3O6AA

F144y/f258y double mutant of exo-beta-1,3-glucanase from candida albicans at 2 a
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
394
structure length
394
Chain Sequence
AWDYDNNVIRGVNLGGWFVLEPYMTPSLFEPFQNGNDQSGVPVDEYHWTQTLGKEAALRILQKHWSTWITEQDFKQISNLGLNFVRIPIGYWAFQLLDNDPYVQGQVQYLEKALGWARKNNIRVWIDLHGAPGSQNGYDNSGLRDSYNFQNGDNTQVTLNVLNTIFKKYGGNEYSDVVIGIELLNEPLGPVLNMDKLKQFFLDGYNSLRQTGSVTPVIIHDAFQVFGYWNNFLTVAEGQWNVVVDHHHYQVYSGGELSRNINDHISVACNWGWDAKKESHWNVAGEWSAALTDCAKWLNGVNRGARYEGAYDNAPYIGSCQPLLDISQWSDEHKTDTRRYIEAQLDAFEYTGGWVFWSWKTENAPEWSFQTLTYNGLFPQPVTDRQFPNQCGFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Glucan 1,3-beta-glucosidase
publication title Carbohydrate binding sites in Candida albicans exo-beta-1,3-glucanase and the role of the Phe-Phe 'clamp' at the active site entrance
pubmed doi rcsb
source organism Candida albicans
total genus 150
structure length 394
sequence length 394
ec nomenclature ec 3.2.1.58: Glucan 1,3-beta-glucosidase.
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3o6aA00
3MMUA 1CGTA 1GOMA 2E8ZA 1C8XA 3CUIA 2XFYA 4HOZA 2XVLA 2D0GA 2DQXA 2WLYA 2C8NA 1WP6A 5HOSA 2UY4A 4U33A 1OB0A 3UCQA 2DIJA 1WDPA 3PN8A 2J7GA 1CXHA 3W38A 5A8MA 3ZO9A 2J7HA 3D5HA 3LPOA 2EJ1A 1VF8A 5CLTA 4AZHA 4JFVA 3WF3A 1GOIA 5BYWA 2WZEA 1SMDA 3OA5A 1TFVA 4JKLA 2F2HA 1OGGA 2J4GA 2F61A 1E4IA 3AS0A 2VX6A 2QF8A 3CUGA 2WCAA 3N11A 1XYFA 3IJ8A 2XVGA 4U31A 4D72A 2WBKA 3WUFA 1UKPA 3RPMA 3SCRA 3WDRA 4Z2JA 1W3LA 3I3EA 5A6SA 1LWHA 1HJWA 4W5UA 3AYSA 3AHYA 3M7SA 4W87A 4X0VA 2WC7A 3VD4A 5HPOA 4HPGA 3RCNA 2A3AA 3VIFA 2RGLA 3F5LA 4UZSA 4B9ZA 4F9JA 3WNNA 1UKOA 5DF0A 2BY3A 1UD6A 4N42A 2OWWA 2JF7A 4GXPA 1QBBA 1UWIA 4MB4A 4AD2A 4S3JA 1JZ4A 4J3TA 3AHZA 5BROA 1XYZA 4HZ7A 5IHRA 4LPCA 1ZBKA 2QHAA 1V0MA 1LJYA 4A3HA 1KWGA 3ZM8A 3QR3A 1UHVA 1JXJA 3D3AA 3NYDA 3T0AA 1KBKA 2W92A 4MNKA 2G3MA 1H0GA 3GTNA 4UR9A 5A1AA 1J0IA 1HF6A 1E6PA 1I1XA 3QOKA 4HZ8A 1M04A 4OJYA 4AZCB 4D1IA 3KL0A 3BMWA 3L4TA 3ARVA 4C7GA 3WD0A 1JL8A 1N82A 5E09A 2JEPA 2V5CA 3N12A 3B8SA 5KZ6A 5JBDA 4YHGA 3PZNA 1NWRA 2CHOA 4J3SA 1E0VA 1E73M 2YBTA 3K8LA 1G5AA 2WVTA 4C7FA 2WXDM 3N1AA 3L2LA 1CXEA 2XSAA 1GHSA 1X1NA 2OLHA 2VOTA 3VMNA 2WYSA 2G3JA 1W9PA 3AXXA 4UNIA 5CGMA 6CGTA 2GJRA 2CBIA 1JF6A 5DO8A 1PZ3A 4J28A 1LL7A 2QV4A 2YA1A 1QNQA 3BH4A 4CUCA 3VOCA 1OIFA 2ZE0A 2X0YA 1C91A 1BQCA 3QHOA 1Q4NX 2XFRA 3WMBA 1E15A 2XSBA 3EDDA 1R8LA 2OYLA 4CGTA 3VINA 4JKKA 4HMCA 1H41A 1XGZA 7TAAA 3AZSA 3CZEA 1RPKA 5ABEA 3ZJKA 4AZGA 1G1YA 4MB3A 3OLGA 2J7FA 3HMCA 3ZJ6A 2NT0A 1V0NA 2E40A 3CUHA 4TVUA 4ZFMA 3TP4A 4OKDA 4GZEA 1OM0A 1K9TA 3MUZ1 1MW0A 4HMDA 3MMDA 1CLXA 2FGLA 4PMZA 4U2YA 5DMYA 4NRRA 1ITXA 1V02A 1E6RA 1JFXA 3WQ8A 4CU7A 3WQWA 4UTFA 5I79A 1BF2A 3SIMA 1WPCA 2W5FA 3VMOA 5JBFA 1JYWA 1EHNA 4FK9A 3BXWA 1JZ6A 5C8BB 1NOFA 1KXTA 2ZXBA 4MTVA 1BAGA 2UY2A 4PTWA 4UQCA 4MAVA 5A6AA 3WD1A 1RD6A 4XX6A 4YHEA 2WWCA 3EDEA 2AMGA 1E4LA 3T09A 1R86A 1CNVA 1QOXA 5C71A 4RE3A 4D6IA 4KGJA 4LQ1A 1DWFM 5GPRA 3DYMA 3WEZA 5CQ1A 4P8VA 4B16A 1KGWA 1TVNA 3BAYA 4PMOA 1NP0A 3GNRA 4DUVA 1RP9A 3AI0A 5E0CA 4AY1A 4A4AA 2BY1A 3QHNA 2F8QA 3VDAA 4CCEA 2VUYA 1CTNA 4W7WA 1S46A 4JCLA 1PPIA 3AFBA 3L4XA 3K4DA 1B3YA 1U33A 2DSUA 2ZUUA 1QVBA 1QI0A 4MDPA 4PEEA 5CXPA 3TTOA 1WDRA 5E70A 4UFHA 1AMYA 4E2OA 3T0BA 1XSIA 1WZMA 1UH3A 5CGTA 4EAMA 4M80A 2WNWA 2ZUMA 5HNNA 1HX0A 5A2CA 4PMVA 5A6LA 1C8QA 4RL3A 2GDUA 1LF1A 3VVGA 8A3HA 1W1YA 3U7BA 1UA7A 3LPPA 1H3GA 2XYLA 3WNKA 1XSJA 3RM9A 4PTVA 1G9HA 3U7VA 3CMJA 2DSZA 3NCOA 3RIKA 4QLLA 5BWFA 3EDFA 3KL5A 4BF7A 2WMJA 4UFMA 1JDCA 3EMZA 2EXOA 1CIUA 3F4VA 2WK2A 4W85A 4JHZA 3MV11 1G94A 5A2BA 1WB0A 3WF0A 3UETA 3WIJA 1JF5A 3WFLA 1E6ZA 4AD1A 3WDJA 1GQJA 3CGTA 4H41A 1H2JA 2JF6A 1ITCA 1HL9A 4KH2A 3AIRA 5HDRA 3VKKA 2G4FA 3VGDA 3CZLA 4D1JA 3ZJ7A 1GJWA 5ABGA 1QHZA 3DC0A 5DT5A 4D6EA 7CGTA 3SCVA 2CKSA 3BC9A 3PTMA 1CDGA 3VIMA 3IJ9A 3MU7A 5EFDA 4W8AA 5BXPA 4HOWA 1G01A 2CEQA 1LL4A 1QNRA 1PX4A 1CZ1A 1JZ7A 2QPSA 2XM2A 3SCTA 1GCYA 5M03A 3B9AA 3F5KA 3K8KA 2YLAA 4C7DA 4AIOA 1EDQA 4J7RA 5A2AA 4F66A 2ZX5A 4JIEA 4P8XA 4BS0A 1IV8A 4ZE5A 1M01A 4QDMA 2VZUA 3VM7A 1W1TA 4U3CA 2D2OA 1E5JA 3AZRA 2EO7A 1MVYA 3MANA 3W53A 3WKZA 3ZOAA 5D4YA 2XGBA 5A69A 1V0LA 2BXZA 1V6YA 3GZAA 4FLOA 1BYBA 4PMQA 4UOQA 5CPTA 2V3FA 3GNOA 1B0IA 1HP4A 1JYNA 1VRXA 4WKHA 2DIEA 2OSYA 3UG5A 3ZT6A 1L0PA 1QHPA 2G3NA 1EXPA 5M17A 3POHA 5EB8A 2J7CA 3T2QA 2D3NA 8CGTA 1E4NA 1E72M 1W2VA 3ZT5A 1QNOA 3FAXA 1HT6A 2GJXB 1OD0A 1UQZA 1R7OA 1CGYA 6A3HA 2J8FA 1EIBA 4FMVA 3PZ9A 4FLQA 4D6FA 4MNJA 4GQRA 4U3AA 1PJ9A 2DEPA 3CZ8A 2FH8A 2WHLA 4ZE4A 1MYRA 2NSXA 3ARTA 3ARXA 3PBGA 1H49A 2XVKA 2ZX6A 3AJ7A 2O9OA 1IT0A 4P7NA 4Z2LA 1C90A 3CHCA 1UWSA 2DGAA 4W88A 4MB1A 3AHVA 1BYCA 2BNJA 2ZUSA 4JL1A 3VPLA 2X1IA 2PWFA 4AD3A 2WLZA 2WWDA 3RM8A 4LXFA 3AISA 4TOQA 5BRPA 4ZXLA 3SCSA 4KMQA 2WSPA 2CBJA 3IJ7A 1GUVA 1V3HA 3OBAA 1BHGA 2BHUA 3AIWA 2EPLX 4NI3A 2ZXDA 3IK2A 1KBBA 2VZTA 1D7FA 4JAWA 1ZJAA 1E6XM 5D8WA 1EOMA 2GK1A 4CD6A 1UWTA 2EPOA 4D71A 1F4AA 4GIAA 3GXMA 4UZUA 1VEOA 1G0CA 3OG2A 1VFUA 3WQ5A 4WKAA 4NSBA 2BS9A 2W61A 2GDVA 3WENA 1BTCA 4PMUA 2J62A 2GJXA 1DWGM 2VMFA 3VGFA 1CXLA 3SUTA 3AQUA 3WSUA 1UH4A 3CH9A 1EDTA 2WAGA 5M5DA 3K8MA 2ZWZA 1X6LA 3AYRA 2J75A 2JIWA 4PMDA 1E55A 2D20A 4AIUA 3L4YA 3WEMA 3QGVA 2YBUA 3W82A 1E43A 1AQMA 2WCGA 2WMHA 1KQYA 3DYOA 2A3CA 5D8ZA 1VJSA 1H5VA 1X6NA 4HZ6A 1HVXA 2B31A 2FDMA 1NWSA 2PWEA 2VVSA 3EDJA 5GNZA 2ZX8A 4DWSC 1Y7VA 2BY0A 2E9MA 2RGMA 4BQ5A 1V0KA 3WUGA 1OWQA 4QP0A 3RILA 1MW2A 1UR1A 4IM4A 3GH7A 3SEPA 4ATLA 4B15A 1BVZA 3FW6A 1OGBA 1VFOA 1UA3A 3U5UA 4B3KA 4X9YA 3WDIA 4OBSA 4TVCA 1JAKA 3WN6A 4GI9A 1KGUA 4IUGA 3K1DA 2VQTA 1E1EA 1ESWA 1XV8A 2UY3A 1DTUA 1ZL1A 1LG1A 2DT1A 4GZIA 3RO8A 5CG0A 1QI5A 3W0KA 2YL5A 2G41A 4ACYA 1C92A 6TAAA 4Y7EA 1GORA 4ATWA 4A3YA 1ZU8A 1E56A 3IAQA 3MUAA 4MB5A 4HU8A 2XVNA 3B9DA 1BSIA 2QLYA 3WD2A 4TUFA 3RJYA 4P7OA 3OLDA 2TAAA 2OYMA 2ZUNA 1XHGA 4AIEA 4TVDA 3N9KA 2DH3A 1TMQA 1TZ7A 1HJXA 1BLIA 4W8BA 2W67A 2WZHA 2OSXA 3ARWA 2ZWYA 3OZOA 2E0PA 1TCMA 4AW7A 1OIMA 3KE0A 2J79A 4OZOA 4GINA 3O9NA 4M8UA 2FHFA 4AZ5A 2XFFA 3W29A 4WSJA 3U5YA 1W32A 4OUEA 3BAXA 4AZIA 3NUKA 1FA2A 1E3XA 1NOWA 1W1PA 2VVNA 3VM5A 4J3WA 1W1VA 1GJUA 2WKLA 1B9ZA 1I1WA 4U2ZA 3MV01 4BZYA 4PCTA 3AMCA 5CZKA 5D9MA 1HJUA 4AZBA 5FCZA 1W9UA 4V27A 3VD5A 4M1RA 3DHPA 3ZSSA 1NQ6A 2V3GA 4PTXA 1TVPA 3W25A 1CBGA 1VBUA 2E9LA 2CHNA 3AROA 1TG7A 3AIQA 1TE1A 1KFWA 1UR9A 1E40A 1UYQA 3PZUA 1W9BM 2WVVB 3M46A 4M24A 3PZGA 2VI0A 5FL1A 3WQ6A 3WNOA 2PC8A 1J0KA 1EO7A 5E9AA 3DYPA 1HKMA 4RE2A 2X05A 4UFLA 1NWUA 4PYSA 4W86A 2XTKA 2VX5A 2YL6A 3AIBA 3EYPA 1J18A 4W7UA 1KCKA 3DHUA 4KRUA 3MKKA 3CZKA 2D3LA 2WMIB 2ZIDA 2X8RA 1E0XA 2ZX9A 1ODZA 3ARRA 4JFTA 1I75A 1KR0A 1XH1A 3PZVA 1M7XA 4P7RA 5AY7A 4RE4A 1V6VA 1VENA 3N04A 3RJXA 1F4HA 1GNXA 3AZTA 4U5IA 1BGAA 4TX8A 1W9XA 3TTYA 1K6AA 3TOPA 1P6WA 2VQUA 2Q8XA 4AZCA 2J8GA 3UERA 2VCAA 2WB5A 3LPGA 3FAWA 2BHZA 2BY2A 1J10A 1FHLA 3RM4A 1EH9A 1J0YA 1TA3B 1E71M 4KGLA 1GQIA 4YN5A 2WC3A 1VEMA 2YDRA 1OCQA 4DM1A 1E6SM 2BV9A 4Q22A 4H8HA 2BFGA 4UOZA 2GSJA 3W26A 1JNEA 1HJVA 3VD3A 2C0HA 1UZ1A 2CKRA 2YDSA 5I24A 1UQYA 3B9EA 4W7VA 2WHKA 1HJQA 1KXVA 1UG6A 2NT1A 2VT0A 3OGRA 2XIBA 1J11A 5IFPA 3FHAA 3OLIA 2WMFA 3AXIA 5FKYA 1NH6A 3MMWA 4AD5A 2CNCA 1JYVA 2YA2A 1V6UA 1ODUA 3W81A 4E8DA 3MSDA 2WMIA 4QLJA 4L4OA 2PB1A 4CVUA 1W9VA 2J7DA 2D0HA 3SUWA 3GXIA 3TA9A 1JI1A 5EFFA 3VILA 4AZ6A 1FH8A 4QLKA 5I5RA 1BYAA 2W4XA 4LYPA 2AOSA 1R7AA 4QCEA 4DUXA 4GO8A 5F7UA 2EPNA 4JCMA 2Z1SA 2VX7A 1QNSA 3GH4A 3L4ZA 1WO2A 3BAKA 3PTKA 4HP5A 2JEQA 2XPKA 3BAIA 2BVDA 4WKFA 3AXHA 3ZJ8A 1E6QM 3CBWA 2FHBA 1SYTA 5E0FA 5DFAA 2XGIA 3L2MA 3THCA 3SCUA 3GBEA 1C3FA 1TR1A 4UQEA 1BPLB 1JD9A 1QI3A 2X0HA 1U30A 3CTTA 5DEZA 5IFTA 4PUDA 1XCWA 4CD5A 3L4WA 4F79A 2G8ZA 2E4TA 3WNLA 4E4PA 4FF5A 4PSRA 1J0HA 1UWUA 1UD4A 4D6DA 4E8CA 4H2CA 2ZXQA 2WVSA 3VGHA 1FOBA 1LG2A 1V02E 1KXQA 1CWYA 4N0RA 4F9DA 3J7HA 1B3VA 1PEZA 4Z2KA 5M3WA 5CLWA 1GOWA 5GNXA 3VMPA 1HN1A 3BLPX 3WF2A 1HKKA 3L4VA 2GUYA 1Q6DA 3WL0A 2GJPA 4UOJA 4FLSA 1JIBA 1B2YA 3BCFA 1KB3A 1OT1A 5I3DA 3VX1A 2YLLA 1VEPA 4V28A 4DWSB 2O9PA 7A3HA 4P7QA 4M56A 5LYRA 3AMGA 2Y24A 1D2KA 3VIPA 1AQ0A 4CVWA 1JG9A 1CGVA 4MADA 3W4RA 1HJSA 2HVMA 3CHEA 3MUY1 4M81A 2YA0A 1LQ0A 5ABHA 2XJ7A 4QCFA 1J01A 2VZVA 4HTYA 2WMGA 2DPEA 3CHFA 3VX0A 2WVUA 4BQ2A 4KWUA 5GQBA 1VAHA 3HJEA 4J3VA 3S6TA 4ACZB 3KEHA 3GDBA 2PWDA 2VCBA 4CD7A 3WY1A 4AEEA 4EANA 1V6WA 1JYXA 4GKLA 2XVPA 3MSGA 5AYIA 4H04A 1LWJA 3RDKA 2XM1A 5FD0A 1V03A 3AIEA 3ARUA 1D3CA 3WFZA 1WKYA 2CETA 4HA4A 1GW1A 2CXGA 4MAZA 2WBGA 4F8XA 2DSKA 3ARQA 1EDGA 5A6BD 1PBGA 3WUBA 2V3DA 1MXGA 1XC6A 1WDSA 3SCQA 4NF7A 2EPKX 4TX6A 2XUCA 1OSEA 1JD7A 1DWHM 1W3JA 5BCAA 1VFFA 4GQQA 3KWXA 5FOOA 1VBRA 4WLCA 5A8PA 2DSWA 3SCOA 4AISA 3AS1A 2XIIA 3VGBA 1GONA 3M6DA 2PWGA 2VO5A 2X09A 1PX8A 1CEOA 4TXEA 4R27A 3GNPA 3AS3A 5JIWA 1UD5A 3KZSA 4WK9A 4ZENA 5JBEA 2CCRA 3WBAA 1J12A 1ZB5A 5IDIA 1E1FA 3BGAA 1OINA 4AYSA 3DECA 3VGGA 1B3ZA 5A6BA 4ATDA 1H11A 5I6SA 1SR0A 2O9RA 2WHJA 3QOMA 4JHOA 3A4WA 1B3XA 3VD7A 3EMQA 4IISA 1M53A 3NSMA 2VJXA 1IZKA 1UD2A 3CUFA 2XWDA 1J9YA 4Z2HA 1V6XA 2VZSA 3FNDA 3GYCA 1NP2A 1BYDA 2VTFA 3O2LA 3ZQ9A 1AQHA 1JZ5A 1UR0A 3KL3A 3WDHA 3WNPA 3SCNA 1MQRA 1JNDA 5GNYA 5IXEA 3AHXA 2ZUWA 2OWCA 1ZS2A 2DT2A 1WNOA 4R5EA 1KGXA 1WZLA 3ALGA 4PUEA 4CN6A 3PZIA 2C7FA 2J47A 1UKTA 4HU0A 4TTUA 1UWRA 2QPUA 2UY5A 1MW1A 1A47A 4GI6A 4CN1A 3BLKA 2DH2A 4GO9A 4UQ9A 3AIUA 3VIHA 4HPHA 1CGWA 1ISVA 3WD3A 3N17A 3II1A 1CGUA 5A95A 1NWTA 5HBFA 3A3HA 1VFMA 4QFUA 3ZR5A 3VIGA 1HKIA 1B1YA 2VURA 5CJ5A 4NZCA 3WBEA 3OGVA 1EA9C 4JZ5A 3BAJA 2OWXA 4HOXA 2O92A 3T2PA 3OIHA 3SUSA 4V2XA 1UD3A 3L4UA 3OZPA 1YHTA 3ARPA 1AVAA 4AXNA 1BGGA 1CGXA 5FIPA 2Y5EA 5AC5A 2GVYA 3AMKA 4HMEA 1HNYA 4BQ4A 1BG9A 4B9YA 1YQ2A 1SMAA 2CBVA 5CSYA 3VIJA 3CPUA 3M07A 4CCCA 2CITA 3AICA 1US3A 3T2OA 2X2YA 3MS8A 3NSNA 5HXMA 3UG4A 3ZSTA 1CXIA 1US2A 3WMSA 3WH7A 1V3LA 3N13A 1E3ZA 4AMCA 5A94A 1HXJA 2EEXA 1DWIM 1O7AA 4L4PA 4BCEA 2WC4A 5I2UA 2JFEX 4CD4A 1JDDA 2A3BA 3N15A 2J25A 2Y4SA 4JFWA 3SUUA 4UFJA 2PBOA 4LYQA 2MANA 3NDYA 4U5KA 4AWEA 5ECUA 1GPFA 1DEDA 1EQCA 5A6MA 2QMJA 5I77A 4CU8A 3ZR6A 2BVTA 4AD4A 2D0FA 1W2PA 1Z32X 5I23A 1QNPA 4PCSA 4UFIA 1PIGA 4CU6A 2W63A 2JIEA 1XCXA 1J0ZA 5ABFB 1EQPA 2YOCA 3VD9A 3W28A 3HN3A 4W8LA 3FY1A 3VDHA 2YL9A 3WEOA 2VR5A 3AOFA 3APGA 5A8NA 1V08A 1HL8A 2BHYA 1QI2A 2BVYA 4PMXA 3WH8A 2WANA 1RP8A 5FL0A 1H1NA 2OYKA 3G6LA 3VTRA 2FGZA 1GOOA 2Y8KA 2WW5A 1SFSA 2JE8A 3CLWA 2CESA 1KR1A 3ECQA 2D23A 3CHDA 1C93A 3CZJA 2W66A 4MPKA 2ZX7A 5A8OA 1KCLA 2G3IA 2UWFA 1V3KA 4CCDA 4CKQA 3WNMA 1ZBCA 2CPUA 2PI6A 4M82A 3PZOA 2E9BA 1CXFA 3S2CA 1CPUA 3WL1A 4B3LA 3CO4A 3VDCA 2WHMA 1UH2A 3GXFA 4AEFA 4D6JA 4GPNA 2WZIA 1WZAA 2E8YA 3K4AA 1JFHA 1JZ3A 2FHCA 5LA1A 2W91A 1GVIA 1K9EA 1UWQA 4W89A 1XD0A 1JGIA 3G6MA 2XG9A 2ZICA 3WDQA 2AAAA 3ARZA 1CYGA 5D9NA 1MFUA 4NRSA 2EPMX 1R87A 4BA0A 1UUQA 1JAEA 1PIFA 5ABFA 3I3BA 3UEQA 5A8QA 5A6JA 3MUIA 3BAWA 4XB3A 4UQAA 4MJ2A 4XUYA 1DHKA 5BRQA 1W3KA 3GXDA 4D6CA 1VB9A 5LA2A 1V3IA 3O6AA 3PHAA 1GHRA 5EMYA 2J7BA 5CSUA 3A47A 3VIKA 4H8VA 4PMYA 1H0IA 1HP5A 3WH6A 1E5NA 1JDAA 4D6GA 1VIWA 4WIWA 3F5JA 4W93A 4OOUA 3NJ3A 2WSKA 2DT3A 3BCDA 2VRKA 5AC4A 4W84A 5EBAA 3N18A 1WAWA 1J0JA 2WVVA 3NDZA 1B30A 4Z2GA 5E6ZA 1OGSA 3WDPP 4PMRA 1Q6CA 2XHYA 4JL2A 3FXYA 3LMYA 1UZ4A 1GQLA 2ESCA 4W5ZA 1NOUA 3NSXA 1VJZA 3OLEA 3A6OA 5BXTA 1E4MM 2WKGA 2V3EA 4P8UA 1PX3A 2EQDA 2VRQA 3OB8A 2JALA 1Q6FA 3ZT7A 3FHQA 1E0WA 4XZBA 5D9OA 1ZBWA 2J74A 3VNYA 1EO5A 1JXKA 4PTMA 3AMDA 2Y8VA 2HISA 3T0DA 4IPLA 3HU7A 3AIVA 5CPSA 1XH2A 2DDXA 2D24A 3PZMA 2ZOXA 1WZKA 3T08A 3EBVA 3VIOA 4DUWA 3BMVA 1CLVA 4Z2IA 2DSVA 4HA3A 4LYRA 4UFKA 3SCPA 3IANA 4UQDA 1M03A 5IHSA 3POCA 4P7LA 1MFVA 1OD8A 1UR8A 4HA1A 1NM9A 1ISWA 3OGSA 1ZJBA 1C7SA 1DWJM 3UR7A 1HVQA 1JZ8A 1C7TA 3CMGA 1TA3A 5LA0A 3LPFA 2YDQA 1MQPA 2WM0A 3JUGA 5BXRA 1RH9A 4LGXA 4K68A 1U2YA 2VRJA 3W27A 4CD8A 5JIPA 1MW3A 3UESA 4D6HA 1UR4A 4WF7A 2ZUTA 1O6IA 2YJQA 2IXUA 4URIA 3UG3A 4MNLA 4H7VA 1EGZA 3RMEA 1FH7A 2GFTA 4S3KA 4IPNB 1K9FA 3WELA 3THDA 3VU2A 1CECA 3W24A 3AHTA 1XD1A 2NW0A 3CIVA 4J3XA 2XWEA 1GZJA 1FHDA 4LX4A 5I0DA 4FLRA 2W62A 1OBAA 1ECEA 4Q7NA 2V38A 2ZUVA 3NIYA 2VZOA 1MXDA 5KEZA 3VDBA 4ML4A 1E6NA 4DM2A 2IUZA 3VIIA 4GI8A 3SCWA 1FFRA 3QHMA 4OBRA 3WQVA 1MQQA 3U57A 1C8YA 2D1ZA 3ARYA 3CZGA 2VC9A 2YKKA 4PN2A 1CXKA 2VX4A 1DWAM 4EKJA 1WDQA 5E6YA 1TUXA 1QBAA 1B90A 2V5DA 1PAMA 4PBGA 3ZIZA 4AZ7A 9CGTA 1OT2A 4WSKA 1B31A 4XZWA 4M29A 1LLOA 3GBDA 2OSWA 2A3HA 2CERA 2CYGA 4H8UA 3VGEA 2PBGA 4AD0A 2QMKA 4MJ4A 4AC1X 4OOZA 4DWSD 2ZXAA 1IZJA 1QW9A 2Y2WA 4X0NA 2VNCA 1UKQA 5HPCA 1NARA 2FH6A 2A3EA 3GM8A 1W3HA 4WJXA 4PSPA 3WQ4A 1CENA 3ZMRA 3ALFA 1MWOA 3FN9A 4ZEPA 1GOQA 4J27A 5AYBA 3ARSA 3PZTA 1W9DM 2J7EA 2PWHA 2CIPA 4KRTA 1ISZA 4UQBA 4ZXOA 2GK1B 5TD4A 1XH0A 3EMCA 1JI2A 4CN4A 2EBNA 3MO4A 4MDOA 3GH5A 3W6LA 3WH5A 2BXYA 1LL6A 2J78A 2O9TA 4EE9A 4JFUA 5A3HA 4JKMA 2VCCA 1UR2A 1HKJA 1Q6GA 4UCFA 3CUJA 1KXHA 3SURA 1E70M 4GZJA 3IAPA 4PRWA 4DWSA 3A4AA 2YL8A 1EHAA 5DT7A 3K46A 1DP0A 3W37A 1FP8A 2DT0A 3A4XA 3E1F1 5D9PA 2YIHA 1XRVA 3TTQA 2CBUA 3WF4A 4XV0A 1BG4A 1QHOA 1W91A 4OIFA 1UKSA 3EDKA 3PTQA 1H4PA 2WCSA 3VUPA 1ISYA 3AS2A 1WE5A 3PZQA 1A3HA 2E3ZA 1UD8A 1V3MA 1GVYA 1R85A 1GQKA 1WCGA 5A6KA 3VNZA 1JZ2A 1KQZA 3UR8A 4PMNA 4ACZA 1FH9A 5BXSA 1PZ2A 1FFQA 3BSGA 1E9LA 1Q6EA 1QPKA 1EOKA 2VL4A 1HIZA 1V3JA 1XSKA 1L8NA 1KWKA 3WF1A 1FP9A 4EK7A 3TONA 3BSHA 3W6MA 1H09A 3VO0A 3WH9A 3AMLA 1ZBVA 3WMCA 3WUEA 5I78A 1QI4A 1ISXA 2J77A 2Z1KA 4BQ3A 1UOKA 4J3UA 2IXVA 3TTSA 1BVNP 2VR4A 3I3DA 2PF0A 2WPGA 2WMKA 1QW8A 4JFSA 5JUVA 1BFNA 1B3WA 4QAWA 4YPJA 5CPQA 5C70A 4TTGA 4P8WA 3SUVA 1K9DA 2D22A 1GOKA 4MNMA 3WD4A
chains in the Genus database with same CATH superfamily
4S3EA 2SFPA 2X1TA 1RY8A 2GGEA 1VBHA 3W74A 2D0GA 3P84A 3C52A 4IGNA 5HOSA 2UY4A 1J5SA 3GW0A 5KETA 4MHBA 3GY1A 1WDPA 3PN8A 4JTTA 5AYZA 1FDZA 5CBJA 2AGKA 3BW4A 3UZXA 2EJ1A 1I45A 1E1CB 5CLTA 3L12A 3WF3A 1GOIA 2TRSA 3MJMA 2WZEA 2F2HA 5D38A 2VX6A 2WCAA 1XYFA 1ICQA 2RKXA 3NQEA 2Y5JA 5LSMA 1X38A 3RPMA 2HS6A 3SCRA 3QV7A 4PODA 1ZFJA 5D04C 4DBWA 2KX9A 1M9HA 1W3LA 5A6SA 4EPKA 2NUYA 3JZEA 3TYEA 3BLOA 1LBMA 3AYSA 3AHYA 4G1KA 3B0PA 3M7SA 3CJPA 4S3GA 5FJJA 3BV4A 3U2OA 4Q4RA 4XZNX 3UVAA 3E96A 4CNOA 3GG8A 4UTLA 3F5LA 4F9JA 4G56A 5DF0A 4C1LA 4N42A 2OWWA 2AQOA 3TC3A 1QBBA 3PVFA 5LGXA 2XFWA 4S3JA 1JZ4A 3OTRA 3OQEA 4HZ7A 2QT3A 1S5VA 1ZBKA 4A3HA 3FV9A 1VIZA 3ZM8A 4JY8A 2ZQ0A 2W92A 2Z7KA 4NIRA 3IRDA 3GTNA 3OHIA 5A1AA 1HF6A 4NY2A 2HNEA 3GSMA 4MIMA 3SQSA 3KL0A 3BMWA 3TQVA 4IMDA 4C7GA 3WD0A 3AUJA 1DJZA 3TN4A 2V5CA 5JBDA 3B8SA 2NUWA 4YHGA 1NWRA 2CHOA 3N34A 4AWTA 4RNJA 1VD6A 3L2LA 4GH1A 1WDWA 2YXOA 1KW1A 1X6UA 4IIEA 1KM1A 1P7TB 3VMNA 4DI9A 2WYSA 3GC5A 2QJIA 4FIRA 1RD5A 4TMCA 2ZRZA 2VGBA 1WYIA 2EAWA 5CC6A 1LL7A 1F8MA 2FTPA 3TC7A 1RK5A 2ZE0A 2CW6A 3QZ6A 2D69A 3WMBA 3EDDA 3C56A 4JKKA 2RH9A 4PEKA 3OEXA 2QUTA 2BXVA 4FEZA 5ABEA 1YW1A 1RQBA 3KBSA 3CWNA 4AZGA 2V82A 3PFMA 4MWAC 4M6UA 1BKSA 4NZ3A 3WBXA 1LZOA 3L68A 3HMCA 4M7SA 1XLLA 2QAFA 3CUHA 1OM0A 3S5YA 1XWYA 2IPGA 4HMDA 4PMZA 4B5XA 3H8AA 5DCEA 4CU7A 3TXVA 5IBXA 3W1NA 5I79A 5T8GA 3ZWTA 4ZZ9A 2HQAA 4FK9A 4DPQA 4FPSA 1DHPA 4AEOA 1KXTA 1K8YA 2XZ9A 3NO1A 3UJSA 1BAGA 1XDLA 4MAVA 3WD1A 1ZSXA 4XX6A 1E4LA 4K6AA 3T09A 3GR8A 1QOXA 3QVQA 1JPIA 3OIXA 4RE3A 4D6IA 2BB0A 1Z44A 3BVJA 4A3QA 1A5OC 5CQ1A 4P8VA 3GNRA 2G4JA 3WJXA 1W8GA 3AI0A 4ZB5A 4A4AA 2OOFA 4L6DA 2QJMA 2QJJA 3QHNA 3VDAA 2VUYA 2X41A 4YTUA 4C1NA 3N2XA 4LVAA 4QDPA 1DE5A 3K4DA 5FEWA 2DSUA 1QVBA 3BANA 4CQ8A 3FEMA 4KCVA 3D0CA 4PEEA 4DYEA 3LY0A 1Q2SA 1JCJA 1SJBA 1SSGA 1UH3A 5EY5A 6REQB 3F03K 4HHMA 2VEFA 1IXNA 4GY0A 1WXJA 2ZUMA 3AU2A 5EGRA 3UWQA 3LDVA 1RA5A 2Q02A 5A6LA 3AJXA 4TQTA 3AWOA 4Q8WA 2GDUA 4XBJA 4FALA 5CCZA 3ZXWA 3LPPA 3NL3A 2XYLA 3MQTA 3RM9A 5TF0A 3PS7A 2DSZA 3W7MA 2GVJA 5T9BG 3RIKA 2HMCA 1O95A 1TKKA 3EDFA 2QUMA 4DXVA 3QY6A 4UFMA 1YXDA 4GYJA 2YCLA 4PRRA 3CEUA 3EMZA 5IM51 2VEPA 5M2FX 4W85A 1T7LA 4JHZA 3TW7A 2ZKMX 2HPIA 3QSTA 5A2BA 3DKJA 2GWGA 1WB0A 3LUTA 4LAZA 3WIJA 1JF5A 5H1WA 2JGYA 1JCXA 1RZMA 5CJNA 4KESA 1YDNA 5AVHA 3P82A 1XINA 1ITCA 1EBHA 2BGQA 2G4FA 3VGDA 4D1JA 4NP7A 3DC0A 7CGTA 2G0WA 1CDGA 1S38A 1M5WA 2BBFA 3D6NA 3KXQA 3EWBX 4IGMA 4Y9PA 2NXIA 1UZHA 4HOWA 3IARA 4FXJA 5HK4A 3R8RA 4XSMA 2X30A 3IV3A 3B9AA 1PYMA 3K8KA 3H2FA 5A2AA 4W9TA 4NYUA 5FJTA 4P8XA 1S3HA 1EUAA 4ZE5A 1R9ZA 3ORWA 4ZCWA 1TSIA 4QDMA 4GIYA 3S83A 1CLKA 1W1TA 3QV8A 4U3CA 4RE0A 1E5JA 1KLYA 2EO7A 3RG6A 1MVYA 4NU7A 3SY1A 2P8CA 3LHYA 4FLOA 4UOQA 4B4HA 2V3FA 3GNOA 1B0IA 1BF6A 3PJUA 2OSYA 3H2MA 1XLBA 2G3NA 4JBRA 3FGCB 1ME8A 5EB8A 2D3NA 3VCCA 1W2VA 8CGTA 3ZT5A 4J3ZA 1OD0A 1UQZA 1KRCC 4GCXA 5GJNA 3CWHA 4FMVA 3PZ9A 4FLQA 3SZ8A 4GQRA 2B81A 4BKNA 1PJ9A 3LBOA 3IVUA 2NSXA 1QUMA 1SQ7A 1H49A 4UNLA 2O9OA 4US6A 1C90A 4MB1A 4L56A 2X1IA 4AD3A 2WWDA 4ZO8A 1P43A 5DCDA 4TOQA 3LX9A 4A21A 1KFKA 2WSPA 2CBJA 1V3HA 3OBAA 3V0SA 1DV7A 3M7WA 2VFEA 2A7PA 3NPVA 5D09A 1EYEA 4NI3A 4Q8NA 2REQA 1E6XM 1UZDA 1HFBA 5M1TA 5REQB 2EPOA 1BWLA 2QUVA 4NG3A 4UZUA 3OG2A 7REQB 1VFUA 4NSBA 2PD9A 2BS9A 2GDVA 2WPBA 2YCJA 2GGHA 3VDGA 5F4XA 2J62A 3RU6A 1TX2A 3LU2A 4RJEA 1XFBA 1FWDC 2PLCA 4OWGA 1UH4A 3NGFA 3H23A 4QQUA 3ES7A 1YBQB 4S3FA 5M5DA 1NDZA 4LUTB 2ZWZA 4YVPA 1X6LA 4Y9NA 4GQGA 1FKXA 2JIWA 3KZPA 4A8NA 1QR7A 3GD6A 3L4YA 3P0XA 5B7ZA 1FWWA 1ITUA 1K03A 3DYOA 4EX4A 1BVWA 2IQDA 5EU9A 1JRBA 2B31A 2VVSA 4EWND 2XN1A 3EDJA 1K4HA 5I06A 1Y7VA 3HFYA 2F7FA 2PLJA 4BQ5A 1V0KA 2QCFA 1RSCA 3RILA 3LSBA 1K02A 1POKA 1OGBA 5I3HA 3W22A 3ITYA 3IRSA 4Q3MA 4KBXA 4TVCA 3OPSA 3LCXA 2QV5A 4LEQA 3W7QA 1KGUA 4WDXA 4K2SA 1E1EA 3DG7A 4OV4A 1XV8A 3QKZA 1DTUA 4L65A 1R9YA 4GZIA 2OMAA 4E2DA 2PLMA 3W0KA 5DY2A 2YL5A 1PIIA 1K3UA 3N6JA 4JGDA 3MCMA 3K13A 1OX5A 3INPA 2EJAA 1ZU8A 3IAQA 1GJPA 4LB3A 4MB5A 2ISFA 4QEHA 4HU8A 3G1VA 3B9DA 1DXEA 3S1VA 4R7JA 2QLYA 1WKDA 3IIOA 2ZUNA 1XHGA 3GAYA 1TMQA 3V18A 1M65A 3T78A 2W67A 4GY7A 3NQDA 4PUJA 4K1GA 2ZWYA 3OZOA 3RR4A 1KBIA 1AQFA 3MVIA 3W1AA 4BFAA 5C9UA 1NDWA 4GNVA 3N29A 3M1ZA 1IYXA 2F6KA 3ANUA 3PC0A 4WSJA 3U5YA 2INEA 3BAXA 1J6PA 3DFPA 1H63A 5C9ZA 3VM5A 2UV8G 1YE6A 1W1VA 2VD9A 1OADA 3HBLA 4I3GA 4NILA 4G7FA 5CZKA 4V27A 1I2NA 1GVFA 3DHPA 4UNKA 2QUUA 3ZSSA 2V3GA 1DIDA 1ZZMA 1HGYA 2GGIA 7ODCA 1J2WA 3AROA 4H01A 4ES4A 2ZTKA 2OT1A 3AIQA 1TE1A 5G1YA 1AD4A 4DYKA 1UYQA 3PZUA 1W9BM 4JX5A 1KM3A 1TMLA 1V7YA 1IF2A 3PZGA 1RLCL 3WNOA 2PC8A 1J0KA 5E9AA 1HKMA 3NTYA 4RE2A 4ML9A 3TSBA 3VOFA 1K70A 4AF0B 1NWUA 1M1BA 3G1AA 1ZHAA 2YL6A 2RFGA 1J18A 4ADTA 5HULA 1XBYA 2D3LA 3BURA 3TCSA 1E0XA 3N9RA 4M7TA 4GBUA 4H4IA 4EF8A 3PZVA 5AY7A 4RE4A 1V6VA 3CIWA 3L7RA 4AQLA 4U5IA 3UY8A 3GHTA 2AGTA 2Y7GA 1ONWA 1O1ZA 5CZJA 3H6OA 3TOPA 3KBMA 1P6WA 1L6YA 1T96A 2VQUA 3S8HA 2A6NA 8RUCA 2J8GA 3E49A 3BUVA 3UERA 2VCAA 1PWLA 2WB5A 2XISA 4REQA 1EH9A 1J0YA 3LRMA 1E71M 2R91A 4UC5A 3O16A 1DIEA 3JS3A 4A8RA 3CQIA 5DMLA 3P7YA 3KBJA 1YTKA 1EP3A 2WO5A 4DM1A 3LHZA 1XBVA 4UOZA 2GSJA 3W26A 1JNEA 1HJVA 2CKRA 1AODA 5CAHA 5I24A 1FVPA 2Y70A 3UWEA 3KBWA 3CQJA 3W88A 2C91A 3KOFA 1MZHA 3OGRA 5IFPA 3M0KA 1FKWA 3TFXA 1O12A 3UU0A 2OQLA 1C29A 3MMWA 1EJVC 4AD5A 3T9PA 1JYVA 2WOQA 1ODUA 4E8DA 4ZOEA 2VEKA 3APTA 3SM0A 4JQ1A 3W86A 3PNZA 4CVUA 1RHCA 1UPMB 4MY8A 2R1LA 3CB3A 3CIXA 5EFFA 3ONCA 4LYPA 2AOSA 1OX4B 3UGVA 4PFHA 5F7UA 3QTPA 3V1PA 3DDMA 4KRZA 1JPHA 3L4ZA 4TO8A 3NQ6A 2XPKA 3NO5A 1E6QM 4LRTA 1AK5A 3L2MA 3GBEA 4LUYA 5HMFA 4GIEA 2EGZA 1TR1A 3EX4A 3S2MA 3STCA 3L21A 4MOZA 3VC5A 1U30A 4R9XA 3NQAA 4C6FA 4PUDA 1XCWA 4UB9A 3BPWA 4GY1A 4HB7A 4JIQA 3CWOX 4CD5A 1LYXA 1ICSA 4F79A 3PFRA 3JU2A 4OBTA 4D6DA 4GHRA 4H2CA 5G1TA 1LCOA 4AIBA 2WVSA 1DTNA 3VGHA 4X2RA 3KHDA 1V02E 1KXQA 3KHJA 3GDLA 1IXPA 4ZODA 1TYGA 3MHFA 4OV9A 1PEZA 3TYUA 3R5EA 1J6OA 1VFLA 4V15A 2RJHA 2H90A 2DV0A 2NX9A 2GUYA 1Q6DA 1YLVA 4FLSA 3FJNA 2PDYA 3BCFA 2PU0A 3JW7A 3ZVHB 2O9PA 3GW3A 2Y24A 3FX4A 1D2KA 1LOLA 4V1YA 4R33A 3HOJA 2WSRA 1JG9A 6XIAA 3CS2A 1HJSA 4DPPA 2E1WA 5AKQA 1DJHA 3CHEA 1WXYA 1H61A 2DUXA 2YA0A 4POCA 4OE7A 2RDUA 2PDQA 1J01A 2V5JA 4L80A 3C2YA 3CNYA 3PPHA 3EB2A 2DPEA 3HQPA 4BQ2A 1EJ7L 2PRMA 4KWUA 5GQBA 3HJEA 4J3VA 4MKVA 3KEHA 2YW3A 3N4FA 1JYXA 2YXXA 4H04A 3RDKA 2FMNA 2XM1A 5FD0A 3N3MA 4HA4A 4MAZA 2VC5A 1PS9A 3WUBA 1XLMA 2V3DA 2QIWA 4O1EA 3W3OA 4LJ3A 5C7VA 3LHTA 2XUCA 3EXTA 4LCSA 3QY8A 4WUIA 3FK4A 1GTEA 2VHLA 4IMEA 3R58A 3CQHA 3PSVA 3SCOA 4AISA 3BJSA 3AS1A 1UBPC 2G95A 2XIIA 4FF7A 3UWZA 3W02A 1B4EA 4K8GA 1SZNA 4NKCA 3A5VA 2X09A 3BICA 1H1ZA 1KFJA 3AS3A 1AG1O 3G0UA 3W7HA 1F3EA 5JIWA 3IIPA 3O15A 3ITXA 3TAOA 3N2OA 4Y8EA 3C0QA 3U3HA 1KC7A 3RCMA 2FJUB 3E2QA 4ZO9A 1J12A 5IDIA 3BGAA 4LUIA 3DECA 4ZO6A 3UZYA 1B3ZA 4ATDA 1RBAA 1SR0A 3UA4A 2WHJA 3QOMA 1U22A 1B3XA 1IQ8A 1QT1A 3EMQA 4IISA 2XN2A 2W0UA 1RY0A 5CPLA 2XWDA 1NY1A 5EMKA 1Q8AA 1V6XA 1OX6A 5MKGA 4WD0A 1X7FA 3RX3A 3CYVA 1KTNA 1H50A 1PTGA 1OZMA 4GC4A 3NNTA 4IMGA 4L9ZA 4H9TA 4LVBA 4LT9A 1RJQA 5DY3A 5GNYA 1A3XA 3QQ1A 1WZLA 1XFCA 4PUEA 4DEFA 2ZCGA 3SQLA 3PZIA 3QZAA 2J47A 4HU0A 2CLMA 3G5EA 2QPUA 2UY5A 3W7CA 1N2VA 1IGWA 4X3ZA 1SM9A 1DE6A 3U2EA 3DC8A 1OCBA 2BX7A 4LTSA 3W83A 1ISVA 4BY3A 4HK6A 5HBFA 3WX7A 1VFMA 3VIGA 2VURA 4NZCA 3WBEA 4JTSA 3GKAA 3S5OA 1VFTA 1VPXA 4QHRA 2V68A 2OWXA 4HOXA 3DBNA 1K7EA 2QCGA 2ICSA 3T2PA 4MWAD 4WGHA 4V2XA 1UD3A 3L4UA 4GIRA 4NX0A 1L6GA 3STEA 4KFPA 1YHTA 3P80A 5AHLA 1IEIA 4Z1BA 5HWNA 1CGXA 2PP0A 4G8TA 3AMKA 4BQ4A 1BG9A 4ZMGA 5CSYA 4MUZA 3CPUA 1US3A 3LGGA 4HT3A 4G7EB 5K9CA 4QG6A 1TTQA 5HXMA 3UG4A 3A5FA 2J13A 1NJJA 4E2BA 3U2ZA 1V3LA 4AMCA 5A94A 1NIUA 1MSSA 3DERA 4BCEA 2VWTA 1OZQA 2WC4A 6XIMA 2C18A 1JDDA 1IEXA 1TRIA 2ZRVA 4KF1A 3EXSA 2MANA 5D33A 3N14A 4U5KA 3NQ8A 4LF2A 1GPFA 2RAGA 4X9SA 5A6MA 4MWAA 1NQKA 1GKQA 1IEVA 1LBFA 4CU8A 5JVLA 4AD4A 2D0FA 3MO7A 1GK8A 4CEXC 5I23A 3BG9A 1TJ1A 3BQ6A 2NQZA 4K39A 4CU6A 3PJTA 5HUPA 1DQUA 1XCXA 5ABFB 4GGBA 2ANUA 1P4CA 2ZZ6A 1IZCA 4RNFA 1A80A 3GLCA 3FY1A 2X7WA 3E5PA 3APGA 2OEKA 4O0QA 5A8NA 3S9ZA 1ADSA 1HL8A 1QI2A 2WANA 3SSJA 2OYKA 3VZZA 4UTIA 3VTRA 2FGZA 1GOOA 2Y8KA 1F2JA 1Z6KA 3CLWA 2CESA 4IF2A 3GO2A 3HQNA 2W66A 4HNVA 4MPKA 4FHAA 5LNUA 1EP2A 2YFNA 5D32A 4CCDA 4D8LA 4ADSA 1ZBCA 2CPUA 3E9AA 2Z28A 1CPUA 4R7OA 5DN1A 4LY8A 1UH2A 2J8TA 5CGQA 1UROA 4LBRA 3UXKA 4DBEA 3M0HA 1ZJIA 1MUWA 2E8YA 3K4AA 1JFHA 1XLEA 2FHCA 4WY0A 5KTLA 2NVAA 1DBTA 4AFYA 4RDWA 4DAIA 3DENA 3M9YA 3WDQA 1YYAA 2C71A 3ENLA 3REQB 1HZYA 4G1NA 4I8YA 4NRSA 3KBNA 1ONRA 4Z42C 3M0JA 4N9EA 5JU6A 1JAEA 1PIFA 4ZOAA 3I3BA 3UEQA 3QH2A 3MUIA 1W3KA 1XLKA 5LA2A 1OCNA 3PHAA 1G4TA 3T44A 4MZ8A 2J7BA 4AC7C 3A47A 3NQ2A 2YGYA 4H8VA 2FYMA 1H0IA 3FA3A 1HP5A 1JDAA 4D6GA 1VIWA 5HUOA 3DFNA 5J5DA 3NJ3A 2DT3A 1X97A 3O63A 2VRKA 5AC4A 4H8NA 1C9WA 1J0JA 3NDZA 1W0MA 3EOSA 3TYDA 5I3GA 5E6ZA 3VCNA 4E3VA 1OGSA 4A29A 2I1OA 3E2VA 2OZ0A 3T40A 1GQLA 2ESCA 4DWDA 3CV7A 3BG3A 4O28A 4UIOA 4MJMA 2ZZ3A 3ZYZA 3F2BA 1E4MM 2V3EA 1EBGA 4M3PA 3ZT7A 1SPQA 4KETA 1ZBWA 5CKSA 2FVMA 4F0SA 3PANA 3CHVA 1OF8A 1PCWA 2DDXA 4CLMA 3PZMA 2ZOXA 3BMVA 4R53A 2PDWA 2FVKA 4O54A 4HA3A 3RX4A 3SCPA 2YCIX 1FDYA 1M03A 2E09A 3BOFA 4HA1A 1NM9A 5AZ0A 1ISWA 1ZJBA 2DUZA 2ZDRA 3CMGA 3EB4A 2OELA 3MI2A 4C5ZA 1A49A 2YDQA 2WJFA 2E5CA 1RH9A 4K68A 4CD8A 4RPPA 5JIPA 1MW3A 3V75A 5LNRA 2YJQA 4C90A 1TV3A 1T41A 4JTRA 3RMEA 4A05A 4EVZA 4YWIA 2GFTA 2XIMA 2PTZA 1JQVA 1PL9A 3NQVA 1K9FA 2PP1A 3K1GA 4AVNA 1D8CA 3THDA 3W24A 3AHTA 4N9BA 4FB7A 4QX4A 2XWEA 3H4GA 1JUKA 4LX4A 1FBAA 2FZNA 1MXDA 5KEZA 3H2OA 4ML4A 1XYAA 4AG0A 4LBSA 1TPC1 4DM2A 2IUZA 4GI8A 3SCWA 1SZGA 4JYDA 4V33A 3QHMA 3AUOA 3NFUA 4PRTA 3WQVA 3AWNA 1TV5A 3ZWSA 4JYFA 3W1XA 1XUUA 4GXMA 3ARYA 3DFYA 1A0DA 2ZC8A 1WDQA 1B90A 4PBGA 4GBDA 4OUIA 2HROA 4BI6A 9CGTA 4XZWA 3SRDA 3GBDA 4A8IA 4AX6A 5BZAA 4K7VA 1F07A 4C91A 4MJ4A 5ENLA 5JMUA 1W1A1 2Y2WA 3HV9A 5D05A 4QSHA 2FH6A 1S5WA 4KWOA 2A3EA 3GM8A 1V6TA 3NQGA 3Q45A 1CENA 3H54A 3ALFA 3PZTA 1W9DM 2CIPA 1OFDA 5TIMA 2J9XA 1ME7A 1ISZA 4ZXOA 4O1DA 5E5CA 3MO4A 4XD6A 3A23A 4JFUA 5A3HA 2J24A 1R3WA 2IKJA 3IEBA 2VCCA 3LK6A 4IXXA 1UR2A 4UMAA 1HKJA 3FLUA 1Q6GA 3G18A 3N19B 3CUJA 6PTDA 1E70M 1TTPA 1EHAA 1DP0A 3E1F1 2YIHA 4JQ2A 3EB3A 3DG3A 2BG5A 1AW2A 2IPWA 1QHOA 1W91A 3EDKA 1TV7A 3TQPA 3WQGA 4BWLC 2B7OA 1HQTA 3WLOA 1A5AA 4G5DA 1V3MA 1GQKA 1WCGA 5A6KA 5A5WA 1PHWA 1MRAA 2V81A 1JZ2A 3NG3A 5G2WA 2FZ9A 2VM8A 3C3NA 1E9LA 2O4QA 1Q6EA 1QPKA 2NZLA 1V3JA 2OQHA 3H26A 3FKRA 4B90A 3PF3A 3HF3A 3W6MA 4ZL1A 4JD4A 3VO0A 3WH9A 1ZBVA 2PMQA 3S9IA 2YX0A 2ON3A 2AMXA 2P53A 1H7OA 3V5FA 4XD5A 1PE1A 4RW5A 3KVLA 1P0KA 1B3WA 4LVGA 5CPQA 3DFQA 5C70A 1SO5A 3B8UA 4P8WA 4WDTA 2W6RA 4Y96A 3CU2A 3WQCA 4MFEA 2D22A 4ZGYA 1S39A 3I10A 4O0ZA 4MNMA 1SFJA 3MMUA 3DOPA 4Q8UA 4FX7A 3LCLA 5TAOA 4WOQA 4O14A 4JN7A 2WLYA 2C8NA 4KQNA 3TA6A 1WP6A 1NSJA 2QYGA 4DIAA 4U33A 1OB0A 3EOOA 5D02A 2ZRWA 1GVOA 1CXHA 4HZMA 2BVWA 5A8MA 4NJIA 1PXGA 3ZO9A 2PWVA 3B0VC 2J7HA 3ATZA 3I6TA 3LPOA 4AZHA 4JFVA 2QUNA 3U9IA 2G5WA 4RV3A 3O1NA 3PULA 4KEUA 5D2TA 1IIGA 4UXDA 2J4GA 1LROA 3SY5A 2QF8A 3CUGA 3VNMA 3N11A 2XVGA 3HG2A 4U31A 1Y65A 1TCDA 2G50A 2JK2A 1AJ0A 1Z3NA 7TIMA 2FZ8A 4ZQPA 3LI1A 3GG0A 5FF0A 4R34A 1E0UA 4X0VA 5HPOA 4F3HA 3TSMA 2X2GA 5CEWA 3DFHA 4TIMA 4MY1A 1XCFA 4Z0SA 2QCMA 3DXIA 5FSEC 5AN7A 4HIBA 3EA2A 4E6MA 3H24A 3BK0A 2IW0A 1UWIA 5HWJA 1JUEA 4S2BA 3OYXA 5C2CA 3AHZA 5BROA 1XYZA 5IHRA 3N2MA 2QHAA 3RLUA 1KWGA 3OO2A 3QR3A 1RCXB 1PZ0A 3WLSA 5KINA 1KBKA 3THAA 4NAFA 4MNKA 1DL3A 1H0GA 3URAA 4NX5A 1J0IA 1S1RA 2O7SA 4B5WA 2HV5A 3HG3A 1M04A 4OJYA 4AZCB 1OY0A 4D1IA 3USZA 3PNUA 4RLIA 3AYVA 5E09A 1EX5A 2V67A 3PZNA 4J3SA 2ISVA 2VC6A 1E0VA 1TWSA 3C2VA 4XBKA 3SGUA 1XIHA 3W1UA 2WVTA 4DXXA 3N1AA 4Z1CA 1GHSA 2QF7A 4OT7A 2VOTA 1MEWA 1XIJA 3A3XA 1YIXA 5G5IA 4LS2A 3AXXA 5CSRA 4UNIA 4HN4A 3UWYA 3I65A 2JKAA 1W5OA 2QDHA 3BH4A 3MP4A 4A3RA 3VOCA 3EWXA 3QV6A 3QHOA 4XO6A 4YYFA 4O8AA 1T5AA 4HCLA 1CB7B 1UUMA 1R8LA 1GG1A 1QPRA 1PCKA 2P1FA 1ONXA 2O0TA 3LG3A 1NAL1 3E3HA 1TQJA 1S1PA 3H4XA 3VNKA 4H83A 3E0VA 3OLGA 1NU5A 3ZJ6A 1R3TA 1V0NA 2O55A 4PB4A 4LAOA 1AW5A 3MTWA 4X61A 3MMDA 2FGLA 3B4UA 4HKPA 5DMYA 4XO7A 1JFXA 1JQXA 1KO0A 2XZ7A 1GEQA 4ZA0A 2DZXA 4F40A 1SO3A 3IIXA 2JKPA 3BXWA 3U48A 5C8BB 2ZXBA 1XQLA 3DHFA 5A6AA 2PCEA 2YBVA 2YCLB 3EDEA 2AMGA 3VOIA 3STPA 4HYRA 1R86A 2X1SA 1CNVA 1MO0A 5C71A 1AMKA 1DWFM 3A64A 5GPRA 4C6OA 4D9PA 5HQMA 2Z24A 2BLEA 1KGWA 3TWAA 1NP0A 4NNAA 3TN6A 1RP9A 2J6VA 4A6GA 3QQWA 4S2CA 4WQ6A 2IKHA 3LTYA 1CTNA 3OA3A 1U33A 3BE7A 3GVWA 1X7IA 3DH7A 3CT2A 3RMJA 1WDRA 4E2OA 3LTPA 2PDXA 3T0BA 1XSIA 4AVOA 2EF9A 4EAMA 1U5HA 4M80A 1XICA 2C19A 4KEVA 5A2CA 1GYLA 5FEPA 2NXHA 3MZ2A 4ERAA 1Q2RA 1YE4A 2VEIA 4PB5A 4HVXA 1A4LA 3GTIA 3U7BA 1R2SA 2NVDA 3R0UA 1OYBA 1XSJA 3PBMA 1G9HA 4CNNA 2I9EA 1XYCA 3M0LA 1XLIA 2FKPA 3MY9A 5BWFA 3KL5A 3R89A 4BF7A 6ENLA 1JDCA 1Q7MA 4ZB2A 2EXOA 3C5QA 3F4VA 4M51A 5D2WA 2WK2A 1AL7A 4TMBA 4GXWA 3MV11 3O07A 1G94A 3VUSA 4J9JA 3R11A 3FEQA 1XIEA 1BXBA 3WFLA 1E6ZA 1PKMA 1IHIA 3WDJA 3OQ8A 1ZAIA 1GQJA 3QTGA 3CGTA 4H41A 3GR7A 1ML1A 4KH2A 3TN3A 4MMWA 4O10A 4HMNA 3C61A 3MDWA 1YNYA 3A9BA 2VFGA 3SSZA 3ZJ7A 4M6QA 4QS5A 1R5YA 3OVGA 5DT5A 1V77A 2G96A 3PTMA 3SB0A 4NJGA 4DB7A 3T42A 3AXMA 1UMLA 3M5VA 3PK7A 4BF5A 1Y5VA 4W8AA 2CEQA 2CZVA 1LL4A 1J79A 1LRTA 4H1ZA 4HNUA 1BRLA 3EX2A 2B0MA 3KLLA 4JN6A 3TMQA 5M03A 4JNMA 2YLAA 3TLQA 3XIMA 1DJXA 4H7CA 2ZX5A 2FFIA 4GCAA 4HHLA 3ONBA 2WM1A 2D2OA 1YNQA 3Q37A 3NZPA 2NV2A 2I16A 2H3DA 4PULA 4DJDC 1EF2A 3TFCA 2C1IA 3NQMA 3GZAA 1BYBA 4PMQA 4C6KA 4I5UA 1OG6A 3DZ1A 3PSWA 4WKHA 3P8JA 1EXPA 3R8GA 4ZTXA 3XISA 3S47A 3C8NA 3GB6A 4KERA 1O66A 2R24A 1K7FA 1R2TA 4ZFCA 2ZVIA 2OGYA 2JBMA 3CAWA 3CZ8A 1MYRA 4O13A 1UC4A 4U4MA 3PPFA 5LHEA 4N7QA 3PBGA 3K30A 4YTSA 3CO8A 5DMNA 5DX7A 3AJ7A 4HGXA 3N6HA 1YTDA 1SZRA 1UWSA 3QC3A 4W88A 4WOZA 2BGSA 4N9CA 2BNJA 1QCWA 4LCQA 2PUZA 1QK0A 2YPIA 4ILSA 2XH0A 4S3BA 2E1DA 4LXFA 4L61A 3SCSA 1QASA 4KMQA 3IJ7A 5C9WA 3RR1A 5AYYA 2R1PA 3R7MA 4IMFA 3FSTA 2ZXDA 1KBBA 1RLDA 2R14A 1D7FA 3HV8A 5D8WA 3KAOA 4H6KA 4YTRA 2GK1A 4AY7A 1QOQA 1DQXA 3NQ7A 4CD6A 4HPXA 3GXNA 1F4AA 3GXMA 4LYKA 2ACRA 4I7VA 1H5YA 3WQ5A 3PBYA 3WENA 5E1QA 3A21A 4A2RA 1D8WA 4PMUA 2ZRXA 2AL2B 3H12A 3JZUA 4JNYA 2EG8A 1DWGM 2VEGA 1JCMP 1XLFA 3URQA 3BLDA 3S5NA 1CCWB 1ZCCA 2E25A 1R3RA 1GTHA 1Q13A 3F7JA 3VOJA 2FLIA 3AYRA 4HNNA 1O5XA 4PMDA 1E55A 4YIWA 3H7UA 1WKEA 4GK8A 1FWNA 5IRPA 3PB0A 3QGVA 1XYMA 2WCGA 2XIOA 4IWWA 4XVEA 4JX6A 4GUIA 5D8ZA 4IIFA 5U7SA 1VC4A 5AECA 4KT2A 4HZ6A 1HVXA 1Z41A 1NWSA 2PWEA 2QZRA 2ZX8A 4L6HA 2UZ9A 3A9IA 3F4CA 5FF3A 1LQ2A 4DJEC 4R7WA 1L2UA 1UUOA 2BTMA 4JS3A 9XIAA 3LCWA 1UR1A 3SEPA 2FZMA 4ATLA 3FW6A 1UA3A 4C6BA 2ADAA 4B3KA 1EZ2A 3VZXA 4OBSA 4ENLA 2YYUA 1JAKA 2YXGA 4IUGA 2VQTA 1S5TA 1ESWA 2ALRA 1A5SA 3GTXA 3C6CA 1ZL1A 1LG1A 4WXZA 4IICA 3HB9A 1MUCA 2YFOA 1QI5A 1KLZA 4Y7EA 1CT5A 4ATWA 4A3YA 1DQWA 3MUAA 3LBMA 3G3DA 5BMXA 3ABZA 5FEXA 1AD1A 1UIPA 2XVNA 2OX4A 2QIIA 4TUFA 4P7OA 2DZSA 3OLDA 2OYMA 4Q8VA 4Q6XA 3UR2A 3N9KA 2DH3A 4IPIA 5BMWA 3UG8A 3TQKA 1HJXA 2J27A 5I09A 2WZHA 3G24A 5IDZA 2E6FA 4NL1A 1OIMA 3KE0A 1CX9A 3T6CA 4XZIA 1E1CA 3W7PA 1E9YB 2XFFA 3W29A 5DXYA 6TIMA 3HGOA 1VBGA 1FA2A 1W56A 3W00A 4L1WA 4YCPA 1NOWA 1T0OA 1I2QA 1GJUA 4UCGA 3MV01 5I7GA 4AZBA 3G1XA 4N2YA 1W9UA 4IHCA 2F84A 3C2FA 1SJCA 1WKFA 4LVDA 2Y8UA 1ZPTA 5TNVA 3RITA 3QRHA 1XG3A 3MWAA 4IG2B 1QNVA 3EOUA 1J96A 5F2IA 3QPYA 5FL1A 3WQ6A 3QJAA 3M5YA 3DFSA 4YWSA 4NZ5A 3OP2A 4Q8PA 4W86A 3F4DA 4GE8A 1V4YA 4W7UA 2XH2A 3OVPA 4S1FA 3CZKA 5BWAA 4XZMX 2X8RA 1O68A 2TODA 3S5ZA 2PTWA 4OGZA 2HPMA 3M0IA 5LXXA 1PWMA 4P7RA 3E6EA 2PDIA 3IGXA 1F4HA 1F73A 2OEMA 3AZTA 1SW3A 4TX8A 3TTYA 2NQJA 1XP3A 1K6AA 4GVGA 4DZ5A 1MNZA 2Q8XA 4Q6JA 1S2UA 4FNUA 5HR6A 4LSBA 3RM4A 5FAGA 4YN5A 3QKEA 3TKFA 3HTWA 2YDRA 1IXQA 3JR2A 1E6SM 1NFPA 2BV9A 4Q22A 4S23A 2GLKA 4MFDA 3VD3A 2C0HA 3NZGA 4EPDC 2P0OA 1P7TA 3T7VA 2PLKA 1WUFA 5DRIA 1VLIA 4W7VA 2WHKA 3WK1A 3P0WA 2E68A 4JEQA 4HYWA 1J11A 4IMCA 3FHAA 3AXIA 3UFYA 4E2VA 3VXGA 1LLZA 2ZE3A 2YW4A 1V6UA 2W3ZA 3CEPA 1NFGA 4E0CA 2INZA 4QLJA 4IQLA 4L4OA 2Z1WA 1O5QA 2PZNA 2J7DA 3EX6A 3TA9A 1JI1A 3VILA 1JPDX 2W4XA 4NJKA 3LHUA 4GO8A 1FWEC 4YTQA 1SVDA 3M0YA 2EPNA 4IP5A 1GT8A 3GH4A 1MRQA 4IFKB 1WO2A 3GVRA 3BAKA 4JXCA 3NEHA 2JEQA 4JTKA 1KCXA 3ZJ8A 2FHBA 5FESA 1SYTA 2OEJA 5DFAA 3CV2A 1OFRA 4MGGA 3THCA 2C1GA 2FPVA 3SCUA 3OZMA 3NOYA 1C3FA 3RCYA 4JY9A 1X98A 3V1HA 1E51A 1PDYA 5AZ1A 2GQ3A 3XINA 1BPLB 2ZRYA 5C9RA 4OVXA 1QI3A 3DBPA 3HQOA 1F8IA 2FDSA 5HWMA 2GL5A 3L4WA 2G8ZA 4XQ6A 4E4PA 3JRKA 4AWSA 4E8CA 3W1PA 4DHGA 1FOBA 5LNVA 2R82A 1CWYA 5HQEA 1TTIA 3J7HA 3GNNA 2QULA 2PGEA 4Z2KA 4JQAA 3S4TA 3WJYA 1XBZA 5GNXA 1EC7A 3UWWA 3EX1A 3WF2A 3UQNA 3VA8A 2VFIA 3PTDA 4BWLA 4FIQA 4LV4A 6REQA 2DU2A 1KB3A 5I3DA 1VEPA 2AKZA 7A3HA 4M56A 5LYRA 2F9RA 3I7QA 5K4ZA 5I02A 3KX6A 3TQ0A 3HPFA 2PDGA 2VYOA 1GEHA 2V2CA 4M81A 1TJ2A 4QSFA 2XJ7A 4QCFA 4Z08A 3CV6A 2VZVA 2I5GA 1W1ZA 4P5UA 5CSSA 3N3TA 3B97A 3GX9A 1DXFA 3V5OA 3CHFA 4AYGA 2ZZ7A 1QWGA 4ACZB 1QTWA 2QDEA 4AEEA 5CG7A 1X96A 4EANA 2XVPA 5AYIA 4B92A 1LWJA 3KOZA 4IFRA 1FWIC 3ARUA 4IIHA 1D3CA 4UMCA 2CETA 3P60A 1QATA 3E0WA 4F8XA 4C6NA 1CI1A 1EDGA 1AZ1A 5A6BD 2EHHA 3CL8A 3GWQA 4GNKB 3I6EA 1L9WA 4BF9A 4N9DA 4RNHA 4FZIA 3IVTA 1JD7A 1DWHM 1W3JA 1VFFA 2GSEA 5FOOA 2DZAA 4M6PA 4MJZA 1VBRA 4WLCA 1X8CA 3CMFA 3GTFA 1K8ZA 3E0FA 4A22A 1TIMA 2FZBA 3SRHA 1JVNA 1PKYA 4KCWA 4P2VA 2Q8ZA 1PX8A 3C3UA 3LCHA 4R27A 4TXEA 3PWGA 2G37A 1YX1A 1UD5A 3H2EA 3KZSA 4WK9A 5PTDA 5JBEA 2BWGA 1WV2A 3O0FA 2CCRA 4EP8C 1ZB5A 3DHDA 2Y6ZA 3CXOA 4XUGA 3ELFA 4I5XA 5A6BA 2GSHA 1XGEA 1XI3A 4LC8A 4XIAA 5I6SA 2O9RA 1I0DA 3BLIA 5LIWX 4DO6A 5FI8A 2X40A 2VJXA 3CUFA 4IT1A 1J9YA 3FGCA 2YCEA 3STGA 1UWAA 1T99A 1GYNA 1XYBA 2VTFA 3ZQ9A 1AQHA 1R3YA 1JZ5A 3KL3A 4C5YA 4DRSA 2HNHA 1JNDA 3NA8A 2C15A 4YYCA 3AHXA 3R25A 1TIWA 2Y62A 3NM1A 4R5EA 1KGXA 5GVJA 3AXKA 1OQFA 1R47A 1Q66A 3ALGA 4QR6A 2OU4A 2C7FA 2AQVA 3M0MA 1UWRA 1MW1A 1A47A 2WSQA 3NL2A 4A8LA 4GI6A 2PEVA 3BLKA 2DH2A 4JQ3A 4UQ9A 4ZO7A 4JTAA 4NVTA 3PUGA 3NL5A 4HPHA 3N17A 3II1A 1CGUA 1EGMA 1NWTA 3HQ1A 4IJCA 3A3HA 1M41A 1EA9C 4JZ5A 5HMEA 3BAJA 2NQHA 3ICJA 2QCLA 4WR3A 3V36A 2VDIA 2ZVRA 4IIBA 1BGGA 2HJPA 5REQA 2Y5EA 5AC5A 2V2DA 2GVYA 3TSDA 2Y0FA 5F2LA 4CNPA 7REQA 1SMAA 1EC9A 2Y7DA 2CITA 3AICA 2ABBA 4MM1A 1F7BA 3IJLA 3MS8A 3S2NA 3TYAA 3ZSTA 1CXIA 3QSRA 3WMSA 3WH7A 4GJJA 1IEQA 3TV8A 1E3ZA 1HXJA 4GH3A 2PGFA 3FOKA 5I2UA 1FWHC 3ITOA 4LVFA 2PF8A 3F2CA 3NURA 4DY1A 1YBQA 5LXEA 3CQ0A 3TNOA 4LUTA 4TV5A 3L65A 1S2TA 2CZEA 3SUUA 2OGJA 3VKAA 4UFJA 3EZ4A 1EWEA 1TQXA 3GIPA 5J04A 4DBSA 3UJ2A 4WY0B 1T8QA 1VLWA 2QCCA 2QMJA 4QITA 2DJXA 4ALDA 1GKPA 3VOGA 3ZR6A 4KW2A 1Z32X 4I6VA 3C0JA 4ORMA 4FXSA 4PCSA 4PCFA 4PCPA 1GQNA 2JIEA 4XAZA 1EQPA 1YDVA 3VDHA 1HG3A 2YL9A 4XAGA 5CZ0A 4OU1A 1XJBA 3N2BA 5FL0A 2Z2AA 5BU9A 1FY6A 1SFSA 2OLSA 3BWWA 1JCNA 1KR1A 1EA0A 3ECQA 1XPYA 5A8OA 1KCLA 2DVUA 1VQTA 4R85A 1V3KA 5D03A 2NSOA 3B8IA 2CFFA 4M82A 1FWSA 3UGRA 3SBFA 3T55A 3S2CA 1TV2A 3BW3A 1EC8A 3N2CA 2PDMA 3CO4A 3QYQA 4GLEA 4Q7BA 3GXFA 4BI7A 1JDFA 3UJRA 2WZIA 5G1MA 1G7UA 3MBFA 4DLFA 3R13A 2G3FA 1XD0A 2ZICA 1GZ1A 1CYGA 3NPUA 3FJLA 2V5BA 1ZAJA 1GZGA 5C0QA 3SGGA 2R94A 2BP1A 4BA0A 4AVFA 4K8HA 3FJ4A 3B05A 4Q33A 4MKSA 4FR6A 3E38A 3BAWA 4Y6GA 3GXDA 3MUCA 5HA7A 3P2VA 4Q8QA 2BASA 2C1HA 1V3IA 3O6AA 1S2AA 4HTBA 4B5VA 1R9XA 3LBCA 3ES8A 1TPH1 5I00A 3VIKA 4PMYA 1E5NA 4XZ9A 5CC3A 4GX8A 3WJWA 5LGZA 4WZHA 4WIWA 4YNGA 3R1ZA 3C4UA 4W93A 1E9ZB 3NEVA 2OPJA 3R12A 2V5KA 1EJUC 4LW7A 3N18A 1WAWA 4GQBA 1JJKA 4Z2GA 3UWUA 3MBDA 3G1YA 4JL2A 3UYIA 4DJDD 3LTSA 1WBJA 2P3ZA 4FAMA 3OLEA 3A6OA 2F6XA 2E67A 2J66A 2EQDA 1VKFA 3OB8A 2JALA 1TUFA 1MI3A 3S2LA 1JCYA 2V30A 2Y8VA 2HISA 1RBLA 4IPLA 5KZDA 1TR9A 2PC4A 3EKGA 3EBVA 1Z89A 3QV9A 3TW9A 4ADUA 4LYRA 4UFKA 5A6TC 3IANA 2GYIA 4P7LA 4FOUA 4AH7A 1MFVA 2WZTA 1A5MC 1OD8A 1VHNA 3S1WA 4X63A 1WAUA 3QYSA 1C7TA 1A5CA 1MEHA 3T8LA 3LPFA 3WLTA 1LDCA 1KCZA 4DJDA 1PDZA 2NLYA 2VRJA 5AHMA 1REQB 1WXZA 3N4EA 2XH4A 1FCQA 3WMLA 3EWUA 2DZUA 1O6IA 1OG0A 3OODA 4H7VA 1EGZA 1MZRA 4C6CA 5C2XA 3T07A 5IBXC 4IPNB 3B3DA 3GHRA 3WELA 2YZRA 3TLLA 2OQYA 3SGZA 3VU2A 5K7JA 1NF7A 1A50A 4J3XA 1S2VA 4PR4A 5I0DA 2W62A 3IJIA 3R43A 3BARA 5HAOA 4K1WA 1LP6A 2XDFA 2V38A 4GMEA 1EWDA 2X0SA 3TYCA 3VDBA 3KDOA 2VELA 1E6NA 4BHYA 3VIIA 3CL6A 3SI9A 4O0KA 3NQFA 1FFRA 5JH2A 1OJXA 3NXLA 4ROQA 1OX4A 4BK9A 3U57A 1C8YA 1X1ZA 1XLJA 4O16A 3UXLA 3CZGA 2VC9A 2YKKA 1BSLA 2VX4A 1DWAM 4EKJA 5E6YA 1P0DA 5FJIA 1NF0A 1GGOA 1PAMA 3SRFA 3I7RA 3TTEA 2Z6IA 4IJRA 2Y63A 2HVNA 3CPGA 4H8UA 3KDNA 1R30A 1TJRA 3GNXA 2ZXAA 1IZJA 4UTUA 4B5NA 2ZC1A 3F4NA 1H7PA 4DJED 3MPGA 4YXGA 1ZP3A 3VFCA 3GHSA 4RDYA 4PSPA 3ZMRA 1MWOA 1XQKA 1DJNA 4J27A 1NTHA 1MNSA 4K38A 4BR1A 3WJZA 2GUBA 3NL6A 2VFHA 4NZFA 4CN4A 2EBNA 2RDWA 1TPVA 3GH5A 3W6LA 4QNEA 3FVDA 2RDXA 1LL6A 4GFIA 4EE9A 4JKMA 4CEUC 4UR7A 1KRBC 4TU1A 2QVHA 1OHLA 1H7WA 4UCFA 3TR9A 4LEFA 3SURA 3IAPA 3ZVHA 2FB3A 2IKGA 4RXFA 2TMDA 2DT0A 4DJEA 2FQIA 4HCDA 3GXTA 4F2TA 1FWAC 3PBVA 3WF4A 3UW6A 3HGSA 1BG4A 3H2CA 1VFSA 1I6NA 1ALDA 3OOQA 4S39A 1OFEA 3G1SA 1W3TA 1H4PA 2D2HA 3V3WA 1QJWA 2DQWA 1ISYA 1A3HA 2E3ZA 1EJTC 3HGRA 4I6KA 1KQZA 1XG4A 2Z1XA 1XPGA 3WJSA 1FH9A 1FFQA 3B06A 3CM4A 1TVLA 2DJLA 1EOKA 1JPKA 1HIZA 2B7QA 4K36A 4O53A 1KWKA 2ZA1A 3UPMA 1FP9A 5C7HA 4AHQA 4JIIX 3WMCA 4O4VA 1ISXA 1SR9A 3BGGA 4JX4A 2J77A 2Z1KA 1F05A 1UOKA 2QPXA 2IXVA 3GVVA 2ZDSA 5MF5A 3I3DA 3WK3A 2PF0A 4C6QA 5FAJA 7ENLA 1BFNA 1JGMA 4QDWA 4GNJA 2I5QA 1K9DA 1VYRA 5RUBA 1DVJA 1CGTA 1C8XA 3CUIA 2RUSA 4C65A 2ISDA 4B4FA 4HOZA 1H1YA 2XVLA 1RXOB 3LV6A 1T6MA 1DOSA 2DQXA 4XIMA 3A24A 4I9AA 5J8LA 4GGHA 2J7GA 3UD6A 4KIRA 3LNPA 1AJ2A 4H9VA 3D5HA 4KCTA 1R3SA 1VF8A 4Y2WA 3NGJA 3RUBL 3G8EA 4QTGA 4H6EA 1OGGA 1UMYA 3P3BA 1EX1A 3WO8A 3IJ8A 4D72A 3WUFA 1UKPA 3KOWA 4QIUA 1J8VA 2ZTJA 4Z2JA 3M44A 3VNLA 3UJEA 3I3EA 1UB3A 3VAVA 1HJWA 5ABTA 2XU2A 3GUGA 5LNSA 3S46A 1F6PA 3D46A 1LRNA 3W1RA 2WC7A 4PUKA 1V93A 4WJEA 1VCVA 4AU0A 4HPGA 1XISA 3RCNA 4J2PA 1F61A 3MYOA 3VIFA 4B9ZA 1UKOA 6ALDA 1Q6LA 4H9XA 1B57A 1UD6A 5DLCA 3W2MA 2UBPC 5E9XA 2JF7A 1FWJC 5XINA 4GXPA 2WJEA 5EKYA 1I0BA 2F6UA 4MB4A 1GVEA 1RVKA 1UASA 3W7EA 1LJYA 4IZGA 1UHVA 2I5IA 1JXJA 4LB4A 3D3AA 3NYDA 1I2PA 2CLLA 5AC7A 1N7KA 3BTNA 1X1OA 4O18A 1GG0A 4UTTC 1POJA 1HTIA 2Q71A 1FWGC 1E6PA 1EEPA 2NXGA 3QOKA 3O8AA 5CZSA 1PUDA 3TVAA 1HKWA 4G7EA 3FIGA 1XW8A 3QR0A 2JEPA 2CLHA 4O8RA 1F3XA 3N73A 3FDKA 4GD0A 2YBTA 3K8LA 3MDUA 4ICMA 3P67A 1YNPA 3CB8A 2WXDM 2CLPA 2WQDA 1CXEA 2XSAA 3TDFA 2OLHA 1FQ0A 3CTLA 4PTNA 4O17A 2ACSA 2G3JA 4IP7A 4IXHA 1RCQA 2CBIA 5DO8A 2V63A 1PZ3A 4J28A 2FGBA 1AL8A 2YA1A 1QNQA 3GAKA 4CUCA 1OIFA 1FUYA 1C91A 1BQCA 1Q4NX 1GVRA 1YXYA 2XFRA 2ZA3A 4L4MA 4MLRA 4JYEA 3BG5A 3VINA 3PG9A 1H41A 1XGZA 7TAAA 3AZSA 1RPKA 3DG6A 1LUCB 4GC3A 1ZLPA 3ZJKA 3NYZA 4MB3A 2VGIA 4DN1A 4EIVA 1HUVA 3KBVA 2NT0A 3KOXA 1EJXC 1M68A 4TVUA 4OKDA 3F1QA 4GZEA 1K9TA 1MW0A 2OX1A 4NRRA 1ITXA 1KFEA 3EX3A 1M7JA 3WQ8A 4CQCA 4MWAE 1BWVA 3TIMA 3UBPC 5ECVA 5I3FA 1BF2A 3KRZA 3SIMA 1A3WA 2W5FA 1U5VA 1JYWA 1EHNA 2V6AA 1JZ6A 5LHFA 2OFJA 4B2DD 1LT8A 4PTWA 4NNBA 4PE8A 2WWCA 1W3NA 3RO6A 5F1UA 3M0VA 5JQ9A 1EGVA 5I03A 4GQ0A 3D47A 3IGSA 4LQ1A 2NQ9A 4GA8A 3TN5A 1P0BA 2A4AA 4B16A 4JIPA 4PL1A 3BAYA 4IMAA 4J5NA 4WX2A 2ATSA 2XIJA 3REQA 4AY1A 1TPWA 4W7WA 1S46A 2Q3OA 4PUNA 3L4XA 1B3YA 5EPDA 2ISSA 2OG9A 3CYJA 2QNEA 1W31A 2XN0A 3W7KA 4MDPA 3COTA 4H6RA 2NUXA 1EFZA 5CXPA 5E70A 1FTXA 1WZMA 5KITA 1DKWA 4WRHA 3Q4DA 2WNWA 3B0UX 5HNNA 4LUSA 3RN6A 1KNWA 1W8SA 3N4AA 4PC8A 1C8QA 1W5QA 3LQGA 8A3HA 3A3WA 3WNKA 3BLEA 1OCJA 3U7VA 2MNRA 4HNCA 3NZRA 4PFMA 4HCHA 4UMBA 1XRFA 1ADOA 4QLLA 1GOXA 1P0NA 1EPVA 1QPNA 1EKOA 4E5TA 4D8AA 1OFBA 2WMJA 3GQYA 3UJFA 1JULA 2H8ZA 1TPFA 1L8PA 4IL0A 3P8IA 3WF0A 1XDMA 4FA3A 1IR1A 1JUBA 4AD1A 1AZ2A 3L0NA 3WQOA 3APYA 4GI4A 5K9DA 1HL9A 1P48A 5XIMA 1BD0A 5HDRA 1P6BA 5G4WA 2VP8A 4N02A 3TZFA 4C60A 2DUAA 5ABGA 3WLNA 2Z26A 3R6IA 2YR1A 1T8XA 3BC9A 4NAEB 3LEPA 3KVMA 1PX4A 1CZ1A 3VNJA 2QPSA 3W71A 3F5KA 4KFOA 3M16A 4C7DA 4AIOA 1EDQA 4J7RA 3P5YA 1H62A 1XIBA 2TSYA 4GYPC 4BS0A 1IV8A 4E4UA 4R3UA 2VZUA 4IH3A 4US5D 3W53A 2F2KA 5D4YA 5A69A 1A5NC 4RZ5A 3WK2A 1NELA 3NAVA 1V6YA 5A8GA 1KM0A 2TYSA 3QXBA 1KM6A 2I7GA 1HP4A 3IUIA 1C9DA 1JYNA 3V0TA 3UG5A 3ZT6A 3SN4A 4LWWA 3EEGA 5M17A 4B91A 3POHA 2DVTA 2X7VA 1E4NA 1E72M 1XC4A 2VXNA 1HT6A 4LANA 1G4SA 3EWZA 5FJRA 2OCZA 6A3HA 2J8FA 5K4XA 4CQAA 1L2QA 3OBKA 4JNZA 4ZE4A 4GVHA 2Z6JA 3ARTA 3ARXA 1KD0A 2ZX6A 2D73A 3LHWA 4HQVA 4US5A 4Z2LA 1GW9A 3E2RA 4I90A 2Y7EA 1BYCA 4L6OA 3TROA 3LSCA 4M0XA 4QROA 1X39A 1YMYA 2WJDA 4JPGA 5BRPA 4ZXLA 1B3OA 1GUVA 1RJPA 1S2CA 3HO8A 4AHPA 3UXDA 3VCRA 2DVXA 4Q4MA 4L1XA 3PUEA 4DZAA 2A7RA 2EPLX 4JAWA 1RR2A 3WG6A 1EOMA 1W54A 2VR2A 1UWTA 1AUSL 3UP8A 3KS6A 4D71A 4GIAA 4KPLA 3L0GA 1G0CA 4JTEA 1B9BA 3TCEA 3P6LA 3GIQA 1CB2A 4IQEA 4JTGA 4WKAA 1BTCA 3MSYA 2MUCA 2GJXA 3EWCA 2VC7A 3GVQA 4RUBA 2VMFA 3VGFA 1CXLA 3EOLA 4O1CA 1EDTA 1FX6A 4I7UA 3MUXA 1I8JA 4S3AA 4HNOA 4PL2A 2D20A 5EA9A 3UT0A 1PTDA 3NPWA 2HWGA 2OOGA 1E43A 1AQMA 2WMHA 2A3CA 2HTMA 3FSUA 3VNIA 4Q4KA 4QJ3B 3VKJA 2BY0A 3TOYA 2RGMA 4FR1A 4XBSA 1QOPA 3TJIA 4QP0A 4DO7A 1RA0A 5DBTA 4RW3A 1T40A 4P61A 1H7NA 3BOLA 1E0TA 4IM4A 2PTDA 2BOFX 4YS1A 1IR2A 1BVZA 1VFOA 4RR4A 5CBBA 2QCDB 2QAPA 3L0KA 3WDIA 1SZFA 1J4EA 1QO5A 3O05A 1ENUA 2P5NA 4LAUA 4GACA 1W5NA 3TEVA 3K1DA 1LLWA 2PDUA 1YADA 4AHOA 1D9EA 1W3IA 2DT1A 3VKBA 5CG0A 1VGAA 2G41A 4ACYA 1QW7A 1C92A 3H2AA 6TAAA 4J2MA 1GORA 3QQ0A 4PUMA 3D3FA 3DI1A 1S5MA 3QLDA 2OJPA 2PURA 3MHUA 1BSIA 3NVDA 3O6YX 3FYYA 1TRDA 1OVDA 4AIEA 4TVDA 3THQA 1KA9F 3STFA 1F74A 1BLIA 4W8BA 3KCOA 3H53A 3UYCA 1XR2A 3LS9A 3B9NA 3QLLA 4OZOA 4GINA 3O9NA 4M8UA 3KM8A 2Q01A 1W32A 3ABRA 4OUEA 3W7IA 4IIGA 3R0DA 1VCFA 2PDHA 1UP3A 3I6RA 4GUGA 3B9OA 3MMTA 3QGAC 4J3WA 1B9ZA 1KV8A 1I1WA 3GZ3A 1LQAA 4Q8MA 4U2ZA 4PCTA 4BZYA 5AHFA 2H3BA 5T91A 1NDVA 5LIKX 5FCZA 4INFA 2ODOA 3MVTA 3GU2A 2FZDA 4M1RA 4IX2A 4PTXA 1TVPA 2L5HA 3W25A 3ITGA 3KTCA 1VBUA 1TX0A 2CHNA 5I3IA 3OVQA 4ZSUA 4Y8FA 3LHVA 1TG7A 1ONEA 1KFWA 4H9MA 5F4SA 2WVVB 3M46A 2O7QA 1N8WA 4M24A 4UTJA 2PTYA 1K8CA 1EO7A 1AFSA 3LLXA 2OLAA 2F38A 5B80A 2XTKA 4LAMA 4MYXA 1BXCA 2PWUA 3AIBA 1KCKA 2YB1A 3DHUA 3IUDA 4YVVA 3WQFA 3AALA 4KRUA 3MKKA 2A6LA 3UR5A 2YZ5A 5DQPA 2ZX9A 1ODZA 2C3ZA 3ARRA 2GOKA 4EXAA 5LIUX 1I75A 5CC5A 1KR0A 2GVEA 4ZTYA 5K2ZA 3PP7A 3B03A 5BOOA 3LQLA 4ZB0A 3SO7A 4F48A 3RU8X 4F4RA 3VK5A 1GNXA 4OHQA 1U1HA 2C79A 2INFA 2DZVA 3SN1A 3P5ZA 2XH7A 4AZCA 3WLIA 2Z27A 1FWTA 3K2GA 3URNA 2BHZA 1FHLA 4XKYB 1TA3B 4KGLA 3TWBA 3EA3A 5HR7A 2WC3A 3R2GA 2H9AB 1OCQA 2BFGA 4RZ4A 3SFWA 2CWNA 2NLIA 2PRHA 3UNTA 3P81A 3LXAA 2YDSA 2PZ0A 3KTXA 3UWVA 3OHMB 1JR1A 1SO6A 1UQYA 3B9EA 1HJQA 1KXVA 1UG6A 2NT1A 2VT0A 3K4WA 1OEPA 2GGJA 3V7PA 3V0UA 5FKYA 2PAJA 3KCLA 4UTKA 4IGHA 3OG3A 1W5MA 2VUNA 1XDJA 2YA2A 2Q3RA 2PSNA 4WVXA 3W81A 3MSDA 3RXZA 1YKWA 1A5LC 2WMIA 1ZAHA 4IQDA 1XYLA 3ZS4A 4S38A 3W70A 2OT0A 1UC5A 4ERGA 4XWUA 3S3GA 2DP3A 4IFOA 1R7AA 4DUXA 2VD8A 4JCMA 5AHIA 2VX7A 1K77A 4JDYA 3UXAA 3T8QA 3PTKA 1U1JA 1Z42A 3NM3A 2BVDA 3W07A 5E0FA 2DY3A 1V79A 3VKCA 2H6RA 2J6XA 5FSDC 2LLEA 1JD9A 3GYEA 2X0HA 3CTTA 4LS1A 4O57A 1E9IA 4CCZA 5BOEA 3QW3A 2FTYA 4YCOA 3QPEA 1Q6OA 5FJOA 4MSSA 3WNLA 4FF5A 4PSRA 1UWUA 2GQAA 2E6AA 5CBIA 3DUGA 1PVNA 1R6WA 4TX9A 3AC0A 3Q65A 5CAKA 3QN3A 1KM2A 1XL9A 3IK4A 3ATYA 3BZGA 5CLWA 1GOWA 1XLDA 1HN1A 4Q4QA 3L4VA 5GJMA 4LUJA 4HSNA 3A22A 3KP0A 1UW9A 1OT1A 5EL1A 3VX1A 4V28A 4DWSB 4P7QA 2E6YA 4B5TA 3ZZ1A 1EP1A 1AQ0A 4CVWA 2HEJA 1CGVA 4MADA 2HVMA 4LRSA 1KFCA 1EIXA 4O1BA 4FNSA 3PWAA 1FHVA 2C0AA 5HJYA 1SJDA 1IEWA 5ABHA 1KKRA 2BSLA 4HTYA