5EMMA

Crystal structure of prmt5:mep50 with compound 15 and sinefungin
Total Genus 200
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
200
sequence length
625
structure length
625
Chain Sequence
RVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and Property Guided Design in the Identification of PRMT5 Tool Compound EPZ015666.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Protein arginine N-methyltransferase 5
total genus 200
structure length 625
sequence length 625
ec nomenclature ec 2.1.1.320: Type II protein arginine methyltransferase.
pdb deposition date 2015-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05185 PRMT5 PRMT5 arginine-N-methyltransferase
A PF17285 PRMT5_TIM PRMT5 TIM barrel domain
A PF17286 PRMT5_C PRMT5 oligomerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 5emmA03
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 5emmA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5emmA02
1RJGA 1XLDA 3VNJA 3VC2A 4LECA 3PFGA 4DZRA 1ORIA 4RTJA 5E9JA 4XISA 2CMHA 3B3JA 1I9GA 4GOOD 5XIMA 3EVZA 3UJDA 1QANA 1DIEA 2YQZA 3M33A 2XIMA 9XIAA 1KHHA 4WVLA 5E2BA 5B1SA 1S5NA 3FUTA 4BP1A 5EZSA 2P3OA 5E8JA 5LQAA 3OFJA 1U2ZA 4MHTA 4K6MA 3TVAA 1XYMA 1SG9A 3HCAA 2IH2A 4XSLA 2ZIEA 4XUCA 3BUSA 2AOWA 2Z6QA 1L3IA 5BP7A 2JHAA 1NE2A 2IDKA 3V97A 3UVAA 3R24A 3NGFA 4C08A 3VNMA 1IM8A 3C0KA 1INLA 2ZSUA 5CUQA 6XIMA 2ERCA 4E2WA 1NV9A 2PT9A 2BH2A 3KQMA 2QY6A 3LKZA 4ER6A 1XIEA 5K03A 1RI1A 1DE5A 2AN5A 5FQOA 2NQHA 2AOTA 2I57A 2B9EA 2PVCA 2CKDA 4KVZA 2QYOA 4PINA 1OADA 1JSZA 3OBEA 3KPUA 3MQ2A 3NDIA 4YMHA 4KIFA 5GINE 4LWPA 3KTCA 4LWOA 1G6Q1 3FPFA 2X7WA 4ER7A 5KYGA 3ANXA 4PIMA 2IH5A 1P1BA 3GO4A 4IV8A 5DTRA 1BKYA 1QYRA 2AOUA 2YR0A 2GUBA 3MTIA 3CQKA 1JQDA 3VYWA 2ZDSA 5DM4A 2OKCA 5T6BA 5AVNA 2PLWA 3M0LA 5C9ZA 3IYLW 3LCVB 3KPWA 4R6WA 5LQUA 1EG2A 3OU2A 3F4KA 1L3BA 2BR4A 1NW3A 5FCDA 4RTOA 3G2MA 2FYTA 3SMQA 7MHTA 3CJTA 1D2CA 1G38A 4AZWA 1GW9A 3KCJA 3KR0A 3BZBA 3SSNA 5EIFA 3P9KA 2YXDA 4X63A 1KYZA 3GJYA 3TKAA 4DMGA 4ER5A 1WY7A 2BR5A 4EKIA 1G8SA 3ORHA 2G4JA 4HGXA 3QZAA 3TC3A 2QRVB 3DMHA 4OBWA 4K1GA 2A14A 1SKMA 3TM4A 4ZTBA 3ID6C 3UJCA 1XLBA 4GUAA 3QC0A 2OBFA 2ZULA 3GRYA 1Z3CA 1VP3A 2AN3A 3NWEA 2G72A 5GP1A 5E1DA 4X61A 1HNNA 1VBFA 2YUIA 4A8IA 1N7JA 5JR3A 4FR0A 4HC4A 4OA8A 4PGHA 3GRRA 2VS1A 3JU2A 4PYOA 3UJ9A 3DH0A 2ONYA 3CNYA 3ERCA 2I9KA 3HVKA 2V7EA 2ZLBA 3HA5A 5LQJA 3ELUA 4GOMD 5EGSA 4GC5A 3AAMA 10MHA 1RI2A 3T7RA 4HG2A 2P41A 4RTRA 4MTLA 2ADMA 2BR3A 5DT2A 1DL5A 1XYBA 4OVXA 4ISCA 4DCMA 3NVKI 5K01A 1ZGAA 2BM9A 4BLUA 3FZGA 3LECA 3CQHA 2K4MA 1DUSA 1G60A 3KHKA 1XYAA 1XYLA 1QAOA 2ZVJA 5E1OA 8XIAA 4E70A 3P9NA 4RV9A 2UYOA 3G2QA 4DVOA 3KBMA 1L1EA 1XJ5A 3C3PA 3FUUA 3ER9A 1JG2A 3OZSA 3BANA 3TKYA 1XIFA 3CJRA 3ELYA 2XVAA 4IKPA 5XINA 1XLAA 1X19A 3FPHA 4Y30A 5DXAA 3BGVA 2EG5A 2ORED 5HFJA 1XIIA 3SGLA 1XDSA 1XLHA 3OE4A 4YV1A 3PX3A 4RTMA 2GYIA 4H0NA 3GRVA 4BLVA 5E2AA 8XIMA 2YX1A 5DM2A 2CWWA 1I60A 3TM5A 3BGIA 5T64A 4QTUB 2XISA 1XLJA 1M6EX 1R6AA 2DULA 3HCEA 3I53A 2ZBQA 5EC8A 3SXJA 3GDHA 4PNEA 2HMYB 4PWYA 1P91A 1ZKDA 1SVUA 1ZGJA 4R6XA 2JHPA 1XYCA 1AQJA 5TNVA 2PX2A 3G5TA 5E8RA 3I58A 1Q0SA 3BXOA 5FWAA 1XIHA 1NBHA 4PCLA 2C7OA 4O29A 1XLEA 5BW5A 3B3FA 3KR9A 1SQGA 2GLKA 1X1AA 2AR0A 4P7FA 1VLMA 3H2BA 4YTQA 3DX5A 1XCLA 5EZQA 3HNRA 5FHQA 4F84A 4YUZA 1D2HA 3LGAA 1S5MA 3TQSA 4QVKA 3XISA 2EJUA 3QXBA 5H6HA 5LQRA 2OU4A 3BWWA 2WA1A 4FP9A 3DUWA 4DCGA 5H1WA 5XIAA 4YV0A 4DF3A 1AQIA 1NW7A 4GOLD 4KW2A 5CVDA 2OB1A 5DRTA 3HCCA 4PYIA 1R18A 2H1RA 3AYTA 1ZG3A 3MERA 3R6TA 4KRGA 4OQEA 1BOOA 3DLIA 2VP3A 3HVHA 4HTFA 1OR8A 5HIKA 5LR6A 2AOVA 2JG3A 1JTFA 4RVFA 2HV9A 3M0VA 2IIPA 5LQCA 3P9IA 2JHCA 2ZCJA 3NMUF 4BLWA 2AOTB 3FYDA 4PYJA 1YF3A 4R8SA 4KDCA 5F2NA 2P3QA 1F3LA 4HGZA 5GIOE 5ICEA 2Q41A 1JG4A 1X1CA 1O1HA 2UYQA 2FHPA 3UJ6A 3UJ7A 6XIAA 4XSMA 4AX8A 3C6MA 3LPMA 4ZB0A 3M6UA 3HVIA 5DSTA 3GNLA 2HTEA 3OPNA 5DSXA 2P8JA 3TR6A 5K0BA 3KQPA 5FTWA 3DXYA 1DXIA 3X0DA 1XINA 2HK1A 2J6VA 3M0XA 1NW8A 3FYCA 3C0QA 3A4TA 3KU1A 5EQJB 4CXMA 4E2ZA 3UA3A 8MHTA 3JWHA 5K8VA 4QDJA 1JR4A 2QUMA 3DR5A 3GRUA 4QDWA 2G71A 1ZQ9A 2AN4A 3A25A 4RX1A 1QZZA 4ZBCA 4DKJA 2ZTHA 2GVEA 3CKKA 2XINA 5FA5A 1QUMA 2B3TA 5HILA 2AVNA 4EQZA 4F86A 4C06A 4A6EA 3Q7EA 1XIDA 1PRYA 4M36A 2NXNA 3PVCA 4PYQA 3KBWA 1B42A 4Z2YA 4CKEA 3LX6A 4PYLA 2KW5A 3LCCA 1R8XA 1JQ3A 3M70A 3KQOA 1YFLA 5ICGA 2Z6AA 2DPMA 1XLMA 3C0LA 3CCFA 3UXIA 1BXBA 3NTVA 4F85A 3BT7A 3SM3A 4U7TB 1XIMA 5LQKA 2QW5A 1DIDA 1QAMA 2ZW9A 3FUXA 4QPNA 5EVJA 4YV2A 4YUWA 3P9CA 5DX1A 3CQJA 3ITVA 4QDKA 3EEOA 3G2OA 3LDUA 5GM1A 5F2KA 1UIRA 3EVAA 1XLFA 2AS0A 1EQAA 3BWMA 3OCJA 4GF5A 4RTNA 5EKXA 3AXTA 5E1BA 3VYLA 3GU3A 1KYWA 2ESRA 2PKWA 4X60A 4EK9A 2FRXA 2G70A 4M37A 3LMZA 1NBIA 5GWXA 4IV0A 3BKWA 4P7GA 5H02A 2JH9A 3PS9A 3DMFA 3LL7A 5EEGA 2GAFA 1RI4A 4P7KA 5T67A 5K09A 3NW9A 2P3LA 3FTEA 5CCBA 3L8DA 2H00A 2FPOA 3DLCA 1VE3A 1XCJA 3AJDA 3FTCA 3LDFA 3P2KA 3THRA 3A7DA 5EHGA 4C07A 1XLKA 4YTUA 1TW3A 3UWPA 5BW4A 5CCXA 3DXXA 3Q87B 5IKMA 3KQQA 3KCOA 3M0YA 4L7VA 4MIKA 3T7SA 2QRVA 3EPPA 2O06A 3KPYA 1X1BA 3R3HA 3P8ZA 1XLLA 4V0QA 1P39A 3SR4A 4QEEA 3EGEA 3N4AA 2YXLA 4QTTB 2HNKA 4GJIA 2R6ZA 2G0WA 1AF7A 2NXJA 2PX8A 1VL5A 2ZIFA 3DOUA 3O31A 1XDZA 4FS8A 4XCXA 3KCLA 4Q7IA 1KPGA 4V0RA 4QE5A 3DBNA 4E32A 4RVGA 1A0CA 1A0EA 3C0SA 1O9HA 3XINA 2B25A 2FK8A 2ZFUA 3KKZA 4GEKA 2UYCA 1NKVA 5FULA 3OFKA 3S68A 5K0FA 4ER0A 4RTSA 4E2YA 4YTRA 5DTQA 5K0LA 1NW6A 1KXZA 2AOUB 4OA5A 4OBXA 5EIWA 3MHTA 5K0JA 1R00A 5D1NA 5KVAA 3EVDA 4OX9Y 3P6LA 3MCZA 1XIGA 3AXSA 3T0IA 2IBTA 5DXJA 3IUHA 3BZGA 3P2IA 3BWYA 2WK1A 4UOEA 5MHTA 4C03A 3RW9A 1BXCA 4HGYA 1MNZA 3JWGA 2P7HA 1ORHA 1XLCA 3TRKA 4E31A 3HTXA 2O07A 5B80A 2AZTA 3OU6A 4LG1A 3KBNA 5FQNA 1FBNA 2CMGA 3C6KA 3RIEA 2G8NA 4FSDA 4CKCA 4Y2HA 5LQNA 1T43A 4EACA 5GM2A 4RTKA 2P35A 4FGZA 3KBJA 3HM2A 4BY9E 2PV0A 2XYRA 3HA3A 5DM1A 1O9GA 1WZNA 4ATNA 3M0HA 2BM8A 2HCVA 3ITXA 4PIPA 4RWZA 5D1HA 2C7RA 1QTWA 3FRHA 5I7GA 4A8NA 1EIZA 1BC5A 2HWKA 5EKUA 3OZTA 4E2XA 2JH8A 1DE6A 4X41A 3A7EA 1R74A 3C3YA 4A8RA 2QUNA 3KQWA 3O4FA 4CWAA 3HA7A 3PX2A 2I62A 3IHTA 1FPQA 1TW2A 3R0QA 5FWDA 4RVDA 1VQ1A 4PFHA 3EGIA 4QVGA 1RI3A 5U4XA 4C04A 3U3HA 4DQ0A 3FPEA 5C1IA 3IUIA 3P14A 5HZMA 1KIAA 2GA9A 2IP2A 2YVLA 3EGVA 2PXAA 3KQSA 4X1OA 2UZ4A 3ITLA 2PGXA 4C05A 4DUOA 5GIPE 3I5UA 3B7PA 3KBVA 1CLKA 4QQNA 1JG3A 1RI5A 2IGTA 2XYVA 3FPGA 2QE6A 3G8BA 3M4XA 5E9WA 4GOND 3REOA 1I4WA 3HCDA 1M0EA 3WQOA 1XIBA 3BWCA 3HVJA 3NDJA 3RODA 4DM3A 3OZRA 4B17A 3TFWA 3ER8A 3TMAA 3LSTA 1P1CA 3G5LA 4EMSA 2AOXA 5CIYA 3TLJA 5K0EA 3P2EA 3FUWA 3KWSA 4E33A 3E7PA 5DX0A 3VNIA 2VDVE 1MUWA 3ITTA 4ER3A 5HEKA 2PX4A 2ONZA 2XVMA 5J8LA 2O0LA 3SVZA 3UJAA 9MHTA 3DP7A 1F38A 5CVUA 1R8YA 3VC1A 5DX8A 3GNXA 3E05A 3MTEA 4KWCA 2N47A 1N7IA 2OYRA 3L23A 4XIMA 5KS2A 4PGLA 3DTNA 3BWBA 2HK0A 3K6RA 5HIMA 1V39A 1NV8A 4NECA 2IBSA 1KP9A 3EVFA 4M7RA 4EVIA 2GS9A 1N2XA 2VDWA 3HCFA 5GOZA 4JXJA 3KR2A 3CWHA 7XIMA 4CTJA 2Y1WA 5P8WA 3FPJA 4YUVA 1WG8A 2E5WA 4M38A 4RVHA 3R9XB 1D8WA 1RJDA 1XP3A 1SUIA 1VP9A 2ZWVA 3QV2A 2V74B 3DXZA 2ZVRA 4K3ZA 2NXEA 2I56A 1G8AA 1H1DA 3K0BA 1XLIA 3BZJA 3SX0A 3FTFA 4LNCA 1AV6A 3BDKA 1I1NA 3FUVA 1TZ9A 2ZBPA 3SSOA 3QOWA 4PYKA 5CM2Z 2PX5A 1EJ6A 1RJEA 4BP3A 2O05A 2VDUE 4EAYA 2PWYA 4HSGA 3AYVA 5DWQA 5K0CA 3O7WA 4GQBA 1DCTA 5EHIA 4XKMA 2ZZNA 3JWJA 4YMGA 4GC9A 1XDUA 1RJFA 5KQRA 4PCAA 3EMBA 3HEMA 4AZTA 3TOSA 2HR1A 3KQTA 3G89A 5C0OE 2FCAA 1EAMA 3EMDA 3GIWA 4G56A 4GLEA 3B3GA 4ZB5A 2ZZKA 1QT1A 3M0MA 3ITOA 4P58A 4R05A 3EVGA 3PFHA 5ERGB 2NQJA 5HIIA 3WSTA 3E23A 4QQKA 1VPTA 2PXXA 4HNOA 2GH1A 1SQFA 2OZVA 2P7IA 1XXLA 3ME5A 1KPIA 5EOVA 1TPYA 4OQDA 3P97A 1KPHA 3IEIA 5DPMA 2IH4A 2IDJA 4GBED 1NT2A 1YFJA 2Q02A 3OE5A 5CD1A 3AWIA 2Z6UA 1YX1A 3CC8A 5K0NA 3CVOA 3KBSA 3EVBA 2PBFA 3TPZA 2NQ9A 3M6VA 1JSXA 4HH4A 2OY0A 4POOA 5EMLA 4PYNA 1MHTA 1XTPA 5EMJA 3ELDA 2PWPA 3DMGA 5CVEA 3LCUA 3P71T 4C4AA 1IY9A 1D2GA 2IPXA 3FTDA 4P7JA 4WXHA 2IFTA 3PB3A 3LHDA 3FVMA 3IUDA 1JG1A 5KQSA 2PXCA 4EKGA 4A6DA 3MCTA 3EVEA 2YXEA 2JJQA 4XUEA 2PSSA 4PYMA 5FA8A 3THSA 4CTKA 3G2PA 2ZIGA 4QPPA 3DULA 2NP7A 2PT6A 2B78A 3UBTA 3PLAE 1ZHFA 3A26A 3M6XA 2NYUA 5DRYA 5HOQA 3OU7A 2NXCA 2ZBRA 4QE1A 4J4KA 1YZHA 1A0DA 9XIMA 3U0HA 5CVVA 1G55A 5DM0A 1WS6A 4HTFB 4R8RA 1XISA 1YB2A 3UJBA 1HMYA 2XYQA 5FHRA 5K0GA 1FP1D 5E1MA 3AALA 1EJ0A 4FSXA 4RTLA 3VSEA 4KW7A 3LBFA 3ELWA 4KDRA 4PGGA 2WA2A 3CQIA 3IV6A 4FZVA 4E3VA 2Y1XA 3B89A 4A8LA 3G7UA 1IXKA 1WXWA 5B7ZA 1YZ3A 3BKXA 3EEYA 3QOXA 5JUWA 4AZSA 1FJXA 1XICA 1O54A 3NVMB 3GRZA 5EG5A 3V8VA 1JQEA 3PT9A 2ZZMA 3D2LA 1XVAA 2F8LA 3AY0A 5B7YA 2GB4A 2P40A 2PY6A 5ICFA 2H11A 3MAGA 2X7VA 2PJDA 3G88A 3I64A 3LBYA 4IWNA 4AZVA 5CVJA 4YTTA 4E30A 2NP6A 1XIJA 3KR1A 4YUXA 4U7PB 3QYSA 3G8AA 1FP2A 3FRIA 3I9FA 3BGDA 4FT2A 5EPEA 2LD4A 4KIGA 3T7TA 1BHJA 2FK7A 3JWIA 3SSMA 5AVHA 3VNLA 3XIMA 3B5IA 1VIDA 5IH3A 2OB2A 2O57A 3PTAA 3GCZA 3GXOA 1NW5A 4AUKA 3HCBA 3UA4A 1PJZA 2B2CA 3CGGA 3VNKA 2EX4A 2QULA 3LKDA 3NJRA 5DTMA 5FADA 3UZUA 2OXTA 4QE4A 2GPYA 2R3SA 1QAQA 4HHLA 3LDGA 4QDPA 3CJQA 4QEHA 3E8SA 4MWZA 1YUBA 2ZWAA 3UJ8A 4W4QA 2VZ9A 3M6WA 2G1PA 2OPBA 4GJJA 1JTEA 1K77A 1L9KA 1XLGA 1MJFA 1UWVA 3MB5A 3CBGA 5EEHA 2C7QA 4PONA 1L3CA 2NNWB 2OO3A 3UFBA 5M5BA 1X1DA 1Y8CA 3ITYA 1Q0TA 3KQYA 2XBMA 2C7PA 5EMKA 2I6GA 3EVCA 4HHMA 3KQVA 1UFKA 2I7CA 3NWBA 4YTSA 1M6YA 2QM3A 3HP7A 4US6A 3U81A 4CKBA 5LSAA 2UYHA 3KPJA 5K05A 3GGDA 2P1DA 3GWZA 5BXYA 4XIAA 2EFJA 5E9QA 5ICCA 4MQ4A 1SUSA 5F2OA 4YUYA 2YTZA 1KR5A 2EJTA 5DLYA 4ZB2A 2AVDA 4RTPA 2BZGA 4FT4A 5EMMA 5HIJA 4DA4A 3A27A 4RYLA 3KPVA 4RSRA 3UU0A 5G02A 3MGGA 2CL5A 1WXXA 4RTQA 4HRAA 5FUBA 2GLUA 4XUDA 1I6NA
chains in the Genus database with same CATH superfamily
4PZUA 3CZLA 4LECA 1OHHD 4P38A 1SA0A 1MO3A 4F66A 2QM0A 5FWYB 4B5NA 4X1YB 2IDKA 1L7BA 2VT7A 5AJZA 1EFVB 2QB5A 2VGFA 1QK3A 4P3XA 3ZXYA 5GVSA 3M64A 3IP7A 3T7JA 1OKKD 1B1YA 3TZLA 3HPFA 3F90A 1H2BA 3SECA 1GZVA 2ZDSA 4R5HA 4NMLA 3TFXA 3D6TB 2LIPA 3X1MA 5CGQB 1TEZA 4AY2A 4ZGBA 5CVTA 2YWGA 1E72M 4LAKA 3TM4A 5C5EA 5DOZA 3VR6D 4TSFD 5TMDA 3GRRA 5SWUA 3AKDA 2Q3CA 5AW2A 1NRXA 2E4UA 5EZYA 3TOVA 1JDTA 1SUWA 4M5PA 3AMGA 4MPPA 3RUPA 1D5WA 1MVOA 1P2DA 1U8EA 3EK2A 4GBGA 5KX5A 1NDWA 4YVVA 3QV7A 3A3WA 3G5AA 4KCGA 1Y7LA 4O1EA 4K6OA 1C8KA 4XX6A 3E8MA 5B1IA 1D7OA 4XPIA 2B4QA 1NM5C 4J3WA 2RHMA 3F5JA 1IWPA 2GBLA 5IJXA 1KGUA 2J27A 1RALA 2WA1A 2PDCA 1F4HA 4TTSA 3LCIA 4OF4A 4ND8A 3MWDA 3SGZA 1VFOA 1JTFA 4HDMB 4FHAA 3U4IA 4G4SO 3AV3A 4IDDA 3AUSA 3UY8A 1YNQA 1RCOB 2NXIA 2JGYA 2IIBA 3GRIA 5KEIA 2OCDA 1G4TA 3PZQA 2X5JO 3L4TA 4Z7JA 4V0SA 4FNAA 1R1DA 5KEZA 1UFOA 2B7NA 2ZTHA 1SZRA 4DDHA 1U9CA 1JFHA 4EQZA 1WLYA 1Y5IA 3HB9A 3GV0A 3VM7A 1J0XO 1E99A 2V9ZA 5LP6C 4MO2A 2NWSA 2J4DA 3HU1A 4DEVA 3V4ZA 1Q66A 3KWMA 4ALIA 1M34A 4BEUA 4J49A 5HQLA 3ZFHA 1P81A 4NBSA 3IT1A 4IJBA 2VRCA 5KC8A 3DBHB 3C3WA 2MSLA 4DB2A 3P2KA 2X76A 3AETB 1NFRA 3OG9A 1XGDA 1EO5A 3CNBA 3D0QA 3I6ZA 4YY3B 4WXMA 3BIWA 2NWRA 2IBMA 4UBJA 3H1PA 3PEWA 2WJ6A 1TPH1 1Y7IA 3F03K 2E4ZA 5C7OO 1Y1KE 2QSYA 4HXGA 2OT0A 4TIMA 3E3LA 3U7QA 4AX6A 2BJHA 2Q21A 4GGBA 1FYVA 1MFUA 5HGJA 2D4AA 3PPYA 2QF7A 3RFCA 2UUAB 4JYBA 1Y3AA 4WXPA 4LSMA 2YIMA 3H2KA 3WBWA 3V7WA 3OPVA 2IYYA 2Z3WA 5K3FA 3WDRA 1RI3A 2YNMC 1JUBA 4GUFA 5F4XA 4X1OA 3ZQJA 3KSAC 1L1RA 1Z0SA 1G3IA 3FPGA 2G3JA 5H16A 1VLZA 2BMFA 3BFVA 4BA0A 3GDWA 2JI8A 2I3ZA 4B3CA 5D8DA 4GMXA 1IL0A 4AI6A 1PEZA 4DBUA 3EH1A 4DWWA 1U6JA 1C3LA 2PLRA 2PFHA 2X0EA 1RQLA 2C5EA 2ZS9A 5FPPA 4F46A 4JXJA 3GJ7A 3PJDA 5U9CA 1LWJA 3MMXA 3UHOA 3DS8A 1OBHA 5SZHB 3QYAA 1Y48E 4W84A 5H5JA 3PN8A 1QH1B 1WD5A 4P4SB 5AOUA 1KFKB 3WR5A 2V3FA 1WTAA 3AKEA 3OIYA 1NF9A 3EMDA 1UKEA 3LNTA 4MP6A 5G4WA 4D9FA 3U4GA 4F2WA 3P97A 2BJVA 1WUIS 4ABTA 3MWJA 4COKA 3L46A 3EWXA 4KN5A 3W2KA 2YCIX 3ZD6A 2PKRA 1KFEA 4Z8XA 2QLYA 4G7FA 4A05A 2VX5A 3W7DA 3AICA 4KO8A 3ZDZB 2AI1A 2BMVA 5EBAA 1E98A 3H3FA 3UMMA 3K71B 2L17A 1RADA 4WASA 3IGUA 2NYAA 3YPIA 3MRSA 4AZSA 2CMDA 1QWSA 3DL0A 4Q03A 3E9AA 4UNIA 4L0DA 1SZCA 1J5TA 4YUXA 2CXPA 4U7PB 4HB0A 1FUUA 3KEGA 3AONB 3B7WA 5DTMA 1BF2A 3GIPA 3T54A 4UTTC 3E8SA 2IXFA 1RCQA 2JAQA 2OPBA 4UOJA 1Y37A 3UFBA 3ZWSA 3S1WA 4OUEA 1Q7GA 3IP9A 4RY2A 1E6RA 4CKBA 1U5JA 1I5RA 2VVSA 2LRHA 3WWDA 3HU2A 4U28A 1L4NA 3I1IA 3UU0A 5G1NA 2OKOA 1CYGA 4GNKA 4H6WA 3NH9A 1YTDA 4FU0A 1HDGO 2ET6A 4QJ3A 2I17A 2VT3A 5LKAA 2VHYA 1RRVA 3TJZA 1QGOA 2IOYA 1L7AA 2APJA 2A5DA 5JRDS 3DXIA 3RIHA 2XAUA 2BM1A 1AJZA 1JF8A 4XB1A 4I66A 1UJNA 2PDJA 3NM6B 1ICPA 4BAGA 1W1IE 2QVHA 2VEKA 3EBLA 1GIAA 1KO8A 3VPAA 4PMYA 1KJZA 4GSLA 4UE6A 3GHUA 3I9LA 5LUBA 2VVTA 4JFSA 3QZAA 3AVPA 1ZJBA 5T6MA 2Q5IA 1XZMA 1FLNA 2IF0A 4JY8A 3PIDA 5F4BA 3ZLFA 3K72B 3SP1A 3EDRA 4D3FA 4S3EA 2J9GA 4GMGA 1YS6A 1OHHA 1K0FA 5T8KA 5G2OA 4L0CA 5BWOA 2H2FA 1ECQA 5FNVF 3KS6A 5A3QA 3RHGA 3ONDA 3C86A 3MUCA 1Z3IX 4TS1A 3IP8A 1MZVA 4I9NA 2CWWA 2J85A 2VFHA 2FJUB 2VDNB 1BFUA 2BHYA 4A3QA 3UGKA 3LSCA 3RWBA 3DKRA 1XUZA 4DY4A 4DLZA 4B48A 1NDZA 2ENWA 2H2AA 3L7AA 4CQLB 1Q3NA 1K8RA 3O2LA 3LHFA 3OZWA 5JANA 1XRTA 5CPOA 3HOJA 4QUDA 4LDJA 2WYWA 4DJDA 4WZBE 4ZDJA 4RNHA 1ACMA 1NWRA 2I4RA 1VR6A 4UPDA 4Y6GA 2O8EA 3NNDA 4R9UC 5KTTA 1TPWA 1WR8A 3FFXA 3UKOA 3W9UA 5JRJA 2DFDA 5E4TA 3WFLA 3W7IA 3U7IA 1PFYA 5GJVC 4XK2A 1B31A 1QIHA 1ZP6A 2NT4A 1N2CA 1RP1A 1H1NA 3HWRA 5AFSA 4O2AA 1P62B 1N2VA 4DDUA 4P84A 2QW5A 1XV5A 5EVJA 5AW4A 2RJ3A 1IUNA 3WUEA 5GM1A 2PKWA 3P80A 1SHZA 3WK0A 2XXJA 2RI0A 5ICSA 4M37A 2JH9A 5BV7A 2ID7A 3EG9A 1VE3A 3LDFA 1RVKA 2LLEA 1RCUA 5LNVA 5KITA 3L7DA 4OQLA 4KGLA 1XLLA 4QG6A 2HNAA 2Q2NA 1JQVA 3HJHA 4H3HB 1G59A 1A0EA 4RY8A 3T1TA 4CIVA 4IQGA 3NHWA 1CQJB 3BBPA 4FN5A 3BLLA 4Y6LA 5H7XA 5EIWA 5EINA 2R1MA 1PKYA 1D2MA 3UG7A 1GA4A 2AFHB 1MO0A 3VTAA 3EZ6A 2P7HA 3K70C 1KAOA 1LQ2A 4AWEA 4R9RA 3UMBA 1YASA 2IK8A 1VC4A 4AC9A 3A47A 1YXYA 1OA0A 1O9GA 4ATNA 5A1TA 4KGZA 1LDGA 2IYLD 4RWZA 5ISMA 1EEXB 3K8KA 3RARA 3H75A 5JBQA 2IMRA 4RANA 2PU1A 5IVPA 1N2SA 4ZK2A 1UR8A 3JVAA 3H9CA 4EMSA 3OTQA 4G5SA 3UC9A 5KYVA 4TX1A 1E43A 1ZOOA 1B54A 4X62B 1E4MM 3E05A 4EYSA 3FPSA 1QPBA 1HTIA 3ZWPA 3C1OA 1QOPA 4YP7A 1JPUA 3EQ2A 2O55A 4CQMB 1OXUA 3FPJA 1SEPA 3WX0A 4CM4B 3LA4A 1JGMA 8RUCA 1ADJA 2H51A 1R9ZA 1V26A 3HKCB 3BQ5A 1DV7A 2BC9A 4NCXA 2PZEA 2G63A 5CYOA 1V95A 4CN8A 1EJ2A 4FHDA 4V15A 5FWYA 3R4IA 1R37A 5SYNA 1P29A 4O4IF 3V0SA 1QHHB 1C1DA 3AM4A 4J1OA 4FGKA 1KXQA 3DEYX 5EIOA 3PB2A 4WMLA 3HURA 2Z27A 3O7MA 1GEEA 1E9SA 1YVUA 4PLGA 3ZI0A 1PK7A 4Z0TA 3ME5A 4HA1A 1XGKA 2YMLA 4BFCA 4EB3A 1KSGA 2CESA 5L3RA 3A9IA 4I6EA 1Z0FA 3VKHA 4AUBA 4UNPA 1JZSA 2PWPA 4B3XA 4MEJA 4TRJA 4BO7A 1Y0EA 3P0IA 1Y4AE 3TTWA 4CEIB 1IN5A 2I67A 4GI1A 3WMCA 1XP5A 3RSLA 3MUY1 1C7IA 1CT9A 3GK3A 3P2YA 1U83A 4K8GA 2OK8A 2DZVA 4J3JA 1R5BA 2Y71A 4OAPA 3LBFA 1TYAE 1O96A 2EPOA 1I2AA 1MGPA 1DPMA 3TK7A 4WPGA 4OECA 3ADCA 4UNLA 3THAA 3BDIA 3ISTA 4I1VA 3G1UA 5FUQA 3GMIA 1A69A 2XE4A 3L0PA 4WN9A 1YYAA 4BYGA 2XI4A 1E6ZA 5C4GB 2VYVD 4L9WA 1AX9A 1L3CA 2ZX6A 3BFJA 1Q0HA 4JIMA 1CQIA 4BZXA 4K7JA 4LZZA 4GHRA 4QG8A 4XIAA 2CWXA 2YTZA 4TLEA 3ACCA 1WHTA 4ZANA 1UMCB 3EEFA 3CMJA 2ENUA 4BX3A 4BI6A 2QCDB 4UTRA 1SB8A 3G0OA 3SJ3A 3ASZA 2JGDA 3CRMA 3PIIA 4AMVA 1Q50A 4JDYA 2ZI9A 1OX6A 2A5FA 4ANFA 5H4HA 1MHPA 3VPDA 4F6LA 2VR5A 3RRMA 3LHYA 4Y7EA 3TFCA 5AI5A 5TARA 2VOMA 2PT9A 1D2RA 1DFGA 4CU8A 3TQRA 2AFHA 2QG6A 3WP1B 1QHSA 3DPUA 4ONEA 3A58B 4R2JA 3COJA 3VD9A 1I4NA 4ZI3A 3BRWA 4L80A 1LI5A 2QZSA 4W8LA 3L9CA 2JJ8A 5DMMA 4E2DA 2A9FA 4Z7NB 2V0NA 2QTMA 2YXDA 4D6XA 3OQHA 3BIXA 4NNOA 1L5HA 4GVFA 1NAL1 2VCHA 1VXRA 1RPAA 3GDBA 4GKVA 3DT6A 3AIUA 4EOGA 3RYHA 2YV1A 4JKYA 2GBIA 1GJWA 3GEPA 2AT1A 3VR6A 1ETHA 4WDUA 4G85A 1Z4NA 1Q7CA 4NV0A 2Y1LA 3OQ8A 3MJFA 4LMAA 3X1KA 3PFCA 3OOHA 1YXDA 2E4YA 2RSLA 3IKVA 1G8FA 2QVCA 4FYWA 2GSWA 1QR2A 3FPBA 3TZNA 3MMZA 2NXWA 1AKQA 2YLAA 4PSKA 3CE6A 4N8SA 1XW8A 1JA0A 3MYOA 2HBZA 2PU5A 2AEEA 3OVRA 1O58A 4KE9A 4FWIB 4AKEA 2HV9A 1DZIA 4S3GA 2WNIA 1YQUA 4FFBB 2W8BB 5FBLB 4POAA 4EPYA 3TJRA 2FZEA 4Y8EA 3IVSA 1UAYA 2E85A 2VCEA 4O53A 3UXLA 1JNYA 2X86A 1C8QA 5LL6P 1SC6A 4X93A 2ZYDA 3GWQA 4QYWA 5L51A 4JASB 1Q74A 3P9QA 3H87A 2J6HA 3PFNA 3EWDA 4HFJA 1DLJA 3LQQA 3KQKA 4MIMA 3IQZA 4O1AA 4AZCB 3HR8A 1AQYA 1SJAA 4OB8A 4GIAA 2ZE7A 2WHKA 1IGWA 4JV5B 1Z9AA 2ZOXA 3N6JA 4OGKA 3J7HA 2H2WA 1S2IA 3UXKA 3NYWA 4B92A 2VZUA 1IOWA 2E3ZA 2HVOA 1VPEA 1I3OA 1GFSA 3ZQ4A 1REQA 1JDJA 4AS3A 1JUEA 1X7WA 4ZCIA 4H0CA 1RBQA 3VA8A 1QASA 1UANA 5CLHA 1VLQA 1CF2O 2CUTA 1A98A 1K5PA 3Q8LA 1WDKA 1QFJA 5TV2A 1QMLA 3W7OA 1KXZA 3ZUPA 4X3ZA 5AWFC 5KAPA 1EBGA 1EWEA 3G1HA 1D1SA 5IU6A 3LUPA 2G17A 2QR5A 4JLKA 2WMHA 5C9RA 3V2GA 1E15A 4YAIA 1WHTB 1LF5A 2GILA 2QTLA 4PHCA 4Q3LA 3BE6A 3VNYA 1UJCA 3VDNB 3MW8A 2C88A 4NFLA 4AL4A 4P86A 1T6XA 1FSZA 3GC2A 3ARYA 3W76A 3VOIA 2XUKA 3VZYA 4A21A 5BRAA 4JT8A 1QRSA 1FFBA 3KNZA 3ZM8A 5TX7A 1XQYA 1P6WA 2LDXA 4M24A 3JV7A 1K4GA 4DYDA 1S8NA 1CGTA 1P5HA 4XQ0A 1JJ7A 1UQUA 4XYGA 1QS0A 1K6MA 3S9IA 4HNCA 2D1FA 4ARVA 1BSIA 2EJVA 3JVVA 2RHBA 1D04A 3T7DA 5J1TB 3NGMA 4L7QA 5E0FA 3Q6IA 2JIRA 4JTKA 3LYAA 3ZGOA 3H9JA 2W6OA 2IQDA 1K9FA 5BO5A 3KQTA 4MI6A 1YI8A 4G56A 1G291 1J22A 1PZHA 1BE0A 5EKTA 2J07A 2HMUA 4HHPA 1E0TA 5IT4A 3L7OA 2IH4A 3MRVA 1NM9A 2LW7A 4RW3A 4I6KA 5DFAA 2AMGA 3KYBA 1CJCA 2FGKA 4Y18A 3OQVA 4N6OA 2R8EA 2PIDA 3BTOA 2DAPA 4JLNA 2WJ3A 5SYMA 3AY3A 3S40A 3CZ4A 1QF9A 1OVDA 2B5WA 3BCJA 2I33A 1HORA 3UJBA 2QROA 3PQCA 2J67A 4ES4A 2QF8A 3L84A 3FVWA 2WY2D 2JLVA 2WSKA 4CN4A 1NNLA 1F9EA 2EC5A 1FP2A 4FT2A 4PO3X 3RFVA 1YA4A 1DWFM 2VPQA 5F4WA 5FAJA 4BWFB 4INPA 5DJ5A 1OFPA 1H66A 4QAIA 5D30A 2FPVA 1E1EA 4D6CA 2H1IA 3B1JA 3EBVA 3GXMA 2V59A 3YASA 5K05A 4UARA 3W5HA 3PK7A 1Q8AA 3PNQA 4FI3C 2GQ9A 5HOEA 1XZDA 4G8CA 5L7TA 4JI4B 2GDZA 5IUJC 4ESOA 3B3JA 2WFAA 3OPYA 1JR3D 4RF4A 4HYWA 1ATZA 1JHXA 4IFOA 1Y34E 3S6JA 2QNBA 2WUVA 3KQHA 5KVSA 2NQ8A 4U0KA 1XAIA 1K86A 3ZLGA 2OO5A 4G24A 4N3BA 4UKDA 6XIMA 4UM5A 3AI2A 3NYIA 2PLCA 4CKQA 2DE0X 5KZMA 1OFIA 3NXFA 3NHMA 2CCRA 4U4MA 4H3KB 4PRRA 4GR5A 3QJ5A 4MW5A 3DONA 3ZI4A 1KEPA 2FZVA 2P0YA 3VIJA 2CZEA 4EFMA 2XH7A 2PBGA 1FWRA 1QK2A 3AETA 4MWAD 3U4HA 3LLVA 1M2HA 1HNNA 3I6TA 1E0SA 2H54A 3G8RA 1Z0UA 5K4XA 4KQ9A 2IUTA 1WKVA 2Q50A 3WY9A 4RDXA 4GOXA 4IIHA 4WK9A 2NVUB 3WTBA 3LWBA 3V7NA 2X30A 3I05A 3NGXA 3OZSA 1TV2A 4LHSA 3TEMA 2EIHA 3V0TA 4NJGA 3GUHA 3ZY3A 3KAOA 2VUSA 1SBYA 2OC4A 4FJ0A 4QKQA 4PWYA 2GNPA 1WJGA 2CDAA 3B0XA 4GZ6A 3UKJA 1FZQA 4HTYA 2VI5A 2I22A 3LGAA 4NX0A 4JX5A 4DILA 4FDTA 1Z2NX 3ECQA 4EUFA 1DBWA 1G2PA 3K1TA 4PYIA 5I4BA 1ZG3A 2DH5A 2ATCA 3WMRA 4XOIA 1E6XM 1GVNB 1V3LA 2J46A 1XKXA 3D4NA 4MLPA 3LO5A 2G04A 4KESA 2RGBA 5JROA 1IHYA 1QCWA 5LP6B 4O10A 3SADA 3SCQA 1YIXA 4PNPA 5FLKA 3P0HA 4L9SA 3LY0A 2PKCA 5HILA 1BS2A 4RV8A 4M36A 2X2GA 3IUNA 1K1EA 2ACKA 4BQQA 4WJKB 3D31A 4YDSA 3HSSA 1QGYA 1RWPA 4QD3A 4MKHA 1D2KA 3P9CA 3N6XA 5FBVB 4R84A 4A16A 2WR8A 2QP9X 4MRAA 2VWHA 3S42A 1NVDA 2PO7A 2QTVB 4N9WA 5EEGA 3RU8X 5T67A 3JS3A 1BSLA 1BMTA 4ENRA 3V3WA 1XAGA 5G0UA 1H51A 1EZZA 1KO0A 5I02A 2JCVA 5BUSA 4YIWA 2ODQA 2J6IA 2YFQA 1MUMA 5TC4A 1PZ2A 1DS6A 4CF5A 4X65B 1O9HA 1SGWA 1NKVA 5HNUA 4ZTXA 5I9MA 1A5SB 1OXMA 1HG3A 3C8DA 3NYRA 4KEAA 4LZWA 2PD4A 2RC6A 1VCGA 4TVCA 1TUBA 2FH6A 3KVJA 1TYDE 4LVUA 1I3KA 3OJ0A 3OPMA 3E5PA 4N0QA 1FDSA 1KDZA 4BY9E 5ELMA 5DH9A 1TVCA 5ULLA 3LF1A 2PBZA 3R5TA 2FSPA 4K8RB 2QUNA 4LMRA 2RHGB 1NXOA 2JVJA 4U9UA 4JOMA 1DWOA 3E7FA 1JI1A 3IERA 3BS4A 1WXZA 4LZAA 2CXHA 2GRUA 2XNHA 2MSWA 2P3ZA 1N5RA 4YO8A 2GJAA 1U1GA 1GOQA 3CH0A 3IR7A 2Z83A 2C2XA 1Y8QB 2XB9A 4CVWA 2Q7XA 2CDCA 1NJJA 5AVQA 1RBOB 4CD5A 1DQSA 4LC1A 3E4DA 2WHMA 1XLIA 1EZ1A 4ERXA 4IFRA 1AQHA 2RGRA 4J7RA 4JS0A 1MEIA 1WNFA 3MP3A 4KFSA 3DECA 1IT8A 1TLFA 3EAGA 1HURA 1QLHA 5IH7A 3BF8A 2GBCA 2WT9A 5FCZA 1UKPA 1ZUNA 4L9YA 2VDLB 4M21A 1J0KA 1S2AA 4AIBA 1U7HA 2PFSA 3R7MA 1MOSA 3IQFA 1JALA 2C4WA 1NXWA 3N0TA 1F8GA 3MEQA 1OYCA 1KAEA 1XJQA 1XKTA 3IUDA 2DFLA 4V1CB 1PDWA 4FXPA 8A3HA 2PDBA 2WV7A 4F4HA 3W4RA 2EOAA 2IKGA 4X64B 1N33B 2XYQA 4EPKA 3VKGA 1K27A 3MUEA 2O48X 5BNZA 2CBXA 5C8XA 4G1MB 3JZEA 1A5MC 4M6WA 4W5TA 1H23A 4BNLA 1UWTA 3UFXB 5EMYA 1LB1B 3FJ6A 3RITA 2WSSA 4Z86A 1V51A 1QDUA 1GU1A 1C8YA 4BDSA 2GA8A 4N0MA 4B73A 2DGAA 4UM9B 2Z58A 3KWJA 1SIWA 3MV01 4OYLA 2VWPA 2DPGA 3E5MA 1LNQA 2JJ1A 1EFUA 1WE2A 5C2XA 1JDCA 2WWGA 5G02A 1B3WA 3AC0A 1JVBA 3A3OA 2OAGA 1Q8JA 3GG7A 1NAIA 3I45A 3PFGA 5CDHA 4XISA 4GOOD 1E2UA 2PDFA 2OC9A 1OASA 1Z88A 1SBCA 5JPCA 1W9DM 3BQ6A 3W9SA 2QQFA 4MVAA 4AO7A 3ITEA 4GIYA 2BH2A 3AEXA 2PODA 5K03A 4ZFNA 1DE5A 5JH7A 3DMTA 1OYAA 1KFLA 4BLRA 5I07A 1NYLA 3PGJA 1QYRA 1L5WA 1KDPA 1GLVA 3EFOB 4L2IA 4UBPC 3B6JA 3OOWA 4TLAA 5FCDA 4ZO4A 3FR8A 1BEUB 4P54A 4LGXA 3GUUA 5TEWA 4PAQA 5LIPA 3ITCA 3L02A 3TC3A 4QG3A 1VSTA 4MPQA 1ZIDA 2GZXA 1QFXA 4H7KA 3O83A 4YJFA 3OF3A 1OZGA 1NMQA 3TZQA 1IWBA 3DM5A 4PGFA 4E5DA 3OJXA 2W9XA 3ABXA 2C95A 3EA2A 1HT6A 2VEGA 4EUHA 4DA7A 5BW8A 3FWZA 3AQ4A 3HB0A 4ZGGA 4JC4A 1EXPA 3OLZA 2NZWA 4J1SA 4IMRA 4A4AA 3T52A 1XGEA 3WXBA 4MS4A 2RJNA 3IMEA 4UMFA 3NPMA 2DBZA 2O2CA 2W63A 1NTRA 4L72A 3I0NA 2O1XA 1SAYA 1L8LA 4BHTA 1L5LA 3W6PA 4QS6A 2F2TA 3RUBL 1T5LA 3E0VA 1FFAA 5BR1A 1OPXA 3XISA 4FLSA 5H1WA 3DG6A 3UJHA 2PTWA 3WZ2A 3BM5A 4JYMA 1ZCZA 1DKNA 1V6TA 4J1QA 2EPKX 4Y1EA 4WVXA 3D54D 2F9LA 2OR2A 4ZU3A 2OELA 3Q2KA 1EH5A 1CDEA 2ZG6A 1JG4A 1EYZA 3C6QA 5KYKA 2XOKA 4O3MA 3R0DA 1PTAA 5BOEA 5J58A 2EO7A 4LYQA 2SKDA 3RC3A 1OH7A 4LEFA 3M0XA 1VHWA 3RPMA 3MB8A 2QXUA 3PQ8A 4DKJA 4U8GA 4FW8A 4RDIA 3AHYA 5T9BG 2HN9A 4C43A 3G02A 3O6VA 3FR7A 3VX3A 3C0LA 1TUGA 4FM9A 3M0IA 3VOHA 3RANA 4LHXA 2X1IA 4W4TA 4BV8A 3K1DA 3OHSX 3WSVA 2XUDA 1MEJA 3H2JA 1A53A 4LS3A 3PNOA 1E0VA 3N9IA 1KS9A 3CRQA 2QYTA 1T3ZA 3CPEA 2QK4A 1GY8A 4YH1A 5D9PA 3P8ZA 1CUCA 1Q2XA 3LH5A 3CZPA 4XLLA 1KZ4A 4Q6WA 1YZYA 1LOQA 4B4VA 3FJYA 4GEKA 4OHQA 4AQYB 4JNKA 2V6GA 2P90A 4WLVA 3OBIA 1HBJA 1OBCA 521PA 3ZV5A 3NTQA 5K0JA 4HWGA 3AROA 2II6A 2WSYA 4R4JA 1R5JA 1AL8A 3U3ZA 4BZYA 3K15A 1KIFA 4U2KA 1J4AA 2VEMA 4LDQA 4JJ4A 3O91A 3UGRA 2HRWA 1I30A 3IJ7A 3V35A 1ORDA 1COZA 1ZD5A 3COSA 2A78A 2DT1A 4NDAA 3IUYA 1PIWA 2YJ4A 2FJ0A 1RA0A 4EHDA 1FXWA 4MVXA 3F5MA 2VWTA 2CD9A 3FUWA 1ZK1A 1WF6A 1P0QA 3SVZA 1MV8A 3MJRA 3GAKA 3BGOS 5KOYA 4RD1A 3VSCA 3BWDD 3FF1A 1CRWG 1DC3A 1TB3A 1WV2A 5MGBA 2GF2A 4JJ6A 4CD6A 3MJEA 3BDKA 1XRPA 1J0EA 1CXLA 2YW3A 1ZSXA 1ZEJA 3TD6A 1O87A 3AIKA 4X54A 5CP8A 1OK6A 3AEQB 2AEJA 3SJAA 2PMWB 5J2TF 3KCQA 4C0HA 1BWQA 5HJLA 3MINA 3VNDA 3PU6A 3AU9A 3T4WA 5A2CA 1CNVA 4PEEA 1JDZA 3OE5A 4C6BA 4LB4A 1P9WA 4P4LA 2V03A 4L6DA 1UBRS 4BB5A 1OYVA 3AV0B 2WNHA 3ALGA 2QCMA 1PLLA 1IR2A 2PEZA 1EDOA 4LXUA 2XGBA 3WH9A 2BGUA 1L5QA 4I5EA 2B78A 3GFGA 2D4HA 2O4UX 5AKXA 3WLPA 4EHHA 5HQEA 3MO4A 4YP9A 4MVJM 4QSHA 1KU6A 3U0BA 1OINA 1PGNA 1ZFJA 1N6KA 1JKMA 4KLZA 4XZIA 4GLJA 3W02A 1BMFD 3L0CA 3FW6A 5E9AA 3LQFA 2O9JA 4AJJA 1UBPC 2FG6C 1NBMA 4I4TA 3B5IA 1NN0A 1D6NA 4M1EA 4WKBA 4M89A 1I9CA 3AR9A 1USIA 4DF1A 1RWWA 3L0YA 3J80A 4XTCS 2XBMA 3PZOA 3ZBQA 4IRUB 3GDGA 2VCYA 4DQXA 2O4QA 3KZCA 1EX5A 1CEEA 3D5HA 4QL3A 3R0XA 1EC7A 3UYIA 1IZKA 2X22A 4RTQA 3OLQA 2BTOA 4RJ2A 5AW6A 1ORIA 1IZCA 1T8QA 4D6EA 1I3NA 3WQGA 3G2IA 3OOEA 3GW0A 4H1TA 4S2EA 1H2HA 4YT4A 3GFRA 2VPXA 4AJOA 3BCHA 2P65A 2EF1A 2BOFX 3HBLA 2HROA 1XC7A 2C5HA 3NDIA 2VNSA 1J2JA 1IE7C 3C7KA 4IKOA 1W3NA 5TVKA 4W5WA 4FLOA 2C3OA 1B3OA 1H7NA 3SMQA 1MJ5A 1CDDA 2WSQA 1ZH8A 5DV9A 4DEXA 4B5KA 3D6NA 4AHQA 3DMHA 3AFGA 4JLAA 3K9BA 1DEHA 1IK4A 2OBFA 2AN3A 3DYIA 1BWPA 4A2QA 1ZGHA 1JJKA 1E8MA 2ZANA 4BFZA 3ZDCA 3ZLTA 4IPLA 3LFUA 3RVRA 3EUEA 1R3DA 2X0SA 2Y2WA 2KZHA 1RIFA 1VFPA 1HDZA 1BRTA 4ZODA 3H2FA 1XIFA 3PNYA 4IKPA 3G1DA 3HR4A 3GRVA 3RWMB 3L12A 3TQCA 3T34A 1TPEA 2GZ3A 4IO1A 4PC3A 2Q8XA 2PLKA 4FYPA 3EZ9A 4D6FA 3ILHA 2X05A 3QE3A 1T29A 4E08A 4DCGA 4ME6A 4GYKA 1Q6OA 4RHUA 2VATA 3LK6A 1PDVA 1J5PA 3HA2A 1BQ3A 2F1JA 2LWIA 3NRBA 2L82A 1S0UA 2EYQA 4KE6A 3W1RA 1N4DA 3E70C 2YBTA 1K7EB 1XYVA 4EGJA 3KTOA 2I7TA 2UUOA 1E1YA 1J25A 2PB1A 2A0WA 2HQ1A 3EDMA 2ZI3A 4IFKB 1MX9A 4FIZA 1WV1A 3OJWA 1WPGA 3TX6A 1YFLA 2GF9A 2Z6AA 4H9TA 2JIQA 4F85A 3ZHCA 4HMCA 4OI4A 4WCFB 2V2CA 5L3SA 1GDHA 2C1XA 4JGGA 3Q85A 3URKA 3BKWA 1MJHA 2NO4A 1GORA 3B1VA 4RZQA 1DAMA 2H5EA 4LJ8A 3COPA 3T1YB 1A5ZA 2HNKA 3CMFA 4ACZA 1MH9A 2ZRLA 3NQCA 1XDZA 1K89A 2VP0A 3ZWDA 1RXUA 2X23A 3DCNA 1KEZA 1KGSA 3SR7A 1SCKA 4IQEA 4BF7A 3EOAI 5GPRA 4DSZA 5FFMA 4OA5A 3OWHA 1IE3A 4QU8A 4GK8A 2I29A 2X3FA 4DUGD 5K8CA 4J3ZA 4Y9DA 4U10A 4G4JA 1O89A 4AUMA 2JZOA 4MM1A 3GX1A 4LGCA 4C21A 3MC5A 1WUHS 4EKDA 3PAOA 3TMLA 2FRDC 3EGVA 3AJ9A 1KLYA 3DOPA 2GXAA 1ISWA 1HFJA 3AF6A 3GBSA 4XVUA 3WMSA 5JQGF 3G2GA 3HDQA 1DIRA 2X7XA 4PULA 1U9IC 4CPDA 1C90A 2SBTA 1VDMA 4AF6A 1GN9A 4B87A 2VUYA 5B4UA 1ZBCA 4L56A 2ZJ5A 2H4WA 3DFUA 3QW3A 5CPQA 4M6PA 1V2GA 5D84A 1LUAA 1M7GA 1DELA 2ZJBA 1THTA 2ZBPA 1CDZA 4ATWA 1DAEA 1JQAA 4TMZA 1PT5A 1QI3A 4S2UA 1W44A 3NPVA 4S3KA 2AMJA 1JAHA 1NMYA 4M87A 1Z06A 5AKGA 3HPZA 4LOHA 5DLEA 1JW9B 3WIJA 2UVPB 4KQXA 2R84A 1M3SA 1X74A 3HJFA 5HNRA 3R3XA 2QJGA 2VUTA 4IXMA 1UXGA 1KMHA 2BH9A 1OWNA 1XZAA 1L7NA 3KK0A 3ATZA 1XTTA 3EOZA 3AP1A 2PXCA 2G9RA 2PSSA 4MRPA 4YWJA 3OU7A 5HJEA 1A0DA 2GJXB 4I7UA 5AVZA 1IVNA 2Y1XA 4H59A 3BMOB 4U2CA 4B6JA 1MRNA 3W7MA 1QLWA 4G3XA 5AVKA 2WF8A 5LVAA 4J35A 2BKAA 2WJEA 1RZUA 2ZM5A 3QVXA 4B76A 1M2KA 4WEVX 3LF2A 1CPYA 4WY0A 1EWKA 1YT5A 4CUZA 3VUPA 4M9ZA 2CZDA 5JXQA 1BXZA 1OY1A 1E4EB 1BCRA 2DVUA 3CBGA 2IW1A 2XCRB 1D09A 3H70A 4QQ3A 2GBFA 4YGXB 2D3WA 3GK0A 2DR3A 2VKQA 1WZIA 2CL5A 2YVKA 2Z57A 4KXYA 2ZVPX 4RTJA 3LX5A 1UODA 2WWDA 4EJ0A 4PANA 2VNCA 2JGMA 3T4EA 4RSMA 1H94A 2PDYA 4LBSA 5L9AA 1ONEA 4IIJA 2WW5A 3SRFA 1HT0A 3DWIA 4DCSA 3LJKA 3UW1A 1PYDA 1OXTA 3BOSA 2UYYA 1M6VA 1Z13A 3N73A 3QJGA 3KHJA 3HCOA 1K8ZB 1TEXA 3KKEA 5I45A 3PP8A 1JV2B 1F3WA 5AVNA 2QVZX 2X8JB 2XGSA 4AXNA 4E3TA 2PS0A 1ISRA 2PMCA 3FKKA 4MTVA 1A5UA 3U6WA 4H15A 1T8XA 4L7ZA 1DQRA 2OGTA 1IHOA 2K87A 5IXEA 2EQAA 1FUEA 2VHCA 2YWDA 1QS0B 4ML4A 5LXXA 1DO0A 5TS2A 1FFHA 5IAAA 5FNVB 1V6CA 2ADMA 1ZOLA 3GXTA 1L8PA 1CPUA 2DFKB 4PW0A 3U4MA 3BWVA 4Z9YA 4OKDA 4AZHA 1G16A 5LZ7A 4QTYA 7ADHA 4PZCA 4JUFA 4TM7A 3CHVA 2PSFA 2YL8A 1TZ7A 1KEVA 2MYNA 2ABBA 1R6VA 4LUYA 5HMEA 4A10A 4YYZA 3WL1A 4M9QA 1U98A 3NTUA 4HGNA 4X9XA 4W9NA 4E1BA 1FRBA 1G8YA 2NV2B 1DB3A 1UH4A 3DWFA 4JBYA 1FTNA 5AXDA 5C5IA 2CVQA 5JECA 3EXHA 4JYZA 1J7KA 1S02A 2JFZA 4Q4HB 3DV0A 2YDSA 3HVIA 4GPNA 1SBQA 4XX0A 4QDJA 3GJRA 1N5DA 2AJLI 2J3QA 2ZAYA 2XINA 2D2VA 1RYEA 3VOFA 2CGEA 1XXHA 4CN9A 1Q91A 2XXAB 1H4VB 4OREX 2ORYA 4RADA 2R60A 2ZSJA 4UR9A 1ZBWA 4LUIA 4JGIA 3BWMA 4C3VA 4ZI7B 2G70A 3L79A 3PENA 4EYGA 3AUUA 3NW9A 1WUEA 3N11A 3N7AA 3LCWA 2FPLA 3L6UA 3RYIA 1M2OB 3Q87B 5FWXB 1P39A 4Z4FA 4UFKA 3W2TA 3MVTA 1N3IA 4RNIA 1BHQ1 4G8JA 3AILA 2F1IA 4RTSA 2JGLA 5ALTA 1V02E 1RKUA 2XADA 1R86A 4JU8A 2CXRA 1C3EA 3BPWA 3DOEA 2UY4A 4X1IA 3RU9A 1MXDA 1KRHA 5AM3A 3Q3IA 3OIHA 4WUTA 2HRZA 2PDKA 1MOQA 3DDCA 3AZQA 3D7LA 2V9CA 4G0NA 1K7FB 1VBMA 2C8LA 2R4QA 1W1TA 3GH7A 3KQUA 3IUIA 2OE2A 4OL0A 1IQ0A 3KQSA 4D0LB 2O2SA 2HLNA 2W8ZA 1Y5XA 3HFJA 4DJED 1RYNA 1TIMA 4Q00A 2TSYA 2CNBA 4JTRA 2FVLA 2WP0A 1U0TA 2J79A 1NBMD 3MA0A 1DBRA 3BV7A 4MB1A 3ZJVA 2Q8PA 2J9YA 4YIKA 1E2GA 1EJ7L 2RKOA 1SXJB 3BL6A 4Q3DA 2NN3C 1E92A 1XZKA 2QMEA 4PLVA 2TPSA 1M6HA 1WUTA 5DASA 3TGLA 3OQMA 4EAYA 3UMCA 1U5BB 2BKVA 4RKRA 1ZRSA 1L1QA 3LK7A 2H63A 1DG9A 1C29B 2JGJA 4B6PA 3S2IA 1FP8A 3ZY5A 2B6NA 2E18A 4JI2B 2PC4A 3P45A 1EJBA 3LZDA 1OT3A 2C5LA 4INZA 2Z4TA 4BQEA 4PTLA 1UZ1A 1E1LA 4JYAB 4L4XA 3ZDDA 4UR8A 1DBPA 2NUPA 3CINA 4RVSA 1KDOA 4RZ6A 4GKTA 5AIBA 2B69A 4H7VA 5A5VA 2W2QA 3O07A 4AJIA 4ZCSA 3ZGLA 4PG6A 1T2DA 3E2MA 2QBYB 2QTAA 2QMKA 3ROMA 3B1XA 1I2NA 5AYIA 3CXOA 4FALA 3FCOA 1OGJA 3KJGA 3HDTA 3NZRA 5A7HA 4I9GA 1UWUA 2RH8A 1S2OA 3C4VA 4S05A 3M82A 1H2EA 2FZGA 1MJFA 2WT4A 2BBWA 4I36A 2CZFA 3LHIA 1NN1A 2Q3DA 3I2KA 3DOIA 1GPNA 4W5UA 4U5IA 4XB2A 1YONA 4L1WA 1F0YA 2P9CA 4R69A 1EHAA 1UWIA 3GAYA 4Y98A 3N1AA 2EDAA 1NF0A 2Y4SA 1TWSA 4L5IA 3QF7A 4JN8A 3EGWA 1WXEA 2IEGA 1KOGA 4W5NA 2AK3A 3KLMX 5LP6F 1XD8A 3SYNA 3NEJA 1UJMA 2PTHA 2JHAA 3UVAA 2BFCA 4KBYA 3A1VA 1JIXA 4ER6A 2RDWA 1FA9A 2AOTA 1FWSA 4J0DA 5MHTA 5B7GA 2ZIWB 2YL2A 5HJXA 1W4CA 5DW3A 3MYYA 1U0GA 5IM4A 1VECA 3D4PA 3WLKX 4TTUA 4JA2A 2NV0A 3L93A 3UK7A 3OLYA 4Q8OA 3TCXB 2ZX5A 4F96A 4LJ9A 3OCUA 1KM2A 3C3NA 3OZCA 2DSTA 4PBGA 2PU7A 2EW1A 4DV1B 5A6SB 4OFXA 4JQCA 2XOEA 4P08A 4DAEA 3KBMA 1H41A 1AUXA 3MMSA 3WUFA 3WGGA 1E2LA 1XDSA 2FZNA 1EA9C 1LFDB 1QK5A 3GLKA 2I3DA 2O52A 3TQVA 1C7JA 3MANA 3EIHA 5KQMA 3GTNA 3W7CA 4GX8A 2PK3A 4G0QA 2C7OA 2Q62A 3FSUA 4ZVJA 4P7FA 4B3BA 4KAJA 1TMGE 4JTDA 2DY0A 3VE7A 4I1PA 1WDPA 1JSRA 3UT5A 2CKSA 4LGVA 3STXA 4U31A 3QA9A 5K99A 2C59A 4TN1A 1BX1A 1YHZA 3M0VA 4Q0MA 3GPIA 2IHUA 1CIUA 3LBIA 4QUAA 4GVLA 2UYQA 3LPMA 1WCGA 3O84A 4JQ3A 2V5BA 4CGZA 2QDXA 1DGQA 3TQ0A 1JTVA 2IS1A 2FZDA 2HVNA 3DR5A 2NSOA 4BGEA 1DDGA 3C4JA 4LYHA 1AJEA 2Z7KA 3KQOA 2IUUA 2CB9A 4UTKA 2BV3A 4BECA 2WVTA 4X91A 2V8ZA 3E0FA 4E7OA 2NU6B 1WKFA 3WQDA 4OK5A 4BO9A 2BMAA 3HACA 5GWXA 3KFVA 4H4DA 2GXQA 3TUIC 4DG5A 3K0AA 1TI7A 1R87A 1ECJA 4X84A 1HQDA 3W2HA 5FPTA 1TJ2A 5CLTA 4MV4A 4PRWA 3DOCA 5C6MA 5GJCA 5KQPA 2BEWB 1XLUA 4GX1A 2A3RA 3RC2A 3WYFA 2WYOA 3GYGA 1UF9A 2PGOA 3V9PA 3IJ8A 1LNSA 4BMNA 1OT1A 1EX6A 3ZWWA 1OZMA 3KBNA 3PHAA 2C84A 4FINA 3ICVA 2G4CA 1A9PA 1JZTA 3C3YA 1ZM4A 4ARCA 1W9UA 3PGKA 2WFZA 1L5YA 1TTPA 2PSEA 4BEBA 4MWOA 1N6LA 4GBDA 4YUAA 2YHIA 4DSNA 3ZW9A 3GVQA 1XHLA 2INFA 2AQ8A 4DQUA 3P67A 2OQYA 3RBAA 1VYRA 4TMTA 1PX0A 1UXJA 1FDJA 2I7GA 5JAZA 3ABZA 4XZ3A 2WTUA 4O16A 1Y6GA 3I39X 1KM0A 5EWJA 3ONWA 1IBRA 1YL6A 3HWSA 3HTWA 3C3EA 2I56A 3KO8A 3RFAA 3JQGA 2ZC1A 3RREA 4KWTA 4J27A 5BURA 4ZVLA 3ZH2A 1EBFA 3AGPA 4W8HA 2CZVA 2JJMA 1LL6A 4M9RA 3O7WA 4P81A 4BI5A 4CT4B 3SHVA 3H65A 3KZXA 1TKRA 3DR3A 3WV4A 3SU8A 3UT6A 2XQKA 3DMDA 1UPMB 3CZEA 4JVMA 1XF0A 4GXNA 5LIWX 1VPTA 2HJSA 1Q0LA 4MQLA 4LNHA 3LQYA 3EXIA 2GDQA 4DXDA 1WXYA 1YI0A 1QNQA 4FJ2A 4P5EA 1NLMA 3G59A 2IPXA 2IHBA 4M1BA 3WFIA 1IJFA 3GGOA 4IUCS 2YCJA 2ZBTA 1NIJA 4UQEA 1XPUA 4RV4A 1KTIA 1A27A 2FG7C 3EMQA 1JFFB 3QY9A 5BY2A 2DECA 4Z9BA 2ARKA 4HO1X 5TPWB 4DOMA 4FXFA 4HR7A 3IB3A 3D2LA 3FKRA 6ENLA 1RRFA 3U5TA 2B8NA 2OX1A 3WKZA 3NQEA 5D2VA 4JN6B 4NU7A 1VZ3A 4H1UA 2C2YA 1Q1EA 2IODA 1F6PA 5CLJA 5PGMA 2D23A 4QDPA 4PXYA 1A9YA 3EZXA 2B2XA 2EBWA 3WMWA 3I83A 2QRZA 2QSUA 2PFGA 1PUJA 3WMLA 2V3CC 2R82A 1HDXA 3ZYZA 1GCAA 1W8DA 2XQJA 3RE1A 3KFLA 3KUXA 3GZJA 3NONA 4G2TA 2WE8A 3SEZA 1E3XA 2P0OA 5KYTA 4WY2A 4KFUA 5JWHA 4YX9A 5KINA 3LU2A 2H1VA 5D4YA 1PZ1A 3R8XA 4II2A 4QWMA 4WKGA 5F2NA 4MUPA 4L07A 4FNSA 1ESEA 3TVAA 2E09A 3P9XA 3QWBA 5JATA 3BUSA 5EHQA 3R9WA 2BZSA 4RZ2A 5IRCD 3ZKAA 1NSJA 2C57A 2CNLA 1NV9A 1AG9A 4FYIA 3KQNA 2Z2KA 4IX0A 1MXGA 3E22A 2GD6A 5AM2A 2IH5A 1U6KA 3MSGA 5FYQA 1WQ1R 1ACLA 3NV7A 2ZQ0A 1BYDA 4FCCA 3M0LA 1MMFB 1JEOA 5FL3A 2OM2A 1G38A 1M68A 4UZFA 4HIBA 1SGJA 1G8KA 5AECA 1U11A 4FFDA 1XT6A 1JEEA 3CRNA 4HC4A 1KQZA 1NWTA 2VDIA 1LEHA 1Z17A 4DG9A 1BG6A 4X1YA 1W5NA 1BPLB 3IIZA 3M3DA 4HOXA 2NYVA 3PI6A 4O1HA 2VJLA 5LJLA 3V3KA 2WKGA 3SKXA 4ZQEA 4DNQA 1JI2A 2XBLA 3BANA 1W1VA 1P7WA 3SC3A 2E40A 4NS1A 2IGBA 1I1HA 1JLMA 3KUCA 5TPZA 3FX4A 4B3HA 1ZN8A 4WEOA 2HF8A 3OTGA 2XT9A 4UDYX 4IZOA 1YHNA 4I4TF 1NBHA 3NBUA 5IC6A 2XDAA 2X2OA 3NCHA 3QKUA 1ABFA 1IHDA 1TX2A 4GI2A 4BKRA 4RA9B 3RC8A 5B1YA 4MKVA 1KW1A 1EDBA 1H1ZA 3W77A 2X5OA 1YZVA 1SKAA 4XTDA 1KAQA 2NPIA 2ZP1A 5GIOE 3U7QB 1GTHA 2EFDB 2PGAA 3FJLA 2FXVA 3KFTA 4GI7A 5DSTA 1GXSA 3GFVA 3VO2A 8MHTA 5C55A 4N82A 5K3BA 3UAGA 5FYDA 4EGSA 2ZIDA 3RO8A 1B23P 1SU8A 2ACRA 4D4IA 4AC1X 5FA5A 3OY2A 4FJ1A 1OTXA 4F71A 2EPNA 4ZVUA 4QYTA 2J7BA 3J81k 4F0LA 1KL7A 1LBMA 2VJYA 2IA5A 4A27A 1RWVA 5LBIA 4I5DA 1VBKA 1V3KA 2YN0A 2HRBA 5DVZA 4JLMA 2HA3A 5KYYA 3NZGA 1CGUA 2FIQA 4EWJA 4OHKA 2WM8A 4RLQA 2E4AA 1BVNP 5JVDB 1R0WA 4XD3A 2ONJA 3PAJA 3QF4B 3GXPA 4H6RA 2WSBA 4KLCA 1AMOA 2IPMA 1SIUA 3DFQA 4Q1CA 2QL5A 2HJGA 4BP9A 2H17A 4RGBA 1CWUA 4LZLA 1OYBA 4Y2WA 1IPHA 3E6AA 2D2IA 1NGSA 3MLBA 3OFKA 1S1PA 1OF1A 1LF1A 1YHTA 2OXRA 4RIFA 3MNFA 4UTPA 4XVDA 1Z47A 4KN8A 4W7SA 5KINB 1U31A 4OCZA 4DUWA 1TO2E 2X77A 1Y1PA 4J2OA 1QPRA 3LQ4A 1SMAA 1H3GA 2OYMA 3IJ6A 1R74A 5J63A 1TO3A 4Z4QA 3AO0B 3FD8A 1E62A 3V8QA 3VAVA 2CYAA 4D79A 2QUTA 1WEHA 4Z2GA 3AM5A 3L4SO 3M4JA 2QEQA 1P9NA 2I1LA 4KH2A 1T1EA 4DM3A 4B79A 2HIAA 2IS4A 3I4EA 5JAPA 4JZYA 1K7SN 5AXCA 5JNTA 1KQPA 3MTEA 5JQGB 5T9CE 2NV1A 1R0MA 3VGFA 1U2GC 4M7RA 1TX4B 2XR1A 1S3GA 1DAKA 2WJJA 5FDFA 4LDZA 5JFGA 4QS5A 4ID9A 1NP2A 2F3UA 3L04A 2C15A 1KA9H 1V9SA 3EHDA 1DKRA 1KVQA 2ZRIA 4V1YA 5I7AA 1WZAA 1ZSVA 2PUGA 1XHGA 4H8VA 1IRXA 1SURA 3FPKA 2O2HA 3SX4A 3C41J 1P2BA 5A62A 3J7TA 2O3UA 2B34A 2ZTKA 4J2MA 2LV8A 3MT1A 4BO0A 4G0UA 3H16A 4HJFA 3A4LA 1F9AA 2JEOA 1JQBA 2GXSA 3EWWA 2I6FA 2Z9DA 3C6BA 4FYJA 3WK6A 2NP7A 1TCDA 1YMYA 5IHXA 3I9NA 2GARA 3OF5A 4C6JA 4FSXA 4GKJB 3KT8A 3GP5A 3WJAA 1XICA 4EEKA 3ZZTA 1VFNA 1WBHA 4MA5A 4B7ZA 2OCIA 3AIVA 2LD4A 1NPDA 1AGNA 5AHMA 3BIJA 1XMSA 4I8DA 4G5YA 3GDRA 2YOGA 2A5GA 4IGSA 4CL3A 3QFFA 4PONA 1JIIA 3B8VA 1C9KA 2OFOA 3CUIA 1QOQA 2X42A 3S2YA 2I6GA 3AL3A 1A4LA 2HO4A 1VLJA 3RYTC 4YUYA 1VZWA 2MMCA 2YASA 3RLVA 2ZB2A 3VIKA 4HEA6 1V6UA 1K2VN 2C2OA 4N3GA 2PNJA 1KO7A 2BBFA 2DSVA 3BD7A 3JWEA 1WP4A 1WOBA 3NHAA 3M4NA 1GPFA 3UHFA 2QTNA 1GL9B 1LX6A 1NBME 4IJKA 3ZBUA 1LUCA 3T9AA 1VHJA 4Q3MA 3DKLA 4RZXA 1V6YA 4HMQA 1NI3A 4DLFA 2H65A 4PIMA 3GFQA 1VRDA 1ZH4A 3HMKA 2WJZA 2DQKA 1HYEA 1OFVA 1GILA 4AZ0B 4ZYLA 3FMFA 4OLHA 3S2FA 1SNYA 2B7QA 3T2OA 1Y7HA 3MBKA 1RK5A 1Z4LA 1EWVA 3HGTA 4ATDA 1FNMA 1PL6A 2P41A 3LS9A 4IH3A 3N6RA 4BLUA 4NH0A 3R2GA 3JALB 4L28A 1KDRA 4R9OA 5BW6B 4CM8A 3BGVA 2M98A 4PPFA 4P80A 4LXFA 2BGLA 3VZSA 3TOXA 1ISIA 1UXOA 2EBNA 1E51A 1AQJA 2QGYA 5TNVA 3KAKA 2VYOA 4E5MA 1ONWA 3H1GA 4Q9HA 3BMCB 2GK6A 5FBKA 4RMGA 3ZWBA 5CLWA 1S5MA 3WDPP 3GFYA 3OC0A 3P96A 3AVXA 2R4TA 3UJ2A 5MHBA 2XUQA 1BOOA 5FBQB 2RIPA 2OP1A 3CH9A 3PR2A 5F12A 1FW8A 1RDFA 3EFHA 4QP0A 4IIEA 1W88A 2GQAA 5JE8A 4BJHB 2ZZ3A 1Q7MA 4RX1A 3LIIA 3NT4A 1FDIA 1ZC3A 1QFZA 4EB6B 3FWYA 2TMGA 5LZ8A 3K05A 3IIPA 4BB6A 3CNEA 4PCFA 4EELA 5BU6A 4BMCA 3P0RA 3BG3A 3FCXA 2RHCA 2FRVA 1P73A 3HC7A 4FKZA 2WMFA 1WF3A 4FB7A 3ZWAA 3B3DA 1PX3A 4C87A 4GF5A 2CZCA 2G4LA 1NBIA 1QCDA 4YHGA 1N5MA 1OI2A 1LBFA 4JMPA 1CTQA 1JX6A 1YQGA 2YBEA 1WXIA 3TZBA 1D1QA 5DT5A 4HQVA 3QEJA 3KPYA 2HK6A 3KQLA 1HSOA 4UEJA 4QTTB 3RT1A 3K1YA 4DUGA 3MRXA 4LYAA 4QROA 3SYRA 3OX1A 2CF6A 3W2FA 3DB2A 1IC6A 4LVGA 1ZIPA 1M6NA 1XGZA 3OIFA 3FHOA 4F72A 3ZYCA 1UK6A 4C4ZA 4JWTA 2PE4A 4RTKA 1KO4A 1OV4A 3TC6A 2YHUA 4D8WA 1IEXA 4AS1A 4MICA 2HUNA 4WINA 1I7SB 2F38A 2F7SA 4F4DA 2MINB 2XFYA 1O94A 3I52A 4IQ0A 1SXHA 5IF3A 4ILEA 5BXSA 3GJ5A 3V1TC 3GVXA 3K9NA 5A0VA 2EX1A 1AV7A 3OZVA 2H4HA 5ESXA 3DP7A 1K8XA 3SF8A 1XD9A 4HNAA 3OODA 4EAMA 4BNDA 3KX2A 5T3UA 3IS3A 4JDBA 3W3OA 1PQWA 4PY2A 1QDLB 2WT8A 3DVAB 1VMKA 3IMKA 1WCXA 2CITA 4XD2A 4G1NA 3C8UA 4M55A 1A7UA 2PZ0A 4D8XA 5THQA 4WDTA 3ZWQA 3OFVA 4PYKA 5CCZA 1M0SA 1TF2A 3H12A 5EL0A 4WIWA 3TJLA 2VSQA 3IULA 3GLHA 2FWNA 4HSOA 4G01B 2F48A 3B40A 4DRYA 2CL6X 4P82A 4L16A 3GLFA 3NQAA 3GJZA 1NXSA 1E2PA 2OODA 3HM9A 1TJ5A 3IJLA 4GZ5A 2JAOA 4ZOBA 1F20A 1ZM2A 4FNTA 1TJ0A 3BAWA 4NAEB 1KFWA 4KTVE 3WHPA 2D74A 3TBKA 1ONOA 1A71A 1VIWA 4UD2A 5B2ZA 1KV5A 5F4ZA 2ZEJA 4PBEA 1RTKA 5ALPA 2QRKA 3QGKC 3EZ4A 4J4KA 4U7HA 5CMLA 2V63A 5JPIA 3EEIA 2PX3A 3IXMA 1LBTA 2DT3A 3G0HA 5IBRA 1EP3B 3EDOA 5KO2A 4FD3A 1WXWA 1SUFA 3JRXA 3T5GA 4F93B 3NS7A 2ISCA 1ORWA 1XIJA 4L50A 3WLEA 3S5ZA 3LD5A 1W3KA 1P72A 3HMCA 3X2FA 2OBLA 5EWLA 3JQDA 4DSTA 4INJA 3PNPA 1Z6ZA 1YUBA 1O0BA 5HF9A 4JUDX 3ZZ1A 1XKLA 3A3PA 1OIVA 2Q9BA 2O2GA 1JZ5A 2VRCD 4YNGA 4Q4CA 4RE3A 5C46F 4KXFB 1IBLB 2H7VA 1WU7A 2WXDM 3GYCA 5IJ0B 1BLIA 3COYA 4L78A 3JSXA 2CFRA 3ORWA 5BXTA 3R89A 2RB5A 3GRKA 4UB9A 1DIEA 4AH7A 4FHZA 4V33A 3GG2A 2JRLA 2FP4A 3QM1A 4OQYA 5AMXA 4WK2B 5F3RA 3MLEA 4KNYA 1M7JA 2CL7X 2PI6A 1OD6A 1BYUA 5DK6A 3EWUA 1BKSB 3V0UA 5C8YA 3RSFA 3ANXA 1ADOA 1XNRB 1YDNA 3MI6A 2CU0A 3O2SB 5F33A 1QR7A 3LQGA 3RIGA 3TOZA 1NOJA 2ACEA 3V48A 4K1GA 1Q7RA 1F2TA 3AF1A 1Z83A 2G3IA 4AP5A 1U7DA 4D80A 5HJYA 3ICWA 3N17A 4Z2KA 1YV9A 5DW0A 4ZDKA 3AXXA 1PGQA 1V7ZA 1NN3A 3C3PA 4JKKA 3OVQA 1L7RA 4AB4A 1E96A 4QBHA 3CUZA 1UPBA 2XDYA 3GZNB 5T64A 1BA2A 4DLNA 5HKOA 2ST1A 3GH4A 1J2EA 3MO7A 3ROEA 4MRMB 2WJVA 3OB8A 4MULA 4F84A 3AHJA 4AW7A 4CU2A 1C50A 4FHFA 1DXYA 4UMCA 3HXOA 3VR5A 1R0LA 3L1JA 1KMMA 1KAHA 3MZNA 3T95A 4ZKEA 4YI3A 1IFXA 2DOKA 3N5CA 3B9NA 3TYZA 2C92A 1ZS2A 4DBEA 5AVJA 2IVZA 1OKKA 4K9RA 4MZDA 1DXIA 5AI4A 3WGUA 3CXUA 2PMBA 1Y5RA 4LJ5A 1MQ9A 3H2CA 5KHOC 3R6GA 2CSUA 1FTYA 4YXGA 3M70A 4BGIA 2QSZA 3NTVA 4CM6A 3C1TA 1E0KA 2TECE 2QDHA 1JB9A 1D0IA 3RROA 5IWAB 5FD0A 4QELA 4P7GA 3CAKA 2AJDA 1Z8HA 5EHZA 5TS3A 1H0GA 4TTJA 3TQQA 3C39A 3NIDB 2BCEA 1P80A 2Z2JA 1M75A 2GTPA 2FA9A 4C4TA 4WAUA 4COOA 3L21A 2QIPA 2Y0BA 4BUCA 2PLFA 3DF9A 3T7VA 1YRYE 5DB4A 5E7JA 1ZUHA 2HJRA 1PGJA 1VKNA 4OFBA 2R8XA 3MRTA 5DGXA 2H8XA 4DCTA 4CT0A 4HAYA 4GFDA 3DBLB 3RX2A 1EK6A 4BVHA 3TR9A 3O4GA 4ZVQA 3OQPA 1X38A 4U2GA 5SZIA 3SHOA 3AW9A 2X6RA 2Z8YA 1QTWA 4DF2A 1PDOA 2W5UA 3WO8A 3MYRA 1RKQA 4K26A 4Q7EA 1VBRA 1WO2A 4KX3A 2NTNA 1HE4A 3PFRA 4R7ZA 1G5PA 3TFWA 1P1CA 3OZAA 4FXSA 3TINA 3LA8A 4UQOA 1EOMA 4AKGA 4RDHA 3N2MA 3NHSA 4ER3A 2A4MA 2AI2A 3OAAD 3QIAA 1V6SA 3O8AA 3HCFA 1F5SA 4FLMA 1A9XA 4CTJA 1NQOA 4Z1OA 4M19A 4Y9AA 1D4OA 5CJNA 1V5XA 2CXQA 4F2HA 5ALGA 5ABTA 3ARQA 3S47A 1G9SA 4ITUA 3EB2A 1RPKA 2F61A 1Y3CE 2ZWIA 3NHUA 3D8RA 5AHLA 2YHIB 1DIOA 3UXAA 1UD2A 3M0MA 3PCXA 4P7QA 4H27A 1YEYA 1EFPA 5EPDA 4MVJE 4R1SA 3CAQA 3WIOA 3VSBA 2Z6UA 3K6JA 2BTQA 3GHTA 4IPIA 3TCKA 1F6YA 1R3TA 5C71A 1AXRA 5EP4A 2CV1A 3JAKA 1U2TA 1DJQA 4EFNA 4EKGA 3ESCA 3USCS 1DRJA 3F9RA 2VR1A 4U7JA 2JNWA 3MIZA 1R7OA 3J7AC 3BSHA 3MV11 3CUJA 3UQYS 1WRBA 4DNPA 3KKNA 2ATMA 4GUGA 3ABQA 3H1EA 1UBHS 1XR2A 2VZTA 1XVAA 1L7DA 2W27A 1QIIA 1PG5A 5CX4A 1GUBA 2PDXA 1ZNNA 2HNBA 1FEZA 3COTA 1DE0A 4ZSUA 1TWIA 2QAGB 3CZGA 4QE4A 2YUTA 1ECGA 3BARA 2VTBB 4GQAA 5KKNB 2V7QA 2V0CA 1ZM9A 1L5RA 3B13B 1O5XA 3N2BA 3S5UA 3WADA 3PQ4A 5C80A 3QY8A 3WKEA 4WDXA 2QPUA 3VZRA 3OUZA 1XZPA 2QYHA 4NMHA 4M8UA 3LE8A 3RGGA 1VIZA 4ZAFA 1T1GA 3LRKA 1PJTA 5K3CA 1G3QA 3T5MA 4AJKA 1QCYA 4MRVA 2XIMA 3CGTA 1ULSA 2FVYA 1CRLA 4UNRA 1PQYA 5CAEA 3IIEA 3NYQA 3OFJA 3NOYA 3PHHA 3WJ2A 4XWKA 3OJEA 3RK1A 4RD4A 3MF4A 1N7KA 3NGFA 3C0KA 3A21A 2QIOA 2A9VA 4MUIA 1WCIA 4FLRA 5C8YB 4GW3A 2EW8A 4HXFB 1F4AA 2OHHA 1HFKA 3ESAA 4ALMA 5F7OA 1OTHA 4KITB 4F3HA 1JIVA 4R6WA 1YDGA 7AT1A 1P3Y1 1S1MA 2DT0A 4WJXA 4MPRA 2HMTA 4MIOA 2ZI5A 3GLSA 1W5TA 3QWHA 4URWR 3RG6A 2R6DA 1DJLA 2EP5A 3DZIA 3A9SA 2EWMA 4QARA 1XLTC 1T6ZA 1CUSA 3G2QA 1ISVA 1ZM3A 3SO7A 4P34A 4OQZA 5IW8A 2KX7A 1NVKA 1F73A 3SQMA 3NQ41 4E2VA 1N77A 5IRPA 3Q3HA 2BS9A 1YCDA 2B8TA 3MTQA 3QW2A 4WIAA 1VCOA 3KS9A 4NYJR 5G0VA 1D9ZA 4RK1A 5DNAA 1L7EA 3T3GA 1HX0A 2GFTA 4DUYB 4B15A 2XQFA 3BD6A 5ILOA 5JS2A 2RHWA 4KEVA 1T9ZA 3FNRA 2I4LA 2FEMA 3DD1A 4ENSA 4GZ3A 4RW5A 3A6JA 4AWBA 5GGXA 2FNAA 2FZBA 1ZK0A 1FJ2A 2H1FA 3PYMA 3V00A 3L4JA 4O54A 1XRLA 4IM7A 3E12A 3S2LA 4Z0NA 4WSJA 5KTRA 3DAQA 1EBHA 1ZUD1 2I9EA 3SHTA 2D54A 3G2HA 4ZBCA 3CH6A 1MB2A 1LF0A 1RM5A 3AIMA 4Z7QB 4JR0A 4BC1A 3W6ZA 4WXYB 2JK1A 3S1AA 4NRSA 2I55A 5JXHA 5LNWA 1GNPA 4OV9A 5DCUA 1NVGA 4RE2A 2V58A 1Z6KA 3C3XA 1RLOA 5FFFA 1RY0A 1J00A 4D3XA 1LJ8A 3KRZA 2DDXA 4HK5A 3ORSA 3NEHA 2V6FA 4US5A 1F8XA 2FEXA 3VD7A 3VMOA 3IGXA 3VNVA 3QKSB 5JY6A 1EEPA 3WBJA 1GV1A 2QJNA 4Y2VA 1S8OA 1YS7A 4W99A 3C8ZA 5KVCA 1H85A 1EX1A 3AR3A 4N4PA 2BFFA 1ZGGA 5K0LA 2DFAA 2QY9A 1Y4ZA 5B3AA 1YBHA 2VYCA 3OEWA 2ZKIA 3W3AD 1K4KA 6PTDA 3O1NA 4E14A 2B7CA 1T3LA 2CW5A 5HKLA 1QPNA 4GKAA 3FDKA 5GM2A 2VQ6A 2W6RA 1R4ZA 2GN1A 1JFLA 4MAVA 4P35A 2E6DA 3KZSA 3DZDA 4F0MA 4H16A 4DQ0A 5CNJA 1IBKB 4EA6A 3USZA 4RC9A 4Z4IA 5BROA 2QRNA 4JFUA 2VPTA 1YZLA 4GYPC 2D0HA 5FPYA 3RJ9A 1SKYB 2CXTA 5LMCA 1W9MA 1X96A 3RI3A 2JATA 2ISWA 5KNBH 1UQYA 3PNVA 2NUTB 1YJ8A 5F9MA 4IFIA 2N47A 3OO2A 3WNBA 1V3VA 2JLQA 3ZHVA 3DOOA 1C9DB 5TXGA 4PEKA 3RBVA 4ZZ0A 4B45A 1LBHA 1LP6A 1W8IA 4TLMB 3NL2A 1BJRE 2WKWA 4RK8A 5J2UA 1FWGC 1RSCA 2AGKA 3BE8A 4QUGA 2POZA 1RZVA 2DZTA 3SK0A 3G0BA 2NZ2A 6REQA 4GC9A 1FWBC 1R2TA 1IWOA 1I2DA 5ILQA 1EB3A 2JGKA 3ZDBA 3B3GA 5H3CA 2ATEA 2QGZA 1L5OA 2D59A 1W31A 4R3WA 4U5XA 4LY0A 4GFSA 2H8KA 3SRHA 5I01A 4CQNA 1H65A 3DMGA 4AUNA 1VJ1A 4DBZA 3P8IA 5JG7A 1JG1A 1EUYA 5KSYA 3IH5A 3IAHA 3THCA 5FBZA 4PMNA 4CE6A 3BAJA 3MKCA 4CM7A 1TKBA 3I7RA 2BFEA 3KLLA 3W1XA 2XE7A 1M2EA 2F1KA 3BH4A 1G9HA 5GNZA 2P3EA 4MVJH 1WVIA 4LHVA 1JQEA 1QORA 3PZMA 3S70A 5L40A 3FXYA 4E4FA 3FYUB 2VJMA 3T5CA 4WVFA 1SBTA 4KIGA 3H9GA 1H0KA 2CVHA 1LWNA 1U5VA 1NWUA 1CZRA 3RILA 1NDHA 3RCMA 1UR1A 1DP4A 1CUFA 3WFZA 5CLQA 4K7VA 4AMUA 1OFQA 3O0FA 5FRDA 1TXGA 2QM3A 2IY9A 2WF5A 2HS6A 3OURA 2FPYA 2FOIA 5CBPA 4O0ZA 3WI7A 4DV3B 1PE0A 1XPGA 1NM5A 4K9QA 2AZDA 3TNJA 2CBZA 3UD6A 1EF3A 3G68A 2UZIR 3PRHA 2DZWA 1XSKA 2QL6A 3KTAB 4D8YA 5FEUA 7TIMA 4D0RA 2Z1XA 3ZV3A 1NXTA 3R24A 4TROA 1WEKA 1T2UA 4TR9A 1KJNA 1JDAA 2HRRA 3W25A 2ZIAA 5FB3A 1GR0A 5JIBA 3SS8A 2HPZA 1BG4A 3QF0A 3EWNA 4F9EA 2VFDA 2KS6A 1O7AA 2DB3A 3CLVA 5E0KB 1RZRA 3WNLA 3GBPA 3KW3A 1OBAA 5CT4A 5KWSA 3S2SA 1TT5A 4KMQA 1KKOA 4ER5A 4Q18A 4RNCA 4GUAA 3CM0A 3T08A 1IXRC 1YGPA 2EIXA 3DHEA 3LSBA 2H1CA 3UAOA 3T3OA 3H2EA 4N18A 4GRAA 4P7BA 1FTQA 1RE0A 5EJ9A 2IHTA 1UBEA 1XVIA 2XY4A 1ITXA 2FXIA 3OM8A 1ZESA 4QM7A 2ACSA 4X3CA 4C7VA 4U2BA 1GUZA 2O5CA 4Q19A 2ZGVA 2IPWA 5C8YF 1ZN2A 2CEKA 1HT2E 4DC0A 4CIWA 1RJQA 2AX4A 5D2CA 2GYWA 5C35A 3G9ZA 4OB6A 1W4ZA 3QXBA 3ZJ5A 3L6BA 4F9DA 4QU0A 2VOTA 1P5FA 2VL4A 2ALJA 4PF1A 4G0