5EMMA

Crystal structure of prmt5:mep50 with compound 15 and sinefungin
Total Genus 200
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
200
sequence length
625
structure length
625
Chain Sequence
RVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein arginine N-methyltransferase 5
publication title Structure and Property Guided Design in the Identification of PRMT5 Tool Compound EPZ015666.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 200
structure length 625
sequence length 625
ec nomenclature ec 2.1.1.320: Type II protein arginine methyltransferase.
pdb deposition date 2015-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05185 PRMT5 PRMT5 arginine-N-methyltransferase
A PF17285 PRMT5_TIM PRMT5 TIM barrel domain
A PF17286 PRMT5_C PRMT5 oligomerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 5emmA03
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 5emmA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5emmA02
1SQFA 1X1DA 4QQNA 2O0LA 3GRZA 2OY0A 3PX2A 4PINA 2QYOA 5E1OA 1RI3A 2B2CA 4GJJA 3F4KA 3AY0A 3EVZA 4IV0A 2HWKA 3AYTA 3LBFA 5E1DA 2AN3A 1KP9A 5B7YA 4RVDA 3G2QA 4GLEA 1PJZA 5LQKA 1R74A 4X1OA 5K8VA 8XIAA 2ZWAA 1VP9A 3MQ2A 4RTQA 2JHPA 3HCBA 5EHGA 3KR1A 3HVJA 3OCJA 4RTOA 3N4AA 1A0EA 4YUYA 2PWYA 2NQHA 4RVHA 2IGTA 2GA9A 3FRHA 3HCEA 3UJBA 5JUWA 3EVFA 3QOXA 3G8BA 3E05A 4QVGA 2HMYB 2AR0A 5T67A 3SSOA 3BT7A 4OQDA 3UJ7A 1G60A 1R8XA 2ZIFA 2HR1A 2PWPA 1VPTA 4FT4A 2GLUA 4PYMA 3PS9A 1Z3CA 7MHTA 4IKPA 3B3FA 3EGIA 4Y30A 1ZQ9A 4FSDA 5H1WA 4YUVA 3KTCA 3PX3A 2B3TA 4EKIA 5MHTA 3PB3A 5EGSA 2NXEA 1D2CA 4XUCA 1XXLA 4BLUA 1AQJA 1KPGA 2ORED 4WVLA 4CTJA 5C0OE 4FS8A 5EMMA 3SX0A 3KCOA 4QDPA 1D2GA 2AOXA 3BGDA 1NKVA 1NT2A 5CVUA 1XLKA 5H6HA 3G8AA 3LL7A 3FTCA 3M70A 3EVCA 3ERCA 1FJXA 5EHIA 3P9NA 4ISCA 4YTTA 3EMDA 3BANA 2CKDA 2PX5A 4WXHA 3M33A 1JQ3A 2ZBQA 2ZBPA 3BXOA 4R6WA 5DX0A 1XIIA 3OPNA 3A27A 2K4MA 3ITLA 3FUVA 3R9XB 4POOA 2YQZA 4X63A 2F8LA 3MTEA 4KRGA 2YTZA 3IEIA 3ME5A 4E31A 4CWAA 3IV6A 3CGGA 3XIMA 5XIMA 4P7KA 4EMSA 4US6A 5GP1A 1BXBA 3HTXA 5GM2A 5FQNA 2ZBRA 2YXEA 3KQYA 5FCDA 3B5IA 5BW4A 3KU1A 2H1RA 3NDIA 3GCZA 2HK1A 2ZCJA 4E3VA 1M6YA 4CKEA 1DIEA 1QYRA 3EVGA 4AZSA 3DUWA 5K09A 3K0BA 3LBYA 4GUAA 4YV1A 2XINA 3B7PA 1X1CA 5E9WA 5KYGA 5T64A 2JHAA 4QDWA 4RTPA 3BKWA 2C7RA 3CJRA 3P71T 2JJQA 3RODA 1D2HA 5E9QA 4PONA 3VNKA 4E30A 3BGVA 2G4JA 3M0HA 2A14A 1M6EX 2R6ZA 2DULA 4PGLA 5LQJA 3PLAE 3I64A 3H2BA 1MHTA 1R6AA 4PGGA 4U7TB 4R8RA 5ICCA 2VDUE 1EQAA 1FP1D 3GNXA 3M0LA 2PSSA 1QAQA 3NMUF 1VE3A 3EVAA 3X0DA 4K6MA 5CVVA 3HEMA 1FBNA 3TKYA 5E2BA 5HIIA 5LQAA 3MHTA 4B17A 5XINA 5DWQA 5EPEA 4C03A 3SXJA 5IKMA 1EIZA 3GRVA 4HG2A 3NJRA 4Q7IA 4A8LA 4E2XA 2IBTA 4QVKA 3OU2A 3XINA 3HA5A 2AOUA 2VP3A 4R6XA 3U81A 6XIAA 3HP7A 4X60A 2BR4A 2GLKA 1VQ1A 5K0NA 3NTVA 4BY9E 4YUZA 1INLA 5E8JA 1AF7A 1XLGA 3UA4A 4AUKA 1CLKA 3HNRA 4HGZA 4HH4A 1L3CA 2JHCA 2PX2A 5IH3A 1QAOA 2V7EA 4F85A 3NGFA 3G89A 2AOUB 5E1MA 3ITOA 3GWZA 3GDHA 2NNWB 5DT2A 1VP3A 5DTRA 4RVGA 4HSGA 2NP6A 3C0SA 4XISA 2ZDSA 3G88A 3CVOA 2ZIEA 2XYVA 3V8VA 3TVAA 5EG5A 4YUXA 5DXAA 3JWIA 2YX1A 3DMGA 3TRKA 3A25A 3OE4A 2QUMA 3P2IA 4PYQA 3NVKI 1G38A 3ITVA 2H00A 4Z2YA 5DX1A 4F86A 3LKZA 4GOMD 2C7PA 1RJDA 1YUBA 3GO4A 3KQPA 3EPPA 2B25A 4PIMA 2NXNA 3IUHA 4GQBA 2FK7A 2EFJA 2P40A 3VSEA 3KPUA 2J6VA 2P41A 4E32A 2ERCA 2QRVA 2QULA 3KR0A 2V74B 1FP2A 1DXIA 2Q02A 3G5LA 5EKXA 4A8NA 2QM3A 4GOND 3UWPA 3KQTA 1QZZA 4X41A 3L8DA 1EAMA 5P8WA 1XIDA 5DPMA 4RYLA 2IP2A 5E8RA 3SSNA 4QDJA 4U7PB 5CVDA 3TPZA 2QRVB 3BZJA 2ZIGA 2PJDA 3FTFA 3P8ZA 5HIKA 3M6VA 3KQQA 3VNLA 3DLCA 4RWZA 1XLIA 2FYTA 4BP1A 2G1PA 1S5MA 3KWSA 3QXBA 4L7VA 1YFLA 2IDJA 3HCAA 3JU2A 4PCAA 3SR4A 5EC8A 5BXYA 4PYNA 1XINA 5HIMA 2OU4A 1JR4A 5BW5A 3CWHA 1XP3A 5DTMA 2JH8A 3D2LA 5GIPE 4AX8A 2AVDA 1L3BA 3EEYA 3NWBA 1FPQA 4DZRA 3QC0A 4QTTB 3OE5A 1XLJA 1BC5A 1G6Q1 4DVOA 3FYCA 3MGGA 5EVJA 5AVHA 4DA4A 3WQOA 4HRAA 2H11A 3R6TA 4CXMA 5JR3A 3FZGA 3I53A 2I9KA 1Y8CA 2GS9A 1MUWA 1N2XA 2WA1A 3FRIA 5I7GA 1XLBA 1RI4A 2ZTHA 1JTFA 3FPGA 4DCGA 4GC9A 5DM2A 2G0WA 3ORHA 1NE2A 2C7QA 5XIAA 4RTSA 1HMYA 2GAFA 4XCXA 4LNCA 3UU0A 4HNOA 2CL5A 5D1NA 1D8WA 1VIDA 1Q0TA 5G02A 3O31A 2P7IA 2VDVE 5M5BA 2PKWA 1I60A 1IM8A 3KKZA 4IV8A 1ZGAA 5EIFA 3E7PA 5K0EA 5E1BA 3GU3A 2ZZKA 2BM9A 4HC4A 5EMJA 3KHKA 1XLFA 4GOOD 2VZ9A 3A7EA 3NDJA 5EMLA 4XSLA 4XKMA 1XYLA 4KW7A 3LECA 3ANXA 2ZSUA 5ICGA 3LMZA 1NW3A 1XDSA 1O9GA 1WXXA 3CQIA 1MJFA 3FUTA 3C6MA 3M6XA 4NECA 2VS1A 3SM3A 4PCLA 5KQRA 2IH4A 2I57A 1KXZA 3TM4A 4GBED 4V0RA 4HHLA 5GM1A 3QOWA 2FRXA 3MAGA 5FADA 3LDGA 3HA7A 2AN4A 4FP9A 5DSTA 3ID6C 1SG9A 5E9JA 1RI1A 4KVZA 4DF3A 1XVAA 2FPOA 1QT1A 2P7HA 2P3QA 3UJCA 4ZB0A 1XLDA 2G8NA 4PYLA 3SMQA 2QE6A 1NBHA 3T7RA 3KPJA 3G2OA 4H0NA 5CM2Z 4FGZA 3LHDA 3FYDA 4KDRA 1G8SA 4A8RA 1RI5A 4OA5A 4DKJA 2Y1WA 8MHTA 1XIBA 1YFJA 4ZB2A 3PFHA 3DX5A 4G56A 3LSTA 4MTLA 2IFTA 1L9KA 4Y2HA 3KBWA 2JG3A 2X7VA 1JSXA 2WA2A 1NW8A 5ICEA 1N7IA 4MIKA 3C0LA 1KYWA 5EEGA 1K77A 5FTWA 3M0YA 3KBSA 1XDUA 2C7OA 3SVZA 1XIEA 4PIPA 5E2AA 1XLCA 3KBJA 5C1IA 3HCFA 3KQVA 1G8AA 5CD1A 2UYOA 3BWMA 3R24A 3BKXA 4HTFA 3R0QA 3FUXA 3GJYA 4XUEA 2PLWA 1I9GA 4P7GA 7XIMA 5KS2A 4X61A 4K1GA 4PYJA 3TC3A 1XCJA 3BWCA 3JWHA 2PBFA 4E33A 2IPXA 1JG1A 3TQSA 4YTSA 4O29A 1X1BA 1M0EA 4HTFB 2R3SA 2NYUA 2Z6QA 3KPWA 4RV9A 5LQNA 5EIWA 1A0DA 5EQJB 4RSRA 3ELWA 2NXCA 4PYOA 3THSA 1XIMA 4QE1A 5EMKA 3T0IA 3ER8A 5DTQA 1XDZA 4LWOA 3EVDA 5HIJA 3OZSA 2O57A 2YUIA 3T7SA 3DR5A 3B3JA 3DTNA 4HGYA 3I9FA 3KBMA 3SGLA 1DE5A 4XIMA 4HGXA 4YTRA 4R8SA 3TMAA 3GRRA 4RTNA 2NQJA 4E2WA 3FPFA 2Z6AA 2DPMA 3KPYA 2UZ4A 4DMGA 5D1HA 3KR9A 4QE4A 1JQEA 2AOTA 4EAYA 1WG8A 1ZKDA 1ZHFA 5DM4A 1F3LA 3LCUA 4FT2A 3ITXA 2FCAA 2XVMA 3TKAA 2GH1A 2PY6A 3IYLW 4BLVA 1F38A 1L3IA 3ER9A 2P3OA 4YUWA 3NVMB 2JH9A 1EG2A 2AOTB 4PWYA 1WS6A 2E5WA 1X1AA 2PGXA 1O54A 4RTLA 4EKGA 5HEKA 5ERGB 1P1CA 3CNYA 1XIHA 2FK8A 3VNIA 4P58A 5DRYA 2GYIA 3C0QA 2PX8A 1EJ0A 3IHTA 1KR5A 1P39A 4YMGA 2Y1XA 2X7WA 2HTEA 3EGEA 3UA3A 5CCXA 3CQHA 2ONZA 4KIGA 3LGAA 4QPPA 4A6EA 4PNEA 3EVEA 1WXWA 5J8LA 1OADA 4JXJA 1DIDA 3OU6A 5FWAA 2I6GA 2OB2A 3TOSA 1VLMA 4C05A 3DULA 1NW7A 1XIFA 5CUQA 1XLAA 5CCBA 3KCJA 4PGHA 3FPEA 5T6BA 5F2NA 5EKUA 3C0KA 3LKDA 3TM5A 2BR5A 3JWGA 1R00A 4OBXA 5H02A 3UZUA 5FQOA 3DXXA 3UJAA 4OVXA 3AJDA 3OFKA 1U2ZA 2NP7A 3U3HA 3HA3A 4ER6A 4XSMA 3GNLA 4YMHA 1SUSA 4M38A 3MCTA 3AAMA 1XLLA 4M36A 5LR6A 1A0CA 5LQRA 5K0CA 1O1HA 2ZW9A 2UYQA 4ZB5A 1SVUA 3KBNA 2IIPA 4EACA 3E23A 3GRYA 4ATNA 2AZTA 3VC1A 3OZRA 3UFBA 1GW9A 3OU7A 4ZTBA 1WZNA 3P14A 3MCZA 1JG2A 5DXJA 3VNMA 5K0FA 2YVLA 4YV0A 4LECA 4GEKA 4GJIA 3UJ9A 2P1DA 3DXZA 3BWWA 4ER3A 4ZBCA 3LX6A 3OZTA 1I1NA 3IUIA 3CQJA 3FUWA 3GGDA 4ER0A 2I56A 1NW6A 3FPJA 5EZSA 4LG1A 3QV2A 3AXSA 4C4AA 1SQGA 5BP7A 5LQCA 3FVMA 3Q7EA 2I62A 2PX4A 4M37A 3UJDA 4HHMA 2N47A 5CIYA 3LDUA 1P91A 1O9HA 1I6NA 2AOWA 1XYAA 3FUUA 4CKCA 3REOA 1XTPA 2IDKA 3LDFA 1H1DA 4QQKA 5FA5A 5EOVA 3MTIA 3ELUA 1XJ5A 4IWNA 5AVNA 3KQSA 3CBGA 1ORIA 3NWEA 1JG3A 3DMHA 1UFKA 2UYCA 3HCCA 3M0MA 1L1EA 4AZVA 1ZG3A 1EJ6A 3DOUA 2PXXA 2P35A 1TW3A 3C3YA 4GC5A 3OFJA 1UIRA 4C08A 1XICA 2EJUA 2ZULA 4K3ZA 1SUIA 2PT6A 3CC8A 3SSMA 5K01A 3I58A 3PVCA 9XIMA 3UXIA 1NBIA 3BWYA 4QTUB 1RI2A 4A8IA 5DX8A 1N7JA 1G55A 2XVAA 1WY7A 3MB5A 1NV9A 1BXCA 5TNVA 3TR6A 1MNZA 3QYSA 2ZFUA 3P9IA 1IY9A 5K0JA 3B3GA 5B7ZA 1KIAA 3MERA 2WK1A 3PT9A 10MHA 2BR3A 5K05A 1XLHA 5CVJA 4MQ4A 4KWCA 3M0XA 1ORHA 4AZWA 2Q41A 3RW9A 4YTQA 4AZTA 4RVFA 1X19A 1KPHA 2AVNA 3DH0A 4J4KA 3AXTA 3I5UA 5GWXA 4YV2A 2IH5A 2EJTA 3S68A 1ZGJA 1QAMA 2ESRA 5HFJA 3P2EA 2B9EA 3GRUA 1YZ3A 5EEHA 1SKMA 3VYLA 3C3PA 3EVBA 3DBNA 4OX9Y 2GVEA 3UBTA 1PRYA 8XIMA 4PYKA 5KVAA 3VNJA 5EZQA 3JWJA 3P9KA 2ZZNA 3FTEA 4RTKA 2OXTA 2ZZMA 3P97A 3E8SA 4RX1A 3CCFA 3TFWA 3BZGA 1AV6A 3ELDA 3ITTA 4RTJA 1YB2A 3BWBA 1XISA 3M6WA 4KIFA 1I4WA 5C9ZA 2GUBA 4A6DA 3NW9A 9MHTA 3HVKA 5K0BA 2XISA 5KQSA 3DXYA 5F2OA 2HK0A 3CKKA 4M7RA 4QEEA 1BHJA 3HVIA 2EG5A 2CMHA 2KW5A 4QE5A 2HCVA 1V39A 4GOLD 4E2YA 3QZAA 3P9CA 2ZLBA 5FUBA 4ER7A 3GIWA 4PFHA 3KBVA 4E70A 4RTMA 3GXOA 5DRTA 2VDWA 3CJTA 1Q0SA 3O4FA 1XCLA 4XIAA 1YX1A 5DSXA 2PXCA 1JTEA 2NQ9A 2BZGA 4CTKA 3G7UA 4F84A 5DM0A 2PV0A 2YR0A 9XIAA 4R05A 3U0HA 2IH2A 2ZVJA 4ER5A 5FA8A 2ZVRA 3B89A 4DM3A 2G70A 1HNNA 1QANA 4LWPA 4BLWA 1UWVA 3C6KA 3VC2A 1XIJA 3TLJA 3FPHA 1XYBA 1VL5A 2G71A 3KQMA 1DL5A 1JG4A 1OR8A 2ZWVA 2O05A 3PFGA 5K0GA 3A4TA 3DLIA 3L23A 4GF5A 2ADMA 3A7DA 4KW2A 4DCMA 3CQKA 2AN5A 2OPBA 5GINE 2GPYA 5LSAA 5HOQA 4QEHA 3EMBA 1B42A 1R18A 2OZVA 1TPYA 3Q87B 2G72A 1BOOA 1KHHA 3G5TA 3PTAA 5FHRA 1AQIA 5DLYA 4CKBA 3HCDA 2PVCA 3IUDA 4OBWA 2HNKA 1S5NA 1RJEA 4QDKA 1YZHA 6XIMA 2FHPA 2Z6UA 3HM2A 4YTUA 3CJQA 2XBMA 4C04A 2O07A 4P7JA 5GIOE 3BUSA 5B1SA 3LCVB 3RIEA 2O06A 2EX4A 1NV8A 2P8JA 3G2PA 2XYQA 4DUOA 1XLMA 3ELYA 3THRA 3KR2A 1KPIA 4EVIA 3UJ8A 5CVEA 1YF3A 4RTRA 2QUNA 2YXLA 3T7TA 1XYCA 5K0LA 3BGIA 3G2MA 3P2KA 2QW5A 3M4XA 1T43A 1R8YA 2CMGA 4C06A 2I7CA 3XISA 2OB1A 3AALA 2BM8A 1IXKA 4EK9A 5DM1A 2HV9A 3DP7A 3WSTA 3VYWA 4C07A 3KPVA 1QUMA 2YXDA 3KQOA 5ICFA 2NXJA 1P1BA 3KQWA 2QY6A 4FR0A 3UVAA 2XYRA 1NW5A 1QTWA 2XIMA 5FWDA 5GOZA 5LQUA 5HZMA 3M6UA 1TW2A 2PXAA 1BKYA 2LD4A 1DUSA 3KCLA 5FHQA 4PYIA 3AYVA 2OBFA 3UJ6A 3P6LA 2UYHA 1DE6A 4UOEA 3M0VA 2AOVA 2B78A 4MWZA 1DCTA 1JQDA 4FSXA 3ITYA 5K03A 3V97A 5B80A 2BH2A 3LPMA 3AWIA 4E2ZA 5U4XA 2GB4A 3OBEA 3BZBA 2AS0A 1VBFA 3O7WA 2PT9A 3K6RA 4BP3A 4DQ0A 1RJGA 3DMFA 5F2KA 3BDKA 2OKCA 1JSZA 4V0QA 3LCCA 1RJFA 4FZVA 2P3LA 2OYRA 2IBSA 4OQEA 4XUDA 2CWWA 2ONYA 5FULA 3FTDA 4P7FA 3HVHA 1KYZA 3EGVA 1TZ9A 1XYMA 1XLEA 3A26A 2OO3A 3EEOA 4EQZA 4OA8A 5HILA 3R3HA 1XIGA 4QPNA 4W4QA 4KDCA 4MHTA
chains in the Genus database with same CATH superfamily
1NM9A 5DY3A 1OVDA 4MHBA 2QYOA 4W4TA 1EWVA 3FKSD 3AHYA 1IAVA 1A50B 4QQ8A 4HVAA 3N17A 1ISPA 2ZKLA 3QVQA 3GDRA 3PDHA 1GV0A 1NMEA 1TPUA 2WSYA 2C04A 3GG9A 3LGEA 3GAYA 3I8OA 1GTMA 2ZSKA 1UBKS 1H9AA 2WY2D 1P62B 1W48A 3JARB 3EFHA 1WKYA 4WZAA 3L7JA 3AWNA 5JSZB 3D0OA 1JYNA 4XGIA 4UHDA 2EPOA 6YASA 1GP2A 1U5HA 5CA1F 5E9AA 4QITA 1DJMA 3I9KA 1FKXA 1SBNE 3GKFA 4ZXLA 3LOQA 1SBHA 2ZAIA 3CM0A 1Z28A 4P4LA 3MSGA 4R68A 3NIFB 1HRDA 4DC1A 1WX1A 1WR8A 4LAFA 5IVHA 2A35A 4UQCA 3FOZA 1ZY9A 5B57C 1M33A 4RNHA 3T0DA 4NBTA 3B04A 1ISJA 1NFGA 2A4KA 3FZQA 4YBRA 5GZ3A 4L4ZA 1Z3CA 1P0DA 3BXWA 4KRZA 4P7NA 2WMIA 4JNYA 3V00A 3EGIA 2EEPA 4IG4A 4L1GA 1L5HA 1D6SA 3K5PA 1BWPA 1YR6A 5DBEX 3PX3A 2GWRA 5EGSA 2ZYGA 2HROA 1XXLA 1AKRA 3F5SA 3WWYA 1XF1A 4L0QA 4OGGA 3AG5A 4LCSA 3T9PA 3KKQA 3W0LB 1A5UA 2GYWA 1R4NB 3G8AA 4O4HB 3AVUA 3WIJA 2ZXBA 3NXSA 5EHIA 1YCHA 3Q0EA 3Q3IA 2H6RA 3M3DA 4RD6A 4L61A 5DW0A 1O5RA 4LJLA 3LTPA 3H65A 1DXQA 1R64A 2IU3A 4XGQA 4A21A 4R6WA 1UBTS 4PLYA 5IVIA 5JSQA 2FGBA 1JHPA 5EL1A 4BC1A 2RHBA 2MYTA 2HMVA 4H4EA 3T07A 4I9GA 1RHKA 3HP1A 4X63A 4N3GA 3E15A 2X86A 5CFLA 2H7YA 4C7FA 5KAPA 3HXTA 1NAHA 2HDOA 2AOSA 4HSHA 3DMTA 2CXXA 2DEUA 3B4UA 4JS0A 3RBAA 1WDWB 2LE0A 4FEGA 4KO3S 4ZCQA 4AJJA 1ZN2A 3R25A 2COEA 5C8VA 4FXRA 1ZCJA 3HG4A 3HKCA 3V8BA 2P5NA 1UPAA 4HQRA 2O52A 5B53A 1EH9A 4XDYA 4DA9A 5AQEA 4DNXA 2X2PA 4WL0A 1BVHA 3AVOA 2PDQA 4HD8A 1M6HA 3VAYA 1XQWA 2H1RA 3MJHA 3NDIA 4PXAA 1QBBA 3AO0B 3L5LA 3BMWA 2ZJAA 3UATA 3A58B 4MDYA 4PODA 2HLPA 5AFSA 3H5AA 1NWTA 4U9IS 2C3OA 1P2TA 2YFKA 3TCXB 4BB9A 1ODFA 1Y1SA 2MU1A 4LYKA 3GYBA 3W7IA 5TMPA 4GZ3A 4O1EA 4H6PA 5CK4A 1HOXA 3UT5A 1MXSA 1CUVA 3BAJA 1YIDA 4DCTA 2C7RA 3P71T 5HUQA 2JJQA 1J01A 4QNWA 3CNBA 1KOLA 3CH0A 2MJLA 2HNEA 2XAAA 3PHHA 3G68A 3BHIA 1HWYA 3BHNA 2ERXA 3R5TA 4E5PA 4YJ2A 3WK1A 4K38A 1FSSA 1KC7A 3NIBA 4ZVKA 4DBVO 3QVUA 2YWCA 3AIMA 3TR5A 2FRVA 2QAGC 5DMXA 1QFEA 3FEMA 3UCXA 2VZOA 1THGA 4WK4B 3HI6A 2WFAA 1UPUA 2QRPA 4BNVA 4JQ4A 2BKLA 2WYWA 1AK9A 3VVCA 4IFKA 4EA9A 1WXZA 1PWXA 3QKRA 3DDCA 2CB9A 3EA4A 2DZVA 5DWQA 1U2YA 1FUEA 5FEMA 2AKMA 3X44A 1BVUA 1GGMA 3WBBA 4Q3DA 1CFJA 2E4UA 5CBKA 4Q8QA 1DQRA 2XX3A 4M49A 1SO3A 3UWOA 3VNBA 2V6FA 1QRAA 3FD8A 1COWA 1IIBA 1Z29A 1LW6E 4J9UE 4X1IA 4FKBA 2O6HA 1I1OA 3QE0A 3ZQUA 2YW9A 3OZWA 1X7XB 3R58A 2D22A 1CGTA 3T5GA 4CEIB 1HEIA 1ISFA 2FR8A 2A0UA 3ZLFA 3KM8A 4TL6A 5HNTA 2QF7A 1H1LA 3E9YA 5IKXA 3GDHA 2BV3A 4Q48A 3GLFB 4L8WB 5BU6A 4UEKA 3VTKA 3SB0A 2OHVA 2FQWA 1GZHB 2IXBA 3IE2A 1UH5A 2VEGA 2EJBA 2PO5A 5BPFA 1WXJA 4WXMA 2WCAA 2X4IA 4B6OA 4NWIA 5E9XA 4R8KA 4LCQA 3O8BA 2R60A 2C2XA 1WVGA 3AINA 4KFRA 3KXPA 1AIPA 1F8YA 2HQRA 3R7NA 1BH6A 1LZKA 3CPJB 4DGSA 5JIWA 3H0EA 1K9EA 2PSNA 2CV0A 1OA1A 4DZHA 3IS4A 2PXHA 2ONJA 2P5UA 3DAOA 4L74A 1FPMA 1ICPA 2IHTA 1TZMA 3SF0A 2J8TA 4DRXA 4LY3A 4XWYA 4LUSA 4EPWA 2WC4A 3WIOA 4UFIA 3UWPA 5LJIA 3KQTA 3HYRA 5CAKA 4J4BA 3LENA 2X1HA 4UTUA 4O33A 1AKVA 4DDUA 3LT2A 3RTBA 3EWNA 4TSKA 1X70A 4F04A 2NUXA 3KB1A 4A3UA 2CJWA 3TPZA 1IQPA 1UC5B 3ESYA 1XM3A 4DXKA 3BSHA 3WLHA 4KL8S 3LV6A 2FYTA 4TXLA 2YHSA 1SGJA 2C8JA 3IULA 2H0AA 2JJ1A 3HKBA 5T57A 2V0GA 4B5WA 1RVGA 4KWWA 1W9XA 3JU2A 5CJNA 3SK0A 3TSMA 1OC4A 5JYDA 2AD5A 4AJ4A 4LGYA 5BXTA 3RFTA 2O2HA 4H7HA 4OATA 3VFCA 5TR9A 4NKCA 3L4VA 4L7QA 4BV9A 2YJ4A 1U8TA 3EQ2A 3LO8A 3FW6A 3A32A 2I4LA 1OBCA 4DF1A 2Q3OA 2WAOA 4QTTB 1NQ5A 1OV6A 1MGOA 1N5DA 2K5UA 5M2QA 2B69A 4A73A 4QUDA 3U44A 2DGDA 2B99A 2XECA 1L7MA 2GCGA 4OBSA 1ADFA 4TVOA 4QHYA 3CO8A 3FZGA 3KT8A 5TXGA 2ZS8A 1VJCA 4PMRA 4A0GA 4EH1A 3OZAA 1JI1A 4QD3A 1V16A 2ZRQA 1EWQA 3GNTA 4WY0A 3HKDB 2VHEA 4QRHA 5K9XA 5K3BA 2XHYA 3LQRA 4IZIA 5HMFA 2XMRA 1A9ZA 4ZHSA 3GVVA 3Q6IA 4HLQB 3GH4A 3G5UA 5DGTA 3P81A 1D8WA 2G6TA 4NIRA 2TRSA 3L8MA 4QZVA 2VDVE 5GVJA 3DMRA 5C8YF 4GOKA 3BAXA 2PUWA 3SC3A 2QJFA 1NY6A 4DMCA 1I2OA 3VR3A 1NRWA 2J27A 1HDEA 5LYYA 3LXAA 5ITWA 3GU3A 2B82A 3D3AA 4PZVA 3ZW8A 4U5IA 3RU2A 2VYOA 1JF8A 1TX0A 3NLLA 3W24A 3A7EA 4P0TA 4RH3A 4R71A 3GK0A 2XH4A 2AMYA 4OEHA 1EDDA 3KEOA 1YRQA 1N2SA 3VR5A 1C5KA 1X87A 3TH5A 1R3UA 3N2OA 4ZANA 2B35A 2VXNA 5F1YA 4BEWA 3ESRA 1OZFA 3WNBA 2G7MC 4R27A 1E1QA 1O4VA 3PUXA 1HT6A 2PL5A 1KTBA 3N2CA 5T5QA 3OYZA 4ZSTA 1GG2A 1LDMA 1MG0A 4H4IA 2DWCA 4WOQA 1AD4A 4JR1A 3H8WA 1NEYA 3WGNA 1Z42A 2RHGB 5F5NA 4ND2A 3ZU2A 1RYZA 4A05A 3NDRA 3VRHA 2FRXA 4EUFA 4RPKA 4CEUC 2QMOA 2XI4A 3ID6C 3GYGA 1GPDG 4JI6B 3B9PA 2VJBA 4DS3A 2GERA 5D3ZA 5EPDA 4HKTA 1PAMA 2PDYA 2FPUA 2D00A 4AF6A 4M8UA 5AW6A 4CGZA 3E96A 4ZB0A 4HUTA 1KMHA 3LWDA 1MVNA 4JXZA 5HKAA 3L21A 2HVNA 4Y6GB 3A9TA 4KN6A 4BN5A 2A0KA 2QE6A 1YL5A 2QRNA 2Q28A 1KFJB 3MBFA 3FYDA 3D0RA 1R0WA 3A3HA 2J48A 1V8EA 1GL3A 2INZA 4XVRA 1NRXA 2QZJA 4LVGA 3W1TA 4ZB2A 4CVNA 1ML3A 3PF9A 1EVYA 3M89A 2IFTA 1OTXA 1E4LA 1IR2A 2PBLA 2X7VA 4KKXA 1LJ8A 2WA2A 4KMMA 4E2OA 5DNAA 1VBRA 2CNNA 3DLBA 5FTWA 3D6MA 3IJEB 3PB2A 2G3JA 4H7DA 3FLUA 1JF6A 1JDEA 4PLPA 5DVZA 3W06A 1YQ2A 5D9NA 3W1WA 1T8XA 4ZT7A 4O2AF 1WU7A 3WWDA 4B3GA 3W79A 5BR7A 2RAUA 4JC4A 1T6ZA 3CWZA 4L57A 2OSBA 4P7GA 1MO6A 3TBHA 5HP4A 4YRRA 5JATA 4PYJA 2NSJA 1A5KC 1JFTA 1G67A 4Q21A 1E79A 5BR8B 4RV3A 1L4YA 3IIIA 2NZ8A 3TQSA 2VF4X 2H8GA 4GH1A 2JGIA 3HJEA 3SDOA 4PPNA 4LBZA 1OIWA 4X6YA 4O4HF 2FX3A 3N8IA 1J56A 4B45A 2Q4RA 3U7RA 4XZHA 1B00A 1A3XA 1G63A 3BMQB 1U6JA 3A1UA 3EWIA 3GLVA 4W5HA 1GW1A 3V4BA 1MP0A 2OXNA 3U6WA 3U37A 1Z6QA 1H1YA 4QE1A 1UMLA 4JY8A 3R3VA 1TF5A 3OI7A 1IQ0A 3LUJA 1PKNA 2Z24A 1N6PA 2RHLA 2XV1A 4L1WA 2RDWA 3D5TA 3F6PA 3P2MA 3RIXA 1JFVA 2YUIA 3DR5A 3JQGA 1URPA 1K89A 4XWOA 1YXYA 4JB8A 2XUGA 3SDBA 1DKWA 3A3OA 4BUCA 5LYJA 4PS0A 3C8DA 4ALDA 2WMGA 3GRRA 2NQJA 4LZAA 4HLUC 4NXSA 2ZUBA 1HIZA 3Q5DA 4C1KA 2GEVA 2UZ4A 4YMZA 3ZZ0A 2AOTA 5AHEA 3UZWA 3QQ5A 2C2BA 3QHPA 2VG8A 2KX9A 3NBUA 4C43A 1OI3A 4WLFA 3ZY5A 3AGPA 4PLGA 4FT2A 4P84A 3TKAA 2ZFAA 3G2JA 4H6RA 3IYLW 1XA0A 5T9BG 3PIDA 3MJRA 1EE9A 2CCGA 2JHFA 1V8PA 2AGKA 4GQAA 2DPEA 1PNTA 5AOAA 1WP6A 4WSJA 1RQNA 1EFLA 1RXWA 2HBYA 5ALXA 2ZRWA 3WBAA 1RHQA 3ZTWA 1NJ8A 2QN1A 4IDPA 3ECCA 4RLHA 2X1SA 4P58A 5D38A 4JXCA 3CVYA 3FF1A 1EJ0A 4RPIA 1ODUA 1FWFC 2Y1XA 5H5JA 4E12A 1KORA 1GOQA 3ZBTA 4EMBA 2NLIA 1F0PA 1OHLA 4HXEB 3OQ8A 3EGEA 3SCZA 4A6EA 1NVMB 1S89A 4RZ3A 1U2EA 3E1SA 4XD4A 2BFNA 2J9XB 3CF2A 2NSYA 4JQSA 3IQIX 3WB2A 2FW0A 4E88A 2XB6A 2FDCA 4PQGA 5KYTA 1DUVG 4L5AA 4RY8A 3RU9A 1DIKA 4I6EA 3C0KA 1ONSA 2NU6B 2P4QA 4UUMA 1H5NA 3DH7A 2O8DB 4O11A 5FQOA 1EXBA 3TI9A 3KDOA 1EDQA 1U2ZA 2YWGA 5JJIA 2GD1O 4HAIA 3ORFA 3N4FA 2P0IA 1VYPX 1DFGA 4II3A 4IFIA 5H83A 5BY2A 3WLMA 4HQ0A 4BLQA 3AIVA 5KWIA 4ZVUA 5LR6A 1U0SY 2NO1A 4EF6A 4DWSD 1OEPA 4LY0A 1UAAA 2DPHA 2OV4A 2VOMA 3MTBA 4JXXA 4W99A 5FD0A 3KWJA 4BVKA 1Z07A 3PQ2A 1TUXA 1FNCA 1W56A 4XBJA 4DT1A 3IQGX 2FFHA 1G5TA 3DEAA 3RO8A 1NVBA 4LECA 1I7NA 4PTNA 2VF2A 3DFQA 1BG9A 1NVWQ 3NANA 4OQPA 4C6RA 2WUWE 2KZHA 1K4KA 3U1BA 2WICA 3H13A 2ZJ4A 3NRJA 1NOFA 3PSAA 3CLWA 1P1MA 5H8WA 4D4IA 2NUTB 2OLKA 1BU5A 5CLLA 3NEVA 2C9ZA 3OX1A 3QYAA 1IXQA 3QPWA 1NJGA 3ABOA 3URMA 4BASA 4QLBA 2VD8A 1SHTX 5I23A 1P5JA 1V37A 3QPDA 5HRUA 3CX7A 1I6NA 4KO2S 2E5BA 3QWFA 3X1KA 1NVAA 3V8EA 1QTNA 1THMA 5CYOA 4GDFA 4DR7B 1JA9A 3V4SA 4QQ3A 3WOVA 2YYZA 3MMNA 3GGGA 3GVWA 1RYBA 3OC0A 5H0IA 5CQ1A 3W2FA 3WLJA 1U8EA 2XCLA 3BG9A 2XMBA 2IPJA 2FSSA 3WYZA 3WQGA 1XDBA 2GBPA 3CNOA 5FPPA 1Y5XA 2ZTSA 3PRKE 5FFFA 1PS9A 4LHEA 3U09A 1Y5WA 3RADC 2FEWB 1E96A 5JSKA 4BFXA 2V8ZA 4TTIA 3K30A 2QGNA 5BN3B 2ZIXB 1MO5A 4C6MA 4R5MA 4PLFA 4C89A 1RBYA 1OY0A 5FPQA 2WHXA 1ZD1A 4QG3A 2G4LA 1JHXA 2PT6A 4B2PA 3IA2A 4AFNA 1H1ZA 3EB2A 3K53A 3WNCA 2QJRA 4TWRA 1E73M 3MP3A 1DHRA 2PS1A 2PGFA 5DHSA 4URUR 4K8RB 1AJEA 1YTLA 1N0IA 5DY2A 3BRCA 4FXPA 4Z4EA 3MC1A 3A64A 5CB4A 3L12A 2HTMA 1DELA 3TV8A 2OZTA 3F2DA 3TR6A 1DDGA 1X7FA 3LTEA 2ZJ0A 5L45A 3NC0C 1JYVA 3HJCA 1GCIA 2DFLA 3TTOA 2Z29A 1ZMBA 3WD1A 2X9LA 3VGJA 4PW0A 4YACA 1TG7A 5I47A 3UWUA 2BR3A 2IE8A 2QGZA 1NVUQ 3SRHA 3AUAA 2F00A 3A37A 2FOLA 4TTTS 4F96A 1PFYA 4LV6A 4K87A 1UBMS 5E3IA 1KBBA 3LRKA 3HBMA 5IVDA 3L1KA 4J3ZA 2H3EA 3H9GA 3TG8A 2H0RA 5LYRA 4G0XA 1YDYA 1AS3A 3D3KA 4QBHA 1YZ3A 3VV2A 1N6KA 4HDQB 4IHAA 4UNPA 1PBNA 2A7NA 4OX9Y 1SKYB 4TTRA 2OQVA 2PFKA 3SFKA 1PV4A 2P11A 2E0PA 2G25A 3AV0B 4PLWA 1HC7A 4Q8VA 4H0FA 4X45A 4OH1A 1EXNA 2G0NA 1HFEL 2WM1A 3UQZA 1GSHA 4XKYA 4P86A 1VB5A 4FFBA 1H3EA 4GC3A 2C59A 4QTYA 3FVWA 5F78A 5GJPA 2YL8A 4BZPA 4DCCA 3WLFA 1SQ7A 4KNYA 1M9HA 1E89A 2GA8A 1WSAA 1G7UA 5E0CA 4MIYA 1KZ1A 2OWEA 3GOHA 1GPJA 4F0RA 4AD4A 1YI8A 5IC4A 2VTBA 3HVKA 1H9CA 4LQLA 4KYVA 1WA3A 2HKIA 5JH1A 1FDUA 5CG2A 3IARA 2DQ4A 3CKKA 3GC5A 4UHBA 1JFXA 2HNBA 5BUQA 4AMYA 3PWSA 4H9TA 3G3EA 1I3NA 3PXAA 5AOUA 3SCQA 3KVMA 5BYBA 3WAKA 4P4GA 4CG3A 4IP4A 3L8FA 8ATCA 4RFLA 5JHHB 2FEAA 3DXIA 3I4LA 1G291 2VQFB 3FZEA 2BVWA 4LF7B 4U2YA 1IUPA 3DR3A 2UY2A 3QKSB 1Q6ZA 3OCXA 3F4NA 3QU7A 4ASUD 2HK7A 3HB0A 3WDIA 1YRAA 3DOJA 2OGYA 2QMUA 1HT3A 1H5QA 4QFBA 3CAQA 1XVIA 3ZIDA 4MVCA 3AMVA 2Q9UA 1OOEA 2X77A 2V81A 4O12A 3O07A 3FKJA 1AHHA 3MJYA 3IUPA 4HWKA 4W7HA 4U6NA 3RRJA 3OH8A 4DJ5X 2R7NA 3A4TA 2O19A 3FMVA 4DMHA 3L4BC 3A7DA 4K0RA 4HUQB 4IF6A 2IXFA 3R12A 2RAGA 3RR2A 2C4TA 4DZTA 1GRQA 1IVNA 2Q5CA 4LA4A 5PNTA 3MW7A 1NMZA 3RR4A 2OL4A 1Q4NX 2PGOA 4DBUA 3EXSA 1K8QA 2Z8ZA 2R25B 1KHHA 2IS2A 4P4NA 3LG2A 4JLSA 3RDPA 2WW8A 3WQBA 3TF5A 3AI3A 2X5OA 1LTKA 4WOKA 5FUMA 3T5TA 2PVCA 1HE5A 1BS9A 3IUDA 2PDGA 3VNSA 3ZDFA 1TF2A 2A0YA 2Q0HA 3P5BA 4V0OA 2YFNA 1UR0A 4B5TA 4K8OA 4H4CA 4AURA 3L04A 3T38A 4OHYA 1JQLB 3W00A 2HS6A 3FAXA 2GTPA 2FPGB 2BGWA 3W83A 1PT8A 4PN3A 2HRQA 2VXYA 4GI9A 3ZN2A 2HCRA 4EHIA 2QCDA 4A36A 3P7YA 4MGGA 3EXRA 1Q66A 2CNLA 3NM6B 3A1VA 4Z1MA 3H5TA 5CRIA 4P5DA 4LFCB 3ANYA 4J0GA 3D7LA 2FKAA 2FKNA 2Z4SA 1M2OA 5CVEA 4ZHQB 1PR0A 3O63A 4HZ6A 3JQAD 4V2XA 5I9BA 5B37A 3DAYA 4R0VA 1XRSA 2QENA 1ZA1A 1SUCA 3P2KA 1C7IA 3CV7A 3TO5A 5DEIA 2D0FA 4J94A 2I7CA 1TKCA 4MB2A 1H7OA 3T9BA 3Q3JB 1X6UA 2C9BA 4JIRA 3DP7A 3RN6A 3WF2A 4L6HA 1YZNA 5D84A 1E69A 1GVSA 1P1BA 2DT8A 3MXOA 5B7QA 4J3JA 3JZEA 1PLJA 1IN8A 4UD2A 3T3MB 3CY6A 3DD5A 1IN5A 3LXBA 3ZJYA 1EA7A 1D7AA 4OJKA 2H4XA 4LVBA 2H08A 4FR2A 5DNEA 3A1SA 5F98A 1BMDA 2J4GA 3LVRE 1YKWA 2REQB 1DUSA 1Z26A 3IT3A 1EHAA 2DY1A 1XHFA 3K96A 3R0VA 4CNOA 4UNSA 2FFJA 5EQDA 1BQCA 2G3IA 1D5CA 3DI1A 3ITYA 3WYNA 3AHTA 1JXAA 2E67A 2CLEA 3C2FA 1JSRA 4F97A 3HFRA 1U7XA 3KZVA 2PC4A 1L4GA 3OZFA 2X22A 4WKFA 5U4XA 3R94A 3WLEA 1DIOA 3BZBA 1VBFA 3WI7A 1E1NA 3K6RA 1XDWA 2XQGA 4JITA 4WX2B 1WHSA 1XRJA 4FZVA 3VD4A 1DQSA 5DN6D 1GVFA 4MGZR 2FP4B 4JXKA 3N2NA 4Q32A 1KE1A 2I4TA 5LBUA 3Q0IA 1CYGA 1JMYA 2V5CA 5KQGA 2BHZA 4MGKR 1LPSA 4PAWA 1H7NA 1M34B 4Y6LA 4ARSA 2XVKA 5BN4A 4CV3A 4NAVA 3SUTA 1OLOA 3UT0A 1KFCA 4LXHA 1BWRA 5EVCA 3L79A 3DHDA 3AF2A 4WA7A 2WKRA 1QIGA 3ZE1B 2O0LA 1I1QB 3C87A 2P2LA 4LKRA 5C32A 3F4KA 5JW6A 2IX3A 1JYWA 1T2FA 4I6JA 4EB6A 3HHPA 2Z6JA 1A7AA 3KFVA 1U9JA 2YOFA 4LXYA 3EQ8A 5MKGA 1X7YA 4GUHA 4NU0A 1U0FA 4DREA 2QLNA 4DABA 1B54A 5BCAA 1T9GR 2ZBEA 2X8JA 1IDOA 4RTQA 3MB8A 3RK8A 5BORA 4EEZA 1QU2A 1JB9A 3OJ0A 2ZA3A 4D9EA 4DAIA 1KFWA 2C3ZA 3RYSA 3SC6A 4BZYA 4RVHA 4FK9A 3OE1A 3SUUA 3UJBA 1JSCA 5JH2A 4BFCA 4PPQA 2QQ5A 2IYQA 3UJ7A 1WDLA 5L7YA 3OCYA 4DLAA 3DNMA 4M0EA 2D2JA 2WOQA 3D5QA 4FFVA 4RXUA 2PWPA 4DCSA 4ME6A 3H4VA 1EI9A 4HXFB 4KH1A 5BVGA 4TL9A 3EHEA 2BKXA 3OZIA 4IQ4A 3TXVA 4TUFA 2QAFA 1F2JA 1I2NA 4X22A 3QR0A 1YB4A 1U0HC 3N0WA 5HZKA 4YHGA 1R88A 2C79A 2WCGA 1TUEA 4RZIA 2NO4A 3NH6A 4RL3A 2VRCD 1EKXA 2VP2A 2OCIA 3I04A 3EF3A 3WMRA 1DX6A 5JCZA 3SX0A 1FX6A 3S0JA 3WBKA 4S2EA 1Q0ZA 3DPSA 1NKVA 1Q1AA 3PR1A 3LRTA 5U4NA 4MUBA 3TSZA 5DP1A 4DEYA 1IOVA 2C0PA 1NE7A 3CIWA 2PL3A 3SAJA 1OIVA 3ZWOA 3EMDA 4HVLA 1IIRA 3WGGA 4OJTA 3L6RA 2QL5A 3LRXA 1R0LA 5TQ0A 1AKWA 1O6FA 5GONA 4MYSA 1YPXA 3CUTA 3UGTA 4G0ZA 4RD4A 2EGHA 1MI3A 1GQKA 4LK2A 4AJIA 4R81A 1Y9JA 2YQ5A 5CMLA 4EG7A 3FNRA 4PG5A 4EG5A 2V38A 4C3VA 4MQMA 1QV9A 2QYSA 1V1RA 2YA0A 2XUJA 1MDBA 1YTKA 1XFCA 1KEKA 4J1SA 3HTXA 4GE0A 4HNLA 5CYGA 1JEQB 2C1HA 2Z26A 3WL0A 4J3FA 4P4TA 1Z82A 4DV1B 4UTOA 3PBMA 1V5GA 4C01A 4RK0A 5IG2A 1HJVA 4L2IB 3BQ9A 4NMXB 4HMNA 5K2ZA 3TIIA 4CTNA 1KCKA 1RRFA 1IT8A 2QMEA 3EVGA 4ANFA 1UAGA 1VGAA 2FN7A 3JQFC 1R4MA 4ENQA 1ONOA 4BNWA 1OLXA 5DULA 1C1XB 1R0KA 1U8UA 4DLPA 3UICA 3I4EA 3L49A 5DHTA 3OUZA 4Q47A 1YQ9A 5I24A 3QKIA 4KIWA 3LQ4A 3DC0A 2JANA 3ZW9A 1XRRA 5H80A 1WZKA 3OFSA 2XNSA 2QYGA 4RA6B 4I66A 4XCVA 2R6ZA 2QTMA 1C0IA 3PLAE 3SYMA 4EJMA 4DBLC 1RAIA 1DZ3A 2UUBB 1UDAA 1NNI1 4QG7A 3W6MA 3HYNA 1TU0A 3S9ZA 1W0CA 2UDPA 1B6RA 3CUYA 3OJOA 4QJ4A 2NVOA 1H6BA 3EJ6A 3FROA 1KU6A 2IKJA 5LWHA 1DORA 2BP7B 1TLLA 4PZZA 1FBNA 3AHFA 4JMLA 2E49A 4D0SA 5XINA 3NONA 1LRLA 4ZI2A 2WTEA 1X9GA 3LFTA 3DOEA 2XY4A 3R41A 4Q7IA 4UFPA 4XCQA 2VA9A 2VH1A 1FWRA 4LF9B 4TLAA 1D0VA 1OBHA 3V5FA 3G9ZA 2ALRA 5JVDB 3HP7A 5IXSA 3Q7QA 3T2PA 2NX2A 5IAGA 5CVTA 1GTJ1 2IYZA 4UTHA 2H65A 5FF2A 3V1TC 1DC8A 1P18A 3F6BX 4GR5A 4DXAA 3A70A 3DN5A 2OV2A 4C6LA 2VLBA 1AQ6A 3SXUA 5IH3A 3E7WA 3SAZA 4JJ6A 3VM6A 4XB6B 1EVZA 1XR3A 2YC4C 1IAQA 4A4DA 2Y0PA 2WJDA 1Q15A 1RMQA 3D6JA 3ESBA 3O2SB 4RUKA 4EY7A 2HRZA 2ZDSA 2MYUA 3GHSA 2A8YA 3WMEA 1EPXA 2QKFA 1RRGA 2W4XA 1PG2A 4GI1A 1TAQA 3H16A 4BYGA 1T5TA 2B7QA 1GTG1 2IXVA 1LY1A 1WB5A 2J5QA 2QRLA 3KEFA 1Q0RA 2O3QA 4G63A 2BFEA 3V36A 1Q2SA 2BGKA 1WPGA 3KLOA 3WNDA 1J9EA 1Z15A 2M6RA 1EX1A 1T26A 4CMGA 5E6SB 1LJYA 3RUFA 3V7PA 4HS4A 4H8UA 3E5HA 4Q8PA 2DE0X 2FIQA 4DTCA 3LT1A 1KDVA 1S8AA 5EQTA 3K0HA 2ZRZA 4NHEA 5HULA 5CX1A 1Z3IX 4HLDA 1WDSA 1F8XA 5KYYA 2IIQA 3KXIA 4GBGA 1ZOSA 4YB8A 4RL4A 1H4VB 1T8RA 3OURA 1RM0A 2CXTA 4OP1A 1GLGA 3AP2A 1BSLA 1KQGA 2H2IA 4BY3A 4BMZA 1L8LA 4KAAA 3EPOA 3PZOA 1S3IA 5KYVA 3A12A 3X2EA 5CA1B 1GOXA 2NO0A 8ABPA 1QE5A 1UWIA 4C6PA 3P62A 5PGMA 4ZICA 3PYXA 3JR3A 3UXLA 3PSHA 4QXAA 3AEUA 5ENDA 3WF4A 4LBVA 4S1OA 2OCYC 1W36D 3LCWA 2IS1A 1E9ZB 2QTGA 2VF7A 3IAEA 2RJOA 3SR4A 4M7WA 1C0PA 5J40A 1T9BA 1RRMA 3GBPA 4NZYA 3CWHA 2RGDA 4MDEA 4MS4A 2DQSA 4ED9A 4X8LA 1NWRA 3T95A 4MA5A 4ML3A 2BMAA 4KE7A 4HPWA 1Z2DA 1R8JA 2KPOA 1Y7LA 3EFEA 3OE5A 3VYRB 4MZDA 2ABAA 2CDBA 2PURA 7ODCA 1HNWB 5HJXA 3R0XA 3W7CA 1J39A 1Y7VA 2RGLA 2YCEA 1FTQA 3HNOA 4PX3A 3KT6A 4YRDA 3RSHA 3I53A 1UCFA 1J2TA 5FI8A 1O95C 3H2YA 2WNQA 3E5PA 4V39A 3RANA 1SOUA 3HYTA 1W4CA 2KMLA 3TCKA 2CYCA 1UJNA 1RAKA 3MD0A 2ZTJA 1PU2A 2DU8A 4U9UA 3V8PA 2VUSA 2Z5GA 2YNMD 3I1FA 2DY0A 3GVXA 3ZV3A 2YFQA 4FF7A 2QUTA 4GY7A 4ML4A 4JJ8A 3UU0A 1P4HA 4E2DA 3R6LA 1Y6JA 2YLAA 4NCNA 1P0PA 2C31A 3PQ5A 3O31A 1JZ5A 3K70D 4RGVA 4XR4A 1OZHA 2VEDA 1FWCC 3WMXA 2ZS9A 1VPEA 4IYRA 3WLSA 4D8TA 3VHLB 2V0CA 1N7GA 2QTHA 4J16C 3UMMA 4D9JA 3DG7A 2IELA 1O5IA 2FMNA 5CCZA 3N28A 4P2BA 1MUMA 5KTYA 5DEOA 4MG4A 3RBVA 1NXVA 1VDMA 2HLDA 4E13A 3CXRA 4ADUA 2HEIA 3LECA 3E9QA 1W1ZA 4GGMX 1WOYA 4P2GA 4PH6A 5CSRA 5JS7A 1JB1A 2OPHA 3VAZA 3WGZA 2Q49A 4FFOA 3QYQA 4O1BA 3CQIA 4RMGA 4HPNA 4B4UA 1KQNA 1ZYUA 2VS1A 3SM3A 1WCV1 3W81A 1WW3A 2F84A 2OGUA 1HKKA 1QHYA 1MW9X 2GTHA 2V2CA 1F3TA 2PCJA 4NBRA 4FP9A 1W5EA 1IJKA 5CZJA 5E9JA 3TIGA 2WRZA 4LDAA 3KELA 4KVZA 4UR7A 2FFAA 2VL4A 2WJJA 3NO3A 3UWDA 3I2HA 1F07A 3SZMA 3RNLA 4FIRA 3RYCB 2ZPAA 3F78A 4PMQA 1YQDA 4GKVA 4UIOA 2GZ3A 2WUVA 2PU7A 2XD9A 1EWEA 3UKJA 4D4LA 1YFJA 1GL7A 1NUHA 4LYJA 1NQ6A 5BW6A 2PLFA 3BGJA 3D5EA 1L9KA 1EJXC 3RSFA 2EYUA 5ECUA 2Y7FA 2GJXA 3TEJA 3BFKA 4MIKA 1E51A 3KJXA 3VXKA 2YA1A 3IEKA 3GEPA 3NFRA 5DHRA 5AYXA 1TTIA 3V3TA 4GSKA 2Y0FA 2HQBA 2OG9A 2C20A 4FZIA 3D3QA 4OLAA 2UYOA 3R24A 2BEUB 3O3NB 1QX3A 5CPBA 1XNHA 5ITVA 3ITGA 1PZ1A 1RLCL 4Y2PA 2AHOA 1RYFA 2H3HA 2RBEA 3K8MA 3V4RA 2AFHE 1SCKA 3B13B 3O3CA 4BDTA 5EIEA 4B9ZA 4DRZA 1V2HE 3ON5A 1EIXA 2VP4A 1U65A 1KRXA 1RCOB 2QAGB 4HQNA 1K70A 1JG1A 3QBVA 5H4GA 5GJBA 1KO8A 4ND5A 3FN9A 4I9UA 1QH1A 4Z4HA 3CPUA 3MMSA 1JVSA 4HY3A 3IJ9A 4RSRA 2GZRA 3IPCA 4WXEA 1GEGA 3WLNA 2BFBB 1F3WA 4FHGA 4PYOA 3CJPA 4JTKA 1GONA 4DM2A 3H1TA 1W0KD 1W46A 1E1DA 1S5PA 1JUKA 1XDZA 3UQYS 4LWOA 1NI3A 2CKSA 1Y6QA 3ACBA 1S2OA 1EZ1A 4QCEA 1P2GA 1HR0B 1TJPB 2WT4A 4GO8A 2NXIA 2JCYA 1R0XA 3TMAA 3NBXX 1WNTA 5JRJA 1QOXA 1W4ZA 3K16A 4WDWA 4PNHA 4NJMA 2WV7A 4HMDA 2E8ZA 4CMBA 1SNYA 2YJ6A 3VGPA 1UBSB 1D1TA 5C51B 4Z54A 3GJ8A 1S3FA 2ZUWA 1VBJA 1KO0A 2ZR0A 1F3LA 3LCUA 1QZUA 3ILYA 3AVQA 3JZFA 3PRJA 2I5PO 1I2RA 1GNLA 3PNYA 2Z1BA 4G65A 1E2QA 1T2AA 4OJYA 2PAJA 2JJ8A 2W00A 5B1YA 4N0MA 3BQNB 2VDLB 5GJWC 1ZD5A 1Q6QA 3F3SA 4OJQA 3CUZA 3RYHA 3AX6A 4GPTA 3H7UA 2G97A 5ALUA 1CJKC 4OP3A 4BO5A 3UGVA 3SGZA 2GYIA 3BBPA 3RROA 4KGXA 3QY6A 621PA 2QROA 2XNHA 2X7WA 4FONA 4NX5A 3AI2A 5IXJA 3MZ2A 2ZTLA 4YS6A 5CCXA 1V7CA 5EPOA 2G28A 4M55A 2QCFA 4URHA 3K1AB 1JUBA 2FW7A 2F62A 3QLDA 3H2FA 5HWSA 3B6ZA 3AHIA 3QFCA 1GHRA 1YVDA 1HX7A 1OWQA 3EPNA 3IK2A 1NP0A 1NUTA 2RHTA 4D0LB 1IBCA 3GROA 4QX6A 4AYTA 1VGVA 5J59A 3VU9B 4ZYVA 5EP1A 3GG2A 2CEAA 3NPUA 1ZUNA 2IEAA 4AF7A 1TV7A 2A9FA 3ZR5A 3K8OE 3ZK8A 3HA3A 2YWJA 5I4KA 4DARA 3LU1A 3R11A 4IJKA 5JVDF 2UUAB 1X8CA 3ILHA 4PEEA 4Q1VA 4JOMA 2ZE8A 4EXQA 5CH9A 4Z7JA 3I8SA 4EACA 3FXYA 1RD6A 2EP8A 3HR4A 4PB3A 2ZYTX 3UFBA 4TWBA 2I1QA 1ZLYA 2WVVB 3FHQA 4BO6A 1P0KA 4QASA 4GEKA 2I54A 2JGMA 2AYXA 4ER3A 3LZ6A 1NP6A 1WU8A 5C8YB 1S1RA 4RZ5A 4FMVA 2AI3A 5JCXA 3GMIA 3ZVKA 2VPTA 2WMJA 1JCNA 4BMSA 4C4AA 2XVGA 3AHDA 5K3EA 4M37A 4DV4B 1B3WA 1D1SA 3OIHA 1E55A 4C4YA 1BWLA 1PR3A 4M1WA 4YAOA 4DGQA 1ADCA 1MO3A 2X8RA 4U4AA 2F6KA 3LP5A 2JFQA 2YCLB 2WIKA 4F5YA 1WLSA 1UOZA 3ZQ6A 1XMVA 1KSGA 1PSDA 1K0FA 3G3MA 2ZIZA 2DH3A 1IBLB 1UFKA 3WFAA 3R5EA 2WMYA 3MCNA 4K9SA 3IJ8A 4X9SA 2BNJA 3GJ3A 3WD3A 3W7JA 3SZLA 4QDMA 5I4BA 2C4UA 3I0ZA 3W3ZB 4KWUA 4DJDA 3ZD9A 1P2SA 4C9BA 1LDCA 2DORA 4C08A 5ERYA 2PS3A 1B0IA 4RGQA 1D07A 2FZNA 3OODA 3P9XA 3CUSA 4B6PA 4XM2A 2H31A 5DLPA 1EYEA 1ENOA 1MQAA 2R8EA 3GHHA 3T5PA 4BIIA 3UK7A 1IVYA 1ZI6A 5A4JA 5T7BA 2YMQA 4JBIA 4W9NC 4BNUA 1ONPA 4P8RA 3V1UA 2WE8A 1ITUA 1XQKA 4TLLB 121PA 2NACA 1KRCC 1QZXA 4FBMA 3IUNA 2WAXA 4NPHA 3ENZA 4G8JA 2I9UA 4KGDA 1PG0A 5K0JA 3UPTA 2JFPA 4CR6A 2BSLA 1F8FA 3L0KA 2C8NA 3UHOA 1DWHM 4FOJA 3QVLA 5EMNA 3CONA 5AVSA 2WK1A 4KCVA 3OIFA 3ZGVA 2QN6A 3NIDB 4YPOA 1ZIXA 4XPIB 1LZOA 3IRDA 1E98A 3EISA 4KAFA 1VLLA 2C15A 2XIOA 1XLVA 2DERA 3CRW1 4ID9A 4BP8A 3IIVA 2X1VA 1M2VB 3NTUA 3USES 4W9MC 3SG0A 3Q2KA 4YO7A 2Q7DA 2Z0MA 4O2AB 5DWDA 2FZ8A 3GRUA 4K9MA 4EKJA 1R87A 3VYLA 1OD6A 2VX4A 3UK0A 2QBYA 1XD0A 2VFHA 4MGHA 2CB0A 4GKKB 1RA5A 2EV9A 4AB1A 2FPWA 2B98A 3EGCA 1NA5A 4A82A 3VNJA 1AQNA 3CFYA 2G3MA 4NESA 4N8EA 2B7BA 4M7TA 3CCFA 2E48A 2B0CA 4INFA 3RIKA 4IIJF 1PZ2A 3R8RA 2SFPA 3L2LA 2O0HA 5CURA 3DBHA 3I0NA 4YALA 3ZKWA 2WG2A 3LYHA 3S5UA 4CKWA 3ZCVA 1ESWA 2BOVA 3S70A 4RJEA 4EB3A 2KSQA 4PSKA 3N2IA 1TCCA 4GPZA 1V7ZA 5ECVA 1XI2A 1RU3A 3IQXA 3MS2A 1LRJA 5JH7F 4GYKA 2ASEA 3WH6A 4QARA 1TJ2A 3BURA 3VHQA 2IK8A 1A8QA 1V39A 4B6QA 4QS5A 2AEEA 1HH4A 4FE7A 4E8DA 4BB6A 3STXA 5G1PA 3FBGA 3X43A 4LH8A 1I2CA 1WHTB 3DFIA 3QA9A 1JFSA 4YYZA 1U7WA 1NNUA 2AWNA 3FIGA 3HCWA 5TF4A 1QKJA 4K3UA 3G7UA 2FZBA 4DW8A 9XIAA 4K86A 3HB7A 3SHVA 5EWLB 3I9V1 4X54A 5C1PA 1RLIA 2FH6A 4YN5A 5A8OA 1TTJA 1V96A 3BCSA 2V6MA 4IX9A 3W2EA 4RDXA 4JTTA 1UWVA 1VG8A 2CEKA 2PUTA 3RMJA 2PGNA 3R0ZA 3U60B 2MNRA 1UM9B 4XJSA 3MPOA 3OP2A 4NCHA 5AM2A 2ZWVA 3GA5A 3H2IA 4H6KA 3H11A 4Q19A 1GZDA 4N8DA 4KGVA 5TEWA 2CEQA 2GDVA 3RV3A 3D59A 4QDUA 5JCOC 3TTEA 4FNRA 2V7BA 3ABIA 2OPBA 1TU4A 2VKQA 3D46A 3DDNA 2QT3A 4C7BA 1TPYA 1QDSA 3T7EA 2O4CA 1P60A 4AIUA 4V33A 1GOWA 5I2UA 3S5OA 4R3UA 1WV0A 1TMQA 1VEOA 4MV9A 4JI5B 3VAAA 3MCUA 3TEMA 1W1PA 4DLZA 2QZZA 2PPLA 3TTSA 1XN4A 2CLIB 1F14A 2QGFA 4R2MA 1B2LA 4YJHB 2AC2A 4P22A 1BVYF 4OH7A 5CCDA 1GFIA 1TVKA 3VIKA 4YTUA 1N5MA 5K8IA 4LV5B 1TD1A 3P2OA 3DKPA 4CQBA 1I2AA 1EESA 4NENB 3TIMA 2G41A 2DUJA 3G49A 3MSYA 5CFOA 1I4LD 3OM1A 3DBLA 5JZSA 1O3YA 3ZDAA 3KWMA 2R8RA 4O8CA 3JVAA 5GQSA 4YMLA 3EBLA 4I3HA 3KR2A 1KPIA 3M1IA 3IUEA 1VIWA 2R4QA 1JVNA 3ND5A 3HVRA 2YXLA 1DTNA 3ETNA 1UMDA 1KEUA 2ATIA 5ENLA 3G2MA 4BKMA 1RLDA 1L4BA 3IDAA 4FC7A 2OTDA 1SYTA 4CF5A 2B1GA 4B3TB 3SI7A 1JRCA 1XU9A 1HFBA 5LIKX 4BB5A 3L8YA 4A6GA 1J8MF 2O8EA 5JOQA 3PHCA 2QP4A 1WKVA 4ES6A 1TYCA 4HN8A 1DKOA 1NF9A 1M7BA 1L6IA 1NW5A 1PTJC 2EOAA 1KSFX 3WL4A 4GVXA 5GOZA 5BMVB 3IVXA 2VT7A 3O75A 5HRAA 4G1KA 3S42A 5HZMA 1K4MA 4CMAA 3PL1A 3TUUA 3REQA 3Q85A 5BOSA 3VTRA 5LXEA 4EPDC 1CXFA 4IZ6A 5F7OA 1XYFA 3NOQA 4IILA 2WTUA 3ABQB 2UXCB 2OVLA 1HJSA 3M49A 3O9ZA 2EFYA 3VU0A 3P0JA 4D46A 1WPCA 3GCDA 1FHUA 3WSVA 4JV5B 4P3OA 3T1HB 4MNLA 3WZ2A 3EAQA 3ZQ9A 1LBTA 4REQB 3OZEA 4C5BA 3O92A 4MS3A 1JRLA 4HRXA 4XQGA 1OKKD 4WCJA 4U28A 5FORA 4JYEA 1FP6A 3SECA 2RGMA 5DSZA 2I4NA 4P7FA 5HTOA 4HZUB 4CM8B 4FGUA 1HLPA 2DQKA 5HQJA 1VFFA 3BQMB 3PTKA 2ZRUA 1ESCA 3MILA 1GUFA 1ZINA 3HU7A 4K81B 3RD5A 2YJNA 4YCOA 5FWYA 4M29A 4H7ZA 1SQFA 4NMMA 4MUIA 2WMNB 3GRZA 1EXVA 1MB0A 3NNSA 3DCNA 2WKGA 1C93A 5LDDC 2PODA 1H3NA 1GJPA 2JLXA 1MEHA 3MUCA 4LSZA 1H9BA 2NV2A 4RVDA 4KREA 3A9IA 4ZREA 3GJXC 1RACA 2BH9A 8XIAA 4M60A 4GW3A 1OI7A 2GDUA 4D8ZA 4B4OA 2X0SA 3L77A 1LLOA 2GPBA 3H12A 1AGNA 4MARA 1IHXA 4RFVA 3SQOA 3CHDA 4RTOA 3DTVD 3GLQA 2OQ2A 1YPFA 2MANA 3U1VA 4P08A 2VJOA 3W9SA 5HIAA 1NQXA 3F3MA 1R5YA 3IIXA 3WIEA 1VKJA 2GEBA 1YMUA 4F2TA 1C91A 3ZS9A 2BJVA 3G8BA 3UESA 1QCCA 1VIYA 2A92A 2WPDA 3BT7A 2PS2A 3M4ZA 1X92A 3O4HA 1G60A 2J7GA 2P6RA 3NS7A 1ZM7A 2ZIFA 1E4IA 3GZAA 2O14A 5KQPA 1CDGA 1IWBA 3UAOA 1JZQA 4YVPA 4PYMA 4H3VA 4BE7B 4DIKA 5KYXA 1CPYA 3HJBA 4YMWA 4XTIA 3C8MA 2JALA 3MCAA 4RIGA 1M6VB 1XKLA 5AKXA 2B30A 2G9NA 1LBSA 5KMGB 1TIKA 5AC8A 3RWMB 2KS6A 1JR6A 1MC5A 1NMSA 3NO4A 3OCVA 3IIOA 4RS3A 2CBVA 4UR9A 3KDSE 2QW1A 2OK8A 1Q8AA 1KPGA 1TMKA 1VRDA 3SR7A 4DA8A 1MAUA 4PBTA 2R7KA 4WESB 1C8YA 1Q0PA 3VMFA 4Q3LA 1ZP4A 2A94A 3COYA 2VZTA 5L7WA 3W02A 3AZPA 5EKDA 5KTTA 2G9VA 2QIOA 5F2MA 2J7PA 1GKPA 1YBQB 1PJTA 3LCJA 4MKVA 4CIDA 2FTPA 2JAPA 3T1TA 3BREA 2WD7A 1VCIA 4YTTA 3IKVA 5CW2A 3WNVA 3VPXA 4MQEB 3PPCA 1R4ZA 3GGCA 1DFHA 3DE6X 3TA6A 4MV0A 3BMCA 5A94A 4FDUA 1DS6A 5C7YA 3A27A 1LC3A 3NZGA 2O2YA 3MYOA 3STTA 3WYBA 4CQDA 3R9XB 4AZCA 2PE4A 3OZDA 4JUCA 3KAJA 3LCFA 4C2AA 4J0CA 3U13A 3ME5A 4CWAA 1RBOB 2PUGA 4EMSA 5LKYA 3AROA 4H2CA 1E3LA 3H8SA 5KX5B 4KN5A 2B8JA 2XB9A 1O8BA 3HL4A 4WE3A 3CLKA 3CKMA 1F8MA 2ZYIA 1PKLA 1T99A 3KRZA 5J2TF 1AKQA 2ZAOA 3OPSA 1F2TB 2AJBA 3WBXA 3LXUX 3GPLA 2W63A 4PSRA 1Y9EA 3CA8A 2WV8A 4NF2A 1KKOA 2CNBA 3VO2A 3NAVA 3UCEA 4LQCA 2FPTA 5JASA 2I87A 4O53A 4QCFA 3M4JA 3BSGA 1H61A 2GRJA 4RLQA 1UWTA 4H35A 2TMKA 2OFWA 4AMVA 1WSBA 4U8GA 1LP6A 3NYWA 3PLRA 4AYXA 4MQ6A 1I94B 5AKIA 4YJ3A 1Z7YA 1OH6A 4PQFA 3UMSA 4J7CA 4Y1EA 3RUDA 3IT1A 2AFHA 2O8VA 1FYEA 4IXNA 4PNPA 3D7SA 2UZ0A 4JKYA 3SZUA 1HORA 4PGLA 3PBWA 3LGSA 3OJCA 3O47A 1C7EA 2JKEA 1KJ9A 3I9OA 3H2BA 4U7TB 3PZBA 2E37A 2XGOA 3W9YA 2QP9X 3KJEA 5DANA 4G37A 3UXKA 1RM3A 5J5RA 4MEAA 1Q63A 4FW9A 3MO7A 1FX0A 1NPYA 3AIQA 3X0DA 3ZU6A 3ADBA 1ISYA 5BYKA 5CVVA 4C4PA 1NG9A 4UTPA 3W1EA 3GJTA 3KBOA 1M1NB 1BHGA 4IGKA 2ERYA 5JYBA 4G09A 2AI2A 4KGJA 4UVEA 3N2ZB 1E0UA 2QXWA 2CL6X 2NOAA 1W3TA 1VLHA 2E4ZA 1XEAA 5HANA 4YCJA 4BO3A 4IMJB 3SPXA 3HGRA 5AC7A 1KKMA 2JBMA 3EB3A 4OHXA 5K5EA 2YXOA 3QXHA 3R10A 3SLKA 3EZ6A 2O5CA 1HKUA 2JD1A 3ZFHA 5CC5A 3ZEAA 3RHSA 2JEQA 4E6MA 1U1JA 2PX2A 4LOIA 3K6SB 2DFDA 1G0OA 3G59A 5B58C 1VHDA 3A14A 3R4CA 2JEPA 1MC4A 3VDAA 4Q1BA 3K9CA 4J4TA 4HU3A 5G41A 4D81A 1UKOA 5ALEA 4Q9JA 2XT0A 3H9CA 5A1TA 4NNBA 4BQIA 3IVTA 1RZVA 3FCOA 4PMNA 3LPOA 4EUHA 3LA6A 4ACBA 2CF6A 3RCNA 5A6JA 4IEEA 4C20A 4BLPA 2OZ8A 3DCJA 2R85A 4MR8A 3Q72A 4PZPA 5TB5A 1E2JA 1CWYA 1DAOA 2H17A 2QUMA 3A9UA 3NVKI 4WK2B 1PTKA 3ET4A 3SIRA 3NI2A 2PF0A 1B8UA 1MJ5A 2BIFA 3WRYC 3U7GA 1K6JA 4LC1A 1P33A 1XU4A 1SZDA 1NOJA 2ZUCA 4GPNA 1WKBA 1S3SA 1U1EA 1OBAA 3OWHA 4Z1OA 1MO0A 5CJPA 4D2JA 1R15A 1VTKA 2J77A 3LK6A 3OEEA 3G17A 2F43A 3KYDB 2Q02A 1DT3A 2HPAA 3RJZA 4GOND 2KHZA 1XDJA 1CC1S 3FPAA 3L1HA 2EG6A 2ZE6A 2JEOA 5D05A 4GH5A 5D2XA 5P21A 2ROQA 1ZBVA 2VGBA 1QORA 5A3VA 5FJPA 2C1EA 3OA0A 3E0QA 1KYXA 1Z2OX 2ZIGA 1NDVA 3GF4A 4C90A 3GJRA 4WZBB 2JKZA 3KQQA 3UT6A 2M32A 2CLHB 3UAYA 4L75A 2Z98A 4KCGA 2J74A 2IP1A 3HADA 3NQMA 1DQNA 1S5MA 1E2KA 3NQAA 4AXNA 1TYZA 2VHCA 3WYFA 3ISVA 3FZNA 5K8UA 1P1FA 1RR6A 2CV2A 1C3VA 1E18A 2ZRKA 4RNJA 4O4WA 3EOUA 3VM7A 3ZXWA 1HTTA 3SU8A 1I6KA 5LU8A 4ADSA 2Q1TA 2C0AA 3AR5A 4NZ5A 1XWWA 4PRYA 5BMVF 4Z1DA 3ESAA 4V0SA 1SR8A 2OV3A 4MOZA 2OSYA 2XLCA 4Q4MA 3Q3EA 1DHPA 2GEUA 1UBLS 3GHUA 3HZOA 3ELFA 2AZMA 3R6TA 2O7SA 3MTWA 3ZBPA 4PUWA 1PZNA 2J66A 1QW8A 2RAFA 3V0UA 2WFLB 4JHLA 1N2XA 2N46A 1YDHA 3PWGA 3IACA 4X1KB 4OJNA 5ANRB 5I7GA 2WJZA 2ZTHA 3KD3A 3RT7A 5T8GA 4GC9A 2XM1A 3EXG2 4YI5A 3ICJA 1XFDA 1OMOA 1L4NA 3VR0A 3IP6A 3R3YA 5C5DA 1G0CA 3BMNB 1E2NA 5AJTA 3WDJA 4AAJA 1Q0TA 4EA6A 4P33A 3KU4A 4DJEA 5U7SA 2D74A 2I4IA 2J9YB 3EDEA 3C3BA 3CZMA 3ZLTA 1N3IA 3U4MA 4CD8A 3ICWA 4JD4A 1OGJA 2RG1A 4UOQA 4GGHA 5JNUA 4FR1A 1E2DA 3R5FA 1T6YA 3SN4A 5CEEA 1P0EA 1WCYA 5HJ5A 1ZS2A 1A5AA 2R4UA 2C14A 2O1XA 1XVVA 4OZOA 2ZSUA 1CRZA 2A5LA 1TQ8A 3Q3VA 3C6MA 2XOEA 1ZXLA 1PCWA 3B70A 1J79A 2WWTA 5F76A 4PCLA 4DUZB 3QUCA 1DAPA 3RIGA 2ESCA 1QU4A 4DPQA 5B3AA 4KLRA 3VDRA 2CLLA 4DJFA 3O1HB 2YDSA 4HJWA 3EZ2A 5EUMA 2VDPB 5BSGA 3HA7A 2AN4A 2I55A 4GX1A 5KSWA 1SG9A 2HF7A 3K2QA 4S1NA 4AJEA 3H2KA 1K6MA 2Z5LA 3CG4A 1T96A 4C0HA 3H04A 3H4MA 2AZXA 3SNKA 2C9CA 4LWWA 1YR3A 2DVUA 4X7RA 1P74A 4E5YA 4KXVA 3NV9A 3BTNA 2CDCA 2XYHA 5EMUA 2R4TA 4N49A 3KPJA 2PD4A 1IG3A 1T5BA 2J8ZA 2XN0A 3L5MA 3AZTA 2VDRB 4RJKA 3KBBA 5KWEA 1ODKA 1RI5A 4MYRA 4LY4A 1Q0LA 4OA5A 1U1DA 4UASA 4IQ8A 4IO1A 3VZZA 4E6EA 1GG5A 4MTLA 1UK6A 4KHZA 3EGDB 3UMVA 2QCHA 2AL2A 2OD2A 2R82A 1UKBA 5DTJA 2I5QA 3H8VA 2PLKA 5ADWA 1K77A 4P61A 3UJRA 1ACJA 1XIEA 1QLJA 2DKFA 3FGNA 4ZN6A 2QM0A 2P30A 2VWPA 3RILA 1N9GB 2FSGA 4YAFA 3S40A 3GZNB 5SZHB 1JPVA 4XUEA 2XW6A 4R31A 3AEQB 3N9IA 5HDQA 4R01A 1A7UA 5JXJA 3A6PC 4UNQA 3MRXA 3B52X 4B8WA 4KWEA 3EAFA 4FYWA 2AQVA 6Q21A 3NBKA 1ZR4A 4GQQA 5F7JA 5A2GA 3BWCA 1JQJC 1CW2A 1ZH6A 4R5EA 3VIFA 2XFWA 3IJLA 2DPLA 2BS9A 4B6RA 3H70A 2AQOA 1YJ5A 1GVYA 1EM8A 2IXDA 2ZZ3A 3BSFA 1ZIPA 3UCQA 2ZANA 2VNCA 5KQMA 3EA2A 4G1MB 4IV5A 4ZOBA 5E0FA 1KI6A 4IR7A 1VGRA 4OXNA 1DXHA 4K03A 2IWRA 2WIAA 3K4WA 4XWUA 3E3AA 3ZWNA 3ITCA 4I9FA 2H2AA 3ZS8A 2W92A 1DEDA 3ER8A 4H3DA 4KG7A 1ENUA 2C82A 2O57A 2IMRA 1RE0A 4DUWA 3IMFA 3FPCA 4Q4AA 2OWDA 4QEZA 1VRCA 3EPHA 5TGTA 3HU3A 2FYMA 4CM9D 3GH3A 4WV3A 5F23A 5KX5F 3T7VA 4N54A 4KITB 5CHEA 3HSYA 3CV3A 3KR9A 1QH8B 2BY4A 2V1UA 2Q8PA 3UFXA 1ZKDA 3BSSA 1BDIA 5HMLA 4YRCA 2A9PA 1L5WA 3R6IA 1TJ4A 4REMA 3UV6A 3BJIC 2YA2A 4IFTA 1TWZA 1KYVA 3CT4A 5F1PA 1TF7A 1HEUA 4X9YA 1OF1A 1FZQA 2D5LA 1S1CA 3H17A 2ZZ4A 2BUAA 5E7IA 1GLVA 3ETLA 1P7ZA 2PD9A 2IHNA 2UZIR 2AL7A 1KGSA 5A04A 4RPCA 4EMTA 1DBTA 4NYIR 3HDYA 3QTLA 2EDAA 2IZ7A 5A1AA 1BU8A 3IC5A 3BLIA 3NR0A 3W74A 3NDOA 3MP5A 3VR5H 1V0LA 3SP1A 4R1SA 3OEWA 2Z57A 4IXTA 3B6KA 4LHYA 2B21A 3GLSA 3CMJA 3KO8A 3OBAA 3CQHA 2ZADA 3K4HA 2ZWPA 3TVYA 4QG8A 2O2XA 1XUUA 1WZUA 4QA9A 2UZ9A 2YL9A 4FLQA 3FPSA 4N12A 4LRSA 2I6GA 3OZBA 2B7LA 1EE1A 4JUIA 1XIFA 1A0OA 2VTVA 1RBLA 1XF0A 4AYGA 2VGGA 3C0JA 3MT7A 1QQTA 2C94A 5EAIA 1G16A 1QO9A 4Y6OA 3AMKA 3T8LA 1H3FA 3AF3A 3KHJA 1H2ZA 1LPNA 1GQNA 5AW2A 3GLCA 5ESXA 2ZRYA 4C3UA 3OF3A 1F0NA 3MZNA 1KYIA 2YXGA 2JBHA 3BE7A 1CJBA 4U33A 2Z58A 3GQVA 4D8AA 5JNWA 2IYOA 3MXTA 2XUFA 2X5JO 1JU9A 2YIJA 3U4QA 4WOJA 3PHLA 3B8WA 2HFJA 1RZUA 5M17A 2O20A 3PANA 3SY8A 4X20B 2PUDA 4WQ6A 4ENSA 2DBVO 4BKQA 1K4YA 3KTOA 2CZDA 1C7TA 3AM1A 1XMPA 2BE7A 2H29A 3ZXUB 2CVOA 1B0UA 3DWIA 4LRTA 4EWLA 2I56A 2VUTA 1SXQA 2DSKA 3GA7A 4M9QA 3SOPA 1EZ2A 2D5BA 3ANLA 5E70A 2VPXA 1J0IA 4JL2A 1LXCA 4OUKX 4HMOA 5J2UA 1MH9A 4RADA 4B3HA 3FX4A 3BCJA 2J0UB 4TMFA 1IJEA 2I2CA 4CKCA 4CLRB 2R87A 1O5QA 3CUGA 2W2VA 2VNSA 5CAEB 3GTIA 3LDFA 2EQ5A 1Z7BA 1Y1LA 4O1HA 4RNDB 1H1DA 3PUEA 5AC4A 3GS6A 4ZZ2A 3SDSA 2KX7A 3F2VA 3KQSA 3JAKA 3CBGA 3BE6A 3LGGA 1X94A 4YMTA 4OREX 2OLJA 3JYOA 4GCAA 1AHIA 1DO0A 4ACZB 1WVMA 4J2OA 2RUSA 2LW7A 3L7OA 1H0GA 3HWSA 3ECQA 4C6TA 1RXCA 5ER9A 1TMGE 9ATCA 3OCCA 2O6LA 3ZJ4A 3TQHA 3GH7A 1OYOA 2ZWOA 2BJHA 3Q6MA 2A5GA 5BROA 4RXFA 1U1GA 3P61A 3GDGA 1FBAA 3I05A 2ZYFA 3BJEA 4LU0A 3DZ8A 1H8EA 2ZXQA 3S2UA 3REFA 4PL1A 2IYUA 1UM8A 2PWVA 3QHQA 4I1PA 3L7BA 1PIWA 2PWBA 1C8QA 3ETHA 2C4HA 3P9IA 4TTUA 4F4IA 2J3HA 1CUXA 4PB5A 2XDWA 4UULA 1PWZA 3DC2A 1W54A 4X8MA 4QOSA 4NCAA 4JVSB 2VHTA 2AMLA 5A8QA 2CNOA 1I1WA 2Q1WA 4RJ2A 1M8JA 2BUBA 4AC1X 5JIBA 1OVGA 1SA0B 1OZQA 3DT6A 1TJRA 5IM4F 2OBYA 2XF2A 3U7QB 5G4LA 2DZAA 1EFUA 3G2IA 2CHQA 3TL6A 3SM0A 2PT5A 1XD8A 1MAHA 3KDAA 4UCFA 1OTYA 3OT5A 4H16A 1COWD 3TJMA 1QB7A 3D64A 4Q9DA 5I77A 1E9AA 4DLXA 2GOKA 3A11A 4RTJA 3U7EB 1L7EA 5LMNB 7AT1A 1RE1A 4KQHA 4KIFA 2PDWA 4KQXA 5JV5A 3QHMA 3MINB 5D03A 1MCZA 5C9ZA 3MG9A 2QTWB 5F2GA 3AYXB 4TXJA 3LUAA 1WBDA 2BVTA 4Z9BA 5C1DA 3W2UA 2Z8XA 3NP9A 4OGWA 2HIAA 1RFLA 2PTZA 2WV9A 1VL8A 5JNSA 1Z4MA 2WSQA 3IVRA 1CR2A 5J3JA 1K5GA 2IIBA 4NBLA 3AUSA 3CZ5A 2NU7A 3B8EA 3UHAA 2V69A 1W3JA 4OOZA 1UXOA 4OBTA 4H1VA 2W37A 4G5GA 3MSRA 4PFHA 4F92B 1IBMB 1EUAA 4KXLA 1EBBA 1L6RA 5HVNA 3HF3A 4WOPA 1O2DA 1C81A 4DNHA 4QRDA 2GVNA 4CG1A 2QD5A 4LIPD 1N2CB 1Q6YA 5DQPA 1VSTA 5LU9A 1A5SA 1XHLA 2QRGA 1USKA 2MOKA 3Q45A 3JSAA 1JJAA 5FA8A 1EL3A 3P19A 4BV3A 5EL0A 3IAQA 1H0IA 3ADCA 1JD7A 4YQEA 1GPWA 2G83A 5MFZA 1XF9A 1ESNA 2FOXA 4IXXA 2DZUA 3N6HA 1U90A 2E4YA 4HNCA 3NHYA 1XIJA 5I03A 1DPGA 2C4VA 4Q9AA 1DL5A 2QN9A 4YIWA 3MOGA 1P5FA 3PFGA 1LC0A 1NX9A 1CTQA 1Z25A 5KTOA 5EJAA 4CKZA 1BA2A 3LK7A 1PKYA 3GG1A 1A71A 2XUQA 3UZYA 3RUPA 3CQKA 2GPYA 4HFJA 1E3IA 1GT6A 4DHGA 4NNAA 3KQNA 7REQB 3CLMA 5C2GA 3N29A 2JJ1D 1E59A 1U9IA 2RK3A 5AC6A 5BWLA 5D02A 3LPLA 1ZMRA 3WK3A 5CSUA 5TLSA 1VYTA 3BGAA 1P2BA 3U9TA 2HH9A 2BI4A 1RNLA 2GTIA 3MT1A 3B12A 4YCBA 1DJYA 3G5AA 3ZJKA 2LV8A 3LKBA 3P0FA 2QCEA 3W7LA 1P7PA 5FOWA 4IUDS 4IXDA 4OBBA 4KMRA 2ATSA 2FI1A 2GJ4A 3TR9A 2FSHA 1V48A 2R2AA 4FDTA 2Q1UA 3U26A 2NAPA 2Z27A 1ZM3A 4JJIA 3ARWA 3CUHA 1PT6A 1B3RA 3KS6A 3K71B 1Q19A 1DWFM 1TQ6A 3FDIA 5HJ2A 1GGJA 5LB4A 1CIPA 1OFBA 4IDQA 4JVNA 3OMWA 2Y66A 3KDPA 3JQQA 1N1MA 1X8LA 3D3WA 2PD6A 1IV8A 3EGXB 1NG1A 3NWRA 2V03A 4MPTA 3CAWA 1V7PC 2FG6C 3PPXA 2OEPA 3VR3D 3C2RA 2WZQA 3EPJA 2HJGA 2FSUA 1QHSA 2UVDA 4FR0A 4LJ8A 3QHNA 2EKQA 4UM9D 4GRSA 2XIMA 4JR5A 1UIMA 4ACYA 2OTCA 5LQUA 1HE1C 3DTTA 1W6RA 4NDNE 4D79A 3VR5D 1JHOA 3FGCB 1IXRC 2FSVA 4HNGA 1GGOA 2I7DA 3II1A 3RYIB 3WLRA 1GZSA 3AYVA 2ZUEA 1H09A 1MUUA 3IT2A 4PXSA 1E1QD 5KTRA 3WL7A 3M9WA 2CYBA 1OJXA 3P9QA 1O6BA 1DCTA 3UR7A 3VH4A 1G5QA 1WRBA 2F3SA 4RE3A 2I6FA 2B8NA 4KUHA 1V7AA 1DBSA 4GUDA 1SJCA 1MX1A 1E7SA 4NI8A 1TV8A 1SKQA 1W1VA 4I0WB 2VX5A 3F67A 1QGED 4OV4A 3DMFA 2QPXA 1Y5LA 3SCUA 3LCCA 4AG3A 2QVCA 4Z6KA 2BFDB 2AAAA 3PA8A 4BEJA 1JGIA 5G0SA 3SC2A 2G1UA 4YCMA 2F9FA 3HVHA 2EZTA 4FGLA 1Y8BA 2ZUTA 1IEQA 1XLEA 4GQGA 4AZIA 5BURA 3WF0A 2RAVA 3AF5A 2WYUA 5GPRA 1V35A 3FE2A 1ISZA 2HU7A 4EFLA 4XUGB 4MHTA 4HOXA 4G2TA 1VHQA 2HXYA 5KJCA 3TZNA 3X1MA 4AMBA 4FPXA 1QNFA 4GDMA 4Y0AA 4PFMA 3IVAA 2ZUNA 4IV0A 4Y1FA 2HWKA 3G1HA 4F8XA 4N65A 3IMKA 1XHGA 1L4FA 1B6TA 1TT5A 1N7HA 3N8DA 1SVWA 4NRDA 2C5EA 1V6XA 4PHTA 3I62A 2ZWAA 4BFWA 1IYXA 1UKQA 5LLTA 3URQA 2GRAA 1QQ7A 3O0KA 1XTSA 3BWVA 4KH0A 3EIXA 3A6LA 3UMFA 1E79D 3QEJA 1E9LA 3I2IA 5A4FS 4ZT4A 2DUMA 4IIJB 4C78A 4XDHA 1T6MA 4EDFA 1ORVA 2QG9A 1CZKA 3EA3A 1P3JA 3G1UA 2ATMA 3PNQA 4F6RB 1VCMA 5A5VA 4JFSA 4DNFA 4OQDA 4GABA 3NDPA 3R8XA 2RHMA 3IIEA 5HKLA 1YHNA 8ADHA 2X4DA 3E6AA 3G5MA 3FB4A 1PK9A 5JH7B 4AS1A 2GFQA 4ZP1A 2B5OA 2QTVB 4XVHA 1LOLA 1K8CA 2WP0A 1CJMA 4L22A 1C3LA 3LHVA 1YIAA 4NZ3A 1BTMA 4GMDA 4GVIA 3BERA 1LCIA 1EFZA 4X3ZA 1N2ZA 1U7PA 3PTMA 4MCHA 4WY2A 4FDMA 1H0HA 2CDNA 1Y1TA 5M5DA 3VGGA 3ENKA 5F1OA 1JS1X 1E3SA 1R0YA 5I8ZA 1ID1A 2WLYA 3RC7A 1XEWX 3W7MA 2W6PA 2C2GA 4HK4A 3SHOA 5A7FA 1ZCCA 3B0XA 4H7IA 3K0EA 2I1WA 4ML9A 1QI0A 4E8GA 2I1LA 3BE5A 3Q1LA 4G1FA 3JUGA 1B4KA 1LK7A 1LUAA 1RBMA 4X91A 1AA1B 2GM9A 1EFVA 1MJGA 2OLHA 1MO2A 2QJWA 2NZVG 1JJIA 3U40A