3EX2A

Human orotidyl-5'-monophosphate decarboxylase in complex with 6-cyano-ump
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
257
structure length
257
Chain Sequence
MELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Orotidine-5'-phosphate decarboxylase
publication title Lys314 is a nucleophile in non-classical reactions of orotidine-5'-monophosphate decarboxylase
pubmed doi rcsb
source organism Homo sapiens
total genus 98
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.4.2.10: Orotate phosphoribosyltransferase.
pdb deposition date 2008-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ex2A00
1IGSA 3P80A 2Z0IA 3N19B 3TROA 3TX9A 1F73A 4K38A 1JR1A 3SGZA 3W86A 1AK5A 1GPWA 4JN6A 2ZDRA 1JCXA 2OT1A 3W07A 5AHMA 1TPUA 4ZL1A 1W5NA 3FOKA 3PC0A 4AF0B 1SW7A 4O18A 1YLVA 1LYXA 2J9YA 3F03K 1G7VA 4KFPA 2QKFA 1KM4A 4MYXA 4ML9A 2O7QA 5HQEA 2X1RA 4K8EA 4LW7A 4HIBA 1Q6LA 3CTLA 4K36A 4NZFA 1LTDA 1TJRA 1OHLA 1KFKA 4AWUA 3EXSA 3ZWTA 1G7UA 5AHNA 4UTTC 1O94A 3W22A 5MHBA 1W5MA 2XN0A 3BW3A 2HS8A 1H7NA 1G6CA 1O5XA 1G4TA 3GDKA 1VS1A 3P67A 3W2UA 3EX4A 4MPQA 5EMUA 3C2FA 1K02A 3MO7A 4PTNA 3W2JA 3Q2DA 4AAJA 1YDOA 4K7VA 2NXGA 2B7OA 2QUUA 4JDBA 3W9ZA 2ZZ6A 3W1LA 3W7HA 2F84A 5CSSA 1C8VA 1VHCA 3EX2A 3LHZA 3P8IA 2J9XA 1DKWA 1RZMA 2B7QA 3CIXA 2QCCA 3SIZA 4O52A 4DBEA 3GAYA 2C14A 2PCQA 3HG5A 4LS1A 4XQ6A 7TIMA 2WOQA 3GDRA 4EVZA 4IX0A 1DORA 4E0CA 1JUEA 4UFLA 5K3VA 3KFTA 1D9EA 1KA9F 3A5VA 3LHYA 3QC3A 4AMAA 4CQ9A 4TMCA 3I68A 2E1DA 3HOJA 1OFQA 3LX9A 1SZGA 4O12A 3EWYA 4NT0A 1M6JA 1L6SA 4N4PA 5AYYA 2RFGA 1QAPA 1DVJA 2YCEA 5D02A 2TRSA 3DGRA 3M16A 2ZZ3A 5K9CA 1A5AA 3LTSA 1AW1A 3W7RA 4UTTA 3KOFA 1H1YA 2A6LA 1TQXA 3BLEA 5CKSA 3L21A 4MKNA 1ONRA 1W1ZA 3EXTA 4UFHA 2YDAA 3L0KA 1S5TA 1UJPA 3MHUA 4JX5A 2ISWA 4CNNA 4FO4A 3CHVA 2A21A 3PM6A 1FDJA 2RDWA 2R94A 4UFIA 1PL9A 3IIVA 2PRLA 3DENA 2DP3A 3G3DA 5CZSA 1LM1A 4S2BA 3UXDA 3W7OA 1NAL1 4WY0B 3W7NA 3LCHA 4YWIA 2FPTA 3TU9A 1KM2A 4N4QA 1F6KA 3LI0A 3S1UA 1WBHA 3PBYA 1QNVA 3P81A 4TO8A 1ME8A 3HJZA 2QUVA 3O15A 4RV8A 1VLIA 4DEFA 4O1BA 2V30A 3SW6A 3TH6A 5LHEA 1EWEA 1PCWA 4O13A 1XDMA 3VNDA 2E6YA 4DF2A 4CCDA 4O0ZA 5D37A 3O16A 5BMWA 1LBFA 3W70A 4Y8FA 3EX3A 3FLUA 1N55A 1LBLA 2QAPA 3NNTA 5AYZA 5AOUA 2G96A 1GQNA 2VC6A 1OX5A 3W3OA 2AQWA 4AHQA 2YFNA 2V0TA 3GR7A 4EF9A 4UCGA 4IXHA 4RZ5A 3MMTA 4UFKA 3QSRA 3EWUA 1GTHA 3C0JA 2E6AA 3THQA 5D2WA 1OFRA 1ME7A 3T55A 2WV8A 3G0UA 4UNLA 1KFJA 3KVJA 2ZA2A 3FYOA 3DZ1A 1PVNA 4MLJA 3L5AA 1W5QA 5DCBA 2JKEA 3QH2A 4LY8A 1IXOA 1TMHA 4I9AA 2JGQA 3NPXA 1K7FA 4X3ZA 1DBTA 4LC8A 5TQLA 2QCGA 4ZQRA 1H62A 4LWWA 2WSQA 1EUAA 3QSTA 3KX6A 3TQVA 3LHTA 1T8XA 5I3HA 2D73A 1EP2A 1BKSA 3R2GA 4O50A 4JYDA 1W0MA 3M0ZA 2H8ZA 1H60A 1KW1A 2CU0A 1TPC1 2ZA3A 4EWND 3TFCA 2CLFA 5IBXA 3W23A 4YMZA 1JCYA 3MP3A 2R91A 1TPWA 2TMDA 3BW2A 3NPVA 3O07A 1JUKA 4LV9A 5K9DA 1R47A 1EUNA 1H5YA 2OZ0A 3O6DA 2CZDA 3T7VA 1SPQA 2DZPA 3O6YX 5CZTA 1KM3A 3VCRA 1U83A 3IVTA 1B4KA 2VFEA 1OFOA 1SUXA 4DO4A 1DHPA 5A8GA 5D2TA 1I2NA 3NYZA 2QCNA 4PC8A 1AW5A 2ZRZA 4EF8A 1W5PA 3FJ6A 4N6EA 2X1UA 1FWRA 3NXFA 3TQKA 1FDYA 5D2VA 3KAOA 1GVOA 3ZWSA 1Q6QA 5D33A 1ICQA 4JTIA 4M6PA 4MJZA 2GUUA 2E77A 3I65A 3KXQA 4RXGA 5F4SA 1M7PA 1S5VA 3NQGA 1AG1O 4NUWA 4HNTA 1JCMP 4FXRA 1ZNNA 4PH6A 5D38A 3YPIA 1VQTA 5LHFA 2NUYA 4GUHA 5DN1A 4RCXA 5BNKA 1GYNA 3INPA 3P74A 3W73A 4QNWA 1I45A 2VELA 1EIXA 4M19A 5C54A 1I2RA 4OHQA 2OCZA 1WBJA 3M41A 3TUUA 2Y88A 1OF6A 2EGZA 2EKCA 5I3KA 2C15A 1EEPA 4UXDA 3KVLA 5EBUA 5T26A 4LUJA 1PIIA 5I3GA 4DBDA 3UWWA 2FB2A 4S1FA 1LOSA 5DCDA 3ABQA 1FCBA 2C1HA 5AYXA 4FXSA 4A2RA 3IRDA 3IIPA 1WAUA 4AF0A 1GJPA 1ICPA 2FQIA 3GX9A 4IXXA 2QUTA 1ZAIA 2YPIA 3F1QA 1I8JA 2DJXA 5FEZA 3G1AA 2ABBA 2F7FA 3IVSA 4XTDA 4M6QA 4BWLC 1Z42A 3EWXA 3NQCA 3CQ0A 4DO5A 2Y89A 2EHHA 3QJAA 5C2XA 2OT0A 1FX6A 3B05A 2WNNA 1XBVA 1HO4A 4LS2A 1X1OA 1KTBA 1ICSA 1OABA 2A85A 4RZ4A 4EOUA 1JCLA 3FS2A 3MYPA 4GUJA 1XDLA 1KLYA 4FEZA 4NXSA 4IOTA 2CLMA 2VFHA 3A24A 4ZQNA 1W31A 3LRMA 3RLVA 3AJXA 4Q33A 1U5JA 4LV4A 5G1TA 5DLCA 2H6RA 1D3HA 3W7JA 4NQ1A 4JTGA 3SR7A 1A53A 4PEKA 4X2RA 3TR2A 5DY3A 3OA3A 3UWQA 1JQVA 4JS3A 3GXNA 1QR7A 5EKYA 5ABTA 3MI3A 3MJYA 3G24A 5U7SA 3LERA 4YCPA 3LRLA 1B4EA 4LRTA 3F4WA 4TR9A 2PRMA 2YFOA 1IXQA 1SSDA 4QM1A 4O16A 4O17A 4FNRA 4S2CA 1SZEA 1PCKA 4FHAA 1SW0A 4FNPA 3NQDA 3N3MA 1B3OA 1VRDA 4UR7A 2A4AA 2AGKA 3E12A 3PUOA 3B06A 1W5OA 3ANYA 3BPWA 2ALDA 4XKYB 4BI7A 3PBVA 1TRDA 4JGDA 3S5YA 4O11A 2V8ZA 3K30A 1LDCA 3LXCA 3TK7A 3L0GA 1GG1A 5FEXA 1MSSA 1PHQA 1NEYA 1CI1A 4JX4A 1MEWA 4UTUA 1OF8A 2YR1A 3TJLA 3LOTA 1YXDA 2UV8G 1TRIA 5F1VA 5FEWA 1SSGA 1JULA 2DZWA 3T78A 1TTIA 1JRBA 5F2GA 3MBDA 3DHDA 1DJNA 1OX6A 4EIVA 4O4WA 1DL3A 4LVFA 4IGHA 1TSIA 4ZQCA 2WNZA 3H55A 2RH9A 2FPYA 2V9DA 2YYTA 1WOAA 1F6PA 4W9TA 2VOMA 1LCOA 3GKAA 1SQ7A 3CC1A 2ZBTA 4NJKA 4IX2A 5HR7A 3Q58A 4BF9A 4FF7A 3CWNA 5FEPA 1XL9A 5F4XA 4Y6GA 1UASA 3STCA 2YXGA 4KFOA 1T96A 3IVUA 2QCMA 5HNRA 2NWRA 3WK0A 1KTCA 4JEQA 5D04C 4P61A 3GXPA 3UWYA 1DQWA 4GFSA 3M6YA 3IGSA 2WPBA 1VPXA 3MWAA 3C6CA 3TSMA 4HNVA 1SO5A 1DQXA 2BLEA 4AXKA 4N02A 3OVPA 4FNQA 1PHWA 4J9JA 3IIOA 3GXTA 3MW7A 2I14A 3NEVA 4OV9A 1BWKA 4K8HA 3UWVA 1QWGA 4ZVJA 3W1MA 2V5BA 5KITA 4MYAA 2VEMA 5KMYA 2WJZA 1RD5A 1WX0A 2C0AA 5CPNA 2B4GA 3OBKA 3TIMA 1G4EA 3PVFA 5KSWA 2DZUA 1WYIA 2X1SA 3C2OA 4WXZA 2FIQA 3NQAA 3EKZA 1FUYA 3GDTA 4DPQA 3PWAA 3UQNA 5DY2A 2GJNA 1P5BA 2GOUA 1SR9A 2QCLA 4GUIA 4FNTA 1F76A 3DH7A 1B57A 5LNRA 3LCFA 3TSDA 4BR1A 3A9IA 3C4UA 5C5YA 1RV8A 3TDFA 1K8YA 5HJLA 1WQ5A 1QO5A 1SZFA 2ZYFA 3C61A 4FNUA 2CLEA 1VLWA 3T4CA 3LM7A 3UWUA 3PBWA 5LNWA 1T99A 2Y70A 1KBJA 2Q3RA 5K7JA 1K7XA 4NZJA 1VCFA 1TPFA 4AWSA 3MI6A 5HINA 3MBFA 5KINA 1Z48A 1KM5A 4DQWA 1W3IA 4LU0A 2ATSA 3N9RA 3PAJA 4Q4KA 2DJLA 2C18A 1HTIA 3R5EA 4PODA 4CQ8A 4Z1DA 3DKJA 3G1FA 2VEIA 3GNDA 2G97A 3BGGA 3M5ZA 1OFDA 4DELA 5BRBA 2NWSA 4O1AA 3G1VA 3B0UX 1Z41A 3A23A 3G0XA 1N8FA 3S1WA 1C9DA 4MUZA 4N9BA 4CCEA 1W8SA 4X9SA 3JS3A 3LBCA 4C1LA 1OYAA 3HG3A 3C2EA 3W6YA 5DCEA 1VZWA 1OVDA 5LNSA 1WA3A 2O7SA 2A7NA 3TMLA 3CB8A 4LOCA 5D09A 1P1XA 3BARA 1YTDA 5E0KA 5CPMA 4QQ3A 3A5FA 1Q45A 1G4PA 3PF3A 2ZTJA 5G4EA 4UC5A 3M44A 3GIYA 1L6WA 4UFMA 3LCIA 5EPDA 1NVMA 4OQVA 3SECA 4XBSA 3W87A 3KVKA 3E02A 2J88A 3ABSA 1EX5A 1GVFA 2YX0A 1GT8A 3MP5A 1TPDA 2WKJA 1O4UA 3C3NA 1ZENA 3GNNA 3UYCA 4MOZA 3LI1A 1RR2A 1SO6A 2YZRA 3CU2A 2WSYA 3A22A 2J9ZA 4O15A 5KZDA 2OX1A 4O10A 2J27A 5BMXA 2YYUA 5C6MA 3W76A 4BI5A 1A5SA 3NPUA 5CGQA 1Z44A 1Y0EA 5AB3A 3HQ1A 2XFWA 4HNNA 3QRHA 4GUGA 2NX1A 2DU2A 3W88A 1H7RA 5CZ0A 4XTIA 1O95A 2OMAA 1PV8A 4GJ1A 4HPJA 1XFBA 1QPRA 1TB3A 1H7OA 3DAQA 4GE8A 4GNJA 4JIPA 4JTFA 1LRQA 3DFQA 1OK4A 3R13A 3PB2A 3RNDA 4M5PA 2DZSA 4MJMA 5LSMA 1OYCA 3KVMA 1G67A 3HPZA 5DBTA 3PG9A 4O4VA 2NUWA 4Z08A 2C6QA 3OG3A 4GC4A 2V81A 4O1CA 1OFAA 5D05A 5L9FA 1V5XA 5G2HA 3WJWA 3LTPA 1QOPA 4H3DA 2XN1A 1YDNA 3CT7A 3M9YA 4ZMGA 2ZTKA 2E6DA 3ATZA 4UNKA 2W79A 3U8GA 3NQ6A 3EEGA 4UFJA 3UPWA 3O06A 2NLIA 3E49A 3Q37A 4LS0A 3W1PA 1XBYA 1X7FA 3LLFA 6ALDA 3W7KA 4MZ1A 3S8HA 4UTMA 1L9WA 1YXCA 1W3TA 2E68A 4NNCA 2C16A 1LRNA 4UTIA 3WK2A 4A3UA 3V1PA 2DZXA 4IQLA 4OGZA 1A5CA 3NG3A 3P84A 1W37A 5KZEA 3TNOA 1KFCA 5K4ZA 4AHOA 2NX9A 3FJLA 4ORMA 3WK1A 3HF3A 4ICNA 3O8AA 5DBUA 1OJXA 4A22A 1SFJA 3ZFHA 1UUMA 1TO3A 1FXPA 5FESA 2JBMA 4R53A 3HBLA 4R7JA 2V2HA 1JUBA 3BVJA 2ZZ7A 3G8RA 5CPOA 3CEPA 2ZQ0A 1R30A 3VFLA 2ZRWA 1EP3A 1W56A 4JTTA 2Y61A 1IXNA 3SI9A 5G4WA 3S1VA 1YPIA 4KWVA 3UPBA 2E5CA 3IGUA 1H7WA 1VHNA 1YPFA 3TW7A 2HTMA 4QITA 3W2NA 1FWNA 3LXAA 2GVGA 3RLUA 3W1TA 1LLWA 1IF2A 5I3FA 4XKYA 4UMBA 4DPPA 4XBKA 3BLFA 1XC4A 2NV1A 4WX2A 1VC4A 2FPVA 4TIMA 2GQ8A 1G4SA 1UBSA 4YXGA 2E5DA 1MEIA 3QYQA 4UTWC 3W74A 1WXJA 3TSBA 4DXVA 5KTLA 1TV7A 3M1ZA 1J2WA 4O0KA 3TXVA 1RVGA 4CCCA 1EB3A 2VFGA 1YADA 3L67A 4FIRA 1IIGA 4NJIA 4FX7A 2H3DA 3QF0A 4FIQA 4O57A 1K7EA 1OX4B 3STEA 3O05A 4DF1A 5HWMA 3DBPA 4WD0A 1QPQA 1M5WA 1CX9A 4E2DA 3C8FA 3L68A 3QMSA 4N9CA 3EWZA 2Q8ZA 1ZAJA 1P0KA 2RKXA 4GBUA 1P0NA 4ZQPA 2WSRA 4OT7A 4Y90A 3W1QA 4NJHA 2FTPA 2KZHA 4N6FA 4N9EA 1SU5A 1SFLA 5DELA 2HS6A 2CLHA 2JKAA 3HPSA 5HULA 5LGZA 4HHPA 3IIZA 3UNDA 3RF9A 3NL6A 2WNQA 2BWGA 3S9YA 4LUIA 3MHGA 5LZLA 3QW3A 3SY5A 1V7YA 1JRCA 3SSJA 2Y7EA 1HO1A 2Y7DA 3NL3A 4IWWA 2X2GA 4YLWA 3LDVA 1ML1A 4LRSA 4UIOA 5K4XA 1EWDA 2P0OA 1MEHA 2W6RA 1KM0A 1QPOA 4PCFA 5HUOA 3NDOA 2X16A 1FQ0A 3P8JA 1F5ZA 3C56A 3WJZA 4L4LA 3W75A 2BSLA 3W2MA 2NV2A 4ONVA 4IUOA 5HMSA 2VEPA 4HN4A 3S5ZA 4OU1A 5H2ZA 3QQ0A 1TV8A 3NR0A 1XCFA 3BG5A 5F2LA 4HKPA 1I2QA 4XWUA 3TA6A 3P5ZA 3STGA 3KHJA 3G3MA 5FF3A 3EX6A 3BLIA 3S6DA 2VXNA 4M7SA 4U4MA 2ISSA 3NL2A 1LROA 1VR6A 4JY9A 4QJ1A 3NQ2A 1FDZA 2Y85A 2B7PA 3UZ5A 1ADOA 1SO4A 4I7VA 3BGJA 3MI2A 1AMKA 4TU1A 4O19A 3GDLA 1TYGA 4MLRA 4OBTA 3NGJA 4NX0A 3P62A 5E1QA 3NAVA 4JTUA 3ELFA 4YCOA 3GB6A 3N2XA 5CG7A 1ZY9A 4UMCA 3SFKA 4NXKA 1KFEA 1F74A 2PURA 4R33A 1WV2A 3ATYA 4U28A 3T44A 5F2MA 3HGRA 1NF7A 1C29A 3UY8A 4NVTA 2QR6A 4UR8A 5AHEA 4M7TA 1EP1A 3CIWA 1YYAA 1VJIA 2Z6JA 1RPXA 4HPXA 2ZZ2A 4Z1AA 1TTPA 3I7SA 4MZYA 5J5RA 1X1ZA 4BWLA 1F7BA 1OFEA 2QCEA 5KZMA 2QJGA 3M5XA 5D03A 1NSJA 3W7QA 1XBXA 2DZVA 3R8RA 2PE4A 4MFDA 4MY9A 3NO5A 1N7KA 3LTYA 3HG2A 5EA9A 2OJPA 2G95A 1ZJIA 3NM3A 3R89A 3N9SA 1GOXA 1JJKA 4LVAA 2B7NA 2RDTA 3BG3A 2BXVA 3TQ0A 4KWWA 1LP6A 1VYSX 4IMGA 2GQAA 2A6NA 4WY0A 4E38A 2Q8LA 1TTQA 1GZGA 1XUZA 3USBA 1UCWA 2NUXA 4O54A 4H6KA 4HSOA 3TJXA 3OHIA 4RK8A 3ZR4A 5LNUA 4O14A 1IXPA 2YGYA 4NJJA 2CFFA 2VFFA 3W7PA 1NFBA 1BEUA 2Y6ZA 1FWSA 1FY6A 2EF9A 3QQ1A 2J24A 3B4UA 4NNAA 1H63A 3PUEA 4WZHA 5E93A 1Q3NA 1XXXA 1H61A 3PSVA 1A5BA 1R46A 1TPVA 3G1SA 4Z0SA 4UUIA 4BK9A 4HT3A 3NM1A 3LBMA 2QDHA 3TC6A 3DFTA 3WK3A 2YSWA 3WJSA 3IV3A 3NQFA 3S5NA 2E6FA 4MY1A 1VCGA 5FI8A 3HMJG 3HGOA 4KFNA 3W72A 4X22A 4BI6A 1GWJA 4JTLA 4LTSA 3BG9A 2HSAA 1YDVA 4O1DA 1FBAA 1UB3A 4OV4A 2B0MA 3M43A 3O6CA 4R34A 3KRUA 2ISVA 4RR4A 2A0NA 3PB0A 1PE1A 3M5VA 2E09A 3CWOX 3DI1A 3FFSA 5DXYA 1FWTA 4JDYA 1TPB1 4FX6M 3PSWA 1QDSA 2AAMA 3B0PA 2GVJA 1HFBA 5F2IA 4Y9AA 1LOQA 1VYPX 1TTJA 4HSNA 3W71A 2C13A 2QJIA 4GUFA 1J4EA 2VEKA 1H7XA 3OIXA 4WXYA 1KBIA 1TQJA 1J5TA 5LGXA 1O5KA 3RK8A 3IIXA 3LCXA 3UZJA 4IMFA 4MZ8A 1H51A 1HG3A 5CPLA 3WJXA 2GVLA 1B9BA 1EPXA 1H50A 2YW3A 1ZAHA 4IJBA 3EB2A 3MP4A 3W84A 2P10A 5G5IA 4QAIA 4FNSA 4WOZA 1AL7A 5G1YA 2H8XA 1AW2A 1MO0A 3N34A 3PG8A 3CM4A 4WOQA 2FB3A 1LORA 4O28A 4G1KA 4Z0JA 3TXZA 2YW4A 1GVSA 1GYLA 2QCFA 3G1XA 4RX0A 1Q6RA 3O1NA 1NF0A 3NQVA 3LHVA 2CZEA 3L5MA 3FEMA 3NOEA 5HUPA 5CZJA 3E9AA 1BTMA 2BX7A 1SZNA 3SZ8A 5BOOA 4AVFA 2JGYA 4PFMA 4AH7A 2Y7GA 3NZ1A 3TAOA 2EAWA 4PL1A 3KRSA 3QPZA 3TCEA 4ZQOA 3CPRA 3DFPA 2QCDB 3W1AA 2VFIA 1T0OA 4JR5A 1F2JA 4NJGA 1AL8A 4A29A 1A50A 3QPYA 1TIMA 2ZFAA 3PY2A 1IIHA 3E96A 4CQAA 2XN2A 4JYFA 3RMJA 3GYEA 1OX4A 1VGAA 4LC6A 4LVGA 4Y96A 3SJ3A 3S0CA 5D2XA 2A1YA 5LNVA 2PC4A 3QW4B 1ALDA 3GVGA 3HGSA 3GKFA 3VE7A 4I7UA 3HGJA 3W7MA 2Z1BA 3W7IA 3QMRA 1I2OA 4TMBA 2TPSA 1VYRA 3P61A 3FYPA 3DFNA 3QZEA 4N9DA 2CWNA 3VE9A 4QISA 1JCNA 3FKKA 4O8RA 1TREA 4CNOA 5IBXC 4CNPA 1HL2A 3L2IA 3NA8A 6TIMA 1UUOA 4UTLA 2ZRYA 1QFEA 2ABAA 3TV8A 4KKXA 3ZS4A 4ALDA 1GTEA 2ZRUA 4UTHA 1ZHAA 4MIMA 1OG0A 1WDWA 3GK0A 3G1HA 1RQEA 2ZZ5A 1LZOA 1R2SA 2BTMA 1KV5A 5C55A 1F05A 3N14A 5HWNA 4C1KA 4JICA 2X30A 1X8FA 1R2RA 1DOSA 3DXIA 3W7EA 2RHGA 3DFSA 1E51A 1X6UA 3LB0A 5HWJA 4JTKA 1JCJA 2WO5A 2WQPA 4JTEA 3P60A 1PS9A 5EY5A 4L4MA 1K8XA 3NQEA 5J5DA 3G22A 1FCQA 3DU0A 4UMAA 2NXHA 1XKYA 2QJHA 1MZHA 3FA5A 3TC7A 2C3ZA 4JXCA 3E0IA 2CZ5A 4LVBA 4XZ9A 3W7GA 3NQ7A 3LV6A 4A21A 3LHWA 2CLLA 2ZRXA 3LXBA 1XM3A 3OVQA 4Z1BA 4HNUA 4RKAA 2TYSA 3A21A 3G8EA 4B5NA 1LLZA 3QEZA 5F1UA 4FB7A 1QO2A 1OFBA 2CLOA 2JK2A 3VI2A 4JD4A 3S1XA 3P5YA 3PBUA 2FDSA 5FF7A 3HIJA 1SO3A 1K8ZA 3WJYA 3KRZA 4ADSA 4MVAA 5G2WA 4N2YA 4JTSA 1G69A 1QPNA 4TX9A 2E5BA 3LGEA 3LCGA 4K37A 3R12A 3O63A 1OYBA 4K39A 3NPWA 3C52A 4IMCA 3PR2A 5F4WA 1KV8A 4ADTA 3W7LA 5TBOA 3B03A 2J6XA 1FCVA 5AFDA 1RQHA 3UD6A 4POCA 3G18A 2CZFA 4QSHA 3NZRA 2R14A 5AC6A 3W85A 3F4NA 2X1TA 3GAKA 3HG4A 3LRKA 1XBZA 1SW3A 1WOBA 1KLZA 4AEOA 3N73A 5AN7A 5DXXA 1QOQA 1JQXA 2BZNA 3I7QA 3NQ8A 3BW4A 3LV5A 4IMDA 3JR2A 1LOLA 2V82A 1THFD 3MHFA 3N2MA 5FF2A 1Q6OA 3EKLA 3EWWA 4JYEA 3HB9A 1I4NA 5EYWA 4LNYA 2DZTA 3FKRA 3W1XA 5GVJA 3PULA 3GDMA 3S42A 3NQMA 3MUXA 2FFCA 2NZLA 1OFPA 3IEBA 3EWBX 2A7RA 4PL2A 3RFAA 4RJEA 5D32A 4I7WA 3UY7A 4XUGA 5SWUA 1EA0A 3P7YA 2R8WA 3T40A 3MYOA 1DV7A 4QIUA 5FF4A 1BWLA 5H91A 5AHFA 3VKJA 3SGUA 4UTJA 2VKZG 3LCLA 5IM51 4FX8A 2ZCGA 3DFOA 5LKYA 1P4CA 3DI0A 4GRSA 3QM3A 1K3UA 2V2CA 4BFAA 2P1FA 3GZ3A 4CLMA 2LLEA 1MXSA 2H90A 4JNMA 3W83A 1KM6A 3C2VA 5G2IA 2W0UA 4NU7A 3STFA 2CW6A 2Z2UA 4A2SA 1ZCOA 3OEXA 2FLIA 3TMQA 1KM1A 3U2OA 3ABRA 2JKPA 3W2LA 1CW2A 1D3GA 3TKFA 4IPIA 5BW6A 1KFBA 4UTKA 4WUIA 4WQ6A 1K03A 5AC7A 3DKLA 3L0NA 3TFXA 4JTHA 3BV4A 3HO8A 4IMEA 5FF0A 4YL2A 3C2RA 1S3HA 4H4IA 4UTWA 3I6RA 1ZALA 3M7WA 2GJLA 2NX3A 4Q32A 2G5WA 3IGXA 1OK6A 1QMLA 1TPEA 3HPXA 3L66A 4AHPA 4WY0F 3CLMA 3S5OA 3ABOA 5K2ZA 1LRTA 3QFEA 2Y63A 3EXRA 2ZA1A 3M5YA 1L2UA 4K6AA 3D0CA 1M7OA 2QAFA 3BO9A 1XUUA 4MFEA 1XI3A 1GEQA 3BK0A 1FXQA 3V75A 5K9XA 2Z6IA 5HR6A 2GQ9A 3L5LA 1H1ZA 1GG0A 1DJQA 4DF0A 5I3JA 2QF7A 1KTNA 3H53A 1TV5A 3RU6A 2ZRVA 3I7RA 3NL5A 3TE9A 4LVDA 3UXAA 4NX5A 3B8DA 4D2JA 4GXMA 4OWGA 1O60A 1S5WA 4RXFA 5AHIA 1GVRA 4Z1CA 2NXIA 3EX1A 3W7DA 5AC8A 1L6YA 2QEZA 2ZZ1A 3GLCA 2TSYA 4QNEA 2ATMA 5D2YA 4M6VA 4LT9A 3L65A 3B0VC 4ADUA 1JVNA 1ME9A 4JY8A 3FIGA 4JTJA 5L6UA 4K7YA 3W1NA 3W1UA 4MY8A 1VCVA 3THAA 3PS7A 3G1DA 1HUVA 4AWTA 3QMTA 1H7PA 4ZQMA 2V5LA 3CEUA 3M47A 3U6WA 1VH7A 1LBMA 4ZZ9A 4GWEA 5AHLA 5I3IA 3B04A 2I9EA 2QCHA 4RZ6A 8TIMA 1R2TA 1W3NA 3W2KA 3P82A 4OE7A 2GPTA 2A5HA 3DHFA 3UWZA 4IPJA 2C19A 2QCDA 3TW6A 1TCDA 1GVQA 5CSRA 5D30A 1YXYA 2Y7FA 1YTKA 2FJKA 3AO0A 3OVRA 3LCWA 1W54A 3WFAA 2PRHA 2H3BA 2Q3OA 2HMCA 2Y62A 1FCUA 1KFLA 2CLKA 5TIMA 2A2IA 1RQBA 3LLDA 5U4NA 2A7PA 2RDUA 1I2PA 4AB4A 3G1YA 4ORIA 2ZZ4A 2DORA 1FWWA 3GR8A 4JIQA 3H54A 4NNBA 1QCWA 4DO6A 2CLIA 1YTEA 5EL1A 2IQTA 3G0SA 4WJEA 2VFDA 3TAKA 5A5WA 2V2DA 3JRKA 4PA8A 1TJPA 3W1RA 4RLIA 3LHUA 3W7CA 3PUDA 4E2BA 2QDGA 4P2VA 1ZFJA 2EPHA 3L9CA 3NVTA 3Q94A 2I1OA 2VENA 4JX6A 1TPH1 4O53A
chains in the Genus database with same CATH superfamily
1VP5A 3E0VA 1CGVA 4R7OA 1JR1A 4JCLA 3W86A 2PLKA 4JTQA 3B4YA 2ZUUA 3W07A 4GGHA 1EEXA 4JFWA 1EJXC 1WZKA 4DYKA 4HNLA 3WIJA 4MYXA 1AJ0A 2O7QA 4BQ3A 5HQEA 2FGZA 3GG0A 5BXPA 4ATDA 3BLLA 3RILA 4IUGA 4K36A 1HJXA 4NZFA 2XZ7A 4PTDA 1JDAA 1LTDA 5C7HA 1KXTA 2WSKA 2Z7GA 1GZJA 4FA3A 4XZWA 2BVDA 1G7UA 5AHNA 5GJMA 4Q22A 1ITCA 2ZUWA 3AIEA 1SJCA 1WXZA 3MO7A 3O0KA 1A5OC 2NXGA 3LU2A 3GU9A 1UUQA 3W9ZA 2EQDA 4KCVA 4XAZA 2JALA 2JIWA 4YTQA 5CSSA 1C8VA 4PUNA 4P7NA 1Q6CA 1ECEA 3OOQA 4JIRA 1QXLA 2J9XA 3PFRA 1DKWA 3T0BA 3VX0A 4DBSA 2GGIA 1CBGA 1XR2A 4Q3MA 3R79A 3W6LA 4DBEA 1MRAA 3EZ4A 2WOQA 3R4IA 3VDBA 4EVZA 4IX0A 2RGLA 1FFRA 4I9MA 3IK4A 3IUDA 4AMAA 3W82A 3CUZA 4TMCA 3I68A 4AY7A 2DSUA 4H2CA 1SZGA 3EWYA 4NT0A 3IV8A 1L6SA 1SVDA 4ZTYA 2BVYA 2DH3A 2PZ0A 3KWSA 1GQIA 1M9HA 2ZZ3A 1A5AA 3DIPA 3PZQA 3IJDA 4HU4A 3W7RA 3DYOA 3KOFA 1ISYA 3CLWA 2A6LA 2BOEX 3EB3A 5CKSA 4MKNA 1ONRA 2ZE0A 3I10A 2YDAA 4DJFC 1S5TA 2WSPA 3LNPA 4JX5A 2ISWA 1Q8JA 2A21A 3PM6A 2RDWA 1Q5MA 3PBMA 5CZSA 3W7OA 3WUGA 4YWIA 3TU9A 1KM2A 4QFUA 5D9NA 1F6KA 3S1UA 4CEXC 3OODA 4L1WA 1WZLA 4KMQA 4RV8A 1OZMA 1VLIA 3SW6A 5C9ZA 1EWEA 4O13A 3WEMA 3ZT7A 3VNDA 1DHKA 1XYFA 2E6YA 1RJQA 1XW8A 4AY1A 3O16A 3W70A 1N55A 4QDWA 4JHOA 5AYZA 3QV6A 1PPIA 1XLAA 3AMCA 4QDMA 1ZLPA 2ACSA 4EF9A 4GACA 3MMTA 3QSRA 1GTHA 3THQA 1OFRA 4WSJA 1C91A 4UNLA 4LF1A 2ZA2A 1KRCC 2G37A 3FYOA 1MW1A 4MLJA 5A1AA 3AS3A 4PCTA 2JGQA 3NPXA 1K7FA 4X3ZA 4LC8A 4LH8A 1UH4A 5CJMA 5FJTA 3QSTA 4Y7EA 1V02A 4GI9A 5I3HA 1AJZA 1WDDA 4ZOEA 3M0ZA 4GH3A 1TPC1 2ZA3A 4ZE5A 5D4YA 5DRCA 3ZLGA 1F07A 1FHLA 5IBXA 3U5UA 4J4KA 3FSTA 1V3KA 4F9DA 4HVXA 3EMCA 2TMDA 1OM0A 3KP1A 2BOGX 4C6BA 5HQLA 2CC0A 2UBPC 3T7VA 4DJED 1V3JA 2DZPA 3H2NA 3O6YX 2XVLA 1KM3A 2VX7A 1AQFA 1U83A 4DO4A 1DHPA 3A12A 3S2CA 3TYAA 2D1ZA 4AZBA 2ZRZA 2P0IA 3ZVHB 4J35A 1EOMA 4MSSA 2X1UA 1FWRA 4KEZA 1WUFA 3EBVA 3ARYA 3RCYA 1GVOA 3ZWSA 9XIMA 1A0EA 2Y2WA 3LSBA 5D33A 4M6PA 5F4SA 3KXQA 3CZ8A 4I5XA 3KOWA 4V27A 1F3EA 2C91A 4CNUA 2YZ5A 4PH6A 5D38A 4GUHA 5DN1A 1IEWA 4RCXA 3MV01 3DN5A 3ES7A 2NQZA 3P74A 3W73A 4QNWA 1R3QA 1I2RA 3T0AA 2OCZA 1BSLA 5ECVA 3UZXA 3DEQA 2Y88A 3GTHA 1BGGA 4ZODA 1E6PA 1UR3M 2C15A 3S2NA 2DT1A 4ZTXA 5EBUA 5T26A 3IJ6A 1PIIA 4XBJA 3EKGA 3ISIX 1CDGA 4PMQA 3MCNA 3RAOA 4L4OA 1LOSA 2QIWA 1FKXA 4XZBA 5EBAA 3UXIA 1FCBA 2HDJA 4FXSA 2YBTA 1AJ2A 3H26A 5DRIA 4AF0A 4NZCA 1YMYA 1M7XA 2FQIA 2VT0A 2QULA 2E40A 4L9YA 4HBKA 3VILA 1I8JA 3G1AA 2ABBA 1YDYA 3IVSA 4XTDA 4EXBA 2XHYA 1TUXA 4XK2A 1XLMA 1US2A 5C2XA 2YBVA 3KBSA 1FX6A 5I0DA 4QRNA 3V36A 4LS2A 4NF7A 1ICSA 1B30A 1OABA 1BRLB 4ZCWA 4GVIA 4EOUA 3MYPA 1XDLA 4IOTA 3A24A 3TEVA 3ES8A 1FFQA 3AS0A 4IMAA 2NQJA 4LV4A 1V6TA 2WJFA 1D3HA 2YIHA 4X2RA 1KWGA 3N1AA 2I16A 3OA3A 3UWQA 4D72A 4CNTA 4IM4A 1QR7A 5EKYA 3MJYA 1KRMA 1TWIA 3G24A 3LERA 5U7SA 3TR9A 4YCPA 2YFOA 1IXQA 4FI4A 3WLMA 4QM1A 1WO2A 2O4MA 4HMDA 2R24A 3WQ8A 1PCKA 2J25A 3PPFA 4IF2A 2A4AA 4OOUA 3WD0A 4XAGA 3B06A 3ANYA 3BPWA 2ALDA 4CD6A 2ZUNA 1TRDA 1V0NA 3WLJA 3H7RA 4H9ZA 4W8BA 4G2DA 2BP1A 1F3XA 1DXEA 2RGMA 4P8WA 1E0TA 1B2YA 1NEYA 3LG3A 2HRWA 2YR1A 3TJLA 1LL4A 4R88A 4PMJA 3VZXA 1YXDA 2IKJA 3MS8A 3T78A 3P0XA 3S9IA 4DN1A 5T9BG 3LMZA 4TV6A 2HV5A 2OGYA 4FOJA 2HVNA 1TSIA 3TYCA 1JGMA 3H2CA 4D6CA 3QV8A 1LCOA 3GKAA 2ANUA 4GVGA 3GBEA 5BWFA 4IX2A 4EXQA 1E1FA 3Q58A 1VEPA 4W85A 1TKKA 4FF7A 2NW0A 4FLQA 1EF2A 5FEPA 5F4XA 2QGYA 1J0JA 1W6TA 4YVXA 5HNRA 3F5KA 2NWRA 2W66A 4QQUA 3P0WA 4QDPA 4H9YA 4GFSA 5A95A 3M6YA 3IGSA 3WNLA 1LUCB 4IP4A 3MWAA 3TSMA 4HNVA 2WQDA 4J3TA 4L6HA 3H2OA 1FWEC 2VWTA 3OVPA 4FOKA 4FNQA 2OZTA 3GXTA 3NEVA 2EG7A 2CCRA 4K8HA 2FMOA 3AS2A 1CGTA 2W5FA 3M0HA 5H6HA 2WJZA 3ZIZA 4GZEA 2C0AA 1US0A 5CPNA 3PVFA 5KSWA 6PTDA 3C2OA 3CZGA 4QJ4B 5HMDA 4HOXA 1FUYA 2BOFX 3NCOA 3VOGA 3GD6A 1CLKA 2RJGA 2GOUA 2OFJA 2Z1XA 4RDZA 4FNTA 3U2EA 5LNRA 5C5YA 1RV8A 3TDFA 1XF0A 1XINA 1WQ5A 1QO5A 2VCAA 2PDPA 3VA8A 3PZTA 5M1TA 1K7XA 4NZJA 1V7AA 1VCFA 3BOFA 3MI6A 3BGAA 1M04A 1C93A 3N13A 1Z48A 1VD6A 3OIHA 4MAVA 1L6GA 4YHEA 1ISWA 3ZLHA 4DELA 5BRBA 2NWSA 4O1AA 2QVHA 3G1VA 3B0UX 3A23A 3G0XA 2HE8A 3S1WA 3CPUA 3GG8A 3H2AA 1RALA 4C1LA 2WC3A 3MC5A 3L23A 5LNSA 1WA3A 2R82A 2A7NA 3CH9A 4NRSA 3E6EA 4Z17A 5E0KA 4J2PA 5CPMA 3GNPA 4X0NA 1G4PA 4NG3A 1E9IA 3PF3A 5G4EA 2R1NA 2VHLA 4W8LA 2WVTA 4OQVA 4QTGA 3K2GA 3KVKA 3ABSA 2XVGA 1M01A 1OWQA 1ZENA 3UYCA 1HJVA 3AZTA 4MOZA 3W0KA 1UMYA 3FV9A 2J9ZA 4O15A 3LGDA 3WQGA 2OX1A 4B3KA 4TVDA 4O10A 3W38A 2OLSA 1AH0A 1FHVA 1E43A 5C6MA 3OZYA 2WZIA 4BI5A 4ZFMA 5CGQA 1H09A 2HK1A 2DY3A 5BROA 2XFWA 4HNNA 2WHMA 1K6AA 3W88A 3ZM8A 4XTIA 1J0KA 3ZR5A 4AD1A 3KCLA 1WKFA 5XIMA 3GVQA 4GJ1A 1DIOA 5AZ1A 1H7OA 3DFQA 4JKMA 3A4JA 4AZGA 3UA3A 3PB2A 2W63A 3AWOA 1OD0A 3KOXA 5C2GA 3NUKA 3N6QA 2PDCA 1I0DA 3W25A 1M7JA 5DBTA 2NUWA 4Z08A 3KBWA 2XM1A 2V81A 5L9FA 3RX3A 2Z1SA 5G2HA 3QQWA 1XHGA 3V5FA 3WJWA 1QOPA 1IHIA 3CBWA 4A35A 1YDNA 1MQRA 1JCTA 4GX9A 3M9YA 4ZMGA 2OEMA 1XS2A 3M0XA 2V5JA 4DAFA 3NQ6A 1NDWA 1UHVA 3ZQ9A 4C6QA 5IHRA 5DANA 3CHFA 3E49A 1OC5A 3QLDA 1OC7A 1C90A 2VL4A 4LS0A 3W1PA 1XBYA 1X7FA 2E8ZA 3W7KA 3ARPA 1W3TA 1ZGDA 5AZ0A 4UTIA 2DZXA 4IQLA 4OGZA 1RP8A 5ECUA 3SCOA 4EXAA 1KR0A 5BXSA 3HM7A 4J1OA 2PWVA 4C5YA 4H9XA 3M0IA 1PAMA 4IFOA 3VCNA 5FESA 4R53A 4R7JA 4LYRA 4TXEA 3SCPA 3VIGA 5JH2A 1XIFA 4RE4A 4Y8EA 2YCLA 1W56A 4MB3A 3UR2A 4LUTB 3CAKA 3ECQA 1XLFA 3THDA 3S1VA 2X40A 4PYSA 4F0HA 1ZCCA 3PJUA 3V0TA 1WPCA 2ZXBA 1FP8A 1FWNA 1EGMA 2GVGA 5TD4A 3WL0A 1LLWA 5I3FA 4XKYA 2XPKA 4D1IA 4XBKA 4DBUA 5BXRA 3BLFA 1XC4A 1QBBA 1LWHA 3T6CA 1K1DA 4UQEA 5DMLA 1MEIA 1EGZA 3TSBA 4DXVA 5FL1A 4AUBA 3TXVA 2ZVRA 2VFGA 3JVAA 5JUVA 3L67A 2YLAA 4FIRA 4FX7A 1YPXA 2Z7KA 5GNYA 3M0KA 4O57A 3O05A 1V6UA 2YXXA 1CX9A 1T8QA 3UXLA 4GHRA 3PPCA 1GGOA 4N9CA 4U5IA 3EWZA 4RPPA 3BAJA 3ITVA 1R3TA 2WSRA 3AHVA 3W1QA 4NJHA 2FTPA 4N6FA 4N9EA 1SU5A 1SFLA 5DELA 2HS6A 1ZU8A 1JL8A 1ZBVA 2YL5A 3PFMA 4HHPA 3SN0A 4F0MA 4ICCX 3QTGA 3OBEA 2PWHA 3O3RA 2X0HA 2ZICA 4PUUA 3QW3A 1DJXA 3SSJA 2Z25A 3CMJA 2Y7DA 3NL3A 3ARQA 4GQRA 2X2GA 4UQ9A 2XVPA 4NZ5A 2CBUA 4NAFA 1TELA 1Q65A 2GJPA 1PX4A 5AYIA 4GG9A 3WDQA 5M5DA 1Z3NA 1E1EA 3VNKA 1DWIM 4TVUA 1B3YA 4ONVA 6CGTA 2WK2A 4IUOA 4OJYA 5HMSA 3S5ZA 4OU1A 3UP8A 1F4AA 3B8IA 4AZ5A 1HF6A 2VX4A 2C0HA 3BLIA 3KLLA 1C3FA 3B9OA 4L61A 2ISSA 3IACA 3LPGA 1Q4WA 3UZ5A 3DGBA 4Q4QA 2BY1A 2OWCA 4L1XA 1TYGA 4OBTA 4DUWA 4MDOA 5JH1A 3P62A 2GDUA 3GB6A 2YL9A 2XFRA 5IOBA 1G1YA 1JZ7A 4R33A 1WV2A 1J93A 1TCMA 1C29A 1KRAC 1JNEA 1LQ2A 3AOFA 2WM1A 2QR6A 4XO6A 5AHEA 3MKVA 2PDXA 3QHMA 1RPXA 4HPXA 2J7FA 4A05A 1GKPA 2JEPA 1HKWA 4JHZA 6XIAA 3BAKA 3B8SA 2Y0FA 3PZVA 1HVQA 1K9FA 2QJGA 1UZ4A 1QI3A 4B9YA 1C92A 4S39A 2EKGA 1XLGA 2VP8A 2CERA 1MW3A 1N7KA 1WDSA 3B9AA 3TONA 4V28A 2OJPA 3ALFA 4E8DA 1GOXA 1KXQA 2B7NA 3TTSA 4KWWA 3S1GA 1MW0A 4C1NA 3V18A 4LCRA 2WCAA 4E38A 2Q8LA 4YJ5A 2NUXA 1EX1A 3M0JA 3TJXA 3UNTA 4RK8A 3ZR4A 1IXPA 3W37A 2CFFA 1S38A 1NFBA 1BEUA 1FWSA 2EF9A 3KTXA 3QQ1A 1H63A 3QGAC 3LY0A 2X09A 1TPVA 2D2HA 3URNA 5CH9A 3PZNA 4GZJA 3CL6A 1IYXA 2YSWA 4ZOAA 3IV3A 3NQFA 4MY1A 5FI8A 2PDQA 4X22A 3ID7A 4DHGA 3UR7A 3OYXA 1UWIA 3E1F1 2C8NA 1YDVA 4O1DA 5C9UA 1KCKA 1MUWA 3K4AA 2ZE3A 4RR4A 2A0NA 1YNYA 1EJUC 4U33A 1PE1A 2E9BA 1HJQA 1NARA 1ZB5A 2C1IA 1RK6A 4D8LA 4KERA 1GK8A 1N2VA 1QHOA 1ZP3A 4FX6M 1QDSA 3D3AA 3VM7A 3B0PA 4O8AA 3W81A 1E6XM 1HFBA 3GXFA 4Y9AA 5D9MA 2NT0A 4UNIA 1R0MA 1D8WA 4AEFA 1H7XA 2FTWA 1J5TA 1FWCC 4WRHA 5LGXA 1O5KA 3RK8A 1QW8A 2AKMA 4PGLA 1GQKA 3UZJA 3RJYA 2OELA 1HG3A 5CPLA 3T07A 4TTUA 4B3ZA 1B9BA 4IJBA 2H9AB 3EB2A 2VX6A 1R3YA 3ARTA 3W84A 4NASA 5G5IA 3V0SA 4AYSA 4QS6A 1ODUA 4FALA 1UWAA 3CWHA 4I6KA 2G41A 4WOQA 1H49A 4Z2JA 2J13A 4HNCA 2QCFA 3O1NA 1NF0A 3NQVA 3LHVA 5FKYA 3V4BA 3FEMA 2XU2A 5HAOA 3VKKA 2WM0A 1MI3A 3QLLA 1BXCA 3EWCA 1W3JA 3RUBL 3WELA 3KRSA 3QPZA 4H9MA 1A4LA 4ZQOA 2BNJA 3DFPA 1EIBA 3W1AA 2VFIA 1T0OA 3WQFA 1F2JA 1AL8A 2ACUA 2A3EA 3PY2A 3E96A 4CQAA 2XN2A 3M0LA 3M0VA 1XICA 4V1YA 1VGAA 4TUFA 4LVGA 2P3EA 2XH7A 4H7ZA 2I5QA 2YDQA 2PC4A 1NDYA 4EAMA 1ALDA 1ONWA 3HGSA 2JF7A 4I7UA 4EPKA 3HGJA 3SGGA 3W7MA 2Z1BA 4ROQA 4D6JA 2WZEA 5D8WA 3QMRA 4W88A 2TPSA 3P61A 4ERIA 5C70A 2AL2B 1C7TA 4QISA 4EPDC 1JCNA 2OYMA 3QR0A 4H2HA 1HN1A 4CNPA 3L2IA 3G1RA 4UTLA 3OW1A 2ZRYA 1QFEA 4Q4OA 1QHZA 4AX6A 1Q6FA 1W32A 4XIMA 2ZRUA 3C2YA 3CZJA 3VGDA 4UTHA 2DPEA 1PDZA 2X1IA 4DJFD 1UP3A 4GY1A 1DEDA 4DIAA 1F05A 3N14A 4C1KA 4JICA 1IR1A 3W7EA 2DIKA 3A13A 4D6HA 2FGLA 3N6JA 3S9ZA 4JTEA 4LBUA 4Z2LA 3RXZA 1PS9A 2GZXA 1EC9A 2R1LA 1K8XA 1JFHA 5C0QA 2PTDA 4EE9A 4HHMA 3I3BA 3QOMA 4XZ9A 2HROA 1O68A 4A21A 3ABXA 3LHWA 3ZOAA 3OVQA 4HNUA 1KBKA 4RKAA 2E67A 3A21A 2PDWA 2CITA 4FB7A 1BTCA 1V3MA 2CLOA 3GTFA 4H6RA 3PTQA 3P5YA 2HBXA 1GVEA 3HIJA 3WUBA 4ADSA 1UZHA 5H8MA 2D22A 3UJRA 3RPTA 4HZMA 1RA0A 2IKHA 2ZIDA 1G69A 2E5BA 4LFYA 3LGEA 4K37A 1OYBA 1DJYA 4IIGA 3CZEA 1UR0A 3AMLA 4ZO9A 2QYGA 4GC3A 3VXGA 5FCZA 2ZOXA 3B03A 2J6XA 3M46A 3WUEA 3KL3A 1MXDA 4POCA 2CZFA 3NZRA 4DNMA 3N4EA 2QHAA 2HQAA 1GKRA 3T42A 3NWRA 4U3AA 3LRKA 2NQ9A 1SW3A 1WOBA 3MU7A 4LAOA 1PTAA 3A6OA 1SFSA 1BVNP 1CGYA 1P7TA 3NQ8A 3VU2A 4GYFA 1AMYA 1OCJA 2PDHA 1ZJAA 4W4QA 4UZSA 3QVQA 3MHFA 3GTXA 5I6SA 3ZSTA 1Z89A 3OYZA 4LNYA 1VFMA 3RCNA 1RA5A 2PWEA 3S42A 1UQYA 2FFCA 2NZLA 1OFPA 4Y9NA 5I2UA 4PL2A 4WR3A 1L6FA 3VMOA 3RFAA 5A2CA 5D32A 1XPYA 4IFRA 4I7WA 1J18A 4XUGA 5SWUA 1EA0A 4S3BA 2R8WA 4QIUA 1LLOA 1N8IA 5FF4A 5AHFA 3GU2A 2VKZG 3WEZA 3SBFA 1LWIA 3DFOA 3RIKA 3GVVA 5LKYA 4GRSA 4KCWA 5FACA 5IDZA 1K3UA 4U31A 2Q02A 1UYQA 2LLEA 3W83A 1KM6A 5G2IA 2VUNA 4NU7A 3STFA 2Z2UA 3OEXA 3BURA 1E4MM 1E15A 3WLPA 2VQUA 4P7QA 9CGTA 2JKPA 2Z26A 3W2LA 4S3EA 3PZIA 3TKFA 2WPGA 3K8MA 1MW2A 3LZ3A 1KFBA 4I8DA 4UTKA 4WUIA 1W3LA 3RGTA 3UCCA 3W26A 5I78A 4P8UA 3TFXA 4JTHA 1JGIA 1KBBA 1Q7QA 3U0HA 2OOGA 1RCOB 1W1B1 1W3HA 1CLXA 1S3HA 4F0KA 4H4IA 4UTWA 3I6RA 2GJLA 4IQDA 3U3HA 1EJWC 4Q32A 3AHTA 3IGXA 4BF7A 3L66A 3JZUA 5HDRA 4AHPA 2XVNA 4UCFA 4WY0F 1NQ6A 3IANA 2FZMA 1LRTA 1J79A 3EXRA 3F4VA 5F7UA 4IL2A 3NGFA 1WDPA 2ZXDA 3C8NA 4K6AA 1V77A 3VUPA 3BCFA 3BO9A 3VGFA 2PLMA 3E2RA 3G6LA 2WANA 2G3FA 3HV8A 2X0YA 3VTRA 3WLSA 4HYRA 1GG0A 1DJQA 1OC6A 1UWUA 3GH5A 4CQDA 3GS6A 1V0KA 1TV5A 4F3HA 3ITGA 4ERGA 3TE9A 4LVDA 3DHPA 3UXAA 4GQGA 1YIXA 3GHTA 5BU6A 4GXMA 4RXFA 3L4YA 4QE1A 2NXIA 1CNVA 3W7DA 4GCAA 2XGBA 3AQUA 5CCZA 4P7LA 3VCCA 1JVNA 4ADUA 3JZEA 4JY8A 3FIGA 5L6UA 4R7WA 2D2OA 1OG6A 3QR1A 5A6MA 4F0SA 1UKPA 4ACZA 3THAA 3G1DA 1M1BA 2V5LA 4DY1A 2F8QA 1PJ9A 4ZZ9A 4S3AA 4GWEA 4GYPA 4RZ6A 2CXEA 4HCLA 3TTEA 3W2KA 1PYMA 2XDFA 3RR1A 3P82A 4MADA 1P0DA 1PZ2A 3A3HA 2DSVA 2REQA 3VZZA 1QUMA 4IPJA 3R7MA 1GVQA 5CSRA 4H7VA 4RZBA 1V03A 2E1WA 3GDBA 5HOSA 2H3BA 4MWAE 2Q3OA 2C79A 5FA5A 4LYKA 3ZXWA 2Y62A 1FCUA 1KFLA 3FVDA 3RM4A 4DXXA 5U4NA 2RDUA 3TN4A 2PLJA 1I2PA 4AB4A 2ZZ4A 2DORA 3OGVA 4X60A 4NNBA 4KESA 2CLIA 2EBNA 3VKAA 1YTEA 4WJEA 3TAKA 5A5WA 1TJPA 3CUGA 4G56A 3DFHA 1ZFJA 2P8BA 2NQLA 4W7WA 4GJIA 4MJ4A 1YW1A 5T8GA 3TROA 3AISA 2O4QA 1F73A 3IAQA 1XH1A 1R7AA 4I3GA 2OOFA 2ZDRA 4S38A 3RDKA 4J3WA 5AHMA 1W5NA 3FOKA 3UZWA 4DJDA 1KKOA 4AF0B 4L64A 2F2KA 3CUIA 5AYBA 1LYXA 3NVDA 3F03K 3KUMA 1EA9C 1KM4A 4S3DA 4AVOA 4N7QA 2X1RA 4B5UA 1OINA 4X61A 2DVXA 1W1TA 4XX6A 1BF6A 2QGHA 1IR2A 1ITUA 4U3CA 3VGHA 3MMUA 3WEOA 4NHVA 2Q09A 5HNUA 3HQOA 3R58A 4P8VA 1S5MA 2GK1A 3F4CA 2XN0A 2HS8A 6A3HA 3CYJA 3C2FA 4LF2A 1YDOA 2G4FA 1XLIA 2G3MA 2QUUA 4JDBA 1JZ4A 2ZZ6A 2W3ZA 4DLMA 1RHCA 3W7HA 2CEQA 2F84A 1VHCA 4Q7BA 3EX2A 1AODA 4ZR8A 3UERA 4E3VA 3P8IA 4IJRA 2YKKA 3ANVA 2B7QA 1D7KA 2Y24A 4O52A 3GAYA 2C14A 3HG5A 4LS1A 4M0XA 5BYWA 3GDRA 1DORA 4E0CA 2OR2A 2WCGA 3KW3A 5BRQA 1JUEA 4UFLA 5K3VA 1D9EA 3VNYA 1KA9F 3A5VA 3QC3A 3WMBA 1XCXA 2OPJA 3WMLA 2E1DA 4IH3A 2X7WA 1BQCA 4GZIA 1LWJA 3ZYZA 1X7IA 5BZAA 1M6JA 1IQ8A 3N9KA 3D46A 4X9YA 4M8UA 3AXIA 1DVJA 2DSKA 2YCEA 2HK0A 3CASA 1E0UA 4UB9A 2TRSA 3M16A 5K9CA 2VRQA 3LTSA 4D1JA 2VD8A 1AW1A 2EPNA 1QTWA 2FGBA 1TQXA 3BLEA 3EXTA 3CHDA 3MHUA 4CNNA 4W7VA 4FO4A 1JZ8A 2PGEA 5LA0A 1E3ZA 1PL9A 3S6OA 3GXDA 3OZOA 3IIVA 2PRLA 1X8CA 3G3DA 3UXDA 4E2OA 4WY0B 3S6TA 1DP0A 4HPGA 2VJXA 1Z69A 1LQAA 3LI0A 1WAWA 1KGXA 3H70A 5GNXA 1WBHA 3PBYA 4EK7A 1AZ2A 3P81A 3AIVA 3HJZA 5E0CA 1P48A 1EGVA 2V30A 2J7BA 1PCWA 4WIWA 1XDMA 3T81A 3BAIA 1TA3A 4O0ZA 1HXJA 1NFGA 3FA3A 3NZQA 4NI3A 3ITLA 4HHLA 2QAPA 3MJMA 3SUWA 3NNTA 5AOUA 3OU8A 2PD9A 2O9PA 2VC6A 1IWPA 1H4PA 2XIJA 2PWUA 1VFOA 4RZ5A 4ML4A 3CB3A 3C0JA 1ME7A 1D2KA 5I06A 3WLKX 4DWSC 3G0UA 1XLHA 3OO2A 4YN5A 5E70A 4DUXA 1VF8A 3DZ1A 1PVNA 5DCBA 1W5QA 2JKEA 1DXIA 2DUZA 1KNWA 3T05A 2QCGA 4ZQRA 4DJEC 2WSQA 1EUAA 3GHSA 2J4GA 1EP2A 4CN4A 3R2GA 5G1MA 1EYEA 1ZBWA 2H8ZA 5CAKA 1BPLB 4EWND 4G7EA 1MMFA 5JXQA 4PMUA 1R9ZA 4HP5A 1EQPA 3MPGA 2R91A 4LCQA 1NDVA 1TPWA 5A3HA 4LV9A 3KDOA 3LEPA 1EUNA 2Z1KA 4P7OA 2CZDA 1CENA 4A3QA 2X42A 1PIGA 3FXGA 2IPWA 3VCRA 3WD1A 1B4KA 2VFEA 1OFOA 4DYJA 5D2TA 3RN6A 3NYZA 4PC8A 3VKBA 1AW5A 1I75A 1W5PA 3SN4A 4N6EA 3NXFA 3TQKA 2BGQA 3EOEA 1E4NA 1XLJA 1HKVA 1W17A 3H7UA 2QJNA 3CL8A 1CXKA 4MJZA 3I65A 5E9AA 3MVTA 4NUWA 3E0WA 5FL0A 3YPIA 5LHFA 1IE7C 3INPA 4F0RA 5CSUA 2JQXA 1W1VA 3USZA 1EIXA 5IFPA 4M19A 4OHQA 4PMVA 5FJJA 1HQTA 2W62A 3GM8A 1OF6A 4IIFA 2EKCA 3PZOA 3UFYA 5I3KA 1QVBA 1EC8A 3LPFA 4QJ3B 4XISA 1V93A 3ZMRA 2ZWYA 5BOEA 5IRPA 2OO6A 2VUYA 1J12A 4S1FA 4U10A 3N15A 3NSXA 3TLQA 3ABQA 2CLPA 2C1HA 4LYQA 3IRDA 4C6KA 3IIPA 1GJPA 1ICPA 4FPSA 3GX9A 1UPPA 4IXXA 1J0ZA 1C9WA 3WF2A 4K3ZA 1ZAIA 3SADA 4L6DA 2PMQA 2DJXA 2BVWA 4BWLC 4M6QA 3NQCA 1CEOA 3CQ0A 3CL7A 4DI9A 2EHHA 3QJAA 3TC3A 4NAEA 2WNNA 3UYIA 4AZ6A 1X1OA 1U33A 2A85A 2YBUA 3W01A 4RZ4A 2X8RA 1JCLA 3FS2A 3MUIA 4BCEA 1XH0A 2VFHA 1W91A 2GGEA 3EDEA 2ZXAA 2CNCA 4Q33A 1TV2A 1U5JA 2H6RA 3WH5A 1RAKA 5DY3A 2PAJA 4JS3A 3GXNA 4GLEA 5ABTA 3ZJKA 1MUCA 4CU7A 2OU4A 2PLCA 3BLPX 3F4WA 2YCLB 4O17A 3ORWA 4GO8A 2YJQA 1SW0A 4FNPA 1X6LA 2WVSA 1CXLA 1B3OA 1KC7A 2WBKA 3E12A 4BZYA 3A3XA 3BTNA 1W5OA 1B0IA 4XKYB 4BI7A 5HXMA 4MB4A 3S5YA 1KKRA 2V8ZA 4O11A 7CGTA 1REQA 3AMKA 3H23A 5M17A 4UQBA 3AXMA 3TK7A 1V3IA 2V63A 3L0GA 1MSSA 1DPMA 5CLTA 5AY7A 1PB0A 1YE4A 1OF8A 4ES4A 1ZJHA 3LOTA 2CKRA 4KF1A 5FEWA 1SSGA 4C6MA 3W28A 3RPDA 1TTIA 3MBDA 3DHDA 1DJNA 3CQKA 3GSMA 1DL3A 4LVFA 4IGHA 2P5NA 4N0RA 4RPQA 3FJNA 7REQA 2RH9A 1EJ7L 2PDGA 2V9DA 1F6PA 2P53A 5ABGA 4G9PA 4CD7A 2ZBTA 2C7FA 4JQ1A 4B3LA 4IIEA 3ZJ7A 1B3WA 4BF9A 1O5RA 3RG6A 1QRQA 1W9UA 4MJ2A 1VIWA 2OLAA 1T96A 3CQJA 4GIEA 3QGVA 3RHGA 4W7UA 3GNXA 3VIIA 1KTCA 5GJPA 1MDRA 4V15A 4HK5A 1EJRC 2OYLA 1SO5A 4HB7A 4AD4A 2D69A 4BHYA 1XFCA 3MW7A 1DYSA 1TV4A 3MSDA 2I14A 3UG8A 1QNPA 4IPNB 1BWKA 3HU7A 1VFLA 1QWGA 2PDIA 4YYFA 3RCMA 4D6EA 5KITA 4PB4A 4NAFB 1RD5A 3GWQA 3WF1A 1A5NC 2V5DA 3CV7A 2BODX 1SJDA 2B4GA 5DF0A 3TIMA 5I77A 3MCOA 1XWYA 5DQPA 4GXPA 5DY2A 2GJNA 1P5BA 1GHSA 3IARA 1B57A 3LCFA 1UC5A 1VRXA 3TSDA 3C4UA 3ANUA 1K8YA 2YDRA 4QCEA 5HJLA 2CLEA 1VLWA 3KCOA 4H6EA 3CHEA 3WLTA 3PBWA 4NILA 1FWIC 4H6QA 2Q3RA 2PBGA 4CCZA 3S47A 1GPFA 1JPKA 1TPFA 4FXFA 5HINA 1UWQA 3B9DA 5KINA 1AQHA 4LUSA 3O9NA 4LU0A 4LB3A 1HTIA 4WF7A 3R5EA 4GY0A 4CQ8A 4Z1DA 4PBFA 3DKJA 3V1HA 3WNOA 5EMJA 1QHPA 3GNDA 1OFDA 1RBOB 3SQSA 3FA4A 4Y9OA 1N8FA 2Y8UA 1C9DA 2HNEA 4MUZA 4QG6A 1OYAA 3HG3A 3W6YA 2HE5A 5DCEA 4B5TA 1UKSA 2ZX9A 3IWPA 3VABA 4CQBA 4DRSA 1ZTVA 1HKMA 2MUCA 4G8TA 4F79A 4KIRA 1PKNA 2QLYA 3BARA 1U1JA 2DW6A 1P0BA 1YTDA 3EYPA 5H8UA 1JZ3A 2FVMA 3GVWA 4GYKA 4UC5A 2DZBA 3RM9A 3EA3A 1NVMA 3MSRA 4XBSA 3N6HA 4C6PA 4GNKB 2YXOA 3SRDA 2DVTA 1TMQA 1GT8A 1HL8A 2WKJA 4KIEA 4IICA 3CZLA 3L4ZA 3LI1A 1JI1A 3PTMA 2YZRA 3E0FA 2ICSA 5I24A 1R38A 5JIPA 2XWEA 4EPEC 3RRXA 1F9CA 2WHLA 3VO0A 3R1ZA 3DG7A 3W76A 1CXFA 3KBVA 2PDYA 2Y8VA 4C1NB 2DSZA 4H8UA 5I3DA 1LF1A 3POCA 1V0LA 3EOOA 7PTDA 2NX1A 3Q65A 1O95A 2OMAA 3W24A 3RPMA 1PWLA 1UWRA 3TW9A 1MRQA 4NZ1A 1XFBA 1TB3A 1SM9A 4JIPA 1LRQA 4Q8VA 3VZYA 5XINA 4D8ZA 3CPGA 3KBJA 5ABFA 3UW6A 5LSMA 3V0UA 3HPZA 3VC5A 4INFA 1CIUA 5LA2A 2C6QA 4FMVA 1V5XA 1PZ3A 2GSJA 1Z9AA 3SCTA 4L65A 3R6IA 2W79A 3AXKA 3EEGA 4UFJA 3AHXA 3EDKA 2DQXA 2O9TA 3CUXA 1HKIA 4W8AA 4PMXA 3LLFA 4MZ1A 1SMDA 2YB4A 4DJFA 1GZ1A 2DGAA 4IZGA 1PSCA 2C16A 3KWXA 1LRNA 3WK2A 3LMYA 1XGZA 3NG3A 5KZEA 4TOQA 1FTXA 1KFCA 3WQPA 2BASA 5EU9A 1RK5A 4ZOBA 5DBUA 4Z2GA 1OJXA 4AIOA 4B9ZA 1UUMA 5HK4A 2JBMA 5I79A 1RJPA 2A79A 3G8RA 2EEXA 1YNPA 5CPOA 3CEPA 4E4PA 2GL5A 5A6KA 2V5KA 3OLIA 5JU6A 4IP7A 1GKQA 4JTTA 4OOZA 2WMIA 1H7WA 2J8TA 1VHNA 4JHMA 4GGBA 1IF2A 2XISA 3EA1A 4H41A 2NV1A 3WD3A 1C8YA 4TIMA 1G4SA 3URQA 4YXGA 1L8NA 4ZO6A 1WXJA 4WGXA 4ZXLA 1R5YA 4REQA 5KTLA 2QV5A 1TV7A 3UETA 4DZIA 1MNZA 4O0KA 4YYCA 5M03A 1XCWA 1R3WA 2WW5A 4K1GA 4J40A 2J66A 4G1NA 3PNUA 3ZSSA 4R5EA 1YADA 2H3DA 3HQNA 4CEUC 4H9VA 4IP5A 4RE3A 4YPJA 4LAZA 1K7EA 3STEA 4DF1A 3VIKA 5HWMA 3DBPA 3TN3A 4KGJA 1J0IA 4E2DA 4JNYA 1EDGA 1G5AA 3VGBA 3C8FA 2BY2A 5C9WA 2GJXA 2Q8ZA 1G0CA 2RKXA 5A69A 4GBUA 4C91A 2WAGA 2VZSA 5KZ6A 1AQMA 1EJTC 3FX4A 5HULA 3HQPA 3AS1A 3QY7A 1XRFA 1NU5A 3MHGA 5LZLA 2HVMA 3SY5A 1V7YA 1EQCA 1HO1A 1OQFA 2YL6A 1WP6A 4IWWA 5CG0A 3BL3A 4LRSA 4H01A 1EZWA 3FXYA 4IGNA 1EWDA 4ZO8A 3SM0A 2VDGA 3LENA 4LYPA 1TVLA 3AI0A 2E0PA 4PCFA 1XLLA 3NDOA 3SCSA 3FNDA 1UWTA 1P6CA 5A8MA 3RU8X 3TVAA 1F5ZA 2YOCA 2NV2A 3UJSA 4UBPC 3VAVA 4F2TA 2PTYA 2V67A 4XWUA 3NZPA 3P5ZA 2WHJA 3STGA 4ZBCA 3EX6A 3UZYA 3S6DA 2VXNA 3FHAA 4C90A 1NWUA 3UJFA 3UVIA 3QR3A 3KOZA 2QW5A 4Z2KA 1FDZA 1Q13A 4D6FA 4AZ7A 1ADOA 4RUBA 1U1HA 3MI2A 4O19A 1S1RA 4CUCA 3NGJA 4NX0A 3UGRA 5E1QA 4HA1A 1EPVA 3ELFA 2RJHA 1Z8AA 4DXKA 3KP0A 1UOKA 1ZY9A 2ZDSA 3SFKA 4B2DA 1SMAA 1KFEA 3BZGA 2PURA 4CN6A 3T44A 2QXWA 1AH3A 3OHMB 3AHYA 2P50A 3UY8A 1JPHA 2FZNA 1P0EA 4UR8A 5JBFA 1EP1A 1YYAA 2CBVA 3GNRA 3GW3A 1Q8AA 1TTPA 1SYTA 4MZYA 1DWAM 2Y5EA 1RSCA 4D9PA 3LNMA 1P7TB 3DECA 3SCNA 1NSJA 1DTUA 2BG5A 1V0MA 3R8RA 2AL1A 1OIMA 1KRBC 4MY9A 1GW9A 3NO5A 1TJ1A 3ARUA 3WDJA 1XDJA 3EEZA 1ZJIA 2A3CA 3APTA 2RDTA 3M6DA 2ZKMX 3BG3A 2PF8A 1LP6A 4IMGA 1RD6A 5IDIA 4XAFA 3V7PA 3NQBA 3BH4A 3R25A 3OHIA 3DYMA 1FHUA 3MSGA 2PP1A 4O14A 3VDAA 2YGYA 4NJJA 2VFFA 1A47A 3GVRA 3BC9A 2Y6ZA 4NZ4A 2J24A 2QVNA 4Z2HA 4KWUA 4WZHA 5E93A 1XXXA 1H61A 3GH7A 3PSVA 4LBSA 1R46A 1XRTA 3G1SA 4Z0SA 4UUIA 3NM1A 3ICJA 3TC6A 1UR9A 3WJSA 1P6WA 1XIHA 3VIMA 4JTLA 3BG9A 2HSAA 4MKVA 1FBAA 3M43A 3AHZA 3FJ4A 4D71A 2NVDA 3T0DA 2HEJA 4ZENA 2E09A 3TWBA 3Q4DA 3WSUA 3EWDA 2VEGA 2AMGA 4PCPA 3DI1A 1CLVA 1TPB1 2AAMA 3D5HA 4C6LA 1VYPX 1O12A 3O6AA 3VFCA 4GPNA 4HSNA 2FDMA 5A8QA 3OIXA 1TQJA 2ZX7A 4KH2A 3LSCA 3EOUA 3NOYA 3IIXA 3LCXA 1K9TA 3KL0A 2YA1A 4DUOA 2DT2A 1ZAHA 1BLIA 2XSXA 2HVOA 1SJBA 1V3LA 1E6QM 1W1PA 4Q4RA 4FNSA 1J11A 2DDXA 4BA0A 1AL7A 2H8XA 1GOOA 4BEUA 3N34A 1M68A 5BWAA 1LORA 2BY3A 4G1KA 3M0MA 1U1UA 1GVSA 1GYLA 3G1XA 2YCIX 4RX0A 5I03A 4ACZB 4HHHA 1Q6RA 1MDLA 1UD5A 3WLOA 2ESCA 2EG6A 3GC4A 4X0VA 2WVUA 1SZNA 2J6VA 4AVFA 4AH7A 3XISA 3NZ1A 3DC8A 2J79A 3TAOA 1S5NA 4GQQA 2REQB 3QY8A 4NJGA 1B3XA 3KBMA 4O1EA 3HZ3A 5AC5A 3UEQA 2ALRA 1V8EA 4JYFA 4UOZA 4R27A 4AX7A 3MT1A 2XH0A 3VNJA 3GYEA 1OX4A 2VDIA 3C5QA 3TJ4A 4Y96A 1UH3A 3SJ3A 3TYDA 1A5KC 3WDHA 3U4AA 3QW4B 4CGTA 1XV8A 4S3JA 3WQ5A 3GKFA 3VE7A 3WBAA 3L2MA 3W7IA 1JF6A 4X63A 1B9ZA 2VVSA 4TMBA 3FYPA 2G8ZA 3QZEA 4N9DA 2CWNA 2D23A 1Q2RA 3FKKA 4O8RA 1TREA 1NWRA 1HL2A 2FVLA 2E28A 1BWVA 5M3WA 4KKXA 1MZRA 5FJUA 4MM1A 4FAMA 1OG0A 1WDWA 4F8XA 2GUBA 1OCNA 1TZ9A 2ZZ5A 5FJOA 1KV5A 4UZUA 4QS5A 5C55A 5HWNA 3K4WA 1R2RA 3DFSA 3OTRA 5GPRA 3GBDA 1JCJA 3VIPA 4L4MA 4RL3A 1SFTA 4KCTA 4IGMA 1FCQA 3DU0A 3TZNA 2HPMA 2NXHA 2QJHA 3TC7A 3U7VA 8XIAA 4JXCA 3E0IA 2CZ5A 3ARXA 3NQ7A 4H00A 3LV6A 4GCXA 4S3GA 2ZRXA 3LXBA 2GK1B 4DM2A 4OUIA 3BXWA 4B5NA 1LLZA 3GHUA 3BWWA 2RDXA 4WKAA 2CZVA 1LJYA 3S1XA 3PBUA 3WJYA 3IUIA 3T2OA 4MVAA 4Z1YA 5G2WA 3DERA 4N2YA 1K8CA 4JTSA 3IJQA 4XD6A 4PTXA 1QPNA 3HPAA 3LCGA 3R12A 3NPWA 4DWSD 5H1WA 3PR2A 3CIVA 1KV8A 1UQZA 4ADTA 1EBHA 3W7LA 3N4AA 2QJJA 4DZHA 3BAYA 5AFDA 1RQHA 3G18A 4Y9PA 1PO9A 3QFWA 3LGGA 2UY2A 3AUJA 8RUCA 3DOPA 2Z29A 3UPMA 1KLZA 4AEOA 2E4TA 4ICMA 1JQXA 2PODA 4JQAA 2BZNA 2VZVA 4WDWA 3SRKA 3N17A 4J3VA 4IMDA 5FOOA 4R9XA 1VFTA 1LOLA 2V82A 2BBFA 1XGEA 1POKA 3EWWA 1WNOA 4JYEA 3HB9A 4HU3A 5EYWA 4PFHA 3W1XA 3PK7A 4DI8A 1BYAA 2WWCA 2ZWZA 3NQMA 2MNRA 3MUXA 3TP4A 3LK6A 3WNKA 9RUBA 3EWBX 2BGNE 2D2JA 3WMCA 2BV9A 3P7YA 2BDQA 4KWSA 1B90A 1FH7A 3N3TA 4Q4SA 4XD4A 5H91A 3VKJA 4CQCA 1PKYA 4FX8A 1E3XA 4BFAA 2W61A 2P1FA 3GZ3A 1MXSA 3C2VA 2W0UA 1O1HA 4QLJA 1TE6A 2WHKA 1TWZA 3VGGA 3ABRA 2VNCA 2OSXA 1I6NA 2JIEA 1TA3B 1Q85A 1I1XA 3WLQA 5FIPA 2FTYA 2Q6ZA 5LXEA 3N4FA 3DKLA 3L0NA 2IKIA 3HO8A 4IMEA 4QEHA 1TVPA 4Z2IA 1RLDA 1VEOA 5DFAA 3AZSA 3CQHA 4URIA 3M7WA 2XGIA 2NX3A 2G5WA 2CWXA 3WBEA 1OGSA 1QMLA 3NDZA 3GIQA 3CLMA 3S5OA 3WF0A 3ZT5A 3C3UA 3QFEA 3VD4A 2Y63A 3R8HA 3CHCA 3AJ7A 3WLLA 3KZPA 1L2UA 1M7OA 2QAFA 1XUUA 4MFEA 1XI3A 5DX7A 2OQLA 2DQWA 2WVVA 4ZXOA 1FXQA 3V75A 1UH2A 2OZ3A 5HR6A 2D0FA 2HZGA 4MGGA 4G6CA 2IPFA 3TWAA 1E6ZA 3H53A 1E4IA 4WKHA 3UR5A 2YB1A 1R9XA 3BANA 3NL5A 4LXFA 2DUAA 4G7EB 2VQTA 4WSHA 4KW2A 2Z24A 1XSJA 3VMNA 4PEEA 4JKLA 1UD4A 5AHIA 1GOIA 3EX1A 5AC8A 2FKPA 1V51A 2VRKA 4DJDC 4LT9A 4HK7A 4G7FA 2FZDA 4JTJA 4GA8A 4K7YA 2GLKA 3SEPA 2QQ6A 3WDIA 2JFEX 1LQ0A 3IRSA 1QBAA 3CEUA 3M47A 2BHZA 4B5WA 1VH7A 1UD3A 2I9EA 8TIMA 1R2TA 1W3NA 3RLGA 2R1PA 4FLSA 1J0HA 2JF6A 1ITQA 1TCDA 3R8GA 4JFVA 4RDWA 3E2QA 2FJKA 3VUSA 1BSIA 3WFAA 2PRHA 2I5IA 1AVAA 1H2JA 2PDFA 3W00A 5TIMA 2A2IA 1RQBA 3IJ8A 1FWHC 1TWDA 1VB9A 3BSGA 5DT7A 4YNGA 3GC5A 1QCWA 4DO6A 2VCBA 2HPIA 4HQVA 5EL1A 2BHYA 2V2DA 4XVDA 3JRKA 3UVAA 3W1RA 3W7CA 4GABA 4NL1A 4IL0A 3PUDA 2VYOA 2Q01A 3GIPA 1D7FA 4GXWA 3NVTA 3Q94A 4PSRA 3POHA 1TPH1 1G9HA 1IGSA 3P80A 1BXNA 2Z0IA 3TX9A 1QI0A 5A8PA 1C8QA 4MWAA 2PSNA 3MWCA 1RLCL 1TPUA 2ACRA 3M0YA 1FVPA 4WJ8A 3PC0A 1SW7A 4GOAA 4O18A 1YLVA 4AIBA 2J9YA 3OLGA 4KFPA 2QKFA 3E38A 1TWWA 1B3ZA 5E09A 4K8EA 4HIBA 1F8IA 1X97A 1Q6LA 3TTQA 1W1YA 1J8VA 3BOXA 3MDUA 4HPHA 1UIOA 5T91A 1XYBA 1TJRA 3K5XA 3B9NA 1LL7A 4NAEB 4RDVA 4AWUA 4YIWA 3EXSA 3ZWTA 4HYWA 2O55A 1RPKA 1FP9A 4LEQA 3W22A 5MHBA 4F2BA 1W5MA 3LQLA 3S83A 1G6CA 1Y5VA 3GDKA 1OGGA 1VS1A 3EX4A 5EMUA 1PWMA 3W2JA 1K02A 1ZUAX 1MQPA 4E3TA 1QT1A 4K7VA 3BICA 3M4HA 4KS0A 4BQ2A 2PDMA 1UA7A 3OA5A 5TNVA 1E70M 3K1DA 1D3CA 2R1MA 1YNQA 3W1LA 2WB5A 1ONXA 3H4GA 1XX1A 4F2UA 2I56A 3VPLA 3WCZA 2WKGA 1JZ6A 2CETA 4MB1A 4KEVA 2OO0A 3CIXA 2QCCA 3SIZA 3BMXA 2F2HA 2PCQA 3QV9A 4NZ3A 4XQ6A 1AH4A 1T6MA 4ZA0A 1EOKA 4CN1A 4L7ZA 1R7OA 3LHYA 2NVCA 1REQB 3B0YA 2NVAA 4O12A 7ODCA 4H9UA 4N4PA 4GKTA 4BS0A 7XIMA 5FAGA 1Y8BA 5D02A 2OXNA 1ITXA 3WQEA 1ELSA 3WQOA 4GO9A 1K6WA 3KRBA 1NQKA 5ABHA 4UTTA 1H1YA 1XIEA 3L21A 7REQB 5GJNA 3FCPA 2P3ZA 4UFHA 1I9CB 1ODZA 4HU0A 2R94A 2WC4A 4XZLX 2VTFA 1UBPC 1LM1A 1ADDA 4S2BA 2PI6A 1X6NA 1NAL1 4GQBA 3NEHA 5CSYA 3AC0A 3LCHA 2FPTA 3CZKA 3WO8A 2QMKA 3WBXA 1S2CA 1I60A 4Q6XA 2QUVA 1PZ0A 4DEFA 1A4MA 2VR5A 5LHEA 4NYYA 3JW7A 1AUSL 1GOQA 2FZ8A 4CCDA 5D37A 1LBFA 4JIEA 4Y8FA 3FLUA 5E6ZA 1LBLA 3BJSA 3K8KA 1IWAA 3EDJA 2XG9A 3W02A 3FK4A 5TF0A 4FXJA 4AHQA 2YFNA 2V0TA 4DZAA 2B81A 3GR7A 3U57A 4BQ4A 4UCGA 4IXHA 1W1IE 5ENLA 4EPBC 4UFKA 4ERAA 2ZX6A 3EWUA 1W2PA 2E6AA 2V3EA 3T55A 2WV8A 2G3JA 5JBDA 2A3BA 7ENLA 2WC7A 3KVJA 3HV9A 1QOXA 2WZTA 4WK9A 2D3LA 3L5AA 4QEEA 3OGSA 4PUWA 3BMVA 1R9YA 4LY8A 1IXOA 1TMHA 1E71M 3HA1A 1H62A 4LWWA 2ZX5A 2OLHA 5CBJA 4LUSB 4M80A 1T8XA 3PANA 1BKSA 2OSYA 5I09A 5PTDA 1Z6KA 4JYDA 1H60A 1KW1A 4JFTA 2FHFA 4ROPA 4MF4A 5DEZA 3R43A 5EB8A 2CLFA 4QE5A 3QZAA 4AZIA 2OX4A 2AQVA 2DZAA 1X1NA 4RNHA 2PBOA 2O56A 3MO4A 1DJIA 3S2LA 2Q8XA 3RR4A 2EPKX 5K9DA 3NPVA 1JUKA 4AISA 1HIZA 4Q8WA 1H5YA 2OZ0A 5A94A 1DQUA 2VM8A 3UZZA 4ZEPA 2QT3A 5CZTA 2GWGA 3IVTA 3AROA 1SUXA 4LJ3A 5A8GA 2PWFA 5D9PA 1K9EA 3H4XA 4B15A 2QCNA 1XKJA 4XUYA 4OVXA 4I6VA 3E2VA 3VOJA 4AD5A 4AW7A 4DLFA 3L4XA 3CMFA 4GNVA 3D47A 2OVLA 3HPFA 2PDJA 3CQIA 2P8CA 5BCAA 1KCZA 1Q6QA 2CIPA 3BE7A 3EPNA 2E77A 4RXGA 1S5VA 1UP0A 4HNTA 1JCMP 4MUPA 3PN8A 3COTA 1Q6EA 1ZNNA 4GK8A 1DWGM 4MG4A 4DX3A 5BNKA 1XLBA 1GYNA 2A3LA 1VBUA 2VELA 5I7GA 3F7JA 1PX3A 2CHRA 4XVEA 5CC6A 4LUYA 3CV2A 9XIAA 1PKMA 1EEPA 3WNNA 3K4DA 2XIQA 1A5MC 4LUJA 3N2CA 3LZ5A 3GYCA 5I3GA 2XVKA 1VPYA 1Z32X 4C6DA 3MMDA 1EDTA 3UWWA 4DBDA 4NRRA 2FB2A 5DCDA 3BQ6A 3PTKA 3QHNA 4HZ7A 3U48A 5ABFB 5AYXA 5AVHA 4EWJA 1Z7AA 1HJWA 1W9VA 4K2SA 7A3HA 4LBRA 3SQLA 4RNFA 5BRPA 3E0LA 2QUTA 4CKQA 4Q8QA 3WLIA 4AD3A 5FEZA 4YTSA 2WMJA 2ZX8A 1XRVA 2F7FA 3J7HA 3FVMA 4JN7A 3B8WA 2Y89A 3A4XA 3AALA 1RCXB 3DFYA 4Z42C 1GHRA 1NH6A 1HO4A 3UWEA 5AECA 4GJJA 2O9RA 4GUJA 1KLYA 1NOFA 4ZQNA 4L1GA 1MFUA 1W2VA 4QSFA 5JIWA 4DZ5A 3AJXA 1JPDX 4CVUA 5DLCA 1BGAA 3W7JA 4JTGA 4HYVA 3TR2A 1EL3A 1MWOA 2P76A 1VJZA 1SZRA 1ECQA 3LRLA 4H19A 4LRTA 1UR1A 1VFUA 1FH9A 2L5HA 2PRMA 2PGRA 1SSDA 2IKGA 1M53A 3WN6A 1H3GA 4IT1A 4FNRA 4S2CA 3WBYA 1SZEA 4PB3A 2WMIB 3ONBA 1KWKA 3NQDA 3N3MA 1VRDA 1ZS2A 1NFPA 3PUOA 2INEA 4HJWA 2DVUA 4GI6A 1DIDA 4LNCA 3TA9A 3K30A 3VDGA 5EMKA 2CPUA 3WFZA 1HNYA 3TYEA 3LXCA 3H7VA 1UD2A 1GG1A 4REQB 4ECLA 3T2PA 3FAWA 5M2FX 1PIFA 1MEWA 3MKKA 4UTUA 3JU2A 2GDQA 1S2VA 4HZ6A 2UV8G 1TRIA 5F1VA 2DZWA 4KRUA 1F3WA 1VFSA 3WH8A 3S46A 2O92A 2BHUA 4O4WA 4U2YA 3RO6A 3H55A 3N29A 1DIEA 4YVPA 5B7YA 2YYTA 1SQ7A 2NV9A 4NJKA 1A80A 5HR7A 5IHSA 2GJXB 4E4UA 3UF9A 4IIDA 4D6IA 5CJNA 4AC7C 4XD3A 4CU8A 4Y6GA 1UASA 3GTIA 3BQ5A 3STCA 2YXGA 4KFOA 1CGWA 3IVUA 4J3XA 5D04C 2D0GA 1DQWA 3R10A 3F2CA 4MNKA 3C6CA 1DQXA 5A8NA 2BLEA 4N02A 4KBXA 1PHWA 4J9JA 3GQYA 4FK9A 3TLLA 2UY4A 3UWVA 4ZVJA 3W1MA 5CC7A 2V5BA 4DO7A 4ATLA 2FJUB 4MYAA 2PP3A 2PZNA 1CXEA 3T08A 5KMYA 3GFXA 4JL1A 3OBKA 4KRZA 5HA7A 1R87A 2FIQA 3NQAA 3DHUA 3EKZA 3GDTA 3STPA 3PWAA 4Q4PA 4BR1A 1QNRA 4HTYA 2Z2AA 1HT6A 2VRJA 4QE4A 2ZYFA 1SZFA 3C61A 2Z1VA 2CBIA 3T4CA 3LM7A 2GSEA 4QROA 2HJPA 5K7JA 4H8HA 4AWSA 4NP7A 1JIBA 2OGJA 2VVNA 2ATSA 1DWHM 1EH9A 3PAJA 4Q4KA 4DM1A 2OWWA 3M5ZA 2CKSA 1UA3A 3AU2A 2BFGA 4XB3A 3WL1A 4CCEA 4KQNA 1ENUA 3JS3A 3LBCA 3ZR6A 1VZWA 1U22A 2OKOA 1OVDA 2UY5A 2XH2A 1UJQA 4L5ZA 4BKNA 2KAUC 1P1XA 5HPOA 2PDKA 4LALA 3PBGA 1KQYA 4AZCA 5CXPA 1UROA 2I7GA 4DBWA 3M44A 3GIYA 1L6WA 4UFMA 3B40A 2VGBA 2PTZA 3CT2A 5E6YA 5KEZA 3E02A 1EX5A 1GVFA 2YX0A 5A2AA 3MP5A 1O7AA 1XYMA 1O4UA 3DCPA 1XD0A 3C3NA 4L80A 3GNNA 2EJAA 1RR2A 2OG9A 2WSYA 1CZ1A 2X2YA 1IZJA 1V08A 4JNZA 4C60A 3F2DA 1I1WA 5EMLA 2J27A 5BMXA 3TTOA 1KGWA 5B80A 1JZ2A 1A5SA 4US5D 3NPUA 1Z44A 1Y0EA 2FHCA 1R3RA 3HQ1A 1FWFC 1KQZA 4XAPA 3QRHA 4GUGA 2WYSA 1E1CA 4O1FA 2DU2A 5REQA 1R3VA 3BLKA 3AXXA 4HPJA 1QPRA 4GNJA 4JTFA 3U7BA 4UOJA 1OK4A 3RNDA 3DG3A 1PKLA 1Q6DA 4CNSA 2IXVA 1OYCA 3KVMA 1KCXA 3PG9A 3GO2A 3OG3A 1OFAA 1F61A 1AQ0A 4GFIA 1O1ZA 4H3DA 2XN1A 2VZUA 3IJ9A 2UZ9A 3CT7A 2VR2A 4C7GA 1IEQA 2ZTKA 4UNKA 1O5QA 1VBHA 3S4TA 3A3WA 3U8GA 3UPWA 3B8UA 3O06A 3VD7A 2NLIA 4FS9A 4PN2A 2WMFA 1VFHA 1YKWA 6ALDA 3N2OA 5HQMA 4QCFA 3S8HA 3CAQA 3TOYA 1ZRQA 1BQGA 4XG1A 2VO5A 2VURA 5LIXX 2PU1A 4ATWA 2FVKA 2PEVA 4FSAA 3P84A 1BYDA 4A8IA 3TNOA 1JDFA 5K4ZA 3GH4A 4AHOA 2NX9A 3FJLA 4ORMA 3HF3A