3O6AA

F144y/f258y double mutant of exo-beta-1,3-glucanase from candida albicans at 2 a
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
394
structure length
394
Chain Sequence
b'AWDYDNNVIRGVNLGGWFVLEPYMTPSLFEPFQNGNDQSGVPVDEYHWTQTLGKEAALRILQKHWSTWITEQDFKQISNLGLNFVRIPIGYWAFQLLDNDPYVQGQVQYLEKALGWARKNNIRVWIDLHGAPGSQNGYDNSGLRDSYNFQNGDNTQVTLNVLNTIFKKYGGNEYSDVVIGIELLNEPLGPVLNMDKLKQFFLDGYNSLRQTGSVTPVIIHDAFQVFGYWNNFLTVAEGQWNVVVDHHHYQVYSGGELSRNINDHISVACNWGWDAKKESHWNVAGEWSAALTDCAKWLNGVNRGARYEGAYDNAPYIGSCQPLLDISQWSDEHKTDTRRYIEAQLDAFEYTGGWVFWSWKTENAPEWSFQTLTYNGLFPQPVTDRQFPNQCGFH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucan 1,3-beta-glucosidase
publication title Carbohydrate binding sites in Candida albicans exo-beta-1,3-glucanase and the role of the Phe-Phe 'clamp' at the active site entrance
pubmed doi rcsb
source organism Candida albicans
molecule tags Hydrolase
total genus 150
structure length 394
sequence length 394
ec nomenclature ec 3.2.1.58: Glucan 1,3-beta-glucosidase.
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3o6aA00
4TXEA 1HJUA 1QW8A 3NSXA 3LPGA 4B9ZA 1CXIA 1VFMA 3KL5A 2Y4SA 4RL3A 4MJ4A 5DEZA 4PMOA 4FF5A 5I0DA 1JAEA 3K8KA 1C92A 4HU0A 3SUSA 3N17A 4UQ9A 5CPSA 2GK1B 1DWAM 3D3AA 2F2HA 3UCQA 1HVXA 3CUFA 4H8HA 1UD4A 4GZIA 5BRPA 3TOPA 3FAWA 3GM8A 3M6DA 4OUEA 3WF4A 5A6BD 3CUJA 3CUGA 5D9NA 2Q8XA 3WD4A 1QBAA 4CD6A 2WVVB 3AJ7A 3WD2A 3VU2A 1PJ9A 4UZUA 4P8XA 4OZOA 1W9PA 4Q22A 3U57A 1V02A 4M24A 1A47A 3UR7A 3WD1A 2VI0A 3ZMRA 3L2MA 2F8QA 1GORA 1Q6EA 4EAMA 1N82A 3EYPA 1DWHM 2W61A 4QLKA 4F8XA 2YL8A 1BYDA 1ZL1A 1EDTA 4AD0A 2J74A 3LPFA 1BHGA 1GCYA 3UERA 3OZPA 3KE0A 3ZO9A 4P8VA 2WLZA 1B3WA 5DT5A 4DWSD 2YDSA 3W81A 3RM4A 5FL0A 4FMVA 4M1RA 2ZUSA 3NCOA 4UQCA 4TVDA 1HKJA 1NWTA 4UFKA 3WL1A 4XV0A 4V2XA 4Z2GA 4J3VA 5A3HA 2C7FA 1HL8A 3OG2A 3WNOA 1EHAA 4WKHA 2YOCA 1MVYA 2WMKA 4OKDA 3AIWA 1HN1A 2D3NA 1HX0A 4ACZB 1K9FA 1QNQA 3BCFA 2UWFA 1E9LA 3MS8A 4BA0A 1IZKA 1AQHA 1R85A 4PMDA 2CEQA 1TZ7A 3NYDA 3AHZA 3D5HA 2VCAA 2PBGA 5GQBA 4UCFA 3WEMA 1NQ6A 3RMEA 1ZU8A 3BAWA 1B9ZA 4UOZA 2ZOXA 3T0DA 2XYLA 1E4NA 1CNVA 3ZR5A 1V3HA 3HN3A 5BWFA 2VVNA 3EDDA 3AIRA 3PHAA 4BF7A 2D3LA 4XZWA 1OD8A 2BHYA 4CUCA 4RE3A 4C7DA 1WDQA 4NRRA 4ZEPA 5A6AA 2DDXA 1RP9A 3FXYA 5HNNA 3EMQA 1ISXA 3AS3A 1UA3A 1ESWA 5E0CA 5A1AA 1CLXA 2VO5A 4UOJA 2DSWA 3OLGA 4KRTA 2IXVA 2DT2A 3GH5A 2JALA 5CXPA 2AOSA 1U30A 2PC8A 2ZX6A 4EK7A 3VINA 2J7EA 5GPRA 2OWXA 1V3IA 4W5ZA 2XUCA 4QCEA 1GQJA 3AROA 1HJSA 4JFVA 1C8XA 2E0PA 4UFHA 3TONA 3VNYA 1OGBA 1BGAA 2QPUA 3AXHA 5GNXA 1QVBA 4F66A 2VRKA 1OIFA 2XJ7A 3WH6A 1GONA 3GBEA 3B9DA 1WPCA 2JIEA 2QMJA 2V38A 1J0YA 1W1YA 2XWDA 1V3KA 1JD9A 1UWSA 1XRVA 2BV9A 3U5UA 2QF8A 1ISVA 1TE1A 1JF6A 4LXFA 4TOQA 1BPLB 1E6RA 1GPFA 4BS0A 4N0RA 3W26A 1XYZA 1GOWA 5CQ1A 3WNKA 4IPLA 3BAKA 1E71M 3QR3A 4IM4A 2NT1A 4PRWA 1TVPA 2WMGA 4J3XA 1H09A 2YL9A 4W8BA 3UR8A 1WP6A 3GXIA 5BXPA 3PZVA 3B8SA 3M07A 1GZJA 3GH4A 1JYXA 1E3ZA 1WZKA 2PB1A 4HTYA 4UQAA 3GXMA 3VGGA 1CGVA 3OGRA 5JUVA 3FAXA 3MUY1 3VKKA 2VUYA 5BRQA 3SIMA 4GO8A 3PTQA 1DWFM 3WEOA 3VDBA 1G5AA 2GVYA 2WK2A 1P6WA 3FNDA 5C8BB 5F7UA 1E6QM 5A6LA 1JAKA 3GXFA 4GKLA 5A95A 2BVYA 1DHKA 3F4VA 4UFMA 3SCRA 4TTUA 5A8QA 2WSPA 3MMDA 3UG4A 2OYKA 3GNOA 1W2PA 3BC9A 1LJYA 2XGIA 4WK9A 3ARZA 1AMYA 3WFZA 2ZX5A 1QI5A 4JKMA 2J75A 4XZBA 1LQ0A 3CPUA 3CZLA 1TCMA 1LF1A 3AMDA 1UR8A 1E56A 3ARUA 3AI0A 3LPOA 4J7RA 2XIBA 1ZBVA 3AIUA 1E73M 1K6AA 2D23A 1C91A 1CYGA 1DWGM 1ODZA 1R87A 2VZUA 1R7AA 2RGMA 4LYPA 8CGTA 2A3CA 4MB5A 4PCSA 1MQRA 4QDMA 3CLWA 2W63A 4PMNA 5CZKA 1U2YA 3IJ7A 4L4OA 4ML4A 1ECEA 3VIIA 1UKTA 2XIIA 3BCDA 4UTFA 4JAWA 2J7CA 1RPKA 1W2VA 4H41A 3VD3A 3WBEA 1UQZA 2A3BA 2ZX7A 2EBNA 4MNKA 1KB3A 2G3IA 3BAXA 4D6JA 3VGDA 2WHJA 1CECA 1RD6A 1KR1A 3GTNA 3AS1A 3ZJKA 2WBKA 4V27A 1HJVA 4MADA 2V3GA 1NOFA 3CH9A 3VMOA 5A94A 2XWEA 3W6MA 4AZCB 4R27A 1C93A 2DT3A 3PTMA 5D8WA 3WSUA 2A3AA 2ZWYA 2X0HA 9CGTA 3SCQA 2YDQA 4CD7A 2X05A 2MANA 4OBRA 1QBBA 4K68A 4MAVA 1KXHA 3AIVA 1MQQA 1HKMA 3CZKA 4OOUA 3SUTA 2EXOA 2EPMX 4NZCA 5BCAA 5I5RA 2Z1SA 1TA3A 5CSUA 4PCTA 1UR0A 3B9AA 1AVAA 1W9XA 3A6OA 4N42A 2VOTA 1FP8A 4M56A 4BZYA 2A3EA 4YPJA 1JZ3A 3KWXA 1H1NA 3CZEA 1BTCA 2BNJA 2WZEA 2VVSA 5I6SA 1E70M 1LL6A 4PSRA 1JG9A 3L4YA 3OLEA 3KZSA 4H7VA 1ZJBA 3QOKA 4KMQA 4HA1A 4CD5A 3K46A 5E6ZA 1OM0A 1UD8A 5FL1A 2QPSA 5I78A 1XSKA 1VFFA 1FP9A 4GQQA 1CZ1A 1XYFA 4W86A 1V0LA 3AICA 3T2QA 1XSIA 1BQCA 5A6MA 1JZ8A 1WZAA 2J62A 3WDPP 2BVTA 1XCWA 1XV8A 2WC7A 2OWWA 4AEFA 3AHTA 5HXMA 4E2OA 4HMDA 1K9TA 3THCA 4MNMA 1PX3A 2GDVA 5GNYA 3WKZA 4FLRA 4D6FA 1W32A 1WB0A 2IUZA 3PTKA 5FKYA 4F79A 5ECUA 6TAAA 3VILA 4MJ2A 1OIMA 1PBGA 4GI9A 3WMSA 4TTGA 5FCZA 3PN8A 4TUFA 1WCGA 3KL0A 1KWGA 4J3SA 1MXGA 1UOKA 5CG0A 2QV4A 4AD3A 4B16A 1BFNA 2O9RA 1US2A 2YLLA 1V0KA 4AZBA 4D1JA 1G0CA 2IXUA 2G3NA 1QHOA 4DM2A 1ZBWA 1YQ2A 5E0FA 1Y7VA 1X6LA 4AC1X 1HJWA 4UOQA 3I3DA 2QHAA 2VQUA 2BXYA 3RM8A 1WNOA 2CBIA 2ZX8A 1PZ3A 1NP0A 1UR2A 1BVNP 4NF7A 4AZHA 3SCSA 3WIJA 3O9NA 4W7WA 3AMKA 3DHPA 2W5FA 1GJWA 4AW7A 4CU8A 1SMAA 4CVWA 2FDMA 3IJ8A 3A4WA 1BF2A 1X6NA 3WENA 3GZAA 1H49A 4S3KA 2FH8A 3VIGA 4CKQA 3AMGA 1ISZA 2VCCA 4HP5A 3WDJA 1UD5A 1NWUA 4KGJA 4AZ5A 4DWSB 5C71A 1JGIA 4W7VA 3POCA 4W85A 1JI2A 5M5DA 3VIKA 4LYQA 3W37A 3OGVA 1JYWA 1W1PA 2V3DA 5JBFA 3SCTA 1UD6A 2DSVA 3VUPA 1W1VA 5IHRA 4U2ZA 3POHA 3VIPA 4YHEA 4E8CA 4E4PA 1JFXA 4WLCA 3UETA 2G41A 1B0IA 3VD7A 4U3CA 1CXKA 3WD3A 1V3MA 1KXQA 4QLJA 4C7FA 2GJXB 1NOUA 3EDFA 5CPQA 1J0IA 3WH9A 2PWDA 2J7HA 5HBFA 1W3KA 2CBJA 2JEQA 1RH9A 4OOZA 1OCQA 1CPUA 1ZB5A 1FFRA 2E3ZA 4CD4A 3TTSA 2GFTA 3MANA 2D0FA 1JZ4A 2DSZA 3BSGA 5JIPA 3BAIA 2WBGA 5IHSA 4W87A 4ZENA 1HKKA 3N11A 1W1TA 1J0JA 4HOWA 1EQCA 1W91A 4JL2A 2VC9A 3WH5A 2WC3A 1E6XM 1UHVA 3ZT7A 3GYCA 1SMDA 4HOZA 4CCEA 1LG2A 1EA9C 3MKKA 4NSBA 1WKYA 2WMIB 3VD9A 2EEXA 2JF7A 5CLTA 2WZHA 3SUWA 4AXNA 4FK9A 2J77A 2ZUTA 4LX4A 5D9MA 4J28A 1MWOA 1XGZA 4UFLA 1C7SA 1E43A 1JXKA 4AZGA 4D6GA 4M80A 3WDRA 3IANA 1V3LA 3PZGA 2FHCA 2UY5A 4ZXOA 2PWFA 3PZ9A 4HMEA 2WYSA 3ZR6A 2ZXAA 3QGVA 3AIBA 4GI8A 3VX1A 3DYPA 4H8VA 1B31A 1E4IA 3W27A 3VGBA 1M7XA 1GJUA 3WF3A 1DWIM 1W3JA 5GNZA 2BY3A 3F5KA 4LQ1A 4P7OA 5I77A 5D4YA 4U5KA 3T08A 3T0AA 5FIPA 4WKAA 3VM5A 1XSJA 1F4HA 2OSXA 3JUGA 4ZFMA 4PMZA 3T2OA 1V0NA 3HJEA 3WDIA 2EPKX 2XFYA 2BY1A 5M3WA 2VZTA 2OSYA 1V6XA 2VQTA 3ARQA 4HZ6A 3ARXA 4BQ5A 4WKFA 3ZQ9A 4AZ6A 1KGWA 1MW1A 4GINA 2G4FA 3NUKA 3ARSA 4H8UA 5IXEA 3AISA 4OJYA 3VGFA 5BXSA 2WSKA 2EPOA 2TAAA 1J11A 4HA4A 3W6LA 3NSMA 4CCDA 4D71A 4HPHA 4CD8A 2GK1A 3WUEA 2V3FA 1V03A 2BVDA 1G94A 2GSJA 3N18A 2O9OA 4AWEA 3AOFA 3IJ9A 1WZMA 3GDBA 5ABFB 1VJZA 2YL5A 4U31A 1ISWA 3MU7A 4BQ4A 4A3YA 1R7OA 1BYAA 4GI6A 3ZOAA 1E6NA 1XCXA 3GXDA 4UR9A 4P8WA 2WVVA 3WDQA 1E6PA 3WUGA 3N04A 4PMVA 1G9HA 2BY0A 1BAGA 3CUIA 1FH9A 4DUVA 3WBAA 4FLSA 1HP4A 2W92A 3WNMA 2ZUUA 5A6KA 3UEQA 2W67A 2J7DA 1J0HA 2BY2A 5BYWA 1MYRA 1UG6A 2YBUA 3BLKA 3CZGA 3U7BA 3DECA 2WZIA 3WF1A 2WVTA 3AMLA 3E1F1 1EDGA 2XG9A 3L4WA 4Q7NA 2ZIDA 5M03A 3RO8A 2J7BA 3IK2A 2WHKA 4FLQA 4WIWA 1VEOA 1EH9A 3CMJA 4EKJA 2EPLX 4PUEA 2YKKA 2PWGA 4URIA 4ZXLA 1A3HA 4AZ7A 3TTQA 3AZSA 4GZEA 3ARVA 3VIJA 4PSPA 3DYMA 2FH6A 1I75A 1GUVA 1KWKA 4PMUA 2QMKA 2BHZA 1Q6GA 4D1IA 2J78A 3MMWA 4NI3A 4IPNB 2ZE0A 3IAPA 2E9BA 2NW0A 3W28A 4ACYA 1JXJA 4ACZA 2VL4A 2VX5A 1TG7A 4PYSA 1E0XA 3F5LA 3A4AA 1QNRA 4HMCA 1GOIA 1XH2A 3WQWA 3EMZA 4DUXA 1OB0A 2DIEA 4Z2HA 4OIFA 1HJQA 5JIWA 4UZSA 1OSEA 3APGA 1UH2A 1CGWA 1E5NA 3CGTA 5DMYA 3WD0A 1HXJA 3K8MA 2V5DA 1VEMA 5D9PA 4GO9A 1DP0A 3PZIA 3UESA 3T2PA 3WQ6A 4AEEA 1XH0A 3CHDA 1D2KA 4HU8A 3VOCA 1WZLA 1EOMA 4M29A 1DTUA 1OT1A 4WJXA 3VDCA 2JF6A 4AD2A 3QOMA 1B90A 1EGZA 2WWCA 2WHMA 1PX8A 3BMVA 4TX8A 5BROA 4EANA 1E55A 3OBAA 4RE2A 5I79A 2GDUA 1W9BM 4ATLA 2EO7A 1K9EA 1LL7A 1NM9A 1VB9A 2X8RA 3ARTA 3F5JA 2XFFA 1KBKA 3AHXA 1VIWA 2VJXA 1SYTA 1GHSA 1UUQA 3RCNA 1ITCA 4J27A 3VX0A 3WF2A 1FH7A 2CNCA 4MB3A 5A2CA 3MUAA 3VMNA 4QCFA 3N12A 2Y5EA 3SEPA 1UYQA 2CPUA 3NDYA 1ZS2A 3ARPA 4ZE5A 3WELA 3RPMA 4PBGA 4W93A 5LA1A 4MNLA 3VIHA 3CZ8A 1B3YA 4CN1A 3FW6A 1CENA 2X1IA 2DSKA 3RM9A 1MFUA 2JEPA 2DT1A 1CGYA 5KEZA 2XFRA 1MFVA 4LPCA 2OYLA 1XH1A 1YHTA 2WANA 8A3HA 2ZWZA 1TVNA 3L4UA 5DT7A 1EQPA 1ODUA 3SCVA 5I3DA 2AAAA 1E1EA 4HZ7A 3PZTA 2XM1A 7CGTA 5E6YA 3WNLA 1HL9A 3WUFA 1GOMA 5IFTA 3FHAA 3W0KA 1XD1A 3AHYA 2WB5A 2XM2A 5EBAA 2EQDA 3FHQA 4KWUA 1LG1A 3CZJA 1JIBA 4DUWA 1OT2A 3AXXA 1H0IA 2Z1KA 3CHCA 1UR9A 3PZQA 3BMWA 4QFUA 5BXTA 5KZ6A 2PWEA 1UD2A 1GNXA 1R86A 3BGAA 3WDHA 1RP8A 4AD1A 2ZUWA 4GIAA 4CU7A 1ITXA 1UR1A 4JFSA 4MPKA 4P7LA 2VZOA 5E9AA 2C0HA 2VCBA 3A3HA 4W8AA 1JZ7A 4W84A 2YBTA 3K1DA 1BSIA 3ZT6A 1KXTA 2J8FA 4QP0A 2ZICA 1UKSA 2ESCA 2ZUMA 5E70A 4QLLA 4U3AA 2CCRA 1W9VA 2B31A 1VFOA 2VZVA 3M7SA 3WH8A 2E40A 5DF0A 1CGUA 5JBEA 3NJ3A 1M53A 2CESA 3ARRA 1HKIA 4PTXA 5CGTA 5A8PA 3BLPX 3CTTA 1O6IA 2CITA 5AY7A 4X0NA 2HISA 4Z2IA 3VM7A 4S3JA 3EBVA 4PN2A 4AMCA 2XSAA 3WNPA 2XPKA 1NH6A 1JNDA 1XHGA 2FGZA 5AYBA 1UH4A 2X2YA 2D20A 5I2UA 3NIYA 4JCMA 1JDCA 1DWJM 3W29A 1V6VA 2WAGA 3VIMA 1UKPA 1MW3A 1E5JA 3VNZA 4ATWA 1B3ZA 3KL3A 2YLAA 1QOXA 3W53A 2FHFA 2E9LA 1C8YA 1UR4A 1NARA 4Z2JA 3BH4A 3SCPA 3EDKA 1ZBCA 1H11A 1W9DM 4FLOA 2OLHA 5CLWA 2CYGA 3DHUA 1VRXA 1ISYA 2XHYA 5EMYA 1TUXA 1KBBA 7A3HA 3TTYA 1CLVA 2WC4A 4M8UA 1PIGA 3VGEA 3RJXA 1E40A 3MUIA 1CXEA 1IV8A 4R5EA 1OINA 1UWQA 1CTNA 1UQYA 3WEZA 2E8YA 4CGTA 2G3MA 1JYVA 4XB3A 3ARWA 4M81A 5CSYA 2XSBA 1E1FA 4CCCA 1UKOA 1Z32X 3AZTA 3VIFA 4IISA 1WDRA 5D8ZA 3L4ZA 4AD5A 2ZX9A 1W3LA 5EFFA 2FHBA 2XVGA 4Z2LA 4F9JA 2D2OA 3SCWA 3AYSA 1KQZA 3MUZ1 1CXLA 2DT0A 5A6SA 2WXDM 1JNEA 1UA7A 4GPNA 1WDPA 1JFHA 4AZCA 4MB1A 2DSUA 1J12A 4KGLA 3G6MA 1EHNA 4J3UA 3S6TA 4AYSA 1SR0A 2O9PA 5HDRA 3EDEA 3J7HA 1R8LA 1BYCA 1H4PA 3ZJ8A 3LMYA 1GHRA 2ZXDA 2J79A 5A6JA 5E09A 3MMUA 4HOXA 5DFAA 1V02E 4X0VA 5I24A 1UD3A 3L4TA 3W24A 1CIUA 5FOOA 4JKKA 3ALGA 3RILA 1UH3A 2GJPA 1UZ4A 2W91A 3WMBA 2E4TA 4TVUA 4LGXA 1W9UA 1V0MA 1JF5A 1LL4A 2D1ZA 1LWHA 2PBOA 1KR0A 3MSDA 3OZOA 4AZIA 4JHZA 1TFVA 2A3HA 1LWJA 1MQPA 3S2CA 1KCLA 1V3JA 1D7FA 1Q6FA 1Q6DA 2XTKA 4B15A 3VO0A 1VF8A 2VTFA 4Y7EA 1JYNA 2DEPA 1HT6A 2EJ1A 3OA5A 1EO7A 1QHZA 4P7QA 3CBWA 6CGTA 3ZJ6A 1GW1A 2WKGA 4U5IA 4D72A 2UY3A 3RIKA 3OLDA 2O9TA 3WH7A 1VENA 4JZ5A 5ABHA 2ZUVA 1J0ZA 1CDGA 3TP4A 1NOWA 2Y24A 5A69A 1E0VA 2PF0A 3VTRA 2VX6A 2WVSA 2NSXA 4P8UA 1QNOA 4CVUA 5A2AA 1UWIA 1UWUA 5IFPA 3ECQA 1WO2A 1C7TA 5DO8A 3G6LA 2VX7A 3BAJA 3MV11 1E3XA 3LPPA 4D6EA 3OB8A 1GQIA 4PMYA 3O2LA 1GOKA 1L0PA 3THDA 1MXDA 1VBUA 3M46A 3WQ4A 5ABGA 2JIWA 3ZSSA 2J8GA 1CXFA 3PBGA 1GOQA 3SCUA 2BFGA 4JFUA 5CJ5A 2XGBA 4L4PA 4JFWA 5A6BA 4GXPA 5TD4A 4W89A 3CHEA 3WY1A 1K9DA 4UQEA 4UNIA 1KGXA 2VR5A 2CKSA 5HPOA 2VR4A 7TAAA 6A3HA 2X0YA 2J7FA 3WQVA 4JKLA 2AMGA 2G3JA 3BXWA 3N9KA 1Q6CA 3AHVA 3SURA 4GZJA 4A4AA 1CBGA 1BG9A 3ZIZA 4GQRA 1Q4NX 2CIPA 1E4LA 3CUHA 3QHOA 3N1AA 5FD0A 1QHPA 2XVLA 1AQ0A 4MAZA 2VRQA 2VT0A 2YJQA 1I1WA 1KCKA 2WKLA 4DWSC 1BLIA 4AY1A 4DWSA 4PUDA 2D24A 1GVIA 4D6IA 1VAHA 1H5VA 1E15A 2DIJA 3OGSA 1OD0A 3QHMA 1UZ1A 4NRSA 1M04A 5CGMA 1JZ5A 3ZT5A 2WCGA 4H2CA 1PEZA 1B2YA 2W4XA 3SCNA 1WDSA 4PMXA 3IAQA 4U33A 2YA2A 2V3EA 3SUVA 2GJRA 5HPCA 2OSWA 1CWYA 2D0HA 5HOSA 3B9EA 1IZJA 1S46A 3VD4A 1BG4A 3SCOA 4PTVA 3W4RA 4AIOA 3WF0A 3OIHA 1C90A 3PZMA 1HP5A 4J3WA 3EMCA 3WUBA 3HMCA 4H04A 3MO4A 2GJXA 1TA3B 1EIBA 1GOOA 4WSJA 4W88A 4WF7A 3WN6A 2WMFA 1HJXA 1UWTA 5LA2A 1B1YA 2WNWA 4W8LA 1J10A 4D6HA 4AIUA 4BQ3A 1LLOA 4HPGA 4IUGA 1QI2A 2VX4A 4EE9A 2DQXA 1E6SM 3FN9A 1BYBA 3WL0A 3BAYA 3WMCA 2CHOA 3UG3A 3AQUA 1E0WA 3CIVA 4PMQA 2D0GA 1WE5A 1VFUA 2XVPA 2D22A 1JZ6A 1E72M 1GQKA 3VVGA 5A8MA 1V08A 1WAWA 2JE8A 3MV01 4CN6A 3RJYA 4CN4A 2UY4A 2FGLA 1M03A 2DGAA 1FOBA 4TX6A 4YHGA 3OLIA 2WW5A 4MNJA 5LYRA 1J01A 2PI6A 2C8NA 3AIEA 1H2JA 2WMIA 3HU7A 1ZBKA 3A4XA 2VURA 2ZXQA 1OGGA 1H3GA 4B3LA 2BS9A 1C3FA 1JL8A 5IDIA 4HA3A 2WHLA 4JFTA 5EB8A 4UQBA 2NT0A 4B9YA 3RDKA 1NWRA 4JHOA 5EFDA 1J0KA 5A8OA 4JL1A 2DH2A 4J3TA 1M01A 4M82A 2F61A 2WLYA 3EDJA 5AC5A 4PTMA 1UKQA 3ZSTA 1EDQA 2BHUA 1G1YA 2J4GA 2OYMA 3WQ8A 4P7RA 4TVCA 1GQLA 1F4AA 2WWDA 2ZXBA 5M17A 5A2BA 4V28A 3T0BA 1MW2A 2CKRA 3AMCA 3K4DA 4MB4A 2RGLA 2CXGA 2XVNA 1NWSA 1QI4A 2UY2A 3GNPA 1QPKA 1CGTA 1BGGA 4UFIA 3NSNA 1JI1A 2PWHA 4AD4A 1FA2A 3I3EA 4WSKA 4W7UA 3W38A 1V6WA 1XC6A 1OGSA 5AC4A 3VDAA 3BSHA 4Z2KA 1O7AA 1FHDA 1NP2A 1U33A 1BVZA 1JDDA 2VZSA 4B3KA 3CO4A 4D6DA 4OBSA 1PPIA 3ZJ7A 3DYOA 2WPGA 1HVQA 1J18A 4JIEA 2O92A 4U2YA 5CPTA 1B30A 3W82A 3O6AA 2CERA 2XVKA 4XUYA 1KXVA 1HNYA 2E9MA 1VBRA 3VD5A 4W5UA 1PAMA 2CBUA 3I3BA 5A8NA 2V5CA 1CGXA 1FH8A 1E6ZA 1EO5A 1H41A 4MDOA 1AQMA 3N13A 3K8LA 1IT0A 5ABFA 2J25A 2DH3A 1ZJAA 4PMRA 4C7GA 4KH2A 3GNRA 3L4VA 4PTWA 2WCSA 3A47A 1US3A 3II1A 1MW0A 2YA1A 3T09A 2Y8KA 3WFLA 1QNPA 5ABEA 4X9YA 3ALFA 1QNSA 3PZUA 2ZUNA 1CEOA 1TMQA 5I23A 4ZE4A 1V6YA 5JBDA 1GVYA 4QAWA 3NDZA 1E4MM 4YN5A 1PIFA 3FY1A 3GH7A 2WMHA 3AYRA 2G8ZA 3K4AA 4LYRA 1QI0A 3W25A 1DEDA 2J47A 2WCAA 2E8ZA 4A3HA 3TA9A 4F9DA 4UQDA 3N15A 1FHLA 4KRUA 3AS2A 2WMJA 3U5YA 1PZ2A 3ZM8A 2J7GA 3AIQA 2HVMA 3AXIA 2CETA 4AISA 2W62A 1G01A 2VRJA 1JDAA 5LA0A 4AIEA 1VEPA 4XX6A 4ATDA 3MSGA 3L4XA 3ARYA 3VMPA 1KFWA 5BXRA 1EXPA 2VNCA 3CMGA 3WQ5A 3DC0A 2EPNA 5AYIA 1H0GA 4E8DA 1VJSA 4CU6A 4DM1A 1B3XA 1JD7A 4RE4A 4HZ8A 1L8NA 3TTOA 1CXHA 2WVUA 2OWCA 4UFJA 3QHNA 1D3CA 2JFEX 2CBVA 2X09A 1W3HA 1QW9A 3AS0A 2GUYA 4PEEA 2YDRA 3CHFA 3PZNA 1J9YA 1SFSA 3VPLA 3L2LA 3UG5A 4P7NA 2W66A 4JCLA 2BXZA 1PX4A 4MDPA 2YL6A 3PZOA 3WNNA 3AFBA 1C8QA 2DPEA 3U7VA 3KEHA 1B3VA 1XD0A 5D9OA 3VGHA 1UWRA 1I1XA 3VIOA 3GBDA 1JZ2A 2WM0A 4BCEA 4BQ2A 2YIHA 2QLYA 1KQYA 1OWQA 1HIZA 3VDHA 1EOKA 4MTVA 1HF6A 1TR1A 2Y2WA 1OBAA 2VMFA 2CHNA 2Y8VA 1X1NA 4D6CA 2YA0A 3AZRA 1QI3A 5C70A 1FFQA 1KGUA 3SUUA 1V6UA
chains in the Genus database with same CATH superfamily
4BI6A 4WY0B 1QW8A 1OJXA 4Q8PA 4R33A 5D2WA 5MKGB 1UP2A 1VFMA 2JKPA 2Y4SA 5DEZA 4GIRA 1HGYA 2G96A 5I0DA 3K8KA 4HU0A 3SUSA 5CPSA 3APYA 3SW6A 4MJZA 3DI0A 2GK1B 1TJ0A 1OG0A 4YWSA 2F2HA 4YWIA 4PODA 4AY7A 3WF4A 4OUEA 1RQHA 4IGHA 1NEYA 3UJEA 1T5AA 4GX8A 2Q8XA 1EJXC 3VABA 4IG2A 2BOEX 3LOTA 3IIZA 3U57A 1V02A 4GWEA 3T42A 1H7NA 1A47A 3UR7A 1V93A 3AWOA 2VI0A 3V36A 3L2MA 2C19A 2VEMA 3MO7A 2F8QA 1GORA 1S1PA 3LI1A 2NWRA 3GQYA 2VGBA 1N82A 1I0DA 2W61A 4QLKA 5K3VA 2FPVA 4AD0A 3U3HA 2X1TA 3LPFA 3E5PA 1S38A 2VDGA 1RK6A 4LUTA 1PWLA 3H22A 4Q4KA 3V5OA 1RVGA 3UERA 3KE0A 2Y7EA 3GR8A 3RM4A 1P0DA 4FMVA 4M1RA 1R3YA 2IKHA 3NCOA 4HT3A 1U5HA 4GNVA 1W1IE 1TJRA 3SJNA 3WL1A 4XV0A 1RCXB 3LY0A 3DXIA 2C7FA 4GH1A 1S2UA 1A5SA 3L67A 1R9YA 4GUHA 4E4UA 1ZQ5A 5AZ1A 1SO6A 1FCBA 5CJMA 1HN1A 3KDNA 4QROA 3T4WA 4YVXA 4O14A 2QCLA 3M5ZA 4MKSA 1E9LA 1DE5A 3N9RA 1AQHA 2CEQA 1TZ7A 3NYDA 5XINA 3UGVA 1IZCA 1ZU8A 4FXRA 3BAWA 1B9ZA 3PUGA 4R7JA 4PGLA 3ITGA 2E1WA 1LT8A 5HA7A 4HSHA 4RZ6A 3ZR5A 1ZLPA 3TDFA 1RJRA 3VC6A 2DZTA 2VVNA 1OVDA 3AIRA 4G5DA 5CKSA 4BF7A 1YDOA 4CUCA 2DIKA 4M0XA 3G1FA 3IGUA 1EJWC 3LUTA 7PTDA 2DDXA 3EMQA 3W7MA 3KWSA 1PV8A 3JZEA 1CLXA 4FSAA 2FZMA 4UOJA 3GVRA 1AZ1A 3GH5A 1U30A 2PC8A 4QXIA 3VINA 1LRQA 3FDGA 1V3IA 7REQB 4W5ZA 2X1SA 3W7JA 4H9XA 4GGHA 4H6EA 1GQJA 2OU4A 1C8XA 4UFHA 1OGBA 1BGAA 1XF0A 3LGGA 5FJJA 1HGWA 2VRKA 1KFEA 4MWAB 1ONEA 3UJSA 3WH6A 2INEA 4JTKA 3MWAA 5CG7A 2V38A 1IF2A 1J0YA 4JTIA 1V3KA 3WO8A 5I3FA 3L2IA 1GVRA 1UWSA 3RPTA 3DDMA 4RNJA 2ISVA 1V7YA 6REQA 4F2TA 1KCXA 3W26A 4WUIA 2FMOA 4ZTXA 2YXXA 3WNKA 3BAKA 2TPSA 2WQPA 1RQBA 3NZPA 3WQEA 3EEZA 3I4KA 4PRWA 1XJBA 4J3XA 3MW7A 4IP7A 4PTDA 3QPZA 1ZCOA 1YDVA 3B8SA 3M0HA 3M07A 3OOQA 1GZJA 2DQWA 1G4SA 2PB1A 3VGGA 3GXMA 4UTUA 1KD0A 3FAXA 4Y96A 3RX4A 3LNMA 3MUY1 3VKKA 1BVWA 3PVFA 1JPKA 2VUYA 2ONEA 1GEHA 5EL1A 3D0CA 1X8FA 1VRDA 4A8LA 3EOSA 4K36A 3GTHA 4EPEC 1JAKA 1F6KA 3QM3A 1K8CA 4FNPA 1R3RA 3G8RA 4G8TA 1B4KA 2OGYA 4UFMA 3RGTA 1Z48A 4KIRA 3SCRA 4N9CA 4Q8NA 2Z24A 2C15A 3LTSA 5A8QA 3UG4A 1NFGA 1W2PA 4Z1DA 5FSDC 4RKAA 2XGIA 2OR2A 2QJIA 1KFJA 1RHCA 3H23A 3WFZA 2ZX5A 5C2XA 4XAGA 1UIOA 2J75A 2FFCA 4K3ZA 1V6TA 1T0OA 2PDNA 1D7KA 1OZMA 4H1ZA 3H4XA 2NLIA 3FX4A 3W84A 3LPOA 2XIBA 3AIUA 2R8WA 1ODZA 1R87A 4OTKA 2DZAA 5HWNA 4I7UA 4LYPA 1GYMA 3PG9A 2XN0A 4OUIA 2X1RA 3S42A 3L7RA 4RJEA 4J4KA 3BARA 5CZKA 3DIPA 1YBQA 3IJ7A 4L4OA 4N2YA 2PCEA 2ISFA 4GACA 2ANUA 2XIIA 3G0UA 3AUJA 3CQJA 4HNNA 4JAWA 3REQA 1K7XA 4O19A 4UWMA 1RPKA 3U9IA 2HZGA 3WBEA 2BOFX 1UQZA 2A3BA 3PTDA 4LOCA 1KB3A 4DI8A 4KFPA 3T4CA 1B3OA 2FFIA 5MF5A 4K39A 2WHJA 1S2WA 3H53A 4QJ4B 3GTNA 3AS1A 3ZJKA 2WBKA 3FS2A 3KOYA 2ISDA 1TRDA 2P0IA 2V3GA 2H9AB 2RFGA 1NOFA 3CH9A 3VMOA 2XWEA 3NQFA 1JCMP 2E77A 4R27A 2DT3A 3FVMA 5D8WA 3TQVA 3DCPA 3WSUA 4B5XA 2POTA 4QIUA 3SCQA 4E8GA 4JTQA 2HPMA 2YX0A 4XAPA 2PDKA 4MAVA 4I5XA 3QFWA 2GVGA 1KXHA 3V4BA 3IIVA 3H2OA 4OOUA 3A5VA 3SUTA 5BCAA 4IIBA 4WSHA 3UZYA 4GYJA 4MF4A 3P93A 3B9AA 1AVAA 1W9XA 1IWAA 2J9ZA 4YPJA 3ITOA 1ZRQA 1XYAA 5TQLA 3CZEA 3EPMA 2DZVA 2WZEA 2YCLB 3N29A 5I6SA 1DV7A 2H3DA 1F3TA 4PUJA 2ZRVA 1JG9A 3LG3A 3OLEA 1XIHA 1ZSXA 3K46A 3PAJA 2E6DA 5E6ZA 1UD8A 3GXPA 1FP9A 4GY0A 3E2RA 3M16A 1QMLA 1XSIA 2XZ7A 4C6IA 5A6MA 2Q02A 1WZAA 2J62A 4Y2WA 4YS1A 3RX3A 3DFPA 2XINA 4FR1A 5HJXA 4WOQA 1CB7B 3D47A 4HMDA 1I2NA 2UV8G 3THCA 3KRUA 3Q37A 3O1NA 2E25A 3GNNA 1W32A 2IUZA 4F79A 4AEOA 4GABA 1NDVA 1LRTA 4OWGA 3C0SA 3V75A 3WMSA 2H6RA 1RCQA 1WCGA 3KL0A 1UOKA 3P74A 2PTWA 3ITTA 2O9RA 3QR0A 2YLLA 2G3NA 1SJBA 5CEWA 2OLSA 1ZBWA 3M64A 1XBVA 1X6LA 4DXKA 3E0FA 2JGQA 4A3RA 1R2RA 4ASTA 1WNOA 4C5YA 1UR2A 2E1DA 1BVNP 1J2WA 1UBPC 3CEPA 3AMKA 1GJWA 2OKTA 4LF1A 3CL7A 3MI3A 3NQAA 5T8GA 4LAZA 2VEFA 2PLCA 3NQ8A 1FX6A 3LYEA 4S3KA 4CKQA 1ISZA 1OX5A 2OZ3A 1KKOA 2WSYA 3LCWA 4BEQA 3FSTA 3M0IA 1VGAA 1LCOA 3RFAA 1FWNA 5C7HA 3W37A 1W1PA 2R9RA 3UXKA 3LQLA 1UD6A 1QCWA 5LZLA 1ZGDA 3AO0A 2HTMA 4YHEA 4E4PA 2IPGA 1JFXA 1RSCA 1BSLA 1PKYA 5BMXA 3UETA 3MVIA 4F0RA 2PWVA 3VD7A 4U3CA 5AHNA 3L5AA 2QDEA 2PDLA 4XSLA 1J0IA 3FJ4A 4JTCA 3WLQA 1W3KA 4EXBA 2JEQA 3JR2A 3MP3A 2GZXA 1FFRA 2D73A 3RU8X 3B8VA 2ATSA 4CD4A 1ENUA 2TYSA 3BAIA 1LDCA 4W87A 4V33A 3N2OA 1POJA 1AJ0A 3P14A 1ZP3A 3PP7A 3SDOA 2WC3A 1E6XM 3ZT7A 3GYCA 4B5TA 4GG9A 3SGZA 4NSBA 1WKYA 2GVEA 1R3TA 4GUFA 3SUWA 4FK9A 4YMZA 4KCVA 3LENA 2ZUTA 1AW5A 5D9MA 1XGZA 4UFLA 3VA8A 1V79A 1EP1A 2Y70A 4AZGA 4M80A 4D6GA 4FS9A 3PJWA 1YXYA 1QDSA 1OFEA 3N6HA 2PWFA 4MMWA 1JPIA 4HMEA 5AYZA 2ZXAA 3AIBA 2Z6JA 4H8VA 2E5DA 4LSBA 3LCHA 2Q01A 3VGBA 3ZVHB 3W2JA 1SZEA 3C2YA 3WF3A 1DWIM 2ZZ5A 4LQ1A 5I77A 1TTPA 3T08A 2V6AA 4KRZA 4CEUC 1F4HA 1PE1A 3T2OA 1V0NA 5AC8A 4DF2A 2BY1A 1NIUA 5M3WA 4Z1YA 2VZTA 2OSYA 5M2FX 1DXIA 2XIOA 3ZFHA 3KP1A 3ARXA 1FWWA 1SFTA 1MW1A 4GINA 3B8DA 2P0OA 4WY0F 1W1ZA 3V16A 2VEGA 3HFYA 4AVFA 2AGKA 5BXSA 2WSKA 3PWAA 4LUSB 3SRFA 3MCOA 3W6LA 4C1NA 4H9YA 2A7RA 3PBWA 4D71A 3TV8A 1VBGA 2BVDA 3N18A 3OIXA 4AWEA 3AOFA 3THQA 3TOYA 5ABFB 2EG8A 1R7OA 3ZOAA 5ECVA 2OO0A 4YU1A 3OODA 2WVVA 2Y62A 4MZYA 3IUHA 5C54A 3QBUA 4PMVA 1G9HA 1J79A 2BY0A 4DJFC 4DUVA 1HP4A 2W92A 4X60A 3UJFA 3WNMA 1W17A 3B4YA 3BLDA 4MHBA 3UEQA 1S39A 1TPH1 4G56A 1ZZMA 5FJTA 3DECA 1FVPA 4JIHA 3XINA 3VK5A 3SN4A 3T81A 1E9YB 3L4WA 2ZIDA 2PP1A 5I3IA 1BRLB 2Y5JA 4IPJA 3QGKC 1EH9A 2OXNA 1W3TA 5HMDA 1JCXA 2EPLX 3E0WA 4OU1A 3IVSA 5FJRA 3GSMA 2YKKA 4JICA 2PWGA 4URIA 4ZXLA 4JTHA 3TTQA 4JD4A 4A2RA 3N2CA 1J93A 1XBZA 3DYMA 1I75A 3SGGA 5CC7A 3LXCA 1YXCA 3CASA 2J78A 3MMWA 3QY8A 1RLCL 1AUSL 1B5TA 2ZE0A 4HIBA 3KX6A 4ACYA 3IJ6A 4ACZA 1LROA 1TG7A 4PYSA 3UY7A 1PZ0A 3F5LA 3DKJA 4GIYA 4O0ZA 3KAOA 3QFEA 2BB0A 4DF1A 3EMZA 4DUXA 1EX1A 2VGIA 1HJQA 3C2VA 1CGWA 3CGTA 3K8MA 3CQKA 4AVNA 4DHGA 1VIZA 3UYIA 4GO9A 4OECA 4DLFA 3LBOA 1VFHA 2R24A 3V1HA 3HF3A 1H1YA 1WZLA 2E67A 2A79A 1EOMA 4M29A 5K4ZA 3HTWA 3WX7A 1Q45A 1VHCA 4Q7IA 4XD4A 1O95A 4LCQA 1B90A 2E28A 5LIXX 3JZUA 3HV8A 2FGBA 4HKPA 3OBAA 4RE2A 5I79A 3U0HA 4IL2A 1K9EA 1IXOA 4NP7A 2Z00A 1NM9A 1VB9A 2X8RA 4S3GA 4DIAA 3O63A 1VIWA 2V0TA 3RCNA 1UPPA 1XG4A 1AW2A 3VX0A 5DANA 4J1OA 1LOLA 3VMNA 1NAL1 3N12A 4JNYA 4IIFA 3UXIA 4DVOA 2GGJA 4GA8A 4W93A 4WVXA 1B3YA 1HL2A 2QCDA 1GTEA 2VELA 1I9CB 2D2JA 1PHQA 2XFRA 3IIOA 1MFVA 1EL3A 4S38A 2OYLA 3NZRA 1XH1A 2OGJA 2ZWZA 1O1ZA 5CBIA 1ODUA 1XLEA 5BU9A 2ZZ3A 2QCEA 2AAAA 1DJWA 3TN5A 1TB3A 1E1EA 4HZ7A 3VOHA 1LRNA 3W1QA 3HGSA 3T44A 3M0LA 3AHYA 3IPWA 2FPTA 3FHQA 2WV8A 3CZJA 4DUWA 3LK6A 1OT2A 3AXXA 2Z1KA 3VNLA 1KCZA 3MZNA 3UXDA 5KZ6A 1UD2A 1GNXA 3AUOA 1Q6QA 3WDHA 1OC5A 3SZ8A 1ITXA 1UR1A 4C1KA 2C0HA 1UMLA 2G50A 1JZ7A 2PZNA 1OCBA 4BI7A 2YBTA 3K1DA 1BSIA 3VKCA 4KCTA 5DBTA 3V5CA 1UKSA 1R3SA 1F07A 1X1ZA 1MRAA 3I10A 3RRXA 5E70A 4U3AA 1FWJC 4N6EA 1FCQA 2B31A 4YLWA 5C7VA 2RAGA 4QJ5B 2VZVA 3WH8A 4H8NA 1M9HA 1CGUA 3PULA 4KEZA 3NJ3A 3ARRA 3B0YA 2OLAA 4QG8A 5CZSA 5CGTA 3EWZA 4IHCA 4IIGA 3G1AA 3M4HA 4DBEA 1O6IA 2FZ9A 4MM1A 2ACSA 4X0NA 4NZ4A 2HISA 4S3JA 2C18A 1H7PA 4WRHA 2OZ8A 3WQCA 3E49A 3MB9A 5I2UA 4R7OA 3R10A 4JTEA 2BMBA 1UASA 2AQWA 2NX3A 4DWDA 1E5JA 1EIXA 2YYTA 3VNZA 4ATWA 4RNHA 2IQDA 2NZLA 2YLAA 2FHFA 1KFBA 4IZGA 3TN4A 3TYBA 3AALA 2Z1WA 3TJLA 3BGJA 4NX0A 1F8IA 3EDKA 2D69A 2W79A 4TV5A 4FLOA 2OLHA 3B0VC 4WDUA 2XHYA 4Q8OA 5EU9A 3RCMA 3CQ0A 1LUCB 1MDRA 2QJNA 3MUIA 3WFAA 5U4NA 3WQGA 2V68A 1OINA 1CTNA 2E8YA 3L12A 4Y9NA 2FZ8A 4PEKA 4XB3A 4ZL1A 4CCCA 1GYLA 1Z32X 4IMCA 3SGUA 3W1PA 4Y9MA 1NELA 1OEPA 3AZTA 2QDHA 3W1TA 3MSRA 3VIFA 3E38A 5EFFA 1A5NC 1F8MA 3MI2A 1KQZA 1VFSA 4JYDA 3DG6A 4WQ6A 3RN6A 1J5SA 3F4WA 4LALA 1UA7A 1PYFA 4IGNA 1JFHA 4MB1A 4EPBC 5G2HA 2J88A 1SR0A 3VOGA 1SU5A 1BYCA 4F0HA 3CXOA 2TSYA 3R89A 3ZXWA 1H50A 4HOXA 1TX2A 2WZTA 4LY8A 1FXPA 4GBUA 1V02E 2A7PA 5I24A 3W24A 4EVZA 5FOOA 2CZEA 2W91A 3LRKA 1OADA 4TVUA 1TPDA 2V8ZA 1LL4A 1X8CA 2D1ZA 4EP8C 2O0TA 3QJAA 1XFCA 1KR0A 2R1PA 1GTHA 3MSDA 2DU2A 4AZIA 2ISSA 3M6YA 3SM0A 3RXZA 3THUA 1V3JA 4LBUA 4GISA 3VO0A 2VTFA 4Y7EA 1IEIA 3DFHA 2A85A 1D3HA 3IJLA 4P7QA 4HBKA 3BICA 2FJUB 4AFYA 3PG8A 3ZJ6A 3W2LA 3RIKA 1K4HA 3QZ6A 3WH7A 2IW0A 4H3DA 2YCKX 1CDGA 3TP4A 2Y24A 5A69A 1E0VA 4IJCA 2W6RA 4A3UA 1UWIA 1EXBA 1UWUA 1SW0A 4S3AA 5IFPA 3TYCA 1KC7A 1C7TA 4S23A 3R1ZA 4BR1A 4E2VA 1E3XA 4NZ3A 4LFYA 5KSWA 3THDA 4QJ3B 4RPPA 3M46A 4FZIA 4QDWA 1F05A 2QT3A 1X6UA 4JFUA 1PYMA 4BF5A 5FF4A 3EWUA 3N6QA 2NV2A 5T9CE 3AXKA 1K9DA 2WO5A 4Z0SA 1FWTA 3W74A 2I5QA 6A3HA 2X0YA 4FIRA 3P8IA 4JKLA 4GZJA 4RW3A 4HU4A 1CBGA 1CW2A 1P0EA 2G0WA 2ZE3A 3CUHA 1GWJA 2ADAA 2AQOA 3B9NA 3U8GA 3N1AA 1Q7ZA 2C1GA 4UTIA 1V8EA 1GG1A 1QHPA 4IWWA 2XVLA 1KV8A 4L9ZA 4HPNA 4RE0A 4MAZA 2Y7DA 1M41A 4DWSC 2JQXA 4PUDA 2VYOA 4QISA 2HE8A 1VAHA 3N3TA 3ANUA 1V4YA 3NL2A 1OD0A 3QHMA 4C1LA 1SM9A 4WZHA 2Q3OA 5CGMA 2R94A 3LV6A 3ZT5A 2SFPA 4LEFA 1B2YA 1Q8JA 3SCNA 1WDSA 3QKZA 3PWIA 4GVIA 2YA2A 3HGOA 2V3EA 2GJRA 3TWBA 1DJNA 1CWYA 2D0HA 1IZJA 2X40A 4AIOA 3WF0A 1OF6A 2KZHA 4UR7A 2E7FA 3ZR4A 1HP5A 3BE7A 4N4QA 1NF0A 5E1QA 1EYWA 2J6XA 3GDRA 3M0ZA 3IS4A 1TA3B 1EIBA 1GOOA 1PTDA 3WN6A 2WMFA 5LA2A 1B1YA 1BD0A 2PTZA 4FXSA 3KDOA 3LLDA 4AIUA 4U28A 1X96A 3NL3A 1QI2A 2VX4A 4GD0A 1Q6LA 3AYTA 4WR3A 3WMCA 2WOQA 3A9IA 4G6CA 4PMQA 1WE5A 4I8YA 4GBDA 1ECQA 3U2OA 2D22A 1QATA 1GQKA 3OYXA 5A8MA 1WAWA 4PRRA 3UR2A 3C3UA 3KHDA 4XUGA 3RJYA 1ICQA 1M03A 3S47A 1TWSA 4MUZA 4N4PA 3VZZA 1A5OC 1US0A 2ZXQA 1OGGA 4ECLA 1ADDA 3M41A 2O4MA 4LVFA 3S9YA 2YYUA 3PK7A 4JFTA 5EB8A 1NWRA 2HNEA 3N6JA 4JHOA 5EFDA 1D9EA 4JL1A 3QPYA 4M82A 3BTNA 4Q4QA 3GC5A 1P4CA 4RK8A 4GVHA 4M6UA 2J4GA 4TVCA 4LUIA 2WWDA 4JDYA 5M17A 2GJNA 3T0BA 5BMWA 2NVAA 1MW2A 1YNQA 1WOAA 4O28A 3TAOA 4DELA 1Q4WA 4D9PA 3GNPA 3VFCA 2C0AA 3APTA 3GFZA 1EBHA 2FMNA 3QYQA 1KRCC 4NXSA 1QO2A 4WSKA 2O7QA 1V6WA 1XC6A 5KETA 1OGSA 3VDAA 2AKZA 1A5KC 5AN7A 4Z2KA 5LKYA 5K9CA 3DESA 1PSCA 4XKYB 3S5ZA 2F2KA 5I3JA 1XC4A 4AF0A 4DJDD 4OBSA 3ZJ7A 2WPGA 1J18A 5CPTA 1KXVA 1HNYA 3KS6A 3GIYA 1ZP4A 1VBRA 2PP0A 3VD5A 2WKJA 4W5UA 1PAMA 4ICNA 2ZRZA 3L0NA 2CBUA 4IIEA 2V5CA 1CGXA 3S2JA 1FH8A 3L0GA 1EO5A 4YIWA 1AQMA 1SVDA 3W7KA 5C6MA 2C6QA 4AC7C 4IGSA 3O0KA 4GLEA 4C7GA 3L4VA 2ACRA 3OVRA 4NKCA 4PTWA 2WCSA 3P5ZA 4ZQCA 3EOUA 1ICSA 2VD9A 3WFLA 4GIEA 3STGA 3NEVA 3U4FA 4BI5A 3PZUA 3YPIA 3KS5A 1T8QA 2OKOA 3NGJA 2HE5A 1GVYA 3DUGA 4XAYA 3IV3A 5LNUA 4YN5A 4UTTC 3GH7A 3LXBA 5H6HA 3W25A 1DEDA 3G2GA 4O8RA 2WCAA 4AAJA 2E8ZA 1QU4A 3HURA 2OT0A 4F9DA 3QQ0A 2EPHA 2OEKA 5D2TA 3U2CA 4NAEB 4HNTA 3B8UA 2WMJA 3S1UA 5TBOA 3GB6A 3AIQA 3ID7A 3AXIA 1JDAA 5LA0A 3BANA 1FWBC 2MUCA 5DRCA 3TYZA 2GDQA 4RDWA 3PB0A 5BXRA 2PGEA 4LC8A 3WQ5A 5AYIA 3W87A 2CLKA 2DZUA 1H0GA 1ZENA 4ORMA 5E93A 3RCYA 2Y6ZA 4AYGA 4QAIA 1RXOB 4RE4A 2BGNE 3UVAA 3B03A 3VE9A 5EMJA 4OE7A 1O5RA 4ZO7A 1K77A 4LVGA 3CV7A 4UFJA 1D3CA 5SWUA 3TJIA 3AS0A 4PEEA 1E1CA 2CBVA 3TJXA 2GUYA 3PZNA 3V0TA 3G1DA 4FX7A 5EKYA 3WLSA 4HK7A 4P7NA 1XPYA 2W66A 3NZGA 4MDPA 2DPEA 4H83A 3KEHA 1XD0A 4XZ9A 3HM7A 3VGHA 5JMUA 1Q7QA 3TH6A 1AD4A 3GIQA 3H7UA 4BQ2A 2OT1A 3TSBA 5TF0A 2YIHA 3WLMA 4M6PA 4REQB 1XPGA 1HF6A 3C2OA 1TR1A 3F4CA 1OBAA 3UWYA 4YCPA 4K6AA 4D6CA 2YA0A 3NQCA 1OC7A 1FFQA 3P0WA 1HJUA 2G3FA 1XUUA 5DN1A 4B9ZA 4JIPA 2QNEA 4RL3A 1L2UA 3SFKA 1PDYA 4FF5A 2XFWA 1VPXA 1JAEA 2HSAA 3PANA 4LU0A 4WHBA 3NA8A 1P0BA 4JXCA 3WJXA 1S1RA 3FA4A 1UD4A 3FJLA 3GM8A 3TOPA 5CSSA 2Y85A 4UB9A 4CD6A 2GSHA 2HEJA 3VU2A 3TC3A 1PJ9A 4A2SA 1KM4A 2A7NA 3C2EA 4P8XA 3TAKA 1G67A 4OZOA 1W9PA 3WD1A 2B7NA 4HNLA 3ZMRA 3R2GA 3I7RA 4ZOBA 1XWYA 3HO8A 3SAZA 1ZPTA 3MYOA 3G18A 5C9ZA 1Q6EA 4EAMA 4Q8WA 4GRSA 1IXNA 2EJAA 1DWHM 1KNWA 4F8XA 1TKKA 2QIWA 2X7VA 3ABZA 4Y9AA 1EDTA 2FTWA 3R4IA 2J74A 4A3QA 5C0QA 4DZIA 1GCYA 3ZO9A 3C6CA 4P8VA 1B3WA 3L21A 4DWSD 3W81A 1Q6RA 1YTDA 3B8TA 2Z28A 4TVDA 4E5TA 3LNPA 1NWTA 3C4UA 4UFKA 1KLZA 2V9DA 3VE7A 4V2XA 4Z2GA 4GC4A 1FKWA 1IEXA 4XD6A 4J3ZA 5KZMA 3WNOA 1TIMA 2YOCA 1GQNA 4QX4A 1A5AA 2D3NA 4GI4A 4NAFB 1HX0A 1QNQA 2B7QA 2NVCA 2UWFA 1KFCA 4S2CA 4C6QA 3TC6A 3AHZA 3D5HA 2VCAA 4QM1A 3UZXA 4UOZA 1QPNA 3PB2A 1M1BA 3T0DA 4NYUA 1E4NA 1KM1A 4LTSA 3HN3A 3SY5A 4LUYA 1GZ1A 1FWAC 1M68A 1BWVA 3EDDA 3HGRA 4LH8A 2OX1A 1KBIA 2VFFA 4ENLA 2C79A 4RE3A 1WDQA 4FX8A 1YPFA 4ZEPA 5G2WA 3NO3A 4B91A 4O4WA 3FXYA 3I68A 1ZFJA 2HMCA 2DSWA 3OLGA 3OVQA 4KRTA 1T41A 1DIOA 2DT2A 4JTTA 3AYVA 1XFBA 2AOSA 4XBKA 3FEQA 1FRBA 6TIMA 2J7EA 3ITVA 2OWXA 1U22A 1SQ7A 1EZ2A 3GVWA 2QYGA 5GVJA 3PBMA 4FOJA 3WQOA 3KBSA 1XISA 2ZDRA 4F66A 1QVBA 5LHFA 5I06A 1OIFA 2XJ7A 3FV9A 4IMFA 3G77A 2V81A 1K7EA 4H6RA 3ATYA 1GONA 2PDJA 2J27A 1VKFA 2WJFA 2JIEA 4Z08A 2BG5A 1W1YA 1JD9A 1SZNA 1IHIA 2BV9A 3DKLA 3U5UA 2QF8A 1ISVA 3A12A 5AHFA 4FA3A 3W70A 4OGZA 4BS0A 1O5XA 3TR9A 1UUMA 2VFIA 2X1UA 1GOWA 5CQ1A 4IPLA 5LNRA 1E71M 2OQYA 3QR3A 4A8NA 3W7RA 4JTUA 5EGRA 2ZZ1A 2ACUA 5C2CA 2YW3A 1H09A 1V51A 2YL9A 3DI1A 5BXPA 1OFRA 5BW6A 1WX0A 2ZZ4A 4B4HA 4DX3A 1BF6A 3GH4A 1JYXA 3IVUA 4Y8FA 3I4EA 3V18A 1JPMA 4UQAA 4H9ZA 5JUVA 1SW7A 1SZFA 5DELA 3KCLA 4JTJA 4LCRA 4GO8A 3MJMA 1Q2RA 3PTQA 1DWFM 5B7YA 1I8JA 3WEOA 2GVYA 4UR8A 3FNDA 3GXFA 3KVKA 2INFA 3A22A 3WLJA 2BVYA 3LHUA 3NXFA 3F4VA 1F9CA 4B92A 4TTUA 3FKRA 1PVNA 3NGFA 3MMDA 3MC5A 4DYEA 2OYKA 3GNOA 2PTXA 3BC9A 4IH3A 3TZNA 4LW7A 1LJYA 3GG1A 2QAFA 4F40A 2GQAA 3CB8A 3N25A 1AMYA 4GHRA 3AAMA 4JKMA 1LQ0A 3CPUA 1S5VA 3CZLA 3FYOA 3G0XA 1LF1A 3AMDA 3IGSA 2PAJA 1E56A 3ARUA 3AI0A 4O8AA 2R1NA 1ZBVA 3DU0A 2D23A 4Z1AA 1C91A 2JBMA 3EEGA 2L5HA 2YCEA 2VZUA 3R5EA 2RGMA 4EWND 1KM5A 1L8PA 3FA3A 4MB5A 3W6YA 2WNNA 3CLWA 4L9YA 2W63A 2GWNA 2GVLA 4OHQA 4JQAA 1U1UA 3EPNA 4E0CA 2YB4A 1U2YA 1F3WA 4ML4A 3C2FA 4PFHA 2HPIA 3BOLA 4XVDA 4XD3A 1ECEA 4DEFA 4JN7A 3VAVA 4RNFA 3VIIA 4MY9A 3BCDA 4XZNX 4G9PA 4UTFA 5HR7A 2QEZA 4EIVA 5CZJA 1PHWA 2QGYA 1L6YA 2ZX7A 2EBNA 4XKMA 3S1WA 4MNKA 4UMAA 2G3IA 5FAJA 3LU2A 3BAXA 1NDYA 3VGDA 5AECA 1CECA 2NX9A 3PBVA 1KR1A 3M43A 2QULA 2H90A 2A21A 1EZWA 1XYCA 5A94A 3W6MA 4AZCB 1OX4A 3LBCA 5EMMA 4WGHA 2X0HA 4AWTA 9CGTA 4YNGA 5AYYA 3LMZA 1RJQA 4K68A 1A5BA 4RDVA 3D46A 1JDFA 3E02A 1D3GA 3CZKA 1XCFA 3GVGA 1ZAJA 2WSRA 2CW6A 5CSUA 1FHUA 1DE6A 4S1FA 2ZZ6A 3CL8A 2PDQA 4S3CA 2VC5A 2VOTA 1FP8A 1JZ3A 1YNPA 3KFTA 2BNJA 4O18A 5AFDA 3G1VA 2E68A 1E70M 1P7TA 1AA1B 3LM3A 4KMQA 2PRHA 4TO8A 4Y8EA 4QE1A 1FTXA 2QCGA 5FL1A 4B4FA 5I78A 4DQWA 3BJFA 1G69A 4F0LA 1CZ1A 3C5QA 1EEPA 1V0LA 3AICA 1BQCA 4HPJA 1MXSA 1R3WA 1DJXA 2P88A 2WM1A 3HPAA 2BVTA 3KBMA 4XZMX 3KBJA 3AHTA 2XH0A 4C90A 4E2OA 1XIEA 3UPBA 2C71A 1PX3A 2OVLA 2UBPC 3W73A 4YL2A 5GNYA 4D6FA 3BMXA 3PTKA 1S2TA 3CAKA 4IFRA 3ITYA 3DH7A 4DJDA 3G1SA 4N02A 1KRAC 3W2NA 5FCZA 3Q65A 4YVVA 1KWGA 4J3SA 4A8IA 3W72A 2J24A 3G1XA 1X7IA 3N2TA 4B16A 4ZGYA 3TYUA 3EKZA 5E0FA 1Y7VA 2ABAA 1HJWA 2CBIA 2ZX8A 1PZ3A 3GZ3A 3WIJA 4W7WA 3DHPA 2W5FA 1K7FA 3TUUA 4HYRA 4NU7A 3W7QA 2VEPA 1N7KA 4CU8A 4PZVA 1SMAA 1PZ1A 3GUGA 3O3RA 5KTLA 4LVDA 1BF2A 1TYGA 3VIGA 2FH8A 3AMGA 3WDJA 3P0XA 5C55A 1OK6A 4NQ1A 1C8VA 3RITA 7ENLA 3W1RA 4AZ5A 1MDLA 1OQFA 2XIJA 3POCA 1A3XA 3C2RA 5M5DA 4HN4A 2PDXA 3W2MA 3VIKA 3OGVA 2R82A 3OO2A 4KIEA 5JBFA 4IIHA 2FDSA 3SCTA 3L5LA 3VUPA 1W1VA 4U2ZA 3W9ZA 3GXTA 4E8CA 1XIJA 1XQLA 3B40A 5B80A 5CJNA 4ZSUA 1DIKA 3QLLA 3NQ6A 4GUGA 2QV5A 3KZPA 1MNZA 3WD3A 5K7JA 4FNUA 4C7FA 3ANYA 1NVMA 2CZ5A 3DFOA 4L7ZA 5CPQA 2OTDA 2PWDA 5HBFA 3PPFA 4QQ3A 4WJ8A 3RLHA 4OOZA 3S2MA 1W8GA 3M5XA 3USBA 4KPLA 3CPRA 8XIMA 4HQVA 2H3BA 1LBMA 3A21A 3TSDA 1VLIA 3MANA 2D0FA 1JZ4A 3BSGA 5CZTA 1QWGA 4I90A 2DZSA 3N11A 1J0JA 4HOWA 5I03A 1W91A 3OBKA 4JL2A 5LIYX 4LS0A 3WH5A 1PUDA 2J9YA 1VH7A 1S3TC 4D2JA 2QVNA 2ZC8A 1SMDA 2VFGA 4HOZA 3RRAA 4PH6A 3VD9A 2EEXA 2JF7A 2WZHA 3LSCA 1CCWB 1P6CA 4J28A 2ASHA 1C7SA 5AYXA 1IR2A 3IANA 2EKGA 2FHCA 3PZ9A 4LAOA 1QPQA 1I45A 3O05A 3ZR6A 3QGVA 3VX1A 4GI8A 3DYPA 1ITQA 1B31A 1F6PA 4M51A 1M7XA 3E0LA 3FYYA 4QE4A 5HJLA 5HNTA 3V1PA 3NDOA 3EA1A 1VS1A 3QW3A 1W3JA 3QEZA 2Z25A 3F5KA 4P7OA 3BLIA 1M3UA 4A05A 4U5KA 1DXFA 4IMAA 3TW6A 4AB4A 4BEUA 4D8ZA 2FQIA 3VM5A 1XSJA 2BSLA 3NM3A 1VBJA 2OSXA 3JUGA 4PMZA 6PTDA 3CNYA 2Z27A 4QG9A 1W0MA 3BJTA 1H60A 1V6XA 2GGIA 5CAHA 4HU3A 1U1HA 2V2CA 3ARQA 4WY0A 4HZ6A 5D32A 4GY1A 4BQ5A 3UA4A 5MKGA 3ZQ9A 2GPTA 1KGWA 4XISA 3TLQA 1OY0A 4AZ6A 3JRKA 3B3DA 1SGJA 3ARSA 1WUFA 4H8UA 1GT8A 5EPDA 3ITLA 1J11A 1FKXA 3GVVA 2OFJA 2YCJA 4F2UA 1SR9A 1OYAA 4HPHA 2GK1A 1Z69A 3WUEA 2V3FA 3SBFA 1V03A 3UXAA 2GSJA 4WEVX 4KWVA 1VJZA 4U31A 4BQ4A 3SJ3A 1BYAA 4GI6A 1LWIA 3R0KA 3Q45A 3GTFA 3GXDA 5G1MA 3WUGA 4JN6A 4LF2A 1TJ1A 1BAGA 3CUIA 3DFYA 3W7GA 4PL2A 1FH9A 4I9TA 4F48A 3GR7A 2ZUUA 4MUPA 1J0HA 4O13A 1UG6A 2QZRA 3CZGA 3PJUA 3U7BA 3BLEA 3SRDA 3WF1A 1E0TA 1EDGA 5M03A 1G7UA 1XUZA 3IK2A 1A0DA 3STEA 1IEQA 2OEJA 1VEOA 1A5CA 3UW6A 3CMJA 1Z42A 2PDMA 4E38A 4EKJA 4LVBA 2FB3A 4H00A 4NUWA 1W5MA 4AZ7A 1RCOB 1T99A 2Z4GA 4LYKA 3PAOA 4GZEA 4A22A 3CQHA 4XO6A 3B0UX 1UJQA 1BXCA 1GUVA 1KWKA 3T9PA 2VGFA 3NFUA 4I9MA 1F61A 2INZA 4XTDA 4DY1A 3WLIA 1M7JA 1Y65A 4C6PA 1EF3A 3W1LA 3IAPA 4AIBA 1JXJA 4LBSA 1H63A 3AU2A 1E0XA 3C61A 4KERA 1AZ2A 1H7XA 1OHLA 3TSMA 1XH2A 4GFIA 1V7AA 1R9XA 2RKXA 4RLIA 2DIEA 4OIFA 2C14A 3LX9A 3CLMA 3WD0A 3QW4B 5KITA 2YPIA 1DP0A 2JKEA 2ZA2A 3UESA 3T2PA 4XG1A 2FZBA 1XH0A 4C6OA 3KRBA 1JR1A 3VZYA 4AD2A 1EGZA 4FF7A 2FVLA 2C16A 1RA0A 4PA8A 1PX8A 2GYIA 1F7BA 4TX8A 2CLMA 3S5YA 3LM7A 2HK1A 4IF2A 3CEUA 5AOUA 1LL7A 1DJIA 1LTDA 3NM1A 3AHXA 2VJXA 1SYTA 7REQA 1GHSA 1UUQA 1TQXA 1ITCA 3W7LA 3BOXA 1I2OA 2Z1XA 1GKPA 2Z2AA 4JN8A 1ZY9A 1OFAA 1YDNA 3M44A 4QCFA 3SEPA 2CPUA 1RJPA 1TV3A 3WELA 3RPMA 2CLHA 4GX9A 1XI3A 4MWAA 3RX2A 4QSHA 4TMBA 3FW6A 2Z1BA 4QNWA 4ZQPA 2DSKA 3PJTA 1RQEA 2JEPA 2DT1A 1CGYA 2HWGA 4AH7A 3I7QA 1UPMB 3KLLA 1BQGA 1TWDA 3SSZA 8A3HA 3L4UA 3QMSA 4V1YA 1ML1A 3INPA 2ZRWA 2EF9A 3FGCB 4LT9A 3EOEA 4QGCA 5EBUA 5CBBA 3H12A 3SCVA 4QDPA 3CHVA 4Z42C 1KBLA 1XLGA 4LNCA 3HG2A 1OX6A 3FOKA 1HL9A 4K8HA 3VC5A 3FHAA 4MFDA 1W5NA 1UP0A 2XM2A 4KCWA 1TWIA 1PWMA 2PRMA 2EQDA 4FI4A 1W56A 4LNYA 3TYAA 3O07A 5JU6A 5E5CA 3L68A 4GCXA 3G3DA 2E6FA 3PZQA 3BMWA 3QTGA 5BXTA 2PWEA 4Q7BA 4JTAA 3HB9A 3BGAA 1RP8A 4AD1A 1U1JA 4GJJA 3PC0A 1XR2A 2VENA 1J2BA 2QR6A 1MZRA 2VCBA 1MUCA 2FZNA 5K9XA 4HTBA 2GOKA 3WJZA 2J8FA 4QP0A 2GVJA 3MUXA 2ESCA 1E9IA 2CCRA 4UTHA 3KXQA 2PSNA 5DMMA 1YW1A 1VFOA 3GC4A 3E2QA 4JIRA 4S3FA 5DF0A 5JBEA 1M53A 4IQDA 1HKIA 2NUWA 4PTXA 1RBOB 2ZZ2A 5A8PA 4DZHA 3F7JA 3UBPC 4M6QA 4ZBCA 3T0TA 1JCNA 3EBVA 4UBPC 3A23A 3WNPA 2XPKA 4O0QA 4G1NA 3M0YA 1NH6A 5C9WA 5LNVA 3BUVA 2FGZA 4B5SA 4HSNA 4ZO6A 3PM6A 1MO0A 4P2VA 2Y7GA 2ACQA 1DWJM 2R91A 2WAGA 3VIMA 3W53A 4O1DA 1C8YA 2VWTA 1NARA 5H8UA 4YTSA 3BH4A 3W7OA 1AJZA 3M7WA 3Q94A 3IUIA 2Z26A 1TELA 1PCKA 2CYGA 1VRXA 4R88A 3S83A 1OCJA 3EWBX 4QS6A 1KBBA 3TTYA 3EXTA 4US5A 4M8UA 1PIGA 3H2FA 1XLIA 4ADTA 1R2SA 4C5ZA 4R5EA 2XH4A 1UWQA 1UQYA 9XIAA 2G3MA 1JYVA 5CSYA 3UJRA 4XVEA 1UKOA 2OZTA 2IPFA 1WDRA 5D8ZA 3LHTA 4ZOAA 2FHBA 2D2OA 3SCWA 4UC5A 3UXLA 3WCZA 2VWSA 5C5YA 1JGMA 1J12A 2XZ9A 4X9SA 3G6MA 1EHNA 3CIWA 3G3MA 4J3UA 1WXYA 2O9PA 1O68A 4QITA 5HDRA 3J7HA 3NQ2A 1R8LA 2KAUC 5J04A 1QNVA 1GHRA 2J79A 5E09A 4WDXA 5DFAA 3BG5A 2F84A 1N8WA 4JX6A 1S2VA 1UCWA 3H6OA 1CIUA 4KQNA 4Q8UA 1ADOA 4LGXA 1W9UA 1ADSA 1XLMA 1V0MA 2QCMA 2YCLA 2PBOA 3LTPA 3QMTA 3OZOA 1TFVA 3R58A 3W07A 2P10A 1Q6FA 3W7NA 2DORA 1JYNA 3CB3A 2EJ1A 1FWDC 4ZQNA 3G8EA 4QEEA 2GQ8A 2PLMA 3CBWA 6CGTA 2OG9A 2NV1A 2FIQA 1KFKA 1GW1A 2WKGA 2QJJA 1Y5XA 3L9CA 5C9RA 3MHFA 3OLDA 2ABBA 5A8GA 4JZ5A 1GVFA 5I00A 5C9UA 2WVSA 4DXXA 1GVOA 3VZXA 2GWGA 5A2AA 3OQ8A 3ECQA 4QG6A 3G6LA 4GYKA 5HINA 1YDYA 2PDHA 3NL6A 2VX7A 3E0IA 2QQ6A 4PMYA 3O2LA 1GOKA 1L0PA 3GU2A 1DORA 1MXDA 4PMJA 4ADSA 1A53A 1UUOA 5ABGA 2BXVA 4L65A 2J8GA 4QJ1A 3NG3A 2BFGA 2R1MA 5A6BA 4GUJA 1JQXA 5FF0A 4W89A 4YTRA 2HBXA 1NDWA 2CHRA 1WXJA 1B54A 3ICJA 5DRIA 4UNKA 3N9KA 1Q6CA 4NASA 3AHVA 2DV0A 2VUNA 3KTXA 2VGGA 2HJPA 3B4UA 3TFXA 1QWKA 2CIPA 4K7VA 1GVSA 4H9MA 1CB2A 3SFWA 3WK3A 4DBDA 4HCHA 3AWNA 1XRSA 3ENLA 2VRQA 1K3UA 2YJQA 1EWDA 3C56A 4H6KA 4B5UA 4AY1A 5T91A 1ZCCA 4D6IA 2YBVA 3RPDA 1H5VA 3R43A 1M04A 4TU1A 1JZ5A 2WCGA 3QGAC 1RZMA 4H2CA 1HO1A 3IRSA 4U33A 5FI8A 1EP3A 4IFOA 4I3GA 3NQVA 5HPCA 3SR7A 3M0VA 5HOSA 4RNIA 1Q13A 2E5BA 1BG4A 2NQZA 3VD4A 4PTVA 1F3EA 4CNOA 5LIUX 3TLLA 2GQ3A 3PZMA 2ODOA 4CQCA 4H04A 3TFCA 4JTDA 1SJCA 4WSJA 4WF7A 2QCCA 1UWTA 4O0KA 3PR2A 4AHQA 3O8AA 5REQB 4D6HA 2O55A 4BQ3A 1LLOA 4EE9A 2DQXA 3FN9A 4NIRA 1UBSA 3N4FA 1VFLA 1G4TA 1I2RA 3TYEA 3W88A 3UG3A 3AQUA 3NQBA 4GK8A 1TV4A 4GVFA 2D0GA 1VFUA 2HS8A 1JCTA 4MJMA 5CGQA 3S46A 1E72M 4IP5A 1TVLA 3GDMA 2B0MA 3NPWA 4CN4A 3SSJA 2UY4A 3OW1A 4YHGA 2WW5A 1J01A 3AIEA 4XTIA 4MG4A 4TR9A 1ZBKA 3GO2A 2VURA 3B8WA 3R11A 3CUXA 5IDIA 4HA3A 1F6YA 1XDMA 2BLEA 3CUZA 5AHIA 3GE7A 2DH2A 2OZ0A 2F61A 2WLYA 3EDJA 5AC5A 4GE8A 3ZSTA 3WLHA 2NXGA 2BHUA 2YSWA 3F4NA 4P7RA 2VKZG 4L5ZA 1F4AA 1TZ9A 3ZVHA 5A2BA 2HROA 2CKRA 3S0CA 2RGLA 3W01A 2CXGA 4IFKB 1QPKA 1ZALA 4RX0A 1S5WA 4UFIA 2V63A 4XWUA 3M5VA 1VBHA 4ES4A 4O12A 4A21A 8TIMA 2NQ9A 1FA2A 4BKNA 3I3EA 2RJGA 3OU8A 4W7UA 1S3HA 1FHDA 2YW4A 1U33A 2VZSA 3ONCA 3HPFA 4B3KA 3TE9A 4D6DA 1GOXA 2YXOA 1N2VA 2D2HA 1B30A 2TRSA 1UOZA 2ALRA 2XVKA 1QOQA 1RLDA 3UVIA 3WK1A 4LUSA 3CYJA 4LY4A 3I3BA 4C6DA 3EWWA 4X22A 2NWSA 3NXLA 4JQ2A 2HQAA 4AY8A 1DBTA 3N13A 1IT0A 5ABFA 1ZJAA 4XAZA 3GNRA 3M0KA 3Q4DA 1US3A 3II1A 4LUJA 2YA1A 1SW3A 3MP5A 1UC5A 4M5PA 3A64A 2Y8KA 1QNSA 4KWSA 1TMQA 1F76A 5I23A 3L23A 3QYSA 4ZE4A 4FR6A 3OPSA 4INFA 4ERGA 3QZEA 2WQDA 3ITCA 2G8ZA 4YYCA 1XLFA 4H2HA 4ICCX 2VFDA 4UTWA 2J47A 3ZLFA 1AW1A 4A3HA 3EB2A 5AZ0A 3TA9A 4UQDA 4MFEA 3N15A 5HK4A 1BRLA 4KRUA 2VC7A 1QAPA 4GXMA 1A4LA 4MKVA 2J7GA 5HAOA 1UB3A 1HKWA 3CMFA 2HVMA 4J2PA 4AISA 2W62A 4FHAA 1R30A 2VRJA 4JTLA 4XIAA 1UIPA 3GD6A 1VEPA 1HW6A 2Z1VA 3MSGA 2A0NA 2QCNA 3LI0A 4QEHA 5AHEA 1EXPA 3CMGA 5A5WA 4KEMA 1VJSA 4YYFA 5AHMA 1A0CA 4DM1A 3LHZA 1O4UA 1XBYA 5D04C 2I5IA 1Q8AA 4D8AA 5G4HC 1FDZA 4WGXA 4HD5A 4OVXA 4FXFA 3QHNA 2V2DA 2JFEX 2Z2UA 1KRBC 2YDRA 3CHFA 3TNBA 3OVGA 4HGXA 4BWLC 3VPLA 1T40A 3L2LA 3UG5A 3PZOA 2PDFA 1C8QA 4KW2A 1YE4A 3O06A 1I1XA 3DZ1A 3VIOA 3GBDA 3C52A 3T7VA 2WM0A 3UNTA 2XDFA 4C60A 2QLYA 1W54A 1KQYA 1HIZA 4DJED 3VDHA 8RUCA 1EOKA 1EKOA 2Y2WA 1DJHA 2CHNA 1X1NA 3R13A 1FHVA 1KGUA 3SUUA 4OFCA 1V6UA 4TXEA 3NSXA 3G1RA 4MLJA 1RK5A 3SI9A 4AUBA 1DJQA 2F6XA 2WNZA 1XQKA 1XP3A 1ME7A 3UZJA 5MHBA 2MNRA 2FPYA 1DWAM 2C1HA 4C65A 4GYFA 9RUBA 2DZWA 1O66A 3CUFA 3OG3A 2X16A 4H8HA 3HG5A 1K1DA 5BRPA 3FAWA 3MCNA 4C6JA 3OZYA 3BW3A 1RV8A 3CUGA 3UWZA 5D9NA 4XZIA 3WD4A 1QBAA 3NQDA 1FWFC 1Z8AA 2ZCGA 1MUWA 3K30A 3T78A 3TK7A 1R47A 2LLEA 4BHYA 2B81A 2PDCA 2PFHA 4J9JA 4PRTA 3EPOA 5JXQA 1AJ2A 4JHMA 3P2VA 3EYPA 1QUMA 1EC9A 2NXIA 2YL8A 1UR3M 4O50A 1IXPA 3G0SA 3GHRA 3MQTA 3RF9A 4S3BA 1HZYA 2WLZA 2PU1A 1KRMA 2YDSA 3JVAA 4QE5A 5FL0A 4LV9A 1YLVA 1MEHA 4DBUA 2Q71A 2ZUSA 3LV5A 1GGOA 3QV8A 2DUAA 1QOPA 5HMFA 1Q66A 4HHHA 3VKAA 5D2VA 1RBAA 3LGDA 1YTEA 1IXQA 4I9JA 1HL8A 5A6TC 3QTPA 4WKHA 1MI3A 4IX0A 4HHLA 1MVYA 2WMKA 2BGQA 3P84A 5D05A 1K9FA 3BCFA 1MUMA 1YMYA 4UMBA 5DY2A 4BA0A 1B4EA 4MZ8A 3OHIA 4PMDA 4ZQMA 1JCLA 3SQMA 2PBGA 4UCFA 4AWUA 1SZGA 1KTBA 3RMEA 3DN5A 1R5YA 2ZOXA 1W31A 1WKFA 4R34A 3WQDA 4C91A 3LCGA 1IEWA 1XIBA 1V3HA 3U2EA 5BWFA 1Y5WA 5JH2A 3U4AA 3PHAA 4L64A 1R3QA 1OFQA 4OBTA 2D3LA 3KVMA 1R2TA 2PE4A 4FX6M 4DF0A 2BHYA 4MVAA 4C7DA 4LC6A 3OQEA 1BWLA 4EPDC 5A6AA 1MRQA 1ISXA 3AS3A 1UA3A 4KKXA 5A1AA 1THFD 3MYPA 1SFLA 4H4IA 1TMHA 2JALA 5CXPA 2ZX6A 4GCAA 3MBFA 4PUUA 1Z3NA 1GG0A 2XH2A 4QCEA 2OX4A 1Q63A 2E0PA 1LUCA 3VNYA 1LZOA 3NQEA 3GKFA 3AXHA 4RZBA 3ZWSA 4NY2A 4IXHA 4R85A 1VYSX 3QR1A 3GBEA 4FOUA 2YCIX 2QMJA 4EACA 3BLFA 1VJIA 3GY1A 3EA2A 1XRVA 3PPCA 3KTSA 2BOGX 3NPVA 2GLKA 1DTNA 1JF6A 4LXFA 5E9XA 1RAKA 2HRWA 3WZ0E 1MEIA 4GC3A 4RV8A 1GPFA 4N0RA 2E5CA 1XL9A 2PGRA 3WLOA 5HWMA 4IM4A 4C6KA 2NT1A 5BOFA 4B5VA 5LGXA 1TVPA 1UJPA 3UR8A 1TV5A 2Q6ZA 3P7YA 1WP6A 4XD5A 5HANA 3P61A 3TVAA 5AKQA 2JKAA 3RLVA 3S1GA 2G4JA 5F2MA 4K1WA 5CAKA 3PNUA 1WZKA 1CGVA 1I60A 3SY8A 1V77A 3N19B 3QF0A 1WA3A 4G1KA 4HNVA 5BRQA 1R38A 3SB0A 4EOUA 1TPWA 3W1MA 1G5AA 2WK2A 3UJ2A 2FKPA 4ONVA 1E6QM 2VFHA 2J13A 4GKLA 5A95A 2P76A 3GUWA 3GVQA 2WSPA 5H1WA 4HNCA 3FDKA 4IPPA 4XAFA 4WK9A 3VYLA 2OB3A 3LS9A 3N14A 4OT7A 2R6OA 4HPXA 3AXMA 3OVPA 3T55A 1E73M 1HUVA 3CO8A 2QCFA 4WDWA 1CYGA 2DUXA 1R7AA 3VCCA 8CGTA 2XN2A 4DO4A 3S9ZA 2ZTKA 1TV2A 3S5NA 4N9EA 4PCSA 1MQRA 3RR4A 1H7OA 5B7ZA 4GOAA 4JOMA 2FVKA 1EPVA 3UT0A 2QJGA 2XGZA 2HDJA 1TPB1 1L9WA 3TXVA 4BK9A 3STFA 2QPXA 4NJKA 4M6VA 3TIMA 4YTUA 2J7CA 2OMAA 3TCEA 1PKMA 3TROA 4PCNA 3VD3A 4KWWA 3OYZA 1XGEA 4G7EA 4OV4A 3PBYA 4RR4A 4D6JA 2YDAA 1A5MC 2HK0A 5DXXA 4PFMA 1HJVA 1NFPA 4MADA 1TREA 4Q6XA 4FAMA 1A3WA 3RU6A 4I6KA 3W7HA 3ANVA 4NNCA 3BJSA 4HCLA 3PTMA 8XIAA 2A6LA 6XIAA 4H9TA 4ICMA 2EAWA 4KEVA 4CD7A 2MANA 1QBBA 3GDLA 4UTTA 3N9SA 4V1XA 1PL9A 3WQFA 3AIVA 3PBUA 3K2GA 1DKWA 1MQQA 4UTKA 1HKMA 4J5NA 1MMFA 3W7PA 2E6AA 2IKJA 1S2CA 2EXOA 2EPMX 3GAYA 4NZCA 1YRRA 4TQTA 1Y0EA 1TA3A 4I7WA 5T9BG 4PCTA 1TTQA 1QK2A 3TJ4A 4N42A 4M56A 4BZYA 4GQBA 3KWXA 1H1NA 4Q4SA 5D37A 4O53A 3S2NA 1ZHAA 2YXGA 4LBRA 1VYPX 4JPGA 3PPHA 3KZSA 4H7VA 4C6CA 5F1VA 4HA1A 1OM0A 1XYFA 3STCA 3EB4A 3QZAA 3T2QA 2Y1HA 4X3ZA 4ERIA 1JZ8A 3LA4A 3WDPP 2A5HA 1XCWA 1XV8A 2WC7A 2OWWA 4AEFA 1EB3A 1S5MA 5HXMA 5G1YA 2QUTA 1GW9A 1K9TA 3NO5A 3LSBA 2GDVA 3WKZA 5XIMA 2IPWA 2J8TA 3RO6A 4DJDC 4MJ2A 1YEYA 3P81A 4UCGA 3NVDA 1PBGA 5DQPA 1ONXA 3PN8A 5M1TA 2GGEA 4F3HA 1BFNA 4L56A 4YTTA 3QC0A 4WJEA 1V0KA 4AZBA 1G0CA 2IXUA 4DM2A 1QPRA 1XX1A 4AC1X 3Q2DA 3I3DA 2QHAA 4UOQA 2BXYA 3CV6A 2POZA 3T8LA 5G5IA 5F4SA 1NP0A 4NF7A 3KTCA 3SCSA 4DZ5A 3O9NA 2VP8A 3VCRA 1UC4A 3SN1A 1P6BA 2FDMA 4XKYA 4RZ5A 1X6NA 3GZAA 1H49A 3QVQA 4MLRA 2VCCA 1H1ZA 3PSVA 1UD5A 1NWUA 1ME9A 1EUNA 4KGJA 4RDYA 4IIDA 4DWSB 3BV7A 4FOKA 2BWGA 3UF9A 1JGIA 1TR9A 1PTAA 3VXGA 1DJZA 3HFTA 1WBJA 2PURA 3C8NA 3WK0A 1JYWA 2CZDA 2V3DA 4XZLX 2AMXA 3RLGA 4DB7A 3VIPA 3GNDA 3UNDA 2CU0A 2EGZA 1FWIC 1B0IA 2G41A 4RUBA 3RK8A 5JQ9A 3C86A 1K70A 1FWSA 5HMSA 2GJLA 4H19A 3N2BA 1EGVA 1V3MA 1KXQA 2GJXB 1NOUA 3EDFA 2PS2A 3H55A 4HZMA 2VD8A 2J7HA 2CBJA 2G97A 1I0BA 4TIMA 1RH9A 1OCQA 1CPUA 4FEZA 2E3ZA 2FLIA 1XRFA 4NAEA 3TTSA 2GFTA 3E3HA 1SUXA 4CNUA 2DSZA 3WK2A 5KINA 3BL3A 3S2LA 5IHSA 3H8AA 1TV7A 2QAPA 3T6CA 2WNQA 3CV1A 1HKKA 1W1TA 4R3UA 1EQCA 1FDJA 4FNRA 3V3WA 4CQ9A 5LXEA 1EX5A 1UHVA 3NPUA 3N3MA 3RR1A 1PCWA 1J4EA 4GH3A 4CCEA 1LG2A 1NU5A 4MSSA 4GMEA 3MKKA 1E51A 3LRMA 2WMIB 5CLTA 3NQGA 1HG3A 4AXNA 1XLLA 1A5UA 2J77A 3K4WA 3GYEA 4LX4A 4DJEA 1MWOA 3EX4A 2ZA1A 4DO7A 5CC5A 3TMLA 1JXKA 3SECA 4NG3A 3WDRA 1V3LA 3PZGA 2UY5A 1GKRA 5G1TA 4NZFA 2WYSA 1Z89A 4ZMGA 5XIAA 4IJBA 1XYBA 1E4IA 3W27A 1GJUA 4GUIA 4QS5A 3R8HA 4H9VA 1B57A 2WJZA 1YYAA 3LXAA 5H8MA 3W23A 2BY3A 1TIWA 5D4YA 5LIWX 4K8GA 1Q5MA 3LN3A 3CYVA 3H2NA 5FIPA 3T0AA 4ZFMA 4IMGA 3HJEA 3MI6A 2ON3A 4XQ6A 4REQA 3DFTA 1JRCA 4ZA0A 5LNSA 3MCMA 4HNUA 2WJEA 5GJPA 1AH0A 4X2RA 3HPZA 4ALDA 5IXEA 2RDUA 1K02A 4ORIA 3IGXA 2NQJA 1XGDA 3VGFA 4CCDA 3E74A 3P82A 5F4WA 1KM2A 1ZAHA 1W1A1 1Z7AA 1G94A 2P3ZA 3IVTA 3IJ9A 1WZMA 5F1UA 3GDBA 2YL5A 4GZ7A 1U5VA 4A3YA 1E6NA 1NTHA 4C6NA 2F6KA 3R0UA 4UR9A 4GJ1A 4LB4A 3N04A 4M1BA 3NVTA 3MZ2A 1LP6A 4Q32A 5I3KA 1R9ZA 3WBAA 2H8XA 4FLSA 4MZ1A 3W71A 1WDWA 1GYNA 1JUKA 4FNSA 1LBFA 1XG3A 5A6KA 2W67A 3DHFA 4RXGA 2YBUA 1NJJA 3WLKX 2WZIA 4NILA 2IPJA 3LZ5A 2NUXA 4Q7NA 1EP2A 3M5YA 2WHKA 4C6EA 1NDZA 4WIWA 1XXXA 1QRQA 1YADA 3BW4A 2J66A 4PUEA 1W5QA 3A3WA 4QTGA 3SQSA 1RVKA 2EHHA 1YPXA 1DPMA 4MY1A 2IQTA 1AFSA 2QMKA 2QDDA 4D1IA 1GEQA 4NI3A 1F2JA 2NXHA 1XLHA 4IPNB 3W2KA 4B2DD 2NW0A 3W28A 4NAFA 3KOXA 3O15A 3E96A 2VX5A 2E09A 3KCOA 3A4AA 3SY1A 2NX1A 4HMCA 4O1BA 4POCA 4L1XA 2HVNA 3W76A 4U4MA 4Q8VA 2CLEA 5FEXA 4Z2HA 5JIWA 1OSEA 2ATMA 5TAOA 1UH2A 1TWZA 4HSOA 1TUFA 3UP8A 1HXJA 3MDUA 2H8ZA 3LB0A 1NF7A 4C6FA 5D9PA 3PZIA 3CT7A 2ZKMX 2REQA 1TQJA 2GL5A 1D2KA 1C29A 3OHMB 3QV7A 2Y8UA 2E6YA 3I6TA 1DTUA 5FSEC 1RA5A 4L9XA 1JEZA