3EX2A

Human orotidyl-5'-monophosphate decarboxylase in complex with 6-cyano-ump
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
257
structure length
257
Chain Sequence
MELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine-5'-phosphate decarboxylase
publication title Lys314 is a nucleophile in non-classical reactions of orotidine-5'-monophosphate decarboxylase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 98
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.4.2.10: Orotate phosphoribosyltransferase.
pdb deposition date 2008-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ex2A00
1IXNA 5K4XA 1LTDA 3SIZA 3UWWA 5D37A 1FQ0A 1QAPA 2WV8A 4JTSA 3S0CA 4UTKA 4O54A 5HUOA 3THQA 1OHLA 1VH7A 4R33A 4NJGA 1FUYA 2UV8G 1WBHA 1Q45A 3DZ1A 4DF2A 3T40A 1R2TA 2Q3OA 5F1VA 1TRIA 3UQNA 3TXZA 3KHJA 1AW2A 1UB3A 3S1VA 4LW7A 2RDWA 3NPUA 1OABA 4LRTA 5CZ0A 2VFDA 3ATZA 2P1FA 2ISWA 3PC0A 3UNDA 5D32A 4AHOA 3LXCA 5BRBA 2XFWA 2XN1A 2V0TA 4UTJA 3EWUA 4LUJA 3HQ1A 3NQ6A 3TMLA 3GXNA 1J4EA 2H8XA 4O19A 3W75A 5H91A 3W1PA 3TQ0A 2C14A 5FF0A 5LNWA 3BGJA 5D2WA 1QWGA 2ZYFA 3MYPA 1BKSA 1YDOA 1ZHAA 1HUVA 2G97A 4RZ6A 3HF3A 3NQCA 3P7YA 3OVRA 2FB3A 2R94A 4KFNA 5D38A 4EIVA 2A0NA 2E5CA 4DBDA 3W1LA 4K7YA 3UPBA 1PV8A 3NR0A 4NXKA 5FEPA 4UCGA 2Y7EA 3EEGA 1YLVA 2IQTA 4N9CA 2FPYA 4AWUA 3CIXA 1H7RA 4K8HA 3OHIA 1O60A 4O18A 2NUYA 3BO9A 1Z44A 2YCEA 3N73A 4P61A 2NLIA 2BLEA 2Q8LA 1LOSA 1NAL1 1TCDA 2VEMA 1BWLA 3CLMA 4PA8A 4FHAA 3LGEA 1FBAA 2A2IA 2GJLA 3H53A 5CKSA 2CU0A 4XTIA 4UUIA 1XBYA 4Y8FA 3LM7A 3W72A 1B4EA 2B7PA 4Z1AA 3P8JA 1Z42A 4M6PA 1KV8A 2C16A 5BOOA 2WQPA 2WPBA 3BLIA 3S9YA 3H55A 4GRSA 3W07A 5K4ZA 1PIIA 2H6RA 4ADUA 4DELA 3O8AA 3WK1A 2ZTJA 3EXRA 2JKPA 1LDCA 3QMSA 4NJKA 1LBFA 2C15A 5EKYA 2YR1A 3W7EA 1Q6OA 2Q8ZA 3G1XA 1KV5A 4GXMA 1TV5A 4MFEA 3SW6A 1Y0EA 1NF0A 3CWOX 3KRSA 4UIOA 1AMKA 5HQEA 4WY0B 3W1UA 4C1KA 3HGJA 5K9XA 4CQ9A 1K8ZA 4TMBA 1RZMA 4M19A 4JYDA 4UNKA 3LCWA 1W0MA 1WXJA 4JYEA 1WBJA 1V7YA 3G1DA 2ZRWA 4AVFA 4N6EA 4NJJA 1AW5A 5CG7A 3B0PA 5AB3A 4LWWA 4A2RA 3W7LA 1QFEA 1DV7A 3NZRA 3M44A 2VEKA 2QJIA 4MKNA 4Z0SA 2Z6JA 5L9FA 3NQEA 2NX3A 4TX9A 2NXIA 1LCOA 3DXIA 4DO4A 4LS0A 3WK2A 3W70A 4LVGA 3UWYA 3R12A 3G0SA 5HINA 1FDZA 4LVBA 3UWZA 1NF7A 4AWSA 4HIBA 3W7GA 1KM1A 1YXDA 5G4EA 4QITA 1W5MA 1P5BA 1JCMP 3TMQA 1VRDA 1VZWA 2QCNA 4MZYA 5KZMA 1ZFJA 3UXAA 2BWGA 4Q4KA 1W56A 3W2MA 1TQXA 5AN7A 3LHZA 4NVTA 3LV6A 3MJYA 3TAOA 5KINA 1HO1A 4J9JA 3GLCA 1WAUA 2RFGA 2V81A 4RXGA 5HWMA 2NV1A 3G1YA 1P1XA 2Y7DA 3PM6A 4BFAA 1D9EA 2WSQA 4XKYA 5CZSA 2R14A 3PY2A 3QF0A 4CLMA 2VFHA 3C2FA 1KM6A 3QQ0A 3S1UA 2RH9A 2C13A 4XBSA 4U4MA 4A21A 5K9DA 5E93A 2LLEA 3EX3A 2TSYA 4D2JA 3PUDA 2JKEA 3NL5A 2HMCA 4OT7A 2FTPA 4O1DA 4OQVA 3CIWA 3S1XA 1QOQA 1N7KA 6TIMA 4IMFA 3GXTA 4AEOA 1PVNA 3G1AA 2KZHA 4X9SA 2YXGA 4K7VA 2V5LA 3BLFA 2J9YA 1QDSA 3NPWA 5D05A 1ONRA 1DJNA 4IMGA 4ZQPA 3NPXA 3TXVA 3QYQA 2QAPA 3GR7A 4MY8A 1J2WA 3W74A 3BK0A 3L0KA 1W5NA 4MUZA 2QF7A 2XN0A 1SW7A 4FO4A 1R2RA 1RPXA 5AC8A 1ICSA 1XBVA 4OGZA 1G4SA 4FNQA 2YZRA 3CU2A 3WJYA 3O06A 3GDTA 2B0MA 2W79A 4O57A 4LV4A 1ADOA 1ML1A 4HHPA 4JNMA 4BI7A 3F4WA 4ZQMA 4JTGA 2ALDA 3AO0A 1SO4A 3TSMA 5G1TA 4WXYA 5EYWA 3DBPA 1QOPA 2NZLA 3E02A 3ABSA 4O8RA 4QM1A 4JXCA 4O10A 4PTNA 1XCFA 2YYTA 3L65A 3JS3A 4XKYB 2A7PA 3M5XA 2YYUA 3W23A 4EF8A 2DZWA 2CWNA 3CEPA 3KVLA 3C2RA 5H2ZA 3BW3A 3EKZA 3IIOA 3GXPA 4UFIA 5FEXA 3W85A 1UUOA 3P84A 1G4TA 3UWUA 1EWDA 1O94A 1TIMA 4JTIA 5LGXA 1DJQA 1NEYA 4PC8A 2VFFA 1KM0A 2X2GA 3KVJA 2WNNA 3LCHA 1EIXA 4YWIA 4O12A 4QJ1A 1F7BA 4RKAA 3W2JA 2I1OA 3RMJA 4OHQA 1GYNA 1LRNA 1H60A 4RV8A 3DFSA 3GYEA 3NL6A 3T44A 3GNDA 5G5IA 1KFEA 2Y7GA 1AK5A 1TTQA 3B03A 4FXSA 3W2LA 5AOUA 4M6QA 1E51A 1ME8A 3A24A 3L67A 3W7OA 3A5VA 4FNTA 3R5EA 1UJPA 4N2YA 1UUMA 4KWVA 1PHWA 1S5WA 5DXYA 1LP6A 3QPZA 3PG8A 3R2GA 1H1YA 4NQ1A 4A3UA 2DZPA 3S5YA 3M0ZA 3N19B 4BF9A 1IXPA 1YXCA 5KZDA 3MUXA 1SZEA 4FNPA 4ZQRA 1OJXA 2Y85A 3TNOA 1W37A 3MHUA 4JTJA 3ZWSA 3G0UA 4O14A 3B8DA 4MLJA 2Y7FA 2TMDA 2ZA3A 1AG1O 1YXYA 1O5KA 3S5ZA 1ALDA 4HNUA 1IF2A 4GUGA 1Q6RA 4NX0A 3EX2A 4PL1A 8TIMA 1XBZA 2DZUA 4JTHA 5FF3A 2H3BA 4PEKA 1RQHA 1CW2A 5CPMA 3W71A 1SZGA 1F6KA 4IQLA 1C29A 3NQ7A 4S2CA 4MFDA 3O16A 1VLWA 3SY5A 3EWWA 3IEBA 4UXDA 3O6CA 3B4UA 3MW7A 1H63A 1LORA 1TPDA 2A6NA 4MLRA 4H6KA 3B0UX 1R46A 3W1TA 4CCDA 2QCGA 1LRTA 4Z1CA 2QCCA 4LS2A 4WOQA 3W7JA 5K9CA 3I65A 1SPQA 3WK0A 4EWND 4E0CA 5A8GA 5L6UA 3N14A 3MWAA 4JX4A 3PUEA 4PL2A 3W7DA 1GEQA 5AHFA 3RLVA 3DI1A 3W1AA 1G7UA 3DAQA 3P8IA 3TW7A 5AC6A 2G5WA 1K3UA 3O6DA 3P62A 5FF4A 2E09A 5BMXA 4A2SA 4TU1A 3LI1A 1TV8A 4PCFA 1H7PA 3FLUA 6ALDA 2Y88A 4QIUA 3M6YA 3T78A 4GUIA 2ZDRA 2C1HA 5AYYA 4OBTA 5D04C 3O07A 1PCKA 1S5VA 2ATMA 3BW2A 3W2NA 1RV8A 3G1SA 3LLDA 5CPLA 4BI5A 4ZL1A 4CNPA 2YDAA 4AXKA 2Z6IA 2HSAA 5CGQA 4WUIA 3HPXA 5T26A 4M7TA 4ZVJA 4DO5A 3L5LA 4MY9A 2QCEA 1OVDA 4UMAA 3M16A 3NXFA 5CPOA 3M7WA 4FNUA 1JVNA 5F4WA 2PC4A 2EHHA 4ADTA 3PBWA 2CLMA 1TB3A 1SQ7A 4HKPA 4LC8A 3TFCA 4UTMA 3MYOA 2YGYA 1ME7A 1VC4A 2WOQA 3NEVA 3M5ZA 5MHBA 1SO6A 1B4KA 4HPJA 4X22A 4O1AA 2V2CA 2C18A 2WSYA 3NAVA 4AAJA 5J5RA 1MEWA 3SSJA 4MIMA 1EPXA 2CW6A 4FX7A 1GVRA 1I2PA 1T0OA 4CQ8A 3HG2A 1QO5A 4CNNA 1I8JA 2A6LA 2J27A 3GAYA 3TFXA 5LNUA 3BVJA 3OG3A 1ICQA 2V9DA 3FJLA 5F2GA 4WY0A 3KAOA 3NG3A 3S8HA 4RLIA 4ALDA 3QRHA 1QNVA 3L9CA 3NGJA 5CSSA 3TA6A 1GZGA 3LERA 3G1VA 3BGGA 1JQVA 3I68A 1KM4A 1P0NA 4HT3A 1LYXA 3JRKA 4KFPA 3C6CA 2W0UA 2ZBTA 3W7MA 4YXGA 2J24A 4NUWA 3G24A 2DZVA 3C52A 1F76A 4WJEA 2WKJA 1OFOA 3M41A 1YTEA 3LV5A 3M43A 2GQ9A 4RZ4A 2H3DA 3O05A 3TC7A 1NFBA 4KWWA 4NNBA 3LTPA 2C3ZA 4CCEA 1TTPA 3TW6A 3QW4B 4UTWA 3P67A 3DFTA 1FX6A 1N55A 4OV9A 3G3DA 1JUEA 4GE8A 3QFEA 2F84A 3S6DA 3W1RA 2VEIA 3FS2A 1LROA 3NOEA 3TAKA 3EXTA 5ABTA 3FJ6A 1FWWA 4QSHA 1SO3A 3ZS4A 1KLZA 4QNWA 4GNJA 4WOZA 4JTEA 3KOFA 4DF0A 3SGUA 4N4PA 3G8RA 1A5BA 1M5WA 4MZ1A 5IBXA 1GJPA 1DOSA 5G2WA 1QPOA 5HJLA 1VPXA 5DCDA 3RLUA 1TPUA 4DEFA 1FWRA 1S5TA 2BSLA 1DHPA 5FEZA 2QEZA 4IPJA 3L0NA 3NQDA 3NVTA 1FCBA 5D33A 4O52A 2O7QA 2QDHA 1K7XA 3LHVA 1XDMA 1ZALA 2ZA2A 4RZ5A 3M5YA 5FI8A 2B7QA 1TRDA 2VOMA 1OX5A 3NA8A 2J6XA 2OZ0A 3W7RA 3N34A 5DY2A 1FCQA 1B57A 3TJLA 4EOUA 1G4PA 2OT1A 1OK4A 1AL8A 4ICNA 2R91A 5AYZA 4JY8A 1ZAHA 4O16A 2Z1BA 1TTIA 2E6FA 3V1PA 1GVSA 2FDSA 4AF0B 5DLCA 3G18A 3UXDA 1DBTA 3BG5A 3GZ3A 2RDTA 1WV2A 4HSNA 1P0KA 1WOAA 4IX2A 2V8ZA 1RVGA 1F73A 1VHCA 2ZZ3A 3HGOA 1TO3A 3IGUA 3MI6A 3LHUA 3NO5A 1KBIA 4OE7A 4UMBA 4CCCA 3CC1A 4O4WA 2GQ8A 3LXAA 4UTTA 1W31A 4NJIA 1TJRA 1W5OA 1SW0A 5F2MA 1EEPA 3CQ0A 1JCJA 4UTIA 4UFKA 2ZRYA 4ZQCA 1FDJA 1SFLA 1T99A 4DPQA 2CZ5A 3IV3A 5AC7A 3NDOA 2Y89A 3KVKA 2CZFA 4MJZA 5K7JA 3L5AA 3NQMA 4NNAA 3PSWA 1KFBA 1W3NA 4FNRA 1ICPA 3I7RA 4Z0JA 2YPIA 1TQJA 3CHVA 1Q6LA 4YL2A 4LT9A 5C5YA 4GFSA 1I4NA 1QPQA 2DJLA 5LKYA 4YLWA 2X1RA 1XUZA 2YFNA 5K3VA 4QQ3A 3IVUA 4HSOA 1W54A 5G1YA 4AB4A 3I7SA 3N3MA 4JDYA 5HULA 4K39A 3TCEA 4E2DA 5KITA 1ZENA 2FJKA 1TV7A 2ATSA 2VFGA 3HG4A 4UR8A 2WNQA 1EA0A 1H1ZA 5HUPA 4AHQA 7TIMA 1VCFA 3NYZA 4UC5A 3L2IA 1P4CA 4HNVA 3W6YA 2H8ZA 1SU5A 3DFPA 1OFRA 1UBSA 3DFNA 2ZRZA 3F4NA 4JS3A 1O5XA 1XUUA 2CZEA 3GKFA 4L4MA 1OFEA 1XL9A 4IMEA 2BX7A 4ZZ9A 2GVLA 2AQWA 5C55A 2X16A 5D2VA 1LBMA 5D03A 4LOCA 3C4UA 3PF3A 1A5SA 2XN2A 4NT0A 3V75A 1QPRA 4K38A 3R13A 3RK8A 4BI6A 1A5AA 4K36A 5LNVA 1QCWA 1JRCA 2OMAA 3DHFA 2ZRXA 2ZZ2A 3NM1A 4WXZA 1GTHA 1CX9A 4BWLC 1OG0A 3KRZA 2QUUA 4X3ZA 1YPIA 3A21A 4UTHA 4FX6M 2PRMA 2NV2A 2CLHA 2B7NA 5EPDA 1TJPA 3STCA 3NQGA 1O4UA 3M1ZA 3ABOA 3G0XA 3AJXA 5HWJA 1GG1A 1KLYA 1YTKA 4AH7A 4DF1A 3PULA 3T4CA 4OWGA 3IVSA 5E1QA 3HPZA 3NZ1A 2Y63A 3W7IA 3GDRA 4K8EA 3MO7A 5E0KA 4I7WA 1G6CA 3O63A 3TROA 4S2BA 1EWEA 1JRBA 3P5ZA 1F05A 4O0KA 1KFJA 2JGYA 3GDLA 3W7CA 2X1SA 4O13A 3SGZA 3SECA 4GUJA 4GC4A 5KZEA 1IIHA 4JTKA 3GB6A 4ML9A 5LSMA 2QJHA 1OFQA 2V2HA 1VJIA 1OYCA 1XXXA 3UZJA 3EWXA 4IPIA 2ISSA 4YCOA 1SFJA 3OVQA 4UFHA 3E49A 2A7RA 3I7QA 1WDWA 1THFD 4IUOA 1DL3A 3RU6A 3PR2A 3PUOA 4Y6GA 1KW1A 1GPWA 2PCQA 3BG3A 1DQXA 1LZOA 3R89A 3QMRA 1GWJA 3DKLA 5DN1A 5AFDA 3UD6A 4UR7A 1NVMA 2FFCA 1AW1A 2I14A 3S1WA 4JEQA 3S5OA 1GTEA 3QMTA 1HO4A 3NM3A 3LRLA 3G3MA 4ZQOA 4LC6A 1X1OA 4UMCA 1ZAJA 5FF7A 1XDLA 1ZNNA 1LLZA 3QEZA 3E9AA 3P81A 5TIMA 2Z0IA 3G1HA 1R47A 1M7PA 1G7VA 2ZRUA 3STEA 4O11A 5A5WA 4R53A 1PHQA 1XKYA 2CLIA 2ZZ7A 2ZZ6A 3W87A 3W7HA 4X2RA 4N9BA 4O17A 4JTUA 5DY3A 3Q58A 4FEZA 3STFA 5F2LA 4UFMA 1TSIA 4NU7A 4WQ6A 4UTWC 3QJAA 2E6AA 3LHWA 1M7OA 2WO5A 4FF7A 3PSVA 1H61A 2X1UA 3NQ8A 3O1NA 2V2DA 2CZDA 2DZTA 3C2VA 4FX8A 1DKWA 5FF2A 3F1QA 4R7JA 2ZZ5A 1X7FA 5HWNA 3TSBA 5IBXC 3HBLA 1OYBA 1YPFA 3QPYA 2ZA1A 3FKRA 2C0AA 1V5XA 3CM4A 3W1XA 4DPPA 2V30A 4UTUA 5C6MA 4ORMA 4UFLA 3ABRA 3GR8A 2X1TA 1SZFA 3G1FA 2A4AA 1WQ5A 3LRMA 1MXSA 3DKJA 5G4WA 3NQ2A 1XFBA 3DH7A 3ANYA 3ELFA 2YX0A 2VENA 3DGRA 3HGSA 1VYRA 2ABAA 3W7QA 2VELA 3LB0A 1K7FA 2Z2UA 1RQBA 2RDUA 2WNZA 1OX6A 3E96A 3TV8A 5D02A 2EF9A 2EAWA 3P60A 3PBVA 4QISA 5AHIA 3PWAA 5KTLA 5LZLA 5D2TA 3STGA 1FCVA 1XM3A 3HO8A 1K7EA 1F6PA 3VNDA 1KFKA 3QSTA 2RKXA 3N2MA 1ZY9A 3WJZA 3MI3A 3IIXA 3SR7A 3LXBA 1TPVA 4GUHA 3W22A 5AHLA 2R8WA 1OFBA 1FXPA 5LHFA 3W7NA 4UTTC 3UYCA 1VS1A 5I3KA 1KM5A 3L5MA 4JTFA 4P2VA 3U6WA 3N2XA 3L68A 2VKZG 3A22A 1PL9A 1IIGA 1KBJA 4NJHA 1GQNA 1EB3A 1KFCA 2E6YA 4ZQNA 1RQEA 3IVTA 4Z1DA 4ORIA 5D30A 1MEHA 4XQ6A 3GAKA 3QM3A 3W73A 4PODA 3L0GA 1B3OA 3TK7A 1DVJA 4LUIA 1HFBA 4N9DA 4E38A 2GVGA 1G69A 3UY8A 3USBA 3LLFA 4O1CA 2VXNA 1R2SA 2H90A 1EP1A 3EX6A 3SZ8A 3CTLA 3HOJA 1GVQA 2NWSA 1HG3A 1ZCOA 3HPSA 3HIJA 5D2XA 3MP4A 1KFLA 1C8VA 2FQIA 3TSDA 2OCZA 3ATYA 3NQFA 1YTDA 2Q3RA 4FXRA 3W3OA 4PFMA 2TPSA 5DBTA 4RCXA 4MZ8A 3DI0A 3B05A 2FIQA 1TPWA 4QAIA 5G2HA 3GKAA 1AL7A 1CI1A 1WYIA 2FPVA 4O4VA 1EP3A 1JCNA 1K8YA 2ZCGA 4WX2A 4GBUA 4LTSA 4AF0A 1TYGA 3MI2A 5SWUA 1VGAA 1SSDA 1LOQA 3CEUA 2D73A 2DORA 1TPC1 4DQWA 5I3GA 1H7WA 2E6DA 1K02A 3LDVA 4I9AA 4OU1A 2RHGA 4K37A 5G2IA 3WFAA 1PS9A 5LNSA 5AHMA 4NNCA 2QDGA 2JK2A 1MZHA 2J9XA 1UASA 2F7FA 2PRLA 3K30A 3TJXA 1W3IA 1BTMA 1L6WA 4LRSA 3LBCA 3GDMA 4HNTA 1F5ZA 1SR9A 1TPEA 3KFTA 3OA3A 4JTLA 1OF8A 2QUVA 3CPRA 2WJZA 3VE9A 4HN4A 4KFOA 4I7VA 1OFAA 4ZMGA 4JX6A 1L6SA 3Q2DA 4Q32A 4HPXA 4OV4A 1VHNA 3W1MA 3U8GA 3LCFA 3NQVA 3A5FA 1XI3A 1OFDA 5AHEA 3LTSA 1JR1A 1MSSA 1JQXA 1N8FA 3W86A 3OVPA 3Q37A 2QCDB 5F1UA 5C54A 2CLEA 1EX5A 2E1DA 1SUXA 4JDBA 5HNRA 3BARA 1U5JA 3FA5A 3NL2A 1TREA 4RR4A 3IIVA 4RXFA 4UFJA 3HG3A 3TE9A 3TC6A 4JD4A 1FDYA 4B5NA 2QKFA 4I7UA 4QNEA 2CLKA 2FLIA 2GVJA 4NXSA 1W3TA 1QMLA 4A22A 3QW3A 4MY1A 1H5YA 2C6QA 4WZHA 3WJSA 4R34A 3PB2A 4Y90A 4IOTA 5CPNA 3UWVA 1L9WA 2VC6A 4CNOA 3KX6A 2BXVA 5AYXA 2GPTA 1M6JA 2OT0A 1RR2A 3L21A 1GT8A 3EKLA 2QCFA 2BTMA 2QJGA 1LM1A 1F2JA 2A1YA 1H62A 1Z48A 3LTYA 1BEUA 1EUNA 1FWSA 3SFKA 4FB7A 3DFOA 3TQVA 5U4NA 5IM51 2B4GA 5EMUA 3W88A 2QCHA 3W83A 3M9YA 4O50A 2A85A 2GJNA 4Y9AA 3VE7A 2BZNA 1OK6A 2OJPA 3KXQA 3OBKA 2O7SA 3W84A 4G1KA 2EGZA 5DBUA 1GVOA 2ZFAA 4FNSA 1LBLA 1QPNA 3HJZA 4LS1A 5HR6A 2V82A 3FYPA 1GVFA 1TPB1 3TH6A 4M5PA 4WD0A 1T96A 4JX5A 3PVFA 1I2QA 2NX9A 4IGHA 5FESA 3TQKA 1RD5A 1KM3A 5GVJA 3WK3A 4TO8A 3QSRA 3DU0A 1TPH1 2Y6ZA 1LRQA 3HG5A 3QZEA 4GWEA 1IXQA 1KTBA 1QR7A 3GIYA 4BK9A 4XTDA 4U28A 3EWBX 1X1ZA 1XC4A 3P80A 1KTCA 2E5DA 3FOKA 1S3HA 5F4SA 5EBUA 4JIQA 4XZ9A 4O1BA 1Q6QA 1A5CA 1YYAA 4EF9A 3NPVA 3W7PA 1I45A 3H54A 1VLIA 3N9RA 2X30A 3O15A 3TKFA 3MHGA 4E2BA 4AHPA 1FXQA 3MBFA 5AHNA 1YDNA 3EB2A 4O53A 4IWWA 2HTMA 4AWTA 4K6AA 1GG0A 2J88A 4A29A 3IGSA 4RX0A 5J5DA 3GVGA 3W1QA 3FFSA 1X6UA 4JR5A 2NUWA 3IGXA 4NX5A 3BV4A 4RK8A 5U7SA 3PG9A 2C19A 1HTIA 1FY6A 1I2OA 1LLWA 2V5BA 1T8XA 2NXGA 4ONVA 3GK0A 1DORA 4MOZA 4S1FA 1YADA 2DU2A 4IMCA 3ZR4A 3M5VA 1L2UA 3T55A 3MBDA 5LGZA 4Z1BA 3LOTA 1OF6A 3LHYA 3E12A 2B7OA 5KSWA 2HS6A 1WX0A 2TRSA 2NX1A 1JJKA 5DELA 1X8FA 3P74A 3KRUA 1GYLA 1FWTA 2DZSA 2TYSA 2PURA 3E0IA 5CZJA 3LCXA 3IRDA 4O0ZA 3W2UA 4XUGA 3ZWTA 5BMWA 2PRHA 2AGKA 3P61A 1VCVA 1ZJIA 4N4QA 4CQAA 5F2IA 1J5TA 1G67A 1LOLA 1I2RA 4L4LA 3MMTA 3LCLA 4MPQA 4IX0A 1D3GA 2CLLA 1VYPX 4MJMA 2QUTA 4YMZA 4M6VA 2QAFA 3RF9A 3U2OA 3VFLA 1OYAA 3W76A 5HMSA 3LCGA 2DJXA 3UY7A 2NWRA 1XBXA 5I3IA 3EXSA 1ZAIA 2OX1A 4C1LA 4IXXA 2QR6A 3C61A 4JYFA 2QCLA 1TMHA 1L6YA 1JCXA 1KA9F 3DHDA 3ZFHA 1W5QA 2AAMA 1KM2A 4JN6A 4DBEA 5I3JA 3G22A 3P5YA 1JCLA 4LVFA 2PE4A 1JUBA 2GOUA 3WJXA 1EP2A 3GX9A 4Y96A 5DCBA 2YSWA 2ISVA 2GUUA 2ZZ4A 5I3FA 2DZXA 3IIZA 3DENA 5KMYA 3NNTA 1PE1A 3LX9A 1FCUA 2A7NA 4N02A 3WJWA 2CFFA 3LI0A 5BW6A 1IGSA 4LVAA 3T7VA 3QC3A 4TR9A 4NZFA 3BLEA 3CB8A 4FIRA 1BWKA 1JULA 2VEPA 1OX4A 3EX1A 2JGQA 3EWYA 3THAA 3CWNA 3CT7A 1W1ZA 2CLFA 2ZQ0A 3UZ5A 3IIPA 2E77A 3EX4A 5HR7A 1A50A 1F74A 2A21A 1MO0A 2VFEA 4JGDA 3C3NA 3W1NA 1D3HA 4GUFA 3I6RA 3NL3A 2HS8A 2J9ZA 3SJ3A 2ABBA 1JCYA 3OEXA 4XWUA 1SZNA 1VYSX 2NXHA 2E68A 5TQLA 3R8RA 3UPWA 1H50A 4H4IA 4TIMA 3D0CA 3EWZA 5DXXA 3BPWA 1YDVA 2YFOA 3PB0A 3BW4A 3GDKA 1I2NA 3INPA 3PAJA 1EUAA 2ZZ1A 1KTNA 4W9TA 3C2OA 4AMAA 1H7NA 3F03K 3YPIA 3B0VC 3TIMA 4LU0A 4DXVA 2CLOA 4H3DA 4TMCA 4M7SA 4JIPA 4HNNA 1WA3A 1R30A 5CZTA 1NSJA 4KKXA 3HGRA 5D09A 3LBMA 3UWQA 1C9DA 1ME9A 3MP3A 3JR2A 2GQAA 4YCPA 4UTLA 3DFQA 1W8SA 2YW4A 2EKCA 2W6RA 3HMJG 5CSRA 3BG9A 2YW3A 3TUUA 3SI9A 3ABQA 1A53A 1GOXA 3PBYA 1G4EA 4FIQA 1JUKA 1SO5A 2P0OA 1MEIA 5LHEA 1SW3A 3VI2A 5F4XA 2QCMA 3TX9A 4Q33A 3VCRA 1TTJA 2I9EA 4O28A 5D2YA 1HL2A 4O15A 3PBUA 2G95A 4UNLA 3LHTA 1VR6A 3L66A 3C0JA 2Y62A 1FWNA 3N9SA 5TBOA 2Y70A 4JY9A 2JKAA 4Z08A 5DCEA 4JTTA 1OX4B 3O6YX 3PS7A 1WOBA 1H51A 4EVZA 1TPFA 5BNKA 1U83A 4JICA 3OIXA 4XBKA 3TU9A 2G96A 4IXHA 2Y61A 3KVMA 1VCGA 4IJBA 2WSRA 2ZTKA 3B04A 4MYAA 2JBMA 4IMDA 3FEMA 3C56A 4POCA 1Q3NA 4BWLA 4LVDA 1QO2A 4LY8A 3FYOA 4RJEA 2P10A 3A23A 4ADSA 1PCWA 3TDFA 3FIGA 5EA9A 1IXOA 3Q94A 3NQAA 1K03A 3MHFA 4MVAA 1B9BA 3W9ZA 2QCDA 4N9EA 4N6FA 2FB2A 1VQTA 1DQWA 4BR1A 3S5NA 4NZJA 1OFPA 3A9IA 4GJ1A 2A5HA 1H7OA 3B06A 3M47A 3LRKA 2NUXA 3VKJA 3TR2A 5K2ZA 2EPHA 4LV9A 3QQ1A 3W2KA 4LNYA 3RFAA 3RNDA 5LNRA 3C2EA 1SSGA 5C2XA 3HB9A 1Z41A 1O95A 5I3HA 3MP5A 4DO6A 4WY0F 2DP3A 4MYXA 1H7XA 3QH2A 3C8FA 3W7KA 2E5BA 3S42A 2FPTA 3GNNA 3FKKA 3LCIA 1K8XA 5EY5A 2VFIA 3G8EA 1W5PA 5FEWA 5EL1A 1UCWA 4PH6A 2ZRVA 3P82A
chains in the Genus database with same CATH superfamily
2YDQA 4ECLA 3SIZA 2D1ZA 1FQ0A 1QAPA 3LNMA 2WV8A 2QMJA 2PTZA 3AZSA 1R9ZA 2ZXDA 1NFPA 4ICCX 1MQQA 1VH7A 5HUOA 1FUYA 3MDUA 1Q45A 3UR8A 4R9OA 3H2AA 3KM8A 5LA1A 1P6BA 3UR2A 3AXHA 3LUTA 4AZCA 1AW2A 2F8QA 2FHFA 4MAZA 3FA3A 1MQPA 2Z29A 4GYJA 1S1RA 4UBPC 3UNDA 5C9ZA 1TWSA 5BRBA 8RUCA 2HWGA 3NQ6A 3TMLA 1J4EA 1LL6A 4Y9MA 4Z1YA 4IICA 5FF0A 1GOIA 4GXWA 1QRQA 1QWGA 2ZYFA 3MYPA 5AKQA 1ZHAA 5D8ZA 1HUVA 2G97A 4RZ6A 5TD4A 4GPNA 2ZX5A 2FZDA 2A0NA 3NR0A 4JFWA 5FEPA 3SEPA 3M6DA 4UCGA 1O5QA 2Y7EA 2QZRA 3S1GA 6TAAA 1ISXA 3GH4A 2DIEA 1S5NA 4P61A 5FOOA 1XYFA 2I17A 1LOSA 3AS2A 1DJZA 2DUAA 2W62A 2QPXA 3DG6A 4GK8A 4FHAA 2GJLA 1EKOA 2J7EA 4LF2A 1XBYA 3EPNA 2B7PA 3T0CA 1UQZA 1XIDA 2ZDSA 4XUYA 3FCPA 1UR0A 3WF4A 1MDLA 1FHUA 3M0VA 3BLIA 4AZIA 4F0LA 4AX7A 4DJEC 3VNIA 2ZTJA 2JKPA 1LDCA 1KBKA 4NJKA 1UYQA 5JU6A 2YR1A 2Q8ZA 3TEVA 2HK1A 4AZCB 1Y0EA 4Z2IA 1MUWA 3CWHA 3BOXA 5JBEA 1TMQA 4ZA0A 1EEXA 3HGJA 3BAKA 5HDRA 2QGHA 2V5KA 4YTSA 5JVLA 1CLKA 1W0MA 1WXJA 4RE3A 1WB0A 4JYEA 1PB0A 4N6EA 1JDCA 3WEMA 3BLPX 5AB3A 2DQXA 3W7LA 1P0EA 1BD0A 1CZ1A 4AZGA 4Z2GA 1DV7A 1H41A 1B3WA 4AYGA 1ZJHA 3F5JA 5DX7A 2Z6JA 4Z0SA 2PI6A 5A8OA 4Z2KA 4TX9A 1ITXA 2NXIA 1LWIA 3GC2A 1VIZA 4L64A 4DXXA 4LS0A 4D71A 2ZC8A 4LVGA 3G0SA 4EK7A 2V5DA 2YKKA 4LVBA 1NF7A 3WFZA 4HIBA 3OYXA 1YXDA 4XZLX 1OADA 1W5MA 4QITA 1UH2A 4MZYA 4Q4KA 4H83A 4E3VA 1TX0A 3NDZA 3MJYA 1UG6A 3TAOA 3NWRA 1IEWA 1V7AA 2RFGA 3WD4A 1PO9A 3FVMA 2EPLX 4RXGA 3AUJA 3LSBA 1RCOB 2Y7DA 4BFAA 3QKZA 2WSQA 3N17A 4UB9A 4PSRA 1YQ2A 3QF0A 2DH2A 2VFHA 3C2FA 1KM6A 1G9HA 4OECA 3WQ6A 2XUCA 4WDTA 1JZ7A 4XBSA 3SUVA 2PD9A 2Q8XA 3HJEA 4YVXA 1JZ4A 3BAJA 4DXKA 2PZ0A 3E0WA 4NRRA 3WLHA 3S1XA 2PEVA 3UG3A 1XCXA 4IMFA 3GXTA 3ZLGA 4K7VA 5BOFA 3M0XA 2RAGA 3MSDA 3S5SA 1DJNA 3FDKA 4ZO8A 1W17A 3PK7A 3GR7A 1QVBA 3SGGA 3W0KA 3B8WA 4C6JA 3AWNA 4R85A 2VR5A 3BK0A 3MCOA 4MM1A 2FH6A 5DEZA 4WSKA 2WCGA 3A64A 1C7SA 4F40A 3CH9A 3S2JA 5A6JA 4AIOA 1XBVA 5FSEC 1XLCA 1XLAA 4CCZA 4LUTA 4O57A 3SURA 1ADOA 4W85A 4ATWA 1IEXA 3SY8A 3F4WA 4DYKA 2ALDA 3TSMA 1BVZA 4ACYA 1HZYA 3G1RA 3E02A 3ABSA 4O8RA 2OQLA 4QRNA 1CXFA 1KBLA 2XFFA 4PTNA 1FHDA 3WO8A 4ERGA 3UESA 3BZGA 1G5AA 1FHVA 4B3ZA 2CWNA 3CEPA 4I6VA 3EA3A 4WJ8A 3C2RA 3D5HA 2EG8A 4H6QA 4MTVA 5EB8A 4IM4A 4UFIA 4HPGA 3THUA 3UWUA 1O94A 5A6BD 1IT0A 5E09A 2YCLB 3VINA 4PUNA 2X2GA 3PNZA 2WNNA 3LCHA 3N11A 3MV11 1B30A 4O12A 1F7BA 3W2JA 3PAOA 1BSLA 4QLKA 3RMJA 4OHQA 2WLZA 2G37A 4ES4A 3SQLA 2W27A 4U33A 1JDFA 4XSMA 1LQ2A 3WD3A 1P7TB 1E51A 3WH9A 3L67A 2O4MA 4N2YA 1UUMA 1EC9A 5DXYA 3WLIA 3RPDA 1RPKA 3KOWA 4IIFA 2I16A 4KEVA 4LUTB 3ECQA 1XWYA 3BOFA 2Y85A 3TNOA 2VX6A 2O9OA 2O56A 4W8BA 1H2JA 4B91A 2XVKA 5I00A 3GC5A 3ARXA 2QIIA 1W1B1 4NX0A 8TIMA 1UA7A 3MMWA 5CPMA 1SZGA 5A8QA 3ARPA 2AQOA 4BEUA 2D2JA 2HVNA 4S2CA 3IEBA 3B4UA 1H63A 1I1XA 1V6WA 3W1TA 2PLCA 3KL3A 4WOQA 3W7JA 3I65A 3WK0A 3T1GA 4X0NA 3RJXA 4EWND 5A8GA 2Z2AA 1GEQA 3RLVA 1RY0A 4E3TA 3V4BA 1G7UA 2G5WA 3I3DA 1XLGA 1TV8A 1H7PA 6XIAA 1C3FA 1I9CB 1Q2SA 4GUIA 5AYYA 2PDHA 5HJXA 4OBTA 2QXWA 3O07A 1IE7C 2GQ3A 1UROA 1WUFA 4NI8A 4AVNA 3BUVA 2YDAA 5CGQA 4WUIA 4M7TA 5BWFA 4NAEA 4DO5A 5PTDA 1EDGA 1R9YA 4TV6A 4XZIA 1KRBC 5HNUA 3O9NA 1XSKA 3C3UA 4HHLA 2PC4A 3UW6A 2J7HA 3GO2A 4HNOA 4KH2A 2XFYA 5CC5A 4UTMA 1K77A 3MYOA 1TFVA 1US3A 5MHBA 4MNLA 2IPFA 1VD6A 2P50A 3NAVA 5J5RA 4QLJA 1EPXA 4ZCWA 3UG5A 3JZEA 3HG2A 1SMAA 4BQ4A 4CNNA 4AD4A 4W88A 4XD4A 3OG3A 1VPQA 1V08A 2QULA 5F2GA 3KRBA 3KAOA 4ALDA 3QRHA 3UPMA 1KXQA 5DO8A 5CSSA 4PMQA 3NUKA 4RNIA 1GZGA 1DIKA 1V3JA 3USZA 3E2VA 1TWDA 3KOXA 4W7UA 4MJ2A 3BGGA 3I68A 1L8NA 2ZBTA 2WMIB 3P2VA 4YXGA 2J24A 3C86A 1F76A 4DYEA 1VBRA 2WKJA 3M41A 3M43A 2H3DA 3VU2A 1XSJA 4NNBA 1RAKA 3WUGA 3BH4A 3RIKA 3UZZA 4PMUA 1SZRA 1ZBVA 4GE8A 3QFEA 1FFRA 2PDWA 3FS2A 3NOEA 1XHGA 3EXTA 4LBSA 2BG5A 1FWWA 1SO3A 2CPUA 4WOZA 1TR9A 2DT1A 4H9VA 1UA3A 3H22A 4DF0A 1PYMA 3LEPA 3EEZA 3WD1A 4LXFA 2ONEA 1GJPA 4DZHA 5DCDA 1TPUA 3FY1A 2GUBA 1S5TA 2BSLA 1DHPA 2QEZA 2EBNA 4IPJA 2BY2A 1VRXA 5C0QA 1FCBA 4I6KA 4O52A 2J66A 4QEEA 1HKIA 5AYBA 1ZALA 2ZA2A 2PDUA 2VJXA 4RZ5A 2SFPA 5FI8A 5A6LA 4LQ1A 2OPJA 3VGEA 2XSXA 1V3KA 3NA8A 2J6XA 3W7RA 2OZ3A 3N34A 3TN5A 4F0HA 4EOUA 3U5YA 1OK4A 4G8TA 4IZGA 5EMMA 2E67A 4O16A 1TTIA 2VX4A 2PP1A 5A1AA 3V1PA 2J62A 1TWZA 2KX9A 3CMJA 1J10A 1DBTA 2RDTA 5A6TC 4DZAA 4HSNA 1P0KA 3TLQA 4Y2WA 5BZAA 1F73A 3VOCA 4ML4A 4W89A 3HGOA 1YHTA 3WLTA 1J96A 4UMBA 4CCCA 1VEPA 3KUMA 1QOXA 1US2A 1TWIA 1SW0A 5F2MA 1UR8A 4JHOA 3RX3A 3T81A 3CQ0A 1JCJA 3ZSTA 1QU4A 2ZRYA 3CZ8A 2VX7A 3IV3A 5AC7A 3OB8A 3VIGA 1X1NA 3U3HA 3AIQA 3B8SA 4Q6XA 3GH7A 1W3LA 4LEQA 3OLDA 2DJLA 4XZNX 3UT0A 2X1RA 3RM4A 4Q7BA 3IJLA 4QQ3A 3PZMA 1YRRA 1RSCA 1W54A 2CWXA 5CAKA 2EXOA 1PX4A 3GVWA 2FJKA 3FYYA 4GYPC 5CJNA 3V5CA 1H1ZA 1PPIA 1ZU8A 3QKEA 1KGWA 2QNEA 4DN1A 4HNVA 2H8ZA 3DFPA 4CQBA 3DFNA 1ZUAX 2PWUA 1E5JA 3WLPA 4JNYA 1XL9A 1ZRQA 3B9DA 1A4LA 4WIWA 2V6AA 3QV6A 3GS6A 3C4UA 2YXOA 1XYMA 2E0PA 4K38A 3RK8A 4BI6A 2GGJA 3TYCA 2PD5A 5LNVA 4A4AA 3E1F1 2ZRXA 4WXZA 1GTHA 1CX9A 3KRZA 4BA0A 4GVIA 3OU8A 2ICSA 1YPIA 1WE5A 1XYBA 3TJ4A 4NZ3A 2NV2A 3QGVA 2B7NA 5EPDA 3SCWA 4HOWA 2IPGA 1HJSA 3NQGA 1R86A 4RNJA 1WNOA 4JFUA 1K4HA 1MFVA 1YTKA 1OCBA 4AH7A 3PULA 4DWSB 1FA2A 2A3LA 2INEA 2PWGA 3W7IA 4PB5A 2PP0A 5T8GA 2PDKA 2Z2BA 1EWEA 3SCQA 5IDZA 3UCQA 3UR5A 1KFJA 3W7CA 3SGZA 2J4GA 5BYWA 3BSGA 3VD7A 1AD1A 1DPMA 2QJHA 2V2HA 3EA1A 1NWUA 1XXXA 3H2CA 1KCKA 2Y5EA 2ISSA 5A95A 4YCOA 1W9VA 5A8MA 3PUOA 3BCJA 3AXKA 3BG3A 1DQXA 5DRCA 2WBKA 3K5XA 1EJTC 1VF8A 3KS6A 5HNNA 5DN1A 5AFDA 2FFCA 1AW1A 1MQRA 1RBLA 1YPXA 3TJIA 1PSCA 4JQ2A 4ZQOA 3A13A 3DCPA 3SCNA 1R3SA 3UJFA 4UMCA 5FF7A 1XDLA 1ZNNA 1LLZA 2Z1KA 1UJQA 3GTNA 3MKCA 3E9AA 2W4XA 4D6IA 1M7PA 4O11A 2L5HA 5A5WA 3WYZA 3OGSA 4KWOA 1XKYA 2CLIA 2ZZ6A 3W7HA 2EG7A 2GDQA 3URQA 5CG0A 3Q58A 4FEZA 3M0JA 4GJJA 3BQ5A 1PZ1A 4FF7A 1ONWA 3U7BA 1UWIA 4BEQA 2JE8A 1B3YA 1QI5A 4LAZA 4PRTA 3WL0A 3GG7A 1XLIA 2ZX8A 4KRUA 2ZUNA 2ZA1A 3FKRA 2C0AA 3O0KA 4H9XA 3UXKA 4A3HA 2VNCA 4AYSA 3MUY1 1CXKA 3UETA 1UP2A 1BXCA 4ZGYA 1F3WA 5C6MA 2EO7A 4UFLA 3MZ2A 2X1TA 2FZNA 3V16A 1IT7A 4PMYA 2XZ7A 3COTA 1FP8A 3VKBA 7XIMA 5IRPA 4DI9A 3DGRA 4AFYA 1FOBA 3HGSA 3VABA 2WNWA 3W7QA 2VELA 2XWEA 1RQBA 1OX6A 3E96A 3IJ6A 4HOZA 3DYPA 4ZENA 5LZLA 4GY7A 1XM3A 4UNIA 3QSTA 1EPVA 3N2MA 5T91A 2RGMA 3SR7A 4AC7C 1U1HA 2VGGA 2JFEX 3AS3A 4GUHA 1ISYA 4LEFA 4AZ7A 2WMKA 3URNA 1XPYA 4P7NA 4P2VA 3ZVHA 4B16A 3L68A 3WD2A 1B31A 3L4TA 1DJYA 4Q8WA 1EB3A 5BXPA 2E6YA 4ZB2A 3IVTA 3K2GA 3W28A 3WMLA 1SR0A 5D30A 2IPWA 4WSHA 4HTYA 4DWSD 4U2ZA 1DVJA 4LUIA 1TA3B 4N9DA 2GVGA 3UY8A 3AISA 3M4HA 1V6TA 3USBA 3H7UA 2QUMA 5JMUA 4Z2LA 1R2SA 2H90A 4GVFA 3EX6A 1GVQA 3HFTA 4HJFA 2OOGA 3HPSA 2QV4A 2ZX7A 1S2WA 3CASA 3GR4A 3TSDA 4HK5A 2D24A 1UIPA 1V3LA 1YTDA 1OGBA 4YJ5A 4BCEA 4FXRA 5DBTA 2WWCA 4RCXA 1CCWB 4GX9A 4XIMA 2FIQA 2GVYA 1HW6A 1TPWA 5DMYA 2BY3A 2G4JA 3GKAA 5G2HA 1CI1A 1E3ZA 1A5NC 1XF0A 1K8YA 2AL1A 2XGZA 4WX2A 1OCNA 3MTWA 2X8RA 4AF0A 2HQAA 1T5AA 2CHOA 1XIIA 3ARVA 3AMLA 3CEUA 2DORA 4TVCA 1J2BA 3GBDA 3VGBA 1EGMA 5I2UA 5TNVA 3B9NA 4TTUA 3VDCA 4UWMA 3SRDA 3WFAA 5ABHA 5AHMA 2JK2A 1US0A 3RX4A 3VIMA 5M17A 1W3IA 3MANA 3W25A 1F5ZA 5LXEA 1X38A 4PMRA 5MF5A 2FJUB 1MW0A 2QUVA 3NEHA 4W7VA 4KFOA 3XIMA 3BLDA 3ZVHB 1S38A 3RHGA 1PX3A 4OV4A 2BXZA 3A5FA 1OFDA 1OIFA 4Q7NA 3LTSA 4LB3A 1JQXA 3CK5A 4B4FA 3U0HA 2FMOA 4R9XA 2P88A 3U57A 3AIEA 1W3HA 1EX5A 1TREA 4RXFA 3WEOA 1FDYA 4MKVA 4US5A 2QKFA 5CEWA 3CHCA 2CLKA 1L2QA 2FLIA 2EEXA 1E73M 3MT1A 1QMLA 4A22A 2DIJA 1RLCL 2C6QA 4WZHA 1E1CA 4Y90A 3GSMA 1L9WA 2J8FA 1AQMA 3M0YA 5AYXA 1M6JA 2QCFA 1F9CA 2D0GA 4DZIA 3PPFA 5A2CA 1H62A 2PWVA 3RDKA 4CEUC 3LTYA 1FWSA 4XAPA 2X0HA 1I0DA 2P5NA 2MNRA 2GSJA 2QCHA 3NQBA 3W83A 5HXMA 4TXEA 1GVEA 1NIUA 4AD5A 1CGYA 1RHCA 2B31A 3OBKA 1Z32X 2O7SA 3W84A 4G1KA 2EGZA 3VIOA 2C7FA 3U2EA 3GRIA 5GQBA 1QPNA 3MV01 3FYPA 2XWDA 1TPB1 2YL5A 3ZVIA 1IR1A 1T96A 4JX5A 2F61A 1JDAA 3N18A 4IGHA 1KM3A 4H8UA 1JNEA 3WX7A 3QZEA 1UMLA 3TP4A 4F4RA 3AIVA 1XR2A 4JFVA 3R11A 1BF2A 4DO7A 1KTCA 2E5DA 3SRFA 4MWAB 2ZWYA 4JIQA 3OODA 4O1BA 1Q6QA 1TKKA 1Q6DA 3N9RA 1YNYA 4E2BA 1F61A 4AHPA 1FXQA 3MBFA 3O3RA 3W01A 4RDZA 1KGXA 3EB2A 4O53A 1ZLPA 2CBIA 4K6AA 4HP5A 1XC6A 4A29A 3IGSA 1Q6GA 3N12A 3WNKA 3BV4A 5U7SA 3BMWA 3VNZA 3WBWA 3VOHA 1I2OA 2V5BA 1T8XA 4XZWA 4ONVA 5RUBA 3VD9A 1PUDA 2DU2A 3NO3A 4K3ZA 1E55A 2HPMA 5I3DA 1L2UA 3URAA 4NL1A 3FX4A 1JZ5A 3L7RA 5LA2A 1WZLA 1R38A 4HJWA 4RPQA 4WVXA 2OYLA 3SRKA 3SUTA 1ZSXA 2NX1A 1LG2A 4V33A 4LBUA 3AMKA 1BAGA 1KXHA 3FW6A 3IRDA 3W2UA 3ZWTA 4A3YA 9CGTA 4S23A 2AGKA 2RJHA 4CQAA 2DT0A 5F2IA 1G67A 2HCVA 4M51A 2BY0A 2DSKA 4W8LA 4GY1A 3FK4A 5IFPA 2OZTA 3CLWA 1RP9A 1UUQA 3SAZA 4BQ5A 3W76A 1T8QA 1KWKA 1KRCC 4K8GA 4V27A 4JYFA 3PNUA 3QN3A 1KA9F 2HE5A 3DHDA 1KM2A 4JN6A 3URBA 4C6FA 2W63A 5I3JA 4E6MA 2J78A 4L1WA 1OGSA 3POHA 4O8AA 2PPGA 4G7FA 1IEVA 5CJ5A 2CESA 1JAKA 4GJIA 5LYRA 3CNYA 3GXMA 4A35A 2W5FA 3OZOA 1FCUA 2W3ZA 3QGAC 2OQYA 4N42A 4LVAA 2VVSA 3IACA 3LQLA 4TR9A 4JCMA 2CBUA 4CN4A 4EACA 4MF4A 3ENLA 4XSLA 4S3DA 4ZOAA 3EWYA 3CWNA 5HQMA 4Q6JA 3FAXA 2CLFA 2ZQ0A 3IIPA 2E77A 2PAJA 1A50A 3BZJA 3EOEA 3LU2A 3W1NA 4JHMA 1HJWA 3NZQA 1RBAA 1UBPC 4CD4A 1RD6A 1FH7A 1SZNA 3UPWA 3T09A 1JIBA 2FKPA 3AMDA 3EWZA 4GQ0A 4J3ZA 1UP3A 1JZ8A 3PJTA 1FWJC 3HV9A 2Z1XA 2Q71A 3B40A 4MWAD 4GBDA 2O55A 3UVAA 5CZTA 3HGRA 4UCFA 5DANA 4H9MA 5D4YA 1JZ3A 1P1MA 1QI2A 3FGCB 4UTLA 2ZX9A 3Q65A 2W6RA 3BWWA 4OIFA 3BMVA 1JUKA 5LHEA 3CH0A 1SW3A 4U3AA 3CUHA 1TTJA 4RE0A 4PTXA 2I9EA 1HL2A 1OD8A 1Q8AA 4UNLA 1VR6A 3LHTA 4LCRA 5FA5A 4YYFA 3A3WA 4KWUA 3C0JA 2ZVRA 5TBOA 4ERIA 1QJWA 4HOXA 1AH3A 5DCEA 4QJ3B 1DTNA 4JOMA 5DMLA 5CC7A 4FAMA 2VDGA 4UOQA 1KR1A 5AZ1A 1XIHA 3TU9A 3KVMA 1OY0A 3WF2A 2JBMA 3BXWA 3MWCA 1QO2A 3T0TA 4H01A 1QTWA 1E6XM 2P10A 2BGQA 1UC5A 2WHKA 3E74A 3MHFA 2FGLA 4A8IA 3W9ZA 4N6FA 4J3SA 1DQWA 5C2CA 1KQZA 4HA0A 1OFPA 5CZKA 4G9PA 3KBSA 3A9IA 4GJ1A 2A5HA 2CHRA 1XFCA 2CKSA 3M47A 2NUXA 4GFIA 3VKJA 4DUOA 2EPHA 4LV9A 4IGSA 1RJQA 3KLKA 4LNYA 3RNDA 1J18A 2PDIA 3H7RA 1WPCA 3GE7A 4IQJA 1E40A 5G4HC 2DP3A 1H7XA 1XRSA 3ARQA 3OGVA 2H9AA 1EA9C 4QQUA 4JTCA 5ABFB 3FKKA 1K8XA 4J28A 4I5RA 5EL1A 2PDBA 1UHVA 4PH6A 2P8BA 2ZRVA 4QS5A 3GU9A 3IJ9A 4CN1A 3WSUA 2FVKA 3EZ4A 1UQYA 4J40A 2NW0A 1AMYA 4W4QA 2D69A 4YYCA 1VP5A 2X7WA 1WBHA 3DZ1A 3A4AA 1G1YA 3VIIA 4D6EA 4Q4OA 5F1VA 3R0DA 2OTDA 2DDXA 5FACA 4NP7A 4HU8A 3R8HA 1XLKA 4KCTA 3RCNA 3CZJA 2AKZA 4LRTA 1LQAA 2HVMA 2P1FA 5HPCA 1PYFA 5LIWX 3GTIA 3TW9A 5D32A 4AHOA 4ZSTA 4TTGA 2XFWA 3CO4A 4U2YA 2V0TA 4UTJA 5H91A 3W1PA 3UJ2A 3TQ0A 2C14A 3E3HA 5AECA 2GSHA 2PTXA 2BNJA 5JBDA 1POKA 2FMNA 1HJVA 3RG6A 3P7YA 3OVRA 2FB3A 1IGWA 5D38A 3RO8A 3BLOA 1PV8A 1FRBA 2IQTA 4N9CA 4K8HA 1O60A 1R87A 3O7UA 1L6GA 1NOUA 1GNXA 1YX1A 3V0TA 2NUYA 1IR2A 3BO9A 3VYLA 3BGAA 3N73A 4ZE5A 1SM9A 3ZQ9A 5KETA 4GGBA 2GYIA 3EB4A 2Q8LA 4Q4PA 1VBJA 3GXFA 4BJHA 4L7ZA 4FXJA 4PA8A 1F07A 1FWIC 1BPLB 1FBAA 2A2IA 2XM2A 2PODA 5IFTA 3ITTA 5CKSA 1Z89A 3ZR5A 3O2LA 1B4EA 2WHJA 1VFUA 1K9FA 3AUOA 5FAJA 1Z42A 4M6PA 1KV8A 4NY2A 2PZNA 4UOJA 3S9YA 4GRSA 2QPUA 3P3BA 3APGA 3PZNA 2H6RA 1F3TA 1S5MA 3LQGA 4FLOA 3CAVA 3FEQA 2FYMA 2C15A 3W7EA 3GQYA 2E25A 4WSJA 3IJIA 1KV5A 2EG6A 4GXMA 3EOUA 4MFEA 3SW6A 4UIOA 2ZUSA 1GORA 1J12A 5CQ1A 3W1UA 3OTRA 4C1KA 1K8ZA 4NSBA 4TMBA 3RCMA 1UPPA 1AQFA 1NDYA 3LCWA 4C91A 1W9DM 3XISA 3O6AA 3WNLA 4PMVA 1V7YA 3G1DA 2TODA 3AHXA 1B2YA 3RJYA 1AW5A 2VC7A 4LWWA 4NAFA 4QTGA 1EFZA 4UZUA 4NHVA 4MKNA 2NX3A 2VWTA 3NQEA 1TUFA 1RY8A 5DQPA 3NTYA 2AMGA 1LCOA 3ALFA 4H9ZA 3U4FA 4ZBCA 2IKIA 4I3GA 5HINA 1BFNA 3PN8A 4KPLA 1BTCA 1EJ7L 4PYSA 3UWZA 4AWSA 1OZMA 1KM1A 3RRAA 1P5BA 1JCMP 3WN6A 1VZWA 2YL6A 4MB4A 3PBGA 1NDWA 4D72A 1K6WA 5KZMA 3UXAA 2HBXA 4GVGA 1W56A 5AN7A 4L9XA 4NVTA 1HQTA 1HO1A 4J9JA 1WAUA 4MWAE 4KEZA 1MW1A 2V81A 3OIHA 1P1XA 5E0CA 1HKWA 4PMDA 3MS8A 5CZSA 3PZGA 1N2VA 2C13A 4U4MA 5K9DA 5E93A 2LLEA 2F6XA 4US6A 2JKEA 3NL5A 4Q8MA 4QBXA 1WP6A 3CIWA 1XKJA 2UWFA 2KZHA 4X9SA 2YXGA 3BJFA 1ITCA 2V5LA 2WMGA 4F79A 2J9YA 3S2NA 5D05A 1ONRA 3GNXA 4NAFB 1DXEA 4PGLA 1A0CA 3R10A 4YHGA 3E5PA 3W74A 3WQWA 1WXYA 2WWDA 1KRMA 2F38A 1W5NA 1UOKA 4G7EA 5EMKA 3QZAA 4F0MA 4HCDA 4FO4A 2VZUA 3LSCA 1UP0A 4XVEA 4OGZA 3P14A 3B9OA 2PDJA 1Q7MA 3KE0A 1YBQA 3O06A 3GDTA 3TTEA 4YN5A 2EJ1A 5C9XA 1ML1A 1BXBA 4TQTA 1T40A 2XSAA 4OUIA 4HZ7A 2OLSA 1JPIA 4ZQMA 4S38A 1F8IA 3AO0A 4JTRA 1SO4A 3EOOA 5EYWA 2NZLA 3VIHA 4AQLA 1AVAA 4QM1A 4JXCA 4O10A 3VKCA 2YYTA 3LA4A 4FP1A 4EKJA 3L65A 2F6UA 2YYUA 2DZWA 1UR3M 1PZ2A 4GD0A 3B3DA 5H2ZA 3BW3A 3EKZA 4KEMA 1I6NA 4IFKB 1UUOA 1H5VA 3P84A 3ARTA 3GFXA 1TIMA 4JTIA 5FJPA 3W53A 5LGXA 4E4FA 4PC8A 3HFYA 2Z1WA 2DV0A 1ADSA 3F7JA 2VR2A 1KM0A 5AVNA 1IWAA 1U2YA 4YWIA 4QJ1A 1Q7ZA 2YCIX 3KW3A 4MB3A 1WZAA 4L1XA 1P0DA 4S3AA 3VVGA 2QJNA 3B03A 1TIWA 1E9ZB 4S3JA 4Q4RA 1A3XA 4RW5A 1JPKA 3CPGA 3W7OA 1UD4A 1E9LA 1B9ZA 4KCUA 5FJIA 4KWVA 4S3GA 4HU4A 1PHWA 3GFZA 1LP6A 4UTFA 5D9NA 4DRSA 3N19B 1YBQB 4BF9A 1WDDA 1TVLA 2G3IA 2PDMA 3VGDA 3N15A 3D47A 3MHUA 3CHFA 3ITGA 3B8DA 4Q22A 4MLJA 4QEHA 4A3QA 4Q4QA 1AG1O 2IKJA 4GUGA 2WZEA 3A4XA 1Q6RA 2XFRA 3MSYA 4AD1A 3U5UA 3LGDA 2H3BA 4PEKA 4EP8C 3AXIA 3WENA 1HL8A 3SBFA 3VCCA 4J3UA 3EWWA 2QQ6A 1MW2A 4UXDA 3MW7A 1LORA 1TPDA 2A6NA 1MWOA 1OWQA 4H6EA 3AZTA 5K9CA 3GY1A 4K1WA 1PBGA 4AX6A 2HXUA 4E0CA 3APYA 3KBWA 3FDGA 4JX4A 3PUEA 4IP5A 1HP5A 1J6PA 3HM7A 4IL0A 9XIAA 4TU1A 5KEZA 3LI1A 2BVWA 3FLUA 3RR4A 6ALDA 3UXIA 5HPOA 1Y7VA 3OLIA 3IJ8A 3PTDA 2C1HA 5HOSA 4C7DA 3TTOA 4EXAA 3IPWA 1JGMA 4I8DA 1W2VA 2OFJA 2KAUC 3BW2A 2A3BA 3W2NA 3SCRA 1RV8A 4ZL1A 4Q8QA 2HSAA 3HPXA 5T26A 5CSUA 1EJWC 3ARUA 3IUDA 2QCEA 1OVDA 4UMAA 5CPOA 5JBFA 4FNUA 2PBOA 4XZHA 5F4WA 3TN4A 3PBWA 1TJ2A 1TB3A 2CITA 1FWGC 6ENLA 1VC4A 2W67A 2W66A 3DX5A 1J0IA 2OSXA 1SO6A 1B4KA 2CXGA 3PTKA 1XGZA 1QW8A 4A8LA 2VZVA 1AD4A 2C18A 1MEWA 1PDYA 4MIMA 2CW6A 3PFRA 3KS5A 1UMYA 1QO5A 5I07A 2QJJA 1QBAA 3RX2A 3GAYA 3IK4A 3BVJA 3BICA 2V9DA 3VIJA 3FJLA 3MQTA 3UZXA 4WY0A 3S8HA 3NG3A 3OZYA 2VWSA 3NGJA 1XIMA 1W1PA 3WG6A 3G1VA 2WCAA 1JQVA 1HJXA 1KM4A 4HCHA 3W02A 4KFPA 4QG8A 4NUWA 3C52A 3MZNA 2BOEX 4K1GA 3O05A 1MYRA 1DWHM 4GYFA 4D9PA 2YLAA 1OB0A 2DY3A 4OV9A 1LUCA 1MDRA 4HU0A 4WF7A 5IHRA 1LROA 1NOFA 4QE1A 5ABTA 5D9OA 1JD9A 3FJ6A 4PMXA 4JL2A 4GNJA 1CXEA 3KOFA 1NM9A 3SGUA 4MZ1A 2OO6A 1CGXA 3T8QA 1B0IA 4C1NA 1QPOA 1VPXA 4EPBC 4B90A 3L0NA 3NVTA 4JKKA 4H41A 4B5TA 3LGGA 1PWLA 3AHZA 4GACA 3LHVA 1XDMA 2YXXA 1B54A 1TRDA 3FXYA 2GGEA 1OX5A 4R7WA 2OZ0A 1B3XA 3VMOA 2QVNA 3PANA 1FCQA 4KBXA 1G4PA 4ICNA 3PZTA 1EDQA 5AYZA 4A8RA 1J0ZA 2E6FA 2C91A 4YHEA 1JD7A 1RLDA 2FDSA 3B8VA 3WIJA 5E5CA 5BXTA 3VNLA 2HNHA 3VX0A 4AZ5A 1WOAA 4IX2A 3GZAA 1VHCA 3VDHA 2J8GA 4DLMA 3IGUA 3LHUA 3NO5A 4GZJA 2GVEA 3IJQA 2EPMX 5AYIA 2OKOA 2Z00A 3U2ZA 1V0KA 1VAHA 3EAUA 2GQ8A 4NJIA 3WNOA 4GABA 1EEPA 2JEPA 3Q45A 3ZZ1A 2Y5SA 4UTIA 2HDJA 3WFLA 5A2AA 1FDJA 3WDRA 3NDOA 1NU5A 3KVKA 2CZFA 5K7JA 3NQMA 4NNAA 1EC8A 4FNRA 1LUCB 1ICPA 4Z0JA 4NRSA 1TQJA 3ZM8A 1Q6LA 4EXQA 2IPJA 3HMCA 4GFSA 1CDGA 3DN5A 3V0UA 2P3ZA 3ZJ7A 4YLWA 2CERA 3CQKA 3WUFA 3RGTA 1XV8A 3AQUA 2FZBA 1BQCA 3IVUA 5G1YA 2DPEA 4GO9A 4JDYA 4C1NB 4K39A 5E9XA 2PDYA 4MDPA 4XG1A 3MMDA 1ZENA 3CV7A 1TV7A 3HG4A 4J2MA 2WMHA 3L4ZA 3DFYA 2C71A 1LL7A 1FH8A 1VCFA 4RE4A 4UC5A 1P4CA 1UC4A 1S46A 3WLQA 4MG4A 1JXKA 1OFRA 2WVUA 4C60A 3KEHA 3NO1A 3F4NA 2EPNA 3GKFA 2CZEA 4L4MA 1TZ7A 4IMEA 3ITOA 2BX7A 5I79A 2GVLA 4HQVA 3PPGA 5C55A 3WEZA 5D2VA 1LBMA 4ZSUA 1MXGA 1KRAC 3DIPA 2XN2A 4WK9A 3DC0A 4NT0A 3ZJ8A 3V75A 4BS0A 4NZ4A 1DWFM 1A5AA 5CPQA 8XIMA 2OMAA 3DHFA 5G1MA 1EX1A 5CLWA 3NM1A 3WQVA 1ZBCA 1PJ9A 4GG9A 2CYGA 4BWLC 1YE6A 2PWEA 4X3ZA 3A21A 1A3HA 3HV8A 5LA0A 2VRQA 4H00A 2PRMA 3HZ3A 1E9YB 3S6OA 3EWCA 1O4UA 4MNKA 3ABOA 3G0XA 2JF7A 4FF5A 4G6CA 3I3EA 2DVTA 1FFQA 3AAMA 4DJFD 1CLXA 1IZCA 2QMKA 4DF1A 1XIGA 3B9AA 5EU9A 3TYDA 5HMFA 3NZ1A 3S9IA 3WLLA 2Z25A 3MO7A 3SY1A 2QIWA 1VPYA 3P93A 4UQ9A 4I7WA 3TROA 1Q6FA 4S2BA 1KKOA 4AD3A 3GDLA 1D8CA 4O13A 3SECA 4CUCA 2ASHA 4GUJA 4GC4A 1NARA 5KZEA 3V36A 3GB6A 4ML9A 5LSMA 2O0TA 3BC9A 3UZJA 1JI2A 1V6VA 2XJ7A 3U48A 4L1GA 2Y8KA 1O68A 2OB3A 4LJ3A 4EAYA 4IUOA 4GZIA 3RU6A 1KW1A 1GPWA 3UU0A 2PCQA 2D3LA 4Y7EA 2OYMA 1XP3A 2X41A 3R89A 1XH2A 3UNTA 3DKLA 7PTDA 4XZMX 1R7AA 1Z8AA 4ILSA 4S3EA 3UD6A 1NVMA 2BHYA 2BVDA 4U5IA 2YIHA 5FL0A 4FS9A 3S1WA 3S5OA 1HO4A 4PRWA 4LC6A 1BRLA 1EHAA 3JW7A 1QBBA 3OZPA 4IG2A 3WLSA 3WDPP 3KDNA 1XIEA 1G7VA 3ITVA 2CHNA 3ZT7A 1PHQA 3BOLA 2ZZ7A 8CGTA 1HXJA 1YE4A 4O17A 3STFA 4WKHA 1F6YA 4GH1A 3WQ8A 3E2QA 4GQRA 2Y0FA 4X61A 1ZBWA 6CGTA 3LHWA 3QV8A 4TX8A 2Y24A 4AMCA 1M7OA 2O9RA 2X1UA 4DJDC 2WKLA 2P0IA 4AW7A 5BCAA 2QUNA 1A5OC 1DKWA 5FF2A 3F1QA 4R7JA 3T6CA 2MANA 4CN6A 2GSEA 2ZOXA 3CS2A 1FWEC 2D23A 3VAVA 3GW0A 3F2BA 7REQA 1V5XA 1LT8A 2GFTA 3W1XA 1XCWA 4DPPA 1XS2A 4ORMA 4RDVA 4NASA 4C6DA 4KGLA 2BDQA 3ARSA 2PF8A 1XFBA 3NQ2A 1REQA 2ABAA 3IWPA 4MADA 1K7FA 4TUFA 1E6SM 2WNZA 3Q67A 3UCDA 4Q3MA 5A6MA 5D02A 4QISA 1M68A 4WKFA 3PWGA 4OFCA 5D2TA 1FCVA 1BXNA 4HZ8A 3S9ZA 4KCVA 1KFKA 2RKXA 3MI3A 4IG2B 4HMCA 2E8YA 1TPVA 5AHLA 4DYJA 3N3TA 3W6MA 1OFBA 3PFMA 3W7NA 3UYCA 3L5MA 4JTFA 3U6WA 4C6LA 3A22A 1KWGA 2VZSA 1IIGA 3M0KA 1KBJA 3R7MA 1GQNA 3T4WA 1KFCA 5DFAA 4ZQNA 2A3CA 3M46A 4ORIA 3QZ6A 4B5XA 1CXIA 4XD3A 3KDOA 1G69A 1VFHA 1RCXB 4AY8A 4FLRA 2NQJA 5FJTA 1V51A 3LLFA 1V79A 1EP1A 3VA8A 3SZ8A 3CTLA 4GNVA 2FHCA 4IP7A 5BU6A 3WMBA 2FTYA 4PUEA 2W91A 1ZTVA 1KFLA 3F2CA 1K9TA 1UR4A 2OCZA 3ATYA 3FNDA 1TMLA 3W3OA 4PFMA 2TPSA 2ZUTA 3B0XA 4GYKA 2WZIA 4QDMA 2VP8A 1Q13A 1YMYA 1DIOA 1A0EA 1OCJA 1EP3A 1REQB 3OZMA 3KTSA 2BOFX 3MI2A 5SWUA 2GJPA 1X6NA 1TPC1 3KTCA 1JAEA 1UWSA 2DFAA 4I9AA 4OU1A 5EFFA 3QYSA 3W37A 1PWMA 1FHLA 4V1YA 2QDGA 2DSVA 1UASA 2F7FA 3BANA 7ODCA 3OA5A 3K30A 5GNZA 3TJXA 5CBBA 3EWDA 3GDMA 3KCJA 1TPEA 3NSNA 3OA3A 4QCFA 3CPRA 2WYSA 3VE9A 4HN4A 1OFAA 3DEQA 2J7FA 4JX6A 3LBOA 3P0WA 3WDJA 4WGXA 4BZYA 1MSSA 2XH4A 4HCLA 5BXSA 3Q37A 2QCDB 5F1UA 4F2UA 5C54A 4C6CA 2E1DA 1LJYA 1V6UA 4F9JA 2YL8A 1TX2A 1QWKA 3BARA 3DGBA 1U5JA 1PKNA 3NL2A 3QLDA 4RR4A 1OC7A 1BYBA 4WLCA 3HG3A 3TE9A 2ESCA 3CAWA 4B5NA 3KWXA 4I7UA 1A5KC 5DMNA 4XAGA 3ORWA 2C1GA 2GVJA 4NXSA 4HPNA 2ACSA 2OVLA 4PUWA 3GHTA 3QW3A 1GZ1A 1H5YA 3ANUA 3WJSA 2BODX 5A69A 2XYLA 2B81A 5CPNA 4FI4A 2GK1A 2VC6A 3PZUA 9XIMA 2GPTA 2OT0A 1M1BA 1GT8A 3EKLA 2BTMA 1T41A 1LM1A 4Q7IA 1F2JA 2WHLA 1Y5XA 2PC8A 4OTKA 3FJ4A 2VI0A 2CKRA 2Z24A 4FB7A 3DFOA 5ECUA 4LYRA 3KP0A 4E5TA 5IM51 2B4GA 1GQLA 3W88A 3W24A 1GQIA 1RJRA 3MCNA 2A85A 1QT1A 4Y9AA 3VNYA 3VE7A 4RUBA 3BV7A 4DJED 2GWGA 1OK6A 1KBBA 2OJPA 4LAUA 3CJPA 2VRKA 2OGYA 5LIXX 1GVOA 4FNSA 3ZMRA 2CC0A 5HR6A 2V82A 1GVFA 2J13A 3TH6A 5JH1A 4M5PA 4WD0A 3VUPA 1KCLA 1M04A 3CV2A 2NX9A 4GQQA 3POCA 1L6FA 3WK3A 3QSRA 2ZE3A 3HG5A 3NCOA 1IXQA 1KTBA 4G5DA 1JCTA 3HA1A 1ZL1A 4LAOA 4WHBA 1CECA 2V3EA 2VDIA 1XC4A 1S3HA 3NJ3A 1GEHA 2XH7A 5EBUA 1A5CA 1UZ1A 3OG2A 3OOQA 5FJUA 4IPPA 2X30A 4M8UA 4HZMA 5AHNA 1ZP4A 5CLTA 3T42A 1XQLA 1GG0A 4HMDA 4QDWA 4RX0A 4WRHA 3FFSA 2UY4A 2FDMA 1X6UA 1YNQA 4JR5A 2NUWA 2ZIDA 1FWFC 4GNKB 3PG9A 1QK0A 3GHRA 3FA4A 1HTIA 3EGJA 5GNXA 1Q6EA 5E6YA 3ABXA 1ZBKA 2NSXA 5EFDA 4S1FA 4IMCA 4YVVA 3KLLA 3LOTA 4M6UA 2R6OA 5GJMA 2R1MA 1U22A 3NFUA 4KERA 1TZZA 1JJKA 4FMVA 5C8BB 2IXUA 1FWTA 2PURA 1E72M 3E0IA 4OOZA 2A3AA 3E0VA 3UZWA 3P0XA 3WDHA 1A47A 2C0HA 1TE6A 1UR9A 5BMWA 4XD6A 3GG1A 1DYSA 1D2KA 5E0FA 3A4JA 3TQPA 1I75A 8XIAA 1ZJIA 3TYEA 4N4QA 1XGEA 3T0AA 1WKDA 3UR7A 1I2RA 4L4LA 4DB7A 1CIUA 3MMTA 4CVUA 3VILA 4IX0A 2PDPA 2R1NA 4H9YA 1GK8A 1HX0A 4MJMA 3SQSA 1E0TA 1CBGA 4M6VA 4GGHA 1DJHA 3CMGA 3N2CA 4K68A 3LCGA 3UY7A 3QHOA 3GNRA 4QR6A 4JN7A 1XBXA 3NSMA 5I3IA 3EXSA 2G4FA 2OX1A 4MAVA 3V5FA 4F8XA 2QR6A 2PGFA 1L6YA 3ZFHA 3LNPA 2AAMA 2CETA 4W5ZA 4MB5A 4MMWA 1JZ2A 4OBSA 4DBEA 3P5YA 1BSIA 4Y9NA 1JUBA 2GOUA 2AQVA 5DCBA 1V77A 2GUUA 4NG3A 2XG9A 2E8ZA 2ZZ4A 1W91A 2Z1VA 1DIEA 3DENA 5KMYA 1UZ4A 4Y9OA 4PTMA 1GW1A 2XGIA 1MUMA 1UW9A 2DZAA 3MJMA 1JI1A 3AU6A 3E2RA 3CYJA 2OEMA 3R0KA 4ZO9A 5C9WA 3QC3A 2WPGA 1OBAA 2HXTA 4GI6A 4NZFA 3BLEA 3CB8A 4GO8A 1JULA 2VEPA 3ZT6A 3N2OA 1CTNA 1OX4A 3ICJA 3WQOA 1RUSA 3ZIZA 2PWHA 1EXBA 2XGBA 1E9IA 1V8EA 2X7VA 1JYVA 3BTNA 1F74A 2A21A 2XVNA 1IEQA 5BRQA 4V15A 2G8ZA 2YDSA 3NL3A 4FK9A 4FOKA 3NVDA 3GUWA 3NIYA 1JCYA 2WSPA 2NXHA 2E68A 2POZA 3PTQA 4C6BA 3GWQA 2VEFA 1UWAA 4U31A 1H11A 3BPWA 2WQDA 2YFOA 3GBEA 3OBAA 4QSFA 3V7PA 3GDKA 1I2NA 1EUAA 2ZZ1A 1SYTA 1H7NA 1EQCA 3TIMA 4DXVA 4H3DA 1R30A 2WLYA 3LBMA 3BLLA 3JR2A 1XJBA 3EOSA 1W8SA 1O1ZA 1HJUA 2E9LA 3L4YA 1CPUA 2YW3A 3TUUA 3SI9A 1A53A 4R88A 1HVXA 1MFUA 4KRZA 1G0CA 1SO5A 1MEIA 2NQHA 1GOKA 3L4UA 4P7QA 4GYPA 4GKLA 3R43A 3TX9A 4C6KA 4P7RA 2QT3A 3BSMA 1XLHA 3K13A 2VEGA 1XPGA 2G3MA 2GJXA 3ZYZA 4GLEA 1EZ2A 4JAWA 4QFUA 3W81A 1JGIA 3L66A 1ECQA 2DVXA 5ECVA 3KOYA 4PSPA 3N9SA 4JY9A 2ACRA 1A80A 1YNPA 4IMAA 4JTTA 1OX4B 3UBPC 3GTFA 1WOBA 4EVZA 1U83A 1JL8A 2G96A 2Y61A 5JIPA 1FKXA 4B5WA 2WSRA 3B04A 3FEMA 4POCA 1OT2A 1Q3NA 3LZ3A 4LVDA 2VD8A 4GX8A 3AWOA 4LY8A 4H9UA 1W1YA 2WHMA 4M56A 4QCEA 1MI3A 1CNVA 4ADSA 4Z17A 3FIGA 1IXOA 2PTYA 2X40A 1K03A 3NQAA 3R94A 3PZVA 3CHDA 4TOQA 1WDSA 1DP0A 1H0IA 1V6YA 1L0PA 4BR1A 3S5NA 1UKTA 3UCCA 3CB3A 1H7OA 3KBMA 3B06A 1ZB5A 2UY3A 3AIBA 3TR2A 1S2VA 3N2TA 1TZ9A 1EYEA 2VZOA 1AFSA 1SSGA 4FLSA 3PJWA 4B4HA 3HB9A 2O92A 3SCVA 2GOKA 3PPHA 5H1WA 3W7KA 2PDCA 3DBNA 1JPMA 3NXLA 4M3PA 1M7JA 1NELA 3G8EA 5HBFA 2REQA 3F4DA 1UCWA 2GJXB 4YNGA 3P82A 2V38A 4GZEA 3UJEA 2CIPA 4QJ5B 1LTDA 2HV5A 1H09A 3R0UA 3UWWA 1LF1A 3H2EA 5D37A 2Y2WA 4REQA 5HJYA 3N25A 1NWTA 4UTKA 4O54A 1EJVC 4S39A 3THDA 1DTUA 4GH3A 4IPLA 1ZGDA 3T40A 1NFGA 4UQAA 2QYGA 3MVIA 4YS1A 5CJMA 1QPKA 2Z7KA 3R6IA 2OSWA 1TRIA 4B92A 5A3HA 3JU2A 2C79A 2DW6A 2RDWA 5EMLA 4JN8A 4B2DA 2QGYA 3WL1A 4DUXA 1QNOA 3ATZA 1D7KA 1UD2A 7TAAA 2W9MA 4B9ZA 4FSAA 3G6MA 4C6IA 2XN1A 3EWUA 3HQ1A 4IH3A 3GXNA 2H8XA 3M0HA 1AQHA 1R85A 1AQ0A 4KETA 3S47A 3R4IA 5D2WA 1EOMA 1PXGA 4CD6A 3RUBL 1YDOA 2OOFA 1DXFA 3HF3A 3R8GA 4M1RA 4KFNA 1BLIA 2VYOA 3QGKC 2E5CA 3WUBA 2HISA 3W1LA 4FR1A 4K7YA 2I7GA 3UPBA 4NXKA 5I02A 3SO7A 3RPTA 2AGTA 3WLKX 4R5EA 2XHYA 1YLVA 4AWUA 2FPYA 3CIXA 3VMPA 2YL9A 4HK7A 1VFOA 2FGBA 3MA8A 4IQEA 2WVVA 1EO5A 4XV0A 4NAEB 1E71M 1Z44A 2NLIA 1NAL1 1TCDA 1GOMA 2VEMA 3CLMA 4HU3A 3IS4A 3LGEA 3OYZA 1B1YA 3H53A 2HBVA 4MGGA 4XTIA 4UUIA 4LSBA 2O9PA 1M01A 4S3FA 4HA1A 4CKQA 3ITYA 3CUFA 2PP3A 2C16A 5BOOA 4UQEA 2WQPA 2WPBA 1MRQA 3H55A 3UF9A 4D1IA 2BFGA 5K4ZA 5C7HA 4ADUA 4DELA 3O8AA 3G2GA 4KW2A 4AIEA 2PDQA 4O1EA 1NTHA 1A4MA 1C93A 4CU6A 3G1XA 3TYZA 1TV5A 3CQJA 2X0SA 3KRSA 5HQEA 1KGUA 2FTWA 1RZMA 4JYDA 4UNKA 3QVQA 2ISDA 3BMXA 2A3HA 1KD0A 1WBJA 1EXPA 1H49A 3GXIA 4J2PA 3REQA 2ZRWA 3EDKA 1W9PA 3RO6A 3B0PA 2HPIA 2WBGA 4JFSA 5DMMA 4A2RA 5I06A 1QFEA 2Z4GA 3M44A 2VEKA 1Q6CA 3NURA 1J6OA 4HYVA 5B7ZA 2QF8A 5L9FA 1UWRA 3WLJA 2PWFA 4D6GA 3T0DA 2VRJA 3DECA 4DNMA 3DXIA 4DO4A 4ACZA 3IAQA 5C2GA 3C5QA 3R12A 5CC3A 1FDZA 4NZ5A 1UD5A 2WVVB 4R7OA 3NZGA 3W7GA 5G4EA 1TELA 4H7ZA 1XYCA 1I60A 1VRDA 4GMEA 4NZCA 4JQ3A 2BWGA 4ROQA 4PMZA 1TQXA 4KMQA 3LV6A 5KINA 1U1JA 2QS8A 3VGFA 2VTFA 5HWMA 2NV1A 3G1YA 2XIIA 5M03A 2XVGA 1D9EA 3V35A 1PZ3A 3C0LA 2BOGX 3AYSA 2R14A 4RZBA 3QQ0A 1WKFA 3CIVA 4M24A 2Y1HA 3S1UA 3R79A 4WGHA 1KXTA 3KBNA 2TSYA 2GGHA 4D2JA 3IUHA 2WZTA 4PMNA 4OT7A 2FTPA 4O1DA 4A8NA 1QOQA 1GJUA 1N7KA 2PLMA 3SM0A 4ATDA 6TIMA 2DSZA 3G1AA 3QXBA 2F6KA 4JQAA 3BLFA 4CNUA 3WF1A 3REQB 2XIMA 1QDSA 4DM2A 2VO5A 3TXVA 1NWRA 1KQYA 2HROA 1F8MA 3MKKA 3VDAA 3DHUA 4MUZA 1JDEA 4IP4A 2QF7A 4HB7A 5D9PA 3MUIA 3TWBA 1PEZA 3ITXA 1R2RA 1RPXA 4TVUA 5AC8A 2ZXQA 3K1DA 1G4SA 5A8PA 2YZRA 7ENLA 1QHZA 3CU2A 4EPDC 2B0MA 3RITA 4LGXA 5EGRA 4BI7A 2GUYA 1Q7QA 4CD5A 3VOFA 1R3YA 4JTGA 3MY9A 5D8WA 5G1TA 3K8MA 4EXBA 3HU7A 1O6IA 3WCZA 3VM7A 4ZE4A 4DAIA 2ALRA 1SJAA 1XCFA 2PFHA 4KRTA 4FPSA 3JS3A 4JIHA 3W23A 1VKFA 4KWSA 4PUMA 2XM1A 4J5NA 4E4PA 4PR4A 3E0LA 2BVTA 2XINA 3IIOA 3DG3A 3GXPA 3H4GA 1J93A 5FEXA 3W85A 3W6LA 1IZKA 1TCMA 3VZZA 4Z2HA 1EWDA 4B2DD 3KCOA 4XIAA 5E70A 4GIRA 4XX6A 3KVJA 4XD5A 4AIBA 4RKAA 4YIWA 1DWGM 2ZUUA 3ZO9A 1LRNA 1H60A 1QATA 4RV8A 1XQKA 3DFSA 3GTHA 1XRVA 4JQ4A 3NL6A 3T44A 1HNYA 3GIQA 1XLFA 2NVDA 3GNDA 1N8WA 5G5IA 1AK5A 3VD5A 4FXSA 1V03A 2XIOA 3W2LA 2JF6A 1WZMA 5AOUA 4M6QA 4CVWA 1TG7A 3A24A 4KIRA 5LIUX 4DM1A 3R5EA 1UJPA 2VUNA 4YVPA 1S5WA 5FD0A 3QPZA 2PTDA 1H1YA 2G3NA 4QROA 1NDZA 2DZPA 1J79A 1JPDX 3S5YA 3M0ZA 1IXPA 3FN9A 1YXCA 5KZDA 1SZEA 4IIEA 3EPOA 4ZQRA 1ENUA 1PAMA 1XLLA 4LALA 1W37A 3VDBA 2P3EA 4BKNA 2VL4A 1E4MM 2TMDA 1LQ0A 1YXYA 4HNUA 4BF7A 3F4CA 2ODOA 1XBZA 3UG8A 2DZUA 4B5VA 2VDHA 2ACUA 1UD8A 4MFDA 4DBUA 3SY5A 2BS9A 4PUKA 3O6CA 3AU2A 1X98A 1BYAA 4H6KA 3B0UX 1R46A 4CCDA 2QCCA 1U33A 3UA4A 1SPQA 1CLVA 3UYIA 5L6UA 1QK2A 3TN6A 4GY0A 4I5UA 4XKMA 4C7GA 4PL2A 3W7DA 3DI1A 1UZHA 1JFHA 3P8IA 3T0BA 5AC6A 1K3UA 3O6DA 3P62A 1JYWA 2I5QA 5BMXA 1TJ0A 4PCFA 1JDDA 3NYDA 5HAOA 2PCEA 2Y88A 3ITLA 3SCSA 3T78A 4D6JA 2ZDRA 1S2UA 3DUGA 5D04C 5I0DA 4W5UA 1S5VA 5T9CE 2ZADA 3ABZA 3CV1A 3G1SA 3LLDA 4NILA 4CNPA 1J9YA 4AXKA 3NDYA 4PCSA 2YA2A 3QY7A 2G0WA 4JZ5A 4ZVJA 3N6QA 4JIRA 3TONA 1JZ6A 3QV9A 3NXFA 3M7WA 4D8LA 4LUYA 2WAGA 1V3MA 4PMOA 2EHHA 1NH6A 2CLMA 1Q85A 1EZWA 5XINA 2ZVIA 4HKPA 2PGRA 4H1ZA 1B90A 4XAYA 1TWWA 4L4PA 4U3CA 4JFTA 1CENA 1W9UA 3TFCA 2PGWA 1ME7A 2CNCA 1JPHA 1GONA 3NEVA 1GOOA 1S2CA 3ANVA 4O1AA 5H8PA 5HNTA 2WSYA 4AAJA 3GNOA 2ZKMX 4FX7A 1GVRA 5T9BG 1I2PA 4CQDA 1T0OA 4RV3A 4HD5A 3L12A 1I8JA 1MRAA 3TFXA 5LNUA 3C0QA 3QR3A 1VFLA 1XD0A 5A6BA 3EOLA 4RLIA 2UBPC 3L9CA 3TA6A 1Q8JA 3LERA 2A79A 1P0NA 4HT3A 1BHGA 3JRKA 2W0UA 4RPPA 3W7MA 4D6CA 1WDPA 2QPSA 3STPA 3FV9A 1Q5MA 2ANUA 2RJGA 3APTA 4WJEA 4IF2A 3GVRA 4YU1A 3TVAA 3LV5A 2GQ9A 2WC7A 4RZ4A 3TC7A 1NFBA 4KWWA 1GVYA 3UWEA 2C3ZA 3ARRA 4CCEA 1TTPA 3QW4B 4L80A 4UTWA 3P67A 1N55A 4PCNA 2PMQA 4QX4A 3S6DA 2VEIA 4B3LA 3TAKA 3N2BA 3ZOAA 2BGSA 1VFSA 3K46A 4DHGA 3ZS4A 4CGTA 1KLZA 5DF0A 3T2PA 4CU8A 4JTEA 1CEOA 1E0XA 3PBMA 3UZYA 2XVPA 3G8RA 1A5BA 5HJLA 3AJ7A 4DEFA 3ARWA 1GYMA 5FEZA 2NT1A 3NQDA 1EC7A 1Z69A 2O7QA 2QDHA 4Z42C 3AS0A 3H2OA 5C7VA 2V3FA 1F3XA 2INZA 2W92A 4EANA 3OQEA 4FLQA 3M5YA 3K4WA 2OELA 5REQA 2VOMA 2YBUA 4QGCA 1E6ZA 1EYWA 1E4LA 2J7GA 2R91A 4L6HA 1ZAHA 2YA0A 2BXYA 2Z1BA 4GI4A 1W2PA 2ZWZA 4JEJA 4AF0B 3WMCA 1IV8A 3BAYA 3G18A 3UXDA 3GZ3A 3WZ0E 2BGNE 4NF7A 2V8ZA 1WDRA 4I8YA 1RVGA 5J8LA 3AI0A 2BHUA 1M3UA 3AALA 1KBIA 3W38A 3WLMA 4LX4A 1KCZA 3T8LA 4UTTA 1H0GA 1W5OA 3V5OA 3WQGA 2PLJA 4FALA 4ZQCA 1SFLA 1T99A 4DPQA 5HANA 3LPFA 2Y89A 2ZXBA 2D2HA 5FCZA 3L5AA 1TVPA 3PSWA 1W3NA 3WH5A 3CAKA 1GKRA 1XGDA 1EBHA 3CHVA 2WMJA 5C5YA 2WB5A 3BAWA 1DJXA 1QPQA 5LKYA 4KS0A 2XIJA 3OLEA 4FOUA 2GWNA 2YFNA 3S2CA 1DIDA 3TCEA 4E2DA 3UFYA 2E4TA 3V0SA 4NI3A 4F0SA 4JPGA 4LFYA 2ATSA 3PZOA 4UR8A 4C7FA 2WNQA 4J3WA 2OKTA 1EA0A 2BP1A 1E1CB 5M1TA 3EMQA 3L2IA 3WBAA 4B5UA 4HPHA 1QUMA 3ZR6A 4CD7A 2Q6ZA 1TV2A 1SU5A 4PBEA 2IXVA 5REQB 1UBSA 3TA9A 3AHVA 1E1FA 4JS3A 1O5XA 1NOWA 3I4KA