3EX2A

Human orotidyl-5'-monophosphate decarboxylase in complex with 6-cyano-ump
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
257
structure length
257
Chain Sequence
b'MELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine-5'-phosphate decarboxylase
molecule tags Lyase
source organism Homo sapiens
publication title Lys314 is a nucleophile in non-classical reactions of orotidine-5'-monophosphate decarboxylase
pubmed doi rcsb
total genus 98
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.4.2.10: Orotate phosphoribosyltransferase.
pdb deposition date 2008-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ex2A00
3P60A 5U7SA 3G1DA 5AC6A 1W5OA 1NF7A 4IMCA 5C55A 5AB3A 4O12A 2X1RA 5K7JA 2VC6A 1L6WA 5KTLA 1TV7A 4JTTA 2CLFA 4QISA 3RF9A 3DKLA 2DORA 1H7WA 1Z42A 3GKAA 3TW7A 1ZAIA 3NPVA 2QCNA 4AH7A 3MI6A 3HBLA 4O13A 3SECA 2DP3A 4RK8A 2DZUA 3U6WA 1CI1A 2EPHA 1RVGA 1KFJA 4LRSA 3W88A 1T0OA 4H3DA 1ICQA 1UCWA 2EAWA 4HSNA 3R2GA 1W54A 1F76A 5FF3A 4IX2A 3DI1A 1QCWA 5AHLA 4AVFA 4MKNA 3GZ3A 5EYWA 4DBDA 2GJLA 3CHVA 3LERA 5U4NA 1A50A 3E96A 2C14A 3EWXA 2X1TA 1MSSA 1K03A 3QMSA 2CFFA 4FX7A 4UUIA 1FWTA 3O15A 2ZZ3A 4XTDA 3QH2A 4BI7A 4OV9A 1JQVA 4UNLA 3W22A 4MZ1A 2WKJA 2VENA 3S0CA 3S6DA 3LM7A 2RFGA 4LRTA 3W1QA 4DELA 3W1MA 1VCVA 5LNWA 1W5NA 2A0NA 2ZDRA 4EOUA 1TMHA 3G0SA 1JCYA 4NJHA 3L2IA 4UTJA 3M5XA 4CCCA 2QF7A 3FJLA 5D02A 1W3NA 1OFAA 2VXNA 4IXXA 1Z48A 1J5TA 2OT0A 1F6KA 4FNQA 1EEPA 3HGJA 4RZ6A 3A5VA 1B4KA 3F1QA 3CQ0A 3C2EA 1W3TA 3W71A 3PB0A 4K7VA 1H7NA 2H6RA 5G2IA 1I2NA 3WK0A 5F2LA 4UFIA 1FWRA 1JCXA 4LC8A 1A5CA 1VGAA 1KBJA 4CQAA 5D2YA 4RKAA 4UR8A 2NV2A 3M47A 1TSIA 2CW6A 3UXDA 2ISWA 1EB3A 3LRMA 5G5IA 1KM4A 2G95A 1X6UA 2FB2A 5F2GA 1O5KA 1LBLA 3BLEA 3O07A 3TH6A 4O50A 1BEUA 3GDLA 2P0OA 2QAPA 1BTMA 1LRNA 4AWUA 1QOQA 3W1LA 5T26A 1IXQA 4X9SA 1QAPA 4UFHA 3MMTA 4JYEA 1SPQA 1GWJA 1XFBA 5C5YA 1QO5A 5EL1A 2NWSA 1KTNA 2OT1A 4UC5A 1PV8A 2IQTA 1WBHA 3WJXA 4IX0A 4ZMGA 3OVQA 2GOUA 3W7KA 1HFBA 1PHQA 3BVJA 1LOQA 1EWDA 3TJLA 1Q3NA 1K8YA 4GXMA 5AC7A 2FDSA 3C2RA 4XUGA 4NNAA 1LDCA 1UB3A 5I3KA 5DXYA 3W9ZA 4O14A 3S1UA 4NT0A 3GAYA 1DBTA 1LROA 4KWWA 1W0MA 2C6QA 5A8GA 4UFLA 1G6CA 3CEPA 3CTLA 3NO5A 3TR2A 2NXHA 2A1YA 3KAOA 1GPWA 3LHYA 2YW4A 3HO8A 4RLIA 2GQAA 3BO9A 3O6CA 5FF0A 4JTUA 3W1TA 3DFNA 1WA3A 3F03K 3HMJG 1XDMA 3H55A 1K7FA 3W87A 2AAMA 1BKSA 4O52A 4PA8A 1TRDA 4FXRA 3W7LA 2VFHA 1KV5A 2VFFA 1R2TA 4MUZA 4LS1A 3GAKA 1HTIA 4RZ4A 2OX1A 1GZGA 3KRUA 4UTIA 2YPIA 1XBZA 1QMLA 2JKPA 2XN0A 4ZQOA 4JN6A 1H61A 1LZOA 3A5FA 2CWNA 3S1XA 3MP3A 2ZRYA 2GVLA 2CLOA 3UWYA 4XTIA 1SQ7A 1Z44A 1S5TA 3ZWTA 3W3OA 1W56A 4GJ1A 1YDVA 3LCWA 4Z1DA 1ME8A 1PL9A 3O8AA 3R13A 4AEOA 1H60A 1JR1A 3W2LA 2ZA2A 4UMAA 3W1XA 4LVBA 4JY8A 5D04C 2QCFA 3P67A 1YTEA 1RQEA 3VNDA 4OE7A 3PUOA 1OJXA 1OFOA 1GVQA 3YPIA 5FEWA 4MLRA 3QW4B 3LHZA 3LRKA 4JGDA 3PSWA 4ZQRA 4O1AA 3MO7A 1TPVA 3L9CA 3H53A 4WQ6A 3PAJA 2DU2A 1GTHA 2QUTA 1G4EA 3LI0A 4JTEA 4ZL1A 1Z41A 3QPZA 4JTHA 1A5AA 5TBOA 3TKFA 4RXFA 1KFKA 5CGQA 1TREA 3HIJA 2GQ8A 3NQMA 4YCPA 5G2HA 1JJKA 3N3MA 4MVAA 4NJIA 4UTUA 1GQNA 3W1PA 4DO4A 5EY5A 4IUOA 1XI3A 3MHGA 4X2RA 4H4IA 4EIVA 2V0TA 1FQ0A 3KRSA 2WNNA 4MFDA 1TQJA 3NDOA 2GQ9A 3DI0A 1W8SA 4WOZA 2YFNA 1UBSA 2PRMA 1B9BA 3KFTA 3TU9A 3E49A 3INPA 3CU2A 4LNYA 4MJZA 1L6YA 4WX2A 1FUYA 1Q45A 3JR2A 3TUUA 3W74A 3QEZA 2WSRA 4N9EA 4E0CA 2X16A 2F84A 1YYAA 3Q2DA 4FIQA 3TFCA 3PBYA 1HL2A 4JDBA 5CPLA 1VCGA 5F1UA 3EB2A 3GKFA 4LVAA 2RDWA 4IXHA 3TC6A 2I1OA 4K6AA 1A5BA 4O18A 5L6UA 3SZ8A 1WOAA 2E68A 1DKWA 4BF9A 2C13A 4FO4A 4Y90A 3TXVA 4LOCA 3TSDA 2CLEA 3ZWSA 1X8FA 3RLUA 4LT9A 3UWWA 1HO4A 1BWKA 3PVFA 3AO0A 4IWWA 2AGKA 3DAQA 3EX6A 2HMCA 4S2CA 4I9AA 3TA6A 3W7RA 1KM2A 1SSDA 1LBFA 1TJRA 3ZS4A 3LXAA 4BWLA 4GNJA 5CZTA 5G4EA 3EWZA 4N6FA 3I7QA 4R53A 2H3BA 1B3OA 3W7HA 3G1YA 2DZWA 2OZ0A 4R33A 3LV5A 1WXJA 2Y6ZA 5J5RA 5C2XA 3PB2A 2B4GA 3N73A 5G2WA 3FA5A 3W76A 1H7PA 2VFEA 1G4SA 3HPXA 4LS2A 4O1DA 4UFKA 3TNOA 1W37A 3NZRA 3TJXA 2Y88A 2FPYA 3QM3A 5K9DA 3NL2A 1W31A 3GYEA 2YXGA 4A22A 1MEHA 2BLEA 1DL3A 3HG4A 1XL9A 4JX5A 1S3HA 3HOJA 3N2XA 4WUIA 4MPQA 4Y9AA 2H8ZA 3CB8A 4PL2A 4WOQA 3FKRA 3BW4A 4Y6GA 1MEIA 2H90A 3M7WA 5HUPA 1TTQA 3SJ3A 4Y96A 3NPXA 4C1KA 2YW3A 4GRSA 1SZNA 3W1UA 4AHPA 4DO6A 1I2RA 1QOPA 3MYPA 4RXGA 1WV2A 1DQXA 3BGJA 2A2IA 3L5LA 2W0UA 2OMAA 2RH9A 2TYSA 4LS0A 1SW0A 2Q3OA 1K8XA 3KX6A 4BWLC 5LGXA 1V5XA 4ORIA 1RV8A 4I7VA 3QF0A 4J9JA 5E1QA 2YX0A 3SGZA 4UFJA 4DEFA 3LCGA 3BW3A 3W7IA 1UJPA 1XKYA 1LM1A 4U4MA 2WO5A 5HULA 3IVSA 1JCMP 2YYUA 3FOKA 1PCKA 5DELA 3W7DA 1FWWA 1H63A 3S1VA 1OFBA 1KM3A 1D3HA 3NYZA 3STEA 4LVFA 3EKLA 2E6AA 4MYAA 1DHPA 7TIMA 4MOZA 1YXCA 4OQVA 1NF0A 3G0UA 1KLZA 1MZHA 4ZQMA 1JVNA 4QM1A 4JD4A 1YADA 3QMTA 4GUFA 4NX0A 4TIMA 4TO8A 4JTKA 2V82A 5K2ZA 3DXIA 1X7FA 2Q8LA 4K8HA 4EF9A 1KW1A 1LYXA 3NA8A 3VE7A 4O28A 3NZ1A 2B0MA 4NXSA 3SR7A 4LV4A 2E1DA 3FFSA 4MIMA 4LVGA 2NLIA 2XN2A 1VYRA 3THAA 2C19A 4N4PA 5BRBA 3EWYA 4GUHA 2DZXA 5LKYA 5IBXA 1GOXA 2X2GA 3TAKA 3OVPA 1Q6OA 4UTTA 5DN1A 4FHAA 1VC4A 1EP2A 4Z0SA 1PHWA 5D38A 3LCFA 1ZAHA 5F4SA 1SO4A 2G97A 3GXNA 3ATZA 3B4UA 4PCFA 4FXSA 5CZSA 1NEYA 4UTTC 1R2RA 4OT7A 3LLDA 3DFPA 3LB0A 3TMQA 4NX5A 1AW5A 5KZMA 4R34A 5HINA 4KFNA 3NEVA 2JKEA 3EXTA 1YTKA 1TTIA 4M7TA 4HPXA 4W9TA 2NWRA 3SSJA 1GVRA 3WJZA 2V30A 4ADSA 1YDNA 4S2BA 3L65A 1A53A 3WK2A 1H62A 5D03A 2J9ZA 5I3HA 3B0VC 3R12A 5J5DA 2A6NA 3MBFA 4QJ1A 4NJJA 5D2XA 5DCBA 2D73A 1EX5A 4XWUA 1IXOA 3G8RA 4Z08A 3T40A 2NUYA 1IF2A 3MI3A 2B7PA 1RPXA 3G1HA 5HWMA 2B7QA 4WJEA 1ICPA 3QQ0A 3W73A 4GBUA 3WJWA 5I3FA 2J6XA 2A21A 1ADOA 4AHQA 2HS8A 4O54A 4G1KA 2QCHA 4IGHA 3KOFA 5CKSA 2C15A 3G1AA 3W83A 5HWJA 3B03A 4WD0A 1KFLA 3G22A 3UD6A 5FF4A 1SUXA 3HB9A 2YZRA 2CLIA 2RDUA 4BI6A 2WOQA 2UV8G 3PG8A 5HNRA 3C2FA 2GVGA 4E38A 2PE4A 3UZJA 5EMUA 4I7WA 4RJEA 2VFIA 1GG0A 1R2SA 2X1UA 5FF2A 1P0NA 3BPWA 3ZR4A 4TMCA 1VS1A 3R8RA 1IIGA 2C1HA 3P62A 3W7CA 2QCDA 4XKYA 4DF1A 1FWSA 5FEXA 5AYYA 3FKKA 3EEGA 5AHMA 1OABA 4TMBA 1JCNA 3BLFA 3VE9A 1JRCA 2NX9A 3M41A 1LLZA 1NSJA 2QKFA 5CSSA 3C52A 3GB6A 5HUOA 5AHEA 2CZEA 4QIUA 4B5NA 2QUUA 1YLVA 5LNSA 4QAIA 4FX6M 1I45A 4WY0A 2A6LA 3IVUA 3IVTA 5KITA 2J9XA 5TQLA 4YLWA 1OHLA 4JX4A 3EX1A 4N9BA 1WDWA 3MUXA 2CLMA 4AF0B 2QUVA 2WQPA 3PY2A 2WJZA 4ZVJA 3DU0A 1GVSA 3U2OA 1LORA 4UIOA 2DZPA 3GNNA 3M43A 3DZ1A 1KTBA 1ME9A 1ZY9A 1OFQA 5K3VA 4Q4KA 5D32A 4EVZA 1VHNA 4UTWA 5K4XA 5AYZA 3RLVA 1GVFA 3PULA 1H7OA 2WPBA 3NQCA 4L4LA 5LSMA 1I2PA 1X1ZA 4HKPA 4YWIA 4QNWA 3CIXA 5I3IA 3STFA 3NGJA 1RR2A 3I68A 1XUZA 3W86A 1N7KA 3LGEA 1SSGA 3PF3A 4GWEA 1OX4B 3P74A 1SW3A 3P5ZA 3HJZA 1I2QA 1ZAJA 1IIHA 2BXVA 3G1XA 2KZHA 3QRHA 4NVTA 3M9YA 1M6JA 3M5YA 4JDYA 1KFCA 5D2VA 3F4WA 2ZZ2A 1JUEA 2FB3A 2J27A 4ZQCA 3BLIA 3IRDA 1SZFA 1KFEA 3W2MA 3W70A 1T8XA 2EF9A 3E0IA 4JXCA 3B04A 1LCOA 4IJBA 3ABOA 3G1SA 1GVOA 3C8FA 1DJNA 3GR7A 5K4ZA 5DXXA 2R8WA 3EWWA 2Q3RA 5I3GA 5E93A 1THFD 2QCMA 2NZLA 1EA0A 1JCJA 3MBDA 5LNUA 2EGZA 1W3IA 2ZRVA 1H50A 1AL8A 1AL7A 3W6YA 3W2JA 3MHUA 4FX8A 4O4WA 1EWEA 2V5LA 1L6SA 1TPDA 5FESA 4O10A 4UTWC 2V2HA 3L0KA 2VFGA 5D30A 3T4CA 1ONRA 3HG3A 2DJXA 2QCCA 1K8ZA 4TR9A 4A3UA 4XBKA 4UNKA 8TIMA 3QYQA 2H3DA 4NNCA 2C18A 4JTGA 3EX4A 1VYSX 1PE1A 2WV8A 1KM0A 4DF0A 3TW6A 2JK2A 1JRBA 1EP3A 5KMYA 4UFMA 1ZHAA 2V9DA 5D05A 1AK5A 4N9CA 3TX9A 4LC6A 4IMFA 3UWUA 5AC8A 3UZ5A 3ANYA 4CQ8A 3UQNA 1WX0A 4UCGA 3W7JA 5CZ0A 4JYDA 1DJQA 2GJNA 3TQ0A 3W1AA 2A85A 2BWGA 2ZRUA 3HPSA 3L0GA 1S5WA 3JS3A 1VJIA 1TQXA 1QPQA 2QJIA 2Z0IA 2FLIA 2I14A 3FJ6A 4I7UA 3EWBX 3SIZA 3CWNA 2E5DA 1OF6A 1TO3A 1GJPA 2Z6IA 1I8JA 3UPWA 1XBVA 4TX9A 3NPWA 4EWND 2E77A 4S1FA 5E0KA 2Y62A 4O0ZA 3B06A 1HG3A 2P10A 1VHCA 1QPRA 2NX1A 3LBCA 3W7MA 3G3DA 1P0KA 1F73A 3PBVA 5EKYA 4Z1BA 1S5VA 3DHDA 4AWSA 4IOTA 3TROA 4NJGA 3C2VA 1G67A 1H1YA 1LOLA 2Z2UA 3USBA 4HNVA 3H54A 1QWGA 2Z6JA 3THQA 1XBYA 3W85A 1OYCA 1VLWA 3QQ1A 4H6KA 4JTFA 1H51A 3EXRA 4CLMA 1A5SA 1O4UA 4PTNA 2E6YA 4D2JA 1SFJA 2ZRWA 4E2DA 3NQ7A 4X3ZA 4AXKA 3SGUA 2YFOA 3LCHA 4ADTA 4IQLA 4LWWA 3ABQA 3M44A 4O11A 2NUXA 5HWNA 3NVTA 4AB4A 1J4EA 3UWQA 1K3UA 4FNRA 3TV8A 5C54A 3NG3A 4ZQPA 3KVKA 2V2CA 3UWZA 5LHEA 1B57A 2FJKA 3GXTA 1C8VA 2RHGA 1DQWA 1SZGA 1LLWA 1O60A 2ZTKA 5EA9A 4HNTA 5AOUA 3DHFA 3NR0A 3NQ8A 3I7SA 4M6PA 4YCOA 3P81A 4HSOA 4M6VA 3WFAA 2C16A 1F5ZA 3G1FA 5SWUA 2PURA 3QW3A 2QCGA 1FX6A 5BNKA 1FDZA 3W2KA 3FS2A 3ABSA 3GLCA 1OX4A 1VQTA 1IGSA 4PFMA 3JRKA 1X1OA 5FF7A 1SU5A 4ONVA 1OFDA 1JQXA 2Z1BA 3LTSA 2P1FA 1TV8A 3IIVA 4Y8FA 2HS6A 3BW2A 1U83A 2TPSA 4LUIA 4MY9A 4BR1A 3GDKA 4MZ8A 2VEPA 4ORMA 1SZEA 4O53A 3UY8A 4CQ9A 1JCLA 3MYOA 3M6YA 1KM6A 2ISSA 3P8IA 3HGSA 3HF3A 3S9YA 2AQWA 3QPYA 3LCXA 3GR8A 1FCBA 3I65A 3PG9A 4OBTA 1I2OA 5BOOA 2ZRXA 1TTJA 1GYLA 4O4VA 1O5XA 4Z0JA 5F4WA 1TPB1 1W5QA 2QJGA 4CNOA 1PS9A 2H8XA 2WNZA 3Q58A 3IIZA 4JEQA 4JYFA 3RMJA 4O57A 3L21A 4CCDA 5DY2A 3B0UX 3VKJA 4X22A 4ZQNA 3P5YA 2OCZA 2FFCA 3FIGA 1EUNA 5D2TA 1ZALA 3P80A 2ZQ0A 3KRZA 2X1SA 1FDYA 5KSWA 1VZWA 2ABAA 2BTMA 4O15A 3W7GA 3LTYA 4O16A 4K7YA 3SW6A 2A7PA 2FPTA 3Q37A 4FNSA 1OK4A 2ZTJA 2ZA1A 1QDSA 2E09A 4C1LA 4LW7A 4AHOA 4Q32A 1OFPA 1R46A 3TCEA 3NM1A 4M6QA 3OIXA 3BV4A 4MLJA 3O6DA 3W75A 3GXPA 3TDFA 5LNVA 2J9YA 3C61A 2JGQA 3PBWA 3NXFA 4RV8A 2V8ZA 3UYCA 3TMLA 1TPC1 1Q6RA 3T78A 3BARA 3CIWA 1C9DA 1YXYA 4WZHA 1LP6A 2Y61A 2FPVA 1G4TA 3OA3A 2FQIA 1P4CA 5D2WA 3TC7A 3O63A 4CNPA 1QPNA 4NNBA 5LZLA 5BW6A 3FYOA 3GDMA 1TPH1 2VEKA 3BG5A 3EXSA 5BMXA 3NQEA 4TU1A 3UY7A 5FEZA 4PODA 5GVJA 2JGYA 2Q8ZA 3A9IA 4KFPA 4O8RA 2GVJA 4MY1A 5AFDA 3ABRA 4XZ9A 5HJLA 1Q6LA 5FEPA 5CSRA 2R14A 2Y70A 4U28A 1FXPA 2BZNA 1OX6A 1QPOA 1PCWA 3W7PA 3ATYA 2FIQA 2PRLA 3WJYA 5AN7A 2PCQA 3Q94A 4NXKA 3PWAA 1KA9F 1TIMA 1NVMA 3O06A 3WJSA 5KINA 1L2UA 2CZ5A 5G4WA 1TB3A 1L9WA 4WXZA 5G1TA 5TIMA 4O1BA 1KV8A 1P5BA 1ICSA 1O95A 3KVJA 3M16A 4DBEA 4HNUA 3PC0A 3KXQA 5D37A 4NZJA 3PUEA 1XBXA 1FY6A 2E5CA 3L0NA 2GUUA 1RQHA 1EPXA 3N34A 4L4MA 4GFSA 4PEKA 2XFWA 4JIPA 3CEUA 3LHWA 1R47A 2B7NA 1RQBA 5I3JA 3T55A 3QJAA 1WQ5A 4YL2A 5DCEA 3BGGA 4ICNA 3GIYA 4E2BA 5LGZA 3LHUA 4OHQA 1VPXA 4HIBA 3B8DA 3OEXA 2ZYFA 3STCA 1F05A 5AHFA 1HO1A 1FCVA 3IIOA 4EF8A 3N2MA 2PC4A 4YXGA 5HR7A 3T44A 3M5VA 1U5JA 4LUJA 5H91A 3S5ZA 4AWTA 3G1VA 4XKYB 4PH6A 5G1YA 4IMDA 5HQEA 4GE8A 3TQVA 3AJXA 4JNMA 1DVJA 4WY0F 3NPUA 1V7YA 4N02A 4FB7A 4O19A 3NQAA 4ZZ9A 3DKJA 3CM4A 3HPZA 4PC8A 1FCQA 4A2SA 1F6PA 3MP5A 4IPJA 3A24A 2VOMA 3L68A 3P61A 4MY8A 1RZMA 4DF2A 1H7XA 3ELFA 2JKAA 3DENA 2NUWA 4FNTA 4POCA 1AW2A 1TPWA 3O6YX 3B05A 4FF7A 2Y85A 3WK3A 3EWUA 4DPQA 2VEIA 3OVRA 5F2IA 3VI2A 1XDLA 6TIMA 5D33A 3PBUA 2ZFAA 1N8FA 1Y0EA 2ZRZA 2QDGA 3G8EA 2NXGA 4K37A 1BWLA 3LBMA 3TFXA 1G7VA 4QSHA 1K7XA 3LI1A 1YDOA 3BG3A 2B7OA 2RKXA 3IV3A 3A22A 4N6EA 4UTHA 3MHFA 2CLHA 2NX3A 3LDVA 3IIXA 3OBKA 3VCRA 1YTDA 4LTSA 4OU1A 3S5NA 3W84A 1JUBA 4DXVA 2VELA 1AW1A 3R5EA 2QR6A 3W23A 3TQKA 4IPIA 2DZSA 3OHIA 1XCFA 1FDJA 3W72A 2Y7FA 3S8HA 4N4QA 2YDAA 3LTPA 1G7UA 4MJMA 4Z1CA 3EX2A 1D9EA 4O0KA 5BMWA 2DJLA 2G96A 4JIQA 3C0JA 1JUKA 1M5WA 3GX9A 5F4XA 2EHHA 1GEQA 6ALDA 2CLKA 3LHTA 4M5PA 1WYIA 5CPMA 1D3GA 1UASA 1KBIA 1R30A 4ADUA 5HMSA 3NM3A 3MJYA 3ZFHA 4UMCA 1W1ZA 5LHFA 1SW7A 4NJKA 2CLLA 3KHJA 3TSMA 1KFBA 3G24A 5D09A 1FWNA 1OFEA 1NFBA 3C3NA 1OYAA 3CC1A 1TPEA 2ALDA 3UWVA 5AYXA 3NL3A 4IMEA 1VH7A 2QCDB 2TSYA 2ZZ6A 5HR6A 5F2MA 1YPFA 5L9FA 5KZDA 2QEZA 4JTSA 3I6RA 4FIRA 5MHBA 3MP4A 1OYBA 4JTLA 3TK7A 3QFEA 3M1ZA 1K02A 1TJPA 3WK1A 1UUMA 3PM6A 1GT8A 3S5YA 3I7RA 3MW7A 1XUUA 3LXCA 1QNVA 3IGUA 3NNTA 3SY5A 2Y89A 3P7YA 2TMDA 3EX3A 2QAFA 1TPUA 3UPBA 4Q33A 5LNRA 3NQ6A 2YYTA 1VCFA 3GDRA 2A7RA 2CZDA 2ZZ4A 3DFOA 3G3MA 4GUJA 4KWVA 3E02A 4M19A 5EPDA 3DFTA 4RZ5A 3G0XA 3O16A 1WOBA 3CWOX 5AHNA 1LTDA 2ABBA 4BI5A 1F74A 2PRHA 4AF0A 3CT7A 1G69A 1VLIA 4P61A 4LU0A 2G5WA 3NQFA 3LLFA 1EUAA 3O05A 4JX6A 1EIXA 3A21A 4K39A 4LV9A 2CU0A 2J24A 2I9EA 1ALDA 1F7BA 3S1WA 3SI9A 3W1RA 1QO2A 3TAOA 3L5AA 3QSTA 5H2ZA 5DBUA 4UMBA 4KFOA 4A21A 4LY8A 4BK9A 3NAVA 4UXDA 3NOEA 3DGRA 3MWAA 1M7OA 3N14A 3LRLA 3N19B 1LBMA 4RX0A 5KZEA 4ALDA 1ME7A 4CCEA 4KKXA 3W2NA 1DV7A 2JBMA 3B0PA 3NL5A 1TV5A 5ABTA 4HHPA 3SFKA 3HGRA 4HNNA 2ATSA 3RK8A 1KM1A 3V75A 3GK0A 5DY3A 4BFAA 1TRIA 1ZENA 1GYNA 5EBUA 1CW2A 5CG7A 3RU6A 4K36A 3GDTA 5DCDA 3CPRA 4NU7A 2A4AA 3K30A 2O7SA 1O94A 2DZTA 4JTIA 1G4PA 1VYPX 3HQ1A 3T7VA 4HT3A 3OG3A 4ML9A 3GNDA 3M5ZA 3HG2A 1IXNA 1UUOA 1KTCA 5IM51 5CPOA 3C56A 4YMZA 1EP1A 2J88A 3W7NA 3LV6A 1TTPA 5F1VA 4DQWA 4GUIA 2BX7A 3E9AA 2HSAA 4RR4A 4GC4A 2W79A 1H7RA 5A5WA 4AAJA 1W5PA 3U8GA 2QJHA 3A23A 3L67A 5C6MA 4MFEA 4MYXA 2WNQA 2Y7EA 2OJPA 4FEZA 1OG0A 1XXXA 3V1PA 1TCDA 3W2UA 3W1NA 5CPNA 1GG1A 4UTLA 4RCXA 1OK6A 2X30A 3F4NA 2YCEA 2ZZ1A 3S42A 3C6CA 2E6FA 2WSQA 1HUVA 1IXPA 1J2WA 2F7FA 2BSLA 1QFEA 4OWGA 3FEMA 3FYPA 4UTMA 3P84A 2C0AA 2C3ZA 2W6RA 2VFDA 2Y63A 4O1CA 3C4UA 4M7SA 5CZJA 1CX9A 1P1XA 2WSYA 1W5MA 2E5BA 4MZYA 3C2OA 1LRQA 1OX5A 1AMKA 1OVDA 3PUDA 4XBSA 1ML1A 1VR6A 3DFSA 2ZCGA 1YXDA 4JS3A 3QSRA 3LHVA 1C29A 1F2JA 1XC4A 4OGZA 1FXQA 3IGXA 3P8JA 4WXYA 4AMAA 3BK0A 3L5MA 5AHIA 3W7EA 3KVLA 1DOSA 3UXAA 2TRSA 5IBXC 4PL1A 3HGOA 1B4EA 2LLEA 1OFRA 3D0CA 3DH7A 3W07A 4OV4A 2RDTA 4JR5A 1ZFJA 1E51A 1SO5A 4K8EA 3NQ2A 1SO6A 2A7NA 3NQVA 1T99A 5K9CA 4QNEA 2V2DA 2ISVA 3R89A 4GUGA 3BG9A 3IIPA 5K9XA 3CLMA 2ZZ5A 2NXIA 1K7EA 3IGSA 1DORA 2CZFA 4JTJA 4K38A 4NUWA 4LVDA 5DLCA 1YPIA 1QR7A 2R94A 1T96A 1ZCOA 2R91A 4IMGA 1OF8A 3E12A 1LOSA 4FNUA 1ZJIA 2Y7DA 3L66A 1LRTA 3LCLA 4DPPA 3QZEA 1KM5A 3QMRA 4UTKA 1Q6QA 2ZZ7A 2HTMA 2ZBTA 1FBAA 4P2VA 4A2RA 2E6DA 3NL6A 2ATMA 2EKCA 3LOTA 2A5HA 3PSVA 3GVGA 3M0ZA 2YSWA 3PR2A 3IEBA 1WAUA 4JY9A 1SR9A 1GTEA 4NZFA 3W7QA 4UR7A 1TYGA 3FLUA 1AG1O 3VFLA 2QDHA 3KVMA 3P82A 3O1NA 3QC3A 2ZA3A 4N9DA 4O17A 3LX9A 2V5BA 1FCUA 4FNPA 1SO3A 1TPFA 3HG5A 5DBTA 1ZNNA 1SFLA 2YR1A 4QITA 2Y7GA 1WBJA 3TE9A 4DO5A 1MO0A 3RNDA 4CNNA 2VKZG 3G18A 3DFQA 1M7PA 3LXBA 1JULA 2V81A 1PIIA 3TXZA 3N9SA 1VRDA 3MI2A 4N2YA 1KLYA 3STGA 3TIMA 3TSBA 4WY0B 3UNDA 1RD5A 4Z1AA 3RFAA 3NQDA 2DZVA 2NV1A 1XM3A 3EKZA 3N9RA 2VEMA 1MEWA 3W7OA 4NQ1A 3NQGA 4R7JA 4XQ6A 2YGYA 1N55A 2XN1A 2QCEA 1H5YA 4QQ3A 2GPTA 1PVNA 1MXSA 1I4NA 2QCLA 3DBPA 3PS7A 4HPJA 3LCIA 3S5OA 4A29A 1NAL1 2O7QA 1H1ZA 4HN4A 2FTPA 5FI8A 4JICA
chains in the Genus database with same CATH superfamily
3P60A 1JD7A 5AC6A 1NF7A 4IMCA 5LYRA 1YE4A 2CKRA 4L65A 2OQYA 4DWSC 2PTDA 4EP8C 1E0XA 2CLFA 4S38A 3RF9A 1DXFA 3DKLA 1OZQA 4Y9OA 1EF2A 1TKKA 1ZAIA 3AWNA 4PN2A 3MI6A 1PUDA 4AYSA 3HBLA 2YIHA 4GI4A 1R38A 1EYWA 1CI1A 4IFKB 3O0KA 1UC4A 4IIHA 4INFA 2QULA 1MQPA 3R11A 3R2GA 1QVBA 4NASA 1QCWA 4AVFA 4LF1A 4A4AA 3GZ3A 1VRXA 4DBDA 2XZ9A 1UR8A 3LERA 3QPEA 3WKZA 5U4NA 1XQKA 1MSSA 1K03A 4FX7A 4O1EA 1UZ4A 2CETA 4TQTA 4PRTA 3C2YA 3OTRA 2BGNE 3QH2A 4OV9A 2VVNA 1V3HA 3FAWA 3ITTA 1V6VA 4GXPA 1YQ2A 3KZPA 4KEVA 3S6DA 3DG3A 4MWAA 1REQA 4LRTA 3W1QA 1J8VA 2NQLA 3NTYA 3A13A 5LNWA 2A0NA 4B5SA 1TMHA 1HJWA 2E67A 1R5YA 4UTJA 3M5XA 4YHGA 4CCCA 2QF7A 5D02A 3EDKA 1OFAA 2D0GA 3ID7A 3S83A 5IOBA 4M82A 4IXXA 5FCZA 1KNWA 1F6KA 1V4YA 3J7HA 2A3LA 3F1QA 1IE7C 4BQ3A 3C2EA 5E70A 2V3FA 1GKPA 1H7NA 3U2ZA 5F2LA 4W93A 1JCXA 1J6PA 4RKAA 4IL2A 3OBEA 1TSIA 1EB3A 3UEQA 3LRMA 5G5IA 1KM4A 1X6UA 2WQDA 5G4HC 2ZXDA 2G8ZA 3WBEA 4AG0A 2QAPA 2HXTA 2VCCA 3D6NA 5T26A 4Y9MA 1DIEA 4HYVA 1J0JA 1YIXA 4UFHA 4Y9PA 2GJXB 1SPQA 3KRBA 1XFBA 4C91A 2WXDM 3DBNA 4OKDA 1KTNA 4UC5A 1XLFA 1G5AA 3LBOA 3CXOA 2QJNA 1PHQA 3BVJA 3FGCA 4JQ3A 4JIHA 2XYLA 5AC7A 2OX4A 4XZIA 1EIBA 3R8GA 3TYEA 1UB3A 3W9ZA 4O14A 3S1UA 1LROA 3TP4A 3B8TA 4QDPA 4UFLA 1G6CA 3PZIA 2PGWA 2DZBA 2BHZA 4XZWA 2NXHA 3V0TA 1YEYA 3GG8A 2YB4A 2YW4A 3MO4A 3HO8A 4RLIA 2R1NA 3KHDA 1ELSA 5LA0A 2PDQA 4JTUA 3DFNA 2R24A 1WA3A 1XDMA 3QGKC 1JEZA 3CAVA 4L6DA 3VOJA 2ZICA 3HJEA 4Q8WA 1A4MA 2VFHA 2PA6A 3TVAA 1XIJA 4IFOA 2FFIA 2XINA 4MUZA 4LS1A 3AHXA 9RUBA 3GAKA 1US3A 2ZE3A 4JFUA 3AU6A 1QMLA 2JKPA 4IF2A 4YNGA 4J3XA 4PYSA 4JN6A 1CNVA 1H61A 4HYRA 3A5FA 2YDRA 1EQPA 2IKJA 2WJEA 2GVLA 2HVMA 3RG6A 2AOSA 3UWYA 1SQ7A 1QATA 3ZWTA 1KCXA 3EOEA 3FW6A 1ME8A 2G50A 1H60A 1B9ZA 5D04C 5GNZA 1TV3A 1YTEA 1MXDA 1S2WA 3PUOA 3AFBA 1XRTA 4I9JA 1F6YA 4MUPA 3WH7A 3PN8A 5CPQA 3TEVA 3PSWA 1G9HA 4B3LA 4O1AA 5DT5A 4V15A 1TPVA 3GHSA 2QUTA 2EJAA 3GVVA 1GOIA 4C7FA 3QPZA 4KRUA 4K3ZA 3EBVA 4TVCA 4J3TA 1A5AA 4RXFA 3CZEA 4IQJA 1ADDA 2F2KA 3NQBA 4GPNA 1D3CA 4PSPA 2AAAA 3NQMA 1JJKA 2OYLA 4DVOA 3ZVHA 5C7HA 3RMEA 4ZGYA 4AD2A 4EIVA 2EPOA 1FQ0A 2O0TA 1PAMA 4S3EA 3NFUA 3MMWA 2J7FA 3WH6A 2Z27A 4PE8A 1FP9A 3DI0A 3WD0A 2YFNA 3KFTA 3E49A 1DWIM 3VZYA 1JNDA 2P0IA 4LNYA 1KRAC 3QR3A 4P8WA 1FUYA 3U5UA 3S1GA 2JQXA 1Q63A 1A80A 2OLHA 2WSRA 1EZWA 3VKAA 5CPLA 1MZRA 5JMUA 3EB2A 4LVAA 4GA8A 2HPMA 4IXHA 3TC6A 4K6AA 3SZ8A 2V5DA 1E43A 3RITA 3S6TA 3QR0A 3QY7A 4Q4RA 3TXVA 2PWGA 1LWJA 1VJZA 1DXIA 1R7AA 3RLUA 2VQTA 4LT9A 3AYTA 4PMJA 4GQRA 4IWWA 4S2CA 1HJUA 1BKHA 3WF4A 3ZS4A 4MWAD 5CZTA 4DJDD 3EWZA 3I7QA 4MKVA 2H3BA 1ITUA 3W7HA 5TD4A 2VZUA 1TELA 4Q4QA 3CV7A 1YE6A 4OFCA 4R33A 3LV5A 5EMKA 2NVAA 2Y6ZA 1HP5A 3RDKA 3I6EA 3PB2A 1Y5VA 4RZBA 3W76A 1H7PA 2VFEA 1E9IA 4LS2A 3QGAC 3IJIA 5XINA 2VGGA 1LQ0A 1U2YA 3QV6A 1UKPA 4A22A 2QW5A 1B2YA 3E5BA 2REQB 1UP3A 4WGHA 1FWFC 1XL9A 3HOJA 4MPQA 3CB3A 1XICA 2OZTA 2EPKX 1PPIA 1UG6A 3UXLA 3SJ3A 4Y96A 4QCEA 3B40A 3NPXA 4GQ0A 3OA5A 2PGFA 1SZNA 4GRSA 4M29A 3ZVIA 4AHPA 1KO0A 1WV2A 1DQXA 1XKJA 3R43A 1V79A 4YWSA 3S3GA 2Q3OA 3BSHA 1T6MA 2QYGA 1QW7A 3KX6A 2BHYA 3RLGA 4PSRA 4I7VA 4J9JA 5E1QA 1BF2A 3UZXA 3SGZA 4UFJA 1A5UA 3LCGA 3MTWA 5D9PA 3RJYA 1E40A 4S23A 2WO5A 3NWRA 1DJYA 3WDHA 2YYUA 2E4TA 2VCAA 2WCAA 2YA0A 2VJXA 8XIMA 5J8LA 4NP7A 3S1VA 4EX4A 1OFBA 1KM3A 3O0FA 3NYZA 5HJXA 3EKLA 3NSNA 1XYLA 4ZOCA 3UFYA 1KXHA 2GGGA 1JVNA 1YADA 3FGCB 4W7VA 4F0LA 2VWSA 4ZOAA 2QJMA 4X60A 1DPMA 3TLQA 3DXIA 2OFJA 2Q8LA 4EF9A 1WUFA 2XISA 3BOFA 3LUTA 1LL6A 3NCOA 3VE7A 3EWCA 4O28A 4OUEA 2B0MA 1UR9A 4IIGA 3VC5A 1T8QA 3DHUA 4JL1A 4OOUA 1E0VA 4KIRA 3CQHA 2A3AA 1XRVA 4EAYA 3THAA 2DZXA 4ERAA 3LPOA 3WQ4A 2UY4A 3OVPA 4UTTA 2YKKA 4FHAA 4W8LA 3EEZA 1PWMA 2OKTA 2G97A 4PCFA 5CZSA 3LB0A 5HMDA 4MB5A 4NX5A 1NIUA 3NEVA 2I5GA 1EDTA 2PDIA 3SSJA 1GVRA 2I9UA 1DP0A 3WJZA 2V30A 4S2BA 3WLPA 1XF0A 1AJZA 2DY3A 2FGBA 3TOPA 3UXKA 5CC3A 1P0EA 4QJ1A 3E2RA 2FH6A 3CMGA 1IXOA 3ARXA 4Z2GA 2P76A 3G1HA 2B7QA 5DFAA 5GNXA 3W73A 3WJWA 3ECQA 1US2A 1ADOA 2VL4A 2CERA 5HMFA 2HS8A 3VINA 2WMKA 4G1KA 2QCHA 1L8NA 1NFPA 2GGJA 5M3WA 3KOFA 2VRJA 3W83A 2C15A 3G1AA 4AZCB 4AZ7A 4B9ZA 1XPGA 3G22A 3MZNA 3UD6A 3GU9A 2GVYA 2CLIA 2FHBA 3GFXA 2RDUA 2GVEA 4BI6A 3WQWA 3ZT7A 3IJDA 1VB9A 2GVGA 2PTYA 3S4TA 2PE4A 2EG6A 1GG0A 4DJDA 5A6JA 4CD4A 3FJ4A 3MUAA 4UR9A 4DO7A 1VS1A 4C60A 4ZEPA 5MKGB 5HATA 3AZTA 3MU7A 1J0ZA 3U2CA 2FDMA 1C90A 4NAFA 3EEGA 3B8UA 3SSZA 3VE9A 2NX9A 4XVDA 2E0PA 1ZU8A 3N12A 2CZEA 1SJDA 1TWSA 1W6TA 4FX6M 1XC6A 3BANA 1GVYA 4GCXA 5TQLA 4ZODA 4YLWA 4L1XA 1X1NA 4N9BA 3NUKA 4JTAA 2CLMA 2PDGA 2WQPA 4XD6A 3BAJA 4ZVJA 1GVSA 3WLMA 1D8CA 1LORA 2DZPA 4HOZA 3M43A 2G3JA 4IG2A 3CK5A 2O92A 3CZLA 2GL5A 1KTBA 3E5PA 1OFQA 3AIRA 5K3VA 1M03A 4HK5A 1PWLA 3LU2A 3SQLA 3VNYA 4JCLA 3RLVA 1GVFA 1Q2RA 3NQCA 1I2PA 1FFQA 3TTSA 3WEOA 5I3IA 4RNFA 2QIWA 2WZIA 2BY1A 1GYMA 4C5ZA 1N7KA 3K8KA 3OYZA 3PF3A 1HL9A 4QE5A 1TE1A 1I2QA 1ZAJA 2GOKA 2KZHA 1ENUA 4D6IA 1XCXA 1XGZA 2R82A 5DT7A 3U7BA 3VIIA 4M1RA 3W70A 2EF9A 4JKMA 2VUYA 1B1YA 1H5VA 2OLAA 5DXXA 5A6MA 1RLCL 4YTSA 2Q3RA 3AROA 1L0PA 1NFGA 1R3YA 1EA0A 4EK7A 1EJRC 4Y7EA 1LL7A 1ZP3A 5LNUA 3W6MA 3WLQA 2DVXA 1XFCA 2PGRA 3UJSA 1JPKA 5XIMA 3UXIA 4GINA 1AL8A 1AL7A 4GGBA 4KS0A 4J1OA 4C7DA 4O4WA 8A3HA 3CMFA 1PZ2A 1P6CA 5D30A 3GE7A 1ONRA 3HG3A 1PX4A 5HQMA 4Z2JA 1F8IA 2VEGA 4XBKA 4UNKA 4QROA 2E9BA 1E6SM 4NNCA 2ZC8A 1OWQA 3PJXA 3BZJA 4IZGA 2WV8A 3OB8A 1E6ZA 2Q6ZA 2WK2A 4UFMA 3V36A 3UZ5A 5E6YA 2IKIA 3UQNA 3W7JA 1GW1A 3S9IA 5A6LA 4WF7A 1DJQA 4CU8A 2A85A 3WQOA 3HQNA 2HE8A 5T8GA 3JS3A 1VJIA 4DYEA 1QPQA 3FJ6A 3CWNA 4MNMA 3U7VA 1T40A 3STPA 2FTWA 4Z17A 3B06A 1JDAA 1VHCA 3B9DA 5D4YA 1O66A 2NX1A 4XAZA 1RJPA 3AIBA 3GU2A 4M56A 4O0QA 3PBVA 2Y5EA 1S5VA 2ZVRA 3QC0A 1W1PA 2PI6A 1TWIA 3TROA 4L9XA 1AQFA 1G67A 4UQCA 4PTMA 4HNVA 2Z6JA 4D8AA 5I07A 5HK4A 1UD8A 4Z2HA 1YHTA 3QQ1A 5I3DA 1GOKA 1JYXA 2CYGA 3LENA 5CBBA 1SFJA 4CU7A 4X3ZA 3VGGA 4FALA 4GYPC 4LWWA 4NAEA 1A5KC 5HWNA 1ITCA 3VM7A 1QNPA 3TV8A 4JTQA 1VJSA 2WHJA 3MWCA 4ZQPA 3KVKA 1B57A 1ODZA 1C8VA 3SY8A 4GYPA 2QF8A 3RRAA 2PWFA 3PHAA 3Q65A 4NZCA 4JQ4A 3NQ8A 4H8VA 1UUQA 1UH4A 3KOWA 4R7WA 5HOSA 2PAJA 4UZSA 4UZUA 1DJHA 2C7FA 1X38A 3TQPA 3BICA 2H9AB 1ZS2A 4MAVA 1Q66A 1P7TA 1HZYA 1OFDA 4M0XA 2GGEA 2Z1BA 1GJWA 1V0LA 3VNZA 2BB0A 1A49A 5IDZA 1AFSA 4GI6A 3APYA 1U83A 1XLLA 3FNDA 3VNKA 3GDKA 2XFYA 2PZNA 3UY8A 1JCLA 3UCQA 1UWSA 3LNPA 3PFMA 1BG9A 2YCLB 4AXNA 4CD7A 3HZ3A 4PUNA 3W82A 4MWAC 4H7ZA 4Q7NA 3LCXA 2W4XA 1FCBA 3KCLA 4OBTA 4ZXLA 4J7RA 4U5IA 3S2CA 3PZGA 3BJTA 2RAGA 3WYZA 4JN7A 4M51A 3L23A 1MW2A 4LPCA 5AECA 2H8XA 3RMJA 4O57A 3BLKA 3L21A 1W2PA 4CCDA 2AMXA 5LA1A 4GYFA 3GQYA 4ZQNA 5BRPA 2OCZA 2FFCA 4C6IA 1FHUA 4ATWA 4UBPC 1EUNA 4RE2A 1YPXA 1FDYA 4KRZA 4HZMA 3N9KA 4O16A 2VI0A 4PUUA 1TJ0A 2A7PA 1KRBC 2FPTA 4LYRA 3UP8A 4EXAA 1OK4A 2ZTJA 3CL7A 4FXJA 2IPWA 4NZ4A 1CBGA 4PMRA 5C9RA 3BURA 3WD2A 4GLEA 4M6QA 3CHFA 3GXPA 2VD8A 1V8EA 2J9YA 4YIWA 1UA7A 1XIDA 3PBWA 1DWGM 4MWAE 3CZJA 1Z6KA 4C6EA 3UYCA 3VIKA 1VENA 4B5UA 2PWVA 2BVYA 3G6LA 1C9DA 2XDFA 4DZIA 2WSKA 2OQLA 3MSYA 4HJWA 4RDZA 3UT0A 4D6HA 4AD1A 5D2WA 2EBNA 3I3EA 3HMCA 3U9IA 3BZGA 1EL3A 5I7GA 4XO7A 3GDMA 3EXSA 3OIHA 1RK5A 4L6HA 3M0HA 3RGTA 3FXGA 1DJZA 2VQUA 3ZLFA 5FSEC 4O8RA 2ZADA 3PJTA 1Q6LA 1RSCA 5H8PA 5FEPA 5CSRA 4U28A 2BZNA 3NZQA 3PP7A 1JYWA 2J7EA 3AICA 3GW0A 3NGFA 2VM8A 1QPOA 1J0HA 3W7PA 3ATYA 2PRLA 3N25A 3CYJA 2FHFA 1V03A 1VBRA 1TIMA 1JFXA 2WYSA 2ON3A 5G4WA 4WXZA 4PRRA 3TYUA 1ZRQA 5G1TA 4QFUA 2WCGA 2YBVA 1B3WA 1DTUA 1IEVA 3WH5A 2C8NA 4KMQA 4HNUA 4MB3A 5E09A 3GXMA 1J79A 5CGTA 5FJTA 2GDQA 2PBGA 4CNTA 2E5CA 4AIOA 3PPGA 3CO4A 3L0NA 4QLJA 4HOXA 1FHVA 1EPXA 1RQHA 2PBOA 4AD3A 2UY2A 4R9OA 4JCMA 3WQ5A 4CQBA 3UETA 4JIPA 3CEUA 2X1IA 3QJAA 4KF1A 3R7MA 1WQ5A 3BGGA 3EA2A 4XBJA 1VPXA 4ZSTA 2W67A 1BHGA 4AC7C 3OEXA 1QBBA 3GXFA 2HDJA 2JIWA 1F05A 1UKQA 1K8CA 3IIOA 4M80A 2PC4A 2OO6A 2ASHA 1MRQA 4O8AA 5JIWA 1V08A 2B31A 3N2CA 1BGAA 4PH6A 3A6OA 4IMDA 5HQEA 3TQVA 3BLDA 1SFSA 3E0WA 3MDUA 4KEUA 3VIMA 4UB9A 1DVJA 1V7YA 1OGBA 4FLRA 2QVHA 1L6FA 4DJFC 1P1MA 1FCQA 5AKQA 1F6PA 4YVXA 2V3EA 4IPJA 4JKKA 3TNBA 2VOMA 2RJGA 3L68A 4MY8A 1F3TA 3VOGA 1K9EA 4FF7A 2JEQA 2Y85A 4DPQA 4BS0A 3OVRA 3VMNA 1XH1A 3PBUA 1Y0EA 1AODA 2ZRZA 2QDGA 4GC3A 1QPKA 3I6TA 1G7VA 3LI1A 3PBMA 1DEDA 3D5HA 1X7IA 2B7OA 4UTHA 3SRKA 3SUSA 3IIXA 3OBKA 2P88A 1YTDA 2Z2BA 1BWVA 3BMVA 4OU1A 3S5NA 3W84A 3SUTA 2QQ6A 2VELA 3UG8A 2VX6A 1FDJA 3N6QA 9XIMA 2YDAA 3LTPA 4D6FA 4JIRA 4MJMA 1D8WA 5BOFA 2OG9A 3GH7A 4JIQA 3OLDA 2J7CA 4MDPA 2Z29A 1O68A 5F4XA 2VRQA 3CMJA 6ALDA 5FAJA 3L4WA 2G4FA 3CWHA 3WLOA 1KBIA 1R30A 3ITGA 5HMSA 5CPSA 5DF0A 2GZXA 2ALRA 1CGTA 3SY1A 1SW7A 2DPEA 1Z89A 1X98A 1W9XA 4DM1A 2J74A 3R0UA 3VKBA 3R58A 2GUBA 5KZDA 3HM7A 2JFEX 5MHBA 1WKFA 4I3GA 3S5SA 3RU8X 1OYBA 5H8UA 1I0DA 4JTLA 3QFEA 1RD6A 3TJIA 1FVPA 1FKWA 1X96A 1WB0A 4URIA 4ZSUA 5CLTA 3S5YA 3TZFA 4MSSA 2X05A 1AJ0A 1W1A1 4J35A 4CVUA 4HQVA 5IDIA 4KRTA 1MDLA 2P3EA 2TMDA 3EX3A 2I56A 3EDJA 4HA4A 2X42A 1JXKA 4CD8A 1SVDA 2A7RA 1Q8JA 4KWVA 3M0IA 3AWOA 3O16A 1WOBA 4GY1A 2WLYA 4QLKA 4BI5A 3MUCA 3DG6A 3QV9A 3WQ8A 1BVZA 2F9RA 3LSBA 1HJQA 3CT7A 4N42A 4P61A 2G5WA 3NQFA 4JTDA 3OHMB 4JX6A 1EIXA 2J24A 3W00A 4Q6XA 3SI9A 3PPCA 2DIJA 4WLCA 2PDCA 1XSJA 4MADA 1MDRA 4KFOA 4AY8A 4A21A 4BK9A 4DY1A 1AH4A 3UR8A 1EOMA 3A47A 1H11A 1LBMA 2ZUUA 1OCQA 4ALDA 1ME7A 3PZUA 4DB7A 1MW0A 4HHPA 5JBEA 1TZ7A 4MTVA 5IFTA 5EBUA 5I79A 2QNEA 3AS1A 3RU6A 3GDTA 2WZEA 1TA3B 3SJNA 3GSMA 2A4AA 3ZT6A 2O7SA 4PUKA 1O94A 4JTIA 3HG2A 1VFFA 3DC0A 4NZ1A 2F38A 1CIUA 5KETA 1OB0A 2BFGA 2ADAA 2VZOA 4ZB5A 4YMZA 4QRNA 1EP1A 1NQ6A 3WLLA 3W7NA 1SZRA 3LV6A 1OQFA 4I8YA 5F1VA 1MVYA 4A05A 4DQWA 3LQGA 2HSAA 4RR4A 1G01A 3R0DA 2W79A 4GC4A 3VGBA 3U8GA 3T0TA 3A23A 1W3JA 3L67A 5C6MA 4HMDA 2L5HA 4JIEA 4LALA 1HGYA 2GWNA 1OG0A 1XXXA 4ZTXA 2R1MA 1GG1A 4OBRA 4UTLA 4RCXA 1S5MA 2YCEA 1R3VA 1UD3A 1JPDX 4I90A 3FEMA 1WCGA 4UTMA 3P84A 2YJQA 3MVTA 3C4UA 4M7SA 3V5CA 1CX9A 2WSYA 1OX5A 3PUDA 4ATLA 1AD4A 4V1XA 1QASA 2HNHA 3AOFA 4KBXA 3QSRA 1F9CA 1XC4A 2D3LA 4OGZA 2D20A 2WZTA 2Z1VA 4NKCA 2D24A 4XSLA 4PL1A 3HGOA 2QV5A 4KESA 1XIEA 4LUTA 3A4WA 3W07A 3N29A 1E51A 1SO5A 2Z28A 1RA5A 2YDSA 2A7NA 4WDXA 2OGJA 4QNEA 4I5XA 4IIEA 1E9YB 3IUIA 5CH9A 4GUGA 2I5QA 1PKNA 5FD0A 2ZZ5A 1XG4A 3BLLA 2CZFA 4JTJA 4NUWA 1RY0A 1C8QA 3OLIA 4P8XA 1T96A 1GUVA 1ZCOA 4IMGA 3K1DA 1OF8A 3UG4A 1LOSA 4FNUA 4XD3A 2Y7DA 2PLCA 3URBA 3MV01 3WUBA 1BGGA 4B91A 3MMDA 2OELA 4GOAA 1FFRA 3GFYA 4OOZA 4IJCA 5LIKX 4P2VA 4E4FA 3NL6A 4JQ1A 2ATMA 2EKCA 4F9JA 2BOFX 3IRSA 1QW9A 1BFNA 2IS7A 1SR9A 3NZGA 1GTEA 3HURA 2J75A 3FLUA 3VFLA 4QJ5B 5B7ZA 2Z4GA 3ZLHA 1I1WA 4N9DA 1V6XA 4KERA 4FNPA 5MKGA 3APGA 1W9BM 5DBTA 1ZNNA 1SFLA 4QITA 3TE9A 1F8MA 3U0HA 4CNNA 3VIPA 1XH0A 3QFWA 4H19A 3EB3A 3TXZA 3NEHA 2WWDA 3STGA 1YNQA 4WY0B 2WPGA 3N18A 2B81A 2INEA 2J13A 2V3GA 1MEWA 4R9XA 4NQ1A 4R7JA 1GZ1A 2YGYA 4EPKA 2XPKA 3BC9A 1N55A 3S2JA 4AISA 2OEJA 2DUAA 1MXSA 1QWKA 2V69A 3ZJ8A 2WMIB 4HPJA 3LCIA 3S5OA 2E8YA 4LUSA 2FTPA 3BG5A 1LOLA 3AIWA 3I4EA 3TZNA 1IYXA 1YBQA 1FWIC 2WKGA 4GD0A 1HXJA 2X1RA 2VWTA 1UIPA 4O1FA 4I6KA 2VC6A 4JTTA 1TVNA 5KZ6A 1Z7AA 1H7WA 1M9HA 1Z42A 4X0VA 6REQB 3NPVA 1LF1A 1P48A 4GNKB 4MNKA 2DZUA 2NT0A 1RVGA 2XIMA 3L2MA 4Q8UA 2UY5A 3UGRA 3M6DA 4HSNA 4IX2A 1UP2A 5J04A 3ANUA 1DXEA 4ZB0A 4AMCA 1EGVA 2Y5SA 3SUVA 2C14A 2Y5JA 3EWXA 2HBXA 1IT8A 2CFFA 4Q8PA 2D2HA 3BDKA 1FWTA 3O15A 4DNMA 1RJQA 1KC7A 5JBDA 5CBIA 1PDZA 1XX1A 1XHGA 1JQVA 3W22A 2WKJA 3UJRA 3LM7A 3WDRA 3PZOA 4H2CA 2BG5A 7ENLA 4HU4A 2ZDRA 2WC4A 4QSFA 3L2IA 3FA3A 5H1WA 1M7XA 3LZ5A 3FJLA 4JHZA 2YCJA 4GVGA 2Z25A 5AC4A 4QCFA 2OT0A 4FNQA 3B8IA 3V18A 4RZ6A 3P0XA 2GFTA 3CQ0A 1W3TA 3DECA 3PB0A 4AQLA 1HKJA 2WBKA 1QHOA 1P7TB 1Y5WA 5AVHA 2H6RA 4M3PA 4UFIA 4XKMA 4LC8A 1A5CA 5JH2A 4UR8A 2NV2A 3M47A 2ISWA 4PBEA 4J3VA 1CGVA 2PP3A 2IW0A 3B4YA 2G95A 1O5KA 3DERA 3BLEA 3E6EA 4BY3A 4O50A 3GDLA 3GNPA 1CPUA 5E9XA 2GJXA 1F61A 4PMUA 2PB1A 4X9SA 4YJ5A 1AH0A 4C6NA 2IUZA 1GEHA 4JYEA 5C5YA 2V63A 2NVCA 5EL1A 1O6IA 2NWSA 1QRQA 3NZPA 1WBHA 3WJXA 1AH3A 4ZMGA 2QDEA 2REQA 2GOUA 3W7KA 1EWDA 3TJLA 2DH3A 1PO9A 1PIFA 4GXMA 3ZZ1A 4KGJA 1VFSA 3VUPA 4HZ7A 5DXYA 3WNLA 4GVIA 1J93A 4HMCA 4NT0A 3WBAA 1DBTA 4KWWA 3OZMA 4KCVA 3UCCA 1E6PA 4GVFA 4Q22A 3CEPA 1B31A 3CL6A 3NO5A 4W86A 4DJFD 3T2OA 1BAGA 3VDAA 2PTWA 3KAOA 1GPWA 2DT0A 3ISIX 2HK1A 3ENLA 4S39A 1G94A 2FTYA 3W1TA 3ARVA 3F03K 1OC7A 4CVWA 4TTGA 1K7FA 3W87A 2DQXA 2AAMA 1BKSA 4PA8A 4ZE5A 1OIFA 4FXRA 1BYAA 2BODX 1EBHA 2CWXA 1KV5A 2VFFA 1H49A 3RM9A 4EPEC 2Y1HA 1HTIA 4RZ4A 1NP0A 5IXEA 1GZGA 2P8BA 2VTFA 4M8UA 1PX3A 4UTIA 5PTDA 2PGEA 2XH2A 2YPIA 1FKXA 2CEQA 3DCPA 1XV8A 3S1XA 1ESWA 3MP3A 2EEXA 2CLOA 4R7OA 3ARSA 2VX4A 1S5TA 1HT6A 2XGIA 3GXIA 2VDIA 5DRCA 4AEOA 3O8AA 3OODA 4UMAA 1EXBA 4H8HA 4LVBA 2DIEA 2QCFA 4OE7A 4RPQA 1GVQA 1XPYA 4F3HA 2PDYA 3LHZA 4FR1A 1WE5A 4EPBC 3MO7A 1FH7A 4X9YA 3AXKA 2F2HA 1L6GA 4ZL1A 3GG7A 1K6AA 3TC3A 1YDYA 4JTHA 2Y8UA 2W91A 2QV4A 3CIVA 5CGQA 2EG7A 2DSKA 1JGMA 2PD9A 2GQ8A 4L4OA 4YCPA 3EOUA 1WKEA 3N3MA 2VMFA 1GQNA 3W1PA 3VK5A 4IUOA 1XI3A 4X2RA 1IZCA 2WNNA 2CPUA 3K13A 3W81A 1GOMA 3M0XA 4E6MA 1W8SA 4WOZA 3TU9A 4DYKA 4HJFA 1LL4A 4WX2A 1E9LA 1Q45A 3JR2A 1OCJA 4GIEA 4MAZA 4V1YA 1ISZA 1W1YA 4N9EA 4E0CA 1O12A 1O7AA 1HL2A 3TR9A 3TCSA 5CC7A 3GKFA 1IGWA 2XSBA 4H9UA 1A5BA 2E68A 4RNIA 2C13A 4Y90A 3WF3A 2WKLA 3TSDA 4HSHA 1EBGA 1BWKA 3WH9A 4P7RA 2AGKA 3DAQA 3EX6A 4B5VA 2HMCA 2VGFA 3NSXA 1HQTA 1ODUA 3W7RA 3EDDA 4AZGA 1VD6A 4NG3A 4GNJA 1U30A 4M81A 4MPKA 1JFHA 4HU0A 4NHVA 2PTZA 1B3OA 3G1YA 5CAKA 1XGEA 2OZ0A 1SMDA 1WXJA 1PTAA 2DVUA 4XK2A 5C2XA 1RUSA 1R7OA 4XZNX 2CBVA 4REQA 1GQIA 3TNOA 3VNLA 3N4FA 1Q65A 1PZ3A 3TJXA 2FPYA 3TTEA 3MS8A 5K9DA 2YXGA 1TVLA 5GQBA 4LCSA 5D9OA 1DL3A 2NLYA 3ITCA 1S3HA 2PDXA 4WUIA 2YA1A 4Y9AA 2CZVA 1E5NA 2H8ZA 1MNZA 1EX1A 4JBRA 1W1B1 3BW4A 1EC7A 1MEIA 2YXXA 2XG9A 3H2OA 1P0DA 2ZX5A 2YW3A 4LANA 4DO6A 4RXGA 2DW7A 2A2IA 2W0UA 3TJ4A 2TYSA 3QKEA 4RNHA 4BWLC 1V5XA 4E4PA 2W92A 2VT0A 2YX0A 4DEFA 1OG6A 1VF8A 5CPTA 5I03A 3W7IA 2GSJA 1UJPA 4NAEB 3LM3A 1LM1A 4U4MA 5HULA 3IVSA 1I6NA 1JCMP 2V5JA 3E0VA 5A95A 2VOTA 1R85A 1H63A 3CTTA 5M2FX 2O4QA 1EH9A 5FA5A 4MOZA 1BRLB 3G0UA 1KLZA 3QZAA 1I75A 1MZHA 2F6KA 2O56A 4QM1A 4JD4A 4GUFA 1ZUAX 2A79A 4K8GA 3SUWA 3DIPA 1B90A 4WDUA 1QT1A 2V82A 3H21A 5K2ZA 4ATDA 1X7FA 1Q7ZA 3ABXA 1LYXA 4QX4A 2DV0A 4LH8A 1CZ1A 3RCYA 3NZ1A 4A3HA 4MB4A 1E4IA 1J9YA 1JPIA 1PTGA 2VX7A 2OR2A 2R1KA 3VCCA 1EOKA 2PFHA 3WMBA 4F4RA 1BXNA 3GR4A 5D8WA 3EWYA 3EYPA 4GUHA 5LKYA 1H09A 1XLDA 4R88A 1SJAA 4GZJA 1Q6OA 3UA4A 4Z0SA 1IQ8A 5EGRA 1ZAHA 4FXFA 5F4SA 2IPFA 3GXNA 4IFKA 2QT3A 2WBGA 3WLJA 4FXSA 3RAOA 4IIFA 5EB8A 1R2RA 4YTQA 2J8FA 3LLDA 3TMQA 3ANVA 1AW5A 4LB3A 5HINA 4KFNA 4F40A 2JKEA 3EOLA 1GONA 5D8ZA 1JD9A 1CENA 3L65A 2OVLA 3FAXA 5D03A 2J9ZA 5I3HA 3R12A 4JQ2A 3MBFA 4YS1A 1E73M 5DCBA 2QIIA 1IF2A 4ZE4A 2HE5A 1HKVA 1ICPA 3K2GA 3QQ0A 5I3FA 2J6XA 3QY8A 2A21A 4AHQA 3H26A 1K70A 1TE6A 4CEUC 5HWJA 2UWFA 3B03A 4W5ZA 3PZQA 4YYFA 4GKTA 1F4AA 2WOQA 5HNRA 3ALFA 3DG7A 2BY3A 4P5UA 1XP3A 4I7WA 2ZE0A 2PDHA 4RJEA 2VFIA 4FK9A 4BKNA 1A5OC 3WF1A 5FF2A 4HBKA 3ZR4A 4BHYA 3R8RA 3KBSA 4GQGA 4C6CA 3VOFA 1UWAA 3P62A 3G2GA 3I3BA 1A3WA 3E38A 5M17A 3FKKA 1OABA 1XIHA 1ONEA 1BSIA 3CV6A 1V3KA 3EWDA 3GBEA 3GB6A 1UOKA 4LGXA 5AHEA 1CGUA 5LNSA 3W27A 2AL2A 2J9XA 4D8ZA 4GXWA 4J3WA 3EX1A 1KQZA 3PY2A 1ITXA 3WLIA 1HX0A 1PKYA 2I5IA 3IWPA 1WUEA 2VZVA 3LQLA 3NDYA 4Q4KA 2JALA 2QUNA 4EVZA 4S3CA 2BDQA 5AYZA 2R9RA 4Q4MA 1JZ7A 1A47A 4H41A 3DYMA 1F3WA 5LSMA 4HKPA 1XLBA 3CIXA 2ZX7A 3ZSSA 3NGJA 1RR2A 4OBSA 1XUZA 1UWQA 2HISA 4IIBA 4PUJA 4W89A 2ZUTA 3W86A 2Z1SA 2FMOA 3VIOA 4ROPA 1C92A 1OX4B 3P74A 1SW3A 1IIHA 2BXVA 3G1XA 4NVTA 3M5YA 3F4WA 1EO7A 2J27A 4S3KA 4UQ9A 3AUOA 3K4DA 4CU6A 1E6NA 1B54A 1V02E 4JXCA 1JZ3A 1LCOA 4IJBA 3C0SA 3A3WA 4IHCA 5ABGA 3VOIA 3C8FA 3GR7A 4KWOA 2R8WA 1FP8A 4J3UA 5E93A 1GCYA 1OCBA 2NZLA 3IJ7A 1JCJA 1B5TA 3MBDA 4WJ8A 3NO3A 3GRIA 2ZRVA 4K68A 3R8HA 3LPPA 1ZQ5A 2PWHA 3S2NA 1V3MA 3W6YA 3W2JA 5FL1A 3MHUA 3GXDA 1KKOA 3K8MA 2D0HA 1EWEA 4Y8EA 2V5LA 4UTWC 3L0KA 1QI3A 3TW9A 3L4VA 1JZ6A 2VFGA 3BAIA 1CTNA 3LEPA 4GK8A 1K8ZA 3NVDA 4IMAA 1QNRA 3QYQA 2H3DA 3KM8A 4Q4SA 3EX4A 1VYSX 1KR0A 3WLNA 1PE1A 1FWCC 4OJYA 1I1XA 4LSBA 3TN3A 3TW6A 4R5EA 3UBPC 3V0UA 2P53A 4ZCWA 2V9DA 2VZSA 3TX9A 4LC6A 2XVNA 3UWUA 5AC8A 1VFOA 1CXHA 3DOPA 3WMLA 4CQ8A 1WX0A 2QUMA 4UCGA 4JYDA 3W1AA 3JW7A 6ENLA 1Y7VA 3KTSA 1JPMA 2BWGA 2ZRUA 2FZMA 3TA9A 1UW9A 2QJIA 2Z0IA 4LAMA 4QG9A 3L4YA 2FLIA 4G7FA 1W1TA 3EWBX 4NZ5A 2Z6IA 3N17A 3EZ4A 1IWBA 5FACA 3CQJA 3L4TA 2VCBA 3UWEA 1ZBWA 2XIIA 3FX4A 1OM0A 1HG3A 1ZP4A 3FEQA 5CQ1A 2GLKA 1H1NA 3HA1A 1P0KA 2VNCA 4J40A 5EKYA 4GY0A 3A4AA 5FJPA 3VNJA 4IOTA 4IH3A 3C2VA 1FWHC 1H1YA 1MQQA 2Z2UA 3H54A 1CEOA 1OYCA 3GBDA 1VLWA 4BQ4A 4JTFA 3EXRA 2EJ1A 1A5SA 2PP0A 1T41A 4PTNA 2XIBA 4D2JA 4E2DA 3NQ7A 1XS2A 4AXKA 2FKPA 5HNNA 4NIRA 3IV8A 3M44A 4O11A 4PB5A 3NVTA 4AB4A 1TUFA 3V16A 1K3UA 4FNRA 5C54A 4AYGA 1XISA 4OUIA 1CXKA 1SZGA 1O60A 3VKCA 1XSKA 3KL5A 4IGMA 4PBFA 5AOUA 2WB5A 3EB4A 3TWBA 3UW6A 4YCOA 3GIPA 3P81A 1VP5A 3WFAA 4XZHA 4W5UA 5FJRA 3QW3A 2D2GA 1I9CB 1FWDC 2RUSA 5BNKA 1VQTA 4WJXA 2C91A 2C71A 1X1OA 1SU5A 2VURA 4YN5A 1A0EA 1JQXA 2XGZA 3IIVA 2HS6A 3BW2A 4LUIA 3DHPA 4MY9A 5C9WA 3N4EA 3PWGA 5XIAA 3WNKA 2A3BA 2VEPA 4GX9A 3S6OA 3VD3A 3MYOA 2PZ0A 2ISSA 1S2TA 3S9YA 2X09A 3KOZA 3UZWA 5JQ9A 1L2QA 1Q6CA 1A3HA 1I2OA 3WO8A 2HNEA 2ZRXA 1TTJA 2G0WA 2POTA 3EMZA 4HNOA 5F4WA 3UR5A 1K9TA 2V38A 3GWQA 1PS9A 4HK6A 4WDTA 1GK8A 1OSEA 4JEQA 4JYFA 4AIEA 3QY6A 4FR6A 1IT7A 1UP0A 2ONEA 3B0UX 2J78A 1VPYA 1R9ZA 2IMRA 2PDNA 2MUCA 4REQB 1LWIA 3AIVA 1ZALA 3P80A 3W02A 1VZWA 2G3MA 2ABAA 2XGBA 3KDNA 3F2CA 3LTYA 4P8VA 3UZYA 2WC3A 4A8RA 3IJ6A 4PB4A 1RP9A 4YVVA 4QE4A 2ZA1A 3PZNA 3CHEA 3H8AA 1R3TA 3TCEA 3FA4A 3NM1A 3BV4A 3W75A 1C91A 3TDFA 5CCZA 1DJXA 1CXIA 3WENA 2F6XA 2V8ZA 2AKZA 3TMLA 4PMXA 1XYCA 3BARA 3CIWA 2XFRA 1BQGA 5CBJA 2FVMA 2FPVA 3E0FA 5I2UA 4IIDA 1TA3A 3TC7A 2PDKA 4XV0A 1QPNA 4NNBA 1VBGA 5LZLA 1ADSA 5BW6A 3FYOA 1IEWA 1QBAA 2I57A 2VEKA 2ANUA 4GGHA 3NQEA 4TU1A 5D9NA 3UY7A 5FAGA 5FEZA 3RPDA 4PODA 3II1A 1OD8A 5GVJA 1WAWA 4MY1A 1DYSA 5RUBA 2AGTA 3ABRA 4XZ9A 2C1IA 1V6UA 1FXPA 4A8IA 2OSWA 5AN7A 2PCQA 3Q94A 3PWAA 1KA9F 1NVMA 3O06A 1JDCA 3WJSA 3H4XA 1TB3A 4HMEA 5TIMA 1KV8A 1IZJA 1TWDA 1ICSA 1O95A 4UOQA 2VC7A 2WMHA 3N2BA 3FXYA 2X0SA 4RUBA 4H2HA 4MM1A 5D37A 3KXQA 1LUCB 4NZJA 1MW3A 2BBFA 3SCVA 5FSDC 3AHYA 2ZIDA 1W3LA 3QYSA 3LHWA 1R47A 1HNYA 4EXBA 5I3JA 3T55A 3HPAA 4YL2A 4ICNA 4RV3A 3LHUA 1Q2SA 1DJGA 3B8DA 3IS4A 1HO1A 3QV8A 3CUIA 3N2MA 1V3LA 3M5VA 3FDGA 5H91A 4UOZA 4AWTA 3GC4A 4S3BA 3B9AA 5G1YA 1KWKA 4X61A 1Y65A 3AJXA 3E2VA 5BWAA 4JNYA 1E0WA 4WY0F 3ES7A 3NPUA 3SCQA 3HPZA 3CM4A 4PC8A 5BXRA 3CS2A 2AQOA 3KTCA 3IJLA 2DUZA 3N2TA 3P61A 3LMZA 4DF2A 3ELFA 2P8CA 3MY9A 3WEZA 1BLIA 3O6YX 2OXNA 2W62A 1ISYA 3WK3A 3JU2A 4S3JA 1XDLA 1V93A 1N8FA 4ASTA 1X6NA 2NXGA 3ONCA 1BWLA 3C0LA 3TFXA 4H8NA 1US0A 4ML4A 2DEPA 1YDOA 3SGGA 3CV2A 2RKXA 4N6EA 3OJGA 1PKLA 3POCA 4J4KA 3L12A 4IGNA 3N1AA 1XLAA 4IPIA 1JGIA 1KCZA 1XCFA 3OHIA 3W72A 4LEQA 2D1ZA 1IWPA 1G7UA 1PXGA 2D23A 2OEKA 3ONBA 2OYMA 4Z1CA 3K4AA 4GI9A 4E4UA 1J11A 3CYVA 3N3TA 3UERA 4O0KA 4WHBA 5BMWA 2P3ZA 3C0JA 1GEQA 2BY0A 8RUCA 4M5PA 2X8RA 1WYIA 3NURA 1DIDA 4LYKA 3DDMA 4F2TA 3TTQA 4ADUA 1J2BA 3CNYA 3SIMA 3ZFHA 4UMCA 2WCSA 1KFBA 1FWNA 1NFBA 2ALDA 3UWVA 4U3CA 5AYXA 3H70A 4L7ZA 2ZDSA 2ZZ6A 4ERIA 4H6RA 1G1YA 1ONWA 3FSTA 2QEZA 3I6RA 1JF5A 2FYMA 3M1ZA 3WQDA 1FWBC 2WAGA 1J18A 3XIMA 3MW7A 5CC6A 1NDWA 1FH8A 3LXCA 4OIFA 4AZ5A 3NNTA 3OW1A 5BROA 3GTIA 5CGMA 2Y89A 4JIIX 1E4NA 3KTXA 4LYPA 4FLSA 3W38A 1M53A 4QTGA 5BWFA 4XSMA 2W27A 4Q33A 5LNRA 3AMKA 2DSZA 1AZ2A 2E9MA 4EWJA 1VCFA 1Q6EA 3GDRA 4XG1A 2CZDA 2ZZ4A 1BPLB 3DFOA 3G3MA 1TMQA 1CT5A 4GIYA 1ZB5A 3V7PA 4RZ5A 2CBJA 5HXMA 1EJVC 3CUGA 3B0XA 1EC9A 4GISA 4U2ZA 1T7LA 1G69A 4Z42C 1VLIA 1QUMA 5I24A 1EUAA 3O05A 3K5XA 1OINA 1XIGA 2X7VA 2CU0A 4HTBA 1TX2A 2Z1WA 5I09A 4PMYA 3SCRA 1UQZA 2VO5A 3L5AA 5IHRA 3WQCA 3ITOA 4D6CA 3GO2A 4Q8QA 2XZ7A 3NOEA 1WXYA 1BSLA 3DGRA 1OZMA 3N14A 3N19B 3SB0A 3TN4A 4CNUA 2V67A 4PZVA 5KZEA 3VZXA 3H2FA 5ECVA 1AQMA 1TV5A 5ABTA 4D6EA 3HU7A 4KIEA 1NM9A 2ATSA 2J7DA 4B2DD 1UZ1A 3V75A 5DY3A 4BFAA 1GYNA 3QHNA 1CW2A 1DWFM 3H2MA 1A0CA 4GY7A 5DCDA 3CPRA 9XIAA 3K30A 5ABHA 3WG6A 2DZTA 3QTGA 1G4PA 3HQ1A 3T7VA 1DE6A 4HT3A 4DM2A 2QPSA 1IXNA 3AS2A 3H7UA 1J01A 4DLFA 2Y4SA 2IXUA 1UC5A 3K46A 5CPOA 1CLXA 2J88A 1W91A 4XAPA 4GUIA 4IQEA 3KBNA 3MCMA 2BX7A 4Z2LA 3IPWA 1H7RA 1W5PA 2QJHA 1P6BA 4MYXA 2WNQA 2Y7EA 4CGTA 1IR2A 1E1CB 2YDQA 1J0YA 1GGOA 1A0DA 3LSCA 3OG2A 1OK6A 4IQDA 2HXUA 4JHOA 2E6FA 1ZJAA 1IXPA 1J2WA 4I8DA 1XIBA 1RLDA 1QFEA 4OWGA 4X0NA 2C0AA 2C3ZA 4GABA 4UTFA 2VFDA 3M0KA 4O1CA 3BMXA 2X0YA 4PBGA 1W5MA 3DC8A 1LT8A 1LRQA 1OVDA 3UJFA 3V5OA 2ZCGA 1EPVA 4JS3A 4ZR8A 3WZ0E 4WSJA 2OZ3A 2QMJA 4H8UA 2AQVA 3IGXA 2C1GA 3AIUA 2P5NA 1IR1A 4GJIA 3BK0A 3WQ6A 5AHIA 3W7EA 3KVLA 4Y2WA 5IBXC 1FHLA 2LLEA 4ENLA 1OFRA 3D0CA 3KW3A 2RDTA 1E1FA 5H8MA 1ZFJA 3REQA 2CXEA 2WMGA 3AC0A 1XLHA 4BCEA 3NQ2A 4C6DA 4HN8A 1RHCA 3OYXA 2BGSA 4GZEA 2V2DA 2ISVA 3R89A 5I23A 1HIZA 5K9XA 3CLMA 2I7GA 2FZ8A 4XZMX 2NXIA 1K7EA 2DGAA 3OGRA 4K38A 4LF2A 1QI5A 2NQ5A 2J47A 4U33A 4Q4OA 3R94A 2XH0A 2R94A 4ZXOA 2R91A 3E12A 3VC6A 4S3FA 3L66A 1QI2A 3S47A 1K9FA 1KFWA 1AVAA 3EOSA 4DPPA 1HF6A 2XWEA 3QZEA 3QMRA 4AD4A 1Q6QA 2ZZ7A 2HTMA 4L9ZA 2IQDA 1CXFA 4A2RA 1W3KA 3S2MA 1E6XM 3KDOA 3PTQA 3H4GA 3PSVA 1ZBVA 3M0ZA 2YSWA 3PR2A 3IEBA 2IXVA 1WAUA 4EE9A 3F5JA 4W7WA 3GHRA 1JZ2A 3KVMA 3IANA 3O1NA 3QC3A 3F2BA 4O17A 3RPTA 4FAMA 2PWDA 3OZOA 3VA8A 1FH9A 2QJJA 2ZUMA 5BOEA 4PR4A 4DO5A 4LAKA 1MO0A 4Q3MA 3M4HA 3NXLA 3UR2A 3DFQA 4L1WA 1JULA 1XSIA 4HTYA 2V81A 1PIIA 1U22A 1KLYA 4JN8A 3UNDA 1RK6A 1UD5A 3R4IA 2NV9A 4JEJA 2NV1A 3M0LA 3WD3A 3EKZA 2BASA 2WVVA 3WUFA 3L4UA 4MHBA 2QCEA 3F2DA 4QQ3A 1ZTVA 1R87A 1F3EA 4DN1A 4A29A 4HN4A 3WFZA 4B4FA 5FI8A 4JICA 4JNZA 3IK2A 3L7RA 4GKLA 4OTKA 5E5CA 2WVSA 3MQTA 5HQLA 1MUCA 4WKFA 4GHRA 3MUY1 2FVLA 5KTLA 1TV7A 2F6UA 4QISA 4F2UA 3KOXA 2DORA 3APTA 3VKKA 3CASA 3GKAA 3TW7A 2QCNA 3VX0A 2DUXA 4AH7A 3KL3A 4AZIA 3SECA 4RK8A 2EPHA 2OWCA 3QVQA 3W37A 1JIBA 4B15A 1RP8A 4LRSA 3PNZA 1PZ1A 1T0OA 1UCWA 1W54A 5FF3A 3PK7A 3DI1A 4MKNA 5EYWA 2GJLA 3CHVA 2OPJA 1A50A 4KW2A 3QMSA 3AMLA 4GACA 3AMDA 4E2VA 4MJ4A 4HD5A 4QBXA 3O3RA 3GTNA 3AHZA 1CGYA 2DW6A 1ZGDA 3EDEA 4BI7A 4PFHA 4UNLA 4MZ1A 4DELA 3T9PA 3VD4A 3W1MA 1QNOA 3M0YA 4NSBA 1W5NA 1IEXA 5C71A 2HJPA 1EKOA 4JL2A 3G0SA 4U10A 1O1ZA 1JCYA 5A6SA 2EQDA 1XRSA 1W3NA 5LIYX 2VXNA 3BJSA 2O9OA 3ARWA 1WO2A 4PMQA 3ZR6A 2OTDA 1Z48A 1OC6A 1J5TA 3CZ8A 4ZO7A 6PTDA 3HGJA 3A5VA 1B4KA 2I16A 3WFLA 1UR2A 2Z1KA 4Q6JA 1UOZA 5DQPA 1EQCA 1I2NA 2Y2WA 3ITXA 1GJUA 3T09A 1KBJA 4CQAA 1UR1A 2CW6A 4MNJA 5REQB 3UXDA 2QPXA 4LBSA 3W28A 2FB2A 3OZPA 1LBLA 3T2PA 1XQLA 1DQUA 1BEUA 3P93A 2P0OA 2GQ3A 3PPHA 4AWUA 3W1LA 1IV8A 4IISA 2V5CA 4QEEA 1QAPA 1E72M 2A3HA 3BCJA 3POHA 1GWJA 1QO5A 3T6CA 1B3ZA 4QJ4B 2OT1A 1VBJA 2IQTA 4ACZB 4Q8NA 5A6BD 4PEEA 2VC9A 3AYRA 4ROQA 1MUWA 2SFPA 1NDZA 4CN6A 4W88A 9CGTA 3C2RA 1LDCA 5I3KA 1M01A 1X97A 2CKSA 1W0MA 2C6QA 1CB2A 1XIMA 2O9PA 4LJ3A 3TYCA 4U3AA 3L4ZA 4MG4A 4L1GA 3TR2A 2A1YA 3OLGA 3MT1A 3VDBA 1FTXA 1UD6A 3A4XA 3O6CA 5FF0A 2W9MA 1DIKA 2PWEA 3HMJG 4TV6A 2FGZA 1EJWC 3GU1A 1TRDA 1O5QA 1EDQA 4H01A 1R2TA 1JF6A 2DFAA 2XTKA 5BRQA 3KBJA 2OX1A 3MA8A 4PGLA 1W32A 1JNEA 4LCRA 3IGHX 1XBZA 3OO2A 3BGAA 5E0FA 2XN0A 1HJXA 5DO8A 4ZQOA 1CXEA 3T07A 2CWNA 2ZRYA 3DEQA 4XTIA 1Z44A 3VIHA 1AA1B 1LT7A 4EXQA 2BVDA 1M7JA 4D1JA 1W56A 3LCWA 1P43A 4GJ1A 1PL9A 3R13A 1KR1A 1JR1A 2ZA2A 2GSEA 3U4FA 4H9TA 5BZAA 3CHDA 4D1IA 3T08A 4MMWA 1WZKA 5AY7A 3VNDA 3LY0A 1OJXA 3YPIA 2C0HA 4HZ8A 5FEWA 3QW4B 1DTNA 1UWIA 3VDHA 3LRKA 4JGDA 4ZQRA 1UROA 2O9RA 2NQJA 3L9CA 4WQ6A 5BXPA 3PAJA 1G4EA 7REQB 4JTEA 4DJFA 1KXQA 2YLAA 5DRIA 3TKFA 1SFTA 4QQUA 4TX6A 3FDKA 1GW9A 1VFTA 1VKFA 2FMNA 5G2HA 2DIKA 4FPSA 4NJIA 4UTUA 3RM8A 4DO4A 5EY5A 3QR1A 3COTA 5LIXX 3MHGA 4H4IA 1ZBCA 2V0TA 3VO0A 4MFDA 1NY1A 2G3NA 3URQA 2GQ9A 4G7EA 3E1F1 1EYEA 1B9BA 1XJBA 1R3RA 4L64A 5DMMA 2OZ8A 3CU2A 4MKSA 4MJZA 3I10A 3SDOA 4PCPA 3QEZA 2X16A 2BS9A 2F84A 4FIQA 3Q2DA 3TFCA 3PBYA 4JDBA 1VCGA 4LXFA 5F1UA 5I02A 5C8BB 1HJVA 2P50A 2I1OA 3G5EA 4F0HA 3VD5A 1WOAA 3ARUA 3KWSA 3LPGA 4BF9A 3T42A 3RCMA 1RJRA 1V6WA 1XYAA 2CLEA 3WLTA 3VIJA 5I77A 3GD6A 3PVFA 3AO0A 4I9AA 3TA6A 1LBFA 1S3TC 5C2CA 3ME3A 1KXVA 2BVTA 1PYFA 4DI9A 2IPGA 4N6FA 2A3EA 2OQHA 4R53A 3EMQA 4PB3A 4QJ3B 2FVKA 7REQA 1U33A 1UKSA 5J5RA 2QMKA 4P7LA 1POKA 2B4GA 5G2WA 3VAVA 3HPXA 1G4SA 2ZKMX 4UFKA 1E9ZB 1W37A 2JEPA 1R3SA 2Y88A 4HHLA 3SRFA 1W31A 3ARQA 3GNXA 3OU8A 4PMZA 3GYEA 3Q67A 2BLEA 2PDLA 4ZA0A 3EA1A 4G56A 3UVAA 1SJCA 3EGJA 1FHDA 3IACA 4A3QA 2Z7KA 3N2XA 4JHMA 3ORWA 4IPPA 4E8GA 1V7AA 4FMVA 3CB8A 4PL2A 3FKRA 3IARA 2YL8A 4WR3A 4C6MA 4QGCA 3WLKX 3RHGA 5EMMA 3VD7A 4PUDA 1GQKA 1I2RA 1XLEA 2OWXA 6A3HA 1Q6DA 2OMAA 2VZTA 4LS0A 1Q7MA 1XYBA 1PX8A 4GYJA 4AVNA 1SW0A 1EGZA 1K8XA 5LGXA 2Q09A 4ORIA 1RV8A 3OLEA 1W9VA 5CJ5A 3ARYA 3V5FA 4PUWA 5AYBA 3BW3A 1XKYA 2O9TA 3KP1A 2J6VA 2ZVIA 5DELA 4HCLA 4GQQA 2RJHA 2BXYA 3W7DA 1FWWA 1DWHM 4C5YA 3KBWA 4HNLA 3STEA 4MYAA 5AVNA 1NDVA 4OQVA 1NF0A 4V28A 1TJ2A 1EGMA 4C6KA 4ZQMA 4HK7A 1N8WA 3LNMA 4L80A 4NX0A 3GTXA 4JTKA 3W6LA 2YZ5A 4GVHA 4WKHA 2WC7A 3PZ9A 4TVDA 4B5WA 2HQAA 1M3UA 1QHPA 1V3JA 4NL1A 3WQEA 4LV4A 2J7HA 2HVNA 4PCSA 4W8BA 2E7FA 5AZ1A 1UMYA 2VR5A 2XN2A 2VGBA 1FWAC 2C19A 2J62A 4HB7A 4N4PA 1CLVA 5IBXA 1GOXA 3W26A 3KEHA 3UA3A 5DN1A 1VC4A 3UG5A 3VIGA 5D38A 3LCFA 1SO4A 4AIBA 3ATZA 1W17A 1NEYA 4UTTC 2FJUB 4OT7A 3DFPA 2QZRA 1YTKA 1XYFA 2E40A 4M7TA 3RUBL 2NWRA 4GIAA 4US5D 1UYQA 3FVMA 1YDNA 4ADSA 1A53A 3WK2A 1RBAA 2ZUWA 3B0VC 2A6NA 2MNRA 2D73A 4H7VA 4XWUA 3G8RA 4Z08A 2NUYA 3HTWA 4WJEA 4OZOA 4GBUA 4H9VA 4AFYA 1VEOA 8CGTA 2Z7GA 3OGSA 4AVOA 1F3XA 3W25A 3WMSA 4ZFCA 1XRFA 4IGSA 4IGHA 2Z24A 4G2DA 3EA3A 5CKSA 1ZZMA 3BSGA 1KFLA 3SRDA 5FF4A 1SUXA 3HB9A 3SURA 2D69A 1PSCA 4UQEA 5I5RA 5M5DA 3OP2A 2UV8G 3SRHA 1HKIA 2HCVA 3C2FA 3DN5A 5ABFB 3P6LA 1LJYA 1RA0A 3UZJA 5EMUA 3RYSA 1RCQA 1UD4A 2X1UA 2VVSA 2XM1A 1NARA 3BLPX 4TMCA 1UWTA 1U1UA 2BV9A 2C1HA 3BAYA 2PWUA 3H7VA 3RX3A 3IUDA 1XD1A 3P2VA 3WLHA 2QCDA 4DF1A 5FEXA 5AYYA 3MDWA 1JCNA 4WIWA 4JAWA 3M41A 2ZWZA 2QKFA 5CSSA 3C52A 3URNA 3SCPA 1C93A 3W53A 3BE7A 3XINA 1I45A 4WY0A 5A6BA 1JZ4A 2A6LA 3IVUA 3H2NA 3IVTA 2F8QA 3QQWA 5KITA 1A3XA 4JFWA 1OHLA 1XLCA 1QXLA 4OVXA 4AF0B 3WN6A 3C8NA 3M07A 1R86A 2PDBA 2R1PA 3GNNA 3W01A 5CSUA 1EZ2A 2RGLA 3QHMA 1A4LA 2YL5A 4DZ5A 1ME9A 1LWHA 3NYDA 1UZDA 3PULA 1H7OA 3T0AA 5A69A 1C8YA 3KLLA 2QGHA 1LG1A 1X1ZA 4YWIA 1ECQA 4H9YA 3STFA 2OB3A 2AMGA 3S9ZA 2JE8A 1XW8A 3VGDA 2V68A 4YVPA 3P5ZA 1MW1A 3HJZA 3AHVA 3QRHA 1KFCA 3D47A 1TZZA 2ZZ2A 2FB3A 3AYVA 3VD9A 3IRDA 1KFEA 1C7SA 3TTYA 2E9LA 1RAKA 3DGBA 3B04A 3ABOA 1