1UROA

Uroporphyrinogen decarboxylase
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
357
structure length
357
Chain Sequence
GFPELKNDTFLRAAWGEETDYTPVWCMRQAGRYLPEFRETRAAQDFFSTCRSPEACCELTLQPLRRFPLDAAIIFSDILVVPQALGMEVTMVPGKGPSFPEPLREEQDLERLRDPEVVASELGYVFQAITLTRQRLAGRVPLIGFAGAPWTLMTYMVEGGGSSTMAQAKRWLYQRPQASHQLLRILTDALVPYLVGQVVAGAQALQLFESHAGHLGPQLFNKFALPYIRDVAKQVKARLREAGLAPVPMIIFAKDGHFALEELAQAGYEVVGLDWTVAPKKARECVGKTVTLQGNLDPCALYASEEEIGQLVKQMLDDFGPHRYIANLGHGLYPDMDPEHVGAFVDAVHKHSRLLRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human uroporphyrinogen decarboxylase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords PROTEIN (UROPORPHYRINOGEN DECARBOXYLASE)
total genus 129
structure length 357
sequence length 357
ec nomenclature ec 4.1.1.37: Uroporphyrinogen decarboxylase.
pdb deposition date 1998-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01208 URO-D Uroporphyrinogen decarboxylase (URO-D)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.210 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 1uroA00
3GVWA 1R3SA 3GW0A 3GVQA 3PPGA 4L5ZA 1UROA 1JPIA 2EJAA 1U1UA 3GVVA 1R3QA 4L64A 3CYVA 4ZTXA 3L7RA 4AY8A 4AY7A 1R3WA 3PPFA 4ZR8A 4L61A 1JPHA 2NQ5A 1R3VA 4L6HA 4WSHA 2Q71A 1T7LA 1R3TA 2Q6ZA 4L65A 1U1HA 1R3RA 4ZTYA 1YPXA 3PPHA 4QQUA 1XDJA 4EXQA 1U22A 1J93A 3BQ5A 1JPKA 3RPDA 3T0CA 1XPGA 4L6OA 1U1JA 3BQ6A 3GVRA 3PPCA 1R3YA 2INFA 1XR2A 3GW3A
chains in the Genus database with same CATH superfamily
5HULA 4R85A 4NNBA 1H7RA 5FJPA 3HGRA 3UXKA 4LU0A 1KTCA 1VRXA 3C56A 2IUZA 5XINA 3UA3A 1JUKA 2QCEA 3L23A 3UG5A 2XIOA 4N42A 1RD6A 5A8MA 5ECUA 4O28A 5GJNA 1DWJM 5DF0A 6REQA 4US5A 3SUSA 1UA3A 4LC8A 1W1ZA 3WN6A 2Q8XA 3FIGA 1QASA 3N19B 1CGYA 2A7PA 4N02A 1FWNA 4GH3A 3M7WA 2VI0A 1GVOA 2KAUC 5M03A 3WMSA 3PJTA 4EPBC 4ERIA 1H4PA 1JYXA 1QBAA 1UP2A 4F0KA 3VIJA 4UR8A 3FDGA 3DENA 1H7XA 1K9FA 3NQEA 5CJNA 3VKBA 1AVAA 1J96A 3WQDA 4E5TA 5EYWA 4CN6A 3PWGA 4S3CA 4HPJA 3TOYA 4MYAA 4X60A 5CPLA 1LRNA 2E25A 2ZUTA 3SQLA 5HMFA 4UOJA 3H8AA 2ZXQA 4XIMA 1AMYA 5LNSA 1ZBWA 3MT1A 4G9PA 3W7RA 4MTVA 5DELA 1PZ2A 5A6JA 3WQWA 5CC6A 4P7OA 4QBXA 2KZHA 3N3TA 4V1YA 1RY0A 1GPFA 1NQKA 5CPQA 1EP1A 3PC0A 5JH1A 1GW9A 3GW3A 1LWJA 3CO8A 4Q4KA 2FYMA 5E93A 2OG9A 3R0KA 3TAKA 4GPNA 3TYUA 4X0VA 3KLKA 1RP8A 1UW9A 2YBUA 4NNCA 3F4CA 4QM1A 4OIFA 2YXGA 3M47A 1J0JA 1M5WA 4I90A 2G3FA 3S6DA 1W56A 1HFBA 2HQAA 4I6KA 4ZSTA 3KRZA 4LEFA 4AVFA 3AICA 4LXFA 3RJYA 3B4YA 2QUVA 4H9UA 5G4EA 1KTBA 4OE7A 3T0CA 5FJTA 1DXEA 1KV8A 2X0YA 3IUIA 1NARA 3AHTA 1O12A 2NX9A 2WMIB 5D2TA 3GBDA 3PZMA 1PDZA 5FEWA 2X7WA 4LANA 4Y7EA 1UH2A 1TJ0A 2WSPA 3HQNA 3G1HA 2YX0A 4IQDA 1TV2A 3VC5A 2WANA 4GA8A 3T8LA 3W7LA 3EEGA 1XXXA 3DFSA 4DHGA 4HNOA 3S9ZA 2V38A 4LVFA 4MB5A 2G50A 2NV9A 1X96A 1V79A 2ZXAA 3IV8A 3QYQA 2QF7A 3R58A 1PIFA 1ZALA 2BXYA 2ZZ1A 4WSJA 4GVGA 3GXDA 4HPNA 3NZPA 7XIMA 2XIMA 1E4IA 1Z41A 2E77A 3L5AA 1HQTA 3VNYA 2PDNA 5LIKX 3W1TA 3ARYA 3GH5A 1BWKA 3MKVA 3BQ5A 2R1MA 3TTYA 3W7KA 2JQXA 1R47A 3U5YA 1J5SA 3IJ9A 2O7SA 1M65A 3W1PA 3F5LA 1W32A 4MNJA 1PSCA 3QZAA 4R9OA 2WSYA 4HK7A 3WF1A 3SY1A 1AJ0A 3UWEA 2ZUWA 4ICNA 1WO2A 5M17A 3GRIA 2PUZA 1XLFA 3GXIA 4NAEA 1XBZA 1Y5VA 3RUBL 2OYMA 4J9JA 3WBAA 3SUVA 2V5BA 4O0QA 4ZQNA 1G9HA 3VZYA 1CCWB 5T26A 2J7HA 2O4QA 1JR1A 1Q6RA 3ANYA 4YL2A 3SUUA 2VWTA 4M3PA 2Y2WA 4QEHA 4NI3A 4LUJA 3V7PA 3RLGA 3G1SA 1XUZA 2OODA 4JIHA 3TWAA 1J11A 3BLKA 4W8AA 4AWTA 2QAFA 2DVUA 3W2JA 2HNHA 2GUUA 1UQZA 4N2YA 4JIIX 2DT1A 1PX8A 1ISWA 1ONWA 3HG3A 1H50A 3M44A 4ZVJA 3WD1A 1FWIC 2E4TA 4IP4A 2DJLA 1QDSA 3OBKA 1JZ2A 1JPDX 1GOIA 1JPHA 2F2HA 4ZXLA 3W25A 4DB7A 4QFUA 3KZSA 4NIRA 4JL1A 3KEHA 4PTDA 2DZVA 4C1KA 3KDOA 4NAFA 3RXZA 4DEFA 1WAWA 1UR9A 1FCBA 2XGIA 3GBEA 2G4JA 4GYPA 4IOTA 4QLJA 4UTTC 1R7AA 2E09A 4LF2A 2BGQA 4TU1A 1H61A 1R0MA 2PGEA 4C6LA 1WDWA 1P0BA 2I1OA 5E6ZA 2WAGA 4RNFA 4DPQA 2Y8VA 4E3VA 5IDZA 4NZ1A 4AHOA 2E5BA 2J27A 3ZM8A 1ZCCA 2ZUVA 2J78A 5F2GA 4KMQA 3BOXA 1FWCC 1K8ZA 1SO4A 4LEQA 5FJOA 1ECQA 2EPOA 3D3AA 3UR5A 1NH6A 3G6MA 1FRBA 4UTIA 4P8VA 1E70M 5H1WA 3EX1A 5C9XA 4PFMA 3G3DA 3SCSA 2NLYA 3L4UA 4DJEC 4Z1CA 3EX6A 3ONBA 4J4KA 2RUSA 3N1AA 2AMXA 2WYSA 3GLCA 3GUWA 1WOBA 3N25A 3CZ8A 3KL5A 4WR3A 2REQB 4IG2A 1B3WA 5C9ZA 2WVVB 3UG3A 2PDQA 4FAMA 3WJSA 5CZ0A 3VIIA 3XINA 3FHAA 1C8QA 4LY8A 2VR5A 3B8UA 4JTTA 2YBVA 3E2VA 3VGBA 1S3TC 5ABEA 4A22A 3N12A 3TTEA 2PDWA 3UW6A 4DO4A 1J0ZA 1VFTA 1WE5A 2PRMA 2D2GA 2VP8A 2QUTA 3HV8A 1IXNA 4PMDA 4O14A 1V08A 1O5KA 2J62A 1N8WA 5G2IA 5RUBA 2VZUA 5AVNA 3UPMA 1S38A 2EPNA 3AJ7A 1EPVA 2BHYA 5BMXA 1X39A 3P84A 1GEHA 4OT7A 3Q2DA 2V5CA 2PC8A 6ENLA 4S39A 4ICCX 5C2CA 3I6EA 1E9IA 3BMWA 1B0IA 1EJ7L 2C13A 1VEMA 3O0KA 4IL0A 1WPCA 3QM3A 5A2BA 1Q7MA 1UP3A 1X6NA 2Y7EA 3LX9A 1Q6GA 1UWRA 1K02A 5A6BA 2WBGA 1V93A 4JS3A 1T41A 3U4AA 1RQBA 4EOUA 3TK7A 1RJPA 5HK4A 3LHYA 1C9DA 2QUNA 1Y65A 4GJJA 2YCLA 3U0HA 1BQCA 1WKDA 4WRHA 4AIUA 4IFKA 3NPWA 3CB3A 4GXPA 3GXNA 3W00A 3WJXA 2O9PA 3EA2A 3N2XA 2DFAA 2IKIA 2REQA 1M6JA 4AW7A 3A6OA 5HUPA 4DUWA 4XD6A 1V0KA 2Q3RA 3BW2A 1XI3A 3TN6A 1SFSA 2PP3A 1TR9A 3VXGA 4AZ7A 5IOBA 2XWEA 1PYFA 1CENA 1CI1A 1B5TA 1R3TA 1FH7A 1KXQA 3KTXA 1LQ2A 3DG6A 1LRQA 1Q85A 3LYEA 2D2HA 3KOXA 4AF0A 5B7ZA 2A3AA 4C91A 2WV8A 2RJHA 4BQ2A 1OJXA 1XG4A 3SRKA 1LOSA 5CC5A 1QK2A 3U8GA 3T0AA 2H3DA 1XPGA 3I7QA 1UKSA 3T07A 3CMJA 2V5JA 4H3DA 4L5ZA 3UWYA 3DBNA 7ODCA 2CKSA 3NQAA 3VNKA 1P0NA 2DVXA 3CWNA 3B9NA 4JCLA 4GFSA 4N9DA 5HANA 1ZU8A 4L1WA 3CHDA 3EWZA 3VOFA 3BO9A 4M7SA 3P0XA 3TJ4A 3RYSA 1EBHA 1TPFA 1ZY9A 3I7RA 1AW1A 2H6RA 3MMWA 4MLJA 1HKKA 3N3MA 3TTQA 1IWPA 5EY5A 3WLSA 3WLIA 1M1BA 1Z6KA 1XYCA 1K4HA 2XFRA 1EH9A 3UXAA 3E2SA 4WY0F 2FHCA 4RX0A 4GH1A 1Z8AA 1WZMA 2HZGA 3E6EA 5G2HA 3WNLA 1J0HA 3GVVA 1W3HA 1PIGA 4RE4A 3LTPA 1EIXA 5K3VA 3DFOA 3WCZA 1YDOA 4MWAD 3RM9A 3GTNA 5J8LA 4ALDA 1VFFA 4XKYA 4NYUA 3LLDA 5JMUA 4BWLC 3QQWA 2NSXA 4ZO8A 3V1HA 3BV7A 4Y9PA 1MI3A 1TPDA 3M5VA 3UPWA 3ZQ9A 1YXDA 3S1WA 4ADUA 2Y62A 3TTSA 4H6RA 1VBRA 2FHBA 1MW2A 4CQ8A 3GFXA 4HZMA 3PZTA 3SIZA 3KVMA 1H1NA 4HVXA 2VMFA 3FY1A 1DHKA 4RPPA 3DG7A 3T0TA 3PG8A 4PRRA 1M03A 3HTWA 1L2QA 4JTKA 1PTDA 3HV9A 1PL9A 3ALFA 1W3NA 1R3WA 4DM2A 4CU7A 4CEUC 3LBOA 3BE7A 3IGHX 2PRHA 4JEJA 2ZX9A 1E9YB 4AHPA 5EGRA 4GZJA 1JPMA 5XIMA 1E73M 1HZYA 4JHMA 4H8HA 2W63A 5E9AA 4QCEA 1UWSA 4B91A 3T81A 3W85A 1GOXA 4JTAA 5HR7A 3M16A 2VVNA 2I5QA 1DJIA 2OYKA 1SZEA 1DE5A 4C6PA 3MYPA 3IRSA 2X40A 1VYRA 4LBUA 1WUEA 1B4KA 1ZL1A 4C6MA 3OVPA 2R1NA 1QPKA 1YNYA 3GR7A 4CQDA 3N9RA 3UG4A 1TCMA 2CLKA 3NQ8A 4NXSA 1V3MA 5U7SA 1AA1B 3W76A 4LF1A 4XG1A 3F03K 1H5VA 4CNTA 4DY1A 3A22A 4U2YA 3GIYA 3R79A 2R14A 3V4BA 3BSMA 1T5AA 1CGTA 1VCGA 2VVSA 3BH4A 2JEQA 3LDVA 1RVKA 3EAUA 4GNKB 4OUEA 3BJSA 3RPTA 1XIGA 2WBKA 5DN1A 3FJ6A 2XG9A 4S3KA 1M68A 1UWIA 1YXCA 3QEZA 4FLOA 3OVGA 3UQNA 4D6JA 3TW6A 1DPMA 2NZLA 3THUA 1PE1A 3WUFA 1PB0A 1XSIA 4J28A 3W7EA 2EF9A 1TV4A 1N82A 2F61A 4DXVA 5GNYA 1J12A 4GGHA 3PBVA 4DBSA 4L80A 4ZFCA 4NF7A 3EPNA 2WSRA 4QE1A 3WNMA 1ZP4A 3DECA 1QI4A 3N18A 4BQ4A 1J6PA 2B4GA 3AIEA 2VFEA 4UTUA 1GYMA 2W3ZA 2J8GA 2BZNA 1VGAA 3WK3A 1PHQA 3O06A 2Q09A 2F6UA 5HOSA 4DJFC 3MMTA 4KIRA 2W27A 3S46A 1GQJA 2DJXA 2PODA 2E1DA 4R53A 1O6IA 3CAWA 2WNZA 3C61A 3N4AA 2CEQA 5CKSA 4YHEA 5EKYA 4CGTA 1V6XA 2OZ0A 1PZ1A 3MV01 3RITA 5JH2A 2QDGA 1NF7A 3TYZA 2X1UA 2F84A 3GXPA 3LXCA 4GJ1A 3RILA 3MJMA 3MP5A 1BRLB 2YCEA 4X0NA 3VYLA 3DXIA 1SR9A 2PURA 2YZ5A 1ADSA 3T40A 2Y7FA 4FX7A 3AC0A 2R1KA 4JTGA 3TN3A 2ALRA 3MBFA 3A3WA 4A4AA 3ITVA 3S42A 5BXPA 1XGZA 3LCHA 2WPGA 4NRRA 3UJ2A 1JPIA 4B5WA 3EMCA 1HG3A 4C5YA 5CGMA 4QG8A 3P8JA 4I5RA 4RZ6A 4UBPC 4AD5A 3IGXA 2GWGA 4JICA 2OWWA 2GFTA 1K8XA 1VCFA 1TO3A 1BFNA 3IJ6A 1CECA 5HXMA 2GOKA 3SCNA 2F38A 4H6QA 3TJIA 4ADTA 4N0RA 2GDQA 1V77A 1KCLA 4JDBA 3M46A 5TQLA 2ZRZA 4GUGA 4RXGA 1UPPA 4A3YA 1S5NA 3NNTA 3HM7A 4O4WA 2C6QA 1DXIA 1YNQA 3RCMA 5FSDC 4K8HA 2GJLA 1W2VA 4DI8A 1XSKA 3GKAA 1MZHA 1D9EA 4DIAA 3GIQA 1A5AA 3OA3A 1W8GA 4YCPA 1RSCA 1ZTVA 5C6MA 1DEDA 3UFYA 1EQPA 2NVAA 5ECVA 5IFTA 1VBHA 2GJXB 3M41A 3EXRA 3M4HA 2PA6A 3L21A 3U2OA 4LV4A 2V5KA 3WQ6A 1V02A 4HU4A 3K8MA 4UIOA 2GVLA 3G0XA 1FHVA 4R7WA 1EQCA 3ITYA 4L64A 1UUQA 3NZQA 4B5TA 1VJSA 3GIPA 4U28A 3U2ZA 2CXEA 4IWWA 4RUBA 3A9IA 4C6KA 1LCOA 2H9AB 2O55A 3S1GA 4JTQA 3VDCA 3MO4A 5G4HC 3QY6A 3I6RA 7TAAA 4OGZA 4YIWA 4C6DA 2C19A 4NG3A 5D2VA 4UTTA 4PMNA 3NOYA 3CIXA 4RR4A 4NSBA 3WLMA 1NDZA 1TTJA 1TE6A 4K7YA 1UD3A 5D8WA 4J7RA 1QVBA 5K4XA 3A23A 4WD0A 3S9YA 1GGOA 1EZWA 4M5PA 4GUHA 3W1NA 4KWOA 3ZLFA 3QMTA 3EKZA 4FHAA 2WMKA 4V15A 4Z2IA 1EEXA 4BK9A 4QISA 4C7DA 1AW5A 4PTMA 1W1TA 1FDJA 1KA9F 1Q6LA 5D32A 3OPSA 4G7EB 3W2NA 4CNPA 3WFAA 1XW8A 3FEMA 4M6UA 5A5WA 1YLVA 1UZDA 2Y89A 5C5YA 3R12A 4L9XA 3FA4A 3ITXA 1UUMA 3QW4B 4U2ZA 4URIA 5F4WA 3QBUA 3CV1A 4HYVA 3AFBA 4GXWA 3W74A 2W5FA 3KW3A 3F4WA 1A4MA 4GCAA 3A12A 4XB3A 3AS1A 4A3QA 1Q5MA 1KXTA 4FMVA 4PUJA 1K8CA 3PN8A 2NQ9A 1ZJIA 2WO5A 1W3TA 3ARPA 1V0MA 3CL6A 2X0SA 3G6LA 5LIUX 2OT1A 1U30A 2J9XA 4V33A 2WJZA 5HJXA 1RR2A 3RHGA 2GOUA 2DSUA 1E0TA 2AKMA 1XH0A 3FN9A 3QC0A 2DZWA 1XIDA 5F2IA 3TCEA 1CXHA 2DW7A 1VFUA 3VDAA 3CAVA 3LNMA 4KESA 2CW6A 5I5RA 1Z9AA 3NJ3A 3FXYA 3FNDA 4OV4A 1R8LA 1JJKA 1QPNA 2YZRA 3CLWA 3NIYA 1KGUA 2VGBA 3HPFA 4LQ1A 3LK6A 3CZKA 3C2VA 3T55A 1MYRA 5U4NA 2BBFA 4IPNB 4UNLA 3UCCA 3VDGA 2VELA 3LXAA 2I9EA 5DT5A 3SJ3A 4DAFA 3U6WA 3BARA 5IHSA 3BURA 4Z2LA 5T8GA 3UWWA 5CGTA 1GWJA 2KX9A 3UA4A 2ZUNA 3WYZA 4PCTA 4RV3A 4JTFA 3QSRA 3OP2A 2NQ5A 4MB1A 1CXKA 3GTXA 1WA3A 1B9ZA 3K30A 4ZCWA 4JZ5A 3K2GA 3KOZA 1P1MA 3W9ZA 3TR2A 3ZT5A 3EOOA 3ORWA 4HPGA 3MB9A 1VKFA 1SFLA 2OVLA 3T6CA 3TN5A 3B0YA 3APTA 1OY0A 3RFAA 2DZUA 3W82A 3CXOA 1C9WA 4FR6A 2Q01A 1VZWA 5K4ZA 3BZGA 1H7PA 4Z2JA 2ZX7A 2WZTA 4CN4A 3HG5A 1FCVA 2CCRA 3OGRA 4GNVA 3R8HA 5CPSA 1HKMA 3TQVA 5LYRA 1PCWA 3PZ9A 4IIBA 1EDQA 2DT3A 3QV6A 1K6WA 3IJ8A 2WVSA 3DYOA 4UR7A 1FWAC 2YB1A 3XISA 4JTUA 2CLEA 2PWGA 1LUCB 3VM7A 4WIWA 4BF7A 1QJWA 3L7RA 3RDKA 4H6KA 4D2JA 1DIEA 4WOZA 4Z08A 1VB9A 1JDEA 2ALDA 3LLXA 1L8NA 3H55A 1KRCC 1YNPA 3QKZA 1XRSA 1JD9A 2QS8A 5AYYA 3ZZ1A 3MCOA 2YW4A 2I9UA 1GHSA 4DJDD 1UMYA 4CD8A 2Z6IA 1UD6A 1EP2A 1R7OA 2FHFA 3H12A 1LDCA 3G18A 2Z28A 4HMNA 1WXJA 1GYNA 1D3GA 3B03A 4AMCA 1PVNA 2FPVA 1B3OA 2XYLA 4J3VA 3ITGA 4Y9OA 3ZSTA 3PBMA 2E67A 1YTDA 2Y63A 3EOLA 3N13A 5BYWA 3NFUA 1QHOA 1U22A 2HBVA 3VIOA 4N9CA 3NGJA 3KCOA 4L65A 4ORIA 3CYJA 1B31A 4DM1A 2NWRA 1E3ZA 1QI3A 2RGLA 4AYSA 2AAMA 2Z2BA 1L2UA 2YA0A 5EPDA 3ARUA 5EMKA 5LNUA 4JQ3A 4RZBA 3AWOA 4GK8A 4J35A 3C0SA 2VD9A 2ZCGA 1V3LA 3AHYA 4O18A 1FWFC 1EJTC 3L4YA 1W3LA 3QJAA 1F3XA 3M0YA 2VDIA 1QI0A 2ZQ0A 4K38A 2JKPA 3IJ7A 1E51A 1K7EA 2ZRWA 2DGAA 2D24A 1Q13A 3IUDA 1B90A 3GO2A 3BLLA 1W5PA 1BVWA 4GX9A 4Q4RA 1MO0A 1HJXA 2XN0A 1R9ZA 3SO7A 3VCNA 3R5EA 4IXHA 1EX1A 3CPGA 2YYUA 1V3JA 2ZC8A 1ONXA 2P5NA 1FOBA 1WZAA 2FMOA 2G3NA 3WLQA 3DHUA 1AQMA 3LCLA 1IT0A 5A6LA 4ZQCA 3PZQA 1EA0A 1IWBA 2WCSA 1J0YA 1SZNA 3NZGA 4M6VA 2W0UA 1E1CA 2HRWA 4M80A 3KX6A 3ABXA 2A6NA 4JN6A 5EMJA 4G1KA 4HOZA 1XQKA 3UZJA 4TTUA 3DDMA 1E5JA 1DE6A 1ICSA 4L4OA 3H6OA 1AK5A 5D30A 4GXMA 3LERA 1BXCA 4EP8C 2PE4A 3H7UA 2PDPA 1WDQA 2ZWZA 5LKYA 2BTMA 1EIBA 4XD3A 1TTIA 1UKTA 4YNGA 4IFRA 1GG1A 3NPUA 1OEPA 4H6EA 4QDPA 1K9TA 2IKJA 1O1ZA 2GJXA 1GJUA 3AIUA 4RDWA 1A5NC 4DRSA 5LIXX 2C15A 1KFBA 4NASA 5HPCA 1SMDA 3A5VA 4C90A 3LGGA 3PK7A 3C0QA 1SZGA 2P0IA 5D4YA 3VE9A 4DWDA 4EPDC 1KQYA 3CHVA 4GHRA 2NUWA 2WMFA 4Z2HA 3BAIA 4JXCA 1YXYA 2MUCA 3BG5A 2WSQA 5IRPA 3ATZA 3QMSA 1G4EA 3NQGA 3MDUA 2EG6A 3OZYA 4LB3A 1UBPC 5BXTA 3K4DA 2X30A 2WM0A 2YGYA 1MXSA 2HK0A 4JHOA 4QS6A 4W7UA 1NFBA 4F48A 5A69A 2GSEA 4XBKA 3H2EA 2P53A 1GOWA 1SFJA 1KM4A 1H5YA 1OFBA 3GC4A 1UKQA 5K2ZA 3GM8A 4BF5A 4JQ2A 3N2OA 3NAVA 1JCYA 4LVGA 2ZTJA 1RPKA 2NUXA 1IGWA 3LSCA 1QWGA 3MUAA 1XH2A 2BP1A 2GUYA 3W3OA 3NDZA 5HINA 4BHYA 1EO5A 4K7VA 4DNMA 4LGXA 4Z1BA 3OZPA 3B8SA 1W37A 1QW9A 1R3YA 4LYPA 2ZXDA 1YPIA 1LT8A 5CC7A 4I3GA 3R1ZA 2VCBA 4LUIA 1LTDA 2CKRA 3FXGA 4GYFA 2V30A 1RXOB 2OLSA 3R2GA 2YCJA 1E1FA 1POJA 3EWWA 5HJLA 4Z0SA 1B2YA 1NEYA 1RBLA 3GUGA 4IPPA 3EDJA 2J4GA 3V5FA 3G1XA 3WDJA 1UD2A 3F5JA 3TQKA 4KCVA 3ALGA 2Q8ZA 1XLIA 1R9YA 3R43A 2WNWA 3GW0A 1E9LA 3OIHA 2FZNA 3ABRA 3LRMA 3GH7A 1IQ8A 1S5MA 3LB0A 3LHWA 3G1RA 5HDRA 3GR8A 4OUIA 4MJZA 3EOSA 3S2CA 5DLCA 1S46A 1MMFA 1UR0A 3KM8A 5M1TA 4G6CA 4M6QA 4YXGA 2O92A 3GX9A 4QG6A 3ZT7A 3L4WA 2V3GA 3MSDA 4UC5A 3V35A 1OB0A 2QPSA 3KOWA 4QIUA 4JHZA 3MUZ1 1X97A 2TYSA 3IJLA 1WBHA 3BAXA 3URNA 1XP3A 1CXLA 4JN7A 3RK8A 1R46A 3PG9A 4UTHA 4HCHA 2BFGA 4NAEB 2VDGA 1DJQA 3N2CA 5FL0A 5BNKA 4MNKA 4H01A 4I7VA 3NSMA 1ESWA 3MP4A 6CGTA 2E9MA 1LOLA 2ISVA 2FH8A 5CCZA 3D0CA 3M5YA 4GZIA 2F7FA 4XZBA 5KITA 4CLMA 1BEUA 3PB2A 3LNPA 3T44A 1LLWA 2ZUSA 5I24A 1ZBCA 3FHQA 1TZ9A 4EXQA 5I3KA 4IICA 4Q8QA 5JXQA 5ENLA 3WUGA 3LHZA 4MJ2A 3UXIA 2XISA 2C0AA 3OLGA 2ON3A 2G5WA 1RV8A 5BRQA 4WLCA 3CT2A 1QMLA 5E5CA 2ICSA 1QO5A 1TJ2A 2AL2A 3LCFA 1PIIA 2CYGA 1EZ2A 3QHMA 3UZZA 2QF8A 1Q6CA 1WZLA 3RU6A 3SCWA 2GJRA 1ZAHA 4Q8VA 1ZHAA 2QMKA 3QF0A 3C3UA 2WCGA 2VFHA 4LTSA 3VX0A 2D3NA 5BOEA 1M7PA 2V3FA 7CGTA 4ZE4A 2IPJA 4JX4A 1KFEA 4CCCA 2GVJA 1UP0A 3PM6A 3VGEA 4B2DA 5I3HA 4XTDA 4YS1A 3WDRA 4JIRA 1XWYA 3W75A 4NY2A 4QSFA 1EDGA 5AYZA 4MZ8A 1NU5A 1ISYA 2J74A 2GGGA 4J27A 1SSGA 4BWLA 2IXVA 3OLEA 1OFOA 3D3FA 4LALA 3VNDA 3DFHA 3H2MA 2AL1A 1ECEA 1LQAA 1S2TA 1XLAA 1KCXA 3CL7A 4XAZA 4XAFA 3C6CA 2ZOXA 4K2SA 1YADA 4PRWA 1DWFM 4I9JA 1BF6A 3C52A 4W84A 3U57A 1KWKA 2VR4A 5D9NA 1KXVA 1DXFA 4E2DA 1OHLA 2GDUA 4PEKA 3LHTA 3OW1A 1Y5XA 4PSRA 3W1QA 3WDQA 3KBWA 4L61A 4KWUA 4CQAA 4PL2A 3K8LA 3MZNA 5EMYA 2GGEA 4YTQA 3LRKA 5CBJA 5FIPA 1OG6A 3S1XA 4QCFA 1OG0A 2Z27A 1VHNA 2WSKA 4DX3A 2VFDA 1HJQA 1ITXA 4TV6A 4WJXA 1GZ1A 4J3WA 1AG1O 3OZMA 4KFPA 3T2QA 4H2CA 3N2BA 1O7AA 4DUVA 3REQA 1A3HA 1L9WA 2DZAA 2HVOA 1C8YA 1EF3A 3NZ1A 3WNPA 4MKNA 2HROA 2CWNA 4D6DA 3O07A 4J2PA 3NPXA 4XIAA 2EGZA 1CZ1A 1UHVA 4X63A 5T9CE 3UGVA 4AZCA 4JN8A 2WPBA 2YDRA 2D23A 2NVDA 3TW9A 3FKRA 1EGZA 1Z3NA 3B40A 5CH9A 3GXTA 3OB8A 3BOFA 2WHKA 3BV4A 4XBSA 1TRIA 1G4TA 2WZMA 3PPFA 4FNUA 4Y6GA 5E1QA 4DBEA 5FA5A 5KMYA 1KM6A 3TH6A 1VEPA 1NWUA 3T8QA 3GWQA 3D5HA 3TC6A 3IIOA 4PTXA 4XWUA 1YBQA 4GISA 4BF9A 3VIFA 4Y90A 1AODA 2HXTA 4LAMA 2C79A 4YU1A 1KO0A 2VHLA 3PNZA 4D72A 3CH9A 1NAL1 3HG2A 5HQLA 2W6RA 3CUXA 3WBEA 3DZ1A 5FKYA 2AGKA 1O1HA 3AYTA 4OKDA 3GH4A 4G2DA 3E2RA 4JTSA 4ACZB 2PBGA 5DCBA 2VEKA 3MY9A 1J10A 1I1WA 3IGUA 4DJFA 2SFPA 1XLMA 5JVLA 4LCRA 2PDCA 3QN3A 4Z2KA 3SN0A 3ZIZA 3G0UA 4M29A 1GT8A 1ISZA 1B3VA 7ENLA 2OQLA 4GY0A 4PTVA 3EYPA 1W5QA 4QQ3A 1TVLA 3GTFA 3CV2A 3SCVA 3KBNA 3B97A 1XCXA 2PEVA 5A6BD 3S5SA 2GUBA 4NZJA 1WUFA 1DIOA 4KCTA 1YE4A 3P61A 2PZ0A 3WDIA 3N2TA 3PNUA 1SW3A 2B7PA 2J13A 5EMMA 2QZRA 1KFKA 2YFNA 3W38A 1DJNA 2WJFA 2VUNA 3CHEA 1JYVA 1FWTA 3H70A 4GO8A 1EUNA 3URQA 2FMNA 5EMLA 5DY3A 2C7FA 4LS1A 4JYDA 2W9MA 1RUSA 1P43A 3CGTA 1KFLA 5CPNA 5M2FX 5TIMA 1HT6A 1X38A 1QBBA 3M0KA 4MG4A 2GSHA 4ZGYA 3NL5A 4AWUA 4ZB5A 5C9UA 3QY7A 1J4EA 2YLLA 3CUGA 4ZOBA 3WUBA 1EGVA 1HW6A 1HX0A 2UY3A 3S6OA 3LPPA 1OT1A 3LUTA 2FZDA 1EWEA 4NZCA 1DWIM 2XZ9A 4IIHA 5EU9A 4HHMA 2V2HA 3P0WA 2PTZA 4O10A 3UERA 4LT9A 1H60A 2Z1XA 2ZADA 3UJEA 3U3HA 2A5HA 2FH6A 1BQGA 5MHBA 2R8WA 4K39A 1MQRA 3VIHA 1Y0EA 1QK0A 1P6BA 4DZ5A 2FGZA 2B0MA 3NQ6A 1U5HA 4PH6A 1PZ3A 1H09A 3QOMA 1XFCA 1CIUA 2A7RA 5JIPA 1ALDA 4D1IA 4O15A 3TONA 5F2MA 3GHTA 2D20A 4HOXA 1FA2A 3HIJA 4UR9A 4QR6A 4KEUA 3HMCA 4HP5A 5TD4A 3EKLA 2BDQA 3A4XA 4O0ZA 5KZEA 3T05A 4DF0A 4DWSA 1GQLA 4S3EA 3BLOA 3MUCA 4FOKA 3HQPA 2VOTA 1OZQA 2DIJA 1VCVA 4Y8FA 1ME8A 3KP0A 3MHUA 3UZWA 3RG6A 2PDIA 3BVJA 1P6CA 3GFZA 3CIVA 2RDUA 3P93A 4G5DA 4HCLA 4PL1A 4RPQA 4CU6A 1JXKA 4ATLA 4CN1A 1K9EA 4E38A 5LIYX 1GQNA 1D8CA 2B31A 3W24A 3H2AA 3II1A 1C91A 4H8UA 3EDKA 4YVVA 1C8VA 2E5DA 2WMGA 4RW3A 2PC4A 2YBTA 3EWYA 5TF0A 3AYVA 1TPUA 1BG4A 3GD6A 3P60A 1QRQA 2IPWA 4KKXA 3TYAA 3THQA 5BWFA 3QPZA 1B4EA 1Q6QA 3R0UA 4TOQA 3WLKX 3SBFA 1IV8A 1FWSA 3GVGA 2PLKA 4X2PA 1PKNA 1S2VA 3FEQA 1W3JA 4AD0A 1R3VA 3EWUA 2PI6A 5F7UA 1K9DA 1HVQA 1V7YA 1UASA 1JGIA 4JBRA 3C2RA 1Q45A 3KCLA 3AIQA 5AB3A 1A5SA 2X1RA 3LHVA 2Y4SA 2EPLX 4ZSUA 4B5NA 2YFOA 3VNZA 3S5YA 1XD0A 3E0FA 1YQ2A 3T4CA 4Z2GA 5GJPA 4NXKA 1AJ2A 1BXBA 1I0DA 5AN7A 3T2OA 1RPXA 4LPCA 4XZIA 4JYFA 1OYBA 2QLYA 3WIJA 4HHHA 1RLDA 5FF2A 3HQOA 4TX9A 3W7DA 5FEZA 4HZ6A 3PUGA 1B54A 1GVQA 5REQA 2I57A 2YOCA 1QHZA 2E6YA 4GYJA 1SJCA 2P3EA 1VS1A 2DQWA 4LUYA 1R85A 5KZDA 1NDVA 4V2XA 2X1IA 5BMWA 4H9MA 3S5OA 3GHSA 4H9YA 3AXKA 3GU9A 4C7FA 1ODUA 3BCDA 1R9XA 1ELSA 2DH2A 3WK1A 3EA1A 2GDVA 4M1RA 1HL2A 3ARTA 6PTDA 4FXSA 5K9CA 3URAA 1QT1A 4AAJA 5AECA 4KETA 3WH8A 1OFAA 3T09A 2BG5A 1J0KA 4R9XA 4LVBA 2VKZG 2PWHA 4P7RA 1PDYA 1VD6A 3I6TA 3IIXA 5MKGB 2QPUA 4JNYA 5DMLA 3V0SA 2OX4A 3L4VA 3OQEA 4J40A 3U2EA 3RCYA 3AI0A 3P5ZA 1SJAA 4QHRA 4AXKA 2ZVIA 3NO3A 4G1NA 3NVDA 3QLDA 3APGA 1I45A 1EJSC 3JW7A 4B5UA 4HNTA 5D2XA 2BB0A 1B30A 3SIMA 7TIMA 2Z25A 3TZFA 3K8KA 1P7TB 2G95A 3TYDA 3IARA 3PSVA 1NM9A 4GIRA 1UR4A 4AZ5A 4O0KA 3SFWA 3EMQA 1CWYA 3TAOA 3IV3A 4BR1A 1CYGA 1TWSA 4HKPA 1Q4NX 3FVMA 1X1ZA 1WYIA 1JZ3A 3AIBA 4G7EA 1YKWA 2FZ9A 2P10A 3BTNA 2OCZA 5DCEA 3AJXA 4HTBA 4E6MA 3MANA 2VL4A 4U4MA 2B7NA 4TVCA 2XH4A 3C3NA 4Y9MA 1L6FA 2J66A 4IGNA 3JS3A 2ASHA 3DC8A 3MCMA 3ZYZA 4EWND 4LUSA 4IGMA 2JBMA 4LWWA 1BHGA 1IE7C 1WKEA 1TVPA 2QW5A 1JF5A 3UU0A 4KIEA 5EMUA 3DFPA 4KWVA 3P14A 1E6NA 3L4TA 2CLHA 3GE7A 4R34A 4B92A 1XQLA 2WZHA 4P8UA 3VUSA 3NM3A 3TSDA 1D3CA 1EUAA 3MSYA 5JBDA 2QDEA 5A6MA 5REQB 4CQ9A 4B4HA 4ORMA 4BY3A 2QVHA 2H9AA 1B9BA 2INZA 4K8EA 3MMUA 2P50A 1ZS2A 4JIEA 1UG6A 4PYSA 4ES4A 5EB8A 3UR8A 4EWJA 2Z2UA 1RK5A 4H2HA 4KGLA 1XIMA 3PZIA 3FKKA 4FIQA 3EB4A 2PTWA 1K7XA 3RR1A 1EYEA 4M7TA 3ARXA 2GPTA 4RW5A 4UQ9A 4DO5A 2E5CA 3DHPA 1IXQA 2NW0A 6ALDA 3WF0A 1LWHA 4LRTA 5D37A 5HMEA 1EGMA 1XBXA 3V75A 2X0HA 1IR1A 1AFSA 4D6FA 2XM1A 3A5FA 2PGFA 1FBAA 3BL3A 2ZWYA 3W7PA 3R89A 2VWSA 1ZFJA 2PLJA 3EXSA 1N8FA 5D9MA 4GFIA 3VOGA 2WOQA 3RRAA 3VO0A 3O2LA 4TXEA 2WJDA 1JFHA 3QR1A 3GHRA 2P8CA 5D8ZA 3VAVA 3BJFA 2PTYA 4V27A 4KCWA 4HYRA 1HP5A 3HGSA 3L2MA 4KFOA 5AKQA 3N6JA 4S3BA 2RDTA 3GNPA 1MFUA 2PDLA 3E0IA 1C8XA 3QV8A 1R87A 3ME3A 4HGXA 4CUCA 4FOUA 2HNEA 4C1NB 3WO8A 3IANA 3P6LA 4MJMA 3H26A 2CPUA 2PAJA 4MFDA 4QE5A 2Y0FA 3B04A 2HBXA 4PULA 4O50A 1G94A 1K1DA 4I5UA 3SW6A 2BY3A 1Q6DA 1TPWA 2E3ZA 1HJUA 3M0JA 4MZ1A 1OYCA 1NELA 2XN1A 4REQB 5K9DA 1BPLB 3WQEA 4HJFA 2YCIX 3MJYA 1Q4WA 4DWSB 2E6DA 4ZTXA 1H49A 3N15A 3QTPA 1AQHA 3BG9A 3CAKA 1UH3A 1T99A 3H21A 4BQ3A 2PRLA 3W83A 1RH9A 1LBMA 4JFWA 1WZKA 3ITTA 3AMKA 1ZQ5A 4UMCA 3U9IA 4EE9A 4JTHA 1UOKA 3WJWA 3L12A 2VDHA 2YL8A 4FXRA 2V6AA 4JKLA 4OOUA 4DVOA 4IF2A 4A05A 3EA3A 2XFYA 3S2JA 1E1EA 4LCQA 1SO6A 2NQJA 3ZO9A 2YYTA 5FF0A 4AX6A 1KBLA 5D03A 1IGSA 2UY5A 3TUUA 4JQAA 1WP6A 3VFLA 3IK2A 5GPRA 4XO7A 3UJSA 1VFMA 2VZVA 3VZXA 4XD4A 1CXFA 3G1AA 1VYPX 3VOCA 1XLKA 3FX4A 1SW7A 5F4SA 3PP7A 1VIZA 3WY1A 3NL3A 3GDBA 5I3JA 3W2KA 1JZ6A 1AL7A 2PP1A 4PODA 4AY7A 1YDNA 1F4AA 1H7NA 1B3YA 4UNKA 3TR9A 4M19A 4MWAE 5C54A 4BI6A 4PFHA 1WXYA 2A6LA 1K77A 5C2XA 1OGBA 1VBUA 4PUMA 3FA5A 2PDXA 4NJGA 1A53A 4MJ4A 2PF8A 2ISFA 2VEMA 5D05A 1UH4A 1VLIA 3POCA 2NX3A 4ADSA 1XLEA 3QW3A 4AB4A 3NZRA 2V81A 4PMXA 1UCWA 1KBJA 4WJEA 4KPLA 2ZIDA 4IXXA 1PUDA 4GBDA 2PPGA 4DPPA 4IGSA 3TV8A 5EBAA 1TPH1 3GDLA 1Y7VA 1QATA 3DOPA 2ACSA 2W92A 2YSWA 2O9OA 1XYMA 2VX5A 2QJIA 2P88A 2VGGA 2A4AA 1EWDA 4A6GA 4UTMA 2I5IA 2GK1B 3W6MA 3LG3A 3COTA 2FIQA 2F2KA 1JCJA 4Q8NA 4JOMA 2XSBA 1F76A 5BU9A 1LLOA 2EBNA 2OQYA 3EEZA 4D8LA 2CBJA 1JAKA 3G5EA 3WNNA 3GU1A 1AD4A 4YMZA 4OECA 5GQBA 1OX4B 4M1BA 4FLQA 1S1RA 2J6VA 3W26A 2V8ZA 3KBVA 3P81A 4YVPA 4HNUA 1WNOA 1VF8A 1VIWA 1LL7A 5I23A 5HBFA 4J3SA 1X8FA 2ABBA 1HO4A 1FTXA 4IH3A 1TPB1 1Q7QA 4GQRA 3BZJA 2D73A 4R88A 3QVQA 2XDFA 2OWXA 3MS8A 3R7MA 2WK2A 4R27A 4NQ1A 2X2YA 2XJ7A 1CXEA 2QDHA 1E15A 4H8NA 1MW3A 2RKXA 3VKKA 1Q66A 1E1CB 1UC5A 5HWJA 2ISDA 1AQ0A 2QJGA 1SJBA 1WKFA 5HQMA 1HKJA 3GG0A 1B3XA 1BF2A 2ACQA 3Q58A 3G0SA 5AZ1A 3TXZA 3MDWA 4XKYB 3S3GA 3RLUA 2YA1A 3N9SA 1HTIA 4EIVA 4AYGA 2A1YA 3P82A 3UESA 4X61A 3VI2A 4AZCB 3UY7A 1FDZA 2I7GA 1E6QM 3H4WA 1RQEA 3SSZA 1XLGA 4TO8A 1SO5A 5I79A 2BLEA 5HJYA 2QCGA 4KCUA 3ENLA 1US0A 2NV2A 2OOGA 3B4UA 3WQ5A 4CVWA 3WBXA 3BG3A 1YEYA 1JI1A 3V5OA 3QYSA 1UROA 1U83A 3AXMA 3AS0A 4IMEA 4XUGA 3B3DA 2CFFA 3WSUA 5HR6A 1ZB5A 3OOQA 3A9BA 4LCSA 1L8PA 2DZSA 1H62A 4GI4A 4GNJA 4XVEA 4H1ZA 4AVOA 2Y88A 1T8QA 1ZGDA 2QIIA 2W67A 5H6HA 3KTCA 1H11A 1TX2A 5CLTA 3KS6A 4MOZA 4TMCA 3TMLA 1ISXA 3V0UA 1FVPA 4QROA 4OBRA 3CHCA 2ZVRA 4AIBA 3THCA 3PWIA 4D6HA 3OBAA 4O16A 4KQNA 3TMQA 4A35A 4HSOA 3O15A 2Y1HA 2DZBA 3T2PA 1E6RA 2HVMA 3PUEA 2VFIA 4G56A 5M3WA 2CLIA 2DSVA 3ZVIA 4JFUA 4UFMA 3VGFA 2ZYFA 4CEXC 3MMDA 5FCZA 3MI2A 3UY8A 3BAYA 4KW2A 5F1VA 4LVAA 4PCSA 5FAJA 3E0VA 3ARVA 3HJEA 3RX2A 3HFYA 1A4LA 4UFJA 2CHOA 4H9VA 4XAGA 3W6YA 2J7FA 1RK6A 1IZKA 2OLHA 1DWGM 2DT2A 5E0KA 5LGXA 4DAIA 4QTGA 1PHWA 1XIEA 1IXPA 4S1FA 3LSBA 4IZGA 3QZEA 4LH8A 2QGHA 3MI3A 3LZ5A 1PX4A 1RJQA 5AYXA 4AC7C 1CTNA 1CGWA 2F6KA 2WC4A 3AU2A 4Z42C 3W27A 3HOJA 2XH7A 1XKYA 1XC6A 4U10A 1UJQA 3NA8A 1XJBA 1FXPA 4ZE5A 1K4GA 1KFCA 5AHFA 3R4IA 1IWAA 5I7GA 1XCWA 3HFTA 1MNZA 1W1VA 2PU0A 3TJLA 1I2PA 4CD5A 3M0VA 1XISA 2PZNA 4E8CA 4FALA 1C29A 4US6A 3AYSA 1QOXA 3OODA 4IQLA 3B05A 3QPEA 9XIMA 4JPGA 4F4RA 4FOJA 1DJYA 3PUDA 1IEQA 1W1A1 1I75A 3DU0A 1XBVA 4RK8A 3IAQA 5DY2A 3FAWA 1RCQA 1VPQA 1H7WA 3GDMA 3AU6A 4QNWA 4TV5A 3V5CA 3PR2A 4IJBA 4F79A 1KC7A 2J8TA 1OFPA 1CB2A 4K68A 3N73A 1A5BA 1A3XA 4QLKA 1HGWA 1K7FA 1XLHA 2O9RA 1IR2A 3E74A 5KZMA 5IBXC 4C6IA 5LA0A 3PTKA 1JYNA 3ZSSA 1BWLA 4C1LA 3MHFA 3L4XA 1DQXA 1LWIA 3LD5A 1QOPA 3BDKA 4MY9A 4HNNA 4ZEPA 1KWGA 3PSWA 5JQ9A 4EKJA 3PZUA 1A5MC 1AH3A 1JG9A 3BK0A 3NQMA 5G1YA 1CEOA 3MVTA 4GQBA 1G1YA 2YW3A 1G6CA 2OGJA 2GYIA 2PDUA 1JQVA 1W9VA 4PUWA 4RZ5A 3PB0A 4AZBA 5JUVA 2Y5EA 1H63A 1TMLA 4EVZA 1O5RA 2J75A 1W1PA 4AZIA 1DQUA 1ZRQA 2ZKMX 3Q37A 4H9ZA 3EDFA 2XZ7A 3GNNA 2ZZ4A 3MUXA 1RLCL 1W3KA 1TKKA 1F3TA 2PWEA 3G1YA 1LYXA 1E72M 1F61A 1TJ1A 3B06A 4AFYA 1N55A 5C8BB 1VLWA 4WSKA 4TVDA 3Q67A 4PTWA 1V51A 1XLJA 2VEPA 1AJZA 1W5NA 2FGBA 5DMYA 1D8WA 4UMBA 3LCGA 1Q3NA 3CUZA 4WEVX 1YMYA 1DJGA 1OFEA 2YA2A 5LSMA 2RFGA 4QDWA 3O05A 3VOHA 1XGDA 3HU7A 4WKAA 4EXBA 3C0JA 1R3SA 2W4XA 3GC2A 2D69A 3ZJ6A 2OKTA 3I10A 3UYCA 3PBYA 3M0MA 5ABGA 3INPA 4AX7A 4UQAA 2CZFA 4AZGA 4Q4QA 5LHEA 4MF4A 3GZAA 1U1JA 1H51A 4FPSA 3S2MA 1NOFA 2EJAA 4GZ7A 1UZHA 3MSRA 3SRFA 3N17A 2ATSA 4AD3A 1K3UA 2EKGA 1QAPA 2QJHA 2E8ZA 4R33A 1JIBA 3QR0A 5FJRA 1KBIA 4HA0A 3WLPA 1SPQA 4US5D 5M5DA 3IEBA 4GUFA 2A79A 1LOQA 4C60A 2BMBA 4GYPC 1E71M 2FDSA 1KLZA 4LS0A 1O95A 4I7WA 1LT7A 3IJQA 2Z7GA 2BY1A 1E43A 4C6EA 3DI1A 4L56A 2DORA 5E0CA 1DVJA 3SCRA 4UQBA 2AKZA 4ZR8A 4W5UA 3AYRA 3FJNA 6TAAA 4JTDA 4LW7A 3STEA 4DUOA 2DIKA 1M7OA 3ICJA 4O1AA 4O53A 2DSKA 5A2AA 5HUOA 3W23A 1E4LA 1EPXA 2YXXA 3ZR5A 7A3HA 3JZEA 4B4FA 2ISSA 1YDYA 2QCNA 3VIMA 4DJEA 2O56A 2X1SA 1TQXA 3A24A 3BGJA 1NVMA 1PTAA 4LY4A 4F3HA 3GR4A 4IL2A 1J93A 8XIAA 3WQVA 2VTFA 1FP9A 3LQLA 4YWSA 1TSIA 4ERGA 2Z6JA 4KFNA 2X05A 1U33A 1XIFA 4X3ZA 4AY8A 3TP4A 1MW0A 3C86A 3OHMB 4PMQA 2VYOA 3NWRA 2HE5A 2OJPA 1TWZA 1NSJA 5E6YA 3ZLGA 1JPKA 3BWWA 3ANVA 1LZOA 2G8ZA 4C6BA 3TFXA 4MPKA 1KRBC 4JTIA 1RA0A 1GONA 2YR1A 1RP9A 4IIDA 1DIDA 2WHMA 3TQPA 3P8IA 3G3MA 2IPGA 1HN1A 2VFFA 2G3IA 3GVRA 4NP7A 5I2UA 5FEXA 1QNRA 4L4MA 2AQWA 5I3DA 1EBGA 3KXQA 2EO7A 3W7JA 3APYA 1TQJA 1KBBA 5EFFA 2HS6A 1HO1A 2QEZA 1WDRA 4YHGA 2OTDA 3VNIA 4MAZA 4HA4A 1Y8BA 1EXBA 2WW5A 3RCNA 5IHRA 1B57A 1TR1A 1KM2A 1E4MM 2BHZA 3G22A 2ZZ7A 5CPTA 3S5NA 3SM0A 2C18A 4FB7A 3KBJA 1JDAA 2F6XA 3GC5A 2A85A 4KWSA 3AZTA 3SFKA 3S9IA 2JALA 5BU6A 1YE6A 2RH9A 1EC8A 2V82A 3MP3A 3MU7A 1TCDA 3QHNA 4WY0B 4B15A 3GG7A 3W7NA 2R1PA 3CM4A 3AMLA 1DHPA 3HJZA 2XIIA 4QRNA 1FXQA 4J3XA 3S2NA 5AC5A 2DSZA 4WOQA 2TPSA 1U2YA 1ZP3A 1EC9A 5I03A 4WK9A 1V6VA 4UFLA 2EG8A 1Q2SA 1A47A 2Y8KA 1ISVA 6A3HA 4XV0A 1CNVA 4XSLA 5IDIA 2Z1KA 1U1HA 1JZ4A 3PBUA 3M1ZA 1TPEA 3QGKC 3SCUA 4GABA 3CTTA 4OQVA 2PMQA 4A8NA 3CMGA 2HE8A 3L66A 4W7VA 3VNLA 4XK2A 4U3CA 2H8ZA 2W62A 2JIEA 3LI1A 1Z89A 4O19A 1XS2A 1GK8A 1QTWA 2Q3OA 2YDAA 3WLOA 1T40A 2F8QA 3WQ8A 4XZWA 5HPOA 1F6KA 2PWVA 3ATYA 3N34A 1BVNP 3AROA 1AW2A 3RO8A 4GIYA 3PZNA 4MPQA 1WDSA 3F2DA 3ZXWA 2A0NA 3PTQA 5AHNA 1EHAA 4NI8A 4ZENA 1VJIA 3L5LA 1VRDA 3TSBA 1GKPA 4GQGA 1F8IA 1VBJA 4AEEA 3JRKA 1D7KA 2FZBA 2OEMA 5KZ6A 3KRBA 2CZVA 2C3ZA 4GC3A 1NFGA 2QUMA 2Y8UA 2XVGA 4LYKA 1VFLA 4DZAA 2AGTA 3ZJ7A 4YYCA 2QUUA 2FDMA 1YDVA 2GK1A 2GQ8A 4WDXA 4LUTB 3PF3A 2JE8A 4LOCA 5CZKA 4DYKA 1MRQA 3O3RA 4B3LA 3LY0A 3T08A 2P0OA 4Y9NA 1XIJA 2GSJA 5AVHA 3VD4A 2X7VA 1W1IE 3KCJA 1F3WA 1EJUC 5K9XA 1YRRA 4IPIA 1HF6A 1TREA 4L1XA 1FFRA 1EEPA 3UJRA 1RA5A 3AAMA 5AZ0A 3T42A 1GOOA 2PCEA 4N7QA 1C3FA 3K4AA 3NQCA 2BVDA 1EXPA 3CV6A 1F3EA 1VC4A 1OWQA 1I2RA 1ONRA 1W54A 3DFQA 5DEZA 1M9HA 3NYZA 3WH5A 2OU4A 1GNXA 1VJZA 3W0KA 5DXXA 3U2CA 2QCDB 1BG9A 1MEHA 3OGSA 4BI7A 4DJFD 1JRBA 3EX2A 1XINA 2Z1SA 2JF6A 1F73A 3AIVA 3TCSA 1YTKA 3VTRA 3V18A 5C7HA 1QO2A 1UUOA 1MUCA 1W9DM 3HGJA 4TIMA 3TC7A 3C5QA 4FF5A 3JZUA 5E70A 1JUBA 3K5XA 4KWWA 2OQHA 4XUYA 1EHNA 3UETA 1V6UA 4IJCA 4Q7BA 1I1XA 3NDOA 2UWFA 1UPMB 3RAOA 3V36A 3WLTA 1KM1A 1Q63A 2XWDA 1M01A 1UYQA 2VXNA 1FH8A 3P80A 4HPXA 1W2PA 4I9TA 4MVAA 3CBWA 5L9FA 4JQ4A 3ARQA 4IT1A 5I02A 3CUHA 5CSUA 4PB3A 1W1YA 4NU7A 4A2SA 4AXNA 3OBEA 1EB3A 5D2WA 3WH9A 4U31A 2O9TA 5AYBA 7PTDA 2PDJA 1A5OC 3TA6A 2QKFA 3STGA 4AF0B 3NDYA 3CO4A 3E2QA 3EDDA 2WWCA 1CGVA 3EB3A 3EKGA 4YWIA 2WKLA 3M0IA 3TJXA 3ES7A 5SWUA 4QG9A 3TNOA 5C9RA 2FTPA 4JDYA 1O66A 3GG8A 1Z44A 2VURA 3F4DA 4EPKA 3IS4A 2BXZA 1SJDA 3ZS4A 4UZSA 2BNJA 1KCKA 3SAZA 3O6CA 3E5PA 3A4JA 1VEOA 5LIWX 1XLCA 2GJNA 5C9WA 2VZOA 3PANA 1DWAM 3WMLA 4JY8A 3ZT6A 1CLXA 2BY0A 1NDWA 3W71A 4A8LA 3DGBA 3EBVA 3C2YA 3PHAA 3O7UA 2OELA 2IMRA 4Z1YA 2AOSA 4W89A 2DW6A 3W7QA 5CEWA 5BWAA 3M07A 1SU5A 2YL5A 4NZ5A 1G0CA 3MI6A 1R2TA 3AXIA 4LAKA 4ZOAA 3F1QA 3ZVHA 3KVKA 4JTCA 3KHDA 4KEVA 3R8GA 1RCOB 2VC5A 1A5KC 1TYGA 4MSSA 1HL9A 4JAWA 2OEJA 1JCXA 3HPZA 1REQA 5CZTA 2YPIA 1CW2A 2VO5A 3GNXA 1UR8A 3LCWA 1KBKA 4Q6JA 1E0UA 4B3KA 4ZZ9A 5D9OA 4I7UA 3DI0A 2WVTA 4XVDA 3E12A 4WDTA 1RY8A 2DEPA 3VKAA 3FLUA 1ZJHA 5LNVA 1KW1A 4PCPA 5I3GA 1N7KA 3EPMA 3EB2A 4C6JA 3ANUA 3WD3A 4AISA 4ECLA 2DUZA 3GAYA 4PUEA 2C1IA 3OQ8A 3R11A 1EF2A 1JFXA 4PB4A 3NQVA 5HNRA 1HGYA 3WL1A 3EX3A 4F2UA 4FX8A 4PUKA 4O1CA 2ISWA 4FIRA 3C2FA 4LNCA 1KKOA 1WDPA 3LA4A 4LYQA 3CQIA 4AVNA 1FHDA 4FLSA 4H19A 1E6PA 1V3KA 3MTWA 2V3EA 2A21A 1IZJA 1F5ZA 5LHFA 4LBRA 2XVNA 2GQ9A 3POHA 1FWDC 1NP0A 3CPUA 3GVQA 3NUKA 4ZO7A 1TMHA 3GYEA 4UOQA 2QQ6A 3LEPA 1EJXC 1KNWA 4G7FA 4YPJA 3W87A 2EXOA 2CZDA 4ATDA 2EHHA 4DZHA 2OYLA 4YN5A 3K1GA 5A6KA 4KF1A 2CHNA 4ICMA 3H7VA 2W66A 4F0SA 3GNDA 4UQDA 3QH2A 4I8YA 4AC1X 1UKOA 4B16A 4NAFB 1OC7A 3N9KA 3RLHA 1IT8A 4UOZA 1OQFA 4PUNA 4GO9A 4E3TA 1HNYA 2QCFA 1UD5A 1XDLA 2OGYA 1KB3A 5DQPA 1MWOA 4GY1A 3MWCA 2IQDA 4MNMA 3AXXA 3KP1A 2J77A 2H8XA 4ZB0A 1U1UA 4WUIA 4NJJA 3BGAA 2V3DA 3HPSA 4BCEA 3W28A 1AL8A 3NL2A 3LGEA 3SDOA 1H41A 5HNTA 3I65A 1XDMA 3CUFA 2G0WA 2DP3A 2X1TA 3UR2A 3WF3A 2X2GA 2GVYA 2E9BA 5I09A 1EJWC 4HU8A 1OFRA 2QCCA 1TFVA 2ATMA 4IX2A 1OZMA 5AC4A 4I9AA 2FVKA 4C65A 1NWTA 2NXGA 2JK2A 4P7NA 1XD1A 5LGZA 4Q8MA 4CD4A 2E9LA 1XV8A 1OCQA 2A3HA 3BC9A 4YTTA 3LXBA 2NV1A 3QFEA 1KCZA 4RJEA 2BASA 4TUFA 3R94A 3NXLA 1GCYA 4DWSD 3QV9A 1US3A 1BKHA 3HN3A 3VDHA 3NVTA 4FNRA 2ZX8A 3T78A 4ZBCA 3VNJA 3T9PA 2AL2B 3W07A 2VR2A 4XZLX 5I06A 5I00A 3PJUA 3PPHA 3HB9A 2D1ZA 1TTPA 3GDRA 2O7QA 3VZZA 1JCMP 3GHUA 5JBFA 3OEXA 5J5DA 5CC3A 2BWGA 3EWXA 4O1BA 3HG4A 3Q45A 4D6GA 4RE3A 2GGHA 3THDA 3WQPA 3GNRA 3Q4DA 1UC4A 3B0VC 2FFIA 3WL0A 4Q8TA 1M3UA 4GD0A 3I3EA 4NZFA 1ODZA 3B0XA 3BPWA 4WKHA 2J47A 3FAXA 4HZ8A 3OU8A 1UWUA 1E4NA 1VFHA 2FLIA 1PBGA 4RNHA 4FA3A 2Q6ZA 2B7QA 2OFJA 1NF0A 3RO6A 1QOQA 3N11A 3RPDA 3E1F1 1E6XM 4ZQOA 1Q65A 3CV7A 2YLAA 1UJPA 3WQOA 1PKYA 2C1HA 2PD5A 4MB3A 3GU2A 5T9BG 3G1VA 5CXPA 1Q6OA 2ACRA 2CIPA 4HU0A 4GX8A 3W2UA 4I6VA 3WLHA 4BJHA 1VPXA 1T7LA 2OR2A 2RDXA 2P8BA 2YJQA 3GQYA 1FWWA 3OYZA 1W0MA 1W9UA 2WKJA 2DUAA 1QFEA 3CJPA 4LFYA 1R2RA 5AC7A 4UFKA 3SURA 1D3HA 5FAGA 3VCRA 1J2BA 1TVNA 4CQBA 2DIEA 3BLDA 4XKMA 5CBIA 2TSYA 4XSMA 3UVIA 2XIJA 5A8PA 3NQFA 2XHYA 2GZXA 1CGUA 4YYFA 1SZRA 4EANA 3VNMA 4GZEA 3L0GA 3UVAA 3S4TA 1FX6A 1FWBC 4NRSA 3V1PA 3HPXA 3I3BA 3KWXA 3VDBA 2C16A 2VX4A 5BRPA 4Q8PA 4DLFA 1Z42A 3WQGA 1IHIA 5AOUA 4EF9A 2RAGA 1I2OA 1UWTA 4LC6A 4Q4MA 1X7FA 3HO8A 2BGNE 2OSXA 3W70A 1PX3A 1G4PA 1L0PA 4NX5A 5I6SA 4KH2A 5FOOA 1NWSA 2VFGA 2D0FA 3DC0A 5CJ5A 2JKAA 3UBPC 3TU9A 3M0LA 3O6AA 3GB6A 4D8ZA 1ZZMA 4MDOA 1SSDA 2HDJA 3AALA 3HMJG 1JCLA 1P0KA 4FNPA 3WLJA 4A21A 5LNWA 4DF2A 3VGHA 3WELA 4O13A 2R94A 3G2GA 1G7VA 1TTQA 2WZEA 3CK5A 4INFA 3W88A 8A3HA 5HNNA 2D2JA 4DUXA 1DJHA 5D33A 1PV8A 3N4EA 3S5ZA 2V9DA 9RUBA 3GSMA 4ZQPA 3WMBA 4RLIA 3WEOA 4JEQA 1PCKA 3LZ3A 1NWRA 3TYBA 3NQ7A 3SRDA 4IMDA 3D6NA 1J18A 1FQ0A 3RM4A 2IQ0A 2D0GA 1U5VA 2GLKA 3UT0A 4PA8A 1TELA 4IFKB 1A0CA 4P7LA 1IXOA 1W3IA 1ITCA 2OZ3A 3LV6A 1OCNA 3VUPA 3UWVA 2QMJA 2C14A 3WH6A 4MMWA 5LXXA 4L6DA 2ZICA 4HJWA 4WVXA 4OZOA 3VIPA 2VT0A 2ONEA 3N6HA 1FWGC 4PEEA 5C71A 1S5WA 1QPOA 8RUCA 3KRUA 4XBJA 4XAPA 1ENUA 2I56A 4MKSA 1DIKA 3AS3A 5B7YA 2QT3A 4GIEA 4X9SA 1JAEA 4WGXA 2HISA 7REQA 4KBXA 3W1LA 4TX8A 1UZ1A 3W81A 2IKGA 3IJIA 1QNSA 1XIIA 4OBSA 4XAYA 4HNLA 1RZMA 3PAOA 4HBKA 3LPFA 2FVLA 3MC5A 4R3UA 2AMGA 1MDLA 2C1GA 4DXXA 2JKEA 1H0IA 4TTGA 4MFEA 1JL8A 3MYOA 1Q6EA 1W6TA 3KBSA 1IZCA 1PYMA 2Z7KA 3STFA 4G8TA 3AUJA 2PDHA 3DGRA 3SUWA 2WMIA 4W8LA 4LVDA 4N6EA 2DDXA 3E49A 4I8DA 3ARZA 3OLDA 3CAQA 4KRTA 1LQ0A 1FFQA 4E2BA 5G2WA 5JIWA 3CB8A 3CQ0A 1TRDA 2GVEA 1KGWA 4LRSA 3VMNA 1CDGA 4CCZA 4CVUA 3RM8A 2J88A 3L65A 4U5IA 3TOPA 4IQJA 3ZOAA 3STPA 1NP2A 4NJHA 3EOEA 3S2LA 4POCA 5MF5A 3IUHA 4W86A 2QJMA 3SN4A 3W1AA 3IK4A 4NL1A 6TIMA 5A95A 1AZ1A 4AIEA 4NJKA 3NR0A 2A3LA 3VGGA 4PBFA 2I14A 2OEKA 4K1WA 4NZ4A 1US2A 5DRIA 5BXRA 4C6FA 5HNUA 3IVTA 4AUBA 1CLVA 3GNOA 4PC8A 1RVGA 1CLKA 2DH3A 1BYAA 3S1VA 1TMQA 2GJPA 4X2RA 1NY1A 4D6IA 1C7TA 3VOIA 2B7OA 3KL3A 5KETA 4EK7A 3S8HA 2NT1A 3F7JA 3WEMA 3O1NA 1QNVA 3PFRA 5CPOA 3QXBA 3VM5A 4HMCA 3GZ3A 3W4RA 4A8IA 4DBDA 3CASA 2FJUB 1Q6FA 1JZ8A 5A8OA 1B1YA 2V2CA 1XKJA 4GI6A 3PZVA 3RMJA 2NXHA 3CLMA 3FYYA 3KUMA 4E0CA 4FR1A 1ZAIA 2Z1VA 1O5QA 3HA1A 3B9OA 3H2NA 1OF8A 2Z2AA 4HK6A 1KM3A 5A1AA 4H41A 2FJKA 3FFSA 4UFHA 2PU1A 2OO0A 4WHBA 1F74A 1NDYA 1V02E 4S2BA 5DXYA 4ZB2A 4FS9A 3LLFA 1KLYA 2CLOA 1V6WA 3OA5A 4JR5A 1I2QA 5KEZA 2XH2A 1X6LA 3QY8A 4NKCA 3R0DA 4LSBA 1PTGA 2BODX 1NJJA 3DFYA 1FWEC 4NT0A 1IIGA 1CX9A 1SM9A 4FLRA 3IACA 1JXJA 3CT7A 1BYCA 1X1OA 4BQ5A 1PWMA 3QGVA 3ZWTA 1MQQA 5FJIA 4J3UA 1ICPA 1I60A 4Q22A 5F4XA 1E0VA 5HMSA 4UTKA 5PTDA 3SCOA 3WNKA 3PFMA 4H7CA 3GXMA 1GZJA 3K46A 3AMDA 5A6SA 4RDYA 2V67A 4JTJA 3FK4A 4LUTA 2NQHA 1OX4A 2J7DA 3FA3A 1H1YA 3BQ6A 3N6QA 3LBCA 1O94A 3LRLA 2G3MA 3H2OA 4C7GA 4GINA 2A3CA 1V3HA 4E4UA 2Y7DA 1CPUA 2HJPA 4Q4PA 4HTYA 4GVIA 3W86A 1QNOA 1ADOA 4C6QA 3NXFA 2CHRA 1E0WA 3HPAA 2QCMA 1BGAA 1E6ZA 3SGUA 4U33A 1TX0A 3WKZA 2VX7A 2E7FA 4A3UA 1D2KA 4YVXA 1J79A 1LROA 4XTIA 2XINA 2XVKA 2VGFA 3CZGA 2OX1A 5HWNA 4CNOA 3VOJA 4PRTA 3WLLA 2YL6A 4PMVA 1XLLA 3VINA 3QKEA 1T6MA 4F9DA 4Q4SA 2OWCA 4BA0A 3M9YA 1WAUA 4C6OA 4F0MA 1OBAA 4M6PA 3W7GA 4ASTA 5D02A 1GTHA 4Z17A 1I6NA 4D8AA 5C2GA 4F2BA 3W7CA 2VX6A 1O4UA 3RX4A 2J7BA 1M53A 3IIZA 3GKFA 4QJ5B 4V1XA 4HCDA 2Y6ZA 1BSIA 4IUGA 1FH9A 3SY5A 4HK5A 4H9XA 3A4WA 4GGBA 3KDNA 1VYSX 3VKJA 4S3FA 3IGSA 4WDUA 1XYBA 1IEIA 5EFDA 3J7HA 4MADA 2VJXA 4HMEA 4XD5A 4BZYA 4QQUA 1WB0A 4PBEA 1AH4A 4UQEA 3KRSA 4O52A 2FPTA 2XH0A 2Z0IA 3P3BA 2X16A 5E9XA 3DFTA 1L6YA 4P2VA 4GCXA 2C8NA 2MANA 3LENA 3MPGA 3NSNA 3LU2A 3IRDA 2E6AA 3WUEA 4IMCA 4Q8OA 4S2CA 2ADAA 3HZ3A 1F05A 4IJRA 4UFIA 4JD4A 2ODOA 2DZPA 2VNCA 5D09A 2V5DA 3XIMA 4ZXOA 2P3ZA 2TAAA 4B5SA 1G67A 2GQ3A 2PP0A 5H8PA 4NUWA 4Q32A 4D71A 3IAPA 4AZHA 3JVAA 3BSGA 2HK1A 4O1EA 3CL8A 1V0NA 4LB4A 4R5EA 3C0LA 3ABOA 4REQA 1W31A 3WJYA 3I4EA 4L1GA 1K70A 2UBPC 3ZWSA 5E0FA 2XSAA 4GMEA 4LJ3A 1GG0A 4W87A 1XDJA 3SCQA 3GXFA 3IPWA 3GVWA 2OZTA 5DFAA 3NYDA 3NO1A 2J25A 1WBJA 1LL6A 4Y9AA 1HXJA 1ZBVA 2QVNA 2J8FA 4N6FA 1XBYA 1BWVA 1AUSL 1H7OA 3T1GA 5HATA 4QS5A 4PN2A 2ZZ6A 4R7OA 2ZRVA 1SYTA 4A8RA 2DVTA 1W5OA 1ME7A 3QHOA 5I3FA 2PDGA 4FSAA 4JX6A 3VC6A 1GTEA 4YLWA 2ZRYA 2PSNA 3IIVA 5A6AA 2MNRA 3MZ2A 5FL1A 2QV4A 3CUIA 3QOKA 1BD0A 2VRQA 3SUTA 4H00A 4J1OA 2OMAA 3WNOA 2ZX6A 3B8TA 3E02A 5H2ZA 3EGJA 3NEVA 2RGMA 5GVJA 3VD3A 2CLPA 2D22A 3VVGA 3KWSA 5KTLA 3ABZA 3TTOA 5F2LA 4IIGA 1X8CA 4JCMA 3PPGA 5IXEA 3B8WA 4WX2A 3UWQA 4TX6A 1SO3A 2HVNA 1XHGA 3LQGA 4JKMA 3AISA 1BAGA 4OFCA 4RV8A 3A3XA 4Q4OA 1UOZA 3EZ4A 3GYCA 3ZJKA 1BKSA 2FQIA 3GY1A 4HMDA 4YTRA 2HMCA 1BXNA 1GOMA 1Z48A 1EDTA 4CU8A 1FCUA 1TJPA 1VHCA 5HMDA 3UZXA 1YBQB 4DYEA 4DBWA 3ERPA 2YCKX 1OK4A 1UD8A 1XGEA 2ACUA 4ZOCA 4F0LA 3ABSA 1VBGA 3NQ2A 4LUSB 5ABFB 4YTSA 5BRBA 1KRMA 3R10A 4HSHA 4L6OA 1GOKA 3QQ1A 1GVEA 4M82A 2WMJA 4E4FA 3C8FA 2FGLA 1W9BM 3EWDA 2HWGA 4UWMA 3EX4A 5D9PA 1RJRA 4CQCA 4ROQA 2E28A 5LA2A 2E68A 2HEJA 5I77A 5CSSA 3LGDA 4MDPA 4M51A 4UCFA 2PDFA 4ML9A 4H83A 4S23A 1F9CA 2ZDRA 1BRLA 3VE7A 3UZYA 1J01A 3SADA 1JNEA 3W7HA 3QFWA 3QTGA 2QJNA 1P7TA 2HCVA 2OXNA 3RX3A 3V3WA 4IM4A 2PDKA 4AU0A 1THFD 4B90A 3PAJA 1OGGA 3CC1A 1ZCOA 3M5XA 1XYAA 1OF6A 5JU6A 3ECQA 3AHXA 2PWFA 2PWDA 3MA8A 3UNDA 4GRSA 1ZLPA 1JYWA 5FSEC 1C93A 1SQ7A 4H9TA 4MUPA 4M56A 2ZA2A 3BAWA 4IP7A 5HQEA 1P48A 3KAOA 5G1MA 3FW6A 1V8EA 3KBMA 3CIWA 4IX0A 3EPOA 2HV5A 1MFVA 4NZ3A 1MDRA 4L7ZA 3MUY1 3WD4A 2ZXBA 4KT2A 3STCA 4WJ8A 3KVLA 3LTSA 1GZGA 3U7BA 3UG8A 4EACA 3CMFA 5CAKA 2AQVA 4ZFMA 4NYYA 3SY8A 3WLNA 4OV9A 3C2OA 3ZR4A 2X8RA 2BX7A 4IGHA 4F2TA 3C8NA 2VQUA 2PCQA 5DMNA 4AWEA 2OLAA 4OBTA 4HIBA 1QCWA 4S38A 4RZ4A 1BTMA 3EXTA 3RNDA 1LJYA 4RDZA 1MUWA 1SR0A 3HGOA 1LUCA 1T8XA 4MZYA 5AFDA 3S0CA 4WCJA 1DL3A 3SI9A 3F2BA 1OYAA 2WMHA 1GUVA 2VD8A 3L2IA 4Z0JA 2VZSA 4Q3MA 2CZEA 1HJVA 3HF3A 2G4FA 5FACA 4Y2WA 2VUYA 8XIMA 3P74A 3NPVA 4N4QA 5DMMA 2BGSA 4NVTA 4ROPA 4P8XA 2HXUA 1JRCA 3USZA 1KR0A 2J7EA 3O8AA 3VIKA 4RL3A 4A29A 4DF1A 3UWZA 1XUUA 3BJTA 4XZNX 2FKPA 3B9DA 1QR7A 5CLWA 4TR9A 3EMZA 4DJDA 5EA9A 3PBGA 3BXWA 1DOSA 4GQ0A 4GQQA 4TQTA 5AHMA 3OTRA 3PJWA 3WLRA 3MW7A 1SW0A 4MYXA 2DY3A 3K4WA 8TIMA 3K1DA 1R38A 1F4HA 2INEA 2BVWA 3MKCA 3UP8A 9XIAA 3AZRA 2QAPA 5XIAA 5J04A 1GJPA 3UJFA 3DESA 3AWNA 1V3IA 2INFA 1MEIA 3HURA 2E1WA 2BVTA 1R2SA 3OYXA 3OG2A 4N9EA 4GLEA 3ITCA 5TNVA 1N8IA 1TUXA 2A3BA 8CGTA 3M0XA 3LTYA 3EWBX 3VA8A 1YX1A 3O0FA 1VAHA 3GG1A 3JR2A 3EDEA 1KTNA 1ITUA 2VGIA 3N2MA 3B0UX 5CZJA 3KFTA 4OTKA 4ML4A 1H2JA 1A50A 2WLZA 3TW7A 1EYWA 4A3RA 3AIRA 3HBLA 4JQ1A 1Q2RA 1E55A 2CWXA 1ONEA 3JU2A 2QNEA 4WSHA 5AYIA 1JDDA 2CU0A 4DQWA 1TA3B 4DJED 4HT3A 1ZNNA 1FY6A 3R25A 5IM51 1EKOA 4L9YA 3SJNA 4W7WA 3BW4A 1VFSA 4MUZA 5A8QA 5KINA 1K8YA 2PWUA 2D2OA 3NL6A 1EJVC 4EAYA 1UWAA 4DXKA 1OC6A 4JX5A 4D9PA 2VM8A 4O11A 1J5TA 1GOQA 4N4PA 3U4FA 4WY0A 4HB7A 2GGJA 5H8UA 4S3JA 2PFHA 1ZJBA 1E9ZB 4JNMA 4JIQA 3NG3A 2EG7A 1TV3A 2CZ5A 5DT7A 2YDQA 4RXFA 4HN4A 3VPLA 1NOUA 1LLZA 3LPOA 1WV2A 3TKFA 4Q7NA 2ZE3A 2F9RA 4MLRA 2ZC1A 2VZTA 3WMCA 4NJIA 5DBUA 2VOMA 2CLFA 1IF2A 4MY1A 4Z1AA 1JULA 3W1XA 1A0EA 2C0HA 4O12A 4AWSA 4F9JA 3GDTA 4FF7A 1MSSA 4PUUA 4ZOEA 3V0TA 1R6WA 2G41A 4DN1A 1I4NA 3DKLA 3TC3A 1F2JA 2Y85A 4OWGA 5MKGA 1Z7AA 1UR1A 3KL0A 4GKTA 3CZJA 5A3HA 5ABTA 3WENA 1XLBA 4HD5A 4C1NA 4KS0A 3O6YX 1EO7A 4IIEA 5I78A 3TX9A 2IXUA 4HNVA 3NURA 1SVDA 4FX6M 3W37A 2QCHA 3MV11 5FJJA 1GKRA 3S1UA 3WD0A 3LN3A 4YJ5A 2JF7A 4F0HA 1JQXA 4CD7A 3TNBA 5D2YA 4E2VA 2VC7A 4UXDA 2YCLB 5HAOA 1FHUA 1SFTA 2PGWA 1ZENA 4PB5A 2NX1A 3W2MA 2JGQA 1V0LA 2QDDA 3WH7A 4DBUA 1OT2A 1YPXA 3T0BA 4D1JA 3FJLA 1REQB 4UTWC 2WLYA 1A80A 1FCQA 3AXHA 4PZVA 4UQCA 3OVRA 4O17A 1J2WA 1GVYA 4RE2A 5EL1A 3ID7A 3ZVHB 4B3ZA 2CESA 1KRAC 2PGRA 1TWWA 4H4IA 5BOOA 1GQIA 1RQHA 3DEQA 1KXHA 1JCTA 3WDHA 2C71A 3H54A 1E56A 1HUVA 4UTFA 2X42A 2HS8A 2OB3A 3TYCA 1QWKA 3BGGA 3G24A 3TA9A 4IUOA 4ACZA 1C92A 2VRKA 4GVHA 1W9XA 2I5GA 3THAA 1V03A 1CT5A 4XO6A 4F66A 3NQBA 3CEUA 3P67A 2YL9A 3E0LA 3M0ZA 1XRTA 3TXVA 4JYEA 4UCGA 3DYPA 2RDWA 2EQDA 1Z69A 1K03A 4O4VA 3WFLA 1UKPA 4PBGA 3ZFHA 1OCJA 4GUJA 1HL8A 4CNSA 2P76A 4GC4A 3KTSA 2WVVA 4IPLA 2BV9A 3BUVA 3WZ0E 3MSGA 3WK0A 4IG2B 4IP5A 2CC0A 2TRSA 3F2CA 2QJJA 1VP5A 1HJSA 1MZRA 3ZLHA 4IIFA 2EPMX 3E9AA 1BTCA 1XM3A 2W79A 2C91A 2D3LA 3AHZA 4IMFA 3WEZA 2QULA 4ACYA 3WD2A 3GFYA 3QQ0A 1C90A 2QIWA 1GVSA 1W17A 4GI8A 2Z4GA 4AEOA 4BEQA 4FI4A 1J0IA 2YDSA 1EOMA 3P7YA 2FZ8A 2G97A 4LBSA 3RPMA 1O68A 1WXZA 1HJWA 1PEZA 5LNRA 2XUCA 3E5BA 4W5ZA 4DWSC 3OO2A 5AHEA 1OM0A 3REQB 2V69A 1HIZA 4MGGA 1S2CA 1Z32X 3PTDA 5CQ1A 3P2VA 3W1RA 3NSXA 4S3AA 1I2NA 3TDFA 1Y5WA 1UA7A 3IVUA 4FZIA 4FNQA 3BCJA 3H22A 4WXYA 1FKWA 1PXGA 2FTWA 3DH7A 4GWEA 4A3HA 3TEVA 2ZTKA 4EF8A 2UY4A 4PUDA 3RIKA 1OK6A 5CAHA 2EPHA 3N4FA 3SQMA 3M43A 4Y8EA 3ARWA 3VD9A 5DCDA 1JVNA 1MW1A 4QEEA 1R5YA 4DO7A 1KKRA 1XRFA 4UTJA 1QW7A 3SECA 3UNTA 3W6LA 3AMCA 2A7NA 3C2EA 3FOKA 2FPYA 4XZ9A 1OIMA 3BOLA 4UTLA 2BSLA 1JNDA 5C70A 1NFPA 4L4LA 3SZ8A 2BOGX 2J6XA 1J9YA 3AIWA 1OIFA 1A49A 1M41A 1J8VA 4AD4A 4IISA 4NNAA 1YYAA 1EX5A 4ZQRA 2J7GA 2QCDA 1UR2A 4LYRA 3VABA 5TBOA 3M6DA 3UF9A 1S2UA 3UXLA 1DORA 1GVRA 4AD2A 3W22A 3H4XA 2J9ZA 1RALA 3G8RA 2Q02A 2VEFA 2DSWA 1V6TA 4I5XA 2UY2A 4W4QA 3MHGA 4D6EA 1QU4A 4OHQA 5FF7A 2OOFA 4B9YA 1TV5A 3VCCA 3DX5A 4BS0A 1S5TA 1XR2A 1LRTA 3TZNA 3B9EA 3KVJA 1W5MA 1SMAA 1MXGA 4P7QA 2BXVA 3DIPA 5G1TA 3IIPA 2WC3A 3U48A 3LM7A 2Z1WA 2XIBA 1QUMA 3BLPX 3D47A 3S6TA 2VQTA 3MCNA 3W02A 1F07A 2DZTA 1G01A 3M0HA 4AMAA 1XIHA 4LS2A 4GVFA 1GJWA 2CLLA 1A0DA 2BOFX 4BFAA 4RCXA 3RF9A 1LL4A 5AC6A 3PULA 4QE4A 4JL2A 3LOTA 1FKXA 3VU2A 3W53A 4QX4A 4NILA 1R86A 2Z26A 3OG3A 3U5UA 1K6AA 3S47A 2NLIA 1TZZA 2QCLA 2R24A 4CCEA 1FDYA 2GWNA 4MHBA 2NQLA 3FVDA 2XFFA 4K36A 3VKDA 1ADDA 1XL9A 6XIAA 3OVQA 5GNXA 3ELFA 4JNZA 1OABA 2ZA1A 1XH1A 3UEQA 3QSTA 1UMLA 2ZRXA 1TUFA 2ZDSA 2XN2A 3TIMA 4DELA 3QRHA 1XCFA 2NWSA 3WQFA 1NQ6A 1GORA 4QJ4B 2PB1A 3S83A 2XSXA 1OC5A 3M5ZA 2IW0A 3DFNA 4PMRA 3W2LA 3F4NA 3BAJA 3WBYA 3F5KA 3I7SA 3RMEA 5FJUA 1HVXA 1NTHA 4HN8A 1QW8A 4LV9A 2QGYA 4HPHA 1G7UA 4C5ZA 3CZEA 3F4VA 4GY7A 2H3BA 3ZJ8A 2XIQA 1OCBA 1T0OA 4WKFA 4Q8WA 3H24A 2WQPA 1T96A 2Y5SA 4F8XA 4CD6A 2CLMA 1RAKA 4XZHA 3CH0A 4HHPA 3AOFA 2QYGA 1ZUAX 1S5VA 1A5UA 1LF1A 4O54A 4U3AA 5BCAA 5CJMA 2OZ8A 2WC7A 1I0BA 3LCIA 4IHCA 4PCNA 1SUXA 4F0RA 1UD4A 2CETA 2OPJA 1C7SA 1DJZA 3IVSA 3ITLA 3B8VA 4PMJA 3AO0A 2UV8G 1XFBA 1VQTA 3BCFA 2L5HA 4ZA0A 4FO4A 1OVDA 4W85A 1DQWA 1TE1A 1E40A 3PJXA 4ZQMA 6XIMA 4GOAA 2DPEA 3B9AA 2XVLA 4QP0A 2D0HA 1YTEA 3QGAC 1IEVA 4EX4A 2W61A 1XYFA 3UR7A 3WJZA 3N29A 5C7VA 1CGXA 1EJRC 3MWAA 4S3GA 3FSUA 3NGFA 4GUIA 2XGZA 4W9TA 3CUJA 4K6AA 3H23A 2FB2A 3PTMA 1LBLA 2YKKA 3GTHA 1GKQA 1A5LC 4AHQA 3WBWA 3FJ4A 3I68A 1TIMA 2A2IA 3KOYA 1U5JA 2Y5JA 3KZPA 1XYZA 5D38A 3CHFA 1GQKA 4RE0A 2GQAA 4K1GA 5FF4A 4DNHA 1GPWA 1SGJA 2Z29A 3FGCA 3U7VA 4C6NA 3LM3A 4LAZA 4A2RA 2G37A 6REQB 1D7FA 2BOEX 2AAAA 4QDMA 2WB5A 2O0TA 3EOUA 1P6WA 3AUOA 3CTLA 4CNUA 1CB7B 1WKYA 1MUMA 5CG7A 2R91A 5FI8A 2E0PA 3IWPA 2FVMA 3TN4A 3WF4A 1V7AA 3L67A 2VC9A 2NUYA 1OADA 3MVIA 4QNEA 1HKWA 4PMZA 2NXIA 3QZ6A 5DRCA 1JD7A 5A6TC 2IQTA 3O63A 9CGTA 1YIXA 2ZE0A 4CKQA 3QC3A 3RGTA 3W72A 4JFSA 1P4CA 1S39A 5AHIA 3WX7A 1I8JA 3WG6A 3KHJA 1G5AA 3ZMRA 4RNJA 2XM2A 3L68A 3PBWA 2R1LA 1XPYA 4U5KA 4JTEA 3VMOA 3LMYA 5FD0A 3RN6A 1H1ZA 4ERAA 2HTMA 1JF6A 4MKVA 2CERA 4DZIA 1QPQA 1P5BA 2HPMA 2WJEA 4AY1A 1BLIA 1PJ9A 1OFDA 1JDCA 4PCFA 4HA1A 2XTKA 1TWIA 4HSNA 2YIHA 4S3DA 4ATWA 2DZXA 2GGIA 1DV7A 4E2OA 2EKCA 2PDBA 4K3ZA 3T0DA 1F6PA 1PWLA 3RU8X 3L4ZA 4RNIA 3QLLA 1S3HA 3WQ4A 1UWQA 2J79A 4JIPA 2ZZ3A 3P5YA 2PLCA 1R30A 2HSAA 3D46A 1W8SA 3PVFA 5TAOA 1F6YA 2J7CA 3UCDA 3DG3A 1EL3A 3H7RA 3SRHA 2BS9A 1DBTA 3LBMA 4H8VA 4GIAA 1OX6A 4WF7A 4BKNA 1QI2A 3CQKA 3NOEA 2OKOA 1YW1A 2PTDA 4WXZA 4TMBA 1KM0A 1XF0A 3G1FA 4LX4A 1CBGA 2JIWA 4FNTA 1ITQA 1LP6A 3L2LA 2ESCA 1KGXA 1A5CA 4IMAA 3TLLA 4HU3A 1V6YA 1FWJC 2EEXA 4ILSA 4PMOA 4Y96A 4ONVA 3VGDA 4MWAA 4GYKA 2Z1BA 1QHPA 3KE0A 4KRUA 4J3TA 4QJ1A 4E4PA 2PDMA 4WGHA 4UZUA 3AQUA 3ABQA 5T91A 2JFEX 3VK5A 4HOWA 1DJWA 4QLLA 1AD1A 1GW1A 1P0EA 3L0KA 1ZPTA 4NHVA 4ZTYA 3SEPA 4PR4A 2RHGA 3W7OA 3Q65A 2PS2A 1X7IA 4KEZA 2CBUA 2OT0A 2J9YA 2CBVA 1BYBA 3N04A 1R3QA 3LMZA 3MO7A 2QR6A 2YB4A 3H53A 3H2FA 3W7MA 1JEZA 1JGMA 1FUYA 4Z1DA 2Z24A 2XFWA 3FSTA 3GS6A 4MAVA 3W29A 4QSHA 4ZO9A 4QJ3B 3UWUA 2WM1A 4JY9A 4CNNA 3A3HA 3DCPA 2VC6A 4UMAA 4YTUA 5IBXA 3FYPA 1MXDA 3PZOA 1OFQA 3BSHA 3ITOA 4IFOA 4W93A 2ZZ2A 2J24A 2FFCA 4MNLA 3YPIA 4O57A 2TMDA 1TV7A 3BMXA 3VKCA 4TVUA 2EAWA 4LAOA 2LLEA 2IPFA 2OO6A 2UZ9A 3QMRA 2WNNA 5C55A 4IMGA 2PD9A 5ABFA 1VH7A 5DX7A 1W9PA 3E96A 3L0NA 4QAIA 1FWRA 5H8MA 4KRZA 1XYLA 2WZIA 1PPIA 1L6WA 4PTNA 3ES8A 4AEFA 1VPYA 1Q7ZA 5FF3A 1XX1A 1N2VA 2QHAA 2FTYA 3CS2A 1MQPA 3WDPP 2WCAA 1JZ5A 4WZHA 2R9RA 4Q33A 1UIPA 3WF2A 1LBFA 2VRJA 1TG7A 3BMVA 1QI5A 2VENA 4F40A 1LG2A 1B3ZA 1E6SM 3CYVA 1LORA 3PUOA 1QXLA 4JFVA 3CEPA 2A3EA 1KQZA 4OOZA 2ZUUA 1OD8A 5G4WA 3M64A 2POTA 1LG1A 4LAUA 3ONCA 2ABAA 1PKMA 2Z00A 3DUGA 3RJXA 4OU1A 1EC7A 4E8GA 2GVGA 1NIUA 1ZJAA 3KOFA 3OZOA 1O5XA 4BI5A 4ENLA 5BW6A 3B0PA 4AD1A 2O4MA 1DWHM 5DO8A 1I9CB 4R7JA 4ZODA 2XPKA 4B5XA 3ISIX 1M7XA 1R3RA 3M6YA 4UTWA 5BROA 1L6GA 1E5NA 1TPC1 3L9CA 3TVAA 3DHFA 1GHRA 4FP1A 3HQ1A 2NT0A 2NQZA 1IYXA 3KS5A 2ZZ5A 4K37A 3DBPA 4QITA 3O9NA 4GJIA 3TYEA 1WCGA 1WX0A 3P62A 4GG9A 2ZX5A 1X6UA 4Q8UA 1EP3A 3ARRA 2V63A 3TROA 2WHLA 1X98A 2V0TA 1KFJA 3FGCB 3A47A