4WDRA 4M0EA 3ONBA 2AG6A 3P0WA 3AONB 1N3LA 2A59A 1B3WA 2DULA 1KO5A 2QZZA 5DSTA 4ZE4A 3P0XA 2XE4A 1Q19A 2G41A 1H23A 3EPMA 3ZDCA 1SOUA 5E9WA 5LZ9A 2C04A 4BX8A 3NIDB 4IHKA 3EIXA 1RYNA 3WO0A 3AS3A 3AHDA 3T1VA 3AB3A 1VBHA 1IXZA 1NUAA 1X13A 4HGOA 2OZ8A 1H42A 1OGBA 1YIOA 1FYFA 4MWGA 3O92A 2VWHA 3TLMA 3TW8A 2ISWA 5KTYA 2GH1A 5HW0A 2OV6A 5ABTA 1I9GA 3UG8A 5CB0A 3RAPR 2ZBRA 5DRYA 5CZKA 3LA6A 1GQNA 1RYDA 4YL2A 5C9ZA 3R3JA 4F4DA 3W02A 3E23A 3ZX4A 1YUNA 4M1BA 2YFYA 5UKDA 2V5AA 2CXOA 3OQOA 1OWQA 3QUBA 2Z5LA 5LDDC 4XSMA 1NZDA 1J0DA 4DMKA 2NLOA 2Z9DA 4OL9A 2ZJYA 1D2NA 2IPXA 2PYIA 3QHOA 2QN6A 3MCOA 4JKIA 3AKCA 1EFAA 4BNGA 4UEKA 3OA5A 4AL4A 4QYIB 2DT1A 2R1ZA 3AUKA 2MWMA 2X0IA 2OZEA 1NIPA 2FP3A 1YU6A 2EO7A 2CFOA 1AFSA 5JZVA 2EL7A 3B40A 2J3QA 4EJFA 5I9TA 1EVZA 1AA9A 4MA5A 2V6MA 1WUKS 3QW3A 3GXIA 5DBTA 4BMZA 3NOVA 5KOHB 3T09A 4OI4A 4QOFA 1QRSA 2TSYB 3V0TA 5KWVA 4NPHA 3DEQA 2I56A 1NMZA 5CFRA 4KPUA 4AISA 4JJEA 2P67A 4JN6A 4TRRA 3ZZTA 1RQPA 2DJXA 3AL2A 3C2VA 3S1VA 4UUQA 3WGZA 3HB7A 4FNRA 2XADA 3YPIA 4L5IA 1WU8A 2PBGA 5SYMA 4JY9A 3NXFA 3FK4A 4NQZA 1A96A 3VU9B 2WW8A 2IOFK 1F17A 3TIIA 3BWXA 3RTAA 2I2BA 4UWMA 4N12A 3N2CA 5HXAA 3WLTA 2HQSA 4OHUA 2VKQA 1ZW6A 3RTCA 4LE1A 3ZQUA 4H2HA 3IPRA 4XOUA 1P1CA 1L9WA 5J4VA 4C0AC 3K0FA 2O2SA 3C8NA 1A3CA 3DDWA 4UCFA 1RUSA 1ZUAX 2HPAA 3P0EA 3GT0A 2WOOA 4ZCIA 2QNEA 4RTKA 4WCDA 1LBFA 3UU0A 3W6UA 3EARA 2QIOA 1LD3A 3E6EA 4OH1A 3G79A 3KKMA 5BN4B 3VHLB 3A7DA 3WD4A 4K86A 2BV3A 2HC9A 1UH3A 2QUZA 1OK6A 3NL5A 3N2ZB 2IBMA 4WOKA 4KCWA 1R6AA 1UR9A 4C08A 1L0BA 3FHJA 2Z4GA 2Y6VA 2GEFA 3VOJA 3DW1X 3JARB 2C7BA 2V74B 3D2LA 3L41A 3I9V1 3V3TA 1BW9B 3TTSA 1ZVQA 5L3QB 3FUXA 1CUGA 3N2KB 3X1XA 1BVZA 3L79A 1C7EA 3NHYA 1OC4A 1T36A 4MRVA 3L7AA 1IN5A 4L07A 1WEHA 2Q3OA 3CGWA 3U5UA 3K6RA 2D0IA 1YR6A 3PBYA 1P7YA 4JU9A 5EMUA 1OI3A 4DN6A 3WK9A 5FESA 2JDIA 1Z41A 4HYTA 1XHLA 1XYFA 2XIIA 1VMEA 4PYJA 5LGZA 4QHTA 3VKGA 1T2FA 2QTLA 1XTZA 3TCNA 2QSZA 5LYJF 1UINA 4OP2A 5T4EA 4ECAA 3M1LA 3ONWA 1TWDA 3O3MB 4BYMA 5LU8A 3DZIA 1ADCA 3RS8A 3VXGA 5CA1B 1O7JA 1AGRA 4YPJA 4EO4A 3FFBA 3BCUA 4JFUA 4WLFA 3KBWA 3GEMA 3FNGA 1JVNA 3G6LA 1XDLA 3W7CA 3EVFA 3FGOA 3C52A 4PQFA 2XITA 4HQVA 3NG3A 3I4LA 1XROA 1XH2A 2IS7A 4FD3A 5ALLA 3D0OA 4LYHA 3UR8A 5IKPA 1Z82A 5JC8A 2INEA 1EF2A 2A0NA 1EFHA 2WC3A 3E05A 3GP8A 4OFCA 4HH1A 5CMLA 3C5WP 3ITYA 3F2VA 1M75A 3SBXA 3G0BA 2FN7A 4ENTA 3NC1C 2WW5A 4CFZA 4UZUA 1ZAYA 1D3HA 2V8ZA 2XF8A 3ODPA 4OKNA 4IDBA 1N2ZA 1K6WA 1Z6PA 3DHUA 3T7RA 3H5AA 1NN1A 3JSAA 1I2DA 1G69A 3PM6A 1SKUA 2XNHA 3A9IA 4JU8A 3LMZA 1EA5A 3NLLA 1VYUA 4EJ6A 3NHZA 1OWOA 1KDVA 3DHYA 1II0A 1FDRA 1DOAA 2YHIB 3DEIA 4MIOA 4LDNA 1L5LA 3JSXA 2H0QA 2ZSHA 5G0WA 1G20A 4X0VA 2PXHA 3S1UA 3ZXSA 1T1GA 4JAWA 2C7GA 2CHUA 3L4BA 2PZBA 3EX4A 4WOZA 5DTRA 1U8ZA 4JT4A 2XUQA 2PN1A 6CGTA 4U3JB 4W7WA 1F3OA 3HV0A 3ZDYB 2PT7A 1A9RA 2GZ3A 2WU0A 2EKQA 3VU3A 4KIRA 2XTJA 3EAGA 1PX2A 5BSVA 4GP6A 3BFJA 3FMVA 2IV3A 2ZIXA 4EHNA 1THZA 4AB4A 1YR7A 4QUGA 5DSXA 3WQRA 4DBDA 2CXNA 1HNYA 4LUTA 1D09A 2NQHA 4H3VA 3LF1A 2VRNA 1XG4A 4AX7A 3TRKA 4TYMA 3M33A 5T67A 2D24A 3P26A 3GTFA 5LYJB 3FOBA 1X39A 3ELYA 5BSKA 4R4JA 3U17A 1WO2A 2A0XA 1FSSA 3CO0S 2XZTA 2O52A 1L5WA 4EIWA 1IYXA 1C4OA 1U0NA 2A3BA 4K39A 2ZB8A 5L7WA 2HDWA 3BERA 2NZXA 1QG4A 3TLXA 4PB5A 1U22A 4HS9A 7ADHA 3AMKA 5ENLA 3WHIA 2Y1DA 1E9EA 1RHUA 2DG2A 4JLJA 4CUZA 2PSFA 5A6SA 5CEFA 3LLSA 2O8EA 1PL9A 4K7YA 1LVGA 3A64A 4WOCA 1ZJ6A 5HMSA 4MDOA 3F6YA 4PZ9A 1UA3A 4IBOA 5AJTA 1NHGA 4V0OA 2WIBA 1VJ0A 3O3OB 1NTOA 4BWFB 3WGKA 4CTNA 1ZZEA 4HXFB 5AK5A 1E2KA 3DFHA 1GW9A 4MKIA 5H59A 2JHAA 1F4VA 5LB4A 1W0CA 4I1UA 2IBSA 5KI6A 1CTQA 2GF2A 5JDCC 5KNCA 5B3JC 1W581 1GRQA 4F38A 4NG4A 3FVRA 5ALZA 4MIYA 2CLHA 1H8EA 2I7CA 3SJNA 1KC3A 1RYZA 1YKGA 3BWVA 2AFVA 2V0CA 3IP5A 4ZVOA 4PMNA 2FYTA 1I6LA 3ZKWA 5BU9A 3ZNQA 2VP2A 1U80A 1VZ2A 3DBVO 2IHKA 4RNDB 2V6AA 4X84A 3GOQA 1RK5A 3CU2A 4OPMA 3G17A 4KCUA 1TYGA 2JCSA 1V96A 3H8AA 2PGOA 2X0KA 3CT4A 5IM5A 3STGA 3NL3A 4RTRA 4E4PA 1ZM4A 1DTNA 4ZMSA 3P9QA 1TCDA 1KMIY 2BR5A 1JXAA 4LCJA 2NAPA 2IPWA 1TUFA 5BRQA 2YDAA 4F4CA 3UW1A 5LZLA 3ORSA 5FPHA 2ZJ0A 2P9ZA 4MY1A 5GAJA 2NU8A 3RAFC 3S6OA 3KJIA 3HJFA 2AYXA 1LVHA 2ZKLA 4BRWA 5IDZA 2AKMA 4HT3A 4DBLC 4PBRA 2VUHB 1NG9A 3WX0A 3M9WA 1LK0A 4KQNA 3AKYA 3VC2A 2WTUA 3GVVA 3KAQA 1A5OC 1DINA 3L21A 1V0LA 4AG0A 3KW3A 5AHXA 2GYIA 3WLRA 2XA9A 5JS2A 4M6VA 3A6ZA 4HEJA 4JQ4A 3KDPA 4P33A 4Q3AA 3EA2A 1EP3B 3SN4A 4EANA 4DRXA 4V0SA 1P2SA 1ODZA 1QWOA 4O13A 3NDBB 4NV0A 3V0SA 4J8PA 5EGRA 3SLGA 3QFTA 1E4OA 1X1EA 2ZYSA 4B9ZA 2PGFA 4AUEA 2XN1A 3DSRA 2I9PA 5CW1A 4Q4JA 2P76A 4WJLA 1BOFA 3VSCA 3GBEA 2ZBPA 3VQTA 3EWDA 3XISA 2G50A 4F4FA 2E5DA 1W76A 4REQB 1W88B 2B36A 5HF5A 3NDYA 3CPSA 3KZMA 4HZMA 2IX9A 2I5GA 1QT1A 5LP6F 1XEWX 5LBTA 2OZLB 3ZXXA 5GGXA 1IT8A 1P48A 9CGTA 4Q8QA 2XH4A 1EM8A 2H3DA 2JHFA 5TE9A 3RFCA 1TJ5A 5IDWA 3NETA 2PPVA 4HXYA 1EUNA 4XWGA 3TQQA 3IUSA 1Q66A 1BQGA 3NZPA 1K9SA 1YULA 3P2OA 1XIEA 2PRHA 4HSHA 5DTMA 4B3RB 2NQ5A 4LS0A 5D8ZA 1RK6A 3LXBA 1ONXA 1HO3A 4LFYA 2ZW9A 4LNHA 4Z9YA 3TSMA 4E11A 2HS8A 1DHPA 2BTQA 2HEJA 3BH6A 1T35A 1W9XA 4LJKA 4DCPA 1EUZA 3JASA 3ST7A 3ROPA 4C0WA 4ZYWA 4BBJA 3CEAA 3P82A 3A9VA 1SRQA 3VH1A 4EY7A 2Z4TA 4K9RA 3C7AA 4IOTA 2ARKA 4NZJA 4BE9A 3AHFA 1NOIA 4UAGA 5ILGA 4R84A 4RE3A 4ZANA 5IVIA 2YJNA 3U37A 1U8FO 2HCJB 4MADA 2OXNA 2QW0X 4AJIA 3ZZ0A 4Q4AA 1M76A 2ZCVA 4AZ3A 1XLEA 4AY1A 3UATA 4B43A 1X1SA 2QS8A 5A2AA 3LY8A 2WIGA 4GBMA 1ZD5A 4YQFA 4GKAA 4GC5A 2AMFA 3AETB 3DFYA 4TWRA 1V3TA 1KMNA 1NW3A 2DZUA 4Y67A 3GR6A 4UZSA 3OE5A 4PPNA 4OBSA 3ZDXB 3HV2A 2VJQA 3CM0A 1P2UA 2ATMA 4HDKB 2PYZA 4QOSA 1CJTC 4PB4A 1Y4UA 4AUBA 4JV5B 4EP8C 4PSRA 3U16A 4IDNA 1BQCA 3COSA 4B6GA 1SG6A 1VSUA 2O9OA 2EBHX 6LDHA 3L7IA 4JL8A 4EHJA 3EC7A 2WXDM 1HORA 2V5CA 1D4OA 4NPAA 2C03A 5LP6B 5XINA 4EFMA 1W8IA 4MDPA 3PBWA 2WHPA 2PLAA 1N3BA 1XNQB 1UEIA 4RVFA 1Z33A 1XD1A 2UWFA 2ZIAA 3Q0TA 3WWPA 4D57A 2EJUA 2WMYA 1WOMA 3EEBA 3VAZA 2NX9A 3WYBA 1JYVA 4C21A 2V0NA 1NNLA 2CKRA 2RFLA 3FTEA 4YMTA 4R0NA 5P8WA 4KWIA 4A16A 1UL1X 5D5PA 1EHIA 1KV8A 1T91A 3NXLA 1D7AA 4KRFA 2G9QA 1AHHA 4J49A 1FP6A 1K8RA 3CKKA 4Q9JA 4OQMA 1W2WB 4KFRA 1XC4A 3W26A 2PH1A 5F2OA 5DTQA 4BFCA 5I8PA 4BWVA 2UY3A 3VABA 3RHGA 2WILA 4IMAA 4JOSA 2XPCA 1J8VA 3VA7A 1EYEA 3P8JA 3DEZA 4UASA 4TKUB 2GUUA 1NU8A 1P6QA 3HL4A 1NFQA 1EGZA 2EXOA 421PA 1RQXA 2C18A 2A3LA 2RI1A 2VRBA 4KFOA 1CZLA 3AUSA 5HQEA 3WQDA 5JVDA 1YS2X 3SWWA 1L7QA 3H7RA 1V0JA 4AICA 5D9MA 1FIUA 1KU6A 2IA5A 2Z9BA 1CKEA 3IKJA 4JBNA 1NW8A 5E1BA 4WZHA 4MOZA 4DUXA 3FYHA 3PGLA 3VD5A 4BHYA 1PL7A 2V7EA 3UYCA 2WM1A 4WY0B 3P0HA 1L5MA 3CRQA 4QFMA 3BULA 1ECJA 8MHTA 1CT9A 4EP1A 3MJRA 3WQBA 2PMDA 4MZXA 3NQCA 1OX6A 1G21E 1FF9A 3PDIB 3L4JA 2O6LA 1NF3A 2W93A 1AV7A 5ARCA 3ZWXA 3GGOA 2AN4A 3TXYA 1JRCA 2BDTA 3VXKA 4XQ6A 1J2EA 1KCXA 1LC3A 3VNJA 2EW8A 2I3AA 5J63A 3GNQA 2BY2A 2CNKA 3UMBA 2WWYA 4H8NA 3TR2A 4L27A 2FSVC 3V8NA 2ZG6A 3LUPA 3BF7A 4HUTA 4LE0A 4KPEC 4ZTZB 3O3RA 4MYRA 3K0BA 4CHGA 1MW8X 1WDTA 4C0BA 3I2FA 5A3QA 5CLFA 1F3LA 4OHXA 4DJTA 1ZFJA 2ZBTA 5LIPA 4P4TA 3VR4A 1MA3A 3C4QA 2CZFA 3HG2A 2A4AA 3IV6A 4D9GA 1QGDA 1H05A 5A6LA 5FF2A 1KEUA 3WLFA 1HQCA 5F2NA 3IVCA 2ZJ8A 2NVUA 5HRCA 2NV2B 2RHBA 3ZT6A 3HSKA 5TQ0A 2NXCA 3AUJA 4HX2A 4XQGA 3AEXA 3AEKB 4I19A 3N9RA 4BKQA 3HR7A 1ZQ1A 4I50F 1OGYA 3OZIA 1T5SA 2VDKB 3EXEB 3ICWA 4FLMA 1HSOA 2Q7XA 1F12A 4ZU6X 2H57A 2DIKA 4AKHA 5CDFA 2WSYA 1EFLA 4U4MA 4UNQA 4B5XA 8TIMA 1KI6B 4IMIB 4I6KA 1X3LA 2X6RA 3LQFA 1BN7A 4M87A 2CDAA 3OF3A 2BOVA 1J1IA 5KSYA 2V5UA 4HQOA 1F5NA 2VRCA 4RY0A 1XUOA 2CXHA 1A69A 2OCYC 4LFBB 4MZDA 1J06A 1T1IA 3U1VA 3SVLA 4PS1A 3PTMA 5KU1A 1XBXA 4H9UA 1VBUA 1MZVA 3V2GA 1JEAA 4MO2A 2TRSB 4F3TA 1BMFD 4X60A 4FT2A 5K3CA 1IMJA 4EGQA 2FMXA 1ECGA 3PXCX 1GPWB 4UDOA 3E1KA 4D6GA 3ZWQA 4UMDA 1W6UA 2YJGA 4BP8A 5TT0A 4G5FA 2FIQA 4Q9LA 5AYZA 1JZ5A 1GCOA 3TC6A 3G1HA 4AC9A 1V8BA 1PX3A 2QQFA 3WBFA 5F4SA 4Z4HA 3BPWA 2IIVA 3U5TA 3V7FA 1O5RA 1BU5A 4PTXA 4CN9A 3OOQA 1HNWB 4J94A 4DR1B 5ES4B 1BSIA 4Q15A 4OZOA 3ZJ4A 4YH1A 4A21A 3GWGA 1O96A 4C0JA 3TTQA 3G49A 1UUQA 1YL6A 3DMDA 4LRXA 2VWGA 5KDLA 4BEVA 1SXJC 4H3SA 4B8ZA 4E15A 1LEHA 2A5LA 4JYBA 4DBLE 3V1NA 2P2CA 5GY7A 5I3HA 2B25A 3T6KA 3U61B 4Z5XA 3UOGA 2FFAA 1S2WA 5F1VA 1J4AA 4F6CA 4I50B 1CY1A 3GUUA 5LNUA 2VCBA 1KOJA 2EF1A 2AZTA 1FMLA 4UUIA 1G9TA 4R6XA 1T5IA 3HYRA 3NCOA 3BGVA 4HAXA 4C2BA 3PNSA 2JIDA 1VL2A 4QQUA 3W2JA 2QRVA 3E4DA 3F49S 2D1QA 4KFPA 2OC4A 2C94A 3KT6A 3PYLA 1GUZA 2WP8J 2NQ9A 4OM7A 1I6KA 3P96A 2NSHA 1MUCA 3BAWA 1UR2A 4IDOA 2RHOA 3VAVA 5EXEA 3CWCA 4WZZA 3VDHA 4RKEA 2WFLA 2V3VA 1FU4A 3UNDA 5HANA 3IRVA 3MRSA 4RUKA 4YRBA 4H1VA 4IXTA 4LZOA 2JIQA 4FSDA 3QEMA 1B8UA 4JSYA 4FFBB 3IP6A 4FCVA 1CUIA 3INGA 4EI9A 3U9IA 3H19A 1TB4A 3A36A 2OHHA 3C97A 4POCA 2EW2A 1ZOOA 2VJCA 4M1WA 5EFFA 4HHLA 1IDN1 4K8EA 3SBOA 4GUDA 2GGEA 4FQ8A 4F6RA 1TVKA 4YTEA 2PT5A 4XB3A 3EVGA 2ZRJA 2X0SA 2I4OA 1FWTA 4Z49A 1J9EA 2FHPA 1HG0A 5B7NA 2YR0A 5KIAA 4H6EA 3C8HA 3KKQA 3D4NA 5FP0A 1CR2A 2W4MA 5HJEA 4RDIA 3AMLA 4TTGA 1JEZA 1HTBA 4CU5A 3FOEC 4OMUA 2YFHA 4RFSA 2CLLA 1AVAA 3GE7A 3G5LA 2R1TB 4D8XA 1C0EA 4QX4A 4OP3A 3G82C 1ZA2A 1ZM7A 4W8OA 2UZ0A 1HT3A 1VPQA 4FJ1A 4FAMA 3QOKA 4GBJA 1J9YA 4Y9NA 2R48A 3AOFA 3D2AA 3H87A 4QLJA 3MB9A 5LIWX 3D6HA 4HZUB 1WS6A 1TZMA 3SAZA 3HV9A 3OT5A 3ZQKA 1P5JA 1WZCA 3RVBA 4HK6A 1YH3A 2QROA 3HFYA 3GM8A 5B7PA 4Z08A 2FCAA 3QHMA 3HDTA 1GLNA 1M0TA 4ZV4A 2VJAA 1OFEA 3U4MA 1XZAA 3KQSA 4XM2A 2H4XA 1RKQA 4RYDA 4LRSB 1SZEA 1RRMA 5F21A 3E3OA 1WMAA 2ATCA 3FUWA 3L3BA 3IK4A 4QPNA 1LBQA 1SXJD 5FX2A 1O9BA 3THUA 2BI4A 2VRJA 3EXAA 1W0JA 3NAMA 2MU1A 1GL6A 3EMDA 3PBUA 2RHDA 4JUBA 4I9JA 1LRKA 1V1JA 1J21A 4I7WA 2E37A 4TT8A 1SR0A 1J49A 4RACA 2GK1A 3NP7A 4BWGA 5ESXA 1TVLA 3E61A 1R9XA 3TEJA 3T7JA 2QUVA 5T8KC 4PRYA 1I0ZA 4S1OA 2WIAA 1R6WA 5E2IA 3IXLA 3IJ9A 2ZA2A 4K2AA 1QLJA 2QZ4A 4G4JA 1D7FA 2QHAA 3F46A 1XYZA 1ULTA 4B87A 1JA0A 1EIWA 5BUQA 4NU5A 1R46A 2Z6QA 4NE7A 4D6EA 1RZUA 3LG3A 1K6MA 4YA6A 2GX6A 3ZW8A 4IJUA 1R8JA 4R0MA 4IFKA 2Z1BA 4PS0A 5ER9A 2IBTA 3EZ4A 4KEAA 4C7KA 1SB9A 4J28A 2CLEA 3G8AA 4E5PA 2W2QA 1Z36A 4C1NB 4DF1A 1ATZA 4F40A 3H12A 1K5PA 1SHTX 4U7GA 4PR4A 4EJ2A 1OFPA 4PSKA 4WK4B 3JQAD 1Y8RB 2ZB2A 1QKKA 1DCFA 4XFKA 1R0RE 3ZDAA 4KE6A 3T9DA 5EIEA 1OQFA 5IKOA 5G41A 2NUBA 3AERA 2BY3A 1Z18A 1NE2A 3KKKA 1XMQB 1NQAO 5IAGA 5I3GA 4KBGA 4N41A 1M2VA 4CEXC 5JS6A 4E1BA 4ATDA 4JMLA 4V0MA 3P1JA 1PZ0A 4I4TF 3ZOZA 2IYNA 3N2GB 1KMMA 1J8MF 3PQ4A 2XDFA 4NICA 4EKNB 4JGDA 2ONJA 3N39C 2H6EA 2ORED 3TLBA 3M89A 1YTDA 2C1ZA 1S2AA 5AHIA 4YMZA 1UPXA 2QL6A 3NOEA 4E5MA 5CQ1A 2FPRA 1DJNA 1K7FA 1K8YB 3FVDA 1HBJA 3WUBA 3VNYA 3H4GA 5IYZA 3WF4A 2OG9A 2WG1A 3TECE 4Q8WA 1X8CA 4UQLA 1NDHA 2X2YA 2ZR0A 4YU1A 3GU3A 3HU1A 3LZDA 5CSYA 3H6KA 3LDVA 2CL5A 2OD7A 3OOHA 5DPMA 4LZAA 3W7AA 4PLFA 2HSWA 2CXGA 5JO9A 3TZQA 2HSEA 1YACA 3HIJA 4NTZA 2WAYA 4WT7A 1V3JA 1XXHE 1H1YA 3B0XA 2AW5A 1IXSB 1XJBA 1N9GB 2VCAA 4AXKA 1MNZA 1UPBA 1C8QA 4AJPA 3VOBA 3FAKA 3CC8A 5I23A 1R2SA 5EOVA 1T4CA 5DM1A 4BX3A 2QGYA 4M7PA 3VUFA 3DAGA 4RMJA 3WD2A 2F3PA 2ZRKA 4HH0A 5ED4A 1Y6ZA 2ZWMA 3FXAA 5L53A 2BF7A 2QVHA 1X8LA 3QMRA 1XRSA 3KYCA 1WXXA 4GI2A 3IUHA 2JFXA 1T9HA 5KOJA 4ZO6A 4NAEB 3EIEA 1ZJBA 1QCYA 3AFIA 4MI3A 3FJNA 2YYAA 3ONVA 4Q47A 3DPSA 4IFTA 2VF2A 2TODA 2GJAA 1BF2A 4RPCA 3VTZA 4DDHA 5IH3A 3S5OA 4L3VA 4QVKA 3ABRA 4UBKA 4KPFC 4FBMA 1BGVA 5ADUS 4O2LA 3IS3A 5J2TF 5CAHA 2QR5A 2X05A 3L4TA 3EISA 3CPRA 2GEJA 4G81A 3UYKA 2DSNA 1WUJS 3L7JA 1YZUA 4M1MA 5KO2A 3NV7A 2J41A 3ITCA 4PBGA 1G4PA 1W3NA 5JHGB 1NXPA 3NBQA 1MJHA 1VHNA 2EP8A 3ILYA 4Y3UA 1NAL1 1JBKA 4YAJA 5CBIA 1FSFA 2F61A 3B12A 3KBOA 5LXTA 3M6IA 3UXIA 4FF5A 1JKMA 1V08A 1ONSA 5DM2A 5E1OA 2GSJA 1YDOA 2AGKA 1BRTA 1G5QA 3UWOA 1A7UA 1JCXA 2GJRA 2QI9C 4N3CA 4MMWA 2NV9A 1DBTA 3VIFA 1B0AA 4ZTBA 4R05A 1MC4A 3O8OA 2QGNA 4DM7A 1XZLA 4CKYA 4TTVA 3GBVA 4R1UA 2QM7A 2E6UX 3K0AA 3L0KA 3SURA 1Z9AA 3EEZA 5D3MA 1ZRNA 1JG1A 1ISPA 4HN9A 4NCAA 2CD7A 3CEJA 4IL0A 3MCMA 4PMVA 4AD5A 5TR9A 1LUAA 2WICA 3SZOA 1J5SA 3VDAA 4YACA 2ECKA 4IJQA 4YWIA 4ZT2A 1YDWA 4U5IA 3PCTA 3B20A 5A94A 4GKKB 2ZZ4A 4NU6A 4QOIA 3UZUA 3ELUA 1GPDG 2E87A 1J09A 3L93A 4AJNA 4YN3A 1ZMBA 1SOMA 3RUIA 3LX4A 1TWSA 2F1OA 1DX6A 4WNYA 4QRDA 3ETGA 2ILTA 2M98A 2VF7A 1SXJE 4HADA 1Y89A 4E2VA 2FG5A 1E1DA 4ADSA 1I24A 4KCGA 1DHKA 1A2QA 1OGJA 1LWIA 2XGZA 3DLAA 5JIWA 3UICA 4UTIA 3LHTA 5AHNA 3KTSA 4DM4A 3SUTA 1BNCA 3MTDA 3NR0A 2OOGA 1E9YB 4UJ3A 2RONA 3BH0A 1FNCA 2D1ZA 4PVDA 3BM5A 1RTKA 1CUSA 4OSEA 4G8DA 1YOVA 2C54A 3P9CA 1GVIA 4QISA 1B3RA 2F43A 2G9VA 3UC5A 3G2HA 2P8BA 3JYNA 3O8BA 1JILA 2J33A 1QS0B 4YCOA 4RF3A 2C3PA 5EERA 1TWWA 3NAGA 3TLAA 3URBA 1E9LA 3TTOA 1M1NA 2WHYA 3VYRB 3LUBA 3PSWA 1JZ7A 5DCEA 3W9ZA 1F2TA 1FQWA 1Y0EA 1EO5A 1P4SA 1E6XM 1YQEA 2J59A 4WXMA 1RC8A 1R47A 1KVQA 3O8QA 5DX0A 1HEUA 8XIAA 4RVOA 2D59A 4U3AA 3HYLA 1LV7A 2UYGA 2XTZA 5IT5A 3WRVA 1T9AA 2WUEA 3R89A 2DU2A 2G7ZA 1M2WA 4QTUB 1EC9A 1TELA 2W6OA 4W99A 3FNHA 3FSJX 4B9YA 3TYUA 3IUJA 1SGWA 1YR9A 3T0CA 3TOXA 2QLNA 4RTMA 1K9FA 4BAUA 2H0AA 1QP0A 4J0HA 4YMVA 2A7QA 3KUKA 3V9AA 3N6HA 1NQKA 3WYGA 4DMHA 4EA9A 4X85A 2VK8A 1YE5A 4OSOA 3A3XA 1W5MA 3S2YA 3TEFA 2WHKA 4PTZA 3VCCA 4MQEA 2SCUB 2DKOA 3TN6A 4MQBA 1RWQA 1TCBA 3OPYI 2YCLA 1JUKA 3L7BA 2GAIA 1KIMA 4AUKA 3W01A 2GBIA 4MVJF 4RYLA 3IAHA 2FPVA 1MOSA 2IF2A 2J4GA 1ESEA 3DQZA 5G1NA 5BW8A 5DCDA 4YUYA 5CX1B 5JFTA 3DMNA 5HGXA 4CEJB 5A7FA 2X13A 4MJMA 4NS1A 3PAOA 3R12A 4UBPC 1V5EA 4YGYA 3F4WA 4IF4A 4L15A 4HLQB 4M0CA 2YNMA 3NGLA 1KR0A 4R9NA 2IUEA 5C4GB 5LQNA 4WXEA 2Q3DA 3MQFA 3T52A 3BAXA 3I6BA 3ABIA 4OXIA 2HBZA 5CKSA 4PSVA 2XI4A 5E4JA 4OHFA 1PLJA 1I3KA 5HMLA 4P5EA 3MKCA 3ONFA 3ZGOA 1KA9F 1XZJA 4HRAA 3MHFA 4TN5A 4W9TA 2BBSA 1Q91A 4UU1A 3M6YA 3ZFHA 2GKSA 4QUDA 3ANYB 2WCSA 3A9BA 2J9FB 1Z7EA 2I17A 4IJCA 4GX2A 4XZ3A 4HHPA 2XOXA 3VGBA 2FN8A 2HMWA 5GNZA 3ZGNA 1GGHA 2BM8A 4PC7A 3BIXA 2VJLA 3PYXA 4WESA 1TJNA 3D6MA 5HKKA 4FLOA 3DZCA 1OK4A 3U4CA 1T0PA 2DJIA 2X0NA 3B8SA 1JIIA 4E8DA 2UZ1A 4QIHA 3RT9A 2R8EA 2OD2A 2X9LA 4RHYA 2P4EA 3XIMA 3BGSA 3L6BA 5KQGA 3A9WA 3FHLA 3Q7RA 2PWEA 3NTQA 3AJRA 3L9CA 4LXHA 4E7OA 4GZIA 5F4WA 3TTTA 1FQKA 1H93A 3DFTA 3BCDA 2AG0A 1TPZA 3VSBA 3B9EA 2IPMA 5DHFA 3FNIA 1OKKA 4KFUA 3CAKA 1E8MA 3HB9A 3PPHA 2OAQ1 3UHJA 4RW3A 1M68A 4UNLA 3L0ZA 1F8UA 4JCLA 2PWZA 1T1EA 3CZAA 3U26A 4PG4A 2IHUA 2NT0A 3B6JA 2YS7A 3X3HA 4WCFB 3ARTA 3LTNC 2PS3A 5DK4A 4G25A 4MMXB 1OGSA 4RIEA 3EXHA 4OK6A 1UP7A 3U4QB 4Z0SA 1CQIA 4MAZA 1U5CA 1GEQA 3VE7A 3NYDA 4P54A 1VIMA 1EUCA 1MAUA 3UAXA 2WV9A 2IYXA 4D7AA 5FJOA 1SJ9A 4M7WA 4HLNA 1L8AA 3O0DA 3K72B 2C2YA 1RZVA 2NPFA 1K77A 2NQJA 3K5PA 4DR2B 4BFWA 5FEZA 2ZCGA 3AI0A 4MCJA 1NSTA 3QXJA 5DGIA 1F2JA 3ITNA 2YXPX 1KQFA 3LVBA 2REBA 5FPYA 1UFKA 1EFRA 1U4OA 4D4HA 3SY1A 3D8SA 3WH7A 3L1JA 5KMYA 2FSFA 4DV1B 4A2PA 4ATWA 1Q17A 1HKWA 5FOVA 1T8YA 4KTTE 1GN8A 1F8FA 3QVKA 4AYXA 4HPJB 3PT9A 1IHXA 3EPRA 1ULAA 4A2SA 3DLPX 4JD5A 3AKDA 1W0MA 4A5OA 4UQCA 3KZPA 2G1PA 3WK0A 1UODA 2GYYA 3K9GA 5H2ZA 3O7MA 3H2AA 1U30A 4RHEA 1YUMA 1HXHA 1A82A 4X1IB 5KSWA 4DQXA 3TM5A 3B5JA 1AC5A 5E9QA 2QR6A 1PFVA 2FZNA 4YUAA 2C7RA 4IV0A 1R0MA 4WDUA 3H24A 4BR1A 3ZTYA 5TIMA