5EMMA

Crystal structure of prmt5:mep50 with compound 15 and sinefungin
Total Genus 200
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
200
sequence length
625
structure length
625
Chain Sequence
RVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and Property Guided Design in the Identification of PRMT5 Tool Compound EPZ015666.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Protein arginine N-methyltransferase 5
total genus 200
structure length 625
sequence length 625
ec nomenclature ec 2.1.1.320: Type II protein arginine methyltransferase.
pdb deposition date 2015-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05185 PRMT5 PRMT5 arginine-N-methyltransferase
A PF17285 PRMT5_TIM PRMT5 TIM barrel domain
A PF17286 PRMT5_C PRMT5 oligomerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 5emmA03
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 5emmA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5emmA02
2GYIA 1NW6A 4DM3A 5LQUA 3AXSA 3GU3A 3HCFA 2YXEA 2P7IA 5EEGA 3RODA 5HFJA 1A0EA 3DXXA 4RTKA 1K77A 5EC8A 3HP7A 3MCZA 4QTUB 1QAOA 2UYOA 3TQSA 5GP1A 3QZAA 3PT9A 4RTSA 4FSXA 4BLUA 4A8NA 3NVKI 3MGGA 2I7CA 4ER0A 2JH8A 2VP3A 3QOXA 4R6WA 2Q02A 1XIMA 1TPYA 4ISCA 2ZLBA 2ZDSA 3I53A 1V39A 3FPEA 3JWIA 3UJ8A 2H1RA 2O05A 4DCGA 2WA2A 2JHAA 1L3CA 1XISA 3KPVA 4YUXA 2H00A 5EZQA 2VZ9A 2C7PA 4YUWA 2QUMA 1F38A 5HIJA 3VYLA 1WG8A 5DWQA 1T43A 2AS0A 1VPTA 4PIPA 5DRTA 4EAYA 3NGFA 3NMUF 3TM5A 2QULA 3M0MA 3SSNA 2PX5A 2AOWA 1BC5A 5LQJA 3XINA 4RTNA 2B25A 2X7WA 2OY0A 1JTFA 1N2XA 3C0SA 2AOXA 2P7HA 4XCXA 3T7SA 2NP7A 1G8SA 3SX0A 3WSTA 1YZ3A 2WK1A 5DTQA 3GNLA 3EVGA 4HRAA 4DUOA 2EJTA 3A25A 4JXJA 1SVUA 4RTMA 2XISA 4MTLA 2UYQA 4PINA 2N47A 1XLJA 2XBMA 3KKZA 4FR0A 2UYHA 2G71A 5DRYA 3HM2A 5BW5A 3DMHA 3M0LA 5EOVA 3A7EA 1RI3A 5XIAA 4A8IA 3LL7A 3KWSA 2QRVA 3SSMA 1BOOA 5B1SA 3TMAA 5E8JA 4IV0A 2FK8A 1I60A 4YTRA 3I5UA 3Q7EA 1JSXA 1CLKA 1O9HA 1Z3CA 2ONYA 3GNXA 1NE2A 2ZBQA 3SGLA 5KQRA 1XLKA 3N4AA 2ORED 2Z6QA 6XIMA 1SQGA 3DULA 5DX1A 1YUBA 3OU2A 2GH1A 2P3QA 2ZTHA 2BR3A 3DUWA 4PYQA 4RV9A 5CVJA 2C7OA 3QOWA 2NQ9A 2NXJA 3ITTA 4YUVA 5KVAA 5LQAA 2NQHA 3GXOA 1XDZA 4U7PB 4QE4A 4HTFB 2QM3A 1L1EA 1R8XA 2EX4A 3EVFA 3DMGA 3DXZA 3B7PA 3DR5A 3GIWA 1AV6A 3THRA 3BT7A 4FP9A 3FYDA 3KQMA 1ORHA 9MHTA 2IGTA 3XIMA 1NW8A 2AOTA 4G56A 3FTFA 8XIMA 3KBVA 3EGIA 3PTAA 3P2EA 4PGLA 1XYCA 1D2GA 5GM1A 2JH9A 5I7GA 3KCOA 4DVOA 1XXLA 4HTFA 2I56A 1Q0SA 4F86A 1HNNA 4OQDA 4YTSA 4YUYA 3G2QA 4WVLA 3B3GA 5H6HA 1KIAA 1L3IA 5E8RA 1QTWA 3KU1A 5HIMA 3XISA 9XIAA 3ELDA 4FT4A 2OU4A 3GO4A 3VYWA 3ITVA 4ER5A 1IXKA 3CJTA 1VIDA 1YFLA 5XIMA 4E32A 2IH5A 4EKGA 1SKMA 2QW5A 2ZIEA 3GJYA 3EMBA 4K3ZA 5DXJA 4PCLA 1DUSA 1S5NA 4DMGA 2NNWB 3DMFA 2IFTA 2JJQA 4LG1A 5H02A 3A26A 3BKXA 3BGIA 3VNIA 3G8AA 3AAMA 4RTRA 1XLCA 2IH2A 5HIIA 5T6BA 2CL5A 2YXDA 3TOSA 1I1NA 3LKZA 4RTQA 4FT2A 2ZZMA 4GOLD 5E9WA 1KPGA 2FYTA 4YTTA 2YVLA 3NWEA 4KIGA 2X7VA 2QYOA 5B7YA 2I6GA 2FHPA 2P41A 3BDKA 3LDFA 4GC5A 1NW7A 3PX3A 4P58A 3CNYA 3OZTA 1SQFA 5LSAA 4GJJA 4BLVA 2NP6A 2Y1XA 4C08A 3OFKA 2ONZA 4P7FA 4P7GA 4CTKA 3OCJA 4EK9A 1FP1D 3I58A 5K0LA 3RIEA 4MHTA 3UJ6A 4E30A 3V97A 3GRYA 2PBFA 1RI2A 3G8BA 5EPEA 3VC2A 1L3BA 5FQNA 4MWZA 1VQ1A 5KYGA 4US6A 4ZB5A 1X1CA 3EPPA 3KQPA 4XKMA 3LCUA 4A6EA 1XLFA 4C03A 1SUSA 4AX8A 2I57A 2K4MA 3ME5A 4P7JA 2EG5A 4GC9A 3RW9A 3NWBA 3R0QA 3ITXA 1X19A 4GOOD 3VNMA 3TFWA 3LDGA 5CVDA 4FSDA 4BLWA 4XIMA 2HV9A 3GRUA 4L7VA 4C07A 3O4FA 5EG5A 1XCJA 2E5WA 5C9ZA 3BANA 2NQJA 4E3VA 2PGXA 2PX4A 1YFJA 3C0LA 3AYVA 5DSTA 2IH4A 3FTEA 1MUWA 4A8LA 1RJGA 4PYJA 8XIAA 4KDCA 4OQEA 2P8JA 1U2ZA 2B78A 2NXNA 2NYUA 3MTIA 3ELUA 3S68A 4CXMA 2OO3A 3U3HA 5FA5A 3IV6A 2PT6A 4WXHA 4CKBA 3HVHA 4R8SA 4PIMA 4R6XA 5FWDA 3BWCA 4GJIA 5AVNA 3M4XA 2PSSA 3B3JA 1XLBA 3CQJA 5D1HA 1L9KA 4Z2YA 3M6WA 5LQCA 3WQOA 4AZSA 3P9IA 2BZGA 3T7TA 1JR4A 5K0NA 5K0BA 3FZGA 5DPMA 4QDKA 4DKJA 2BH2A 2PWPA 4XIAA 2I62A 5HEKA 4Y2HA 3KR1A 3ANXA 3K0BA 3PFGA 1XIBA 3FPGA 5DM1A 4ER6A 2ZSUA 5CCBA 1P1BA 2OBFA 2QY6A 4R8RA 5EMMA 3MAGA 3OU6A 5EHGA 3L23A 1XLHA 3PFHA 5K09A 2ERCA 2O07A 3BWMA 3R24A 2AVDA 2NXEA 4PYIA 2UYCA 3CBGA 4EVIA 3PX2A 2BM9A 1JSZA 3MERA 4HGZA 3M6VA 2NXCA 3BWYA 1YX1A 2JHPA 2O57A 4E2XA 5ICGA 4LECA 1PJZA 1JQDA 2DULA 3UWPA 3GRVA 2ZWAA 3CJRA 3KQOA 4GEKA 4E70A 3SSOA 1TW2A 2ESRA 1DIEA 4IKPA 2R6ZA 2XVMA 4GOMD 5GWXA 5K03A 4MIKA 1JQEA 4BP1A 1XIHA 1KR5A 5J8LA 3VNJA 3AYTA 4POOA 1RI1A 3IHTA 4IV8A 3AALA 1BXBA 3U0HA 1ZHFA 2B9EA 4XUEA 1M6YA 5DSXA 3KPUA 2ZZNA 5FADA 2AOUB 3EVZA 4PNEA 2GLUA 5FULA 2ZWVA 3HCCA 4YV1A 3FUXA 1A0CA 1XLLA 3QYSA 4HNOA 3R6TA 3TKAA 4FS8A 1ORIA 2OPBA 5EMJA 3D2LA 3F4KA 4K1GA 2ZULA 3OPNA 2Y1WA 3EMDA 3NDJA 4FGZA 3KQSA 5DT2A 3UBTA 1XVAA 3M0XA 3DLCA 2B3TA 1TZ9A 4RTOA 2C7QA 5T64A 1XDSA 4GQBA 5DTMA 3UA4A 3HTXA 5HZMA 1XLAA 3LCVB 1XYLA 1QANA 2ZCJA 3LX6A 3UJCA 4QQNA 1I6NA 1H1DA 1QYRA 3MQ2A 3ERCA 3EGVA 3UZUA 2GAFA 4BY9E 1IM8A 1VP9A 1VLMA 1FP2A 4YMGA 7MHTA 4H0NA 5GIOE 5FHQA 2YUIA 3DBNA 3FVMA 3BXOA 3HVJA 5CVUA 3TR6A 4AUKA 1O9GA 2I9KA 2HMYB 3EEYA 2OZVA 3O31A 3CQKA 2CMGA 3CJQA 5K8VA 3DH0A 2HCVA 3G88A 4X41A 3LHDA 2UZ4A 3A7DA 3OBEA 1WXXA 4V0QA 1XIJA 2P1DA 4RTLA 4HG2A 2P35A 3GRRA 4PCAA 3A4TA 3HA5A 4GUAA 3TLJA 3EVDA 3VNLA 2PY6A 2IIPA 1MHTA 4HHLA 3KQYA 4ATNA 1PRYA 4OX9Y 1XIIA 2PXAA 8MHTA 4QE5A 4PYLA 3MHTA 3KQWA 4QQKA 1AF7A 4YTUA 4RVFA 3FPFA 4PGHA 4YMHA 4EACA 3UJ7A 2G4JA 2ADMA 3C3YA 2PT9A 4KW7A 5FTWA 3IYLW 3P9NA 4HSGA 5BW4A 5K0EA 5E1DA 5EZSA 1NW5A 3UA3A 1RJFA 4OA8A 4PYMA 1OR8A 2BR5A 5E1OA 3ELYA 2IPXA 2C7RA 1Y8CA 2KW5A 3M33A 4CTJA 5DX8A 4LNCA 5ERGB 3CGGA 3SR4A 3C0QA 4CKEA 1G38A 1YB2A 3NW9A 4OA5A 3TM4A 1NV8A 1QAQA 1BHJA 1JTEA 1BXCA 3IUHA 2G72A 3LBYA 1MNZA 3LMZA 1NW3A 3LSTA 4DQ0A 3NJRA 2V7EA 3M0HA 3QXBA 2HWKA 1RI5A 4U7TB 3HCDA 5DM0A 4RVDA 5LR6A 3P71T 4RX1A 1M0EA 3A27A 1FBNA 4J4KA 4M38A 4RYLA 4KIFA 3JWGA 5G02A 2O06A 2R3SA 3EVBA 5DTRA 4OBXA 3UJBA 3EEOA 4RTPA 2YTZA 4QPNA 3REOA 1JG4A 4M37A 3DTNA 1G55A 1UFKA 3NDIA 5EVJA 3T0IA 1NBHA 4XSMA 1O1HA 3M6XA 4B17A 1FJXA 3X0DA 4QPPA 4KRGA 5CIYA 4V0RA 3CC8A 2ZBPA 4IWNA 5E9QA 2QE6A 4ER3A 3KR2A 2OB1A 3ITYA 1D2HA 3BWBA 4PWYA 2IBTA 4Y30A 7XIMA 4GLEA 1RJEA 3CVOA 4PYNA 5FCDA 2CKDA 4HC4A 4W4QA 3CQHA 1BKYA 1EJ6A 3AJDA 2FRXA 5DM4A 3DLIA 3LECA 4HGXA 3LGAA 2ZIFA 4R05A 3M0VA 3QC0A 1JG1A 1JQ3A 1P1CA 2BR4A 2QRVB 3HCEA 3UJDA 3IUIA 2Z6AA 5AVHA 1KYZA 3THSA 5JR3A 5DX0A 1A0DA 3AWIA 4QVGA 1DE6A 1ZG3A 5EEHA 1NV9A 2FPOA 4C05A 2XYVA 1QAMA 2Q41A 3KHKA 4X61A 5JUWA 3IEIA 2J6VA 1D2CA 1YF3A 3HCAA 4LWOA 2ZFUA 3KCLA 3GCZA 3KQQA 2IBSA 3P14A 3KCJA 3TKYA 4QDJA 5K0FA 5CCXA 4LWPA 1XLMA 1R8YA 2IDJA 2G8NA 1ZGJA 1B42A 3KBWA 2OB2A 2PJDA 1HMYA 3UJ9A 2G1PA 5T67A 1IY9A 1X1AA 1XDUA 5FHRA 4E2ZA 2Z6UA 1EIZA 1RI4A 3H2BA 3BGVA 3OU7A 4DZRA 2V74B 2OYRA 5IH3A 5CUQA 5D1NA 4GOND 1EG2A 4PONA 4NECA 2JHCA 1R00A 3CCFA 2PWYA 5LQRA 2HNKA 2AR0A 4HGYA 5P8WA 4DCMA 5BXYA 2XYQA 3AXTA 3PLAE 3HA3A 4Q7IA 3BUSA 5EQJB 2PXXA 2G0WA 1FPQA 1MJFA 2AVNA 2ZW9A 5CVVA 3QV2A 1INLA 4A6DA 3KQTA 3E05A 3FYCA 3NTVA 3JWJA 5B80A 1EJ0A 3FTCA 1N7IA 2PX2A 1D8WA 1SUIA 5EHIA 2YX1A 4KW2A 5FA8A 5DM2A 1XIFA 5K0GA 1Q0TA 2ZVJA 3CQIA 1G8AA 1EAMA 1QT1A 4YTQA 1KPIA 1NT2A 1WXWA 4C06A 5FQOA 1WZNA 2B2CA 4X63A 2PV0A 3E7PA 4EQZA 2JG3A 3G89A 3BZBA 2VS1A 3P97A 3M0YA 4ZB2A 5FWAA 4RWZA 5EIFA 4RVHA 1XLIA 4ZTBA 3UFBA 3M6UA 3C0KA 5LQKA 3GDHA 2O0LA 2YXLA 1ZQ9A 1DIDA 3EVAA 1I9GA 3HEMA 5GM2A 5C1IA 3CKKA 3UVAA 3OE5A 3P9KA 4E2YA 3ID6C 1RJDA 3G2PA 3GWZA 4EKIA 2GA9A 4XUCA 1NBIA 2AN3A 5EIWA 5HILA 5H1WA 2HK0A 4AZVA 3SXJA 5GINE 3V8VA 3VNKA 4ZB0A 4CKCA 3B89A 3G5LA 3OE4A 2PVCA 3SM3A 10MHA 1XIDA 4A8RA 4ER7A 4FZVA 1KXZA 1XTPA 3ITLA 1N7JA 1YZHA 4QEHA 3FUVA 1XYAA 1G6Q1 1KPHA 2OKCA 1VE3A 2YQZA 4QE1A 3MTEA 4O29A 3TPZA 1XJ5A 4OBWA 4RTJA 4PYOA 2EJUA 5KQSA 2AOVA 3PS9A 1JG3A 4BP3A 4HHMA 5HOQA 2HR1A 3HNRA 2ZZKA 1VP3A 3OZSA 2P40A 3UU0A 5E2BA 5KS2A 3E8SA 5EMLA 4OVXA 4XSLA 4PYKA 4YV2A 5FUBA 3OZRA 2CWWA 1NKVA 1XLEA 4PFHA 1P91A 1UIRA 5DXAA 5B7ZA 3BGDA 3G2OA 2F8LA 1XLDA 4GBED 5GOZA 5IKMA 3JU2A 4AZWA 1AQIA 4C4AA 1XYMA 3HCBA 4M7RA 1R74A 2A14A 3FUWA 3O7WA 2OXTA 2P3OA 5ICEA 3KTCA 5F2KA 1XICA 3R3HA 1DCTA 1R6AA 4HH4A 3SVZA 5K0JA 3SMQA 1TW3A 2YR0A 2LD4A 3UXIA 3G5TA 3KPJA 3M70A 4M36A 5ICFA 3K6RA 1X1BA 3JWHA 4UOEA 6XIAA 3ITOA 3BZJA 3P6LA 3P9CA 1XINA 2FCAA 1XP3A 3FUUA 4E2WA 1QZZA 5EKUA 1X1DA 3DP7A 1WS6A 3HVKA 4XISA 3DOUA 1DL5A 3IUDA 1VBFA 2AN5A 1JG2A 4YUZA 1KYWA 4QEEA 3KR0A 2IP2A 5TNVA 4ZBCA 3FUTA 3MCTA 3TVAA 3VSEA 4RVGA 3LDUA 3LCCA 9XIMA 4KDRA 2EFJA 1ZGAA 3P2IA 1XYBA 3KBJA 2AN4A 4AZTA 3P2KA 4X60A 1P39A 3PVCA 3UJAA 2H11A 4DA4A 2WA1A 4X1OA 1KP9A 4P7KA 1XLGA 2AZTA 2CMHA 2GPYA 3KBMA 2FK7A 3LBFA 1F3LA 3MB5A 4DF3A 5E1BA 3VC1A 5E9JA 5K05A 2HTEA 4QDWA 3G2MA 5DLYA 1DE5A 2XIMA 2PX8A 3AY0A 3C6MA 3FTDA 3BZGA 2VDWA 4CWAA 5K01A 3EVCA 1KHHA 4E33A 5HIKA 1I4WA 3LKDA 3C6KA 3L8DA 3BWWA 3B3FA 1XCLA 4E31A 5M5BA 2GUBA 4C04A 4K6MA 5EKXA 5LQNA 2ZIGA 3G7UA 5F2NA 3FRIA 2XINA 5CVEA 1XIEA 1AQJA 3TC3A 5F2OA 5BP7A 5GIPE 3I64A 4F84A 5K0CA 5MHTA 3CWHA 2AOUA 4QTTB 1UWVA 2VDVE 1OADA 3KQVA 4PGGA 3HA7A 5E1MA 3R9XB 2XYRA 3B5IA 1O54A 4YV0A 1R18A 2AOTB 2GB4A 2VDUE 3KBNA 1WY7A 2DPMA 2PLWA 5XINA 1G60A 3DXYA 4F85A 3KBSA 4XUDA 1VL5A 2PKWA 2G70A 5CD1A 3I9FA 3EVEA 4KWCA 4GF5A 4RSRA 2GS9A 1QUMA 1EQAA 2XVAA 3BKWA 2HK1A 5ICCA 3ER8A 1GW9A 3EGEA 3KPYA 2BM8A 1M6EX 4QDPA 3E23A 3LPMA 3DX5A 3U81A 3ER9A 3P8ZA 2ZVRA 3T7RA 2GVEA 3KR9A 1SG9A 2QUNA 3FPJA 4EMSA 5E2AA 2PXCA 1ZKDA 5CM2Z 3Q87B 2P3LA 3ORHA 4KVZA 3TRKA 3ELWA 3FPHA 5EMKA 4QVKA 3GGDA 5U4XA 3NVMB 5C0OE 3C3PA 3HVIA 3OFJA 3PB3A 1S5MA 1DXIA 2GLKA 2IDKA 3KPWA 3GRZA 2ZBRA 4MQ4A 5EGSA 3FRHA 1XIGA
chains in the Genus database with same CATH superfamily
2GYIA 4BPBA 1W0JD 3O15A 2VCCA 4EI2A 4BLRA 4OH1A 1JPDX 4UPVA 4OSPA 3M1AA 4ZQBA 3NT5A 1RXOB 2OQIA 4IIUA 1DWUA 1N5IA 4XWUA 3W6UA 4X64B 1E6NA 1FA9A 3OA0A 2GBLA 3BHNA 4B5WA 3R9WA 4BBPA 1M2OA 1XF1A 1YC5A 1RHMA 5E9XA 1ESEA 1RC0A 3TSDA 4EHBA 1HE3A 3T5GA 4CL3A 2IYWA 1Y8ZA 4M2LA 3KSAC 5K8CA 1QB8A 2XVZA 5GM1A 3U4QA 2XLCA 4S0XA 1EIXA 3S44A 2I67A 3JQBC 1VCVA 1TB3A 1W5EA 4HJWA 1UC4B 2QZ9A 4L27A 2VHLA 2ZWIA 4ACZB 3ZSTA 2G5PA 3ZEIA 4AN1A 2GN8A 3HDJA 2O48X 3UWWA 4YDHB 4RU1A 5EZ6B 2BS9A 4C1NA 1YJXA 1U65A 4D8UA 4WK9A 4IDBA 3LG2A 1QONA 5AM1A 4M55A 2GBIA 1AKWA 4X00A 4L9WA 4F71A 1DRVA 2XUIA 3C2FA 1AVTA 4GQ0A 2EJVA 4ZQFA 5EKTA 4BB5A 1N7KA 4W1QA 4OQEA 1VL2A 1E77A 2WSMA 2QCGA 4L2IB 1S96A 4MDYA 3NQGA 3JD2A 1HDXA 3OFNA 5CC7A 4GJIA 3KQKA 2HJWA 2OCKA 4D26A 3BFJA 1F0KA 1FNBA 5HEKA 4Y2HA 4YHGA 3LQFA 3KEFA 3ABIA 1P1BA 5KOHB 1C4XA 3KJGA 3A3XA 3L4TA 3T5BA 1XTSA 2CBVA 2XKAA 4CCCA 4AF7A 1S89A 1F8GA 2JA2A 4D1YA 2Y7DA 3HBJA 1A76A 2I4IA 2NU8B 1MW0A 3TSYA 2WUDA 3SG0A 5CPNA 1WQ3A 3BD9A 4GE3A 4DANA 2YDAA 4ZKDA 2J7FA 4KMOA 4M51A 2KQUA 3U4IA 3SKYA 4C6OA 1FQOA 2XCIA 1OT5A 4M1SA 2ODAA 2RI0A 1KEPA 1OTHA 3WENA 7ODCA 1R4AA 3I9LA 1WDLA 3O8QA 1ZS9A 2FQYA 5L8VA 3V4OA 1X1EA 1VZ3A 1S2MA 1AN9A 4GYKA 4F04A 3P9NA 2I6SA 1X9IA 4ASUA 2GYVA 3C8UA 3W2IA 1QWGA 2VFFA 1H2FA 3EF3A 3H1GA 1WB5A 3TH5A 1JYVA 3LMZA 3V0UA 4EXAA 1ZQ1A 2CDNA 3K6JA 2O0TA 3KUDA 5BNKA 1NDQA 3DZCA 2QD5A 2PBZA 3WFAA 1MT3A 4QG6A 5ABGA 5CLGA 2YTZA 5B6JA 4I9TA 2E28A 1I3CA 2NVDA 1QDSA 2DB3A 3ZEAA 1FH8A 4Q32A 3S0JA 1RBZA 4DLFA 1CPYA 4DCTA 5GTDA 4DF0A 3KOWA 1G8HA 3DGEC 3CVOA 2QMOA 1UR4A 2GDUA 1L7MA 1V6UA 2NQ5A 1K7YA 1NI5A 5IAKA 2BKVA 2ADFA 3NBKA 3K4WA 4D4JA 1TQDA 1C9EA 1UMYA 4PE8A 3V5FA 3C8ZA 5LD2C 3S99A 1DBVO 4ZJYA 3GS6A 1XTRA 4GXQA 1Q6EA 1MTZA 3PDUA 2QLLA 1N2GA 5BW8A 1HTTA 2WYVA 2QPSA 1IK4A 4B84A 3PPFA 4CEUC 5JI2E 1UXHA 3G22A 2OT0A 4FX8A 1Q3HA 4L3OA 5TPZA 1M8FA 2Q9CA 1FS4A 2ZIVB 4OGZA 3VNKA 3L5KA 4P32A 3WQVA 1FQJA 4O29A 5F4XA 1Z32X 2CK3A 4YCJA 5SZIA 1P2UA 3ZZUA 4WRRA 3OZRA 4TV9B 4PEKA 2DVMA 2FMKA 4AZWA 5KNDA 4J6FA 3FCCA 2Y88A 1W48A 4ZGGA 5KVQA 2H1IA 1W29A 4O08A 4X1IB 3FTQA 1UJ2A 2KBEA 4B44A 4QBFA 2FP3A 1QOQA 1E1CA 2ISSD 3PKJA 1K86A 4ZV7A 3HZOA 5J04A 3ATZA 1I4WA 3LHWA 1KMQA 1I5RA 2C0QA 3GFGA 2BEUB 3QWIA 4BF9A 1KOLA 4AJ9A 3AZRA 1HL7A 5FI0B 3QKUA 4NULA 5CEFA 1ZUAX 1NTRA 4XVRA 1YT5A 3AUXA 2VR2A 4X2RA 3A9SA 2VYFA 1HF3A 1K4YA 4WH0A 3R5SA 1FDJA 1V4NA 2ZZ2A 3GJZA 3P8ZA 2WPBA 1GZ6A 3RIMA 1I1WA 3FPHA 4Q4OA 3B0YA 2I5QA 1E7MA 4AF0B 3KKPA 3NC4A 1TWWA 4RTKA 2GK1B 3VD9A 1KI2A 4P98A 4XZBA 3GUCA 1GR0A 3OTGA 2O8NA 2ZDSA 1OINA 3QEZA 4IGEA 2DEUA 1XKYA 4M1ZA 1AJ2A 2RJHA 2B9VA 3SUUA 1SKAA 3VZZA 2XN1A 1N6NA 2WKPA 2Z24A 5A2CA 1PZXA 5K9ZA 1E9BA 2VPTA 3C8MA 4MB0A 4BJ3A 4F6RA 1WDWB 5ICMA 4RZ2A 2EX1A 5HJLA 4IJMA 1LTKA 2REXB 2XVXA 3RRYA 4L6IA 3UPMA 3PP8A 2G95A 2W43A 1RY8A 2PZJA 3TNDA 3L8YA 5T4BA 4GL2A 1HG0A 3E9AA 1HNNA 1E2GA 4JQSA 3DF7A 4KXXA 1ISMA 1DAGA 3CUYA 1H4TA 2ZYRA 3SECA 5BNTA 1UH2A 3FX2A 2YXDA 3RX2A 5CJJA 3ZBTA 4GFDA 1MUUA 3HV8A 1D6JA 1NSFA 2FF7A 4CLRB 3LSYA 3V97A 4AMBA 1P7ZA 2BFWA 4P8XA 3R0QA 4LVDA 4DQUA 3N9SA 4AXBA 1YR9A 5AK4A 4NI3A 2Y0DA 3RF6A 1W0KD 1IRXA 3BVPA 1M2VB 2AUNA 1C3OA 3GFQA 4TWRA 5CIQA 3U3HA 3DVAA 4NR0A 2IYZA 1MAHA 4XIFA 4DV4B 4HRVA 4M8UA 1S5WA 3MQ4A 3UJNA 1CJUC 3DO5A 2E1RA 1EWDA 3OAAA 1OH8A 3QW3A 3CX4A 3E2SA 4BTLA 4IS3A 5H59A 3WTBA 2FX2A 5C35A 8TIMA 1DLIA 4N40A 1QHPA 3NU1A 4KR3A 3FMPB 3FHLA 2H8KA 2DPGA 3IEKA 4DA0A 4Y1RB 2QD3A 2D2HA 3M6MD 4UD2A 5AW7A 2OQHA 1ITCA 4PZEA 1EWEA 3JQFC 4R9OA 1UJ5A 1A7KA 1D03A 1JFHA 1YKFA 1S46A 1NM5C 3OF5A 4UASA 4MVJG 1JFLA 3QX3A 5BU9A 3A6PC 2WIKA 1Z29A 1U8CB 2Q1UA 3F4BA 4FDUA 4W88A 4TMYA 1W3IA 1C8XA 2BBFA 4B6EA 1W52X 3BE6A 3PHGA 5JNWA 2PXAA 3KQWA 3R7LA 4AC1X 2ZWMA 2OZKA 5C37A 2DHDA 3O3CA 1GCGA 4OA5A 4YMIA 3RREA 1CQJB 1NW3A 3QLLA 1VKHA 4X20A 3H05A 3E9ZA 5JAHA 3QUCA 4LB3A 3FNRA 3C6YA 3WFLA 3NWPA 3GJ8A 3ZHYA 2XD9A 4AEFA 3MTQA 1DQUA 3W78A 4DZZA 3PWSA 3GMDA 2X7JA 1N92A 4HLUC 4YIWA 2QCHA 2VM8A 1VRVA 4ZENA 1QW9A 2OHIA 3C3CA 1WJGA 5CPLA 2PKRA 3LENA 3G13A 2DF8A 3KHKA 3RLVA 4ZQRA 4HCJA 1O58A 2BHUA 4Q3OA 4DBVO 4QOJA 2G8NA 2QRNA 4KZKA 2MNRA 4BEBA 1IXPA 3IDZA 4F4HA 3QTLA 3OM1A 1WNFA 5AD1A 3SXPA 4D0SA 3FUCA 1RHQA 2AVNA 2IEYA 1SCUA 1SFTA 2HDOA 4CEJA 3L6CA 3W85A 3P0IA 2D5CA 2Q3FA 3AR7A 3PNKA 1UP4A 2XYVA 5BVHB 3NDBB 5G2HA 1FZTA 4AWSA 1NMYA 3C0KA 3U80A 4RPLA 4UCQA 3L7JA 1UROA 5BPFA 4Q4RA 3AT1A 1CUSA 1C9KA 3I83A 3GVXA 3UZXA 2P6MA 4NH0A 4IMJB 4HNLA 2RJGA 5K1ZA 3KU4A 3W05A 1TKKA 3T3PB 2NNLD 4DPMA 3PWKA 4ZA0A 2B94A 1DAOA 1TPVA 5IARA 3SYRA 3JWHA 1NFRA 1KFCB 2YFQA 3G5MA 2RIRA 3LDVA 7ENLA 5AW2A 1KFKA 1QK3A 3TQQA 4ESHA 5LXTB 5F35A 5T6MA 4NSNA 1QI0A 5HCNA 2ZJ5A 2JL1A 2B21A 1B26A 7CGTA 1U0GA 2X1IA 1VBNA 2VEKA 1UD3A 1B2LA 2R8OA 5ARBA 1G21E 2GZRA 4NS1A 3QWAA 3AY6A 4QTTB 2C0CA 3UCDA 1W75A 3C3WA 1BEUA 2F48A 4U39A 2NTJA 3TMYA 1UHVA 4YASA 1XHEA 3EGEA 2VT0A 4BFUA 4JIHA 3CA8A 3EMKA 3C3PA 3C86A 5IWAB 4EF4A 3THYA 4L0MA 3HCFA 3BA1A 1GSAA 1RVKA 3ZZ0A 4A22A 4OUDB 2Y62A 1PGOA 4NRDA 5F2IA 5IC4A 4O4HF 5D9NA 1QKIA 3W3AA 1AS0A 2R84A 2A1YA 5G41A 3QTPA 1YNSA 1LZLA 4ICIA 1VHDA 2PTGA 2O2IA 2QGZA 1JR6A 2NU9A 2YICA 5CCZA 1ST2A 1G5RA 1CLKA 1P4SA 4HYQA 3WLOA 2GH1A 2PDAA 5IANA 2JRLA 3QOWA 4HN4B 5ELXA 2H65A 3UMFA 1I7SB 2ZU0C 4LUSA 1ZJJA 3LG3A 1V11B 3EGDB 1COZA 5AW0A 4NHEA 1TMLA 2CBJA 2QL6A 3PPWA 4LDRA 5IF9A 2GZ2A 1MC8A 5C8XA 1O57A 1UIPA 2ZIWB 5SZHB 1N6PA 2WBKA 5G1OA 3LY9A 4CGYA 5AVWA 1CDGA 2C1ZA 4RPIA 1QGAA 1Z39A 4K3UA 4C6SA 2PWZA 1SUEA 3CLTC 3BIJA 3AIWA 1X1CA 3W4RA 1KVTA 1C50A 4YRNA 2VPWA 4GXWA 3C8HA 1CP2A 2QNIA 3DFFA 3MS2A 3J80A 1FTXA 4J9UE 5EP3A 5I3GA 4HH0A 3K70D 1EVYA 1HL3A 1N7HA 2QR2A 4CFSA 3VUSA 2CGEA 5TS3A 3FWKA 2X0DA 3R5TA 1UZ1A 4E3TA 3C1OA 4V2UA 1J09A 5K6AC 2VBFA 1SXJE 2MU1A 4X6UA 2FZCA 3AHEA 3H5WA 1MO2A 2VNKA 2W4XA 1ML1A 1I10A 1DIEA 3G1WA 3SAZA 3IHTA 1XHFA 1W9UA 4S04A 1TKCA 3TJMA 4NC9A 1GWNA 3HRKA 3Q3GE 3BLDA 4B3MB 1S1MA 4NU8X 3C4VA 2XNHA 1E1QA 3SEFA 3QPYA 1LBFA 2NZVG 1F4VA 4WESB 4IWYA 5PGMA 2GAFA 5JPIA 5H2ZA 4FSAA 2IQ5A 1CZKA 2GK6A 3DBNA 4Q03A 1BFDA 4CTMA 2HCVA 2VSNA 3CSDA 4YP0A 2GL5A 5BRNA 5BCAA 4PNZA 1PXGA 1V41E 2EQAA 1JAHA 3PTKA 3WDMA 1LRKA 4NV0A 5HAOA 1BQGA 4ZEOA 1OF6A 1T9AA 4Y7EA 3LHVA 2ZE0A 2CJXA 3TOXA 1RC1A 1ESCA 1SUWA 4N01A 2IPXA 2XCRB 1XCOA 1UMCA 4WSOA 3CE6A 3QYPA 1NBME 2ABWA 2GK1A 2VBCA 1ZGGA 1ZL2A 3ZIUA 3O82A 1TO3A 5HDQA 4Q8UA 1OSNA 1AUVA 2ECFA 5C4IA 1RWKA 5HMFA 1YA6A 4GPZA 1USUA 4OXRA 5EVJA 3QFTA 4B17A 1SOAA 4G0ZA 3DW1X 4F40A 3WLIA 2WYHA 3AO0B 2NVUA 2UY3A 2ZYWX 1EINA 1IM2A 3UKOA 3AEUA 3UXEA 2TSYB 1QUEA 1Z8DA 1JG7A 1WB4A 3FYYA 2PH1A 4BX8A 1O6CA 1QIDA 2IBSA 3UG4A 3TKYA 3OZOA 5AK0A 2HF8A 1ZISA 3DPIA 4LXTA 2FMUA 3LTNC 1TA9A 2E5FA 5M03A 13PKA 3U7RA 4KZPA 3GCDA 4AKTA 4B0OA 3CCFA 1XDDA 2HRDA 3M6YA 1EAMA 1RW4A 3VR4H 1RABA 3K4HA 2ODNA 2BZSA 3THXB 1RTTA 1QHXA 1KORA 4CDRA 4O4JB 2NW6A 5LUBA 4EGFA 4JITA 1MQPA 10MHA 4DV1B 4FX7A 2OO7A 4MKHA 4HHMA 3T3MB 2B4RO 2YJQA 4TKMA 1BQ4A 4V0LA 1J2RA 1TTIA 1GHTA 1TFUA 3TGWA 3CH5A 3PE3A 1TGVA 2AFIA 3STGA 1P6BA 3HB1A 3OD1A 3G5TA 3NEYA 4RJJA 2HBQA 4MGKR 1N6OA 3W7PA 3T41A 7PTDA 1Z0AA 4YJ2A 5BWFA 2IHTA 4LJ8A 4ZWNA 1UDRA 1UKVY 2BMEA 2CMHA 1YB7A 1KY4A 2TODA 4DWSA 4B3RB 2HU2A 3LGDA 4N9CA 1WDSA 1H9CA 3WQEA 1XF9A 3SLRA 1DJGA 1PDVA 4XXHA 2ZYAA 2DKOA 1P0KA 4RPPA 2CLLA 3LVFO 2ID7A 2QJWA 3KBSA 3AZPA 2DJIA 3VGFA 3GLSA 2VD8A 4KRFA 3IRUA 3PL1A 2ZRUA 3IIOA 4JHOA 5BSMA 1T9ZA 5FP0A 4NJEA 1G5HA 2ZAMA 2W4QA 1V6YA 2AC4A 2XTAA 3PB3A 3EOSA 3S2FA 1UUOA 4W5TA 3STFA 4NYJR 4XWAA 3DQQA 5HR5A 1MB9A 3U3DA 1QAOA 3S1AB 1BTCA 2XMQA 3S40A 4E2BA 5E6YA 3KRTA 5FNZA 4J03A 2P0OA 3UYCA 1HKIA 3FN9A 4XAPA 2V6JA 3GVPA 3WIUA 5K2ZA 1NOFA 4QUJA 2E18A 3L82B 3TAUA 3TEFA 3AY3A 1H2RS 1H0RA 3N8GA 2CZQA 3SSMA 1RRVA 2A7PA 4YTRA 2AEJA 4CPDA 1M1XB 4HZ6A 5CBPB 3APYA 3U6WA 2CFCA 2O59A 1PNOA 1WXHA 2AQKA 621PA 4FU0A 3HO8A 3H12A 4KCWA 3VDMA 1G5IA 4CQAA 2YVKA 3XIMA 3MKVA 1SK9A 2EP7A 4Q05A 1MI3A 3FSGD 3E9MA 1PAUA 4LOIA 1LEHA 9XIAA 1KI7A 1ZUD1 2HD4A 1F6WA 3ENVA 5U1PA 1PZFA 4EDHA 1PD0A 2IH5A 3K35A 4ZR8A 3DMYA 2ZRYA 4MYXA 4IO1A 3CUKA 1YL5A 3JALA 2CFIA 4KWTA 2QCLA 4CEJB 5E70A 4BLVA 1O5IA 3OCJA 3TXYA 5LU8A 3GRYA 1ZCBA 4C03A 2E5BA 2PSNA 1A8QA 4MEBA 2C91A 5IM4F 2YN4A 5I51A 4UFJA 4R81A 1UJQA 1THMA 2PP3A 2I03A 2WFAA 5LZ9A 1HGYA 2QUTA 3O1NA 3CHEA 4TYYA 3ABQB 4OHYA 4CBVA 2Q49A 1CQPA 1PWEA 3EAFA 5DPMA 1UQYA 5TGDA 3LSCA 3UG8A 4MO9A 3RRJA 4DM4A 4UNQA 3NHZA 3DAOA 4JJGA 4ADTA 4DNOA 2GZDA 2AXNA 1IF2A 1J23A 4WZBB 4F8XA 1XQVA 3VA7A 2A86A 3E35A 3E9QA 1NTHA 3ZWSA 2VH2A 1PD1A 4W82A 1HJXA 3SNHA 5A6MA 3TTOA 5A62A 1S2VA 4IIBA 2Q4BA 3QX7A 3EX7C 1C7ZA 4ZI7F 1N8SA 5L9FA 5K8VA 1DCKA 3BIOA 4JBIA 1QVZA 2HDWA 5DK4A 3RC2A 3FNGA 4QBXA 2Z28A 3FXGA 1N8NA 4K3VA 4HHLA 3L4EA 4JR1A 3DH7A 4OZOA 4OUIA 4IXDA 4L51A 4EEXA 3MEQA 1JYSA 4H3HB 5BW4A 1NM5A 1UP7A 2VF8A 3MC1A 1MO0A 3FJLA 3M5ZA 4PYMA 4D82A 3MQTA 1EWYA 3TRHA 1DEAA 4WKCA 2FPIA 4PEVA 4E2DA 1NUTA 1KV5A 4PPGA 4ATLA 4PTWA 1R2TA 2C15A 4LFAB 4WY0A 1FWHC 1DEHA 4WADA 4IXMA 5EHZA 1EP1B 4LHVA 3VOCA 1R0XA 5BV7A 2VC2B 3WZMA 5A7HA 3WZ2A 1SQ7A 4TVDA 1BHSA 1LI5A 2F1RA 3HKCA 3NGLA 3DV0B 4BWLA 3ZGLA 2WNQA 4UZFA 4EB0A 3L3BA 1PGNA 3WDJA 1FWTA 3TN5A 2PVPA 2CCRA 1ZA2A 4AUBA 5EZ5A 1UF9A 4TVBA 4YCOA 5C8VA 3ERPA 4K26A 3I4LA 4ECEA 4GVLA 2C8LA 2PDYA 2C8VA 3L8CA 1QQ5A 5CGMA 2VF4X 4V33A 2VLBA 2OX1A 4MPKA 4YTQA 1D6NA 5FOWA 2E09A 5HOEA 1K7EA 4WBNB 3L0SA 2BW0A 3L8GA 1OQAA 1T99A 4AQ7A 3RRBA 1UZNA 3OUTA 3QVVA 4Z0JA 4KEUA 1JQXA 4PHCA 3GP8A 1AA1B 1O97C 5K4GA 2H3BA 3LNCA 2M32A 5F7OA 5B7ZA 3K1JA 1XYMA 3FUWA 1CGWA 5HMMA 4D43A 3FI0A 2BP7B 2JARA 4YJ5A 2FFJA 4UQAA 2WYUA 1IE3A 3ZV6A 4Q9KA 1S5PA 3W7BA 1OK4A 4UR7A 3PZGA 1AQNA 2Z95A 1E4IA 3EB4A 5C7YA 3JQ8A 3P2KA 5CM8B 5FO1A 2R00C 5FTWA 4M1TA 4ES6A 5MFPA 4EPTA 2P9QA 4UTWA 4CWAA 1V1RB 4H08A 1ADFA 4JT4A 3D4PA 2DPHA 5M5BA 2Q5FA 4B2YA 4U2ZA 3LT2A 1AQJA 4LBSA 3K5PA 3HPXA 2BHLA 2QVYX 5EZYF 3R9XB 3G2IA 4R8MA 3PY2A 3GBVA 1KFBA 3L4UA 3LBHA 1E1YA 3GFVA 1JEDA 3O95A 3W75A 3ZE1B 3THCA 1XEWX 5J4VA 3WMCA 3BN3A 2BFEA 3PNZA 3P9QA 3DONA 5D2VA 4EAQA 1M7PA 1IOWA 2FMOA 4XWYA 2PU1A 1E4EA 4W5UA 5I5RA 4MQ4A 4QFCA 1YDHA 5TE9A 1IPHA 3MPUA 2W6PA 5FUXA 4JI5B 4ZO9A 1RU3A 3SRDA 3CLRD 1ONPA 2DQXA 3NNSA 1TJ4A 3UN1A 1TYBE 3BFPA 1BSVA 3FNHA 4EGSA 2FLVA 4B3LA 3REQA 1Y0EA 2Z4TA 4LEFA 3AU2A 3OWOA 3BRSA 2UYHA 3DMPA 3HJTA 4Z08A 5T41A 3WLHA 4B74A 3VGEA 4KVGA 4M54A 4HRYA 4C4OA 4Z17A 2V69A 5BPHA 3UOWA 5D8WA 4Z2IA 1R6DA 3DHDA 3DMGA 1Y6JA 1DKLA 2ACRA 3KBVA 4KETA 1GKIA 4FN4A 5E0FA 2W37A 1Q6CA 4RNJA 4JLMA 1AZSC 5A6JA 1ECPA 3MYPA 3CAQA 1ZCOA 3SIPA 3RX4A 3LPLA 3BLIA 2P3EA 1J24A 4AZBA 3RJMA 1IK6A 2J0EA 4KGVA 5B2ZA 4C20A 5JANA 2JFOA 1ZI6A 5LP6B 3DDZX 1JZ7A 2EIHA 2GBPA 1UMBA 3IBGA 4W7SA 3GY1A 3X43A 2FR0A 3ZZ1A 5BMXA 2PYDA 4XIYA 3T2QA 4CKBA 2DIJA 2JGDB 4FEEA 1EL3A 1UMDA 2WNHA 1NATA 3ZX4A 1T2DA 4PBSA 5LIKX 2Y63A 1E1LA 2QQ5A 2AKZA 4OPMA 2HY7A 1N5KA 3PKZA 1ZGZA 5G3YA 1Y1PA 3BMNA 4K9RA 1ZUNB 2AOUB 3HKCB 3RK1A 1J06A 2XA2A 5ALXA 3TKAA 5AIAA 4K1GA 1K7XA 2B3TA 2OVFA 1EP3B 5KX5B 1YCDA 3BIWA 3RVKA 1ZY2A 3FMGA 3I42A 4Q8QA 3HVJA 5A6BA 1M2NA 2CMGA 4UFNA 3L12A 2W0MA 1ONEA 4HP8A 2P1DA 4MS1A 4LF4B 4YI3A 4K9OA 1IWAA 5AUOB 1UADA 2ZS7A 2PKYX 2CLEB 2WVTA 5CC5A 3IVXA 4MWDA 4KYIB 2O4UX 4HPJB 6LDHA 4G07A 4UBJA 1TL7C 2JKYA 2WPGA 2FW7A 2KW5A 4NZYA 1DELA 2CLFB 2F1HA 1QAPA 1NF7A 3KJHA 1P2BA 5G4KB 3FPLA 1TUIA 3R7FA 1DRWA 1AODA 3FPKA 4Q7KA 4QPNA 3CISA 2ZQZA 3NTQA 4BC0A 3W7IA 4I1SA 4X6YA 4K5QA 3U7QB 5HS4A 3AYSA 3WEZA 1P0QA 3VIGA 3NATA 4UCWA 5B58T 4LMPA 1E9EA 4Z0TA 2HT1A 2OMEA 4LVBA 3TWOA 1KJZA 4PXAA 1MX5A 2GAIA 2BHTA 1JLKA 2BY2A 3I61A 4MNKA 1QH1A 5CA1F 1ARZA 1PWYE 4F0SA 4DHWA 4I1PA 3AHFA 4G4IA 2JB9A 1UPUA 1XC4A 4G7EA 1DJZA 2V4MA 4XZNX 2J7EA 3BF7A 3N87A 3EQ9A 1RRKA 1IY9A 4BQ3A 3G9UA 4ME6A 3H3FA 4MPTA 1WCGA 2AR0A 3T3EA 1UBRS 2CNCA 3O0FA 2P9TA 3KS5A 5AI6A 1CXZA 2VCBA 3DZIA 1XZCA 5L4NA 1K03A 2R60A 3P0EA 1OYVA 5U9CA 1PYMA 1NBWB 1K4MA 4EF9A 1S4QA 3F5QA 3MWGA 4OK6A 2R4TA 2WXDM 4QOSA 2GLTA 2IXGA 4IICA 3FJNA 3W7NA 1T5DX 1K6IA 3GU2A 1DU4A 2HK0A 5GINE 3ZBUA 2G17A 2ODWA 1EVZA 2OBMA 2AJBA 3W5AA 3QXXA 3DI0A 1I14A 3QELA 3AFIA 2ZZKA 1JQKA 4UMVA 5F9FA 4ZYWA 3KHTA 3BFXA 2FLIA 4HKTA 5C7LO 4NF2A 2CDBA 2PVSA 5IRCD 2G5TA 4WZAA 3WMBA 2A33A 3BAFA 4QU5A 3N86A 3Q1KA 2QPTA 1I4EB 1YL6A 4AIBA 1UPTA 3F6RA 1C4WA 1KYWA 2LCFA 2H4WA 3DHYA 3JQAD 5AI4A 2ZJ1A 2Z2KA 5E1BA 3JQPA 1TVLA 3DVRX 2XHEA 2PGNA 2PFKA 3O0KA 1MO4A 2UXCB 3IPLA 5G1YA 1GEHA 2ZIGA 4OLJA 1SEVA 3S29A 4ZCPA 5J5RA 4DVJA 2J0QA 1DT3A 2INFA 4MGIR 1XDJA 2A3LA 2DT5A 4YJHB 3JYLA 4EHFA 2LTAA 1NUPA 1XJ0A 4HFNA 2IYUA 2RH9B 1LJYA 2OHFA 3LWDA 4QECA 4FHEA 5BWCA 2XMSA 3A04A 1OY1A 4YJ3B 4GHWA 2LE0A 3CUGA 3NAMA 3VR4A 1S8OA 1PFWA 4CKXA 1D9ZA 1UWTA 1OFEA 4QTUB 1UD4A 2OZ8A 3MLEA 1FSZA 4G1KA 1VGAA 4AY5A 2YZ7A 3VR6A 5AK3A 3O6AA 5KC9A 1PK9A 5IYZB 4AZ0B 1B43A 2PGEA 4RLIA 3A25A 1SVUA 1O1ZA 3O8OB 1LDBA 1TEHA 3OA3A 3W6NA 1YO6A 2VP2A 3KB6A 3QEJA 4R1QA 1M6JA 3LX4A 3EEQA 4O2RA 1EP1A 1XTTA 2H48A 3SX4A 2YQ4A 2HISA 5ALQA 5TAOA 1NDHA 4YUVA 3IP8A 1EX1A 2QZJA 2NO5A 2QTGA 1Z6PA 3ECQA 4WX2B 3THUA 2YIJA 2YB4A 2MSKA 2NTVA 4J0EA 5CTAA 4I4NA 2IZ6A 3GB6A 2DQYA 3MUXA 5XIMA 1IIGA 4LJLA 2PPLA 4IZ6A 2J9FB 2QAGB 4DV3B 4CF4A 2C77A 4PZ0A 3A26A 1RVDA 3WO1A 1CJVC 1V48A 3TRIA 3UF0A 5T6BA 4L4PA 4PMZA 4RD6A 2FZ8A 4HR7A 3FYUB 3HXOA 5A6LA 4QQ3A 5KX5A 4GI6A 3CNYA 1YZFA 4EW3A 3FDXA 1XCPA 1JHQA 3PN8A 2P2ZA 1VQ1A 3NIBA 1OFVA 4HMQA 3VDXA 3GBSA 3A3KA 5EJAA 1HL8A 3BANA 5FOUA 1B41A 3U3RA 3QSYA 2Y77A 2ZE6A 1L5WA 1MBZA 4CU6A 5IT4A 5F7XA 3SIRA 1MW1A 1XLBA 2Y6UA 4Z2YA 1WUFA 3LX5A 5DSZA 4D5GA 4N3NA 1KQGA 5BWOA 2ZU6A 5EMMA 3RR2A 2P2SA 1XAIA 4IPLA 2LBPA 2B7PA 1AHNA 3D0QA 2GM4A 4OHOA 2Q2WA 3IELA 2NZ8A 4TSFA 1T9KA 5AECA 5LKAA 2W6IA 1V1RA 3WL6A 4EOGA 2YWBA 3L6RA 1E2PA 4RC9A 4IJ5A 3QKEA 2EKGA 1KKOA 4DX3A 3GR7A 2YLAA 1Q3KA 2Y1KA 1SCQA 4BNUA 4MA5A 2Z2UA 4AUKA 3K9WA 3LO5A 2NSYA 3UXKA 1KQZA 3CQKA 2PCQA 4I6GA 3HVUA 1RRPA 1ONBA 2DQ4A 2VNJA 4MRRA 4E51A 1JT2A 5JAZA 5KTNA 1PWLA 4AJ2A 1MEOA 1VFFA 1G9HA 4H3KB 2Y27A 3NW9A 4WOZA 2BLLA 3CO0S 4YBRA 4NZ9A 1E59A 4MB1A 4S24A 3NS7A 3AZOA 4R54A 1OG6A 2P2GA 1HJVA 3PFWO 5LLSA 1WZKA 2OZ3A 4HXFB 3VU8A 3AVUA 3T0IA 1OWQA 2WFLA 3HYNA 3RUHA 3VNUA 1JFFA 2PD5A 4GBGA 3O16A 2BR4A 1G5AA 5A6SB 1XZDA 2YYZA 3SZLA 1ZJ4A 2WJJA 3LFUA 3K9BA 1Y9DA 3T5MA 3NQ7A 4R1OA 4EGJA 3LC2O 2SCUA 4G1VA 2PZLA 4PL1A 3V1PA 1CUYA 1QIHA 4JUBA 1P1KA 1BF2A 1NYTA 3QV2A 3UPDA 1H1YA 3FYCA 4CZ2A 2GGEA 4M0LA 5C5YA 3TBKA 2R1TA 4TQ9A 3LKBA 1G2PA 5JXJA 3BZBA 4EPDC 5CFOA 2DW6A 3RSQA 3UVAA 3K73O 4BUZA 1XCMA 1EIBA 4YQEA 1YZLA 4YH1A 3CLMA 5DGCA 1RHKA 1G6CA 3ARSA 3OI7A 3N2ZB 3L46A 3P0FA 1BKSB 5CLWA 5KYVA 1NE7A 1URPA 1KYXA 1WLSA 2GYWA 4JYPA 2R44A 1XFBA 5KOJA 4GZ3A 1N9GB 5KNDD 4JEJA 3U7VA 1P91A 2ODQA 2QUUA 5LMZA 2NMVA 3PEWA 3LM7A 1X8LA 3TB6A 1P62B 1P0BA 4GZLA 3AHJA 4E2WA 4FHGA 1ZIPA 1GYPA 1QVRA 1IT7A 3TXAA 3MSCA 1G8YA 4FGJA 4D25A 4BS9A 1TAGA 3JVAA 1H8ED 3EXAA 2O23A 4F91B 4KAJA 5AIBA 1OBHA 2GN9A 1KO0A 1JWBB 1Q19A 4JS3A 4K36A 3LBCA 1SR9A 1CNFA 5A4MS 1P7PA 1M10A 3P9RA 5FAXA 1XZJA 2HUPA 5A5VA 2PKWA 1G20E 2M98A 3TSWA 1JNDA 1YHZA 5CT4A 1E9LA 3R8CA 1DJLA 4ZCTA 4R0NA 5HA7A 1FDIA 3LT0A 1IR2A 5I3DA 4DMLA 3S27A 1VENA 2HMWA 5BN3B 2A0YA 2DW7A 1CLEA 4LCSA 4GDMA 5CT6A 2N75A 3PG5A 1W17A 3W53A 4LC0A 3HVRA 1II8B 3OEWA 4P7RA 1AURA 2Z8YA 1WIWA 3ARVA 1L7VC 2ZRPA 1AA6A 4LV8B 1RA0A 1BVNP 3FWNA 3PRHA 2XVLA 1X9GA 1XELA 2O3UA 2PBGA 3ENQA 2GXSA 3EVGA 4LVOA 3LTPA 1GYNA 4E3WA 3OQEA 4R9RA 4CF3A 4GX5A 4IR7A 2Q2VA 5FEZA 5TMBA 3LA4A 1RI3A 3U7QA 2VP4A 4HNVA 5E8JA 3GA5A 1KZYC 5H9WA 1XW8A 2J66A 2YV2A 1YIXA 1ZW6A 1W2GA 5FI1B 3VKAA 1WKDA 1VECA 3WUFA 5JZMA 2PZ0A 3M1YA 2F9RA 2OT1A 2E21A 4RO0A 4Q4HA 3R20A 3U9TA 1ZGHA 1E4LA 3BV7A 1WXZA 2FHCA 4DT1B 4ZT2A 3RU3A 1AS2A 4KMRA 1T36B 1RSZA 4QUKA 1A72A 1LOLA 4J9VA 1W36D 2V7VA 5DN1A 1TRIA 3VZXA 4HPXA 4IWWA 3KYCB 5BSWA 4HK6A 3W1PA 1SQFA 3WGIA 3NHJA 3F3YA 4E30A 3R3SA 4D6EA 2RGYA 1DJOA 1S4MA 2A3AA 2OG1A 1V6CA 3GCGA 1P1XA 3DJYA 1R50A 2H1VA 4YAWA 2NQJA 4AYGA 4MJ3A 3O6VA 3RLFA 2HLDA 4MS4A 1JLMA 2ZIAA 1Z45A 4AICA 1TF2A 3O3NB 4BJ1A 2PAAA 4RPKA 3RSOA 3ZDZB 3ONWA 3WDKA 4HMNA 4RH0A 4ITRC 4M6WB 1CPUA 3WNZA 2O92A 4ZO7A 1OKKD 5DNYB 1VE9A 1ORWA 4O33A 2YJZA 1EM8B 4OHUA 4ITVA 3BHMA 1XG4A 2OX4A 1EFVA 3MT8A 3NQVA 3EUFA 1HY3A 5E6RA 3PHCA 4XCQA 1GARA 2ZJ3A 3H2ZA 3GXTA 4DBWA 2FWNA 3OE1A 3NDJA 4DNQA 1H5NA 3PCXA 3KP1A 3QBJA 4AY7A 3GJ6A 4G5DA 3VGGA 3TLGA 1H1DA 5F5XA 2NVBA 3PC0A 5T3YA 2GVDC 2FZDA 4ETNA 4JTHA 1X8FA 1YBAA 4D9CA 3VOFA 2PQ6A 2BE9A 1OLXB 4F1JA 2WKSA 4FN5A 3EZ9A 3MAAC 4UQLA 1KFEB 3HBFA 2ADMA 1C3OB 3OLXA 4RSHA 4U7JA 5JNSA 4L8WB 4QRDA 2FDSA 4CU7A 2XVNA 2I5PO 1BMDA 4C7MA 1BGAA 1OWOA 5SWUA 4NRRA 4BNNA 4JICA 3QNUA 2DIEA 5BUZA 4IF2A 3D4IA 4P22A 1MJGA 1RBAA 3AHTA 4JBHA 2J0VA 3KUMA 4XIGS 3QVMA 3QGMA 7XIMA 1U0HC 3M5VA 4W4QA 4ZTZB 4AI6A 4TX9A 1UH5A 2J41A 4INFA 5C9WA 1HKWA 3RFAA 2Y5SA 4MEJA 1EX7A 3SHTA 2EG9A 3CNNA 4LXHA 2Y1LA 1P4HA 1TE6A 2APJA 2E9SA 3T1GA 4S1PA 4BC1A 4IDDA 2GRUA 3ZV7A 1F6KA 2TECE 3W8RA 2B81A 4N6GA 1EC7A 5CX1A 3PXGA 1XRSA 3HL0A 1O94C 2OQLA 2PH7A 3C5WP 4HZIA 4JYAB 2CJYA 2BFFA 3JXEA 1OFRA 4YREA 1NT2A 2C3ZA 1DWIM 4AMZA 3IA2A 2I14A 2Q9AA 3UFBA 4LXXA 2ZCVA 3EXG1 4FJ2A 5BQ3A 3RUCA 4JMPA 1R47A 3OOYA 4X8MA 4A8JB 3LNMA 3OE4A 4M46A 2JLAA 1GRNA 1FSPA 4BI6A 1GOOA 2H52A 3C1TA 2WM0A 3S5JA 3FI9A 4WLEA 1KTBA 3MOSA 1WXFA 5BR8B 1SG6A 4GBUA 3EFOB 5BMVA 4AU1A 4TYMA 2FWBA 3BCDA 1WL8A 3A1CA 1JXMA 5EXDA 3W90A 2IEDA 4WCDA 2Z1MA 3VC6A 5EKUA 2WCSA 1K1EA 4AD4A 3HPRA 1G0OA 2AN5A 1ADDA 4NENB 4JYFA 3AMLA 3BWEA 3GVGA 1Y65A 3W86A 3HJGA 3QNMA 2UU9B 3EX1A 3TW7A 1KAOA 2OQYA 4IQLA 1ORVA 3MIZA 4UMEA 3DFKA 1FFBA 3U40A 3WZLA 3PC6A 2Q6OA 2VZSA 4HOYA 4MDOA 3F4CA 5LD2B 3D3AA 1M76A 3GRIA 3VR5D 4J90A 1AMNA 5CW2A 3R3JA 3Q87B 2L82A 2I2DA 4IIXA 4BBZA 1ISZA 1QO2A 2FWMX 2COEA 2ZUFA 3DOIA 3GRZA 1KKUA 5BR4A 2QE7A 2HW8A 2XDQB 2CMFA 3H1EA 1YNYA 3S1UA 4ZC1A 1NI3A 3WYEA 2H1RA 3P27A 3N6XA 5CLFA 5EZQA 5D3QA 2I87A 2RH4A 3RB8A 1OAOC 1KFCA 1TE2A 1Y6RA 5BY2A 2NQZA 3M0IA 4P33A 4DIFA 5FPHA 3SX0A 3U1TA 3OIYA 1KAMA 3N13A 3DUGA 3DMHA 4LYKA 1M5RA 1G5TA 4CM9D 4D6HA 1MIHA 4B85A 3NUQA 4EG3A 4AMUA 4NG4A 3QZEA 2VHVA 1KXVA 1US2A 2AI3A 1DAPA 5ILOA 5CCDA 1DDOA 3AESA 2O8CB 3KVVA 3S55A 1NPDA 1V7AA 2FMTA 3B4UA 3GJYA 1I7QB 1T7LA 1EPUA 3LFHA 2PZBA 4BO6A 4OU5A 4IQGA 3LKZA 4IMPA 4N3AA 3AEZA 2AG6A 4GRAA 3ZJVA 1PKLA 3ESXA 3QFCA 1NFGA 1W4ZA 2OO5C 1EDEA 2BKUA 1ZBQA 1FWEC 2YINC 1VPYA 3C24A 4JWKA 3JATB 3KTFA 1O2DA 3QEKA 1V71A 4M3NA 4D9IA 1RALA 4Q7JB 2DWOA 2V2HA 3L5LA 1EI9A 1OYCA 1YFJA 3MP3A 2IH4A 5AKZA 1E3WB 1C4OA 5KTSA 1HT3A 3EOUA 3HCWA 3IV6A 1TZKA 2XUQA 5JQGB 1VCGA 2EW8A 4F3TA 1GZVA 3DEIA 3L6DA 1ABEA 1KEKA 1B7GO 1AQ0A 1SCNE 5JWRA 3G8EA 3T8QA 2DSNA 2ALRA 6ALDA 1O6BA 4V39A 4HA3A 3TNOA 2GEVA 2QM8A 3E2QA 1Q20A 4IYRA 1ODCA 3BWMA 3DHPA 1FP4B 2V5KA 3UK0A 1Q66A 1XTUA 4GEKA 3TLZA 5DRIA 3KCNA 4FGUA 5L95A 5BQXA 1C81A 4GA8A 4Z7JA 1MTOA 4NNJA 1IBLB 4AJHA 5B3AA 3UAOA 1LCIA 1XLWA 1MAWA 3WLTA 3ZG6A 3LHTA 4RPQA 2I91A 5E4FA 3LZ3A 3SRHA 3CMJA 1NDVA 4TVOA 4GUFA 1OZFA 2I9KA 2XKJE 5CX1B 3IGUA 1WBJB 1C30B 2TYSA 1NJFA 2BKAA 3VXKA 3U56A 2M6LA 3NGXA 3QE9Y 1XS2A 2F8SA 5L9AA 4PC8A 4OXYA 3E12A 1HP5A 4U7TB 4F3CA 5JYDA 3IMFA 2QDGA 2X9VA 1JAYA 2HVOA 3A27A 4KIFA 1A4MA 2Q46A 5HSGA 3CEHA 2FYMA 1G55A 3LY5A 3P94A 5I45A 4NQRA 2WEKA 4Q4MA 2HCFA 2Z2XA 5GJPA 4GOAA 1VI5A 4IF6A 4LWQA 4TMCA 2ZIFA 4OGFA 2Z00A 4CNSA 4CIWA 4CU5A 2WAAA 1LLFA 1ZOPA 4BVLA 5D5QA 1KMHA 4Y2TA 1I5OA 3TQPA 1Z8HA 5KTYA 1CB0A 3PHLA 2I1VB 5EKYA 1PKXA 3H2BA 4QUEA 4JLSA 2D54A 3U61B 4Q7IA 3HU2A 3KQUA 4NIMA 3GX9A 3IV9A 4HYRA 1MZVA 1OVGA 3LRXA 4G41A 4XZIA 1NVDA 3ORFA 3T9EA 4A0GA 5KZMB 1EGVA 3ZE2B 2J4CA 5CXSA 4ED9A 2R25B 1XYVA 1YUNA 2MINB 2AN3A 4MFEA 4Q8NA 3ZDAA 3IJ8A 2R7AA 2ZQYA 4TTRA 4P92A 1RK6A 4LUTB 4C4XA 1ADGA 2RHBA 1J39A 1M3SA 1ZB5A 1P4AA 4J3JA 1E55A 3OZIA 2NSLA 4DXHA 1JX6A 4H83A 2LD4A 1S2NA 3M70A 3TAXA 2WMIB 1W1UA 3CXRA 1ZONA 3NH6A 3UYLA 1TV7A 4BTEA 2QE7D 2H6EA 4OQMA 5KMGA 1ZI8A 3Q6MA 4IBOA 1NBAA 5LYJB 3K1ZA 2PX8A 3FTDA 4AWBA 1JR3E 1VI6A 3L7BA 4HAOA 5I06A 2WWFA 3ILVA 4WI1A 5MHTA 3KQVA 3ETLA 1DXHA 1SOWA 3CT6A 1UM9B 1XSEA 4L8VA 1NA5A 4C0KA 1KB3A 3IQIX 1PNVA 1RLDA 4G67A 2CNWA 2NPOA 3JSXA 4QXQA 1BG6A 1MRAA 9RUBA 4NZ1A 3IH5A 1HWYA 4IXNA 3WH8A 4O2AF 2AFIB 3M6AA 3Q15C 3UAYA 3NEPX 4GPIB 2BGIA 4YALA 2VHZA 1OB5A 3RO7A 4CU8A 2XKKA 3HRHA 3F9RA 1U5BB 1YZ3A 3JZFA 3CKYA 2UZAA 5F77A 2GPSA 1UWQA 3IBYA 3MVTA 3NETA 3A6ZA 4E38A 3BDVA 4N5NA 4F4JA 4C6QA 1N2HA 1UKOA 4YP7A 2J4GA 2HWGA 1ZJWA 1RJ9B 5FLXA 2CHUA 2RGDA 3GIWA 4EUFA 4CD6A 4NNOA 1Z4LA 4FD3A 1L5LA 3OTWA 5D04C 1GVRA 4CVWA 3MLBA 4M7WA 3NOEA 4FPXA 1IOLA 1ZTVA 1P1RA 1CCWA 3KRSA 4JEQA 4L4LA 1XLCA 2OLSA 1BVWA 4HQKA 3TQKA 1QQTA 1GPUA 5CLHA 2JEQA 1F06A 1R10A 4HWSA 5KSWA 4QGHA 3T1TA 4RESA 2VH5R 2ZX8A 2EBNA 4QODA 2W3ZA 1GEQA 1J20A 5A03A 4MKNA 4GUJA 3FZEA 3BTNA 5KX5F 3TJ4A 3QU4A 5TMEA 3WIOA 1W30A 2ISCA 3LO8A 3EB2A 3A21A 2GK4A 4ENRA 3OHSX 1FWGC 2I62A 4Q1VA 1DFIA 2NW0A 5F2MA 3PQ3A 3MMUA 3BVJA 1VKNA 4BAUA 4PX2A 4IJWA 2Z6VA 5KKCA 4D71A 4PVDA 2VWHA 1ZP4A 4BX3A 4D45A 1N2OA 2J6XA 3IPAA 2B9EA 2FR1A 1U6IA 4XOUA 2Y66A 3EVZA 3K8OE 2JGJA 1UZ4A 3PZRA 2R8RA 3T5AA 2C57A 2BGTA 4S3DA 1A4UA 3OPNA 3RD5A 3A1NA 2B99A 2WU4A 2C7QA 3QPVA 1XPYA 3V32A 1T0HB 3UFXA 5J5CA 3LU1A 3VMMA 3IMKA 5C54A 4X3ZA 1IMOA 1MGOA 3WLRA 3GNSA 5E6UA 3OIDA 3O31A 3WNDA 2Q6IA 1XIJA 2V6IA 2IE8A 2RCNA 4ID9A 3H5NA 3IIIA 3HG7A 4O53A 3W72A 2ATCA 4CN6A 1YE3A 1U11A 3R2JA 4QS6A 1SUXA 4FXJA 4MMWA 2IF0A 4L8GA 1PNQA 3DBRB 4KQHA 2XDQA 4DABA 4L6DA 4ZTYA 2ZRFA 5BRPA 2R3SA 1X70A 3CZGA 2ZVQX 4I7EA 4JY9A 4CIBA 3RYIB 2G1KA 1GQOA 3EIHA 3FEMA 5EIEA 3M81A 5DM4A 2O1EA 4KK4A 3F5KA 3MXTA 3CWNA 2D2FA 1WWKA 4DYEA 5MF6A 1GNTA 1AXRA 3QX8A 5JUWA 3SIMA 3TW9A 6ABPA 2G76A 4B5XA 4JOCA 1RM5A 3WLSA 1XDUA 1QCDA 1E1FA 4ND7A 5JHGB 5F4BA 3BRCA 1YDOA 1EG2A 3H4TA 2G1AA 3TIMA 4OY3A 2VYVA 3DKKA 2G5WA 3EEZA 4I50B 2XVGA 2JFFA 4K03A 1YSCA 3FTCA 1P74A 1XTKA 4WDTA 5DFAA 4NY2A 4JX9A 1KPIA 4I9UA 5EI5A 4UVHA 1OEPA 1TKBA 3T9DA 3GE7A 3OOJA 1Y4ZA 3VPAA 5ITZB 4H9ZA 1H1TA 3IUMA 4PTMA 2AC2A 1PQ4A 2KPOA 5F52A 4FOKA 2AFRA 3IAQA 4GVXA 4IH4A 5HM8A 3CB4A 3USBA 4GBED 2CZEA 4KWVA 3FB1A 4H7FA 4R31A 3R3HA 4DQKA 5JFTA 1FUYA 2YY6A 4A27A 3LGXA 4AQDA 4X95A 3Q11A 5CPFA 1VLHA 3TIFA 1TZBA 4MAMA 4W9NC 2VP5A 3U13A 3IOMA 3QSRA 2J6IA 1AD4A 1TUFA 3I9V1 5BSFA 3B85A 3G1YA 1A2QA 3OKCA 1LNQA 4N6EA 4F72A 1H6BA 3GROA 5DH9A 1PAMA 1QX4A 3W5HA 3SFKA 1AL7A 3MB9A 4TXLA 1XI3A 1UL1X 4PQGA 1Q6GA 1IG3A 3MINB 2WUWE 3KHUA 3UEOA 2X8JA 3SIZA 3TJXA 1Y8RA 3KVJA 4K9QA 1H23A 4WBNA 1HDOA 4XTCS 2W91A 3OX4A 5L45A 3VO0A 3NVMB 4NY1A 4IAOA 5DT9A 4AS1A 1UKPA 3KJEA 1M8PA 1F2TB 4S2EA 2QV0A 1K6JA 1NWRA 1CJTC 2EG6A 1DJIA 3B6ZA 5HFJA 1TJNA 4J16C 3IMCA 5KSWB 5IDQA 2PYZA 1HZJA 1VSQA 4HCHA 1O96B 2BHRA 1D3AA 2K6GA 3LUBA 4HZUA 2REBA 2XQFA 1M0TA 2H00A 3B8UA 1K92A 4TQUS 3WBKA 3RU9A 4QTXA 1DBPA 2UUOA 3AOEA 1D3CA 2D69A 2H4ZA 2BXYA 4D9MA 1SUPA 3R3WA 2ZJ6A 2P3QA 1DAMA 1I2QA 1E4OA 4JQZA 1R8XA 1G98A 5LOVA 5DGTA 5FKYA 2B83A 1LPMA 1CLXA 2WUGA 4BJ6A 1GGMA 1U0BB 2NV2A 1Q6ZA 4CNOA 1D2EA 1N2IA 2ATXA 4FYHA 3D3JA 4KPUA 3W7OA 2GEUA 4EKGA 2QSJA 1ZM4A 3EK2A 3WRWA 3WL7A 1KBJA 4G5RA 4DSUA 4PZUA 4QYWA 1ZNQO 1Q1ZA 3VUPA 2WR8A 2C5BA 3EQ8A 1R2RA 4JC4A 4Q3AA 3GDGA 3V42A 2K4MA 1TREA 4LOJA 3OC0A 4ZYZA 4ZAGA 3R7WB 2ZUMA 4R5EA 2O3JA 1UPCA 5EIAA 2VVTA 4KDCA 1LVHA 4LN1A 4Q3KA 4H7CA 3DE0X 3WGQA 2OAP1 5DYYA 3HVHA 3MUEA 4IP5A 1E94E 4LAKA 2OQVA 4I8YA 1JR4A 2Q71A 2O0HA 4Q3NA 4OI2A 3T35A 4IS2A 4XLZA 4D4IA 1OHHD 4G36A 5DXFA 3ZHZA 1CUBA 4LECA 3P9SA 1GPKA 1Y5MA 4ARVA 3SC3A 1KF0A 3V8QA 2AIRA 3M16A 3EWDA 4NJKA 5AJUA 5G1TA 2WIDA 3JS5A 4I5IA 2X3YA 2VAPA 4HLUA 4JD5A 3L0GA 1UC5A 3NQ41 3RF7A 2QB5A 1CUEA 1Y5WA 3M5YA 5CFMA 4J7RA 5D00A 3RYFA 4D92A 1OXSC 3MWKA 4ERXA 5KBYA 3B9BA 2PUEA 2WPNA 2JFHA 3I34X 4X41A 4Q47A 5BYKA 1E3XA 1UT5A 1JCLA 3DDWA 3UGKA 5JH7F 3BHJA 5EZYA 4GZIA 2VWQA 4JN7A 3M1LA 4M76B 3OBAA 3R43A 2CUNA 5IYZF 4Z2GA 4LNCA 3R6DA 1NNI1 4O28A 3IT2A 1YAJA 5ITZA 1VHWA 4DG9A 2V7EA 3CPEA 1GPAA 3A9IA 2DLDA 2ODEA 3H2IA 4RYLA 4V2IA 2PS2A 3IJPA 3VKVA 1KBIA 3IUJA 3JARA 1E6EA 3DTNA 1Y42X 3PTZA 1XVUA 5HFNA 3WJ7A 1U0RA 3CUWA 1FX1A 1RCUA 4JTIA 3ETGA 4LB4A 1U8ZA 3RI3A 1C1DA 3CEPA 3HM7A 1JG1A 3TX2A 3ZQUA 3H0EA 4HOXA 2P9JA 5KPJA 2XN0A 3SYNA 4B48A 4NABA 3AYZB 4L75A 1ISRA 4FHDA 5GV7A 1FZQA 1XEFA 4MJMA 1L2UA 1AJ0A 1P7TB 2BF4A 3DESA 3I23A 2YXOA 1XHLA 3E9CA 3IOEA 2DY1A 1K3UA 2QPXA 5DLPA 3UYKA 2B82A 1IM5A 1UJCA 4ZO8A 5FA8A 1OI2A 1Q0TA 1JEJA 3RUEA 5K01A 2W5FA 4DQXA 2A5DA 2IUZA 4CMIA 4EY7A 1U5CA 3OMWA 1WXGA 3OE5A 3T9BA 5DMLA 5H1WA 1EEPA 2WIFA 4Y2PA 1RAIA 5AKQA 1KDVA 1V7QA 3PC2A 1BYUA 3BCUA 5DCUA 4AYXA 1PL0A 2WFZA 3PBYA 5TGZA 3KJFA 4AYWA 4N7MA 2C2WA 5IBXA 2VQ6A 5AKJA 2QG9A 1UBFA 3BZJA 2R97A 1ZH0A 1NT4A 4AO7A 2G1UA 3V5OA 4U02A 1DXQA 4NESA 3U44B 3GM8A 3DFIA 5AKLA 1QNQA 4L72A 3ZVKA 2R4QA 4LF7B 1JJAA 1N7GA 3UJAA 1SMDA 3VHXB 3A36A 4CF6A 3LKDA 1W9XA 4HBKA 3W29A 2XXAB 3T7EA 4KGJA 2HNBA 2HDJA 5DI3B 1JDTA 4WCFB 3I64A 2J13A 1D5WA 1H2XA 4F0MA 1PF7E 2W11A 4JTEA 3THDA 1U7TA 5K8JB 2HJSA 4LYYA 3CRRA 3I9FA 4QO7A 1VIAA 4ADUA 5M04A 4EG0A 4E4TA 1Z5VA 1TE1A 3NBZC 4LMBA 1E32A 8RUCA 1TVKB 5HJ5A 3B04A 5I7VA 1ZBKA 3ENNA 4ML4A 1J01A 3L0BA 2W6ID 4BV8A 1A0EA 1W3KA 4Q16A 3W2JA 3IE2A 4FYPA 3RGTA 2ZAIA 4ZREA 1AO3A 4R6WA 3H6HA 3ILSA 2WA2A 1L3CA 1O5KA 2WTXA 1M2FA 1I0LA 1QCZA 3W24A 2PRYA 3KSDO 2IE0A 2VF2A 5DW0A 4AZIA 4Q15A 1GHSA 1BCRB 4RUKA 1J4EA 1VC2A 4MINA 2AMYA 1BROA 2ISDA 4I1OA 5H3HA 5H4HA 1CIUA 2ZBQA 1Q1NA 5AHEA 3MILA 3VMFA 1MV5A 2E87A 2ATEA 2IXVA 3WC4A 2HROA 3R5FA 4L5IA 4E2VA 1B31A 3I2YX 3CVXA 3NA8A 1ICEA 1SFSA 4ASTA 4O2AB 3HJBA 3URQA 2QLMA 3ZD8A 3ONEA 4NMLA 2G3MA 4WPGA 2PL5A 3IUQA 1H4QA 2E1WA 1AFSA 3SIWA 4DXVA 2IH2A 4KT2A 3STTA 4N0QA 3NWEA 3MBOA 2NXIA 2HNHA 3LCJA 1V5WA 4BKNA 1DXFA 3IS4A 4DMUB 3FYPA 3OMXA 3MWLA 4R7OA 5ENLA 4RFSA 2QORA 3UJ6A 3RU8X 4OEHA 3P61A 1T3HA 2XZ9A 2PRMA 4I90A 4PUEA 3WSWA 1N5JA 5FSDC 3VNMA 4O4JA 1L4YA 4DSTA 5I7SA 1QYDA 4A16A 4QITA 1RKQA 4DGSA 1E2JA 1UWUA 2ST1A 1HNWB 5HFAA 1AO0A 1EFLA 5G0WA 3UPBA 3H7RA 3BWCA 1VIMA 3HN3A 3UK6A 3KKQA 4E1BA 4P5UA 1WEKA 2GDJA 2MYTA 4LS0A 3DZFA 5AXAA 1IWOA 2QHXA 1X86B 3C45A 2XE4A 2OBFA 4M21A 4U2DA 3VZQA 1U7XA 1J8VA 4G1EB 2AN9A 3PX2A 2A3NA 5A4JA 2YZRA 3RCBA 3DDSA 4JODA 2DULA 4R3NA 1JE1A 2RK6A 2QX4A 5AC7A 2RKWA 4QOIA 3K9HA 4EL0A 4L4XA 4MJZA 5CAEB 1UBCA 3JTEA 4KYUA 1X8XA 3PZNA 3P8IA 4M8LA 4HFMA 2JLVA 5AJVB 4FYYA 4GQBA 1H8HA 2F55A 4C1LA 2PWVA 4DNHA 4RKQA 4LUYA 3CV3A 2CKRA 1O89A 2AG0A 1I7LA 1VIZA 3L2IA 2WMYA 2BVNA 2IKHA 2VELA 3ME3A 3MINA 1JGMA 2REQA 5DNAA 4EPVA 1L1RA 1XG3A 1PRYA 1PZMA 3STCA 4J2OA 4UJ3A 4QEZA 4EACA 3MJYA 4GXMA 5FNVA 1U7HA 1FWAC 1RJFA 4JLAA 5CG1A 1FNCA 4GFIA 4ND2A 5TF4A 3W5BA 4N6NA 3SMVA 3Q5EA 1FDTA 3CX7A 4PNPA 2DOKA 4LFBB 4POCA 2FZMA 1FBNA 3MJEA 1MEEA 5GY7A 3AXIA 2JFXA 2P1ZA 1PX0A 3OJFA 3KUUA 1Q1BA 5AHNA 1KEEB 3UMJA 1EO7A 2QE6A 3QEMA 1FP7A 1WDKA 1EK5A 1IY0A 3IAUA 4FFLA 1Z6XA 5JRDS 4A0SA 3PULA 4FNAA 1ZN2A 3NXKA 1FSSA 5SYAA 2YZGA 5HW0A 1RR2A 1RRFA 3K8MA 3PJXA 3AHHA 2A0NA 2J78A 3AKCA 2ZJ0A 5AVYA 1SW0A 2QXUA 2QQFA 1VQTA 2AJLI 3L79A 5JBIA 4XQ6A 4NVRA 4A73A 3UEQA 1G4TA 2Z1WA 3TEJA 3O9VA 1UPAA 1B23P 5DK6A 3H5RA 4MVJH 2G82A 4IQFA 5J2UB 3UUEA 1SCUB 5E3HA 4CKCB 4JTSA 4FC7A 2H2FA 3BILA 5LOVF 2HZ7A 2OAQ1 4KPYA 4TV8A 5HQ3B 4B6JA 2HR1A 2IRWA 1W47A 1C3EA 3DOEA 4KE9A 1TAHA 3JU2A 3HCBA 3BOXA 4UD6A 2FKPA 3P9CA 3QMWA 1NDZA 1YQTA 2H08A 2WWHA 3AF3A 4L6OA 3C56A 3HFYA 4HNQA 4HZGA 3WTCA 2E40A 1GCOA 3DWIA 3KR0A 4FB7A 3F90A 4XD7A 1GLNA 3NQDA 1ODKA 1ZGAA 3LQLA 2V9CA 3OM9A 4AJNA 3PJRA 4JTTA 1Q14A 2ACUA 2XZTA 4YP6A 3W7JA 3DHVA 2O8BB 5A1TA 4GDFA 5CVEA 2OFFA 2RHLA 4PLZA 3H6KA 5DNUA 2AI1A 4K6GA 3NLLA 4BIMA 1O54A 3JPYA 2XF2A 2O8DA 5GJVC 5JFGA 4BNDA 1ZC3A 4K1WA 4HMPA 4QRNA 1TLFA 2YC2C 2HX1A 3FHQA 3RYFB 4LFYA 1DPMA 1J79A 2VQEB 1XYGA 3V8RA 3JQ6A 4QX4A 3K0FB 4Y2GA 4DIAA 1CX9B 4W84A 1RXYA 4K9MA 1LS6A 1TYDE 1RYDA 1DKUA 3LHZA 1G8PA 1ZS2A 2DPYA 2ZRVA 3F4VA 1E5XA 1V8EA 1W94A 1Y6ZA 3IB3A 2IYOA 1CU1A 2Q3OA 1V7YA 1R3DA 5A9TA 4GPNA 3VIMA 1FRQA 1SZPA 1FCUA 4LUJA 4P4TA 4KUHA 3KRBA 3KJQA 3EXG2 1P6XA 4CN4A 3NI2A 2BONA 5C1DA 3T34A 5CFNA 1GTHA 2BHZA 5DBGA 5ALWA 3FH0A 1W5OA 1NY6A 1DT5A 4WT7A 4LIPD 2QM3A 2JS7A 2GYUA 1MVYA 3R3VA 1ZUHA 5BWLA 3UT0A 3G85A 1O5TA 1JPUA 3P2EA 4PG8A 1CQIA 2ZREA 5GVJA 1E2KA 4CQNA 3B60A 5D6NA 4ZVLA 3EMBA 1UQTA 1JDFA 3LS9A 3ARPA 4M98A 2VK4A 1QQ6A 1QORA 3BK1A 1K3UB 1Q2XA 1IIHA 4CD7A 4GRSA 3E0LA 4ZCMA 4ZSTA 1JRBA 4U7HA 1I4DD 1ZEJA 3R44A 2FSVC 2EF9A 1KJQA 3JR3A 3EIWA 3NWBA 3N0TA 3T9PA 4GOOD 3ZDQA 3AR8A 4RL4A 2J7CA 1DQXA 3VNQA 3KQLA 1EWRA 5LDDC 3E3NA 2CKSA 3FE2A 2NXNA 1A9PA 1RXCA 3M5DA 3EJWA 3KHDA 1T0OA 3ETDA 1Q6DA 1B4DA 3P84A 4LVCA 3KTAB 4L56A 1ZYUA 1NVAA 4CGZA 1JAKA 1E63A 1K1DA 5AHFA 5ICGA 1VL8A 3T78A 3SSOA 1EFCA 6GPBA 2A5GA 1S7GA 4DSOA 4PL2A 5L3VA 4PFQA 1Z0FA 8LDHA 4DV0B 4XKJA 2XB8A 2QTRA 1XLUA 2GEBA 4JS0A 2V6MA 3NO1A 2OJPA 3OETA 2OKTA 2MMGA 2FQQA 4LVGA 4NT0A 5DM70 3F2IA 4F12A 2IA5A 2VDNB 4E0BA 3MJVA 1FFAA 4LYJA 2HMYB 2ID9A 5LGXA 4R9NA 3TQ0A 3JQRA 4LY3A 3MXOA 1UKEA 3B3QA 5AICA 3PDWA 4AW7A 3EA1A 4KRZA 3ESRA 3DNPA 1C9YA 4PGHA 4LYAA 1S2WA 2WJAA 4V0ME 3LA6A 1XXHE 1R9YA 5EKSA 4TMXA 3IQGX 4XIJA 2NSXA 2PJRA 3X1DA 5JIBA 3UETA 3OJXA 2H2WA 1ZK0A 2IQDA 1U3TA 1XF0A 3RRZA 4P0TA 1Q1AA 4V0RA 3OZGA 5THQA 1DKWA 3TG2A 4Z4HA 3WQSB 2W70A 1PZEA 5LWHA 4CFYA 3VSBA 3IUYA 4I08A 1O03A 4BFSA 1ADOA 1CBUA 2J6BA 5M17A 2RCYA 2P8BA 4BQOA 2PIDA 1LY1A 3M49A 2ZXDA 4BU0A 1R6VA 1HX0A 2PDIA 2ZI7A 4QLAA 2NAFA 5AWFC 3L9CA 3SJCA 1KV8A 5TBOA 2NTNA 3ND6A 3V9AA 2RHCA 2IHNA 2R2GA 4PYSA 4WKHA 3TXXA 4LNUB 1TIBA 5LIWX 4D6DA 4CNPA 4GMXA 2PH5A 1I4NA 4X63A 4PLGA 3DG3A 1UWAA 3A58B 2WVAA 3CVUA 2BHYA 4IHQA 4EIVA 4LHXA 3WK5A 1GEEA 1XKLA 4HMOA 2AHOA 1E6XM 5E0OA 3W9YA 3QF4B 4BRWA 4FW8A 3EGCA 3TI9A 1DB3A 2JEOA 2MWMA 1QFSA 1TUGA 1FE8A 3SBFA 1HRDA 1I30A 4PFHA 3NEVA 4AJEA 2YR0A 5I8ZA 3TUZC 2J9YA 3QMVA 4AZ6A 2BGKA 4MQLA 1UMDB 4NBLA 2UZ0A 4JEUA 3LRMA 4DF2A 2V5BA 2NADA 4AB4A 5DIZA 5LKRA 1U9YA 4DAEA 4PCVA 4FCCA 3LYEA 3FVVA 1X39A 4ZV4A 3FRIA 4DDWA 5LA1A 1XUUA 3CR3C 3WSVA 2XQGA 3OTHA 3PUDA 4V27A 5DCWA 1F76A 3T4CA 3LPAA 2O8FB 3ABSA 3A2LA 3CYFA 2B61A 4BO2A 4HHHA 1BDBA 3AEXA 1X7GA 3ADCA 2A58A 1VJTA 5IDIA 3A8TA 3C5QA 1IZJA 5DHTA 4RGQA 4YFVA 1XTQA 2ZI6A 4H17A 2FSGA 3EFOA 2I7CA 4DS3A 2XOKD 2YZKA 1JLSA 1B74A 1WBHA 5E09A 4C6KA 4I9FA 3S1AA 4PCPA 1T43A 1U2DA 5IBQA 2ZYGA 3QVOA 2B25A 4J9JA 5NULA 4B82A 5C5DA 3I6ZA 3BAXA 2INGX 4IFKB 2ECPA 2OYCA 3NM3A 3A7EA 1ZVQA 1BJRE 2YOGA 4UREA 4C2UA 7GPBA 4JL2A 1Z3CA 3ILHA 4B31A 2JAOA 1OKKA 3ZNOA 5FV4A 4GKVA 2BKXA 3EG9B 4OQZA 3BCFA 1W37A 1GR1A 3WO0A 1UWCA 3OH8A 3W6OA 1NFPA 4WEOA 1YASA 2EZ9A 3OQPA 4X93A 4XYGA 3PHIA 4EJSC 2C5GA 2KWIA 4MUJA 3BCHA 1KWKA 3VIHA 3A6KA 2MMCA 3ORRA 3BE7A 3PHHA 2RGXA 3WP1B 4UMAA 5LSMA 3F8WA 4DM7A 1XJQA 1VCFA 2YFKA 1Z6GA 2PD9A 1P4CA 4P7JA 3UBMA 2OCDA 3GT7A 4FSDA 4UDYX 3NUGA 3GRUA 2CLMA 2OV2A 4QJ1A 2VAMA 1WBDA 2PJZA 1RCQA 4EVQA 4JN6A 3TXVA 1LBSA 2GSJA 4DUWA 5CK5A 2BFDB 3M4XA 1SXJA 1IIBA 2P2DA 2NT1A 3F2BA 3NYQA 3FFWA 2BVTA 5A3VA 1E5LA 2HCJB 3INPA 3UJFA 1EJSC 3WYAA 1MEWA 4RETA 3A06A 5THXA 5FFNA 1OXVA 1GCYA 2XWBF 2V59A 2I76A 1SJBA 5WRFA 4C6NA 3ROFA 4D8WA 4GPTA 1W34A 3UWPA 1VB5A 2J27A 2WM8A 3N6QA 3DR3A 2IW1A 1ZU4A 3N2MA 4OXIA 3EZLA 1WAMA 1WD7A 4BKMA 3S2LA 3ZU4A 2YCKX 1GNLA 5EL1A 3NVTA 1MEIA 3TS1A 1WDWA 3UXMA 2GR9A 4C5AA 2Z4GA 3O7UA 4OL9A 5I7EA 3TWAA 1OFIA 1BWPA 4NBTA 3JATA 2MSWA 2HVMA 3VNLA 1MC1A 1Q16A 3GLHA 4BE9A 3HB9A 4Q4JA 1GVEA 1NPTO 4F66A 4ZODA 4PE5B 5AJXA 3H2HA 5EMNA 4QFBA 1DO8A 1KDZA 5H91A 3SJZA 5CJ2A 4B3KA 1GLVA 2GTPA 3KXLA 3F5SA 3BORA 6TAAA 5B1HA 3SFTA 3G2JA 4EHDA 4YVVA 1H61A 1UMKA 3LYLA 1IN5A 2ZBPA 3RU6A 4IPTA 2RAFA 2CBGA 4I4