5EMMA

Crystal structure of prmt5:mep50 with compound 15 and sinefungin
Total Genus 200
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
200
sequence length
625
structure length
625
Chain Sequence
RVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein arginine N-methyltransferase 5
publication title Structure and Property Guided Design in the Identification of PRMT5 Tool Compound EPZ015666.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 200
structure length 625
sequence length 625
ec nomenclature ec 2.1.1.320: Type II protein arginine methyltransferase.
pdb deposition date 2015-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05185 PRMT5 PRMT5 arginine-N-methyltransferase
A PF17285 PRMT5_TIM PRMT5 TIM barrel domain
A PF17286 PRMT5_C PRMT5 oligomerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 5emmA03
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 5emmA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5emmA02
2GLUA 2AZTA 3HVKA 2IBTA 4HGZA 4EQZA 4FT4A 3IUHA 5EKUA 2XIMA 2AN3A 4PGLA 3KBVA 4OQDA 1FBNA 3TPZA 4KDRA 4V0QA 4C4AA 1S5NA 8MHTA 3G88A 1XLLA 3F4KA 1NW5A 1XLCA 4YTSA 3NGFA 4PONA 3OE5A 3UA4A 3BGDA 5HIMA 1ORIA 3KWSA 3M6WA 5DM4A 3FUTA 2G70A 1XICA 2PT6A 2X7WA 3LX6A 4DCMA 2GB4A 5DPMA 4GC9A 4PGHA 1XLMA 1EQAA 5KQRA 4PIMA 4EMSA 3AXSA 4CKBA 2QUNA 3CQIA 3KQQA 4AX8A 1YB2A 4IV0A 3DR5A 3KPJA 1TW2A 2E5WA 4WVLA 1XLKA 3KQOA 2GA9A 1KPIA 3BT7A 1X19A 2PX8A 4GC5A 2BM8A 5B7YA 5LQUA 3UJ6A 4YUZA 5DX8A 1YX1A 2EX4A 3AWIA 3LGAA 3HCBA 1PJZA 5EMLA 4GOLD 3UBTA 3ITVA 3UJCA 5LQAA 2Z6QA 1G60A 2ZIEA 1O9HA 5DSTA 2JJQA 2PV0A 3P2EA 3EVAA 4P7FA 2ZIFA 3NW9A 2YVLA 4ER7A 2OKCA 2YXLA 3PFGA 3IYLW 2P7IA 3E05A 4QDPA 5H6HA 5DX1A 4M36A 4EKIA 4QDJA 3PFHA 2Q02A 3BWMA 2OBFA 1KPGA 3TR6A 3I5UA 3VC2A 2QE6A 5K0CA 1ZHFA 3LKDA 5FHQA 3SSMA 2BZGA 1UIRA 1KHHA 3JWJA 3DLIA 1SQFA 5T64A 2OY0A 2VS1A 3FRIA 1OR8A 5DLYA 4AZVA 4ER6A 3JWHA 4OQEA 2ZW9A 4OX9Y 1QYRA 3ER8A 2ZTHA 3A27A 3TC3A 2UYHA 2A14A 2IFTA 1G8SA 2GH1A 4LECA 1KP9A 1Q0SA 3C6MA 3PVCA 4YUYA 2UYCA 3G2PA 4E3VA 2CL5A 3M4XA 4CTKA 4XUCA 3A4TA 3MAGA 2P1DA 3P2IA 4BP1A 3ITLA 4W4QA 1TPYA 5HEKA 3G2QA 3TVAA 3KQMA 4RTLA 1IY9A 1VBFA 3MTEA 4A8NA 3I64A 5E9QA 3RW9A 4C04A 3KQTA 3BWWA 3KBNA 4A6EA 3R6TA 3CJQA 4NECA 1INLA 3B7PA 1JG2A 1QT1A 4QTTB 5FWAA 3LBYA 1DE5A 1MJFA 2C7RA 4ATNA 4KDCA 1KYZA 3E7PA 5BP7A 3BXOA 5EEGA 3NDJA 3VC1A 4PFHA 3NVMB 2ZBPA 1SUSA 2ZWAA 2JG3A 3UJBA 1I6NA 2PWPA 4PYIA 4B17A 4CXMA 1D2HA 3T7TA 5CVDA 4FGZA 4IWNA 1VPTA 1JQ3A 3EGIA 3OPNA 1FPQA 2H11A 2PJDA 4QPNA 5LQJA 2QRVB 1XIHA 1BXBA 2I62A 1VP9A 4JXJA 3FPFA 4KVZA 3S68A 3DTNA 2Y1XA 2WA1A 4UOEA 3LL7A 2AOXA 5EHIA 1XIMA 3EGVA 3LBFA 1HNNA 2K4MA 1NW8A 1AV6A 5DTRA 4RTNA 4YMHA 4EKGA 2ZZKA 4GBED 2CMGA 3PX3A 4GOND 5EZSA 6XIMA 3GRZA 3GWZA 4QQKA 4PWYA 3FVMA 9XIMA 5E1BA 5FADA 1R74A 1XCJA 1RI4A 5H02A 4J4KA 1JTEA 4RTMA 2G1PA 1KIAA 3AY0A 2NQHA 4QEEA 2G72A 4F86A 2EJTA 2PSSA 1N7IA 3TLJA 4DF3A 1VLMA 1D2CA 2ZZMA 3SGLA 3HCDA 3ID6C 1X1DA 5CVJA 4E33A 4C07A 5H1WA 1M0EA 3KBSA 1YFJA 2VP3A 1Q0TA 3TM5A 2XBMA 1JG4A 5EGSA 1IXKA 3KU1A 4F84A 3P14A 1P91A 2YXDA 1G6Q1 3U81A 3VYLA 3P9KA 2GAFA 3KR0A 3UFBA 3SXJA 3LDUA 4RTRA 5EQJB 3MTIA 3FUXA 4RTKA 3EVDA 4E31A 4DA4A 3FTFA 4HHMA 2NQJA 3SSOA 4BLUA 2Q41A 3HVIA 1VL5A 2Z6UA 3TMAA 1N2XA 2XINA 5B80A 3UVAA 1F38A 3GU3A 1XIIA 1XP3A 2NXNA 2LD4A 1P1CA 3CKKA 5K0GA 4YV0A 4H0NA 4ER0A 5KS2A 5K0LA 5DXAA 4HG2A 5ICFA 2EFJA 1I4WA 2HMYB 4QE1A 5J8LA 3KPUA 3HCAA 1YUBA 2HNKA 3A7DA 4PYOA 4YTTA 3EEYA 2GYIA 5EKXA 3DXXA 5GM2A 3BDKA 3L8DA 4X63A 1XJ5A 4K3ZA 1ZG3A 1XIDA 2QW5A 5K09A 3GIWA 3KPWA 3VNKA 4QE5A 8XIMA 4RWZA 2NNWB 1HMYA 4PCAA 4YUVA 4XIMA 1CLKA 3BZJA 1NBIA 3BKXA 4QDKA 1NW7A 2R3SA 1XIGA 3SMQA 1M6EX 4PGGA 1XLGA 1D2GA 2PLWA 1DXIA 3QOXA 3VYWA 2V74B 3AJDA 2BH2A 3NMUF 1R8XA 4XISA 3RIEA 1YFLA 5BW4A 5ERGB 2YXEA 1EG2A 5K0JA 1RI1A 3QXBA 2BR4A 4GJJA 2FK8A 3TM4A 1KYWA 3CJRA 1GW9A 1DUSA 3HM2A 4G56A 3DMHA 5G02A 1G8AA 3G7UA 3C3PA 2AS0A 3TQSA 2P40A 3V97A 3LECA 2HWKA 3OCJA 1H1DA 1XIFA 1QANA 3ME5A 3KR9A 5BXYA 5DX0A 5DWQA 2IBSA 3KPYA 5LQCA 3WQOA 4DCGA 5DRTA 1RJDA 3DXYA 4DVOA 3LDGA 1X1AA 4AUKA 4MHTA 3O7WA 1XLBA 1ZKDA 4KW7A 3KR1A 1JSZA 2NXCA 3B3GA 2AOTA 2GVEA 2PXXA 1JG1A 2R6ZA 2PX4A 2F8LA 1JG3A 2YR0A 2YQZA 1SQGA 3BKWA 4PINA 1QZZA 2BM9A 3M33A 2OPBA 1VP3A 3OZTA 3UZUA 1FJXA 3EVCA 3U3HA 2O0LA 4FR0A 2PWYA 3HEMA 5EOVA 1FP2A 3SVZA 3G8AA 3VNMA 1DCTA 5FTWA 1ZGAA 2FCAA 2HK0A 3VNLA 5E2BA 1KPHA 4X1OA 3DX5A 2P8JA 4R8SA 1XLFA 3KQYA 5FQNA 1N7JA 3PX2A 3EMDA 3OFJA 5EHGA 5BW5A 3LDFA 1IM8A 4DM3A 2AN5A 5T67A 4FS8A 4XIAA 5E9WA 3QV2A 3LPMA 3UJ8A 4PCLA 2WK1A 1TW3A 4CKCA 3FUUA 4WXHA 2EJUA 3G8BA 2ZBRA 4OBWA 5ICGA 3KTCA 2IGTA 5HIKA 2NXEA 4CWAA 2N47A 3Q7EA 3CC8A 5FA8A 5FUBA 5EC8A 1XLHA 3R24A 2ZFUA 1JR4A 3P2KA 1NE2A 3G5TA 4ZBCA 1NKVA 4HGXA 5K01A 1AQJA 3HTXA 4GEKA 5EZQA 4P7GA 1A0DA 1ZGJA 4RTPA 4U7PB 1Y8CA 4A8RA 4KIGA 1XLEA 1XDUA 5E2AA 4QE4A 3FPEA 1P1BA 3ELWA 3P9NA 1BC5A 1BOOA 3UJ7A 2ZWVA 3L23A 3AYTA 2P3QA 3R0QA 4BLVA 4FSDA 5K0NA 1XYLA 3KHKA 5JUWA 5C9ZA 3E23A 3GNLA 3BUSA 4FSXA 1WXXA 2YUIA 3LCUA 2I9KA 2FPOA 1K77A 3QOWA 3FTEA 1DIEA 3BWBA 4RTSA 1RI5A 3I9FA 5LQRA 5TNVA 3CCFA 2ZCJA 3BGVA 2OYRA 1G38A 4EACA 2PX5A 2HK1A 2ORED 5HIIA 5D1HA 4E2XA 5KQSA 1XXLA 4OBXA 4MWZA 2G0WA 3M6VA 4KW2A 3QC0A 3SSNA 3NWEA 1L3BA 5CCXA 2P3OA 3UU0A 3THSA 3LHDA 3BGIA 3K0BA 1X1BA 1XINA 2NQ9A 2ZVJA 1XIBA 1VE3A 2O07A 4RTJA 3MGGA 4HC4A 3DULA 3BANA 1U2ZA 4DUOA 1ZQ9A 3PB3A 2B78A 4RYLA 2YTZA 3MERA 1MHTA 5E8JA 1T43A 3OFKA 1NW6A 3TKAA 3A25A 3MB5A 3KPVA 5GIPE 3IV6A 1I60A 4FP9A 3PLAE 5K05A 3G2OA 5F2NA 3N4AA 5K0FA 3WSTA 2PKWA 4QPPA 4QTUB 2QYOA 5EMJA 2ZLBA 2AOUB 3DUWA 2ZBQA 3G2MA 1QTWA 3ERCA 3DMGA 1SVUA 5I7GA 3GRYA 4MIKA 2I56A 2AVDA 1R8YA 3P9CA 1XLJA 3AYVA 2C7OA 1D8WA 3FUVA 5FWDA 4PNEA 1RI2A 4YMGA 1XLDA 3C0KA 3B3JA 5T6BA 5GINE 5AVHA 3GRUA 4M37A 1OADA 1EIZA 2PBFA 4GJIA 4AZTA 1V39A 2NP7A 3FYDA 3GDHA 2IH5A 3I53A 4RV9A 3G5LA 3HCFA 1NBHA 2VZ9A 3X0DA 4PYNA 3REOA 3A26A 4LG1A 2QRVA 3C0LA 9MHTA 3KCLA 4BY9E 3KQVA 2UYQA 5XIMA 3MHTA 3BZGA 3R3HA 3KQWA 3CNYA 2H1RA 3ANXA 2PXCA 3THRA 4A6DA 2UZ4A 1XVAA 1YZ3A 4L7VA 5K03A 3DMFA 1RI3A 1RJFA 5FCDA 4RVDA 4ZB2A 4QVKA 5F2OA 3ITOA 3HNRA 3OU7A 4R05A 2OB1A 3I58A 2AOVA 3SM3A 3FRHA 2JHAA 1MUWA 4PYKA 3C0QA 2ESRA 4IKPA 4KWCA 1JTFA 3VNIA 5DM1A 3CBGA 1QAOA 3Q87B 4XUDA 1XLAA 5B1SA 3DH0A 4HSGA 2ZVRA 2NXJA 4HRAA 1XLIA 4P58A 3FTCA 2B9EA 1XYBA 4R8RA 5FULA 4CKEA 4FZVA 1R6AA 3OE4A 3AALA 3NVKI 1O54A 3EVGA 3M6XA 2AOWA 3M0HA 2IPXA 4C06A 2PX2A 2OB2A 2I7CA 3EPPA 2QY6A 1XIEA 5HIJA 4X61A 4C03A 1M6YA 2O06A 2FK7A 2QULA 2AN4A 1RJGA 3KCOA 1BKYA 3PS9A 1YF3A 3GRRA 2I57A 4Q7IA 4DZRA 1KXZA 1SKMA 4YUXA 3IUIA 4Y30A 3PT9A 2GUBA 1XIJA 2B25A 3BWYA 3DOUA 1L1EA 3GGDA 5GOZA 4IV8A 3OU6A 5IH3A 2O05A 4A8IA 2ZDSA 3JWGA 3ER9A 4OA8A 2EG5A 2P3LA 1DL5A 4ER5A 2KW5A 4XSMA 5P8WA 1DE6A 5DRYA 2JHCA 3GCZA 3OZSA 3M0YA 2ZZNA 3JWIA 3CWHA 8XIAA 5MHTA 4OA5A 1JSXA 1B42A 5U4XA 2I6GA 5JR3A 2OXTA 3A7EA 2CKDA 2NP6A 3DP7A 3GNXA 1O9GA 3GXOA 3LKZA 4YV1A 1XTPA 4V0RA 3M0VA 2ERCA 5E1OA 1WY7A 4BP3A 4LWOA 1QAMA 3P6LA 4QEHA 6XIAA 5K8VA 4ER3A 1EJ0A 1TZ9A 1XYMA 3RODA 3TKYA 3CVOA 1EJ6A 5KYGA 2H00A 3KBJA 2JH8A 4K6MA 5DTMA 1XYCA 2QUMA 2DULA 3NDIA 4US6A 2WA2A 5HOQA 1L9KA 4C05A 5DXJA 1WXWA 2XYVA 3XINA 3KQSA 2ZSUA 3ELYA 4PYQA 5LR6A 3B3FA 4M7RA 4BLWA 4K1GA 3D2LA 5CUQA 4E2WA 3KBMA 1R00A 2JH9A 3T7RA 2FYTA 1VQ1A 3LSTA 5FA5A 4C08A 1Z3CA 4HTFB 1QAQA 4F85A 2C7PA 4Z2YA 1UFKA 4YTRA 4LWPA 2PT9A 5EG5A 4A8LA 5DM0A 3O4FA 3KR2A 4PIPA 7MHTA 3IHTA 5CCBA 4E32A 1KR5A 4RVFA 5CD1A 5LQNA 2P7HA 3PTAA 3OZRA 2XISA 1WZNA 5HZMA 2IDJA 3K6RA 1I1NA 3HA5A 2G4JA 3LMZA 4PYLA 5KVAA 3O31A 1QUMA 5E8RA 4XKMA 3QYSA 3KCJA 4XUEA 5EIWA 5FHRA 4U7TB 5E1DA 3BZBA 4GOOD 3HP7A 2PVCA 1JQDA 3ITXA 3ITYA 3HA7A 4EK9A 4XSLA 1WS6A 3P8ZA 5EIFA 3FYCA 2AR0A 4RTQA 3KQPA 2GS9A 3DXZA 3IUDA 4QDWA 5CIYA 2ZULA 3CJTA 4RTOA 5GM1A 5GIOE 4MTLA 4QVGA 5HFJA 3UJ9A 3NWBA 3LCVB 5LSAA 4O29A 3C6KA 2ZIGA 1SG9A 3EVZA 5F2KA 3MQ2A 4ZB5A 2PXAA 3FPGA 3H2BA 4R6WA 3ELUA 5ICCA 3UWPA 3FUWA 2G71A 4E2YA 4GF5A 2IP2A 2CMHA 5DT2A 1NV8A 1A0EA 4AZSA 5IKMA 4LNCA 2JHPA 5ICEA 5C1IA 4HTFA 1BXCA 4YV2A 2HTEA 1SUIA 4CTJA 3CQJA 4X41A 5LQKA 2J6VA 1XCLA 2P35A 1AF7A 3KKZA 1L3CA 4DMGA 5CVUA 2NYUA 3UJDA 4GQBA 2ONYA 1ORHA 2FHPA 1EAMA 2IIPA 1F3LA 3BWCA 5E1MA 4RVHA 5EMKA 3QZAA 5K0EA 3HVJA 2Z6AA 4EAYA 10MHA 5CVEA 2DPMA 3MCZA 5GWXA 3TOSA 2CWWA 2OO3A 4ISCA 3XISA 2B2CA 4HHLA 2PY6A 1XDZA 3OBEA 1XDSA 2VDUE 3EEOA 2HCVA 1S5MA 4YTQA 4Y2HA 3GO4A 3DBNA 1NT2A 2QM3A 4XCXA 2Y1WA 2IH4A 3CQKA 3EMBA 2C7QA 3M0MA 5AVNA 4DKJA 1BHJA 2AVNA 1R18A 4KRGA 4E2ZA 3HA3A 3VNJA 3B5IA 3NJRA 4HGYA 3UXIA 3FTDA 5DSXA 3TRKA 5K0BA 1G55A 1FP1D 2ADMA 2HV9A 3C3YA 3CQHA 2GLKA 1YZHA 4PYMA 3E8SA 5XIAA 2ONZA 4EVIA 5B7ZA 3B89A 5XINA 4RVGA 2X7VA 2PGXA 7XIMA 5HILA 1UWVA 3EVFA 2XVMA 3M70A 2IDKA 3U0HA 2VDVE 3DLCA 4FT2A 1DIDA 5EEHA 4ZTBA 4P7KA 3CGGA 1MNZA 3GRVA 5D1NA 4OVXA 4KIFA 3P9IA 4MQ4A 4YUWA 1JQEA 2HR1A 2XYQA 1A0CA 3FZGA 1NV9A 4RSRA 3EVEA 3P97A 3ELDA 2BR5A 3OU2A 3C0SA 1NW3A 3ORHA 5DM2A 3T0IA 3JU2A 3HCEA 3FPJA 3M0LA 3NTVA 4AZWA 4GLEA 1RJEA 4RX1A 5M5BA 3HCCA 3SX0A 5DTQA 3M6UA 5FQOA 1I9GA 3MCTA 5C0OE 3V8VA 2B3TA 2V7EA 2AOUA 3XIMA 3AAMA 5EPEA 1XYAA 4M38A 4X60A 5E9JA 3UA3A 4HH4A 3KBWA 2G8NA 5CM2Z 2AOTB 2YX1A 1AQIA 4QQNA 3SR4A 3AXTA 3TFWA 1O1HA 9XIAA 5GP1A 2XYRA 2P41A 3ITTA 4P7JA 2O57A 3EVBA 1PRYA 2OZVA 2UYOA 3T7SA 4GOMD 1XISA 4E70A 3G89A 3VSEA 3EGEA 3R9XB 2GPYA 4R6XA 2IH2A 2OU4A 5CVVA 2FRXA 4PYJA 3FPHA 1VIDA 3P71T 4YTUA 1L3IA 2XVAA 4DQ0A 4ZB0A 1P39A 3M0XA 1WG8A 3GJYA 1X1CA 4GUAA 5EVJA 3IEIA 3HVHA 5EMMA 2BR3A 4POOA 2VDWA 3LCCA 4E30A 4HNOA 3UJAA
chains in the Genus database with same CATH superfamily
1Z8NA 3GK3A 4UVIA 2IHUA 3OSUA 5AVZA 1U4SA 5AW6A 4EQZA 1NMXA 3RVJA 4NL1A 2D74A 3VKJA 3U9TA 2ZC8A 1GT91 4PFKA 3S55A 3KZCA 1IBRA 1M6VB 4KLRA 5HYVA 3AY6A 4FBGA 4KXVA 3FCPA 3R5JA 2KE5A 1SAYA 5F77A 2N0SA 1C2TA 1XZHA 5FYDA 3BLOA 3LQQA 3NEJA 4DTIA 1L0PA 1XBYA 3DTVA 5A6TC 1I4LD 2GQ0A 4LVAA 4ANFA 2HWGA 2BFFA 4CUCA 4E5DA 4ZVMA 4R16A 4G3XA 2OELA 4HZ8A 1KZGB 4C2AA 1HT6A 4OYRA 8AT1A 1AK9A 3R2GA 1VR6A 4M1RA 1T6XA 1R5BA 5COBA 3OVMA 1O94C 1NVDA 3KQQA 5FTKA 2HDNB 4PZPA 1FWEC 1LK5A 4HWOA 4WVLA 1K6EA 1T34A 4XYGA 1OJLA 2HVMA 1JQBA 4LRWA 3CWOX 3LA4A 3FCEA 1QFMA 4FNRA 1AN0A 2P9JA 1LZKA 5CGQA 2G95A 3NZGA 2ATEA 3AWIA 2NSXA 5IEBA 1P0CA 5LWHA 1RHJA 3ZQKA 3OTGA 1L7MA 1ZBQA 1NF7A 2VK8A 2Z6JA 1H65A 3G1YA 1O9HA 1AZLA 2E82A 2H1LA 3EXG2 2R1UA 2Q29A 2ZXEA 3THWA 2ZIFA 1V26A 3NW9A 3MTGA 1NRJB 2HHAA 1IOWA 5IAGA 1CBUA 2C1XA 4ENSA 3H4IA 4I4NA 2WWXA 4JY8A 3OQ6A 1AODA 3CM4A 1OUMA 3NHYA 4RX0A 1VYSX 5AKIA 1J5XA 4KQKA 3BWMA 2HMVA 4RIEA 4TTPA 1U9IA 4G1NA 4Y7DA 5K0CA 4M8LA 1H0HA 2BZGA 3VSDA 1UIRA 5JBFA 1YA6A 2EGZA 2B2NA 4S1FA 4LV8B 1JDNA 1RR2A 1YT5A 4JWKA 4MWOA 1I6LA 3LHFA 4BB5A 4CCWA 1JU3A 1B90A 1PX0A 5T7BA 1OX5A 3EPJA 5ELLA 3W07A 3BMVA 2ZDRA 3D0CA 4CG1A 2B0MA 1N5OX 4YCOA 2KYRA 3OUUA 4KS0A 1E58A 4H3HB 1JIJA 5HE8A 4LF5B 3K4DA 3CZEA 1XSEA 2D5IA 2VJLA 3HGRA 3FKQA 4S0ZA 3CISA 3U0VA 2HLPA 2FZDA 2Z3VA 3PICA 2DQYA 3A47A 1J9GA 2A7NA 1OSNA 3AR5A 2NUYA 3PDJA 4C91A 1UJQA 2O7RA 5E9QA 3GLGA 1KOJA 5DLQC 3OWOA 1L2UA 2XXJA 4AUMA 1CIVA 1FJ2A 2YLLA 3BCDA 4M51A 3RVBA 4OK6A 3HG4A 5BP7A 4KDCA 1KYZA 1GPNA 1PV4A 1UP2A 3TQIA 2ZETA 4RMNA 1F8IA 3BIXA 2VN8A 1D5CA 4WECA 1BFDA 1IRXA 1JG6A 2Q1SA 5FWYA 1FCQA 1YULA 4LCJA 3P9YA 1JT2A 4WZZA 2PD9A 1MX1A 3A12A 1EFPA 1JKFA 4FCWA 1XD2B 3B2EA 1OBOA 5ALYA 1TB3A 1ISVA 3FA3A 3L49A 4R9NA 3G9TA 3QG1A 2WNZA 3NBUA 1SSDA 1LBHA 4GO8A 3W4RA 2EKDA 2VD9A 2VPWA 3LL7A 4YO7A 1PAMA 3WYNA 3EGVA 1X0XA 3TEJA 1OINA 3BTVA 5DK6A 4J3XA 4LANA 2IUZA 2VBFA 3D6NB 3GL9A 5LOVB 1BQ3A 3UAZA 4MUZA 2Y24A 1XZQA 4WY0A 2V03A 4DABA 1G6KA 1Z6TA 3QEBZ 4KQ9A 1Z68A 4GOND 5TR9A 2MSLA 4JCCA 4R9SA 1CB7A 2MTBA 1QDSA 3PHCA 3I65A 5A4IS 4I9MA 2J46A 4N9QA 2VZUA 2X23A 1ODFA 1E99A 5BZAA 3TLGB 4FYKA 3MWAA 1WZCA 3HRIA 3WGOA 2YVQA 5E1QA 3BF7A 1DU4A 3S46A 1UKYA 3LHSA 1M7BA 1CECA 3CPRA 2V38A 3PXXA 4MUHA 1R9YA 1XWWA 3O2JA 2LCFA 2VP3A 1OCJA 4KQIA 4NG4A 1JG4A 5CGMA 5HATA 2W6JD 3PQ8A 1P0IA 5IM51 1E62A 2I2FA 2RGBA 3REFA 2NQ5A 4BASA 3OY7A 3W1QA 2Y76A 3HG2A 1QQ7A 2CBJA 3QPCA 4MW1A 1C5KA 2J6CA 3TUIC 1KBJA 3SBFA 9RUBA 1KAGA 1X96A 2PGDA 5F7JA 1JAYA 3T8YA 1HDGO 1HKIA 4XZIA 3TYDA 5B80A 4KWHA 3E1GA 3HV9A 2WM1A 1O6ZA 1UMYA 3NBQA 4H0NA 3KRBA 1IXRC 4MIEA 1BGWA 3WGZA 4CU8A 4EUSA 4EABA 4HG2A 4DJEA 3NQGA 1FC0A 3OURA 1CBGA 1VRVA 1MV8A 2D59A 1KSHA 1HIZA 3T0AA 1JALA 2YA0A 4FNUA 1VGQA 2GGHA 1E2JA 1MNAA 5E6SB 1Q6QA 3MJCA 2HF8A 1TWDA 1GD1O 1C1HA 1V7AA 4F6RB 4O28A 4MZ8A 3C2VA 3B1YA 2X2YA 4JDUA 3DOJA 1CB2A 2WU3A 4K1LA 4JGGA 3DVQX 3HZOA 3KPWA 1MX9A 4K0KB 3KUUA 1OGYA 3E0XA 3M34A 4OJNA 3QYJA 4BLPA 1CLKA 3CINA 4L56A 3AXKA 1NW7A 2FXVA 4ITRC 1VKRA 1T99A 3K4QA 2HBXA 4EHKA 4PGGA 3FIUA 3K73O 1ZP3A 2JL1A 1OWNA 4KRXA 2OVBA 1Q5PA 2JA1A 4KXYA 2W3ZA 3DDUA 3RRXA 2HBYA 1NOKA 4LDPA 4JJ6A 4D1YA 3AHHA 3CSDA 5CPLA 4JNKA 5ERGB 1UXOA 3OUZA 1KY5A 4C0BA 4NHOA 4KQ1A 2VDOB 1W1VA 4PRWA 5FACA 4G2NA 3M2TA 1NI4A 2H1IA 3U2QA 3H86A 3VR2D 4WXYB 3T9PA 1FK8A 3GQVA 1MH1A 3KP0A 3EIHA 4UXIA 2A5YB 3GXTA 3H2EA 2YH2A 4NJMA 1CW2B 2PRHA 5CT4A 5IASA 4TSFD 4NXKA 1V3IA 2F7FA 1VCOA 3FAWA 4GLJA 4G6CA 4LF6B 4FB7A 3DAHA 2PRIA 3N19B 3NXSA 1HL3A 5JRJA 4YHBA 3TYAA 3ZHVA 2R48A 1RRGA 3GO2A 1QZTA 2A7RA 1WXIA 3TQRA 1U1UA 1T9BA 5JVLA 4URZR 3ZOZA 2WWWA 4HAZA 4QAJA 3WIJA 2NO5A 1NY5A 4LVCA 2C4MA 1IZJA 3U3ZA 3WENA 1JG3A 2GPSA 3SK0A 5ESWA 3HJFA 1O5XA 1YR6A 1YQ2A 2WMIA 2FH6A 3K5PA 2ZFAA 2JHFA 2NWQA 2QVNA 1IN8A 4MQLA 2AB0A 5FI3A 2IYVA 3UZWA 2FH5B 3RHGA 5FTWA 5GQBA 2GT1A 3H16A 5AQEA 1PAUA 3PE4A 1HORA 3S1LA 1F3EA 1CFZA 3DX5A 1G4AE 1XZAA 1XLFA 3SGUA 3BFPA 3HO6A 2QX4A 4EVSA 3W6ZA 4LBVA 1H63A 4I5FA 3BOFA 2C2BA 4FOTA 5EUMA 3BB4A 4IQ0A 2PU7A 3R5TA 4UUPA 1CI1A 4XIAA 4YQEA 3TCKA 3AR4A 4MDEA 3QV2A 4RZHA 4YXFA 3NPVA 5K51A 3JQ8A 1RPAA 4RC9A 2BUAA 3MLBA 3ILYA 4PWZA 3VD3A 1VRXA 4HVTA 3AUYA 4RJ2A 1IL0A 4B35A 2VA9A 4NEQA 3LB0A 4PBGA 2J3KA 1NMSA 3LZ6A 1P7YA 4A29A 5GJBA 4ZU6X 2CUKA 1EP1A 4CD4A 1HDZA 4GIEA 5G4HC 1TA4A 2J4CA 4JLSA 1QPKA 4U3CA 1BTOA 3HV0A 4GI4A 3B97A 3ITEA 3ICWA 2N47A 5IBXA 2FSUA 3KE0A 5KWJA 3E3NA 2CVHA 2XGGA 3MZ2A 4N18A 1HA3A 2BTOA 4LF7B 3RVMA 5JMUA 4UJ5A 1BAPA 3Q65A 3KBOA 1J0XO 1BWLA 3R1IA 2P79A 4JENA 4U7PB 2WIJA 3KQLA 2PDKA 1XDUA 2XX3A 4JVMA 3OJXA 2FLVA 3V2UA 5ALEA 1DGQA 3P9NA 1AUSL 3WGMA 1PR6A 3AJ7A 3UESA 5J2TB 2GEVA 1EFRD 2WAAA 5EP3A 4GMFA 1J7JA 1BTMA 4IMIB 2J9ZB 4PEVA 3G17A 5LMZA 5BU9A 3GNLA 3D4BA 3PFCA 2POCA 2CXNA 1LJUA 3HLTA 3UV7A 4UM9B 3DWGA 3H1TA 3LCUA 5E4FA 2I9KA 4O33A 3RMJA 2Q46A 1ZGCA 3VISA 5IJZA 3MOSA 2ZUUA 4BFVA 5AW3A 2OYRA 1G5TA 1FWCC 1ODUA 4JJ7A 1XSKA 3TOVA 5D1HA 1SA0B 1EFCA 1NBME 3WGUA 4ZZ1A 2X7JA 3F0TA 4ARUA 4MJ4A 4Z4EA 2E4YA 4ENWA 4F04A 3I1JA 3W90A 1Q6ZA 4B0OA 2OSBA 1VLZA 3EJWA 3STVA 4IIXA 2AQIA 3WCZA 1HDRA 3DL7A 1RKUA 4R4JA 1YNPA 2NXGA 4DUOA 4ZD6A 1TJRA 3IJEB 4RK1A 4HK6A 4CCYB 2R00A 2BJHA 1ZBDA 2YTZA 1SJ9A 1C7SA 3PUZA 4ORMA 5DB4A 1PS8A 1B16A 3KT8A 4GUIA 4OI4A 1FXQA 3MB5A 2HRRA 1I51A 1XCOA 1AK1A 1T4MA 1V9CA 3AHFA 3W3OA 5HQLA 3V2HA 4DIAA 1P2SA 3DB2A 2F9MA 3MG9A 4HYWA 4JC8A 1GFSA 4UXDA 1KDOA 1T0OA 1C41A 2ZBQA 5BYKA 4ENRA 1X3LA 3U0BA 1XCBA 1QMPA 2ZWPA 1L5GB 4BKRA 4XVEA 2Q5CA 2AKEA 5B4TA 5ULLA 1DAHA 2VXOA 3VJMA 5BU6A 3VR4D 5HE9A 3KRTA 1DRVA 3NQ7A 2ZI6A 2BM1A 1EE9A 3NTRA 1ENUA 4NY1A 4PGMA 3UT5B 2J0SA 1V39A 1XRTA 2HHHB 2NP7A 3SSAA 3P1JA 5C5DA 3UOWA 4IUBS 1QHFA 3CUSA 4LY6A 3QV6A 1RYEA 1AHNA 5F1KA 5B2ZA 3X0DA 3CASA 4WLEA 4LG1A 4WT7A 3KOYA 4DT1B 2JKZA 5FAGA 1XD2A 1E20A 1AW2A 1M7PA 1LORA 1PT9A 4BQIA 3PQ3A 1D7AA 4JVOA 2Z43A 3LY5A 3KLLA 3ANXA 1CRQA 2AX3A 1I3LA 3BSYA 4V02A 3P96A 1JQVA 2VAMA 4UNSA 2AG0A 2C57A 3A6JA 5A8GA 4P4GA 4NSBA 2Q49A 4BFXA 4IPIA 3D6NA 3DMFA 2ISQA 3NAVA 5LNVA 2I3BA 1PG2A 3DZ8A 2UXDB 1WZLA 1KEKA 1YVDA 2ZUFA 1S46A 1HGYA 3HNRA 4MB0A 3DBVO 2FMIA 1GQLA 4WNAB 1JA9A 4RY2A 2PD5A 5IYZB 2DSUA 3T99A 2D0GA 3LP6A 2XH2A 4NYIR 4XTRA 2DP3A 3EWCA 3NOQA 3HBNA 2B8WA 1R16A 2GF9A 3GCWA 1XSIA 3DKJA 1H8EA 2ZX8A 5CLIA 4G0UA 4H9ZA 4AMBA 2XKAA 3O4RA 1OLUB 3N0XA 3QK7A 3HSKA 5AVKA 1GARA 1MDBA 2DU8A 3VTKA 2VHUA 5CA1B 3KV3O 4KH2A 4IUOA 1CTQA 4EG8A 4X71A 5FPHA 4MVJF 3V1HA 1WMEA 5B2FA 2W00A 4M7SA 3SUTA 1RHKA 2PU5A 2YQ4A 4PFSA 1K8CA 2AN4A 4AVNA 2R4UA 3HUUA 2VWQA 2YWEA 3I30X 5D37A 2G9RA 3AUJB 2P78A 3TTUA 3UMMA 2GUBA 3QBDA 2PYDA 3EX7C 4K26A 3BWYA 5FUXA 3JTEA 2QAPA 4BB0A 1UC5B 5EE1A 2DP4E 3DESA 1CEQA 1MC1A 2Z98A 2G9UA 4LBYA 2C91A 4QLKA 1AT1A 4ZQNA 3TPCA 2Y8EA 2O48X 5EQDA 3RKRA 3ZY6A 1SBNE 2ODBA 1E1CB 4M8KA 4IGEA 1E1QA 1NDWA 3R4CA 5JYEA 4P0QB 2CHFA 4F6RA 1YVUA 2ID7A 5I03A 1K70A 4MWCA 2GCGA 1U1HA 1J01A 4IPLA 1KEPA 2MSKA 3DBHB 2HSJA 1H1TA 5AC5A 2HAEA 4G4GA 4PC6A 4YRSA 1WY7A 2ACUA 2ZDGA 1IAVA 3FKSD 1Z75A 3IQGX 3OIVA 1JQLB 1JLSA 1PYGA 4KO8A 1DWIM 4AEEA 1MQSA 3OA2A 4FE3A 1Z6ZA 4F4CA 1HF6A 1GR1A 4EVRA 1ADOA 4ZQGA 2PDBA 4K6MA 3WX7A 2BFBB 3I1FA 2ZYWX 2QUMA 3GJXC 4EPDC 1KO1A 5DBGA 2H4FA 1GQOA 5AESA 4HRVA 3SW6A 4J16C 4NCAA 3ZD8A 4RHCA 3EEFA 5DKFA 5CUQA 5CPNA 5I7FA 3KBMA 1RYZA 3DYIA 4QG3A 1QI4A 2FCRA 3BM5A 1KQFA 3GWGA 3MUEA 4QEDA 2JBAB 3E3AA 3OKPA 3A0UA 4PHGA 1CUZA 4QOSA 3T1OA 4GXRA 1XYZA 1JCTA 2B7PA 1V4YA 1J0KA 4Q12A 4PVDA 4LFYA 1P1RA 2L19A 2FTWA 3I04A 4QM1A 4P3OA 3L1IA 4FGWA 5ALMA 3A13A 5DM0A 1H85A 1FTNA 3U7VA 1T9AA 5NLLA 5F7UA 3V55A 4M19A 5IDIA 1XKLA 3UWQA 4QLLA 2CZFA 3PN8A 4BV8A 1EVJA 4WKGA 4NONA 1P0NA 1EK1A 3LRXA 1I1NA 4OJTA 1JZQA 4PYLA 2NTJA 3MT0A 1GG9A 4DC9A 4BYMA 3QMTA 4AS2A 4XKMA 1DV7A 3LCMA 5FHRA 4GOOD 5AD1A 5J5DA 3K0CA 2W2QA 1PXGA 4ZWNA 3QUAA 1M1BA 4XSLA 3G9ZA 1DQWA 3LBOA 5KTYA 1WBJA 5HSGA 3ZS4A 2J32A 3VKAA 1JEAA 2ZANA 2TRSA 3VOFA 2R91A 1XKQA 3ZNPA 3WL5A 3Q5DA 4LE1A 3REQA 3FPCA 1OZHA 1SG9A 1I3MA 3KKLA 3IDSA 4IZHA 3E7WA 2HM7A 2F3QA 3SZRA 4HIBA 5C80A 1F6DA 1FDOA 4ZB5A 1LRKA 1UOPA 4DBEA 3OB8A 2Z7KA 1Y82A 5F7XA 4UNLA 2QMEA 3LHUA 1YOBA 2IVZA 3IL2A 3L0ZA 2IP2A 3PQCA 4ZVVA 4PX9A 1O8CA 2J45A 1NV8A 4IVPA 3WD2A 1UJCA 2JI6A 3T0DA 4AFNA 1VG9B 1NWCA 1U99A 5C1IA 3UR7A 1W3JA 3H53A 1F6YA 5C0QA 1KTIA 4HTFA 3MK31 5EJAA 5BNWA 4AI6A 3S6JA 2R9RA 4REQB 5A4DA 3W38A 1P45A 5MHBA 2I4NA 2AW5A 3B5JA 3K4PA 3STUA 4LZWA 4DMGA 2ZS8A 1U2DC 3T1HB 4XCQA 1VMIA 4XBKA 5FAKA 3I8OA 5JSKA 3DZDA 1Q4WA 3E1SA 1TIWA 5ICMA 2RDMA 1W8GA 1HG3A 4OQMA 4GGMX 2Y2VA 3OCXA 5EYPA 1WB0A 3RUAA 1N32B 4NAFA 2HBRA 2XSAA 3RWMB 2W37A 2WPBA 1JBEA 1XTSA 4PHTA 1KAHA 1F20A 5E7QA 1IIRA 2A0KA 2ZT6A 2YN2A 1DBVO 4EKNB 4LJAA 3OG2A 1U7DA 2JBHA 1DSSG 2QCDB 3X1KA 1YZQA 1YR7A 3MMPA 4PA8A 4QUBA 2KZHA 1LCIA 4MWGA 4WBNB 2YVAA 1WDRA 3EZGA 3RLFA 3F6RA 1TCBA 5JQGB 1E3JA 3C3EA 1BE0A 2J9ZA 1UMCA 3N3MA 3EXG1 2FJKA 1EVEA 1V9SA 2ISFA 3NBKA 5SZKB 2IHTA 3CF0A 4HGYA 2GM4A 4NI3A 2Q01A 2QTAA 4IF4A 3Q6NA 3F4WA 1BXZA 5ECWA 4LZOA 4I6GA 3LCFA 4MVJE 2YDXA 3NEYA 4ME6A 1UFQA 4MO9A 3NA8A 1Z45A 3HJUA 4URXR 2P91A 2R6HA 2E4WA 1TYCA 2V4MA 4JMLA 2EW1A 1NVVQ 2WO5A 4JGDA 3H2IA 3JVUA 2YCBA 3MILA 2OC9A 1WA5A 4O18A 1NN5A 2IYXA 4AY2A 4P5EA 5AW0A 2X30A 1JDSA 1SGWA 2Y2UA 4CCYA 2HMSA 2XH4A 4UHEA 2IS2A 4MVAA 2COUA 3DGFC 5DI3A 2RGEA 4D6XA 1DJGA 1ICQA 1UJNA 1RR6A 3DZCA 4L9AA 1VL1A 3LPLA 5KNBA 4CV3A 4GHRA 2VNAA 4H41A 4GPEA 3KTAB 2W98A 4GYJA 1G8MA 1RJEA 3UM9A 4LFBB 4ZVLA 2V7EA 2JK0A 3XIMA 4IMAA 4U5IA 2QTHA 1P5ZB 3BMQB 1KRCC 1M2FA 4YPJA 1VCFA 4HQVA 4GR9A 5LM3A 2C4KA 3EOZA 3TFWA 3V7PA 1P9OA 2A0XA 5DMLA 4JLWA 5SZIA 1XNRB 4PSKA 4DNHA 4CMAA 2YL6A 4P7JA 1PRYA 3U1VA 4WDUA 2QAFA 1XISA 4YDRA 3DZ1A 2PO5A 4MHOA 1M68A 5B7GA 4WKFA 4P7OA 3H3XA 1XZJA 1TZMA 3UT5A 4NYYA 5AWFC 2X14A 5E4YA 3DL0A 1T8UA 1ZHOA 5JEEA 1D8AA 3B6ZA 3WO8A 2WFMA 3X1JA 3DOOA 2I5PO 2QTLA 4DT1A 3AHXA 1UW9A 2ZKMX 2I34A 4YCAA 4KAFA 1J0BA 4HNSA 1YZLA 2RFGA 4POOA 1LV7A 1PBTA 5EA9A 3KYBA 2IXVA 1IHXA 3MPGA 1NZFA 5DP1A 4TTTS 2XIMA 1WV0A 4OQDA 1ZH6A 4MI6A 1GT6A 5T8KC 1DLJA 4V0QA 1S5NA 1KQPA 4LGCA 2XQKA 3ZGNA 3LCJA 5HKBA 4HTYA 5D3QA 3AK4A 2VHYA 4I5RA 1MI3A 3FCOA 1W9DM 3UVIA 5C37A 5AYVA 3BW3A 1IEVA 2GDQA 5FBWB 5LMNB 5DM4A 3L0KA 4C0WA 3GPDG 4CQMB 1MDFA 2PMEA 4G0MA 5IYZA 3HIJA 4V03A 1YB1A 4BRSA 4IMPA 2E18A 1TKAA 1JKJB 3HACA 3MJEA 2F1RA 3HXMA 6YASA 4IQLA 3U31A 1AKQA 3DHPA 1XG5A 2VG8A 3HBMA 3ORRA 4H9UA 4C3VA 1F9AA 5T5QA 4AG5A 4MHSA 4W7VA 3KQOA 1BZYA 1PEZA 4AURA 1FLDA 3R7DA 2HC9A 4ND2A 4L5BA 4HYEA 2JKEA 1JDDA 4AC7C 1A9XB 1WDWB 5CA1A 4RDWA 1T9ZA 2IEBA 1YHYA 3B9PA 3AJXA 2PUCA 2YY5A 4RSGA 1Z08A 3FB1A 3N25A 4PZVA 1G60A 4NX2A 2A3RA 3E96A 4C6QA 1RAGA 1GAQA 4TT3D 3S6DA 3ZJYA 3AUJA 5E7JA 2ZVQX 4ER7A 1I3NA 1U04A 3W4KA 1P1JA 3FYTA 5B5SA 3IYLW 1C92A 3ABRB 3ZWTA 4Q7EA 4M2LA 1RA5A 3UMRA 5H6HA 1Z7BA 5DX1A 3CV3A 3VI3B 3EZYA 4DCSA 1MQRA 4YV7A 1HO1A 4UMBA 3KSDO 4D82A 3KETA 3WB2A 3IP6A 3NSXA 2H0AA 1CP3A 2O55A 3CUJA 4L6OA 1O95A 4LW8A 1A5SB 1E1CA 3W5SA 1GGKA 2I16A 1HF3A 3OEHD 4KG7A 2OSYA 3BILA 5BWFA 5DXYA 4W6QA 5GVSA 3K5XA 4X2PA 5LQMA 4IV5A 1PFKA 3LI0A 2FF7A 2R62A 3KE8A 3M5VA 2CT8A 3DBHA 2NLIA 3IJ8A 5KYKA 4B3TB 4UIOA 1GOKA 1YO6A 3OQBA 1C3OB 1PKNA 3N2YA 4YRTA 4FCTA 3S28A 5KKNB 2WQPA 1Q0SA 4Q4KA 2VAXA 2HSZA 3HBLA 2Q6OA 1SFJA 1FOBA 3TZCA 2H65A 1N2CA 1OB2A 3CRMA 1G17A 1H8ED 2BFBA 3QNUA 4LQ4A 4Q3DA 4F66A 5LIWX 2DT2A 1RE0A 4TWZA 1HUVA 4FJ1A 3TLBA 3UANA 4RTLA 3TAXA 4FMCF 1A5BB 4IMCA 4NBLA 3C2YA 5COQA 1WNFA 4EK7A 3WHLA 3IUEA 5HPOA 3W7PA 3PG5A 2A3AA 5CP8A 3DKKA 1XJ0A 2DW6A 1S2UA 5JBDA 4PTDA 2JBAA 4XWOA 3V42A 4DNQA 1R4MB 3Q7QA 1DE5A 3B8VA 4X92A 3B04A 4NESA 1G01A 3BXOA 4TKZA 4H1TA 1CULC 1K9FA 4YDHB 8RUCA 3E58A 2JG3A 5IXEA 1LVHA 1LBMA 5BXQC 1BMFA 1I6NA 5FJTA 4QAWA 4TM7A 4CI0B 3ZS8A 1J2BA 1COWD 1FLNA 4D9NA 4IWNA 1CYGA 3FTQA 4M1MA 2B37A 4GO9A 4COOA 1IZ7A 1ZIDA 5LP6B 2E4UA 4LJKA 3O74A 1VC4A 4E6MA 1EDZA 4OREX 1MCZA 2R6DA 4J0QA 4YRAA 4LTNA 2JLAA 3I9JA 4NP7A 4LX8A 3WQPA 1BSLA 1Z74A 4H7PA 4M0PA 2ACRA 2PODA 2MYUA 2Q2WA 3V8MA 3PD1A 3NL6A 2WZBA 2OCZA 1ONEA 1SQ0A 5EHIA 1R6UA 1XU7A 2WC4A 3G1SA 1E0KA 1DWAM 1RYHA 3JYQA 1XVTA 2J7BA 2C7VA 4GBED 2HZBA 1PPIA 1G8YA 4M0LA 1J0IA 2WVHA 3EH2A 1HK7A 2EXXA 2IUSA 1Q15A 2ON3A 2Q8PA 4I8IA 5FADA 1FNBA 3CUVA 2DT1A 4QSFA 3K4HA 2QN8A 3B9DA 4NXNB 4IRXA 1DEOA 1SJBA 5IBQA 3LTNC 5KOHB 2VQEB 4QQUA 1IEIA 4MADA 3GLUA 3WJ7A 4JTGA 5I07A 3C7AA 1ZJJA 4DJJA 3IX7A 2ZJ1A 1N1DA 5M5DA 2ZZMA 421PA 3WLMA 4WEQA 2IUEA 1QNLA 1PVDA 4IHJF 3U62A 3LKBA 1EP3B 3WWEA 1M0EA 3WK0A 3JR7A 4IDNA 2IP1A 4DNFA 1JL3A 2BBOA 1EBFA 4REQA 4H2HA 3PR2B 4Z53A 3VYLA 1GJPA 3DYOA 3MB9A 3IK4A 1K63A 4RTKA 1DEXA 4OUDB 2CB9A 3TGLA 1TPZA 4GRDA 3LBIA 1IT0A 3IBFA 3PNSA 2ADOA 4FLRA 5FT9A 4JOMA 2XV1A 3LP8A 4M88A 4BO8A 4IS2A 2NPIA 5I7AA 3B3QA 4KC0A 1DO8A 2BE9A 1ICIA 1I2OA 3GZJA 2F2TA 5KYUB 1AIPA 2FN4A 3BQ9A 1V08A 1RZMA 2GPWA 2Q5JA 5T26A 1SPXA 2G40A 4UB9A 3IR6A 4MITA 2HZGA 3ZJVA 2Q5FA 2D00A 1ZBKA 5JQGA 4RQAA 3ZIUA 2VUSA 3F2DA 1CRPA 2XD9A 1TWZA 3DXXA 4M1BA 2YDRA 4X63A 1YZFA 1QJCA 4ZZ2A 4IH3A 4ZREA 2OUKA 3LM3A 4FZ5A 3FF1A 1FX6A 1XD8A 3WYZA 3IERA 1Z4MA 4WFQA 4MCAA 3LLCA 5D8WA 3IJ9A 2Y8VA 2ZSJA 3N73A 1P1FA 1RQ7A 1HE2A 2V4UA 3G8RA 4LN1A 2GZ3A 4BCBA 2C13A 3F9CA 1ADCA 1Z32X 2OBBA 2CVZA 1JEYB 4O0LA 1E2EA 3OZPA 1MVYA 1VE7A 1J4EA 4DJ5X 4QR6A 3P2OA 2AQ8A 3LWDA 3T55A 2J7DA 4DLBA 5KYWB 1P6XA 1TRHA 3ZLVA 1EBGA 1THMA 2X1UA 1P7CA 3QPAA 4HGNA 2WAXA 4AVOA 1BJKA 2VYVA 1GKRA 4PTVA 3LW8A 1YSCA 1DUSA 4Z9FA 4EDFA 2P2CA 3BAKA 2F48A 2Y8UA 3VPDA 1EFLA 5PTDA 5GJNA 3SFVA 2Q4TA 3WBXA 3QY9A 1UR3M 1ONBA 3FYHA 1IBLB 2WV7A 2VYOA 4AD5A 1SBIA 3V97A 1RBLA 1HJSA 1EGMB 1EI9A 2YZ5A 2HS8A 1QBKC 2R6AA 1JECA 3C4QA 5GONB 3NOEA 3KR9A 2PHZA 4J29A 5EERA 3M4YA 5K0SA 1GKIA 3KPYA 5LQCA 1QXSA 4KX5A 4M9QA 4DCGA 3HFTA 3LXRA 5U1PA 2EG8A 1PK9A 1G98A 4XX6A 4QNMA 6CGTA 2VFHA 4ASUA 3ZVMA 1J0CA 3D4PA 1XE3A 2WSRA 1L1RA 5KZ6A 2A1IA 3BMQA 3LRTA 3F5LA 3D9QX 3M9WA 2ZZ1A 2EWMA 2IXBA 3R1ZA 4HYTA 5AVWA 3W8RA 1FWBC 4WWHA 5GVRA 5F2EA 3OZTA 4HAIA 1OFQA 5KKCA 1FJXA 3SRFA 1CDDA 1OF8A 4A8JC 1V8BA 2BJVA 5B1IA 4DLXA 2J8ZA 3CMCO 3EX2A 3T7DA 1W19A 2X22A 4AF6A 4R53A 2Q6KA 1QO5A 4KRYA 4JI5B 3MP5A 4Q32A 1KPHA 2RC6A 1W3NA 1Z3IX 2RHHA 3I0NA 3NZ1A 3W86A 3O7MA 2OGTA 3VIMA 2VZVA 3QKWA 3S2EA 4P3NA 4MWAE 2OO6A 3JZDA 2WSKA 2IOFK 2Y7DA 3GKFA 1UK8A 3Q7PA 5HCNA 5BW5A 2AN5A 4ZR8A 4OB7A 2PVSA 4KGZA 3RLUA 3W88A 3Q8MA 4M1TA 1Y7IA 1DTNA 3ZCRA 3GFXA 4XAZA 5K5EA 4GY0A 2DLCX 4GEGA 5CH3A 2WK1A 1WZMA 3N6VA 2JI4A 1HNXB 3FPBA 1YEYA 2XW6A 3FA5A 1R0WA 5JLAA 2ODNA 3KUDA 1BA3A 1YCGA 3RU2A 4QXRA 1IOVA 1NWTA 4CQMA 3JX9A 1VFNA 4YCCA 2F9FA 1FHUA 2QAGA 5KNBD 4A73A 1RUSA 1JKJA 3NPAA 3WHPA 1WZEA 1LWNA 4BLRA 1OT2A 3KTDA 3EKGA 1RS0A 2PS1A 3WQWA 5TQLA 4QJ5B 2QUIA 5K6AC 1DAGA 4CMCA 4NV3A 4ECAA 2R7AA 4KVFA 3OLVA 5I6SA 1MO0A 3RHSA 3P9SA 3IP9A 1A9XA 1CY4A 3O26A 3WYEA 5IMBA 5CXSA 3TEMA 4B43A 1MX5A 3DCPA 2CW5A 1F8MA 4F3KA 5I23A 3O2NA 4J0KA 2PZEA 3RADC 1MTZA 3LCGA 1PX2A 2P5NA 1CVRA 1XMOB 3PQ2A 3KLOA 2I14A 2Z30A 3K9FC 1YS2X 1TWSA 5K0NA 6TIMA 2XUJA 4LYPA 3FDFA 1YJCA 1SY7A 3PZQA 2J9GA 4BL5A 4GXNA 3ND9A 3R7FA 5CITA 2YUIA 3M7IA 3ABRA 3QLTA 1SQ7A 4DMRA 1ISGA 2YJ4A 2NUBA 3MBFA 5EJ6A 2EFYA 1FP4B 1F2TA 2PX5A 2HK1A 3TKFA 5HIIA 2CV2A 3B8HA 1XQXA 4ZK6A 3LQ1A 3AEKB 1A5SA 2H3DA 1DXOA 2ONEA 3O16A 2HRDA 4QKQA 1FEZA 3MINB 4UWMA 2W4MA 3ZE0B 4JUCA 3O7UA 5JTTA 5EIAA 2G0AA 5DN6A 2WMGA 5JAUA 4GLOA 2KM1A 3SSNA 3DD5A 2I22A 4C43A 1UIOA 5B58C 1XCGB 4OL0A 1HV8A 3AU9A 2J6IA 3Q2OA 1ZNZA 4R2LA 5JXHA 2GVJA 2IEAA 1Z6AA 1YXDA 2IIVA 2E5DA 1M1YE 2HSAA 4N0MA 3G7NA 2VDKB 2Q6ZA 4QPJC 4XZWA 3DDSA 1NW6A 3R3WA 2NO7A 3UP8A 1VDMA 1JG9A 4CKWA 5GNYA 3UR5A 4FP9A 3O8NA 2YJNA 4Q6WA 3JVEA 2GVGA 4RL3A 1IXPA 3NZPA 2PKWA 4RL6A 3VI2A 5KBYA 4NPAA 1XROA 3CZKA 1UH5A 3KL5A 5A9SB 1A5BA 1NOWA 1ZD3A 5DU2A 5FLXA 3ER6A 1QTWA 3ESAA 4AZCB 3DMGA 1BQEA 2ZB2A 2D62A 3CHFA 3BRCA 5KWEA 1IBMB 1M33A 5K99A 1T91A 4MIKA 3VBCA 1ZR2A 5CLHA 1YS1X 1R4MA 1T1GA 4U7DA 3P9CA 3EGXB 3NNSA 3LXXA 1XTTA 3AYVA 2WM3A 3FDXA 4H0FA 3JALB 1HFKA 5B4UA 1CUHA 3AOGA 1B4EA 1I1HA 3C0KA 2AX4A 4UDXX 1Y3AA 2UZAA 2NX1A 1E1KA 2HTFA 5C8YA 4MLJA 1XLTC 1D07A 4LUYA 1WB5A 1Y4DE 3MMXA 2IZ1A 3FK4A 3GU1A 1W0JA 1RWKA 4PYNA 3SYLA 4JX9A 1GG1A 2B4KA 1S5WA 3SN4A 2GN4A 2H07A 3BFXA 1V6UA 5JJBA 4BY9E 1K6XA 1O95D 2INGX 1UJ4A 4HPNA 5DRCA 1SMAA 3BUVA 4DZIA 1QONA 3RNOA 2Z4SA 4OXRA 3JTMA 1FU4A 1ZCOA 4HL6A 4DGSA 1N2ZA 5H70A 2OHGA 4BNGA 3ZFHA 5FYQA 3NYWA 1T3SA 1JKMA 5TPZD 3KD2A 3GBPA 4EHHA 5KZMA 3LLFA 1N5DA 4H4DA 4Q6BA 1YD7A 4ZCTA 3B9BA 2XB4A 4ZB2A 3ECCA 1SU4A 1Q0RA 1ZI9A 1C8LA 4DM7A 3DAGA 1GAWA 3G1AA 4INJA 1JDAA 1QE5A 2JARA 1D1TA 4PYKA 5AHNA 3VGBA 2ESRA 1JLLB 4W82A 1QPBA 2CK3D 2BEKA 3WVNA 1QRAA 1N3BA 1TPWA 1T5DX 5KOHA 4DC1A 4DR4B 3Q58A 5DNAA 2ZVRA 2R7NA 1YDOA 3URMA 2BELA 4IM7A 3V16A 4F2WA 1L8AA 2Q3BA 3CB3A 1X86B 3CN9A 5C5YA 4TMBA 4TMVA 1YCFA 3ZOAA 4E5NA 3VOGA 1EP3A 4ENPA 5BV2P 1J6PA 4K86A 1AUQA 2GJ8A 4XPZA 3T9BA 2HV5A 4B4WA 3PC8C 2GHTA 3PR2A 3X1ZA 1NR5A 3AZSA 2IYEA 4J1OA 5DHSA 3VUEA 3W7HA 1KI6B 1GYQA 3HURA 1Z35A 4AK9A 5IT4A 4X6LA 3W7IA 3BCSA 5B3JC 1SEPA 2JE8A 1WXEA 2JRCA 1KXTA 4R88A 4O17A 3AXHA 4EUHA 4W9NA 1U5BB 4N40A 1LQ2A 1QFJA 1EC8A 1MF7A 2YIDA 1JUKA 3BK2A 1M8KA 3MFYA 1NA5A 3OIFA 1QRUA 4QUEA 1L8QA 2J6XA 2H2FA 1HZYA 1SPQA 2X4IA 3OZSA 1CPUA 1NFBA 2PWHA 2V5LA 1LDMA 4C29A 5AW8A 4TVUA 2OV4A 5U4XA 3S2CA 4A2SA 3CYVA 2PWDA 3GJ0A 1Q0ZA 7A3HA 5IVDA 1SUWA 1U98A 2C3UA 3SLKA 5CEJA 3H5TA 2X2EA 4C7OA 4Z4IA 3MOIA 4YHHB 1S2LA 1ZALA 1HYQA 1YI8A 2PANA 1C9WA 4ZI7A 5DANA 5K8VA 3E9DA 2NU9B 1ISWA 4FFPA 2Q45A 1W37A 3AR9A 4FR6A 1KXVA 3RODA 3CVOA 2WSYA 4C0JA 3IAS6 2QRJA 3KQHA 2PDXA 1W4AA 4Q0MA 5DWDA 5HOQA 4GDMA 1L9KA 2IPGA 4RULA 1UCFA 1S8AA 1L7NA 3E1F1 1NUSA 3EZ9A 2WWHA 5KYWA 5AKYA 5TLSA 1A9YA 4PQFA 3ELYA 4HNGA 2CLCX 3D2LA 3TLZA 2AFHB 3EFHA 4ACZB 4KQNA 4OQVA 1Q77A 3PTMA 5EBAA 2AKZA 4R2JA 2FPGA 3UF9A 3KT3A 4MLPA 3KOOA 4UTUA 2FR8C 1EGMA 4NUWA 4Q8TA 2PBGA 4I5XA 5BPHA 1SOMA 2OYLA 3EOSA 1RHRA 4RZ2A 5DBOA 4YHEA 2ZXFA 4DMMA 4Q4AB 2ZQYA 1FOEB 4LYQA 2QT3A 2VLIA 4MRRA 3F74A 4XFJA 3NL5A 2ZS7A 6REQB 2V6FA 4Q8UA 6A3HA 1RWXA 4U6NA 1LNSA 3CH7A 2B8EA 5JW6A 3BLDA 3TRDA 2GJLA 4HDOB 2D7DA 2XA2A 4MVJH 3HGSA 1H9BA 3KELA 4O1MA 4GL4A 1PW5A 1MMFB 3Q10A 4CEUC 4ARBA 1E60A 3QXXA 4HR7A 2VQFB 3RVSA 1I30A 5LIUX 2INZA 1XXHB 3HA7A 3O8OB 3GFRA 1WS6A 4HWKA 1BVRA 4AMZA 3SS7X 1GPJA 1PHPA 3HQ1A 4NJKA 4RK7A 1CUWA 3G22A 4S3MA 4Q6XA 3VA7A 3RNLA 1ECLA 4B5KA 3VI4B 1B15A 3ETLA 4WXPA 4XYBA 5KITA 1ZK3A 4F7DA 1F74A 3H1PA 2G3YA 3IUMA 2CLHA 3WF1A 2BRUA 3R3UA 3KX6A 4IQGA 1IEWA 1UP0A 4RFVA 2H1CA 1C9EA 5K8LA 4CV1A 2DFNA 2JHPA 1MFUA 4C30A 4BXOA 4PUDA 1NI5A 3DEKA 4PZYA 1TKKA 4CTJA 1QMLA 1WF3A 3WUBA 2RKXA 4Z2AA 3G6KA 1JUDA 1L8PA 2NPOA 1YFKA 4RY0A 1KZ9A 2HMUA 1M1NA 3NI2A 4A36A 1Y7PA 1UANA 3WP0A 4C89A 4RIIA 2ISCA 2H7XA 4W5ZA 4FD3A 1JHVA 5D3ZA 3TI9A 2XYPA 2J13A 1G16A 1P4HA 3ZJUA 2PS2A 2Z6AA 2GFIA 2G7MC 4CIDA 4X0NA 3CY6A 1T24A 3RHFA 2WTUA 1RQNA 2BISA 2P10A 1P19A 4RVUA 2UBPC 1POJA 1P5JA 2B2CA 1C0LA 3NOYA 3GNOA 1FFSA 2BBSA 4B87A 5H8MA 2NO4A 2Q2VA 1JXKA 1ZI6A 2BCGY 1OVGA 5TB5A 1GEEA 3DW3X 2PT7A 5HAOA 3L6BA 1RALA 5JSQA 3LOQA 1OFVA 4LVDA 1RRMA 4YBRA 3W9YA 3W53A 4F5WA 2NVCA 4EEKA 4BQNA 4RY8A 3TP4A 3W8NA 3PUEA 3B5IA 2QMYA 4IMGA 3C3XA 4BPRA 3AKCA 5K4GA 3JV7A 3CB4A 1OPXA 3V9PA 3K70C 1SXJA 1QCYA 2E4ZA 3GN2A 3A6LA 1H62A 3ECAA 3MTBA 2O8FB 1FP4A 2GSDA 3B8SA 3KHSA 1GNTA 3BD9A 2UWFA 3MMWA 3HDQA 4BPBA 1XG3A 2VF4X 4HNAB 3AEKA 4QFCA 2V2HA 4LRQA 2I1WA 4Y2QA 1EZ2A 1TYAE 1PKXA 3ROEA 3EX4A 4F3RA 4MYRA 4FVTA 2QPXA 3HYSA 2A5DA 1SPBS 1E51A 1ML1A 4FT2A 3AESB 3FTPA 3E8XA 2R1PA 4YJKA 2OMEA 2ATMA 1MABB 1G4TA 4JR0A 3EF1A 1T3HA 4TX8A 5K4XA 4DA8A 1YCHA 4MQEB 1A0CA 1OWMA 1AC5A 3SPXA 1TVKB 4Q9KA 5DHTA 1DIGA 2XUPA 4U5KA 3RSZA 1HFBA 2VSOA 4DCJA 3G85A 3TF5A 2JQXA 1Q6FA 4GMHA 4ZT2A 5AM1A 1HVXA 3PUYA 2ODTX 2OLEA 3NPXA 1Z33A 4LYDA 1I9GA 3PS7A 1GQKA 4V1YA 4MKIA 1LY1A 5A9SA 5EQTA 3U5YA 2I2AA 4LYAA 1DTWB 5EPEA 1XDGA 4LXFA 4ZU1X 4L8WB 3B8TA 2ZRPA 4AZCA 3EXAA 2G8NA 2O3QA 4Q9AA 4UUIA 4EOGA 2XYRA 3UF0A 5LL6P 3WDPP 4HGRA 3TR2A 2C14A 1KO5A 1E4LA 2F1IA 2JANA 1W8DA 3TUJC 2JLWA 3KZKA 3JALA 2OO7A 3RG2A 4CMKA 3C98A 1L6FA 4G5HA 4B80A 4MKXA 4I4IA 4ZAXA 1SUDA 2BMVA 1J8DA 1PN3A 4X2RA 3JS3A 1VIDA 5FF4A 1HQKA 1HE5A 3EQ8A 5EJIA 3BXEA 2CLSA 1R46A 4K40A 3VDCA 3IALA 1L5RA 4R34A 3KL3A 1H23A 3VM7A 4R9VA 5CNMA 1JYFA 3KL2A 4S1OA 1P1KA 1FP6A 3HVHA 4IGFA 3S5ZA 4E30A 3JQ9A 4KFCA 4HNOA 3PWGA 2ODWA 3T07A 3TTOA 1Q92A 5JZMA 3OMWA 4P92A 4YONB 3NG1A 1WHSB 2B5WA 3NLLA 3VJLA 4I9JA 3EA2A 2LZ0A 4J2PA 2JASA 1EWEA 3ASZA 4XWUA 1NX6A 2GNPA 4ESOA 1GU0A 3PNYA 5HM8A 3EOAI 3PSAA 2RHCA 4PR3A 3RT7A 2DWPA 2ZAYA 5IX8A 4LPKA 4HRYA 3CB2A 4BNNA 4ED9A 3N04A 4A3QA 5FUWA 1Z6YA 4YU1A 1XQ9A 2F1HA 3IQWA 3M6WA 1UR5A 4LH8A 2X6RA 1EYEA 4AU1A 1GPBA 3B36A 1KOGA 3R9WA 1Y1PA 3WSVA 3W2UA 1XICA 5BYAA 4M24A 5DPMA 4US1R 1XLMA 1HJQA 1TJ5A 1W1WA 3FDZB 4AWBA 4ZARA 2IEGA 3RIGA 4M0MA 1KY3A 2H2HA 3KLMX 4MMXB 1KIMA 5JADA 4JFSA 3SQLA 3AJRA 3TMQA 1OBVA 2BM8A 2GHQA 2J4GA 5LQUA 1CR0A 4PO1A 2ANCA 2EX4A 3B40A 3HEBA 2X0EA 3H9UA 3J81A 1WCXA 4NASA 4I2VA 5FPQA 4LBUA 1NVKA 4GOLD 1YDGA 4M9ZA 3JD1A 3L4KA 4EW2A 1MIOB 4DZAA 1VC2A 2XOXA 5C1DA 3VO0A 1XFDA 2HWUA 2Q1WA 4HAOA 1L4KA 2X5KO 4O10A 3SOZA 1OFEA 3RSFA 4UAGA 1SFLA 4QOJA 4URYR 1AW1A 2OKCA 1A7UA 2ZYAA 4H08A 3N1AA 2RGWA 3PFGA 3E05A 3VHLB 5JDCA 4GPAA 4NILA 1U5BA 2ISSA 3N05A 1SU8A 4CMEC 2W11A 3H9CA 1L5ZA 3BXGA 3PFHA 1M6VA 3HFGA 2GOYA 4F60A 3GTHA 2HSDA 3I34X 3BG9A 1BCRB 3A22A 1PZ1A 2QE6A 4HMPA 3KJFA 1KETA 2EJAA 2JGEA 1O0CA 2WD7B 3AF3A 3MQFA 3SDSA 2V6BA 3SSMA 1KJIA 2BOFX 1KHHA 3LPOA 1O5OA 4Q22A 4OV9A 2AW3A 5T64A 2MHCA 4B73A 2VS1A 1C8QA 2P1RA 2AR9A 3OX1A 3R6DA 3NIYA 1SZNA 1E6SM 2YMMA 1A5MC 1AKEA 1FY2A 2JPDA 1LBFA 4PZ9A 2GVDC 2V67A 5J3JA 2ILTA 4Z9XA 1AKVA 4ZHQB 1B1AA 1JA0A 4P83A 1G7VA 2YN0A 4TKUB 3GW8A 3M1LA 5ILGA 1KP9A 3BORA 3PVCA 1U0BB 2PZAA 4HP8A 1S02A 3ZYZA 1VSUA 2GK4A 1UR2A 2CF6A 4E3VA 4TTVA 1L4NA 4H9VA 3CRZA 3A4TA 3PJRA 1VB5A 1JYNA 1XVLA 4BP1A 4MB3A 1L5SA 1N8KA 2B6NA 4LQ1A 1HG0A 4QQFA 1UKQA 1WXFA 3ARQA 5FJOA 3LVBA 7ADHA 3FVWA 5FUVA 3LF1A 5FL7D 3SEZA 1WSAA 3VYUB 3G0IA 1MWOA 4FFLA 1ISPA 2AFHA 5DWVA 2OMAA 4ERGA 4ROSA 4ACZA 2IF2A 2YB1A 3QY8A 3RGWS 2XPKA 3X2FA 4F3YA 3L79A 4OYHA 4Q48A 1UZDA 3E7PA 3ZU3A 3IT2A 2VSFA 4K87A 2JAWA 2V6AA 3M43A 5AH0A 2XMGA 5T4EA 1VYPX 1QVVA 4KNVA 1VJCA 2IOQA 3OLIA 4Q4AA 2RD2A 1DRKA 3EDDA 4J3JA 3G1HA 2D24A 2UDPA 5EP4A 3VPSA 2J7KA 6REQA 1XIHA 3PIRA 5I9LA 5G40A 1JWAB 2I62A 1MTOA 1QO7A 5E95A 3OJOA 1BO6A 2FPLA 4DLLA 4AKIA 4IYJA 4I90A 3EPHA 3VM5A 4G5GA 2BSLA 1R7AA 4WY0F 3OOHA 3UWZA 4INAA 3DTVD 2DPHA 1ZICA 1MMFA 4FLOA 2ZI4A 3W82A 1GHSA 3K09C 2QX9A 1X1ZA 4CFSA 4DLFA 3DDCA 3PXCX 3O8OA 3VX4A 3PX3A 2O7SA 2O3SA 1BMTA 1W5AA 4U2EA 3VUPA 4BU1A 4QQKA 5DNVA 4PSVA 3NORA 3R4IA 1I2NA 1S1RA 4KLCA 3VYSB 3Q45A 4F38A 4EITA 5FOXA 4LUTB 3GP8A 4E5YA 3UK1A 3B9AA 4A3HA 1P4JA 2QS8A 2XWSA 3QKIA 4XD3A 3QI7A 3ZWPA 2ONCA 3FE2A 4PB5A 4UHJA 3LC0A 4MS4B 3P27A 2NT4A 3IIOA 2ZATA 4BF7A 2ZPUA 2FPIB 1JIVA 3BGOS 1FRZA 3VCCA 3WQDA 4J1TA 4RELA 2WP8J 4O2LA 4PGFA 1PJRA 3W8EA 2Y8KA 3WIUA 3EA5A 1VI2A 2K2WA 2YNMC 1CJBA 1HM5A 1IR1A 1C7TA 1SN7A 2QR2A 3MYYA 4JUIA 1P5BA 2QDHA 4RZ5A 1OU0A 1U6KA 1K8YB 1W0KA 4QU9A 8OHMA 3HY6A 1N2JA 4LSBA 1ZSVA 3IDAA 3ROZA 2CZCA 1JHUA 4TV6A 1VJ1A 3RUHA 3KLPX 4XOIA 4GA8A 1G21B 4RHTA 3WH6A 4ZVNA 5LOVA 5I45A 4MFEA 1M9NA 3KPUA 1IXSB 2QX8A 3OIDA 1JI3A 5JXGA 3KJNA 2Q62A 2E85A 3L68A 2Q3HA 4GOXA 4ZZIA 2HF9A 4QDMA 4E5MA 4FE7A 2WB4A 2C15A 3TLGA 1BF6A 4IP5A 4RMHA 1PWHA 3GW3A 4CU2A 4GNJA 1E6LA 1DO2A 2R8BA 3IOBA 3HO1A 3ONVA 4J07A 3BZJA 1YNSA 2O8FA 1KFWA 4LSGA 4LFAB 4W7IA 1MP0A 4LALA 4H8UA 4HNAA 3TNYA 5IBRA 1DXIA 5HOEA 2CBZA 2HXGA 2ZICA 5E6ZA 1AXGA 3UEQA 3CT2A 1ZGHA 3PAOA 1KMMA 4YS6A 4AEFA 3GJSA 4M1YA 3RIEA 4FOUA 2PUDA 1KQZA 3AESA 2O7QA 4I50F 3EWDA 3LTPA 1MABA 1GTSA 3LC2O 3LY8A 5BO5A 1QHSA 3LNMA 3ND7A 3O3MB 2ANBA 4A8TA 3W7VA 4HBGA 1KM2A 5D38A 3LAWA 5IDYA 5JZOA 2P40A 4CD7A 1XTIA 2DTDA 5IHSA 3VX3A 5EJ2A 3LECA 1H1LB 2J6HA 4NZZA 3EF0A 5DN1A 3FYSA 3MGAA 2QQGA 1WLYA 3VTRA 2HRQA 5BXYA 3NO3A 2PRYA 2YJQA 3E70C 5BNZA 1VKNA 4Q01A 4NRRA 4TZ6A 3OKAA 4G7EB 4RIFA 3DW1X 1R9MA 3C3UA 3L7YA 1D6SA 1DTWA 1QV9A 5E6SA 1LEHA 2VWTA 1JSZA 4FOKA 1SUBA 1ZH0A 3T2QA 3B1WA 2HE8A 2EKCA 2X3YA 2EARA 1JG1A 2FIQA 1CGWA 5AXDA 4CQAA 2YR0A 2YQZA 5AY7A 2IXGA 4KH1A 4MKGA 3UZUA 3ZWAA 4WOQA 4CU6A 2D3LA 3ETCA 1JDCA 5I4CA 1IZ0A 4FMDB 1Q7QA 4D9MA 2XNSA 3E3LA 4UHCA 3AM3A 3TZKA 4K5QA 2WYOA 4G1FA 4XVUA 3TJRA 4O0KA 2W2TA 2LKCA 3PEVA 3W2NA 1KK1A 4X1OA 2QORA 5M03A 2I2CA 2B1GA 3LP5A 3L5KA 1SCUB 1BE8A 1T2UA 4DF2A 3DT8A 3U5TA 4TQAA 5FQNA 4XPIB 5DNUA 2ORWA 2QIIA 4DSUA 3VSAA 3ONFA 3F97A 3ZN2A 4DEVA 4LX0A 3PCXA 3U4IA 1W36D 1WHSA 2H48A 2FZ5A 1FW6A 1IHIA 3C3JA 1DWOA 2E89A 4WXYA 1NL3A 3ARPA 3D54D 4JB0A 3WYFA 5IPFA 4C7XA 2G3FA 4GD0A 2A5GA 3BB1A 1VTKA 4H7KA 1LQTA 2UY5A 1TW3A 4J49A 1CW2A 4X45A 4O53A 2M2IA 2Q9CA 1M10A 3EZ4A 2FLKA 2OD2A 2ZE8A 3GDGA 2ZBRA 4AY7A 2OSWA 4JHZA 1C14A 3MTJA 2QYGA 2PL9A 4HJRA 3QWFA 2C2ZA 4LJ4A 4JUFA 3HDGA 5AC6A 1XZDA 3JQPA 3WRYA 3EX6A 3GRPA 1YDVA 4DJED 5I24A 1JHQA 1QGYA 1QNSA 1W1IE 1HQYE 3N2EA 4J3ZA 5A2GA 2OMKA 3NGLA 5JZVA 3L7AA 5DMHA 4MWAC 3T09A 3HTXA 5EZQA 4R33A 1BF2A 1ZOPA 5G1PA 5IUNC 4V0SA 5JSHA 1RXUA 5KI6A 2EKPA 2XCQA 4QE4A 3FPEA 3RAFC 1P1BA 2G9QA 1PT7A 3H5WA 4P31A 4EGJA 1MIOA 2QMHA 2I2DA 4M6WB 1ZK0A 2P3QA 4UNRA 2P0YA 3B6MA 1VFHA 1FP7A 1UD3A 4LHZA 1H05A 3U44B 1D9ZA 1YKGA 3IXMA 4F4FA 3T4PA 3ITCA 1OYBA 3BUSA 1KS9A 1R6WA 1K77A 1G63A 4GKAA 4X6UA 4GP7A 4PL1A 4X0VA 3RRJA 4FSAA 1X7IA 3GNRA 1OT3A 1BCRA 2ZRWA 5L6LB 3A6ZA 2OHFA 4FYIA 4E2XA 3ZMRA 2WD7A 5D33A 3VIKA 1U8XX 1XXLA 3OQEA 1GOXA 1LJLA 3HR4A 1BFKA 3TOXA 2ZT7A 2RJOA 4GC4A 3S0JA 1RLMA 2XUZA 3L43A 4YGYA 1OK6A 6CHYA 4TKLA 3HI6A 1YE5A 4UNPA 4KH0A 3AI1A 4ZENA 2NQ9A 1UWCA 1QQ5A 4ZHQA 3R23A 4M4SA 4TKUA 2RHJA 1YHTA 2ZRAA 3NQFA 5C6MA 1SZCA 1TE6A 2BCJQ 4YL2A 2ZG6A 3TSYA 1XRVA 5EZYB 4DY4A 3L06A 2CN1A 1EBUA 1CC1S 3NFUA 2J66A 3SLRA 5JC8A 1T40A 4DV4B 4JFUA 1D6NA 1W9XA 1WCWA 3BFJA 3GK0A 3PYMA 1EFTA 2RGCA 4AWSA 1ZI8A 4P84A 2AZ4A 3HR8A 5UKDA 1NU8A 2F3TA 5AKGA 5J2TA 1US2A 5I7GA 1IB0A 2A92A 2R5WA 3OZCA 4BN5A 1J4AA 4XAGA 4QUGA 2P2DA 2VQ3A 3NSNA 1UDRA 3CZQA 4YPVA 3DSRA 4S12A 1QE0A 5F4XA 4QOEA 3ZHBA 3CO4A 3B3JA 1E2UA 4M37A 5FF2A 1Q7RA 3QRWA 4AZTA 1DFGA 2JK1A 4E8CA 1P60A 1SA0A 5KNLA 1DBPA 1JAZA 2PLCA 5CIQA 4DUYB 3OF3A 4QULA 1MDRA 3L8YA 5C8XA 2FFJA 3IVXA 2XNJA 8GPBA 4TMZA 3RMEA 5ELMA 1W3TA 3QE9Y 4AY1A 4DEFA 2DETA 4K05A 1XCXA 1ACLA 2DAPA 2KWIA 2XNDA 2O3UA 1NVTA 2GZ2A 2C2WA 2NQTA 1ZK4A 1HKHA 1EPXA 1AQUA 1GUAA 2RJGA 1DEAA 1K1EA 4OI2A 1YJBA 3SYMA 4UZFA 4IL5A 5TEWA 4C01A 4QVKA 5DVZA 5EAIA 2DY3A 3VKWA 3W37A 1SKQA 1NEYA 4AHOA 3WDQA 2OHXA 2UAGA 3ZW7A 3MU7A 1XOIA 3VTZA 2OAGA 3BJIC 3N53A 3JRWA 4LUTA 3G24A 3WBYA 3VIPA 1LF1A 4LXHA 4H18A 3NYQA 2PLJA 4ARIA 1QBBA 3M9LA 3G0DA 3ZGOA 3VD7A 2W2KB 2YMQA 4PZEA 4MS4A 2NVAA 2CHGA 3GBVA 4R8RA 2VOJA 2ZRDA 3TB6A 4FZVA 1O54A 1DBIA 1XLWA 5KTSA 4NU8X 5TQ0B 3SKYA 1EIWA 4M46A 2IPXA 2QIWA 3DKIA 1BPLB 4KERA 3VNSA 2FRDA 1N34B 4X61A 1LRNA 2ZTMA 1U0TA 2YCKX 4BX8A 3SDZA 5JH7B 2QULA 3HLYA 5HMMA 6Q21A 1UD5A 3PS9A 2I57A 4AD3A 3JZIA 3TDKA 5ALJA 4EY6A 1KXZA 3NO4A 2B8JA 3NDBB 2GAAA 3S7ZA 2B25A 3DR3A 2VR5A 1ZX1A 3TNFA 4TGLA 1HDYA 4O54A 3GZ4A 2EG5A 1Q2UA 1DFIA 5CMLA 4DRYA 4JP5A 2OQIA 4EFKA 4YRFA 4E5SA 1Y1SA 3R7AA 4G4IA 4B4OA 3Q3IA 3I37X 2UVDA 5DRYA 2AJDA 4UXJA 3AHZA 4G1KA 5L6UA 5J43A 8XIAA 3AVTA 1K4HA 4ZMGA 4DIEA 1JSXA 1JJKA 4US5A 3SKXA 4HDAA 4FX5A 1ABBA 1UWSA 1B26A 4WNAA 1Y5VA 4BWLA 1LPSA 1EXDA 3G9UA 3TLLA 5ALIA 3C2OA 2BKVA 3S2IA 4L07A 1C0PA 2ERCA 2X42A 3MVIA 1AH0A 3LGSA 4HUQB 4FIQA 5K3EA 3KAOA 1GKYA 3KS9A 3BFVA 5T4BA 1H6CA 5ALTA 4ER3A 1EJTC 3A31A 5A2CA 1XYMA 2J4FA 3ABOB 1OLUA 2EW2A 4OMCA 2EPHA 1SXQA 1ML4A 3JVIA 3IPYA 1PEYA 2H00A 3OVRA 1Q4NX 1PQ4A 3PJGA 4DE5A 2ZKLA 3EWIA 3F7MA 3KJXA 4DF0A 2XYVA 2ZSHA 3KNZA 3KB1A 1U7HA 1ZMOA 1C3FA 3WL8A 3GUGA 4I8YA 3UETA 1RPXA 1TYDE 5FNZA 3BLEA 4B33A 3ZG6A 4B6SA 3QLUC 1O4UA 5AZ1A 1NT4A 5E0FA 4NEGA 4EGQA 1OYVA 3M44A 3ZY5A 3GSMA 4I9UA 3FX4A 4ZOBA 4LIPD 2YLAA 1UC5A 2JIEA 1H1LA 1RXIA 4HXGA 4GINA 4GT1A 2XLCA 5L4NA 3UY8A 5BOEA 3H5NA 2W5UA 4H3VA 3ZEAA 1KV8A 4QREA 4AY3A 2H2IA 1DE0A 4D5GA 4G7EA 3EDJA 4D0GA 3A10A 3A70A 4V1CI 2XJ7A 5CCBA 3NH6A 1J11A 4P53A 2Q2OA 3S5NA 2A7XA 3NWPA 4AMGA 2C59A 4JTEA 4FGLA 1WBHA 1E4VA 1Y37A 3EASA 1Z73A 2GHIA 3AZRA 1FFBA 1RAAA 1QUMA 2BI8A 3PYLA 4V0OA 4YS1A 3O3OB 1L8OA 3HGMA 2PQMA 2D1FA 3UXAA 3B53X 4MA0A 3GLFB 4DJAA 5E1DA 3PEWA 4EYSA 1F3XA 2E3JA 3QOMA 2FDCA 4E46A 2WWDA 1PIIA 1AUPA 3C3AA 1TM2A 1TQ4A 3HJTA 4XUGB 4JTAA 1PWZA 1SZDA 3PL5A 1SCUA 2NO0A 4AMAA 3H97A 1Y6RA 2J79A 4F71A 4LSZA 2AKAB 4NZNA 3E5BA 1FWGC 4EGSA 1GUVA 1FYDA 1TU3A 2CXRA 4O4JB 3NPWA 3FZYA 3PGA1 3PFMA 1EQUA 1W3IA 3B4UA 1VKHA 1V96A 4CGZA 4G2DA 3WD3A 4JIGA 3LDAA 3PC7A 3II6X 3UKDA 4WESB 4M6UA 5ICCA 1TQDA 3WB9A 1DC4A 1V1MB 4PMNA 5TX7A 3DOIA 3N9RA 1U28C 4ERIA 4AZSA 5IKMA 2YHBA 4EAAA 4IX2A 1N82A 1BMDA 1G5QA 4G1VA 1XA0A 2FHSA 4PC1A 2J3DA 2WWCA 1TDJA 2WJIA 4B6FA 1A82A 2HCFA 4XGKA 4JB3A 2VRBA 4B45A 5CFOA 5D2WA 1DBQA 2ATIA 4DHWA 4EAMA 2RGUA 2XUIA 1R0KA 1YZGA 2JAPA 2B81A 4FS9A 2NOAA 1Z0FA 1JXMA 4LHSA 4EG5A 4BNHA 4G8JA 1E1QD 1N3IA 2DPMA 3TOSA 3ILVA 1VBKA 2VGFA 4IUDS 4E2FA 4GM0A 2X0NA 5KVSA 4TYQA 1KQGA 3HUEA 1UBUS 1ZMXA 3ED1A 4HHLA 5J1SB 1J49A 2YA1A 2WU8A 1KVRA 5A06A 2O3JA 3UY7A 3N5CA 4Z3KA 1XRNA 1BVYF 3GO4A 4KEZA 2ETVA 5C81A 3LUKA 2FUCA 4CN6A 1OC7A 3V7WA 1DO0A 2FEKA 4D9PA 1XN1A 4M6WA 4R2IA 3UWYA 4X7BA 1MO6A 2C96A 4ND4A 2PRKA 3KEQA 2I6QA 4AULA 3VZYA 3N75A 4U8HA 3UV3A 2DBZA 4JY9A 4IFOA 2NAPA 1C80A 4TZKA 1PLKA 4JIMA 1C7IA 4KZPA 4MGEA 1IJEA 1P5HA 3UK6A 1KLZA 1LBLA 3M49A 5IFTA 3VMMA 3WL7A 5KU1A 7REQB 2GYWA 3PC3A 2WPNA 3S1UA 3DFQA 2JAHA 3S2FA 5DMMA 2J74A 4QXIA 2VSXA 3PQ5A 2QRHA 3CPEA 1N6HA 1K4MA 2ACKA 4PV7A 3TEFA 2I2WA 3PK7A 3GUWA 3UMYA 1JEEA 4A91A 1WKEA 3FZGA 5IRPA 2Y61A 3DPSA 4Q8MA 1V7ZA 2F8SA 1U3GA 1O08A 3C56A 4K9DA 3MSYA 1ZCCA 3T0IA 5E93A 2IJGX 4AZ5A 3RANA 4JTUA 3BH0A 3M4JA 2QCDA 3L3BA 1ZK1A 4BQSA 2HLDA 2G1AA 1O60A 4WBNA 4BQPA 4NU5A 3LI2A 5L4LA 4XEUA 4N0RA 2ZRQA 5G1NA 2FZEA 1HZZC 3U49A 3INTA 4F21A 2AQWA 4I1OA 4YDQA 3ECQA 1KJWA 1I4NA 5EE9A 3WGQA 3OT5A 4A82A 3DFTA 3V4RA 3B1ZA 5EFZA 4Q3BA 5DT7A 3AUKA 3OPQA 3T7SA 3Q0EA 2KSQA 3TLMA 2XCTB 3QVVA 2I03A 3JZEA 5G0VA 1P9RA 4R6XA 2F9LA 2CHQA 4BVHA 1Z17A 2XDFA 1JGTA 5H0IA 1UA7A 3D0KA 2VUNA 1RRCA 1ZCAA 1WZIA 3UC5A 3ZWDA 2JZNA 3EOBI 3TYBA 2P65A 1E9FA 3EWNA 4NFLA 4ZC8A 4D3XA 3FEQA 1CZ1A 1KGWA 1KCZA 2OQVA 4PCTA 4CNSA 3AO0B 2OQRA 2J7HA 3AMDA 1CLXA 3UWKA 4NG3A 4ILEA 3WRXC 2Y88A 3GDLA 4P8WA 1OHHA 1O5RA 5L6MB 4KRFA 1H0SA 3UT6A 4P8VA 2AF4C 2PD4A 3TPZA 4G23A 3HKCB 2H5LA 1XFBA 4YWJA 4WDRA 2HBVA 4WXMA 1E0XA 3T2OA 1WPRA 3RYTC 2VDGA 3UFYA 4OJYA 2RHWA 1L4MA 5HIMA 2PSHA 3KTAA 3RYCB 1U4OA 3VUSA 1RCXB 3NEHA 1N2BA 2IY7A 4K9LA 4DZTA 1FLAA 2PYIA 4PIMA 5AM4A 4DXKA 3TCXB 5AW9A 3PWSA 2EJBA 5CA1F 1RPTA 2W2KA 4X3PA 2C95A 1L9XA 1S9HA 1WE2A 4Q24A 1A8HA 4BGEA 2Y1KA 3BT7A 4RDVA 3FNQA 2PX8A 4ZO4A 4DAOA 2VX5A 4PUMA 4PULA 3UJ6A 4URHA 3TCSA 4HDQB 3QKTA 4Y2WA 3Q67A 1IATA 4QJIA 3V48A 4YCLA 3LT1A 1PG5A 1PNQA 4UM9D 1ENPA 3VH2A 3A4IA 5JH7A 2Y1DA 4RZXA 1MYRA 4QYSA 4Q7QA 1NNUA 4X7PA 5FLYA 1Q21A 1ZD4A 2PVPA 3TL2A 3LT4A 4GI5A 4YB8A 3AF0A 3GEEA 5ABEA 4YYFA 2Q6LA 2YXLA 4UR9A 4B47A 3UG4A 1GVYA 2F1JA 4TTJA 1H09A 3WV4A 2HQ1A 2XGBA 2Y4SA 2ZA3A 4MWDA 4GP9A 1UD4A 3R8FA 2J9YB 3GA0A 4KR2A 4CMHA 4XEHA 2QL7A 3ANUA 3RSCA 4LC8A 3G8YA 3O9MA 3SBXA 4L08A 2TAAA 3F4BA 1ZJZA 3PQ4A 1CGTA 4MV3A 2C8NA 4JTFA 3DBRB 2Q5IA 2MSCB 4OQEA 3VHRA 3QMWA 1GSAA 4RY9A 5KCMA 1D3CA 3H8JA 1QWGA 3HCWA 4QYTA 3KHDA 1KTVA 5D86A 2P6MA 4HUQA 2XEDA 3RS7A 1Q7TA 1IZZA