1UROA

Uroporphyrinogen decarboxylase
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
357
structure length
357
Chain Sequence
GFPELKNDTFLRAAWGEETDYTPVWCMRQAGRYLPEFRETRAAQDFFSTCRSPEACCELTLQPLRRFPLDAAIIFSDILVVPQALGMEVTMVPGKGPSFPEPLREEQDLERLRDPEVVASELGYVFQAITLTRQRLAGRVPLIGFAGAPWTLMTYMVEGGGSSTMAQAKRWLYQRPQASHQLLRILTDALVPYLVGQVVAGAQALQLFESHAGHLGPQLFNKFALPYIRDVAKQVKARLREAGLAPVPMIIFAKDGHFALEELAQAGYEVVGLDWTVAPKKARECVGKTVTLQGNLDPCALYASEEEIGQLVKQMLDDFGPHRYIANLGHGLYPDMDPEHVGAFVDAVHKHSRLLRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords PROTEIN (UROPORPHYRINOGEN DECARBOXYLASE)
publication title Crystal structure of human uroporphyrinogen decarboxylase.
pubmed doi rcsb
source organism Homo sapiens
total genus 129
structure length 357
sequence length 357
ec nomenclature ec 4.1.1.37: Uroporphyrinogen decarboxylase.
pdb deposition date 1998-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01208 URO-D Uroporphyrinogen decarboxylase (URO-D)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.210 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 1uroA00
2Q71A 3GVVA 4L61A 3T0CA 3GW0A 4ZR8A 2EJAA 3PPHA 3GW3A 1XPGA 4L65A 4AY8A 3BQ6A 2NQ5A 2Q6ZA 1R3VA 4QQUA 3L7RA 3PPCA 2INFA 3GVRA 4AY7A 1U1JA 4ZTYA 1R3RA 1R3WA 3GVQA 3GVWA 4L6OA 1JPHA 1YPXA 3PPFA 4EXQA 4L64A 1UROA 4ZTXA 1JPKA 1U22A 4L5ZA 3BQ5A 1J93A 1U1UA 1XDJA 1U1HA 3RPDA 1T7LA 1R3YA 3CYVA 3PPGA 1JPIA 1XR2A 1R3QA 1R3SA 4L6HA 4WSHA 1R3TA
chains in the Genus database with same CATH superfamily
2QF7A 2PSNA 3GYCA 4AIEA 3EX1A 4HHLA 3P74A 2WV8A 2W6RA 1KWKA 5CG0A 1TJ0A 4Z08A 2AMXA 2IMRA 2ZZ2A 3AI0A 2PDPA 2WNQA 4KS0A 4G6CA 5I7GA 5DFAA 5H8MA 1O7AA 3LCXA 1UPMB 4Y90A 3LCWA 4W5UA 3MMDA 2E5CA 1WP6A 3RU6A 2QDHA 1F4AA 1NSJA 4L1WA 2NSXA 3UESA 1E70M 1LF1A 3UERA 4CQ9A 1UBSA 2FGLA 1EEXA 3EKZA 1YPFA 1IZJA 2V5LA 3G22A 3FAWA 2AGTA 5DBUA 2I14A 3OYZA 4DJFD 1I2RA 4B2DD 2QVHA 1C8QA 3D6NA 5E1QA 3CHEA 4PL1A 3LCIA 4JDBA 3T2OA 3DG6A 2HZGA 1B57A 4MWAA 6TIMA 4YCPA 2ZRZA 2OTDA 1XJBA 4ZVJA 3EB2A 1N8IA 4Q6XA 3TCSA 4J27A 3SECA 1DORA 5IFTA 1UC5A 3S6TA 2C13A 3ZR4A 4ONVA 1EEPA 3OBKA 1F61A 5J04A 3VGDA 4V28A 1ZZMA 3PBVA 3MJYA 2Q09A 1JAEA 1ICSA 4I9AA 4AZCB 2BXVA 1G94A 2QF8A 1CGUA 1I2OA 5E5CA 3U2CA 4CCDA 4UTTC 1OFBA 4KKXA 1KO0A 3M5YA 1GORA 3HGOA 1ZBCA 4PULA 2VZSA 2QQ6A 5H6HA 1YKWA 1GTEA 4KESA 1F3XA 1NP0A 4AZ5A 3NO3A 1R5YA 3GHUA 1PS9A 4PMXA 1GK8A 4DUXA 1BKHA 3M46A 2XH0A 2X16A 1XBXA 1UKQA 3TYDA 1RQBA 1W1YA 4AEEA 4HSHA 3JZUA 3KHJA 5FACA 3E0WA 3EAUA 3BXWA 2OLSA 5FJTA 4BHYA 2WZTA 3EX2A 3BQ5A 4J3UA 4PCFA 1D8CA 2RAGA 1M68A 2NX9A 3SURA 3RU8X 3P67A 2OEKA 3IK2A 4J2PA 5BXRA 4C6NA 1L6YA 3OGSA 3IK4A 3RILA 2F7FA 1RCXB 4W8LA 4BF9A 1AMYA 2GZXA 5HR6A 1PSCA 1GOXA 1SO3A 4D8LA 3QW4B 3H55A 1SW0A 4R34A 2VDGA 4UQDA 1YXCA 5C5YA 3WD2A 4GKTA 3WD4A 1R0MA 4GX8A 2HBXA 1KBBA 1XF0A 4PEKA 5F2LA 2J7DA 1E1CA 3UW6A 1Q66A 4OWGA 4A3UA 1TB3A 2YXXA 3SJNA 3UCCA 1UZ4A 3WCZA 1K3UA 1SFJA 1GKQA 5HMEA 2GSHA 1LG2A 1XWYA 2Y63A 4QG6A 1FWIC 1US3A 4KPLA 2INEA 3ARYA 3L4TA 3T7VA 1Q4NX 1RBLA 2ZDRA 3EWWA 5HMFA 4F0SA 1TVLA 3PJTA 2PF8A 3SI9A 1YE4A 4KEMA 3QOKA 2OYMA 3VKAA 4JPGA 1KLYA 1XFBA 2PMQA 4S23A 2ZRVA 3A6OA 1OJXA 4WQ6A 4AZGA 3ZMRA 4GNVA 3ITTA 2QPXA 2Q8XA 3LRLA 4MG4A 1U22A 2TRSA 3W6LA 2A3EA 5A8OA 4JIHA 4UTHA 4F0HA 1QATA 1DV7A 2UY5A 4LUYA 1TA3B 4WX2A 4CQCA 5KEZA 2GJXB 1KCKA 5M03A 4PL2A 3DH7A 3M0VA 1S39A 3HOJA 1HO1A 3KL0A 1EA0A 2VQUA 4LOCA 1BQGA 2V3EA 2J88A 3REQB 2TSYA 1B4KA 2J27A 3T44A 2XFFA 3W81A 1VF8A 3KVLA 2A6NA 4HNUA 4GNJA 3SCVA 2O9TA 1XDMA 4NVTA 2WOQA 2XH4A 4RV3A 2GUUA 1ENUA 3N12A 2E67A 3TSMA 2PRLA 2TYSA 3EDFA 4KT2A 1B3WA 3NZPA 4H83A 3A5FA 1IT7A 1X6UA 1KXHA 1LP6A 3ZOAA 3VOIA 4F4RA 3MV11 5A6SA 3HG5A 4P5UA 3GG8A 4KCUA 4DJEC 2E9BA 4HYWA 4EACA 2GQ3A 1ZCOA 7ODCA 1C9WA 2WM1A 2CZDA 4IFRA 3EA2A 5C9XA 3DHDA 1ZP3A 1B31A 4RXFA 4QJ1A 4S3KA 3PVFA 1AL8A 1V3MA 3SCUA 2VFGA 2ISVA 2VXNA 3RFAA 3GC4A 1EL3A 3GS6A 1LL6A 5BU6A 2V3DA 2CBIA 3W29A 1RZMA 1WXZA 2W9MA 4O57A 2D69A 4F3HA 1M01A 2VELA 3WQOA 2HCVA 3H23A 1MW2A 2CLMA 5D30A 2OO0A 4MDPA 1M6JA 3DI0A 1IWPA 1AMKA 5HQMA 1KGUA 1OX4A 4W7WA 5BU9A 5FI8A 3N2CA 2YL8A 5LHFA 2QJNA 5C55A 1XDLA 3GVVA 1E0UA 1K70A 3JRKA 3LPGA 2GDUA 2X8RA 2WXDM 2WQPA 3IAQA 3BOLA 3R8GA 2YIHA 4P7OA 5CKSA 2C19A 3WLRA 3WQEA 3K2GA 3B05A 2ZXQA 1PX8A 5DMYA 3PNUA 1QWGA 2C18A 4W85A 3E49A 2CLKA 1W1IE 1FHVA 4ZQNA 4IQDA 3TYEA 1T99A 3AJ7A 3R2GA 3RMJA 2OXNA 4C60A 4BQ3A 4DAFA 1ONXA 4HA1A 4PTVA 1KTNA 3SZ8A 4YTQA 1RBOB 3U7VA 3UXLA 2VRJA 3IRDA 4US6A 1DWAM 4P7QA 3MUXA 1SGJA 3MVIA 2E8ZA 4GIAA 3WLOA 3V0UA 2VVNA 1JPHA 3SUSA 3NXFA 1UH2A 3M5ZA 4LVBA 3SRHA 4QBXA 3GUWA 1EDQA 3CHVA 2P50A 4IXXA 4C6OA 5BZAA 2A5HA 3K8KA 4AC1X 2WNZA 4KERA 1Q6OA 3WNOA 5CSYA 3B8IA 1W9XA 2BMBA 3GM8A 3ITXA 4JTAA 4JEQA 1XIJA 2XN2A 1PTDA 2ZZ5A 4H04A 2GK1A 5D02A 1FDZA 3DI1A 3EOSA 5EMKA 1M1BA 4AYSA 4PUJA 4S3FA 3GD6A 1XLLA 3OHMB 3MUY1 1I75A 3HA1A 4OV4A 3SW6A 1B9BA 3EMZA 3ITCA 4IMEA 1W37A 5F4SA 2XYLA 3CB8A 3F4NA 3CPGA 4HN8A 2ISSA 1FWFC 4HPNA 1AJ2A 5JUVA 3C0LA 4PMRA 2BZNA 2J13A 4IL0A 3HU7A 3L2IA 3GNDA 3VFLA 4A05A 5AZ0A 1I1XA 1HTIA 2XDFA 3UXKA 1HW6A 2UY3A 2PAJA 3QEZA 3E2QA 3CJPA 3M47A 3NOYA 3COTA 1KNWA 2QGYA 3ONCA 1QMLA 2G3MA 1F4HA 2QCFA 3OODA 3CZKA 1RUSA 3CB3A 2WSKA 3IJQA 1ZY9A 3TROA 2R1NA 4Q7IA 1ELSA 4MWAD 4D71A 2GSEA 4PODA 1RPXA 3DBNA 4JTUA 5E6ZA 1D7KA 4FF7A 5B7ZA 3L2MA 4JTEA 3V16A 2FHBA 1E9LA 3GIQA 1JDEA 1H0IA 3MJMA 4Z2JA 4EAYA 1BXNA 3DHUA 1JVNA 3WBWA 1UH3A 4TR9A 1XKJA 1ODZA 1W1A1 4FALA 1AK5A 1JZ3A 3UXIA 3BG5A 3NL6A 1K8YA 1QK2A 1CBGA 4X0NA 3LHZA 1A3HA 4A29A 1PX3A 5D33A 2A79A 4HMCA 3LXAA 3OYXA 5HATA 3B3DA 5T91A 1GWJA 1OFPA 2E6YA 3UVAA 4EPDC 9RUBA 3GU9A 2GQ9A 1FH8A 7CGTA 1XS2A 2QHAA 2BVDA 4ZFCA 4DZ5A 1ITXA 1WDPA 5HJLA 3TYAA 1ZAJA 3GB6A 3VKDA 1QNRA 1K4GA 2G5WA 1LZOA 3LDVA 2Q71A 4ROPA 5LA0A 1BPLB 5JXQA 3AXHA 1V02E 5EGRA 1DWFM 3W7EA 2ZTKA 1JCTA 1OD0A 3A9IA 5CBIA 5C9ZA 2FJKA 1IXNA 1GKPA 1FWCC 5HWJA 2D22A 2IKIA 4DJDC 1G4TA 3AMLA 1V93A 5GNXA 4L1XA 1Y65A 3NM3A 4XZMX 2C1IA 1CTNA 1ITQA 2YL6A 4AD5A 1H7RA 4BQ5A 1GVIA 3CMFA 3FDGA 4HNNA 1RBAA 1JXKA 3BDKA 4MSSA 3FN9A 4PSPA 2Q3OA 3T05A 4H7ZA 3GTHA 1UA3A 4JY8A 3N3TA 3WELA 4JQ3A 3T1GA 3Q58A 3QV9A 3WEZA 3IVSA 4PGLA 4UBPC 2PPGA 1CXHA 1V7AA 5EFFA 1T8XA 3LMZA 3KUMA 1RQHA 3NQ7A 4DNHA 2GUYA 4Y8EA 3CXOA 3VMNA 3VDAA 5D9MA 2B7NA 2RKXA 1A5MC 2ZUTA 5DO8A 3ZR5A 1JUEA 1DXFA 3DENA 1WOBA 1SZGA 4ZSTA 1RVKA 4UFJA 1ZJAA 1UA7A 4MLJA 1R8LA 4GCXA 4GI4A 2EPKX 4I8DA 1B4EA 1DQUA 1X1NA 1VLWA 3IAPA 2VRQA 3IEBA 3VIPA 1G6CA 1Q7QA 1AZ2A 1HL2A 4AD4A 2CBJA 4MJZA 1L6GA 1PCWA 2GGIA 1B5TA 4Y2WA 1T6MA 5HNTA 5FF4A 4GXPA 1J0KA 1VPYA 4PTXA 2BBFA 1LM1A 2A2IA 4MHBA 3HV9A 1GOIA 1XYFA 1Z3NA 4C6QA 3NGFA 3NQ8A 4O13A 2CBUA 1J01A 3AXMA 3UJEA 1VYRA 3N4FA 4MNKA 1W1ZA 3NPWA 2Z27A 4JHMA 1EQPA 3V5CA 5G4EA 3EWZA 2CHNA 3NXLA 3UCQA 3FFSA 2CEQA 3FJLA 1X97A 4WDXA 2HROA 4NI3A 4O1FA 4WR3A 4WRHA 4AMAA 4ACZA 1NM9A 4AY8A 2J9ZA 4K7VA 3AZSA 3AALA 3TYBA 1TMQA 1VFSA 1AW2A 3SGUA 4CQAA 4IWWA 3WLKX 1M41A 3WD1A 2YXGA 2DT0A 1OINA 1TVNA 5H1WA 2WZIA 3NZRA 4HJFA 1CIUA 3IIZA 3V4BA 2JF6A 3BSMA 3RJXA 1CDGA 4I90A 4XK2A 3GH4A 1OIMA 4LT9A 3CAWA 3GC2A 5FOOA 2DJXA 5E09A 3TJXA 3ZLGA 1IXQA 4H6EA 3ARUA 3EWBX 4AZ6A 3K1DA 4C6FA 2UY4A 5E0KA 4GE8A 3NQDA 1JL8A 3QM3A 4BQ4A 1KRAC 1DE6A 2BOGX 1UWQA 1YDYA 1U2YA 1WB0A 5GVJA 4CCZA 4DBSA 1XV8A 3H4WA 1RALA 3PC0A 2WVTA 1KCXA 4NZCA 1GNXA 1Q13A 2W63A 1A4LA 2EJAA 2RH9A 3QKEA 4A6GA 1CXLA 2QAFA 1YLVA 1W1B1 3O9NA 2BGNE 4O1CA 2FDMA 4ML9A 4JYFA 2QMKA 3NQVA 3GDMA 1TTQA 2J7HA 4IICA 4OE7A 5FJIA 3VO0A 2ZBTA 3E5PA 1DOSA 2FZ9A 3TNBA 3D3AA 3VD3A 2DEPA 3ZM8A 3PZMA 2HNHA 1FVPA 2YJQA 3VD9A 3DHFA 4JFVA 4EF8A 1D2KA 3F2DA 1VEOA 3GX9A 1PZ3A 1J6OA 5HWNA 1AA1B 2GSJA 4TXEA 2R91A 3VM5A 4HN4A 3B06A 1DBTA 1A5LC 1G5AA 1NJJA 1GHSA 3RJYA 4A22A 3MI6A 5C2GA 4HPGA 4FMVA 4W89A 2VFDA 5SWUA 4YYFA 3PBUA 2TODA 1W3LA 3IRSA 1LWIA 4Q4KA 4HZMA 1LBMA 2IPJA 3CYVA 4REQA 2A4AA 1ZLPA 3G8EA 4PUUA 4LRTA 3PB2A 3FX4A 3OZPA 1OGSA 4GUGA 4M6VA 3MT1A 4BF5A 4UFKA 3UR2A 1ZAHA 1W91A 3FSTA 4E0CA 4J3XA 3AU2A 2YBUA 3MANA 2CPUA 4W4QA 4GI9A 4LCRA 3PZTA 1DJXA 3VX1A 1JR1A 3FHAA 2PP1A 3LOTA 1EQCA 1W5NA 1KQZA 1OBAA 5LXXA 4BEUA 2Z25A 4RZ4A 2XVPA 3P6LA 3XISA 2CLLA 1TREA 4C65A 3OVGA 1PWMA 5D2XA 5MHBA 3F4CA 3I4EA 4FF5A 3UPBA 3QV8A 1VFFA 3KE0A 1X7IA 2XFYA 4LAMA 1GEQA 3WFZA 4ZOAA 1MNSA 1QUMA 3PB0A 1E6ZA 3P8IA 3CTLA 4XAPA 5M2FX 2E9MA 3A3XA 1ZQ5A 3WF1A 1CEOA 4WSHA 2XVLA 3SSZA 5BRPA 4MIMA 4JIIX 2NQLA 1GONA 1EUAA 3MUAA 4HNOA 4Z1AA 2IQDA 3LCHA 2R1KA 1EDGA 1IYXA 5BWFA 2VZVA 1TPVA 1ML1A 2XZ7A 4DO7A 3R0KA 3ARVA 2D2GA 4L4OA 1KKOA 2C0HA 1XLIA 2UV8G 4BQ2A 4MJ2A 4Y9PA 4H9ZA 2TAAA 1Q2SA 4I6KA 3PNZA 2AAMA 3L0NA 4ZR8A 5IFPA 3G3DA 1W9VA 4V1XA 2G0WA 1VHNA 3NCOA 2VOMA 1EWEA 2JK2A 3BLIA 1UZDA 3DYPA 2PWDA 3MUZ1 4GQGA 5AZ1A 2NW0A 3H2NA 3PFRA 4IF2A 1EDTA 2XIQA 1SPQA 2YA2A 4P8VA 1Y5XA 4W86A 2B7QA 3SQLA 3THAA 4HQVA 2BP1A 3OO2A 4RDZA 4W9TA 1SO6A 1EC9A 3VCNA 1F9CA 9CGTA 3MUCA 1OT1A 1FXPA 3FA4A 3CHDA 4M51A 4IJCA 4IFKB 4GWEA 3L5AA 3NJ3A 4FIQA 3QSTA 1HL8A 5AFDA 4E3VA 2V67A 1ITCA 1TR9A 5CZSA 4HU4A 1T41A 4FLQA 3PJXA 3IUDA 3ITVA 1KA9F 1XRSA 4G5DA 1JPDX 4C6IA 3T8QA 3DHPA 1GCYA 2Y89A 4J3TA 3IANA 5C54A 2PGEA 3GXTA 2GJXA 4IM4A 3MI2A 1FWWA 3DFNA 2QCCA 1VYSX 2Q8ZA 2GOKA 3MSRA 5IOBA 2J75A 3PTKA 3VYLA 4Y9AA 2BXZA 5J5DA 5BW6A 1OK6A 3B8DA 2RDXA 1N2VA 3ATZA 5FL1A 2Q8LA 4PCPA 2ISDA 1QASA 3VOFA 1VZWA 1UPPA 4PRRA 3URNA 4XKYB 4F9JA 1MXDA 1LQAA 4LTSA 1V6YA 3LHTA 3R43A 4WHBA 3H53A 3CH0A 3M16A 1ZSXA 4NZ3A 3WDJA 3B8WA 3TNOA 4UC5A 4O8RA 3N9SA 3URAA 2J8TA 4PFMA 1CT5A 3ORWA 3CU2A 3VDGA 1F3TA 4Q3MA 4GC4A 4Z2LA 1GVEA 4H6RA 1UR0A 3EWUA 1Q63A 3MMUA 1OC7A 4MM1A 1PX4A 2WJFA 2WZEA 4JL1A 2DSVA 3V36A 2WKGA 4HTBA 2WK2A 1LROA 1A80A 1EJVC 4NXSA 3A13A 1UKOA 2FZ8A 4LBRA 4JY9A 2GJNA 2WKJA 4FB7A 1W0MA 2YDSA 2OODA 2CKRA 1ALDA 1JGMA 2DIEA 3N14A 3B03A 1RLCL 4I7UA 3OZYA 3DFYA 1OQFA 1SJAA 1RAKA 2ESCA 5LNUA 4B4FA 1EO7A 4UTLA 1XIEA 5HQLA 3HG3A 3CQIA 3AHVA 1FRBA 2FHCA 2FZBA 2YOCA 3DX5A 1KRCC 3W72A 1MUWA 2DDXA 1IIGA 1RP8A 3LG3A 3VA8A 2ATMA 3B8TA 3TQKA 3T0BA 3UZJA 2BVWA 1V0LA 3K46A 5GPRA 3W7PA 2I17A 3WBYA 4M6PA 3WQ6A 1SSDA 4GKLA 2PU1A 1ME7A 1TSIA 2WMIB 2EG7A 2WBGA 3RLUA 3RPTA 4GHRA 4B4HA 2H3DA 3S2CA 4IMFA 2FTPA 4NJGA 2VCAA 4Q4PA 3G0SA 2NQHA 1BGAA 1JCXA 2YW3A 5C9UA 2DY3A 3GDRA 2JIEA 4RXGA 4AD0A 1ZS2A 1VCFA 1U30A 1RJPA 2R1PA 3H70A 1UR2A 3UFYA 1A5CA 3GXNA 2R1LA 3OIHA 5HOSA 3G6LA 4EE9A 3C8FA 2WPGA 3N13A 4HCHA 3W71A 5I3IA 3TN6A 1QRQA 3HO8A 3SBFA 3FA3A 1JUKA 3KRZA 2NV2A 1PB0A 2XH2A 3S8HA 4LY4A 2PDWA 1W3NA 1EA9C 4EP8C 4R7JA 4H6KA 3VMOA 3PPCA 3PUEA 1JQVA 2XJ7A 3GNNA 3QGAC 3WLTA 1S5WA 3M0LA 2HSAA 3USBA 3BJFA 4WKFA 4XAZA 3ARTA 4C90A 1Z6KA 2B4GA 3HJZA 4ZOCA 2P3EA 1QT1A 3NQFA 2Q6ZA 3QYSA 3O0KA 4NZ5A 4UFMA 2DW6A 1JUBA 3CL6A 3SCNA 3W37A 4B15A 2DT2A 4A3YA 3K30A 5LIUX 1F07A 4AYGA 4QP0A 1OT2A 3UY8A 2NVDA 1XG4A 4U28A 3SGGA 3WLNA 1ZJBA 2E6DA 2Z1XA 3W1UA 3R8HA 3MKCA 3CZJA 4RPPA 1XLKA 3G1VA 3U4FA 5L9FA 2A1YA 5HK4A 5DY3A 4DEFA 4LB3A 3GG7A 4RZ6A 3VOJA 1WDDA 4NZ4A 1AUSL 1FWBC 2OX1A 5PTDA 4JYDA 1E51A 4H01A 2GGHA 3VK5A 3HBLA 4FXRA 2ASHA 3BJTA 4B90A 3A12A 2EO7A 3I3DA 3M07A 4IJBA 1DHPA 3D5HA 1WPCA 1KLZA 1YIXA 5MKGB 1VFMA 3PF3A 2IQTA 3M64A 3OZOA 4JIQA 3TONA 4DM1A 2PC4A 4QAWA 4QE5A 3ES7A 1JGIA 1V3IA 1XCFA 5LNRA 2G37A 2OVLA 2QULA 5IDZA 2PDQA 4ICNA 4DWSA 1O5QA 4Q22A 2NT0A 2QKFA 1MNZA 5T8GA 4UUIA 1WCGA 2FPTA 1CW2A 2J24A 3P82A 4HZ6A 1MUMA 1I2NA 2E1DA 1H7OA 3KFTA 5DCEA 1DEDA 2HVNA 4O1AA 1PHQA 3HPAA 4DBWA 4Z1YA 1JZ4A 5D9PA 4ZQCA 2DH3A 2AQOA 1TWDA 3W4RA 4ALDA 1BSIA 3K5XA 3C2YA 1F6PA 3U5YA 4Q8VA 3WDIA 3MBFA 1UD3A 3Q67A 2P3ZA 3KP0A 3TC3A 5CSUA 2P1FA 4GY7A 2QPUA 4AC7C 2EKCA 1EWDA 5A3HA 4MB4A 3SM0A 1H7NA 1S5MA 4GA8A 4GFIA 3L9CA 4Q6JA 3UR5A 5AVNA 3WFAA 4NG3A 1WXJA 2BODX 3V5OA 3KBSA 4FPSA 1J93A 4A3RA 1OM0A 1NFPA 3B8VA 3EKLA 4QS6A 4UFIA 1ISVA 2PCEA 1WKEA 3DG3A 3ZSSA 1TPDA 4XVEA 4QSHA 2PBGA 3WH9A 2H6RA 3ABZA 1UR1A 5HNRA 2NVCA 1V5XA 4RDVA 3DCPA 3JU2A 3TR9A 4K8GA 3NEHA 5I00A 2OOFA 2X30A 3G8RA 3KOYA 2E0PA 1KC7A 1EO5A 2ABBA 1B1YA 4AG0A 1TE6A 1SZNA 4ZENA 4GUFA 3KS5A 3VIHA 4HU0A 5BOOA 3WJZA 4GIYA 1Z9AA 1VCGA 4ZL1A 1YDVA 1G01A 4JTTA 1T0OA 4Q8NA 4CCCA 5CC6A 1HVQA 3OVPA 4IMCA 3YPIA 4KWSA 3WBAA 4E8DA 2PWUA 4JKLA 1OF6A 2QJIA 1CGXA 1OD8A 4L56A 4NJHA 1E15A 3L23A 3GE7A 3GG0A 4IIHA 1CXFA 1GYNA 3W87A 1VCVA 2REQB 1FH9A 4B5WA 2E3ZA 1LTDA 4YCOA 1Q7ZA 3BW3A 4H1ZA 1HGWA 1QBBA 1KCZA 3GDBA 2QT3A 4DXKA 3W82A 3QR3A 1NIUA 4B3ZA 2DQWA 4DUVA 3URQA 4XZWA 1HJVA 1AJZA 4AXNA 5I6SA 3VI2A 1O68A 2GQAA 4D8ZA 1CGVA 3UXDA 3O16A 4H9VA 1HKVA 1M7OA 3W00A 1E0XA 4MFEA 3KAOA 3N9KA 1NU5A 2DVUA 1FWRA 5FEPA 2CZVA 4B5TA 3B0PA 5DMNA 3UJRA 1WYIA 4PMJA 1XSKA 3HPZA 2VEPA 4FAMA 2EQDA 4MF4A 5BNKA 5B7YA 5CLTA 4Q8PA 4H9YA 4MUZA 4GYPA 3ZSTA 4IMAA 4QQ3A 3TQVA 2H8XA 2VFFA 4V33A 4CD4A 3AIVA 4XZBA 4MYAA 1C91A 3Q2DA 1UP2A 4XZNX 3MMTA 2B31A 4I9JA 2W91A 1PKLA 2E7FA 2XN0A 3C86A 5IHSA 3O7UA 2XISA 2V2DA 1SO4A 4WGHA 1YBQA 2WHKA 2VQTA 1DQXA 1O12A 1A5OC 2YBVA 1BXBA 2BS9A 3WQ5A 1TYGA 3WLIA 1OFEA 4MGGA 1LLZA 3THCA 1E3ZA 2E6AA 2XIOA 1LORA 3MI3A 4JTJA 2VYOA 1H1ZA 1EPXA 3NL2A 2G8ZA 1F73A 3CNYA 3R25A 1QO5A 1D8WA 3FYOA 3T8LA 3WMBA 1MQQA 1OCJA 2WMHA 2WCAA 1W9BM 4JHZA 2ZRWA 3MC5A 5E0CA 2EPNA 1OFQA 2CZFA 1S2WA 3C3UA 3G0UA 2ZZ1A 3L4XA 3ID7A 1IEWA 1L6SA 2Y6ZA 2CWNA 2PLJA 3INPA 1NDYA 4LEFA 3FIGA 5HAOA 3MMWA 4GYKA 3P81A 2AKZA 4UZUA 4U3CA 3B97A 3U5UA 4CEXC 3TX9A 1XSIA 3ELFA 5LIKX 5FEZA 1JFHA 3NG3A 3LRKA 1EOKA 4M3PA 3W1MA 3CPUA 3VXGA 3L0KA 4NRRA 2AL2B 4F48A 1P5BA 3E1F1 4UOQA 2F6XA 1VS1A 1F8MA 2ZUUA 3CC1A 3C2OA 1AH3A 1DJYA 4I8YA 1Z7AA 4UTFA 2VUNA 3BQ6A 1GQJA 3EYPA 5C71A 4J5NA 2Y61A 2CWXA 3QPYA 4N6FA 4KRUA 4K2SA 3DDMA 1G9HA 1V08A 3WG6A 3HG4A 4RE2A 1CXEA 4JTIA 3WQCA 3W2JA 3P8JA 2GOUA 1X38A 1TMLA 5AY7A 2PGWA 1YTKA 3QGKC 4O18A 1O6IA 3QV7A 2NXHA 4K7YA 4EF9A 1UR4A 5BXSA 4IUOA 4QDPA 5H91A 5GJNA 4HMEA 4TVUA 3GG1A 3HFTA 4O0ZA 4NT0A 4JNYA 4A21A 1QDSA 1AD1A 3IVTA 3S47A 2Y8UA 5DRCA 5D04C 4ZQPA 1MDRA 5DXYA 1DWJM 1K7FA 1GVSA 3LV5A 1VH7A 4PTWA 2F61A 3BZJA 2VP8A 4A8IA 4WJXA 4IGSA 4UQAA 3G1FA 4KEZA 4BFAA 2PDKA 3THDA 2FZDA 2EEXA 1YNPA 3PBMA 4JXCA 1GOWA 4JTDA 1FWEC 2JF7A 3VNYA 1KFCA 3WX7A 3GU2A 3OLIA 3AIUA 3FNDA 1R87A 2QV5A 3ZIZA 3MCOA 2EPHA 3HPSA 1ZCCA 4OFCA 1XISA 4QTGA 5K9XA 3GAYA 1GYMA 3AFBA 3QC0A 4BEQA 1XLFA 3GXMA 1XX1A 4LX4A 4TTUA 4ZOEA 3CZ8A 1A5UA 3ITLA 4CNSA 1VYPX 3NSMA 1TUFA 1H3GA 3NPVA 4G56A 3WZ0E 3KS6A 3KCJA 1DIEA 1EXPA 4GK8A 5DX7A 4IG2B 3T2QA 3W7HA 4JL2A 4DY1A 4E3TA 3NA8A 1TPWA 1GUVA 3ZJ7A 3BK0A 3RX4A 4DWSD 3TU9A 4FNTA 4JIEA 1MVYA 1MUCA 3O6YX 1IT0A 3L5LA 2E8YA 4R88A 1EJWC 3N6HA 4DWSC 3KZPA 1EC8A 4IFKA 1YX1A 3WH8A 4CNOA 3LBMA 1G4EA 2D3NA 3DFHA 4XD4A 4NSBA 2E25A 3G18A 2CHRA 2ZX9A 2ODOA 5IDIA 1J18A 4WD0A 5E6YA 2XIMA 3WJWA 4PUKA 4XBSA 1U33A 3AIEA 3MHGA 1E6XM 4C6EA 2ICSA 3AXIA 3C2EA 3MA8A 3WL1A 3GR7A 1GOQA 3MU7A 4LF1A 4RR4A 3RGTA 6ALDA 1SZFA 2BNJA 4FSAA 3C56A 4EXBA 1K03A 3L21A 4QDWA 4S2BA 3LMYA 3EPNA 2NV1A 4XKYA 4IH3A 3VOCA 2HK0A 4MUPA 1S46A 1ISZA 1EXBA 2V5JA 4X2PA 4AF0B 4YTRA 5FSDC 2I57A 4NP7A 1KWGA 1XYBA 4BI6A 3FGCA 2J62A 1M04A 4JNZA 3VE9A 3CAVA 2V2HA 3ANVA 2QPSA 3RCYA 4GXWA 3R7MA 2XIBA 3BJSA 3BTNA 4JKKA 4FO4A 1H2JA 3NSXA 4Z2KA 2RGLA 2VUYA 3SCRA 4X9SA 4KFPA 5I3HA 1YNQA 3TVAA 4GC3A 3ZYZA 2J7BA 2VCBA 4QM1A 2OJPA 2E77A 1RJRA 1IQ8A 1K6WA 2E28A 2AQVA 6TAAA 3UG8A 5EKYA 2OQYA 3H12A 4PMDA 1DWHM 2PDYA 4F8XA 1XUZA 2EGZA 3NQAA 3OVQA 2GGEA 5T26A 3P7YA 4CD7A 1ZPTA 3T0DA 2L5HA 3KCLA 3CLMA 4ZOBA 1A0EA 5I3DA 3NTYA 4D6EA 4C6CA 3TN4A 3WF0A 4XZIA 1KQYA 4PUMA 1KGXA 4AWSA 1PZ0A 1TV5A 3N34A 1B3XA 3E0VA 5F2IA 2OZ8A 3A47A 3KVKA 4XG1A 4AHQA 1MZRA 4AWUA 2E40A 3E2VA 1D3HA 4N9BA 2A7NA 3E74A 2NQ5A 4ES4A 3S83A 2DUAA 4C5YA 1R38A 3AHYA 3LTPA 2C6QA 2O9PA 1UASA 4KWVA 4KQNA 4QHRA 3PJUA 5LHEA 3B0UX 3K8MA 4J1OA 2WMIA 4KRZA 1W56A 4MNMA 4KIEA 3W7JA 3OHIA 2VFEA 1DKWA 3AS1A 3NDYA 2QAPA 2PRMA 1V51A 3G5EA 1F2JA 1LBFA 3BLFA 4LAKA 1LQ0A 3RR4A 4E2DA 2PD5A 1G1YA 4B5SA 4U4MA 3I7RA 4FEZA 1H63A 4JCLA 1WX0A 4W7UA 3ICJA 2YB4A 5C9WA 1KR1A 4CQDA 1S2UA 4QDMA 3ANYA 1TTJA 3WSUA 2CFFA 1ZENA 1HNYA 4EAMA 1ZJHA 5G2IA 3CIXA 9XIAA 3ZFHA 3SCSA 1OYCA 1ZHAA 4R3UA 2ZKMX 2PA6A 4GUIA 1SW3A 1CECA 2X0SA 3K1GA 4F2UA 1LBLA 3UZYA 4UMBA 4US5A 5EPDA 4PMYA 4O28A 3UEQA 3QF0A 5K4ZA 3CT7A 1FWAC 2Y5JA 2DV0A 4N42A 3A4WA 4RPQA 1JIBA 4R53A 4FS9A 2VL4A 4GOAA 3LBOA 1BXCA 1Q85A 1TMHA 4IGHA 1M3UA 2A7RA 2WCSA 3HPXA 4B5VA 3GKFA 4XZHA 1SR9A 3H7RA 4QROA 2OELA 4Q4QA 2Q02A 2ZRXA 1TWWA 4PYSA 3ZS4A 4FNQA 4F2BA 1FA2A 4NNAA 1JD7A 1A5AA 2YB1A 2QLYA 4AD3A 5FJPA 1J9YA 1S2CA 4MFDA 3NQGA 3EDEA 3TJIA 1KM6A 4DO6A 2HNEA 1DHKA 5MF5A 2CLHA 3MQTA 3H2CA 4D6FA 3G1SA 1UP0A 1ZTVA 3NDOA 4S3BA 3LHVA 2WNWA 1XGEA 4IIDA 1BVWA 1W9UA 3QFWA 1XH1A 4OOUA 3LK6A 3NVDA 2HQAA 4Q32A 3WNPA 1YXDA 5IHRA 4FLRA 4DWDA 5I79A 5TAOA 1EIBA 5M17A 4M81A 5MKGA 4PMOA 2VEIA 4K6AA 3W7CA 4OVXA 1IE7C 2FB2A 5LA2A 2BX7A 4MKNA 3VDHA 2GJPA 2ACUA 3I3BA 4LU0A 2R8WA 4ERAA 1NEYA 1GOOA 1C29A 4JTHA 4NYUA 2ZX6A 2C1GA 3MZ2A 2RFGA 3WDHA 3S5SA 3PTMA 1UOZA 4YHGA 1H51A 2PP3A 3LXCA 3RCNA 1R6WA 2QV4A 1HQTA 2HE8A 1W3IA 3VZXA 4P61A 3W6YA 4PRWA 3W7NA 3CH9A 3HV8A 3KWSA 4YWIA 5LXEA 2FLIA 1XYLA 1WZMA 4O1DA 3Q45A 1QNOA 1WBJA 3IIVA 3P14A 5CLWA 3F5KA 4GZIA 1DJQA 1DVJA 5D09A 3QH2A 2GJRA 1EF2A 4IHCA 3HB9A 1B0IA 1XLGA 5FJUA 3GFZA 1W17A 3W01A 3S5NA 2ZZ3A 1BQCA 3BCDA 3RDKA 2DORA 2FHFA 3U9IA 5I07A 1IHIA 3HGJA 3UCDA 4DUWA 7TAAA 1MW0A 2DZSA 3QHNA 2VWSA 1TG7A 3UQNA 2NZLA 2V82A 3BZGA 2CKSA 2X1TA 2G50A 3UYCA 2TPSA 1S1RA 3VGFA 3AMGA 1E43A 4HVXA 2E4TA 4Z0SA 1AH0A 1BAGA 1C3FA 2CNCA 3ZVHA 1JF6A 3RR1A 3SRDA 3AYVA 1UR8A 1JDAA 2P53A 1K9DA 1BF6A 1P6CA 3FKRA 3BE7A 4L61A 3DBPA 3WO8A 2QVNA 2H8ZA 3CQHA 2XZ9A 2GDVA 4YXGA 1FCBA 1Z42A 4DYEA 3O63A 3TR2A 3A21A 4OJYA 1UG6A 1RCQA 1MEWA 3WEOA 2X41A 4CNTA 2YCIX 1PJ9A 5FD0A 7A3HA 2XGZA 3GYEA 1ECEA 3P0XA 3DZ1A 3ONBA 4YJ5A 1PV8A 1AJ0A 3UETA 3VKBA 2QCGA 3N15A 2JGYA 5K7JA 2V8ZA 4O4VA 1O94A 1OSEA 3AHXA 1P7TB 4IOTA 3BLEA 2QCDB 3RO8A 1LUCB 4IX0A 4ZQRA 1EC7A 2J25A 4DZHA 3SCTA 4NKCA 4H00A 2PWFA 4R9XA 4Y7EA 3NVTA 3TN3A 4DI9A 3C8NA 4FNPA 5K3VA 3VX0A 4PCSA 1TPC1 1EGMA 4TMBA 1OCQA 1A0CA 3APTA 5KZDA 1OY0A 3JW7A 1HKMA 4UXDA 1CXKA 2Z1WA 3RO6A 1YTDA 2GGGA 5IBXC 5A6KA 4FOJA 4IMDA 4Y6GA 3P84A 2YSWA 3NO1A 3VIOA 4LAOA 5AHNA 3BSGA 4AD2A 1SZRA 3WUBA 4YNGA 2D0HA 2JGQA 1V3HA 1JZ7A 3CQKA 1CENA 3N6QA 3LS9A 2YCLA 1XC6A 3LV6A 3UWYA 3GU1A 3IPWA 3CBWA 5EL1A 4V15A 2BHZA 4QSFA 3ZLHA 5TQLA 3QPEA 1GZJA 2ZUNA 4N4QA 3F4VA 3PZIA 1H09A 1L8PA 4OHQA 5AHIA 3WQWA 3B0YA 4KH2A 4FLSA 5A95A 3TIMA 1ZU8A 4ICCX 2FFIA 4WZHA 2JKPA 1K8XA 4O12A 3VD4A 1FWGC 3DKJA 3W07A 3NQ2A 4OIFA 5AKQA 3W53A 2VC7A 5A6AA 4Q7NA 4D2JA 4DLMA 3R0UA 1AZ1A 1TWSA 4AZHA 4N02A 2EG6A 4WSKA 1DIDA 4CVUA 1Q6DA 1TPB1 2VZUA 2XVNA 4PR4A 2POZA 1JZ2A 1I6NA 4CGTA 1DIKA 1EKOA 1NFGA 5HR7A 4HHMA 3BCJA 1OX6A 1DL3A 1M5WA 4N9DA 3AISA 4W93A 1GHRA 4GIEA 3ZJ6A 3MSGA 1TJ2A 5C7HA 1H0GA 2X1UA 1TX0A 1EJSC 2AGKA 2Y7EA 3D3FA 2FH6A 1TKKA 3B40A 4O53A 1E55A 2ZIDA 4EKJA 2OGJA 4XZLX 1DJNA 1FDJA 4C6LA 1QR7A 2AL2A 2QJJA 1OF8A 4ZA0A 4AISA 5DN1A 3TMQA 1E0TA 4GFSA 4ZCWA 2O56A 4I7VA 1I0DA 3PBWA 1QPNA 1KW1A 2D24A 3W7DA 3WENA 1Z44A 1A0DA 3O07A 2GUBA 1H7WA 2XM1A 1PVNA 2YBTA 1K9FA 3P2VA 5LNWA 2NQJA 1RP9A 3HM7A 8XIAA 1IWAA 4AVFA 2ISFA 2XH7A 3DESA 4F66A 3ENLA 4KEUA 4US5D 1RSCA 3PWAA 4JFWA 5KETA 4ZE4A 5I5RA 3QQWA 3KL3A 2V38A 5D8WA 1UCWA 3GIPA 5M1TA 5C70A 2D0FA 5FIPA 3ARQA 4X9YA 4DVOA 1E4LA 4CN1A 1QPKA 3S2NA 1F8IA 1XBVA 4HGXA 4A8RA 3EWCA 1AD4A 3PPHA 3W76A 2GGJA 4QRNA 4PUWA 2VRKA 2VGFA 1M53A 3CS2A 4ZTXA 1E9YB 1LG1A 4HPHA 1IZCA 4LUJA 3M6DA 1T7LA 3GH5A 3KTSA 1ITUA 4BWLA 1E6QM 1ISXA 1IIHA 2RJHA 2FPVA 2OMAA 2FMNA 2PTXA 2G95A 4LGXA 1RK5A 4A3QA 4D6DA 3NFUA 1YADA 1KV8A 1BWKA 2I9UA 1Q45A 3CHFA 3JS3A 1E71M 1A47A 4WIWA 4WY0A 1QVBA 2G96A 1U83A 2OO6A 3O6CA 1YMYA 3OLDA 3V0SA 1J11A 1F3EA 3II1A 3HPFA 1QPOA 1J5TA 4X2RA 1V8EA 4LVAA 2PWGA 3FYYA 2FGBA 3M0YA 3PS7A 1Q6GA 1P48A 2VX5A 3CMJA 8XIMA 4P7NA 1KKRA 3LRMA 4RDYA 2FH8A 4NL1A 3VD5A 4HB7A 1I0BA 5CGMA 4IG2A 1P43A 1O95A 1W1VA 1J96A 1BYBA 4YVPA 4UTIA 4DJFC 2F6KA 4ZQMA 1P1MA 2VR5A 3T07A 1EGVA 4HYVA 1BG4A 1R85A 1LWJA 4DUOA 4FZIA 3N2OA 5A6JA 3LHUA 4XZ9A 5HUOA 3USZA 1DXEA 4MPKA 2HDJA 4S38A 3R5EA 3TSBA 1GGOA 1BKSA 2OZ0A 4ZODA 4N0RA 3UR8A 3I7QA 1HZYA 1XBZA 5EA9A 2QCNA 3IWPA 4BR1A 2VX4A 3OIXA 1W5PA 4KFOA 1XQLA 1ICPA 3DYOA 1NQ6A 2ZYFA 4KF1A 2V30A 1FHLA 4WDUA 3T42A 4LC8A 4F0RA 4KGJA 5BOFA 1A5KC 3P0WA 4H19A 2FTYA 3RPMA 4C6JA 1PKNA 3GDTA 1R9XA 3UPWA 2GVJA 1XIFA 3GNOA 1WKDA 2RHGA 3DIPA 1FWTA 2PDNA 1CB7B 1G7VA 1JJKA 3UZZA 3NNTA 3RRAA 4OGZA 4M19A 1X96A 5GQBA 2X2GA 1WZLA 3N6JA 3GDLA 3NL5A 2OWCA 3IIXA 3IJIA 4LPCA 3L68A 2VHLA 1N82A 4AF0A 3R10A 5F2GA 1NOUA 3TXVA 3EOEA 3WDRA 3GNPA 5FJRA 1PIIA 1RQEA 3MKVA 5BYWA 2CIPA 3SY1A 4UOJA 1K8CA 3MO4A 5DT7A 1LRTA 3LYEA 5BRBA 2PDIA 5JBFA 3QZ6A 1R47A 1XKYA 1RA0A 5A8NA 5ABFA 4PFHA 1JZ8A 1WV2A 2OOGA 2VEGA 1DJHA 1JYVA 5LA1A 4MLRA 3S6DA 4Q4OA 2B81A 4UNKA 2NUWA 3PAJA 2WSYA 4WY0F 2Y24A 4RNIA 1J8VA 1VBRA 3VC6A 3ES8A 2ZICA 1PBGA 2DGAA 1BYCA 5C2XA 1QI2A 4O8AA 2VJXA 1H11A 2ZZ7A 2PBOA 1KXTA 3C0SA 3LY0A 4R33A 2C14A 3WK1A 1RXOB 3W1LA 8RUCA 3GVGA 3V1PA 3C2VA 3KCOA 2YZRA 1PPIA 1XDJA 2IKJA 3HGSA 3GUGA 1QI0A 3TK7A 1JCYA 3EEGA 4HHPA 2IS7A 3SUWA 2GDQA 4O0QA 4NJJA 1UUOA 3F7JA 3PG8A 1EJTC 1R46A 3ISIX 1J2WA 1F6KA 1OC5A 4IQJA 2Y8KA 3W28A 2MUCA 2ZX7A 3LSBA 2DP3A 4JN8A 2ACSA 2HS8A 3O0FA 3NYDA 5M5DA 3CZLA 5FESA 5I78A 5DRIA 1AODA 3CL8A 1JZ5A 1WZAA 2VC9A 2JQXA 2HBVA 1XLJA 3EDKA 1A3XA 1HIZA 4H8VA 1OCBA 2V5CA 1TPEA 2AOSA 3G0XA 4LYRA 4GMEA 4TVDA 3QOMA 4F9DA 3S9IA 1BD0A 1OYBA 3WN6A 1LLWA 3BAWA 4ILSA 3H24A 1W5QA 4MDOA 4IPPA 4ZO6A 2BASA 2PDHA 1PYMA 2HJPA 3VCCA 5H8PA 2PE4A 3TUUA 4HSNA 4CNNA 4LUIA 3O3RA 1W2VA 3LPOA 4V27A 3PBGA 4Q4RA 2P0OA 4H41A 4Q4SA 1CI1A 3PAOA 3A9BA 3CZEA 4XO6A 2OB3A 4FLOA 2Y7FA 5A8QA 2DSUA 5CBJA 3T55A 4M29A 3KLKA 2ZXBA 5F7UA 2A3BA 1N55A 4UTWA 4Q33A 1PL9A 1XXXA 4DO4A 3O05A 3OA5A 2Y7GA 4QX4A 3P62A 1RLDA 3A23A 3ECQA 4N7QA 3TW9A 3S2LA 1KXVA 2Y2WA 3KHDA 1VFHA 5CZTA 3W7IA 5CG7A 4JICA 4JKMA 4L5ZA 1E5JA 1X6LA 4PMZA 4E4PA 2C3ZA 2VR2A 2PDFA 1VJSA 1E40A 1LT7A 3JZEA 2PDCA 1RD6A 3NGJA 2DZXA 1YE6A 2YDQA 4E2OA 1EBHA 2WVVB 2HVOA 4IIEA 4L64A 3C2RA 3B9AA 2QS8A 2DZPA 3WH5A 3R58A 4F79A 2DZAA 2PGFA 4PUDA 5E0FA 3AAMA 3BG3A 3E5BA 4GVFA 4UMCA 1IV8A 3SCWA 3WJSA 4G7FA 1DE5A 1AVAA 4Q8UA 2QGHA 1QBAA 4KEVA 5AHFA 3CAQA 2V69A 2QZRA 5J8LA 2F9RA 4AEOA 5FL0A 1QW9A 1V7YA 3DFPA 5EBAA 1E1CB 5CXPA 2YW4A 4DXXA 3WDQA 4LALA 1QPRA 3PN8A 3VILA 3CEPA 1T96A 4YL2A 5LIYX 1M03A 3BOXA 1QOXA 1YXYA 2HXTA 2HTMA 4JTSA 2V81A 2OKTA 1TRIA 3UG5A 2J6VA 3M1ZA 3WDPP 3GTIA 3E2SA 4QR6A 2PLKA 3QW3A 3A5VA 3NPUA 1V0NA 1FH7A 4HT3A 1R3YA 1TJRA 4M24A 1R7AA 3N17A 1YRRA 4ZB2A 3ITYA 8A3HA 3LB0A 1TUXA 3AUOA 1CZ1A 3BOFA 1XQKA 3ZJ8A 4O14A 1QO2A 5HNNA 4MTVA 3SUTA 4H2HA 3CASA 4HA3A 3IV8A 2Z2BA 3W27A 3TFXA 2FZMA 2NV9A 4IT1A 1KFBA 1B2YA 5LSMA 4CUCA 3CV2A 1JYNA 4BWLC 4J3SA 1GYLA 4JTCA 3VFCA 2OSXA 4NNCA 3W1RA 4QEHA 3QPZA 3CQ0A 3MS8A 3ABXA 1VR6A 1X39A 1RHCA 4D6JA 1I9CB 2C16A 3WK2A 3TXZA 4PRTA 4MJ4A 5JU6A 4YU1A 3E3HA 3N18A 3QXBA 3BH4A 2BVYA 4HNCA 3SFKA 4L4LA 4Z42C 5I3JA 2OCZA 2UY2A 1FKWA 5DLCA 2IXVA 4PBGA 1RD5A 4IPNB 3KTXA 4POCA 4UTMA 3VNJA 1DJGA 1US2A 2BSLA 2NUXA 3KOZA 2WWDA 3FV9A 2I56A 2O0TA 1MDLA 4NAFB 3W0KA 2PURA 5G2HA 5HJYA 4O11A 5HINA 4MWAC 3GBDA 5CZ0A 4A2RA 3CUHA 1X8CA 3HQPA 4NZJA 4AIOA 4BS0A 3ITGA 3R6IA 3AIQA 4GUHA 4LEQA 1G7UA 2OKOA 1VGAA 3AQUA 2CLEA 4UQEA 5E93A 4JQAA 3KL5A 3MP5A 2PWEA 5CAKA 2WBKA 1NOWA 2YR1A 2WJZA 4Y9MA 4GVIA 4XIMA 3SEPA 4C1NB 4C6KA 1GJUA 1P7TA 2Y88A 3IIOA 5T9BG 2QCDA 2GJLA 3R13A 3WQPA 1F5ZA 4AXKA 2QIIA 4K3ZA 1E1EA 1JDCA 3VIIA 1AQ0A 1EP2A 1M7PA 3NOEA 2E5DA 3L0GA 3V0TA 1XYZA 2OGYA 2VEKA 1UQZA 1CX9A 2NLIA 3HF3A 2PGRA 3DKLA 4HOXA 3NDZA 4LS1A 4YN5A 2YXOA 3L12A 3H2MA 4AZBA 4KCTA 1WAWA 3N4EA 3L4WA 2DT3A 4NF7A 1VB9A 1YEYA 1HKWA 3BSHA 4TX6A 3K4AA 2ZVIA 2DT1A 3H7UA 3H2AA 4WKAA 5FAJA 4PTNA 2Y85A 2QIWA 3UZXA 2VMFA 1GT8A 3W86A 4WK9A 3WEMA 4GH1A 5D4YA 4GJIA 4NX0A 2F2HA 3AC0A 1FUYA 2WC4A 4S39A 2WPBA 2ZADA 2IQ0A 1UD6A 2B7OA 1XFCA 5BOEA 4UZSA 4KWUA 3T0TA 1MW3A 2WCGA 4XQ6A 2Z4GA 4UQBA 3LN3A 4M82A 1BF2A 4DF1A 1CPUA 2A6LA 1EX5A 3PK7A 3E02A 1HO4A 3HFYA 1JI2A 4NAEA 3EB4A 4CNUA 2VD9A 1R3SA 4JN7A 4HCDA 4Q8MA 4QISA 4OTKA 1SW7A 3IJDA 3QBUA 4GH3A 5IRPA 3DU0A 2H9AB 2XM2A 4CKQA 1WAUA 1Q6CA 4IZGA 4ORMA 5JBDA 3TMLA 4PSRA 2A7PA 3D46A 2PP0A 5D9OA 1G4PA 4QG9A 4ZEPA 3KVJA 2W0UA 2WC7A 3QQ0A 5JIPA 5C8BB 3FS2A 3NO5A 4XD3A 5RUBA 3EX3A 4OUIA 5AB3A 4MWAE 4YVVA 3PULA 4WCJA 3UBPC 2JIWA 2NX3A 3I4KA 3EXTA 1K7EA 3CV7A 3S9YA 2ZUWA 3UWEA 4E8GA 3DOPA 3OU8A 1C9DA 3KWXA 1DXIA 3U2ZA 4OU1A 1KM3A 2JE8A 5A69A 2PODA 1M65A 4AD1A 1KTBA 1L6WA 3PBYA 3A4AA 1HJXA 1EJUC 1ADSA 3OVRA 5FKYA 1D3GA 4EPEC 2ABAA 2O7SA 5JMUA 3EA1A 3L4ZA 7REQA 4G7EA 1I4NA 4B16A 3VIMA 1W8SA 1HKKA 4AEFA 2O7QA 2X2YA 4GVGA 3IARA 1XIDA 3SY8A 2VNCA 3PM6A 4XX6A 5E9XA 1L9WA 2O4MA 3UG3A 1XRFA 1N7KA 1E4IA 3EXSA 1JRCA 3HN3A 3NAVA 2X7WA 3G6MA 3BGJA 1KB3A 4PH6A 3W6MA 3W70A 3BAYA 4GYFA 3QMRA 4Q8TA 3SN4A 3CO8A 3NR0A 3AYSA 4XB3A 1JG9A 2R1MA 1UJPA 2Z1BA 2PUZA 2B0MA 4RW5A 3SSJA 3IJ6A 1ODUA 3ALFA 4ERIA 5I3FA 5CPOA 2Z28A 3KOFA 1KXQA 3TC7A 2A85A 2G4FA 1PYFA 2C1HA 1QNVA 2ANUA 3K8LA 5G2WA 3FSUA 3PZQA 4E4UA 1NF7A 3P5ZA 2RUSA 1AG1O 6REQB 4DX3A 3DC0A 5AECA 3FXYA 3PFMA 4ADSA 2OG9A 1TWIA 2DFAA 2EBNA 2XGBA 1ZFJA 1VIZA 3E0FA 4TX8A 4C6BA 2NXIA 1WA3A 3MKKA 1XYCA 2VZOA 2FIQA 2A3HA 5A2BA 2BY2A 4Z1CA 4ATLA 1WUFA 4WXYA 4Z2GA 3BANA 1KV5A 3WNLA 1IXOA 2QDEA 1R3VA 3GZAA 4U2ZA 2G3FA 3N2TA 3STGA 4FX8A 1AW1A 3NZQA 4DJEA 2VR4A 2ZVRA 2Y0FA 4L1GA 3GXIA 1MXGA 3AUJA 1GPFA 2W92A 1HGYA 4H4IA 5A6MA 3PJWA 3TE9A 1WKYA 5EY5A 1DP0A 4AY7A 4DPPA 1TFVA 1ICQA 1OC6A 1UROA 3N3MA 3U4AA 4NJIA 3EDJA 5E70A 1DQWA 4C6DA 1EP3A 3QY8A 3OQ8A 4RK8A 4ZZ9A 4ZB5A 1IEXA 4TV5A 1XRTA 3UPMA 1SSGA 4AZCA 4H8NA 1EZWA 1OK4A 5F1UA 3BPWA 1TV8A 3ZVIA 1YW1A 4ZGYA 1NWRA 3L4VA 1W5OA 3PZVA 3WQDA 1REQB 4CCEA 1S1PA 4PZVA 2QUTA 3AS3A 2BWGA 2Z6JA 4WF7A 5G1YA 3VU2A 3QC3A 2P0IA 2WHLA 1NY1A 1QU4A 5HMSA 1VBJA 5A1AA 5KZEA 1YYAA 4F0KA 3A24A 2PFHA 1WNOA 5CGQA 4XV0A 4JAWA 2IW0A 3TN5A 4BI7A 3BLPX 1YNYA 3QZEA 1W31A 1BTMA 4GCAA 4IFOA 3PHAA 4D8AA 1ZL1A 3CYJA 1OGBA 5EMLA 2E68A 1TTPA 3TTSA 3BL3A 4E2VA 1XC4A 5H2ZA 1LL4A 3AYRA 1QNSA 1MO0A 1P0BA 2G3JA 2YYTA 3W2LA 4B92A 5AYYA 4LQ1A 4S2CA 4TX9A 3TJ4A 3W26A 3F5LA 2NVAA 3LQGA 5GJMA 1V02A 4PB4A 1KFKA 1W3TA 4EWJA 3H2EA 2FGZA 3ABQA 3SR7A 2Z2AA 4D72A 2V63A 3CAKA 1WE5A 1O1HA 2G4JA 2V3GA 3RUBL 1TR1A 1BHGA 3AICA 1LL7A 3IGXA 3LXBA 4B5NA 3CUIA 2J7EA 1CNVA 1MI3A 1GVOA 1XGDA 4UB9A 5FF7A 5EYWA 4MAVA 4MKSA 4J40A 2HRWA 4O50A 5T9CE 3RLVA 2BDQA 1W3KA 3SN0A 5LIXX 4DB7A 4Z2HA 3CQJA 4C6PA 2J7FA 1CXIA 4J3WA 4MKVA 4XUGA 1JF5A 2WO5A 3A4JA 3KBVA 2HV5A 5CJNA 3RX2A 3WK0A 3SJ3A 3RM4A 4B9YA 2EG8A 1HX0A 3W22A 3N11A 4M1BA 1TA3A 3EOUA 4QE1A 1TV7A 1YQ2A 1Q6LA 3M44A 3TYZA 1F6YA 3F4DA 5A2CA 4JX6A 5I77A 1LRQA 1FFQA 2FPYA 4I5RA 2FVMA 3POCA 2P8CA 2C0AA 5A6TC 3GDKA 3G3MA 4HK7A 3REQA 4GO8A 2DUXA 2MANA 3SN1A 1GKRA 4I9TA 4O54A 3A3WA 4WVXA 1C8VA 1O5KA 2Z29A 1ZNNA 1H49A 5CQ1A 2YLAA 3RM9A 4FNUA 4REQB 1L2UA 5BXTA 4AX6A 4LNYA 4DBDA 1RA5A 1NQKA 2V5BA 2OYLA 3IACA 2GPTA 4GGBA 1RY8A 1MQPA 1H50A 1MRAA 2X05A 4QITA 1ADOA 4HD5A 3NUKA 3EBVA 3GQYA 4NYYA 3N4AA 1MFUA 4LWWA 3S1GA 1V77A 4Z17A 3U2EA 4DNMA 3DXIA 3MBDA 1F7BA 3VIKA 4XO7A 5JH1A 1NAL1 1R2RA 3R12A 1IGWA 4UFHA 3GKAA 4O52A 1DTUA 1TQJA 4NQ1A 2GWGA 4IPLA 1C8YA 4UQ9A 2FVLA 1A4MA 2ADAA 3FA5A 4B3KA 3N29A 3KDOA 1X1OA 1C7SA 3GRIA 2P5NA 2Q3RA 7PTDA 3LGEA 4ML4A 1MFVA 3RF9A 3WLSA 2WVVA 3ZQ9A 2YGYA 5LKYA 1QCWA 3G1AA 4PA8A 2YA1A 1QHPA 4GACA 3BGAA 2VCCA 3DN5A 2FFCA 4MMWA 1HXJA 2HE5A 4ZTYA 1W54A 2F6UA 3MYPA 5BMWA 2KZHA 3AZRA 3CMGA 4DJDA 4TO8A 1BYAA 2XSXA 3TA6A 4JIPA 5AOUA 4BJHA 3A3HA 5HA7A 1MMFA 2NSOA 4CD6A 2D0GA 2NLYA 1R9ZA 1V4YA 1OFRA 4HA0A 1UMYA 3DG7A 1TCMA 4C7GA 2OZTA 3QQ1A 1UWIA 3C0JA 4QFUA 2ZDSA 3CUZA 1JQXA 3GK0A 4X60A 4BCEA 4C7FA 1B3ZA 5K9DA 2QDDA 6PTDA 1JAKA 5AYBA 1W5MA 4B5UA 1NF0A 2ZZ4A 3BLOA 1JCNA 3BO9A 4GJ1A 2AL1A 3IJ9A 4S3EA 4K8EA 4WDTA 3NL3A 3G1HA 2XIIA 4X61A 2WZMA 3N25A 3CWNA 1TE1A 1HJSA 3UJFA 5KMYA 1UD4A 4K39A 4LV9A 1AFSA 3VIGA 1UWSA 2I5QA 3M7SA 1QNQA 4W7VA 3V1HA 1R2TA 4HA4A 3KEHA 1V6VA 1HJQA 3UWZA 2CBVA 4FP1A 2XU2A 1DWGM 4L9XA 4X22A 2XWEA 1R3TA 5KSWA 4RZBA 5TD4A 1GQLA 2WJEA 3VTRA 2VC5A 3WLHA 3W2NA 3WF3A 1PO9A 5LNSA 3PWIA 4E2BA 2BGSA 3WLMA 4JTFA 3N1AA 3OG2A 4ASTA 3T40A 1S38A 1QPQA 4G8TA 4IP4A 3WLQA 5D03A 1BWLA 4U5KA 5D2WA 4U2YA 1PKMA 4S3GA 4IXHA 5D32A 3ZWTA 5A6BA 3IJLA 3QN3A 3SUUA 2R24A 3KZSA 2DZTA 6XIMA 4JX5A 3H54A 2C8NA 4BF7A 2V0TA 3SB0A 3EB3A 4JHOA 3S3GA 1OIFA 5HDRA 3GR4A 4GZ7A 2TMDA 4S1FA 2NQ9A 4FXSA 5D38A 2VTFA 5G4WA 1R2SA 3FVDA 3VIFA 3BARA 3A4XA 2GWNA 3I6TA 1OX5A 3KW3A 4DJED 1CGTA 1B9ZA 2QCMA 2QDGA 4F40A 1OFDA 2XIJA 3WL0A 3CV1A 1WXYA 5HANA 4NAFA 5ENLA 4M6QA 1RV8A 3FY1A 1PDYA 1LQ2A 1SYTA 4OECA 3NURA 3G1YA 2JALA 4Y8FA 3V7PA 3B4YA 3CUGA 3POHA 4PN2A 2GFTA 1DYSA 1TRDA 1OABA 1XPGA 3ARXA 6ENLA 2FYMA 2F8QA 4KRTA 1VFUA 1D3CA 4LXFA 3KBWA 2NUYA 4EK7A 3R8RA 3V35A 1MW1A 2PTDA 2FTWA 3H2OA 4C6MA 1R7OA 2WMGA 3LU2A 3TAKA 4ZXLA 4JOMA 2W67A 3T6CA 3WMSA 4C1NA 4HNLA 3TLQA 3W2KA 5EMYA 4P8UA 3F4WA 2Q01A 4UOZA 1U1JA 4OQVA 3VGGA 4LUTB 3PTQA 3U57A 3MZNA 3QMSA 3KM8A 1AW5A 4Y96A 2I1OA 1W2PA 2OQLA 2Z6IA 1W6TA 4A35A 4QNEA 3IIPA 3U7BA 5LGXA 3U0HA 5G4HC 3ANUA 4MB3A 5CH9A 1S2VA 4UCGA 2Z7GA 5A2AA 1YHTA 4JTGA 3FEQA 2WYSA 1LLOA 3S1WA 1NOFA 4MY9A 4S3JA 1BFNA 1HT6A 1Q7MA 4DQWA 1RPKA 4QS5A 3QHMA 3GY1A 3UA3A 1J0HA 3WQGA 3I68A 3WFLA 2BY3A 3CIWA 4QLLA 3PZOA 3E12A 1JPMA 4IUGA 3T08A 2INFA 3UWVA 2IKHA 3W9ZA 3ARRA 5DF0A 1TIWA 1VPQA 3OBAA 3GHRA 3GAKA 1Q2RA 1U5JA 5G5IA 4LH8A 3W1XA 3AHZA 3VD7A 4P8XA 3WH7A 1NH6A 1QI3A 4JTLA 3ME3A 3WQFA 5CPNA 5I06A 4B5XA 2V68A 5ABEA 4GVHA 5CSRA 2WMJA 1G0CA 2XN1A 1GQKA 3M6YA 1VC4A 1HG3A 4LS2A 4R5EA 3RHGA 3TLLA 3WNKA 2V3FA 4ENLA 3EZ4A 4M8UA 4W84A 1JEZA 5K4XA 4UR7A 2H9AA 3N2BA 3JUGA 5BROA 1QAPA 1P4CA 4CD8A 1A5SA 4GUJA 3S1VA 5I02A 4X0VA 4LW7A 2X40A 4IQLA 1UBPC 4N6EA 4NY2A 4EVZA 4KETA 2QJGA 3CPRA 4RLIA 4RNJA 3CGTA 4CNPA 2DUZA 2EHHA 2YLLA 2WANA 2R9RA 3ARPA 4INFA 3CL7A 3SIMA 4JCMA 5L6UA 2LLEA 2DQXA 1O60A 1V3KA 3ABOA 4DN1A 1FHUA 3O15A 1MZHA 1UOKA 3H7VA 4XD5A 1QW8A 1XL9A 3VNLA 4N9CA 3RITA 3MWCA 3U6WA 1K77A 1E9IA 1BSLA 1FWHC 3FEMA 1EPVA 2QYGA 3PSWA 1C90A 5TNVA 2V6AA 2VGIA 4PCNA 3SCOA 4QLJA 3BLKA 2VX6A 3AJXA 3LM7A 4YTTA 4FX7A 3S46A 1AH4A 3BCFA 2CU0A 5CZKA 5G1MA 5HNUA 5HJXA 1NWSA 4AFYA 4U31A 3VNIA 4DWSB 1ZALA 5AYXA 1FDYA 2PS2A 4ZO7A 5I09A 4MPQA 3KBNA 3NZ1A 5C7VA 3W23A 3WH6A 1PZ2A 1THFD 1J0YA 1BYDA 2VURA 3ZR6A 1EJ7L 2W3ZA 3GVRA 4N2YA 4KCWA 2JEPA 3KOXA 3L67A 2QCHA 1PIFA 3EDDA 4CVWA 1OG6A 4IGNA 4LAUA 4K68A 1P6WA 4W5ZA 5IM51 4JD4A 5AYZA 1FCQA 2O9OA 4QJ3B 3SCQA 2BGQA 5EMUA 4D6GA 1E6PA 3B0VC 1EB3A 4QQUA 3KTCA 3QTPA 4DJDD 3TQ0A 4P8WA 6REQA 4NILA 4JBRA 4XD6A 4HSOA 3QSRA 2VX7A 2CITA 2X0YA 3TV8A 1E1FA 1KM2A 1L0PA 2VDIA 4TUFA 3KX6A 5CZJA 3UVIA 4AUBA 1BEUA 1OADA 5HMDA 4H8UA 4IMGA 3EX6A 1AQFA 1KFEA 3E2RA 4HBKA 5JH2A 3C6CA 4O10A 3T09A 1DJIA 5DXXA 4HZ8A 3W7KA 2WSQA 1NP2A 1V0KA 3MTWA 7TIMA 3UG4A 4DZAA 3GZ3A 4NZFA 1QFEA 1NDZA 2KX9A 1SR0A 2CC0A 3QRHA 1R30A 2ATSA 3HIJA 1TV3A 3AYTA 1VJIA 2J77A 1IR1A 4Q7BA 2XGIA 4RE4A 5AVHA 1KBJA 4GJJA 4Z0JA 3UGVA 2Y5EA 1QXLA 4WJ8A 3S5OA 4HIBA 1UZHA 4FHAA 3KBJA 4AAJA 3WMLA 4NJKA 4GISA 4IP5A 1KBLA 4PTDA 2WVSA 1D7FA 1K9EA 3LNPA 2WMKA 4EWND 1REQA 1JDFA 4NIRA 1XLHA 4N9EA 2YYUA 2CYGA 3UU0A 1O66A 4I6VA 3LENA 2P10A 3OG3A 2NWRA 1BWVA 1IEIA 3G2GA 1SMDA 2DJLA 5A6BD 3GXFA 3VM7A 2B7PA 5LGZA 5D8ZA 3FW6A 5FCZA 3MDWA 4RL3A 4X3ZA 4JN6A 4PC8A 3EMCA 1VHCA 4M7SA 4DRSA 3OGVA 4JDYA 4M80A 5DCDA 1ZRQA 1ZBKA 4RE3A 3PUOA 4ZXOA 5G1TA 1EBGA 3T4WA 1SMAA 2XTKA 1Q65A 2NWSA 4RZ5A 1FKXA 1TV4A 5AC6A 3VABA 2CW6A 2VKZG 4D1IA 3L5MA 4LUSB 1PKYA 4AZ7A 1TZ9A 3DEQA 5A8GA 5B80A 1OEPA 1V6XA 3VPLA 4FI4A 3QR0A 4GD0A 9XIMA 2RGMA 1SFTA 3AZTA 2AAAA 1N8WA 1UP3A 2WNNA 1GG1A 1TPFA 1Y5WA 2F2KA 3ZZ1A 3UP8A 5HXMA 4FK9A 4PMUA 4R85A 3W02A 1UWAA 2J8FA 1DTNA 2WAGA 4HTYA 1UUQA 3OLGA 1RK6A 1MWOA 4GZJA 3E0IA 3P80A 1YBQB 1LT8A 4YTUA 5EBUA 2PTWA 1FBAA 1XBYA 3P60A 3M0IA 3QKZA 5U7SA 1QWKA 3E9AA 5CEWA 4TV6A 3U2OA 2VZTA 3FJ4A 1ZJIA 1GTHA 5ECVA 1R86A 3BMXA 2D23A 1I8JA 3GTXA 4RDWA 1Z69A 2V5KA 4G2DA 4XUYA 1ME9A 4CD5A 3F2CA 1V3LA 4EPBC 1Q8AA 2YL9A 4NZ1A 2J79A 1L8NA 2Z24A 2DSWA 1YPXA 4H9MA 1FP8A 3O2LA 5E9AA 5KTLA 3P3BA 3U8GA 1H1NA 3QY6A 3AS2A 3C0QA 4RV8A 4RNFA 2WWCA 4NU7A 3BV7A 4BKNA 1Z48A 2PLCA 3IGUA 4J3VA 4ZO9A 1H60A 4Q8OA 2IXUA 2WLYA 1CB2A 4O17A 1FQ0A 2YCEA 1TPH1 3NWRA 4B9ZA 1ISYA 3GTFA 1ZAIA 4XSMA 1IZKA 1OCNA 1EH9A 2OYKA 2Z1KA 2Y7DA 3RK8A 5ABHA 2I9EA 4JQ4A 4WLCA 1X7FA 3V5FA 6CGTA 3WQ8A 3DECA 1FWSA 4AW7A 1UQYA 1FFRA 5A5WA 1XIHA 2BG5A 3L4YA 4RE0A 2POTA 4I5UA 1UYQA 5HUPA 4DM2A 1EIXA 1H1YA 1OVDA 4TIMA 4AU0A 3K13A 2H3BA 2W5FA 4D9PA 2VVSA 1WUEA 3P61A 4GYJA 1GVQA 1TVPA 1KBIA 1ME8A 1NFBA 5LYRA 1VIWA 3ZXWA 1EP1A 2P8BA 3O6AA 3LI1A 5I0DA 1SJDA 4RUBA 5A8MA 1E56A 5I24A 3M41A 3EMQA 3VOHA 2YDAA 3Q94A 1R9YA 1KM4A 3WMCA 5FEXA 3BAKA 3T9PA 3EWXA 1S5VA 2WC3A 1X98A 4LANA 4GPNA 3RRXA 1BVZA 3FHQA 4UIOA 4RKAA 4EXAA 4GI6A 1R3WA 3AWNA 5CBBA 3W85A 4CQBA 4FXJA 3C52A 1HUVA 2PCQA 5D2YA 3GHSA 1GJPA 4NASA 3AU6A 2PDUA 4QEEA 1QHZA 1F05A 3BV4A 4MYXA 1HN1A 4LC6A 4WOZA 4PUEA 1EUNA 4HU3A 4ZMGA 5AC4A 4XSLA 1Y7VA 4RX0A 3C3NA 1V3JA 1V6WA 3BW4A 3LERA 1GQIA 3H6OA 3FOKA 5LNVA 1WO2A 1QNPA 4PEEA 1FY6A 3EWDA 1NWTA 2PDLA 1NARA 3QGVA 1FWJC 1KD0A 4MZ1A 3FK4A 4K1GA 3DYMA 4UNLA 3G24A 3ERPA 4HHHA 2P76A 4OV9A 3AXXA 3BUVA 4CEUC 5K9CA 4UNIA 4YLWA 1XICA 2IPWA 2NQZA 4MZYA 2A0NA 3LCGA 1J79A 3R11A 4EXQA 2ZUMA 3PZNA 3WUGA 2ZXDA 3W25A 4DPQA 3AOFA 3GWQA 4ZB0A 4YWSA 2DIKA 3AIBA 5D9NA 1HKIA 4GYPC 3MPGA 3NQCA 4TQTA 2YZ5A 2D1ZA 3THUA 4ROQA 4C5ZA 1XW8A 4P7LA 1MXSA 1JI1A 2ZXAA 1SM9A 4MNJA 2EPMX 4W8AA 3VNKA 3UR7A 2DIJA 4EOUA 1V03A 1UJQA 4OUEA 3EPMA 3PY2A 4GQQA 4JS3A 4HOZA 2DZUA 1VLIA 1LOSA 4QGCA 3PPFA 1RJQA 1FCUA 3GIYA 4GRSA 1GOMA 1QTWA 5DMLA 4AIUA 3STEA 4NRSA 4PB3A 2WM0A 3W7QA 3LSCA 1L6FA 5XINA 4DF0A 1CCWB 2IKGA 1XINA 2YCKX 1E72M 2GVLA 3WYZA 2Z1SA 2AKMA 3H2FA 3RCMA 3SAZA 1OHLA 3W3OA 4QJ5B 1R3RA 5BCAA 1J10A 1E6SM 1W9DM 5DCBA 3UJSA 2H90A 4LYQA 1A49A 2VM8A 1UW9A 3W2MA 1KM1A 1GOKA 1O5RA 2ONEA 3T2PA 1WKFA 1ONWA 3MP4A 3UD6A 3TAOA 2W61A 2WSRA 2OFJA 4WEVX 4C7DA 4FX6M 1MRQA 3PP7A 3DERA 3OB8A 2XSAA 1H4PA 5A8PA 3H26A 1AQMA 1FTXA 1VRXA 4OBTA 3EGJA 3CM4A 4Q8QA 3TA9A 2VFHA 1TV2A 1GW1A 3FGCB 4PMQA 5HQEA 4HOWA 3LLFA 2VGBA 4V1YA 3KBMA 1VBUA 1OB0A 3LGDA 2WW5A 2PLMA 5CJ5A 1Q6EA 4U5IA 2CXEA 2EXOA 4P7RA 4F0LA 1TO3A 3B8UA 4ACYA 4HNTA 2HS6A 3OPSA 4AHOA 1XIGA 2NX1A 4PTMA 2PDGA 3VKCA 3ATYA 3KDNA 3RNDA 1UUMA 2PD9A 1OFAA 2ZOXA 4XIAA 4GY1A 1E3XA 4PMVA 1FWDC 3ARSA 1W9PA 4MOZA 4DF2A 1KBKA 3LEPA 4EX4A 3HQOA 1PEZA 1UKSA 2JBMA 4GG9A 1V6TA 3MDUA 4V2XA 4CQ8A 1RY0A 3RYSA 2OWXA 2OWWA 3FDKA 5C9RA 4N4PA 2O92A 1JULA 1K7XA 1IF2A 3RG6A 5D2TA 1QI5A 3WF2A 4I9MA 2IUZA 3R89A 3V75A 4K37A 4I5XA 1VFTA 3IGHX 2GYIA 2ZA1A 2QUVA 3BICA 6XIAA 2FMOA 2X1IA 5CCZA 4QE4A 3C61A 4KWWA 3RN6A 4GINA 1IXPA 4LUTA 4DLFA 4HU8A 1IEVA 2OSYA 2XVGA 3W7OA 1BVNP 5FAGA 4JFUA 4K36A 1UR3M 1UIPA 2F38A 4FR1A 2JEQA 2X1SA 4DHGA 3IUHA 3HTWA 4M0XA 4YS1A 1A53A 3RIKA 1TWZA 3KXQA 1E6NA 3CUFA 2CLFA 1C7TA 2DZBA 2V9DA 3VIJA 3LQLA 4KBXA 4AX7A 5ABGA 3VNMA 2YA0A 3TOPA 3IJ7A 3SQSA 1KM0A 3ZLFA 4G1KA 3U48A 3GHTA 2HMCA 3LHWA 3S4TA 1T40A 2VC6A 1Q6RA 1Z89A 4L65A 3GBEA 1OG0A 1O5XA 1UH4A 4D1JA 2G3NA 3MSDA 2Z2UA 1NWUA 3L66A 3GR8A 4O0KA 1Z8AA 2PZNA 2QUMA 1XIIA 2PTZA 1TX2A 2PZ0A 1O1ZA 1FHDA 3CK5A 1QI4A 2VO5A 3K4WA 1PCKA 3ZJKA 1J0IA 1IGSA 1BLIA 4IPJA 3B9EA 2XINA 1VD6A 1UZ1A 2XHYA 3GXPA 2BV9A 3EOLA 3VC5A 3IV3A 1CWYA 1SFSA 1BG9A 5REQB 1U1UA 3BURA 3AS0A 4EPKA 3DFQA 3W1NA 4YYCA 4GBDA 5AYIA 3S9ZA 1GZ1A 4YVXA 3UJ2A 2WSPA 2O4QA 1E0VA 2ZWZA 2QJMA 1PUDA 4UTJA 3URBA 3JR2A 2DSZA 2HPMA 1PTGA 3T81A 3VVGA 4O1EA 4H7VA 2INZA 5HPCA 2PF0A 4L6HA 4UCFA 2ACQA 3TYUA 1GVRA 2I7GA 3EWYA 2ZE3A 4M56A 4O19A 4U33A 3R79A 1HJUA 3M0ZA 2DU2A 3H22A 2E5BA 2REQA 4GLEA 1SO5A 3D0CA 2QUUA 2GVEA 1KR0A 2BFGA 1POJA 1LYXA 1XI3A 5H8UA 2I5IA 2Y5SA 4DIAA 1VQTA 2CERA 1J0ZA 5FSEC 2WHMA 3S2JA 2ZWYA 1DPMA 2PWVA 1XLMA 3ITOA 4WSJA 1NTHA 1RVGA 1F76A 2QCLA 4JIRA 4OBRA 4LYKA 4ZO8A 3TZNA 2WKLA 3GLCA 3LHYA 4LVDA 2A3LA 4OBSA 1QK0A 4PMNA 3A64A 1GEHA 4JQ1A 2NT1A 4PBFA 4IPIA 3B9OA 3W1AA 1J0JA 4XAFA 4BA0A 3AWOA 2Y1HA 4LV4A 3S2MA 5LZLA 4LVGA 4IL2A 2HPIA 3WK3A 1F3WA 3LNMA 2ON3A 2ALRA 3C5QA 5BWAA 1XR2A 1GVYA 4ORIA 4X63A 3LZ5A 4CU8A 2XWDA 4HPJA 4LY8A 1BRLB 2NXGA 2Z1VA 3GW3A 1JCLA 2WQDA 3UYIA 4R7WA 1O4UA 1CGYA 1LCOA 3MV01 2J78A 2EF9A 4JTQA 3PPGA 5AHLA 2VWTA 3WKZA 3CTTA 2FVKA 3C4UA 3LCLA 6A3HA 1H7XA 4AZIA 4FOKA 4HPXA 1VEPA 1XD1A 3SRFA 3QJAA 4J28A 5DANA 4M1RA 4B91A 4GXMA 2ZE0A 1EHAA 4FNRA 4J35A 3BG9A 4AVNA 5AC8A 1CYGA 1NELA 4UTUA 3VKJA 2PI6A 5DQPA 2I5GA 4UWMA 2WLZA 4BY3A 4KWOA 1Y8BA 5BRQA 3VGEA 5JQ9A 2RDWA 3VDCA 4AQLA 4DO5A 4XBJA 3UF9A 1W3HA 2DZVA 3QR1A 3W7RA 2YFOA 4E5TA 1TELA 3UZ5A 3OEXA 2G41A 3BAXA 5BXPA 3TKFA 2BOFX 5DMMA 4MB5A 4ERGA 1JYXA 5J5RA 3F2BA 2EPOA 4XWUA 4MNLA 2R6OA 2IPGA 3TW7A 2BHUA 1LOLA 3BC9A 3W2UA 5KZ6A 4KGLA 3ZVHB 1XYAA 4A3HA 2JFEX 3LUTA 2ZX8A 2CCRA 4UMAA 3DGBA 1K1DA 5EMJA 4W88A 4S3DA 1TJPA 3NSNA 2PDMA 1H5YA 4K1WA 3NQMA 3RLGA 3FJNA 3UT0A 3QYQA 3PZGA 1ZB5A 2D20A 2CXGA 3O6DA 2DVXA 3G1RA 3TZFA 3M9YA 1J12A 1ONRA 1EJXC 4H6QA 3EX4A 2D3LA 4M6UA 3VNDA 1TZZA 1SVDA 1VAHA 5AHEA 3QLDA 4LCQA 3W24A 1A5NC 2D73A 3LD5A 3U3HA 3TYCA 1JYWA 1E4MM 2YKKA 4E38A 4GIRA 3KOWA 1EZ2A 4ECLA 1I60A 1VFLA 1FCVA 1UD5A 2PU0A 3BMWA 4A4AA 4O1BA 5DY2A 4NI8A 5AHMA 2G3IA 3HGRA 3LCFA 4ZE5A 3BAIA 4GABA 5CGTA 3OZMA 4Q4MA 1NDWA 1IWBA 1PXGA 2RDUA 2J9YA 1SQ7A 2X09A 1UWUA 3KRUA 3M0KA 4G9PA 5CPLA 3GO2A 1EYEA 4IGMA 3STFA 2ZA3A 2MNRA 4R27A 4LUSA 3TC6A 1POKA 2W62A 1W32A 3UZWA 2WMFA 3I6EA 2J6XA 1JNDA 5JIWA 3E38A 4AHPA 2GVYA 3DFSA 4DXVA 3BGGA 4J2MA 5C2CA 1XLBA 5BMXA 4PBEA 1JRBA 2HEJA 3W75A 3OTRA 4GI8A 1J2BA 3OGRA 4OT7A 1GJWA 1I45A 2X42A 2YCLB 7ENLA 4H2CA 3I65A 3CZGA 4IP7A 4E8CA 3M4HA 1QHOA 4LYPA 3HG2A 3I7SA 1XLCA 4GZEA 1P0DA 1HKJA 1JPKA 5DEZA 3UWQA 1PZ1A 3LLDA 1S5TA 1UMLA 3VINA 4URIA 5LIWX 1MYRA 3M0HA 1JFXA 4UR8A 4LBUA 3AMCA 3SRKA 1UKPA 3OLEA 1X6NA 3SFWA 4A8NA 3MHFA 3TTQA 1XD0A 2ZCGA 3GNRA 5A94A 5ECUA 3GC5A 4O15A 2XFWA 1OWQA 1I2PA 4QNWA 4ICMA 4QCEA 3MVTA 3ZT6A 4LNCA 3B9DA 1E0WA 3W1PA 1B30A 1FXQA 1XRVA 2HK1A 2ZRUA 1P1XA 1Q4WA 4BZYA 1Q6QA 2ZTJA 2X0HA 2ZUSA 2YFNA 4D6HA 3VUPA 1C92A 3AIRA 2Z7KA 1PIGA 5I23A 3VZYA 4HMNA 2W4XA 3ARWA 3MO7A 3RLHA 3TFCA 2CZ5A 4WUIA 3GVQA 1M7JA 1YDNA 3S5ZA 2ZC1A 3ABRA 2EKGA 1B3YA 3AXKA 5I03A 4CU7A 1Z41A 3DFTA 3IUIA 4H9UA 3OQEA 4AH7A 3OW1A 2PWHA 1HL9A 3M5VA 5FA5A 3TOYA 3EOOA 2DSKA 1UWRA 2UWFA 3RX3A 1RH9A 3GVWA 1H62A 3M0JA 2OR2A 3UWWA 3N2MA 3PG9A 1NDVA 4RCXA 4GX9A 3J7HA 4CN6A 3LI0A 3WNMA 1LDCA 3S1UA 1EX1A 3HQ1A 4XISA 3SADA 1P0NA 1XLAA 2J9XA 1PAMA 4IIFA 4GBUA 3W88A 1S2TA 2ZRYA 4JX4A 1TCDA 4JTRA 3CHCA 1GW9A 4HP5A 3S42A 4DELA 2PDXA 2E09A 3FXGA 3WNNA 4DYJA 1T8QA 2YL5A 1XPYA 1S3TC 1MQRA 2V2CA 1QOQA 4ZFMA 5TIMA 2ZQ0A 1ADDA 4JZ5A 4W8BA 3GH7A 3Q4DA 3LPFA 1W3JA 3HURA 4L4PA 3WD0A 3SIZA 3STCA 1SZEA 2DVTA 1V0MA 2A3AA 2YX0A 3P93A 3TDFA 3E96A 3N19B 3PANA 2BY0A 2CLOA 3M7WA 1P0EA 4TTGA 2Z00A 3E6EA 4U3AA 3WJYA 1IEQA 1LWHA 1XCWA 1V6UA 3VNZA 3UY7A 4WY0B 1XLEA 3MB9A 1B90A 3I3EA 3I6RA 2OLAA 3KRSA 1OFOA 5FF2A 4WGXA 3ALGA 1E4NA 3WY1A 1CGWA 3R1ZA 3H4GA 4MY1A 4KIRA 2Y70A 4D6IA 3G77A 1BGGA 3LPPA 1B54A 4MADA 3QVQA 3QZAA 1FOBA 4L6DA 1ECQA 4L6OA 2R82A 3M0XA 2ZFAA 2J7GA 2SFPA 1JCJA 3V3WA 5F2MA 1UKTA 1W1PA 3DFOA 5HWMA 1S3HA 4ATWA 4MWAB 3QHOA 4L80A 2X7VA 3VE7A 3EKGA 3UGRA 3M5XA 1XIMA 3TH6A 4J9JA 2FQIA 4ZSUA 1UWTA 4H9TA 4O4WA 3PZUA 5FJOA 2GVGA 2QXWA 4C91A 3NZGA 3LLXA 4QLKA 1WDWA 1UHVA 5FF0A 3TP4A 3WJXA 1GPWA 4TVCA 1CLVA 1G67A 4FOUA 2YDRA 2EJ1A 3N9RA 3DAQA 4EANA 1X1ZA 4NXKA 3EEZA 2CESA 3H21A 2VD8A 4S3AA 2E6FA 3W1TA 4K8HA 4WKHA 2YCJA 2C79A 1XP3A 4H3DA 3PZ9A 2R94A 4QAIA 2DW7A 3ZT7A 1WBHA 1JDDA 3TTOA 4IX2A 3OP2A 1EF3A 8CGTA 1XYMA 4DZIA 2ISWA 3W38A 1JZ6A 5EU9A 1WDQA 2FB3A 5D2VA 2ZX5A 1EYWA 1QOPA 1UIOA 1H5VA 2FDSA 1EGZA 4MY8A 3CWOX 1LRNA 1WQ5A 4OKDA 1RR2A 4L9ZA 3KVMA 5IBXA 5FF3A 2W27A 2VGGA 4GNKB 2J74A 1X8FA 1XIBA 2VDHA 1YDOA 5XIMA 3CT2A 3BVJA 4LB4A 1JNEA 3IGSA 2BOEX 1C93A 2ALDA 4HZ7A 2DPEA 2XSBA 4J7RA 4NHVA 3IS4A 3VGHA 5ABFB 3UA4A 3B4UA 2UBPC 1VENA 4LS0A 2OZ3A 3VZZA 1KFLA 3TW6A 2OLHA 5HULA 3L2LA 1VBGA 3VKKA 4XTDA 5F1VA 3WLLA 5C6MA 1P6BA 4FA3A 1Q3NA 3W7GA 3ZO9A 1VP5A 1E73M 3B04A 3F03K 1A3WA 3MCMA 4J3ZA 1J6PA 4JYEA 3RM8A 2VT0A 3NQEA 1HP4A 1WDRA 1FP9A 2OEMA 3VDBA 2I16A 3HMCA 3GNXA 5GNYA 4RW3A 4FNSA 2VI0A 3LTYA 4GQBA 4MJMA 3W73A 2OU4A 1K6AA 1KTCA 2WJDA 1OZMA 1TQXA 5CJMA 3FCPA 1A5BA 1TTIA 3LGGA 2AMGA 1KRMA 1VEMA 3UXAA 1XG3A 3QLLA 1HVXA 4GQRA 2FKPA 3MP3A 3XINA 2W66A 1US0A 1L2QA 3TTEA 2C15A 5EB8A 2J47A 1G4SA 1TPUA 2AQWA 3EXRA 3BWWA 1WZKA 2C71A 3NQ6A 4LVFA 1IR2A 1HFBA 3PTDA 3CEUA 4WJEA 3C2FA 1KFJA 1GQNA 1PWLA 3DUGA 1ZGDA 2EAWA 1WDSA 3GFXA 4I3GA 3TCEA 2X1RA 2QW5A 4D6CA 2QEZA 5JBEA 4K38A 4WDWA 4IIBA 1LOQA 3S5YA 3E0LA 5CPQA 3AHTA 2OPJA 2XPKA 1Q5MA 1T5AA 1UD8A 3PSVA 5CPTA 1VKFA 4O16A 4B3LA 3B9NA 3K4DA 4I7WA 3GXDA 4EIVA 3GFYA 3MUIA 1KCLA 1V79A 3RPDA 3IVUA 4PUNA 3N73A 4Z1DA 3MY9A 1I1WA 4ADUA 5DBTA 5REQA 2VENA 2ZZ6A 1K8ZA 4GGHA 2HXUA 1XCXA 3T4CA 4HK6A 3THQA 1BTCA 3HMJG 3N04A 3AMKA 4AVOA 4WOQA 3ZT5A 4XAGA 4H9XA 4JFTA 3FAXA 3TEVA 1YTEA 3T78A 3L4UA 3S1XA 2Y8VA 3KP1A 4P2VA 2Y4SA 5U4NA 3APYA 1OYAA 3QTGA 3NPXA 3L7RA 3G1XA 3MHUA 2OX4A 4CLMA 4LRSA 5CC5A