5EMMA

Crystal structure of prmt5:mep50 with compound 15 and sinefungin
Total Genus 200
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
200
sequence length
625
structure length
625
Chain Sequence
RVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and Property Guided Design in the Identification of PRMT5 Tool Compound EPZ015666.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Protein arginine N-methyltransferase 5
total genus 200
structure length 625
sequence length 625
ec nomenclature ec 2.1.1.320: Type II protein arginine methyltransferase.
pdb deposition date 2015-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05185 PRMT5 PRMT5 arginine-N-methyltransferase
A PF17285 PRMT5_TIM PRMT5 TIM barrel domain
A PF17286 PRMT5_C PRMT5 oligomerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 5emmA03
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 5emmA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5emmA02
3SSNA 4L7VA 2LD4A 2VDVE 5T6BA 4YUYA 1NV8A 1F3LA 4EK9A 2GS9A 3P9KA 4YTUA 5B7ZA 5ICEA 1NBIA 5KS2A 2P3QA 3FPGA 4C07A 3OFJA 3EVEA 5H02A 1DXIA 2P3OA 3DTNA 3MERA 2GA9A 3AJDA 1VBFA 4XSLA 4ZB2A 7XIMA 3ME5A 4PYJA 4LWOA 2AN5A 2ZBQA 3P97A 2NXCA 4RTMA 2I62A 2IDJA 2C7OA 3TVAA 3KCOA 2OU4A 3IUDA 3G7UA 3GCZA 4GLEA 1A0EA 2HTEA 2P7HA 4GBED 2OBFA 2EFJA 2ESRA 3DXXA 4IV0A 5TNVA 6XIMA 1P1CA 2IGTA 1H1DA 5ERGB 3UJBA 4ER7A 1QYRA 3BZJA 3P14A 1SQFA 2UYOA 1BXCA 3PTAA 2CMGA 1TZ9A 1KPHA 3PFHA 2I57A 2OO3A 3B7PA 1DE5A 1G8SA 4PINA 4AZSA 1VQ1A 1YX1A 3D2LA 3GRZA 1XXLA 3S68A 5FQOA 3BWCA 3LDFA 1ORHA 2EX4A 3AXTA 1X1DA 4IV8A 2QUNA 3TRKA 4A6EA 4E32A 3AXSA 2IDKA 3LCCA 2P41A 4GC5A 1YB2A 1SVUA 2IIPA 3BXOA 5EPEA 3FTEA 1PRYA 2YXLA 1RI5A 3E23A 4KWCA 5EKUA 1XYAA 2OY0A 4RTJA 3C0LA 3BGIA 4ER5A 1DCTA 2X7WA 1EQAA 3EMDA 3M6UA 4M37A 5EMKA 3BZBA 3QV2A 2NNWB 4P7KA 3BGVA 5F2KA 1YUBA 5E9JA 2WK1A 3CKKA 4DCGA 3U3HA 4OA5A 1XLBA 1ZGJA 3NW9A 1V39A 3MHTA 4RSRA 4E2XA 4PYOA 3VSEA 4DCMA 1FJXA 1KIAA 1G55A 3LCUA 4XKMA 4HTFB 5FCDA 3CJTA 1XDSA 6XIAA 2V7EA 2PVCA 3M6XA 5E9QA 3KPJA 2BR3A 3CGGA 3ELYA 4A8LA 5FA8A 3SSOA 1RI4A 2QY6A 2AOXA 3SSMA 4PONA 2G8NA 2NQHA 1UWVA 1BKYA 3B3GA 4DMGA 4EMSA 3KBJA 1SUIA 2O0LA 3CJQA 3TC3A 1Y8CA 1IXKA 1NT2A 1ZHFA 5C1IA 3TMAA 2ZLBA 2QW5A 4BLVA 4LNCA 1L3IA 5I7GA 4YTSA 4LG1A 4R05A 3KBMA 3FUXA 4C05A 3PB3A 3V97A 5FUBA 5E9WA 1I9GA 5EKXA 4FT2A 3KWSA 2IH4A 1NW7A 2QRVA 2R6ZA 2YVLA 3C3PA 4MWZA 5EHGA 3FUUA 3GRUA 3VC1A 4X41A 2AR0A 3LKDA 3T7TA 3KQWA 4PYNA 4PCAA 3UWPA 5EMJA 2AOUA 3HNRA 1Z3CA 2PJDA 4PYIA 4QE5A 1XIMA 3L8DA 4M7RA 4AZTA 3OE4A 5E2BA 1X1BA 3HCEA 2OXTA 3A7EA 3KPVA 4PWYA 5ICFA 3PT9A 3AALA 1XYBA 1FP2A 2AVNA 4K6MA 4XUEA 1FP1D 9XIAA 4MQ4A 3NVMB 5K0EA 4YV0A 4GJIA 4RYLA 3N4AA 5HOQA 3GU3A 3NJRA 3UFBA 5K05A 2B9EA 4E2YA 3KQMA 3KQVA 3KQSA 2BR4A 1QAOA 4RTKA 3RIEA 2NXEA 3R0QA 2Y1WA 3ITVA 1R6AA 2GB4A 3OU6A 3UJAA 5ICGA 1RI2A 2PSSA 4QDWA 1NBHA 2Z6AA 5EMMA 3ITLA 2QM3A 4JXJA 3QOWA 3QYSA 5DTMA 2ZIGA 5C9ZA 1XYCA 3HA3A 5EEGA 4AZVA 3KR9A 2ZVJA 3B3FA 4A8RA 3ELWA 3M70A 1KYZA 2NQJA 1ZG3A 4RWZA 4K1GA 4GOOD 5EEHA 4YTQA 1IM8A 4E3VA 3M0YA 1QAMA 3CQKA 4HG2A 2B25A 1WS6A 1OADA 1VIDA 5LQKA 3I58A 4C4AA 3P71T 3R3HA 5DXAA 2A14A 2HCVA 3REOA 4GOND 4F84A 2JG3A 2FYTA 2CKDA 3KHKA 3TQSA 2XBMA 3KR0A 2BH2A 3BGDA 2NP7A 4ER3A 5M5BA 2ZIFA 4R6XA 4CKCA 4FT4A 3GIWA 4HGYA 4OBXA 3NMUF 1AQJA 1P1BA 2PWYA 3QOXA 1XLIA 5DLYA 5DT2A 3AYTA 2B3TA 2JH9A 1MUWA 1RJEA 1B42A 8XIMA 5J8LA 3M4XA 2G72A 5T67A 4RX1A 4RVFA 3SXJA 3JU2A 4BLWA 3OFKA 1KPIA 5CVVA 1FPQA 2HK0A 2IFTA 2ZFUA 2PT9A 3DMGA 4XIAA 3T7RA 3HA7A 4CWAA 4EVIA 2FPOA 5FA5A 3JWGA 2XVAA 5LQUA 4OA8A 5IH3A 1XYLA 4PYQA 3UJ6A 4KVZA 2YXDA 3KQOA 3VNIA 4PGGA 5EHIA 5HZMA 3CNYA 1SQGA 2DPMA 5EVJA 3UJ8A 5CCXA 1XJ5A 2PX5A 3E7PA 5DRTA 5CVDA 1D2HA 10MHA 3OZTA 3KCJA 2IPXA 1KP9A 3G8BA 5F2NA 3ITOA 3QC0A 4HHMA 2Q41A 1BHJA 3DOUA 3O4FA 5CUQA 5DTRA 4X63A 1XIIA 1DIDA 1N7JA 1WXXA 5CVEA 5FHQA 1U2ZA 5GOZA 4HC4A 1UIRA 2FHPA 5HILA 5E2AA 1QAQA 4QPNA 1R8YA 2E5WA 1ZGAA 4ER6A 2B78A 3CQHA 3EGVA 1YFJA 3KQPA 1INLA 1TPYA 2FK8A 2R3SA 3P9IA 5K09A 3IUIA 2BM8A 3MCTA 1XIFA 5AVHA 2P8JA 1XINA 5GWXA 5K0JA 3M0XA 3C0SA 5XIAA 3E8SA 5E1OA 1XDUA 2VDUE 1XLFA 3A7DA 2H1RA 2GVEA 3LL7A 2OZVA 4EACA 3C6KA 1O9GA 3TR6A 3G2OA 3UZUA 4A8NA 3FRIA 5E8JA 2G1PA 2CL5A 3BWWA 2XYRA 3ELUA 4IWNA 5CIYA 3EGIA 1FBNA 4P7JA 1XLHA 3LSTA 5DWQA 4XSMA 3G2MA 4FSDA 3JWIA 4FSXA 5EQJB 3A25A 1I6NA 2YR0A 2VS1A 3NWEA 2ZZNA 4ZBCA 5GINE 3C0QA 4DVOA 3UA4A 1JG2A 3GRRA 5K0LA 1P91A 2QRVB 3EEOA 5CVJA 4GJJA 3VNJA 1L3CA 2PX8A 3MTIA 2P1DA 4FGZA 4PIPA 3UVAA 4LWPA 5FHRA 4RTLA 4QEEA 3BANA 2AN3A 2FK7A 3A27A 3AYVA 3LGAA 4DKJA 5HIMA 2GYIA 1YZ3A 3UJCA 3ER9A 5KYGA 3MQ2A 2Z6QA 1EG2A 3FUTA 4POOA 5LQJA 5B1SA 3ER8A 3ITXA 2AOTB 4WVLA 3XIMA 1KR5A 2PXCA 5K03A 5FADA 1NW8A 1BC5A 1T43A 4J4KA 2JJQA 2YXEA 1NV9A 4RTRA 3ITTA 4C08A 5LQAA 5HIKA 2KW5A 1EJ6A 3CQIA 5JR3A 2WA2A 3LDGA 4E2ZA 3FPJA 3P9CA 1M0EA 4KDRA 4RTOA 1XLEA 2XYQA 3HVHA 3P2IA 2XYVA 3DLCA 4ER0A 3HCFA 3Q7EA 1GW9A 4CKEA 3KU1A 1XCLA 3OE5A 4K3ZA 5C0OE 1VPTA 3FZGA 2ZCJA 2YUIA 1RJGA 3OCJA 4YV2A 3ERCA 3T7SA 4EQZA 3LPMA 3C6MA 4XISA 1ZQ9A 3BWYA 3SGLA 3SR4A 3OBEA 1NKVA 3DR5A 3I53A 3THSA 4E30A 5KQRA 3I64A 3HCAA 2HMYB 5DX8A 2O57A 5E1DA 4PGHA 4ZB0A 1HMYA 4R8SA 3DMFA 4YUWA 5LR6A 4RTQA 2QUMA 4GQBA 3E05A 1VLMA 4PIMA 1S5NA 1MNZA 2ZW9A 1R18A 3FTDA 2NXJA 2GUBA 2OB1A 2F8LA 3AY0A 3GNLA 1JQDA 1MJFA 3RODA 3TKAA 1WG8A 3KBSA 4QDKA 2P3LA 4X61A 4Y2HA 5AVNA 1JTEA 3PVCA 5CCBA 4C03A 2ZVRA 3M0VA 2ORED 4HGXA 4YTRA 2PV0A 3CJRA 3M6WA 4Z2YA 1XIHA 3P2KA 3KTCA 5DPMA 5DSTA 4GUAA 2PX4A 3BT7A 2FRXA 5K0CA 3IUHA 2AS0A 3HCBA 3IYLW 3M0LA 1DE6A 1RJFA 2ADMA 3LBFA 4FP9A 4PNEA 3P6LA 2GLKA 4R6WA 4A6DA 5ICCA 2AN4A 3GRVA 2IH2A 3C0KA 5GM2A 3GGDA 2JH8A 3TKYA 4YTTA 3DXZA 1WXWA 4DQ0A 4QE4A 3DUWA 2G4JA 3FYDA 2ONZA 3EVDA 4P7FA 3DMHA 3KPYA 3AWIA 1XIDA 3A26A 3RW9A 2UZ4A 3MB5A 3HVIA 1SG9A 5E8RA 3BWMA 3DLIA 4Y30A 3ID6C 3K0BA 3SVZA 2Q02A 4UOEA 2HR1A 3EEYA 4ATNA 3OU2A 3G2PA 3GJYA 3UU0A 5EZSA 1BOOA 1XLKA 4NECA 2Z6UA 3QZAA 4A8IA 1EJ0A 1M6EX 3TM4A 1JTFA 2XVMA 2NYUA 4QVGA 4E33A 4HSGA 2PX2A 1NW6A 4E70A 4XCXA 1RI1A 4WXHA 3JWHA 3VNLA 5EZQA 2UYQA 4DUOA 2N47A 1QTWA 3KR1A 5F2OA 1KXZA 3SM3A 1R74A 3GDHA 3PFGA 4U7PB 3DP7A 3FPEA 2K4MA 1XLGA 4RV9A 5LQCA 2XISA 3XISA 3MGGA 5EIWA 4F86A 2ZZMA 3NWBA 4EAYA 4E31A 2PY6A 2JHCA 4KDCA 5EOVA 3TPZA 5KVAA 3HP7A 2PWPA 3F4KA 4HTFA 1XLAA 1BXBA 2UYHA 4QTTB 1YFLA 1HNNA 1SUSA 3GO4A 4CTKA 5DXJA 3PLAE 3M0HA 5DRYA 3G5LA 3UJ9A 2C7PA 4US6A 2PKWA 1I1NA 3FVMA 3KBVA 1RI3A 4W4QA 4G56A 2XINA 3KPWA 3PX2A 4P58A 4PYKA 5LSAA 5BW5A 2HWKA 5CVUA 1R00A 2PBFA 2AOWA 4RTSA 4GF5A 3A4TA 3G2QA 5JUWA 3HVJA 4HRAA 3TM5A 1XLDA 4BP1A 4M36A 3NTVA 2I7CA 1S5MA 5G02A 3CWHA 5U4XA 4O29A 1G8AA 1I4WA 4KW2A 1XCJA 2NXNA 2OB2A 3O31A 3NDIA 1NE2A 4KIGA 5BW4A 3KR2A 9XIMA 3CQJA 4QVKA 1VP9A 5K01A 5K0GA 3IHTA 1XTPA 4B17A 1XYMA 3XINA 5LQRA 1CLKA 3PS9A 2I56A 3I5UA 2O05A 2G70A 3FPFA 1XLMA 3M0MA 1O54A 3LDUA 4FZVA 4Q7IA 2BZGA 2GH1A 2OYRA 1XLCA 4BLUA 5EC8A 4OX9Y 4U7TB 3DXYA 2ZBRA 2YTZA 4P7GA 1JSZA 4GOLD 4H0NA 1O9HA 2V74B 4V0RA 1DL5A 2YX1A 3UA3A 3UXIA 3G8AA 5GP1A 2PLWA 4LECA 1L9KA 3EVFA 1L3BA 1UFKA 3V8VA 4DM3A 1AF7A 4YMHA 3BUSA 5BP7A 5FWAA 2PXXA 2ZTHA 3UJ7A 1RJDA 1TW3A 2VP3A 2P7IA 4AUKA 4QDPA 4C06A 3BKXA 3KQTA 1JR4A 2BR5A 2ONYA 3KKZA 3LCVB 3MAGA 2AOVA 3R24A 5HFJA 1JSXA 1JG4A 2FCAA 5BXYA 4XUCA 1AQIA 5GM1A 3G89A 8XIAA 1F38A 2CWWA 3CC8A 3CVOA 2IBTA 1PJZA 5LQNA 4PCLA 1N2XA 3DX5A 4YMGA 1K77A 2DULA 5DX0A 3G5TA 3FPHA 3WQOA 1JG1A 3P2EA 4F85A 3GNXA 2P40A 4YUZA 4ZTBA 5D1HA 4BP3A 5MHTA 3EVGA 1KYWA 4FR0A 2X7VA 5DM4A 1KHHA 8MHTA 3DH0A 4PYMA 3M6VA 1QT1A 4QQNA 3FUVA 1G6Q1 3MCZA 3VC2A 4ZB5A 3FTFA 3ELDA 2EJUA 3UBTA 3KQYA 4FS8A 2QULA 4HH4A 1OR8A 2HNKA 4PFHA 4RTNA 3BWBA 3VNKA 1ZKDA 3CCFA 3GXOA 3OZSA 5GIOE 3EMBA 4YUVA 3OU7A 5FULA 1XIEA 4CXMA 7MHTA 1VL5A 1XVAA 1JG3A 3HM2A 1I60A 2O07A 2PT6A 2ZWVA 1D2CA 2JHAA 3G88A 4GOMD 2H00A 4KRGA 5E1MA 4QE1A 3PX3A 3HCCA 1X1CA 4ISCA 9MHTA 3WSTA 2AOTA 3FUWA 1X19A 1YF3A 4YV1A 3ANXA 3BZGA 4R8RA 2H11A 2HV9A 5B7YA 3GWZA 3KCLA 3LX6A 4QTUB 4QQKA 3IEIA 3X0DA 3TFWA 1XIGA 2PGXA 2ZDSA 1TW2A 2B2CA 5CD1A 3P8ZA 2C7QA 2GPYA 3SX0A 2OKCA 4EKGA 3L23A 1D2GA 3JWJA 2ZULA 3M33A 4AZWA 3I9FA 4AX8A 2BM9A 1A0CA 4M38A 3O7WA 1XIJA 1R8XA 2ZIEA 3ORHA 4HNOA 2NP6A 3LBYA 1D8WA 1L1EA 2HK1A 5D1NA 5K0BA 3LKZA 1QZZA 5XIMA 4IKPA 2VDWA 4XUDA 3C3YA 4CTJA 2WA1A 3HTXA 2QYOA 1JQ3A 5EMLA 5FWDA 5XINA 2CMHA 3B3JA 2AZTA 4EKIA 4OBWA 2ZSUA 3KPUA 3AAMA 1VP3A 2XIMA 4GEKA 3Q87B 4KIFA 3BDKA 5DM0A 3KBWA 4RVGA 3NVKI 5K8VA 1O1HA 5HEKA 5IKMA 1EIZA 1KPGA 3NDJA 1Q0SA 2ZBPA 2OPBA 2UYCA 2G71A 3VNMA 5H1WA 3OPNA 3NGFA 4QDJA 4XIMA 4YUXA 1AV6A 2Y1XA 1XLJA 4PYLA 5K0FA 1Q0TA 1ORIA 5CM2Z 3THRA 2GAFA 2YQZA 2ZWAA 3EVBA 4V0QA 1XLLA 2AVDA 3VYWA 3IV6A 1MHTA 2EG5A 3LHDA 3BKWA 4HHLA 1SKMA 5FQNA 1A0DA 4X1OA 2P35A 3EVZA 3FTCA 5DSXA 4BY9E 1XP3A 2ERCA 3FRHA 3LECA 5E1BA 2G0WA 2O06A 4HGZA 3OZRA 5K0NA 3EPPA 2QE6A 2NQ9A 4X60A 3SMQA 5DX1A 1WZNA 3HA5A 3CBGA 2VZ9A 5DM1A 5FTWA 2GLUA 5KQSA 5DM2A 2AOUB 1XICA 5HIIA 3R6TA 1G38A 5DTQA 1QANA 4MTLA 1XISA 3KBNA 2PXAA 5P8WA 3P9NA 4RVDA 3LMZA 4OVXA 1N7IA 4MIKA 2I9KA 3MTEA 3EGEA 1NW3A 3HVKA 4CKBA 4RVHA 1YZHA 4QPPA 5HIJA 1XDZA 2J6VA 3K6RA 5EG5A 4GC9A 3U81A 5EGSA 3DBNA 1VE3A 5B80A 3EVCA 3UJDA 4DF3A 3B89A 4RTPA 1QUMA 2C7RA 5GIPE 2ZZKA 4C04A 2JHPA 5EIFA 1IY9A 5T64A 3U0HA 1DUSA 2IP2A 3KQQA 3QXBA 5H6HA 1JQEA 2EJTA 3B5IA 4KW7A 4MHTA 1DIEA 4QEHA 3HEMA 3DULA 3VYLA 1XIBA 3TLJA 4OQDA 1WY7A 3GRYA 4OQEA 4DZRA 4E2WA 4DA4A 1NW5A 2IBSA 2IH5A 1X1AA 3EVAA 3FYCA 3R9XB 3T0IA 4PGLA 3HCDA 3H2BA 3ITYA 1G60A 2I6GA 1P39A 1EAMA 3TOSA 1M6YA
chains in the Genus database with same CATH superfamily
1H8EA 2VDVE 5TGDA 4F4RA 4E6MA 3PR1A 1KFJA 2O8DA 1NMYA 1YS1X 2WSYA 3GZ4A 2QD3A 4YJGA 4IIJA 2NZWA 3ZBPA 4P61A 3AR9A 3DBIA 2JIRA 3ZZ1A 3LUTA 1YTUA 3I9OA 3GLIA 3AUOA 3OSZA 2IUZA 4IDOA 4HPNA 3WR5A 2CVQA 5I3IA 4RE2A 4B81A 1B8NA 3SCUA 5I09A 2CDRA 4HHEA 3QVJA 4WJKB 3CW9A 3QE4A 1FDVA 3A6EA 3O1HB 4P33A 1DAOA 3B3GA 7YASA 1TO2E 3NOVA 2X1TA 1ZMBA 2DIJA 4FLOA 2W70A 3PJRA 4LJ6A 2C1IA 4G4IA 2BYTA 1QDUA 1DS6A 4HUTA 4M7RA 4B6EA 4QULA 1NEYA 1B31A 2AEMA 1ME9A 1I4OA 5DIFA 3KDNA 4ND4A 2Q7DA 1ECJA 4PZEA 4D0GA 1L5GB 4HQFA 3S0JA 2AG0A 4RTKA 3RGWS 1M1BA 5L40A 2FW1A 3ZS4A 3ONDA 3ITLA 3NEPX 1FB5A 2RBKA 1XGDA 1MC1A 3P3BA 4BEQA 4Q32A 1LSUA 4R9XA 5JJKA 3T54A 1TIBA 4DNMA 3I30X 2O19A 4UMFA 4I9FA 5J4HA 4EWLA 3JRXA 2DZVA 1UMBA 5U9CA 1LBTA 3BJEA 4HJFA 3UJ8A 2I76A 2R48A 1TOAA 1E51A 4CUCA 3QIVA 5A9SB 3FR8A 1BVYF 2PCEA 1XAIA 2V7GA 2WMIA 4PLGA 3VR4H 4GPIB 1YC5A 4RHTA 4KGVA 1Z6QA 2GVEA 4NJKA 3TR6A 4N6NA 5GNXA 4MI1A 3T9EA 3DLBA 1SMAA 2BFPA 3U7FB 4FK9A 4BO1A 2CXUA 4H04A 2X5OA 2R7AA 6YASA 4FU0A 3GCXA 3V48A 1O8BA 2B34A 3CV2A 1WZ2A 4U8GA 2Q28A 2QT1A 3ANSA 2G3NA 2PLKA 2BP1A 1DAEA 1F05A 2VYND 2J3EA 1TZZA 2QMHA 3W2MA 1Q22A 2D3TA 3QHAA 2JCXA 3MKCA 3WQVA 2Y85A 3THUA 1YHNA 1EGMA 3R8FA 4UTKA 1J6UA 3DJYA 1R27A 1OFVA 2PV0A 2ZQ5A 4PEKA 3C6XA 3OESA 2V65A 1EHYA 2CDAA 4NOMA 4PAOA 1Z15A 3P6LA 5JNVA 1D07A 3C0KA 2VH2A 1FOBA 5CHEA 1GR0A 1JT2A 3MFYA 3F6RA 2ZTSA 4I9NA 3OU2A 2HDNB 1XLKA 3BLDA 2PDHA 3OP1A 4DQVA 4J29A 4UNSA 2B1RA 3RVLA 4EAYA 2JHCA 5CEFA 3OH8A 1BTMA 1GUZA 2OPHA 2A1UB 4D99A 3D3NA 1EYEA 5D32A 2AOWA 4JLVA 1ZY2A 2ERYA 4MMZB 4M1KA 1BXGB 3TAXA 4ALKA 1MAWA 2C00A 3FCYA 2ASEA 4FSHA 1XO1A 2VFGA 2XFFA 4MH0R 4WXYA 1XMQB 1J5TA 4XD7D 3LOTA 3M0MA 4EW2A 1CERA 5CVTA 3GZNA 1Z75A 1E4LA 1WCYA 3P0XA 1TIWA 2PLWA 5A94A 4IDPA 3V46A 2JA1A 4C4PA 2XIOA 2PIDA 3W7MA 1RAIA 3R6IA 3V2HA 3PZGA 4UM5A 1ZRMA 3VOBA 4DLUA 4O1MA 1RM3A 1RYFA 2VDIA 4O4IB 2X77A 1KNXA 3DVQX 2NU8A 2O07A 2PT6A 3ZLHA 3PL1A 2B2NA 1HWYA 1E70M 1K9DA 2JKVA 1E7MA 1RE1A 2OYMA 4DXHA 5IJAA 1DC5A 3BBLA 4CQDA 3RVDA 4O1IA 1ECCA 5HJLA 4KEVA 3OIFA 2I2BA 2GAJA 4LCQA 3NX4A 1CRQA 3ZOZA 1RD5A 1Z6YA 3PI6A 4ZC8A 5DANA 3EIOA 3DPIA 1J90A 3NEAA 4GICA 3JQ6A 3RR4A 3THYA 4JOSA 1SK8A 1CUVA 5I9MA 2VR1A 5F5XA 4TKVB 1XTBA 4DNFA 5P8WA 2CFOA 3KVYA 3MTJA 3T6CA 1T9CA 1KV8A 3T7JA 3HMKA 2GOYA 1SMKA 5HINA 1K7SN 3WWZA 4KLZA 1CHNA 4BMVA 1FP4B 2X1SA 1NOKA 2IH5A 1WPQA 2QDKA 3AHHA 2FW7A 3W1UA 3D6HA 4ZHQB 3WF3A 4R1SA 5DZSA 2D2IA 1TK9A 5LHFA 2QB5A 1IXQA 2HF2A 3HCNA 3U2EA 2YWEA 3UJBA 4KR0A 4ATDA 2X14A 2W92A 2Q8PA 2IMRA 4M7WA 3BVJA 4QREA 4MSUA 2QTNA 3E9ZA 5FQOA 5ADVA 2IDKA 3R0VA 3CLVA 4C22A 2MYUA 1HKJA 2GZ3A 1FNBA 1VRVA 1EO7A 3PR2A 3KK0A 5J04A 4WRRA 1T5LA 5FNZA 4ZDKA 3S6OA 5FJUA 3VK5A 2R9RA 1GNQA 4N9WA 2DHQA 4FKBA 2C2HA 5A6JA 2OMKA 3CPRA 4H7JA 4IYJA 5I7RA 5FB3A 4DLWA 3EX7C 3GVRA 5KQSA 3HURA 3FVVA 5CG1A 5F9MA 5ICFA 3NHJA 2XNDD 2MYTA 2Z2KA 4HWGA 5TQVA 4YXGA 1T10A 3IODA 1PD0A 1Z6XA 2LW7A 3DZ1A 2GM4A 3GHSA 1A9XA 4LHVA 2CHQA 4RK5A 5CB8A 1QX4A 4S3EA 1EX1A 3ILHA 3IBYA 1M5TA 2VVNA 1NFRA 4RVOA 4XFJA 3M6DA 4XSVA 3MXTA 1KIFA 5HKAA 4ZL1A 3P5YA 1L7NA 3EDOA 4UM9B 5FWNA 5JBNA 3W38A 3INGA 1AQJA 4LV5B 2DU8A 3DKKA 4K8HA 3FZYA 3V0SA 2OXFA 4G85A 3CH4B 4RXGA 1F2JA 1HE1C 2ZYWX 5CCXA 3E7PA 3ZZTA 3FGCB 3VXGA 3QMSA 2N75A 1O87A 3EIUA 3TYDA 4DV0B 2FMUA 1YZGA 4G89A 4GO9A 2CVFA 1ND6A 5H83A 1Y9ZA 3OOJA 3F5SA 1Z4LA 2XVLA 8LDHA 4AO8A 1TXGA 1DAMA 4C6NA 3SEZA 5JC8A 3IC5A 3SBDA 3P7YA 4JT8A 3RFAA 1L3CA 3WJZA 4FGZA 3WADA 4LGMA 4Y7EA 3EX1A 1SZDA 4MWGA 2DIEA 5TC4A 3HJNA 3TTSA 2VTDA 4P2BA 3DBPA 3CUYA 2M2IA 4UFNA 4DY6A 2J3LA 1EFZA 1UL1X 4LV4A 4GYJA 2QX9A 4B7CA 3CQIA 4NI5A 3FPJA 3IBCA 3EPKA 2JFWA 2WMOB 1NLYA 1DAGA 1N2SA 4UZUA 2QLBA 2KAUC 1QHHB 4D0LB 3I64A 9ATCA 3VUFA 3NXFA 1K06A 3MBDA 2EQAA 4NF2A 1RS0A 4A2CA 3J81k 5ARDA 3NNDA 3LHWA 3QG1A 4IVRA 4WK6A 2I03A 2JIPA 3LPNA 4KEAA 1WZLA 2VUSA 1HGWA 3EAUA 3ARQA 4ONVA 3JZIA 3IAUA 1QYCA 4UKDA 3M5YA 4OHZA 1DAFA 1R66A 2QIPA 2VD9A 1H1LA 4KPUA 4C6SA 2DORA 3ETNA 3IDSA 1FTNA 1JZ8A 3EXG2 3ZWPA 3PIIA 3DBRA 5ARBA 4JZYA 5IJXA 1XC7A 1SUDA 4UATA 2MDTA 1SU5A 3NTVA 1NJSA 2P30A 3EC2A 2XOKD 5F2GA 3ITCA 4ETNA 2JCBA 2E9SA 3MWGA 3U7GA 2QR2A 2O05A 1E9IA 4FFBA 1NMQA 3NUZA 2A9JA 2POZA 2QJTA 4OHFA 4QDOA 3CX6A 4IT1A 3I2YX 4RNJA 5BSUA 3EWAA 4CQAA 1VMIA 3KQTA 2CLHB 1C7IA 1GOWA 4OSOA 1BU5A 4B7ZA 3QEZA 1AQMA 1JH9A 2VHZA 3QVUA 4PV7A 4OT7A 3GNXA 2ABWA 4B7XA 1YI1A 2OGTA 3MT1A 4HGPA 1HL7A 3PEVA 2NVUA 4PTMA 4RA6A 3QJAA 4OX9B 4N4AA 4YJ2B 4D8AA 5KSYA 3G88A 2WQPA 4YAJA 3TCSA 3GVIA 4WY2A 4KR6A 1C3EA 4HVXA 4CQMD 3E9MA 3AUXA 1YE4A 5DMMA 1Y7TA 2YV5A 4J3FA 3WQ5A 5H7XA 4QSHA 4Q0MA 2XUPA 2OQLA 4D81A 4FIZA 2QQ6A 4Q01A 5BNIA 4RSHA 1WWKA 4Q3AA 4LJ9A 5F1UA 1JYFA 2G1AA 4WOJA 3HKBA 1MQ8B 2Y71A 3HU7A 3AEZA 4NYIR 1CIPA 4KI0A 5B6IA 2V7BA 5DTQA 1LLCA 4CF3A 2PBZA 4RVHA 4DV1B 1TEVA 4O50A 5ALEA 2AN9A 2FN9A 3AO0A 1GPAA 4H9ZA 3WJWA 1QV7A 3R3SA 1LJLA 5M2FX 3PZRA 3WMFA 2P9BA 2EPHA 3VR3A 1EHAA 1T29A 2WIJA 3LP8A 3NHKA 3W3AA 4AMGA 1I1HA 1TJ1A 1N6OA 4FR2A 1TI7A 3O8NA 4B3ZA 4GUJA 3KCOA 4JEJA 4RL4A 1AUOA 1V5EA 3ARZA 2LBPA 1CUAA 2CMDA 1SQFA 1W0JD 5JEDA 1EP3A 1M8PA 3AYRA 4DRZA 3KS9A 4QXIA 3KO8A 3ZHCA 3AXSA 1GEQA 4U2YA 4KWCA 1RWXA 5JI3E 4PTNA 5TJ9A 4M37A 4B4OA 1A5AB 3LDAA 1EFPB 3U3HA 2VEMA 2GCEA 3LTNC 2J6XA 1FWEC 1RAKA 5KZDA 4GX0A 4BQFA 3ARPA 5D2WA 5BXSA 4JA2A 1TV7A 3AGQA 3CO0S 1P73A 1FHUA 1E3QA 4IOTA 2FRDC 3V5CA 3FA4A 5CPNA 3ZXYA 3E0LA 3VI3B 2FSVA 5BOFA 1CEQA 3BMCA 4F7DA 3MGBA 2C99A 1R3WA 4LV9A 4CQ8A 4DW8A 3W1AA 4DADA 2ZBGA 3IJLA 4B16A 5E7QA 2HREA 4TTIA 3ELFA 3PHIA 3DUGA 3EVTA 3VNRA 3AI7A 1N6RA 1H7OA 2O1EA 2HQAA 4D8VA 2APJA 1E15A 3JU2A 3T3NA 4GX8A 4AD0A 4H3SA 2G4FA 4RNFA 1WPXA 3NHZA 1XCOA 5CFQA 1F14A 3EXHA 5FAXA 4BNYA 1B54A 4FMDF 3AUTA 3OFSA 4RJIA 3OSUA 2PVPA 3G8YA 3B8WA 1H11A 2QK4A 2PD5A 3KS6A 1RW4A 1G1YA 1EJ2A 3E5NA 5JCOC 5JJCA 1I7QB 4L4LA 2WWRA 1RLDA 1H5NA 2GK1A 4DWDA 4PCTA 5K8LA 4Z0JA 4AD1A 5AK4A 1TC1A 1S9HA 5CDSA 3MMXA 3C2YA 3VYRB 3ASYA 4KWTA 2OAP1 4UNIA 1PSDA 2SKCA 2E6KA 4E5DA 4M0DA 5K3AA 2BY0A 2GO1A 1B9ZA 3DE4X 3C5WP 5AOCA 5TD4A 4MI3A 2AGVA 2WJ6A 4OHCA 1J2UA 1S9DA 3IBSA 3GGSA 5K4AA 1SQ7A 4NU8X 1MC5A 3P4UA 3VZSA 3BWVA 5DWVA 5DYWA 1L7PA 2G5CA 3B8VA 2NXJA 3B6JA 4IGKA 4UEQA 3ANYA 4EJ6A 3GK0A 3GHRA 3O83A 1V6SA 2PUTA 2OV4A 1GQSA 4LMPA 2PX4A 4GM1A 3GGDA 3A4LA 2QUIA 1YMYA 5H3LA 4FEEA 1TT5B 5B2ZA 5TX7A 3ZH2A 3NPXA 5KQMA 2Z27A 1JEQA 3RJMA 4BGEA 1P7TB 1SXGA 2OHXA 3IESA 3KSAC 4D4JA 4M6VA 4OOFA 3VDHA 1Z28A 2JAPA 1UXHA 5F35A 3OF3A 2L17A 1XFDA 2WJZB 4Y2QA 4AN0A 5H91A 2FFJA 4BV2A 3W9ZA 5CDYA 3U5UA 2YYYA 4OL0A 4RLIA 1N4AA 2VAPA 2VMFA 3Q9LA 4ARUA 3L4SO 3UJ9A 4US6A 2A2ZA 1Z7GA 4JVLA 4OGWA 4RTSA 4MAZA 3PDHA 2EP5A 1R5OA 2BKXA 1XLDA 2WSBA 3HO8A 3OA3A 3CYJA 3DEAA 4H19A 1JZ4A 1SIUA 5CG7A 1M1NA 4C6EA 4CVNA 1MF7A 3ETGA 3QG5A 2H3BA 2WF7A 4Q7MB 1DCMA 2IK8A 2DH6A 3OOEA 3S3GA 1UWAA 4G5RA 5KMYA 2YX1A 5BWNA 1T0PA 1D09A 1ZY9A 2P11A 1VL1A 1E4MM 4C9BA 4WXMA 2Y6ZA 1LT7A 5GM1A 4X00A 2GRJA 3W5UA 2VWQA 4ZHSA 1KFKB 1B90A 3NYDA 4JN8A 3D3WB 1G6OA 4MO2A 2WD7A 2AFHE 2WU4A 2WU0A 3E8XA 4EZBA 3Q67A 4GX5A 4S39A 4OUIA 1U1CA 1H4PA 1GAEO 1N7HA 2R1ZA 1T2AA 3QA3E 1PN3A 1I4EB 1MH9A 1RHMA 1DU4A 1FWTA 4G5DA 1UJNA 3KCLA 1QQ7A 4PSRA 4JX5A 1BQGA 1UOZA 1RJWA 1KXHA 4EHFA 4NULA 1DRKA 1TQ4A 3M33A 3CVUA 4QPZA 5AKGA 3TRHA 3P32A 2WC4A 4I7WA 4YAWA 1MDRA 1PGNA 4XW2A 4I1PA 2YDAA 3W7EA 1IUKA 4CNNA 1V25A 5FBKA 1ONRA 5FSDC 1O1HA 4UULA 5HEKA 2G71A 3HPRA 5D9NA 1USVA 3DDNA 2P9HA 2DY1A 4OAPA 2VNIA 4BY9E 3KU4A 3BEOA 1UEXC 2OK8A 4LJAA 3DLAA 5D2CA 4F1KA 3DE1X 5LP6F 3D8BA 2LCIA 3H8JA 4EJSB 3IAS6 1YRQA 1V08A 3PVSA 3Q37A 2Q8XA 1WY7A 4QGBA 2JFPA 3FYCA 4V1CI 4I3HA 4E08A 1CUUA 1HNZB 3QQWA 1MO4A 2QJJA 3SRKA 4PUUA 2ZXAA 3ME3A 3DFFA 1JAHA 1MUMA 5FI1B 2ID8A 2Q21A 2ZYSA 1U1JA 2BCGY 2BDQA 3AVWA 4ES6A 3K70C 3K4HA 3PFHA 3UJNA 3OX4A 4MV7A 1KTBA 5HKKA 2J5KA 4IH9A 2A0XA 2RAFA 4EATA 4KQNA 1BHO1 3PRJA 3FTNA 1PKMA 4WZAA 2BI7A 5EMKA 3RASA 2XZPA 1U11A 1BD4A 5I03A 3VR6H 1JDTA 4TU1A 3JRKA 4PZVA 2O2HA 5HFAA 4RV5A 1YJXA 4IVNA 1CZRA 2H5LA 4PONA 1SB9A 2RG1A 2QYGA 1SUIA 1FTSA 1XU7A 3WGJA 2QW5A 4L9RA 1DTEA 4YIKA 5TPWB 3R7WB 1US2A 1RJPA 1XWFA 4X6LA 4D46A 2YNMA 4PS1A 4I9MA 1Z3CA 1R6XA 4IW3B 1EBHA 4MRNA 4W6ZA 1QP8A 4CN6A 2JBAA 2PN1A 1QW9A 4DWSB 1H3FA 1ELOA 4RBNA 4AI6A 3O82A 4A82A 5I23A 3VNVA 3KKEA 1Z8AA 2EIXA 1RKQA 4OAOA 4GK8A 1YRHA 2J3MA 2PTDA 5CT8A 4J4HA 4JHMA 4JQ1A 2RJHA 1NE7A 2IHUA 4I1IA 3BGDA 4MW1A 3ENLA 1CC1S 1C8KA 3LK7A 1FCVA 1YE5A 2VJOA 4B3LA 1EQ2A 4XXHA 3S6JA 4W87A 1GGNA 3RLVA 2DT5A 4MWSA 4ZVNA 3SEFA 4RV8A 2HSJA 5LBTA 1GSAA 3B40A 2NV2A 4NV3A 4DQUA 3AM4A 3FRJA 3B0XA 1EF2A 2C5FA 4D2IA 3AB3A 3KRUA 3QRHA 3G13A 2CITA 2VEOA 4C3UA 2HRCA 2FPSA 5IOBA 2O4QA 2OT1A 3VC7A 3OE1A 2Z29A 3E9NA 5AYZA 1C0LA 4AB1A 4KPEC 3H42B 3DTTA 3OO0A 2GFQA 4D0SA 5AICA 3FZNA 2KM1A 1OI3A 2DRIA 3FNRA 3BWXA 2AOSA 3T0CA 1NFFA 2Z2UA 3M5XA 4C08A 2XSAA 4Y6LA 3U6BA 3BJZA 4D80A 4G0ZA 4V24A 3NONA 3Q12A 2IF0A 2CCGA 4CLOA 3ASVA 2J67A 3B8HA 3FIUA 3RF9A 4ZT3A 1PFYA 5ER9A 3ENQA 2OAGA 3HR4A 3NQDA 1PD1A 1BJKA 3RSSA 3M6WA 3V7UA 3ZG6A 1GL3A 2UZ0A 3WJSA 1PNQA 4IGHA 2AS0A 5ALLA 5J2UA 3NO1A 1Z5NA 5ICCA 3VNDA 3L05A 3LAWA 1DKNA 3EVDA 3KC2A 4K6KA 3L0CA 4K9LA 4ERXA 3IALA 4DTCA 3L4EA 4FMDB 5FWXA 5J9FA 2PE4A 1CUIA 3G18A 5JROA 4DPLA 2IDZA 3C56A 1ZI6A 5LZLA 4WFQA 3WDQA 2NZJA 3T4XA 2XINA 4A26A 1DJGA 4GF5A 1ADYA 3JQGA 3DFNA 1UWTA 3TL2A 3B1XA 4C0HA 1OXMA 2NUPB 1LPOA 4OGFA 3WK9A 1CLKA 4AISA 3PS9A 5FYDA 3DCPA 3GFQA 3WX0A 1GUDA 4ZTZB 5DN1A 4UW9A 2B7BA 3HKDA 3UXIA 2HGSA 4LYRA 3VR3D 1C0EA 5JVDF 2YZ2A 1WUYA 2Q0SA 2EWMA 5FBRB 1YDHA 1ODLA 1EGAA 4E5MA 5K8TA 3N9IA 1DWIM 2Z5VA 3WQOA 4B6RA 4G4SO 4G9EA 2I1OA 4OLAA 3GCWA 5KU7A 2YMPA 5IBPA 3T4WA 4PL1A 3QVTA 2JIOA 2IDMA 5BRAA 4G7EB 3V6LA 4R85A 1D2CA 5AO9A 1K70A 3CB3A 4R8RA 2UZIR 1TEHA 1N57A 3VOIA 2E87A 1AD4A 4JDUA 1DOSA 2X9VA 1ZHOA 1OLOA 4TUFA 3HKBB 5KOHB 3G6WA 4B2PA 2BPOA 1EJBA 4PE5B 3L4WA 1JA9A 2WM3A 4F2HA 1EWTA 4F2TA 1GJRA 1BQ3A 1Z4QA 4CNOA 2AVDA 3MJCA 3V5FA 1XB2A 4TKUA 2CZQA 1KP2A 3KXPA 4ZU3A 5BR7A 1CJMA 2YWJA 2PGLA 1TJYA 4IDDA 3VO2A 2GJAA 3ATYA 4U39A 5EJIA 2WIDA 2YCLA 1RWNA 4PG8A 4MB3A 3VOFA 1QHPA 3K2QA 1UJ4A 3K8ZA 3NCOA 3TO5A 2NUBA 4MPDA 1O94D 1TUXA 5JDIA 2Y88A 1FVOA 1OC2A 5CIQA 1C4XA 1WVMA 4YALA 4D3XA 1CUEA 4RVUA 1OU0A 3HDYA 4ZQGA 4DSNA 5CQ1A 4IHJB 3EDQA 3I09A 5ABGA 4MKXA 1K4KA 2EFJA 2HLDD 4GZIA 4XZBA 4HNQA 3URNA 1A5LC 3PKZA 4DSOA 2WTUA 1HT6A 1X7IA 2RJ3A 4ACYA 4CQJA 4WGFA 4MS1A 3EKZA 5GPBA 4XKMA 4M9RA 2BR3A 2O0JA 4NQZA 3TLKA 2D73A 2PKCA 1Z36A 2QTHA 1QHFA 2H1VA 4CNSA 3MD0A 3VZRA 2PEYA 3MPUA 4EPXA 1R87A 1AMUA 3S8HA 1BCSA 2Q3MA 2VJLA 3FGPA 4JIMA 4AKIA 4GPEA 4MS3A 4Y98A 5DLQC 3G1VA 4BFVA 5JD3A 4ML4A 4A2WA 2XYGA 1VKRA 3VHLB 2QP4A 1FP8A 3RVBA 1KYZA 2CL6X 2XOEA 1W4BA 2JJ1A 1VR6A 4H7IA 3KHKA 2YWCA 4MO9A 2V9CA 1ADGA 1C1XA 3GLKA 4EF6A 2XZTA 1V37A 3S6DA 3PHJA 4B3RB 3VOCA 1G8FA 4CR6A 1HLFA 1YIOA 2BKVA 1SBHA 2P0AA 3JWGA 2MSKA 3QYJA 5BN3B 3RDPA 5CNKA 2X58A 4NPAA 3JY6A 4ZK6A 4YCSA 2PPLA 3EK2A 4RR4A 2DBVO 3I6IA 1EDZA 1JLMA 3SXUB 4UXIA 4J27A 1NRIA 3STWA 1C9MA 4G84A 4XQ9A 3R5XA 3TD6A 5CZ0A 2QW0X 5KDLA 4CN4A 3L68A 4OUDA 1IE3A 1TAUA 1FDYA 1MRAA 4P7QA 1CB7B 4NU7A 2ZUTA 3TLGA 3ROXA 3AU6A 4G23A 1PUXA 5EJ2A 4RY8A 1QZXA 4PC1A 3W2NA 2AYYA 3L2OB 5F2LA 1TD9A 3DKIA 4B3TB 2JI6A 4O4LB 4GZ3A 3F96A 1VXOA 3FJLA 4DO5A 3MWCA 4L3VA 4MP8A 1BN6A 1R0CA 2NZUG 2FTPA 2YC2C 3O7UA 3BJSA 3F7JA 2AMFA 3L77A 2PG3A 2XNDA 4LOIA 2W0UA 1BWPA 3WIBA 1NUHA 4K40A 1OT2A 4J3SA 4RJEA 4ETWA 2ZRHA 2IYFA 1EVQA 3ZU3A 3P45A 2V7QD 4YTTA 4QE4A 2HJGA 1GPJA 1A04A 2BEJA 1SUBA 1XSIA 2D8AA 7REQB 4W8GA 2DXIA 3R0XA 4UOQA 1CRWG 3LUFA 4BN5A 4LRYA 2LVBA 3RSOA 1R0WA 1B1YA 2FFBA 2MINA 4EPRA 3MGGA 1RD4A 4AJKA 1EG7A 5JVDA 2UYHA 2GEJA 1XTQA 4UXDA 5CVCA 1L4NA 3CPSA 4WY0B 4OHBA 1HSOA 1K8ZA 5U4XA 1DQYA 3NAMA 2PSDA 5JFGA 4JHZA 3GLHB 5BW4A 4WK2B 4ZI7B 3LQKA 4N7RA 1LOLA 2BB0A 4BNMA 1Q1GA 1IK6A 3KUCA 2YN2A 2CEAA 4B33A 1J09A 1XQLA 1DC7A 2PDWA 2JPDA 3A9WA 4GFIA 4AUKA 3ZI4A 3VMOA 2R0QC 3GJXC 2ICAA 3MI3A 3NIDB 4X84A 4H6KA 2FUEA 3LPAA 3NHUA 3ZPXA 4Y9MA 3KZCA 1KQPA 1A9PA 2P40A 4FXFA 1E64A 1QU3A 1O96B 5JAZA 4JB2A 1G17A 4IMFA 2REQA 4ZB5A 2G3FA 3WNZA 4QM6A 3KVMA 1LBSA 1PZNA 2REQB 2QPXA 2PTWA 2OAQ1 2GILA 1HJVA 4HU8A 1IK4A 4DR3B 2F8MA 1W0KD 3S0CA 3HI6A 1MVYA 2CZCA 2I54A 3SC4A 1T36A 2IS1A 3JD4A 1IJBA 3TMKA 4AYXA 3B1FA 7ODCA 5GZ3A 1VE1A 3TCKA 3LBYA 3EMQA 3A6JA 3C3YA 2PUZA 3QLEA 1CJUC 2OT0A 5DK4A 5T26A 2PDPA 1W1UA 1Y5NA 1ZLPA 2CJFA 3Q7IA 3JQAD 2HIAA 4PNPA 4HMDA 4F4IA 4OB7A 2NNLD 5BWOA 1E3IA 3EGDB 3K7EA 5K9DA 2RI6A 5DX1A 1LZLA 1ZM3A 3H5WA 1W17A 1DXHA 3M49A 5CT9A 2C9MA 3E22A 3FYSA 3PTQA 1GG2A 1NW3A 1I32A 3JQ8A 2WJAA 2B7QA 5AHEA 1GJUA 4DLVA 2Z98A 1FNCA 3RWOA 3W5CA 2A8YA 3ZZNA 4JODA 4WZAB 3HHEA 1U2EA 3WH7A 3GMTA 3IJDA 3FOZA 3BV4A 2O3TA 3D3JA 4NNAA 4NVRA 3G6MA 4R9UC 1MC4A 1YVEI 9ABPA 4KBXA 3WUFA 1UQUA 2FP4B 3PDIA 2NTVA 3OIDA 1QO0D 2XQKA 3LI0A 5J2UF 1EVLA 4HGQA 1VFUA 1MW2A 1CNVA 4OI0A 1NPDA 2YIDA 4R68A 3DHUA 5U4QA 1T2CA 2DBYA 2DH5A 4WN3A 1FLDA 5LIPA 4DKXA 2X09A 3THWB 3PFMA 3R1IA 1MVLA 1SFLA 2IU0A 3WF0A 2RD2A 4CLEA 3DI0A 3B52X 4IG4A 3UMYA 1Q6YA 3NSMA 4OYLA 3KYCA 3AL0C 2R47A 2WBKA 3O94A 4GXQA 2OODA 1VHDA 2EZ8A 4RTNA 4OKDA 1N36B 1TQ8A 1DQNA 2FMFA 3H1EA 1TZCA 2JFZA 3ICCA 2HHHB 1G8GA 2D3LA 3WLIA 1K4MA 2PMQA 3G6LA 1GPNA 4PMNA 5K8UA 2GN6A 2VOMA 4EB6A 1Z4MA 3AKYA 5EZYA 1CYGA 5KNDH 2PR2A 4IPNB 2J3HA 3QX7A 3PS7A 2RC6A 4A2QA 3W8NA 4LYGA 3W2GA 4XZLX 4RF2A 1ZAKA 5FESA 1FYDA 2Y3IA 5EYPB 2FSPA 2ET6A 3DKRA 3WH9A 4F84A 3CH0A 4FGJA 1UPUA 5EYPA 2MCFA 2DR0A 5ES4B 1IWPB 1IEQA 1WQ3A 2PDMA 1PDVA 3ZR4B 2O23A 4FNRA 4OOEA 4BLWA 1DBTA 2XXAB 2FPYA 2RFGA 2QCLA 3OEHD 2R7LA 5DHPA 5CBPA 1N32B 2C0PA 4FS9A 4G5XA 4D4IA 1JFXA 2PD9A 5SYMA 5E2AA 3JU3A 2I3AA 5JS1A 3KQPA 5IKOA 2R3SA 4F1WA 1RC0A 3U48A 3WMCA 2PWEA 4P32A 1GRRA 4BVGA 4P4UA 1SYTA 1QBKC 4QOJA 2PFSA 1DJXA 1JG2A 1QI5A 3O0KA 5CVJA 1WZKA 4XTCS 3SY5A 3OG9A 4IO0A 4OM8A 3H5AA 2P3EA 2C0AA 3HYTA 3BSGA 4YCLA 3VFDA 2EU8A 4YP5A 2NSLA 1H0IA 1E2IA 5IWAB 4QUHA 2XZ7A 5JZ9A 2R8WA 1RXVA 4AZ0B 1OJXA 2O2JA 1X7YA 3E70C 1DQPA 2IYRA 1EQCA 4BVAA 1GARA 1PAUA 3T4CA 3WZLA 5DY3A 2CF6A 4CLDA 1GVNB 4Z2YA 1ZHHA 1DOHA 3CWQA 1PR1A 5EMNA 4F3RA 3SKXA 2FRXA 4OMFG 4XO7A 3BIFA 3BIXA 3RMJA 2GD2A 5LKYA 4NV1A 1UM9B 1Y6RA 5HGXA 4GH3A 4FFMA 1QI0A 4ESHA 4B5SA 2ZT7A 1YBMA 4HCHA 1SCDA 2ZRLA 3EG9A 3FK4A 5FL3A 4C30A 2O8BB 3VNYA 2EDAA 3A04A 1I80A 5I4IA 3P27A 5G0VA 4DWSD 4C2UA 1HL8A 3MRXA 3FVMA 4E4RA 4ALNA 2BGSA 1HOXA 4JLWA 5CX1A 5BORA 1JEDA 3DUFB 2OR3A 4HXGA 4JUCA 5FD8A 4Y9OA 4I5DA 1T9GS 4PQFA 4OX9Y 5FEWA 4S3KA 2G77B 5JHHB 3WN6A 3EVFA 4DM3A 4BNKA 4JLDA 6ALDA 3UJ7A 1JPMA 3H3FA 4BATA 2DJXA 4C6LA 5B2EA 2XA9A 4FK8A 3CTMA 4D0NA 2M98A 5CPTA 3CUKA 3B0YA 2H2AA 3URQA 3MWJA 1CUWA 1KXVA 3SECA 3PXGA 3BF8A 1A9OA 3WQ6A 3RSQA 1UOKA 4W7HA 4ARCA 3GJ4A 2EEZA 1B9BA 2QRJA 1VBMA 5FTLA 3KT0A 3IEIA 1LH0A 3LHVA 2BAGA 2LGJA 4LQLA 3HGRA 4Q1EA 2D5IA 3QUCA 1U5VA 1LW7A 3LKZA 2XH7A 2EO7A 1XJCA 1ZRNA 1EUCA 5DLEA 4XTIA 1VCVA 1AW5A 4CDNA 3EXHB 2V69A 5FL1A 3NVKI 2WIGA 3WB9A 1E1KA 3AR4A 2UYCA 5IJ0B 3VNMA 1M2OB 4DB7A 5BVGA 3THRA 2BDUA 1VZ3A 3EA5A 3LXXA 1H9CA 4QIUA 5LXEA 3VNBA 1KNWA 1EPUA 3IXLA 5F3WB 4M89A 3W2IA 2ZJ8A 4FMCB 1Z7EA 4TTVA 4TTAA 4RKYA 4I5IA 4B4VA 4GS5A 4Q15A 2PI6A 4HYWA 2VC7A 1IHUA 1KR2A 1GT8A 1M1XB 1R0XA 2YQ5A 2D1YA 4IZGA 3RDKA 1QCDA 1NLMA 3T0IA 4HS9A 2QNEA 2JLWA 4IIEA 2ZRYA 2FSGA 7ENLA 3GC6A 4RIIA 2UVDA 1I1WA 3Q7SA 3NQAA 1IB0A 1FIUA 1M1UA 1H22A 1U0EA 3G49A 3TJIA 2BHNA 3CQ0A 2WY2D 4JTLA 1N3BA 3WB0A 4PBTA 3ZBTA 3AC0A 3MDWA 2XW6A 4AWUA 1DUVG 2H4HA 3PB2A 1L5RA 1VYUA 4G6ZA 2DUJA 2NVDA 3F6SA 4NV0A 4IUYA 4JB3A 3ORSA 2XIJA 2DZAA 2Q7OE 1QF7A 3DBHB 3GX1A 1KFBB 4N5MA 2R6OA 3NA8A 4TLAA 5K3BA 3ZHUA 3V1TC 4EFNA 2AEFA 1JJAA 3DN5A 4S05A 3G1TA 1R8LA 1BEZA 3AF0A 5C32A 1XVIA 2GT1A 2V5DA 2HHLA 5JC1A 2WYVA 1ZCCA 1OC7A 1QTIA 1TUIA 3V3KA 1NDYA 2EPNA 1QE5A 1K9EA 5FDFA 5I6SA 1NUQA 2DUXA 2RH4A 3SGZA 2IELA 1NVVQ 2QX8A 5F51A 1K7YA 2DP4E 4Y0AA 5LYJF 1TV5A 5F52A 3K9HA 4FXPA 1TEZA 3RVKA 1TCAA 2Y4OA 2Z6VA 3S1AB 1XN4A 3TP4A 1NYRA 4B6PA 3FV9A 2YY6A 4FOTA 3BGGA 3PE3A 3QR0A 5FI5A 4DBVO 1VL6A 1OFDA 4Z7JA 3TNBA 2VYFA 5K3FA 5T3UA 1JX6A 1M75A 1E5JA 3BOSA 3LZCA 1UJ2A 3C70A 5LD2C 1JEJA 3H53A 4CGTA 1CUCA 3LBAA 4K9OA 3UV6A 4ENTA 2XCRB 4QNEA 1KJIA 1Y7PA 2CLLB 1ACLA 1M67A 2FQYA 1Z18A 3HYCA 5HBRA 1VJZA 3UK7A 3PT5A 4PZYA 4LY8A 1TJ3A 2TMDA 5JAOA 4AD5A 3V8MA 3PNKA 4FCTA 4DYHA 1Q63A 2D69A 3IAPA 3CRMA 1NW9B 4D9HA 2D13A 4DJTA 3A25A 4BB5A 1EGVB 1MX9A 2OD7A 1GGJA 2JHGA 3AJXA 1J24A 4D02A 4DM2A 3PHHA 3JVDA 2VRJA 1XWIA 3D7RA 3Q3IA 5HIMA 3O0FA 2Q3EA 2O5EA 1NI3A 3VD9A 1EG2A 4Y6SA 5T4FA 4TYPA 4J4KA 4F8XA 5C8DA 2WKGA 4K05A 3TEVA 1C3XA 4YNGA 4PQRA 3TH5A 4F2UA 1R0LA 3EJWA 1ULSA 1MDBA 4I5RA 2RCNA 3IEBA 3N29A 5HA7A 3AQUA 4CRWB 1JJ7A 4RV3A 1XIHA 2ZJ6A 2OG1A 3BMOA 4UMAA 3MUEA 2HJPA 2HZGA 3HNPA 4DIFA 4LRXA 1MFVA 1XXXA 1AUXA 4IJKA 2JIEA 1KV5A 1XIDA 4UE3S 4MV4A 3W6UA 2HR1A 1USUA 2O2YA 3LMKA 4KJZA 4Y2YA 3S2EA 4AO6A 4BJ6A 2P0IA 1FDTA 8GPBA 3JARB 1PKNA 1VG1A 2ZS8A 2ZZ1A 3U3ZA 3NHWA 5F98A 4XUGA 3H04A 2Y99A 5JRZA 4YVVA 1NRWA 4F12A 2MOKA 4JTHA 1GTMA 4GSKA 2BSLA 5CNIA 3RSFA 2XQGA 3B1YA 4DCPA 4MUAA 3CWNA 4CGZA 1QPOA 4S3DA 3RROA 2PUHA 1AH3A 1U7TA 1R6UA 1M01A 3BSYA 1RXSA 2JC3A 4U10A 2F8TA 1QE0A 1V3IA 3G2HA 4MS4B 1KM0A 4Q1DA 3KL2A 1RJ9B 3O6YX 1XAJA 2VAWA 2VTEA 4FIDA 4HAOA 4LY9A 1ODCA 1KMMA 3G1UA 2GPTA 4B5XA 1FPMA 1N2XA 3ETDA 4Q4RA 4CM6A 1EGQA 4YPOA 4L4SA 4Z42C 5DM4A 4NJOA 4WQ6A 1EAYA 2QJMA 5FUYA 3AMKA 3MCZA 1KCZA 1EXDA 1NFBA 1KETA 1D5CA 2JLZA 1AQNA 4PFHA 3EXAA 3RLGA 3TX9A 2OE2A 1KI9A 1JIXA 2GN9A 1KMIY 4S3FA 1ZNNA 1MAVA 4JLJA 1CF9A 1MKYA 3JQ7A 2VJNA 1RHRA 4X1IB 5DH9A 2ZXEA 3ZVRA 2WICA 3EGWA 3FSJX 3JWPA 1FJ2A 3KV3O 3E58A 4IKPA 4BTVA 1P0KA 4AL4A 1I33A 2CLKA 4EKIA 1W8SA 3ZVLA 2OP0A 1WXIA 4RETA 5DBEX 2Z24A 2PA0A 3TNLA 2R9VA 4DJJA 4KQ9A 1OBOA 3R8HA 3NRBA 4LXXA 5BOEA 1HF6A 4XIYA 5AUPB 2J7PA 3OF2A 1FMTA 2J9YA 5KZEA 3LCRA 1G64A 1YZHA 4WBNF 3N74A 3QM3A 1PWHA 3DZIA 4O4LA 1SQSA 1GL6A 4K9SA 4Z0HO 2IE8A 3IHLA 2JJ2A 1A9XB 1X1AA 2N46A 1JGIA 4QUKA 1P9WA 4R31A 4L7VA 4XJVA 1G98A 3G2NA 4GMEA 1GWJA 6PFKA 3CNBA 2P3QA 2JFEX 5YASA 3AJDA 4H1HA 1E77A 2GCGA 2PEVA 5T91A 1Y3DE 4KFSA 4GABA 3GKAA 1OGIA 2WR8A 2QN8A 2HXUA 1WBHA 4XBSA 4M0XA 2B4GA 4WR3A 3O1NA 2ODNA 4E32A 2IT1A 2ZR7A 4Q7KA 3U44A 1EX6A 5KBYA 1FP4A 4LUYA 3OZYA 3V42A 1P0DA 1LWNA 2ZYIA 3T34A 2WJ4A 1G5RA 2PDGA 3KKOA 3N07A 1G2QA 2FUKA 1W35A 2BUAA 4YJ3A 1SR8A 2X0NA 5CYFA 1AQFA 3WCZA 4ZO4A 1YV9A 5ISMA 1YDWA 2H51A 1RHCA 3M47A 2WUVA 1QFMA 1VCOA 2GK3A 1WPRA 3MBFA 1WF3A 2ZJ7A 3FUUA 5GOTA 1EA7A 3H9GA 3O2SB 4IXWA 3THQA 1PFKA 4ZDJA 3EXSA 2YNMC 1CNFA 3TYEA 1QR2A 3BMNB 4UTWA 4RYLA 2DH2A 4UTZA 3C0JA 2PDXA 3VU9A 1PDOA 3RRAA 2GB4A 1T0JB 1JFRA 1BGGA 3SI9A 3D4OA 1VJCA 2LKDA 2QD5A 2Q0HA 1HN1A 3UH0A 1J06A 1N5OX 2YRXA 5KTRA 4XZHA 1MDLA 3EHEA 4UDXX 3CRNA 3LW8A 2Y7GA 5CKSA 3L7DA 3H7AA 3UG3A 1Z5UA 4GOND 5FI3A 4Q22A 3NQBA 4FOSA 4I1SA 1M1YA 3Q3EA 1T8XA 1ACMA 4EGSA 1KYTA 5J8LA 4U28A 3Q5GA 1MQSA 5HOSA 2ENWA 3OFKA 3VHXA 1L2UA 3NQVA 2O2XA 1IH8A 4KC0A 3VKKA 3W1NA 1Q8JA 3OZTA 3K0SA 4WEVX 1KAQA 5A62A 2VWGA 4LF6B 3LRLA 1BDBA 3ZD9A 5IAAA 1ZCZA 2BY2A 5KVQA 2DGAA 1MNSA 2VSOA 2NLYA 2W2XA 1ADDA 1SUCA 1PDWA 1WQ5A 1KHTA 3RM3A 2C9ZA 4L5BA 4IISA 4H6QA 3NDZA 4RZUA 1LOSA 1N8NA 2AF3C 4RK7A 3ZK8A 4EP1A 1TTJA 1W3IA 2BFCB 2IVFA 3W6YA 3WQSB 5CJMA 4XWGA 2VKQA 3EF0A 1J70A 1UBPC 2JEPA 4OVKA 4JQ3A 1ZCAA 5G1YA 3CN9A 4IX2A 4KTVE 3VPFA 3C6MA 4JOCA 5IKPA 4MGHA 4EF4A 3RILA 3O73A 3B9OA 2CHVA 4D3ZA 4UBNA 4RNIA 1JQDA 2EJWA 1B15A 2JI7A 2XVXA 1DJIA 4C03A 2RONA 1F4PA 1HC7A 2FN3A 1UBEA 2BY1A 1TWWA 5IEJA 1XH1A 4MQ6A 2YINC 1E9RA 1IAVA 3TL3A 1JV2B 1VLJA 2PF8A 2EKBA 3FZEA 2N1BA 4PFQA 3EX2A 1RPTA 2NYUA 1XA4A 1EBFA 4UBIA 3KOXA 5D30A 5HRAA 2FQ1A 4EL0A 3CVVA 4TX6A 1E6XM 2CZVA 3DM9B 3JD1A 1XLAA 2Q4TA 1Y65A 4Q3MA 3OM8A 3KAQA 3MQTA 3I6MA 3ZJ6A 4ZQEA 3BRSA 1GVHA 5L7TA 4O3MA 3N17A 1UJ5A 3FH0A 3EVNA 2J0EA 3N39C 1OB2A 4WF7A 1P1IA 3BTNA 3N7AA 2E18A 2CB0A 1QFYA 3MG9A 1XV5A 1ZLYA 4U7TB 2XY4A 1KU0A 4V0RA 3RC3A 2Q1XA 4FBMA 1YZLA 2JS7A 4EI7A 4DMRA 2OVFA 3MUXA 4M9XA 1JSXA 3MUY1 3AEQB 4ROTA 3FOFC 1GDDA 4O2BA 4JVOA 4UTVA 2GJRA 3BK0A 4ZI2A 3GJRA 5DHTA 2GXQA 4B2IA 4H2CA 5CYPA 5BPFA 5IVPA 2WWYA 2FNAA 3OLXA 4ZMRA 3R5SA 2CNLA 5HANA 5BNKA 4D9FA 1YZVA 1HKKA 1A53A 4LZJA 3S2JA 4CR8A 2JD0A 3EQ2A 5LB2A 2P2DA 1O4UA 1E9VA 1IC6A 3ESAA 1OEPA 3BX1A 5A3RA 2N1MA 4LF4B 4E5KA 1OX6A 4MS3B 4IQ8A 3ORFA 3FW1A 4ZCIA 3FYHA 2P76A 2PGXA 2EAWA 4TVKA 5C55A 3QV6A 4K9MA 3C6BA 4O2AB 1HDRA 2B83A 5IJ0A 4GPTA 3FPLA 2GN2A 3P9XA 3DE7X 5EIHA 2B99A 4NAEB 2O14A 4UAVA 2BHRA 1TCVA 3AAMA 5KI6A 3UR5A 4C78A 2RCYA 5EZ6B 5A7HA 3OE7D 5J2UB 1QLWA 3H8WA 1HO1A 3PJTA 2B20A 1YU6A 3TZEA 3VZYA 2F3PA 2C2YA 3EPPA 1JG7A 5LL6P 4B83A 5TQ2B 4GI6A 4ZC1A 4PN2A 1JEQB 5HIJA 1J8YF 3MIIA 1Y33E 3EUEA 1XP8A 1DRUA 2GYUA 5KVSA 3K2BA 2R1VA 4UUIA 2XPCA 2GVJA 3B06A 1AS2A 4FHEA 2VT2A 1QDSA 3AFOA 3L66A 3KJZA 2V5KA 3KT6A 3BXXA 2HMWA 1MD9A 1OCBA 1CUZA 4HVAA 1JLRA 4FOPA 3LZ3A 2V6FA 3LLCA 4RDHA 3DE0X 3R9WA 2B8EA 5I3KA 4IWXA 1YX1A 1XZNA 2TMYA 3GNPA 3W5HA 2QUNA 1Z29A 3DMTA 2VA8A 3UXLA 2E8ZA 3ROZA 2VBCA 1J0DA 2OY0A 3K4WA 1XEFA 3CF2A 4PR0A 2FLIA 1NF9A 2C2ZA 4PRLA 1X7GA 3MSCA 3RTBA 1B3XA 4B4UA 2I6QA 3ELYA 1B3ZA 2VX4A 4ICNA 3THCA 2PK3A 3D31A 4JIIX 1ISRA 1F6WA 4XYEA 1I9CB 3WMRA 3DT8A 3UESA 1LF5A 5EY5A 1Z2PX 5KKNB 3COZA 1UFRA 1NLZA 3SCRA 3R3YA 4HZGA 3SCNA 1PYGA 3NC4A 1M7OA 5IPFA 3KZXA 4WE3A 2GFTA 2EGHA 5AUNB 3T40A 4I1RA 1J1ZA 3TWOA 2WU8A 4D6HA 4RZHA 5DTMA 2QSJA 1A77A 1ZW6A 4GG1A 4DA9A 4B3CA 4M80A 3C1AA 1FFBA 3GPDG 1ZMRA 4UUBA 5L3QB 4F71A 3KR0A 4HWPA 3C3MA 1PL8A 5KTSA 2AFIE 5JS8A 3F4LA 3BXHA 1Q6EA 2BGNA 3OT1A 4N3CA 1ZBVA 4N01A 3K1ZA 1T5HX 3TQPA 2NZXA 3HPZA 2VTKA 3EZXA 3WGNA 3OJEA 5DM70 1T4BA 5HR7A 1E1CA 1Q6QA 2A0NA 4R7GA 1CZ1A 2IZ0A 3BTSA 1U2ZA 1ZJAA 3TA6A 1AZTA 4EF8A 4HEA6 4EG7A 1UC8A 4JTJA 1A5BB 2WYHA 3FF1A 1PJ3A 1TUBA 1QR7A 3OIWA 2GJSA 4E22A 4KSYA 4UAUA 4Z3OA 3Q0TA 1R9ZA 3AY6A 2PMEA 1SO6A 3TW6A 3UC5A 2FSFA 1QP0A 1VFHA 4BUCA 3N25A 3WQPA 1CNMA 1P3JA 1U0LA 4ZOLF 1M6VA 4M1WA 3NM3A 1Y82A 3M6YA 1HGXA 4X45A 2FQIA 3QYPA 5BNWA 1U7OA 4PMYA 1OH6A 1CE8B 3BD8A 4YMIA 3D7SA 3R3ZA 1FU8A 1WLSA 5AVQA 4JOBA 2VCAA 3GFTA 3P9CA 4G1BA 5D5HA 2XYQA 1WA5A 2GEKA 2ZBDA 3OCXA 1CXKA 3C3EA 3DZJA 2ONKA 4XISA 3IAS1 4U33A 2WJWA 2Z95A 4Z1CA 3U9TA 1W3KA 4HCLA 3H86A 2O0MA 1KLYA 2OYLA 4J3ZA 1V02E 3M0EA 3TSBA 5E0KB 4ERAA 1ODTC 3NWPA 3V36A 3RU6A 3GXPA 2DFAA 3GLFE 5ADUS 2B7LA 3QEMB 5DGHA 1QZTA 4EJSC 1ZITA 4AJOA 4BWGA 3PBGA 1L5YA 3IUMA 1H4VB 3V4BA 1V6XA 3COWA 1ZB5A 2OOGA 1KAEA 3N04A 4R81A 1E6QM 4IL2A 3JAKB 2R97A 2MSCB 3GNTA 4RH3A 3DYOA 5LUAA 4B5LA 1F3WA 4NNCA 1K4YA 4RD6A 1FNMA 3OTQA 5F4WA 3CPGA 1W9DM 5K5EA 3L4JA 2DF8A 3FG9A 5CX1B 5K0GA 5K01A 3OHMB 4WBXC 1E1LA 5EJEA 4BWLA 5J4LA 3ZLUA 2DHEA 3FNHA 2P1FA 2HU7A 4KN5A 3VI2A 4PCVA 2XE6A 3LCGA 3PSAA 4ZEXA 3M81A 4GDMA 2PM8A 3EG9B 4A0RA 5EN4A 3MIZA 1JLHA 1BKDR 1EQPA 2IWRA 1XZPA 1TZKA 4MUFA 4KN9S 1OAKA 1UA3A 4QFDA 1DELA 3FJNA 2Z08A 2BEWA 3DMPA 4LYKA 3FTFA 4J4TA 1TWIA 1W2HA 5A69A 3N6HA 3NBYC 2LXNA 2IXTA 1ZIDA 3M1YA 4F92B 1RQHA 2J75A 5J2TF 4QE1A 1TJRA 3LQGA 1YF3A 4UNLA 2QVXX 1R6TA 3IEVA 2X0FA 1UZDA 3WUEA 1W2WB 2XF8A 1C8QA 4QQKA 1DC8A 2ZJ1A 1Z4JA 1QRRA 1D2GA 4OXRA 1PK8A 3PC3A 3W2FA 4N3GA 4BGIA 5F3RA 2ZWMA 1NQKA 3T0FA 4JELA 1Y3HA 1YVDA 4AKGA 3KPUA 4K0KB 1LRNA 1PEZA 5LZ9A 1P29A 3UB3A 3RRMA 1UR5A 4A3YA 1S02A 4WK4B 2G4CA 1E98A 3VU0A 1OXKB 3AIRA 5DTIA 3VOAA 5K0NA 4WDQA 1K88A 4HGZA 2Q71A 4HDRA 1PP4A 1X80A 3L7AA 2FHCA 3KUUA 3HPXA 3F8WA 1LBMA 4N03A 1OM0A 3LX4A 4L3OA 1IT7A 4YMZA 2X1UA 5EIFA 4Z8XA 2XWBF 3JARA 2FMNA 3H18A 2BBFA 5HQTA 4K37A 1EFPA 1LX6A 3A1NA 2XZLA 1FS4A 3DTNA 1AZSC 3JD3A 5C8VA 4B84A 2V6MA 2ZBQA 4N6OA 3WK7A 3RC2A 3KM8A 4AF7A 4OGGA 1S2DA 3LZDA 5K4HA 2WZMA 3BW4A 3WNDA 1AKRA 3PHLA 1YDMA 3F4VA 2H4WA 4CQCA 2ZJ5A 5AKJA 3SHTA 1X80B 3EMDA 4GRSA 2CBIA 4DJEC 4I9HA 1MFUA 4IPJA 4XKYA 3E2IA 1V11A 2BEWB 1JHQA 3G0UA 3NQ2A 3R8CA 1T8RA 3AEUA 1SU7A 3QGKC 3O3NB 3UWZA 1JZ5A 4NQ1A 1GO2A 3MPGA 4HQVA 4OV6B 3K1YA 4Y2TA 4ME6A 4QUEA 3T95A 3R40A 4KMMA 5TNXA 4OHVA 3WAKA 1UBSB 1XEWX 2PUBA 4ZEWA 3A2NA 4JN6B 2K5UA 1XYYA 1SB8A 1A5AA 2GGIA 3T5CA 5KSZA 3I1YA 4GJIA 5A05A 3BLLA 2B9EA 3B9AA 3WBXA 3OY7A 3WRXC 3W8DA 1PTAA 5I7WA 2A79A 1AM4D 2WM8A 3ANUA 5HF8A 3EAQA 4KV9A 1T5TA 3REQB 1H2EA 1BGWA 5C70A 2HCTA 4N12A 1X1RA 4OZOA 1FFEA 1NMSA 1BWRA 5E4YA 2QGZA 3PF8A 1CQWA 1QHGA 2PB1A 5BUCA 3I0ZA 4IIGA 3ZZMA 2XM2A 3KQOA 3CMMA 1SQGA 4U5QA 3R4CA 1Z0FA 1DT3A 2QRPA 1RYDA 1KB3A 4DY1A 5HUHA 3TAHA 5KEZA 1LWOA 3DYMA 1NJ2A 3OE7A 2HPIA 3NFRA 1E18A 2C4TA 3WENA 3DG9A 2BE9A 2AG1A 3EZLA 1UWSA 4PAQA 3URAA 1GTL1 1P8AA 1RACA 3A3KA 3MS8A 3GVQA 4Z9BA 2G9UA 1TLTA 4EAMA 2OGZA 3G9TA 3FY1A 4AEEA 4OI1A 3W7NA 3AS2A 1JDAA 2UUBB 3EKLA 5MF5A 4FXOA 2IZ5A 1URPA 5DYNA 1CQJA 1QW7A 2CLSA 1EPVA 2E6YA 2P62A 1XLEA 2R1VB 3NDOA 4JIPA 2X0HA 2E5CA 4WNCA 5B3KA 5FEUA 1HL9A 1YXMA 4YMVA 4KMSA 3DMNA 2NVBA 1HMYA 4W5ZA 5IVHA 4R01A 3DZBA 3RSLA 3TS1A 3LD9A 5DHUA 3SR0A 1V4BA 5LYJA 2P9QA 1ZRHA 1WV2A 3ESXA 3W7OA 1YJ8A 2QVYX 4G65A 3WBYA 3WK5A 5CPSA 3MJDA 2PFGA 1B4KA 3QJYA 3C2QA 3FCUB 2HMUA 4RANA 2LDBA 2ZWYA 5FIUA 2ZRXA 2PDYA 4B79A 2BGWA 4KCTA 1YFLA 3SS7X 4MS1B 5TF0A 4RLFA 1E0JA 1WA3A 4AMAA 3A06A 4HRAA 1ZH8A 3RCBA 1QG6A 4ZALA 1XCJA 4IGMA 4PCUA 1GQKA 3RUCA 2EOAA 1RQ2A 3EGCA 2P65A 3G1HA 3NHFA 4HYQA 2DKFA 2ZREA 2WTBA 3PNMA 3B20A 3AIKA 5LU8A 1USWA 1SVWA 4UVDA 3VH3A 4QDPA 4C06A 3KKNA 3TLZA 2GD1O 3KKZA 1QC5A 5F7OA 3QOKA 4B75A 1HM5A 3NRJA 3CC8A 3C3BA 3E7WA 3GK3A 1G8HA 1KH1A 3RMEA 3IE2A 1TQ2A 5BSMA 3T5TA 4Q3EA 4HH4A 3VUEA 1DG9A 4P0TA 3SCOA 3RYHB 3S6TA 3S9IA 4P3OA 2HLHA 4TYNA 3MSRA 1XDJA 1BYUA 3R76A 3TA9A 4N6FA 3RRXA 1IZYA 1UOPA 4Q6XA 1VB5A 3FR7A 3T1NA 4HQRA 4LKRA 1ECEA 4HNOA 2NP6A 1D8WA 3RX3A 1UBFA 3GDGA 2KYRA 3P74A 4CTJA 1YIXA 1FNNA 4RDXA 3GGGA 3UG6A 5AECA 5I9BA 1JEYA 5KEIA 1PZFA 3ZR6A 5D6NA 3F3MA 4ISBA 3EWUA 2J3DA 4G81A 3W7VA 2PRLA 1DIBA 5EWMB 1P45A 4B9EA 3TQ0A 4DC1A 3RANA 2HXGA 5ALYA 5AHMA 4C7BA 3ECAA 3EQZA 1UDAA 1NARA 5CGMA 3DOJA 2QV7A 3BOLA 2VVSA 4X0NA 1PT9A 5CFPA 1R4ZA 3RYHA 3LBHA 2XPKA 2A9VA 4GT1A 4ZJZA 3HUUA 2WP8J 1N5DA 1ZZGA 1U0SY 4YHGA 2GEVA 4OQEA 5IC6A 4L02A 2X3FA 2CHRA 3A1UA 5T6BA 3ND7A 3VD4A 3L5OA 3C6QA 2O7NA 1P5BA 3ZLVA 3JQRA 3FCEA 4MXDA 3OPQA 5AW5A 4D8WA 4DV4B 2AMVA 3O0DA 1GT6A 3KEGA 3V4LA 1XF9A 3KX2A 1G3IA 3TECE 1BXCA 1PW5A 2VJMA 4TN5A 2VEFA 1YEYA 4QDZA 4MAMA 4JYBA 3WL5A 4EQ6A 1ORHA 1B0ZA 1OXSC 2G96A 4HPJB 1JSCA 3BXOA 2GX6A 2WJVA 4BFWA 4H1WA 3GGJA 3R2GA 3UB2A 4H17A 2P2YA 4UQLA 3CE9A 5CTJA 1XSJA 4R1NA 2ZSAA 5E9QA 4IG2A 3UVEA 5JNWA 3AVTA 1YPFA 1J0ZA 2XWJI 4L1GA 4N2YA 4LOAA 2ZX9A 3GEPA 5B3AA 1CGVA 4BK9A 2F7FA 2O4CA 4OECA 1FNDA 1KH3A 4YRIA 2WFMA 2ORWA 4QWMA 1C9NA 2E0PA 5EIOA 1FE8A 2AQKA 1J96A 1A50B 1MWOA 3G2GA 4F56A 3T4PA 1NVKA 1OXTA 1PX8A 3QOWA 3RUDA 1FVHA 3MCVA 4AZVA 1NGSA 4G0VA 3CLUD 2DLCX 3HGMA 4Q3LA 3CQKA 1IBRA 2BKAA 2DTEA 3GB9A 1HE3A 2SKDA 2X9NA 1GTVA 3P0JA 3QHQA 4HDOB 3K09C 4D42A 3D4NA 5FORA 1KGUA 3NL5A 1UCWA 3HMCA 4CEJB 5F1VA 3TQVA 3B85A 3IIZA 4CF5A 3U80A 3SFWA 2G4VA 1H1NA 1K8ZB 4XIJA 1JCJA 4HK5A 4UHEA 1GP2A 3JYPA 5FJRA 1JD7A 3NETA 2PGFA 5F1YA 1IHOA 2XWEA 4HSEA 3R10A 3HFJA 1D2KA 4MR7A 1VKJA 1ZFNA 2G04A 5HHTA 5T8GA 3TZNA 2V7QA 3AINA 3GH3A 4JBXA 5BRQA 4WKPA 3PGA1 3VNJA 3L04A 2ZSFA 3W76A 2Y6UA 2L69A 3SEPA 4JLSA 1W85B 3GDKA 2OECA 4HA0A 4ZYUA 3QMPA 1RBYA 3W7BA 5JAQA 1JEOA 3T78A 4GQRA 3EIFA 3DEZA 3SJBA 3C41J 3NOXA 1U33A 1KP3A 2ZWPA 4Q4PA 1HO4A 3WGYA 1NU5A 3H2OA 3EA0A 2BW0A 1U2SA 4YV2A 3FROA 2WD9A 4K9NA 2O8DB 1Q6OA 4PIMA 4X20B 3OWHA 1YDGA 3PVCA 3IOYA 3B36A 4BC0A 1CUHA 5EINA 1RK6A 3GRVA 2NSDA 3TLGB 4M83A 4MV5A 4KOAA 4I9JA 1UBKS 3IMKA 2OZLB 4F06A 4CZ2A 1OWLA 4E70A 3CS2A 1BE6A 3PPXA 1PX4A 3OX3A 1KXZA 1BVWA 1PNTA 2RHLA 4OUKX 2CN1A 4OYYA 2QAPA 1HEIA 2R6R1 2IUTA 3QYFA 1ZZMA 4NCJA 3AF5A 4ICMA 3ZGVA 3VKAA 3QKIA 1LOQA 1Y63A 3NTUA 3KZ1E 3FAKA 3PHBE 3O0TA 2WUGA 4O4IA 4KZKA 5EI5A 2QSYA 5BN3A 5ADHA 4NESA 3SF0A 3EFOA 5ESDA 1WTCA 1AHIA 3QPWA 1UBHS 3Q9NA 3WAGA 1HKHA 2OBBA 4B8YA 4A7PA 2QVLA 3C1OA 3GHTA 1IULA 3N7UA 5IRPA 2ZSDA 4OP1A 4IXNA 1AXEA 3V8VA 4US2R 1U3GA 2PRYA 3B38A 3E7XA 4LYJA 3HACA 2WFAA 4MR7B 4HAYA 3WQGA 3QIAA 3P9ZA 3ZE2B 1QV6A 1DJHA 1PS9A 4LE1A 1DIRA 3WKCA 3CZQA 3LT2A 4Q8WA 3FPAA 3G8DA 4S1VA 3W2JA 4M1YA 1KQOA 2E28A 3UPDA 2BDEA 3LG3A 4I9AA 4GOMD 4O28A 3V75A 1BCSB 4AWTA 1KMNA 4HY3A 3ANXA 3ICEA 3H5LA 2CNDA 1QX3A 4E6EA 1VJ1A 3K5PA 2B4AA 4FZJA 2QCCA 1J12A 1QZZA 4ZXLA 4EVQA 4DF1A 4KPGA 1PHPA 1VBHA 1WSAA 4GPNA 2Q6KA 1H7WA 3K5IA 4J40A 1LLQA 1SJCA 2F6UA 4JX4A 3D4IA 3BL3A 5JG7A 3S7TA 3IV6A 1LSJA 3GKFA 1QF6A 3FRHA 2FX5A 3O8OA 1KA9F 5FACA 2PDBA 4LYQA 3ACDA 4XPIA 1YQ2A 1LWHA 3AV0B 4K88A 2Z30A 4KLAA 4MVJG 4HZMA 1K27A 4UFOA 1O77A 2V2DA 4GC9A 4R7WA 3TZ6A 1YNQA 4H6XA 3USZA 4XO6A 3DVAB 3A58B 4G5FA 1O5IA 3N2EA 4J1SA 2YW2A 5D85A 2V0TA 3EVEA 3CLTC 4G36A 2ZUDA 3H1GA 5I02A 1E9ZB 2ZJFA 1UP3A 4AJ9A 3GXDA 4IJUA 3T41A 2OZ0A 5EUMA 1BE1A 2A3NA 3R75A 3GX9A 3JQCA 5DO9A 1EK2A 2I57A 2ZTMA 2FQWA 2P2CA 1O7JA 1Z5VA 5KNBH 1UXOA 2J9ZB 1KM3A 3HZ3A 2IYVA 2IIPA 3G1FA 1T1IA 1MZPA 4BUZA 4RDZA 5HS4A 1SJBA 4G0NA 1SPBS 5CZKA 3SAZA 1WULS 6XIAA 1RQEA 3SSMA 5I9NA 2YW9A 3H8AA 1G0OA 5F7JA 1ZH2A 2EGUA 3N18A 3GZAA 4NZZA 3EODA 5BSFA 4G0PA 4M53A 2NQLA 4BVHA 2ORYA 2ZETA 4BX2A 2BZSA 2IY8A 1H41A 4WTOA 3VKDA 1C0KA 1AJZA 1XHLA 5LOVB 1Y4SA 3CK5A 2VKTA 4AW9A 3A1FA 3N4AA 4IJ5A 3AVVA 3HABA 3UPBA 2IUUA 2X6TA 3QPBA 1GYLA 4YUAA 3SRHA 4PPGA 4G5SA 2VFHA 2AYXA 4LJSA 4KCUA 4EW1A 5F21A 1M5WA 2GZ2A 1OADA 1WNTA 2WB2A 4GXPA 4NDNE 5HDRA 2HQRA 1HTWA 1EP9A 1F0PA 4LZNA 3IB6A 1KKLA 4XD2A 2H06A 3WBFA 1TZMA 2LKCA 4N39A 2VVTA 4AIBA 2I99A 4L4RA 2H8XA 4BLQA 3QPDA 1S7CA 4GEGA 3CMJA 3TEMA 1XL9A 3CZJA 3WLKX 2OCPA 3TIGA 8TIMA 1QAQA 1I7DA 3BLIA 1I8TA 1K6IA 4OBRA 3IUIA 3M1IA 1MTZA 3LQ4A 2B8TA 4QTGA 4ITRC 1JDVA 3L7CA 5LZ4A 4IWNA 2I34A 3HF3A 4N0RA 4JTTA 4HU0A 1XVLA 1JPNA 5K0LA 4Z54A 2H6EA 3PQ4A 1XPGA 1NWHA 2FK7A 4HOZA 3ROFA 3ZQJA 1Z6GA 3WD1A 4I2VA 1TQ6A 2JIQA 3OLGA 3EWIA 2WOOA 1YU9A 2HSAA 3L5AA 1PV4A 1O89A 4IINA 3TYCA 1HW6A 3OQPA 4MWCA 2WRZA 5BQPA 1KO4A 3KU1A 3ZXSA 1RJ9A 5C0OE 3M6LA 3D8HA 2WP0A 5H5JA 1QRUA 2BTMA 3GIDA 4CLOB 4F4DA 3I3EA 4FFOA 4JEHA 1WCGA 2GJ8A 3VC6A 1XBVA 1YTEA 2YV1A 4NXNB 2O2DA 4V0MA 2CKSA 1Q3KA 1D6NA 4TMBA 1Y5XA 3AYSA 4FJ0A 2RI0A 2OLHA 4A1FA 3DE2X 5A3HA 4PTDA 4PCPA 5AVTA 1WXWA 4URXR 1D3AA 2GVGA 2PH1A 1NMXA 2OXNA 4ATNA 4P83A 5EZSA 4NXMB 1JPDX 1GD1O 5DN6D 3VNLA 1ZIYA 4KFPA 4EPTA 2H8ZA 2PR7A 4ONEA 1TE6A 4YFYA 2XISA 3VPSA 2BLNA 1A5OC 2PD3A 1NWSA 1P19A 2DFNA 4JFTA 5HDBB 2HPZA 4CBVA 3PLAE 1Q5PA 2WKQA 2RGBA 4REMA 2YSWA 3EZGA 1I7PA 1BVRA 3ED1A 2D06A 4FNQA 2ZRMA 4RW5A 3NOYA 2W98A 5AFSA 2F61A 4MM1A 2B35A 1XYMA 3K31A 4L4PA 4EPVA 3NPVA 1PZ0A 2BVDA 3LQ1A 1RWPA 3NI2A 2TRSA 4LOCA 1NF7A 2UV8G 1QWGA 3N2LA 4UPVA 1DC4A 2OO0A 4BVBA 1XCMA 3G89A 3CNEA 4J7RA 2C71A 1G1AA 4GMFA 2JLYA 7ADHA 2ZRWA 4WADA 5HK9A 4MEBA 3CTLA 2ZE6A 1O5RA 4IXXA 2Z6JA 4RZ6A 2W5UA 4EA8A 3B3QA 4PUWA 3W9UA 5MFPA 1ISSA 4E8GA 4U5XA 4DBWA 4MOWA 1WW3A 3WLFA 1BTCA 4I5GA 3RO6A 4TUYB 3QQ1A 3IPCA 3ORHA 4ILSA 1P7CA 1XU9A 3NL3A 4GYPA 2AXQA 4OKIA 3QU9A 3HXTA 3CGTA 5TXGA 4LEIA 1RKUA 4DG8A 2PMKA 2JFQA 3C3AA 1P3DA 3FWPA 1FSGA 4D9KA 4Z1MA 3MV01 5JOQA 4HN4B 3WKAA 3VZXA 2OZEA 3EVBA 2GZDA 3L1VA 3NO4A 5AM3A 4KYIB 4B3KA 1GW1A 2BI8A 3D4BA 1W5PA 1V16A 3FMVA 3U6KA 4ZTXA 4JQYA 3SQSA 2ZXFA 1MB9A 3T8YA 4QOSA 1JBQA 4P35A 2BFFB 1PNVA 4JIGA 4RTPA 4HTAA 1QB7A 1UKOA 4MI9A 4O14A 2JGNA 4IOKA 2V30A 1KJ8A 1X9IA 2GVNA 2G5WA 2IHKA 3N86A 2HK8A 3SDSA 4AIIA 4PQYA 4O16A 4DAFA 1NV8A 2I4TA 2E77A 1GKKA 3DB1A 1OD6A 2WKJA 2J74A 1Y3CE 1KKMA 2P3OA 1KXJA 5I8ZA 1Y9AA 4Y1FA 2IBMA 3W86A 1DBRA 5T9CE 3A12A 3FHTA 4H7DA 4INZA 3MVTA 4A2SA 4JCOA 1J9YA 4AZSA 3W7