2Y89A

Crystal structure of mycobacterium tuberculosis phosphoribosyl isomerase a (variant d11n)
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
244
structure length
240
Chain Sequence
MPLILLPAVNVVEGRAVRLVQGKAGSQTEYGSAVDAALGWQRDGAEWIHLVDLDAAFGRGSNHELLAEVVGKLDVQVELSGGIRDDESLAAALATGCARVNVGTAALENPQWCARVIGEHGDQVAVGLDVQIIDGEHRLRGRDGGDLWDVLERLDSEGCSRFVVTDITKDGTLGGPNLDLLAGVADRTDAPVIASGGVSSLDDLRAIATLTHRGVEGAIVGKALYARRFTLPQALAAVRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords PHOSPHORIBOSYL ISOMERASE A
publication title Bisubstrate Specificity in Histidine/Tryptophan Biosynthesis Isomerase from Mycobacterium Tuberculosis by Active Site Metamorphosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 72
structure length 240
sequence length 244
ec nomenclature ec 5.3.1.16: 1-(5-phosphoribosyl)-5-
pdb deposition date 2011-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00977 His_biosynth Histidine biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2y89A00
2V5BA 3LM7A 3GAKA 4GXMA 2Y7EA 3PAJA 3FKKA 4RV8A 4JYDA 2VC6A 1VH7A 1GEQA 3LX9A 4K8EA 2ATMA 1N55A 2JBMA 2ISSA 5G5IA 1HTIA 1VLIA 1SW3A 1W3TA 1FWSA 4UTWC 3CPRA 1WA3A 4DELA 1BWLA 2V2DA 1W5MA 3NYZA 2W6RA 1MEWA 1TPEA 3KVLA 2QCCA 1EEPA 4CCEA 3CEPA 3B03A 4LRSA 3TFXA 3N2MA 4NJJA 2B7OA 3LRMA 4ZQCA 4Z1BA 3G0UA 1RZMA 5HJLA 3NL5A 4ICNA 2WPBA 5BMXA 3KRUA 4ZQPA 4MLRA 2ZZ1A 3VE9A 3B04A 1W3IA 1JCLA 3C2OA 2E6AA 4LUIA 1QCWA 3HOJA 4UTTA 2NX9A 5K7JA 4WOQA 3LI1A 4JTUA 1GZGA 3GNDA 2CLHA 1NAL1 1H62A 2WJZA 1KTBA 5G1YA 3TAKA 4DO6A 1OK6A 4IMEA 2OX1A 5F4XA 2P1FA 1BEUA 4JX4A 4DQWA 3QSTA 4ALDA 2HS6A 4QM1A 1KA9F 3EX4A 2ZRUA 2A0NA 2B4GA 4O4WA 2H90A 2QCGA 1PS9A 2WNNA 3M1ZA 2DJLA 1ME7A 1PCWA 3QW4B 3DFSA 2C0AA 2C1HA 3CLMA 3LCWA 1WQ5A 4KWVA 1XI3A 1P4CA 3OIXA 4A3UA 2Z1BA 1B3OA 1GTHA 6ALDA 5BRBA 1RPXA 2VFHA 3MBDA 3P7YA 5AYZA 3M47A 4K7YA 2DZPA 3GNNA 3SR7A 3FFSA 4MIMA 4XKYA 2YDAA 3LCIA 5EBUA 1K7EA 2FIQA 5KINA 1I2OA 4GE8A 4XQ6A 5EPDA 3IEBA 4FIRA 3DH7A 2G96A 1KM6A 3M0ZA 3PBWA 2I9EA 1M6JA 2C19A 5D2XA 3LHUA 1XDMA 2F84A 3KVKA 4RKAA 3W1AA 1ALDA 4WY0B 1BTMA 2Y88A 2QCFA 3EX6A 3G0SA 1H50A 1XBXA 4JTFA 3TCEA 4IMCA 1VZWA 4NJKA 4Z0JA 4PFMA 1Q6QA 4WY0F 3M41A 1KM5A 4O1AA 1KFEA 1R2SA 2J9XA 2PRLA 4FXSA 1KLZA 5DELA 1KM1A 2HSAA 3QZEA 3S6DA 4QAIA 3W7RA 3P81A 4UTHA 2E68A 3LTPA 5EKYA 4BF9A 1L6SA 3N73A 1SFJA 1H7NA 4HT3A 1O5KA 3LOTA 1H7RA 2ZZ5A 3IGSA 3NPVA 3TC6A 3Q2DA 1TTQA 2A6LA 2G5WA 3A23A 1OX5A 4NQ1A 4LV4A 4JTJA 4TMBA 1GYNA 4E2DA 1PIIA 4MVAA 3C52A 1L9WA 3L66A 3INPA 3T40A 4MJMA 5FEWA 2QCMA 3TK7A 1OX6A 4NZJA 3L65A 3CB8A 3OG3A 5CPLA 3N2XA 3UWVA 1JULA 4N9CA 5BOOA 1QAPA 3UD6A 1YDNA 3G1FA 3CWOX 5K9XA 4BI6A 3JS3A 5CZJA 1WYIA 2H3DA 4EWND 2DZTA 5AC6A 2QCLA 5I3IA 1L6YA 3G1XA 4JTGA 2HTMA 4HNNA 4N9EA 3SFKA 1VYRA 3PF3A 2QUUA 2A4AA 1EPXA 3HPXA 3C8FA 4O14A 5C55A 4MZ1A 1XBZA 3R5EA 3P5YA 3KVJA 4LC8A 1SUXA 5KZMA 5D32A 4LV9A 4LOCA 2C18A 1FX6A 2QUVA 3NQVA 2EHHA 4K7VA 1PL9A 3TX9A 3AO0A 4MYXA 2QCHA 3NZ1A 3P84A 4JY8A 1UUMA 4IGHA 4R34A 4OBTA 4LNYA 3W7EA 1RR2A 4RK8A 3L9CA 1QR7A 1ZFJA 1I4NA 2A7PA 3TQVA 2V81A 3MP5A 1GG1A 3TDFA 3MWAA 4JDBA 1TPC1 5H91A 3S5OA 1KM2A 2TRSA 1EA0A 5F4SA 1OFBA 2A6NA 1H7OA 1FCQA 1FWWA 1ZNNA 1PCKA 1SO5A 1KTNA 2Z2UA 5L9FA 1Q3NA 2ZZ6A 1QDSA 1NVMA 2I14A 4RR4A 4IPIA 3P61A 5AHIA 3PB0A 3WJZA 1A5CA 2FJKA 5KTLA 1EUAA 4Y90A 3TR2A 1Z42A 3C2RA 3FJLA 4TU1A 3ZS4A 5I3HA 5D2YA 3LHVA 1F6PA 3OEXA 3M5XA 4O13A 4N9BA 5I3KA 3FKRA 5G4WA 1SO6A 5AHFA 3EKZA 2Y7FA 2DP3A 1VJIA 4UMBA 3LCFA 1WV2A 4UTLA 3NL6A 2C13A 2BWGA 5HR6A 2PRMA 3NQ2A 5FESA 2YCEA 3TSBA 5FF0A 3SIZA 4ONVA 2A21A 2NUXA 5MHBA 3GDMA 1F5ZA 2VEPA 2PURA 3TC7A 2ATSA 1FDYA 4LS0A 1U5JA 3STEA 2VXNA 4O1DA 3W7PA 3S42A 4ZL1A 5D02A 3G18A 4AXKA 3W3OA 4LRTA 1NSJA 1DQWA 4JX6A 1WBHA 2NXGA 4X2RA 5CZ0A 1D3GA 1LZOA 2E1DA 1H1YA 4DF2A 4E38A 5CKSA 4WXYA 4FX8A 5CG7A 3TA6A 4GWEA 4M19A 3HG4A 4WUIA 3GR8A 3G1VA 3L68A 3B0VC 4O11A 3TJLA 1PE1A 2Z0IA 3LCXA 4D2JA 3H55A 3G3DA 4HSOA 1UASA 4GUHA 3ABRA 2V8ZA 1FXQA 2QF7A 4RX0A 1EWEA 1GG0A 3LBCA 1O95A 2W79A 3KXQA 3CHVA 4CLMA 1K03A 3UZ5A 1W8SA 1AW5A 3W74A 5AHEA 1EP3A 3G1YA 3BG3A 4CQ9A 2JKEA 1JCYA 4LS1A 2Y61A 3IIVA 3LCLA 2NUWA 1DJQA 2ZZ2A 1LOSA 1EP1A 1DL3A 3EKLA 1N8FA 3O6YX 4BI7A 1JCJA 4M7SA 5FI8A 3M9YA 4EVZA 4GBUA 4ML9A 2FDSA 3QW3A 4E0CA 2V82A 2YW4A 2ZRZA 5HR7A 4O1CA 3A22A 1MSSA 2AAMA 4UFIA 3MHGA 4B5NA 3O05A 4S2CA 3KHJA 3W7LA 3NM1A 1R30A 3IRDA 2G95A 1ZCOA 3ELFA 1DJNA 4TX9A 5K4ZA 1MEIA 3MUXA 5D03A 2VFGA 3LXCA 4RLIA 4UTUA 3HG3A 4LVAA 2B7NA 1LTDA 2ZTJA 2CZFA 3HPZA 5D38A 4A2RA 3G3MA 3OVQA 4MKNA 3M44A 4FX7A 2XN0A 5CPNA 4RXGA 4K36A 3M16A 3EWYA 1WOBA 2B7QA 4FB7A 2NWSA 4C1KA 2GPTA 4O4VA 5AN7A 3NQFA 5BNKA 4IMFA 1OYBA 4RJEA 5AC8A 4AB4A 1EP2A 3ZWSA 3L5LA 1QOPA 1XUZA 1DQXA 5HULA 2X1TA 3NNTA 3IGXA 4TMCA 4K6AA 1VR6A 3KX6A 3E9AA 2WKJA 3W1LA 4JTTA 4O0KA 1SO4A 1G6CA 1W5QA 3BW2A 5LHEA 3PUDA 3BLIA 2VEKA 3NQGA 1SZNA 2QKFA 4NXSA 3MP4A 1JUKA 3F1QA 3RLVA 3G8EA 1NFBA 4O12A 1SO3A 2WNQA 3FA5A 4NJGA 3C6CA 1LOLA 2V30A 1XCFA 2F7FA 5HINA 3SY5A 3MBFA 2YPIA 5F2IA 3BVJA 4O10A 2ABBA 1GVRA 2ZRVA 3G1DA 2I1OA 1WOAA 3LXBA 4ORMA 4ZQNA 1ZALA 3BG9A 5K9CA 4IXXA 1X1OA 3DKJA 3W9ZA 2C6QA 2B0MA 1XUUA 2GJLA 3QMTA 1W5OA 1TCDA 2Y70A 3GKAA 1W37A 4PH6A 4UFMA 5J5RA 3I6RA 2BXVA 2RDUA 4M6PA 3S1UA 1M7OA 1RQBA 1VYPX 5DCEA 2ZTKA 3SGUA 4YL2A 4UR7A 3HO8A 2A5HA 4HHPA 4JIQA 2VFEA 1H60A 1PVNA 3HB9A 3P67A 1LM1A 3NGJA 4FX6M 1AW1A 4YXGA 1FY6A 1TV8A 3QRHA 3C56A 4PC8A 1KV8A 5H2ZA 1FWTA 1YADA 3A5VA 4H6KA 4KKXA 2JKPA 4GNJA 1XDLA 2CLLA 1D3HA 3Q94A 2X2GA 1LYXA 3CWNA 4YWIA 1MXSA 5K4XA 4MUZA 1OK4A 1OFDA 4NJIA 3OBKA 5CZSA 2C14A 3QEZA 1OFPA 4HNUA 4IJBA 2VOMA 3BARA 3LCHA 3QMSA 5EA9A 2Q8LA 4AWTA 2FPTA 3LB0A 3T78A 1WX0A 3LLFA 2G97A 3W2MA 4JN6A 3RNDA 3OA3A 2CFFA 4BWLC 1YDVA 3PWAA 4EOUA 1IIHA 1TSIA 1TJPA 3QSRA 4WOZA 1P0NA 4JYFA 3NQ8A 4GJ1A 3QM3A 2ZA2A 4O8RA 2WNZA 4FHAA 3W1TA 3W7JA 1TTIA 3A5FA 3R8RA 5K2ZA 4JNMA 4UMCA 4QISA 5KZEA 3DHDA 3PB2A 2DZVA 3L2IA 4DXVA 2ZZ4A 2QCNA 2ZBTA 4LTSA 3I68A 4OGZA 3B05A 1T96A 4RZ6A 3E02A 5D2VA 2E6FA 1ME8A 4CCCA 4Z1CA 5U4NA 5FEPA 2NLIA 2TSYA 1B57A 2B7PA 4MZ8A 1ZAJA 4O28A 2A2IA 1IXPA 1Z48A 4IX2A 3ZR4A 3LRLA 3LHYA 2CLOA 1EUNA 3EWBX 1KM3A 4N6FA 1R2TA 1QPOA 3HQ1A 3GDRA 5C54A 3TAOA 3S9YA 1TMHA 5I3FA 2AQWA 3EEGA 2H6RA 4XUGA 3GLCA 4LVBA 5G4EA 1G7VA 1XKYA 5U7SA 3M6YA 5HUOA 6TIMA 4WY0A 1FCUA 3I7SA 1OF8A 1F2JA 1S5VA 3G1HA 4Z08A 2EF9A 3ABOA 3L0NA 2QAPA 2EAWA 3B0UX 1G4EA 1OG0A 2V2HA 2QJIA 2ABAA 4UTWA 2YZRA 1N7KA 4PODA 1UBSA 2FPYA 4I9AA 4QITA 3P74A 4CNNA 1W31A 3DENA 4GFSA 4C1LA 2Q3OA 3W22A 3SZ8A 1B9BA 2CZEA 3M43A 1KV5A 4DPQA 3YPIA 3FEMA 4LVDA 1I8JA 1YPFA 2ZFAA 2H8ZA 4JTHA 1VCFA 3UY8A 1PV8A 4Q4KA 1S5TA 3QPYA 3HIJA 5F2LA 1QWGA 3G24A 1DOSA 4PCFA 3GB6A 1H61A 2PCQA 4IQLA 3UWQA 3N19B 1XBVA 1YTEA 3GXNA 4N02A 2DZSA 1XXXA 2J24A 2WSYA 4UXDA 4X9SA 3L0KA 5LNUA 3IVUA 2OZ0A 5D09A 3LHWA 4UFHA 4OU1A 3LTSA 3W7GA 3WK3A 2A7RA 1TYGA 3E96A 2EPHA 2FPVA 4NU7A 2QR6A 3UZJA 4ADUA 4HPJA 5A8GA 4NX5A 1KFCA 1O5XA 4XWUA 3IIXA 2ZRXA 4XTDA 3THQA 2X1RA 4JTEA 4UTJA 4JTKA 5LZLA 5BMWA 5LGXA 3TW7A 3HMJG 4JX5A 2QJHA 5AB3A 2FB3A 3VKJA 4JTLA 4BFAA 1MZHA 2V5LA 3PG8A 4YLWA 5LNWA 1YYAA 4POCA 2ZCGA 3HGSA 3W87A 1VPXA 4U4MA 4NXKA 1TRDA 1LRNA 5HNRA 1I2NA 4P2VA 3BV4A 1QMLA 3P8JA 1ME9A 2NUYA 1LRQA 1CX9A 1TQXA 5LNVA 1QO5A 2VFFA 4JDYA 2D73A 2AGKA 2NWRA 3R2GA 1SU5A 3BLFA 5D37A 1FWRA 3MO7A 3RFAA 1LDCA 4S1FA 5K3VA 3C2FA 1VQTA 3EWXA 1KTCA 3CIWA 3PY2A 1UJPA 1IGSA 4H4IA 1SW0A 3UYCA 5G2WA 4FEZA 1LLZA 1OYAA 4IUOA 5FF4A 4J9JA 1RV8A 1YDOA 4U28A 2ZYFA 3BK0A 3C2VA 2X1SA 2CLKA 1DVJA 3EWUA 1TQJA 3TH6A 4N4PA 3I7RA 2CLIA 4GUFA 3QH2A 4I7WA 2QAFA 3TQ0A 1ZENA 5K9DA 2Q3RA 5LNRA 1S5WA 5CSSA 2FQIA 3KRSA 1H7WA 4O52A 2J9ZA 2O7QA 4JYEA 2X16A 4Z0SA 3TMLA 1CI1A 2PC4A 3L67A 4M7TA 1JQVA 5LSMA 3DI0A 2CLMA 4O15A 2CLFA 3BPWA 1PHWA 1XFBA 3MYPA 1NF0A 3QF0A 4JXCA 1XM3A 1D9EA 4NNBA 1W5PA 3B06A 3QJAA 4K38A 3W2KA 2VEMA 2NXIA 3RK8A 2CWNA 3QFEA 2QCDB 3ABQA 2A85A 3IVTA 2BX7A 3W2LA 4Q33A 4JEQA 4R7JA 3F4WA 4MFDA 4AVFA 3DFTA 3DGRA 4ORIA 1T8XA 4LVGA 1F74A 5F4WA 3W73A 2Q8ZA 1Z41A 3W1XA 2ZA1A 2YFNA 1I2QA 5FF3A 5FF2A 2DORA 4IWWA 4JY9A 1HO1A 3GZ3A 4G1KA 3STCA 4DPPA 1LLWA 3NR0A 1TPH1 1JQXA 3TMQA 3TIMA 4CNOA 1RQEA 1VHNA 2WV8A 3Q37A 2VENA 3W6YA 3F03K 1SSDA 3EWZA 4HSNA 4NZFA 3BGJA 1ZJIA 1KM4A 4KFOA 1H1ZA 1H5YA 3QC3A 3WJXA 5DN1A 3NQCA 1HG3A 4LW7A 1HFBA 3DFQA 3W2UA 3NOEA 2YYUA 2E5BA 3H54A 2QDHA 1H63A 3ABSA 3Q58A 4IPJA 1ZAIA 4XBKA 3T7VA 1YTDA 4MY1A 3LGEA 1VHCA 5IBXC 2NZLA 1TPWA 5CPMA 3W1NA 3UWWA 4RZ4A 4LC6A 4PL2A 3K30A 2DU2A 3FOKA 3LDVA 4LUJA 3PSWA 2CZDA 2LLEA 3IIZA 3IIOA 3W75A 1HL2A 1Q45A 5TIMA 3TUUA 1F05A 3LERA 2ZZ7A 3M5YA 1QNVA 3NPUA 2Y85A 1BWKA 2RDWA 1X8FA 3CC1A 1VCGA 3LI0A 3FJ6A 4GC4A 1OFEA 4TO8A 1HO4A 4O16A 4JS3A 4UFKA 3EWWA 1A5BA 4GUIA 3BO9A 3TW6A 1KFLA 3O6DA 2GUUA 3MI3A 2C3ZA 4HN4A 1UUOA 1TB3A 4UTIA 5F1VA 1KBIA 3SJ3A 4N6EA 1TTJA 4XTIA 2WSRA 4FIQA 4O53A 5KZDA 4LVFA 2VFDA 1KFKA 3FLUA 3DFPA 4BK9A 4Z1DA 1THFD 3WFAA 5LGZA 1Q6RA 3TXVA 1LP6A 2WSQA 1WDWA 4OV4A 4WZHA 3SSJA 5J5DA 3W1QA 4QQ3A 4DEFA 3GIYA 3U2OA 4JICA 1ZY9A 2BLEA 4Q32A 3HBLA 1H51A 3O06A 1F76A 2XN2A 2EKCA 3W7IA 4QJ1A 5AFDA 5I3GA 4GUJA 3PUOA 4EIVA 4K39A 2GQAA 4M6QA 4N4QA 1TPFA 3NZRA 3UPBA 3I65A 1W0MA 3TXZA 1OX4B 3HJZA 3G22A 4IMGA 1FWNA 3GDTA 3WJWA 3UY7A 3SI9A 3OVRA 3ATYA 2VFIA 4BR1A 1ONRA 3F4NA 3W7OA 1RD5A 2FTPA 1OABA 4UTKA 3S8HA 3S0CA 1T99A 3O63A 2P10A 4O0ZA 4CNPA 1F7BA 2FFCA 2YW3A 2IQTA 4AF0A 4FF7A 4ZZ9A 2ZRYA 3PG9A 3U8GA 4XBSA 3NQ6A 1GJPA 1TIMA 4Y8FA 1AL8A 3FIGA 2V0TA 2R14A 2E5DA 3S1WA 3HGJA 1K8YA 5KMYA 2WO5A 3EXRA 2GQ9A 2NXHA 4UIOA 1SZGA 2A7NA 4MFEA 5E1QA 1DBTA 2R91A 3G1SA 3KRZA 3NL3A 3QPZA 4NUWA 2GOUA 2Y6ZA 4EF8A 1SQ7A 2H8XA 4ADTA 1LORA 4ZMGA 4UNKA 2E09A 2J88A 2VELA 3W1MA 4KFNA 1LOQA 1YXYA 1AW2A 3FS2A 3DHFA 5AYXA 1G4PA 2R94A 4ZVJA 1TV5A 3EXTA 3KOFA 1MEHA 1B4KA 1EX5A 4MOZA 1TTPA 3TNOA 3O16A 5F2GA 3T4CA 3LCGA 4AF0B 3TFCA 1SFLA 3G8RA 4FXRA 4R53A 2Y7GA 4FNSA 1OFAA 3MP3A 5AOUA 3UNDA 4OT7A 3QQ0A 4KFPA 3HPSA 1R46A 3TSMA 4UNLA 1ZAHA 1GQNA 1OFQA 1GOXA 3NQDA 1LROA 1Z44A 3GR7A 3C61A 3LHZA 3NQEA 3W7CA 4WD0A 3PBVA 5D04C 4OHQA 3LV5A 1KFJA 2RFGA 4UMAA 1SW7A 2ISVA 1JCMP 2HMCA 4I7VA 2TYSA 4NT0A 4DBDA 2V2CA 3QMRA 4WQ6A 3VE7A 4UTTC 1A5SA 4QNEA 1S3HA 5HUPA 3A9IA 2ZZ3A 3T55A 5DCBA 3DXIA 5CSRA 4CCDA 4LT9A 5F1UA 3SGZA 1TPB1 3HG5A 3WJYA 3RLUA 3A24A 3NPWA 4YCPA 3MJYA 4EF9A 4MZYA 3W1UA 3O6CA 4JTSA 2FB2A 2BTMA 1X7FA 1SSGA 2YSWA 1QO2A 3S1XA 1VGAA 3E0IA 4LS2A 3C4UA 5EMUA 2OJPA 1DV7A 3LXAA 1OJXA 5FEZA 3W1PA 3D0CA 4OWGA 3MMTA 2H3BA 4AH7A 3PSVA 5I3JA 3E12A 1Y0EA 2GJNA 3JR2A 4AAJA 1DKWA 4UFLA 4R33A 1K8XA 3MYOA 4A29A 2RHGA 3UQNA 4AMAA 3V75A 4UR8A 1VRDA 3THAA 4L4MA 1EB3A 3JRKA 4UCGA 4K37A 1IIGA 3PULA 4HPXA 4S2BA 4UFJA 3GYEA 2DJXA 4PA8A 5LNSA 4JGDA 2NX3A 3KVMA 4FNTA 3UWUA 3W23A 2FLIA 4BWLA 1RQHA 4IXHA 1FBAA 2TMDA 3C2EA 1KFBA 2C16A 5CPOA 2JKAA 2WOQA 4GRSA 1TO3A 3VNDA 3U6WA 1XL9A 3RU6A 2J27A 3G0XA 4ZQOA 4Y96A 4NNAA 4WXZA 2DZWA 2CU0A 3L5AA 1E51A 5DXYA 2QEZA 1W5NA 2NV2A 3W85A 3HGOA 2GVGA 1LBMA 3NM3A 1Q6LA 3NAVA 4I7UA 1T0OA 4H3DA 3NEVA 1B4EA 3MI2A 1WXJA 3GDLA 3EX1A 5AHNA 1FCVA 3NPXA 1YLVA 5AHLA 5IM51 2BSLA 1G67A 5D30A 1OHLA 3DZ1A 2YYTA 4Z1AA 2RH9A 4ZQMA 5TQLA 3W7NA 3N14A 2Y62A 1KW1A 4XZ9A 4DBEA 4DO5A 1XC4A 3TQKA 3GXTA 2CW6A 3LTYA 2XN1A 4WX2A 3EXSA 1JR1A 1KM0A 3M5VA 1TJRA 1TPDA 1GT8A 1JCXA 3E49A 5ABTA 4IMDA 5HWNA 4O54A 4FNUA 1K02A 3LRKA 3NQMA 1SPQA 3W2NA 5G1TA 8TIMA 3OVPA 3O07A 3LBMA 3OHIA 3PBUA 4JD4A 4X22A 4UUIA 5EYWA 3DFOA 2O7SA 5D33A 3WJSA 1A5AA 1TREA 1LCOA 4PL1A 1JRBA 4AWSA 4O18A 1VC4A 3L5MA 3DBPA 3TV8A 1JUEA 4W9TA 1LBFA 4K8HA 1FXPA 4M6VA 1AK5A 5BW6A 5DLCA 2E6YA 4MY8A 2E5CA 2Y7DA 4UC5A 4E2BA 2ISWA 1UB3A 2X1UA 1A53A 1QPNA 2P0OA 4XKYB 1J5TA 4FNRA 1FCBA 2YXGA 1FUYA 4AHPA 3MHFA 4MPQA 1W56A 3DKLA 3NL2A 1L2UA 1LRTA 2NV1A 4IOTA 2QCDA 4MY9A 2QUTA 3W84A 4OE7A 4AHOA 3TSDA 4O57A 4A21A 3TKFA 1ADOA 3PM6A 2ZA3A 5T26A 4A2SA 1AMKA 3A21A 2PRHA 4N9DA 3QYQA 3PS7A 5LKYA 5G2IA 1H7PA 1X6UA 1ZHAA 3SECA 3NA8A 1GPWA 1YPIA 1K8ZA 2ZRWA 1YXDA 1R2RA 2PE4A 4P61A 1VCVA 3NVTA 2J6XA 3DU0A 2YR1A 3O15A 2JGYA 3O1NA 1JJKA 1TPUA 3CEUA 1C8VA 1P5BA 4GUGA 1JVNA 2GQ8A 3L21A 1O4UA 1C29A 5FF7A 2NX1A 4LWWA 1I2RA 3P60A 3KFTA 5E0KA 3VI2A 1TRIA 3ANYA 3MHUA 1KBJA 2XFWA 3CQ0A 1OF6A 1I45A 3W83A 3ATZA 4MYAA 5HMSA 4TIMA 1R47A 1G69A 1P0KA 3NG3A 3BW4A 1BKSA 1FDJA 3STGA 4YCOA 1GVFA 1DORA 3P62A 1NEYA 2OCZA 3B8DA 1J2WA 4AHQA 3W7HA 3MI6A 3GDKA 1Q6OA 1OFRA 1A50A 3H53A 2OMAA 4KWWA 1W1ZA 5G2HA 1JUBA 3W76A 5CZTA 1KLYA 5DY3A 4MLJA 3WK1A 3BLEA 5KSWA 3W70A 1JRCA 1GVOA 2Y63A 2BZNA 1DHPA 3TU9A 3V1PA 2QJGA 1I2PA 4O17A 3EX2A 2CZ5A 4PTNA 5AHMA 3R12A 3O8AA 3I7QA 1K7FA 3TJXA 3TROA 4QIUA 3W88A 2R8WA 5L6UA 4IX0A 2YX0A 1W54A 3M5ZA 1WAUA 3CTLA 5D2WA 4YMZA 2Z6IA 4HNVA 5SWUA 2ALDA 1IF2A 3N34A 1PHQA 3CU2A 1ICSA 1VYSX 1G7UA 3NQ7A 5C2XA 4TR9A 5F2MA 5DXXA 1GVQA 3KAOA 3P8IA 4WJEA 1CW2A 1LBLA 4BI5A 1ICQA 1V5XA 3HGRA 1K3UA 1SZFA 4JIPA 3W7DA 1OX4A 3UWZA 3HF3A 1AG1O 3EB2A 3G1AA 3P80A 1JCNA 1J4EA 2YFOA 4QSHA 4RZ5A 4AEOA 1F6KA 1VS1A 1U83A 4Y9AA 3W72A 2OT0A 3PUEA 1W3NA 1XBYA 3UXAA 3DI1A 3LV6A 4N2YA 2VEIA 3W86A 2RDTA 5C5YA 2CLEA 3W1RA 1ICPA 1GWJA 5KITA 1AL7A 1GYLA 3DAQA 4FO4A 2GVLA 3FYPA 2ZQ0A 5IBXA 4O1BA 5DY2A 4X3ZA 5A5WA 3GVGA 2DZUA 3W7MA 2E77A 3P82A 3NDOA 4O19A 5AC7A 3UPWA 1QFEA 3STFA 1GTEA 1YTKA 5HWMA 1YXCA 3PC0A 5TBOA 4HIBA 3S5ZA 1C9DA 3BG5A 3VFLA 4HNTA 5HQEA 5DBUA 2KZHA 4NJHA 1NF7A 2JK2A 4AWUA 1WBJA 4PEKA 1M5WA 4RCXA 3IIPA 3UWYA 1OVDA 5D2TA 2W0UA 3IV3A 3N3MA 3ZWTA 2DZXA 4CQAA 4RXFA 4OV9A 4JR5A 1EWDA 4DF1A 1P1XA 3QQ1A 2RKXA 2ZDRA 1O94A 3GXPA 5CGQA 3R13A 3MW7A 3BW3A 3DFNA 5EL1A 3B4UA 2JGQA 2QDGA 1O60A 5FEXA 3N9RA 3W07A 1VLWA 3AJXA 1TPVA 3WK2A 1G4TA 2GVJA 3SW6A 1X1ZA 3GK0A 3NO5A 1QPRA 2A1YA 5AYYA 1TV7A 5D05A 2X30A 1UCWA 2UV8G 3TE9A 1SZEA 1RVGA 1F73A 1GVSA 2J9YA 3VCRA 3C0JA 3C3NA 4M5PA 3LLDA 1HUVA 5LHFA 2YGYA 1H7XA 3GAYA 2OT1A 1QPQA 3IVSA 3S5NA 1OYCA 3PR2A 3USBA 5HWJA 4DO4A 3UXDA 4DF0A 4A22A 4CQ8A 5GVJA 4UTMA 3N9SA 5DCDA 4QNWA 4L4LA 1K7XA 2V9DA 1M7PA 2VKZG 1FQ0A 4HKPA 4ADSA 1IXOA 3LHTA 1EIXA 3P5ZA 4JTIA 4NX0A 7TIMA 3FYOA 1MO0A 2QCEA 1SR9A 3W71A 3HG2A 3CM4A 3W7QA 3ZFHA 2Y89A 3EX3A 5C6MA 2TPSA 3W7KA 1G4SA 3CIXA 3PBYA 5EY5A 3L0GA 4FNPA 3W2JA 4FNQA 4O50A 1QOQA 3BGGA 2E6DA 4NNCA 1V7YA 4LU0A 1ML1A 4Y6GA 3RF9A 3RMJA 1OFOA 3GKFA 3M7WA 5DBTA 3GX9A 4ZQRA 5E93A 3IGUA 2Z6JA 3S5YA 4OQVA 2HS8A 4NVTA 2WQPA 3CT7A 2EGZA 1L6WA 3WK0A 4LY8A 1IXNA 2C15A 3R89A 3T44A 1IXQA 3NXFA 3PVFA 3B0PA 3NQAA 4MJZA 1FDZA 3S1VA
chains in the Genus database with same CATH superfamily
3VD5A 2Y7EA 1MW0A 2CC0A 4JYDA 4XKMA 2GVYA 3S2LA 4CEXC 1BQCA 1R9ZA 1WUEA 3E2SA 4H1ZA 1GEQA 2BG5A 3PZVA 3FA3A 2JBMA 3N04A 4LEQA 4L5ZA 4H41A 4D6HA 1J0YA 4DELA 1X38A 4GPNA 1W5MA 1S1PA 4W86A 1MEWA 3RJXA 2QMKA 4BQ2A 2NVCA 3B03A 3TFXA 3N2MA 4NJJA 3IJLA 3LRMA 1VEMA 1KRCC 4ZQCA 3SUSA 3KRUA 1DJXA 2GSHA 3IV8A 3VE9A 5H6HA 1ONEA 4WK9A 1WZMA 1JCLA 2QULA 3C2OA 3SAZA 3MS8A 5C9ZA 1BKHA 4TOQA 5CJMA 1B31A 3LI1A 1RPKA 2INZA 1E9YB 4JTUA 3GNDA 1XDJA 3WLIA 1NAL1 1KTBA 2AL2B 3WQCA 4FPSA 1Q6CA 3GUGA 3V18A 3B0YA 2ZUNA 2HS6A 4R88A 4QM1A 3EX4A 5DFAA 1JZ6A 2A0NA 2PWVA 1EYEA 2QCGA 1PS9A 2WNNA 2ZKMX 1HKVA 3M1ZA 1W1A1 4XVEA 2CEQA 2XISA 3CLMA 3LCWA 4QX4A 4H8UA 4KCTA 1C93A 1OADA 4A3UA 1H4PA 2Z1BA 4HZMA 1XYFA 3UCQA 2XVNA 2ZE3A 5AYZA 2BDQA 3VKAA 4F48A 4K7YA 3GNNA 4WGHA 4DYEA 3UG3A 3U3HA 3BJTA 1X8CA 1RY0A 4XKYA 3LCIA 1FH8A 3NURA 5EBUA 3WQGA 4FIRA 2J8TA 3OLGA 1QNSA 3DH7A 2G96A 1KM6A 3RCMA 2PWUA 4ZTYA 3PBWA 4FOJA 4US5A 1XYZA 5D2XA 4Z2JA 3LHUA 1GW9A 3KVKA 4US6A 3W1AA 4HU8A 1PWLA 2CIPA 4JTFA 4IMCA 2VUNA 1DJYA 5KEZA 2GUYA 1KM5A 1KFEA 3OA5A 1GYMA 5CAHA 2HSAA 3D3AA 4P7RA 3P81A 3OB8A 4UTHA 1Q4WA 3OQ8A 2PD5A 4W8AA 3WDHA 1SFJA 1H7NA 2FGBA 1PKMA 4HT3A 3QTPA 3DX5A 3TN6A 1H7RA 3IGSA 2OZ3A 1HNYA 2G5WA 3A23A 4GVHA 1OX5A 4E2OA 4LV4A 1PKYA 3C52A 3C86A 4OUEA 3ECQA 3ZZ1A 3L65A 3N2XA 4MNKA 4N9CA 3UZXA 5BOOA 3CWOX 1PDZA 1WYIA 5CZJA 4S3CA 1HKKA 3OJGA 5I3IA 2HTMA 3SQLA 3SFKA 3EB3A 1E71M 1SJBA 2CBUA 5A6TC 4C90A 5IRPA 1CXFA 3U2ZA 3ERPA 2P88A 4W7VA 4O14A 4MZ1A 1XBZA 2OO0A 1H09A 3U7BA 3O2LA 4LOCA 2D0HA 2C18A 1FX6A 3SCOA 4K7VA 4F2TA 1EJWC 1ZJAA 1CXEA 3BMVA 4ZSTA 5CZKA 3P84A 4IGHA 3NIYA 3JUGA 4LNYA 3W7EA 3P0XA 1EIBA 1RR2A 3L9CA 4J4KA 4M8UA 2QS8A 1QR7A 1ZFJA 4XO6A 4ZXLA 1KR0A 1TPC1 1MNZA 1KM2A 1P0DA 1EA0A 5CAKA 5C2CA 3DOPA 1SO5A 3VZZA 1UD6A 1EBGA 5M17A 2VQTA 1LL7A 4CEUC 3VGFA 1QDSA 4B90A 1FHVA 4RR4A 3RM4A 3DFHA 1UWQA 4DNHA 1EHNA 3P61A 3PB0A 1T8QA 1XSJA 4KESA 3FX4A 3C2RA 3ZS4A 1HXJA 5I3HA 3OGRA 4HVXA 1Q6GA 4O13A 5J04A 4N9BA 1CLXA 2YXXA 3CL8A 4GI4A 3VGBA 1SO6A 2V3DA 2DP3A 1WV2A 4PUMA 1GQJA 2C13A 1VBRA 3NQ2A 5I2UA 2YCEA 3TSBA 5FF0A 5G1MA 3L7RA 4ONVA 2A21A 4GJJA 1F5ZA 2PURA 3TC7A 3ZIZA 2J25A 3STEA 4O1DA 4P8XA 3VX0A 4AXKA 5LIYX 1B2YA 3MO4A 4JTAA 3QPEA 1X96A 3ARTA 1WBHA 2NXGA 1JF5A 2W3ZA 5CGTA 3UXKA 1LZOA 2E1DA 2ZXDA 1H1YA 5CKSA 4FX8A 3CS2A 4JBRA 3M0JA 4JKMA 1UD8A 1HKMA 3G1VA 2REQA 4IFKB 4AZCB 2BGNE 2EEXA 3TJLA 3U2EA 1EWEA 3CJPA 1MQPA 2QV5A 4Y9NA 5BXRA 3ANVA 1OCJA 1EP3A 4PCSA 2ZZ2A 1LOSA 4IISA 1EP1A 4MNJA 3QVQA 1S2WA 3SQMA 4EPBC 1JCJA 5LIXX 3M9YA 4GBUA 4ML9A 2GK1B 1S46A 2RGMA 3GR4A 1JYXA 3AXHA 2KAUC 2QF8A 3R8GA 2I17A 3VGEA 4HCDA 3NM1A 4DJFA 4FXFA 3WQFA 2WSPA 4PTVA 4TX9A 4LEFA 3A3HA 3HM7A 4EXBA 2ACSA 1CIUA 3WNNA 4AIOA 3G3MA 3OVQA 4MKNA 1JYNA 1V3KA 1EF3A 2Z27A 4RXGA 4K36A 3CV2A 4IG2A 3QY8A 3VNJA 2GPTA 5BNKA 4IMFA 3L4TA 5AC5A 1OYBA 2W66A 4RJEA 4XV0A 4AB4A 5C9XA 4WVXA 1D8CA 1JDDA 1EP2A 4UOQA 2VQUA 1XUZA 1DQXA 3WMCA 1J93A 1VFHA 2X1TA 1VR6A 3E6EA 3W1LA 1S5MA 4JTTA 1QNPA 1SO4A 3F2DA 1RCQA 3PUDA 2D2OA 4PTXA 1JUKA 3S2NA 4O12A 4BJHA 3MTWA 3W24A 1JPMA 3C6CA 1DJWA 3H2MA 1XCFA 3KZPA 2E9BA 1GOKA 1NARA 2O9RA 1Q7MA 3VKDA 3O9NA 2BOFX 4RPQA 4O10A 2WVTA 3O3RA 5I00A 3UNTA 3G1DA 1TE6A 1TMQA 3H4XA 4B5TA 3LXBA 1ISWA 4ORMA 3N29A 3S2MA 1BFNA 4U3AA 3QR3A 3BG9A 3VUPA 3DKJA 3CL7A 4N0RA 2B0MA 4NKCA 2ZVIA 1H0GA 2J74A 1E4NA 5LIKX 1Q65A 2DT2A 3UR2A 4UFMA 3CZJA 3DC8A 5HBFA 5TF0A 1TJ2A 2YA1A 3AYSA 3ES8A 1RQBA 3SGUA 3ONBA 3DECA 4DBSA 3POCA 3P67A 3WQ6A 3LZ3A 1LM1A 2XFYA 1M03A 3AHXA 3MSRA 2RAGA 3GE7A 1YADA 4XSMA 4JIRA 3GW3A 4GNJA 3Q94A 3I3BA 1U1JA 1AVAA 5JVLA 4G7EB 4GINA 1OK4A 4NJIA 3SM0A 4GBDA 2GSJA 3QEZA 3RPDA 4IJBA 1L0PA 3XIMA 2XM1A 3WMSA 3GD6A 1VFMA 2FPTA 2ZUTA 3LLFA 3QV8A 2G97A 2PB1A 3WBXA 3OA3A 3PWAA 1IIHA 4TVUA 1F6YA 2Y1HA 5GQBA 4HSHA 2PMQA 3MV11 4X2PA 2ZA2A 4O8RA 3K46A 2WNZA 3A5FA 4ZCWA 4NSBA 3PB2A 1C91A 3V35A 3H4GA 4WDWA 2ZZ4A 2QCNA 2ZX8A 4LTSA 3F5LA 5BROA 3B05A 3GNXA 4TX6A 3ITGA 1K9FA 1PBGA 2D1ZA 1WKYA 3UGRA 5D2VA 4PEEA 4CCCA 5I79A 4Z1CA 3IRSA 3WUFA 4GO8A 2VEGA 1CGVA 4J28A 1PTDA 3OYXA 2CBIA 2A2IA 2XIJA 7REQB 3LRLA 2WVVB 3EWBX 1KM3A 1JDEA 1ZLPA 3URQA 4JQ4A 4U3CA 3TAOA 1IEVA 1YNPA 2H6RA 1JD9A 4LVBA 5JQ9A 4LYQA 4DJDD 4PB3A 4JIHA 2HE8A 4IQDA 3UCCA 1WZAA 3GNOA 1S5VA 2CWXA 1B1YA 4WCJA 1OG0A 2V2HA 5FAJA 4UTWA 1UBSA 2PSNA 4W85A 2ACRA 4A3RA 4CNNA 4L4PA 1W31A 4DM2A 1C7TA 4GFSA 3SIMA 3DBNA 1N82A 4QS5A 2CZEA 4PUEA 1EJVC 3VNIA 4J3SA 3YPIA 3FEMA 1I8JA 1YPFA 4J3XA 4B15A 2HK0A 3UY8A 3IWPA 4A8LA 1H5VA 4ASTA 1DOSA 3CASA 1VB9A 4H2CA 4YHEA 2PCQA 3WMBA 1OB0A 1XXXA 2V6AA 1QHZA 4U10A 1B3XA 2OZ0A 3TJIA 4PZVA 5D09A 3LHWA 4UFHA 3W7GA 1E0VA 1TYGA 4JQ1A 2FPVA 4NU7A 1U33A 3UZJA 2PTZA 5A8GA 3T81A 4XTDA 4KH2A 2X1RA 4XD5A 4ZODA 4Z2GA 3UJEA 1RLCL 5AB3A 4C1NA 2FB3A 1US3A 2V5LA 3XISA 2ASHA 1NQKA 1YYAA 3HGSA 1UZDA 5FA5A 2AGTA 2OSWA 1ME9A 4HMEA 1LRQA 1V79A 1CX9A 1TQXA 5LNVA 1NIUA 2ZOXA 4CD7A 3NFUA 4CU8A 4S3BA 3AMKA 3R2GA 3U4AA 4NI8A 1LDCA 1PDYA 4Q7BA 1VBUA 1JF6A 2D22A 3BLLA 3H2FA 3TN4A 4FEZA 1OYAA 1ISZA 4NAEA 3LA4A 1YDOA 4GXPA 2J7BA 4ZB5A 4CD6A 1G5AA 1DVJA 2P0IA 3TQ0A 5PTDA 3RM8A 1XLBA 3UYIA 3LM3A 5LNRA 1S5WA 5M03A 3KRSA 1VFSA 2J9ZA 2O7QA 2QQ6A 2X16A 3UERA 3TMLA 1UG6A 3FSUA 1CI1A 2XVKA 1XLCA 4HU3A 4RDZA 1CDGA 4NF7A 1JQVA 3W6LA 3RM9A 2CLMA 3BPWA 4XAYA 1XFBA 1UOZA 4YVXA 1D9EA 4PMYA 3SN0A 3WG6A 3GXDA 3P14A 3B06A 4PBEA 4MNMA 4C6FA 4D1IA 2XJ7A 5DEZA 2O4MA 1TJ0A 1P0EA 2OFJA 4Q33A 4JEQA 3P2VA 1QWKA 3IK2A 2F61A 4J3UA 3DFTA 3OYZA 3W73A 1KWGA 4U2ZA 1OBAA 1T6MA 5FF3A 5FF2A 2R24A 1HO1A 3GZ3A 4D6DA 4DPPA 3WLPA 1LL6A 4C6CA 4NZCA 2Z1XA 1V6UA 2DUZA 3K2GA 4ZB2A 4QLKA 1XICA 5EMLA 3KBJA 1ZJIA 1AJ0A 1KM4A 2G3IA 1H5YA 1GEHA 3WJXA 4Q4RA 4GY7A 4HJWA 2OYKA 5C9UA 3DFQA 3L4XA 3H8AA 3NOEA 2YYUA 1PJ9A 2E5BA 1E0WA 1XS2A 1AJZA 2QDHA 3CPGA 4B5SA 3ABSA 1EJUC 3KCLA 1YTDA 2CERA 4PMZA 3LGEA 2D0GA 1WDSA 2Z1VA 4PMXA 4GYPC 2VDGA 3VGDA 4LC6A 3VZXA 4PL2A 1U1HA 1HJWA 3K30A 2CZDA 2E7FA 1KO0A 1JDAA 4YS1A 2LLEA 3GQYA 2AOSA 2FH8A 4LPCA 3TUUA 3TONA 1Z32X 3LERA 2ZZ7A 1HL8A 3ARPA 3M5YA 1QNVA 3URBA 1OC6A 1G01A 2X0SA 2PWGA 3LSCA 2WBGA 2YBTA 3CC1A 1VCGA 1Y7VA 3U0HA 4ATLA 3A3WA 1TWIA 3GDBA 4QBXA 4JKLA 3EWWA 2PTXA 1A5BA 3QR0A 1GUVA 1WKDA 4S39A 3O6DA 4V33A 1XR2A 3MI3A 4H2HA 1UUOA 3AMCA 1TB3A 1LG2A 1Q2RA 4FIQA 4O53A 1W1YA 3DFPA 4XSLA 1Q6RA 1LP6A 3PTDA 2WSQA 4J1OA 3KL5A 4DEFA 3GIYA 2PDCA 3C3UA 7A3HA 5JBEA 1ZY9A 4Q32A 2X42A 3HBLA 3O06A 1X98A 1W8GA 1F76A 2EKCA 4U31A 1R7OA 5AFDA 2YCKX 1F9CA 5D9MA 4K39A 4XZIA 2H9AB 3WLQA 3E0VA 1CEOA 3WLLA 3S9ZA 5FCZA 1E6RA 3TXZA 1W0MA 3I4EA 2Z29A 1K6WA 3HJZA 3VIJA 4AC7C 1K8CA 2OOGA 3SI9A 3OVRA 2DQXA 3KRBA 3WDQA 4BR1A 4AY7A 1NH6A 1E70M 1NP0A 1TX0A 3S8HA 1KRMA 1HJVA 4CNPA 2R82A 3RILA 2WAGA 3SEPA 1GJWA 5GJNA 3PG9A 3U8GA 2ISFA 2XVGA 3NQ6A 1BGAA 1L8NA 3OOQA 1TIMA 4Y8FA 3NUKA 5CSYA 3T0CA 2WO5A 2GQ9A 1EKOA 3OO2A 4UIOA 4N7QA 4IM4A 3VIMA 1XH0A 2PDBA 1H1NA 4UNKA 2E09A 4C60A 4EX4A 4M81A 2R1PA 1W9PA 3DHFA 3EXTA 1MEHA 5HMEA 5IHSA 1EX5A 4G6CA 3K13A 4MOZA 3L4WA 1Y5VA 2YKKA 3ZVHB 3WD3A 5A6MA 3G8RA 2EG7A 1GNXA 3L4YA 4DY1A 2Y24A 3CUXA 3ZT7A 3QQ0A 4AFYA 4G2DA 4C6MA 3TSMA 1GQNA 3WF2A 1NWRA 1PKNA 3LHZA 4AYGA 2PWFA 3IJ9A 4MADA 3PBVA 4WD0A 2QUMA 4I7VA 2TYSA 3AQUA 1F3XA 2BS9A 1BPLB 1DJHA 2X41A 1ZGDA 1A5SA 3NSMA 1S3HA 4K68A 3WEOA 3N4EA 4DUXA 2ZZ3A 1O7AA 4ZOAA 5DCBA 2FHFA 4LT9A 4MB4A 2XIBA 3RLUA 1MDRA 3PNUA 3MJYA 5CEWA 3W1UA 3WH7A 1M1BA 4GK8A 1QO2A 1D3CA 3HZ3A 3E0IA 1B3YA 3USZA 1QRQA 2VR5A 3AALA 3W1PA 2NQHA 1E40A 3A4XA 3D0CA 1GK8A 4OWGA 1OCNA 3R8HA 1BVZA 5J8LA 4HMCA 2V68A 1V0KA 4Q6XA 4UFLA 3LN3A 2XH4A 4KIRA 1FWDC 3MYOA 4IPLA 3IS4A 4AMAA 1UKQA 3SURA 4UR8A 5I5RA 3THAA 4B4HA 3C2YA 2E67A 1IIGA 4UFJA 4R3UA 1VD6A 2R6OA 4JGDA 2PI6A 3AOFA 2BFGA 3OLEA 1FBAA 1A5NC 1KFBA 2Z28A 3A3XA 4GRSA 4P7LA 3A4AA 4ZE4A 5C0QA 3HQOA 2ZUVA 4ZQOA 4NNAA 3TYUA 4WXZA 3V5CA 3L5AA 3WDIA 3TYZA 5DXYA 2QEZA 1XLDA 1E6NA 4LYPA 4NY2A 2GVGA 5FJPA 3NM3A 4FMVA 1FWBC 3NAVA 3NEVA 2WC4A 1BRLB 1P1MA 3OQEA 1MMFA 1NDWA 4AZ6A 3CK5A 2XHYA 2PDXA 1YLVA 4DN1A 1P6WA 5AHLA 3A9BA 7ODCA 1VENA 3DZ1A 2YYTA 3CO8A 4D6IA 3W7NA 4QROA 4DBEA 3VNKA 3GXTA 2OSXA 2XN1A 1XG4A 3WDPP 1TPDA 1ZB5A 3M64A 5IDZA 1GT8A 3GRIA 4IJCA 5ABTA 3R0DA 4CN6A 1OT2A 2HDJA 4IMDA 5HWNA 2BP1A 1K02A 3NQMA 5G1TA 4QE1A 1XLMA 8TIMA 1XLEA 1RBLA 3PBUA 4JD4A 3T1GA 3UF9A 3BANA 2NLYA 3H23A 4K8GA 5LXXA 1TREA 1GQLA 1MRQA 3EMCA 4PL1A 4F79A 5DF0A 1VC4A 1A5KC 3DBPA 2PDNA 3TV8A 1JUEA 4JZ5A 1WDPA 3GH4A 2EPNA 1AK5A 2E5CA 2VEFA 2ISWA 3G6MA 2ZE0A 4XKYB 2OWWA 3BAYA 5LXEA 2OVLA 3DKLA 3NL2A 2NV1A 1IEWA 5E0CA 2QUTA 3TSDA 4A21A 3NCOA 4M1RA 3PM6A 1UUQA 3ARWA 1AUSL 4DNMA 2FH6A 3QYQA 1I6NA 1H7PA 3SECA 3BICA 2VR2A 2OKTA 1YXDA 3OIHA 3NVTA 3R1ZA 4L80A 1I0BA 1KBBA 4GABA 1JJKA 4BQ3A 1C8VA 1HP5A 4ZFCA 2DW6A 7PTDA 2GQ8A 4W5UA 3AYTA 1C29A 1C3FA 2E28A 5FF7A 2FKPA 4ZGYA 1I2RA 1EBHA 1ODZA 1AH4A 4GGHA 1TRIA 1I9CB 2F2HA 5ENLA 1C8QA 2HXUA 1R47A 1UR3M 1G69A 1P0KA 3NG3A 3ARZA 3TYDA 3BW4A 4L65A 3HJEA 3GS6A 4B4FA 2X0HA 4E8DA 3P62A 1NEYA 1TCMA 4MWAA 1I60A 1JFXA 4QFUA 2NQ9A 2XYLA 1Q6OA 1A50A 1BF2A 4TV5A 1VAHA 4E4PA 2R9RA 4IMAA 5EBAA 4H9YA 4E3TA 3DCPA 1KLYA 3QHMA 4CVWA 2ON3A 4XD3A 2IXUA 4JN7A 4RZBA 1UR8A 2Y63A 1QBAA 3TU9A 1QHPA 4PTNA 2E25A 3EDFA 2PBGA 4HA3A 3E2QA 4QCEA 5AHMA 3R12A 4D8AA 3WQOA 3CHDA 3MUIA 1UKOA 1Z9AA 1UH3A 4QIUA 1JXKA 4XUYA 1B3ZA 5AZ1A 5D2WA 3M5ZA 1GVYA 2ALDA 4WHBA 4IH3A 3CU2A 2RUSA 1F4AA 1SR0A 5CBBA 4DJFC 3AWNA 4LALA 5F2MA 3TYEA 3KAOA 3MSYA 3P8IA 3VMOA 2GDQA 3AIEA 3PFRA 1K9DA 3VDBA 4JIPA 1OX4A 2WMHA 2B81A 4Z2HA 1VS1A 3OBAA 4Y9AA 2Q02A 3AIRA 3Q45A 1M41A 1FKWA 1UWAA 3LV6A 4N2YA 4YTSA 1DTUA 2BODX 4Q3MA 3RPTA 4MJ2A 5DQPA 3N4FA 2P76A 2GVLA 1R7AA 4Z17A 4Q4PA 3PZOA 4JTRA 4X3ZA 5A5WA 2R1KA 3GVGA 2DZUA 2XFRA 1JPIA 1UC4A 3W7MA 4DZHA 4HOWA 3NDYA 3NDOA 3ES7A 4EPDC 1QFEA 1GTEA 5I09A 3U48A 1E0XA 4DO7A 3DIPA 3PC0A 1XPYA 3BAJA 2WC3A 4H6RA 1C9DA 4LAMA 1DIKA 3PJTA 4QR6A 3ITYA 2BHYA 4QDWA 3WBYA 2KZHA 4NJHA 1NF7A 4LAUA 2REQB 1XIEA 3EEZA 1HIZA 2IQ0A 4PEKA 3UA3A 2AQVA 3IV3A 3N3MA 3WNKA 3TZNA 5JH1A 4JR5A 2BVWA 1I1XA 3KBSA 4DF1A 1P1XA 3BOXA 3SCVA 4XISA 5A69A 2FHCA 4HGXA 4CD5A 3DFNA 3OPSA 1O60A 1VLWA 3GTHA 9XIAA 1JIBA 1REQA 4DB7A 3GK0A 3QLDA 1JEZA 3NO5A 1XLAA 1QPRA 2J7EA 1UKTA 2WMFA 1MQQA 5D05A 1F61A 3V36A 2X30A 1UCWA 5CJ5A 5BWAA 2UV8G 3OW1A 2J9YA 3UBPC 4CQCA 4JTQA 1HUVA 3WX7A 2DUXA 1ECQA 5LHFA 2QYGA 2VVSA 1QPQA 3USBA 3SADA 2VZOA 4V27A 3DYMA 4IG2B 4DF0A 1V6WA 3OU8A 4I9TA 5DCDA 3F7JA 3C0SA 1FQ0A 2BGQA 4DBWA 7TIMA 1LJYA 2ODOA 3FYOA 3BAWA 2CXGA 1E55A 1BWVA 1SMDA 3HG2A 3AZSA 1OD8A 2NT1A 2RGLA 6ENLA 3DN5A 1EGVA 3CQIA 1FTXA 1IHIA 3W2JA 4FNQA 3BGGA 1HKJA 2E6DA 4NNCA 2O92A 4M6UA 1YMYA 4CCZA 4JTDA 1JCTA 5DBTA 5E93A 4NVTA 2WQPA 4LY8A 1SVDA 1IXNA 3N6JA 3VPLA 2NVAA 2V38A 3WYZA 3UJFA 3PVFA 1W2PA 5I07A 4H8HA 1PKLA 4MNLA 3UG8A 2V5BA 3OGSA 3QKZA 4GXMA 2JEQA 4D72A 3PAJA 4LUTB 3E1F1 1D7FA 2VC6A 1VH7A 4P7OA 4QQUA 1N55A 3H2OA 5I23A 3CPUA 4C6EA 3WDJA 3IJDA 4L56A 4WKAA 1WA3A 4UTWC 1ITUA 2EBNA 2GUBA 3RYSA 3CAWA 1CNVA 5CC3A 3WLTA 2QCCA 4ECLA 1JL8A 3CV7A 2OX4A 1TIWA 1BTCA 2CKRA 5XIAA 3QC0A 2VCCA 1IR2A 1UD4A 3NL5A 3BCFA 4ICNA 2WPBA 3QXBA 3LGGA 2ZZ1A 3A4WA 3DG7A 2C8NA 2I56A 2YL9A 1W3IA 4E3VA 5HQLA 3TNBA 4QE5A 1Z7AA 3R58A 3PZTA 2P53A 2O9PA 3TWBA 4C7GA 2WJZA 1XGEA 5G1YA 3T6CA 3PZ9A 4GISA 3CL6A 5F4XA 1CPUA 2P1FA 3ME3A 4DQWA 3QSTA 4ALDA 2IPJA 1KA9F 3N11A 1PEZA 2ZRUA 4JN8A 4HK5A 3BLPX 1PX8A 2DJLA 4HNCA 1ME7A 3QW4B 3UA4A 1ZQ5A 1MNSA 4WF7A 2Z2BA 3WQDA 1NOWA 1WQ5A 3ARUA 4KWVA 2V5JA 3GU1A 3OIXA 1O66A 3G5EA 2ACQA 1XRSA 3GXMA 4PRTA 1MZRA 5CQ1A 1JYWA 3TJ4A 1I0DA 4TV6A 4IIGA 4H01A 2DZPA 3RX4A 3SR7A 2OEKA 3FFSA 2YDAA 1K7EA 4GE8A 4XQ6A 1QT1A 3IEBA 1XH1A 1WXZA 3M0ZA 1TWDA 1M6JA 1N2VA 2F84A 4RKAA 1BTMA 4UQAA 1H50A 3IJ6A 4WDXA 4Y9OA 5FD0A 4Z0JA 2NQZA 1R2SA 2PRLA 5E0FA 3PANA 3KP0A 2PF8A 1KM1A 3QZEA 4BEUA 3CZEA 3WQEA 1ISVA 2DY3A 3EDJA 3CMFA 1D2KA 2ZC1A 3PZQA 3L2LA 2HVNA 1XV8A 3GG0A 2Y5EA 2IS7A 3N73A 4MPKA 5A8NA 3QY6A 4HMDA 3I10A 4Q4OA 1XQLA 3TC6A 3Q2DA 1TTQA 2A6LA 1GONA 2BXYA 1GYNA 4DIAA 4GIRA 2HPIA 4MVAA 1A49A 2VZTA 1L9WA 3T40A 5FEWA 5XIMA 3CB8A 5XINA 3OG3A 1PTGA 5CPLA 3VILA 1QAPA 1YDNA 4QJ4B 2EJ1A 3JS3A 4F66A 3SFWA 4RE0A 1L6YA 4JTGA 4HNNA 5ECVA 2WZIA 4C1NB 2IPWA 1QBBA 3PF3A 2YLLA 2VGGA 4H8NA 3WDRA 3HPXA 3BLOA 1JD7A 5MF5A 3KVJA 4LC8A 1SUXA 4LV9A 4L9ZA 3NQVA 5JUVA 2EHHA 3AO0A 4MYXA 3CLWA 5M3WA 4GFIA 1M53A 2ZUSA 4JY8A 1UUMA 3PJWA 4R34A 4OBTA 3PWIA 1UA7A 4CQDA 3WL0A 2PF0A 1DWHM 1I4NA 2A7PA 2VX4A 5CC6A 2V81A 4IP5A 1GG1A 3TN3A 1QI3A 4JDBA 3ITOA 3W28A 3WENA 2TRSA 2AKZA 4RW5A 1FHLA 1OFBA 1Q6DA 4RDWA 1UWRA 1H7OA 1ZL1A 2F6UA 3M0MA 1ZNNA 3FJ4A 4NAEB 1KTNA 2Z2UA 3DYOA 4D1JA 2ZZ6A 4Y8EA 3EOUA 1NVMA 4WJ8A 4IPIA 1VIZA 4E6MA 5AHIA 1A5CA 2POZA 1EUAA 4Y90A 3HFTA 3TR2A 2XG9A 3CV1A 3FJLA 1R6WA 1FHUA 4LB4A 5D2YA 3QGAC 4O1EA 1HKWA 3OEXA 3PP7A 3ZLHA 1V8EA 1EQCA 3FKRA 2OWXA 4REQA 2WJFA 4AZCA 1ENUA 1K77A 1VJIA 4UTLA 2BWGA 1XRVA 2PRMA 1ZBWA 4XIAA 5FESA 3V3WA 2POTA 2XZ7A 3ARVA 2WKLA 2VEPA 4A8IA 3FCPA 1S2CA 2ATSA 2JQXA 3S42A 5D02A 2DIJA 3G18A 2XDFA 4LRTA 1NSJA 3ZR6A 4JX6A 2CBVA 1MW2A 1KXTA 3PJUA 4DF2A 1UMLA 2D2HA 4M19A 2OQYA 3HG4A 6XIMA 1VFUA 4WUIA 3GR8A 4H6QA 1WDDA 4EWJA 1PE1A 3QTGA 4YVPA 1GHRA 3NDZA 3VDAA 4JNZA 4NYUA 1O95A 4UZUA 3WBAA 1TZ7A 3KXQA 4GZ7A 4CLMA 1K03A 1W8SA 4OTKA 3W74A 5AHEA 3G1YA 4CQ9A 2JKEA 1WDRA 2VVNA 9RUBA 3LCLA 2NUWA 1DJQA 3M0KA 4NL1A 1DL3A 2OU4A 3LENA 3O6YX 1JGIA 1XINA 1UOKA 2FDSA 3RO8A 4KRZA 4E0CA 3A22A 1MSSA 1UIOA 1R30A 3IAQA 2CESA 2G95A 1UMYA 3UR5A 2YLAA 4AZ5A 3GBEA 1GOOA 3W38A 5K4ZA 2DSKA 3MUXA 5D03A 2VFGA 2QZRA 4RLIA 4UTUA 3KP1A 4LVAA 2B7NA 1LTDA 5D38A 1ZP4A 4BHYA 3CZKA 4FX7A 2XN0A 1UC5A 3M16A 1FH9A 3EWYA 4D6EA 1EXPA 2B7QA 4FB7A 4L6OA 1BLIA 4O4VA 4IFRA 4NAFA 1Q2SA 2DW7A 4TX8A 5KETA 5DMLA 1E6QM 1JG9A 1QOPA 1UD2A 4GIAA 5FJTA 3SGGA 1OT1A 2PDUA 3E9AA 1V3IA 3KOXA 5LHEA 3EKGA 1PX3A 2BVTA 4CN1A 2Z00A 4F0SA 2QKFA 1J79A 3MP4A 3SY1A 3RLVA 4A3YA 1NU5A 1UR2A 3FA5A 2WWCA 5ABHA 4FA3A 3VINA 4KT2A 1SM9A 1XLLA 2YPIA 4PGLA 4G7EA 3V5OA 2WHLA 4ZQNA 2KX9A 1XCWA 4EP8C 2UY5A 2GJLA 1XUUA 3SRHA 3SUWA 1RLDA 1A0EA 2OZ8A 4P8WA 1W37A 3UT0A 2ZX6A 2GWGA 4M56A 1PPIA 2BXVA 4M6PA 3VNYA 1M7OA 2ZTKA 4HZ7A 4C7FA 4YL2A 3APTA 2F8QA 4JIQA 4HHPA 2VFEA 3ABZA 1PVNA 2ZX7A 2ADAA 1AZ2A 2PZNA 4QDPA 1NFPA 1FY6A 3QRHA 4PC8A 5H2ZA 4H6KA 3RPMA 4R85A 1E6ZA 3RR4A 2QXWA 1XDLA 1KGXA 1D3HA 1UZ4A 4HHMA 1HVXA 1MXSA 5K4XA 4XD6A 4MUZA 2OR2A 5CZSA 4UQCA 3GW0A 4QJ5B 1LUCB 2XSAA 3E0LA 4K1GA 3CQHA 2VOMA 3BARA 2VRKA 3QMSA 1J11A 2DVXA 4CD4A 2Q8LA 3LB0A 1UWTA 1WX0A 7REQA 2WVVA 3W2MA 4IIFA 3PBMA 2CFFA 3C8NA 3W81A 1YDVA 3KOZA 4W87A 4QG9A 4C5YA 4F2BA 1TSIA 4WOZA 1P0NA 2MUCA 4JYFA 4QP0A 4IL0A 1CT5A 4FHAA 5K2ZA 3V0SA 1AH3A 3DHDA 1GORA 3L2IA 4L9YA 1NWTA 1QXLA 3FA4A 3XINA 4OGZA 2CBJA 3E02A 1UPMB 3VD4A 3LLXA 1C92A 3B40A 3AROA 4YHGA 1ME8A 3RN6A 3EPNA 2HRWA 2TSYA 3DG3A 1GW1A 1HN1A 1IXPA 2ZXAA 1Z48A 3ZR4A 4AX7A 1OCQA 1RBAA 3R79A 4ATWA 1XP3A 3HQ1A 1TFVA 3S9YA 3UJ2A 1TMHA 4J7RA 2AQWA 1SFSA 2F6XA 2A3HA 5G4EA 1G7VA 2PODA 3LBOA 1LF1A 4FOUA 1E3XA 4WY0A 3AHZA 3W02A 4HYRA 4Z08A 2EF9A 3L0NA 5I77A 2EAWA 1EJXC 2QJIA 2ABAA 1SJAA 1OZMA 2YZRA 1N7KA 4I9AA 2CYGA 1KQYA 3P74A 4C1LA 3R0UA 1W9VA 4DPQA 4IGMA 2ZFAA 4QS6A 1VCFA 1PV8A 5F2LA 3QPYA 3HIJA 3BSMA 1QWGA 3G24A 4KEMA 1H61A 4MJ4A 3SCRA 3N2BA 5GNYA 4ZSUA 1YTEA 3VIPA 4N02A 2DZSA 2J24A 2ZXQA 4X9SA 4M51A 3LQGA 3NWRA 2FDMA 2Z25A 3AIVA 1XIDA 4I3GA 2A7RA 4A8NA 3E96A 4ADUA 1UH4A 1KXVA 3SUVA 1E15A 1M9HA 3R4IA 2HVOA 1CB2A 2ZADA 4JTEA 4UTJA 4JTKA 3M0VA 3MUAA 5BMWA 3EPMA 4JX5A 2QJHA 2Y5SA 3NVDA 3WEMA 1CLVA 4JTLA 4LAKA 4BFAA 2BV9A 3PZMA 5LNWA 1EJRC 4HNOA 4NXKA 1TRDA 9XIMA 2P8BA 1I2NA 4J2MA 1BXBA 1IEQA 2NUYA 2PDWA 2IKIA 1CWYA 1E5JA 4GH3A 2FTYA 3M0HA 1KFWA 2PU0A 2E9MA 1QOXA 2L5HA 2AGKA 2NWRA 3BLFA 3RFAA 2Z2AA 4B5VA 3OZYA 1KTCA 3PY2A 1PIFA 2DZBA 3EOOA 4H4IA 2Q71A 1SW0A 3UYCA 1AQHA 4S3AA 3SCNA 3RG6A 2DDXA 2XSBA 2X1SA 1JFHA 3HTWA 4MWAC 3IPWA 2J47A 2XSXA 2DH2A 3D6NA 4GUFA 4HPHA 1WZKA 3TP4A 2C71A 1ZENA 5K9DA 4C6PA 4O52A 2PC4A 1PAMA 5CXPA 4M80A 4UCFA 5GNXA 5LSMA 3DI0A 1WUFA 1DWAM 4PUWA 1DWJM 2G4FA 4O15A 2PDMA 2CLFA 4Q8MA 2BASA 3WF4A 3E0FA 3MYPA 4AWEA 4FR1A 2WZEA 4HPNA 3RIKA 3FV9A 1OC7A 2VEMA 1Q13A 3U2CA 2X1IA 2O9TA 1I1WA 2XIQA 3QFEA 2JIWA 3DDMA 3LG3A 3F4WA 4AVFA 3DGRA 1KD0A 1T8XA 4LVGA 3S6TA 4H9VA 3ENLA 4TVDA 1DHKA 3ALFA 5BXSA 4G9PA 2JEPA 3TTEA 4PUUA 1Q4NX 1LLWA 3AWOA 1XSKA 2GLKA 3T0AA 1TPH1 5AC4A 4CNOA 3KBVA 4H6EA 2VENA 1SSDA 1QI5A 4HSNA 2E4TA 4NZFA 3BGJA 2DGAA 4AEFA 3BMXA 5A8MA 1H1ZA 4EAMA 4BQ5A 5DT7A 3OP2A 4LUSB 3CMJA 3F2BA 1ZBCA 3PUGA 4DZAA 1Y8BA 1GOIA 1A5OC 2WLZA 3ARRA 2BY0A 3T7VA 3KBMA 4MY1A 2YIHA 1A5LC 3MANA 1WKFA 3QKEA 3UWWA 3BTNA 2PP0A 3PSWA 4JQ2A 5DMYA 2QMJA 3IIOA 3W75A 5TD4A 4BS0A 4MB5A 2JF6A 3MKCA 5TIMA 1F05A 4NRSA 1UQYA 3OG2A 2Y85A 1QI2A 4BA0A 2YCLB 2P3ZA 1XW8A 3LI0A 4R7OA 4O16A 1CGUA 4IGNA 1RJRA 2VMFA 4DYKA 4S3DA 3F4CA 4W7WA 1EXBA 4UTIA 3M0IA 5F1VA 1KBIA 4N6EA 4EXQA 2WSRA 5KZDA 4OOZA 4LVFA 3PPCA 5A3HA 3FLUA 5LGZA 3LMZA 2OEJA 3GFZA 5J5DA 4XZWA 3QGVA 4YTUA 4PN2A 4JICA 3I6EA 2ZC8A 4U2YA 1H51A 2F2KA 1ZZMA 2XN2A 4CD8A 5AKQA 3FYYA 4Q7NA 4JFSA 1HL9A 2GQAA 3NZRA 3F4VA 3I65A 1OX4B 4BQ4A 3GDTA 3FNDA 6CGTA 2X7WA 4PMNA 4E4FA 1RJQA 3W7OA 3VZYA 3CUHA 3S0CA 4F40A 2P10A 1C90A 4O0ZA 4WKHA 2FFCA 3TYAA 2YW3A 1XYAA 5A6JA 1E6SM 4FF7A 3MU7A 3T4WA 2G41A 5I78A 5E6ZA 1E1EA 1GJPA 5CGMA 1YNYA 1BAGA 3W82A 2HXTA 2R14A 2WHKA 4NYYA 2PDPA 3UGVA 2GOKA 3S2JA 4ERAA 1Q6FA 1T7LA 1SZGA 4MFEA 3LPFA 5E1QA 4EE9A 3AI0A 4GLEA 5EU9A 3NL3A 2GOUA 2Y6ZA 1SQ7A 2H8XA 1LORA 4ZMGA 2J88A 1KCLA 4Q8OA 2VELA 4KFNA 4FAMA 4M1BA 2EKGA 1M3UA 5AYXA 2NW0A 3A4JA 4PR4A 1TTPA 4RUBA 1BXNA 4AF0B 1Z8AA 1SFLA 4FXRA 3UFYA 2Y7GA 3WH5A 3W53A 3MP3A 3ZM8A 3QQWA 4XAZA 2J78A 4QXIA 4UNLA 4PE8A 2WJDA 1JZ8A 1FWFC 3ZT6A 3NQDA 1DEDA 1AODA 1Z44A 3GR7A 3C61A 3RX3A 4AD2A 1K9TA 5REQA 1S39A 4GYFA 5FSDC 3GHSA 1Y5XA 2FJUB 3VABA 1SW7A 1W9BM 2ISVA 2HMCA 4NT0A 4DBDA 3QMRA 3VIOA 1PO9A 3CH0A 3R25A 1EC9A 1RP8A 2QPSA 1RBOB 2D3LA 5CSRA 3N2CA 1VKFA 4FP1A 4TTGA 4ZFMA 4E8GA 3WJYA 3A24A 3NPWA 3BLDA 3NEHA 3G6LA 4MZYA 3O6CA 4H9XA 1X7FA 1SSGA 1VIWA 3LXAA 1TVNA 5F7UA 3GNRA 2J8FA 4JHOA 3WFLA 3MA8A 4YWSA 3MMTA 4KW2A 1V03A 2H3BA 4AH7A 5I3JA 4O0QA 1Y0EA 2VT0A 1B90A 1LT8A 4AAJA 1DKWA 2QPXA 4ZOCA 1BRLA 4R33A 4PB5A 3H7RA 2RHGA 3URNA 4NG3A 1VRDA 1ODUA 5JIPA 4LYKA 5HPCA 3FAWA 3JRKA 1S2AA 4S2BA 3PZUA 4D6CA 3GYEA 2DJXA 4PA8A 5LNSA 1EYWA 2FLIA 3C2EA 2WZTA 2WOQA 1TO3A 3LSBA 1XL9A 1Q7ZA 1B5TA 4OOUA 8A3HA 2J27A 2F9RA 4QG8A 1WB0A 1E51A 3GTXA 1E0UA 3H7VA 2NV2A 3W85A 3HGOA 1Q6LA 4X9YA 3QYSA 4H3DA 4A35A 2XH0A 4J3VA 3LYEA 1OGGA 1FCVA 3NPXA 5FACA 1AQ0A 3WFZA 2BSLA 3H12A 4QJ3B 1G67A 1OHLA 4HCLA 2RH9A 4ZQMA 1E4LA 4OBSA 2RJHA 4DO5A 3TQKA 2FGLA 4WX2A 1C9WA 4D8LA 3VNZA 1JR1A 3LEPA 2WJEA 1BYBA 3MC5A 4FNUA 1W6TA 1XIMA 5DMNA 3GXFA 3O07A 3LBMA 3OHIA 1XYBA 4WRHA 4ML4A 4UUIA 1X97A 3VIFA 3DFOA 1EZ2A 3FGCB 5D33A 3VIHA 4E4UA 3WJSA 1A5AA 2PDIA 1DTNA 3ZVIA 1IQ8A 2YOCA 3KDOA 3FEQA 3L5MA 3V0UA 4KIEA 2SFPA 1GQIA 1RA0A 1LBFA 5IDIA 5LA0A 3WH9A 4M6VA 3LS9A 3WN6A 4MHBA 4UC5A 4E2BA 4QAWA 2X1UA 2DSUA 2VRJA 1J5TA 4FNRA 2IQDA 1FCBA 2YXGA 2WC7A 1BVNP 2PBOA 1FUYA 4AHPA 1PSCA 1L2UA 4IOTA 2QCDA 1YRRA 3CAKA 2WLYA 3GU2A 3BXWA 4O57A 3ARSA 3TKFA 1ADOA 1OEPA 3II1A 4MWAE 1YNQA 1QUMA 2VDHA 2PRHA 4IHCA 2OO6A 3PS7A 5G2IA 3CTTA 2X05A 4DBUA 3RUBL 3OBEA 3NA8A 1ZUAX 1GPWA 4F3HA 2P5NA 3BAXA 1R2RA 2PE4A 5I3DA 2J6XA 3DU0A 2YR1A 4QDMA 2JGYA 1V02A 3BL3A 3WY1A 1TPUA 1HJXA 4O1FA 1GPFA 3PTQA 3QFWA 4J5NA 2OOFA 1L6GA 4DI9A 3MKKA 3WBEA 2R1LA 2PAJA 1EJ7L 3T9PA 4XB3A 5A6KA 5FJIA 3SRDA 5T9CE 1JGMA 2Z24A 3EWCA 3VKCA 3OTRA 3LZ5A 2FGZA 5E0KA 3CXOA 3RJYA 3BSHA 2ZXBA 4IQJA 3ANYA 3MHUA 3NZQA 1KBJA 2XFWA 4ZR8A 3TTOA 3RXZA 3CQ0A 5BRPA 1OF6A 3MCOA 3WO8A 2VGIA 1CB7B 1R87A 4IL2A 2WM0A 2ZDSA 4PTMA 3B9EA 4IJRA 1MDLA 3C0QA 2UWFA 4YCOA 3LPPA 4FZIA 1VRXA 3CZGA 3WH6A 1EJSC 2V69A 3D47A 3ZJ8A 1J2WA 4RE3A 4AHQA 7ENLA 2J4GA 3GDKA 1OFRA 2XIOA 3H53A 4WKFA 3ZT5A 4ZA0A 5HXMA 1YEYA 5DY3A 6TAAA 4MLJA 2V5KA 2BXZA 3UEQA 3W70A 1JRCA 5I03A 1DHPA 3L4UA 2VX7A 3V1PA 3ZJ6A 3P0WA 4O17A 1DP0A 2OQLA 1HT6A 3O7UA 2PPGA 3POHA 3WQPA 1TELA 3HA1A 1NQ6A 1LQ0A 3VMPA 4AW7A 3TROA 2QLYA 4B3ZA 4F4RA 1TR9A 1W54A 1XIGA 3CTLA 1OY0A 2Z6IA 1IF2A 5EB8A 4YN5A 1XFCA 3SCUA 4IP4A 2Z7KA 1KBKA 3VO0A 4B16A 2DVUA 1GVQA 4Q4SA 1WCGA 1R3QA 2HE5A 3WELA 1ICQA 1VFFA 1SZFA 5A2BA 4HQVA 3W7DA 2OLAA 4E2VA 5IOBA 3SUTA 3TA9A 1UD5A 3OGVA 3G1AA 4D9PA 3VKBA 4REQB 4GVGA 4AD0A 1NFGA 1DE6A 1O5RA 1EDGA 5M1TA 2OT0A 3REQA 1V7AA 3VMNA 4B2DD 4Q8QA 1W3NA 1XBYA 3UXAA 5BCAA 2VEIA 3VVGA 3W86A 5HDRA 2J66A 1GWJA 1KRAC 4DM1A 3DAQA 2PCEA 1EDTA 1BSLA 5FAGA 5IBXA 4O1BA 5DY2A 1XRFA 2YDQA 2HJPA 1R3TA 3R11A 1NOFA 2VZUA 1EOMA 3P82A 1G94A 5AC7A 3UPWA 3DESA 1MFUA 4ZE5A 4R27A 3FDKA 5E9XA 2WMKA 4HIBA 2O0TA 3KDNA 3BQ5A 2VO5A 3VFLA 4HNTA 5HQEA 3UVIA 4F9JA 3AYRA 2JIEA 1WBJA 1M5WA 4DRSA 4UZSA 4WJXA 3ZWTA 1F8MA 4RXFA 1EWDA 1W1VA 3AXXA 3COTA 3ITTA 3GXPA 3R13A 3BW3A 4R9OA 3HMCA 4H00A 2JGQA 4B91A 3E2VA 4UOZA 2E9LA 3N3TA 4CGTA 1RH9A 5CG0A 1X1ZA 5LA1A 3GTIA 2A1YA 1J96A 1EX1A 1PX4A 3UZZA 3BZGA 4LUYA 6A3HA 4OIFA 3TE9A 2XZ9A 2G37A 3C0JA 3C3NA 3PZNA 4MB3A 1SZRA 3LLDA 3GHUA 1H7XA 4ACYA 4H9UA 5EMMA 4X0NA 4DO4A 1XLIA 1QNRA 3RO6A 4G8TA 3AIQA 4KETA 5GVJA 4L4LA 4NAFB 1GHSA 2V9DA 1B54A 2PP1A 2EJAA 4HKPA 1IXOA 1EIXA 2DH3A 4C6JA 4LUTA 2QIWA 4JTIA 1MO0A 1S38A 1SR9A 3GH7A 1H3GA 3SUUA 4GO9A 3CM4A 3KBNA 3N15A 3W7QA 3ZFHA 2WXDM 2IKJA 3W7KA 3AZTA 3L0GA 2VR4A 5T8GA 4O50A 4C6LA 4Q6JA 1KWKA 1V7YA 3KWXA 4NHVA 5GJPA 2I9UA 3WQ4A 4R7WA 1VFTA 3GKFA 3WBWA 3M7WA 3VU2A 4ZQRA 2Z6JA 4AY1A 3K4AA 4GX8A 1KCXA 2Z1KA 3T44A 1IXQA 4QHRA 3UG4A 4Q8VA 4MJZA 1LT7A 2ISDA 2C1IA 4S3GA 4CNSA 3LM7A 4ACZB 3IUHA 1MW3A 3S9IA 2CNCA 1W9UA 3GC5A 4ICMA 3AZRA 3WF0A 1CBGA 4K8EA 2ATMA 3K1GA 1PYMA 4RDVA 2ISSA 1VJZA 1W3TA 4G7FA 2EPOA 3FN9A 3M46A 2V2DA 3NYZA 1TPEA 3KVLA 1EEPA 2NV9A 1QW9A 2QW5A 2B7OA 1XISA 5AVNA 3G0UA 1RZMA 5HJLA 4OUIA 3OZPA 3CV6A 3HU7A 1J0HA 4D8ZA 1QCWA 3KWSA 4ICCX 2B31A 1ITXA 3HOJA 4UTTA 2NX9A 5JIWA 5K7JA 4WOQA 1GZGA 5HAOA 2CLHA 3ZO9A 1UD3A 1XGDA 1QVBA 4DO6A 1OK6A 3TOYA 2OX1A 4IIDA 3DFYA 1BEUA 4Q8UA 4JX4A 1J9YA 2Z4GA 5BYWA 3H26A 1SJDA 1DWFM 3WLHA 3CAVA 3VXGA 2B4GA 2H90A 3QHOA 5FSEC 3LUTA 2OTDA 4GD0A 1PCWA 4AISA 2FZDA 2C0AA 4C5ZA 3RAOA 2F6KA 1UJQA 1E43A 2BVYA 1KC7A 1HKIA 4LBSA 1P4CA 4HOXA 1GTHA 6ALDA 2GWNA 5BRBA 2X0YA 4PCNA 2P3EA 2VFHA 7XIMA 3P7YA 2OLSA 4Z2LA 3M47A 1V3JA 3H24A 3T0DA 1UR4A 4F0HA 4MIMA 3N1AA 1QPKA 2WBKA 2E40A 4UQBA 5KINA 3DG6A 1BYDA 1I2OA 5EPDA 4KWUA 4Z42C 1E6PA 2C19A 1XDMA 5EFDA 4XAPA 5CBIA 1ALDA 4WY0B 1XIBA 3EX6A 3CH9A 1XBXA 4RNJA 2QJNA 3TCEA 1IWPA 1VZWA 3S2CA 3IJ7A 4NJKA 4PFMA 3AU6A 4WY0F 5ABGA 4O1AA 4KCVA 1KLZA 2MANA 3W7RA 1E1FA 3I3EA 8RUCA 2E68A 2DSWA 5EKYA 4BF9A 1MVYA 4YTTA 1L6SA 1ZSXA 1JPDX 4YU1A 2YL5A 5BZAA 2ZZ5A 1NWUA 3MCMA 5D9PA 2I5QA 3MT1A 1XIJA 4E2DA 1PIIA 3L66A 1UHVA 2J77A 5DX7A 1Q85A 1EGZA 1ZBKA 2HBVA 4R9XA 3UWVA 4M0XA 1JULA 1NJJA 4C91A 5A1AA 3CB3A 4JTCA 3UD6A 5K9XA 4L61A 2H3DA 1OG6A 3WH8A 3AS1A 5AC6A 1E73M 4DAFA 4N9EA 2V3GA 4HYVA 1NDVA 2GGIA 2QUUA 1EPXA 2XVPA 3C8FA 2HISA 4W7UA 2GZXA 3R5EA 5CJNA 2G8ZA 5KZMA 5D32A 4S3EA 5C71A 2G3FA 2QUVA 4AZGA 3TX9A 3ICJA 9CGTA 3TEVA 1YHTA 2QCHA 5CC5A 3VDGA 2YA0A 4HA0A 3TW9A 4AZHA 3EAUA 3B9DA 1DPMA 1XIFA 3ABXA 2OXNA 4OJYA 1P43A 3OLIA 3TQVA 3TDFA 3AMGA 1PZ1A 5H91A 4PRRA 3S5OA 5I02A 2HZGA 2VCBA 1FWWA 3N18A 1FFQA 1PCKA 3AU2A 3W37A 3AHVA 2CKSA 3B8TA 1Q3NA 3WQ5A 2EPMX 3KZSA 3WJZA 4FR6A 2FJKA 1V51A 5A94A 1H49A 4ROQA 1Q6EA 4TU1A 1KNWA 2P8CA 4V15A 1F6PA 4X0VA 1P6CA 5I3KA 5A8QA 3PZIA 5AHFA 5ABFB 2Y7FA 3L2MA 3LCFA 4YNGA 1T41A 3AFBA 5LYRA 1EL3A 5HR6A 4KPLA 4HN8A 2W62A 2VRQA 2OQHA 2E8ZA 3VFCA 3WNPA 3GDMA 1GCYA 5MHBA 4LAZA 5HNUA 2CLPA 1N8WA 4EPEC 2Y2WA 4ZL1A 3K4WA 3W7PA 3WNOA 3E5BA 2WNWA 1FWGC 3GVQA 1J18A 3W3OA 1DQWA 5I7GA 4DJFD 2C91A 4X2RA 5CZ0A 3KCOA 5C7VA 1D3GA 4K3ZA 3WF3A 1Z6KA 2Y8KA 4GA8A 3TYBA 4WXYA 1EEXA 1P0BA 3TA6A 2WYSA 3SRKA 1XYMA 1EH9A 3L68A 2Z0IA 1V77A 3H55A 4D2JA 4HSOA 4GUHA 2V8ZA 1FXQA 4GCAA 3JVAA 3LBCA 3GVRA 4JEJA 3CHVA 4ZO9A 3UZ5A 1AW5A 4OFCA 3O6AA 3BG3A 1TUFA 4LS1A 2VC9A 2Y61A 3QR1A 3QOKA 3GUWA 2HCVA 4EVZA 4WSKA 4Q8PA 2V82A 2YW4A 2ZRZA 5BXTA 4O1CA 3D3FA 1GOMA 4B5NA 3O05A 4S2CA 3CIVA 3KHJA 3W7LA 4P8UA 5H8UA 4YPJA 1TKKA 3K1DA 1K9EA 1ZCOA 1DJNA 3U7VA 3GTNA 1WO2A 2GJRA 4XAFA 3LPGA 1U22A 3E0WA 3GG7A 4DWSD 2ZTJA 4LSBA 4YTQA 2OGJA 3M44A 4B5WA 1EF2A 3GHTA 2G4JA 1S3TC 5MKGB 3HQPA 4LANA 1WZLA 1WOBA 4FXJA 1BG4A 2NWSA 4C1KA 4IIHA 4W8LA 5AN7A 1IT7A 4B3LA 4HCHA 4B2DA 5AC8A 3VDHA 4X61A 1HGWA 3KE0A 3L5LA 5HULA 3NNTA 3IGXA 3OVGA 3WEZA 4K6AA 2WKJA 3W27A 4QCFA 3BW2A 3BLIA 4PMRA 3GIPA 4JQAA 4U5KA 1F3WA 2W63A 2YBUA 3E3HA 4NZ1A 3F1QA 4AC1X 3G8EA 1NFBA 4PCTA 1W1TA 1SO3A 2WNQA 4C6DA 1F3TA 1LOLA 2V30A 5JXQA 4GI8A 1R9YA 4ZB0A 3BVJA 4CUCA 5FJUA 3TTQA 2I1OA 4MKSA 6XIAA 1LUCA 3SJNA 2W9MA 1X1OA 3EB4A 2C6QA 4PULA 2QJMA 3MZNA 1W5OA 4AD1A 1V3HA 2Y70A 1M01A 4GI6A 3GKAA 5J5RA 2WK2A 2DPEA 2HPMA 3GH5A 4XO7A 3AS0A 3S1UA 1A5UA 3F2CA 5DCEA 2A5HA 1H60A 4DUOA 3HB9A 4FX6M 3NGJA 3VM5A 4PSRA 4YXGA 4Z1YA 1TV8A 2QT3A 2BHZA 4LJ3A 1KV8A 4GYJA 4AD3A 1FWTA 2XIMA 3A5VA 4XBJA 2X7VA 4KKXA 4MAVA 2CLLA 2X2GA 3CWNA 4RV3A 2VL4A 4WEVX 4JIIX 3OBKA 4F2UA 2C14A 2JALA 1GJUA 1VFOA 4HNUA 3M0LA 2W4XA 1M7XA 1AJ2A 3IARA 4HK6A 1CXHA 4KEZA 3T78A 2J75A 3EMQA 3KLKA 2J62A 2WVSA 3PNZA 4JN6A 1KXHA 1JPKA 2DSZA 3M4HA 4EOUA 1X7IA 1A3WA 4M24A 3FW6A 1IR1A 1TX2A 3RCYA 4GJ1A 3QM3A 1HGYA 3VCCA 3W1TA 1TTIA 1WP6A 4QISA 3BV7A 3AICA 2DZVA 4I8DA 4DXVA 1AA1B 1UZHA 2ZBTA 3AMDA 3KLLA 5REQB 4F0KA 1T96A 2OODA 3BCJA 2E6FA 1CGYA 3MSGA 3VD3A 3CHFA 5FEPA 3WD0A 2NLIA 1B57A 2VX5A 1ZAJA 5TAOA 4IX2A 4L1WA 4GACA 3E74A 3M0XA 1EUNA 3T0BA 2O9OA 4IT1A 4N6FA 3TYCA 4LF2A 4UWMA 1R2TA 5C54A 4RPPA 1KKRA 1J0ZA 2V3FA 3S4TA 3MJMA 3NTYA 2WZMA 2HQAA 1BXCA 5U7SA 2WPGA 3M6YA 5HUOA 1AH0A 1POJA 1A80A 6TIMA 1L6FA 1F2JA 5JMUA 4AZBA 3ABOA 1G4EA 4C6QA 4ERGA 4QSFA 4QITA 2VI0A 4PMVA 2BMBA 1QI0A 3ID7A 4UQEA 1B9BA 3SZ8A 1W32A 3LU2A 3M43A 1CYGA 3OLDA 3EWDA 4LVDA 3N17A 2WMIB 3RLHA 4JTHA 2CHNA 1S5TA 4Q4KA 4NIRA 2VYOA 5BOEA 1HW6A 1POKA 1OC5A 4DWDA 2WSYA 2V5CA 1X39A 4B5UA 1W1IE 3N2TA 3IVUA 1UR1A 2INEA 1PZ3A 4O8AA 4IF2A 4MGGA 4OU1A 1ZRQA 4J3ZA 5HMFA 2ESCA 2EPHA 2QR6A 4Y9MA 1DWIM 4HPJA 4NX5A 3UJSA 3GG1A 4XWUA 2ZRXA 1FFRA 3P6LA 4FOKA 4I90A 4DJDA 5LZLA 2UY3A 3HMJG 3ZR5A 1CGXA 2PTDA 3K4DA 3VKJA 1MZHA 3JW7A 2IUZA 4POCA 2PTWA 2ZCGA 4L6HA 3W87A 4WLCA 1VPXA 4U4MA 1R9XA 3ITXA 1LRNA 3KM8A 3BV4A 1EFZA 2D2JA 3AISA 2TAAA 3VGGA 1AMYA 4C65A 2CCRA 1QNQA 4P7NA 1O1HA 1MXDA 2DV0A 2D73A 1U5VA 3V7PA 3UETA 3EBVA 5D37A 1SU5A 1W1PA 1FWRA 3MO7A 1CZ1A 5K3VA 5EMJA 2AKMA 2PWHA 1VQTA 3EWXA 2WVUA 5BU6A 2DIKA 3UW6A 1UJPA 3AXKA 2VM8A 1H41A 1IGSA 4C6OA 4LQ1A 1DXIA 4DJED 3WLNA 1LLZA 4IUOA 1X1NA 1QHOA 5DT5A 1JPHA 4AYSA 3C2VA