3EX2A

Human orotidyl-5'-monophosphate decarboxylase in complex with 6-cyano-ump
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
257
structure length
257
Chain Sequence
b'MELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine-5'-phosphate decarboxylase
publication title Lys314 is a nucleophile in non-classical reactions of orotidine-5'-monophosphate decarboxylase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 98
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.4.2.10: Orotate phosphoribosyltransferase.
pdb deposition date 2008-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ex2A00
4CQAA 3DKJA 3NZRA 1LOQA 4KWWA 3TKFA 5LSMA 3CHVA 5G5IA 3IIOA 1H61A 3MW7A 3W7RA 1LLWA 4AH7A 1ZCOA 2ZRUA 4AHPA 4O53A 4UTIA 1MEHA 1AW1A 3WK2A 3N9SA 3S5NA 1EWEA 4JIQA 4HPJA 4W9TA 4JYFA 2QDHA 1I2RA 1VC4A 3G3DA 3S5YA 2YYUA 3A9IA 4MKNA 4UTWA 1OX4B 4ML9A 2DZXA 3LBMA 4BR1A 2V5LA 3JR2A 2ZZ5A 3PB0A 3U8GA 1Z48A 3S1WA 4TU1A 2DZSA 5AHMA 5D38A 4LUIA 4O1DA 2HSAA 3UWYA 3FJLA 1LBLA 4NX0A 5I3GA 1JVNA 4CQ9A 3W7IA 3W7JA 1OVDA 2FDSA 3NL2A 2NV2A 3G1FA 1JCMP 3CIWA 1VLIA 4MUZA 1VZWA 4Z0SA 3W1AA 3GXTA 1KM5A 2FB2A 3DFOA 2FTPA 3O63A 1I45A 1YXDA 2VFEA 1QNVA 2BTMA 2OZ0A 1KFJA 2V2HA 3Q2DA 1FWSA 3G0UA 2YDAA 3G8EA 5AYYA 4ZMGA 2C1HA 1H7WA 3LXCA 2J6XA 1X7FA 4MY9A 4JTJA 1QWGA 4JTFA 4QJ1A 4NNBA 3HG4A 3T78A 1ICQA 2F7FA 4WXZA 3G3MA 2AAMA 2YW4A 1YDNA 1S5TA 2RKXA 1GTEA 2ZRZA 3RU6A 4CCCA 1YPFA 1UASA 3GNNA 1XFBA 2RHGA 1V5XA 1R2RA 5I3HA 4OGZA 3TFCA 5F4XA 3T7VA 1LLZA 3F4WA 4KKXA 4IMDA 1TIMA 3W7GA 1C9DA 1VR6A 4RXFA 2VELA 4XTDA 3LHVA 3GR7A 1JUEA 5HQEA 2Y88A 3CEPA 2CLLA 2V9DA 3I6RA 4QM1A 5LNUA 4JR5A 3UWUA 2TYSA 3N2MA 5FEWA 5K7JA 2VEMA 1B9BA 1QOQA 5D05A 2C6QA 5BOOA 3TMLA 5BRBA 1KFLA 3GB6A 5CZJA 1K02A 5FF2A 4N4QA 1TPEA 1OFAA 4Q32A 1FWTA 4HSOA 5AHEA 4UTUA 3LERA 1KM4A 4RLIA 4GRSA 3CU2A 1EP1A 2CLOA 2WSYA 3MYPA 3NQGA 3P5ZA 2OCZA 3NM1A 1TTJA 3M5YA 1I2NA 3C6CA 4JN6A 4NJIA 3TV8A 3EKZA 3QRHA 3KHJA 1A5CA 5ABTA 2JGQA 1QMLA 3P7YA 4HN4A 3ZWTA 1R47A 4WZHA 5J5RA 3LX9A 2WPBA 5BMWA 3LHTA 3LCLA 2Z6IA 1MEWA 3PM6A 4R53A 3MHFA 5LNWA 4XBKA 2JKPA 4AF0B 1W37A 1VRDA 3GXNA 2BXVA 4MPQA 4Z08A 1QCWA 4OE7A 5DY2A 4MYAA 3UWVA 2GJNA 3AJXA 2QCLA 1GG0A 4CQ8A 3W1RA 2ISSA 3LBCA 4CNPA 3MI6A 4GUGA 2FPYA 3LCIA 2NXGA 3W73A 4UC5A 1CW2A 4Y96A 1FUYA 3W7KA 3THQA 2I1OA 5D37A 1EUNA 4O1BA 3C61A 2TSYA 4IWWA 5E1QA 4HNTA 2WOQA 1KM2A 3CB8A 3QM3A 3LHYA 3LCWA 3DAQA 3C4UA 3EKLA 1TB3A 1XBYA 2QJGA 2DZVA 3W9ZA 3VE9A 1EEPA 2Y61A 3TXVA 3IIPA 4KFPA 3PB2A 1AK5A 1DVJA 1WOAA 1GEQA 3MHGA 2G97A 4FNRA 5LGZA 4QISA 5CPLA 1RQBA 3HB9A 4E2BA 1B3OA 1M5WA 4ZL1A 2E68A 5D03A 3G18A 4R34A 1Z41A 3TQVA 5I3FA 4NJJA 1RR2A 1HL2A 2B0MA 4PL2A 3GDRA 2ZA1A 5TIMA 1DV7A 1QPRA 3VCRA 3W75A 3UWWA 3LI0A 5F2GA 1FCUA 5LKYA 3LDVA 4GUFA 3W2UA 4N9DA 3B0VC 2NUYA 3M43A 4ORMA 1XUZA 4FNSA 3NQMA 4A21A 4LVDA 1GVOA 2E77A 3NA8A 1RPXA 2ZZ2A 2E6FA 1YDVA 1H7OA 2VOMA 1TMHA 1F74A 4R33A 1LBMA 5F4SA 4MLRA 3LCGA 1L2UA 1L9WA 1SW7A 3CLMA 5AB3A 5GVJA 1X6UA 3PUEA 2TRSA 4HNUA 2GUUA 5FF3A 2P1FA 1I4NA 5G2IA 3N3MA 1YDOA 2DORA 1KFBA 5KITA 2W79A 3H54A 1EUAA 4POCA 4N6FA 5EY5A 5C6MA 4GNJA 4N6EA 2JKAA 3STFA 4M19A 1U5JA 3PBYA 1SU5A 3DXIA 3W83A 2ZRVA 3LGEA 4O11A 2J9YA 2V5BA 3EX2A 3C2RA 3LXAA 2ZQ0A 1WAUA 5FEZA 1NAL1 2VC6A 3VE7A 1FDZA 1B4EA 5EKYA 2QUTA 1RVGA 4YL2A 1M7PA 2PE4A 3IIVA 4NX5A 4WY0F 3TSDA 2QAPA 2EPHA 5LNRA 1KV8A 2H6RA 4LV4A 1TPH1 3STCA 3PC0A 1KFEA 3M1ZA 1S5VA 4LS1A 4XWUA 1HTIA 3L5MA 5G1YA 3TAOA 4X9SA 4K6AA 3WK0A 5TQLA 5IBXA 5K9CA 3W74A 3KVLA 2YCEA 5J5DA 2DJXA 3W7QA 1XBXA 3N73A 4YWIA 2B4GA 3QH2A 1A53A 1WV2A 1N7KA 3NPXA 2AGKA 2NX1A 3NPVA 1Y0EA 3E96A 3A24A 3R5EA 2TMDA 3UY8A 2ZRXA 2C18A 2YGYA 5DN1A 3UPBA 3TR2A 2J27A 4P2VA 2CLMA 4IJBA 4C1KA 3W2LA 4UTTC 3A22A 4ZQCA 5EBUA 4IMCA 1D3GA 3JRKA 4JDBA 2XN1A 3NQ8A 1PIIA 1OF8A 4M7SA 1BTMA 3PUDA 2C16A 3PSWA 2QCEA 4O19A 4XQ6A 1J4EA 3RLVA 2E6AA 4Z1CA 3G1VA 3RLUA 3OEXA 4GFSA 1ZFJA 1H60A 3LCXA 1SFJA 1WYIA 5T26A 1JUKA 5KTLA 4ICNA 1HUVA 4Z1AA 2ZA3A 2ISWA 2EGZA 2C19A 4LTSA 1F6KA 3VI2A 4KFOA 3G0SA 3IIZA 4XBSA 5FEXA 2Q3RA 1H50A 2WSQA 2QEZA 3DFTA 1KM3A 4L4LA 4ADTA 4U28A 1YTEA 1W1ZA 1HO4A 1F76A 5D2VA 3W87A 3W2JA 4NVTA 5BMXA 4OV4A 2ZZ1A 3EWUA 5D33A 3MMTA 3T55A 3A21A 1EIXA 1KM0A 3ELFA 1H7RA 3L2IA 2A85A 4A2SA 3P5YA 1UUOA 1ONRA 2JK2A 1YPIA 1AL7A 2ZRYA 1DL3A 1P0NA 2NWRA 4ZQRA 1TRDA 4DO6A 3S8HA 3W1MA 4UTKA 3H53A 4ALDA 4Z1BA 2V82A 3B0PA 2GPTA 3SJ3A 2QCCA 2O7SA 4FX8A 3C2FA 3G1DA 3M9YA 3WJWA 4AAJA 1RD5A 3QZEA 2BX7A 5DCEA 4YLWA 4LS0A 3UZJA 3EEGA 1OX5A 4HNVA 3O06A 5CPOA 3B0UX 1FXQA 4JY9A 3Q58A 2FJKA 4LNYA 3WJZA 2X16A 4N02A 3S5OA 4LWWA 1QPQA 2CZEA 1XCFA 5C2XA 1VCFA 1P5BA 4LVAA 4UMCA 3M41A 2BZNA 4D2JA 1NSJA 1HFBA 2QCFA 2Y7GA 4UTMA 3BLFA 5KMYA 3NPUA 4RZ6A 3DI1A 2A7PA 2Y89A 1PS9A 3M5ZA 3TX9A 3I68A 1TV7A 3HG5A 4HPXA 2A4AA 2VFDA 5FI8A 1BWKA 3DFQA 4O52A 2ZFAA 2FFCA 2RDWA 4NJKA 4ZQNA 4LVBA 4JYEA 1UJPA 3DFPA 1BWLA 3QFEA 3VKJA 4LVFA 4YXGA 2NUXA 4H4IA 4CLMA 1UBSA 3MO7A 4QQ3A 2OMAA 4M6QA 4O17A 3IVUA 5LHEA 1W5NA 2WNNA 3Q37A 1LRQA 4MIMA 1FDJA 2QCDB 3U6WA 3NEVA 4KFNA 3TK7A 3DBPA 4NQ1A 1LORA 3TFXA 3BG3A 2RFGA 1Q6QA 4PCFA 5AC7A 3S5ZA 3B05A 3R2GA 2QCDA 1MEIA 4BI7A 4X3ZA 4L4MA 4JTGA 2YFNA 2FB3A 3PG8A 4OQVA 4AWTA 2E1DA 3ABQA 3RFAA 3QF0A 1FBAA 3VNDA 2V81A 3NQFA 3V1PA 3G22A 3BPWA 3QW3A 1EA0A 3HPXA 3KRUA 3PBVA 2NX9A 1SO3A 2B7OA 1K8YA 2Z6JA 1ZAJA 4LC6A 1LROA 2CWNA 1AW2A 3GX9A 1XUUA 5KZEA 2CLEA 3C2VA 3ZFHA 2VKZG 1GJPA 4GUJA 2X1UA 4CCDA 1DOSA 1SO6A 1EX5A 1TV5A 4JTKA 5E0KA 4ADUA 5U4NA 3JS3A 1OFOA 2QUVA 1UCWA 4ONVA 2X30A 1YTDA 4N2YA 1QOPA 5FF7A 4UTWC 8TIMA 3THAA 3FKRA 2E09A 4NZFA 1DQWA 3PBWA 2QCMA 3GLCA 4IXXA 2YR1A 1W31A 2R94A 1P1XA 1XKYA 1WA3A 2DJLA 2ZZ6A 4I9AA 3G1XA 2ABBA 3LB0A 3NQ2A 4O15A 4O4WA 2B7QA 1VGAA 3LOTA 3QYQA 1PHQA 1FCQA 3O6DA 3LTYA 5BNKA 4HSNA 2FPVA 1TTPA 4AEOA 1F05A 4UNKA 4FNPA 2Z1BA 2EHHA 2QCGA 5I3KA 1S5WA 1OYAA 2QF7A 1MSSA 4JTEA 3A5VA 5CGQA 1OG0A 4FIQA 1XM3A 4I7WA 5D09A 1DJQA 3FJ6A 1OFQA 3L0KA 4QITA 1N55A 2PRHA 1IXNA 4P61A 1SPQA 1M7OA 3DENA 1OFPA 5FESA 4HT3A 3CIXA 3OIXA 4IQLA 4LS2A 3NG3A 4NJHA 4EIVA 3QSRA 2NXIA 3LRMA 4N9BA 3LCHA 4O8RA 5DCBA 4X22A 4GXMA 5HWNA 1Q6LA 5HMSA 4IMGA 1N8FA 1O4UA 3W7HA 2CLKA 3NOEA 4N4PA 3OVQA 2DZTA 3FYPA 1NFBA 4FNQA 3P80A 2G95A 5HR7A 4Q33A 2IQTA 1PCKA 3FS2A 4FXSA 5AYZA 3TMQA 1K8ZA 4OU1A 3OVRA 3L5AA 1O95A 1OFDA 3W84A 1KLYA 4TIMA 4M5PA 1L6WA 3EX3A 3M47A 1W5OA 4WXYA 1EWDA 2GJLA 2NX3A 4M6PA 3IVSA 1LCOA 3PF3A 5G4EA 3DZ1A 3SGUA 5F4WA 3P61A 1GYNA 1TJPA 1SFLA 3E12A 3TROA 5LNSA 4N9CA 3BW4A 2F84A 4QNEA 1PCWA 2P0OA 5AN7A 2A5HA 2NV1A 5DXYA 3CPRA 1A50A 1J5TA 1HG3A 4GUHA 4WX2A 3P84A 1F2JA 2FIQA 1A5AA 3NQDA 3GDLA 4IOTA 4PTNA 1JJKA 3LM7A 3P8JA 3TAKA 2V0TA 1G67A 3UWQA 2JBMA 4JTIA 4ORIA 5DBTA 5LHFA 3QPZA 1VLWA 4NXSA 1I8JA 1KBIA 4M7TA 3EB2A 5K4XA 3G24A 3E49A 5K2ZA 2DP3A 4JS3A 4K8EA 1FCBA 3M6YA 1XL9A 3UD6A 4K37A 3LHUA 3NZ1A 3TIMA 1SZEA 2VFHA 1OFBA 3NYZA 4H6KA 1ME9A 3OG3A 1SQ7A 3TQKA 3FOKA 3DKLA 3UXAA 1WX0A 1GZGA 1X1ZA 4YMZA 3CC1A 3QMTA 3YPIA 1GVFA 5EYWA 2YXGA 1B4KA 3L5LA 5D02A 5CG7A 4MFDA 5HUOA 2JKEA 2RDTA 4O57A 5HINA 3N2XA 4K38A 1JCXA 1IIHA 3P67A 4UMAA 5EMUA 3T40A 4RZ4A 2ZTKA 3STEA 4UR8A 2ISVA 4LUJA 2BLEA 4RXGA 3F4NA 3FIGA 1J2WA 3HPZA 4EF9A 1SR9A 1TPFA 4R7JA 4WOQA 5HWMA 1O5XA 4J9JA 3TSMA 3N9RA 1DQXA 1WXJA 3WJYA 3EX6A 1YADA 4UFKA 2WNZA 3ABOA 5E93A 1UB3A 3IGXA 1JRBA 1FWRA 5DLCA 4UFMA 3LHZA 4GE8A 4JYDA 3EX1A 4RX0A 4GC4A 1T96A 5C5YA 1GYLA 3BGGA 4UTJA 3CWOX 1LM1A 3R12A 3R13A 3EXTA 1TREA 3B04A 4JY8A 1KW1A 1VPXA 4GUIA 4DF2A 4DF0A 1GWJA 4BFAA 1ICSA 4A22A 2GVJA 5A5WA 5FF4A 3MP4A 4OBTA 4AVFA 2A6LA 2Y85A 1XDLA 4JICA 1ALDA 5HJLA 3M7WA 1ICPA 1ZENA 1O94A 3L21A 3W1TA 5AC8A 1SSDA 1ME8A 1VYSX 6ALDA 1IXPA 4XZ9A 3ZS4A 3SSJA 3WK1A 3SW6A 1I2QA 2WJZA 1OK4A 1K7XA 1HO1A 2ATSA 3HIJA 1JULA 3S1XA 3W7CA 2C13A 2DZPA 3RK8A 2VEIA 5CPNA 3IGUA 1TTIA 1KFKA 4OWGA 4NU7A 4DPQA 2Q3OA 5G4WA 3DHFA 3HPSA 2V30A 4O50A 1K7EA 3W71A 2Q8ZA 5I3IA 2DZUA 4MJZA 3B06A 3NQCA 1TCDA 3QQ0A 4LOCA 3NL5A 3EWYA 1JUBA 1JCJA 4QNWA 1QAPA 5KINA 1G7UA 4BWLA 1FWWA 4MFEA 1B57A 2ATMA 3IV3A 1JCYA 2OX1A 1GTHA 1H7PA 3IVTA 3A23A 1V7YA 1DHPA 5D2YA 1E51A 1XC4A 5FF0A 1BEUA 1TSIA 3NQVA 5IBXC 3TU9A 4XUGA 5EL1A 2E5DA 1S3HA 1SUXA 5G1TA 3G0XA 3FFSA 1GPWA 2CZ5A 3TW7A 1DBTA 2VFGA 3G1YA 3GNDA 1LZOA 2WSRA 3LRKA 3NPWA 1KFCA 1TO3A 3AO0A 3W7PA 1TPWA 2ZA2A 3SI9A 1IIGA 5EPDA 4O54A 5D2XA 3IRDA 2FQIA 2Y6ZA 1H1ZA 3T44A 1VHCA 1LBFA 1H62A 1SZFA 3KVKA 5L6UA 1JQXA 5AC6A 3UPWA 1EP2A 1LYXA 4OT7A 1UUMA 5IM51 3F1QA 2EAWA 2YZRA 3PAJA 2QR6A 2WO5A 1KV5A 4TMBA 5K9DA 1XI3A 5D32A 4IPIA 1WDWA 4HKPA 2Z2UA 4BI6A 3PS7A 3QMSA 4O13A 3W72A 3MJYA 4O16A 2QJIA 4N9EA 3EXRA 3O6CA 3NL6A 2NWSA 5G2WA 1H7XA 4Q4KA 4O14A 4AXKA 3OA3A 4RV8A 2C0AA 2CFFA 5D2WA 3A5FA 3L0NA 4PFMA 1R46A 3LXBA 1H7NA 1O5KA 3BARA 5U7SA 4O10A 2H8ZA 3ATZA 1F7BA 1NF7A 5CZ0A 1EPXA 3WJSA 1Z42A 3P74A 1G4PA 3B8DA 3NAVA 1KTNA 4AHOA 2CLHA 2I14A 4NNAA 4JTHA 3O07A 2ABAA 2PURA 4MVAA 4A2RA 2X1RA 2GQAA 1D9EA 3ABRA 2P10A 4YCOA 1A5SA 4LW7A 4E0CA 3W2NA 3HF3A 4PEKA 1SZGA 5AHLA 3CWNA 4UTLA 1QO5A 1OF6A 2Q8LA 2H8XA 4Y8FA 4ZQOA 3HG2A 4JX5A 1WOBA 3NNTA 3RNDA 1ZY9A 5F2IA 4LRSA 4MY1A 1BKSA 1R2SA 2CZDA 3QEZA 3HOJA 1IXQA 1LP6A 4K7YA 2NUWA 3M0ZA 1ZHAA 3C8FA 4XKYA 3C0JA 2O7QA 5K9XA 5LGXA 3TXZA 3N34A 2GQ9A 4DXVA 2X1SA 1P4CA 4RJEA 4TR9A 3PBUA 3SY5A 3L66A 3FA5A 3W2MA 1XDMA 5HUPA 2R14A 4DO5A 1XBVA 1FXPA 3BW2A 3BGJA 1YTKA 3G8RA 5F2LA 2BWGA 4JTUA 2C15A 3NDOA 3W85A 3WK3A 4UFIA 4ZQMA 4O1AA 1XXXA 4MLJA 1L6SA 4AHQA 2E6DA 3W7NA 1G4TA 4JXCA 1F5ZA 5BW6A 1ZAHA 4JD4A 3BK0A 3S1VA 4JIPA 3BLIA 1W8SA 5KSWA 1VCGA 1VQTA 3O15A 4IGHA 4O0KA 1JR1A 3NVTA 1Q6OA 2WKJA 3BV4A 1QDSA 2HMCA 4BK9A 3BLEA 1R30A 2Y7DA 3L0GA 3QSTA 4YCPA 4WJEA 3W7DA 1W5PA 1LOSA 4OV9A 3GAKA 1ML1A 5AHNA 4FNTA 1GT8A 3NQEA 1OHLA 4WUIA 4MJMA 3LLFA 2V8ZA 5MHBA 1KA9F 3GZ3A 3LTPA 2CW6A 3TCEA 1W3NA 4IPJA 3D0CA 4Y90A 1YXYA 4FF7A 4O0ZA 4EWND 4UR7A 1KTCA 5DBUA 1K03A 5F2MA 1G4EA 1W3IA 4UIOA 5H91A 3UQNA 4MZ8A 1D3HA 5K3VA 1SO4A 2OJPA 3N14A 4AWSA 4K8HA 4NNCA 1OX4A 1ME7A 1TYGA 1DJNA 4NUWA 4PA8A 2GOUA 3LV5A 2G5WA 3CM4A 3C56A 1K7FA 3SR7A 3BO9A 4RK8A 3W86A 1FX6A 3PR2A 2J9XA 2Y63A 2DU2A 3I7SA 2VEPA 2LLEA 1G6CA 3W70A 3INPA 2I9EA 3UWZA 3QJAA 2YW3A 3NR0A 1F6PA 1W56A 1U83A 4FEZA 3W7MA 2ZZ7A 2VFIA 1QPNA 4I7VA 5K4ZA 1PHWA 3L65A 2ZTJA 3DGRA 3SECA 1RZMA 4DBDA 4UCGA 4HHPA 4Z1DA 3S0CA 4PL1A 2HS8A 1SZNA 4MY8A 4XTIA 1Q6RA 3UYCA 4O12A 3TC7A 3P60A 5FEPA 3HBLA 3GKFA 2KZHA 1KTBA 2YX0A 3TC6A 3EX4A 4DO4A 1RQEA 2CU0A 2AQWA 4MYXA 1T0OA 3W1NA 3KXQA 1KM1A 1VJIA 3SIZA 1VCVA 2HS6A 4GWEA 1ZNNA 1NVMA 2C14A 4TO8A 3CTLA 3KVJA 3LHWA 4OHQA 3RF9A 4QSHA 3PUOA 4JX6A 4A3UA 1QR7A 1VHNA 2RDUA 2NLIA 5HULA 1PE1A 1W0MA 4H3DA 5EA9A 3C2EA 3PG9A 4UFLA 4Z0JA 2NXHA 1JRCA 3NQAA 1Z44A 2DZWA 2QKFA 3DH7A 1AL8A 3L68A 5HR6A 4QIUA 1TTQA 3W22A 5AOUA 3P81A 1VYRA 3P62A 2VEKA 4NJGA 3QPYA 4NZJA 1LRNA 5KZMA 3FEMA 3NGJA 1IGSA 4A29A 3W1LA 3STGA 4IX2A 3LRLA 4WQ6A 1EB3A 2PRMA 2B7PA 2NZLA 1EP3A 2GVLA 3MUXA 1TPB1 1C29A 1C8VA 3O05A 2VXNA 2W0UA 3T4CA 2EF9A 3LTSA 4PODA 3OBKA 3I65A 4ADSA 2OT0A 1DORA 4DELA 2H90A 2FPTA 3BG9A 3RMJA 1OFEA 1K3UA 1TQJA 2A2IA 3TNOA 4TMCA 3TA6A 2YFOA 3EWXA 4B5NA 4AF0A 1IF2A 3NXFA 1MXSA 3HG3A 2EKCA 3TH6A 2ZCGA 2Y7FA 3MYOA 1W54A 1W5QA 2QDGA 3UXDA 3ZR4A 4UMBA 1F73A 2WQPA 3BG5A 2ZBTA 3W7LA 3ZWSA 2CLFA 1TPDA 4EOUA 2CZFA 3NL3A 4FX7A 3EWWA 1TRIA 4GBUA 4UFHA 1I2PA 2Y7EA 5AYXA 3QW4B 5D04C 4KWVA 1JQVA 4RCXA 4MZYA 1XBZA 1OYBA 1SO5A 4IUOA 2YYTA 1A5BA 3PULA 3FYOA 3LV6A 4EVZA 3W3OA 3KVMA 3TSBA 3TDFA 3WFAA 1QFEA 1OJXA 3MWAA 2V2CA 4GJ1A 3W2KA 4EF8A 3SGZA 3W1QA 4ZVJA 4C1LA 3MI3A 4DF1A 3DU0A 3ANYA 3QQ1A 3C3NA 4DQWA 2J9ZA 3W23A 3ABSA 3BW3A 4LRTA 1O60A 2D73A 1VH7A 3GDMA 1GOXA 1KBJA 3GR8A 3W7OA 3KFTA 2FLIA 4PH6A 1OFRA 3M5VA 3HQ1A 5CPMA 1G4SA 3EWBX 3HJZA 2JGYA 2H3DA 4O28A 1PV8A 1G7VA 3S1UA 1NEYA 1LOLA 1WBJA 1GVQA 1X8FA 2BSLA 4LC8A 4O18A 2Y70A 1I2OA 3K30A 4IXHA 3E02A 4RR4A 5CSRA 3UNDA 5TBOA 2ZZ3A 2A7NA 3BVJA 1GQNA 2G96A 4ZZ9A 4JDYA 3GIYA 4UTHA 2Y62A 4S2BA 2VFFA 1FY6A 1QPOA 4PC8A 3E9AA 6TIMA 3QMRA 3F03K 4E2DA 3LCFA 3M44A 5AFDA 1H63A 3O8AA 4G1KA 1AW5A 1THFD 3HGOA 3MHUA 3NO5A 2J24A 4Y9AA 4BF9A 1RQHA 2A7RA 5CSSA 4WY0B 5D2TA 2B7NA 3H55A 4CNNA 4IMEA 4JTTA 1DKWA 1H5YA 3LLDA 4WY0A 3W1PA 3PSVA 1TPC1 1MO0A 3CQ0A 4NXKA 3CT7A 5I3JA 3O1NA 3GAYA 4LU0A 2UV8G 1OX6A 4BI5A 1AG1O 3ATYA 4UTTA 3N19B 1K8XA 3HGSA 2QUUA 3MP5A 2E5CA 4RKAA 1LRTA 1CI1A 1YLVA 2HTMA 2V2DA 3TQ0A 1FQ0A 3HGRA 4MOZA 4FB7A 1FCVA 3O6YX 4RZ5A 3IEBA 2GQ8A 3FKKA 4JTLA 4ZQPA 2R91A 5DCDA 3O16A 3P8IA 3TW6A 3PVFA 1Q3NA 5G2HA 3W7EA 3G1SA 5AHFA 4QAIA 1YXCA 4BWLC 1KLZA 4E38A 3GXPA 1H51A 5SWUA 2A21A 3B4UA 1TJRA 1T99A 3DI0A 4AMAA 4UUIA 3R89A 1G69A 3DHDA 1WBHA 5DY3A 4K36A 1X1OA 1GG1A 3DFNA 4S2CA 1LTDA 3B03A 3M16A 3R8RA 4K7VA 1TV8A 5C54A 2CLIA 2WV8A 1SSGA 3TJXA 3MI2A 4UFJA 1QO2A 2C3ZA 1FWNA 1W5MA 4TX9A 4S1FA 4JX4A 4X2RA 2R8WA 3KRZA 2PRLA 1ZALA 4FX6M 3UY7A 3V75A 3TJLA 2ZDRA 1VS1A 3IIXA 3KOFA 2W6RA 2A1YA 4CNOA 3M5XA 2H3BA 5DXXA 3HMJG 4FHAA 3W88A 3KRSA 3OHIA 4Y6GA 5CZTA 4AB4A 5KZDA 1GVSA 2RH9A 4K39A 2ZRWA 2YSWA 3DFSA 4LY8A 2VENA 4DBEA 3KAOA 4HIBA 1JCNA 2ALDA 3I7RA 1TPUA 4O4VA 3GK0A 4IMFA 2A6NA 3NQ6A 2XN0A 2PC4A 3NM3A 4WOZA 5A8GA 1ZAIA 5LNVA 5C55A 5L9FA 1NF0A 1RV8A 1M6JA 1PVNA 3W1UA 1OABA 3GYEA 3GKAA 1FDYA 3MP3A 1H1YA 3LI1A 3C52A 1L6YA 4UNLA 4UXDA 1YYAA 3HGJA 2QCNA 2OT1A 1PL9A 3QC3A 3C2OA 2YPIA 3MBDA 4XKYB 3OVPA 4DPPA 1ZJIA 3I7QA 5HNRA 3L67A 1T8XA 1TQXA 2QJHA 1ADOA 4IX0A 4FXRA 4LT9A 3U2OA 3SFKA 5F1VA 2E5BA 4U4MA 1SW0A 2E6YA 3L9CA 3W76A 2X2GA 3PY2A 3G1AA 5CKSA 2QAFA 1W3TA 4JTSA 3NQ7A 3SZ8A 1IXOA 2XN2A 2TPSA 3GDKA 2XFWA 1VYPX 1OK6A 5D30A 3EXSA 4FO4A 3FLUA 5DELA 3GVGA 3E0IA 2QCHA 3HO8A 2ZZ4A 2PCQA 3UZ5A 3TE9A 5HWJA 1MZHA 2GVGA 4LVGA 4AWUA 3TUUA 2J88A 1Q45A 3CEUA 2WNQA 5CZSA 1JCLA 3S6DA 4DEFA 3EWZA 3VFLA 4I7UA 4LV9A 1WQ5A 3IGSA 4FNUA 1P0KA 3KX6A 3S42A 3GDTA 1CX9A 3WJXA 3G1HA 4NT0A 2ZYFA 3USBA 4HNNA 3W6YA 3Q94A 3P82A 5F1UA 1GVRA 3W07A 1TPVA 4JGDA 1OYCA 1KM6A 3W1XA 7TIMA 3MBFA 1LDCA 3S9YA 4JEQA 5LZLA 5H2ZA 2Z0IA 1R2TA 2A0NA 3PWAA 1SW3A 4FIRA 4WD0A 1AMKA 4JNMA 4CCEA 4M6VA 4O1CA 4MZ1A 5AHIA 2X1TA
chains in the Genus database with same CATH superfamily
3DKJA 3VGHA 3TKFA 4Q8TA 5G5IA 1NELA 1X6NA 3LSBA 4AH7A 4Z2JA 3FHQA 3N4AA 3WK2A 3N9SA 3S5NA 1HKVA 3DIPA 1DEDA 4JIQA 3AZTA 4JYFA 1I2RA 3G3DA 3A9IA 3P6LA 1OX4B 2DVXA 1VF8A 5HK4A 2VEGA 3SCVA 2WLYA 3Q4DA 1MW1A 1Z48A 4GQQA 3FDGA 4O1DA 3FJLA 3VABA 1LBLA 3WQ4A 4AQLA 1OVDA 1KXVA 4HJWA 4Y9NA 1J5SA 4LYQA 1VLIA 1V51A 2FTPA 3BICA 1QNVA 1EGVA 2BTMA 1FWSA 5H6HA 2NQHA 4FS9A 4EACA 2PDWA 1POJA 4MY9A 1EHAA 3PZGA 4WXZA 4JN8A 3V5OA 1B3VA 1DHKA 2ZRZA 3PZMA 4NI3A 4D6JA 2OU4A 2OSYA 1S2CA 2RHGA 4GA8A 1R2RA 4OGZA 3TFCA 4FXFA 1WCGA 4FMVA 4KKXA 4IMDA 2UY3A 3W7GA 2PLCA 1BF6A 4RXFA 2EG8A 4DJFA 2WHLA 2X7WA 4YTUA 3KOWA 2GZXA 2Y88A 1J01A 4NHVA 1W8GA 1XLEA 2DFAA 4G7EB 4IP5A 3UWUA 5FEWA 5JUVA 5D05A 4GOAA 1K6AA 3DESA 1JPHA 2PDLA 4Q32A 1BXCA 2Y2WA 4BEUA 1IYXA 3LERA 4DJDD 1TVLA 4GRSA 3URNA 1EP1A 3TQPA 1UPPA 3CYVA 4M8UA 2OCZA 1DWJM 3M5YA 4DWSD 1X38A 3TV8A 2X0YA 3PPCA 4TX8A 2XIMA 4F40A 4Q4SA 5MKGB 5ABTA 1MDLA 5E70A 1EBHA 5BRQA 4WEVX 1MEWA 2OO6A 3RPMA 1PZ1A 2JKPA 3MJMA 4AF0B 1VRDA 3DOPA 5CJMA 1IEQA 2BXVA 4GVHA 4OE7A 3HFTA 4MYAA 3UWVA 1MQQA 4NASA 3JUGA 3BAXA 4R3UA 2NXGA 3E38A 4Y96A 1QI2A 1EUNA 4JQ2A 5E1QA 3I4KA 2XWDA 4INFA 3U4AA 1BQGA 3V16A 3ABXA 1T40A 3QM3A 4GYJA 4EKJA 1EEPA 4Q8VA 3FSUA 1NQ6A 4KFPA 1UR1A 1DVJA 1WOAA 3AIVA 3MHGA 1SFSA 5LGZA 1RQBA 3HB9A 2VT0A 2NQ5A 4E2BA 1EGMA 1QW7A 1MQPA 1EA9C 4IGNA 1RA0A 3T0BA 3BAWA 2RAGA 1Z41A 3TQVA 4QGCA 2A3LA 1RR2A 1HL2A 2B0MA 3VC5A 3GR4A 1QPRA 1QW9A 4QBXA 3VCRA 3UWWA 1EJUC 3R8HA 2X2YA 1O1HA 2XM2A 5XINA 1XS2A 1W1B1 3B0VC 2BOGX 3CHDA 1UA7A 4A8RA 2VURA 1LT8A 4LVDA 1A5NC 1GVOA 2E77A 3NA8A 1RPXA 4H8VA 2EPOA 1QI3A 3MMWA 4UZSA 1E40A 4R33A 1XYAA 1IR1A 2PDBA 3NOYA 1Q66A 4GZJA 1KR0A 4C6FA 1PIGA 5AB3A 5GVJA 3WQOA 4HNUA 4IPNB 1I4NA 2XIIA 1YDOA 1BAGA 3OZYA 4J3ZA 1EUAA 3EDDA 1A47A 3CK5A 4AD3A 3W4RA 2VNCA 3SM0A 2ZRVA 5DO8A 2E9BA 1WKEA 4LFYA 3LG3A 2I5QA 1IWAA 3EX2A 3B9EA 3C2RA 5FEZA 2PDUA 1BD0A 2OG9A 3VE7A 4QDWA 1B4EA 5EKYA 1A5LC 2VEFA 5JBDA 3MDWA 1YKWA 2J6VA 4NX5A 5LNRA 4ZOEA 2JIWA 4HCHA 4UOQA 1S5VA 3VGDA 1S1RA 4LS1A 1HTIA 1J93A 3L5MA 4X0VA 5G1YA 6A3HA 9XIMA 1H4PA 4B3LA 4C6JA 1Z8AA 4Z2HA 2YCEA 2VUYA 1TWIA 3D3FA 1XBXA 2E9MA 3N73A 4QSFA 5CC7A 1WV2A 1Y0EA 3V4BA 3R5EA 3QHMA 3CLWA 2PA6A 3AALA 3UY8A 2ZRXA 4LANA 2C18A 2D3LA 4E3TA 3TTEA 1V02E 1C92A 3GU1A 2PDMA 2WHMA 4UTTC 3P3BA 4ZQCA 3JU2A 4G8TA 2IKGA 5EBUA 1D3GA 4GZIA 1EZ2A 4PB5A 4RE2A 3RJYA 2BVDA 3PUDA 2C16A 4CCZA 5EGRA 4XQ6A 3RLVA 2XM1A 3G1VA 4QLJA 3RLUA 5FA5A 2B81A 1WYIA 2D1ZA 1JUKA 4C6LA 1HUVA 1R3YA 1UMLA 2YZ5A 3WMCA 1BG9A 4I90A 3SQLA 3MVTA 1ITCA 4LAKA 3GH7A 1ITQA 3DFTA 1YW1A 2I5IA 4L56A 5E9AA 3MANA 1JFHA 3EMZA 5C8BB 1W1ZA 4DBSA 4KW2A 2PP0A 3QZ6A 4OV4A 2ZZ1A 3EWUA 3T55A 2ODOA 2SFPA 3A21A 8RUCA 1KM0A 2HBXA 3ELFA 2PDNA 3L2IA 1HW6A 3P5YA 1E5NA 1ONRA 4BF7A 2ZWZA 5C9ZA 1AL7A 2YLAA 3CMJA 1M1BA 2R1LA 1S2AA 4MB4A 1F4AA 1Z9AA 1XWYA 3H53A 4H8HA 4Z1BA 2V82A 2GPTA 4QAWA 1ZUAX 4FX8A 3WNNA 4YJ5A 2J74A 2REQB 3UGVA 4YLWA 1OX5A 4O1FA 2CEQA 4U10A 3QBUA 4AZBA 1VEMA 1PBGA 3T2PA 4FSAA 2W61A 4LWWA 3GNPA 3BAIA 5I03A 3NTYA 2BVTA 3E0VA 1VCFA 3B9NA 1RBAA 1NSJA 3BLKA 1J96A 1KKRA 1R8LA 4UTMA 3TTOA 1RALA 1EJ7L 2WCAA 2A7PA 1E56A 3UYIA 2QMJA 4HPXA 4XX6A 2OR2A 1P6CA 3LQLA 4E8CA 1FWAC 2OLHA 3SB0A 2RDWA 1BPLB 2VZVA 3PTKA 3AXHA 3QR3A 4JYEA 1W2VA 2Y0FA 3M0YA 3VKJA 3QFEA 2ZUNA 4LVFA 1Q6EA 4CLMA 3S2MA 3AU2A 2OMAA 2DZBA 3AS3A 1W5NA 1EDGA 2WNNA 4MIMA 3MVIA 2WWCA 1FDJA 4R85A 2QCDB 5A6JA 3NEVA 1QWKA 3DBPA 2IKJA 3BG3A 2B31A 2RFGA 5I7GA 3S5ZA 3B05A 3PJTA 5DX7A 3TYEA 4J3XA 1F6YA 4OQVA 2E1DA 3H4WA 4YVXA 4ATWA 1X8CA 3AUJA 4AZ5A 1WO2A 3CHFA 4XV0A 4CD4A 4F8XA 4HOWA 1EA0A 4KMQA 3HPXA 1LROA 3GX9A 5KZEA 2BOEX 2CLEA 1DWFM 3GTNA 2W9MA 5C9WA 1GJPA 4GUJA 2X1UA 2GOKA 1OGBA 1SM9A 3H2MA 4ADUA 1GQLA 2YCKX 3JS3A 4ONVA 7REQA 3DFHA 4QS5A 1C8YA 1MFVA 1QOPA 4HCDA 3GE7A 3KTSA 1CBGA 4DVOA 4YNGA 4B4FA 2EXOA 1DQWA 4AD2A 3L4TA 2QCMA 2ZE0A 3CMGA 2R94A 3SUSA 3VIHA 2ZZ6A 4XIAA 4GH3A 4J28A 3G1XA 4ENLA 3ARVA 4O4WA 2B7QA 2OZTA 4JL1A 1FCQA 1NARA 2XZ7A 3O6DA 4C6IA 4ASTA 1L8NA 1S5WA 1OYAA 4WRHA 1MSSA 3A5VA 3A47A 1XM3A 4I7WA 3ZYZA 3FJ6A 1OFQA 4JN7A 3L0KA 4XAPA 1N55A 2OEJA 4RDVA 1M7OA 3DENA 1UBPC 3Q65A 1OFPA 3L4UA 3PZNA 3ARPA 3CIXA 1AQMA 4YN5A 1RUSA 4G1NA 1E70M 4EIVA 4QQUA 2BVWA 1AA1B 4N9BA 3LCHA 5JH2A 5DCBA 2FZNA 1K9DA 3QR0A 5BRPA 4GXMA 2YOCA 1MDRA 4AIOA 2OSXA 3WNMA 1FWIC 1OCNA 4KEMA 2MNRA 2CLKA 3EOUA 4N4PA 4AD5A 5C9RA 1O7AA 3FYPA 1NFBA 4ZXLA 3DUGA 4IGMA 5HR7A 1PCKA 2GGHA 5AYZA 4FXSA 5FJTA 1A49A 3VCNA 2W62A 2W5FA 1XCXA 1O95A 1OFDA 1KLYA 1R7AA 1A5OC 1R3RA 4WSHA 4PUKA 3H4GA 4AWEA 1KO0A 1W5OA 3RCYA 1WB0A 2GGIA 1YE6A 1AH0A 3IVSA 5ABFB 5F4WA 4J5NA 1GYNA 2O0TA 3CO4A 4GLEA 3F4VA 3BJSA 1XH0A 1PCWA 5AN7A 5DXYA 2W66A 1J5TA 4GUHA 2J25A 2OODA 3CNYA 3S6TA 1UA3A 1A5AA 2Z26A 4REQA 2JBMA 4ORIA 5C0QA 2PDQA 1I8JA 1KBIA 3OZPA 3UR8A 4U2YA 4IFOA 3KZSA 2AQVA 1XL9A 1HJQA 4K37A 3G2GA 2IPJA 3E74A 3TYDA 5CPTA 1E9LA 1X7IA 2VFHA 3NYZA 3ZO9A 1ME9A 1SQ7A 3DKLA 1H2JA 1WX0A 1GZGA 3EB3A 4RDYA 3CC1A 1GVFA 4XZLX 5D02A 4C6CA 2O9PA 2JKEA 4O57A 4K38A 3KBMA 4PUWA 1XIJA 3KCJA 1KRMA 5EMUA 3SCRA 1RCOB 1E71M 3IJ7A 3STEA 4K8GA 4RXGA 3WENA 2VM8A 2BY0A 1XIMA 3FIGA 1J2WA 3HPZA 4GI4A 3IJQA 4R7JA 2PDKA 1M65A 1PTGA 1DQXA 1WXJA 1YADA 2WNZA 4G5DA 4GBDA 2G3JA 3ABOA 1UB3A 1FWEC 3IGXA 4DJDC 3ONBA 1ZJHA 1RCXB 4CNTA 4HU4A 1KBLA 1XISA 4KRTA 4DWSC 9CGTA 1UH4A 1EDQA 3R12A 4JY8A 3N18A 3V35A 1PKNA 3KHDA 4BFAA 4MKVA 4A22A 4CGTA 3KBVA 3M7WA 3K4AA 2ZUTA 1TVPA 2YA2A 5AC8A 1IXPA 1NDZA 3ZS4A 3SSJA 2WJZA 1OK4A 2QJMA 2ATSA 4FA3A 2NQ9A 3A4WA 1JULA 2DZPA 3FEQA 4EPEC 3KOYA 3DHFA 2V30A 4Q8NA 2OYKA 2HWGA 4OJYA 1TCDA 2R1PA 3NL5A 3WELA 5KINA 1XFCA 2C0HA 1FWWA 4MFEA 4I6KA 2CBIA 4ERGA 1V7YA 3R1ZA 2BODX 2ZE3A 3KS5A 1OIMA 2NSOA 4NYUA 4RE4A 4GYPA 3P93A 4DAFA 3N25A 2E5DA 1SUXA 2D2JA 3TLLA 2CZ5A 3IK2A 1ONWA 5C9UA 3G1YA 3GNDA 5CC5A 3UGRA 2ZA2A 5HAOA 2J7FA 4Y9PA 4YTQA 1U1HA 2QGYA 1H1ZA 3GSMA 1GHSA 1SZFA 3CMFA 1KGXA 1HT6A 5L6UA 1JQXA 5AC6A 3GG8A 5IM51 3F1QA 3KOZA 1VEOA 1HX0A 2WO5A 1TR9A 1KV5A 3NEHA 4XD5A 5K9DA 1G0CA 4IPIA 1WDWA 4C7FA 2Z2UA 4RNHA 1QATA 4O13A 2QJIA 4N9EA 3EXRA 4MB1A 4PR4A 3NL6A 2NWSA 1ISXA 4IG2A 5G2WA 3AHYA 4Q4KA 2DT1A 1HJUA 4FOKA 3A5FA 5BYWA 4NKCA 2ASHA 3LXBA 4PCTA 3BARA 1U33A 3TYUA 3WH9A 1Q6FA 3WD1A 3P74A 3WQ6A 3K46A 3NAVA 1XP3A 4L7ZA 4AHOA 1E4NA 2VR5A 2ZX5A 4NNAA 1U5HA 1A0EA 2PURA 3CQKA 4MVAA 2GQAA 1D9EA 4QXIA 2P10A 4E4PA 3NYDA 1EOMA 3FW6A 3EOOA 3W2NA 2WZMA 3H26A 4LAMA 1OF6A 3F7JA 3HG2A 1WOBA 3QOMA 3UESA 2DQWA 5I24A 2ZVIA 4MY1A 4QG8A 3DGBA 3SQMA 4AEEA 4QE1A 5LIWX 1A0DA 2CZDA 3HOJA 2PZNA 1TA3A 4K7YA 4W8LA 3M0ZA 4OUEA 1XSIA 3RLHA 3C0JA 2O7QA 5K9XA 3RHGA 1MUWA 2GQ9A 3FAWA 4PTVA 4RJEA 4LEFA 1YHTA 2EBNA 1OD8A 2R14A 4AYSA 3GNOA 3BGJA 4JTUA 1TR1A 4EPKA 3K8MA 3W85A 1BXBA 2QMKA 4MLJA 1L6SA 3W7NA 3TN5A 4ZE4A 5A8OA 4XD4A 1MZRA 3VMOA 1XYLA 3QN3A 2WKLA 1RD6A 2QS8A 4JD4A 4ROPA 2CBUA 3BK0A 3S1VA 1KQZA 4DHGA 3BLIA 3H12A 1W1TA 2WZHA 1VCGA 3ZLHA 1NWUA 1UWIA 3AHTA 3H6OA 3GU2A 4IIDA 2DT3A 3UXKA 3L0GA 3CQHA 2YL6A 4YYCA 1SJDA 3W7DA 2R1NA 3GAKA 4UQDA 1PJ9A 3ANUA 4LCSA 5AHNA 3VD9A 3NQEA 3F5LA 2JIEA 1M7XA 3VXGA 2WMIA 1KA9F 1W3NA 1JZ3A 4GISA 4YWSA 3AIQA 2P3EA 4MZ8A 3SY1A 1ZBWA 3N14A 3KEHA 1NOFA 3W24A 1OX4A 1ISWA 2BGSA 1PYMA 2OQLA 3CZGA 3UCDA 4F0HA 2O4QA 9XIAA 4PUJA 4NUWA 4PA8A 3QTPA 2VX4A 2VDIA 1K7FA 2GJXA 4NF7A 5D8ZA 4LBRA 4EP8C 1T7LA 2J9XA 2DU2A 3B8IA 3S83A 3H4XA 3W0KA 3QJAA 2YW3A 3GZAA 5EBAA 1NWTA 5HMEA 3MSDA 4DIAA 1HJSA 2VMFA 5D9NA 4PMDA 3W7MA 3GXIA 2ZZ7A 5K4ZA 3WF3A 3L65A 3C5QA 3DGRA 3SECA 4GIAA 4UCGA 5BXRA 4HHPA 4Z1DA 4AG0A 3FSTA 3NSMA 3R0UA 1U30A 5KEZA 2XIJA 1AFSA 1VFMA 5DANA 3DECA 3TC3A 1PWLA 3VCCA 2F9RA 2Z1VA 3GKFA 3VIMA 4J3VA 2VRKA 4D8AA 2YX0A 2VDHA 3AIUA 4DO4A 3AAMA 2DPEA 3S3GA 4DJED 4Q6XA 1T0OA 3W1NA 1CGYA 3H21A 4QDMA 1VJIA 3SIZA 3AXKA 2XVNA 5DMNA 3VPLA 1YDYA 3CTLA 3KVJA 2YCLB 3LHWA 4OHQA 3RF9A 2PU0A 3PUOA 2WAGA 3WSUA 2XH0A 4Q4RA 4TOQA 3LEPA 3NVDA 1N2VA 1W0MA 2A3BA 4D6GA 3AUOA 3FVDA 1O68A 3V0SA 4Z1YA 4NAFB 1UD6A 2DZWA 2PWGA 2QKFA 4XAZA 4DUWA 4AX6A 4G7FA 2BHYA 3ZSSA 3P81A 4R7OA 1CYGA 1TG7A 3UG4A 3QPYA 4NZJA 1IGSA 1XLFA 4IX2A 1XRVA 1EB3A 4IUGA 2GVLA 3MUXA 1TPB1 1T8QA 3RXZA 5MKGA 1QNOA 4PRWA 5XIAA 2OT0A 2H90A 5CBIA 4OVXA 2OEKA 3RMJA 2HNHA 1K3UA 1TQJA 2A2IA 3TNOA 3WD0A 4Z2IA 4C90A 3BLLA 2W67A 1IF2A 1ADSA 3NXFA 4S3GA 4AF0A 3SUWA 3TH6A 1LT7A 2E7FA 1ZZMA 4JQ4A 1OB0A 3GVWA 5CC6A 1UIOA 5E6YA 3W27A 1S2TA 2QJJA 4FX7A 4GYKA 3TZNA 3P0XA 5DF0A 1I2PA 5D04C 1RP8A 3OO2A 2OZ3A 1OYBA 2PDXA 4EVZA 3KVMA 2PAJA 2CETA 1VIWA 3BQ5A 4AZCA 3W2KA 3W1QA 4C1LA 4QROA 4WDWA 4IMAA 1DIEA 2Z1WA 3ANYA 4D71A 3BMWA 3VNLA 3C3NA 3BW3A 1O60A 4HA3A 3GDMA 4L64A 1RH9A 1JFXA 4HSHA 1EJXC 3BDKA 4O28A 4C6BA 3GRIA 3VM7A 1V0MA 5LXXA 3B0YA 1OCJA 1QI4A 3WLIA 4MADA 4O18A 4ZB0A 4Z42C 3GBEA 4KEUA 3XISA 4IXHA 5CSRA 2Z2AA 3PWIA 4AU0A 1WDDA 3UNDA 2A7NA 2F6KA 1C91A 1XV8A 4JDYA 2G3FA 4V33A 2NW0A 2PTDA 1C93A 1QPOA 3POHA 1US0A 4E2DA 3LCFA 3M44A 1H63A 4I9MA 1AW5A 3NO5A 4BF9A 1RQHA 1AZ2A 5CSSA 2G3NA 4L9ZA 3NGFA 4D6CA 3AXMA 4YVVA 4XZMX 3GDBA 3LLDA 4WY0A 1TWDA 4HHMA 4L61A 5E09A 5RUBA 1MO0A 3WLMA 5CAHA 3CQ0A 4NXKA 1ISVA 3GAYA 1W9VA 4F0LA 1EFZA 1AG1O 2WNWA 4UTTA 3C86A 1VRXA 3HGSA 4PSRA 2QUUA 5H8PA 2E5CA 4HZ8A 3GS6A 1CI1A 4ACZA 4D1JA 4MOZA 1ZS2A 2XIOA 3QV9A 3QKEA 3FKKA 4JTLA 1FHUA 2GSHA 2HXUA 5E0FA 5AZ0A 1JZ8A 4ZENA 3RM4A 3P8IA 2WJEA 3PVFA 1Q3NA 1R3QA 3IAQA 1KLZA 2GFTA 4BWLC 1VPYA 2OO0A 4C6QA 1CT5A 2A21A 3BURA 4UUIA 1KCZA 5CBJA 2BP1A 1M01A 1R9ZA 3W37A 3DFNA 2E8ZA 2X41A 2PWHA 3R0DA 3B03A 3SURA 3KTXA 3CHCA 5C54A 2H9AB 4EXQA 4S3JA 2WV8A 4QX4A 3TJXA 3T6CA 1UWSA 1QO2A 3VILA 2XHYA 4TX9A 4S1FA 5B7YA 4HTYA 4FX6M 1LQ2A 1FVPA 3IIXA 2H3BA 4FHAA 5T8GA 3UZXA 4AB4A 1TJ0A 1GVSA 3DN5A 2YSWA 3OIHA 2Q6ZA 3CV7A 4LY8A 4DBEA 4WGXA 3KAOA 2PWEA 3H22A 4FZIA 5JH1A 4IMFA 2I57A 2XN0A 3NM3A 3MSGA 5LNVA 1TX2A 2Z2BA 1XGEA 2ON3A 1JZ6A 2VCBA 3GKAA 2QPSA 3WQCA 1FDYA 1H1YA 3QC0A 1XLIA 1YYAA 3HGJA 2WC3A 3QV6A 1V3MA 1BVWA 4XKYB 4DPPA 1ZJIA 1T8XA 3U0HA 2QJHA 4LT9A 4U4MA 1SW0A 3RJXA 2CHNA 3CGTA 5CKSA 4JTSA 3SZ8A 3GHUA 3F2DA 1LLOA 3BV7A 3GDKA 2JE8A 2XFWA 3WQWA 1VYPX 1OK6A 3AQUA 5DELA 3CZLA 3E0IA 2J7EA 4KCVA 5M1TA 3BOFA 4JIEA 2ZZ4A 3KZPA 1Z6KA 4QHRA 2FFIA 4AWUA 2Q8XA 5A2BA 3LA4A 3CEUA 3H2OA 4U3AA 1HXJA 1ESWA 1P0KA 3KX6A 3S42A 3BAKA 3GDTA 3NDZA 3G1HA 3GW0A 4GZ7A 2QT3A 1OYCA 1XLLA 1LDCA 5LZLA 5H2ZA 2XGZA 4YU1A 2WMGA 5IHRA 4WD0A 2E0PA 3WLHA 2V63A 5AYIA 1KB3A 1KXHA 5CZKA 3BOXA 5A6BD 5BWAA 4GK8A 4R9XA 3LPPA 5B7ZA 1O5RA 3W7RA 4AHPA 4O53A 1K8CA 1QXLA 2WVUA 3ZR5A 4JOMA 3ARSA 2V6AA 4W9TA 2QDHA 2VZSA 4E2OA 4ML9A 4B9YA 1XRTA 1HN1A 3PB0A 3U8GA 3WQEA 4ZCWA 2PGRA 3UBPC 4GIEA 3S1WA 1W9DM 1WDPA 3IUDA 5D38A 1L2QA 2J8FA 2HSAA 3TNBA 3K8KA 1JVNA 4KEZA 5ABHA 2HCVA 3NL2A 3U7BA 1ZP3A 3CIWA 4B2DD 3ID7A 3THUA 3W1AA 5A8NA 5TD4A 2FB2A 2IW0A 1I45A 4TVUA 1YXDA 2VFEA 1Q7QA 5CLWA 3G0UA 4ZMGA 4W93A 5CC3A 1H7WA 4J2PA 3VIJA 1E4LA 1OADA 5CGTA 4JTJA 3LM3A 4JTFA 4J3UA 4QJ1A 3TWBA 2AAMA 1W17A 2E8YA 2CERA 1S5TA 2RKXA 1GTEA 4F4RA 3RU6A 1Z69A 1E9ZB 4WIWA 3ALFA 2J7HA 3T7VA 4GXWA 1CLVA 1TIMA 1XIBA 1C9DA 4J2MA 3VDHA 1W9PA 4XTDA 1HP5A 3UA3A 2VOTA 3S5SA 3GR7A 5HQEA 4AZIA 2BDQA 3OYXA 3CEPA 4FALA 3VO0A 5EMJA 5LNUA 4JR5A 2TYSA 3N2MA 3ZLGA 5K7JA 2VEMA 1B9BA 1MMFA 1AD1A 2RUSA 1KFLA 3GB6A 2QULA 1K02A 5FF2A 1FWTA 4HSOA 3WDJA 3CAKA 1HL8A 5I6SA 3BXWA 4B5XA 1FRBA 2CLOA 2WSYA 3T81A 1EJTC 3RAOA 1TTJA 1I2NA 4HHHA 2D23A 2VDGA 2VUNA 3MPGA 3QRHA 1GOOA 4Y8EA 1DQUA 2A3AA 3LPGA 2XWEA 2VRQA 2JGQA 1QMLA 4IQDA 4HN4A 3ZWTA 4WZHA 4B9ZA 1CLKA 3CUFA 3IK4A 5J5RA 1OZMA 3LX9A 4KCUA 2WPBA 1M3UA 4AW7A 4R53A 3O0FA 5IFPA 3MHFA 4XBKA 1P0BA 5M03A 3EDJA 1IEWA 5ABFA 1BHGA 1QCWA 2GJNA 3AJXA 4IIBA 5HMFA 1N8WA 2QF8A 4CNPA 3G77A 3MI6A 8CGTA 3LCIA 4UC5A 1FUYA 1Q13A 4IPLA 2JF7A 4IWWA 1BRLA 5JBEA 3CB8A 1LG1A 3AMLA 3LHYA 3LCWA 4RNIA 3DAQA 3SIMA 5FOOA 3GFZA 3TYCA 4AFYA 3W9ZA 2Y61A 5I09A 4ZO9A 3TXVA 4R7WA 3PB2A 2ICSA 1ITUA 3A4JA 1GEQA 4HK6A 4FNRA 4ATDA 3FYYA 3EWCA 4DJEC 3H7UA 3G18A 3ARYA 3FK4A 1TX0A 4DJDA 4R34A 3SCPA 4IPPA 2A3HA 1QNRA 3T2OA 4CD7A 1DWHM 7TAAA 5F2GA 1WDRA 5LKYA 5I23A 4GUFA 3W2UA 1Z89A 4N9DA 4F48A 4ORMA 2DV0A 2DSWA 2I9UA 3NO1A 1M53A 4OOUA 3NXLA 1H7OA 4GC3A 2VOMA 1TMHA 3MUCA 1Y65A 2PDPA 3N04A 3N3TA 5F4SA 4KBXA 3PUEA 1M03A 1J9YA 4CVWA 2D2GA 4DO7A 2PDJA 3II1A 3BJTA 2P1FA 2OSWA 3RR1A 2Z7GA 3E5PA 3EGJA 1KFBA 2W79A 3H54A 4DNHA 2C79A 4GNJA 5C6MA 4N6EA 1DXIA 4HNLA 2Q01A 2WZIA 3IPWA 1EC8A 3PBYA 3DXIA 3LGEA 4O11A 2J9YA 2V5BA 4JTQA 1UR4A 3JW7A 1KRBC 1WAUA 1NAL1 1PKMA 4K2SA 2IUZA 2QUTA 2ZUSA 1VBGA 4S3EA 4UQ9A 4YL2A 3IIVA 4WY0F 2EPHA 2WC7A 4EANA 2H6RA 3M1ZA 2XU2A 3LZ5A 2PU1A 5LIUX 4H19A 2INEA 2VX5A 1CZ1A 3GVQA 4K6AA 3KBSA 3WK0A 4H8UA 2Y5JA 5K9CA 1ZRQA 3N2BA 5J5DA 4I6VA 4DLMA 4UOJA 4HN8A 2B4GA 1S1PA 3QH2A 2ZUVA 3OPSA 4M51A 4Z2LA 2P88A 3O7UA 2NX1A 5FJUA 1LL6A 3N9KA 1FOBA 4FLSA 3A24A 2YGYA 3TR2A 4C1KA 2CLMA 4IJBA 5LIYX 3R79A 2ZUMA 1NOUA 1GJWA 1GOKA 3A13A 1H0IA 3JRKA 3SAZA 4LF2A 4W7VA 4JTRA 3RDKA 3WDRA 1PIIA 4UTFA 3PSWA 3PNZA 1J4EA 1E0UA 5GNZA 4W88A 4Z1CA 2GWGA 3WLRA 2XIQA 4GI6A 3PZTA 4GFIA 2VTFA 1UHVA 4EXAA 3FJNA 3UEQA 4Z1AA 2WK2A 3VI2A 4KFOA 3G0SA 3VINA 2DIKA 3IIZA 4Y9MA 3UJRA 4XBSA 4IQJA 1LUCA 2Q3RA 2OGJA 2WSQA 5A8PA 1JAKA 3VGFA 4HA0A 4NZ1A 4L5ZA 1AQHA 3WL1A 1HO4A 5D2VA 3W87A 3W2JA 4H6QA 1W1IE 4NVTA 3VDBA 3A3WA 4HK5A 1EIXA 1WZKA 4DY1A 1MXGA 1H7RA 3GH5A 2A85A 4GQGA 1ISZA 2NWRA 5DRCA 3COTA 1TRDA 1XW8A 3E6EA 5CQ1A 2ZWYA 4UTKA 2QCCA 3PZOA 4GCAA 4EK7A 3UJ2A 1Z7AA 3M9YA 1EYEA 3OZMA 3B0XA 4B5SA 2WZTA 3GTHA 3QZEA 1MW3A 5DCEA 3SN4A 4LS0A 3UZJA 4A8NA 5GNYA 4HNVA 1NWRA 3AYRA 5CPOA 1GEHA 4GXPA 4PUDA 1FXQA 4HNCA 3Q58A 4N02A 4LNCA 3M64A 1NQKA 1CGVA 3VVGA 1X96A 3UCCA 3SCWA 4LVAA 2BZNA 5LYRA 4QE5A 5M3WA 2EPLX 3FXGA 2BVYA 2HE5A 1UZ1A 3BLFA 5KMYA 3NPUA 1E15A 4RZ6A 4KCWA 1CXEA 2UBPC 3DI1A 3M5ZA 4FF5A 3HG5A 3MUIA 2XSXA 5HANA 1ZBKA 3VNYA 2JFEX 4PN2A 5FJOA 4MM1A 2A4AA 2VFDA 3WH5A 2FFCA 5EMLA 3MUZ1 4DNMA 4ZXOA 4ZQNA 4LVBA 4ZO8A 3PPHA 1UJPA 2O9RA 3WF2A 4P7LA 3KL3A 3CV1A 1XSJA 3MO7A 4AZ6A 4O17A 3IVUA 1KWGA 5LHEA 1LRQA 1MWOA 3U6WA 2YL8A 1UKQA 4MDPA 3MMDA 1XSKA 2J7GA 5EB8A 4BI7A 3KM8A 1V93A 2FB3A 4XD3A 3ABQA 1B5TA 3U3HA 3ZJ7A 4PTXA 3QF0A 4KS0A 2CYGA 3MV11 3B8VA 3BSMA 4YPJA 3BPWA 4CUCA 5A3HA 1UH3A 3ECQA 5LIKX 3ITTA 4LC6A 1ZAJA 1AJZA 4D72A 2CWNA 5JXQA 1AW2A 3OJGA 3ZFHA 3CAWA 2VKZG 2IQDA 3FJ4A 2XZ9A 4CNUA 2GGGA 1DOSA 4V2XA 1SO6A 1EX5A 1UC5A 2HQAA 4GMEA 5CEWA 4JTKA 5E0KA 3SO7A 3TEVA 1WKYA 1UCWA 2QDDA 4PBGA 1U5VA 5CPQA 5FF7A 3VIKA 8TIMA 4LYPA 2ACUA 2E09A 4NZFA 3WD3A 4GACA 4AZ7A 1RY8A 4AIBA 3UWEA 3W38A 2X42A 1VFUA 4IXXA 2V5CA 4NIRA 2F8QA 4NILA 2VP8A 1UPMB 1WA3A 2PODA 3LENA 4H00A 2DJLA 4I9AA 1LWJA 4RW5A 3F2BA 4PULA 3WLQA 2GSJA 3TONA 4LAOA 3LOTA 1C7SA 1TTPA 1F05A 4YVPA 3UERA 2EHHA 2QCGA 5I3KA 3LK6A 2QF7A 4JTEA 2CWXA 4YIWA 4ES4A 3AFBA 2PRHA 4P61A 1JD7A 1KC7A 1SPQA 1BYBA 1AVAA 5FKYA 3K5XA 3OQ8A 3OIXA 1ONEA 2XDFA 2ZVRA 1XINA 1XPYA 3QSRA 1ENUA 4GNKB 5CJNA 3LRMA 4XBJA 1QHZA 3ZIZA 1NY1A 3OOQA 2VWTA 4GY1A 4AMCA 1Q6LA 1ONXA 2J4GA 1PX8A 1GKRA 4ATLA 1R85A 3OVQA 2DZTA 3BANA 1S2UA 2Q71A 3EZ4A 3QVQA 2RJHA 2XH4A 2IQTA 2XYLA 1K8ZA 3V5CA 3L5AA 3S9ZA 4B16A 3W84A 1JI2A 1IZJA 4TIMA 1L6WA 5IFTA 4ZR8A 2Q09A 3EX3A 5HJXA 5GJNA 2WLZA 4J35A 4F9DA 2NX3A 4M6PA 1LCOA 5G4EA 4XK2A 2XVGA 2FGBA 4U5IA 3H7RA 2YXXA 3LYEA 1UKPA 3UW6A 1Q2SA 3BW4A 2F84A 1Q4WA 1US3A 4REQB 1HG3A 1W9XA 1WE5A 1QHOA 2VZTA 4WDXA 4XO7A 3WDQA 2NVCA 2FIQA 5DMYA 5IDIA 3NQDA 3GDLA 3LM7A 4C6KA 4JTIA 5DBTA 3RPTA 3GNXA 4M81A 5K4XA 4LQ1A 4W8BA 5K2ZA 3GY1A 3M6YA 4HZ7A 3N4EA 5GJPA 3SCOA 2DGAA 1S5NA 2W3ZA 1O12A 4Q8WA 3TYZA 1B1YA 3OG3A 5MF5A 4QLKA 3GG0A 2BASA 2ZX6A 4LBSA 1N8IA 1X1ZA 4YMZA 3YPIA 2ADAA 3I3DA 5CG7A 2RDTA 3POCA 1JCXA 3OYZA 2HZGA 1IIHA 5EFDA 4KF1A 1AQFA 4JQ3A 4UR8A 5C71A 4LUJA 2J66A 2CCRA 1XIHA 4NI8A 4WOQA 5HWMA 2AMGA 5FAJA 5A6LA 4BCEA 3ITOA 3TSMA 4PCPA 8XIAA 1W3JA 3UZYA 2CZVA 3AMKA 4B5TA 4NSBA 1IEVA 4E8GA 3WLTA 5DLCA 4UFMA 1LL4A 3EX1A 1T96A 4HOXA 2XJ7A 2YB1A 4XVEA 2BXZA 1VD6A 5F7UA 2VQTA 2R9RA 1SMDA 4FLOA 3EXTA 3MSYA 1TREA 1KW1A 2ZX8A 4GUIA 1UG6A 1CGXA 3ANVA 3KWSA 4DF2A 1GWJA 3G1RA 3WMSA 1ICSA 4LJ3A 1FFQA 5A5WA 3D6NA 2Y85A 1Z32X 1XDLA 4JICA 1WZAA 4CN1A 4JNYA 1ICPA 1ZENA 3ZQ9A 2ZXBA 3W1TA 4F79A 3T0DA 1XLBA 3NWRA 3SW6A 1I2QA 4KGLA 3W53A 2WMJA 3W7CA 2C13A 3GFXA 2FH8A 3GG1A 3VKKA 3QY6A 5CPNA 2NV9A 4KWSA 4OWGA 1SR0A 3ALGA 4K1WA 2OX4A 1K7EA 1GOMA 3FDKA 3W71A 3ONCA 1RY0A 2EG7A 2DZUA 4Q8UA 3TLQA 1XLDA 1KRCC 1PTDA 4B3ZA 5HDRA 3A3HA 4BWLA 1UZ4A 1IE7C 1IZKA 3UU0A 2ATMA 1DJHA 1DJXA 3IV3A 1JCYA 2OX1A 4X2PA 1H7PA 3H24A 4B5UA 3AC0A 5D2YA 4EPDC 4PMYA 5FF0A 1BEUA 5IBXC 4AXNA 3WY1A 1V4YA 5EL1A 3R7MA 1TWZA 1EBGA 1P6BA 4G56A 4DUXA 2J75A 1GPWA 2GQ3A 3M0JA 1YX1A 2D20A 1MUCA 1EIBA 2WSRA 3LRKA 2E1WA 4XAYA 3RCNA 1Z3NA 1KFCA 1TO3A 3AO0A 3B4YA 4AY1A 7XIMA 3SI9A 1IIGA 5EPDA 5D2XA 2O9OA 2Y6ZA 1VHCA 1LBFA 2Z27A 1UOZA 3KVKA 4XG1A 3RPDA 4H6RA 1UUMA 2PBGA 2YZRA 4CU7A 4JKLA 3PAJA 4AD1A 3D5HA 4Q4QA 1VJSA 4IG2B 1HVXA 4UQAA 3MJYA 3UPMA 5A2AA 2W4XA 4O14A 4AXKA 1BKHA 4UZUA 1PO9A 4RPPA 1OM0A 5D8WA 4PFMA 1OWQA 4C60A 4H2HA 1V3IA 3URAA 4I8DA 3ATZA 4U2ZA 5CZ0A 3DHUA 2R6OA 5DT7A 1J0KA 4KWUA 1KTNA 4GO8A 1JZ2A 2I14A 2NT0A 3O07A 2ABAA 4IL0A 1JDFA 4DZIA 1AODA 1J2BA 4DM1A 4P8UA 2VX6A 3AROA 3HF3A 1SZGA 5AHLA 2HPMA 1DWIM 2H8XA 4Y8FA 3NNTA 1JDAA 2FHCA 3ARXA 1TA3B 1XRFA 1PUDA 1B30A 1R2SA 1MW2A 4H7CA 4GPNA 1LP6A 1EQPA 2JEQA 2AQOA 4XKYA 5LGXA 5A69A 3N34A 3EOLA 3KP1A 3LPOA 1UKTA 1JEZA 4JIIX 4TR9A 3L66A 3FA5A 3MCOA 5A1AA 3AI0A 3UT0A 4PUUA 1YTKA 3M4HA 1UOKA 1V6WA 4ZQMA 4O1AA 4Y7EA 1AD4A 1XXXA 4AHQA 2NVAA 3WUFA 3VDCA 1G4TA 4JXCA 1ZAHA 1SJCA 2BNJA 1R6WA 1UR0A 1V8EA 5KSWA 4M82A 1E0VA 2CITA 2ACSA 3G6LA 2WKJA 3BV4A 3OU8A 4PFHA 4US5D 2X05A 3M46A 3DDMA 1UD8A 2OYLA 4P8XA 1JL8A 4YCPA 1W5PA 3GH4A 1LOSA 5I79A 3VNKA 4YHEA 2WMIB 3CUXA 4KPLA 3E2SA 4QJ5B 4FNTA 1OHLA 5DEZA 3DG7A 2OKTA 3WD2A 4HPHA 1XG4A 3MY9A 3LS9A 1YXYA 4O0ZA 4EWND 3L4WA 1KTCA 1K03A 4PCNA 5F2MA 1G4EA 3T1GA 1W3IA 3IRSA 3UQNA 1ZCCA 4FR1A 1SO4A 2OJPA 4NNCA 1MW0A 1L6FA 1QK0A 1XQLA 2JEPA 4LYRA 4U33A 2GJXB 3WN6A 4R5EA 2ZDSA 2GOUA 2XSAA 1X39A 3LV5A 2G5WA 2HV5A 3O2LA 3SR7A 3ES7A 4TVDA 3EDFA 2ANUA 3I7SA 2FMOA 5HATA 2VEPA 2J8GA 1F61A 4E5TA 4H1ZA 2I9EA 4WSJA 1UH2A 1V6XA 4H9YA 2NVDA 4W89A 3CAVA 1F6PA 5AC5A 3WBYA 1W56A 2OOGA 2VVSA 4XZHA 1R3VA 3UP8A 1GKQA 2OWWA 1DTNA 3AIEA 1FA2A 5FSEC 3L7RA 1HKKA 1SJAA 3KWXA 3HQPA 4MWAD 3T07A 4MY8A 1XYFA 1QW8A 4FOJA 1ODUA 4XTIA 3JZEA 3IJ8A 1ZLPA 4AIEA 3UYCA 3TC7A 5FEPA 2KZHA 4AIUA 3SRDA 1RQEA 1C8XA 4B5VA 2G3IA 1UP0A 2P50A 2GDVA 3PJWA 1M9HA 3AXIA 3TN4A 1FHDA 1VCVA 1NVMA 2C14A 4TO8A 4JIHA 4B5WA 4HVXA 2W27A 3GM8A 4QSHA 3OW1A 4EE9A 1VHNA 2AL2A 3EBVA 5HULA 3NFUA 3A3XA 1HZYA 2A79A 1Z44A 2PDFA 3DH7A 3L68A 4QG9A 4E3VA 4QIUA 3N13A 1TTQA 1VYRA 2DUZA 4NJGA 1HJWA 1OCQA 1FP9A 3M7SA 4N42A 3VOIA 1LRNA 3NGJA 4A29A 1GVIA 3FGCA 3B9DA 1TKKA 3W1LA 1O1ZA 4WQ6A 5BU9A 2DQXA 1UKSA 2OLAA 2W63A 1EP3A 4GVFA 3WFZA 2BB0A 4ZBCA 2VXNA 1SMAA 1V3HA 4ZTXA 5BCAA 2DDXA 4ADSA 2X7VA 1IZCA 3TVAA 5I3DA 1OFEA 3C2YA 3E5BA 1WNOA 1QNSA 3LGDA 4TMCA 3EWXA 2HNEA 3MU7A 2Z1KA 3U5UA 3MYOA 4UCFA 1R9XA 2QDGA 3DHPA 3UXDA 3ZR4A 4KQNA 4DJEA 3ZWSA 1TPDA 4EOUA 2CZFA 3NL3A 3M0KA 4A35A 4DYKA 3QOKA 3EWWA 2NQJA 4GBUA 4QCEA 3SEPA 5AYXA 3QW4B 4KWVA 1NDVA 1BG4A 4PZVA 4IUOA 4DWDA 3PULA 3FYOA 3LV6A 4AISA 2AMXA 4AZCB 4D8LA 1XF0A 3W3OA 4XZWA 2FJUB 3N2OA 4YTTA 4LUTB 1OC7A 2Z00A 1CECA 1OJXA 3MWAA 1WDQA 4PMVA 4CVUA 4JFUA 4J27A 2PUZA 4W85A 4AZHA 1JG9A 3DU0A 3QQ1A 4UBPC 4LRTA 1VH7A 1KBJA 1UW9A 3M0MA 4PH6A 1OFRA 1R3SA 5CPMA 3AZSA 1IWBA 3HJZA 2V3EA 1EGZA 1I1WA 1F8MA 3R43A 1NEYA 2C91A 1RCQA 1C90A 3GXDA 1JIBA 1XLKA 3K30A 1V6UA 4BS0A 3AWOA 4ZZ9A 3S2JA 1WXZA 4KGJA 3GIYA 2PB1A 2Y62A 2DW7A 4S2BA 3LPFA 2VGFA 4Q4PA 1E6RA 1ZTVA 6TIMA 3QMRA 2HXTA 5G4HC 4IIGA 4H01A 2DY3A 2OPJA 2QYGA 4GNVA 4D6FA 1YPXA 2WCGA 4Y9AA 2J24A 3T4WA 4LUYA 3KBNA 4WY0B 4HZMA 1EC9A 3N1AA 3KL0A 3RN6A 4JTTA 3BH4A 1H5YA 3I3BA 3KRBA 3ORWA 3PSVA 3TA9A 1TPC1 3S47A 3PPGA 2GGJA 3CT7A 4LU0A 5AYBA 4BI5A 3V3WA 2IPFA 3WIJA 2WKGA 2ZC8A 4ACZB 4US6A 1Y8BA 3LMZA 1YLVA 2VL4A 4IZGA 4ZB5A 4AY8A 1TZ7A 5JU6A 4QR6A 5AVNA 3P2VA 1FCVA 2X0SA 3O6YX 5H1WA 4GI8A 4PBEA 2X40A 2WMHA 4AC1X 3KW3A 3M6DA 3TW6A 1JF6A 5LA0A 4QAIA 5AHFA 1H49A 4GINA 3WMLA 3WLSA 1YXCA 4GY0A 3P14A 3GXPA 5SWUA 1TJRA 2L5HA 3QQWA 3WEZA 4AMAA 3QTGA 5C2CA 4HMEA 1G69A 5HBFA 1ODZA 1WBHA 5DY3A 2X8RA 4IFKB 3UA4A 2FVKA 4S2CA 4BA0A 3DCPA 2QNEA 4ZFCA 1PKYA 3TJ4A 1RJQA 4JCMA 3SQSA 1J18A 2POTA 5DQPA 2C3ZA 1EOKA 1W5MA 4C1NB 4X2RA 1EO7A 1PB0A 6ENLA 1SZRA 3MB9A 2D0HA 3ZLFA 5EMKA 4D9PA 2W6RA 2A1YA 3AICA 5BXTA 3GQYA 3OHIA 4D6IA 2WANA 5KZDA 4AUBA 3VIPA 3MTWA 3WUBA 1TELA 5GNXA 1GPFA 1JCNA 3I7RA 5ECUA 3T8QA 2Z4GA 2INZA 3Q67A 2A6NA 4E4FA 2PC4A 2CIPA 5A8GA 1ZAIA 2TAAA 3BZGA 4WK9A 3RX2A 1QHPA 2QQ6A 1NF0A 1M6JA 1RBLA 1V03A 3EPMA 1OABA 3CZ8A 3LI1A 1S39A 4UNLA 4GABA 5HNNA 2FTWA 1P43A 3QC3A 3RYSA 1MNSA 2VX7A 4EPBC 5A6KA 5HNRA 4LX4A 5F1VA 3SFKA 5LA1A 2DSUA 2DUAA 3W76A 2X2GA 3PY2A 3G1AA 1YNQA 2QAFA 1V6VA 3NQ7A 4V1XA 1IXOA 3M0XA 3EKGA 1BWVA 3APTA 3EXSA 3FLUA 2DH3A 1EZWA 3I6EA 3ITGA 3VGBA 6XIMA 2PCQA 3GUGA 3UZ5A 2Y8UA 5FD0A 4LVGA 1K6WA 2J88A 1Q45A 4IJRA 5D4YA 1JPDX 3R6IA 3VKAA 4I7UA 6REQA 4LV9A 1WQ5A 5KZ6A 4GI9A 3IGSA 3PJXA 2BY3A 3UF9A 1Q5MA 3C0LA 3HPAA 4H7ZA 2J77A 1Y7VA 4S3BA 5F1UA 2HPIA 1TPVA 4JGDA 3CJPA 3W1XA 7TIMA 3PK7A 4JEQA 3DYPA 5H8UA 1VBHA 3SY8A 1R2TA 2A0NA 4JNMA 4FI4A 4MZ1A 4NP7A 2PPGA 3NZRA 1OZQA 1LOQA 1AUSL 4P8WA 1H61A 4WJ8A 2ZRUA 4UTIA 3CHEA 1XLAA 4D1IA 1E0XA 1EWEA 3ARRA 2HDJA 4HPJA 4RUBA 5HMDA 3VDGA 4DN1A 2YYUA 4JKKA 1CPUA 2P3ZA 5I0DA 2VR4A 3WH7A 4LGXA 2V5LA 3JR2A 3OGRA 3TJIA 1RXOB 1JF5A 1VFSA 4IT1A 4TU1A 5AHMA 4LUIA 4PRRA 4DBWA 4NX0A 5I3GA 4CQ9A 3W7JA 4RW3A 1GGOA 2FDSA 5HQMA 4ECLA 2WB5A 3G1FA 4ZA0A 3CB3A 1JCMP 1UQZA 3N12A 1VZWA 4X63A 4Z0SA 1KM5A 3O63A 2ZUWA 3PNUA 1KFJA 5CSUA 3Q2DA 1BSLA 2YDAA 3EEZA 2XINA 5I00A 1G94A 3LXCA 2HEJA 4YTSA 1X7FA 4QE4A 4NNBA 3GC2A 3T78A 1ICQA 2F7FA 3G3MA 2E9LA 3WKZA 2V5DA 3CASA 4IP4A 3CO8A 4PGLA 4QEHA 4BQ5A 3WBXA 3BUVA 1YPFA 4K68A 3WF0A 1XFBA 5I3HA 3B3DA 5F4XA 5A6BA 2F2KA 1TFVA 1VR6A 1DIOA 4B15A 4J3TA 5LXEA 3GW3A 2GDUA 3HM7A 1HF6A 3VUSA 5HNUA 2FTYA 3VGEA 1KXQA 2V9DA 5H8MA 4QM1A 1BLIA 1B3XA 3G5EA 2O9TA 4Z17A 5BOOA 3TMLA 1AJ0A 1M68A 3GIPA 3WDHA 3IJIA 1TPEA 1FFRA 1BFNA 5AHEA 1PDYA 4UTUA 4GVIA 1EC7A 4DX3A 3AXXA 4KERA 3CU2A 1FWJC 4HA4A 3OLDA 3NQGA 3P5ZA 4MNMA 3W81A 2GGEA 3C6CA 4JN6A 5JQ9A 3M0IA 1VIZA 3EKZA 4B2DA 2BOFX 1QI0A 3RCMA 5BROA 3KHJA 3IJLA 1G1YA 4D6DA 4KIEA 1QK2A 1OGSA 3P7YA 4RE3A 3UJFA 1R47A 3VC6A 3CZJA 4LH8A 3ITVA 4MTVA 5BMWA 1TVNA 3ZZ1A 3LCLA 1G01A 5ENLA 3T0AA 4PTWA 2PI6A 2WSKA 3FXYA 3GXNA 2WM1A 2J78A 4MPQA 4Z08A 4P7QA 1EEXA 2V5KA 2QCLA 4IFRA 5CJ5A 1GG0A 3UXIA 4CQ8A 2ISSA 3SSZA 2PBOA 3CT2A 3W73A 1BRLB 4DB7A 4YTRA 3THQA 2I1OA 5D37A 4GHRA 3C61A 4R27A 1B9ZA 3TN6A 4PMRA 5A6TC 4MWAC 2EJ1A 2BGNE 3THDA 3EKLA 2VI0A 3VX0A 2DZVA 3VE9A 4DZHA 1ZQ5A 3IIPA 1J79A 3RLGA 1JZ4A 2AOSA 1AK5A 3APGA 2G97A 4QISA 5CPLA 1XPGA 3AYTA 2EPMX 1B3OA 1M5WA 3SCQA 4ZL1A 2V69A 2GYIA 5D03A 3S1GA 1Q65A 1JYVA 4DWSB 3WF4A 5I3FA 5I5RA 1OBAA 4PL2A 2ZA1A 2ZXQA 4ZO7A 1W6TA 1DV7A 1CB7B 3IJ9A 3W75A 3QZAA 2FZ8A 2ONEA 1QVBA 4L9XA 4BHYA 8A3HA 2HE8A 2NUYA 3M43A 4UNIA 4M29A 4QRNA 4QJ4B 2VQUA 3TW9A 3NQMA 4A21A 2ZZ2A 2E6FA 1YDVA 2QZRA 4ZOBA 3QHOA 3GTFA 4RNFA 4MLRA 1L9WA 1SW7A 3CLMA 1X6UA 3KLKA 2TRSA 5EMMA 2DORA 1QT1A 5G1MA 4POCA 5EY5A 1D8WA 2JKAA 4M19A 3W83A 1SU5A 4PE8A 2AKMA 1Q4NX 3V0TA 5A94A 6XIAA 2G50A 3AMGA 2GDQA 2VC6A 1FDZA 1W9BM 2I7GA 3AOFA 3GXFA 1UD3A 4UWMA 1UP3A 2VC5A 3ZVHB 1F4HA 2PE4A 4WKFA 3TSDA 2QAPA 2GLKA 4ZSTA 3STCA 3MO4A 3HFYA 3K2GA 1KFEA 1O6IA 4JZ5A 2PDGA 5CLTA 2F61A 4MNLA 4XWUA 3TAOA 4X9SA 5ABGA 5TQLA 5IBXA 1IGWA 3W74A 3KVLA 4Q8QA 2DJXA 3W7QA 3V36A 4YWIA 2OVLA 1SVDA 5BXPA 3CV6A 4AX7A 1J12A 4UB9A 3NPXA 1V3KA 2AGKA 3RGTA 1BXNA 5JIWA 5DT5A 1UWRA 2TMDA 3VZZA 5DN1A 3UPBA 2J7CA 1ZB5A 3B9OA 4P2VA 2HROA 3W2LA 4C6EA 3A22A 5J04A 1NTHA 4MHBA 1TIWA 3A6OA 4KRUA 4IMCA 1V77A 3UR2A 4RE0A 3NQ8A 2J13A 1BTMA 2VWSA 1F07A 2FZBA 4O19A 4GYFA 4Y9OA 1E9YB 2E6AA 2YDQA 2V68A 4GFSA 1MUMA 1ZFJA 1PDZA 1Q6CA 4H9MA 1KR1A 3LCXA 4WDUA 5T26A 4Q8MA 2YBTA 5KTLA 1LUCB 2ISFA 2ZA3A 3M0LA 2EGZA 1TUXA 2XIBA 4S3DA 2C19A 2IXUA 4KIRA 4A3QA 2QEZA 1E6NA 4L65A 4LB4A 1KM3A 3S2CA 3GC4A 4L4LA 4U28A 1YTEA 3VD5A 3LD5A 1F76A 5HXMA 4RDWA 5BMXA 3UXLA 4CU6A 3MMTA 2ZC1A 4Q4MA 4J7RA 4A2SA 1XC6A 1XIIA 2JK2A 4DYJA 1UKOA 4S3FA 3VTRA 3U2EA 2ZRYA 1DL3A 4AYGA 1OGGA 1BSIA 3V18A 3L2LA 4DO6A 2RGLA 3B0PA 3SJ3A 2O7SA 1XLHA 2YJQA 2OXNA 4L4PA 1W1VA 3C2FA 3GD6A 3G1DA 1ZJBA 1DJWA 3WJWA 2HK1A 3ITLA 1RD5A 4GCXA 2BX7A 4C6PA 3VIGA 3UCQA 4DUVA 3EEGA 3O06A 3S46A 3B0UX 3AZRA 2VC7A 3U7VA 2FJKA 4M0XA 3F4CA 4LNYA 4HOZA 4D8ZA 2X16A 4KETA 4JFWA 4GX9A 4IJCA 1MVYA 3S5OA 1QPQA 2CZEA 3VDAA 5C2XA 4FLRA 1GJUA 1P5BA 1R3TA 2ISDA 4UMCA 3M41A 1HFBA 2Y7GA 1I75A 5I07A 3FV9A 5JBFA 2V5JA 1LWIA 2IQ0A 2Y89A 3TX9A 3I68A 1TV7A 2DIJA 4JTCA 1BWKA 3PZUA 3DFQA 4O52A 1XLJA 2ZFAA 2Y1HA 1KFWA 4NJKA 1EYWA 4XO6A 2QDEA 1UYQA 2FDMA 4MNKA 4YXGA 3BQ6A 2XVLA 2NUXA 4H4IA 3UJEA 1UBSA 1BVZA 4D6EA 4QQ3A 4M6QA 1GOIA 4RPQA 3Q37A 3WBWA 4NZ3A 3PN8A 3BE7A 4NQ1A 1EKOA 5TNVA 1Q6QA 3MC5A 4PCFA 4Q7NA 2XFRA 4QCFA 3S2LA 1TMLA 4X3ZA 2CNCA 1B31A 4OOZA 1RAKA 2WBKA 4AWTA 3T09A 2P0IA 1KXTA 2F2HA 3TWAA 1QJWA 3QYSA 1FBAA 3VNDA 5CPSA 3NQFA 3V1PA 1Q8JA 2HBVA 3G22A 3K4DA 3KRUA 3PBVA 2NX9A 1SO3A 4CD6A 1HKIA 1K8YA 4IIFA 1PPIA 3C2VA 3RITA 4CCDA 3NZPA 3WEMA 4IP7A 5U4NA 3WLOA 1OFOA 2EO7A 2QUVA 4V15A 3ZJ8A 2X30A 1VP5A 1NP2A 1YTDA 4N2YA 3LSCA 3WL0A 4UTWC 1O66A 3OGVA 1WUEA 3NIYA 3FKRA 1KBBA 2F38A 3O9NA 2XISA 3PBWA 3BCJA 2DVUA 1BYDA 3CL7A 2VCAA 4PSPA 2YR1A 1A5UA 1U1UA 2E28A 3APYA 1P1XA 1XKYA 5HJYA 2OQYA 1GW9A 2Q02A 3NQ2A 1OEPA 4O15A 1VGAA 4G6CA 3MSRA 3QYQA 1PHQA 4F0KA 5BNKA 2PTZA 4WCJA 4HCLA 2FPVA 4AEOA 4UNKA 4FNPA 1XH2A 2PTXA 4I5UA 2J8TA 2OZ8A 4WKHA 1OG0A 2YCJA 4FIQA 4YS1A 3OB8A 2PLKA 5D09A 3HQNA 5JMUA 3LNMA 4QITA 1XH1A 2J79A 1IXNA 2G3MA 4OBSA 3ZJ6A 3CUJA 4HT3A 3S9IA 2C1IA 4QFUA 3ITYA 1IEXA 4F3HA 4LS2A 3NG3A 4NJHA 2PS2A 3VZXA 3CBWA 3HN3A 3MWCA 1T6MA 2I17A 4PCSA 4S3KA 1UWTA 2E25A 2DIEA 5HWNA 3KCOA 3AU6A 1RSCA 3MCNA 4B92A 5HMSA 1N8FA 2YCIX 3ARZA 3B8UA 3NOEA 4KEVA 1EJRC 1UR2A 4FNQA 4HPGA 3P80A 2G95A 5PTDA 1HL9A 2GJPA 1EQCA 4Q33A 3I6TA 1EJSC 1VENA 4BQ4A 4XSLA 4MAVA 3TMQA 1XCWA 2OYMA 1HGWA 3UNTA 4OU1A 3OVRA 1O5QA 2NLYA 4AY7A 4M5PA 3CUIA 1W2PA 4MUPA 4FXJA 4W8AA 4WXYA 1EWDA 2GJLA 4CQDA 2ZADA 1RVKA 2YXOA 3DZ1A 3M0HA 3H2FA 3E12A 4H41A 3DYOA 3RU8X 3TROA 4UOZA 4N9CA 5LNSA 1OC6A 3AJ7A 1OIFA 4QG6A 3H70A 3N6QA 2P0OA 2GUYA 3CPRA 1A50A 4WX2A 1AH4A 3DC0A 3P84A 3D3AA 2FH6A 1F2JA 4PTNA 1V3JA 4IOTA 1WAWA 3H23A 2V0TA 1G67A 3TAKA 3UWQA 5LHFA 5HOSA 3QPZA 1VLWA 3ZM8A 1EHNA 4J3WA 3EB2A 3E49A 5EMYA 3DC8A 2DT2A 4K8EA 2OWXA 3