2Y89A

Crystal structure of mycobacterium tuberculosis phosphoribosyl isomerase a (variant d11n)
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
244
structure length
240
Chain Sequence
b'MPLILLPAVNVVEGRAVRLVQGKAGSQTEYGSAVDAALGWQRDGAEWIHLVDLDAAFGRGSNHELLAEVVGKLDVQVELSGGIRDDESLAAALATGCARVNVGTAALENPQWCARVIGEHGDQVAVGLDVQIIDGEHRLRGRDGGDLWDVLERLDSEGCSRFVVTDITKDGTLGGPNLDLLAGVADRTDAPVIASGGVSSLDDLRAIATLTHRGVEGAIVGKALYARRFTLPQALAAVRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHORIBOSYL ISOMERASE A
publication title Bisubstrate Specificity in Histidine/Tryptophan Biosynthesis Isomerase from Mycobacterium Tuberculosis by Active Site Metamorphosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Isomerase
total genus 72
structure length 240
sequence length 244
ec nomenclature ec 5.3.1.16: 1-(5-phosphoribosyl)-5-
pdb deposition date 2011-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00977 His_biosynth Histidine biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2y89A00
1OJXA 3UY8A 3S1WA 3W1PA 4GNJA 4WUIA 2JGYA 4UTJA 2JKPA 4LC6A 3VKJA 1GPWA 1S5TA 5F1UA 3GXPA 3W85A 2X1TA 1IXPA 4N2YA 1H60A 2Y7EA 4E2DA 3MI3A 3SY5A 3GDRA 4FX7A 3GDMA 4C1KA 2TMDA 1XUUA 1I2QA 1GWJA 3HG4A 1TTQA 1ZAJA 1K02A 2GOUA 2ZZ5A 4UFKA 3MP5A 2FPVA 4EF8A 1OFBA 3QQ1A 4JICA 2GQAA 4CCCA 3L0KA 3G0UA 2Y88A 5HWNA 1FDJA 3M5YA 2ZYFA 3B04A 5HNRA 2QJGA 4N4PA 3VFLA 1F6KA 3CIXA 3I68A 3W88A 2Q8LA 2A7PA 3NVTA 3ZR4A 4IWWA 1TV7A 2YCEA 5I3FA 1W56A 3PBUA 3GDKA 4GJ1A 4BWLC 3SECA 5KSWA 4HNNA 4ZZ9A 3DFQA 3EWXA 4RZ6A 3VCRA 4AWTA 2QCDB 1ME7A 5DLCA 2Y63A 2NX3A 1YYAA 5I3KA 3G1AA 1DV7A 5BMWA 3NQCA 3STFA 3HBLA 3IIXA 5AFDA 2EKCA 3PAJA 3BW2A 3C56A 2GQ8A 3SR7A 1DJNA 3ABOA 4Q4KA 2TYSA 4UFMA 1Q45A 5DCDA 1LROA 4KFOA 5F2IA 1CW2A 5D2XA 2PRMA 3WK2A 4K6AA 3QW3A 2WOQA 4IMCA 3W7MA 5LNVA 3H55A 2HSAA 2PE4A 1ALDA 4R7JA 4H4IA 5I3JA 4RK8A 1OFQA 3M5VA 1ICPA 1AW1A 4UUIA 2ZRUA 3GAYA 1TPEA 4GRSA 3P81A 2O7QA 3UQNA 5BOOA 3T78A 3W7CA 5AOUA 4AH7A 2YYUA 1TCDA 2B0MA 3W2JA 1LLWA 1W0MA 2E6YA 3E0IA 1ZAIA 5DBTA 4I7UA 2H3BA 1L6WA 5AYXA 2RDWA 4LRSA 2C1HA 4DPPA 3NPVA 3EX3A 3LBCA 3LI1A 4YCPA 1EPXA 3DXIA 4DXVA 3NZRA 1GT8A 4FNPA 2YXGA 4TU1A 4MPQA 2VEKA 3O07A 3TH6A 4FHAA 3CB8A 4QNWA 1UASA 2X1RA 3LCGA 4NT0A 4ZQRA 3FKKA 2OMAA 3D0CA 4GUFA 2BX7A 2YSWA 4YLWA 3W7RA 5KTLA 3LHUA 4GWEA 1YXYA 1M5WA 4JDBA 3S0CA 2J6XA 1JVNA 2YYTA 3LV6A 3O6DA 2YPIA 3W23A 1VPXA 1ZAHA 4JNMA 5CGQA 1PCWA 2PRHA 4JN6A 2VEIA 3B0VC 3BLFA 5K9XA 3W76A 3DFOA 4OT7A 1Q6RA 3L5AA 1K7EA 3MP4A 3GK0A 3PWAA 1L9WA 1KTBA 1JUKA 2ZRVA 3T4CA 5DCBA 4O1BA 3A23A 4IPJA 4O1CA 4UC5A 1TTJA 3TKFA 3UZJA 2F7FA 3LCLA 2NUYA 3W1NA 1PV8A 1TQXA 3TW7A 2ZTKA 2OZ0A 5D2WA 4ZL1A 3TFXA 3VI2A 3RLVA 2NLIA 1TB3A 1Z42A 5AC7A 1H7XA 4LS2A 1IIHA 3NQVA 3I7SA 3CPRA 2VELA 1V5XA 1RR2A 2XN0A 4HNVA 2DZUA 1H7PA 4BF9A 1H1ZA 4WXYA 2CLLA 1SPQA 1F74A 1QNVA 4JXCA 3L65A 1BTMA 3CQ0A 2QCFA 3LRLA 5G4EA 5G5IA 1P0NA 5D2TA 1FWTA 4N6FA 3LX9A 1GEQA 1VCVA 4NU7A 4S2CA 4MY1A 4K8EA 3M1ZA 4C1LA 1LRTA 4ORIA 2J9YA 2C3ZA 3DZ1A 3O63A 3PS7A 3QRHA 3PY2A 2YW4A 3GZ3A 3PB0A 1VYRA 1PHQA 2YDAA 4N6EA 2ZRYA 1WV2A 2W79A 3L2IA 3M5XA 3BARA 3HO8A 3U2OA 5K9DA 1GVRA 1TPDA 5CPNA 3SIZA 4IX0A 3W87A 4JYFA 2XN2A 3PSVA 5DY3A 1OG0A 4LOCA 5FF0A 1LORA 2TRSA 5I3HA 4M6QA 3C2FA 4JTGA 5D37A 3ZFHA 3QJAA 3RLUA 3CEUA 5EL1A 1QO2A 1ML1A 1DQWA 3UXDA 1KM5A 2CZFA 4LUIA 4JGDA 3TMLA 1J5TA 2DU2A 1XC4A 1OX6A 3E49A 3EX2A 5U7SA 4N9CA 2Y6ZA 3MHFA 5CSRA 1AW2A 1KM2A 4WOQA 4LS0A 4AF0A 1NEYA 1TRDA 1WAUA 1OF6A 3L21A 5AB3A 1HTIA 4N9DA 1FY6A 4LVDA 5FEPA 4PTNA 3UWQA 2VKZG 4M7TA 1ZCOA 4LRTA 3LOTA 3PC0A 1MEWA 2ZRXA 1KM3A 4O18A 2QKFA 1DBTA 3G24A 3KRSA 3HIJA 5AYYA 2ALDA 4UMBA 1M6JA 4UTIA 4QNEA 3UWUA 1TO3A 5F2LA 3NYZA 3W2LA 4GUGA 3TAKA 4FNUA 4OV9A 4IXHA 4UFIA 3H54A 4PEKA 2WSYA 4FNRA 1YPIA 1KV5A 2HS8A 1D9EA 3C61A 5H2ZA 1UB3A 4DQWA 4YMZA 4LV4A 1FCBA 3B03A 3CT7A 4QJ1A 4IGHA 2FPYA 3E9AA 4EOUA 2QF7A 3LGEA 3NZ1A 1M7PA 4R33A 3HMJG 3IGUA 5E0KA 1FWNA 3W7IA 1WBHA 2A7NA 4GUHA 3PUDA 2Y7GA 2RHGA 4LT9A 1VCFA 1R46A 2VFDA 1SO5A 2BSLA 5LHEA 1ADOA 2DZXA 5F4SA 3N9RA 4JX6A 2ATSA 3BLEA 3W84A 1K8YA 4M5PA 3W3OA 3UWZA 4Z08A 1VLWA 4EWND 1LOLA 4DO6A 5CZSA 1TPH1 3P67A 1LRNA 3HPSA 4A22A 2ZQ0A 1DOSA 2FB2A 3IGSA 3G3DA 3LXBA 3QF0A 3PM6A 4UFHA 4HIBA 3S5NA 4WY0F 4TR9A 3OIXA 1MZHA 1FCUA 4POCA 3T7VA 2A21A 3EXSA 3ABRA 4NNBA 1N8FA 1TRIA 1G4EA 3GKFA 2B7QA 1W3TA 2CLOA 2HS6A 1VLIA 3P80A 3L68A 1VHCA 1J4EA 3NL6A 3N2MA 1W8SA 4YWIA 1KLYA 3VE7A 2NWSA 1SZGA 3KVJA 1V7YA 4XZ9A 3B4UA 1LDCA 2QUTA 1QFEA 4KFNA 3UPBA 2DORA 3L5LA 4PCFA 4E2BA 4K39A 4TO8A 4LW7A 2GVJA 1TV5A 4NZFA 1S5WA 1GG1A 5EMUA 3LHYA 1YTDA 1EB3A 3YPIA 1QAPA 3P8IA 3GXTA 4HNUA 1X6UA 5H91A 2FPTA 2ZZ6A 2AAMA 4ZQMA 3EWZA 3EXTA 1OFPA 2X1UA 4JTTA 3A22A 4S1FA 3IEBA 4NJGA 4YXGA 1FCVA 2HMCA 5FF2A 1GQNA 3OVRA 4TIMA 2X30A 3WK1A 3LTYA 2PURA 1QPOA 4DBEA 2FB3A 3SSJA 3CLMA 3HGSA 5EY5A 3NOEA 1OK4A 2OT0A 2GUUA 1R2RA 2QCDA 2J24A 1QCWA 2F84A 3B05A 2Z6JA 4M6PA 2HTMA 2QCHA 1QDSA 3F4WA 5D09A 1W5OA 2G97A 3G3MA 1TPVA 3KXQA 2NUWA 4GXMA 1PE1A 3NQAA 2YX0A 3TUUA 3NEVA 3W7QA 4U4MA 5CKSA 5AHIA 3HG5A 3UZ5A 4FF7A 1THFD 3TA6A 1Q3NA 2IQTA 1G4SA 3M43A 5FEZA 5BNKA 2GJNA 3GNNA 1K3UA 2WKJA 1IXOA 3KVMA 1EP1A 1GYLA 3DBPA 1EWDA 4Y90A 5SWUA 1A53A 5L6UA 3R8RA 3NL3A 1K7XA 1SSDA 3G8RA 3G0XA 3ATYA 1G67A 1OVDA 3PVFA 1AK5A 3EWYA 1NAL1 4ML9A 2VFEA 4MLRA 2A0NA 3TSMA 3TXVA 3G1YA 1NVMA 5F2GA 1XDMA 2FDSA 2VXNA 1H7OA 3PG8A 1O4UA 3QH2A 4ICNA 1XUZA 1K8XA 3WJSA 1H1YA 2VC6A 4QSHA 3GR7A 3HGRA 4MZYA 3G8EA 2YR1A 3CEPA 1B4KA 5LNWA 1BKSA 1G69A 4XBKA 4JTHA 4PL2A 2V82A 3UYCA 2A6NA 3G1XA 3DFTA 1WYIA 2JGQA 3GR8A 4O16A 4O54A 1N7KA 3PUOA 4HSOA 5HQEA 4OHQA 1C29A 1LM1A 3L0NA 4O1DA 3M41A 3KX6A 1M7OA 3FS2A 3E96A 1HFBA 3BW3A 3M6YA 1VQTA 2NWRA 2X2GA 5K3VA 2VENA 5I3IA 3B0PA 3KFTA 1GG0A 1PL9A 1JRBA 1H51A 4XBSA 4IMFA 1RVGA 4YL2A 2NV2A 2ZA2A 4GBUA 4HPJA 4PC8A 1IXNA 3PF3A 4H3DA 4Q32A 1WX0A 5HR7A 1SSGA 2OX1A 1KBIA 5EKYA 1W3IA 2YZRA 3BGGA 1SO3A 2V5BA 3MI2A 2VEMA 1G4TA 1X1OA 4W9TA 3OBKA 2P1FA 3BK0A 1SO4A 4EIVA 2AGKA 2H6RA 3N34A 4CQ9A 4AAJA 3SW6A 3R13A 4CNPA 1T96A 1EIXA 1F73A 4ZVJA 4G1KA 3UWVA 1Q6QA 2W6RA 3NDOA 4ZQOA 3E02A 1ZALA 1ONRA 3QEZA 4HT3A 1SQ7A 2GQ9A 3SGUA 3NQEA 2E09A 4ALDA 4CQ8A 3MHUA 3STGA 3B8DA 2WJZA 1TJPA 3W1MA 2J9ZA 4O10A 1JCMP 5DN1A 1C9DA 4RZ4A 4UFJA 5CZTA 5HWMA 4PL1A 4CNOA 5FESA 3MO7A 4UCGA 4RXGA 4MY8A 1LCOA 3C3NA 5KZDA 1WA3A 3KOFA 4UTTA 4RXFA 4LVBA 2J9XA 5FI8A 1ICQA 3LCFA 3UWYA 4ADSA 3L66A 5K4XA 1W31A 4LVFA 3QZEA 3W1LA 3KRZA 3RNDA 2A4AA 3LLFA 1H7RA 1I2NA 3G0SA 3LLDA 3P8JA 3PSWA 3DI1A 1QPRA 2V8ZA 1WBJA 1JULA 4O19A 4QM1A 3W2MA 1GZGA 2QUUA 5G1TA 2DJLA 4NJHA 4LV9A 3FJ6A 1L6SA 3G1VA 2B7NA 3EWBX 3V1PA 3BG9A 1KFJA 1MEHA 2V5LA 3G22A 5D32A 2Q3RA 3LCWA 5D38A 3MBFA 2R8WA 5AHEA 3G1DA 3LXAA 2ZZ3A 3P5YA 3W83A 3LRMA 1W54A 1MXSA 5G2HA 1XXXA 2CWNA 4YCOA 4JR5A 4L4MA 3BG3A 4O14A 5TIMA 1SFLA 1SU5A 4O8RA 4QISA 4A2SA 2ZDRA 1S3HA 2CFFA 4GFSA 3TCEA 4UTKA 2W0UA 4IX2A 4FB7A 1OYCA 1XBVA 1X1ZA 2OCZA 4RX0A 4OBTA 2ISVA 4JX5A 5HMSA 2EF9A 4NXKA 1TYGA 4UIOA 4O0KA 1EA0A 3PBVA 4WX2A 3CIWA 3THAA 3OVQA 1GTHA 3EX4A 4O17A 4JIQA 2C14A 2FFCA 1I2PA 3RF9A 3CWNA 4O50A 4UFLA 2BTMA 1KV8A 2NXHA 2EAWA 1UJPA 4JTFA 3BW4A 4TMBA 3HG3A 4BI7A 4RZ5A 1RQEA 4BI6A 5C5YA 2H8ZA 1VR6A 3C8FA 1UUOA 3TJXA 1UCWA 3MYOA 2RKXA 5C55A 3DFSA 4LU0A 2C16A 1VYSX 4PA8A 4AXKA 1VCGA 1OFRA 2R91A 4JDYA 4DELA 5IBXA 2B7OA 2VFFA 4HKPA 1F05A 2X16A 4O57A 5D02A 1TPC1 2Q8ZA 1YXDA 4LWWA 5AN7A 2QDHA 5F1VA 3H53A 1KTCA 4ZQNA 4JY8A 1TREA 4Z1AA 3BLIA 3STCA 1ZENA 2FIQA 3FA5A 3LBMA 4JYDA 5D30A 1VC4A 5LHFA 5HUPA 1W5PA 2ZZ7A 1JR1A 4M6VA 1G6CA 1R47A 4WY0A 3WFAA 2QCCA 3S5OA 3TQKA 1PS9A 1KFKA 3TMQA 3KRUA 2OT1A 4OV4A 2TPSA 2WO5A 2CU0A 3DU0A 3BPWA 5DY2A 4R34A 3QPZA 3T40A 3LV5A 3MHGA 3W7PA 2PRLA 3IVSA 4MVAA 4XWUA 1VHNA 3W1AA 4NUWA 1LOQA 1RZMA 3LCXA 2D73A 1QOQA 1YDOA 4OE7A 4O11A 1H63A 1SZNA 1YADA 4UNKA 4D2JA 4S2BA 3GIYA 3M16A 1GVOA 1OYAA 3LHZA 2DZWA 4O53A 5ABTA 2NX1A 5K2ZA 1C8VA 4FXRA 2NZLA 3P82A 3WJYA 3IIZA 3P61A 3QQ0A 4MLJA 4JTJA 3O16A 4LS1A 3P5ZA 2DJXA 1RQHA 4CCEA 3ABQA 3W1TA 3M9YA 4A21A 3QPYA 4MOZA 4NNCA 3GAKA 1G7UA 1S5VA 4WJEA 2Y61A 4Q33A 3QFEA 2ZRZA 1YLVA 2QDGA 4UR8A 3TAOA 3WJWA 3BO9A 1XBYA 3TQ0A 5BMXA 1O5KA 3CU2A 4XKYA 4UTLA 4BK9A 1ZY9A 1OHLA 5BRBA 4QAIA 5CZ0A 1YTKA 2UV8G 2GVGA 3G18A 3P74A 5CPOA 3HOJA 3N19B 4MKNA 3Q2DA 3TXZA 3GDTA 3BV4A 1Z41A 5DXXA 1GVSA 4E38A 3A5VA 1NF0A 2C13A 2EGZA 3THQA 1OFOA 1O5XA 3W7DA 1WOBA 4FIRA 2ATMA 2C19A 4Y9AA 3TDFA 3S9YA 1KW1A 1NSJA 1GOXA 1TQJA 1I2OA 3LHVA 4N02A 3JR2A 1VJIA 3W22A 3ANYA 3LCIA 5FF7A 3UWWA 3DGRA 3O06A 1RPXA 3RK8A 2JBMA 1F76A 2CW6A 3N2XA 2FTPA 4NZJA 1HUVA 4UNLA 1QWGA 4UR7A 4K8HA 3Q94A 1HG3A 2Z0IA 4MJZA 4UMAA 4XQ6A 1YPFA 5DCEA 2C15A 2R14A 3INPA 5FEWA 3EXRA 1W37A 2Y89A 5KITA 3MW7A 4QQ3A 4AHOA 3DFPA 3NQGA 3LDVA 3W7HA 5K7JA 3TC6A 1JRCA 3C2RA 1GJPA 3DKJA 5LGXA 1FCQA 3NL5A 5G1YA 1A5CA 2ZZ1A 3FIGA 1OFAA 4UTHA 2A1YA 4A29A 1ZJIA 4WY0B 3S8HA 5LNUA 1ME8A 1IIGA 4AB4A 5HUOA 1OFEA 2H90A 3NQDA 3M47A 5G4WA 2YGYA 3GX9A 3NM3A 1TPB1 1NFBA 2ABBA 4E0CA 3LTPA 2JKEA 3O6CA 2H8XA 5G2WA 1TPWA 3TSDA 4IMEA 4M7SA 4FEZA 2H3DA 3W1UA 1AL7A 1FWWA 1K7FA 3OEXA 3G1HA 1LOSA 1JCYA 4ZQPA 1O94A 5KZEA 1LBFA 3ELFA 3NPXA 3TROA 4QIUA 3PR2A 1SW7A 5DBUA 4RR4A 3EX6A 3QMTA 4AEOA 1JCXA 2X1SA 3AJXA 3N9SA 1K8ZA 1F2JA 1XI3A 2CLIA 2WNNA 4K7VA 4MYXA 2JKAA 4NVTA 1MEIA 3NQFA 3VNDA 1VH7A 1W5MA 2WSRA 4O28A 5TBOA 3GDLA 1G7VA 3C2EA 3IVTA 3W74A 1OX4A 5AHLA 1W1ZA 1IF2A 2BWGA 2O7SA 3W7JA 3IGXA 3EB2A 2DZSA 4FXSA 5LZLA 4UMCA 3NO5A 3TSBA 1XBZA 1MSSA 2E68A 3HQ1A 3ZWSA 3ABSA 2J88A 4BR1A 3IIOA 3ATZA 1EP3A 1ME9A 4MZ8A 2WNQA 4XKYB 4GC4A 4JIPA 1FX6A 1DHPA 1LBLA 2G5WA 5C6MA 3W7GA 3UNDA 2V2HA 1P5BA 4P2VA 3USBA 4I7VA 1KFCA 1SUXA 4I7WA 1T99A 3P7YA 4DEFA 2Y70A 3DI0A 5AC6A 4O4WA 3B0UX 1RQBA 3SFKA 1AMKA 1FXPA 2BLEA 8TIMA 1OX5A 2Z1BA 3NAVA 1WQ5A 3W72A 3FLUA 3PBWA 1HO4A 2Y85A 2CLHA 1FBAA 4N9EA 4RKAA 3MP3A 1BEUA 1K03A 3KAOA 3GKAA 3QW4B 1RV8A 2VFGA 4NJIA 4ZMGA 4IQLA 3TX9A 5IBXC 4PODA 2NXIA 3TE9A 1DQXA 3EKZA 4WZHA 3A5FA 1Z48A 3ZWTA 3OHIA 1JCLA 3FEMA 2B4GA 3GNDA 3W7EA 1I4NA 3OA3A 5KZMA 3GXNA 2QAFA 3K30A 4FNSA 1B3OA 3TNOA 4QITA 5BW6A 1WXJA 5K9CA 4LTSA 1GVFA 5CSSA 1A5BA 3GVGA 3C2OA 3QMSA 4KWVA 4AHQA 2ZBTA 1Q6LA 2XN1A 1UUMA 3NQ6A 2CLKA 2RFGA 1OFDA 5G2IA 1H5YA 3S1UA 2QAPA 1SFJA 4LVAA 1AW5A 4NNAA 2Y62A 3KVLA 1LZOA 1OYBA 4Z1BA 1QO5A 5F4WA 1KFEA 5D2YA 3TV8A 2V9DA 4NX0A 2ABAA 3OVPA 2YFNA 3EWUA 5HINA 2PCQA 3RFAA 5IM51 3EKLA 3HF3A 4AWUA 3HB9A 4UTWA 1KM1A 4U28A 2G96A 2FJKA 1D3HA 2QJHA 3F03K 1H50A 3I6RA 1KBJA 4LUJA 4XTIA 1QR7A 2XFWA 3W1XA 1OK6A 3MMTA 4PH6A 3LCHA 4DO4A 4JS3A 1PIIA 4JTEA 3DHFA 3CTLA 3TJLA 3TQVA 1H7NA 1FUYA 3NNTA 4FX8A 3W2UA 4GE8A 3P84A 3C0JA 4AMAA 3M7WA 3OG3A 2DZPA 3DHDA 5DXYA 1P0KA 3W7LA 3FKRA 1PVNA 4WQ6A 3VE9A 3A24A 4OWGA 2BZNA 2ZTJA 1OX4B 3KVKA 4IOTA 3Q58A 3N73A 2ZA1A 4RLIA 3CM4A 4LNYA 4DBDA 3GLCA 3C52A 3NGJA 3TK7A 4JY9A 4Y96A 2QCNA 3DENA 4OU1A 2Q3OA 5EBUA 4K7YA 4NJJA 4GUJA 4UTUA 2E5CA 1O95A 1Y0EA 5J5RA 2ISSA 5E1QA 5KINA 5D03A 4LY8A 1JCJA 3EWWA 3LXCA 3NA8A 4KWWA 3KHJA 4MJMA 1ZFJA 2QEZA 3IVUA 5K4ZA 5AHFA 1TJRA 1H7WA 3R2GA 2V2DA 4RJEA 5EPDA 1PCKA 1QOPA 3O6YX 1I45A 1W5QA 1A5AA 4XTDA 4IJBA 1F7BA 3W75A 3W1RA 2I9EA 2LLEA 2ISWA 1KTNA 4JD4A 3C4UA 4UXDA 4K36A 1HL2A 1GTEA 2E1DA 3P60A 4Y8FA 4HSNA 4MZ1A 4B5NA 2YFOA 3TIMA 1P4CA 2WNZA 2ZFAA 1FDYA 3TFCA 5FF3A 3F1QA 1ICSA 2CZEA 5CG7A 3W73A 3JS3A 3S1XA 4MYAA 2FQIA 4O0ZA 1MO0A 5TQLA 5AC8A 2CLEA 1X8FA 3W9ZA 4Z1CA 2OJPA 1SR9A 1J2WA 1O60A 5DELA 2NXGA 3E12A 3M0ZA 4O13A 4H6KA 1EUNA 2I1OA 1AG1O 4JTUA 1EWEA 4J9JA 1XCFA 1SW0A 2AQWA 2RDTA 4MIMA 2A5HA 2WQPA 3R12A 4NQ1A 4AWSA 2GJLA 2VFIA 2ZZ2A 1KLZA 3HGJA 4IXXA 3W7OA 4A2RA 4DF2A 1E51A 3S1VA 1L6YA 5J5DA 2GVLA 3I7RA 3B06A 1BWLA 3LRKA 1NF7A 3QC3A 2ZRWA 4ORMA 5I3GA 3FYPA 3EEGA 4EVZA 3FJLA 4Z0JA 3ZS4A 1WOAA 4EF9A 1HO1A 5CZJA 2P0OA 6TIMA 2NUXA 4X3ZA 2ZZ4A 3HPZA 3L0GA 3NQ8A 4NX5A 1B4EA 1YDVA 4WD0A 2A7RA 3NQ2A 3S6DA 2KZHA 4JTIA 3SGZA 3LHWA 3NL2A 3SJ3A 3NR0A 3LB0A 3GYEA 4DF0A 5D2VA 5C54A 3LM7A 1L2UA 4MFDA 3G1FA 1TTPA 2DP3A 4BFAA 3N3MA 5EYWA 2CLFA 2Z6IA 4O15A 2E5DA 1TIMA 3PB2A 2J27A 1XL9A 4A3UA 4X2RA 5CPLA 2VFHA 1W3NA 5GVJA 2Y7DA 1OABA 3QSTA 4HPXA 4NJKA 4MY9A 2WSQA 4O4VA 1JUBA 4PFMA 1FWRA 3MI6A 1GVQA 2CZ5A 1XKYA 1I2RA 3WK3A 1QMLA 1SO6A 2JK2A 2DZVA 1P1XA 5FEXA 1SZEA 2VEPA 1YTEA 3NPWA 5E93A 1B9BA 2E6FA 5HULA 2E6DA 5AHNA 1Q6OA 1KFLA 2EPHA 4KKXA 1B57A 5MHBA 1JJKA 3HGOA 3HG2A 1UBSA 1FXQA 4JX4A 5A5WA 3N14A 5F4XA 5AYZA 4X22A 4KFPA 3U6WA 5KMYA 1QPNA 1EP2A 1F6PA 1R30A 4ZQCA 1OF8A 3P62A 4HN4A 4HHPA 1LTDA 2V0TA 3R89A 3SZ8A 4FO4A 3IV3A 1H61A 4FIQA 3LHTA 1D3GA 3F4NA 4O52A 1GYNA 3PG9A 3W2NA 5LNRA 1T0OA 1EUAA 1TPUA 4MUZA 1G4PA 3L5MA 1JUEA 2E77A 2QCMA 1YDNA 2V2CA 3O8AA 3CC1A 1EEPA 1FWSA 1CX9A 3FOKA 1ZHAA 1R2TA 1AL8A 1T8XA 5CPMA 4N9BA 2ZCGA 4ONVA 1I8JA 2VOMA 1FQ0A 1VZWA 5HJLA 5LSMA 1DKWA 4UTWC 3UPWA 5HR6A 4BWLA 3MUXA 3UY7A 4RV8A 4LVGA 5L9FA 4IUOA 2I14A 1DJQA 1SW3A 2WPBA 4WOZA 4WXZA 3UD6A 3WJXA 2RDUA 3QM3A 1KM4A 4O1AA 1DL3A 4OGZA 4NXSA 3DKLA 1QPQA 3T44A 6ALDA 1WDWA 3NQMA 1JQVA 1DORA 2QR6A 4FNTA 2A85A 1SZFA 3W6YA 3BG5A 3HPXA 1A50A 3MBDA 1LLZA 5FF4A 2C0AA 3DH7A 4CCDA 3S42A 3IIVA 3FYOA 2QJIA 1TV8A 1F5ZA 1TTIA 3S5ZA 3G1SA 1VYPX 1XDLA 5F2MA 3QSRA 1W5NA 4IMDA 3PUEA 5D04C 3QYQA 2Z2UA 4JYEA 4CLMA 3HJZA 3I7QA 1U5JA 3LI0A 4RCXA 2E5BA 4K38A 2ZA3A 1LBMA 2EHHA 4UTTC 3O15A 3A21A 1EX5A 1PHWA 3W1QA 4ADUA 4IMGA 1TMHA 4DF1A 3GB6A 1TPFA 4Y6GA 4CNNA 4XUGA 2QCGA 2Y7FA 1XM3A 4AVFA 5D05A 4IPIA 3STEA 3L9CA 2DZTA 3L67A 1KA9F 3O1NA 3QMRA 1IGSA 3TC7A 2C6QA 2YW3A 4M19A 1RD5A 2WV8A 1ZNNA 2A2IA 3W71A 1H62A 4X9SA 4FNQA 3W2KA 2CZDA 1VS1A 1KM6A 3UXAA 3AO0A 2C18A 2V81A 4DPQA 3NG3A 2QUVA 3BVJA 3JRKA 3S5YA 3IRDA 3DFNA 1JQXA 3V75A 1A5SA 2PC4A 3W86A 4FX6M 3PBYA 2G95A 4AF0B 3MYPA 4HNTA 4AHPA 3CWOX 4JTSA 2A6LA 5LKYA 1LYXA 4JTLA 3U8GA 3R5EA 4I9AA 1Z44A 1CI1A 3NM1A 3EX1A 3MJYA 3M44A 4TMCA 3W07A 5C2XA 4Z1DA 3NXFA 5U4NA 3T55A 1LP6A 2NV1A 4OQVA 3IIPA 4TX9A 7TIMA 4N4QA 4GUIA 3A9IA 2QCLA 1JCNA 2V30A 4Z0SA 5T26A 5A8GA 1VGAA 2QCEA 1YXCA 1KFBA 2GPTA 2TSYA 5D33A 2B7PA 4BI5A 2P10A 3C6CA 3C2VA 4LC8A 4JTKA 4UTMA 4R53A 4DO5A 5LGZA 2NX9A 3DAQA 3NPUA 3LERA 3RU6A 4L4LA 1U83A 1FDZA 4K37A 4MFEA 3CHVA 3RMJA 5LNSA 1X7FA 3Q37A 1TSIA 3SI9A 3WJZA 3TR2A 2FLIA 2BXVA 1VRDA 3TW6A 2E6AA 5HWJA 1DVJA 3FFSA 5AHMA 3BGJA 3W7NA 1IXQA 2R94A 1BWKA 4O12A 1XFBA 3O05A 4P61A 3TU9A 4JEQA 3NQ7A 1LRQA 2RH9A 1R2SA 3WK0A 3M5ZA 4CQAA 3PULA 5EA9A 2CLMA 3I65A 3LTSA 4ADTA 1XBXA 1N55A 3MWAA 3W7KA 1KM0A 3W70A
chains in the Genus database with same CATH superfamily
4NAEA 4Q6JA 1OJXA 3BMVA 4X63A 3BLLA 3W1PA 2UY2A 4XBJA 4WUIA 5ABGA 2JGYA 1KWGA 4UTJA 2JKPA 5C9RA 4YVXA 1GPWA 2XVPA 1XJBA 3SJNA 4BA0A 3W85A 1H60A 3VIGA 2RJHA 4E2DA 4YIWA 4AZCB 2GWGA 1V6TA 1AQHA 5DT7A 4XVDA 3GR4A 4GH1A 3I10A 1ZAJA 3MUZ1 1AQFA 3AZTA 3WZ0E 5A1AA 4EF8A 1OFBA 1EOMA 4PMVA 3QQ1A 2AMGA 4CCCA 3G0UA 2Y88A 3V4BA 2BY2A 1FDJA 5HNRA 3G5EA 2QJGA 3W88A 2Q8LA 2VWSA 2Z26A 1R0MA 3ZR4A 1TV7A 3GDKA 1X7IA 4ZGYA 3SECA 3MA8A 4RZ6A 2YDQA 1QI5A 5KEZA 3MJMA 2Y5JA 1BSIA 1ME7A 2NX3A 5E5CA 5I3KA 1DV7A 1TWIA 2OGJA 3AHTA 1XYZA 5MKGA 1NDYA 2GQ8A 4JFWA 2VR5A 3SO7A 4Q4KA 3IS4A 4BF7A 1Q45A 1RHCA 5A8MA 4XAPA 3OU8A 2HRWA 5AYIA 1ESWA 3OB8A 3WK2A 3WD3A 4XD4A 4J2MA 2HSAA 2PE4A 5I3JA 3WH7A 4QX4A 4YHGA 4YTUA 1PZ2A 1DHKA 2ZX5A 2ZRUA 4A05A 4GRSA 1DWIM 2PDNA 1RH9A 3QLLA 3SCRA 2OLAA 4JN8A 3VDGA 4MTVA 2PDHA 3IK2A 1ZUAX 1LL4A 1L6WA 2XYLA 4DPPA 4QLJA 3LK6A 3LI1A 1T8QA 3CUJA 4DXVA 1OY0A 1GT8A 2HNHA 3AUJA 2YXGA 4H83A 4MPQA 2VEKA 3TH6A 4FHAA 4QNWA 3KBNA 2V38A 1ZJBA 1ZTVA 1GVEA 4RL3A 1EDGA 4FP1A 3MU7A 2ZXBA 3FKKA 1WZLA 3M0XA 3CK5A 3UG5A 3TC3A 3CYJA 3MSYA 4L6DA 4GO9A 1M5WA 3DFYA 2YPIA 5TD4A 1P0EA 5CGQA 2VYOA 4LNCA 2VEIA 1J0KA 2AMXA 4JHZA 3EPMA 1W3HA 4MADA 3MUAA 1K7EA 1L9WA 5AY7A 4XD5A 4O1CA 3TKFA 1T41A 3UZJA 3W1NA 4FS9A 3UFYA 3TW7A 4ZL1A 2I16A 2QZRA 1H7XA 2CPUA 1IIHA 1E70M 1KXQA 3NQVA 4PMNA 4RNHA 4AY8A 4HNVA 2DZUA 2J66A 4F4RA 2OQYA 3WQ8A 4PMJA 1CXEA 1BGGA 3MCMA 3CQ0A 2QCFA 1EQCA 5G5IA 5FACA 1E6QM 1BYBA 5D2TA 1WDPA 4ZXLA 2D2JA 3QRHA 5C7HA 1R8LA 3PB0A 4AZBA 4JTQA 2IQ0A 2ZRYA 2W79A 2QPXA 5IDZA 3U2OA 4G5DA 1O5QA 1GPFA 3RCYA 1XRSA 4W93A 1GVRA 3W87A 1X8CA 2BVYA 1HXJA 4H7CA 4LOCA 5FF0A 3S9ZA 5A6TC 5FKYA 5I3HA 4M6QA 2VX4A 3RLUA 4S3FA 1ML1A 4BQ2A 1UPMB 2WCAA 1XR2A 3TMLA 3GC5A 1J5TA 3P14A 3E49A 5U7SA 4N9CA 2ACQA 1EC9A 3MHFA 3AIQA 1TX2A 1KM2A 1OWQA 1UKOA 3LNPA 4LS0A 1DJIA 1NEYA 1TRDA 3RX2A 1OF6A 1ZS2A 1HTIA 4N9DA 1A3XA 1FY6A 4LVDA 4PTNA 2R6OA 3ARPA 4UQEA 2ZRXA 4O18A 4LALA 2ALDA 4UMBA 2XSAA 1PKMA 5F7UA 5A8PA 1XICA 4US5A 4GUGA 3TONA 1XPYA 3ECQA 4PEKA 4FNRA 1B3XA 1PZ1A 1D9EA 1BVWA 3N17A 4YMZA 5C9ZA 3V0TA 3RLGA 2WC7A 1MRQA 1ZBKA 2QF7A 4JEJA 3NZ1A 4X0VA 4R33A 3V5FA 3IGUA 1BWVA 1FWNA 4HHHA 1WBHA 3E2SA 4MB5A 1E43A 3GC4A 3PUDA 1VCFA 2VFDA 3CPUA 3DG3A 3MMDA 3BANA 4GOAA 2DZXA 4HA1A 4JX6A 2YB4A 2ATSA 1JYVA 3CYVA 5FJOA 2ZXAA 2CESA 3CZ8A 4AYSA 4P7OA 2O55A 2NLYA 5JQ9A 4J3XA 4P8XA 1GHRA 2WK2A 2RGMA 5A6LA 4PCSA 4W8LA 1DOSA 4QDMA 4XO7A 1X6LA 3SN1A 1FWIC 4HBKA 4ZO7A 3OIXA 2ZWYA 4HK6A 2A21A 1XG4A 2YL8A 2B7QA 1E6RA 1J0HA 3PPGA 5HNTA 3NL6A 2VCAA 1PB0A 4HJWA 1V7YA 1UH2A 2DIJA 5M03A 4HCLA 3VC6A 2IPFA 2E9BA 4W85A 3R8GA 1TV5A 3IUIA 1FP9A 3GU1A 5EMUA 2E4TA 3CO8A 4NIRA 1YTDA 2WVUA 1QAPA 3GXTA 5CC3A 1SZRA 2HK1A 1N8WA 4V1YA 2OWCA 3LU2A 4ZQMA 5CC6A 1MVYA 3C0SA 1GQNA 3WK1A 4CQBA 3ARRA 4HNCA 1A5KC 3CZLA 1QPOA 3GDBA 4FLRA 1B31A 3ABZA 3WN6A 4Q7BA 3OPSA 3GUWA 1QCWA 3AYTA 3CQJA 4AX6A 1YRRA 2QCHA 3GNOA 1QDSA 4KCUA 2DUZA 2VQUA 2ZX8A 3TUUA 3NEVA 3OG2A 3WUBA 1QNRA 4PMOA 3MVTA 2Z00A 3UZ5A 3M0LA 5FAGA 3TA6A 3PZIA 1UZ4A 2PWGA 3RG6A 4Y8EA 3OLDA 1HJQA 3LEPA 1E3XA 3KVMA 1JG9A 1EWDA 3NL3A 1MI3A 2ONEA 2PP1A 1F4HA 2AL1A 4CU8A 1SSDA 2DFAA 3ATYA 4JCMA 3EWYA 4ML9A 4YVPA 3CB3A 2PDBA 2VFEA 6ENLA 3T0AA 2A3CA 1SFTA 3PG8A 2VXNA 3UR2A 4HPHA 4XVEA 3QH2A 3BOLA 1XUZA 3WJSA 1ISWA 3VIOA 5E9AA 4JTHA 4Z1YA 2V82A 3OYXA 4RV3A 1RCXB 3E74A 1W6TA 2ICSA 2V3FA 3FEQA 2DEPA 3PUOA 2BY0A 3OZMA 4TV5A 3TOPA 1C29A 2JIWA 4O1DA 1UQYA 3QGAC 1M7OA 4UBPC 4WLCA 4BQ5A 2VZOA 3BMWA 5FJUA 3M6YA 3SADA 2XU2A 5I3IA 3UZWA 3OLGA 4HPNA 1PL9A 4F0MA 4QQUA 1JRBA 2X7WA 1RVGA 4YL2A 2ZA2A 4GBUA 4HPJA 5I79A 1IXNA 3QKEA 1BLIA 2XISA 1SSGA 3ITTA 1YNQA 2YZRA 3NWRA 3A3XA 3VIFA 2ZX9A 3K5XA 4RNFA 1XGZA 1RK6A 1E0UA 1QNPA 4PUUA 5B7YA 2FHBA 4LPCA 4QXIA 4R7OA 4L65A 3N34A 4EK7A 1FH8A 1PWMA 1XWYA 2VUYA 4KCTA 3SW6A 1QNSA 2PLMA 2GGGA 4IIBA 1T96A 4HYWA 4ZVJA 3CASA 3UWVA 1Q6QA 3NDOA 3ONCA 1NWTA 1ONRA 1IGWA 3QEZA 1SQ7A 3DG7A 3SUVA 2F6UA 3OZOA 3L4XA 2WJZA 2QPSA 5DN1A 5E09A 3SY1A 1B3VA 3B8SA 2HVOA 5HWMA 4LAZA 5FESA 4UCGA 4MY8A 1V0MA 1WA3A 2H9AA 2UWFA 2X41A 3KOFA 4RXFA 5FI8A 2J9XA 3EDDA 1ICQA 3P93A 3LCFA 1AZ1A 2UZ9A 5K4XA 5KZ6A 3MC5A 1KCZA 4PBFA 4PSRA 3DI1A 4Q8NA 1WBJA 1HF6A 1A3HA 2D24A 5G1TA 1FWAC 4B3LA 2BGQA 3V1PA 2Z29A 1W91A 3AMCA 3OBAA 1GVYA 3EOEA 2ZUVA 4IH3A 4DY1A 3BJTA 2R8WA 3G1DA 2ZC1A 1ODZA 4MMWA 2ZUUA 1S2TA 5G2HA 1XXXA 3T2OA 2FTWA 5TIMA 1US3A 4UOQA 1SFLA 1XIFA 4A2SA 1TG7A 1S3HA 3TZNA 1XX1A 5CGMA 3GXIA 2W0UA 1UIPA 4FB7A 3S6TA 1M01A 4LANA 4KH2A 5HMSA 2EF9A 1PXGA 1UD2A 1KQYA 3MKVA 3PBVA 3OVQA 3EX4A 4ZXOA 4O17A 2QHAA 4J27A 2C14A 4PCPA 2KX9A 3EEZA 1P0DA 2BTMA 1TJ0A 2O4QA 1UJPA 1CEOA 1JYNA 3VKAA 1UC4A 3F7JA 5C5YA 3E2QA 1UR3M 1VR6A 4MAZA 3R4IA 5A95A 1UCWA 3WYZA 3BOXA 4LU0A 4O0QA 2PDIA 1E55A 2VFFA 3QTGA 4GX9A 5CAKA 1AMYA 4E4UA 4JIHA 3WIJA 1KTCA 4ZQNA 3RPMA 3RN6A 5HPOA 3STCA 1ISXA 2FIQA 3FA5A 1GEHA 3EPNA 3H7VA 1W5PA 4ATLA 3RHGA 4M6VA 1X39A 1G6CA 5CJNA 2ALRA 3NCOA 4FMVA 5DMLA 3S5OA 2R9RA 3TN4A 2GSJA 1MUCA 4OV4A 2TPSA 4IG2B 2PFHA 3T40A 3LV5A 3LY0A 1SJDA 3QGKC 1UQZA 2GOKA 4M1BA 3LCXA 4JCLA 4LEQA 4O11A 4LF2A 1H63A 4NZ5A 1N82A 3EB3A 1HVXA 2VVSA 4LYKA 3R6IA 4O53A 5ABTA 5K2ZA 1A49A 4FXRA 2NZLA 1CNVA 3WJYA 2Z28A 5I7GA 1GOKA 9XIAA 3VOGA 3BOFA 5LXEA 4CCEA 3ABQA 2KAUC 3W1TA 5A6JA 3M9YA 1G7UA 2Y61A 3RPDA 1FHLA 2J79A 2PD9A 3WJWA 3PTQA 1RPKA 2R82A 3B9NA 4CVWA 1ZY9A 4Q8WA 3EBVA 5M5DA 3ZLHA 1YTKA 2NQLA 1DQUA 3NSNA 3DOPA 1A4MA 3HOJA 3N19B 4HYVA 1NTHA 3T6CA 3BLOA 1A5UA 1NF0A 2C13A 2E25A 2PCEA 3THQA 1O5XA 5G4HC 1YHTA 3IJIA 1KNWA 4GJJA 1WDSA 4GC3A 3S9YA 1NSJA 1GOXA 1TQJA 1EGZA 1V3JA 1VEMA 2DUXA 4WR3A 3ANYA 4AIUA 5FF7A 3RK8A 4LH8A 2GDVA 2WHKA 3TTEA 2CW6A 4B5WA 1HZYA 1E6PA 2XPKA 2CERA 1VBGA 5DFAA 1R87A 3DIPA 4GINA 4BCEA 1CGTA 1YPFA 2VGIA 5DCEA 3INPA 5DRIA 3OZPA 5BOFA 5KITA 3MW7A 4QQ3A 3NQGA 2YA2A 3W7HA 4H8UA 5K7JA 2PDCA 3AMGA 4QE4A 4BQ3A 4KERA 2HVNA 2VRKA 5D8WA 5LGXA 3KL5A 2R1NA 1OFAA 3WLJA 4A29A 2VWTA 3ARSA 1IIGA 4AB4A 3NQDA 5G4WA 2HE8A 3M47A 1QXLA 3B0YA 3GX9A 3CV1A 3N9KA 4Z2HA 4E0CA 2JKEA 1L8PA 3O6CA 4Q8QA 4IMEA 4CN4A 4H9ZA 4NAFB 1GONA 1K7FA 5XIAA 3G1HA 3H21A 1LBFA 4PB4A 2OEJA 1NFGA 2XH7A 4RR4A 3ARUA 4LF1A 4AC1X 3QMTA 3COTA 2X1SA 3AJXA 2VJXA 3HN3A 1MEIA 1SVDA 1VH7A 2WSRA 5CSUA 1D2KA 4E8DA 1RBLA 2DSWA 3W74A 1CIUA 2I5IA 3H4XA 1EC8A 1XIJA 1Z89A 5LZLA 4UMCA 5BWFA 1XBZA 1XQLA 4FK9A 1VFMA 1RAKA 3U2CA 2E1WA 1DHPA 5C6MA 3TWBA 3A13A 4PMXA 4P2VA 3USBA 4IMAA 1KFCA 4U33A 4O4WA 4QR6A 3BCFA 2BLEA 1VRXA 4AD1A 4PB5A 1KCKA 4LJ3A 3IPWA 2PGWA 3CZGA 4Y9NA 1BEUA 3HQNA 4ZMGA 3TX9A 1QUMA 3NO3A 1DQXA 4WZHA 4NRRA 3UCDA 4KQNA 4HOWA 3FEMA 3LPPA 3OA3A 5KZMA 4CD7A 1CLXA 4QITA 5BW6A 1WXJA 1KRAC 3DX5A 1GVFA 2WMIA 5GNXA 1J6OA 5D4YA 3M0MA 3STPA 4L1XA 2ZUWA 1OIMA 5I00A 2CLKA 2RFGA 2VZTA 2Z1KA 1XLEA 1KRMA 5G2IA 1H5YA 3WFLA 1AW5A 1UD8A 3KVLA 4Z1BA 4L61A 1KFEA 2GJXB 1NQ6A 1Q85A 4AD4A 2J47A 3DYOA 3LS9A 1R3WA 4PRRA 4NX0A 2ABAA 5HINA 4BY3A 1MDRA 1OG6A 3T1GA 1XCXA 3HB9A 1KM1A 4DHGA 4U28A 4KGJA 2FJKA 1D3HA 2ZIDA 1H50A 3I6RA 1AUSL 2PZNA 1KBJA 1QR7A 2XFWA 1PO9A 1XD1A 4JFVA 1GVIA 1HJUA 1QW9A 4LBRA 4JS3A 2P50A 4D1JA 1VBRA 3NNTA 4FX8A 3BDKA 3W2UA 4HNLA 4QTGA 1XLIA 2DIEA 5I23A 3W6LA 4YWSA 1L6FA 2DIKA 5DXYA 3NIYA 3FKRA 1E4MM 1V93A 3GH7A 1XLAA 2PSNA 4GKLA 1OX4B 4RLIA 4LNYA 2WVTA 3GLCA 3C52A 4ILSA 1SYTA 2PF8A 5FA5A 3DENA 4N7QA 1AA1B 1C90A 3S2CA 4RUBA 3G1RA 4UTUA 3GIPA 1Y0EA 3TP4A 5E1QA 2OZTA 3CQHA 5DMMA 1EDTA 4GK8A 2WJFA 4UOZA 1W8GA 1W9XA 3LXCA 4KWWA 4MWAE 3V7PA 5K4ZA 3N15A 4MNMA 3UXLA 2FHCA 4IG2A 1E5JA 4NYUA 4AZ7A 4IFRA 1PCKA 1QOPA 3WF4A 2CEQA 1W5QA 5C2CA 1A5AA 3GG7A 4XTDA 4IJBA 1F7BA 2LLEA 2ISWA 3C4UA 4G7EB 4K36A 1GTEA 2YFOA 3TIMA 3WQ6A 5LIYX 1QASA 1A47A 2ZFAA 4KEMA 3E5BA 4AIEA 2CKSA 5CG7A 5EU9A 2HK0A 1HKWA 1JZ3A 2FQIA 4O0ZA 1O6IA 5AC8A 1X8FA 3VIIA 3FJNA 1E3ZA 1V6VA 3U7BA 2A3HA 2ZWZA 1RD6A 3M0ZA 3TLQA 4H6KA 2XIJA 3LA4A 1MXDA 4JTUA 2Z24A 1ITXA 1TUFA 2F6KA 1X96A 2PF0A 2ADAA 2GDUA 4CUCA 2A5HA 2WQPA 4AWSA 1U1JA 3HGJA 3TLLA 3VUSA 4GMEA 1Z32X 1MFUA 2OQHA 3RX3A 3I7RA 1TE6A 3LRKA 3A64A 4REQB 2WHJA 3KUMA 3QR0A 1HN1A 3LPOA 4OUIA 4ORMA 4NF7A 5XINA 1VEOA 1WOAA 2WM1A 2QS8A 4FR6A 4Q3MA 4QE1A 2PODA 2V3GA 3NQ8A 3M6DA 4NX5A 4S23A 1YDVA 4WD0A 2A7RA 3CHCA 3GVQA 1DIEA 3NL2A 2DT0A 3VCCA 3Q4DA 3PHAA 5D2VA 4XZLX 1TTPA 2DP3A 2PC8A 1YDYA 2WANA 5CJMA 1O68A 2J8FA 1AH0A 3N3MA 4GYPA 5EYWA 2Z6IA 4U3AA 4O15A 4DZAA 1GKPA 2I5QA 3A4XA 5CPLA 1W3NA 3TTYA 4P8VA 2Y7DA 2RJGA 4NJKA 4MY9A 3W01A 2WSQA 3CL8A 3DHPA 1GQJA 4O4VA 3SUSA 4OBSA 2DVXA 3OLEA 3THUA 4WVXA 2ZC8A 4XD6A 4IQEA 4W7WA 2CZ5A 4PYSA 2JK2A 1P1XA 1SZEA 3AS2A 3NPWA 1NQKA 1DJZA 1R3TA 1ZJAA 1B9ZA 4NAFA 3P2VA 2E7FA 3U57A 5AHNA 1IEXA 4GGHA 4JX4A 3CUZA 3N14A 1NWSA 5F4XA 4KFPA 4MWAD 4EE9A 5ABEA 3P62A 1FRBA 4HHPA 4HN4A 3IV3A 3LHTA 2XINA 4L64A 2XFYA 3BAXA 4MUZA 3EWDA 2BBFA 3L5MA 1R3RA 3O8AA 5HMFA 3CC1A 4AD3A 3FOKA 3F5KA 3N2BA 1AL8A 4J35A 4C91A 1GYMA 1DKWA 4UTWC 3O9NA 4RV8A 4LVGA 2PD5A 3PBMA 2Q8XA 3WO8A 3MCOA 2AQVA 2BMBA 5HJYA 3UD6A 3WJXA 3N2OA 4O1AA 1TELA 2VCBA 3VC5A 1QPQA 3WQGA 4ZOAA 1WDWA 2QR6A 4FNTA 1SZFA 3A4WA 1NARA 1A50A 3CMFA 1LF1A 3AICA 3IIVA 2QQ6A 2HBVA 1O7AA 4K8GA 3T05A 1EZ2A 1S2WA 4ZO9A 3G1SA 3CT2A 4IMDA 1DIOA 1XV8A 2YB1A 4CLMA 1ZZMA 2J8TA 3KDNA 4B5XA 1U5JA 4HMDA 3PJTA 2AKZA 1GKRA 1NJJA 2ZA3A 2R1MA 5HMDA 2X1IA 2YA1A 2ACSA 4YN5A 1PHWA 3W1QA 5I2UA 2E9LA 4H19A 7A3HA 3V0SA 4QG6A 3GB6A 2PDKA 2NSOA 1Q7MA 4CNNA 4G8TA 5AZ1A 4EX4A 4XUGA 5BYWA 4AG0A 1XM3A 2GJXA 3DESA 1KA9F 1IGSA 1YNPA 2J78A 1JGIA 4KIEA 5BZAA 3PZ9A 4M19A 5T9CE 4F48A 4MHBA 1B3ZA 3W71A 1H62A 3W2KA 3LYEA 3A47A 3TTQA 3AJ7A 4Q7NA 3ZIZA 3V16A 3IUDA 3AO0A 2V81A 5BXPA 4EPEC 3GYCA 4GABA 3IV8A 1HJVA 3S5YA 4CEUC 1W3LA 4G7FA 1PTDA 3RXZA 3CHEA 3BZGA 1R9XA 4DJFA 2FZBA 2NQZA 1G5AA 2OODA 4HNTA 4AHPA 2A6LA 5LKYA 3ZJ7A 3ISIX 3MJYA 4XZIA 2V6AA 1FH9A 2GGEA 7REQB 3NXFA 2NV1A 4H7ZA 1DPMA 2PWHA 4TX9A 7TIMA 3KBMA 2V30A 3S3GA 1VGAA 4DWSD 3H2MA 4U3CA 3OZYA 2P10A 4H7VA 5LGZA 4RE3A 1ZGDA 2WWCA 3LERA 1JZ5A 2BVWA 3RU6A 3SQSA 4US6A 4L4LA 4DAFA 3CUFA 4K37A 1O5RA 4LEFA 3SI9A 2O56A 2FYMA 1Q65A 3TR2A 1E0WA 1FWBC 1GOOA 5HWJA 4G7EA 3PANA 5AHMA 3BGJA 3CAWA 1YE4A 2QIIA 1DWFM 4O12A 4JEQA 3N25A 4Q4PA 8A3HA 3MANA 3GNXA 3PULA 4LCSA 4PRTA 3I4KA 3T0CA 3RMEA 3VMNA 3SY8A 1N55A 3W7KA 4DN1A 1WE5A 2CETA 3E5PA 4FXJA 4I5RA 3S1WA 1OC7A 5H6HA 2VX5A 1XYBA 2DPEA 4GKTA 2PDUA 4WDTA 3S2LA 5F1UA 3GXPA 3TYZA 3QHOA 5HBFA 3VM5A 4RDVA 1BYAA 1WDDA 3BWWA 2GUYA 1UR4A 3MV01 1EYEA 3W27A 4REQA 3VMPA 1MMFA 1K8CA 1I2QA 3FNDA 1TTQA 4W88A 2F8QA 2ZZ5A 3MP5A 4B9YA 2FPVA 3K1GA 1ONEA 3N3TA 4JICA 1E9ZB 2G3MA 2J7HA 3KCJA 3GHUA 4S3GA 2ZYFA 3B04A 1A5NC 3CIXA 1EXPA 4ML4A 3SCOA 5I3FA 4GJ1A 1ONWA 3U5YA 5KSWA 3AIWA 4JQ2A 2WMGA 4HNNA 4ZZ9A 1W9VA 3DFQA 3EWXA 4D6EA 4EAMA 1MDLA 3VX0A 3WDHA 5DLCA 1YYAA 1K9EA 3G1AA 4D1IA 3NQCA 3STFA 5M3WA 3BW2A 4C1NA 1TVLA 1E6XM 2BHZA 2TYSA 3C3UA 5DCDA 4S3AA 1CW2A 4U5IA 4C5ZA 1W17A 2W5FA 3EKGA 3R8HA 3QW3A 4V1XA 6TAAA 1ALDA 4R7JA 2WBGA 4ATDA 1IEQA 8CGTA 4HZ8A 1OFQA 3GH4A 2WKGA 2YXOA 4UUIA 1TPEA 2VCCA 5BOOA 4AH7A 2HZGA 3VGHA 2B0MA 2XVLA 1XLFA 1LLWA 1TX0A 5DBTA 4I7UA 4HU3A 3NFUA 4PZVA 4LRSA 4C60A 3NPVA 3OBEA 4YCPA 3DXIA 5A6BD 1J01A 4B5UA 4TU1A 3AYVA 1Q7QA 4DXKA 4IT1A 1UASA 5ENLA 4PUEA 3T8QA 3LCGA 4NT0A 4EPBC 4M56A 2OMAA 4PSPA 4HTBA 2BX7A 3W7RA 2A79A 5KTLA 1YXYA 5FOOA 4WKAA 2PI6A 2YYTA 4Y9PA 3F5LA 3CUGA 1PCWA 2PRHA 2PA6A 3F4CA 1DTUA 1FWFC 3IK4A 3B0VC 3BLFA 2QLYA 1RJQA 3U7VA 1Q6RA 1ZQ5A 3GC2A 3L5AA 3GK0A 3MP4A 2ZRVA 3VUPA 3AOFA 3KP0A 4IPJA 1TTJA 1JNDA 1FWGC 2EPKX 1PV8A 3WQ5A 2OZ0A 4XAGA 5D2WA 5CBBA 1ISZA 1Z42A 5AC7A 2YCKX 3I7SA 1S3TC 3IAQA 1H1ZA 2IPGA 4JIEA 1SPQA 3U9IA 2NSXA 1V3HA 4LUSB 1P0NA 4N6FA 3QGVA 3RPTA 3GG0A 1IWBA 3LX9A 4NU7A 5AC4A 4C1LA 2ZX7A 1LRTA 3K8LA 2AOSA 4ORIA 2O92A 4IPPA 3GVVA 3O63A 2YKKA 2INZA 1W1TA 4AEEA 1J0YA 1FFRA 1VYRA 2VMFA 2E3ZA 2IXVA 1V03A 1UH4A 1B3YA 1YIXA 1ZJHA 3ZOAA 4O8AA 1TPDA 3KTCA 3SIZA 1HKVA 4JYFA 2XN2A 4Q8UA 4ERIA 3H2OA 4QRNA 4WDXA 2REQB 5DANA 1ZPTA 3C2FA 1JCTA 3TNBA 5EL1A 1EF3A 3WLMA 4C6CA 3UXDA 1KM5A 2CZFA 1EJSC 1V02A 2BHYA 5AZ0A 1JXKA 2Y6ZA 1JDCA 4LAUA 4HP5A 3SURA 3PZGA 1Q13A 1WAUA 2G3FA 5AB3A 1XKJA 3VTRA 2VI0A 2VKZG 2J77A 3SCQA 1KM3A 2QKFA 1DBTA 3KRSA 7REQA 2XIIA 3HIJA 5B80A 1M6JA 2INFA 3UWUA 3WH9A 3NYZA 1XIIA 2TAAA 4F8XA 4FNUA 4OV9A 3NZQA 4IXHA 4UFIA 3VD5A 3ES7A 3QTPA 1KV5A 4DJDA 5MF5A 2HS8A 2W66A 4KRTA 5H2ZA 1UB3A 2OWXA 5A8NA 3QPEA 2FPYA 4CQCA 3E9AA 4GY1A 4A3HA 3PWIA 4GI4A 1R6WA 4GXWA 3LGEA 1DXIA 3DEQA 1M7PA 3HMJG 3W7IA 1G1YA 2BSLA 2OB3A 1WO2A 1Z69A 1QATA 5F4SA 2IQDA 3BLEA 4IP4A 2BGSA 1JPKA 1GHSA 4GHRA 3W3OA 1QPKA 3QQWA 4Z08A 1FH7A 1KXHA 3CV7A 3UR8A 2O9PA 1PPIA 1JDFA 1NOUA 3P67A 5FJJA 3T4WA 3ITYA 2ZQ0A 1BFNA 3G3DA 1CLVA 3LXBA 3D6NA 3S5NA 4B5TA 1FVPA 1WXZA 1HL9A 2QXWA 4POCA 3ABRA 1S1PA 4NNBA 1CT5A 1G4EA 4W7UA 3GKFA 4Q8VA 1W3TA 1VLIA 3L68A 1VHCA 1J4EA 3EA2A 2PP0A 3K1DA 1S2CA 3VE7A 3IANA 4IICA 5A8OA 4TVCA 4QCFA 3B4UA 4S3KA 1LDCA 4Q8TA 3AMDA 4LQ1A 1QFEA 1EA9C 1S39A 4KFNA 3AWNA 2XVGA 2OYLA 4E2BA 4K39A 3UCQA 2DZBA 4NZFA 1SGJA 2FZ9A 3N1AA 1GK8A 1EB3A 1NH6A 4L1WA 2VQTA 3VPLA 3MKCA 1X6UA 3B8WA 3WLTA 1MYRA 3VCNA 2ZZ6A 3FY1A 3MSDA 3TJ4A 1OFPA 1VIWA 3WNMA 2VC5A 3B8TA 2X1UA 3MY9A 3ITVA 4NJGA 4R5EA 1HP4A 4FSAA 1FCVA 2CC0A 5FF2A 4R88A 2TODA 1P7TB 3FA4A 3GVRA 3NDYA 1E40A 2XTKA 3SSJA 1HNYA 3CLMA 3HGSA 1GCYA 3EYPA 1B2YA 2OT0A 3WQCA 4I6KA 3B05A 2HTMA 4PUMA 4C6OA 4B92A 1W5OA 3G3MA 4R9XA 3VNLA 3KXQA 3NDZA 4HA3A 3L23A 2YX0A 3TWAA 3WQEA 3W7QA 5LA2A 1HT6A 3ARXA 1Z9AA 4GY7A 5AHIA 1IEIA 1XIDA 1Q3NA 1G4SA 2JQXA 3M43A 4KBXA 4RE4A 3GNNA 1U1UA 5DT5A 1K3UA 1RLCL 1IXOA 3FSTA 4IQDA 5IHRA 1GYLA 1C8XA 4Y90A 5DRCA 3TYDA 3WD0A 2VDGA 5L6UA 3R8RA 3AIUA 3ITGA 3IACA 1XH0A 3KZSA 4GFIA 3GW3A 2QT3A 3G8RA 4RPPA 2VEFA 3G0XA 1G67A 1AK5A 1LQ0A 1NAL1 4WGHA 4C90A 2A3EA 4UQBA 1NVMA 5F2GA 1XDMA 1N2VA 2FDSA 3WNLA 4H9MA 3IJ6A 2X05A 3EOOA 2VC6A 4ZTYA 3OIHA 1R7AA 3GR7A 1K9FA 1S5NA 1D7FA 2ZVIA 3CEPA 5LNWA 1G69A 3ARTA 4XBKA 3AXMA 2IS7A 2CNCA 1O1ZA 3SRDA 4HU8A 4XZBA 2A6NA 1E56A 1WYIA 1CWYA 2OOFA 3IUHA 3KS6A 3FXGA 2GQ3A 3LPGA 2JGQA 1O1HA 1N7KA 1UBPC 2P8BA 4GYKA 5IXEA 2ZX6A 4H9XA 3L0NA 4ZFMA 3GM8A 2VZVA 3FS2A 3E96A 1HFBA 3RR1A 1ZB5A 1PBGA 3NYDA 1VQTA 1XRFA 2NWRA 2X2GA 4A35A 3WUFA 2EPMX 5CAHA 1H51A 1UKTA 1J9YA 3CXOA 4CD4A 4C6FA 1WX0A 1W3IA 3BGGA 3W81A 1SO3A 3MI2A 1X1OA 2X40A 4HZ7A 2OX4A 1KGUA 4YTRA 3WDJA 1F3TA 1PSCA 1P6WA 4AAJA 1XGEA 4LUSA 3VMOA 4URIA 4C7DA 1I0DA 3VZYA 1EIXA 3BICA 6XIMA 4RNJA 5I02A 4G1KA 1XIHA 1ZALA 5GJPA 2PS2A 2Z4GA 4I8DA 3ZLFA 2WKLA 5GJNA 2J9ZA 4DVOA 4O10A 1JCMP 3ZR5A 1S46A 2NQHA 2W91A 4LBUA 4IISA 3FYYA 4LAOA 3UT0A 5CZTA 2REQA 1I0BA 1HJWA 4RXGA 2WMJA 3UESA 4UTTA 1TKKA 1WXYA 3S46A 2BGNE 2DW6A 5LYRA 5HATA 2DVUA 1FWCC 3KRZA 4JOMA 2QYGA 3L4UA 4IP5A 3LLFA 1W2VA 4JPGA 5EMKA 1RBAA 3P8JA 3PSWA 2V8ZA 3BURA 1QI3A 3RM4A 4Q4OA 1BQGA 3APGA 3WD1A 3W24A 3CHFA 1JEZA 4AZIA 6PTDA 3N18A 4NJHA 3G1VA 2B7NA 3EWBX 4RPQA 1PJ9A 1KFJA 2V5LA 1J18A 2ZDSA 4QGCA 5ECUA 5D32A 2Q3RA 1WZAA 4FOUA 4FOKA 3N2TA 1QHOA 4C5YA 1UR9A 5AHEA 3EOSA 1JD9A 3K8KA 1I1WA 2ZUMA 5RUBA 4NI3A 4QEEA 2ASHA 3LRMA 4HB7A 3O6AA 2CWNA 4YCOA 4JR5A 4L4MA 3BG3A 1E1EA 1SU5A 2INEA 2ZDRA 2ZUSA 3TCSA 3T2PA 3UG4A 5I0DA 1OIFA 5LA0A 2VP8A 1OYCA 2OCZA 4RX0A 3BE7A 1E71M 4OBTA 3L2MA 1Q4NX 2OWWA 2Z1XA 4OUEA 5CGTA 4UIOA 3CIWA 1MRAA 1W9UA 5PTDA 2FGBA 3WMSA 4UZUA 2FFCA 3AI0A 3RF9A 1NFPA 4UFLA 3B3DA 2NXHA 2EAWA 2O4MA 1D3CA 4BI7A 4V2XA 1MXGA 1JFXA 4GIEA 4NSBA 1RA5A 4RZ5A 2J7CA 2XIQA 3MV11 4I8YA 1YQ2A 2ODOA 3GW0A 2W9MA 3SUWA 5C55A 3OOQA 2C16A 2BDQA 1J0JA 2XJ7A 3RCMA 3WUEA 1D8WA 1E9LA 3VNIA 1VCGA 2B7OA 3ZQ9A 2Q8ZA 1YXDA 3D5HA 4LWWA 3BSGA 3GS6A 4ERAA 3VDCA 2V67A 2DY3A 1TREA 3OGVA 5T91A 2G3JA 3BLIA 1DWGM 4Z2LA 4GNKB 4HK5A 5D30A 4V33A 4WDWA 5HUPA 5LHFA 1R47A 4D8ZA 4WY0A 3WFAA 4AZ6A 4QJ5B 1J5SA 4RDZA 1XISA 3ES8A 3DU0A 3BPWA 4GQBA 3VNKA 1DXEA 2DQXA 1RALA 1MW3A 1FWDC 3AIBA 4MWAA 3MHGA 1OCQA 4KS0A 4ZB0A 2PRLA 4IFOA 1YNYA 5REQB 2FVLA 1VHNA 1JZ8A 3POHA 1QOQA 1YDOA 4EXBA 3VDAA 1SZNA 4UNKA 4D2JA 3GIYA 3K13A 1OYAA 3USZA 2DZWA 4WK9A 3M0KA 2NX1A 1C8VA 3IIZA 3QQ0A 4DJED 4JTJA 3O16A 1EH9A 2XSXA 1HGWA 2DJXA 5CG0A 4A21A 3HPAA 4JQ4A 4NNCA 1DWJM 4F40A 3KL3A 3APYA 4YTTA 1WUEA 3UZZA 4Q33A 2ZRZA 4UR8A 1NWUA 2OZ8A 2Y2WA 5TF0A 3TAOA 2E67A 4JBRA 1GQKA 3Q65A 4XKYA 4UTLA 3A4AA 4ZOBA 4WIWA 3BAYA 4QAIA 3P74A 4J3UA 5CPOA 2HISA 1V08A 1WNOA 4Q4RA 1ECQA 3Q2DA 3TXZA 2FZ8A 4H6EA 3OODA 4E38A 3A5VA 1JDDA 2W92A 1P43A 4QSFA 4K2SA 1OFOA 5DX7A 2XH4A 1HJSA 1WOBA 3WF0A 3TDFA 1PKYA 4J3WA 1SR0A 4CQDA 5EB8A 4GVIA 3T0TA 3UWWA 3O06A 1RPXA 3DN5A 1JNEA 4D6HA 1JI1A 1DTNA 3EDJA 5C2GA 1F76A 1KCXA 2OLHA 4NZJA 1HUVA 4K8HA 2PGFA 5JVLA 4UMAA 4INFA 3RR4A 4I9TA 4PUKA 1XLLA 1BVZA 4XO6A 2F61A 1A4LA 2OQLA 3LDVA 4NG3A 4A3YA 1ZBVA 2CHNA 4MJ4A 4UTHA 5A6SA 1XLCA 4Z2JA 3WNNA 3S8HA 3EA3A 1MWOA 1UMYA 3AC0A 1TV3A 1OFEA 2H90A 3J7HA 3VYLA 2PGRA 2YGYA 1NFBA 3VXGA 3LTPA 2H8XA 1L6GA 5G2WA 1W1IE 2EBNA 5H1WA 4S38A 3ARWA 3LQGA 4ZO6A 3C0QA 1FWWA 4KWUA 3ITLA 4JL1A 1LOSA 1JCYA 1O94A 4L4OA 5KZEA 3WELA 3ELFA 2XM1A 3TROA 4QIUA 3PR2A 1SW7A 3AAMA 4JL2A 1IWAA 3GWQA 1EHNA 4AEOA 1XI3A 4ZB2A 2CLIA 2WNNA 4S3EA 1NWRA 3NQFA 5JIWA 1PX4A 4KMQA 4M80A 3F2BA 1IF2A 4TVUA 1EJUC 3IGXA 1EPVA 3GY1A 3HQ1A 3ABSA 2J88A 1PX3A 4UTFA 3IIOA 4MZ8A 2WNQA 4JIPA 3L4TA 1YKWA 2G5WA 1ONXA 3UNDA 4I7VA 3T9PA 3UXIA 1SUXA 1W1PA 4AUBA 4GPNA 4I7WA 9XIMA 1T99A 3PP7A 3P7YA 4DEFA 3DI0A 1V6YA 3W6MA 1RQBA 2WZIA 3QOKA 5GNZA 1FXPA 8TIMA 1OX5A 1BG9A 3NAVA 1WQ5A 4RW5A 3A6OA 3SGGA 1RK5A 3W72A 2FTYA 3FLUA 3PBWA 1HO4A 2CLHA 3OLIA 1K03A 1M68A 3GKAA 3KAOA 1QW7A 3QW4B 2HXTA 2OELA 4NJIA 1R86A 5IBXC 1V0KA 1PWLA 3M0IA 3NSXA 3ZWTA 3GNDA 1HVQA 2F38A 2QAFA 4FNSA 1SMAA 3MZNA 5A69A 3AS3A 2NT1A 4QLLA 4Z2GA 5K9CA 1I9CB 2OVLA 3NZGA 4HCDA 1R7OA 3GVGA 3QMSA 4OIFA 2W4XA 1RLDA 3FA3A 3UU0A 2RGLA 1IWPA 3LGGA 2OKTA 2POTA 5FL1A 2OYKA 3CNYA 3GSMA 1QO5A 5D2YA 2Y5SA 1TVNA 3H2CA 2OEMA 2V9DA 4ROPA 1A80A 3OVPA 2YFNA 2IKGA 5IM51 1L2QA 3HF3A 4AWUA 1XH1A 3PZNA 3F03K 1W3KA 4ICCX 5A6KA 3P6LA 3LCHA 1KKRA 1PIIA 3PWGA 4RDWA 4I5XA 4JTEA 3DHFA 4TOQA 1H7NA 3GO2A 3I6TA 3HV8A 4AMAA 4YHEA 3OG3A 2DZPA 3DHDA 4MPKA 2ZICA 3W7LA 1PVNA 3VE9A 1CB7B 1QI4A 1VFFA 2BZNA 2ZTJA 3MTWA 3KVKA 4IOTA 1K4GA 4AWEA 2ZA1A 1KRCC 4DBDA 1UJQA 3NGJA 4QEHA 3PTDA 3TK7A 3O0KA 3WEMA 2P53A 4OU1A 2Q3OA 5EBUA 1I75A 4NJJA 4GUJA 4AVNA 1K70A 3R58A 3WLIA 2D0HA 3WLHA 3AU2A 2ISSA 5KINA 5D03A 2XWDA 4GJIA 4LY8A 3EPOA 1EJTC 1JCJA 2YIHA 5A3HA 3WQDA 1EEXA 3KHJA 2QULA 1ZFJA 3IVUA 3QFWA 4ROQA 1M9HA 1AODA 4NL1A 3BH4A 1WAWA 1UROA 1QHZA 3O6YX 3S6OA 5CC7A 1FHUA 3W75A 3I3EA 4MGGA 1MNZA 2I9EA 3VKBA 3TOYA 4JD4A 2WZMA 3EB4A 2E1DA 4Y8FA 1H41A 4MZ1A 2PTDA 5A6BA 3W37A 4LB4A 4QDWA 1E0TA 3TFCA 1TJ2A 2CZEA 2BY1A 1C8YA 1GORA 3BAKA 4ZO8A 4Q7IA 1C7SA 2DQWA 5TQLA 3W02A 4DB7A 1DJXA 2FHFA 3DERA 4EXQA 5AYBA 4IL0A 1KB3A 3BCDA 4ZOEA 1KGXA 2V3EA 1VBHA 4O13A 3ZLGA 1OGSA 8RUCA 4CU7A 4LY4A 2AQWA 4EP8C 4QAWA 1BYDA 4MNLA 3R12A 1E6NA 4NQ1A 5LIKX 2HVMA 2G8ZA 2ZZ2A 1KLZA 4LFYA 3LGDA 5J5DA 3AZRA 3WQPA 4N42A 2NV9A 4A3QA 2ZRWA 2XGBA 5CXPA 3FYPA 4EVZA 1E9YB 2F2KA 2HBXA 4B90A 2Z1WA 1HO1A 4WJXA 5CZJA 4X3ZA 2ZZ4A 3ABXA 3HPZA 1K6AA 3W28A 4O1FA 4PCTA 3SGZA 1A0EA 2WC4A 1FFQA 4LYRA 5CPSA 5C54A 3H23A 1L2UA 4MFDA 2B81A 1LUCB 3NXLA 2BP1A 2A3AA 4B16A 1IV8A 2XGZA 2CLFA 3VINA 1EGMA 4R3UA 1XL9A 1CECA 1XLGA 5GVJA 4LSBA 1F07A 1XRTA 2WCSA 3HFYA 2AAAA 2V5DA 4CD6A 3BUVA 1BXBA 1M04A 2DZVA 4KCVA 3U3HA 5E93A 2O9RA 1B9BA 3NOYA 4M24A 4L5ZA 4GQRA 2E6DA 4WDUA 3ONBA 1A5LC 4IGNA 3LQLA 1GZJA 3KBSA 1FXQA 5A5WA 1KC7A 4X22A 4BEQA 3T08A 1EP2A 2D2HA 1OF8A 3OHMB 4PFHA 3KCOA 3UGVA 1E4IA 2BFGA 3ENLA 4FO4A 4FIQA 1J96A 3F4NA 1GYNA 1UA3A 3W2NA 5LNRA 1FWJC 1OCNA 1T0OA 3V3WA 4CD5A 1G4PA 1JUEA 1US2A 1XLMA 1UWQA 1XINA 1JYWA 2E77A 5HXMA 2QCMA 1YDNA 1B30A 1EEPA 1FWSA 1CX9A 4QE5A 1ZHAA 1K77A 3P3BA 2DZAA 5CPMA 4Q8MA 1I8JA 4PMRA 1BG4A 2VOMA 4C6DA 1Q6GA 4NILA 3UPWA 5HR6A 3QY6A 3QHMA 3UY7A 3E2VA 3EAUA 4IUOA 4PTDA 4J1OA 2I14A 3SN0A 2RDUA 2GVYA 4FA3A 3A12A 4OGZA 3NQMA 3BG5A 5HQLA 3MBDA 5FF4A 2WCGA 4OBRA 3BJSA 2PAJA 2I7GA 3M64A 1F5ZA 4ZODA 3VAVA 1UKPA 4C6EA 1VYPX 1CGYA 3CTTA 7ODCA 2PMQA 3PUEA 4H00A 2E0PA 4G56A 5D04C 2J8GA 2Z2UA 4IPNB 2J25A 3I7QA 2WB5A 3ANUA 2DSKA 1CB2A 2OXNA 3QN3A 4K38A 1U30A 3DG6A 1JIBA 8XIAA 3BAIA 4UTTC 1RJPA 4DM1A 3A21A 1EZWA 4HVXA 4GZ7A 3AIVA 1CGXA 4A6GA 2QCGA 4UQDA 2GYIA 3QMRA 3TC7A 1W1B1 2C6QA 2YW3A 4K68A 2PDXA 1S2VA 2PU0A 3NTYA 2WV8A 1ZNNA 4AZCA 5E6YA 2A2IA 4YS1A 4MDPA 1CGWA 1KKOA 3PPHA 1KM6A 3UXAA 1XRVA 2J62A 1IR2A 3MSRA 4S3DA 1XF0A 3NG3A 4HHLA 3CH9A 3JRKA 3DFNA 2QGYA 1JQXA 3V75A 1A5SA 2PC4A 3PBYA 2G95A 4HQVA 1YPXA 2I56A 9CGTA 1C3FA 4JTSA 2OR2A 1LYXA 4DZ5A 5D8ZA 1Z44A 3EOUA 4DJFD 3PJUA 3EX1A 4GCAA 3M44A 2BY3A 2XVKA 4H2CA 4TMCA 1DJHA 5U4NA 4B3KA 2ISDA 2L5HA 1E4LA 3IIPA 3UW6A 2E28A 3BGAA 1CXKA 2QCLA 1JCNA 2QCEA 2CLPA 4RDYA 3TZFA 1UWSA 1KFBA 3W29A 1CCWB 4M81A 1E9IA 1TZ7A 3WBEA 3C6CA 2CBIA 3C2VA 4LC8A 4M82A 4J4KA 4R53A 3C0LA 3LMZA 3RO8A 2EKGA 2NX9A 4GI9A 3WMBA 2Q71A 5EFFA 4RZBA 3N4EA 2OFJA 1POJA 1HW6A 3OGRA 3CHVA 1X7FA 3Q37A 1BTCA 2FLIA 2YDSA 2BXVA 3ZJKA 1T5AA 1CZ1A 3M0HA 4K1WA 4PUWA 3PNZA 3L7RA 4B5VA 4DRSA 3BXWA 2Z7KA 3O05A 3CMJA 4L6HA 3R0DA 4DI8A 2IPWA 1ZP3A 3WK0A 2X7VA 3NJ3A 2XFRA 2ZXQA 4CCZA 4CQAA 2CLMA 3LTSA 4ADTA 4OVXA 1KBKA 2EPNA 4ZE4A 4PUJA 1JPIA 4HJFA 1DYSA 2VVNA 4IGSA 2OOGA 3VKJA 4F3HA 1BYCA 4MWAC 4W8BA 2OEKA 4DLFA 3F4VA 1IXPA 4N2YA 1TIWA 3UF9A 2Y7EA 4GYFA 3MI3A 3SY5A 4QS6A 4QP0A 3HPFA 3TYBA 2VR4A 3P0WA 4FX7A 3GDMA 4BKNA 1TWWA 4YYCA 4C1KA 5LIXX 3HG4A 4L7ZA 4XIAA 3B9OA 3T0DA 1K02A 1EJXC 2GOUA 1HIZA 4UFKA 2VR2A 1V51A 1QK2A 1UP0A 3IJ8A 3L0KA 3CQIA 4HCHA 3CLWA 4N4PA 1CXLA 1F6KA 3I68A 3VGEA 7CGTA 1M7JA 2A7PA 1AH3A 2X0HA 3G6LA 2YCEA 3OO2A 4DUWA 1W56A 3PBUA 5JUVA 1UD4A 4BWLC 1YW1A 3VKKA 1XIMA 2QCDB 2PU1A 4H9YA 3TQPA 4A8NA 4DBWA 4TVDA 4BQ4A 2V5KA 3WQVA 3HU7A 3IIXA 3C56A 3F5JA 1CXIA 3OP2A 4UFMA 4E4PA 4UB9A 3QV6A 1LROA 3WQ4A 4KFOA 3KOZA 1UWIA 2XH0A 3SB0A 2XGIA 4K6AA 3LBOA 4IMCA 3H55A 5C8BB 2VTFA 4H4IA 4OTKA 5CLTA 4H9TA 1J79A 1V02E 3OJGA 1H2JA 3M5VA 4AIOA 1AW1A 1IEVA 3KHDA 3B8VA 3P81A 3GXMA 1I60A 2O7QA 5A6MA 4IPLA 4KWSA 4M3PA 5AOUA 2YYUA 3I6EA 3W2JA 1UP2A 2DH2A 2E6YA 3SCWA 1ZAIA 3N4AA 2V63A 5AYXA 2J75A 1KGWA 2CWXA 3UP8A 5JH1A 1EPXA 3UZXA 1J93A 3NZRA 4FNPA 4LBSA 3W25A 3PZUA 1CLKA 2Q6ZA 1WCGA 5JH2A 3CB8A 3L2LA 1S1RA 3CPGA 4XUYA 2J4GA 2XM2A 3TVAA 3CIVA 4J28A 3SQMA 4ZQRA 4GISA 3VU2A 4P8UA 1CENA 2A3LA 3LHUA 1Q8AA 3UJEA 3R0KA 5LXXA 1R3YA 4JDBA 3S0CA 5CPQA 1HKKA 3UJFA 1JVNA 1V8EA 2VGFA 3O6DA 3GHSA 3ITOA 3W23A 1VPXA 1ZAHA 4JNMA 4JN6A 3PUGA 1MZRA 3W76A 1J11A 3DFOA 5C9XA 4JN7A 3PWAA 1KTBA 1JUKA 2QIWA 3RJYA 1V3IA 3T4CA 5DCBA 3BSHA 1DE5A 3VNJA 3V1HA 2F7FA 3LCLA 2VZUA 1TQXA 4RE0A 2MUCA 2ZTKA 3VI2A 3RLVA 3SRKA 2NLIA 5C7VA 3AHYA 4LS2A 3VX1A 4WKHA 3OTRA 4Q4SA 4LUYA 2W67A 1VFLA 4DWSC 1RR2A 3UNTA 3H70A 1H7PA 5KETA 1Z7AA 4WXYA 1QNVA 2PLJA 1WKEA 3XINA 1XG3A 3MMWA 4MAVA 5G4EA 3G6MA 1FWTA 7TAAA 4S2CA 4MY1A 4K8EA 3O0FA 1HQTA 1YMYA 2C3ZA 4YVVA 2PDMA 5MKGB 3E3HA 3PY2A 3GZ3A 4QCEA 4D6GA 1PHQA 2YDAA 1WV2A 3L2IA 3M5XA 1RCOB 4MB1A 4PMDA 5DMNA 3BARA 2HCVA 1XQKA 5BXRA 1Y7VA 2BOEX 5CPNA 1D8CA 4IX0A 1S38A 3WLLA 1MW1A 3PSVA 3QYSA 1UR2A 1FP8A 3WLNA 4C6MA 4AFYA 1LORA 2TRSA 4JTGA 3W4RA 5D37A 3SCPA 3CEUA 4MF4A 2W27A 1QO2A 1DQWA 1K9DA 4JGDA 1XC4A 4DNMA 2WSKA 3EX2A 4JZ5A 5IOBA 1PDYA 4WOQA 3SCSA 1OADA 4KRUA 3M0VA 1JZ7A 5TNVA 4M7TA 3LOTA 1D7KA 1MEWA 5H8UA 2Z25A 4RW3A 5HNUA 2PPGA 5AYYA 4G2DA 2XZ7A 4QNEA 1TO3A 1RXOB 3EWCA 5F2LA 3W2LA 4DJEA 3TAKA 2VM8A 2GL5A 4J3ZA 2QVHA 1V4YA 3GG1A 3H54A 2WSYA 3W00A 2UBPC 1YPIA 3QR1A 2QW5A 4LV4A 1FCBA 3B03A 4QJ1A 4IGHA 3LD5A 3O3RA 4EOUA 3CZJA 4DJDD 3R43A 4DYEA 1POKA 4YNGA 3RAOA 3LPFA 4H6RA 2I17A 2RHGA 4LCQA 4LT9A 1ITQA 1R46A 3GFYA 5I06A 1ADOA 3BCJA 4AW7A 3W84A 4KIRA 1OBAA 1K6WA 4XKMA 5BCAA 3UWZA 1VLWA 4EWND 3ZVHB 1LOLA 4GXPA 2CZVA 4DO6A 5CZSA 4JTDA 1ADDA 3FAWA 1TPH1 1TWSA 1M3UA 4UOJA 2FB2A 3LG3A 2WMHA 3WLSA 4QHRA 4UFHA 3MT1A 4PTMA 4TR9A 1TJ1A 1MZHA 3VOFA 3T7VA 3GRIA 3JZUA 4E2VA 4PB3A 1P0BA 1R9ZA 3RUBL 1V79A 2PDFA 1A0CA 3KOXA 2CLOA 5HNNA 1R5YA 1PKNA 4XV0A 1XYMA 4XZ9A 2CXEA 2WZTA 1UR0A 2EJ1A 4NY2A 3UPBA 2CKRA 1XP3A 4L6OA 1BVNP 3XIMA 3N04A 2OGYA 4S3BA 1VAHA 1S5WA 3MPGA 4XZNX 3R1ZA 1XYCA 3YPIA 3H2FA 3FVMA 4BHYA 4HNUA 1PIFA 1NDVA 5H91A 2FPTA 3KRBA 3UZYA 2AAMA 3G2GA 3EWZA 3EXTA 1DP0A 3E2RA 2V3DA 4WKFA 3AXHA 2EG7A 4CEXC 4ACZB 2FH8A 2HNEA 4YXGA 8XIMA 3GU9A 2HMCA 2DSUA 3P0XA 1IHIA 1K1DA 4D9PA 1RY8A 3NO1A 1LWJA 3VZZA 3OVRA 4BS0A 3LTYA 3GH5A 3A3HA 5IRPA 1E15A 1OEPA 1NDZA 1WB0A 2GUUA 1R2RA 2QCDA 1TV4A 2J24A 3NGFA 3ZXWA 1J10A 5D9OA 4M6PA 3VA8A 3Q45A 2WAGA 4D6FA 2NUWA 4GXMA 1PE1A 3TN3A 1EJRC 1FA2A 3AIEA 5CKSA 4A4AA 4CN6A 2WMFA 3REQB 4HTYA 4AIBA 1THFD 2BB0A 2IQTA 2Z1VA 5FEZA 5BNKA 5HMEA 1EL3A 2WKJA 1EP1A 1A53A 4PCNA 1BAGA 1E72M 3WLPA 2QJJA 4DYJA 3PVFA 1OVDA 1UZDA 4TX6A 5HPCA 4HA4A 5DQPA 2NT0A 3G1YA 1QNQA 4X60A 3PZTA 1KQZA 1O4UA 4PR4A 1DJGA 3V5CA 5FCZA 4S3CA 1P6BA 4GA8A 3VVGA 4MZYA 3G8EA 2YR1A 3HA1A 1B4KA 1U1HA 1TMLA 2HPMA 1DXFA 3U2EA 3UYCA 4ZSTA 3G1XA 4MM1A 4O16A 3GR8A 1F8IA 5E9XA 1Z8AA 3MWCA 3VNZA 1X97A 4OHQA 1DWAM 3KS5A 2V5CA 5JBEA 1LM1A 2OYMA 5EMLA 3FGCB 3AUOA 3M41A 2C91A 3SRHA 1GOWA 4JTRA 3KX6A 5FSDC 4IFKB 3BW3A 3ZSSA 1V77A 5IDIA 5K3VA 3QXBA 5C70A 3KFTA 1GG0A 2ESCA 3LLXA 2PTZA 3ZT6A 4CVUA 2PTWA 4XBSA 3K8MA 4XISA 4IMFA 4ZA0A 2NV2A 2WJEA 4PC8A 2PDJA 5A94A 3PF3A 4Q32A 4IGMA 5HR7A 2OX1A 2JF6A 5EKYA 1JFHA 3OQEA 1DEDA 2VEMA 2WSPA 1G4TA 5FJRA 4W9TA 3OBKA 4HHMA 3BK0A 3L4YA 4IJRA 3WQOA 1SO4A 2AGKA 4IL2A 4I9JA 4LGXA 2GGHA 4CQ9A 2YCJA 1XDJA 4LYPA 3R13A 4CNPA 3JZEA 1F73A 1MUWA 3E02A 7ENLA 3AU6A 4GGBA 4OKDA 1H0GA 2XIOA 4HT3A 5D9NA 2PWEA 1QBAA 3QY7A 4PRWA 1X98A 3NQEA 3RDKA 4DZIA 3AS1A 3STGA 3PPCA 1TJPA 3W1MA 3QY8A 1C9DA 4CNOA 3WL1A 3MO7A 5HQMA 1LCOA 3C3NA 1ZBWA 2W63A 3UWYA 4NZCA 3L66A 2C79A 1W31A 3QZEA 5ABHA 2QUNA 2OSXA 2YBVA 2QNEA 3UVIA 1JYXA 3U0HA 1I2NA 3G0SA 1Q7ZA 4HOZA 1ISYA 3VDBA 1QT1A 3DYMA 4CKQA 1JULA 4C6NA 4O19A 4QM1A 1OZMA 1WZKA 1LG1A 3KE0A 4LV9A 3FJ6A 3B4YA 1MEHA 2VURA 3G22A 5EGRA 3LCWA 4PULA 3FN9A 3MBFA 1AJ2A 1ADSA 2VD9A 3E0VA 3P5YA 2ZZ3A 3WLOA 4LB3A 2HQAA 1PX8A 1S2AA 1MXSA 1VFSA 4E8GA 4DUVA 4O14A 4NRSA 5C9UA 4XK2A 3CH0A 4QISA 2CFFA 4XZWA 3TCEA 4UTKA 4IX2A 1ITUA 1X1ZA 3UA3A 2ISVA 4JX5A 4Q8PA 4NXKA 1KO0A 1TYGA 4NKCA 4O0KA 4WX2A 3K46A 4FLOA 3THAA 2GJPA 1GTHA 4NHVA 1VFOA 3EA1A 3WBYA 4JIQA 3ZT5A 3UERA 3ZVHA 1I2PA 5A8QA 4O50A 3T8LA 1F4AA 1KV8A 2D22A 4D72A 3U2ZA 2PZ0A 3BW4A 4TMBA 1TVPA 3D47A 3QLDA 2HEJA 1PAMA 4BI6A 2P3ZA 1OCBA 2ZUNA 5DF0A 1F3WA 3WNOA 2XSBA 1H0IA 3TJXA 3U48A 2RKXA 4W86A 2PBOA 4XX6A 1HX0A 3N2CA 1K4HA 1F6YA 1WKFA 3GTXA 4GZIA 4JDYA 3PFMA 1TPC1 4G6CA 1ENUA 1JPDX 3D46A 5HA7A 1Q2RA 3L4VA 3PBGA 4JY8A 2Z27A 1LWHA 3KZPA 1B90A 3OA5A 3CGTA 3LBMA 3CWHA 1QTWA 3EMZA 1VC4A 1X38A 3VOHA 2X0YA