5EMMA

Crystal structure of prmt5:mep50 with compound 15 and sinefungin
Total Genus 200
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
200
sequence length
625
structure length
625
Chain Sequence
RVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and Property Guided Design in the Identification of PRMT5 Tool Compound EPZ015666.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Protein arginine N-methyltransferase 5
total genus 200
structure length 625
sequence length 625
ec nomenclature ec 2.1.1.320: Type II protein arginine methyltransferase.
pdb deposition date 2015-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05185 PRMT5 PRMT5 arginine-N-methyltransferase
A PF17285 PRMT5_TIM PRMT5 TIM barrel domain
A PF17286 PRMT5_C PRMT5 oligomerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 5emmA03
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 5emmA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5emmA02
4A8NA 1HNNA 2YTZA 4E33A 2ORED 3TQSA 1PJZA 5LR6A 3GRUA 2XVAA 3EEOA 4E32A 5CVDA 5EKXA 3P9CA 4DQ0A 3LDUA 5CVVA 2QULA 2O07A 5FULA 3BWYA 5CUQA 4QQKA 2YX1A 3HCAA 2UZ4A 3X0DA 1EAMA 4F84A 1DCTA 3HA3A 3PX2A 2WK1A 3AALA 2NYUA 5K0NA 2HR1A 5DXJA 4ZB5A 3EVDA 3BWCA 2PT6A 3P9NA 1ZHFA 3GXOA 3NMUF 1I4WA 5KS2A 2DPMA 5DWQA 2HK1A 4KIFA 3LSTA 2ZWAA 5ICEA 4XUCA 4R8SA 4ER6A 3H2BA 2XVMA 3CQIA 4ZBCA 3QV2A 5T6BA 3AJDA 4KWCA 3QOXA 1G6Q1 1XISA 4HHLA 3KQMA 2VDVE 2IBSA 4QQNA 2ZBRA 1XLCA 1F3LA 2ZZMA 4PGGA 3GIWA 1XLHA 3M70A 3PB3A 3I53A 3N4AA 4F85A 4FT4A 5DPMA 3VC1A 4FGZA 2ZFUA 3EMBA 4HRAA 3SSNA 4LWOA 4QEHA 3REOA 4C08A 2I7CA 4YUXA 4HG2A 1VP9A 1DIDA 2QRVB 3KBMA 1L3BA 2YVLA 1Z3CA 2CMHA 3G8AA 3HM2A 3VYWA 3TC3A 3KQYA 4PYNA 4BLWA 9XIAA 1RJGA 4OVXA 4RTLA 4RTPA 5EVJA 2AOTA 4YTSA 3G2OA 1XCLA 5FQOA 4PYMA 2C7PA 5EG5A 3KPWA 5C9ZA 3IUDA 4GJIA 4R6WA 5CVEA 1B42A 1G60A 2ZBPA 4E3VA 3NDJA 1BHJA 5FA5A 4P7KA 2HTEA 10MHA 1A0DA 2G72A 3OE4A 3JWJA 3KU1A 2PX8A 1JSXA 8XIMA 2BR4A 2ZBQA 3O4FA 2LD4A 2V7EA 3DLCA 2ONYA 3FVMA 1AV6A 1S5NA 1XLDA 2P8JA 3L8DA 4ZTBA 5T64A 4AZSA 4YMHA 4XUDA 1EJ6A 4HSGA 2AOUA 1I1NA 2AOTB 2JHAA 2HWKA 1I6NA 5F2KA 4CTJA 3CKKA 3FRHA 3PFHA 1P1CA 1MUWA 3SX0A 2OPBA 3KCLA 2IH2A 3EVAA 1T43A 2UYQA 3LCVB 5CM2Z 1ZKDA 2CMGA 5D1NA 1XIIA 3AWIA 4IV8A 5K03A 3G2PA 3FUVA 3NDIA 2G0WA 3KCOA 1P1BA 2OBFA 3MERA 4U7TB 5F2OA 3UWPA 5KQSA 5HZMA 2UYHA 4AUKA 2GH1A 3OPNA 4KW2A 4GJJA 3AYTA 3BWBA 5EGSA 3ELDA 4C05A 3U81A 4OA5A 2HCVA 3DUWA 4QVKA 4OA8A 3O7WA 2YUIA 4X61A 1G8AA 2P40A 1JG3A 4KVZA 3DMGA 1R00A 3FPHA 2PKWA 3I64A 3P2KA 5EMJA 2IIPA 1BC5A 1N2XA 1XJ5A 2I62A 2C7OA 1R18A 2AVNA 5BW5A 4OQDA 3TOSA 3BZBA 4CTKA 3P8ZA 1QAMA 5KQRA 5T67A 1SG9A 2IDKA 4ER5A 1KPHA 4R05A 5DTQA 4FR0A 1O9GA 3OBEA 3A7DA 4QE5A 3R9XB 1D2HA 3IUIA 4HGYA 5P8WA 3M0HA 4DF3A 4M38A 1YB2A 4QVGA 1RI1A 3K0BA 4RX1A 1NBHA 4AZTA 5LQNA 2I9KA 3G2QA 1XIGA 4GEKA 4K1GA 2N47A 3UJBA 3UJCA 5EPEA 4GC9A 4PYJA 4PWYA 1VBFA 4QDJA 3T7SA 4YUZA 2ZZNA 2NP7A 3LKZA 4PGLA 1XTPA 4PINA 5CD1A 5DM0A 6XIMA 5ERGB 2IDJA 5GWXA 5EKUA 4C06A 3BZJA 4V0QA 2QUMA 3SXJA 2XIMA 5LQAA 3TPZA 3EGIA 2HMYB 3HCDA 4E2YA 2I56A 1NKVA 4IKPA 2ADMA 2EX4A 2Q41A 2VP3A 3E8SA 3FRIA 3OZSA 1VLMA 3KQWA 1BKYA 4Q7IA 2Y1XA 5DX8A 2VDUE 3BUSA 4PYQA 5EZQA 3MHTA 3BKWA 5FWAA 3M0LA 3EGEA 4LECA 2PY6A 3A27A 5ICGA 4PYKA 5FHQA 2FPOA 2AN5A 2OU4A 3DXXA 4HHMA 3VNLA 1RJDA 4MIKA 1XLKA 5BW4A 1XICA 2GLKA 3VNKA 3G7UA 5F2NA 1KPIA 2ZZKA 3LGAA 5GOZA 2AZTA 3C0LA 4IV0A 5K0FA 3M0VA 2AOWA 4HNOA 1X1BA 2YR0A 2QYOA 2R3SA 4GC5A 1QTWA 4PYIA 5DTMA 4E2WA 3BDKA 3P9IA 5LQCA 3NVKI 3AXSA 2I6GA 2OO3A 5EEHA 4MQ4A 3GU3A 4RTKA 3FYDA 1P91A 2J6VA 2FCAA 2O0LA 2XYRA 4KDCA 4YTQA 3G5TA 1IXKA 3GJYA 4PIMA 2PXAA 3KQSA 1XLMA 3LDGA 1RJFA 2AVDA 2GVEA 1XCJA 5HIIA 2ZTHA 3EVEA 5KYGA 4ISCA 1S5MA 4WVLA 3IUHA 5GM1A 2I57A 4RTMA 5HFJA 3RW9A 3HCEA 3PX3A 5E1OA 1XIHA 4DKJA 3LBYA 5M5BA 1DXIA 1XLJA 2AOUB 5FUBA 1XIMA 3LKDA 3T0IA 1JTFA 5K0JA 3THSA 4P58A 5E9WA 3B7PA 4RV9A 4CKBA 2KW5A 2V74B 2FRXA 1XVAA 5DX1A 4M37A 3DMFA 1XINA 5B80A 7MHTA 4PIPA 4E2ZA 1YF3A 5H6HA 2P3OA 3C6KA 4X60A 1EG2A 1KIAA 1NW8A 3FPEA 3R24A 4P7JA 5E2AA 1YZ3A 4RYLA 3R0QA 1VL5A 5K05A 3U3HA 4MTLA 2G1PA 1P39A 5I7GA 2P41A 3LCCA 7XIMA 4WXHA 4V0RA 3PLAE 4POOA 3GNXA 3C0KA 3FUTA 5E8JA 1UIRA 4ZB0A 2ZWVA 3MTEA 4HC4A 5BP7A 3KR0A 3UZUA 3KBWA 1XYLA 3A26A 3KBJA 5CCBA 1X19A 2Y1WA 3OU7A 5DM4A 3ER9A 1NW6A 1X1AA 1BXBA 2B78A 4EK9A 1DL5A 2XINA 9XIMA 3M6XA 4EVIA 2B3TA 5HIJA 3ORHA 3KWSA 2GA9A 1AF7A 4C07A 5B7ZA 3G2MA 2XISA 2FK8A 2YXEA 4BLVA 4DZRA 3QC0A 3QXBA 3THRA 3HP7A 1NV9A 3O31A 4K6MA 3CJTA 4ATNA 3ELUA 3JWGA 3KBVA 1SQGA 5DX0A 3TVAA 2PVCA 2G71A 2BM8A 3BWWA 3UVAA 2AS0A 3DOUA 4XCXA 4ER3A 3ITOA 3OZTA 2PJDA 4GOMD 4KDRA 2C7QA 2QW5A 3LX6A 3TRKA 2XBMA 3QZAA 3KQTA 3KPUA 3VYLA 4GOND 4AZWA 3B3GA 4HGXA 1SUIA 3PS9A 2HV9A 5EHIA 5FCDA 3GO4A 3SGLA 4DA4A 3M6WA 1NW7A 1VP3A 1JG4A 3JWHA 3ER8A 1KPGA 3B89A 4UOEA 2XYVA 2H00A 3CVOA 3B5IA 4PONA 2A14A 1ZGJA 5ICCA 5E9JA 3DMHA 5EIFA 1DUSA 3UJ8A 3LHDA 2C7RA 2GB4A 2EJTA 5XIMA 2GUBA 2BM9A 4Z2YA 2JJQA 1M0EA 2PX4A 3QOWA 5EEGA 3QYSA 2IH4A 5MHTA 2GPYA 1XYCA 4KW7A 3GGDA 5LQKA 5EC8A 5K0EA 3HA5A 4FSXA 4GUAA 3ITTA 2DULA 1MHTA 3FTFA 1X1DA 2H1RA 3KPVA 3P2EA 3M0MA 1U2ZA 5K0CA 4OX9Y 5K8VA 4Y30A 3VNJA 1VE3A 1N7JA 3CWHA 3DXYA 3F4KA 3P9KA 4CKCA 2PXXA 2HK0A 1TW2A 2WA2A 4YTRA 4QDPA 1JG2A 3UBTA 2G4JA 3KR9A 2CWWA 4EKIA 3MB5A 5IKMA 4OQEA 3BKXA 1PRYA 3AYVA 1KP9A 2P7HA 3KQPA 2NXCA 2QRVA 3CNYA 3PT9A 1Q0SA 4GBED 5LQRA 4GLEA 1OADA 3P71T 5FHRA 5K01A 3FPJA 5LSAA 1JR4A 1AQIA 4LNCA 3EVBA 3V97A 3HCFA 1R8YA 3I58A 4E70A 1M6EX 4XIAA 2IPXA 1NW3A 2P3QA 5FTWA 3RODA 1YUBA 3V8VA 3SMQA 4PCLA 4PYOA 4YTTA 3IV6A 3OU6A 2ZIEA 5GIPE 2Q02A 2QM3A 2VDWA 4FSDA 3R6TA 3ME5A 5KVAA 4CKEA 4XSMA 1V39A 1XYMA 1G55A 5E8RA 3EVZA 4M36A 5E1BA 5G02A 2P1DA 5FQNA 5XINA 4A8RA 1RI2A 3NW9A 4HH4A 3TKAA 3UFBA 4RTQA 3PFGA 3TFWA 1GW9A 5AVNA 3CBGA 2NQJA 3FYCA 1KYZA 3OU2A 3Q87B 2ONZA 1EJ0A 4P7GA 3G5LA 3ID6C 4RVHA 6XIAA 4X41A 2PSSA 4QE1A 2OB2A 3G89A 5XIAA 3KQVA 1X1CA 4FZVA 3AY0A 4RVDA 1ZG3A 3MGGA 4QTUB 3TKYA 1D2GA 3AAMA 4RSRA 2NXNA 4YUWA 3PVCA 2CKDA 4BP3A 3HVJA 3HEMA 1A0EA 4M7RA 4KRGA 1QAQA 4EKGA 3GRYA 3CJQA 2PX2A 1XLFA 1XDZA 5GP1A 4X63A 4G56A 2OY0A 3D2LA 4RVGA 4O29A 5DT2A 2QY6A 1XYBA 4C03A 1RI4A 1SUSA 3HA7A 1XYAA 4EACA 3TLJA 2AN3A 2EJUA 3VNMA 2AOVA 2YXLA 3A25A 2BZGA 2PX5A 3GRZA 4PGHA 4ER0A 4QEEA 4XSLA 9MHTA 4H0NA 8MHTA 3CQJA 4DCMA 2NQHA 1WS6A 3BXOA 4K3ZA 1XDUA 2R6ZA 3C3PA 3ITLA 2PT9A 3CQHA 4GOOD 5K0BA 5B7YA 1FPQA 1R8XA 5C0OE 1H1DA 1XXLA 4XKMA 3MCZA 3BZGA 1RJEA 1WZNA 3NVMB 5DTRA 4RVFA 5CVUA 2VS1A 2P3LA 4FT2A 2JHCA 1ORIA 1KR5A 2YQZA 1ORHA 3BGDA 1QYRA 3M4XA 4QTTB 1JG1A 3CCFA 4C4AA 1XIDA 3LCUA 1JSZA 3OFJA 2ZIFA 5CCXA 5ICFA 3FTEA 2PBFA 3LDFA 4IWNA 3EVCA 4PYLA 4EQZA 4J4KA 3SR4A 2BH2A 1WXXA 1L3CA 4ZB2A 2PWPA 1KHHA 2GS9A 3FTCA 4E30A 5GINE 2OXTA 1UFKA 3GWZA 5TNVA 2PGXA 3TM5A 4BY9E 2FYTA 4DVOA 1DE5A 3FPGA 4P7FA 5D1HA 3T7TA 3UJDA 3DP7A 5HOQA 3C3YA 5JUWA 5FA8A 4RTOA 3I5UA 5U4XA 1A0CA 1XIFA 1VQ1A 3SSMA 1R74A 1VPTA 3KBSA 3FPFA 4GF5A 4DUOA 3ELWA 4HTFB 1HMYA 3NWEA 3E7PA 3K6RA 5EQJB 5H02A 2H11A 4GOLD 5DRYA 3KPJA 2BR5A 3VC2A 5DM2A 4AZVA 1NW5A 1XLIA 2X7VA 3GDHA 3P14A 4X1OA 3MCTA 3DX5A 4NECA 4DMGA 3I9FA 4QDKA 4EMSA 5LQJA 5CIYA 3MTIA 3KTCA 1I60A 1INLA 1D2CA 5FADA 5HILA 4JXJA 1VIDA 3UA3A 4CWAA 3RIEA 2ZVJA 3C0SA 3ELYA 5EMKA 3ITYA 3WQOA 4CXMA 3UA4A 1SKMA 5HIKA 2QE6A 4AX8A 4RTNA 4YUVA 4DCGA 4XISA 3XISA 4HTFA 4DM3A 1YFLA 1YFJA 4E2XA 1L1EA 3CQKA 1NV8A 2QUNA 4W4QA 1WXWA 3MAGA 4FP9A 4MWZA 2UYCA 3GNLA 3KPYA 4QDWA 5HIMA 2IP2A 1CLKA 2ZVRA 2BR3A 2IFTA 2UYOA 3XINA 1QUMA 2P7IA 5E2BA 3IYLW 3EPPA 5EZSA 3VSEA 5BXYA 1MJFA 4QE4A 5FWDA 2E5WA 2Z6QA 1DIEA 3CC8A 3B3FA 1G38A 1F38A 2IBTA 5CVJA 5LQUA 1FP1D 1XLGA 2PWYA 2PV0A 3CGGA 1NBIA 1O54A 1XIJA 2OZVA 3EVGA 4A8IA 1XDSA 3B3JA 4Y2HA 1XLEA 2NNWB 3EVFA 5JR3A 4A6EA 1XP3A 3FTDA 3KHKA 3HVIA 3WSTA 4GQBA 3TMAA 1NT2A 2O57A 3UJ7A 2IH5A 4XIMA 4L7VA 5HEKA 2NXEA 2AOXA 4YV2A 2WA1A 1Q0TA 3ERCA 4XUEA 3M6UA 5J8LA 1JQ3A 3DULA 1XLLA 3OE5A 3DH0A 3FUUA 3LECA 2ERCA 1XIBA 4PNEA 3NWBA 2JHPA 4YV1A 3M0XA 3LPMA 2YXDA 2IGTA 1L9KA 4KIGA 4MHTA 1XLBA 4BP1A 1XLAA 5DSTA 1QZZA 2FHPA 3M6VA 5C1IA 5AVHA 4A8LA 4R6XA 3ITXA 2JH9A 1BOOA 3R3HA 5DRTA 2AN4A 5EMLA 5GM2A 3GRVA 2CL5A 2OB1A 2AR0A 3C0QA 3M0YA 3UJ9A 1I9GA 3ANXA 5E1DA 3A7EA 3E05A 3TM4A 3C6MA 2ZCJA 3Q7EA 2EG5A 3KQQA 3M33A 2PLWA 3NJRA 3OCJA 5DSXA 3G88A 1ZQ9A 5B1SA 4YV0A 3L23A 2K4MA 3HCBA 4QPNA 1TZ9A 1SVUA 3MQ2A 3EMDA 1NE2A 2Z6UA 2PXCA 3KR2A 2G8NA 2NP6A 4FS8A 3VNIA 1WG8A 3BWMA 3P6LA 2G70A 4PCAA 5DM1A 2ZDSA 5H1WA 2OYRA 2P35A 3EGVA 4LG1A 1FJXA 3LMZA 2O06A 3KR1A 3HVKA 4QPPA 4R8RA 2O05A 3DXZA 3NTVA 4ER7A 4U7PB 3PTAA 1OR8A 1TPYA 3JWIA 3LBFA 1EIZA 1JTEA 3OZRA 2ZIGA 3OFKA 3XIMA 1YZHA 3UXIA 3DTNA 2X7WA 5DLYA 5K0LA 3SSOA 2B25A 5EOVA 2NQ9A 2FK7A 1O9HA 2B2CA 4B17A 3FUWA 3UU0A 2HNKA 2JH8A 2ESRA 1RI5A 1FP2A 3GRRA 1QAOA 2F8LA 1L3IA 3DR5A 3P2IA 5DXAA 1YX1A 2ZSUA 3LL7A 2EFJA 1K77A 1WY7A 4OBWA 4BLUA 3SVZA 3UJ6A 4RTJA 5E9QA 3DLIA 3G8BA 3KBNA 1SQFA 1ZGAA 3A4TA 5EIWA 3S68A 1XIEA 2XYQA 3TR6A 1KXZA 3JU2A 4YTUA 3BANA 1EQAA 4EAYA 2GAFA 2GYIA 3HCCA 3CJRA 3HVHA 3EEYA 5EHGA 4A6DA 3HTXA 3BGVA 1R6AA 3BGIA 4YUYA 1JQDA 1IY9A 2NXJA 3KCJA 3IHTA 4HGZA 3DBNA 1KYWA 4LWPA 3UJAA 3GCZA 1UWVA 3SM3A 2B9EA 1BXCA 4F86A 3P97A 2Z6AA 5E1MA 5GIOE 3AXTA 3KKZA 4C04A 1DE6A 3KQOA 2JG3A 2VZ9A 3FUXA 1D8WA 4US6A 1O1HA 3IEIA 5K09A 1M6YA 1FBNA 4RTSA 2GLUA 1IM8A 3E23A 4RTRA 4YMGA 1MNZA 5EMMA 1QT1A 2ZW9A 3HNRA 4RWZA 3U0HA 3T7RA 4PFHA 4E31A 5IH3A 4OBXA 5K0GA 2ZULA 3NGFA 8XIAA 1N7IA 1AQJA 1QANA 1JQEA 1RI3A 1TW3A 2ZLBA 3BT7A 3FZGA 2OKCA 3ITVA 1G8SA 1Y8CA
chains in the Genus database with same CATH superfamily
1OROA 3UF0A 4HCLA 4E6EA 2IS7A 4AC7C 2QULA 4NJMA 3ISIX 3X0DA 2PRSA 2ZVQX 1P9OA 1V79A 1HLGA 4OMFG 3UCFA 3LP6A 1ULSA 1RAHA 4AZ0B 4V15A 1SUCA 1PIFA 1Q2SA 4PGGA 5CM9C 4DNQA 4D43A 4FT4A 3EMQA 3NM3A 3SBEA 5C7YA 4RNJA 2BZNA 4IMIB 5EVJA 3DM9B 1KOGA 3UHAA 3B2NA 3DKKA 5JJIA 1KK3A 1D2KA 1UMCB 2JCXA 7ABPA 1VJ0A 2W8BA 4L50A 1NMSA 2CHFA 4PFJA 3M47A 4BAUA 4MWAA 4JA0A 4OQQA 4A29A 1A5UA 3QPBA 4ADSA 4Z4IA 1K8ZA 1XPUA 4O2BF 2OBFA 1X8JA 5CT6A 3H2CA 4OSEA 2DETA 2VP0A 2HISA 4NNCA 3IQDB 1T15A 3B9DA 3DMGA 1PNQA 3IODA 4YH1A 4H1HA 3KZ1E 5LZ8A 3HB7A 2I3DA 2BXVA 1OWNA 2FRDC 3E03A 4K1GA 5MFZA 1VBFA 2XZLA 4G1FA 1YTEA 4KX5A 1ONRA 2VG8A 1QRUA 3OZSA 4EFDA 1QHYA 4D41A 1WHTA 4IFOA 2FPOA 5JWRA 5IJ9B 3LGAA 4IT1A 1YE3A 5F5LA 4QBTA 5D6NA 3OY2A 1JG6A 1TCUA 1W0JA 2QTCA 4CIAA 1DJIA 4C6IA 1THZA 4M9XA 4LBUA 4F1KA 4E1BA 4CIXA 1I2ZA 4K8OA 4RK0A 4U7GA 1X8FA 4BMDA 4IGIA 5B55A 1FY6A 4Z2IA 4PIPA 1NVAA 3PHLA 4AWEA 4UFIA 1YZ3A 2HL6A 1VL5A 3OESA 4DIBA 4P4TA 4W9RA 1LI5A 4QITA 2I4IA 1B16A 5HNNA 4BUCA 4Q4OA 1QCYA 3DBRB 2QR2A 3B48A 3N7AA 4XQEA 1IQ0A 1Q1QA 3HPXA 3RO8A 1VSVA 3F71A 3N1AA 1FWBC 1DKLA 3LW7A 3I8XA 4Z6KA 4DR3B 1L5FA 1ZGJA 1ZN9A 4B7UA 4J0IA 3WBEA 1K7XB 5HM8A 4RR4A 1W1B1 4ZICA 4G4JA 2JIRA 3LVBA 2QX7A 5KYNA 3FSTA 1UJQA 2GOKA 2PXXA 1XM3A 3UGKA 3V2IA 4YCLA 1FDOA 1TTPB 3U9LA 1I2PA 4GLEA 1YJ8A 3IOYA 1QF7A 4BKQA 1DAFA 3SDBA 3F5MA 1XXHB 4WASA 4HAZA 3DPIA 4CLRB 3K6KA 1FWDC 1TKKA 4IINA 3HJGA 5A5VA 4FZJA 3I9LA 5CPLA 1QYCA 3VIFA 5DN1A 3P19A 1N5KA 2XSZD 1VL0A 1EP2B 4C5AA 2VBGA 3N0VA 2NQZA 4M7RA 5HE9A 3A9RA 1FMFA 2FNAA 3MKCA 1KEEA 1TJ1A 1XRPA 2BSXA 3NG3A 4DA9A 4UU1A 3OCUA 2YXLA 2ILVA 4C21A 1NJ2A 4GFDA 4LHXA 3SCTA 1JU4A 3W04A 2O9PA 4QUKA 5HHTA 4ZGYA 4UVIA 1WU7A 3KKOA 3OJOA 2XXBA 4C4SA 3LUHA 4KR9A 5KWSA 1RYMA 3OEYA 3ZU4A 1Z5GA 3L0KA 3IBYA 1J0DA 4BVAA 5FA8A 1YU6A 3D6VA 4Q8WA 4EW2A 4RPIA 3P14A 4G2DA 1SHLA 2WF7A 4K28A 3TKLA 4X64B 1Q91A 1PTJC 5I07A 3EMCA 1WKVA 2IZ1A 3IS3A 2XNJA 3VGHA 2CZFA 4U5KA 4Y7EA 2UYCA 4QDWA 3BXGA 1QTQA 2ZVRA 4A1FA 3NEAA 3QEMB 3AHXA 3AZQA 3R9IA 4EY7A 4WX2B 3QPEA 3FTDA 3IUEA 2DEPA 3CF4G 3U7BA 1OYYA 3PUZA 1IIGA 3U7EB 2HV5A 4IVQA 1TADA 4KEMA 4NYYA 2QB5A 1PJCA 2GD2A 1AD4A 3QZ6A 4ONEA 4KBYA 3ICEA 1UG6A 3SY5A 5EYPB 1NF3A 1NF2A 3DC2A 1E66A 1YO6A 3LYHA 2XE4A 4KREA 4O5AA 1UF9A 2PMQA 1J6PA 2D4AA 5JNSA 3UYIA 1UWCA 3ZV7A 3R5HA 4MEJA 1P60A 1QFEA 1SMAA 4RDIA 3L4BA 3UW1A 3GXIA 1G8KA 5IARA 3Q45A 2O8FA 3KHDA 4L61A 4AXNA 1OYVA 3AZPA 4PTWA 1FS4A 1OFDA 2DDXA 4LRTA 3GOHA 4H27A 4IVPA 1BFNA 3AXXA 3IJ9A 2JBAB 1ESEA 3W9BA 4O4LF 3W1UA 5D8ZA 1A88A 1SOAA 3GLIE 1EXDA 3R7LA 1PB0A 3FSRA 3ICPA 4QS6A 4FFDA 3BTSA 4MUIA 5M2FX 4NV3A 1C3FA 1ZD1A 1DWJM 3Q8WA 3IBFA 3RG6A 3T3DA 2D74A 4A10A 3QWHA 4D3DA 2CW5A 4QUAA 4WD0A 1YBQB 4OVXA 4BE9A 3PUEA 2GFTA 2ZYHA 1KFBA 4PTXA 3WL8A 1W3JA 1UBGA 3GFYA 4S2EA 1R4NA 4ZTBA 2ZSKA 3DKRA 3K96A 3NQBA 3CMJA 3HQ4O 2OPBA 5AOAA 1W8SA 4F04A 1G4UR 2NO6A 1W4AA 3FZNA 4CIYA 3H2KA 5HCUA 4MKZA 1KO1A 2JD2A 5EMJA 4EJSA 1J7JA 3C2QA 4DYJA 2H1OA 2PTWA 1KCZA 5EE3A 1I33A 4C0SA 3G2QA 1SH7A 2ECQA 3A3WA 1K2VN 1TMOA 2Z56A 3NO3A 4BO4A 3SJCA 1XLTC 5C80A 3HS3A 5AVJA 4RLQA 4RKWA 2G5TA 2WWCA 2PPGA 2AZTA 1WMSA 3W1VA 1QE3A 1X1BA 3BCDA 1XZBA 2G04A 5BMVA 3W38A 1NMZA 4GPNA 1Q6CA 2OO3A 4NEGA 3BWDD 1YDVA 5JS8A 4HDMB 1FWTA 4ZZ3A 1UH5A 2X8RA 1ZRHA 1XIMA 3NKVA 4US0R 1N5JA 4X60A 3PULA 4KZPA 3HFYA 4F0MA 1CETA 4XWAA 1GDTA 2I5PO 2FSVC 1RP7A 3DHPA 4C76A 3BERA 1TYAE 1SCUB 3HYCA 2WQ7A 3PXEA 3VFCA 2PLNA 3LQQA 4OU1A 3M81A 2P9QA 4LXHA 5FSEC 4CM6A 1GOQA 1VL2A 3UCDA 5EYPA 2FPMA 3T41A 5AW4A 1Z6TA 3WQRA 3TC7A 4GICA 3Q7IA 5F3DA 4YFYA 3JQDA 4Z2KA 4UNKA 2QTWB 3D0OA 3QC3A 1KPGA 1MPTA 1AKTA 4OHBA 4LDZA 1DHPA 3ORQA 1I1OA 2JD1A 5DCUA 2JJQA 2NSLA 1MJHA 4UTPA 4FSXA 2MYNA 4H4EA 1HX7A 3GRFA 3QTBA 3QQPA 3CWHA 3RUFA 5CFRA 1I6LA 4HVTA 1W0MA 3C5HA 3KYDB 3B6IA 3UMJA 4JLOA 3AYVA 1THMA 4E4FA 5B7GA 2JFPA 1J97A 4F4IA 5GMOA 3CB2A 3AQIA 2YIDA 3DECA 1ZC3A 3IULA 4LUSB 3R8GA 4DQKA 3MJCA 1XZGA 1ZVQA 4XJXA 2PDPA 4ED9A 5CG0A 2SECE 4ZOEA 5D7NA 3B9OA 3KOWA 2GEVA 5AVNA 2NQJA 4KQEA 3GFGA 3OF5A 2X1TA 1DKWA 2VPPA 5B1HA 3F2IA 1JUEA 1K8ZB 2HEGA 2OCAA 4IZHA 2LBPA 2RGXA 1T3ZA 2D6FA 1HG1A 1T91A 1I2RA 2PP0A 3WJ2A 4ENTA 2QL9A 2AI2A 3IQIX 1YRHA 1U5CA 2GNPA 4GOOD 3ODGA 1J39A 2XF2A 5CTJA 1G63A 4PHFA 1A49A 3FTEA 3K0AB 1R5OA 3G18A 3T0DA 5CPSA 4DO4A 1NQTA 3H6KA 3SURA 4DVOA 4MCHA 3W7IA 1SXJD 5JXIA 4HFRA 2P8CA 1RK6A 3H6HA 2G6TA 4D6GA 2JGRA 4UVEA 1CNMA 4EMSA 3EXSA 4GS5A 4HWOA 2MU1A 4YCPA 6A3HA 3GLHB 3I9KA 3N5KA 3S2FA 2DZXA 4AX8A 3ARTA 1D7AA 5DNDA 1PZ1A 2XKBA 4DS3A 1MQ9A 1OIFA 1O8BA 1XQWA 3KS6A 4F7WA 1XLEA 1Z48A 1RVDA 2AOXA 4XYLA 1SCIA 2BODX 2VJMB 1HEIA 3WWEA 3AFBA 5SY6A 3WWCA 4NCHA 4M1OA 2C5FA 1PKMA 1S2WA 3CTTA 3KL4A 3PJFA 1BOFA 4IY1A 5CVCA 4ZXFA 1DTSA 1E5TA 3POCA 3PNOA 4LXFA 3LXUX 3T2QA 3TW6A 4NH0A 2V2DA 3HVKA 4Z1YA 4IZIA 4MUBA 3SS7X 5KOHB 4ML4A 4D1YA 2DJLA 1HURA 3LBOA 1ECCA 2XKKA 2CZEA 4Y2JA 2OTDA 2QN8A 2HCTA 4ZQCB 1QGUA 3OLIA 2CLIA 1K7YA 5I5GA 4C6HA 3GC4A 2WF6A 5BQXA 2CYCA 4DA0A 2Z3VA 3WAGA 4B2DA 3OOEA 5IT5A 3B8IA 3HYRA 1JCMP 3SJZA 1A5KC 4PTYA 3SCZA 1FX6A 3SHTA 4G6ZA 3VKKA 1JV2B 1LU9A 2YY6A 2YKGA 4J75A 2PSHA 4EKNB 3V1HA 5JJLA 2JEYA 5BYAA 3UT5B 1Y6ZA 3KSAC 2OHJA 4A05A 5I9NA 4A0QA 3NRJA 3U7RA 1IBMB 4YMVA 3AVVA 3TCXB 2EYUA 2VELA 1R9JA 1BSVA 3MMTA 4LF8B 2E09A 2YXOA 3M6MD 5HF6A 3JWJA 1YS7A 4LI0A 5KTMA 4Y67A 4N4QA 2KHZA 2ZJ1A 2PZGA 3IE2A 1E6WA 1H6DA 1RAAA 3R7WB 4B43A 1K3UB 5LB4A 2JDID 3V2HA 3WLRA 3EGDB 5KQSA 2X7HA 4DMFA 1GHRA 4PTVA 3FNDA 4HH1A 4FN5A 2WJFA 1G8AA 2K2QB 2V5VA 1RXOB 1VYPX 2ZIVB 1TVKB 1SUDA 4L3WA 1P1HA 4ZTYA 4S1TA 2FZDA 2PRLA 1EJ2A 4B9YA 4ESVA 4BL5A 3RCBA 5DM0A 4QCEA 5EKUA 3PXBA 2BF7A 2WZCA 4Q7QA 1B0PA 2JFFA 3B1XA 3AVUA 2VEKA 2GBFA 4TV9F 2C5GA 4NBTA 2VD9A 1T96A 2DSNA 4FWBA 4OCZA 3OZYA 3RU6A 2VM8A 1E0XA 4FM9A 2FHFA 3A70A 1BJRE 3R6DA 4OJNA 4X8HA 1SZNA 1EC8A 5LP6F 3JQAB 4PZDA 2F1IA 1W0KD 4ZT7A 4MZ1A 1FU7A 2CE2X 4S1FA 4KU4A 1UZNA 3I61A 3R7WA 2CD9A 2WSLA 2SNIE 4DMKA 4ZXPA 3WELA 1A27A 3PDHA 1WETA 3I4CA 4CR6A 4EVRA 1ZITA 1E94E 3GGSA 4BJ6A 3NOQA 1QHZA 3E5BA 1A5MC 3EG9B 3PQ3A 2RK4A 4FP1A 1WF6A 2XVPA 4I9UA 4PLYA 1Z6XA 3DFZA 2EKZA 3EUWA 5G4KA 3KBVA 3ZVKA 4PTMA 2M6KA 2ECFA 4EKYA 1O5RA 3ITOA 2YQ5A 2WFAA 3V8QA 3D3QA 4FFBA 3FBWA 3ZCQA 3V48A 3ZMRA 1JH9A 4W7IA 4NFYA 4QBKA 4K9QA 2HK9A 2R87A 3RD5A 4HGRA 2DZVA 5IKPA 3SE0A 2GPYA 3TTOA 4BV9A 3SIRA 2D06A 1ODLA 3FY4A 1YXDA 3TNYA 1BXRA 3BDAA 3UBTA 3OGSA 4X45A 2WUGA 3LA8A 4DQVA 3L4YA 4Q9AA 3W5CA 4W8LA 1DBRA 3SJNA 3RR1A 5BXSA 2WSKA 2RIPA 2PGIA 2NV6A 4GYWA 1VSBA 2PLJA 4L5YA 3WLAA 1RFLA 5XINA 4CU6A 2HMUA 1ZALA 5D5QA 5DNCA 2L5HA 3BX1A 5K3EA 1UKSA 5G0VA 4REMA 4DSTA 4N03A 4MRMA 5IP5A 1UM9A 2W2QA 3ALGA 2BUCA 3HXKA 5IJAA 2QTVB 2EIXA 3TQIA 3C5VA 1FWAC 4MJLA 2ZB7A 1X7GA 3DEHA 2M6LA 1Z74A 3W4RA 2BP7A 2G1AA 2Z7GA 2YZMA 3IJ5A 5JBEA 5GV8A 1B2LA 1YSCA 2FPPA 3TSBA 4C0KA 1F7VA 3VIHA 2DC1A 5TF0A 5GINE 3SRKA 1AQLA 3PM6A 1KE2A 1FMTA 2PCJA 3UPUA 4MDPA 5C5CA 3G1UA 2YN4A 5G4WA 3SY8A 4LBZA 4BY9E 3NWEA 3K6RA 5H02A 4ZU6X 3D4IA 3ANTA 4Y9PA 2A7NA 1AKMA 3PNKA 4H08A 1I60A 1I9CB 3B3DA 4WCFB 3KLOA 5HNTA 1LQUA 1B73A 3F8WA 1EFDN 2Y7FA 2R8YA 4LX8A 1GONA 4UBKA 3I2KA 4DV0B 2OHFA 1RPTA 4WCDA 1B7GO 2R1UA 3FDFA 4JIHA 5FWXB 4G5OA 3OAAA 1WHSB 3TF5A 4WFIA 5I0DA 3LN3A 1AK2A 2AYZA 4ZRDA 2QDGA 3L5KA 2CESA 5AT1A 1NN1A 3EYPA 5JSKA 2OESA 3GRIA 3D8NA 1MO4A 4BVGA 4CCEA 4D4LA 3IQFA 1ODSA 2KQUA 1XI3A 4N6EA 2QJNA 5BOFA 3S99A 1NE2A 3KL0A 3DG7A 3P6LA 2WABA 2BFOA 5C2XA 4BF7A 1E2EA 3PA8A 2AK3A 5D1HA 1TCVA 5FUXA 4TOIA 4PUEA 3QY0A 4Z2LA 5AXAA 2NXJA 3VKWA 3LRTA 1XTVA 4JD4A 4BJ3A 1QV7A 1IDOA 4UFNA 4OAQA 3P3BA 1W30A 1YRYE 2XQVA 3KDNA 3IDOA 4V39A 1QK4A 2R48A 3TFQA 1K27A 1ZOOA 4JCMA 5FL0A 4QE3A 3UXEA 4HY3A 2RC6A 1N7KA 1EHYA 1VOTA 1OB5A 3A9VA 3KB2A 2FPTA 2Q9CA 4HZUB 4IQ0A 3C8HA 5CK5A 3OG2A 3CYFA 1MZPA 4WECA 3CUFA 1W19A 3C7TA 3AP3A 3HB0A 2MSCB 3RYFA 4UTVA 2QP3A 4J3TA 3URQA 1Z4IA 3X1DA 2YSWA 3Q9LA 3KPWA 2Y05A 3H7AA 2CIPA 2HI0A 1UD4A 3O4FA 2CLDX 4IMCA 4CMBA 1S5NA 4F3KA 4C7DA 1MUWA 4ND5A 3HDQA 2Q71A 3EOUA 5F2OA 5HG0A 3AEUB 4IQ4A 3WK5A 2NACA 1I2OA 3EOOA 4XWTA 5AKGA 5H82A 2BFFA 2C1ZA 5K4HA 4WN9B 4R05A 4OPMA 4BTLA 5IS2A 3GB6A 4UASA 4DIAA 3NIDB 3LNPA 4L80A 3FNEA 2VP4A 4E2YA 1SSDA 1S5VA 4KR3A 3SUUA 2PQMA 4LB4A 1QNVA 3G6WA 1ZTVA 3NYWA 1C0KA 4NBUA 4WDRA 2Y61A 2QMZA 2UUBB 4OOZA 3N75A 1AC5A 4BX0A 4J91A 1G7UA 3OODA 3BIXA 3M64A 2P6PA 4GQRA 4GVHA 2RFLA 4JAVC 3G49A 2BGJA 4TYMA 2Z83A 3PP7A 4AP5A 5DM70 1AE1A 4PX9A 2J0EA 4FOJA 4PWZA 3N70A 4E2ZA 4FAMA 1A7AA 2P6NA 1XD2A 2XSXA 3AS2A 1OB0A 5FL3A 1ELSA 3FI0A 2J30A 4DCCA 4Q9HA 1R2RA 1JSCA 2XINA 5JNTA 4QG9A 4LS0A 5A9RA 3SR7A 1QPQA 1YKFA 1FFHA 3WF0A 1KRCC 5A6JA 1I0BA 3ABSB 1P9RA 5IBRA 1UR3M 2ECPA 2AWNA 3CMCO 2JI8A 2RHOA 1FFXB 1U0BB 4H7ZA 4AJHA 4KCVA 2EBHX 3NHBA 2OV2A 2M2IA 2HGSA 4YCSA 1E9CA 1PRYA 1ZWKA 2PCLA 2NUPB 4TROA 5IEJA 5DWVA 2GUUA 1UB3A 2O2EA 3DONA 3TLMA 1JA9A 3X43A 4QX4A 4PBSA 1EFLA 2VNHA 1H5YA 1CHDA 3DDWA 4S3DA 3S0CA 3DFUA 1PQWA 2J0UA 3PTKA 5D84A 5AVVA 5ECYA 1QOXA 4HLQB 1HFBA 4ZCMA 4LV4A 3ZEIA 5L4LA 3AICA 4P4SB 2UVQA 3HKEA 3PLRA 4PHGA 4PS0A 4OXNA 4WNCA 2XU2A 3N9SA 1G4PA 1RJWA 2Q5IA 1EDEA 3FDXA 1YULA 3A25A 1YK1A 3VVGA 5DMHA 1QATA 4ZYUA 3T1TA 3W72A 2ZRAA 3UQZA 3L1KA 2D1ZA 3RLGA 2RGNC 3PC7A 4O59O 3WQVA 3KYIB 3KJIA 3L6CA 2BPOA 4TX1A 1DYSA 4CV0A 5F1UA 5ICFA 4J3JA 1SHTX 1OY0A 1VA4A 1V5XA 2F3QA 3RSCA 4KQNA 5D7BA 2WU4A 5B4VA 5I7HA 2VTVA 4FNUA 2H11A 5DRYA 1JSRA 3BAZA 4AECA 3MTIA 4B76A 2FGLA 1QPZA 3ET4A 2OP0A 4AC1X 2X0IA 4DTCA 1U11A 3DI0A 2J9XB 2YCBA 2JAOA 1Q45A 1YQ2A 3ZLTA 3T54A 4H16A 5F2LA 4J07A 1SXJC 4DX3A 4BX9A 1Y1KE 5FEXA 1MCZA 4ZANA 3O3NB 1Z28A 4FCCA 4KERA 1L7NA 4ARZB 1AMKA 5G1PA 4GZ3A 4G36A 2EVWX 4R3NA 4Z9YA 1ZN2A 4YYCA 2OR3A 2RDTA 4M9SA 5CPFA 4QCFA 6AT1A 3EIXA 2MUCA 1U90A 4TV6A 5LZLA 1O5TA 5BXQC 2GK7A 4UOQA 2VNCA 4L76A 1FJXA 3LSBA 3VOHA 4A5OA 3RT7A 1RS0A 4BC1A 1ZGZA 1QAOA 2BZ0A 3P2IA 5DXAA 2GERA 4OQFA 3OIGA 5H3CA 2PEYA 3DV2A 2F62A 2RDUA 1JZ5A 1T41A 4M8LA 1TTQB 2BFMA 2HK8A 1XYYA 3C8ZA 2JCBA 2H2IA 4HZ8A 3EDMA 2RE8A 4LRYA 2VEIA 1C7IA 5IDXA 1AZLA 5CUQA 3UK0A 3JVUA 1YNOA 2DPMA 1UP0A 2FRVA 4Q3BA 4B44A 4L8LA 2AA3A 3KQMA 2ENWA 3GHTA 4E4UA 4HRAA 3TYAA 3IQXA 4OTZA 4YVPA 4RVUA 1W25A 3QVXA 3ITGA 2WM1A 1VL6A 4U8HA 2DZDA 2OT1A 4TS4A 3DBHA 1SKQA 1EP3A 1XLDA 3FAKA 5KSYA 1GG8A 4FLEA 1C1XA 4UOZA 1YDNA 5D1NA 3NR0A 4QJIA 1BWKA 1WCYA 2YCEA 4EF9A 3PNLA 2AG0A 3ZQUA 4URVR 1R8LA 4TKMA 1VBUA 4CG1A 1ZI9A 4CKCB 4B0OA 1KCXA 1W2HA 3NZ1A 1OY1A 2BI8A 1E0SA 2IYWA 1R3QA 2IYZA 1DC7A 2YW9A 3TA9A 5EKYA 4R5HA 3N76A 2AZDA 3EIQA 5I7FA 1T99A 1BQ4A 1C90A 1N77A 3UAGA 4Q19A 1FDJA 4Z7QB 3QOYA 3OM8A 3T4XA 3KUXA 3QA9A 3JALB 1WLSA 2ZXQA 3WQ5A 4IJUA 3UPWA 1A5ZA 1E43A 3INRA 3H8AA 1RSZA 4E5UA 4P35A 2Z2UA 4E2DA 3KT6A 4INPA 1GGKA 4P7JA 5BRPA 4GEGA 2G1PA 4NKRA 2IWRA 3CE9A 2DB3A 3BSGA 3ESBA 4HQRA 2G5WA 4LDQA 1PT7A 4D7AA 3AF4A 1US8B 1PF7E 1E3QA 4M87A 2J3DA 3VX3A 1IWPA 2WM0A 4RAOA 4JGIA 2QDHA 2ZIXB 3NPVA 2D2XA 4IS3A 3RANA 5F76A 4RY2A 4QJ1A 1FSGA 4HGPA 4EYGA 1A0OA 2WBLC 5H8UA 1MDLA 1E2PA 1BMFD 3CSSA 3M5PA 2X30A 4ALMA 1BXGA 1N5MA 5TEWA 4H4DA 2Z2AA 3DHNA 4LJSA 2ODBA 4TZ6A 3AR4A 4PRLA 1JPHA 4XBJA 1KDYA 3REFA 1RKQA 1PX8A 3WLJA 2DBZA 3DXYA 5CDTA 3QV6A 4Q4JB 1DRWA 2HU8A 1HJQA 2FRDA 1P5HA 2NXCA 3EWXA 4LNCA 4UIOA 1MXHA 3KETA 3VNVA 3IV6A 2QM3A 5IJ0B 4MB6A 1QRDA 2IPFA 3NW9A 1KYZA 4MADA 2Y67A 2A8YA 2PD5A 3K1AB 3BXHA 4FZVA 5I7AA 4RNDB 1QIMA 2OSWA 3HVJA 4GH5A 4H9GA 3TIGA 1W9PA 1B2RA 3SIPA 2OY0A 1IK4A 4O29A 4JZYA 3TL2A 1DJYA 1C3OA 2QG4A 1MA3A 3KQKA 2OO5C 1J2RA 4G0PA 2YOCA 4FKMA 1A4RA 3H7RA 1RLCL 1E6SM 4W5NA 1EWEA 1RWXA 3TVTA 4KKVA 3ZDEA 4F3NA 3PNBA 4WJKB 4C7JA 5EU9A 1OAOA 3MB8A 3QR3A 1CBGA 2ZUEA 2PFSA 3MDUA 2FWBA 3ZE7A 5E3JA 1P62B 4Y90A 1PWEA 1OFQA 3HMCA 5FTNA 3TJLA 4FYJA 1ZISA 4TSFD 3FBTA 4DR7B 3UWUA 4FR6A 3ZE0B 4U2YA 1FB5A 4ALLA 4YJ3F 1V3LA 1HSZA 3EFBA 2B20A 4DAOA 3EGOA 2E28A 3EXAA 1CJKC 1M1YB 4YJGA 1BVHA 4KYIB 5IXEA 4D98A 3IHWA 5HR6A 4KVAA 3E9AA 1K75A 2ZX9A 4Y2YA 2A30A 3OLVA 3EDDA 1SFLA 4JGDA 4L8WB 1RPXA 2FJPA 1C1YA 1JKJB 5A71A 1HKHA 1C5KA 4AKIA 3BEOA 4F92B 1BXZA 3ENZA 1QHHB 3SZRA 1Q95A 4X6YA 4M1RA 1XVUA 2VNSA 4MW9A 1RC8A 1M10A 4Q4RA 1FUIA 3TLEA 3STYA 2ATMA 4Q9JA 4CMHA 5DYTA 4CU7A 1LUCA 1KTIA 4TS1A 4PRKA 3JWEA 4QNMA 1PZGA 3BSMA 3ZVIA 3H4GA 1QSGA 1WAWA 4B3XA 5H80A 3ICWA 5KMGA 1GQIA 1IY9A 3EEOA 3TCSA 4EXQA 5CC6A 1D3HA 1XMXA 3HFSA 1TVLA 5BSGA 2A84A 1EUZA 4OXQA 1MNZA 3TCEA 3TXXA 3HGOA 1N7IA 1RI3A 2ANCA 4RE4A 1I1HA 2Q27A 1E5QA 1CDDA 3W37A 5C4IA 3HNPA 3COVA 4CEHB 1JP7A 3L1VA 2CCKA 5TV2A 2IKQA 4OUDB 1GGNA 4AO7A 5I2UA 3HE3A 1PBTA 4KH0A 3F03K 4UC0A 2ZWAA 3GB9A 3H2AA 5JCOC 2HW8A 4ZBCA 1OD6A 3QOXA 5BW6B 2VXNA 5JJ5A 4GR5A 4J90A 3EX3A 1UPPA 5FFMA 1G59A 5ECDA 2I2WA 2CMHA 3B97A 3O2NA 4MB3A 1UKEA 2V3DA 5FQOA 3F7OA 4KF1A 1H0GA 2JFUA 4LYYA 3RABA 1L7XA 3GDMA 1JSXA 3VMFA 1TFUA 4GBJA 3OSUA 2EZ8A 3DBLA 1SG0A 1LTKA 3FUVA 1KOJA 4NZ1A 4KFUA 4CN6A 4YONB 1KYIA 2R00C 1OWPA 1TEZA 3FI9A 1QP8A 1CS4C 4HOYA 4DF0A 1MIOB 4QYTA 2G4VA 4AZTA 2XUGA 3W1AA 3CCCA 2IWHA 2VZUA 1PV8A 3KEFA 2ZZNA 4G89A 4YBZA 3OOYA 4F0KA 3LPCA 2XIMA 1G01A 1C4KA 3N7TA 2PDQA 2Y1XA 1AK5A 6PFKA 2G36A 2VHCA 3R5KA 4Q33A 1P6WA 4H31A 4RETA 1HOXA 2ECKA 5GOZA 2G4FA 1AQUA 4I7VA 4RMHA 2ABAA 3E2QA 2BM0A 3GUWA 2ZUTA 4DJEA 1HUVA 2GUGA 1NW4A 2Q7OE 5M5BA 4EHJA 1XBXA 4NF7A 1IOZA 2XKJE 1EE2A 4RHCA 4RDWA 2VBFA 2X23A 4M0UA 4M55A 3G13A 2DIJA 4QXIA 3NPWA 2YZ2A 4BXOA 1BTCA 3USBA 5BP7A 1E4IA 1MENA 2VWQA 2QNIA 4MP6A 3A3OA 1XTUA 4YWHA 2JH3A 4C0BA 2WCSA 3W1RA 2HJPA 3M3DA 1UASA 3A06A 2OC9A 3WGUA 5E95A 2A57A 4YT4A 1VP3A 3AXMA 1EUCB 2WHKA 5BN5A 4PRZA 2HBYA 1WPQA 4MV6A 1M0EA 3SDZA 3C2FA 1NBEA 2G76A 3CNOA 3ZOAA 1GPBA 3DW1X 1R0RE 2HQSA 1J21A 1IG0A 3SXUA 3L6EA 3NONA 4CKXA 3WUFA 1P6CA 1XKXA 5I9BA 1C8VB 1TA4A 4NEQA 2GVGA 3AYXB 4ROTA 5GONB 4A8HA 4ZGGA 1BCSB 4XIAA 2WFLB 4I7EA 1H7NA 1HLFA 3NAZA 4J4HA 4Q00A 5AVWA 2YN0A 2QM0A 4YYFA 3PGJA 5FI5A 3M5WA 3I83A 2DW7A 3L12A 3ZZMA 1W4BA 2HRZA 3E1F1 4F2UA 3CBGA 3HJEA 3G89A 5COQA 1J0HA 1P2UA 4GINA 3C3EA 1YAJA 3U5ZB 4G9EA 1M01A 3ANVA 3BK0A 2R1TA 3MWAA 3PZRA 5HQTA 3W82A 2DFVA 1UEJA 2FXIA 2RHBA 3W75A 2LCIA 3TLKA 3PHCA 2AGKA 4ALKA 3R6WA 2XIJA 1F76A 1Y1SA 1CBUA 3GAZA 1OZGA 3VGDA 3RLHA 3EVCA 5I23A 4PPQA 5JUVA 3TLLA 1Q1AA 2QMHA 2VTBA 2VHTA 1Q3HA 3P7YA 1WDMA 3WL3A 3A04A 4AQLA 2XN2A 3L7NA 4DCUA 5LIKX 4IDFA 1IWBB 4RIHA 3QV7A 2NYRA 3HCRA 1N2EA 3LQRA 3GCGA 3HL4A 3T40A 4OZOA 3TW7A 1PTAA 4Q8MA 1Z4PX 2IF0A 4BQIA 3LEPA 2H52A 3F8TA 2HRWA 2ISDA 5LNWA 4BNTA 3SECA 2ZIZA 3VXKA 2F8QA 1JWBB 4M9CA 1OXKB 5AUNB 1NHGA 4C4XA 1QVBA 4N1AA 3LPFA 3LSYA 1HDCA 5FIUA 4RY8A 3TPCA 3M6UA 2F6RA 1E9VA 1L7RA 1SBTA 1MTOA 4XAQA 2CUNA 4EY5A 1PR6A 1O94D 1W7AA 4R3UC 1G0OA 1J5XA 3PWZA 2WFMA 2VTFA 1RAKA 3AO0B 2Q8XA 1SUAA 1TSIA 1D9XA 4X3ZA 4HUTA 4M6PA 3CH0A 2DFPA 3SNKA 3KAOA 3TKFA 3EEGA 4LVOA 2B6NA 1ZRNA 1QB7A 3T7AA 4OQZA 1IAVA 4JR0A 5I7EA 4A6DA 2JEPA 3HH8A 2PBLA 4NBLA 1Q0LA 1J10A 2WVVA 3PUIA 4P53A 4P61A 2HS6A 3M4JA 1CZLA 3TNJA 3MKKA 4GKTA 1BX0A 1R15A 1P1XA 3UATA 3WLSA 4M6VA 5KPJA 3IJ7A 1Z7WA 4E2FA 4KIEA 1EJWC 1E62A 3BXEA 4YP5A 4P22A 2O2ZA 1O12A 2ABBA 2Q6VA 3QH2A 1KM2A 1V7ZA 2H51A 2OVLA 1V2HE 2ZJ6A 4A8TA 4YVXA 4EIVA 4F97A 1N55A 4QU5A 3O5AA 3DUGA 3HM7A 3UAWA 4G1UC 5GGYA 3L4ZA 4P3OA 1PYFA 3G8AA 3LG2A 4MPTA 1RJGA 2QYGA 5D38A 2BGQA 5REQB 1JI0A 4NEHB 4PYMA 4QFCA 3RAJA 1CUZA 3H22A 1MVYA 3X1ZA 1AMYA 5I7SA 1P0DA 3TW8A 4Q3NA 1LZLA 3RU7A 2RI0A 3NI2A 4V1CA 3NUKA 4JROA 5I9MA 3FGCA 4AN1A 1YRRA 1PR1A 3I68A 1T2FA 1RVGA 4Q7BA 1TMKA 1TUGA 2CXRA 3CM0A 1TTTA 2C9ZA 3DMTC 3SN1A 1XOIA 1KRXA 3PEUA 1FSPA 4EHFA 1T9BA 3E9RA 4BU1A 5LGZA 5K0ZA 3F74A 1MNQA 2HXTA 1ZNQO 1SPQA 2VP8A 1W2WB 1Z0KA 1E0VA 1T7LA 2DLCX 3EXHC 3KU4A 4ZQEA 1M1YA 3TTQA 2XDWA 2Q1SA 1NKVA 3DXIA 4EG3A 3A9WA 1OWOA 4EDFA 3BBLA 1J2EA 5E09A 1K3UA 1F7UA 3A27A 3DUFA 3O6DA 5K45A 4L78A 4QQ3A 2WYOA 2O19A 2J09A 4DJDD 3RAGA 3V0UA 4NX5A 4U6QA 2AE2A 3MJRA 1NWCA 4RTKA 4QXPA 1EC9A 1VKZA 4OL9A 3G5TA 4F48A 4PN7A 5MGBA 3MMWA 3QLTA 5H70A 2ZBVA 3GLGE 2RH8A 1UIMA 3B1YA 1T9GR 2WYUA 1WPRA 1C9DA 5DW3A 3OZPA 2X0RA 4ARBA 1IM5A 1P39A 2P4HX 4ZYLA 1YZTA 3WH6A 3BB4A 3FG9A 3JYPA 4B3IA 4KRZA 3IUQA 5C54A 1X1AA 4R9RA 5KYXA 3VV2A 5E3IA 3TSCA 5D86A 4DOMA 4LXQA 4L4YA 1ISRA 3TNOA 4D3ZA 5H59A 4GYYA 4ZL1A 1KK0A 4KXLA 2BM8A 4E5VA 3KB1A 3GHUA 4JUDX 4F1JA 2F00A 4K87A 5C5DA 2BNJA 2YOHA 5TX7A 4MR8A 3B5IA 3CPSA 2LPMA 4CDGA 5CX1A 2IHBA 1XUZA 3R7DA 3SW6A 3KFXA 3QJAA 2QAPA 3I1FA 1X8LA 2XDFA 4A3YA 3N2KB 2Q5QA 2DT0A 2WJEA 2PODA 3EB3A 5CJPA 2PMEA 1LTDA 3BTNA 3PT9A 4MVJE 2D0PB 5KX5A 4H9ZA 4R69A 5CFMA 3X2SA 5ISMA 3G8RA 5FTWA 4BAGA 1MF7A 2YVAA 1TQDA 1OU0A 3WK4A 3OE7A 3GFQA 4A91A 2AUMA 4PNPA 1SO5A 4WUIA 1SBHA 2FDXA 1QNPA 1JZ2A 3FGNA 1Z2CA 5CB0A 1XDBA 1V9LA 4LVCA 2EPHA 4NFLA 1UWUA 2IYVA 3LPOA 4QTUB 2I03A 1GNLA 3CU2A 2YCLA 1QG4A 4UZUA 1N0UA 3ENNA 2GN2A 1VLZA 1WPGA 1OT1A 2KLHA 5L7TA 4LJ5A 3UV6A 5C1DA 2UY3A 3E53A 3LVQE 3SHOA 3N14A 3MBIA 4U3CA 3U44A 2YIMA 1DKUA 1N0WA 2IYSA 1O1ZA 3VVCA 3P32A 1MO6A 1X1SA 3EDJA 4LUSA 1XTSA 1XX6A 4HPXA 3CUSA 1UPCA 3TM5A 4N6NA 4M7SA 4YP7A 4REOA 3WYZA 4V2IA 1YVUA 1ZSYA 2QX6A 5FWYA 3KAKA 4QQRA 4DY4A 1LYXA 4JPGA 1T9DA 4RH3A 1IH8A 2PQ2A 3S81A 3A4VA 4D2JA 1IU9A 1GA1A 3N59A 3RTDA 3E0FA 4C1NB 2HEJA 1PHRA 3TI9A 4QJBA 5BXYA 6ADHA 2FJUB 1U8YA 1Z8DA 3ZWAA 3FCOA 4G5FA 5DCDA 3OTOB 2D0HA 1TVMA 4GQBA 5L3SA 4DG5A 4CNQA 1W85B 4XXHA 4AJ9A 1HC7A 3Q0TA 1K7FB 1W6TA 4FMCB 4ZJYA 3M6VA 2QSZA 4YEDA 5FBRB 3IQGX 4D5EA 2B5VA 4WDQA 1IGSA 4ZKDA 3ZVHA 3EDRA 4BFAA 2R6DA 4QTXA 4OBBA 1WX1A 4S35A 4JJFA 5I8ZA 4P5UA 3TMQA 2R4TA 3PG5A 1GZ3A 5DBFA 1XZ8A 4UE3S 3CR8A 3RU2A 4BZWA 2EPOA 1CCWA 4UMAA 1VG1A 5I78A 3KB8A 1HNYA 1SB9A 4KNWA 1ZAHA 4QR6A 3MIZA 3STVA 4CL8A 2ZRVA 2WHYA 4WKNA 1SR9A 1H2RS 2O0JA 3UY8A 4YP1A 2B1QA 4DPLA 1JQEA 4X24A 2QMJA 5DELA 1ZCAA 5TS3A 3EHEA 4DUZB 5L53A 2YTZA 4DQLA 4LVNA 1IMOA 5ADUS 2ZCUA 4HAOA 3NT5A 4F9GA 4DIKA 3KXPA 5JYDA 3TVYA 3H17A 1FWRA 3PC3A 3P9NA 2XT0A 3NIWA 2X5NA 4ER6A 3ETDA 5KKAA 1ADBA 5DY3A 4AJLA 4W8GA 1CW2A 3TAKA 3AFIA 1LLCA 5EKTA 2II6A 4IM7A 1IVSA 4YV7A 2BLNA 3Q7SA 2UZ1B 5ITZA 2JC3A 3F6SA 1TJ3A 1O89A 4P7KA 4HDMA 2GCIA 1A0DA 4YWIA 2WWFA 4G26A 1ZMRA 2GOYA 3PT5A 1DIOB 1MJ5A 1ONOA 3GU2A 1D7KA 3W7NA 2J6CA 4DL9A 1E8NA 1ME9A 5EWLA 1QGOA 3FZYA 3T12A 1UZAA 5IG2A 1GKPA 3Q5EA 3CTMA 5CT5A 1SCUA 3WMCA 5HKAA 3TN7A 1O0CA 3NNTA 3HL0A 4ASUD 2PGWA 4F5WA 3GPCA 1DPGA 3FUCA 4M1TA 2V7VA 1IL0A 1KPHA 4M8NE 2ZRZA 3KYCA 4UNLA 4LJ3A 4OFBA 3ANNA 3ZV3A 4ZU1X 1EFCA 5B6IA 2COUA 1QRTA 1XNQB 1KWKA 2I6XA 5IM51 4JL5A 2XWQA 2XUJA 3TROA 2I16A 3GH1A 1I14A 2VP6A 1E63A 4Q7IA 1JNDA 3OZDA 3LUGA 1MHPA 2XSAA 2YFKA 3CO8A 3IXQA 3V4BA 2WJZB 4QXMA 3KZOA 5AW0A 4QS5A 1CY7A 2QUAA 3BGJA 3BDKA 4M2LA 3BLFA 5IVKA 4ZCRA 1VFNA 4HS9A 1PG5A 3KB6A 1GILA 4IUCS 3FHLA 4ZT4A 2WMNB 4P58A 3M6IA 4D3YA 4OK3A 2H2FA 1S9HA 3KRTA 3MA8A 2VJOA 5K05A 1LP6A 1GZGA 3GR6A 5EJ7A 4H00A 3ZD6A 4J1NA 4ND6A 4N7JA 2FZMA 1GVOA 1ACJA 2J27A 5CFZA 4D74A 1OCEA 2A2ZA 4XUGA 3SCQA 3ROQA 4DZRA 1XSEA 5FI1B 3ZJ5A 3S3TA 3WH7A 3AJ8A 3W7QA 1N7HA 4A3UA 3KJNA 3KZNA 3UAXA 4QEDA 1KI8A 2GK1B 5KTTA 4EHAA 4QOGA 4Z49A 5SZHB 2EWWA 1N5RA 3E5HA 1ULZA 1JEJA 3PUOA 2AKAB 2WG0A 3ESZA 4FDLA 2UY4A 2GUWA 4U8GA 3D5QA 3PR2A 5J4KA 1Y9JA 2PKYX 1XAGA 3G1FA 3ARVA 3QF4B 4FZ3A 5DI9A 3OH8A 2V2HA 1K4GA 3PHIA 5C55A 1YDGA 3ATZA 5I09A 4ESHA 3QX7A 1HDOA 1LB1B 2OHHA 1MD9A 3NGJA 1FDUA 3I9NA 1HE8B 2F48A 5LJLA 4IJQA 1C7RA 1VB3A 1H2WA 4LOKA 2ZRLA 1KBLA 1NLZA 1MDRA 1GEHA 3W87A 3WDPP 3QUAA 3AR6A 3OZCA 2I5GA 5JYEA 3QJGA 1VH7A 3L07A 2NYVA 3CCFA 1DX6A 5CFQA 3VABA 3T7IA 5JYBA 1FYFA 5IF3A 1T5DX 1DWPA 1DE5A 4QSMA 3VMPA 4EF5A 1EI9A 3E4CA 4NYIQ 4JI5B 1JJKA 5H91A 1C9NA 4Y2GA 1ZEJA 3OE1A 4QGBA 4B82A 5CIYA 1CYDA 5G41A 1Q0PA 1AHPA 3IOMA 4W4QA 5C4MA 3AU9A 1P48A 3WLKX 1JNXX 1H2AS 2B0CA 4DIUA 5HQ3A 4UAUA 3STFA 2D1SA 5J8LA 5CSUA 1E15A 3DAQA 5KIAA 2BMBA 3GLTA 3JD4A 4WN3A 1UP7A 9LDTA 1LRTA 5KTRA 1SU6A 2IU4A 2FPKA 2UUCB 2O8EA 4Q0MA 9GPBA 1EU1A 4MQ6A 1MPXA 3BF7A 3C56A 2E1DA 2WMIA 3S6OA 1U1IA 4DXHA 1BMTA 2O7RA 4DUGD 2ODEA 4V24A 1YIXA 3BL3A 1EVQA 1P0NA 4RBNA 4L65A 1OINA 4FLSA 5KZMA 1OR8A 5JJKA 2ZR8A 3G6KA 4C5BA 3WRWA 3FGZA 3A31A 1MFUA 1KXZA 1IUPA 4Q22A 4WESB 4ZQOA 4HDSA 1NKTA 4IH1A 3WC4A 2W6PA 2W00A 1N6IA 2B6HA 5JI3E 1M0WA 4YAGA 3TE9A 1M6YA 3MTGA 3C2RA 2W2LA 2Z98A 5LZ7A 1X7HA 4EXBA 1P4JA 2YVQA 3ANYB 4GEKA 1JXMA 1LD3A 1IHDA 2OWXA 3U7HB 2YXNA 1D07A 3T52A 4LVDA 4G3XA 3GZ4A 4CLRA 1ZJYA 2JI9A 3RG8A 3KUKA 1CLVA 3KEHA 2H0RA 1I4WA 3C6QA 1F73A 1YKSA 3K5IA 1W4ZA 4PN2A 5T6BA 3CU5A 4OGKA 1CG6A 4NCNA 2GRUA 3CWQA 5ALVA 3L79A 4BNLA 1L7PA 3HUTA 1JE1A 2I7CA 5DQPA 4HO1X 4F71A 2YVLA 4ZMBA 1NVXQ 2GD0A 3HM2A 2AFHA 2G9QA 1EO7A 1QYWA 1XCLA 2IUYA 3IRVA 4B40A 1JHDA 2JGKA 3ZDCA 2Z1VA 2IHYA 4ODIA 3O6AA 3HO8A 2DLDA 2KSQA 4FMVA 1CV2A 4FNGA 2LIVA 4UHFA 4ZIRB 4EO7A 3AESA 1USVA 1NG1A 3OFSA 3VGEA 4AAJA 4R9NA 2C7OA 3ESRA 2EKGA 1JJVA 3H2OA 3V1KA 3LHUA 1V8OA 2GDJA 2J7PA 5KQRA 2TECE 3ROPA 3VD9A 1JDUA 4B84A 2X8BA 1YB2A 4NULA 4PS1A 1P6XA 3EBLA 4MKRA 1JUBA 4I55A 5EE1A 1MIHA 2GJAA 2R7AA 2NP7A 4GX8A 3HM9A 4AYGA 1XI2A 1XHEA 4HXYA 2VDUE 3CCBA 2ZC1A 4FEAA 1IZ8A 1XLKA 3F3KA 5UKDA 1PDOA 2VQSA 2W90A 3OW1A 2L19A 4HQFA 2QMUA 1PZMA 2E4WA 4KFTA 1L5VA 1RWNA 3FFAA 3KSZO 1CUAA 4J7UA 2Q0SA 4Z9BA 3UWVA 1S1CA 5B3AA 3R76A 2BL4A 3UV3A 3S1GA 3MWJA 5JI2E 1FP7A 1D4AA 4M60A 1WCIB 2VP5A 1GTZA 1CZHA 2EX1A 4P7RA 2WP0A 4ZEPA 4KQCA 1XAIA 4Q8UA 1SCAA 3V7PA 3QW4B 4OU5A 4H7JA 2Y89A 4LSBA 2POQX 2FPVA 1G8PA 5I7OA 4TSKA 2B0MA 3ELUA 1KQOA 4EY4A 1E3XA 5NULA 4WNIA 1YADA 3TRKA 1U0LA 3Q3JB 5CK4A 1OG0A 4Z8XA 5BYBA 4B9EA 4OWGA 4L73A 3ND5A 1H0HA 3FD8A 1TEVA 2CPUA 3VGJA 3COJA 4WY8A 3DF7A 4RLIA 1U2RA 3BLDA 3ACCA 1QHFA 4CFSA 2GYUA 5ENDA 1D4ZA 3MCNA 3TAOA 3VTFA 1I10A 4LX4A 1IYZA 5CEFA 1TE2A 1EBFA 1L7BA 1UROA 1ENOA 1CEEA 2FSUA 5CLFA 1IVYA 2UZ1A 5ITZB 5JCPA 1KMHA 1JIQA 2CV2A 4WEOA 3W5VA 1WBJA 1W1WA 2C3UA 1YGPA 4KPUA 4WBNF 4GOJA 1AHHA 5FAKA 3KEMA 4YB8A 2PC4A 4L4RA 3JW8A 4TX6A 4Y6GA 3JZMA 1SIUA 3GL9A 3FKKA 1JQBA 3UZ5A 2VWSA 4I1RA 1GQ2A 3EA3A 4N82A 4S2CA 3GLHA 1A0EA 1V1JA 3IAQA 3EXIB 4LV6A 4G56A 4WOQA 2CXXA 3PEEA 1J4AA 3I09A 2PSEA 1ZZGA 2KBEA 2R6HA 5ANRB 3K0AA 1A5AB 1SXJA 5KU7A 1SXGA 1B76A 4YJ5A 4HHEA 1QR6A 4BNIA 3KUUA 5DTRA 4G63A 3G1VA 3ZZ1A 3B6KA 3V35A 2EKLA 3VUEA 2EG8A 2ZPUA 5CYPA 2QZZA 3CRQA 2YVUA 1CY2A 2GO1A 1FW6A 4QUBA 1MXDA 5AK0A 3L67A 2O2YA 3IA7A 2Q07A 5J2UA 3VE7A 4MDOA 2CD7A 4XW2A 2PTGA 5DANA 2PL9A 3K1DA 3GQYA 2WBKA 2WRZA 1VLJA 2YKKA 3ONBA 2PUEA 4EPYA 5I5EA 3LPLA 1E1NA 4CF7A 3B78A 2O7NA 1UP6A 2IEDA 2P91A 4IDBA 4L16A 4D9IA 3MUZ1 4IRMA 2FJUA 5BW8A 2OZVA 4EF4A 2O8CB 4IHJF 4JBGA 1EZ4A 2HRCA 2FWJA 3E6AA 2XQIA 3S47A 3ZLFA 1V3UA 1RHRA 4A26A 2ALDA 4PZAA 1QHHA 3OEEA 3A36A 3G88A 5F52A 1AKVA 3LQ4A 2O05A 3EIOA 2X41A 2GASA 2OZ3A 2Y70A 4LPSA 1F0KA 1QRSA 4JC0A 4NZJA 3LERA 4GE3A 2ZAGA 3EA1A 3PFIA 1DKRA 1R6AA 4XB2A 4M6QA 2ZA2A 2J4DA 1A82A 1MB4A 2JIPA 5FACA 4AFNA 3EDYA 1TNDA 4EAQA 1W1TA 1BWSA 1XTKA 3HLKA 2QAGA 3U9IA 3N6VA 4QPDA 3UC5A 1JPDX 3FTPA 2WY2D 1R9MA 3VDNB 2QG9A 2O9OA 4CVWA 2ZLBA 4M7OA 3UJNA 2J7DA 1QFYA 1FNBA 1FUYA 2ZE3A 4FDAA 4Y2VA 2DBQA 3PFKA 2VHZA 4G9PA 4F84A 5DXJA 2AI3A 4ZFMA 1Q7GA 1L8PA 4LQ4A 3EOLA 3HR8A 5D6OA 1JAYA 3RTAA 4QEKA 4HYRA 3H04A 3TLCA 2WANA 3I8SA 4WK2B 4I5DA 3W9ZA 3LO5A 2I4RA 3W7GA 3SGGA 4RPJA 1X6LA 3QYJA 2Y8EA 4CU8A 1G5IA 3VKCA 3AHHA 2HNEA 3SKXA 3CZLA 1S2MA 5KYWA 3QXGA 3GVVA 2PX8A 2YYYA 4RJIA 4JTSA 4YCDA 4HTYA 4UCXA 3PIIA 4QJ3A 2NTYC 2CMGA 5DULA 2VFFA 2QXTA 4FLFA 4G25A 3DEFA 7AT1A 4I5EA 3SPXA 4GWLA 3IV8A 1JEZA 1DQYA 2PRIA 2HXYA 1XNRB 5J04A 4RK4A 3BTOA 5E5CA 4RJLA 4ER5A 2BY1A 3L82B 1Z12A 3LIIA 1RYHA 1ZK0A 2NVDA 1GZ7A 1TTQA 1WMFA 3L4WA 1ELOA 4I5IA 3F2VA 4RZBA 1Q7EA 1RWPA 3EF0A 3U6WA 2HHJA 2IUEA 3GFRA 1VFTA 3ML1A 3TINA 2R7MA 2VOEA 4RE5A 1QRQA 1KFJB 4UXHA 1KYQA 1B3ZA 2BMWA 2V1XA 2QYOA 4TVKA 4BNKA 4IYRA 4FXOA 1XZIA 3VPSA 1G7CA 1XWFA 1V7PC 3HCEA 4KWUA 3G9UA 4ZOCA 3AUKA 1TPEA 5LXTF 4UQPA 2X6QA 1R6VA 2V74B 2IIBA 1DV1A 2VZ0A 4ZI3A 1MG5A 4DR2B 1IZ7A 7XIMA 4C2TA 4EPTA 1MOPA 1UIRA 4DBWA 2F7SA 4UCQA 3FOFC 3AUJB 1E2NA 1XYLA 1KAQA 2XCSB 2TMDA 2E7FA 2QOEA 3PZ9A 4QT4A 1UT5A 2XMQA 3M6XA 4LRUA 3TZBA 1P1JA 1MEIA 2QCDA 3OVRA 1QYDA 4ONVA 3TG8A 4NNBA 1KERA 3FMGA 4G5RA 3PF9A 4GVXA 4YC7A 3LGXA 4M1MA 2HJGA 4DKXA 4AYWA 4MUPA 3SX4A 4CMKA 1QX4A 4IUOA 3PP8A 5IYZF 2HSGA 4EI8A 3JQBA 1UMBB 5AYXA 1Y9EA 3MM4A 4LAFA 4L9ZA 1UFRA 1H11A 5EFZA 3KVNA 1ML3A 4OKIA 1JA0A 4D0GA 2ZUCA 3NTOA 3NCOA 5JQ9A 1NW3A 4HQVA 2I3GA 4FNMA 2W4XA 4KIJA 2PGFA 1PJSA 4L28A 1GTJ1 2RHMA 1S3FA 3DFIA 2K7FA 2GBCA 4MR9A 4RZ3A 2FVYA 2JLRA 4H6RA 4Z17A 1HT3A 3TQ0A 4KEZA 5LNRA 4UDNA 2BBSA 4XX6A 4HD5A 2Q28A 3CX4A 3N53A 2OZLA 2R6GA 1G7TA 3W1NA 2J6HA 3QKEA 5K0BA 3OF3A 4ZOLF 3SCUA 4LZLA 1XFCA 3GXMA 1A98A 2Y27A 4EW6A 1U8ZA 1O57A 4WLCA 3K7EA 2G17A 2X7JA 3UB3A 3FJYA 3W2NA 3NC0C 4RCZA 4XSHA 3PNUA 1GPDG 4O18A 2Q4TA 3T38A 2Y99A 1JHYA 3BQNB 5AJTA 3CUXA 3U5YA 2CV0A 1ST3A 1YNPA 1S8AA 1USIA 3NFRA 4YL2A 3ZJKA 2DTEA 2GHQA 3C41J 4XBKA 5IOBA 4QDKA 2OB3A 3WK6A 4DQWA 3UA3A 1XZDA 3L8HA 1JXQA 1U8XX 3T2OA 3GLKA 1NUUA 1CJUC 3PRKE 3O15A 3U3KA 1Y42X 1W1VA 1RABA 2YXBA 2IFTA 2UYOA 2PUBA 4LE2A 621PA 1F38A 1FP1D 4GWEA 3D6FA 1XIJA 2WICA 3MILA 3W3OA 2TODA 3I3DA 3B9PA 4YV2A 2WA1A 4HMOA 4WIAA 2Q0QA 2A4AA 4UOEA 1US0A 1XJQA 4JY7A 3TIXB 4C7OA 2ZRGA 2JH9A 2JAPA 1HF6A 3WMLA 2EX0A 2PZ0A 4XD3A 3EEBA 2WF9A 4IIVA 1HT6A 4X7PA 4RXGA 2ZRHA 3PPVA 2JBMA 4ZI7A 4TOQA 3MINB 1V0LA 5IX8A 2CZVA 3HG4A 1NVWQ 1UBRS 4CNBA 4H9UA 3TH5A 2WR8A 1HM5A 2ZA1A 2NZ8A 2ZSUA 3AHDA 5JLAA 2ZXUA 4B4VA 3BGSA 1XVIA 4RULA 3PC8A 5CPQA 3VUFA 1GSIA 5K3AA 3HCCA 1ACMA 2BJWA 5C53B 3A6DA 4X1KB 1RMTA 2AXQA 4N4PA 521PA 4YMTA 1CTNA 3TONA 2DHQA 4UUMA 2G96A 1S02A 4DEXA 2V9CA 3AEZA 1SJCA 1U4OA 5IH3A 1UP4A 1H7PA 1TPZA 2VBCA 2JCGA 1TJRA 2QCEA 5TPWB 3VI3B 2NVBA 2E1WA 1PJ8A 2NNLD 4JBLA 1I7QB 4OKDA 2W0MA 4HNAA 4NZZA 4EB8A 2F3RA 2HQAA 1OI7A 1PWXA 5FD8A 3RVJA 3AEKB 3DOHA 5TQLA 1TMYA 2A5LA 1Z6QA 3SQNA 1P77A 3ZE9A 1HUQA 1RV8A 3F67A 1XMIA 2MHCA 3HU3A 2E4XA 2J79A 2QRVB 1L5WA 4WADA 5TGTA 5EINA 4MB1A 4J1TC 2NT1A 3U3XA 3KS5A 2BUAA 3BGOS 4NPHA 3WGGA 1FXPA 1BZYA 3YPIA 4NNPA 3GMIA 4Z7OB 2WT8A 2OO6A 1SRRA 3LFHA 1QLJA 3PDJA 1O95D 4FZ5A 4I1OA 3QPUA 4Q93A 3DHUA 1U0RA 3IVAA 3QEAZ 2W6OA 3B8EA 4ZKEA 4R27A 5KVVA 3FYTA 1ZQ1A 3W9UA 2A3NA 3LZ3A 2E68A 1FFRA 4O4WA 1FFSA 1X7FA 1QGDA 1EBUA 2OG2A 2QVGA 2CXSA 4L72A 1BKSA 1H41A 4D4MA 4R7GA 5M17A 5FI8A 4KVGA 3OHPA 1MW2A 1EHIA 3NJ3A 5F4ZA 1BJKA 3GEMA 4N18A 4PW0A 1F17A 1OABA 1QE5A 1OCJA 3DVLA 1VIZA 3IRUA 1MRNA 1PKYA 4GMDA 3TMKA 5JDIC 2CDBA 5A6BA 4NVTA 4PYIA 4RGBA 3PJRA 1RRPA 4L56A 3E0WA 4NE7A 3H6GA 1GZHB 3DDCA 3X2EA 3KXDA 4BNZA 4WKPA 1Y6JA 1G94A 2JGIA 3ZHXA 3U16A 3PG9A 1F3OA 3S27A 3DEKA 1C3OB 4RFSB 1BGVA 4PC1A 1N5DA 3WD1A 4YP9A 1XZLA 2W42A 2PIAA 4FFOA 2GD6A 3F73A 3U57A 2XWBF 3UZUA 3VPAA 1B5TA 5KYXB 2B7NA 3RVKA 3KKPA 4HOXA 1YDMA 2DQWA 1U0OC 1MB0A 1L8AA 3O1LA 1S0UA 1EUDA 3THDA 3G0XA 2XM2A 2O2DA 3DOUA 1OZAA 4JUIA 1Y5XA 2CHNA 1QIFA 3EAQA 3PS9A 1U8EA 3AUXA 2R7NA 3B89A 4JTLA 4GHWA 2JB9A 4KX3A 2XN1A 2XWDA 4CM4B 4P98A 3GFFA 2FMOA 4B92A 4KHZA 4LKOA 3TLXA 2QUKA 5BWBA 3LQ2A 1D1QA 2OBLA 1SZJG 4HXEB 1WRBA 1CFJA 3K1GA 2AX4A 3QPWA 1XROA 1KFCB 4BQNA 4FCTA 4DMHA 3GE7A 1DXFA 3WYBA 4PUWA 2RH9B 4GZEA 5E8RA 4ZI7F 2ZTJA 3L49A 1JCJA 4D71A 2XA9A 2IZZA 4FJ0A 2WFLA 5DF0A 3OCZA 4XR9A 2KBFA 4D1JA 1JB1A 1ZX1A 4J9VA 3V5CA 3E0QA 2NT3A 4UFHA 4PTZA 4MUFA 2B4GA 1TPUA 1XPGA 3IOCA 1F1BA 1XDMA 5D3QA 5BQFA 2IOQA 1SRQA 3F4VA 4IDNA 1RCOB 1THTA 4JJ4A 2WZQA 4GPBA 5BSHA 2L18A 4M0PA 4FLQA 4MYCA 4AKEA 4TVUA 5KOIA 4YP0A 2HZ7A 2BH2A 1PS0A 1EJTC 1NRXA 3V46A 3O3MB 4GO8A 4JIGA 1SC3A 1W5FA 2YLAA 1KJYA 4G1CA 5U4XA 1Q6ZA 3N8KA 4EL0A 3FYPA 2PVPA 3VDGA 4EX7A 1TM2A 4CWAA 3RSHA 1O0BA 1JDBC 4N7QA 3ITYA 1RRMA 2G67A 2EZUA 2GTIA 5HIMA 1O66A 3G9ZA 4JCOA 2V38A 3N5CA 3KVJA 1AQMA 1XLGA 1E2FA 4RE0A 2FLKA 2W67A 4FE4A 1PIWA 5KYUA 1L4MA 2YHIB 4RV8A 3ETCA 5L3SB 2ZP1A 2IGTA 5FAJA 4R6XA 2FWNA 4UUIA 3WI7A 2YV4A 2O0HA 4B2YA 5FOTA 2WJAA 2HPMA 5LB2A 5C8VA 2PJZA 5B4UA 4H3KB 2FQYA 4JOMA 1WG8A 3PQ7A 1DWUA 2JLXA 1L6IA 4KZKA 5J5CA 2P88A 2B4KA 3RVDA 5DMXA 4GGMX 1HFJA 3VHXB 3O0DA 3ZOZA 1WY7A 3IAPA 3KBNA 5BWAA 3S68A 1GCIA 1NJ6A 1I3KA 1B3RA 5AKKA 1T29A 2JANA 5AHKA 3ILVA 1FBNA 2GLUA 2D2EA 4PSDA 5DI3B 3MSXA 2ZX7A 1V0MA 3RW9A 2GSEA 2FN8A 4YAOA 3RFAA 3HQPA 1BROA 4E94A 2HR1A 1J5SA 2OAEA 1L6WA 1T0UA 2DERA 5IC6A 3I5AA 4JKLA 5D02A 4M88A 3WYDA 1ZGGA 4HHLA 4BBZA 1EK2A 3WLLA 1F2TA 2YS6A 2C2KA 4IDGA 3UMCA 4F85A 3WDRA 4RHTA 3ZDRA 1S2CA 3TSZA 5IWAB 1ZK1A 2QRKA 1R7RA 2V9ZA 2AOTA 1SELA 2LE0A 3CJPA 2QUUA 1QH0A 4S2BA 5E7QA 3TYCA 3CL6A 4BV2A 3U60B 3WS7A 5FPTA 3PXAA 1OB2A 2ZAIA 4KFOA 4YCCA 3QI2A 2HWKA 1YDWA 1N32B 3LRPA 4EFMA 2POCA 5E0FA 4PC3A 2WTNA 5AKEA 1B30A 1AMOA 5JU6A 4XB3A 3ARUA 1DC8A 3A2NA 1GL7A 1N8NA 1P2FA 5ALRA 4F4CA 3VPXA 3MWDA 3APTA 2BS9A 1KF0A 3IACA 2GZRA 4J3WA 9LDBA 1E98A 1ULTA 2VR2A 2AKEA 4KV9A 3FKJA 5CD1A 3QKTA 3ESYA 2V2CA 2Y1KA 5B36A 1JCXA 2Y85A 4EB6A 5A2GA 3ZHYA 2WZIA 3W7BA 1Z8HA 2UZAA 1V3KA 3RDKA 3Q5DA 2Z8YM 3QBUA 2A88A 4UNPA 2IVZA 4IJWA 1RLIA 3ZWMA 3CG4A 3N2EA 1GAXA 3M89A 2A33A 2G97A 2Q6OA 2GDVA 3S5YA 4PPNA 3LWBA 4FB4A 3AF0A 2V3GA 4CG2A 4P8VA 2CDAA 4PO1A 2V9PA 2PWDA 1LQTA 1F2DA 3DE3X 1NAL1 3G0SA 5CM8B 4URIA 3N9RA 1IN5A 1KQZA 4JGBA 3HF3A 4H0CA 2Y8KA 2AGTA 4UM9D 3CF0A 5B58T 3CO0S 3ZV6A 2ZTKA 1MC4A 4O4JF 4IMFA 2QSUA 4KAXA 3PXGA 3PQ6A 1UEIA 1IZZA 4PUJA 4UWMA 4JXXA 1Y1PA 4UBLA 1QHXA 1X2EA 4EBFA 1HZJA 4AYXA 5ENVA 1BCRB 4A82A 4IJCA 2Y93A 2G9ZA 4DLYA 4B73A 5E4YA 1ETHA 1JDBB 2QIPA 1N2ZA 1J24A 1MLDA 1XH0A 2COKA 3OB8A 1Q2UA 1YIAA 4GM0A 1RP8A 2ZX6A 2HA4A 5IM5A 1T2CA 5A4JA 1VR6A 2W43A 2GF0A 4XFDA 5FKJA 3CBWA 2D73A 4O63O 3W5BA 1FIUA 1AQIA 4DVGA 3ESCA 5GJCA 2AL2B 2AEFA 3DP9A 1JAXA 4M19A 1OFBA 1G55A 4K3VA 2PP3A 2A58A 4C1BA 1M04A 3WLPA 1Y89A 1K8XB 1ITUA 3EAFA 1PV4A 5XIAA 1XC7A 2P0OA 3W2TA 3W2IA 1AK1A 5JCXA 3R8CA 1I80A 3MUXA 4BLSA 5LA0A 4JP8A 1W1ZA 2DF8A 3EGXB 3RVQA 1DO0A 4EG8A 2ACRA 1KBIA 1AVTA 1D2RA 1H1DA 4LDJA 1EXPA 4MHSA 1FH9A 4D8ZA 4NK4A 3SR4A 3GV0A 1GRRA 5HKLA 1V02E 2HQ1A 3CV6A 1T8PA 4NZNA 1L5LA 3FNQA 3GUUA 3JARA 3UJ2A 4GZLA 5A8GA 1WVIA 3GDHA 5IPFA 5HR5A 1INLA 3CE6A 2IPLA 1XN4A 2NYAA 1IBKB 1XL1A 4L5IA 3WQGA 1KA9F 3NM6B 3Q3HA 1RPJA 1HO4A 1MQPA 2QUNA 5TIMA 2X1LA 1BRMA 2O5VA 5A3SA 4X7MA 4DWVA 4HPGA 3EXHB 3HZRA 4KN9S 2EEZA 4XEUA 3WBXA 3IO5A 4CNTA 2WP8J 2GFHA 5KC8A 4U2CA 2DORA 1XWYA 3D4LA 1YZKA 1HORA 1FHDA 4QPJC 2WG1A 4MVYA 2F9MA 4I99A 1G4SA 3IESA 2YJGA 4WZAB 3C3KA 5EWMB 2ZWYA 1GTHA 1EP1B 4KXQA 4H7FA 1SOUA 4AJIA 5BRQA 4B6SA 2AR7A 3V2GA 5J4YA 3UG6A 1YVEI 3E1SA 1R3UA 4H15A 3FVTA 3GDWA 5HK9A 4LXUA 4EO9A 5HOSA 1M2KA 1DBWA 3A2MA 2M1ZA 4L4PA 2BKUA 3DCYA 1EX9A 4RKEA 1ZVVA 1P2TA 1KYWA 2I8LA 2DH3A 1IN6A 2VC9A 4EEKA 1EX6A 1W34A 3NATA 1BWRA 5EGRA 3Q11A 1Z42A 2QCHA 5ALTA 1BE1A 1OFGA 5LR6A 2CGEA 4E32A 1HKMA 1FFGA 3BJFA 4TWZA 5D51S 1W36D 4JLJA 5A69A 3W2UA 5IH7A 2VFDA 1LQAA 2IW0A 3B4UA 1XVVA 5CB8A 1HT2E 2JAWA 1Z0JA 1B1AA 2R751 3T4PA 1X42A 5DW0A 3DB1A 1O2DA 5HQEA 2B7QA 4L9WA 1FS5A 2UYYA 3R0XA 1JX6A 4FX5A 5GPBA 3W7AA 1TMGE 5AHOA 1MAAA 4DJAA 2Z28A 1SC1A 1KNXA 3HKCB 2PLAA 2PRMA 3FRHA 3H5RA 4HUQB 5KX5F 3EVAA 1USUA 3IMCA 3SC2A 5A5EA 1KM4A 3C8NA 3LX5A 1LWIA 2E4UA 3S28A 3BWBA 2YFOA 5CSRA 2PAFA 4NDAA 1MT0A 1R0KA 3H4IA 1TQHA 1KM6A 3WNPA 2PE4A 1MGOA 1OK4A 1E2KA 1LRNA 2WKPA 3IIIA 1HVXA 3WJZA 3L7LA 6ALDA 1UBMS 2ZJ0A 5BRAA 4NYJR 3SE7A 3F3YA 1YL7A 3PSHA 5EUCA 3QLVC 2ZTUA 4HNSA 3E84A 3SZ3A 1G7SA 6XIMA 4POAA 4UEWA 4JR1A 3VKGA 1V43A 5JBNA 3BRWA 1NE7A 1PE1A 4ZODA 4AWSA 4ZEXA 5LQMA 5ICGA 4MW2A 2QJOA 1LEHA 2AOWA 4HNOA 3QLJA 3DKPA 3VU1A 4EXAA 1UWLA 3IAFA 2Q5LA 5BN4B 3MVEA 1K70A 5DMMA 3K16A 4JASB 1HE4A 1EUCA 3SUVA 3E49A 2GVNA 3UXDA 2AOUB 3CLTC 3EK2A 4JIMA 4LEQA 2RARA 1VDMA 3EZLA 3TIFA 3QVGB 1Z36A 4UULA 2R0