3O6AA

F144y/f258y double mutant of exo-beta-1,3-glucanase from candida albicans at 2 a
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
394
structure length
394
Chain Sequence
AWDYDNNVIRGVNLGGWFVLEPYMTPSLFEPFQNGNDQSGVPVDEYHWTQTLGKEAALRILQKHWSTWITEQDFKQISNLGLNFVRIPIGYWAFQLLDNDPYVQGQVQYLEKALGWARKNNIRVWIDLHGAPGSQNGYDNSGLRDSYNFQNGDNTQVTLNVLNTIFKKYGGNEYSDVVIGIELLNEPLGPVLNMDKLKQFFLDGYNSLRQTGSVTPVIIHDAFQVFGYWNNFLTVAEGQWNVVVDHHHYQVYSGGELSRNINDHISVACNWGWDAKKESHWNVAGEWSAALTDCAKWLNGVNRGARYEGAYDNAPYIGSCQPLLDISQWSDEHKTDTRRYIEAQLDAFEYTGGWVFWSWKTENAPEWSFQTLTYNGLFPQPVTDRQFPNQCGFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucan 1,3-beta-glucosidase
publication title Carbohydrate binding sites in Candida albicans exo-beta-1,3-glucanase and the role of the Phe-Phe 'clamp' at the active site entrance
pubmed doi rcsb
source organism Candida albicans
molecule tags Hydrolase
total genus 150
structure length 394
sequence length 394
ec nomenclature ec 3.2.1.58: Glucan 1,3-beta-glucosidase.
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3o6aA00
1R7AA 7TAAA 4OOZA 4FMVA 4MNMA 3VD9A 1CIUA 3L4WA 2G3NA 3AI0A 1KGXA 2VUYA 1B3YA 2YA2A 2PWHA 2J8GA 2BY2A 1J0ZA 4JFVA 1MQRA 4J3UA 1JF6A 1H0GA 3ZSSA 2DT1A 2WCGA 4JAWA 4TX8A 2VTFA 1X1NA 1UR2A 4XUYA 3TTYA 4AZ5A 2EO7A 1B3ZA 3IJ7A 1SYTA 1W1PA 2VZOA 1CDGA 3L4TA 4W87A 1ZBKA 3AISA 4AXNA 1E71M 2WKLA 3ZQ9A 2J7HA 1QVBA 3UR7A 4Z2GA 2IUZA 1GQIA 1AQ0A 3I3BA 1E4LA 3QHOA 1OB0A 2W67A 3ZO9A 2ZX9A 2D24A 3BAKA 3GXDA 4EAMA 2ZOXA 1G01A 2EPLX 1DWFM 3WDJA 1BGAA 3TTQA 1EDGA 4XX6A 2UY5A 1W2VA 2F61A 3SUSA 1CGYA 3TONA 1IV8A 4M80A 3ARWA 2C7FA 4MAZA 1GOOA 5JIWA 1UWRA 4DUVA 5CLTA 1AQMA 1QPKA 2X0HA 1HN1A 2XPKA 1M04A 2ZWZA 4E4PA 4W7WA 1JI2A 1J0HA 1XSIA 1QNQA 3UR8A 3OB8A 3ARZA 3AIEA 1UYQA 1B1YA 1XRVA 1J0JA 4D6DA 1JZ5A 1HJQA 1E6RA 4OBSA 4U5KA 3AIBA 4Z2JA 2WNWA 2J47A 4BQ2A 1GZJA 1Y7VA 5C70A 2X05A 1HNYA 3W29A 3ZJ8A 3SCOA 3CZLA 3OA5A 3CBWA 2WMIB 2BXYA 1ZS2A 3AIUA 2DQXA 1NWRA 2VVSA 1E0WA 2W5FA 3NYDA 4B15A 1GOIA 2VOTA 4FF5A 3U7BA 4XV0A 4UFLA 3VINA 3SUUA 1UKTA 1BPLB 2EQDA 4W8BA 1V3LA 2Y4SA 4UQEA 2VURA 1JXKA 4HOZA 1LL4A 3AXXA 5E9AA 1KR0A 1QI0A 4L4OA 4FK9A 1UHVA 4RE3A 4X0NA 2ZXBA 3W27A 5I6SA 3CO4A 3WF3A 1FFRA 1V6WA 4GI6A 1JNDA 3NSMA 4PN2A 5JBEA 2J7GA 1SR0A 3GDBA 3WD3A 1XD0A 3M6DA 4P8WA 4AD5A 3WIJA 2CNCA 3BSHA 1ZBCA 4X0VA 4HTYA 1OGBA 3MSDA 5ABFA 2WMFA 4WKAA 3ALFA 1W2PA 4AYSA 3BGAA 3N13A 2V38A 1SMDA 3WH6A 4P7OA 3N18A 2J62A 4CD7A 2YL8A 2WSPA 5BWFA 2D22A 1NWSA 5CGMA 4Z2IA 4CN1A 4CCEA 1GHRA 3AIQA 5F7UA 1CXFA 4JFUA 3U5UA 1VBRA 2Q8XA 1ZB5A 2VI0A 4D6IA 4MTVA 4N42A 1ESWA 2B31A 1BYCA 2D20A 2YDQA 1JZ6A 1CGVA 3PTKA 3AXIA 3WFZA 3CLWA 5BXTA 1Q6GA 4PUDA 3UETA 4HZ7A 1WE5A 1KQYA 2WANA 1PZ3A 3OLIA 2UY4A 4JHZA 1JD9A 1G5AA 2CBUA 4FLOA 3SCWA 3WF4A 4PBGA 1GHSA 1KWGA 4TVUA 5D4YA 1ZBVA 4X9YA 1UWQA 1E9LA 5M3WA 1Q6CA 5EB8A 3VGDA 1NARA 1R8LA 1MWOA 1B3XA 3BXWA 1HJXA 2WHKA 3SCTA 1LL6A 3RJXA 4ACZB 5HBFA 5FIPA 2VL4A 3SUTA 1JFXA 1XYFA 2D0HA 5IXEA 1LG2A 3W81A 1CZ1A 3GZAA 4AZBA 1WDSA 1BQCA 1OWQA 1C91A 2D3NA 4PTWA 5EFDA 2GK1B 5GNXA 1B31A 1B9ZA 2HVMA 3EDEA 3AZRA 3RILA 4J28A 5A6AA 1CGWA 2BFGA 1JDAA 3WBAA 3M7SA 3CMJA 1E43A 1J10A 3SEPA 1OGGA 4B9ZA 2VCCA 4H2CA 5D9OA 3MSGA 2XYLA 3PTMA 4PMYA 4U31A 3OZPA 1XH0A 1D7FA 3OZOA 1K9FA 1OIMA 1B3VA 1C7TA 1WPCA 3EDKA 4CVWA 3WNOA 2JF7A 1V02E 1QNSA 1FH9A 1E6ZA 9CGTA 1RP8A 3S6TA 2YA1A 4UCFA 3ZM8A 2OLHA 4PEEA 2VR5A 3W0KA 4QLKA 5ABEA 4AEFA 4LYPA 1GOQA 4MDPA 3SCUA 3VU2A 3THCA 4U3CA 3VD5A 3MKKA 3VGHA 2DGAA 1GUVA 3EDFA 3WENA 4V2XA 4B3LA 2CEQA 4P7QA 2WYSA 5TD4A 1H11A 1JXJA 5I23A 1WDQA 2WC4A 3RJYA 3RMEA 3SCVA 1TCMA 3GBDA 3ARTA 3N11A 3AHYA 1YQ2A 2VZTA 1OSEA 1ZJAA 4DWSA 4HP5A 2JE8A 5KZ6A 2VT0A 2VX7A 1B2YA 1W32A 2G3JA 1EGZA 4W5UA 3UEQA 3MMDA 1G1YA 2F2HA 1HP4A 1MFVA 2YDSA 4QCFA 1UKPA 1GPFA 2E9LA 4MDOA 2V5CA 2JEQA 2JEPA 5AYBA 4JFTA 1HP5A 4QFUA 3WDIA 2ZX5A 1OGSA 3UESA 1LG1A 1R87A 3CHDA 1JAEA 3CZ8A 4IPNB 2CERA 2WHJA 1HJWA 2VRJA 4IM4A 2VZSA 1L0PA 3SCQA 4U2ZA 3PZOA 1JAKA 4MB3A 1JD7A 3FW6A 4F9JA 2J78A 1E5JA 4PMVA 1WB0A 1Q6EA 4PMOA 4W5ZA 5FL1A 2QMKA 4H04A 3AMLA 4B16A 2ZE0A 4WSKA 1JL8A 4Y7EA 3WH8A 3O6AA 4B9YA 4UZSA 4HPHA 2XWEA 1V6YA 1UQZA 3EDDA 4JL1A 2WCSA 3ARQA 3AS0A 1JI1A 3AYSA 1HKIA 3WEMA 4PCTA 3UERA 2ZUSA 2CKRA 2VX4A 4MJ4A 1BSIA 2WB5A 2E8ZA 2XIBA 3IAPA 2XSBA 3WELA 5CJ5A 2X8RA 2J77A 2AMGA 3W38A 3T2OA 2QF8A 2VMFA 4TTUA 2D2OA 1QOXA 4ZXLA 1XH2A 1OINA 1XC6A 1UR8A 1V3MA 1W1YA 1LF1A 4RE4A 1XSKA 2FH8A 3K1DA 4UFKA 2IXUA 2AAAA 3SURA 1QHOA 3WUBA 1JG9A 3W4RA 1C7SA 5DFAA 3WQWA 4L4PA 3TP4A 2QLYA 4W93A 2TAAA 2DT3A 2DSWA 2ZX7A 1HKJA 2BNJA 5A6KA 4KWUA 4MNJA 3CUHA 2VRQA 5I78A 2W4XA 3B9AA 3ZR6A 3ZT7A 1US2A 3A6OA 1KXQA 4PTXA 2DH2A 5EMYA 5IFPA 1W3KA 2OYMA 1QI4A 2XGBA 2VVNA 4HPGA 4PTMA 1JFHA 1PX4A 3L4VA 1W9UA 3ARXA 3VM5A 2YIHA 5A8PA 2XUCA 3IANA 1KGUA 2ZXQA 1WCGA 1J12A 1YHTA 1M7XA 1QI2A 4AZHA 4CU7A 3G6LA 1R86A 3QR3A 1UKSA 2A3CA 4KRTA 4M82A 4UFIA 4B3KA 5D8WA 5CPQA 2O9PA 1GW1A 4AZ6A 5M17A 3PN8A 4F8XA 4ATLA 3L4UA 1TFVA 1E5NA 1M01A 3ZMRA 3PZ9A 1XHGA 3ECQA 3IJ8A 4JIEA 4UOJA 2BHZA 3WEZA 2A3HA 1GVYA 3WL0A 1MYRA 3N9KA 2J7EA 3G6MA 3SIMA 2WSKA 3ZJ7A 4WLCA 1LL7A 1EO5A 1E1FA 3D5HA 3WSUA 3CUFA 1KR1A 3EMCA 3IAQA 2PF0A 4UZUA 4AZCA 1UA7A 3AMCA 1UOKA 4UFHA 5I79A 4UTFA 2CCRA 3GNPA 1JYNA 2WBKA 3VILA 1HJVA 3O2LA 1VIWA 3WUGA 3BMWA 2DIEA 4MNKA 1BYBA 2CHNA 4UR9A 3PZUA 1QW9A 5AY7A 4DWSC 5I2UA 3AZSA 4XZWA 1KXVA 4D6GA 3L2MA 4YN5A 3BAYA 4KH2A 4GPNA 1E3XA 4AW7A 2NT0A 4J3SA 1FHLA 3MUAA 1BVNP 1K6AA 3WNMA 3OGSA 1VENA 4AZGA 1ISYA 1DTUA 4QCEA 1VAHA 3TOPA 3ARSA 1WDRA 4W7UA 1C90A 5BROA 4AD4A 3WH5A 2DEPA 5FKYA 1TA3B 1B90A 2WZEA 3NUKA 3BAXA 2DSVA 2W62A 5CSYA 1BYAA 1MXDA 1NQ6A 3WF2A 1VFOA 4TOQA 1E40A 2E9BA 3A4XA 4M29A 2J79A 4TXEA 3AQUA 1C8YA 4BQ5A 4MAVA 3WUEA 5BCAA 4W7VA 4JCMA 2ZUTA 1E6QM 1O6IA 2D23A 1E6PA 1W9BM 3WNPA 1NH6A 1UWSA 4P8VA 1DEDA 4UQDA 3K4DA 3PZVA 3VD4A 1CBGA 2OWCA 5LYRA 1EHAA 1XH1A 1EXPA 1E56A 3NSXA 3MS8A 5A6BD 3WDHA 2V3EA 3I3DA 1SFSA 1H09A 1S46A 2XSAA 3IJ9A 3W28A 4CCDA 1PX3A 1NP0A 4HA3A 3K4AA 1KGWA 3DYMA 3MUY1 1WZAA 3LPGA 1C8QA 1E4IA 3PZNA 2W91A 2ZUNA 4CVUA 4Q7NA 2D0GA 1H3GA 1VJZA 1VEPA 2X2YA 4BS0A 4GZJA 1QI3A 1K9EA 5IHSA 3JUGA 3VO0A 4PMZA 2YL9A 3VDCA 4WF7A 1CYGA 3SCSA 1UG6A 1FA2A 2J4GA 2WMGA 2CETA 2XVPA 1GQKA 4DWSD 1IZJA 2QMJA 3WY1A 3WKZA 2V5DA 1V02A 4W85A 3NCOA 1I1WA 8CGTA 1NOWA 4FLSA 2OYKA 2MANA 3A4WA 1W1VA 4YHEA 2NW0A 3VGBA 1EDTA 4WJXA 4PMXA 4CN6A 4QDMA 1JGIA 4PMUA 4M81A 4S3KA 4UOQA 2G4FA 5A3HA 1KCLA 3HJEA 4ZE5A 5A8MA 1E6SM 2BVTA 4GIAA 3WNNA 2DH3A 3I3EA 3T2PA 8A3HA 1DWHM 4M8UA 1US3A 3RCNA 2CKSA 1OT1A 2WBGA 4E8CA 2DDXA 2WZHA 1FH8A 1D3CA 4AD1A 1R85A 2RGLA 5CXPA 4BQ4A 3AHZA 4CU8A 1W1TA 2PWDA 1UZ1A 3ARYA 3WQVA 2V3FA 4IUGA 3THDA 4NRSA 3F5LA 1DWGM 1HVQA 5CZKA 3VUPA 1JDCA 1UKQA 2XFRA 5E6YA 3UG4A 1VBUA 2XVKA 3FN9A 3NDZA 5HPCA 4JKKA 5A94A 2YJQA 4HMCA 2PWGA 2F8QA 2YLAA 1E73M 4F79A 3GBEA 2WVTA 3CUJA 2VX5A 4H8HA 5ABGA 1UA3A 5LA2A 1UQYA 3LPPA 1CXHA 1DWAM 4WK9A 1CXIA 5HDRA 2EPMX 3CPUA 4AMCA 1DP0A 3DHUA 4LX4A 3ARVA 3N15A 4QP0A 5I5RA 3CUIA 2YOCA 5EBAA 1VEOA 4JFSA 5JBDA 3VMNA 1AMYA 4OOUA 1VFFA 3VIOA 4ATDA 1CNVA 3HMCA 3AIVA 3OIHA 2XG9A 2WCAA 4IISA 2OSYA 1QBAA 2VZUA 3DC0A 2OWWA 5A6JA 4UQAA 3DECA 2JALA 4DUWA 3AZTA 2Z1SA 4EANA 3GNRA 4ML4A 2WLYA 2WM0A 2CBJA 3PTQA 4F9DA 4HA1A 1ZU8A 3SCRA 3VKKA 3VIFA 1CPUA 3WMBA 3WNKA 1E4NA 5A6BA 1E0VA 2JF6A 4CKQA 2FDMA 3VOCA 1UR4A 1QW8A 4LYRA 1N82A 1LJYA 1W3LA 3NIYA 3IK2A 7CGTA 2WK2A 3AS1A 3AJ7A 2EBNA 1NP2A 1FH7A 1HT6A 1FHDA 5JIPA 3SCPA 2XM1A 7A3HA 2ZIDA 3VIIA 4D1JA 1CECA 2OSWA 3WQ4A 1C3FA 1FOBA 3U57A 1V3JA 5A2BA 2XHYA 1ZJBA 1HL9A 1KB3A 2XTKA 1GQJA 3BMVA 1MW0A 2Y5EA 3VGGA 4AD0A 3O9NA 5ABFB 2O9TA 1RD6A 3W26A 2EXOA 2Y8VA 3OLGA 4H41A 5DEZA 2XIIA 1UD4A 2ZX8A 4UQ9A 1ITXA 1D2KA 2WVSA 5DMYA 1WZKA 4J27A 5HNNA 1TVNA 1UD2A 1UH4A 4Q22A 2PI6A 4BCEA 2XFYA 1R7OA 1UD3A 2GJXA 3CIVA 3PZMA 5DT7A 3RM4A 1OIFA 3VIPA 3N04A 2QPSA 3T0BA 2J8FA 5CPSA 2WVVA 2PBGA 3OGVA 3GM8A 4GQRA 2BY3A 1WDPA 1TR1A 2ZICA 3CZEA 3ZIZA 3WDRA 3NSNA 5BRQA 2CXGA 2C8NA 1DHKA 2XVGA 4ZE4A 1V6XA 3AMDA 3II1A 1UD6A 3WMCA 1E6NA 3PBGA 1BVZA 1J0IA 1W9DM 4ATWA 3APGA 3KL3A 3KZSA 3CHCA 2WW5A 2IXVA 3MANA 5M03A 3K8MA 3GXFA 4KRUA 3T2QA 1K9TA 2BVDA 4LYQA 4CD6A 1H2JA 2A3AA 1UR1A 1KXTA 4OUEA 2XFFA 3OLDA 1UH3A 3WD0A 1CGTA 3WF1A 1HL8A 4PRWA 5JBFA 4W84A 2WWDA 3GXIA 1QI5A 2E0PA 4N0RA 1ITCA 4AIEA 2VCBA 1G9HA 1WNOA 2E4TA 1F4AA 4UQCA 2OYLA 4JZ5A 3GTNA 4KGJA 4U2YA 2WC3A 3FAXA 1KXHA 2WHMA 2XVNA 3VD7A 1GNXA 1ZL1A 1NOUA 1UD8A 2FH6A 3VIKA 4D71A 3W6LA 2D0FA 1V03A 3AYRA 4QAWA 1V0KA 2Y2WA 4EE9A 5AYIA 1ISVA 3U7VA 2GFTA 4D6JA 1TZ7A 1ISWA 5HOSA 4ZENA 5ABHA 5A2AA 1GOWA 3WMSA 3CZGA 2XJ7A 3W82A 1E72M 1PX8A 2VNCA 4D6EA 1TG7A 2YL5A 4AWEA 2WXDM 1NM9A 2UY2A 1A47A 4NRRA 2J7CA 4URIA 5D9NA 2VRKA 2D3LA 1PIGA 4J3VA 2OSXA 4PMNA 1U30A 2DSZA 1MVYA 2YBUA 1DWIM 1MW3A 3F5KA 1K9DA 5CQ1A 3ZT6A 4FLQA 4WKHA 1JF5A 2CPUA 4Z2HA 1JYWA 1X6NA 4P7LA 2JIEA 4PMRA 3AMKA 3EDJA 1M03A 4DWSB 1PBGA 3WD2A 1U33A 4TX6A 1HJUA 3BC9A 1C92A 1LWHA 3AHXA 5KEZA 1J0YA 2WMHA 3AMGA 1CEOA 4GKLA 3PZGA 5A2CA 3ZR5A 2CHOA 4EK7A 5BRPA 3E1F1 5I3DA 2ZUMA 4TUFA 3CUGA 3ARUA 3ZOAA 4EKJA 2NT1A 4BZYA 4KGLA 2GDVA 1MW1A 1V3KA 4GZEA 1HJSA 2WMIA 4R27A 3VGEA 2O9RA 3T08A 1CXKA 2W63A 2E40A 1MXGA 1UZ4A 3NJ3A 2WHLA 5D8ZA 3WQ8A 3WN6A 3BAJA 4AZIA 2J7FA 2EEXA 1UD5A 4U5IA 1CLVA 2XGIA 1QNRA 3BH4A 1UWIA 2WMJA 1UWTA 1ODUA 5A6MA 2GSJA 3ZJ6A 1JZ3A 3VD3A 1W3JA 5GNYA 4GI9A 3RDKA 1EIBA 4LPCA 5BXPA 2A3BA 3MV11 3AROA 1OM0A 1QBBA 1GORA 4KMQA 2GJPA 2X1IA 4MNLA 3W25A 2E9MA 3B9DA 4J3WA 4U3AA 1VFUA 3VGFA 4D1IA 3L4XA 3VDHA 1BFNA 1ODZA 1HF6A 2BS9A 1H41A 1KBKA 5BXSA 3FXYA 1PIFA 4AZ7A 3RIKA 2ZUUA 5BXRA 1BG4A 1KCKA 2BV9A 1VEMA 3MUIA 2W61A 5FCZA 2WMKA 1XV8A 4JKMA 4UFJA 2X0YA 2RGMA 3AOFA 4LQ1A 3K8KA 1ECEA 3T09A 3L4YA 4BQ3A 4W8LA 1DWJM 3OGRA 4P8XA 3OG2A 2V3GA 2FGLA 3VDAA 4DUXA 1PAMA 1EOMA 1GOMA 1BLIA 3AIWA 4MB1A 1Z32X 2ZWYA 2WWCA 4HOXA 4IPLA 4HOWA 1UR0A 4V27A 3TTSA 4PUEA 3WNLA 3W6MA 5A8OA 2W92A 2PBOA 3ARRA 4F66A 1WAWA 2PWFA 3F5JA 3VIMA 2CESA 1RPKA 1EHNA 4HMDA 1PJ9A 1H4PA 1EH9A 5IHRA 3FHAA 1PEZA 3UCQA 4XZBA 2ESCA 3FNDA 3B8SA 2O9OA 4XB3A 2DPEA 4K68A 1ISZA 1J0KA 1W9PA 3BCFA 3RPMA 4P8UA 3GXMA 1C93A 5HPOA 1ISXA 1XD1A 2FHFA 1V6VA 2GUYA 1AVAA 5I24A 1ZBWA 2WPGA 1JZ7A 2X09A 1Q6DA 4D72A 5E6ZA 2ZXAA 1IT0A 1V0MA 1J01A 3GNOA 1W91A 3AIRA 4ACZA 1L8NA 1XSJA 3TA9A 1GVIA 4PCSA 3VIGA 1GQLA 4PSRA 1U2YA 1J11A 1QHPA 4CN4A 4UFMA 4MB4A 2OWXA 1JNEA 2VQUA 5IDIA 4AEEA 2GK1A 3VIJA 1PPIA 4OZOA 4P7NA 3WH7A 3GH4A 4ZFMA 3B9EA 3K8LA 3DHPA 4H7VA 4AY1A 3SCNA 5A95A 4AZCB 3VX0A 5HXMA 1HXJA 4HZ8A 3ZJKA 2VX6A 5IFTA 1AQHA 2CITA 1FP9A 3AFBA 5I0DA 2Y8KA 4OBRA 2XWDA 2V3DA 1J18A 4E2OA 1CGUA 1UKOA 2BXZA 4C7GA 1BHGA 2Z1KA 5D9PA 3VIHA 5EFFA 2D1ZA 3L2LA 4ZXOA 5GQBA 2VCAA 4BF7A 1HKMA 4J3XA 3AS2A 4CUCA 2ZX6A 5LA1A 2XVLA 4Z2LA 1V08A 3WL1A 4MPKA 4QLJA 2YL6A 4R5EA 4AISA 3M07A 1WZMA 2EJ1A 2WAGA 4AD3A 4C7FA 3QGVA 1V0NA 3AXHA 2DIJA 4CU6A 3QHMA 4UQBA 3BLPX 4ACYA 1W9VA 1UR9A 3PZTA 2O92A 4CGTA 4GINA 2FGZA 2WVUA 3ZSTA 3BAWA 1GJUA 2PB1A 3EBVA 3KL5A 4AIOA 1QHZA 5I77A 1EOKA 1BGGA 2ZUWA 2UY3A 2E8YA 3WH9A 4TVCA 1NWUA 3W37A 1MQPA 3ARPA 2BY0A 2BHYA 3AHVA 2GDUA 1O7AA 3GYCA 4P7RA 4GI8A 4J3TA 3T0DA 1CWYA 1IZKA 1C8XA 4M1RA 4MB5A 3VNZA 1JYXA 2YLLA 3A47A 2DT2A 1UWUA 3QHNA 1GONA 5CGTA 2Y24A 1GCYA 3WUFA 1W9XA 4C7DA 1HVXA 3GH5A 4H8VA 2XM2A 3CTTA 3U5YA 5GPRA 3AS3A 1FFQA 4WIWA 3AICA 1LLOA 1CXLA 2DT0A 2WZIA 4JCLA 3BLKA 5AC4A 3VMPA 1H49A 2QV4A 4PTVA 1KWKA 3SUWA 1BAGA 5M5DA 1BG9A 1KFWA 3A3HA 3EMQA 1G94A 3K46A 3GH7A 1UH2A 3LPFA 1CTNA 4OJYA 4WKFA 6TAAA 3EMZA 4NZCA 1HKKA 2PWEA 2UWFA 1VRXA 4QLLA 3ALGA 5E09A 1JZ8A 4AIUA 3UG5A 2GVYA 1XCXA 2EPKX 3QOKA 4RL3A 4DM1A 1OBAA 2VZVA 2J74A 2PC8A 3LMYA 3POCA 5ECUA 1UUQA 3S2CA 4HZ6A 2G8ZA 3PZIA 1RP9A 5DF0A 5A69A 3VMOA 4LGXA 4A4AA 1EDQA 1E4MM 1V3HA 4UOZA 3MMWA 1BF2A 1G0CA 4OKDA 1GJWA 2FHBA 4D6HA 1NOFA 4A3HA 3OLEA 3OBAA 1W3HA 4NF7A 4ZEPA 3W24A 2VJXA 1E3ZA 2J7DA 1JIBA 4HU0A 1CENA 4M24A 5A8QA 3NDYA 5A6SA 2EPOA 2W66A 2JIWA 4A3YA 5A6LA 1OT2A 3KE0A 4TVDA 5C71A 1H0IA 1OD0A 1V6UA 4HMEA 3WQ6A 2WLZA 3WQ5A 4CCCA 3LPOA 1LQ0A 3A4AA 1JYVA 1JZ4A 5FOOA 3CHEA 1XCWA 3BSGA 3WDQA 1I1XA 3CMGA 1E55A 3EYPA 2G41A 5FL0A 3MO4A 2YDRA 5DT5A 3FAWA 1BYDA 1MW2A 2QPUA 1X6LA 4NSBA 2J25A 2QHAA 4AC1X 3CH9A 2CBVA 1P6WA 4GO9A 3N12A 3CZJA 1Q6FA 1FP8A 4CD4A 4CD5A 5E70A 3MUZ1 4W8AA 3PZQA 1KBBA 3F4VA 1TMQA 2BHUA 4PMDA 2AOSA 3TTOA 1EQCA 4GQQA 1XGZA 1HIZA 2WKGA 3RM9A 2FHCA 3VTRA 4YHGA 3DYOA 6CGTA 4H8UA 3RO8A 2CBIA 4MADA 3W53A 5GNZA 2J7BA 4D6CA 5CLWA 1E1EA 2J75A 4J7RA 3WFLA 4CD8A 4D6FA 1RH9A 1XYZA 3CGTA 3T0AA 5E0CA 3FY1A 3MV01 3VDBA 4Z2KA 1NWTA 2VC9A 1QNOA 5BYWA 1B0IA 3MU7A 2CYGA 4GXPA 1EO7A 3KL0A 4PMQA 5CPTA 5CSUA 3PHAA 3AHTA 3WBEA 4LXFA 1CLXA 4W86A 4DM2A 2DSUA 3BCDA 1VFMA 4TTGA 1TE1A 1GOKA 3UG3A 1A3HA 2WC7A 2YKKA 4WSJA 3N17A 3WDPP 1TA3A 4JL2A 5C8BB 2NSXA 1SMAA 3WD1A 2ZUVA 1J9YA 3HU7A 3L4ZA 1Q4NX 3CHFA 1OCQA 2HISA 2G3MA 4W88A 5A1AA 1WP6A 1CGXA 5A8NA 3DYPA 1V3IA 2BY1A 4GZIA 1QNPA 6A3HA 3KEHA 1PZ2A 3RM8A 4MJ2A 4W89A 4JHOA 4HU8A 1B30A 1VF8A 4FLRA 1KQZA 1H5VA 2VR4A 1WZLA 3ZT5A 5D9MA 5E0FA 1VJSA 1WKYA 2EPNA 5LA0A 1V0LA 2ZXDA 3QOMA 3FHQA 1TUXA 2GJXB 2G3IA 1OD8A 5AC5A 3D3AA 1E0XA 2YBTA 4S3JA 1JZ2A 4YPJA 1I75A 3VPLA 2WVVB 1E6XM 2YA0A 1VB9A 3WD4A 3WF0A 2DSKA 4NI3A 1F4HA 2BVYA 3VNYA 4GO8A 1E15A 1BTCA 4AD2A 3VVGA 4M56A 3KWXA 3SUVA 2C0HA 3HN3A 1M53A 1TVPA 1MQQA 3MMUA 4UNIA 1H1NA 5DO8A 3WEOA 4JFWA 4JKLA 1EA9C 4U33A 2A3EA 4RE2A 1CXEA 1WO2A 2E3ZA 3M46A 4HA4A 3VM7A 4BA0A 2GJRA 1EQPA 1MFUA 5JUVA 3VX1A 4PYSA 2CIPA 1B3WA 2VO5A 4OIFA 3J7HA 1JDDA 3N1AA 1HX0A 4V28A 4E8DA 5FD0A 1LWJA 3POHA 4PSPA 5CG0A 1E70M 2VQTA 2JFEX 3BAIA 3CZKA
chains in the Genus database with same CATH superfamily
4O52A 3M5XA 4MNMA 1CIUA 3O6DA 1ZSXA 2G3NA 3AI0A 4ZQRA 2VUYA 2YA2A 1AMKA 3IIOA 3O07A 3STFA 3H2AA 2DT1A 1JPKA 1DIKA 2VTFA 3TTYA 1AZ1A 4F4RA 3L4TA 2J66A 2ZDRA 4AXNA 3IGSA 4UNKA 3ZQ9A 2FB3A 4HK6A 3GR4A 1QVBA 2IUZA 1AQ0A 1M6JA 1POKA 3BAKA 4EAMA 1WV2A 1TTPA 2NVCA 3CC1A 5C55A 1EBGA 1G4PA 1XKJA 4CEXC 1OEPA 1I4NA 4PRRA 4TO8A 2DZSA 1W2VA 1LT7A 3SUSA 4QXIA 3TONA 4N9BA 3LCIA 4WY0B 4A3QA 2INEA 1PKLA 1BXCA 5REQA 4G6CA 5CLTA 4JOMA 1GKPA 2X0HA 2J6XA 1M04A 3TE9A 3WJWA 4ZB2A 3CH0A 3ITXA 3OO2A 3V5OA 2BTMA 1B1YA 1J0JA 3K2GA 4B2DD 1JZ5A 1E6RA 4JTIA 3GIQA 2J47A 3UJ2A 4MY1A 3ELFA 1GZJA 1Y7VA 3QPEA 9XIMA 2J88A 4FX6M 4B90A 2X05A 3ZJ8A 2FZNA 4GX8A 2PE4A 1DJWA 3QZEA 1ZS2A 2FB2A 1S2AA 1QPRA 3BZJA 1OC7A 1E0WA 2HSAA 4PFMA 1L2QA 4N4PA 4UFLA 2R82A 4MWAB 3N73A 3VINA 3SUUA 5FEZA 5BOFA 2X1TA 4PUWA 4AWUA 2CXEA 1LL4A 3AXXA 2NUWA 4MJMA 4FK9A 1UHVA 1UMYA 3B0YA 4GBUA 4Y9PA 4E38A 4JPGA 3W27A 5I6SA 5LIYX 4I8YA 4C91A 1VLIA 2FDSA 4XAGA 4GCXA 2XZ9A 1FFRA 1LORA 3W84A 3S9ZA 1LOQA 1X98A 4PN2A 5HULA 2PU1A 4S2BA 1XD0A 2B7NA 3KLKA 1C9WA 1VC4A 3RCYA 2AGTA 4X0VA 4HTYA 1ZAIA 3E0LA 5AVHA 3MSYA 1W37A 1JPHA 3ALFA 1W2PA 4JICA 3W7GA 3WH6A 4QE5A 3W7IA 4HPXA 4CD7A 2ACQA 2QZRA 5CGMA 4CN1A 1XLIA 1LOLA 4MJZA 3RO6A 2OGYA 2YZRA 3DFPA 1YMYA 5E0KA 4D6IA 4MTVA 2B31A 3PR2A 3CS2A 1JZ6A 4JDBA 3NWRA 3WFZA 4YYCA 4PUDA 1WBJA 3IRSA 3S1VA 3T4CA 2WANA 1PZ3A 3W72A 3OLIA 3HGRA 1JD9A 4FLOA 1GHSA 5D4YA 1SFLA 2RDTA 3QW3A 1E9LA 3I7QA 5T9CE 2PDBA 3W1QA 5M3WA 1TTIA 1NARA 1MWOA 4LUYA 3B0VC 3BXWA 1PYMA 4JD4A 2WHKA 5EYWA 2P3EA 1LL6A 3PJWA 3RJXA 5FIPA 2VL4A 2GWGA 2QVNA 4QX4A 2IKIA 5F1UA 5EFDA 3BL3A 1B31A 1B9ZA 2J27A 5LHEA 5HJLA 2PZNA 3UGVA 4C6BA 4RNFA 3AZRA 1MRAA 2FZ9A 5A6AA 1CGWA 2B7OA 3KBMA 4FOKA 3WBAA 2J24A 4PB4A 3BSMA 2NWSA 2X16A 4LYKA 2R91A 3BE7A 5D9OA 5D32A 4K8HA 2ZRWA 1F61A 2OX1A 3E49A 1FRBA 2VGIA 1EJWC 1D7FA 3OZOA 4FXFA 1K9FA 1V93A 1B3VA 1C7TA 4OBTA 4GHRA 1WPCA 1A5OC 1YXCA 3KRSA 1DIOA 1QNSA 3R0UA 7ENLA 1JCTA 2OLHA 3W0KA 4AEFA 1GOQA 4FNUA 2F6UA 1KM3A 4HKPA 4RPPA 1Q8JA 4V2XA 1H1ZA 1Q7MA 4P7QA 3B0UX 4FI4A 1WDQA 2INFA 2WC4A 4QIUA 4LNYA 4OWGA 3GBDA 3N11A 3N4EA 5HA7A 1IZCA 1OSEA 5CPLA 4WOQA 4BF9A 5KZ6A 4H3DA 2VT0A 4Y90A 1BRLA 2R8WA 4F2TA 2EHHA 3MKCA 4W5UA 3KP1A 3MMDA 1L6GA 1HP4A 1E9ZB 1F74A 4MDOA 2JEQA 2JEPA 3VK5A 3UCDA 3WJZA 4BJHA 3WDIA 1Y8BA 4YYFA 4WX2A 1LG1A 3CZ8A 4IPNB 3ITVA 1Q7QA 2VRJA 4EVZA 2VZSA 4TV5A 3OEXA 3GDLA 1E0TA 3PZOA 1JAKA 4MB3A 1S1RA 3FW6A 3PBUA 3N2BA 1K3UA 1Q6EA 3DKJA 3LXBA 2ZE0A 3LOTA 4Y7EA 8TIMA 1H7WA 1LRQA 4JYDA 4B9YA 3DCPA 1RSCA 1JPIA 1V6YA 3S6OA 3MMTA 1UBSA 4D8AA 4JIHA 3WEMA 4I9MA 4H2HA 1CX9A 1TQJA 3LCGA 4FALA 4IFKA 3LBCA 1O5XA 1XLKA 4F40A 4Q8MA 4H4IA 3KOYA 5CPOA 2XSBA 4LVBA 3EX2A 3GXTA 3Q2DA 2X8RA 5LZLA 2PS2A 2VMFA 3PUEA 2VD9A 4JHMA 4KT2A 1QOXA 3GDTA 4NNAA 1W1YA 4LVFA 3ZS4A 1U83A 1EF2A 5CSSA 4AY8A 3SECA 3CPGA 1JG9A 3W4RA 1C7SA 2RJHA 2QLYA 4LB3A 1F9CA 3IJQA 2XH7A 5D2YA 2PDNA 1XKYA 3MCNA 1HKJA 1M68A 4R7WA 3R6IA 1RJQA 4KWUA 4MNJA 2C91A 4RV3A 4J1OA 1EPVA 4KCVA 3W88A 1US2A 3A6OA 3NL5A 4PTXA 2PZ0A 4DJFD 1ECQA 4XZ9A 2E1WA 3UR2A 1QI4A 4JTCA 3GKFA 2VVNA 3KBSA 1J6PA 4PTMA 1JFHA 2Z6JA 1PX4A 2QDEA 3L4VA 1W9UA 5D38A 1A3WA 5EU9A 5A8PA 4KFNA 2F6XA 1WCGA 1I2NA 4MPQA 3HM7A 1B4EA 4DJEC 3R94A 3WLOA 4CU7A 2GPTA 1KBLA 2IW0A 1QAPA 1XIBA 3QR3A 4UFIA 4LBSA 5DCEA 1R3WA 4LV4A 4ATLA 4JIRA 5DELA 1TFVA 3UWQA 1VCVA 3P8IA 3PZ9A 1XHGA 5GJMA 2QCFA 2QCDA 3RLHA 3HFTA 3IUIA 1YYAA 3VABA 4XAPA 3SN4A 4PUUA 1FWBC 3WLSA 3DHDA 4UFHA 3EKLA 3W1LA 3GNPA 4JEJA 3VILA 3IVTA 4K1WA 3BMWA 2E1DA 3P0XA 4UR9A 1J2WA 1JEZA 4EF9A 4Y2WA 3CB3A 5AY7A 4DWSC 3AXMA 3AZSA 3BJFA 4XZWA 1KXVA 1W5QA 3L2MA 3DI0A 4CQBA 5C9RA 4LT9A 4GPNA 3UD6A 1ONXA 1E3XA 3IUHA 2NT0A 1ZUAX 4J3SA 2QIWA 2QCLA 1BWKA 4YL2A 3H2CA 4QCEA 4I7WA 1VAHA 1XQLA 4JBRA 3ARSA 3ZZ1A 1C90A 3FA3A 4AD4A 3PPCA 1YNPA 4LALA 1H1YA 1VGAA 4B5WA 2C18A 1TWDA 1PVNA 1R38A 1TCDA 4YLWA 1GG0A 3GDRA 3SDOA 1W31A 1LROA 2FFIA 3PBWA 2E9BA 3A4XA 3GU2A 3E9AA 4IP5A 2XH2A 3G1SA 1ZALA 4GIYA 1EJTC 3WUEA 4H83A 5BCAA 4JCMA 3NDOA 4Q4RA 1QWGA 3TAOA 3CNYA 3T9PA 3WNPA 4GE8A 1NH6A 1UWSA 4P8VA 4UQDA 1QUMA 3QQ0A 2WKJA 3NEHA 3BVJA 1DJYA 3OOQA 3WDHA 3BOXA 2X2GA 3T55A 2GJLA 3W28A 2AMXA 4CCDA 1Q8AA 2ZRYA 1PX3A 4K2SA 2C19A 2VDIA 3MUY1 3MC5A 1R3SA 1WZAA 2R24A 2BBFA 3TROA 3R25A 3PZNA 1OFQA 1NFPA 4CVUA 3RNDA 4Q7NA 3A22A 4E4FA 1TPWA 2HE8A 5F1VA 3W7CA 2FIQA 5J8LA 3TA6A 4EX4A 2HXUA 4PUKA 4YJ5A 3VDCA 4GY7A 1ADOA 1CYGA 3L5AA 3SCSA 4B5NA 5HJYA 1IZJA 3KAOA 4XVEA 3WY1A 3P60A 2FZMA 4BR1A 2PGWA 3STPA 4LUJA 2JKAA 2MANA 1WUFA 1W1VA 2HWGA 2QUNA 2POTA 3VGBA 1KW1A 3CIWA 4IL0A 2ZQ0A 4Q8WA 2GGIA 3T42A 4S3KA 2G4FA 1RBLA 4GIAA 4NX5A 1QDSA 1GQNA 1O1ZA 1PHWA 3QRHA 3IVUA 2DDXA 2E77A 3VNJA 1D3CA 1R85A 3TYZA 3AHZA 7REQA 1A0EA 1UZ1A 3L21A 4NRSA 1PXGA 4BWLA 3F5LA 1UP2A 1JUBA 3H53A 2XFRA 5E6YA 2DZWA 3LXCA 3ZR4A 5GVJA 3W73A 9XIAA 2YJQA 4UTHA 3NZQA 4NAEA 1XGEA 3JW7A 1ZJIA 4PCPA 2PWGA 2YLAA 2WVTA 1Z89A 5JH2A 1UA3A 1VBGA 5LA2A 1IE7C 1CXHA 1DWAM 4WK9A 3HF3A 3BPWA 4YTQA 5LGXA 3DHUA 3WMLA 3ARVA 2H3BA 3CUIA 5G4HC 3W86A 1AMYA 3VIOA 3M5ZA 3B8DA 1TKKA 4GOAA 1XW8A 2XG9A 4K39A 2WCAA 3TYBA 1X7FA 5A6JA 4Y96A 4ZTYA 3OHMB 3DKLA 4ML4A 2CLLA 2WLYA 2WM0A 3SQLA 4HA1A 4ROPA 5DMMA 2VEKA 5B80A 5U4NA 1FWNA 3I10A 4MYXA 3VKKA 2R1MA 3LEPA 4HJWA 1E0VA 4ALDA 3VOCA 1QW8A 1XLGA 1NDYA 2G4JA 3PC0A 1LJYA 3KTCA 2VGBA 7CGTA 3GR8A 3DDMA 5HNUA 3N6HA 1TTJA 3KCOA 2FTWA 1TIMA 3QC0A 1W54A 4GK8A 4HN8A 4WHBA 3SAZA 4XD5A 2Y7GA 5AHMA 1UC4A 2R1PA 2Y5EA 4YIWA 1RD5A 1XLEA 3QW4B 3N25A 2NX9A 5IRPA 3WLLA 2XINA 4A8IA 2DP3A 3W26A 4H41A 3EWWA 5DEZA 3IJDA 5ECVA 4KIRA 1R6WA 4JNMA 5C0QA 2HK0A 3SFKA 3EAUA 2ZADA 1LOSA 3THUA 1AK5A 4GJIA 4J27A 3URBA 1TVNA 1LQ2A 1UD2A 2Y61A 2XFYA 4DJDC 3RPDA 3G8RA 5C2XA 2ZA3A 1NY1A 1KNWA 1OIFA 1T41A 3VIPA 2QPSA 3OGVA 1DOSA 1P0EA 2BY3A 2ASHA 1VQTA 2AL2B 1WDPA 1TR1A 2ZICA 3ZIZA 4A05A 3QSRA 1LWIA 3WDRA 3SY8A 2YCLA 2AQWA 4HNTA 4LAZA 4B3ZA 2CXGA 2C8NA 2GVGA 4J5NA 3T6CA 2PP3A 1UD6A 1PUDA 3CAQA 3WMCA 3PBGA 3Q4DA 1W9DM 1EC7A 5HMDA 3KZSA 2PDFA 3MO7A 1VD6A 2IXVA 2B7QA 3FIGA 3WLMA 4R88A 3K8MA 4LAOA 3GXFA 4LCSA 4Z1BA 1K9TA 4CD6A 3M43A 2QCCA 3ZLGA 1UR1A 1KXTA 4OUEA 5HANA 5C7VA 4WJEA 2XFFA 2V67A 4UTTA 1UH3A 5F4WA 5AC8A 3GNDA 3R12A 4W84A 4ERAA 2GZXA 2WWDA 3GXIA 4E2BA 1DV7A 4X9SA 4N0RA 3EB3A 2VCBA 1F4AA 2PP1A 3W1XA 1F2JA 2OYLA 3GTNA 2Q09A 3UYIA 5AZ1A 4NZ3A 3D0CA 3VOIA 2INZA 3VD7A 3CWNA 2WO5A 1ZL1A 3PS7A 1UD8A 4D71A 2D0FA 3AYRA 3TQ0A 1V0KA 3KX6A 1ISVA 3MJMA 1TZ7A 3V1PA 1PS9A 4XD4A 1OC5A 3GVVA 1GOWA 4IQDA 3CZGA 3LCFA 2VNCA 4C6OA 2UY2A 4H19A 4NRRA 1SQ7A 3DGBA 5D9NA 1ZRQA 1JRCA 4O1AA 3G0SA 1PIGA 2OSXA 4I5UA 3QTGA 1MVYA 1F3EA 1AW5A 1DWIM 1XFBA 1JYWA 4P7LA 4HCLA 3LI0A 2REQB 3G0XA 1XLJA 3TJLA 5EL1A 1M03A 4DWSB 3O16A 3QSTA 3RG6A 2WV8A 4GQBA 1UROA 3WD2A 4S39A 1DKWA 1HJUA 1XQKA 1XIMA 4JTRA 1TSIA 2H8XA 1KV8A 1J0YA 1CEOA 3UJEA 3ZR5A 2CHOA 5BRPA 4K37A 3UZ5A 4GNJA 1ML1A 4RDVA 3UZXA 3CUGA 1SFTA 4H9VA 1TO3A 4DZAA 1LBMA 1Y5VA 4NZ4A 2WMIA 4R27A 1F6KA 3NJ3A 4C6QA 3WQ8A 3WN6A 5FESA 1T8QA 1UD5A 3TJXA 1ZPTA 1CLVA 2LLEA 5TBOA 1XICA 2I9UA 2D2HA 1JZ3A 4MM1A 2ZVRA 3CL8A 3DZ1A 4Q8PA 4O17A 4LNCA 4V33A 1XCFA 3BLIA 5BXPA 2OKOA 3MV11 3HA1A 3R11A 5CZ0A 1P0BA 1GORA 2GJPA 4MNLA 3B9DA 3U3HA 4MYAA 1ODZA 1LT8A 1KBKA 5BXSA 4AZ7A 5BXRA 3MUIA 5MF5A 4NI8A 5FCZA 5DCBA 4DX3A 4DNMA 3BOLA 3HGJA 3A3XA 1WDDA 1DQWA 4JTDA 2VR2A 5IM51 4JY8A 1Z41A 4E3TA 1H7RA 3T09A 5CZSA 5HQMA 4BQ3A 1DWJM 3HO8A 1JVNA 4P8XA 1VBJA 1XGDA 1BLIA 2W3ZA 1Z32X 2F38A 3HOJA 1IXPA 2ZWYA 4S23A 4ICMA 2WWCA 2PLKA 1OJXA 2PUZA 1UR0A 4U28A 3LSBA 3N6JA 5LSMA 4I8DA 3W6MA 4ICCX 1UPMB 2W92A 3ARRA 3O05A 3UWZA 3NQCA 1O12A 3AUJA 1LP6A 1ONWA 4CNUA 3M0VA 2RDUA 1WA3A 1EHNA 3NTYA 1RK5A 4XZIA 4HHLA 2CW6A 3GC4A 4OHQA 5LNUA 3JZUA 2ANUA 1DL3A 5F4XA 3G1DA 2V5JA 1W9PA 1W8SA 3RPMA 1C93A 2GUYA 4V1YA 2F84A 1ZBWA 4NAFA 1KKOA 1JZ7A 4HNLA 4D72A 3H70A 5E6ZA 1UZDA 4UC5A 4RZ6A 4WRHA 5CZJA 1SM9A 4LW7A 3SGUA 3I65A 3BG5A 3TA9A 1GVIA 2HRWA 2Y8UA 3EA2A 2G37A 3ZWSA 3NYZA 3MVTA 2YFNA 5L9FA 4GIRA 1XJBA 4WXZA 4OZOA 3SJNA 4P7NA 1UBPC 2UZ9A 3S1XA 3VOHA 5H2ZA 3S0CA 1H7XA 3QKEA 1R9ZA 3B9EA 4GXMA 4ERGA 1IYXA 4M5PA 5A95A 1OX4A 4P2VA 4HZ8A 3N2TA 1M3UA 2YCIX 2IS7A 2XN0A 2CITA 5I0DA 1UJQA 2Y8KA 2V3DA 2XGZA 4E2OA 1CGUA 1UKOA 2O7QA 4OV9A 5KETA 1GYNA 2VFFA 2GGHA 3TWBA 2ZZ6A 3HPXA 1O68A 2ON3A 4US5D 2QV5A 2XVLA 4CQAA 4DYEA 2R94A 1FCBA 2FFCA 3UA3A 2ZKMX 4AISA 2JGYA 3GVRA 3EX1A 1OZMA 3M0LA 4GRSA 3DERA 4LC8A 3TXVA 3I6RA 3AXHA 1R3QA 5JQ9A 3ITTA 1YBQB 1P7TA 2BDQA 2YB4A 4XZHA 2WVUA 3H7VA 1OG6A 3SO7A 1MQPA 2AQVA 2BY0A 4F0MA 1HW6A 4Q8NA 2VC7A 1O7AA 3GYCA 3FCPA 4P7RA 3UXLA 1OFAA 3IS4A 2H3DA 4GYKA 1IZKA 5G1MA 1P1XA 4ZO8A 1R0MA 4LS2A 1FDYA 4FNQA 3VKDA 1TPH1 1UWUA 3MYOA 2Y24A 1W8GA 3KHDA 4ENLA 3CT7A 1W9XA 2WNQA 1HVXA 3OZMA 2X1SA 1OX6A 5CCZA 1CXLA 2WZIA 3BLKA 4OFCA 3R79A 4A29A 5M5DA 1BG9A 4ZQNA 3A3HA 3EMQA 1FWAC 2BOEX 4MOZA 1UH2A 4DI8A 6TAAA 3CYJA 4IH3A 4ZOAA 3GW0A 4QLLA 3PB0A 3HG4A 3K5XA 2EPKX 3UWWA 1HO1A 3DI1A 5CC5A 2PC8A 5KMYA 3C2FA 5C2CA 1OFOA 1X7IA 1YIXA 3SY1A 3PFMA 1RP9A 5A69A 3TUUA 3VMOA 4LGXA 1E51A 3W07A 1EDQA 4UOZA 1Z6KA 4JQ3A 4O8AA 1R2RA 5I02A 3CQ0A 2FHBA 3OODA 5AFDA 4D6HA 3W7QA 3VZXA 4A3HA 2QUTA 5I3HA 5XIMA 1W3HA 4NF7A 1IWBA 3W24A 3O06A 2J7DA 1JIBA 4XKMA 1ITUA 1F3XA 3GHUA 4FNTA 2P0IA 3LX9A 4XWUA 2W66A 2JIWA 1REQA 2ZRXA 3KE0A 4TVDA 1OD0A 2WLZA 4YTSA 1BXBA 1J96A 4NX0A 3G1XA 1XCWA 1TTQA 3XIMA 3VCCA 1E9YB 1OCBA 4N4QA 5DT5A 1A5CA 2PDGA 1BYDA 3NZ1A 1GOXA 3EOOA 1FY6A 3EX3A 4AC1X 3ICJA 4GO9A 3N12A 4IQJA 3ES8A 5E70A 4IMCA 4W8AA 3F4VA 1TMQA 4ZQCA 3W2NA 1LRNA 3TSDA 1YXDA 3TTOA 2QUVA 1EQCA 3P6LA 2VD8A 4LS1A 4H6RA 1U5VA 4YHGA 4WEVX 3DYOA 3RO8A 2CBIA 4O11A 4ADTA 2HROA 2HNHA 4LAKA 3QM3A 2J75A 1X39A 4HSOA 1RH9A 5E0CA 4GFIA 3MV01 4AXKA 1QW7A 1QNOA 3OQEA 4NNCA 5BYWA 3MU7A 4M51A 1IEIA 2CYGA 1XDLA 3WBXA 1ZP3A 3UPBA 3TLLA 4LXFA 1A5SA 4QSHA 3C2YA 1AH4A 4X2RA 3S9YA 4FOJA 1TE1A 3INPA 3HQNA 5C6MA 3BARA 3QGAC 2WC7A 3GKAA 5I07A 2YKKA 3N17A 3O7UA 3STGA 1RA0A 1XRFA 3SI9A 2ISSA 1KM6A 3FGCA 4HSHA 2ZYFA 2B4GA 4G1NA 4TX9A 1OCQA 3LUTA 1AUSL 2G3MA 4DUOA 3DH7A 3N3TA 5A1AA 1WP6A 3R8HA 2WPBA 1P0KA 1V7YA 4GZIA 4GLEA 3V1HA 1Q63A 3A13A 3PP7A 1XIDA 3RM8A 4HU8A 1H5VA 1XP3A 2VR4A 3E2SA 5D9MA 1NSJA 1VJSA 2PC4A 4Q6JA 5LA0A 3GC2A 3MI2A 1LUCA 3LZ3A 1T0OA 3TQPA 1QMLA 4FR6A 2G3IA 1OD8A 2P8BA 1E0XA 2YBTA 2Q8LA 2Y89A 3NPUA 6PTDA 3LRKA 4O18A 2WVVB 3NR0A 4ES4A 4GUIA 4C6DA 1Q6LA 3KLLA 2BVYA 1IGWA 3S8HA 1SSDA 1BTCA 2AGKA 1SJBA 2DIKA 1RJRA 4HNCA 1VYPX 5H8UA 3SUVA 4MWAA 2VEIA 3WQGA 3BV7A 4O4VA 3UVIA 3C4UA 4C6FA 4C1NA 5DO8A 1VHNA 2XDFA 1NDZA 4U33A 2A3EA 2E3ZA 3L9CA 4HA4A 4BA0A 3BW2A 2BSLA 3DFNA 3SN0A 4IIFA 2CIPA 1B3WA 4PYSA 3N1AA 4V28A 3GWQA 1LWJA 4PSPA 1E70M 2VQTA 3ABQA 2VC5A 4OOZA 4FMVA 3VD9A 1A80A 3P62A 2I14A 1A0DA 1B3YA 3GHTA 5I00A 2PCQA 1G6CA 1J0ZA 4C5YA 6REQA 1AA1B 1KD0A 3A4JA 3CU2A 3SRFA 4ERIA 1X1NA 2Y7FA 3EA3A 1B3ZA 1Z8AA 4WQ6A 1W1PA 4W87A 1CDGA 2NV2A 1NF7A 3R58A 1ZBKA 3LHVA 1HKVA 1E71M 2WKLA 3MDWA 3U6WA 1EUNA 2VFIA 3UR7A 4Z2GA 1QPOA 2NXIA 1A5LC 1CT5A 3ONBA 2ZX9A 1SJDA 3GXDA 2ZOXA 2EPLX 4GNKB 4M0XA 4AEOA 1XPYA 3TTQA 1EDGA 2UY5A 3KBVA 1CGYA 5HMEA 1IV8A 3TFXA 1X8FA 2C7FA 4MAZA 2V5KA 4EXBA 3UXIA 1AQMA 2GYIA 1YTDA 1PCWA 1TV7A 1JI2A 4KF1A 1K8XA 3UR8A 2FGBA 4DXXA 3OB8A 4IG2B 1UYQA 1TPC1 3WK3A 1F6PA 1VCGA 3THAA 1QJWA 3CQJA 3KBNA 4OBSA 4U5KA 3ATZA 3AIBA 2D73A 4GISA 4RDZA 3B9OA 3OJGA 1D8CA 1HNYA 3FDKA 3CZLA 1OYCA 5E93A 1FX6A 4QS6A 4H9TA 1NWRA 4KFPA 1I60A 2W5FA 4B15A 3QY8A 4KESA 3U7BA 4XV0A 1Q45A 5KINA 5HJXA 3AALA 1R3VA 3D6NA 4UUIA 3GAKA 4RDYA 1UKTA 1S2CA 2EQDA 4W8BA 2BXVA 1VH7A 2Y4SA 4UQEA 8XIMA 2VURA 5K2ZA 5D2TA 5IBXC 5E9AA 5EMLA 4MUPA 1KR0A 2C14A 4FNSA 4QQUA 3Q45A 1EWDA 1UP0A 3UJRA 4F3HA 2G0WA 4M1BA 4ZTXA 3M0ZA 3JU2A 1F6YA 3NSMA 3U0HA 4Z1DA 2J7GA 4YNGA 2BLEA 3GDBA 3KDNA 1Q7ZA 3WD3A 4A8RA 2VEMA 3M6DA 1DE5A 3H55A 3JZEA 4AD5A 2ISVA 3CO8A 4WDTA 1ZBCA 4A3RA 1TMLA 3QQWA 3FXGA 2WMFA 3C56A 3L0GA 1SMDA 4LEFA 1PKMA 1PWMA 5BWFA 1H60A 2D22A 4JGDA 5TNVA 3H2OA 1NWSA 3NNTA 4PR4A 2ZTKA 1TPUA 1GHRA 3AIQA 4OU1A 5F7UA 4DF0A 4JFUA 4OECA 3U5UA 1YNQA 3EXTA 4MZ8A 3R10A 2VI0A 1IEXA 1ESWA 1ENUA 1Z9AA 2PMQA 1BYCA 2D20A 2C1HA 3LGEA 3IIVA 4N9DA 3CLWA 2V5BA 2TPSA 1HUVA 1Q6GA 1WE5A 4E0CA 4QISA 1KQYA 4XZNX 1MEIA 2UY4A 2Y70A 3P93A 2CBUA 1N2VA 4PBGA 2A79A 3MB9A 1ZBVA 2Y1HA 1UWQA 3HG3A 4QQ3A 4RE0A 4GFSA 5EB8A 3VGDA 2NXHA 1R8LA 4YWIA 3FSTA 5DMNA 3L65A 3SCTA 5HBFA 5DN1A 3SUTA 4UTWC 1JFXA 2D0HA 1VFHA 1EEPA 1S3TC 3U48A 4L6OA 3W81A 3C8FA 1THFD 5C9ZA 5KZEA 1OWQA 4HU4A 2D3NA 2GK1B 1DVJA 2NVDA 2HVMA 3LHTA 4AIBA 1QRQA 3WO8A 2EKGA 1K7FA 3CMJA 5C9UA 1J10A 1F8IA 3SEPA 2OO0A 4IMGA 4H2CA 1RLCL 3MSGA 3PTMA 4PMYA 3OZPA 3H12A 1TRDA 3H22A 4ZZ9A 1XBYA 3ITLA 3U8GA 1V02E 5IOBA 4IJCA 3S6TA 2YA1A 6TIMA 4PB3A 4UCFA 3WX7A 3ZM8A 2BODX 3ABXA 4QLKA 3BICA 5D02A 1PZ1A 4B5SA 3VU2A 1XUZA 1Z42A 3MUXA 3VD5A 1GUVA 3EDFA 3B04A 4GIEA 5TD4A 1UUMA 1H61A 5I23A 1WAUA 2Q6ZA 3RMEA 3SCVA 3ARTA 3QC3A 3VFCA 1ZQ5A 5HK4A 2VZTA 4DJFC 1W0MA 4HP5A 2GGGA 3EB4A 2VX7A 1NFGA 1W32A 2G3JA 3FSUA 2P88A 1EGZA 4ROQA 3UEQA 1YDVA 1MFVA 2YDSA 3OVPA 5D2WA 4B4FA 3FV9A 5AYBA 5CZTA 3IGHX 4QFUA 2ZX5A 3GHSA 5B7YA 1OGSA 3UESA 2QF7A 5CAKA 5I3GA 1SU5A 2WHJA 4LEQA 3V3WA 3SCQA 4U2ZA 1M7PA 4F9JA 3QY7A 4PMVA 1WB0A 5FL1A 2QMKA 4H04A 5D2XA 4B16A 2PGFA 4Z0SA 1CCWB 1RA5A 2HBXA 1WDWA 2PURA 4NZ5A 4UZSA 1MUMA 5DQPA 4QBXA 4HNVA 4QM1A 2OGJA 4UTLA 4JL1A 2WCSA 4E3VA 1VFSA 2XIQA 4RPQA 1S3HA 3AYSA 3TZFA 1HKIA 2J9YA 3UERA 3M4HA 3ANUA 3PBMA 4MJ4A 4JTSA 2E8ZA 1AD4A 3DUGA 2Z1BA 2VDGA 3WELA 3R7MA 3RLGA 2AMGA 2J77A 5FJJA 4ILSA 4XIAA 3S6DA 4LF1A 3E6EA 3T2OA 1PDZA 2D2OA 1TJ1A 3EWDA 4ZXLA 1OINA 4E4UA 2DUXA 4RE4A 4QROA 2G97A 1XSKA 4UFKA 2PDIA 2DQWA 3SURA 4O54A 3K1GA 1XISA 4UTJA 4RV8A 3WQWA 4O0KA 1TMHA 3TYDA 2P50A 3TKFA 4QEHA 3D3FA 2TAAA 3OYXA 2DT3A 2NQJA 4AMAA 3PB2A 3MYPA 4OE7A 1FWDC 5I78A 5J04A 2Z4GA 4DELA 2NLYA 4PGLA 1G4SA 3GLCA 3CL6A 1XBVA 2DH2A 3ITGA 1XINA 1Q65A 2Q8ZA 2C1IA 3BANA 1VBHA 4IL2A 1FWEC 1TV3A 2OU4A 3VM5A 4C1LA 2YIHA 4M7TA 4K6AA 3IANA 3OVGA 1KGUA 1ZHAA 3V36A 3L5LA 5CC7A 5DXYA 1J12A 4ZO6A 1K7XA 1YHTA 1UUOA 2OODA 3LRLA 3EWYA 2HMCA 3G6LA 2C79A 1KCZA 3WLPA 4FEZA 1XX1A 2DFAA 2YBVA 1UKSA 1W3TA 5BZAA 4RJEA 3WLKX 1OFPA 3W1MA 2PD9A 4HTBA 3VNLA 3DG3A 4A2SA 3GDKA 1S2VA 3GAYA 4REQA 1Y65A 3KS6A 3M5VA 1O60A 3PN8A 3ONCA 4JIQA 3QLLA 3PNZA 4JIEA 3WEZA 4FO4A 4XKYB 1G4TA 2NQ5A 1GVYA 4HYRA 4AF0B 1TWZA 1UB3A 4HT3A 1LL7A 2WJDA 1E1FA 4JIIX 4UR7A 1KR1A 1T6MA 1VPQA 1UOKA 3BCJA 5I79A 4DAFA 2VWTA 4M6VA 3WQCA 2CCRA 1JYNA 1P48A 1VIWA 4NILA 1BYBA 3IJIA 4CNNA 4UMCA 1OFDA 3PZUA 3UNTA 4Z0JA 3A64A 3DOPA 1EZ2A 1XYCA 3NL6A 1ELSA 1FKWA 4Q4KA 3ISIX 1WKEA 4KH2A 1TJ0A 4AW7A 4LC6A 1RLDA 4PMJA 2JGQA 3QF0A 1GVEA 4NG3A 1K6AA 3WQOA 3OGSA 1KC7A 1GEQA 5D05A 2FMNA 1X8CA 4AZGA 4NYYA 3MDUA 3P81A 2WZMA 4W4QA 3WH5A 3E96A 3S5SA 4TMBA 2V2DA 3BAXA 4G7EA 2W62A 5CSYA 1BYAA 1XBXA 1NQ6A 1E1CB 4KWVA 5T9BG 3BURA 1VFOA 1R9YA 5LIUX 1E40A 3FA5A 1PE1A 4FF7A 2YFOA 2Z00A 4M29A 4TXEA 3AQUA 5I03A 1XYAA 1C8YA 4WVXA 4BQ5A 3FDGA 5AZ0A 4Y9MA 1BTMA 2BGNE 1O6IA 4LY8A 4RCXA 5HINA 1X38A 5AOUA 1EP2A 1Y5XA 1A49A 1UIPA 5CEWA 2WQDA 1JPDX 2OT0A 3WLTA 3K4DA 3U4AA 2R14A 2OWCA 2HQAA 2WM1A 4DB7A 4FS9A 1NQKA 5A6BD 4Z17A 3I3DA 3EPMA 1SFSA 1H09A 2XSAA 4DO7A 1SW7A 3IEBA 1NP0A 1KGWA 3P3BA 2CZEA 3DYMA 3UF9A 1ONRA 4JTJA 4G9PA 5EMMA 2KZHA 1FWGC 1ZNNA 2W91A 4A22A 3OTRA 4AUBA 4BI6A 1VEPA 3AYVA 3KOXA 4BS0A 4J4KA 1RUSA 4MWAE 1QI3A 1L8PA 5RUBA 1PWLA 4PMZA 2YL9A 4WF7A 3L23A 1KM4A 1UG6A 1FA2A 2J4GA 3GTXA 1RVKA 3RFAA 1Z7AA 3NA8A 2QMJA 3TH6A 3G3DA 3QJAA 3NVDA 3WKZA 1JCMP 1GZ1A 4KKXA 1RQEA 4QGCA 1SO3A 2AKMA 3NCOA 1WX0A 1I1WA 1UR3M 3EKGA 3QTPA 3W2LA 3FFSA 2PDQA 3EXRA 2FTPA 1H63A 2GVJA 2P8CA 1YKWA 4ZODA 3FA4A 4WGXA 3OVQA 3LERA 4KCTA 2DH3A 2E7FA 4YU1A 4XBKA 2CKSA 1OT1A 3NQVA 2FMOA 2GQ9A 3HIJA 4UB9A 2BGQA 3SGGA 4MG4A 3ITOA 3M0YA 2PWDA 3R0DA 3BLEA 3W1PA 2V3FA 4IUGA 2VFEA 3THDA 3GSMA 4EPBC 4IIBA 5CZKA 4IF2A 2HEJA 4XZMX 3UW6A 2BP1A 3WLJA 2Q01A 4HB7A 3CL7A 3DBPA 5REQB 5C5YA 1OY0A 4UCGA 5HPCA 4LCRA 4K3ZA 2ZZ5A 4B5UA 2Y7EA 2QW5A 4FB7A 1OHLA 1NVMA 4HMCA 4F79A 4EWJA 4Z1AA 3D47A 1Q6QA 3B40A 3DEQA 3HTWA 3TJ4A 2QR6A 3B8WA 1P6CA 2EPMX 2PTXA 5F2IA 1FWFC 5EBAA 3BQ6A 3NM1A 5JBDA 5FF2A 1F3WA 2Z1VA 1CNVA 3HMCA 2ZZ7A 5TF0A 2OWWA 4UQAA 2JALA 5EGRA 4HCDA 3OQ8A 2CBJA 2A5HA 3PTQA 3TCEA 3G1RA 4UTMA 3WMBA 3WNKA 2JF6A 3WLHA 3R4IA 1OX5A 2P76A 4K8GA 1R46A 2E6AA 1Q4WA 1GT8A 1FUYA 1J2BA 1TV8A 5HAOA 3NIYA 3IK2A 2WK2A 4RR4A 4NYUA 5FEWA 2EBNA 1FHDA 2X41A 1O66A 4L9ZA 1CECA 3WQ4A 1NJJA 3U57A 3W01A 3S9IA 1KB3A 2XTKA 1GQJA 4KBXA 4AD0A 2OCZA 1A5BA 3BDKA 2EXOA 2CLMA 3UZYA 1EUAA 5H91A 4UQ9A 1VZWA 1D2KA 2WVSA 3PK7A 1WZKA 3VAVA 1UH4A 4BCEA 3E74A 4H6QA 1T99A 1UD3A 2GJXA 3W2KA 5KZMA 4WXYA 3N04A 2A6LA 3CM4A 2J8FA 5BU6A 4GQRA 2QS8A 3T7VA 5BRQA 1XIHA 4ZE4A 5KITA 4IXHA 3AMDA 5I09A 4QDPA 1E6NA 2RFGA 1BVZA 3LCWA 4KS0A 3FOKA 3HURA 3N4AA 2WNZA 2HK1A 1R3RA 2WW5A 4OT7A 2H9AA 5M03A 5FJUA 4KRUA 4DLFA 2BVDA 4IP4A 4LYQA 2A3AA 3GG0A 2WSYA 1KA9F 4IGSA 4H7ZA 4PL2A 4NY2A 3WD0A 4MUZA 4PRWA 4NNBA 3QPYA 1FDJA 1PV8A 3CT2A 4GXWA 1VHCA 5CJMA 3ZLHA 1O5RA 4HVXA 4KERA 2EF9A 4U2YA 3ABSA 1V6TA 3WK2A 8XIAA 1OABA 2OB3A 1KXHA 2WHMA 1UCWA 2YCJA 4K8EA 2ACRA 3VYLA 1PHQA 1AL8A 4EE9A 3U7VA 5HNRA 3GFYA 1ISWA 4ZENA 5JU6A 3W82A 1E72M 1PX8A 2RH9A 2CC0A 4MLJA 2WXDM 4H01A 1A47A 3SADA 4XTDA 4URIA 4IIGA 2VRKA 3LTSA 3T8LA 5AHNA 4DVOA 1R3TA 2DSZA 5D03A 3YPIA 3F5KA 3NM3A 5AKQA 4GUJA 4HNNA 5HMSA 5AB3A 4WKHA 4W9TA 3EPNA 2JIEA 1TJ2A 1I45A 1BRLB 1N8IA 4MFDA 4MKNA 3U4FA 2BASA 1KM1A 3BC9A 3MBDA 1NF0A 2DW7A 1Y0EA 5A2CA 3T1GA 5F2LA 4EK7A 3L0NA 3EX6A 4AX6A 1NELA 3ZOAA 3C8NA 3PAJA 1GZGA 3TNBA 2YCKX 2NT1A 4BZYA 1K7EA 1AODA 4GZEA 1HJSA 3L68A 4FHAA 1A5AA 1MUWA 1EA0A 2TRSA 1KKRA 3M44A 4UMBA 2J7FA 4AX7A 2I7GA 1A5KC 1UWTA 4RLIA 2IKJA 5DRCA 2GSJA 2VOMA 3ZJ6A 2VHLA 4LVGA 4UIOA 4Q8VA 1Z69A 2PPGA 3NQFA 2C3ZA 4IFKB 4O53A 1K77A 4O1FA 2IQDA 4JTGA 3RITA 4MGGA 3IACA 3KVKA 4HHHA 1BFNA 4R9XA 4EWND 3Q67A 4HNUA 1H41A 4AHQA 5LKYA 3DENA 1PIFA 2FQIA 1K4HA 1KCKA 2BV9A 1LDCA 3MQTA 1KRAC 1Q13A 4GQ0A 3AOFA 4BI5A 3OA3A 1ECEA 2QVHA 3P84A 1RBOB 3UQNA 5HWJA 1YTKA 4V15A 3EZ4A 2VDHA 3OGRA 3OG2A 2V3GA 2BB0A 5IDZA 2YX0A 3KW3A 1KM2A 3ITCA 4MB1A 5LNWA 3MVIA 3IUDA 4HOXA 4IPLA 3GYEA 2OEKA 5AVNA 3O0KA 2V2HA 5A8OA 3UNDA 3RU6A 4F66A 1WAWA 3F5JA 3O6CA 5BMWA 2PDLA 4QE1A 4QG9A 1RPKA 3O15A 4HMDA 1PJ9A 3LLXA 3QR1A 2ZC1A 3TC7A 1PEZA 2ESCA 3B8SA 2VC6A 3N34A 1ISZA 4NZFA 1FHUA 3BCFA 3GXMA 1FWRA 3ABOA 4GY1A 2ZE3A 4S1FA 5AHLA 3IGXA 4YCPA 2WPGA 4UBPC 2OO6A 3GUWA 1Q6DA 3KRBA 2HDJA 2V9DA 1IT0A 2CLEA 4ACZA 4PCSA 4NXKA 4L61A 5K9DA 1QHPA 4K38A 1W5NA 3HJZA 4MFEA 4DXKA 1XLBA 2VQUA 1V77A 2EG6A 2QCDB 1Q2RA 3GH4A 2EG8A 2GDQA 2PF8A 3K8LA 2ZA1A 4AY1A 3SRHA 5HXMA 3VKAA 4NT0A 2VX6A 2XSXA 3KUMA 3UY7A 1AQHA 4AHOA 4OBRA 1TPDA 4Q4OA 3DAQA 2GLKA 4HPJA 1ZZMA 1J18A 3QV7A 1DJIA 2BXZA 4A8NA 3RLVA 5D9PA 3LLDA 4Y8EA 1T8XA 4QEEA 4I9JA 2VCAA 1LBLA 4CUCA 4K1GA 1P6BA 4ECLA 5FEPA 3F4NA 3WL1A 4MPKA 4QLJA 4I90A 2EJ1A 4FSAA 4YS1A 4JQ1A 2Y85A 3KRUA 3NQAA 1RBAA 2B0MA 3G8EA 1L6SA 3P7YA 1U1UA 3M6YA 3MCOA 4C6EA 1TPB1 4PRTA 5LXXA 4BK9A 1W9VA 2FVMA 4GG9A 4GUHA 4IIEA 4GINA 1DJZA 2PTDA 3BAWA 4E6MA 2PB1A 4M7SA 3QKZA 1XDJA 4KW2A 1BGGA 1PTGA 4RW5A 1V4YA 3W37A 2BHYA 3NPWA 3AHVA 1FXQA 1S5WA 3T0DA 3LS9A 3L5MA 1JCNA 3TLQA 4FAMA 5DLCA 4MB5A 2Z27A 4AWTA 4UR8A 2YLLA 2HVNA 1TVLA 2DT2A 3XISA 3C0QA 5G4WA 2VKZG 2QQ6A 3HBLA 5F2MA 4GYPA 3DHFA 2O4QA 3MCMA 4JTEA 3GH5A 1HFBA 5GPRA 2GSHA 2DORA 4WIWA 3TV8A 2DT0A 2XZ7A 4B4HA 3TFCA 4ZSTA 2CFFA 3H2EA 1CB7B 4LB4A 1H49A 3WFAA 1POJA 1VLWA 4PTVA 2QCGA 4H7CA 3NQEA 3IWPA 4ZQMA 3K46A 2X7WA 4XD3A 4O14A 2E68A 1EP3A 3TYEA 4OJYA 4HK5A 3C2VA 3MKVA 2YZ5A 1R9XA 4LFYA 1HKKA 3ALGA 4Q4QA 3TN3A 2NXGA 3GD6A 2QUUA 3GDMA 3SN1A 3R89A 2Z7KA 1CW2A 4GH3A 3VCRA 1DJNA 2VZVA 2J74A 2CU0A 5CGQA 1G4EA 3UBPC 3FX4A 1UUQA 4WJ8A 5DF0A 1VR6A 1YX1A 3P61A 3S47A 4B92A 2C1GA 4JYFA 3TSMA 3TC6A 1GJWA 2MNRA 2J8TA 2NX1A 5G4EA 2Y88A 4WUIA 1QASA 1NOFA 4Q8QA 1R5YA 3OLEA 3B8UA 1GWJA 2VJXA 2QDGA 1E3ZA 4DHGA 4M24A 1IWPA 5A8QA 7REQB 1ZJHA 5A6SA 4S3EA 3E2QA 1KTNA 3D46A 5C9WA 5A6LA 3DFQA 1OT2A 4MY8A 1H0IA 1V6UA 1JYVA 4I5RA 1F7BA 3UPMA 4J2MA 1K8YA 1J6OA 3WDQA 2F2KA 1S5MA 2O55A 3FKRA 3CMGA 1E55A 4NAEB 3EYPA 2A3LA 2QT3A 4LAUA 3FAWA 4G56A 4HQVA 4FOUA 3F4DA 4AFYA 1X6LA 2YCEA 1TV2A 1Q6FA 1FP8A 3F2DA 4CD5A 3MUZ1 3EXSA 4EOUA 1KBBA 4GBDA 4O50A 2Q3RA 2BHUA 4PMDA 2AOSA 2Z29A 1WUEA 1NIUA 1HIZA 2FHCA 4H8UA 2E28A 1JUKA 2I56A 4PODA 4ZOBA 2YW4A 1P0DA 5BOOA 5CLWA 1A53A 5F4SA 3DN5A 3UXDA 4CD8A 3FEQA 3CGTA 4INFA 4GABA 3S46A 2Z1WA 3PWIA 3VDBA 4HK7A 1NWTA 1OG0A 2PWUA 2VC9A 3GVGA 4XZLX 5EMKA 3I4EA 3VDGA 4GXPA 4LUSA 2Y7DA 1B4KA 5CSUA 3PHAA 3EWCA 3AHTA 3WBEA 3A5FA 2DZTA 3WG6A 1F05A 3QN3A 3S2JA 1DXFA 4GZ7A 4WSJA 4FP1A 3KDOA 2PDKA 1TA3A 4JL2A 3A21A 2NSXA 5HQLA 1SMAA 1YDYA 7ODCA 3GU9A 4CQ9A 3VC6A 3CAVA 1J9YA 3HU7A 3CHFA 4JTAA 2WSQA 2HV5A 4W88A 3WYZA 3DYPA 3L67A 3WBWA 4ZGYA 5FJPA 3BJSA 1EL3A 3KEHA 1F8MA 3WLIA 3RF9A 2QJJA 3CEUA 4W89A 4DN1A 1B30A 1WXYA 4FLRA 2EJAA 2WNNA 2OJPA 5E0FA 1KCXA 4CQ8A 2Z6IA 2ZXDA 3QOMA 3FHQA 3TVAA 1IXNA 3GY1A 5DX7A 4ZCWA 3AU6A 1FKXA 2VEFA 4S3JA 1S38A 1D3GA 3GIYA 2ZZ4A 2YA0A 4KWSA 5AHEA 3WF0A 2CLOA 1YNYA 2YCLB 2DSKA 3LLFA 3H8AA 1F4HA 2J13A 1BXNA 4Q33A 3W76A 2V30A 1MQQA 4UNIA 2VXNA 4C6JA 3QXBA 1TYGA 4IXXA 1H1NA 2Q02A 4O1DA 1CXEA 3SZ8A 3M46A 2GJRA 3GW3A 4NZJA 3KWSA 1MFUA 3EOLA 3TN4A 3MA8A 4OIFA 1EP1A 4PL1A 5T91A 5DRIA 1JULA 4LRTA 1HX0A 2JFEX 3UWUA 3PF3A 3M7WA 1EJRC 1IEVA 1XLAA 1TPVA 2PWHA 2BY2A 4TR9A 2IMRA 4J3UA 1JF6A 3HQPA 4EF8A 3ZSSA 1MDLA 2OXNA 1HQTA 4JAWA 4TX8A 4AZ5A 3S5OA 3IJ7A 4M6QA 1SYTA 3AJXA 3BUVA 5CBIA 3DFYA 2J7HA 1E0UA 1C8VA 1GQIA 3QHOA 4HBKA 2W67A 1EWEA 3ZO9A 2V82A 4LRSA 3LHWA 5LNSA 1G01A 3W83A 1DWFM 5DXXA 5K4ZA 1FTXA 1V79A 4XX6A 3HG2A 2F61A 2ATSA 2GQAA 4F2BA 3S2MA 4M80A 4A35A 4IGHA 5L6UA 3ARWA 2HNEA 4KWWA 4P61A 1UWRA 3VI2A 3TQVA 3QY6A 2ZFAA 1HN1A 2XPKA 4E4PA 2Y5SA 4W7WA 3CWHA 3V16A 1XRVA 3L2IA 3PTDA 2DVTA 4D6DA 1HJQA 4Z2JA 4A6GA 2WNWA 4BQ2A 1XDMA 3W29A 3SCOA 1KFCA 3OA5A 3CBWA 2WMIB 2BXYA 2OMAA 2DQXA 2OX4A 4C6KA 2X1UA 1RK6A 4C6NA 3EWUA 2QCNA 4ORMA 3Q37A 1BPLB 1CI1A 4L9XA 3UJSA 5GJPA 4TU1A 3FKKA 1M9HA 4RE3A 3FJ6A 4X0NA 3PAOA 5FAGA 1YW1A 5AECA 1ADSA 2BX7A 4EIVA 1IT8A 5G1TA 3U2OA 3PNUA 4CNPA 1JNDA 2VEGA 3UXKA 1XFCA 1SR0A 2DUZA 1C9DA 3DIPA 1NDWA 3LTYA 3H24A 5CH9A 2Z24A 2CNCA 3BSHA 1OGBA 4C6LA 3E38A 2OPJA 1MI3A 3MSDA 5ABFA 4WKAA 4AYSA 4H9YA 2V38A 3NQ2A 2IKGA 4AVFA 4P7OA 3N18A 2PLMA 3BZGA 2J62A 2YL8A 2WSPA 3H6OA 3IVSA 1W6TA 4DZIA 3MY9A 3R13A 3SR7A 2V0TA 1CXFA 2BOFX 3IGUA 1MNSA 1UZHA 4FNPA 3TYAA 4DPPA 3W75A 1FWSA 1EJUC 3M0JA 1WKDA 4PZVA 3EPOA 3LDVA 5E5CA 2YDQA 1ZENA 3KXQA 3W7JA 3MZNA 5U7SA 3AXIA 4NL1A 1HGYA 4KEMA 2I5QA 2PAJA 3SCWA 4O13A 1ITQA 3HQ1A 5FEXA 1KWGA 2Y63A 3PPFA 1NEYA 1I0DA 4EP8C 4AU0A 2BZNA 4NAFB 1B3XA 1HJXA 1YE6A 1XRSA 4KWOA 2I17A 5JH1A 3K13A 1HG3A 2J9ZA 1P4CA 1XYFA 1LG2A 3WJYA 3P5ZA 4M3PA 1T7LA 2CZFA 5EMUA 3W7PA 1WDSA 1OC6A 3EEZA 4PTWA 3M9YA 3KVLA 4ADSA 3EDEA 1N55A 1D8WA 1Z48A 4QAIA 1AZ2A 1OX4B 4B9ZA 4NJIA 2VCCA 1W17A 4B2DA 2XYLA 1J79A 4U31A 1XH0A 4HIBA 1FWWA 4O4WA 3BTNA 5EKYA 1TPEA 3NGFA 3HPFA 3E5BA 4CVWA 1GVRA 1G67A 1FH9A 1S2UA 5M2FX 5C2GA 2OVLA 1JDEA 2VR5A 5ABEA 3SCUA 4H9ZA 1A0CA 4ZQPA 4UNLA 1GPWA 5C54A 3MKKA 2OZ8A 1LRTA 1WKFA 4B3LA 2CEQA 1XG3A 2WYSA 3E5PA 1JXJA 5TQLA 5FF3A 2GL5A 3LNMA 3LBMA 1TCMA 2NQLA 3KM8A 2QGHA 3AHYA 4QDWA 1VS1A 1ZJAA 1P0NA 3HFYA 4IIHA 1B2YA 1BWLA 1P7TB 4G5DA 5D04C 3HPZA 4QCFA 5ABTA 1OQFA 1GPFA 2V5CA 3DG6A 1RV8A 1R3YA 1HP5A 4RZBA 4JTTA 3CHDA 1JAEA 3A3WA 1HJWA 4X3ZA 4IM4A 1L0PA 2FJKA 3TK7A 2J78A 4PMOA 4W5ZA 1XXXA 3AMLA 3LK6A 4L5ZA 3O6AA 4HPHA 3TDFA 1UQZA 3ARQA 4JN7A 3AS0A 1JI1A 4GVGA 4PCTA 2CKRA 2VX4A 1AW1A 3F2BA 1BSIA 1RQBA 3UU0A 2XIBA 4RW3A 3F7JA 5FACA 4FXRA 1O94A 3W38A 2QF8A 4TTUA 1PKNA 3W00A 1XH2A 3U2EA 1LF1A 4O0ZA 2FH8A 3K1DA 2IXUA 4D8ZA 1R2SA 2AAAA 1K1DA 3WUBA 1EJSC 3HQOA 5DFAA 3VOFA 3ANYA 4L4PA 3TP4A 3JVAA 3GQYA 4BEQA 2DSWA 3TXZA 2ZX7A 4RZ5A 9RUBA 2BNJA 5A6KA 5IBXA 3NQDA 3CUHA 1E1CA 1TPFA 2JK2A 3I68A 3ZR6A 3MHUA 3W3OA 1GTEA 3RGTA 2YYTA 3Q58A 4PFHA 3LD5A 2OYMA 4FR1A 1YPFA 3R8RA 5K9CA 3UXAA 2XUCA 4D2JA 2YXOA 3IIZA 1JCLA 3VKBA 2I57A 1REQB 3N4FA 1QI2A 4AZHA 4MY9A 5GJNA 3RRXA 2QJMA 2A3CA 2OG9A 1I2OA 4KRTA 4M82A 5D8WA 1G7UA 5CPQA 2O9PA 1IEQA 3CPRA 1EF3A 1OF8A 1W3NA 4AZ6A 3UGRA 4AHPA 4GWEA 5E9XA 1BD0A 1XPGA 1E5NA 5EA9A 3ZMRA 1JCYA 4ADUA 4AVOA 3ECQA 1RY8A 4UOJA 4Q8OA 2BHZA 1MZRA 3GG7A 3W7MA 3TN6A 3W71A 3G6MA 1RCXB 2WSKA 3C61A 4WLCA 4O8RA 3D5HA 3QV9A 2ALRA 4PTDA 3EMCA 2PF0A 5LNRA 4UZUA 4AZCA 1DIDA 2X42A 3LV5A 1KV5A 4HGXA 3GTFA 2A7PA 5BW6A 4N9CA 1R30A 1N7KA 3PSVA 2WBKA 3O2LA 3WUGA 1NDVA 2DIEA 4MNKA 2CHNA 4M6PA 2VGFA 4JX4A 3T40A 3EOEA 4WGHA 2WJZA 1XLMA 1TV5A 3MP4A 4YN5A 3BAYA 2ZA2A 3WQPA 4AC7C 3ZYZA 2OEJA 4UTWA 3MUAA 4YXGA 1BVNP 3H7UA 3WNMA 5DBUA 1VENA 4NKCA 1ADDA 3F4WA 1WYIA 3TOPA 1WDRA 5BROA 1SO4A 2QEZA 3ATYA 1CLKA 2ABBA 1B90A 2YGYA 3HV9A 2WZEA 3NUKA 4A21A 3PBYA 3FGCB 3KHJA 1MXDA 3N14A 3WF2A 4YVXA 3CV1A 4TOQA 2F9RA 2DZPA 3FS2A 4IMEA 4RDWA 1JQVA 1WXZA 4W7VA 2RKXA 2ZUTA 2D23A 3LBOA 4KQNA 3VOJA 1TZ9A 4G8TA 4FXSA 1YRRA 3CUXA 1E6PA 1GVOA 3WJXA 4BF5A 1W9BM 4DYJA 1LUCB 1DEDA 1V51A 4A2RA 4D9PA 3VCNA 5LYRA 2DU2A 4L6HA 1EHAA 3I7RA 1E56A 3NSXA 3C3NA 4NASA 2R9RA 2QDHA 4HA3A 5CJNA 3K4AA 3UZJA 4DJFA 4X2PA 3S83A 1AG1O 1C8QA 3UWYA 1E4IA 1ONEA 1XIEA 2Y0FA 3IK4A 4OTKA 2GOKA 3C86A 4TIMA 1QU4A 1VJZA 2X2YA 4C1NB 1PYFA 4LJ3A 5IHSA 3JUGA 3VO0A 3WLRA 1MDRA 1KM5A 2CETA 4CEUC 2GGEA 2ZZ1A 1F3TA 3M5YA 2P10A 1V02A 4W85A 3T8QA 3BLOA 3PPHA 3K30A 4Q8TA 3MHFA 3QYSA 3AYTA 4U10A 1NOWA 4FLSA 2JKEA 2OYKA 4YTUA 3H2NA 4QJ5B 2NW0A 2OQYA 6REQB 2HPIA 1EDTA 4WJXA 2HZGA 4PMUA 5DCDA 1RJPA 4M81A 4UOQA 2F6KA 5A3HA 1XIFA 1KCLA 1UIOA 1W1ZA 1E6SM 4ZE5A 5A8MA 4IX2A 3OZYA 3WNNA 4DNHA 3GZ3A 4LBRA 4Q4MA 3I3EA 3T2PA 1DWHM 4M8UA 1US3A 3RCNA 4E8CA 2IPWA 1FDZA 3CXOA 4IWWA 1HZYA 1H7NA 2WZHA 3RMJA 4HYVA 3RRAA 3N2XA 4CU8A 1LZOA 5CXPA 2PLCA 2MUCA 1JUEA 2ISFA 4LCQA 3VNDA 3VUPA 5H6HA 1UKQA 1VBUA 4Y6GA 5AC6A 1W1A1 3C5QA 5MKGA 3FN9A 5A5WA 4LS0A 4UTUA 5HATA 1ME7A 3GXNA 3IV8A 1K70A 3LU2A 3NXFA 4LANA 3AUOA 1Q6RA 4YWSA 1XS2A 2F8QA 1E73M 3GBEA 3MHGA 3CUJA 2VX5A 2X7VA 4H8HA 3B97A 4K7VA 1UQYA 3LPPA 5KSWA 4H6KA 1QFEA 3QV8A 3CPUA 4JDYA 1DP0A 1W3IA 3GG8A 2D2GA 3AWOA 3S5YA 1WXJA 5I5RA 4N6FA 1QNVA 4JFSA 4ZOCA 3VMNA 1F5ZA 4OOUA 4ATDA 3C0SA 3AIVA 4RXFA 3SSJA 2QCEA 4O0QA 2C16A 3DECA 3AZTA 4EANA 3GNRA 1QR7A 4F9DA 2FVKA 3T05A 2BVWA 4RUBA 2C13A 2OOFA 4NHVA 3QVQA 3VIFA 1E4NA 3S42A 2DW6A 2QIIA 2VEPA 2PDXA 3U9IA 3RX4A 3ZVHB 3W1AA 1UR4A 2TMDA 4BHYA 4LYRA 3BK0A 1IGSA 5HQEA 3CWOX 4IICA 4AVNA 3LNPA 3AS1A 3AJ7A 5KZDA 3KFTA 4NP7A 3VE7A 1FH7A 1H62A 3ZXWA 1T40A 1W1B1 3ORWA 2DJLA 2WOQA 3RN6A 2XM1A 3SCPA 1SJAA 7A3HA 2ZIDA 3VIIA 4GJJA 4Q4PA 4L1XA 2OSWA 1U5HA 5FF7A 1FOBA 1AW2A 1IHIA 2A0NA 2XHYA 1ZJBA 3BMVA 2A6NA 3VGGA 4ORIA 3HPSA 1G69A 1FHVA 1TRIA 3WBYA 5AHFA 2XIIA 1UD4A 2VFHA 3NVTA 1S5TA 1RVGA 4PB5A 2Z2UA 5EY5A 3TN5A 2GVEA 4ZO9A 4UXDA 4NZ1A 2YPIA 5HNNA 3N19B 2PI6A 2ACUA 4XQ6A 3UP8A 1R7OA 3CIVA 3PZMA 3RM4A 2DY3A 4TV6A 3O6YX 2PGRA 1XLDA 2EGZA 2PBGA 2QUMA 3GM8A 2E6DA 2ALDA 4JY9A 3CQHA 1OYAA 2V69A 1Q5MA 1DHKA 2XVGA 1V6XA 3WQFA 3PJTA 3I6EA 5LIWX 1H5YA 3S2LA 1XR2A 1QTWA 3APGA 2X1RA 4DLMA 4DBWA 2PODA 3MANA 3W6YA 4C6CA 2PRHA 4LAMA 3SB0A 1S5VA 1BKSA 3WK0A 3GFZA 4DPQA 3IIXA 2XISA 2QJIA 3QMTA 2RAGA 4DRSA 3MBFA 3B05A 4XD6A 3WF1A 3SFWA 1HL8A 1CB2A 3ME3A 4JIPA 3PANA 1SZEA 1ITCA 4AIEA 1EIXA 1WNOA 2E4TA 3BG3A 3PJUA 1UW9A 4JZ5A 4KGJA 1XM3A 3F2CA 1Q2SA 1H51A 4F48A 2XVNA 3W1NA 1GNXA 4GD0A 3QH2A 2FH6A 1H7OA 1V03A 1V7AA 2FZBA 3NPVA 2Y2WA 4LH8A 5AYIA 2NQZA 4D6JA