2Y89A

Crystal structure of mycobacterium tuberculosis phosphoribosyl isomerase a (variant d11n)
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
244
structure length
240
Chain Sequence
MPLILLPAVNVVEGRAVRLVQGKAGSQTEYGSAVDAALGWQRDGAEWIHLVDLDAAFGRGSNHELLAEVVGKLDVQVELSGGIRDDESLAAALATGCARVNVGTAALENPQWCARVIGEHGDQVAVGLDVQIIDGEHRLRGRDGGDLWDVLERLDSEGCSRFVVTDITKDGTLGGPNLDLLAGVADRTDAPVIASGGVSSLDDLRAIATLTHRGVEGAIVGKALYARRFTLPQALAAVRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHORIBOSYL ISOMERASE A
publication title Bisubstrate Specificity in Histidine/Tryptophan Biosynthesis Isomerase from Mycobacterium Tuberculosis by Active Site Metamorphosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Isomerase
total genus 72
structure length 240
sequence length 244
ec nomenclature ec 5.3.1.16: 1-(5-phosphoribosyl)-5-
pdb deposition date 2011-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00977 His_biosynth Histidine biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2y89A00
2A4AA 5K3VA 3EXSA 1UBSA 3LRLA 5G5IA 4QNWA 1M6JA 2C0AA 3R89A 2NX3A 3G8RA 3PBYA 3PVFA 4MY8A 2QCMA 3W2UA 3NM3A 2Y70A 3WJXA 1T0OA 2AGKA 1EEPA 3DHFA 1TPWA 1TCDA 4FX8A 4IMGA 2H90A 3BG5A 4JIQA 4JY9A 4H3DA 2B0MA 3P84A 4LS2A 3G0SA 1A5AA 4IOTA 1TJPA 3TQVA 3R2GA 3QW4B 1OFEA 2Z0IA 2V2HA 1SZNA 2J9YA 5AC7A 4HN4A 4UXDA 1IXOA 4DEFA 5KTLA 1F74A 4CNPA 2J6XA 3IEBA 5I3GA 1SFJA 3TSMA 1QAPA 2DZPA 3NG3A 3QM3A 3W7JA 1W5MA 3DFTA 1IXNA 3KX6A 4LV4A 3S0CA 3V75A 1O60A 1WAUA 1EUAA 5I3IA 5EPDA 3UWUA 1EA0A 2YXGA 2OT1A 2WSRA 3L2IA 3W7PA 4JDYA 4RZ6A 1Z42A 3QF0A 4IQLA 2B7QA 4LRTA 1YTEA 4Z0SA 1VS1A 4DF1A 3O16A 3EWYA 4GUGA 3GR8A 1F5ZA 4YWIA 4GUHA 2C6QA 3M1ZA 4JYDA 3EX3A 2V30A 2GVGA 4GE8A 3NEVA 3PSVA 4LOCA 4CNNA 1NFBA 5EKYA 5FF7A 1I45A 1W0MA 2ISSA 3OG3A 3FJLA 3KVKA 2Y61A 5BOOA 3IV3A 4AWTA 1X1OA 2NV2A 3W7NA 2CZDA 1WBJA 3KVJA 3ABSA 2CW6A 3ELFA 3UPBA 2FQIA 1DJQA 1F2JA 1K7EA 1UUMA 5I3JA 4AHOA 3UQNA 3R5EA 3G1VA 3R13A 3QQ1A 5EY5A 1O5KA 1OF8A 4QISA 3LCGA 4ZQMA 2PE4A 4A29A 5FEWA 2B7PA 3PWAA 5AHLA 2NUWA 1NF0A 1LOSA 2W79A 3NQ2A 2Y6ZA 5DCDA 4C1KA 4PODA 3ZS4A 3SY5A 1OFDA 5C5YA 1EB3A 5DY3A 2ATSA 3P82A 1F05A 4AHPA 3GNNA 4JTKA 2V2CA 4WX2A 3LBCA 4UTTA 2VENA 3EKLA 3HG3A 2GVJA 4MIMA 4BWLA 5AC6A 3M47A 4O10A 2CZEA 4M7TA 2DU2A 4NJJA 1SUXA 1AL7A 4UTWA 4Y6GA 4Z08A 3GVGA 3IVUA 3RF9A 2R14A 4CCDA 1WA3A 3TNOA 2A6NA 1KFCA 3NL2A 5F2IA 2GJLA 3H55A 3H54A 4O50A 1G4PA 5CG7A 2G96A 3M6YA 4IXXA 3TC7A 1JQXA 1VHCA 1OJXA 2PRHA 2ZRUA 1YTDA 4N2YA 4UFKA 1SR9A 4GRSA 5K9XA 1QWGA 5CZJA 2ZZ6A 3GKAA 3K30A 1KBJA 3EX6A 5HQEA 3C52A 1UB3A 4GNJA 3M16A 2ZYFA 4K7YA 2NLIA 4K8HA 5HULA 1AW1A 1GEQA 3NZRA 1B3OA 3TW6A 4DO5A 4LVBA 4Z1AA 3W2NA 2A0NA 3ABRA 3L21A 2JBMA 5BRBA 2E5DA 1K8XA 2WSYA 3QPZA 1S5TA 3UWYA 3HGOA 2V9DA 4FEZA 3M5YA 3PB2A 3T40A 3CPRA 5GVJA 4JR5A 2H8ZA 1Q6LA 3MI6A 5AHFA 1FXPA 4E38A 3QH2A 4M6PA 5HJLA 2YDAA 2QCLA 1D9EA 4IXHA 4JIPA 4AWSA 4HNNA 1YPFA 3TK7A 3WFAA 2Y7GA 4WXYA 3HIJA 4Z1BA 3HJZA 4TR9A 2ZZ4A 4K39A 4KFOA 3T44A 3R12A 4N9BA 3OBKA 1RV8A 2ABBA 3TSBA 3BW2A 3AO0A 1N7KA 3N9SA 3B0VC 1M7OA 2O7SA 3UY7A 1M7PA 1G4SA 3FJ6A 3ZR4A 3UZJA 3JR2A 1H5YA 1VGAA 2Q3RA 1RD5A 1VC4A 3LCWA 3THAA 3LI1A 3DFOA 3G1YA 1FWSA 3LHVA 5HUOA 2C18A 3GAYA 5BNKA 2GOUA 1TQXA 5IBXC 3MBDA 3PUDA 1R47A 2A7RA 5E93A 1PHWA 4WOZA 4UTJA 3STCA 1SO5A 3PAJA 5HMSA 3MP3A 1W1ZA 4NZJA 5D37A 5EYWA 5HR7A 3JS3A 4MVAA 1TPB1 1K7FA 4JX5A 3TMQA 3BLIA 2CLOA 4UNKA 3LXBA 4NNAA 1RZMA 3ATYA 2C16A 1KFEA 1EP1A 3WJSA 3JRKA 3DFSA 3QC3A 3TQ0A 1W5QA 3W7CA 1IXPA 4MFDA 5CZTA 4GC4A 4O53A 2JGQA 4ML9A 4X2RA 3SZ8A 1FDZA 5HR6A 3FEMA 4FXSA 3PY2A 3NGJA 4JTHA 3G0XA 1QR7A 3PBWA 2VFFA 5CSSA 4PL2A 3W1NA 1FX6A 5IBXA 3UWWA 1PL9A 3W1LA 3O6CA 2QUTA 4ICNA 2CZ5A 3EWXA 1TV5A 3D0CA 4Y96A 3C2EA 5D2WA 2NXHA 1ZAIA 2ZZ7A 2CLKA 2NWSA 4WZHA 1F6KA 4JTLA 1IXQA 3G8EA 1YDVA 3G1DA 3KFTA 3QW3A 4NJKA 1OF6A 2DZTA 3FS2A 3HO8A 1KFBA 4OV9A 4PEKA 3ATZA 4JTJA 2ATMA 3UD6A 5L9FA 5CPNA 2RDUA 2WNQA 3QZEA 1FCUA 3IVTA 3QMSA 3USBA 2XN1A 4NVTA 1H7OA 3WK3A 3DBPA 4WY0B 1RQBA 4XBSA 4E0CA 1WOBA 3LCIA 3M5XA 3NL6A 3C2RA 3NYZA 4AF0A 3MWAA 1P4CA 5CGQA 3CEPA 5FF3A 4WY0F 5CZSA 3G1SA 2NUXA 2R8WA 2Y88A 2FTPA 1Q6QA 3O63A 5AYZA 3W3OA 3G1XA 3IRDA 3PR2A 3SJ3A 1KV5A 1FDJA 3MP4A 2YYTA 3BK0A 3LXCA 2YYUA 3G24A 3NQ8A 3NQEA 4Y90A 3LHTA 1XKYA 1Z44A 5D2TA 1VYRA 3LTYA 4O4WA 4GJ1A 3THQA 3WK1A 3N73A 2QEZA 2F84A 5D2VA 1D3GA 1GTEA 4QNEA 4QAIA 1BEUA 4O12A 1QPRA 3N9RA 1SQ7A 4R34A 1LRNA 2QKFA 4MJMA 3P80A 3W1AA 1GVSA 3GXNA 1GVQA 1LOQA 5LHEA 3FYOA 3W1UA 3IGUA 2QF7A 5G2IA 2DZXA 2A7NA 5LGZA 1AG1O 2E6YA 3SI9A 2QCEA 3EX1A 4WOQA 2DZUA 4IMFA 4BFAA 3S5NA 3NR0A 4UTKA 2Z2UA 4OWGA 4O54A 5CPMA 3Q2DA 1VCGA 5I3KA 3CQ0A 4DELA 4H4IA 4WD0A 3TA6A 4X3ZA 3SGUA 2J9XA 1RQEA 5D04C 3ZFHA 2VKZG 3MHFA 2V8ZA 3HOJA 3R8RA 5D30A 1TB3A 4S2BA 5G1TA 4NNCA 1S3HA 4O11A 1AW2A 1MZHA 3TQKA 2QJIA 3T4CA 3GX9A 1F6PA 3IIOA 5TQLA 2C13A 5C54A 1W3NA 1GWJA 3EWBX 1FBAA 3W87A 4CQ9A 1TTQA 4K8EA 1I4NA 4NUWA 3RNDA 1KM4A 3QPYA 3DI0A 3LHZA 4WQ6A 1SPQA 2DZSA 2Y7FA 3M5ZA 3PUOA 3O8AA 5EMUA 3VI2A 1I2RA 1H7WA 5F2LA 4TIMA 1K7XA 4FX6M 4UIOA 1TO3A 3NQFA 3HF3A 1VZWA 3B03A 1PIIA 3IIXA 3EWZA 1JQVA 2J88A 3DKJA 3INPA 4DF0A 2FPYA 4O13A 3HPSA 3OVRA 2EF9A 4UFIA 2BX7A 3LCXA 3W7MA 4MFEA 5K4XA 5IM51 3L65A 4XTDA 3C56A 3P67A 1YDNA 4LC8A 1F7BA 5AFDA 4YXGA 4MZ1A 1EX5A 1GOXA 2ZZ5A 3TX9A 3PULA 3RMJA 1VCFA 3ANYA 1VPXA 4HNVA 1U5JA 1KTBA 4AWUA 1W54A 1JUEA 1XFBA 2C3ZA 2O7QA 4QSHA 2ZDRA 4PTNA 1H7PA 1TTIA 3CWOX 1SO3A 1LDCA 1AW5A 1R30A 2A85A 4YL2A 1VQTA 1XUZA 3SECA 3FOKA 4HHPA 3DKLA 2NXGA 4RV8A 1B57A 2C19A 4PL1A 1O95A 1B4EA 4DBDA 2WKJA 2XN2A 4XKYB 1GG0A 3M43A 3W1RA 3P5ZA 3CB8A 4NX5A 1TPC1 3LHWA 3S9YA 4O1AA 3TIMA 1LZOA 3LOTA 4FHAA 1PV8A 1NF7A 1O94A 3MUXA 3LBMA 5E0KA 4JTTA 3I68A 2X2GA 4UTMA 2XFWA 1OFOA 2AAMA 2FLIA 1TJRA 2CLHA 2R94A 4KKXA 2OCZA 2JKPA 5D05A 3UWZA 5AB3A 1X7FA 5D32A 1QMLA 2TPSA 4ZQRA 2RH9A 5EBUA 1KFJA 2WV8A 3KHJA 2C1HA 2ZRVA 3ABOA 5EA9A 3O07A 4PH6A 2FIQA 4JDBA 2QAFA 2WSQA 4FIQA 1KFKA 2V0TA 3LRKA 4MY9A 4MKNA 4JD4A 3LV6A 3DGRA 4FNUA 1W56A 4K6AA 3PS7A 3MBFA 4TMBA 4BR1A 4UR7A 3BG9A 1ZENA 4RKAA 4JYFA 5F2MA 1PE1A 3QFEA 4YLWA 5AOUA 1MEHA 3UY8A 3EB2A 5DELA 3YPIA 3W7EA 4ZQOA 1S5WA 3GZ3A 3HBLA 1W5OA 3BGJA 1ME9A 2UV8G 3RU6A 2EAWA 1N55A 3VNDA 1QNVA 1XBVA 2QCGA 1VLWA 4M5PA 3W70A 1W31A 4GFSA 2WNNA 4IGHA 1DJNA 2PRMA 2WOQA 2A7PA 1YXDA 1AK5A 1PCWA 1ONRA 2KZHA 4LUIA 4MYXA 4ZL1A 4ZQPA 1OYCA 2CLIA 5LNSA 1D3HA 1H63A 3TR2A 4Y8FA 2X30A 3L5LA 4UTTC 1SSDA 4HT3A 1SU5A 4BWLC 2ZQ0A 3MW7A 2EHHA 3CHVA 1P5BA 3TMLA 4QIUA 3WK0A 1ALDA 3LTSA 3SGZA 4UMAA 3EEGA 3PM6A 4UTWC 1EUNA 1TTPA 3W73A 3WJWA 4N6FA 5KZDA 4AH7A 3C2VA 1BWKA 1UASA 1FWRA 4FNPA 2E1DA 4FIRA 1HUVA 1A5CA 1WDWA 2V5BA 2QUUA 1HFBA 4RXGA 1XL9A 1G4TA 3GK0A 3W88A 3DZ1A 1PCKA 2G97A 3B06A 1WQ5A 2GQ8A 2CLMA 4ADTA 3NQMA 3OVPA 4MY1A 3S5ZA 1ZFJA 3I65A 4WY0A 1WOAA 3EX4A 2P0OA 5KSWA 1OFBA 3W76A 3NZ1A 2WPBA 3NL3A 2Y85A 4A22A 3LHYA 4LT9A 1LRQA 1I2PA 4O8RA 2C15A 3CIXA 1SO4A 2G95A 1RR2A 1SSGA 1TPFA 1A53A 3NDOA 2JGYA 1EP2A 3FKKA 3GB6A 3Q94A 4AAJA 2J27A 4NNBA 2ZZ3A 3UYCA 4N4QA 5G1YA 3GYEA 1FCVA 4HSOA 4EWND 2ZCGA 1VH7A 3W9ZA 3GDRA 3DFQA 4UMBA 4O0ZA 3N2XA 1BTMA 1ML1A 2GQ9A 3CTLA 1XDMA 1ZHAA 3I7QA 1Q45A 1QPOA 2WNZA 4ADUA 5FESA 1UCWA 3BV4A 3A5VA 2Y63A 2VEMA 4L4LA 3CC1A 5FEZA 3LCLA 4TX9A 4JXCA 1AMKA 1PVNA 1I2OA 5LNUA 4DXVA 1V5XA 4N02A 1DKWA 2X1UA 3CT7A 1JCNA 1LYXA 1RQHA 2E77A 2E5BA 4GUIA 3QJAA 2AQWA 3F1QA 3C8FA 4E2BA 3VCRA 3MMTA 4GBUA 4ADSA 4DBEA 2BZNA 1QPQA 3E0IA 3NPVA 3LHUA 2H6RA 4LU0A 2VEKA 5ABTA 4FNTA 4HKPA 2YR1A 4WUIA 2QCNA 4O16A 2CLLA 1TPH1 4RX0A 1G7UA 4EVZA 1WX0A 2EKCA 4MYAA 2Z1BA 2VELA 1A50A 3HQ1A 3EWWA 2QDHA 4P61A 4FF7A 1K8YA 3GAKA 3CIWA 3M41A 4BI7A 2GPTA 4IPIA 5AN7A 1UUOA 4IX0A 4O17A 3UZ5A 1J5TA 1HO1A 4RCXA 4MZYA 1OK4A 4B5NA 3N19B 4NQ1A 5TIMA 3GDMA 4PCFA 1TRDA 3NPUA 2VFGA 5SWUA 1OX4B 2Y7EA 3CLMA 5HWMA 2W0UA 1LBMA 4M19A 2Q8LA 1L6WA 1TV7A 4MJZA 3LCHA 3G1HA 4LWWA 2QJGA 4FB7A 3W1TA 4NT0A 2I1OA 4UCGA 1QO2A 5HNRA 2YZRA 2YGYA 1FWTA 4KWVA 3NQVA 1JUKA 2IQTA 5LHFA 3LLFA 1C29A 4GXMA 1LROA 3TAKA 4AVFA 1JULA 1G6CA 2QCFA 2V82A 3TJLA 1LTDA 1R2SA 3NVTA 1GVOA 2ZRXA 4BI6A 3BVJA 2V5LA 2H8XA 3MI3A 4X22A 2QR6A 4C1LA 3N34A 4GUFA 1G4EA 1OHLA 1R2RA 1ICPA 4TU1A 3W84A 1OX6A 1WBHA 5DBUA 1LOLA 1JUBA 1HG3A 3HGSA 4ZQNA 4A2RA 1JCMP 1QO5A 1IF2A 4ZVJA 3VE7A 1UJPA 3CEUA 3DXIA 1VYSX 4DPQA 3S5OA 4LVDA 2NXIA 4XUGA 1Q6OA 4XKYA 3S1VA 5T26A 3TCEA 4LVAA 1VCVA 3PC0A 3C2OA 2CLFA 4XQ6A 5FI8A 4UFMA 4JX4A 4ORIA 4CCCA 3KXQA 3H53A 4JTEA 3LTPA 2HS6A 2NUYA 5BMXA 3E12A 1YTKA 5D02A 1G7VA 1DQXA 2W6RA 1TV8A 5D03A 3A22A 4RJEA 4E2DA 1FY6A 3NPWA 4IX2A 1NAL1 3BG3A 1CX9A 4W9TA 2QJHA 3W71A 3E49A 4FNQA 1FWNA 3BPWA 2ZZ1A 3W85A 3GNDA 1H62A 1R46A 2Q3OA 1TRIA 1LBLA 4EOUA 3W22A 5K2ZA 1QPNA 2VOMA 1O4UA 5C2XA 4LS0A 4Z1DA 1V7YA 3DAQA 3T78A 4AB4A 3C3NA 1OK6A 5AHNA 4U4MA 3F4NA 1OYBA 4Q32A 3N14A 5F4WA 3QYQA 4BI5A 1OVDA 4JEQA 2I14A 4QQ3A 4ZQCA 3G18A 1KLYA 7TIMA 3GDTA 1XC4A 3W1MA 5I3FA 4UR8A 1QOQA 4J9JA 4LUJA 5J5DA 5CZ0A 3UWVA 4G1KA 3NQGA 4I9AA 3F4WA 3BARA 3L67A 2ZBTA 3P62A 4N9DA 3PF3A 5CKSA 1JJKA 3KRSA 4A3UA 3MHUA 3O05A 1GT8A 2Y89A 2WQPA 4JY8A 3W86A 3W07A 1T8XA 1XBXA 4LC6A 1Z41A 2ZFAA 4UUIA 4CCEA 2Z6IA 1XUUA 4IUOA 4RLIA 1TREA 4Y9AA 3GXTA 3OA3A 2ALDA 2FB3A 2QCDB 2ZRWA 4XBKA 1ADOA 4JTUA 3M0ZA 3B0UX 3GIYA 4JICA 3UNDA 1QCWA 5CPOA 3P8IA 3QSRA 1THFD 1HO4A 2A6LA 2LLEA 1JRCA 4IMDA 3LB0A 1GPWA 4KFPA 3SSJA 2OZ0A 3PBVA 3ZWTA 2YW3A 1I2QA 2FFCA 3C4UA 3Q37A 3L0NA 3VFLA 1ZAHA 5BW6A 3GLCA 1H60A 3B4UA 2QAPA 3B0PA 4OHQA 4Z0JA 1IGSA 4JTIA 4O18A 4DO4A 4IMCA 3T7VA 1H1ZA 2ZTKA 3I7RA 2PRLA 1KV8A 4LVGA 3LDVA 5AHMA 2Y62A 2ZTJA 3A21A 3L0GA 3S1XA 3AJXA 3TUUA 1ZALA 3W75A 4IJBA 5DBTA 3NAVA 5TBOA 4WXZA 2FPTA 2B7OA 4POCA 1SFLA 3C0JA 4IMEA 5J5RA 5HWNA 3TAOA 4HPJA 3HG2A 4ONVA 4HNUA 4S1FA 2CU0A 1WXJA 3C61A 4GUJA 1TPEA 3KVLA 3UWQA 1FWWA 1YXCA 3L5AA 1TIMA 1O5XA 1VRDA 2EPHA 3U2OA 3PUEA 2ZA3A 5FEXA 4X9SA 3KVMA 1W3IA 2A21A 3EWUA 5F1VA 4DQWA 4OE7A 3S6DA 5FF0A 1KW1A 1LM1A 1SW3A 3L66A 1U83A 4LTSA 1LBFA 1DORA 3HGRA 1NSJA 4O15A 2Q8ZA 1KTNA 4RZ4A 1BWLA 2DZWA 1FUYA 2OT0A 2HS8A 3P81A 2C14A 5AYYA 3O6YX 3Q58A 1GTHA 1ZY9A 2YFOA 1YXYA 3BLFA 2OX1A 3MI2A 3W2JA 5D33A 3RK8A 3HG4A 5CPLA 3W7QA 3QQ0A 3U8GA 2DP3A 1KBIA 4MLJA 2TSYA 3IGSA 1OX5A 3LCFA 1L2UA 1VR6A 6ALDA 3S8HA 5U4NA 4NJIA 3B8DA 4TO8A 2ISWA 3W2MA 5G4WA 2ISVA 2FB2A 2VEIA 3S5YA 3P61A 4RXFA 2G5WA 5LKYA 4ZZ9A 4FO4A 4OT7A 3A9IA 2WJZA 4MOZA 2P10A 3QMRA 2ABAA 4I7WA 1SZGA 5AYXA 4KWWA 4DF2A 3E02A 3PB0A 4Q4KA 3IVSA 1OX4A 1KM3A 2ZA2A 6TIMA 2NX9A 3PBUA 4O0KA 5LNVA 3I7SA 4QITA 2H3DA 3DHDA 5F4XA 5KZEA 1LLWA 1DOSA 3NO5A 3GDKA 3C6CA 3SW6A 4AF0B 4IPJA 1Q3NA 4UTLA 3STFA 1TSIA 3NL5A 1W5NA 4YCOA 3N2MA 5K9CA 3IGXA 1ICQA 2E5CA 4NX0A 1JRBA 2VFDA 5DCEA 4CQ8A 3DU0A 3DFNA 4M6QA 3S1UA 3W7HA 1L9WA 4JS3A 4LNYA 3W7GA 1M5WA 3A5FA 2NZLA 3W72A 3NQAA 2X1RA 4HPXA 2GJNA 3P7YA 3LERA 1YADA 3LI0A 3HGJA 3LRMA 2HSAA 3M44A 1H7NA 1OFQA 1YLVA 3P5YA 5LSMA 1LCOA 1QDSA 1HTIA 3W2LA 1T96A 2VFIA 3W83A 4UTHA 4UTIA 3OHIA 5FEPA 1FCQA 3TDFA 1R2TA 1EWEA 3W7DA 3NQ6A 5HUPA 2DJLA 1FDYA 1WV2A 5D2XA 3NPXA 3GR7A 4GWEA 1FXQA 4FXRA 1GYNA 4O28A 1A5SA 4L4MA 3W2KA 3EX2A 3TC6A 1N8FA 3G0UA 3MP5A 4K36A 2FJKA 5D09A 1GZGA 1KLZA 2F7FA 3FLUA 1DV7A 4N9EA 3ZWSA 1W5PA 4O1DA 1OG0A 3CU2A 3WJYA 5I3HA 4R53A 1F76A 1OFAA 2ZA1A 4R7JA 4ALDA 4AMAA 3UXAA 3EKZA 4MPQA 3W6YA 1X1ZA 1TQJA 3DI1A 3G3DA 2YSWA 3IIVA 2VEPA 1P1XA 4JTSA 4PA8A 3UPWA 3STGA 3TSDA 3FKRA 1VJIA 1P0KA 4UNLA 5AHEA 4OQVA 4BF9A 2ZRYA 1Y0EA 3W7RA 5HINA 5G4EA 1KM2A 3U6WA 4ZMGA 3M9YA 1SO6A 2HMCA 1ME7A 3TXVA 4JTFA 3W1XA 2R91A 3IIPA 1MXSA 1G69A 3WJZA 3LX9A 3FFSA 3WK2A 3QRHA 3L68A 2P1FA 3QMTA 4NXSA 1L6YA 1S5VA 1XCFA 4JN6A 4O14A 3RLVA 1XM3A 3M7WA 1G67A 1MSSA 3PSWA 3TE9A 3NOEA 1DVJA 1YDOA 3BLEA 4A2SA 1TYGA 3NA8A 1FQ0A 5LZLA 3MYPA 2YFNA 4HSNA 1ICSA 3P60A 4I7VA 3TV8A 3TU9A 3MO7A 4YMZA 1KM0A 4FX7A 1C8VA 3O6DA 3EXTA 1QFEA 4UFHA 4Z1CA 4S2CA 4M7SA 1DHPA 4CNOA 1KM5A 2QCDA 3W7LA 3W1PA 1K3UA 2BWGA 4JX6A 2WO5A 1GJPA 3MYOA 5DXXA 5K7JA 3NQDA 2E6DA 1K8ZA 2D73A 3W1QA 4N6EA 5C6MA 2CLEA 1J2WA 5KINA 5KITA 4O1CA 4LW7A 4N4PA 2JKAA 2A1YA 2VFEA 3QSTA 3FYPA 3NXFA 2CZFA 4CLMA 1Q6RA 1LP6A 3B04A 3MHGA 3OIXA 4JNMA 4LV9A 2RDWA 2QCHA 1JCJA 1ZCOA 2NX1A 2X1TA 3LM7A 3DENA 4A21A 4CQAA 4YCPA 1X8FA 4QJ1A 2V81A 4K37A 5FF2A 5EL1A 2TMDA 3P74A 3GKFA 2B7NA 2NV1A 5BMWA 5K4ZA 5D38A 3FA5A 4MZ8A 3PG8A 1VYPX 4IWWA 5LNWA 3KRZA 3SR7A 4EF8A 5D2YA 5AHIA 3TJXA 2YCEA 2GUUA 3CM4A 3DH7A 3LLDA 1JCYA 4O1BA 4XTIA 1L6SA 3HB9A 1PHQA 3O15A 2E6AA 3SFKA 1LORA 4DPPA 1HL2A 1Z48A 3QEZA 5C55A 1RPXA 3IIZA 3W7KA 3NM1A 2J24A 2HTMA 4EF9A 3E96A 3CWNA 1H7XA 2QCCA 3BW3A 3NQ7A 4UMCA 2RFGA 3GDLA 4U28A 4OV4A 2BXVA 4K7VA 1EP3A 3KOFA 3I6RA 3B05A 3A24A 3O06A 1XBZA 4EIVA 4FNRA 1AL8A 1NVMA 3STEA 4XZ9A 1GQNA 2Y7DA 2NWRA 2ZZ2A 3G1AA 4RK8A 5G2HA 3HPXA 5H2ZA 4RR4A 1A5BA 3A23A 4NZFA 8TIMA 3OVQA 1KM6A 4JGDA 1MEIA 1J4EA 1H51A 1DL3A 5DCBA 1DQWA 3FIGA 3LV5A 4H6KA 1W8SA 1ZJIA 4ORMA 2VC6A 2A5HA 1OYAA 2X16A 4K38A 1TMHA 2YW4A 4Q33A 2QUVA 3TFXA 1H1YA 4UFLA 2J9ZA 2JK2A 3DFPA 1CW2A 4PFMA 4LRSA 4HNTA 1WYIA 2JKEA 3TW7A 2DZVA 4TMCA 2H3BA 4RZ5A 5DN1A 1EIXA 1MO0A 4DO6A 5KMYA 1ZAJA 3NNTA 1H61A 2CFFA 4O52A 3GXPA 2A2IA 1JCLA 1X6UA 3L0KA 3L5MA 5F2GA 1KTCA 1W37A 4PC8A 4QM1A 3C2FA 5KZMA 3W7OA 5G2WA 1BKSA 5K9DA 4WJEA 2DORA 2PURA 1K02A 5MHBA 4N9CA 5F1UA 5LGXA 1JVNA 5H91A 3SIZA 3RFAA 1T99A 1KFLA 1B4KA 2YPIA 2BTMA 3M5VA 3NQCA 1GVRA 1E51A 4LS1A 2RHGA 3E9AA 3LGEA 4O4VA 2FDSA 1TPDA 1W3TA 2CWNA 5AC8A 3LXAA 1K03A 2PC4A 3W23A 2E09A 1XDLA 2VFHA 3RLUA 4MLRA 4BK9A 3KAOA 2RKXA 4NJHA 1OFPA 4UC5A 1B9BA 3TKFA 4LY8A 1FCBA 3HMJG 2E68A 4JTGA 1VHNA 3L9CA 3BO9A 1GYLA 3T55A 1H7RA 3HG5A 2PCQA 5U7SA 5DLCA 1XI3A 4M6VA 4AEOA 3W7IA 2RDTA 3S42A 3S1WA 2FPVA 5DXYA 1GG1A 3G3MA 1ZNNA 2ZRZA 1OFRA 3EXRA 3TH6A 1TPUA 3G22A 3ABQA 1GVFA 1EWDA 3TROA 1CI1A 4NU7A 1EPXA 4KFNA 1SZEA 1OABA 1YYAA 2QDGA 5A8GA 3UXDA 5E1QA 1QOPA 1P0NA 1TPVA 1KA9F 4NJGA 4R33A 1IIHA 3V1PA 1YPIA 3PG9A 5L6UA 2Z6JA 1SW0A 2GVLA 3VE9A 2XN0A 1IIGA 5FF4A 1I2NA 5A5WA 3W74A 4P2VA 2X1SA 1C9DA 5CSRA 1TTJA 2OMAA 1DBTA 3HPZA 3TXZA 1H50A 4HIBA 4FNSA 3TFCA 1ME8A 2BSLA 2EGZA 1XXXA 1SZFA 3KRUA 4I7UA 2DJXA 1SW7A 4AHQA 4NXKA 4AXKA 4O19A 3BW4A 4LVFA 4OGZA 4OBTA 4JYEA 2YX0A 4OU1A 1KM1A 3F03K 2TRSA 3VKJA 3MJYA 3OEXA 3N3MA 2VXNA 4UFJA 1XBYA 1VLIA 3P8JA 5F4SA 2GQAA 3BGGA 1LRTA 1MEWA 3O1NA 5LNRA 1LLZA 2I9EA 1JR1A 2E6FA 3G1FA 4D2JA 4UTUA 1NEYA 5DY2A 1F73A 5HWJA 2V2DA 2TYSA 2B4GA 1I8JA 2OJPA 4O57A 2BLEA 1RVGA 4MUZA 1JCXA 1PS9A 4XWUA
chains in the Genus database with same CATH superfamily
1M6JA 3SCTA 1E56A 2NX3A 3G8RA 3PVFA 4D71A 2AGKA 2FZMA 1TPWA 1MW2A 2XIMA 1JD9A 3BG5A 2O9OA 2B0MA 4KMQA 3VX1A 1TKKA 1TJPA 2X8RA 3QW4B 4G2DA 1RPKA 4UXDA 5HNTA 1O12A 5KTLA 4CNPA 1KO0A 3IEBA 3UETA 1ZGDA 5I3GA 4D8ZA 3NG3A 3S2MA 3KX6A 2DSUA 2IKJA 4XAPA 4PMUA 5EPDA 4A05A 3WUBA 2OT1A 1V3IA 4UBPC 1Z42A 2NSOA 1P6WA 1OB0A 1X7IA 2WW5A 4J3XA 1YTEA 4H8UA 3O16A 3CQKA 3EWYA 4DLMA 4JYDA 1IT0A 1CXKA 1YMYA 3ECQA 9XIMA 3EX3A 1G9HA 4GE8A 3PPFA 5M5DA 2HE5A 3QR0A 3SSZA 1Q2RA 2ISSA 3OG3A 3KVKA 3DFHA 2Y61A 4J7RA 2FVMA 3ZVHB 1HKWA 1A5UA 2OB3A 1X1OA 2EJAA 3W7NA 1KRAC 1ZUAX 1WBJA 2EXOA 3ABSA 2IKGA 3UPBA 5IXEA 1CGTA 4GABA 1KCLA 1F2JA 4J28A 1W3LA 3THDA 3R13A 5B80A 3WH9A 3UR2A 2O92A 1S2AA 1WZKA 5FEWA 3OYZA 5CPTA 2B7PA 4XIMA 1LOSA 1WXZA 1TJ2A 1KC7A 4Q8QA 4CUCA 4Y9PA 2ATSA 1F05A 4AHPA 4JTKA 2V2CA 1HKKA 1YE6A 2VENA 1AQ0A 3S9ZA 2DU2A 1PUDA 4YU1A 4PRWA 4Y6GA 1UA7A 3RF9A 1ZP3A 4CCDA 2I7GA 3CYVA 1UWRA 1G4PA 5CG7A 4IXXA 3TC7A 3SRHA 1XR2A 1R87A 1VPQA 3FY1A 4XZBA 4F2UA 4AIEA 1E6XM 4D6CA 3DX5A 5K9XA 2NQZA 4AU0A 2CNCA 1JNDA 3RILA 5HQEA 1PX3A 1PZ3A 4KRZA 4JKMA 4K7YA 2NLIA 4K8HA 1DE5A 2XHYA 3GXIA 3OZMA 3U4FA 4GXWA 3GNRA 4L9YA 3W2NA 1F8MA 1JIBA 2FH6A 1CGWA 5BRBA 4RNHA 1XIIA 3UWYA 2BDQA 2V9DA 3UW6A 3GUWA 3M5YA 4ZR8A 1XJBA 4E38A 5ABFA 4Z2JA 2HK0A 3G6LA 3VZZA 3GVQA 2XJ7A 3VKDA 4TV6A 2D0FA 5CC5A 4FLSA 2Y7GA 1KCZA 3HIJA 2J78A 4K39A 1MUMA 3T44A 4G9PA 2E8YA 4N9BA 1V0KA 1XLAA 3OBKA 3TSBA 4EXQA 4D8AA 3HPAA 3TYAA 1Q4WA 3IACA 1G4SA 3ZR4A 3JR2A 2Q3RA 1XHGA 2UY3A 1VC4A 2XPKA 4DLFA 1B90A 1AQMA 6TAAA 2PF8A 4KPLA 1BSIA 1TQXA 1M01A 3MBDA 5HQLA 3PUGA 1U1JA 1W91A 3PUDA 1PHWA 4WOZA 3PAJA 1AD4A 3SY1A 4N0RA 3ZSSA 3NO3A 5D37A 1K7FA 4JX5A 3TMQA 4YVPA 1TMLA 1EP1A 4OZOA 3JRKA 2BVYA 1IXPA 2QYGA 2QUMA 4GC4A 4O53A 2HBXA 1FDZA 4FXFA 5FJRA 1L2QA 2GJXB 3PY2A 2XVPA 4GQRA 5CSSA 4PL2A 3W1NA 2PDQA 3E38A 1PL9A 1XSKA 3O6CA 4B5XA 4H9ZA 3CAVA 4J40A 1TV5A 3WCZA 3D0CA 4L64A 3KTXA 1YNYA 2NXHA 2ZZ7A 2NWSA 1O68A 4P5UA 4GIYA 3MCNA 3APGA 4JTLA 3TTYA 1Q7ZA 4ZOBA 2Y8VA 1KD0A 3G8EA 3G1DA 3KFTA 3QW3A 3WQGA 3LYEA 4GIRA 1RP9A 3FS2A 1V79A 3HO8A 1XH0A 3RPDA 2BGSA 4HA0A 4B4FA 2HE8A 4W7VA 5L9FA 4I9TA 2WNQA 4FPSA 1H7OA 3DBPA 1RQBA 3NL6A 1BD0A 4IGMA 1BRLA 3E0FA 4OBSA 4HYVA 1JAEA 5EGRA 3T8LA 4HU8A 4PUDA 3EMZA 2CESA 3ICJA 5BOFA 5FF3A 1NOWA 2XVGA 3B0YA 4WY0F 3G1SA 2NUXA 2BG5A 1QI0A 2FTPA 3IK2A 3SJ3A 3NURA 4I9MA 3A3WA 3G24A 2YYUA 3LXCA 2DQWA 3NQEA 1Z44A 1V03A 4WK9A 1W1TA 3R6IA 2VI0A 3THQA 3W02A 3WK1A 1U2YA 3KBJA 3DEQA 3TJIA 1P6BA 3VOCA 4I5XA 3KS6A 3OQ8A 4R34A 3W1AA 1VBRA 5CQ1A 1FP9A 3GXNA 4LX4A 2DT2A 3VDBA 4JZ5A 5FJJA 2VX7A 2WMGA 1EF2A 3ZVHA 2P50A 5LGZA 3SI9A 5GPRA 1J9YA 4BFAA 1QOXA 2Z2UA 4H9YA 3ZJ8A 4WD0A 6A3HA 4X3ZA 1TUXA 3ABXA 2J9XA 4F0SA 2VZOA 2PA6A 5D04C 2B81A 3VABA 3HOJA 1DIEA 2PODA 4B15A 4NNCA 2JQXA 3URNA 3T4CA 5JBDA 5AZ1A 4PUNA 4XVEA 1W3NA 5C54A 3SQMA 3W87A 1ISWA 2GSEA 1LF1A 4J2PA 4K8EA 3K4AA 2HISA 4NUWA 3RNDA 4WQ6A 3LHZA 3SCPA 1SPQA 3M5ZA 2PDYA 3DG3A 1VEPA 2WNWA 4PMQA 4GVFA 1H7WA 9XIAA 1G5AA 4V28A 2WSKA 1PDYA 3PTMA 1PIIA 4QS5A 4IG2B 3UVAA 3EWZA 2J88A 3MU7A 3U57A 5I78A 3MJMA 4O13A 3QFWA 1ONWA 1Z89A 3LCXA 4MFEA 4FMVA 3L65A 1MWOA 1AH0A 1ISYA 3GR4A 1XPGA 3SO7A 1ZU8A 1V6TA 1C8YA 5BWFA 4YXGA 4MZ1A 1BHGA 1EX5A 4IGNA 1W9PA 4PUJA 1FH7A 2PDNA 3QTGA 3PULA 1VCFA 1Z7AA 1VPXA 1U5JA 2ACQA 1RA5A 2JALA 2XSAA 3FDKA 1JFXA 5FJUA 2C3ZA 2O7QA 4PTNA 3KHDA 3GTHA 3O9NA 3KOYA 3FOKA 4OTKA 3D3FA 4PL1A 4C6EA 3VC5A 5DT7A 1HKIA 2WKJA 3NXLA 4H9TA 3WLIA 4HZ8A 4Q6JA 2XN2A 4XKYB 1C91A 1XRTA 2ZE0A 3CB8A 1R9XA 3T2OA 3LHWA 3CAQA 4P8WA 1LZOA 2PU0A 1PV8A 1X38A 1NF7A 3TOYA 4CVWA 3HURA 4CNUA 5E0KA 4M0XA 4UTMA 2XFWA 4UQEA 1X6NA 2GGGA 4PEEA 2OXNA 1O5RA 1UJQA 2XFFA 1PWLA 4D8LA 3VCNA 4KKXA 1AMYA 2JKPA 5D05A 3UWZA 4JHOA 4ZQRA 5EBUA 1KFJA 5A8QA 3KHJA 2ZX7A 1BYCA 2C1HA 2ZRVA 3O07A 2FIQA 2WSQA 4BEUA 1UD8A 3LRKA 3GH7A 4A8RA 1TR9A 3LV6A 4W7UA 3OJGA 1J93A 2XIIA 1W56A 3GSMA 3GU1A 3HU7A 4PCPA 4PR4A 3H4WA 4AX7A 2FZDA 3PZIA 2NV9A 2WZIA 5AOUA 4PMZA 3YPIA 5M1TA 3GU2A 3R8GA 3GZ3A 3RU6A 4KERA 2QCGA 1I9CB 1GVYA 1DJNA 2PRMA 2WOQA 2A7PA 1YXDA 4FS9A 1XLEA 2KZHA 1VB9A 4GCAA 3HM7A 3OPSA 2HVMA 4Q8PA 5LNSA 1D3HA 2GJXA 1Y8BA 1KRCC 2X30A 2QXWA 3L5LA 3WQDA 3B8SA 4D9PA 1SU5A 3MW7A 3CHVA 3ZZ1A 1ALDA 4HZMA 1EUNA 4WVXA 4FR6A 4ZOEA 2WZTA 3C2VA 1BWKA 3WH7A 1UASA 3VO0A 3AZSA 4FI4A 1XD1A 4FIRA 1HUVA 1A5CA 4QP0A 4JFWA 2QUUA 1HFBA 4RXGA 1XL9A 1G4TA 1FKXA 1ONXA 3DZ1A 3WLHA 3OYXA 3RUBL 2Z25A 1WQ5A 4W86A 1YRRA 3UBPC 2P0OA 5KSWA 2DPEA 2WPBA 3NL3A 1XICA 4LT9A 4D6FA 4ROPA 4KIEA 3BV7A 1Q85A 2G3NA 1TPFA 4AY8A 5TAOA 1DWAM 2QNEA 4AAJA 2J27A 3UYCA 4O1FA 2GGHA 4EWND 2BOFX 5A6BD 3DFQA 1BTMA 2GJPA 1OGSA 3AHXA 3SCVA 1TWZA 3OGSA 3GM8A 2Y63A 2VEMA 4L4LA 3CC1A 1HJQA 2HVOA 4JXCA 3ISIX 4QG9A 1BLIA 1V5XA 3GWQA 3CUGA 1VFTA 2Y8UA 1JCNA 1LYXA 3VGEA 3FAXA 3PWGA 4C7FA 5A8NA 1XYMA 1WZAA 4GI9A 3W4RA 3GZAA 4RL3A 2WCGA 3QJAA 3WN6A 1GQKA 3AZRA 4E2BA 2GOKA 3HPFA 1UKSA 2DV0A 2HPMA 2O9TA 1RD6A 3V36A 1US2A 1HQTA 4LU0A 5ABTA 3ALFA 4WUIA 2IS7A 4RX0A 4MYAA 1A50A 3EWWA 3M0HA 4PMDA 1EZ2A 3GAKA 4BF7A 5PTDA 1GHSA 1RH9A 4BI7A 2GPTA 2G37A 3N2TA 5HMDA 4O17A 1SGJA 4KWUA 4WEVX 1B2YA 3MZ2A 2WM0A 3AZTA 2ZX6A 4PCFA 4NZ5A 4QFUA 3H22A 3CLMA 3ARWA 3TYDA 2HJPA 2Q8LA 4LWWA 2I1OA 4ICCX 2YGYA 1EDQA 1GNXA 3NDZA 3LLFA 1ISVA 4GXMA 5HNUA 3GRIA 3GDBA 3ZQ9A 1LROA 3TAKA 1G6CA 3SN4A 3BOLA 3F7JA 5CAKA 1LUCB 2ZRXA 3BVJA 5FAGA 4EK7A 2H8XA 3MI3A 2QR6A 3CJPA 4D6JA 1ITUA 3R10A 1OHLA 1R2RA 5I7GA 1OX6A 1WBHA 1HG3A 3I4KA 4QE4A 4A8IA 3RCYA 4A2RA 1JCMP 5BCAA 4LEQA 3POHA 2IPFA 1HT6A 1QNPA 2R1KA 3QHNA 1Q6OA 1YKWA 3DOPA 4XKYA 4DIAA 1QNOA 4I90A 4A3YA 3C2OA 1QPKA 3A3HA 5FI8A 2IPWA 4JX4A 1S2TA 4CCCA 3KXQA 3W6LA 1IR1A 1W1YA 3H53A 3URQA 2AMXA 2HS6A 1B3VA 4FR1A 5D02A 1G7VA 1DQXA 2F8QA 3A22A 4E2DA 4DHGA 2PUZA 4QDWA 5B7ZA 4HN8A 3THUA 4W9TA 2QJHA 3E49A 4FNQA 4CQDA 3BPWA 2P88A 3R4IA 4DYKA 3GY1A 3GNDA 1GOKA 1LBLA 5K2ZA 1QPNA 2ACRA 2X0SA 3VINA 3DAQA 3T78A 3PNZA 4M29A 4AB4A 5DMYA 4C60A 3BJSA 3F4NA 4H04A 3IV8A 1OYBA 4CQCA 3UWEA 4Q32A 3WEOA 2OO6A 3N14A 2PP3A 5F4WA 1UP2A 5D9NA 4PTMA 3BSHA 1ODUA 1DQUA 2PWGA 1QOQA 4J9JA 3AFBA 4I9AA 5JU6A 3F4WA 3DN5A 3P62A 4N9DA 1JJKA 3KRSA 3U0HA 3MHUA 1GT8A 2Y89A 3COTA 3WF4A 3W86A 1EIBA 1Q13A 1T8XA 4CCEA 1EJXC 3B9AA 1WUEA 2YA0A 2W92A 1NDZA 5JBEA 1E9ZB 3ARSA 3OA3A 2BODX 2FB3A 2QCDB 4XBKA 2PEVA 1ADOA 1NFGA 4JTUA 3UNDA 1QCWA 2FGZA 4YS1A 4Q4SA 4EAMA 1HO4A 2PWUA 4IMDA 1W2PA 1FWEC 2PGRA 3UPMA 4L1GA 5RUBA 1ZRQA 3EPNA 3QTPA 2WVVB 2WPGA 1X96A 3VFLA 3GLCA 2QUNA 1Y5VA 3WQEA 2DIEA 3B0PA 4JTIA 1XLHA 1H1ZA 2ZTKA 4H9XA 2YB4A 3I7RA 5FAJA 5G1MA 4DN1A 2J7GA 3EDDA 3O7UA 4JN7A 1RUSA 3AJ7A 4GG9A 3U7BA 2B31A 4CU7A 4B5SA 3PJXA 4E4UA 3R0KA 4HNCA 1CLKA 3L4TA 4GX9A 1FHDA 4WXZA 3T4WA 4WSHA 1F3WA 4ES4A 4XZLX 1GOOA 3C0JA 4HPJA 3MUZ1 2CU0A 2AAAA 2XVLA 2E25A 2V3GA 3S2JA 4GVIA 3AXHA 2EJ1A 4GX8A 3GG1A 1O5XA 2EPHA 1E40A 3EB4A 1A3HA 5TF0A 4FOKA 3BWWA 5A6LA 5D9OA 2HXTA 3KVMA 2A21A 3EWUA 4HMEA 4E6MA 4OE7A 1LLOA 4HJWA 1R9YA 1LM1A 1SW3A 4RW5A 1LBFA 4Q8UA 1NSJA 3UT0A 4C91A 4YPJA 1N2VA 3LY0A 3KDNA 2OX1A 3OIHA 1HIZA 1EDTA 3TLLA 3IS4A 1NQKA 3ARTA 2DP3A 2RGLA 1UMYA 1KBIA 4HGXA 4U2ZA 4MLJA 4HU4A 4QLJA 3CUIA 4QBXA 6ALDA 3S8HA 5U4NA 4NJIA 3FHAA 2QS8A 2QDDA 3PN8A 5G4WA 3V1HA 1DWIM 1RY0A 2CBJA 4ZCWA 4FO4A 4KRUA 4YIWA 2P10A 3QMRA 4OOUA 4Q4KA 3H70A 3IVSA 1KM3A 5HDRA 2NX9A 3BTNA 5LNVA 3I7SA 3ARVA 5F4XA 4WKFA 3TYCA 1PZ2A 4AF0B 2XU2A 3TZFA 3VUPA 3E74A 1LQAA 1XH2A 4YCOA 5K9CA 1J0KA 1ICQA 1XLFA 3A12A 4BKNA 2VFDA 3DU0A 3DFNA 3TYUA 1OGGA 3W7HA 4KWOA 4LNYA 1LUCA 4AZ5A 2ADAA 4W88A 2NZLA 4BZYA 1QTWA 4AZCB 4Y9OA 1TJ1A 3P7YA 3LERA 1YADA 5EMLA 4YTSA 3TZNA 5M17A 2HSAA 1BYAA 2DUZA 3VA8A 1CIUA 3FGCB 5LA1A 1HTIA 3W2LA 4RDYA 2JEPA 2VFIA 4UTHA 3OHIA 5FEPA 1EC9A 1FCQA 3M0KA 3R43A 1R2TA 7ODCA 1BG4A 5ECVA 3NQ6A 2QJMA 1ZBWA 4D6EA 3GR7A 3OG2A 4ZO7A 3TN4A 3TC6A 2PDCA 4K36A 3CZJA 2FJKA 2ISFA 1QNQA 3FLUA 3NFUA 4S3CA 3H4GA 1EJWC 2ZA1A 4XAZA 4ALDA 5JBFA 4NAFA 3FNDA 4ZO6A 3CK5A 1BQGA 1X1ZA 3G3DA 3L4ZA 3UJ2A 4QGCA 2YSWA 2VEPA 1IWPA 4JTSA 2QT3A 4PA8A 3STGA 2OOFA 1J8VA 3FKRA 3WH5A 4OIFA 4GO9A 4UNLA 4BF9A 2AKMA 3OGVA 1V0LA 4QJ3B 3CTTA 4B5UA 1HNYA 1UZ1A 1UW9A 4CEUC 1DIKA 1CCWB 2DGAA 4W84A 3L68A 4AD3A 1L6YA 3H2FA 1QT1A 2NT1A 2WQDA 1XCFA 4F0LA 3ZYZA 4KCWA 4U5KA 4O14A 2BY2A 1XM3A 3M7WA 5JIWA 2REQB 2I17A 3BZGA 1XINA 1ESWA 1BYBA 1MSSA 4C1NB 1DVJA 2GGIA 3WF3A 1D7FA 1CZ1A 4NKCA 1V7AA 3AS0A 1ICSA 3EGJA 1O5QA 3P60A 4I7VA 3TU9A 3NSNA 1LWIA 1EQCA 1C8VA 2CLPA 3EXTA 4UFHA 1EFZA 1BG9A 2QCDA 4TV5A 1IEXA 1P0DA 3MMWA 2WO5A 2PTXA 4PUWA 1XYCA 5K7JA 2E4TA 1UR1A 5MKGB 2YDQA 3LZ5A 3V4BA 3AXIA 4IIBA 3W1QA 1J2WA 1DIDA 1RBAA 2WVVA 1PYMA 1Q6GA 3J7HA 5E9XA 1CB7B 1B3XA 2A1YA 4NZ4A 2R1PA 1RBLA 1M7XA 2VFEA 3NXFA 3FVMA 4Q22A 4CLMA 1CTNA 3MHGA 3OIXA 4MAVA 3S6TA 2I16A 2OKTA 3VU2A 3L12A 1JCJA 4GINA 4QJ1A 4K37A 1O1ZA 2TMDA 3GKFA 1NARA 1VJSA 3RR4A 4AEEA 4MZ8A 3VD5A 3W01A 3OBEA 5LNWA 5FACA 5FKYA 1EHNA 3S1GA 2PTYA 3SR7A 4E2OA 5AHIA 3GTNA 4GY7A 1QHOA 1XGEA 4L6HA 4NRSA 3CM4A 2Z29A 1JCYA 4HHLA 1KXQA 3DBNA 3GNOA 3HB9A 4CGTA 4U3AA 4JHMA 3QEZA 5C55A 1CXFA 3IIZA 4QCEA 4ENLA 4ML4A 1EEXA 4PRRA 1E6NA 1LL4A 5LXXA 3E96A 3CWNA 4ZO9A 1H7XA 4MB3A 3NQ7A 2RFGA 5ABGA 3GDLA 4U28A 3KOFA 4K68A 4BQ2A 3KL0A 4PSPA 4FNRA 1AL8A 3SDOA 1RY8A 5BU9A 2WVSA 2KAUC 1PPIA 4L9ZA 2ZZ2A 3CZEA 4RK8A 3H24A 3HPXA 5H2ZA 1XSIA 4LFYA 3VNKA 1A5BA 4ZXLA 1FFQA 4YTUA 1J10A 1W8SA 1MZRA 2VM8A 1K6AA 2PDFA 3FSTA 2YW4A 3CL7A 1TVLA 5GQBA 3GG7A 2XIBA 2QUVA 1WP6A 1X97A 4PFMA 3BGAA 3QOKA 6XIAA 5DN1A 4Q4RA 5KMYA 2WSPA 3NNTA 4GVHA 5LIYX 3DERA 4HPHA 2ESCA 3KCJA 4PMVA 4Q4OA 1E55A 4GZJA 1UKPA 2DVUA 4JIRA 2CZVA 3PBGA 1VJZA 5K9DA 5A6MA 4WJEA 1UKTA 1JZ5A 5J04A 3TR9A 1K02A 3CQHA 4ERGA 2QMKA 2IKHA 4AZCA 5LGXA 2CKSA 2JFEX 4GYPC 2YPIA 1V02E 2AMGA 5FA5A 3M5VA 3NQCA 1K4GA 3FGCA 2TODA 4QX4A 1AJ2A 1AH4A 2V5DA 5LIWX 4QDPA 4NHVA 2INEA 5AC8A 2E09A 1FWCC 2POZA 2W4XA 5C70A 3S83A 1ONEA 4HD5A 4UC5A 3TKFA 1V0MA 1JF5A 3HMJG 4HP5A 4JTQA 4P8UA 3BAYA 1XW8A 3L9CA 4DWSC 3SCWA 2GUYA 1PX8A 4GISA 2ZC1A 1CBGA 3LGGA 5DXYA 1GG1A 3G3MA 5I24A 2XINA 4AZBA 2VX4A 3A4XA 3UVIA 4MWAD 3TH6A 1TPUA 3G22A 3A3XA 4E8DA 5BYWA 4GC3A 1EWDA 1B31A 2YZ5A 4G5DA 4LBUA 4PBEA 5GNZA 4NU7A 1N82A 1WXYA 2QDGA 4J3ZA 5E1QA 2C1GA 1Q6FA 1IIHA 3EDJA 5C9UA 1YPIA 1R6WA 1Q5MA 5C7VA 4DBUA 2XN0A 3A4JA 4BHYA 5FF4A 1J0ZA 4DI9A 4P2VA 1XIGA 5CSRA 3PZUA 4RW3A 1C92A 3HPZA 1H50A 3O2LA 1ME8A 2EGZA 3AMLA 4I7UA 1MI3A 3GTIA 2VYOA 4AHQA 4NXKA 3H7VA 4HQVA 2REQA 3KUMA 2WZMA 1PTGA 1QW9A 3VIPA 2YX0A 2PP0A 4C1NA 1ZJAA 5I0DA 2C79A 2R9RA 3F03K 3N3MA 1E73M 3V5CA 3RJXA 2VXNA 4IIFA 3BCFA 3VUSA 3GG0A 4AISA 1F3XA 1XCWA 3GIQA 3S3GA 4F2BA 3O1NA 5LIKX 2J7FA 2E6FA 3CUJA 3LZ3A 1NFPA 5FL0A 2TYSA 2B4GA 1BF2A 1RVGA 1QUMA 2DY3A 3G5EA 1GOQA 3NDYA 5E6ZA 4DI8A 3OB8A 3RXZA 1MRAA 3PBYA 2Y70A 1OGBA 3WJXA 4WF7A 1XRSA 1OSEA 2GK1B 4JIQA 1UR2A 4TTGA 5H6HA 4ACZB 3QGAC 1UWSA 1AQFA 3U2EA 1XIJA 3PPHA 4XK2A 4US5A 1A5AA 4L56A 1PKLA 2DSWA 3HQPA 1SZNA 2J9YA 3LG3A 4HN4A 2QW5A 1F74A 3ZIZA 2J6XA 1QRQA 3TSMA 3QM3A 3W7JA 5B7YA 1GW9A 3PZMA 3V75A 1EUAA 5I3IA 3MVIA 3JUGA 1EGZA 1EA0A 1OZMA 2JIEA 2WSRA 3APYA 4HCDA 1Q63A 8XIMA 5A6JA 3EB3A 2XZ9A 4GUGA 3TW9A 3ZR5A 2DVXA 4GKTA 1KWGA 3DYOA 3W26A 3WD1A 3K4DA 3NEVA 3SEPA 3PSVA 4LOCA 3SGGA 1NFBA 4BQ4A 4NP7A 1R86A 4JOMA 3RPMA 4AWTA 2CZDA 2IPGA 3UJFA 1GCYA 4H7CA 2WWDA 1P1MA 3ELFA 2NQ9A 3TP4A 1DJQA 1Z3NA 1W9UA 1W1B1 1EJTC 1K7EA 1UD4A 3R5EA 5I77A 4QISA 4QE1A 4JQ3A 3LCGA 2PE4A 2PDHA 4HMDA 1VAHA 1EJUC 2NUWA 4IUGA 4LH8A 2W79A 1JDFA 1YHTA 2Y6ZA 3RM9A 3VZYA 4PODA 4URIA 1I75A 5DY3A 3GNNA 1U1UA 4BWLA 3EOEA 5AC6A 1JZ2A 4NJJA 5EFDA 4UTWA 3IVUA 4WHBA 2W5FA 4KEMA 1J5SA 4H9VA 4C65A 1WA3A 1TELA 3SJNA 3NL2A 4CD8A 2DT1A 4Z42C 1U5VA 1D3CA 1B9ZA 4PMXA 3HQNA 3V5OA 1VHCA 3BLDA 1GVIA 2YLLA 1YTDA 1XIFA 3UZYA 1ISZA 3C0LA 3AMGA 1WPCA 2ZZ6A 3IRSA 3K30A 2Y2WA 3IARA 3C52A 3CZ8A 3N4FA 4GNJA 2Z24A 1E3XA 1XQLA 3M16A 2ZYFA 1D7KA 1AW1A 1GEQA 2XUCA 5DRIA 1B3OA 3TW6A 3K13A 4DO5A 4LVBA 3O6AA 1GONA 3UXIA 5E09A 2J25A 4UQAA 1MW0A 1S5TA 3HGOA 3WLNA 3PB2A 3CPRA 3W00A 4JR5A 3SCRA 1KGUA 3QH2A 3UFYA 1Q8AA 4M6PA 2HBVA 1D9EA 4FSAA 4HNNA 1B5TA 1YPFA 5FSDC 3FX4A 9CGTA 1I1XA 3HJZA 3VVGA 4ZENA 2ZZ4A 4C5ZA 4KFOA 3R11A 1V3KA 3HQOA 3AMCA 1A0CA 4DYEA 1RV8A 3AO0A 3PJUA 4QTGA 1OCQA 3UY7A 1M7PA 2WMHA 3FJ6A 3FVDA 1VGAA 5EBAA 3VM7A 1XWYA 1RD5A 1HKVA 1M04A 3N17A 3THAA 3DFOA 3G1YA 4J4KA 2ZKMX 2C18A 5BNKA 2YBTA 3R0UA 3CWHA 1PKYA 3SUWA 3T05A 2W3ZA 1SO5A 3Q65A 5I6SA 2WBKA 3BMWA 4LEFA 5EYWA 5HR7A 3CIVA 1IV8A 2DSKA 2CLOA 3BLIA 1EBHA 3L4UA 3TTEA 3ATYA 1UD5A 1KFEA 2C16A 3WJSA 3M6DA 1S2VA 1DPMA 3TQ0A 1W5QA 3W7CA 2WCAA 4LYRA 2JGQA 3B3DA 3SZ8A 5CGMA 4XAYA 4GY0A 1E4NA 4GYJA 3WH6A 4DX3A 2AQOA 4JTHA 3BAKA 2DW7A 3G0XA 3NGJA 3LK6A 1DJWA 3PBWA 4EPKA 2VFFA 3VNMA 3UWWA 1EC8A 1A5KC 2QUTA 1QATA 3EWXA 3AIRA 4RV3A 3C2EA 5XIAA 2CLKA 3KCLA 2EPNA 1ENUA 3NUKA 1YDVA 3A6OA 1V08A 4AIUA 2DZTA 2GK1A 2PWEA 4ACZA 4JTJA 3LD5A 1AVAA 4S3AA 3LQLA 5FJIA 3V3WA 3EMCA 4LYQA 2BP1A 3USBA 4C6PA 1KXVA 2XN1A 3WK3A 2J7DA 1JF6A 1QASA 1JPHA 4XBSA 1WOBA 3M5XA 1C9WA 3C2RA 2BY1A 1WKDA 3DC8A 3MWAA 2BGQA 5CGQA 4J1OA 4EKJA 2PDKA 3WL1A 1WCGA 3CEPA 2VP8A 1ZZMA 1Q6QA 5AYZA 4PUKA 3W3OA 3G1XA 3PR2A 3VD7A 1KV5A 1Y7VA 4JNYA 1UH3A 2XFRA 4H19A 1EKOA 4AY1A 3M0IA 1MXGA 2NVAA 4PGLA 4Y90A 5D2TA 1VYRA 1VFSA 4PUUA 5HK4A 4L80A 2F84A 5D2VA 1GTEA 4DWSD 3DC0A 1BEUA 4O12A 3R58A 1QPRA 3TN6A 1NP2A 1SQ7A 2QKFA 1CXIA 1U1HA 1GVSA 3K8LA 2OQYA 5LHEA 3N11A 4QG8A 4PB5A 2DZXA 1KQYA 1J0YA 1TZ9A 2PCEA 3V18A 5DO8A 3SM0A 1WDPA 3EX1A 4WOQA 1S5MA 1JXJA 3NR0A 5T9CE 4OWGA 5CPMA 5I3KA 4DELA 3OVGA 4H4IA 4NZ3A 1A47A 3SGUA 4B2DA 3CQJA 4UZUA 4C6JA 1YDYA 5C8BB 1LWJA 3VDGA 5D30A 5G1TA 1AW2A 4G8TA 2QJIA 4C6OA 3GX9A 4TX6A 4FAMA 1TV2A 2C13A 3EWBX 1A0DA 1TTQA 4Q8TA 3QPYA 3VMNA 2XGBA 1PSCA 3O8AA 4J5NA 4JL2A 1I2RA 3NTYA 2V5JA 3VIKA 1RBOB 5E9AA 4L4PA 4HVXA 1B3ZA 4UIOA 2IQ0A 3HV8A 4NYUA 3G2GA 1J6OA 4Q8OA 3B03A 1EO7A 1CWYA 1UBPC 3CPGA 1GJUA 3DKJA 1JCTA 1BWVA 2ZX8A 2FPYA 2POTA 2X7WA 3BH4A 5K4XA 4XTDA 5JH2A 1WDSA 2D20A 2FJUB 1F7BA 1BF6A 1K9TA 1GOXA 5C71A 2XG9A 7REQB 1PKNA 3TX9A 4M1RA 4HNVA 3AAMA 1CGVA 4AWUA 1X98A 2R1NA 1JUEA 4IP7A 4QSHA 5LIUX 1V3HA 1TTIA 3OO2A 1XGDA 1LDCA 2A85A 2PTDA 3SECA 3SB0A 4HHPA 3DKLA 2NXGA 3MSYA 1LG1A 1O95A 2Q8XA 3M0MA 3TTSA 4Z2GA 3M43A 2WZHA 3P5ZA 3IJ9A 1NWSA 1OD0A 1TPC1 4XAGA 1E6RA 4FP1A 3E6EA 3UXLA 3I3DA 4O1AA 3LOTA 1O94A 2X2GA 3N29A 1OFOA 2FTWA 4XG1A 5HANA 2FLIA 3ZJKA 2CLHA 2Y0FA 3TWBA 2R94A 3IJ8A 2OCZA 1SZRA 1UZDA 5F7UA 1QMLA 2TPSA 2QMJA 3B9EA 1VF8A 5A6AA 4JDBA 3TLQA 1PDZA 2HNHA 1EHAA 2V0TA 4HK6A 4MKNA 3GVRA 4FNUA 3FEQA 4K6AA 1W6TA 3UG4A 2E1WA 3CH9A 4UR7A 2PLJA 3BG9A 3B0XA 3VD4A 4CN6A 1ZENA 3GS6A 4JYFA 3ITLA 1J6PA 1IEQA 5DELA 1SJDA 2FTYA 4ZQOA 1S5WA 3HBLA 2EAWA 4GQBA 1VLWA 4M5PA 2CIPA 1W31A 4GFSA 4WSJA 3N9KA 3H26A 3E1F1 1PCWA 3UJRA 4LUIA 3SADA 4YHGA 4JCMA 4ZL1A 4ZQPA 1OYCA 1TV4A 3TR2A 4UTTC 4R85A 1GKPA 4PULA 3PTDA 4G7FA 1FHLA 4XAFA 1DJZA 4OECA 2ACUA 2QZRA 4FLQA 2P76A 4QIUA 3WK0A 2NSXA 4GFIA 3W73A 3WJWA 1OQFA 3PNUA 2WB5A 3GHSA 2GGJA 1FWRA 2E1DA 4ZXOA 1A4LA 1DXEA 2X2YA 2PDPA 4IISA 3W88A 1PCKA 1UP3A 1US3A 3BOXA 2Z26A 4S39A 3VD9A 2GQ8A 2ZVIA 4MJ4A 1ZFJA 5LA2A 1WOAA 3WLJA 3EX4A 5EU9A 1OFBA 4H8VA 4GH1A 3HV9A 3NZ1A 4A22A 1E1CB 4X9YA 2QV4A 3RM4A 1QNSA 3EEZA 1EQPA 2Y5EA 4O8RA 2C15A 2DQXA 3CIXA 1YNQA 1SO4A 3RLHA 3BSMA 4OKDA 3THCA 4M81A 1A53A 3WBXA 3FKKA 4LAOA 1RCQA 1VFMA 5JUVA 4N4QA 3GYEA 2RAGA 4HSOA 7CGTA 4BQ3A 1JPDX 2Q01A 1VH7A 3W9ZA 3TYZA 4UMBA 1ML1A 1W32A 2GQ9A 2WVTA 1JI1A 5BXTA 3I7QA 3MO4A 3IK4A 3RMEA 3IUIA 4D6IA 5FESA 1E43A 3A5VA 3MQTA 1DTNA 4GCXA 1GOWA 1TWWA 3PAOA 2Y8KA 4HK7A 4WDXA 1FFRA 1I2OA 2F6UA 1XGZA 4N02A 1DKWA 1R3RA 3A47A 3CT7A 1EJ7L 2YCLA 2A3HA 1Q6EA 1UIPA 2E5BA 1WZLA 2XSBA 5TD4A 5HJXA 3WNLA 4UZSA 3MMTA 4GBUA 4ADSA 4DBEA 4K2SA 3WDRA 2BZNA 4LQ1A 3MWCA 3E0IA 3LHUA 3B97A 4HKPA 2YR1A 5JMUA 3GNXA 4Q4QA 2Z1BA 1GORA 4KWSA 1BKHA 3SUSA 1TUFA 2VX6A 4RNJA 5AN7A 2ON3A 1FP8A 1HO1A 7ENLA 2BVTA 3ID7A 4JBRA 1OK4A 3C2YA 4HCHA 2V3DA 2J7CA 3LBOA 3N19B 5TIMA 3GDMA 3NPUA 3ERPA 5SWUA 2Y7EA 5HWMA 2W0UA 2BY3A 2HROA 1XKJA 3G1HA 1CGXA 2QJGA 2QPXA 2YBVA 4FB7A 3W1TA 3WX7A 4AY7A 2J75A 4ZA0A 5HNRA 1FWTA 2IQTA 1P0EA 2J47A 1JULA 4IJCA 4HA4A 3TN5A 3TJLA 2SFPA 3K5XA 1R2SA 2I9UA 3NVTA 1IEWA 3CH0A 5LIXX 4EAYA 2Y4SA 7REQA 4REQB 4AYGA 4L61A 3W29A 2YDRA 2V5LA 3H2EA 4TU1A 3HGSA 4ZQNA 2PBOA 1IF2A 4ZVJA 4LSBA 1W3HA 3ARXA 1UJPA 3DXIA 1VYSX 4DPQA 3S5OA 1VRXA 2D69A 3FYYA 4LF1A 3S1VA 3TCEA 7TAAA 4XO7A 3AWNA 1A5LC 1VCVA 4H83A 4XKMA 2CLFA 4NL1A 3B4YA 4MHBA 4S3GA 3UJEA 3F2BA 3S46A 1PTAA 3LTPA 2Z1XA 4DUXA 2V5CA 4WDWA 3E12A 3SQSA 2FHCA 1F3EA 2ZX5A 2AL1A 4EPDC 2BOEX 4ROQA 5D03A 4GVGA 3NPWA 1OIFA 1XYBA 3JVAA 3W71A 4DBWA 3UGRA 3EDKA 1K9DA 2Z2BA 4YTTA 1H62A 1R46A 3W22A 1O4UA 4P7NA 5C2XA 2PWHA 4LS0A 3A9BA 2BXYA 3K1GA 3BQ6A 3KOZA 5A2BA 1DIOA 1ELSA 2EQDA 4TX8A 1KFWA 2V3EA 4E8GA 3AIEA 3M0JA 3OZOA 4V27A 2IUZA 1OVDA 4KEZA 3NEHA 4MKSA 3AHYA 1KLYA 4PBFA 4KESA 3W1MA 7A3HA 5I3FA 4LUJA 3OBAA 2BNJA 2Z2AA 1V02A 4HZ6A 2OWWA 4V33A 5CZ0A 2E0PA 3MVTA 3B8VA 5AY7A 2ISDA 2WMIB 4A3UA 4AXNA 2WQPA 5FD0A 3W24A 3A4WA 1XBXA 4LC6A 1K4HA 1Z41A 2ONEA 2J4GA 5XIMA 4W87A 4BS0A 5CPQA 4J3UA 4Y9AA 3RYSA 1L0PA 8CGTA 5FIPA 1EPVA 1UWAA 4CNTA 1TWSA 4DO7A 1HP5A 3M0ZA 1GZJA 3GIYA 3VKKA 3EDEA 4JICA 4F79A 4C6NA 5DT5A 3P8IA 4Q8NA 1VBHA 3VGDA 4WLCA 2OODA 4XZMX 3RX4A 1KR1A 2GDVA 1NDWA 2EPLX 3ZLHA 3SSJA 2AL2B 1LJYA 4P7QA 4S3FA 2XM1A 1I2QA 2FFCA 3WSUA 3B4UA 1V6WA 2A3LA 2QAPA 4OHQA 1G1YA 4Z0JA 3BZJA 4ZB5A 1E1FA 4IMCA 3VDCA 3T7VA 1KV8A 4LVGA 1E1CA 2PI6A 1Z69A 4M24A 1MQQA 4WGXA 1KGWA 4HA1A 1XP3A 4XZIA 3OLGA 3S1XA 3AJXA 5A6SA 4IJBA 3NAVA 1GGOA 1B1YA 1AODA 2B7OA 4QCFA 3TAOA 3WQPA 2VCBA 4PFHA 5LXEA 3KVLA 2ZE3A 3AHZA 1TIMA 1DJHA 1WDQA 4JN8A 3VAVA 3PUEA 1CXEA 5FEXA 4ASTA 5C2GA 2FMOA 1W3IA 2OTDA 4GY1A 3M64A 3AISA 2J13A 3WLQA 3IJ6A 3C3UA 3PFRA 4DQWA 5FF0A 1KW1A 2YKKA 2BASA 3P2VA 3E5PA 4F0MA 2NVDA 4MB1A 2GDQA 2Q8ZA 1KTNA 3F5LA 4KS0A 3CAWA 2C14A 3NYDA 5CEWA 4UOJA 5AYYA 2WMFA 2V5KA 2NQ5A 3N6QA 1UA3A 2PDXA 1YXYA 5CPSA 5D33A 1XLGA 4H8HA 1GW1A 5CPLA 3W7QA 3JZUA 1WAWA 1PKMA 3IGSA 4G56A 4MWAE 1L2UA 1VR6A 4B16A 1RSCA 3POCA 1WKEA 3B8DA 4TO8A 3UCQA 4ZE5A 2F6XA 2ISVA 2VEIA 3S2LA 2X41A 4OT7A 3A9IA 2WJZA 2PB1A 1UPMB 4I7WA 1SZGA 4ZTXA 3GNPA 5JIPA 4JTDA 4DF2A 3E02A 4DWDA 2DZBA 2GWGA 3R0DA 4O0KA 3N25A 1BRLB 3NO5A 3SW6A 4JEJA 3VKCA 1Q3NA 1BYDA 2W63A 4UTLA 2W66A 1TSIA 4ACYA 1W5NA 2Z4GA 3N2MA 4NY2A 1HVXA 3VNIA 4CQ8A 4W7WA 3S1UA 1EOMA 1XPYA 3VIOA 4HTYA 3W7GA 1BAGA 1M5WA 4OUEA 3WYZA 2X1RA 4REQA 2YLAA 4XZWA 2GJNA 5I23A 1MUCA 1TX2A 3LRMA 4H6QA 1YLVA 1NWTA 1CGUA 4HSHA 1UIOA 1OT2A 4JIIX 1QDSA 1TG7A 4H8NA 2WHKA 1T96A 3W83A 1CYGA 4RE0A 2DT3A 2O4QA 3CL6A 1UWUA 3DCPA 3TDFA 1M7JA 4UCFA 3H21A 5A2AA 1UR3M 2DJLA 2PAJA 1WV2A 5D2XA 1PO9A 3GYCA 1FXQA 4GYFA 1A5SA 1TMQA 4F0KA 4L4MA 3W2KA 3EX2A 1N8FA 3CASA 1GZGA 4ZBCA 2ASHA 2F7FA 2VDHA 1F61A 3ZWSA 1W5PA 4O1DA 1F76A 1E9LA 1OFAA 3SRFA 2G3JA 6REQB 3WZ0E 4AMAA 4LALA 5D9PA 2GJRA 4AD2A 1D8CA 3OQEA 3RO6A 1ITCA 3AC0A 2Z7GA 1TWIA 3SCQA 3B9OA 1RLCL 3TSDA 2DZAA 4X61A 5ENLA 1P0KA 5A95A 4JKKA 3F4DA 3IAPA 3AYTA 3LGDA 1KM2A 3M9YA 4RE4A 1ME7A 3H6OA 4JTFA 1DJXA 2QGHA 2R91A 1JL8A 3WJZA 5FOOA 2C91A 3PPGA 2P1FA 1TVPA 1R7AA 4ERIA 2C1IA 4JN6A 1N8WA 1XC6A 3RLVA 3RG6A 3PSWA 3R94A 2WMIA 3BLEA 1TYGA 3VKBA 1KR0A 5DANA 3MYPA 1Z32X 4HSNA 1RCXB 2PDJA 3TV8A 3KL3A 4YMZA 1KM0A 4FX7A 1S39A 3CHCA 4Z1CA 3W25A 1MUWA 3ANUA 1K3UA 5AYIA 1GJPA 3MYOA 1UOKA 5E6YA 2WBGA 1UKOA 4FZIA 5DXXA 1E72M 2BV9A 5FJPA 3SUVA 2VD8A 4E3VA 2AL2A 5C6MA 3KE0A 1S38A 3QVQA 1V8EA 5KINA 1WNOA 1A5NC 4C6BA 3PWIA 4LW7A 4N4PA 5A6KA 1HX0A 3RN6A 3F4VA 1E6ZA 4E2VA 2JKAA 4Y9MA 2E7FA 1E71M 1BVWA 3FYPA 3WF0A 1Q6RA 3B04A 3WIJA 5H1WA 2HZGA 2OGJA 4LV9A 4P7RA 4Q8VA 4CQAA 1T41A 3FDGA 4A21A 1X8FA 2V81A 3Q4DA 2XVKA 3ITYA 5A6BA 4CKQA 3FA5A 2UY4A 1VYPX 1VFUA 4AX6A 1MQPA 2VC5A 1J01A 1FWJC 2ZXBA 3DH7A 4HB7A 3LLDA 1R3TA 4JPGA 4XTIA 1L6SA 3ZMRA 3DHPA 3SFKA 4W4QA 1S3TC 4IPPA 1SMDA 3RCNA 2QCCA 4UMCA 1QBAA 4OV4A 2BXVA 3B05A 3A24A 1JNEA 3O06A 2VCAA 2ZXDA 3EZ4A 2D1ZA 4K1WA 3KBNA 4EACA 4UOQA 2O4MA 3CV6A 3STEA 1GQNA 4WIWA 4UR9A 4RR4A 4Q8MA 4NZFA 3ARYA 4JGDA 1MEIA 3WDJA 3RU8X 3FIGA 2MANA 4H6KA 4EX4A 2VDGA 1ZJIA 1WB0A 2ZUMA 4K38A 2VC6A 1B3WA 1MW1A 2OLAA 4M82A 1XFCA 4Q7BA 5E0CA 3VTRA 3IJDA 4UFLA 3BOFA 2J9ZA 1WYIA 4NF7A 3F4CA 2DZVA 2Q71A 4TMCA 2H3BA 4UQ9A 1XH1A 1EIXA 4JQAA 4DO6A 1ZAJA 2CFFA 3GXPA 3V5FA 2DW6A 2A2IA 1X6UA 4CNSA 3L5MA 5F2GA 4PMJA 4UWMA 4QM1A 1H0IA 3C2FA 3W7OA 1B0IA 2VVNA 3WD0A 2DORA 4IIDA 4NZ1A 5GNXA 3CZLA 2YIHA 3ZR6A 1IQ8A 5MHBA 4B5VA 1K1DA 1GQLA 5H91A 3U9IA 3W53A 1EYWA 6XIMA 4FLOA 4HBKA 1T99A 1QBBA 1E0XA 9RUBA 2BTMA 1E9YB 3SCOA 1GVRA 4IZGA 2VGGA 4GMEA 1E51A 4L65A 1UG6A 3CGTA 6PTDA 1HKMA 1IZJA 3PPCA 4F0RA 3IANA 1O66A 3IJIA 2DUAA 4IT1A 4O4VA 4TVUA 2FDSA 4DJDD 3NQBA 2MUCA 4CD4A 1W9VA 1SFTA 2CWNA 2H9AA 4HZ7A 4WSKA 3LXAA 2WJEA 1QVBA 1K03A 1H41A 2VFHA 1ZL1A 4MLRA 4S3KA 2W67A 3P14A 3EPMA 4LY8A 2E68A 1VHNA 4ZGYA 5I02A 4CQBA 1JYVA 4C6DA 5D9MA 2Y1HA 1MMFA 4AEOA 3UERA 3W7IA 3GH5A 2RDTA 6REQA 3BLPX 1H2JA 3AICA 4Y7EA 4AD5A 4UTFA 1HJWA 3EXRA 5FSEC 1D8WA 3CZKA 3EA1A 2PLCA 3SCSA 3CV1A 2NT0A 1OC6A 1HJVA 4H41A 1SZEA 1YYAA 2I5GA 3CQIA 5A8GA 3UXDA 1QOPA 1P0NA 1TPVA 4DJFD 3V1PA 1GQIA 3WQ6A 3PG9A 3QC0A 2PDIA 2WMJA 3MA8A 1R8LA 4G6CA 3GXDA 4YJ5A 1IIGA 4OVXA 4K1GA 5A5WA 3W74A 3GC2A 3T42A 4FNSA 2XTKA 4QQUA 2OSWA 2WHMA 1SZFA 4AIBA 2V6AA 4LXFA 1OT1A 1RHCA 4AXKA 4GYKA 4OGZA 3QPEA 3UA4A 1SR0A 5BXPA 4D1IA 2XDFA 3MMDA 3KCOA 1KM1A 2TRSA 3MJYA 2CWXA 1D2KA 2OZ8A 1B3YA 2CHOA 5IRPA 3BC9A 5F4SA 3E0WA 2OLHA 1LRTA 5AC4A 5LNRA 4M8UA 3VKAA 4AD0A 1US0A 3VC6A 2J6VA 4D2JA 4UTUA 1R3YA 3T0TA 4FOJA 2V2DA 4UB9A 4O57A 4JTGA 3ES8A 4XWUA 2A4AA 4B9YA 4J2MA 3LRLA 5G5IA 4J3TA 4QNWA 2C0AA 5HATA 3R89A 4MY8A 3W2UA 3NM3A 3VIMA 3L7RA 4P8XA 3DHFA 2XH0A 1TCDA 4IMGA 3N13A 1OCBA 4FX8A 4RZBA 2H90A 5CG0A 4Z1YA 3P84A 4Q6XA 4LS2A 3G0SA 4P7OA 3TTQA 4F4RA 4I5UA 1BVNP 4IOTA 2HWGA 3TQVA 3R2GA 1OFEA 5DF0A 2Q09A 2Z0IA 3GFXA 5AC7A 1IXOA 2OEJA 1YNPA 5HMFA 4PCSA 4B91A 4YTRA 4ZOCA 2DZPA 3QXBA 1VPYA 3WG6A 2J74A 3GXMA 4A3QA 1NELA 3S0CA 4JQ4A 4JQ1A 4H2CA 3AROA 4XSLA 3UWUA 5C9WA 2DSZA 4FA3A 1HN1A 5ECUA 4XBJA 4RZ6A 3BJTA 3P6LA 4DF1A 1VS1A 4YWIA 4GUHA 3D5HA 3M1ZA 2QDEA 2PLMA 2ZOXA 1UR0A 1R85A 2F2HA 2FVKA 4CNNA 5JH1A 5FF7A 3N2OA 1I45A 3GVWA 3PZOA 5I00A 5BOOA 3IV3A 3LNPA 2ZUTA 4B4HA 2NV2A 3KVJA 5C9RA 2CW6A 3FA4A 3WFZA 2RGMA 2FQIA 4PMYA 1XRFA 1AFSA 4AHOA 3UQNA 1CECA 3QQ1A 5EY5A 1FTXA 1EJVC 2G3MA 1O5KA 1OF8A 1P7TB 2PZ0A 4JFTA 2D23A 4ZQMA 2GSJA 1DWGM 3W82A 4A29A 4AWEA 1NF0A 2YL5A 2I57A 5DCDA 3SFWA 4C1KA 3ZS4A 1Z9AA 3SY5A 1OFDA 5C5YA 3K8MA 4IH3A 1NU5A 2VUYA 4MB5A 1G0CA 3H12A 3GH4A 4WX2A 3LBCA 1GVEA 3HG3A 4IP4A 2GVJA 3UXKA 3M47A 4O10A 2EG6A 3KP1A 2W62A 2OWXA 1SUXA 2PC8A 2W27A 3QYSA 4MKVA 4F9DA 1AL7A 3GVGA 2R14A 3IUHA 4OBRA 3WNOA 2A6NA 2GJLA 3H54A 3K2GA 3MT1A 4O50A 4LBSA 3L2LA 2G96A 3UCCA 3M6YA 4DJED 3KZPA 2GZXA 3GXFA 2ZRUA 3TYEA 1FHVA 1VFFA 3FCPA 4N2YA 3STPA 3AIQA 3GKAA 4UOZA 3EX6A 3D6NA 3AMDA 3FXGA 3TCSA 3FJ4A 3HFYA 4PB4A 3NZRA 2Z1VA 2I56A 1DJGA 4Z1AA 2A0NA 4IIHA 1E0UA 3EBVA 2JBMA 1GQJA 4IL0A 4GKLA 2E5DA 3XISA 5GNYA 3AS2A 5CCZA 1T5AA 4KBXA 5E5CA 3T40A 5GVJA 2WCSA 1HVQA 1Q6LA 3MI6A 5AHFA 4MWAB 1H0GA 4HTBA 4W93A 2QCLA 4Z2KA 3WDHA 3HTWA 4IXHA 4AWSA 4DVOA 3WFAA 1ZP4A 3F5KA 4WXYA 4Z1BA 2GGEA 3WNKA 3CMFA 3R12A 1ADDA 2R1MA 4GIAA 1Q7QA 2ABBA 3BW2A 1N7KA 3T1GA 2D0GA 1FWIC 3SN1A 4LAZA 2O7SA 2WC3A 4QDMA 1H5YA 4UQCA 5IDIA 3AYRA 3LCWA 1FWSA 1IGWA 5HUOA 1EBGA 5D4YA 1WE5A 3GAYA 3BDKA 3BAWA 3LM3A 1R47A 2A7RA 1SJCA 2J66A 3STCA 5HMSA 4NZJA 1DE6A 3TYBA 4QAWA 3WLOA 4UNKA 3LXBA 1S1RA 3O0KA 4NNAA 2DDXA 1RZMA 2FYMA 1J2BA 3VNYA 3BCJA 3FHQA 3QC3A 1X6LA 4PTWA 4MFDA 3F2CA 4X2RA 4AD4A 5HR6A 3FEMA 4G1NA 1UMLA 4FXSA 5CSUA 1YBQB 1QR7A 1TVNA 3OLEA 1FX6A 3PJTA 1T7LA 4NI8A 3W1LA 4ICNA 4V15A 3HMCA 4O1EA 4Y96A 5D2WA 1V93A 1LQ2A 2WHJA 2XZ7A 4WZHA 1WO2A 3CL8A 1IXQA 1OF6A 1JDEA 1ZS2A 3N4AA 1UQYA 4OV9A 4PEKA 3ATZA 2ATMA 4HK5A 3UD6A 3RJYA 5CPNA 4XO6A 3WNPA 4R27A 4MADA 3IVTA 3TJ4A 1IE7C 1FWGC 4NAFB 4NVTA 2NW0A 8A3HA 4WY0B 3KW3A 4E0CA 3OLDA 5CAHA 4DUVA 4A8NA 3NYZA 3T0BA 2OPJA 2ALRA 4ZB2A 4BCEA 5KETA 5CZSA 4Z2IA 4PYSA 3DIPA 2QF8A 3O63A 3CAKA 3W0KA 3QZ6A 3BCDA 3U48A 4LUTB 1YW1A 1FDJA 3SBFA 3USZA 3MP4A 2YYTA 5D8ZA 1GPFA 2VR4A 1XX1A 2O9RA 1XKYA 3LHTA 4GJ1A 3C86A 3NCOA 1HW6A 4MDPA 1D3GA 4F9JA 4QAIA 2XSXA 2DIJA 2OFJA 2VURA 3WD4A 3KTCA 3N9RA 1PZ1A 2JIWA 4MJMA 3P80A 3CUZA 4GIEA 4HPNA 3II1A 5I3DA 4PSRA 3KL5A 4GZIA 1RALA 3W1UA 1YE4A 2QF7A 4AVNA 5G2IA 2CBUA 1AG1O 4GLEA 2E6YA 4JFSA 2DZUA 4IMFA 3APTA 4UTKA 3C5QA 3GTFA 1VCGA 3XINA 3VGHA 1Q2SA 3NZPA 1A5OC 1JFHA 2WANA 5I09A 2G0WA 4L5ZA 4F3HA 2OSXA 4KW2A 1A80A 1P7TA 3MHFA 1FHUA 4R7WA 1S3HA 3TQKA 3IIOA 4QROA 2VQUA 1GEHA 1QI4A 1W1PA 1MRQA 4CQ9A 3KEHA 4ATLA 4AUBA 4TVDA 2XWEA 1I4NA 3AI0A 4PTVA 1S1PA 2Y7FA 5GJNA 3TN3A 1E0WA 1HJUA 2ZUSA 5CC7A 4B92A 3UU0A 3LSBA 1DTUA 3RRAA 4TIMA 1K7XA 3K1DA 4FX6M 3KLLA 4FXJA 1TO3A 3NQFA 3VOJA 2VZVA 1NIUA 3N3TA 1C7TA 1VZWA 2VRKA 3I6EA 4QJ5B 2WZEA 4XZNX 4DF0A 3TA9A 3HPSA 4UFIA 4GJJA 3PJWA 2G8ZA 3ITOA 2BX7A 3W7MA 4MWAC 5BOEA 5IM51 1WDRA 1YDNA 2MNRA 4LC8A 5AFDA 5I07A 2GQ3A 3O3RA 3M0LA 3NZGA 3MB9A 1KTBA 1W54A 1G94A 1XFBA 1NWRA 4YNGA 4B9ZA 3CWOX 1SO3A 1M03A 4WRHA 3ZXWA 2DIKA 1R30A 4YL2A 4EE9A 4KF1A 4GACA 4RV8A 4XD4A 1B57A 2C19A 1JDDA 1NQ6A 2PTZA 4Q4MA 4NRRA 4U10A 4DBDA 4ATDA 4KQNA 2VQTA 3RGTA 4WJXA 1U33A 1ZJBA 2FZ9A 4B3KA 1GG0A 4WCJA 3W1RA 1V3MA 1WKYA 4MWAA 2HRWA 3TIMA 1NWUA 4XD5A 5BXSA 2AAMA 2PTWA 1TJRA 4I3GA 3WL0A 2Z7KA 3ITXA 3OP2A 4X63A 5AB3A 1X7FA 3VPLA 5D32A 3LENA 2WV8A 2XM2A 1JGIA 2GVEA 5EA9A 1GOMA 2QAFA 4FIQA 3H7UA 4CCZA 3B8IA 1KFKA 3BAXA 3CNYA 4MY9A 3KM8A 2Y5SA 4JD4A 5A8OA 3DGRA 2BVDA 2CHRA 1HGYA 3BMVA 5AVNA 1UC4A 1Q6DA 3VOIA 4EWJA 5CC6A 2EBNA 1J0HA 5M3WA 1DYSA 4UNIA 1ITXA 2ZUUA 3WUEA 4RKAA 5F2MA 3WMLA 3QFEA 3RR1A 4YLWA 3QGVA 1MEHA 1X1NA 3VNJA 2BB0A 1PAMA 2VL4A 3BGJA 3DYPA 1ME9A 3EOUA 2PWFA 3RAOA 1UD3A 2ZDSA 3W70A 4EXBA 3PFMA 1CLVA 1KXTA 1AK5A 4Q8WA 1W2VA 3GBDA 2NVCA 3AS1A 3SAZA 4MYXA 2CLIA 1E6SM 3D47A 1H63A 1YBQA 3NWRA 4Y8FA 4Z17A 2CETA 3OODA 4HT3A 4GNVA 5BWAA 4AZIA 4RDVA 2ZWYA 3TMLA 3LTSA 3SGZA 4UMAA 3PM6A 3H8AA 1V6VA 1K9EA 1TTPA 2EG8A 1OCJA 4N6FA 1E6QM 1ECEA 2E40A 2Z1WA 1XLIA 4AVOA 5CXPA 3G77A 4DRSA 2E9BA 1WUFA 2ZWZA 4FNPA 3CPUA 3BLLA 4AEFA 1NOUA 1WDWA 3GK0A 1VFHA 1KRBC 4A6GA 4CU6A 3B06A 4HJFA 1A3XA 1Y5WA 4MY1A 4WY0A 3WLPA 3L4XA 3AXMA 4LCRA 1XDJA 4IPLA 4AW7A 3UZWA 1SJAA 2Y85A 1BGAA 1JYXA 3E5BA 1LRQA 2X0HA 3FXYA 3KOXA 3MPGA 2C0HA 1XV8A 4V1YA 4QE5A 1DXFA 1JZ6A 4YVVA 1JI2A 1RR2A 1SSGA 3S9IA 4DYJA 4X2PA 3NDOA 2WLZA 3MDUA 1EP2A 4LUTA 3GB6A 1EDGA 1C90A 2R82A 1W3KA 2IW0A 3AYVA 4DWSB 3GDRA 4O0ZA 1XLBA 3N2BA 3K8KA 2PWDA 3CTLA 3U2ZA 5AZ0A 2VRJA 3S2CA 2QIWA 2O55A 1Q45A