1UROA

Uroporphyrinogen decarboxylase
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
357
structure length
357
Chain Sequence
b'GFPELKNDTFLRAAWGEETDYTPVWCMRQAGRYLPEFRETRAAQDFFSTCRSPEACCELTLQPLRRFPLDAAIIFSDILVVPQALGMEVTMVPGKGPSFPEPLREEQDLERLRDPEVVASELGYVFQAITLTRQRLAGRVPLIGFAGAPWTLMTYMVEGGGSSTMAQAKRWLYQRPQASHQLLRILTDALVPYLVGQVVAGAQALQLFESHAGHLGPQLFNKFALPYIRDVAKQVKARLREAGLAPVPMIIFAKDGHFALEELAQAGYEVVGLDWTVAPKKARECVGKTVTLQGNLDPCALYASEEEIGQLVKQMLDDFGPHRYIANLGHGLYPDMDPEHVGAFVDAVHKHSRLLRQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (UROPORPHYRINOGEN DECARBOXYLASE)
publication title Crystal structure of human uroporphyrinogen decarboxylase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 129
structure length 357
sequence length 357
ec nomenclature ec 4.1.1.37: Uroporphyrinogen decarboxylase.
pdb deposition date 1998-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01208 URO-D Uroporphyrinogen decarboxylase (URO-D)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.210 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 1uroA00
1J93A 3BQ6A 3PPCA 1R3VA 3BQ5A 4AY7A 4EXQA 4AY8A 1R3YA 1R3TA 1U1HA 4L61A 4ZR8A 4L64A 2EJAA 1R3SA 4L6HA 1R3QA 1U1JA 2Q71A 1U22A 1XPGA 4L6OA 3CYVA 3GVWA 3GVQA 3PPHA 2NQ5A 1JPHA 4ZTXA 2INFA 1XR2A 3PPGA 1R3RA 1XDJA 3L7RA 1T7LA 3PPFA 1JPIA 3T0CA 2Q6ZA 4L5ZA 3GW0A 3GVVA 1YPXA 1R3WA 1JPKA 4QQUA 4L65A 3RPDA 3GW3A 1U1UA 4WSHA 4ZTYA 3GVRA 1UROA
chains in the Genus database with same CATH superfamily
2DSUA 4AY7A 1HP4A 3WDIA 2W4XA 1S5WA 3BG3A 4TU1A 1RP8A 1C8QA 3WQVA 5AHEA 1U83A 4E6MA 3GLCA 4FAMA 1CB7B 4BK9A 4UZSA 4AMCA 4LS2A 5K3VA 3OGSA 4QNWA 1HG3A 3SUWA 4PSRA 4EAMA 5IBXC 3CQKA 1Q13A 5A1AA 3WD0A 4KRUA 4HNUA 1IHIA 3M0JA 3CIVA 5DFAA 5AHIA 1OEPA 3I3EA 3BSGA 3FV9A 1VFLA 4R9OA 2DDXA 4IPJA 4LUYA 4DM2A 1RLCL 1UR2A 4Q4SA 4IGMA 1OWQA 4CD6A 4JTFA 4WSHA 3M0LA 4AEEA 1M6JA 4NAFA 3E6EA 3CU2A 1QRQA 1FKXA 3DG6A 4L6HA 2SFPA 4J3ZA 3NR0A 4W5UA 1YTDA 4C6PA 1HL9A 2INEA 1DIKA 2CPUA 5BU6A 1FXQA 4BFAA 4PTDA 2Z4GA 1MW2A 3NZQA 4A3UA 5F2IA 5J5DA 4TIMA 5F2MA 3N2MA 5E9AA 1WUFA 4H41A 3ONBA 2PDJA 4LV4A 1IV8A 4O18A 4A3YA 2WZEA 3M16A 3P5ZA 5JBFA 5A6BD 3G0UA 3WNKA 3CUFA 2X09A 5D8WA 1EDTA 1VB9A 2GGEA 1KB3A 5C9RA 1V3LA 3L4YA 1W32A 5M03A 1HGYA 2YR1A 2PLCA 4TTUA 4LEFA 5G4EA 3I4EA 2GK1A 3ANUA 5HWJA 3TUUA 3UY8A 2RGMA 2PGRA 3D6NA 1AJ2A 3WQGA 1KLYA 3WNPA 4AC1X 5DCBA 1IEQA 3PPHA 3UZJA 2NUYA 1NF7A 4JX5A 2WNWA 1FH7A 1WKDA 1VYSX 3EKZA 1IT8A 4C6DA 3CMGA 1XRVA 4N6EA 1FBAA 2V5KA 3BK0A 4F4RA 2VZOA 5E5CA 1AW5A 1H5YA 5HOSA 1EEPA 3N9SA 4AIBA 1UOZA 5XIMA 5I23A 3ZWTA 1I1WA 4IL0A 1MW3A 3DYOA 4FOKA 4CNOA 1XWYA 2J7DA 3ZS4A 2VD9A 5EFDA 4EPEC 1KR0A 5BXPA 3C6CA 3AUOA 2CYGA 4NZ3A 2QXWA 2ATSA 1GYLA 7REQB 5CLWA 2TRSA 1QOQA 4FXFA 3VDGA 1RALA 3VOGA 4O11A 4AZ6A 1TZ9A 5CPSA 4IPPA 4WUIA 5BOEA 2G3MA 1C9DA 3S3GA 1QW7A 1ZBVA 5A6TC 1XIJA 4LNYA 2YL6A 3SRFA 1U1HA 2PGFA 1BTMA 1TR1A 5C2XA 2DZPA 2D2JA 3BMVA 1US0A 4OV4A 3CASA 3GXPA 3QZEA 3C0JA 1PX8A 2QCDA 3LCIA 1ZJAA 1PIGA 4TR9A 1TIMA 1RH9A 3MB9A 4NG3A 5FJUA 2F6KA 5EBAA 3NNTA 4IJCA 1QK0A 3GTIA 4FF7A 3P81A 3EWDA 1H09A 1H0IA 4ZENA 1EB3A 4PODA 1BXCA 3B8DA 2PRLA 1CCWB 4MAZA 1V93A 1BVWA 1OC5A 3RDKA 2GVLA 4EP8C 4RZ4A 1A53A 2G37A 4LH8A 4H7VA 3S46A 3VABA 4Z1AA 5HR7A 2VWTA 2DW6A 1WB0A 1LOSA 3WUFA 2GVGA 1G9HA 2YXXA 5D2YA 3S4TA 3KBSA 3TN4A 3A4WA 3B97A 2O9RA 3GXFA 4LAMA 5CZTA 3NZRA 5HMEA 2FPYA 1GKQA 4E0CA 2EKGA 3UZZA 5IFPA 3WQCA 3QV8A 2PTZA 4K1WA 1SZRA 4UTWA 4ZZ9A 4EPDC 2ZE3A 4OHQA 2E9LA 2YCLA 4I5RA 4UB9A 1QPRA 3WK3A 2AQVA 4I5UA 1XFCA 4FLOA 3OOQA 3TROA 3JRKA 4XV0A 1H1ZA 1JJKA 2CLIA 3PAOA 2ACUA 4Q4PA 1TRIA 4HNVA 3A3XA 5AHMA 3TQKA 3OODA 2G3JA 2E09A 3RCNA 3FYYA 2E77A 1PIIA 2E67A 1KFEA 2CC0A 1O5KA 4RZBA 3SY5A 3N34A 3P60A 3OG2A 4R53A 3I6RA 2JALA 3AHTA 3PPGA 1KXQA 1FDYA 1JDEA 1DJQA 2V81A 4Y7EA 4P5UA 2X1RA 3QBUA 3A5VA 4QP0A 1V08A 1WZKA 3G6LA 5LKYA 3ARZA 4E2VA 2OEMA 1KM2A 1PKLA 1EXPA 3H12A 2WXDM 2VCBA 4X2RA 1SQ7A 2XIMA 3VIMA 4IFOA 3KRZA 3DFOA 3LHWA 1IZCA 3MY9A 3LERA 5TF0A 1MMFA 3R6IA 4JTUA 4XO6A 1V0KA 3W83A 1IGSA 3M0ZA 1KFCA 3AYSA 2G0WA 4J27A 2FH8A 3RO8A 2BLEA 3W1LA 3S47A 4AF0A 1Q4NX 1J11A 3L2IA 1MO0A 3EWYA 4V1XA 5C8BB 3PSWA 4JY9A 3GXIA 5D9MA 4B2DD 4ZQMA 4QTGA 3DHPA 4C6EA 3AIQA 2XHYA 3NDZA 3OBKA 2E4TA 1MFUA 5FI8A 4YYFA 1SO3A 4DYJA 1L6YA 1WA3A 4XIAA 1EFZA 3NURA 4XZMX 5DXYA 1LWJA 2Z7KA 4DUXA 4UTFA 4IZGA 4XAGA 4IUGA 1R47A 1G7UA 2YFOA 1JXJA 3G8EA 3T09A 3LNPA 2R94A 1MWOA 1LZOA 1XBXA 4JN8A 4Y96A 4GVHA 4MZYA 2Y8UA 5D37A 1TX2A 3I6TA 1HL2A 1QBAA 5K7JA 4HJFA 3R13A 2VNCA 3Q67A 3DKLA 1DOSA 3MBFA 4MY9A 3WDJA 4Z2GA 1Z7AA 5DX7A 4B3ZA 3SURA 4LVDA 3G22A 4L4LA 3RM8A 4JPGA 2QVHA 3P6LA 3KOZA 2JKEA 3W07A 3NO3A 3VDAA 3QR0A 3BICA 5AC7A 1B30A 3O0FA 3CZ8A 2XINA 1R3RA 5G4HC 1ONEA 3IVSA 1LP6A 3W76A 5FCZA 3CIXA 1EF3A 2GUUA 4B9YA 1JNEA 3E9AA 3N2XA 3W82A 5DMYA 3N4EA 4BJHA 1XIDA 4M81A 2HVNA 4LAKA 4U5IA 1PDYA 1GEQA 3I7SA 4MM1A 1UR3M 4QXIA 2WVVB 5JH1A 2PP3A 1HW6A 2DV0A 4EANA 2BY1A 3UYCA 3PSVA 5DEZA 1BWLA 2PGEA 3LGDA 3QPYA 1FDZA 1GOMA 3R89A 4CU6A 4C7DA 4ZBCA 3WQPA 3HA1A 4ZQOA 2G5WA 4KCTA 2VURA 1SUXA 1V51A 2HEJA 3GXTA 3MI6A 4DVOA 3IRDA 3N11A 4YWSA 2O9TA 1OADA 1QPKA 1OGSA 1H5VA 3WMCA 3WCZA 2KZHA 1TTIA 4FO4A 2ALRA 2WJFA 3UCCA 3G1XA 3TJXA 2A3LA 1N82A 2DGAA 4CVWA 4S3BA 2QDDA 1TTPA 4LYQA 2WVTA 2ZZ2A 4WOQA 1KFWA 3TC6A 1YW1A 3CMJA 3OLIA 3TMQA 5G4WA 4IFRA 3OA5A 3E2SA 2ACRA 5D32A 1SR0A 2OO6A 1S46A 3QGVA 1VBRA 3LPOA 1KM4A 1QO5A 2ZX9A 3KL5A 3LM7A 2WMGA 2DSKA 4BA0A 2XH4A 4MSSA 2OWXA 2DY3A 4I3GA 4DXXA 2W67A 3GFXA 3VNZA 1NAL1 1KNWA 1KM1A 1DIOA 2CU0A 4D8LA 3N4FA 4HHHA 1LWHA 4ORMA 3ZJ6A 2B4GA 2V5JA 5F2LA 2QUTA 3TW7A 3ECQA 4M7TA 3VKDA 2A7NA 3KTSA 3URNA 3UU0A 4KPLA 4JY8A 1UR1A 2VGIA 3W7IA 5TIMA 1MI3A 4GKTA 4PEKA 1C93A 3RLUA 1YPFA 3QC3A 3NQFA 1L0PA 2POZA 2Z1BA 3EDEA 4AX7A 3LENA 4JFSA 3ZSTA 4HNLA 3GW3A 4BEUA 3C52A 3M0KA 2BVDA 4PCTA 4I7UA 1U1JA 2NQLA 2OKTA 3ZT5A 1OM0A 5D4YA 2WZMA 1KFLA 3O6AA 2J75A 4NU7A 1ODUA 1FFRA 4N42A 4IXHA 4TTGA 3PC0A 4OZOA 3EPMA 2D2GA 4GYKA 2R1MA 4JNZA 1CENA 3AJ7A 4MB5A 3HQ1A 4BF7A 3H7UA 3RJYA 1F9CA 4GVFA 1ICQA 3LX9A 1UKQA 3JUGA 1J12A 4H8NA 3APTA 4J3UA 2J8GA 5AYZA 1I0DA 4KEZA 4RKAA 3T7VA 5JQ9A 4K1GA 4JTHA 4KGLA 5ABTA 1E3ZA 3NZPA 2CZVA 2Y61A 3OJGA 2O7SA 3AQUA 3TSBA 1EWEA 4RK8A 2GQ9A 1QNQA 3WLTA 3EXRA 4WDTA 2RHGA 4FR1A 1GVRA 2PD9A 4EK7A 4N9BA 3MWCA 4D8AA 3G3MA 4QBXA 4XAPA 1RV8A 1VFUA 3OLGA 1V6WA 3W72A 4PRRA 3UERA 4WR3A 4AYSA 1B1YA 1QNSA 1QPQA 2XVNA 3PZTA 1J9YA 5J5RA 3C56A 2VVNA 1V77A 4HNCA 3DHFA 1DJZA 3QTPA 4QJ3B 1PZ3A 5DXXA 4NY2A 2OX4A 2W92A 3AXMA 4LRSA 3E02A 3VFCA 1E0VA 4JFVA 4LT9A 1YLVA 3P14A 1ONRA 3ZSSA 1FWWA 4QEEA 4PCFA 1AFSA 4PGLA 4UTKA 3PWGA 5I03A 3SR7A 1MUMA 4S3DA 3TC7A 4JTRA 4UWMA 5CGTA 4TX9A 3NXLA 1M9HA 2XIIA 3BOXA 3A12A 3D3AA 3CV7A 4C1LA 1T6MA 3RGTA 5MHBA 1YNQA 3DERA 3WLRA 1XLCA 1CLKA 3REQB 3LPFA 3W02A 1FWBC 4DBWA 3C3UA 5I77A 1OSEA 4U4MA 5E9XA 3BANA 3SCUA 4AD4A 1QO2A 4KWOA 1KWKA 4LTSA 2QW5A 1KRAC 5FD0A 4JDBA 3K30A 3PAJA 4CCZA 5F4SA 5A8QA 2ZUVA 2J66A 3GDRA 4ZB2A 3PZVA 2X1IA 2VR5A 1EBGA 5CZSA 1MW0A 2EJAA 4DJED 2QQ6A 2X8RA 4MPQA 2YBUA 3QR1A 1YHTA 3VD4A 3W84A 4GNJA 3N29A 2WNZA 3MUY1 1XLMA 2BBFA 3GDTA 3S2MA 1XL9A 2J74A 4QQ3A 1RD5A 1EJRC 1UASA 1G0CA 2E9MA 1HTIA 2VGGA 4N9CA 1V3KA 3T4WA 1W3JA 3NGFA 1LQAA 3H2CA 1WXZA 4KRZA 5L9FA 1XPGA 5FSEC 3T1GA 1DIDA 4Q3MA 3WF4A 4HMCA 1XRTA 2ZYFA 3G1AA 4Q32A 1KCLA 2J79A 1F5ZA 1FH8A 2WCAA 1E72M 1TV5A 3ZFHA 4DJFD 2EQDA 2ZRXA 1DYSA 5G1MA 2J6XA 4GI6A 4UCFA 2X42A 1X98A 1ZS2A 4A8LA 3EX2A 3EPOA 3QY7A 4DWSA 4PTNA 3CT7A 1E1CB 5GJPA 1F3XA 3TOPA 4EPBC 3IJIA 3OZMA 2GGHA 2KX9A 4KBXA 4UQCA 2WV8A 1KKOA 1REQB 4PUWA 4O50A 1ZHAA 3AS2A 4CNSA 2KAUC 3QOMA 1RZMA 3TA6A 2PODA 3W87A 4F66A 1NU5A 4RE4A 4H00A 1ITXA 5CBBA 4O1CA 4K39A 4POCA 1TPVA 1LOQA 1VJSA 2NQ9A 1VFSA 2HXUA 3HTWA 3RG6A 4W8LA 1QATA 2ZICA 4TOQA 4H7ZA 4JYFA 4ACZA 4GACA 1WKEA 2Z2UA 1W6TA 2FPVA 4RV8A 3WJXA 2J8TA 5EA9A 3CUGA 3E49A 3ZVHB 1QI0A 1R38A 3G24A 1E6RA 2G3IA 4ADUA 2V2CA 2WMKA 4MVAA 1A0DA 1YPIA 5C2CA 5D38A 1K8YA 3QQ1A 1Z48A 5LNRA 4IIHA 1SW3A 3DUGA 4XQ6A 1XI3A 3GKFA 4WJXA 1SO4A 3EDKA 1R85A 2GGJA 4NASA 4CQAA 2BS9A 4J7RA 4WOZA 5DLCA 4Q8UA 1UH2A 1MEWA 3EPNA 3GDKA 4OIFA 2OG9A 1VH7A 4XZ9A 4CNUA 1TPEA 4C6BA 1PIFA 5FL0A 1XFBA 4P8UA 4V1YA 1V5XA 1KW1A 3PJTA 1POJA 4ILSA 2POTA 3OU8A 3NYDA 3L65A 3HFTA 4DBSA 3EA2A 4UQBA 1SM9A 1R86A 3BZJA 3RRXA 4MJZA 3DH7A 1DP0A 1OGBA 1J2WA 1XGZA 2NQJA 1AA1B 1FXPA 3W7OA 3L7RA 1UR9A 5GQBA 3F4CA 1V79A 4BQ3A 3KOXA 5CAKA 1YNPA 2ONEA 1HJXA 1YE4A 1Z44A 2ADAA 3VO0A 8XIMA 1QOXA 3MJYA 3FVDA 2WSYA 3R0UA 4LUJA 3F4NA 2CCRA 3RR1A 2A85A 2F2HA 3PY2A 1E51A 5DMNA 5XINA 2FMOA 4BI7A 3U9IA 4JEJA 4Q8QA 2JIWA 3MKKA 1CXIA 3UZXA 1Q4WA 1OHLA 1K03A 2CEQA 3W1XA 4R5EA 3B8VA 4QGCA 3LZ3A 4A2RA 1H49A 4L64A 3T8QA 3WQWA 1J5TA 2P1FA 4TO8A 1NJJA 4NJHA 3NSNA 3THUA 3S0CA 3GNDA 4K3ZA 3PANA 5A6JA 2E5BA 2ZZ4A 2IW0A 2VZVA 1UD2A 3NPVA 1C8VA 4GFIA 2ZDSA 2X2GA 4DXKA 1CZ1A 1AH0A 5LA0A 4AY1A 1PTAA 4HHMA 4QAWA 4GH1A 3DFSA 2GSHA 2PDXA 3PTKA 2IKGA 1E4NA 1JDCA 3KCOA 4J5NA 5F4WA 1H3GA 1MYRA 1DBTA 3A5FA 1XRFA 4Z42C 4UR8A 1US3A 2REQA 4GYPC 3NSXA 1LBMA 8XIAA 5I3HA 7TIMA 2UV8G 4H3DA 3UF9A 2RKXA 2ZX8A 4NZCA 5FJJA 1KR1A 1AW2A 1J0JA 2WLZA 2QUNA 1U5HA 2UBPC 3L0GA 2FGLA 3WF0A 4RNFA 3GTNA 4ZCWA 4HMNA 3G1VA 4B5TA 2OWCA 4BWLC 4H4IA 3C0QA 1DJHA 3S2JA 3FAXA 1EQPA 1RJRA 2WPBA 5DN1A 5CLTA 2ZVRA 5MKGB 1Q7QA 3AXKA 3N04A 2ZUTA 4R7WA 2IS7A 3ITGA 3W2KA 2QPSA 5RUBA 3CO4A 3SCVA 1E55A 2OB3A 2E6DA 2XN2A 2BDQA 3F5KA 1DPMA 3OYZA 3T55A 3LYEA 3PHAA 4YTQA 1P0NA 3N14A 3NL3A 3NTYA 3SSJA 3A13A 4R7OA 3C0SA 3SN0A 1D7KA 3I65A 2OVLA 3QMRA 3IUDA 3OLEA 5LXEA 2BB0A 2A79A 2IQDA 1Z32X 3HGSA 1V8EA 4A6GA 1UQZA 3SGUA 2YDRA 3MCMA 4AXNA 3EEZA 4WSJA 3L67A 1CNVA 2W3ZA 3F2DA 1WPCA 1XBYA 1S2VA 2XSAA 3ME3A 3FYOA 1ZP4A 1KD0A 4AG0A 4L1WA 4GNKB 1HKVA 2F38A 2AL2A 1XG4A 2DVUA 4AD3A 1ITCA 3UYIA 2DPEA 4DB7A 3T0DA 4IMFA 3RFAA 1SZGA 3BVJA 1VPXA 4GIEA 4LOCA 3ZJ7A 4TX8A 2PP1A 2C6QA 1CWYA 2XYLA 2WMIB 1XPYA 1A3XA 4HCDA 4QROA 3ZYZA 1J10A 4DWSB 5T8GA 2VDIA 3HPSA 4QJ4B 3SIZA 3N6JA 4HA3A 4I7WA 4PTVA 3A21A 1QJWA 4BS0A 2PLMA 2VFDA 3GX9A 1Z69A 4A4AA 1Z6KA 1MEIA 4ZOCA 2OLAA 3EKGA 1JQVA 2PWVA 3K46A 1VP5A 1WZMA 1DHPA 1TMLA 5KINA 3T40A 3URAA 3ISIX 3GY1A 1WAWA 1VLIA 2WLYA 2ZX5A 3S6TA 3T05A 3W27A 1AQ0A 2A4AA 3CQHA 1DWGM 1TELA 4GK8A 3GNRA 1M01A 1SO5A 1J18A 2WMJA 4WY0B 3EKLA 1YRRA 1NDYA 3SCQA 1W3KA 3OVPA 7ODCA 5KZEA 3Q4DA 4FS9A 1OY0A 1GZGA 1QR7A 2Y62A 2HPIA 1UUOA 4MGGA 3KX6A 4BI5A 3RU6A 4H9VA 2RGLA 1B3WA 3BAIA 2JK2A 4PR4A 3R7MA 3KBNA 3G0SA 3AICA 3RMJA 3ZR5A 3V0SA 2INZA 3KVMA 3N2BA 3MO7A 4L4OA 4B4FA 1E40A 1XSKA 3D0CA 1L8NA 2IKHA 5CG0A 5HXMA 3NQ7A 2V67A 1F6YA 1VHCA 2XFRA 3H22A 3ID7A 1JZ2A 4NYYA 3SY8A 1KLZA 4IP7A 1PHWA 3SCNA 3WLQA 4PB5A 2GYIA 2V68A 2ZXDA 4B5VA 3W7NA 1VFFA 1YDYA 4QE5A 2CHRA 3OZYA 1K7FA 4XTDA 1SJAA 1Y5VA 2RDWA 2VD8A 3LBOA 4DWDA 3LMZA 4AZCB 3EBVA 2P8CA 3LCHA 2E6YA 4KQNA 5BROA 5LNSA 1ZSXA 3GNXA 4L1XA 3LXCA 1WKYA 1OFQA 3DAQA 1O12A 4E5TA 2B7NA 4GY1A 1G94A 4CQ8A 1GPWA 1XYBA 1Y65A 2GLKA 2VEMA 1V6YA 3G1HA 3VZZA 4PMQA 2PP0A 4WDUA 3UA4A 1XIGA 2CBVA 3M0XA 4O1AA 5A6BA 4JOMA 4LVFA 3TNBA 4O4WA 3S9YA 4Z0JA 1I0BA 4NZ4A 3TQPA 3ENLA 3S9IA 2ZUUA 2R6OA 5JXQA 2GQAA 4DF0A 1F6KA 2XIJA 3MCNA 2A3EA 2Y5SA 3K2GA 3WLMA 4NNCA 3WYZA 1H2JA 1EPXA 2E5CA 1UR4A 1E73M 4GQGA 2D0HA 3KUMA 1T7LA 3EZ4A 4Y6GA 4WSKA 1JG9A 1GG0A 2BOGX 1JCMP 3APGA 3H4WA 4JICA 5CXPA 2R9RA 1VFOA 2Y8KA 4PE8A 2Y89A 2ZA2A 4R34A 5HQEA 2OR2A 4RPQA 3CB8A 3VK5A 2QLYA 1O60A 4ERAA 2BXYA 1UZDA 1KWGA 2IXUA 1JPIA 3C2EA 3W3OA 2UY4A 2J24A 4NZ1A 4MDOA 1UHVA 1J5SA 5C55A 3TFXA 3TR9A 4QITA 1B3ZA 3WFAA 1K3UA 4O14A 4UFLA 1T5AA 3DFNA 2Z1KA 1XGDA 2VGBA 2RDTA 5AVNA 3QTGA 3DC8A 3HPZA 1TKKA 2FZMA 2VCAA 3WJSA 4QG9A 3KTCA 3NO5A 5CBIA 3K8KA 3AYRA 3AYVA 3QFEA 4V33A 5IDZA 2Z2BA 2QJIA 4FLRA 4M1BA 1QCWA 1F8MA 2R24A 1ME8A 4RX0A 2YW3A 3MYOA 1TE6A 1NFBA 4KKXA 5JVLA 2BGNE 4JNMA 2FTYA 5HANA 1J0HA 4W87A 4YXGA 3S83A 2WAGA 3OZPA 2FHFA 3UXKA 1C7SA 2ALDA 1GOKA 1UJQA 4NAEB 3ZLGA 3MSYA 1CIUA 3PBVA 2A3HA 1FRBA 2YXOA 1B5TA 3HFYA 4P7NA 3PBWA 4DX3A 3DC0A 4M0XA 3APYA 4PULA 2WHMA 4DUOA 3WLKX 1ICSA 5IDIA 1E1EA 4A05A 5HNTA 5AVHA 1VLWA 3U2ZA 1VEMA 4CQCA 4MPKA 2ZUNA 1H51A 1UZ1A 3A4JA 3AFBA 2H8ZA 1M53A 1ZBKA 1K6AA 3RCYA 1GOWA 1L6GA 2ZIDA 2D3LA 2VEIA 1BQGA 1PTGA 2YB1A 1VC4A 1IT7A 1EJVC 5E09A 2X41A 5CPMA 4J28A 2GJXA 4WDWA 1FWJC 3I10A 1Q6EA 2XH7A 3NG3A 3BOLA 3WEOA 5E0KA 3AU2A 3AALA 3ZIZA 3FJ6A 2BVYA 3VU2A 3NQBA 3GZAA 1W17A 5HJLA 3CQJA 3T0TA 3VCCA 4NX0A 3P61A 3U2EA 1Q6LA 1NP2A 4AXKA 5F1VA 2AGTA 3SUTA 3R2GA 2W62A 4YHEA 1R3TA 4OWGA 4N7QA 1JFHA 5LIWX 1GYMA 3U7BA 5DO8A 4J1OA 3HJEA 3KRBA 4YLWA 3VGGA 3MHFA 3MS8A 1JDFA 2OX1A 2NQZA 3M5XA 3TTQA 1DJNA 1MFVA 3MA8A 1XH1A 2C8NA 4LXFA 4O1DA 4UC5A 2HTMA 2E1WA 4LUIA 1TJPA 4GC3A 1A49A 3TH6A 2JEQA 4JCMA 5KETA 2J13A 3OGVA 1JQXA 5ABFA 4LCSA 3KOWA 4F2TA 3ABQA 3WEMA 5LYRA 1YIXA 2HK1A 5KTLA 3G1FA 3T2OA 3AZRA 1SMDA 4KEMA 1W1B1 4J4KA 4Y9NA 3SAZA 4X0NA 2A7PA 4DYKA 3F7JA 1JZ8A 4X3ZA 3PUEA 4YVPA 2PDWA 3TCEA 1JGMA 5D03A 4K8EA 1CDGA 3GVVA 2VUNA 4H1ZA 3LY0A 3NPUA 2O92A 2P0OA 3IK2A 3GH7A 2C1HA 1VJIA 2J9ZA 3E5PA 5HUOA 1AL7A 3Q58A 3UWZA 1EQCA 1F3TA 2QS8A 1RXOB 1Q8JA 5IFTA 3NM1A 2VEGA 4Q22A 3JW7A 4LEQA 4IX0A 1TJ0A 1NIUA 3B03A 1OB0A 4GZEA 3FVMA 4S3GA 4B2DA 1O94A 2QVNA 1G4SA 3FGCB 4J35A 2L5HA 4Q8VA 3RO6A 2AMXA 4LPCA 4EWJA 2CBIA 1UIPA 1IQ8A 1E56A 2NT1A 3WH7A 4ZO6A 1HKJA 4XD6A 4Y8FA 4DJDC 3K13A 2HNHA 1AD1A 3GC2A 4HP5A 1V0LA 3TX9A 5IHRA 4MLRA 3GTFA 4QR6A 3IGSA 3WUGA 2GOUA 3LQLA 1Z41A 3RPTA 1YBQA 3VIIA 2YLLA 2D69A 2ZXAA 1BGAA 2DUXA 1P7TA 3SFWA 3E74A 3GC4A 1O4UA 3A24A 5F7UA 4IP4A 3V4BA 1OD0A 2ZX6A 3WK1A 5FEZA 4ZQNA 3ALGA 2JQXA 2H9AA 1PSCA 3TKFA 4J9JA 3FOKA 2ZVIA 1Q63A 1BVZA 3SQMA 1DXFA 1RQEA 3SSZA 1MQQA 3U5YA 4UFKA 5FA5A 4ZE5A 1PO9A 1LWIA 2HE8A 4ADTA 1TCDA 3ARXA 3WL1A 4MLJA 4BQ4A 4YTTA 2GL5A 3EOEA 4EE9A 4I5XA 2W61A 4MJMA 3W7CA 4WK9A 2W9MA 1F3EA 4K6AA 3UA3A 4QLJA 2G97A 2NQHA 1POKA 2BNJA 4OT7A 1SGJA 2OWWA 2C1IA 3LXBA 4XZBA 3S1VA 4XK2A 1W56A 4MJ4A 1E71M 2DZTA 4B5WA 2GOKA 4CEXC 4QE1A 3PUOA 1CXEA 2PDBA 2HE5A 4PEEA 4OUEA 3O1NA 2XM2A 4G2DA 1W9PA 4ZVJA 5KEZA 1CBGA 2WKLA 3RF9A 3GRIA 4AC7C 4CLMA 1XLBA 3MMTA 3UWWA 2AQOA 1MZHA 4HSNA 1UOKA 4NSBA 3TZFA 3WDHA 2OQYA 1XDJA 3ABOA 3GXMA 3VIPA 3R8HA 1N2VA 4KCWA 1DQXA 3U3HA 1K9DA 1ZFJA 5CJMA 4E8DA 3ITOA 1EWDA 1W5OA 3H2EA 1F05A 2EKCA 1GZJA 3BSHA 1HQTA 2VX4A 2PTDA 2X7WA 3USBA 1EP1A 3NQ6A 1RHCA 2DH3A 1BHGA 3HGRA 2QNEA 3BZGA 4QDMA 3VDCA 5JBEA 2TAAA 3VMOA 2BX7A 4GRSA 3T6CA 2FQIA 3N3MA 3C0LA 3WUBA 4M51A 1NWUA 2PLKA 3CPUA 4M6UA 3HF3A 3LI1A 4US5A 3UGRA 2VEPA 3IJ7A 1P6WA 4DI8A 3SCRA 3M6YA 5I3KA 2E25A 4ERGA 3QMSA 2VZTA 2YDAA 3EX6A 4A22A 1OCQA 1G69A 2NXIA 2C14A 4W88A 1HT6A 3VGFA 1NH6A 1FY6A 3KAOA 2UY2A 4PMXA 2EPKX 2QZRA 4F9JA 4LYRA 1M65A 2PDFA 3SM0A 3ARRA 4X2PA 4Q7NA 3FSTA 2ZFAA 1QWGA 2WHJA 4X9SA 1G4EA 3JS3A 4AW7A 3QVQA 3DXIA 3PB2A 1NTHA 1V0NA 2HK0A 2OZ0A 4RXFA 3VOHA 5C0QA 4LANA 4M19A 3WKZA 3EYPA 1BKSA 1V6UA 5DBTA 3LNMA 4DEFA 2WQDA 5AKQA 1YNYA 3VDBA 3FAWA 1XS2A 2Y24A 4NILA 3E3HA 2FJUB 1A5KC 4RNHA 2DSVA 2GVEA 3VUPA 1EIBA 5HQLA 4D8ZA 3EWUA 3HBLA 3TR2A 1VBHA 3QV7A 4W85A 3EX1A 5FF2A 3NEVA 4ZE4A 3WN6A 1WP6A 1GW1A 3N13A 3CZLA 4FX7A 4P8WA 5D2WA 1XC4A 1CGTA 4S2BA 1AG1O 3QOKA 4UR9A 3UR7A 6TIMA 4FA3A 4M6PA 3UZ5A 3EX3A 3KVJA 1LL4A 4MWAC 1B9ZA 3T08A 4C1KA 1O1ZA 1EP3A 4IT1A 3TA9A 1S1PA 1LF1A 1W2VA 2GFTA 1FWRA 4HA1A 3UEQA 2XN1A 2W6RA 5C9ZA 3SDOA 2OOFA 1H1YA 2CZDA 4TMBA 2G3NA 2NV9A 4GNVA 4QG8A 1ONWA 4JKKA 4NT0A 2BG5A 1E4IA 3VM7A 1TR9A 1DKWA 3FA5A 3MHGA 4MB1A 4JNYA 3TW6A 3WQ6A 1EJTC 3MSRA 1PB0A 1G1YA 3BLLA 1I9CB 5PTDA 1PKNA 1A3WA 1SFTA 4IISA 3R11A 4MIMA 3KS5A 4GY7A 4JTSA 1JZ3A 1O5XA 2YL5A 4AZGA 1JD7A 1JIBA 1K1DA 2I56A 1X8FA 4R27A 3VI2A 1UMYA 2D23A 2QDGA 4H9TA 2CHNA 1MNZA 4JHOA 3GC5A 1EA0A 4HU3A 4DNHA 3PM6A 3MWAA 1VPYA 5FOOA 3TTYA 3B4YA 1XR2A 1Q6FA 2FGZA 2DIJA 2PRMA 3TP4A 4IP5A 2QGHA 3EOOA 2DJXA 2ISSA 3U48A 1CGUA 3IUHA 1UBSA 3W2UA 4HA4A 1I6NA 5DRIA 3MV01 4JKLA 2I5QA 3KBVA 5CJNA 2V3FA 2OEKA 1DJYA 2BHYA 4H9ZA 2Z26A 4DJEA 3STPA 3TYDA 4S3KA 1QPNA 2GWGA 3TQ0A 3LRMA 4TUFA 3CAKA 3T0BA 1VBJA 4JTTA 3B40A 1Y7VA 4M24A 1NWTA 3BCFA 1C92A 5AZ1A 1RAKA 2ZUMA 1QXLA 1D7FA 1IIGA 2ZRUA 3S5YA 1UBPC 5DMMA 5TBOA 2PDUA 2I9UA 4WD0A 3ZT7A 2XZ9A 4E2OA 1BPLB 1JZ4A 3T78A 4LAOA 3TWBA 3HV8A 1EOKA 4KERA 5BWFA 4DJFA 2FB3A 3R8GA 4GE8A 1UD6A 4M6QA 1QDSA 3H2NA 9XIAA 2DQXA 3WMBA 3LCLA 3GTHA 4ICMA 1ZL1A 3UR8A 3WENA 1WQ5A 3ES8A 2V9DA 5FAJA 4JFWA 2BOFX 3MUCA 3HQOA 1H50A 5LIUX 2XZ7A 3SADA 3B8IA 3WJWA 1SZFA 1BVNP 3W71A 1Q6RA 3KTXA 2ZA3A 3RX2A 3E2RA 2AKZA 3UWVA 4LW7A 1VFMA 3WF2A 3T0CA 3AIEA 5LIYX 2PUZA 3O6YX 1X6LA 5K9CA 1OYCA 3KZPA 2IKJA 3L4ZA 1FWAC 4EF8A 2I5GA 4O1EA 1Z89A 2INFA 4QCFA 1RD6A 2NZLA 4B5XA 4Z1DA 3TNOA 3W4RA 1OFDA 3QYSA 5LXXA 4B4HA 5I00A 3NIYA 3AJXA 2PMQA 1GQNA 4MOZA 1SVDA 1EJWC 2DFAA 3CHVA 2WM1A 1GONA 3WZ0E 3GYCA 1UIOA 1V02A 1H7XA 3TYZA 1BYDA 1Q85A 2ZBTA 4LUSB 4G9PA 3WMLA 2D20A 2AOSA 4RZ5A 1BG4A 3RX4A 2V0TA 2GJLA 3E2VA 3S2CA 3NVTA 3ONCA 5FF3A 1YDOA 4XG1A 2ABAA 4D6JA 4GOAA 1L6FA 2NVCA 2GDUA 4Y2WA 4JHMA 4TX6A 3AAMA 3KCLA 3DFHA 1BYAA 4GQ0A 3M07A 4GABA 1FHVA 3R12A 2OSYA 4IQDA 3GB6A 1XLFA 3QR3A 3RUBL 1OFRA 4N4PA 1PE1A 2HJPA 4LBRA 2OKOA 2OLSA 3OLDA 1LRQA 2WM0A 2B31A 3MSDA 3W22A 1Y5XA 5AECA 1PUDA 3VIHA 3H24A 3LTSA 4PRTA 1N8IA 2PZNA 3R79A 4UTTA 3BJFA 1KBJA 3W7GA 4PL2A 4LJ3A 4OV9A 2PDLA 4RE0A 5GJMA 4DNMA 4NRRA 1JR1A 3MP5A 1EA9C 1VGAA 1XLIA 2RFGA 3GYEA 3WEZA 4RNJA 3ZWSA 1A5BA 4FF5A 2C19A 2WVSA 3I3BA 1AQHA 3VKCA 3U4FA 4NIRA 4O15A 4MKVA 4JAWA 3V1HA 2YSWA 3O07A 5F4XA 5DANA 4RDZA 4UQEA 1JZ7A 3OTRA 2AAMA 1QTWA 3IARA 4HHLA 4PUUA 1EGZA 4RZ6A 1HKKA 3BXWA 3ITYA 1NELA 4IPNB 2YCKX 3W53A 2VI0A 4O16A 1PWMA 4UTWC 1QI5A 4XB3A 4L6DA 5C5YA 1EJUC 5FJIA 5U4NA 1W5MA 4HZ6A 2VFIA 1FFQA 2VFEA 1B3VA 2YYUA 1TPC1 3QQ0A 4EWND 3HGJA 1O7AA 1F73A 4HSOA 3QV9A 4GVGA 1EUAA 5AFDA 3AIVA 5BOOA 2WMFA 3OQ8A 4AB4A 2WK2A 2X05A 3BH4A 5T9BG 4UTLA 3O9NA 1W8GA 1HN1A 3LD5A 3IVTA 3NSMA 4B92A 1Q45A 4UMBA 1SMAA 5H8MA 3GG1A 2ZTKA 1ZBWA 4I90A 2W5FA 3WLJA 4WRHA 1FP9A 3BURA 4DO4A 4G1NA 2CLMA 4UOJA 1BRLB 3ELFA 3WBAA 5HAOA 3MU7A 1ISVA 1FH9A 2ZX7A 3EA1A 3W7KA 1XCWA 4JQ2A 2JE8A 3NPXA 3VMPA 4ZSUA 2I17A 2W27A 2F2KA 2J7HA 3PBYA 4R88A 2FTPA 3PJUA 1TPH1 4WEVX 4OTKA 5KMYA 2DZUA 4UOQA 1K6WA 1Y0EA 5E1QA 3THAA 1TVLA 2QCLA 3C4UA 3MSGA 3H4XA 3E5BA 3WH5A 3KRUA 7REQA 1E4LA 3PFMA 3NPWA 1KRBC 3C2VA 5LIXX 1X6NA 3TFCA 5E70A 1WZAA 2OSWA 1B57A 3M43A 4Y90A 1I2OA 4U10A 2ON3A 2GGIA 1U33A 1E6SM 3LHZA 3AUJA 1LT7A 4FMVA 1AODA 1TVNA 2GJNA 4IQJA 1PYMA 2YBVA 4I8YA 2YZRA 2EG6A 3E38A 3GFYA 4AZHA 3P74A 4HN4A 3UWUA 3VX0A 1IE7C 3IEBA 1TV2A 2XFWA 2DORA 5BYWA 4IMCA 1EYWA 4U33A 4PMNA 2V38A 2Y85A 4Z2HA 4V2XA 2PTYA 4AWSA 3N9KA 1JAKA 1J0IA 4FX6M 4OBTA 4UFHA 2FPTA 2HBXA 3LU2A 3QW4B 5I3DA 3VZXA 1DVJA 3FS2A 1AVAA 1AJ0A 3CH0A 3ZLHA 1TZ7A 1I75A 4S3AA 1JXKA 3CAVA 4TQTA 3BTNA 1LUCB 3NQ2A 1DWHM 4IJBA 1PCWA 4LAZA 2OPJA 1XKYA 1QT1A 1X96A 3N19B 1KM5A 3CXOA 3I3DA 4C6MA 4PMRA 3EWXA 3IV8A 4JN7A 4ROPA 2I16A 2J7EA 2V8ZA 1XINA 4QAIA 3C5QA 2PGWA 3M47A 4R9XA 4PTWA 4DPQA 4FLQA 5JH2A 2FFIA 4Z2IA 3HQPA 3C2FA 3WFLA 4XZHA 5CPTA 7PTDA 3RLHA 2YBTA 1OVDA 3WNOA 1VCVA 4LUTB 1VD6A 4CCCA 1TV4A 1V3HA 3V16A 4GO8A 4GZ7A 2RH9A 2JIEA 4AHQA 2CFFA 3UG5A 3VOFA 2BMBA 4MZ1A 3AWNA 4S2CA 2GPTA 2BFGA 4AAJA 1T0OA 3RRAA 2J7GA 1BF6A 1WO2A 1MRAA 2YA2A 5FIPA 1T40A 1TA3B 2P8BA 2BY2A 4MMWA 3E2QA 4H8HA 2W63A 3LBCA 2PDKA 4UTJA 1WBHA 3LCXA 4LRTA 4EX4A 5LA2A 3WFZA 1P5BA 1GHSA 1AH4A 3BQ5A 1XDMA 4IH3A 4L9YA 4PUEA 1SSGA 3GR7A 2J8FA 3TC3A 4D6IA 3GK0A 4YIWA 4AVNA 4O12A 4CVUA 1QW8A 4K8GA 2QAPA 1VZWA 1D3CA 5D33A 1Q8AA 4WGXA 3QM3A 4XZWA 1A5UA 3OP2A 1K9FA 1E9LA 2E9BA 5K4XA 5K4ZA 4PYSA 1OZQA 3OVRA 4S1FA 2YPIA 1E9IA 3BGGA 4WKAA 1KTBA 4GBDA 3LZ5A 2W79A 4I9AA 4C7FA 3PS7A 1BYCA 4Y9OA 6PTDA 1CLXA 4DUVA 5AC4A 4PUMA 1ISWA 1UP2A 4D6EA 2R1LA 2ZC1A 2PDNA 1AL8A 4Y9MA 1GHRA 3HQNA 1WYIA 3K8LA 4JFTA 1FWNA 1B4KA 1JVNA 2VFFA 3G5EA 3EAUA 3I7RA 3BAYA 1FHDA 3EOUA 3A4AA 1R9ZA 3W1QA 4K36A 2DT1A 1S5VA 1N8FA 2Z29A 4AZ7A 3T9PA 1J2BA 6A3HA 4NZFA 3G2GA 3UETA 4IMGA 2A0NA 3UJRA 1KBKA 4MYXA 1KA9F 3OB8A 4LY4A 4DQWA 5BMXA 4L4PA 4O53A 3LLXA 4F0KA 2NUXA 1BSIA 1U1UA 1PX3A 3JZEA 1TV3A 4DELA 4JTDA 1CI1A 3GIYA 2NX3A 4G5DA 4JFUA 3P7YA 2NWRA 3GH4A 1QNVA 3E0FA 5BU9A 3BCJA 2ZZ5A 3PUDA 3GU1A 2AMGA 3VNMA 4UNIA 1NDVA 3OBAA 3L4XA 2WVVA 3H54A 3TYCA 3XIMA 4FK9A 3DG3A 4EAYA 4AIOA 4L56A 1SU5A 3UR5A 3JVAA 3EWCA 1CECA 3KOYA 3TLLA 1QNPA 3UQNA 4FNRA 5G2WA 3HV9A 1IZKA 4FPSA 3CUXA 2E0PA 3SRDA 4IIFA 4ACYA 4C6FA 1ZGDA 3KHJA 4PUJA 4DLFA 3HJZA 3RLVA 1V4YA 4G1KA 3HMCA 2QCNA 1QPOA 2IQTA 4PA8A 1KM0A 5EL1A 4FALA 4MDPA 9XIMA 3WK0A 3SUVA 1IEXA 3TV8A 4H2CA 4ZA0A 3AIRA 2DT0A 4HOXA 1TG7A 4AEOA 3N73A 3H23A 3O6CA 3NWRA 1HF6A 1KFBA 3WMSA 4KRTA 1XICA 4NJJA 1UQYA 1W5QA 1E9YB 4WF7A 1H7WA 5E6YA 1XM3A 1A5CA 1OF6A 5BW6A 2VL4A 3O15A 4C6NA 1EX5A 3W7HA 3TOYA 1B31A 3ZOAA 5C7HA 2NT0A 1PZ1A 3DFQA 1FDJA 3VIKA 3L4VA 4F9DA 3H2MA 3TXVA 1HFBA 1S2TA 4RL3A 3CM4A 3EB3A 1KKRA 2GVJA 5JBDA 5H91A 3AIWA 2PCEA 2G96A 4GGHA 4XVEA 5HNUA 4F0SA 1JGIA 3MANA 1UB3A 3M1ZA 4HOWA 3M0IA 1G6CA 1SJCA 5HQMA 2EGZA 4AD2A 5ENLA 4JIQA 3IJ6A 4W8AA 1W3IA 1IWPA 1CW2A 1ADDA 1AH3A 4MUZA 1XIFA 1PS9A 4L6OA 1EJSC 2VENA 2ZUWA 2QIIA 3O8AA 4M82A 1XHGA 3B06A 3EWZA 4CQBA 2CW6A 1SPQA 4ZOAA 2FH6A 2HRWA 3VD7A 2VC6A 4BKNA 1XISA 1TWZA 2ZTJA 1W1IE 1G5AA 4JTCA 4KIRA 1GKRA 1UG6A 2XGZA 3FCPA 1JAEA 3V0UA 2X2YA 3NDOA 4O54A 3NA8A 3LGGA 1TWIA 4DN1A 1XV8A 4R33A 1HZYA 3KZSA 3PWIA 3T2QA 4TXEA 5I3IA 3PPFA 4DI9A 5FEXA 1BD0A 4G7FA 3VNJA 5AYYA 1LRTA 3UCDA 1T99A 4RE3A 4J3SA 3IPWA 2TSYA 3G0XA 2WB5A 5I3JA 1E6ZA 2F7FA 4H6KA 2WWDA 5I0DA 1GK8A 3BO9A 1KM3A 3AZTA 3P80A 2QDHA 4DWSC 2FDSA 2CLKA 3KOFA 2X1UA 1LCOA 4MWAE 1L8PA 2CZEA 1KO0A 1ECQA 2J77A 5H8PA 5I2UA 3WL0A 1DWJM 4QCEA 4IIEA 3NQEA 1JI1A 2DZXA 3S5NA 4TVDA 2GDVA 4DF1A 1VEOA 5HA7A 3C61A 1XF0A 1ZY9A 4XUYA 2IUZA 3LTYA 4HPJA 3LHTA 3CQIA 5I3GA 4G7EB 4EXQA 4UBPC 2YDSA 3TTEA 1WXJA 2FVLA 1TRDA 4YVVA 1ZAIA 1G67A 2QJHA 2VWSA 5M2FX 2O55A 4JIIX 2CLOA 1CLVA 3N2OA 2QJNA 3UWYA 3NQ8A 3UXAA 4PB4A 1ML1A 1PKYA 3U2OA 4HYWA 3UJSA 4YHGA 2A3BA 5A6LA 2X0SA 4E3TA 5GNYA 1TV8A 3DN5A 5T9CE 2FVMA 2TODA 1QWKA 1OG0A 5FEPA 3Q2DA 5GNXA 1UUQA 1TMQA 5G2IA 3GHSA 1Q66A 3GHUA 4NI3A 2IXVA 3NQMA 2IPWA 2P88A 2IPJA 1TPDA 3WBYA 2PWUA 2ZA1A 3BARA 4ENLA 3ARVA 1VKFA 3HZ3A 3K1DA 1K77A 3R0KA 1FHLA 5B7ZA 1Q7MA 2DVTA 1XG3A 2NLYA 1RCQA 2VC9A 4QLKA 4X61A 5EYWA 2P53A 2ZRZA 4G8TA 1TWSA 1FTXA 4UQDA 4ZQRA 1XW8A 2Z25A 2QUUA 1H7PA 2CXEA 4GIYA 1QASA 3KM8A 2EPOA 3P62A 3S42A 1C29A 4KWWA 4ML4A 4JTGA 3SQLA 2CNCA 3REQA 1EP2A 3N6QA 1XRSA 2MNRA 1RUSA 2IPGA 3NQDA 3OVGA 4NNBA 1NDWA 1DWAM 2B7OA 3TQVA 3CMFA 3PZUA 4LQ1A 3PZNA 3MYPA 4ZQPA 3GDMA 4LV9A 5C9UA 4NYUA 4WLCA 3S1GA 4IMDA 2VFHA 2WJZA 4MJ2A 3CAQA 1ZALA 1HO4A 4LWWA 4S3EA 3UNDA 3DI1A 1ZTVA 1D8CA 1BSLA 3MHUA 3WO8A 3N18A 1X38A 2WBGA 3RPMA 2QJGA 2QAFA 5CPOA 3D47A 2QPXA 3LDVA 4IFKB 4JTQA 1E0WA 1XC6A 2VDGA 3QY6A 3LHUA 3N6HA 2A21A 3HO8A 4CNTA 1M7PA 4BZYA 4OQVA 1ZZMA 4QM1A 2BXZA 3DEQA 5AZ0A 2E6AA 1ZU8A 1M68A 1UWRA 4FEZA 3CQ0A 3SECA 3PB0A 3QYQA 4L80A 1MXSA 2O56A 1P48A 1IYXA 3OEXA 3WBXA 5BCAA 4UNLA 3TONA 2V6AA 1XX1A 1E1CA 2XIBA 4CU7A 1FVPA 5CGMA 3WLLA 5G5IA 2FLIA 3MW7A 4MY8A 2FHBA 1LYXA 3PG9A 1REQA 4AISA 2OGYA 3O7UA 4REQA 3STFA 4PMOA 1W1TA 1FUYA 4QRNA 1M04A 3BLKA 5HK4A 3BC9A 1PHQA 2ANUA 4HU4A 3QHMA 3WBWA 4LS0A 1DJWA 2YCEA 5CG7A 1ECEA 1PCKA 3LCGA 4ZOBA 3FIGA 2QF7A 3NYZA 4Q8NA 1KV5A 1A80A 4CN4A 4NUWA 3VKAA 4QDWA 3PTMA 1TQJA 2JF6A 2V3GA 1JPHA 3CWOX 4HPXA 1PVNA 1TJ2A 3ZVHA 3VE9A 1FOBA 3VOJA 4ECLA 2HISA 4KWUA 3EMQA 4GVIA 2PDGA 1F3WA 4C91A 3THQA 4IOTA 1FHUA 2C3ZA 1J93A 3TSDA 1R3VA 3T44A 4PBFA 5D8ZA 3URBA 3U5UA 4S3FA 3TYAA 1KQZA 2ESCA 4XKYB 1K8CA 3V0TA 7XIMA 1H11A 1DTUA 1SSDA 1EXBA 3U0HA 1JCNA 1ENUA 4F40A 1JRCA 1OG6A 1R9YA 4A8NA 3ZR6A 2BOEX 2BZNA 3NFUA 3ARYA 4K7VA 3IJ9A 4MHBA 3CUZA 4G6CA 2D2OA 5I6SA 5ABEA 1W1A1 3LRKA 4QIUA 5A6MA 1AJZA 1WXYA 4HQVA 4LB4A 4NJIA 3WBEA 4P7LA 4B3KA 4WGHA 5EFFA 5U7SA 1BWVA 3WJYA 6ALDA 3BCDA 1I45A 2PA6A 3KP1A 5AYXA 2YOCA 4HK7A 4QISA 5HINA 3B9AA 3P0WA 2YYTA 2F8QA 2V5CA 2GWNA 3TN5A 4RUBA 3FY1A 1BXBA 3N2CA 3IIZA 1F4AA 3ZQ9A 4Y9PA 3CWHA 1SJBA 2X16A 2Y7DA 3B8SA 3FX4A 1UPMB 1ZCOA 1YQ2A 4UTIA 4GGBA 1E6XM 2BTMA 4IIBA 3VD3A 3W25A 3GNNA 6TAAA 4QE4A 2EF9A 3IGUA 1AD4A 3CTTA 4HTBA 1C3FA 4W86A 1FWHC 1SR9A 3VM5A 1W9XA 4KW2A 2ZZ6A 1TE1A 3QHOA 3MO4A 4X0VA 4ZTXA 4D6DA 4Z2LA 4DRSA 3KHDA 3MP3A 2DZWA 3FNDA 3LPGA 1E6NA 3TK7A 4IG2B 4FSAA 2XGBA 4PCNA 3GVRA 3K4WA 1VEPA 4YTSA 3TAOA 1S5MA 1KC7A 3CV6A 3DBPA 1B3OA 3MZ2A 4UTMA 1GOOA 4CU8A 1ELSA 3P3BA 3PP7A 1J6PA 3RK8A 1WDWA 3R94A 3CV1A 3M64A 4JR5A 4I8DA 4JTIA 1RVKA 3JR2A 3W81A 3AZSA 3FSUA 2ZRVA 2ZXQA 4PSPA 1VR6A 1E15A 1A5MC 4LBSA 3VCNA 1RBLA 1XYCA 3FN9A 4Q4OA 1TUFA 3WDRA 1C9WA 4HCLA 1I4NA 1F8IA 5HJYA 2ASHA 4H8VA 5EMYA 3DECA 3CHFA 1V0MA 5HNRA 4FNUA 3HPFA 4MAVA 2C7FA 5D9PA 4EXBA 3LV5A 4K38A 3EOSA 3OVQA 2B0MA 3VC6A 4KF1A 5A2BA 2WPGA 5A2CA 1OFOA 3H55A 1PEZA 5MKGA 1VHNA 3HG5A 1R2TA 3FFSA 1J0ZA 1IXOA 1N55A 3VUSA 4ICNA 1JFXA 2RAGA 3U4AA 3DGBA 2DSZA 5H1WA 1Q6GA 3AMDA 3VVGA 1R5YA 3TDFA 4LNCA 4RPPA 5CAHA 2CLHA 1GVQA 1OCNA 4GUHA 3PBMA 4A8IA 3LCFA 2IQ0A 4FP1A 1A5AA 1AW1A 1TWWA 3STCA 1GJUA 6REQB 3O2LA 3KL3A 2W0UA 2DJLA 4XX6A 1UKOA 3MUAA 4QSHA 2OT1A 4E2BA 4AZBA 2PS2A 3NGJA 1EHAA 1GTEA 3R8RA 1EJ7L 4LU0A 3W1RA 2EBNA 3R10A 4GY0A 2XPKA 2VZSA 3VOCA 2BASA 4YCPA 1NARA 3R58A 2FJKA 1EO7A 3RM4A 5EMMA 1VFHA 4OE7A 1YTKA 1MVYA 1UA3A 1TJ1A 4BHYA 5CC5A 2A6NA 2WMIA 1ZCCA 2VELA 3CZEA 3INPA 4AY8A 4O28A 1GNXA 3NQGA 3OG3A 1DL3A 3CV2A 2FKPA 2Q8XA 4Z2KA 4JIRA 4W4QA 5BXTA 3CZJA 1WDPA 2WC7A 2CBUA 3GW0A 1X39A 3L4UA 3MUIA 2PURA 3GE7A 5LHFA 4PBGA 3N2TA 4REQB 3WQ5A 4XUGA 4FNTA 1QVBA 3G1DA 4CGTA 2R1NA 3Q37A 3PJXA 3B9DA 4PBEA 5K2ZA 4OBSA 3B8UA 1OCJA 3LQGA 5LHEA 1ZLPA 1U5VA 4C1NB 3PR2A 3E0VA 1GCYA 5HATA 4WY0A 4XZIA 1MXGA 2V63A 2AQWA 1TIWA 3FJLA 1D8WA 3IV3A 1OYAA 2HMCA 1XIIA 2MANA 3OIXA 2HZGA 1EDQA 3UD6A 1JRBA 2XU2A 3VIGA 4XWUA 1GT8A 2ISVA 4JTJA 1W3HA 3SCWA 3BG9A 3QGKC 1LL7A 2XSXA 2PC4A 4RDYA 7TAAA 3FW6A 4HK5A 4C5ZA 1OFPA 3T42A 2NXGA 1Q3NA 3W38A 4JHZA 2EPMX 3GIPA 4LYKA 2LLEA 5AHNA 2A2IA 3PBGA 1UH4A 4Y9AA 2X1SA 3V35A 2V69A 3UXIA 3HMJG 2UY5A 4N6FA 5D04C 2Z1XA 2VHLA 3PNZA 5A6AA 4FIQA 5IM51 2XH2A 4Q7IA 3A3HA 4GO9A 2FGBA 2WJEA 2D73A 3WLIA 5T91A 4AZCA 3DI0A 1H4PA 2BODX 2QYGA 1UR0A 3M41A 4S39A 3PBUA 4GJ1A 3L4WA 3VGBA 5ABHA 4GUJA 3TEVA 3NL5A 1OQFA 3ITXA 3SZ8A 4GQQA 3P67A 3AMLA 4GHRA 3IIOA 1IEIA 3BMWA 3I7QA 1LBLA 3A3WA 3W7JA 5A94A 1AK5A 3KWXA 2CZ5A 4HPNA 1QAPA 4XD5A 2R1KA 2E8ZA 5KZDA 1EBHA 3UXDA 3C3NA 2E6FA 1LTDA 1DV7A 1NFGA 4ASTA 4OKDA 4JKMA 2O4MA 4GCXA 1JL8A 3WDQA 1XLDA 4DHGA 3W7MA 4XBJA 3C8FA 2Y0FA 1JI2A 5A8PA 2CETA 4KFPA 5HNNA 1ITUA 3E0LA 3VC5A 4UFJA 4M29A 3V7PA 3FK4A 1PZ0A 1LROA 1OT2A 1ZJIA 2Y88A 1TMHA 1UP3A 3ES7A 1MNSA 5AYBA 5E0FA 3CEPA 3NZGA 3WD3A 1Q6OA 4HBKA 4U3AA 2Y2WA 1XLGA 3GDLA 4J2MA 1B54A 3L21A 5M5DA 3B9OA 5A8NA 4JD4A 1YXDA 5D9OA 3A6OA 1XQKA 2WW5A 3H2OA 3W00A 4MKSA 5TD4A 3UFYA 5I79A 2V3EA 3MVIA 4FB7A 3T0AA 3OHIA 2VX5A 1RBAA 2D22A 1J96A 1TVPA 5HUPA 2WVUA 3MVTA 4NF7A 4C6OA 5C71A 3GHTA 1LQ0A 4O0QA 5KITA 3NOYA 1ZJHA 4P7OA 4NRSA 2PAJA 3LA4A 5CH9A 2WSKA 4YS1A 1J4EA 3G8RA 4QFUA 2X40A 2EJ1A 4HU8A 1I2PA 2PDIA 5LNUA 1YKWA 4JTKA 1OX6A 5F1UA 2NSOA 3I4KA 4Q7BA 2HS8A 4LSBA 1UWUA 3KBWA 2I14A 1D9EA 4NAEA 3W88A 1MUWA 4DM1A 4N4QA 1Z8AA 1EGMA 1T8XA 1GYNA 2OZ3A 3QN3A 3W0KA 2JKAA 1QI2A 3SUUA 1PBGA 5BMWA 2E40A 4M6VA 2NW0A 6XIMA 3VIJA 3C2OA 4XBSA 5HJXA 2Q8LA 1KXHA 1S5NA 4Q6XA 5FAGA 4L5ZA 1SYTA 4YCOA 2B7PA 3E0WA 2YGYA 1QNRA 1Q6DA 1F74A 4DYEA 4Q8OA 5GVJA 3M7SA 1EL3A 5E0CA 5REQB 4AHPA 3JZUA 2F6UA 2EPLX 4ADSA 4WCJA 2WNNA 3LCWA 1EEXA 3H70A 3H26A 4A29A 1A4LA 4NXSA 3IVUA 4MNJA 2P3ZA 4JGDA 1EIXA 2ISDA 1WE5A 3B0XA 3QV6A 1OX4B 1H60A 5E6ZA 4PL1A 5DCDA 4YMZA 1WAUA 4BI6A 4YYCA 3UWEA 4FIRA 4B90A 1CXHA 3ABZA 1SZEA 5A5WA 1GUVA 2FHCA 1H63A 3FKKA 3ABSA 1R3YA 4HPGA 3MT1A 2Y70A 1BKHA 4HYVA 4ZEPA 3DFPA 3VA8A 3UG4A 4GQRA 5XIAA 3ZJ8A 4HZMA 1B3YA 3W7RA 4B3LA 3CB3A 1YEYA 4QSFA 2OYKA 4KH2A 4C5YA 2J47A 5C9XA 4RW5A 4C65A 1YE6A 3VX1A 1PWLA 3NM3A 2J27A 3WNNA 4HTYA 3BSMA 4C6KA 2WC4A 2VX7A 2WHLA 1H0GA 4EPKA 1JPKA 3F4WA 3EMCA 1K70A 3SY1A 3GIQA 3GXNA 3SB0A 4U3CA 3QSTA 3VNIA 4DIAA 2ZWYA 4E38A 2ACSA 3V18A 3L5MA 3ARPA 3LPPA 5EBUA 3SFKA 4Q8MA 3V1PA 3TN6A 4UIOA 2JF7A 1UPPA 1DJGA 5DMLA 2GUBA 3F2CA 3LLFA 3VCRA 5IXEA 2FZBA 2BY3A 4CD7A 2OGJA 3DHUA 1ALDA 4X9YA 1CXFA 5A69A 3IAQA 3V5FA 3LEPA 3TTOA 1F6PA 3L5LA 1K8ZA 5CCZA 1K7XA 4MWAB 1FWFC 2JFEX 1MXDA 1I2QA 1LG1A 3O6DA 3EWBX 2Z6JA 4AWEA 3NXFA 4F2BA 5AB3A 1LG2A 4GX9A 3WD2A 4Q4KA 4AVFA 3SGGA 4D6FA 4WHBA 2ISFA 1MDLA 3H21A 3FGCA 4LAUA 4C60A 1CGWA 1Y5WA 4OGZA 1JYXA 3W2MA 1E0UA 1S2AA 1HGWA 2GDQA 4CCEA 3DZ1A 3QMTA 2H3BA 3O16A 2WZTA 2F84A 4PN2A 3DG7A 5C70A 3QGAC 4A3QA 2FB2A 3M9YA 3VGHA 4GBUA 1UWQA 3OW1A 3PF3A 3O05A 3LBMA 3L0NA 4JQAA 1D2KA 1JYVA 4NL1A 3W7EA 5BXRA 4HYRA 1XLAA 1R2SA 3AHYA 3VNDA 1VQTA 3SRHA 5I5RA 4P2VA 1UD5A 5A8OA 3HB9A 1G01A 3SJ3A 4ROQA 1AQFA 2Z0IA 1UD4A 1QHZA 2ZADA 4JQ4A 4EF9A 1EO5A 4GIRA 3UZYA 4Z1BA 4UMCA 3IAPA 2J4GA 3TTSA 2FDMA 1A0CA 2R14A 3BAXA 1CPUA 3WQFA 5BRPA 5GPRA 2JBMA 1DJIA 3B3DA 2EEXA 1J79A 4GD0A 2EXOA 4NAFB 2XSBA 1W5PA 1K7EA 3EWWA 3IJLA 1IR2A 1E0XA 3GVQA 1RQHA 5AOUA 1OINA 3UESA 1W3LA 3QC0A 2V30A 3AWOA 1J6OA 3L5AA 3SW6A 3S2LA 2P76A 4QNEA 3WJZA 2J6VA 2VFGA 2BVTA 5CJ5A 1EPVA 4N02A 4GUIA 2Z1SA 2Z24A 2XH0A 3ZM8A 1EZWA 4I9MA 4ORIA 3UPBA 2EG7A 1KRMA 2ZCGA 2XWEA 4LY8A 1Y8BA 2VT0A 1XD1A 5K9DA 2QV4A 4WKFA 1BFNA 3GG0A 3TJLA 2QUVA 4ZR8A 2J25A 2NV2A 3H7RA 3CWNA 3GBDA 1VYPX 2OEJA 3A9IA 1RK6A 4IL2A 3NZ1A 2VMFA 1XCFA 1OK4A 2GK1B 5G2HA 1ITQA 4PMZA 3L2MA 1GPFA 2PDHA 2TPSA 5B80A 5H2ZA 4WY0F 2YCIX 3FXYA 4D2JA 1DORA 2DP3A 3QZAA 3FHAA 3HOJA 3LB0A 1W9DM 2P5NA 4XSMA 1H7NA 4GWEA 6ENLA 2QJMA 3E1F1 3GWQA 4GIAA 1DWIM 2DZAA 3ITCA 2IKIA 1UD3A 4IQLA 1J8VA 2FZ8A 5D30A 1UW9A 4JDYA 1EKOA 3M0MA 3BMXA 2OT0A 5IHSA 3W2LA 2G41A 3VD5A 5M3WA 1VENA 4PMDA 3CPRA 2PWEA 2ISWA 1GTHA 1TPWA 1OBAA 5T26A 4GUGA 3W37A 5GNZA 3UG8A 1V7AA 4OECA 3TAKA 3W1PA 3AROA 4X63A 2GSEA 4J3TA 4C90A 3W6YA 1AZ2A 3F1QA 4W7WA 2ODOA 1JULA 4KS0A 1GOIA 3M5YA 1JF6A 3W75A 2ZC8A 8CGTA 2BHUA 2Y7EA 3GUGA 1JPDX 1KQYA 1XSIA 1GQKA 3M0YA 2E5DA 2WHKA 3W23A 3L66A 4AZIA 2Z2AA 3GDBA 2CHOA 3KRSA 1ZAJA 1VS1A 3QQWA 2WCGA 4DJEC 5LSMA 1WV2A 4HJWA 1US2A 3FEQA 3W7LA 2QCDB 4C6CA 1MDRA 4ERIA 1OGGA 4CN6A 2V2HA 2PLJA 1CGYA 4JIHA 4NP7A 1TJRA 2C15A 3E0IA 5IBXA 1K02A 4IMEA 4LCQA 1LT8A 1U2YA 4B91A 4KCVA 4LVBA 3QKEA 3TWAA 5DBUA 3AXIA 4DJFC 3S1WA 3KL0A 1KGWA 4LALA 1MZRA 3IUIA 1TB3A 4QHRA 5KZ6A 4LB3A 3DKJA 1FQ0A 1J01A 4BY3A 9RUBA 3SCTA 1OIFA 1RBOB 1CXKA 4OBRA 2DU2A 4ZOEA 3R43A 3PULA 1BGGA 4FNSA 1PDZA 3NL6A 1R3SA 1M7OA 2X30A 4US5D 3AXHA 2YW4A 4IUOA 3THCA 2XVPA 1CEOA 1ZB5A 2XN0A 2R8WA 1IXQA 3CUHA 2Y1HA 3XISA 2YCLB 3BW3A 4NQ1A 1C90A 5C9WA 1MSSA 1S3TC 4O19A 1H7RA 2PDMA 5C6MA 2OZTA 3ABXA 3M0HA 2CWXA 1BG9A 3IIVA 2YDQA 2CLEA 3ITLA 2WQPA 5D02A 4O8RA 2O4QA 5JU6A 1DE5A 4JX4A 2VOTA 4OFCA 2DEPA 4YTUA 3B0VC 4IICA 2QJJA 5HBFA 4QJ1A 1DTNA 1PL9A 4BQ5A 3VKKA 1M3UA 4HN8A 3FHQA 4N2YA 5I7GA 1S38A 2QGYA 1XYZA 4H9UA 1E0TA 2FZNA 5BRBA 3LSCA 3GNPA 1YDNA 1JYNA 2XJ7A 1ME7A 2QPUA 2W66A 2VQUA 1OC7A 1JF5A 1RA5A 3HG4A 3GSMA 5EMJA 1IR1A 5CC7A 4ZB5A 4RE2A 2AL1A 5FJRA 4XBKA 3AHVA 4DY1A 3LMYA 2HCVA 4AD0A 4GPNA 3UVAA 4FOUA 4PH6A 4Z2JA 4DUWA 4UMAA 1Q7ZA 1EC9A 3W2NA 1NOFA 1G7VA 4A2SA 3AI0A 4UTTC 3QHNA 2C0AA 2ZRYA 1WKFA 3BDKA 4ES4A 4ZQCA 1YADA 2CESA 3WY1A 1O1HA 1XH0A 3GD6A 3LOTA 4BQ2A 1PAMA 4YWIA 4PTMA 2WJDA 2XGIA 4AF0B 5AN7A 1HP5A 3UPWA 4GFSA 4HIBA 3MJMA 1OC6A 1NWRA 2J7FA 1XLHA 4FNPA 4GJJA 1PZ2A 4DAIA 3IRSA 2HVMA 5EMUA 2QCFA 1WDSA 1GVIA 3WQOA 2UZ9A 8TIMA 2V2DA 3DX5A 3WQDA 1LQ2A 4GZJA 4B5SA 3VGEA 5CZJA 2BHZA 4XAFA 2IPFA 4GX8A 1U22A 4Z1YA 3OZOA 3V5CA 4K7YA 1X1ZA 2ATMA 4WVXA 1A5NC 4OU1A 1LL6A 1YXCA 1NP0A 1RK5A 3YPIA 3EXTA 1PJ9A 2E7FA 4WJ8A 3XINA 1M1BA 1FX6A 3R5EA 3AS0A 4H9XA 3WD4A 3BLEA 4GISA 4P8VA 2UWFA 1DWFM 2C16A 1EZ2A 1TWDA 3NEHA 1HO1A 4UUIA 1KCXA 3RYSA 1Q5MA 4JYEA 3QPZA 3GUWA 4Q8TA 3FJNA 1XP3A 5HULA 1V3IA 1DXEA 3AHXA 4MNKA 2FYMA 5DCEA 6CGTA 2CBJA 3MCOA 4Q4RA 3DHDA 3IIPA 3PZGA 2ZZ3A 2MUCA 5HMFA 4ZXOA 3DYMA 4ZFMA 3LK6A 5KZMA 5AC5A 3M6DA 1ISZA 1CGVA 5I3FA 1JUKA 5BWAA 3W1UA 1JYWA 2VR4A 3TLQA 1S1RA 3EA3A 2GUYA 3KBJA 3MPGA 3KW3A 4OVXA 1SW7A 3KCJA 1V6XA 4MYAA 1NF0A 2YFNA 3VDHA 2ZOXA 1NDZA 2E68A 4CD5A 4UNKA 4P7QA 3VNLA 5ECUA 4DO5A 3DBNA 3MDWA 3O0KA 3Q65A 2WSPA 4JYDA 4XD4A 1Q65A 3TYEA 4L61A 2QCHA 4N9DA 4LUSA 1SJDA 4ZMGA 4MFDA 1VCFA 5TNVA 4NNAA 3RM9A 4ATLA 2QCEA 4IIGA 1CXLA 4H01A 4O17A 2EHHA 4J40A 3QZ6A 4IHCA 2HQAA 3NDYA 2DH2A 3VIFA 1Q2SA 3MQTA 3CYJA 4O13A 2OTDA 3LV6A 4ZGYA 3FJ4A 4K8HA 4Q4QA 4J2PA 3CHDA 2X7VA 1RPKA 1ESWA 4KFNA 1YYAA 2CKRA 3MKCA 2AAAA 3PN8A 3K4AA 2QEZA 3B9EA 1PYFA 2O7QA 3NCOA 3GXDA 1A50A 4HHPA 1F2JA 4N0RA 4CD8A 3WX7A 3UY7A 1E5NA 2Q71A 4J3VA 4GLEA 1YXYA 2WOQA 3WNLA 3SJNA 1S5TA 3M0VA 1XYMA 5HMSA 4MTVA 1ZBCA 2VXNA 1ZENA 2HNEA 2WCSA 4MKNA 4AMAA 1EUNA 2XVGA 2BVWA 3UBPC 3DESA 2XWDA 3PTQA 3RITA 4ZODA 3MUXA 3EMZA 5E93A 1UZHA 3F5JA 3N12A 3CL7A 2NXHA 2WZHA 2G95A 4NKCA 3CNYA 5D2XA 3SUSA 1PPIA 3GBEA 3FA4A 1E6PA 1O5RA 1C91A 4INFA 4PB3A 3GNOA 1VRDA 2JEPA 4D9PA 1GGOA 2WZIA 4RR4A 3VNYA 3NUKA 4D1IA 5FACA 4DJDD 3MI3A 5HWMA 1RQBA 1KGUA 3R0DA 2CLLA 2XIOA 2YIHA 1LM1A 3N9RA 1JNDA 1FCBA 4GI8A 4NI8A 4H7CA 4QDPA 2DUAA 3H53A 3CEUA 4RDVA 2Y8VA 1R6WA 3AMCA 3GKAA 1YMYA 2PF0A 2YA0A 3AIBA 4PRWA 2FIQA 5DY3A 5HR6A 3B0YA 3RX3A 3BAWA 2PU0A 3L2LA 3CO8A 5I07A 1H62A 3RPDA 1K8XA 1WOBA 1IZJA 3VD9A 4IX2A 5A6SA 3CUIA 1VCGA 2ICSA 3CTLA 3CHCA 4F0MA 2ZE0A 4YU1A 1S2WA 2D0GA 3OBEA 4TMCA 1OCBA 2PE4A 1VJZA 1M41A 1NWSA 2QMKA 1HL8A 1E70M 1OZMA 4JL1A 7A3HA 4ICCX 4OUIA 3LSBA 3ANVA 4KETA 1HJSA 5G1TA 7ENLA 5HPOA 2VTFA 4X60A 1ICPA 3UJFA 2C91A 4L9ZA 3BLOA 3WLHA 4AU0A 3HPAA 9CGTA 1BRLA 2VRKA 2XFYA 1HJQA 1XKJA 2OCZA 3WDPP 2W91A 4O0KA 3QW3A 1L6SA 3LG3A 3OO2A 3KE0A 3PZMA 2OXNA 3WG6A 3U8GA 1R3QA 2I9EA 3ARTA 5AC6A 3POHA 3P8IA 2OZ8A 3N4AA 2Y5EA 4PFHA 4IGHA 3O06A 3R25A 3S1XA 3L23A 2OMAA 4H6EA 4TV6A 1P1XA 4FX8A 4JS3A 2P0IA 1NEYA 2NSXA 3M4HA 5FF0A 2VR2A 1XYLA 4UQAA 1ONXA 2F9RA 2QKFA 3RHGA 1UMLA 5C7VA 4US6A 4GXWA 1AZ1A 3VZYA 4OJYA 3G1SA 1WOAA 2E28A 4IM4A 4UOZA 4A3HA 3PZQA 1WZLA 2G4JA 3CZGA 3ZT6A 4MG4A 3S6DA 5EKYA 1MUCA 5AY7A 3UCQA 3BPWA 3CK5A 1H61A 3GHRA 4IF2A 4IJRA 2CZFA 3BUVA 4MNMA 1Q6QA 1UWTA 1GQLA 3THDA 1KTCA 2DT3A 1UKSA 4WXZA 3TW9A 4M3PA 5BXSA 4XZLX 3SBFA 2BV9A 3C2YA 2NLIA 1WDDA 4O52A 1A47A 3G18A 1U5JA 1JCJA 1W5NA 1LUCA 4CQ9A 2B81A 2PZ0A 4UTHA 3QLDA 2BWGA 2VCCA 4C6JA 2VO5A 1IT0A 1KM6A 3CC1A 4PCSA 2E8YA 3MP4A 1UR8A 1UC4A 1A5LC 1M7XA 3TVAA 4GMEA 1ISYA 1E5JA 2PWGA 4YL2A 3UPMA 3BG5A 2BY0A 2QHAA 2PDCA 3ZZ1A 1MRQA 2J62A 4Z1CA 4QX4A 2WBKA 3T2PA 2XUCA 3SN1A 1CGXA 2YCJA 3LS9A 4XD3A 2ZXBA 4FLSA 4UCGA 4JXCA 4O8AA 3N3TA 1B4EA 1I1XA 3OQEA 2Z27A 1P0KA 1VPQA 4UQ9A 4LUTA 3NQAA 3VTRA 2F6XA 3IIXA 1VYRA 5KSWA 5D2TA 2EG8A 1TYGA 1FCVA 1TO3A 1CX9A 1TFVA 3HU7A 3IANA 4TVUA 2PBOA 3U2CA 3ICJA 2HV5A 1W9VA 3W74A 2FZ9A 4GG9A 4L4MA 1EHNA 3S5ZA 2J7CA 2GGGA 1XIEA 3WSUA 5G1YA 4AH7A 5CZKA 2Q01A 1V3JA 3CT2A 4RW3A 4IQEA 3PUGA 1MQRA 1ZNNA 4PUKA 4PZVA 1GEHA 3VNKA 4UR7A 5MF5A 1TA3A 3RLGA 3D5HA 4JTAA 3UVIA 3TU9A 3ARUA 4LGXA 5LNVA 1ZPTA 1JUBA 4LVGA 2F61A 1RY8A 4DXVA 1IWBA 2RUSA 5M1TA 3WF1A 1DJXA 2YJQA 4MWAD 1UYQA 1XYFA 2VC7A 2QV5A 4ACZB 3ITTA 4HZ8A 3FDKA 1BTCA 1TV7A 3TYUA 4DPPA 1M7JA 1OF8A 2PDQA 4AHOA 4HNNA 5A3HA 2PC8A 3B8TA 2A1YA 1XIHA 2CKSA 1A3HA 4EKJA 4LS1A 2HVOA 1QFEA 3K5XA 2P10A 1RJPA 1C7TA 3PNUA 4JCLA 1HVQA 4JQ3A 4HGXA 5FESA 4GUFA 1R7AA 3QXBA 3GS6A 4D6GA 3WH6A 1QI4A 4WJEA 4LF2A 3F5LA 2IMRA 1JPMA 4DO6A 3BJSA 1KV8A 2PEVA 1EGVA 1RJQA 5J8LA 1VRXA 4TVCA 4O1FA 2WO5A 2GJRA 4AEFA 4LC8A 3W9ZA 5BZAA 3KFTA 5FJPA 3EDFA 1UJPA 4CN1A 3AISA 4PUNA 4ZSTA 5K9XA 1IEVA 1DQUA 3BGJA 5DRCA 3U57A 5LGZA 3KLLA 1LLZA 2G4FA 4ML9A 1W54A 2C0HA 4RJEA 2XM1A 1GVOA 3SCOA 1FCQA 3NL2A 2Z1VA 4Q8WA 4RNIA 2XG9A 4HCHA 4E4UA 1LJYA 1M5WA 4GA8A 4WXYA 3CL6A 1L2UA 3KBMA 3N15A 1T8QA 2GJPA 3KVLA 3MUZ1 3RJXA 1WDQA 1DIEA 3IGXA 2VOMA 2QCCA 4KMQA 4FHAA 3M7WA 1HKIA 4GI4A 2ZRWA 3U6WA 1AUSL 1PV8A 2PWDA 2FVKA 1O68A 1D3HA 1FWEC 5IOBA 5FSDC 3KDOA 4GI9A 3UGVA 2YB4A 4XZNX 4ATWA 1EJXC 2QCGA 3IGHX 4CD4A 3EGJA 1FWGC 2QUMA 2AKMA 3AC0A 2G8ZA 4O4VA 3A47A 3TJ4A 1PTDA 2I1OA 1I8JA 1R46A 3KXQA 3M5VA 4IPIA 1QBBA 2OSXA 1GVYA 4LFYA 1J0KA 1RR2A 4B16A 1IIHA 4NJKA 1W1PA 1RP9A 3AS1A 3WELA 2FZDA 2NX9A 3AIUA 2VZUA 1UWAA 2YA1A 1GVFA 2YXGA 3WUEA 4AIEA 2JGQA 4XISA 3WLPA 1JCLA 1GZ1A 3G6MA 1GORA 1PKMA 2ZQ0A 1A0EA 2REQB 4IMAA 3U7VA 3P5YA 3VYLA 3STGA 3FLUA 3WQ8A 3DOPA 1E4MM 3F03K 4GYJA 1BF2A 2BGQA 2WC3A 3HURA 3I6EA 3K1GA 1Q6CA 2EAWA 2Z00A 5LA1A 1HVXA 2OJPA 4YVXA 4RV3A 4AVOA 5EU9A 4F2UA 2VGFA 1UA7A 4GKLA 3VE7A 2RDXA 1IXPA 4E2DA 1H1NA 1CYGA 4KEUA 3VAVA 3SQSA 5HDRA 4PTXA 2NVDA 2YKKA 4EVZA 2VP8A 2P3EA 3CS2A 5CC6A 1E3XA 4ZB0A 2PFHA 3COTA 1EDGA 3LHYA 4C6QA 1JCYA 1SO6A 3QPEA 4A3RA 1F7BA 1KXTA 1EOMA 3W1MA 3QY8A 3HPXA 3CLWA 1RVGA 1XGEA 2DZVA 1ISXA 3W28A 2Z28A 5FJOA 2VEFA 2WKJA 4NJGA 5J04A 2OYLA 4F79A 1SFLA 1MQPA 3KWSA 4U5KA 3UP8A 5B7YA 3KDNA 2C71A 3BAKA 2Q3RA 4HMEA 2AL2B 4NZ5A 5EGRA 1XLKA 2VDHA 1JEZA 5D9NA 1R0MA 2HPMA 1XLJA 5CSYA 2YZ5A 1G4TA 4G56A 1EH9A 2O0TA 3FEMA 2AGKA 2VVSA 4NX5A 1VBGA 3W26A 1OX5A 1R9XA 4PMYA 2C18A 3AOFA 3PZOA 2DUZA 3ALFA 4LVAA 3HM7A 3HG2A 1XXXA 4Q4MA 1GG1A 4UTUA 3ZVIA 2D1ZA 4M5PA 3C8NA 2OYMA 4H6QA 4CKQA 4NHVA 3A9BA 4JN6A 1TPUA 3IACA 4LC6A 5D09A 2J7BA 3PVFA 1AMKA 3QKZA 4HT3A 1V02E 4R3UA 4I6KA 2D24A 4XVDA 1TQXA 2HSAA 2GZXA 1HKWA 2OELA 1OABA 4G7EA 3WD1A 3AMGA 3S2NA 3DENA 1NSJA 1L9WA 2PB1A 1OT1A 1O95A 3RNDA 1LBFA 3EB2A 4AFYA 4FNQA 3GFZA 4RLIA 2H6RA 3WQEA 1Z42A 4WDXA 1VF8A 1TCMA 4U28A 1KGXA 3W2JA 1UROA 2QR6A 4DLMA 4JIPA 5L6UA 5CBJA 4D72A 4F0LA 3POCA 1R87A 1OFBA 4IPLA 5LNWA 1B3XA 2C13A 3B04A 4AZ5A 2Y5JA 1L6WA 2HXTA 2OODA 3W01A 3N25A 3AS3A 4UZUA 1JDAA 1E43A 4GYPA 4MF4A 2X0HA 3G1YA 4ATDA 3WF3A 1W31A 5FKYA 2I7GA 1V03A 5FEWA 3EEGA 1W8SA 3P8JA 1LOLA 3VOIA 3VKJA 3VPLA 3BW4A 4RDWA 5DQPA 4HVXA 4E8GA 1JDDA 4DO7A 4Q33A 3V36A 3W1NA 5IRPA 3G1RA 4H9MA 4I9JA 1K9TA 4BWLA 3VGDA 2WMHA 3SRKA 3W6MA 2PRHA 1KCKA 5TQLA 2OU4A 5A8MA 2NQ5A 1BWKA 3LTPA 3MBDA 1P6CA 2VUYA 2GQ3A 3A4XA 3IK4A 1GOQA 2PDYA 4ZO8A 4AQLA 3M46A 1RPXA 3D46A 3BQ6A 4HPHA 5EPDA 4D6HA 1EC7A 1W1YA 4URIA 1XQLA 2CERA 2Q6ZA 3LGEA 2VJXA 1QMLA 1FCUA 1P43A 4JL2A 4C6IA 4PCPA 2Y63A 2ACQA 4KCUA 1W9UA 2VRJA 3UT0A 3GVWA 4LYPA 5DY2A 2B7QA 1W9BM 4OOZA 2XFFA 1FWSA 4IFKA 3B05A 5I09A 1LORA 2VQTA 2PWFA 1OFEA 2PCQA 3GZ3A 3TE9A 3FKRA 3QFWA 1SW0A 3HGOA 3LI0A 4GQBA 3WQ4A 3I68A 3P84A 4DZHA 1TX0A 2HROA 2WANA 1D3GA 2E3ZA 4GINA 3LN3A 2PI6A 4TV5A 4B5UA 3S5OA 4W7VA 4BR1A 1TZZA 3UR2A 4W7UA 3W7DA 2Q8ZA 3CHEA 2CITA 4EXAA 4QS5A 3P82A 5I06A 1ZUAX 3MC5A 3RCMA 2YX0A 1VFTA 4JX6A 1CT5A 5BRQA 2PSNA 1QNOA 1IEWA 4JIEA 4GC4A 1MEHA 2EPHA 4S3CA 3SO7A 4XAZA 4W9TA 5H8UA 3R1ZA 1YTEA 2P50A 4P8XA 3QF0A 1GVSA 1UKTA 2BXVA 4MNLA 4NZJA 1XD0A 3W1AA 3E12A 3Q45A 2UY3A 2QF8A 4KWSA 1A4MA 1QW9A 1WCGA 4CEUC 1U30A 1N7KA 1THFD 2Q02A 1VIZA 3IJ8A 3KS6A 1XIMA 2H3DA 4KT2A 4DAFA 2DIEA 5JIWA 4N9EA 1AMYA 1WNOA 5A95A 3URQA 4KESA 4P61A 3EX4A 4HB7A 4YN5A 3BLFA 3UNTA 4QEHA 1TUXA 1IXNA 1R30A 4IGSA 3RN6A 3VIOA 2GSJA 5FF7A 3MMUA 3SEPA 2HBVA 5LIKX 3RU8X 1UCWA 1EF2A 3P93A 3B0PA 4F0RA 3NVDA 4W8BA 1ODZA 2V82A 1IF2A 4XKYA 3TCSA 3CIWA 1UD8A 3GM8A 3M44A 1GW9A 1BQCA 1E6QM 4YTRA 1WX0A 3WIJA 3W7PA 4DF2A 1P4CA 2FFCA 4KFOA 1FWIC 2GJXB 1P6BA 1XBZA 1XYAA 1GVEA 3OA3A 5FJTA 2Y6ZA 3RMEA 2X0YA 1RCXB 3FDGA 4HNOA 3MZNA 4V27A 4PC8A 5CSUA 3N17A 3CJPA 2DW7A 3ATZA 3ARQA 1A5OC 3UJ2A 3USZA 1K4GA 5CGQA 1GQJA 4O10A 4EACA 3PWAA 3W6LA 2HDJA 1UC5A 1NQKA 3CPGA 2QCMA 2DVXA 5EY5A 3QJAA 4M80A 1N8WA 5EB8A 2NV1A 3WK2A 2Z1WA 3GU2A 2HS6A 1G4PA 5CPQA 3BGAA 4JQ1A 3DCPA 3AU6A 2GVYA 1QI3A 1XCXA 4YPJA 3QRHA 5I02A 5D05A 3GO2A 1P1MA 4A21A 4C6LA 4AD5A 1W1ZA 5C2GA 2XVKA 3T07A 3GAYA 3Q94A 4LBUA 3ABRA 3L4TA 2R82A 1UZ4A 2EPNA 5DELA 3GG7A 3B4UA 3AMKA 1NQ6A 3ITVA 2CWNA 3WH9A 4GZIA 1SFSA 1T41A 8A3HA 1GOXA 4E4FA 1JUEA 1F61A 1ADSA 2DQWA 2NVAA 3W1TA 4R7JA 1R2RA 5ABFB 3BL3A 1CB2A 3PG8A 2G3FA 1E1FA 2YLAA 3L0KA 1HJWA 3CZKA 1BEUA 3O3RA 4IG2A 4H83A 3H6OA 1X1OA 3H7VA 2XVLA 4PMJA 2VEKA 4BF9A 3E96A 1P0BA 4DZIA 5CC3A 2XDFA 4JBRA 1HJVA 3LUTA 3L9CA 3ZO9A 3W7QA 3VXGA 1QHOA 1TSIA 3CAWA 1V3MA 3QEZA 1LRNA 4W93A 4Z0SA 2PU1A 2RDUA 1NM9A 1W2PA 1LDCA 3L68A 3PK7A 5EMLA 4E3VA 2Y4SA 3SIMA 1DE6A 3CLMA 4Z17A 1DHKA 3TSMA 3OGRA 2NWSA 3W86A 5CEWA 3K8MA 2VYOA 5TAOA 4W89A 1RY0A 2G50A 4FXSA 4KGJA 4K2SA 1I2RA 5CPLA 1OYBA 1W3TA 3WH8A 2QMJA 1ZP3A 5ABGA 4GYFA 4AUBA 1OFAA 4IXXA 1ZAHA 1IGWA 1UKPA 3LM3A 1QU4A 4Q8PA 1JCTA 1C8XA 2CLFA 1S39A 3B9NA 1DEDA 2Q09A 3W70A 2D3NA 8RUCA 3J7HA 3CH9A 4UXDA 4I7VA 4A35A 3B0UX 4XSLA 5CSSA 4H2HA 4HZ7A 4I9TA 3DIPA 3PZIA 1OD8A 3HIJA 4HA0A 3O63A 1HXJA 1PXGA 4OOUA 3NAVA 2A3CA 1YBQB 3KVKA 4AX6A 1M03A 2H90A 1B90A 4FI4A 4ZFCA 1P7TB 3TN3A 3GH5A 4WKHA 1O66A 3S8HA 4IWWA 3TXZA 6REQA 4PMVA 3DYPA 4BEQA 4S3JA 3WLSA 3NQCA 1B2YA 2J78A 4Q6JA 5I78A 2Y7FA 1GQIA 3KP0A 4D71A 2H9AB 3CUJA 4GCAA 1MW1A 3EDJA 3GR4A 3KEHA 3T4CA 2WKGA 4DBUA 3PFRA 2XTKA 2O9PA 1XIBA 3ARWA 1IWAA 3TMLA 1GWJA 3SCSA 3VMNA 4O57A 5D2VA 4GH3A 4M1RA 4D1JA 3KLKA 1XBVA 3S1UA 2Q3OA 5ECVA 3UXLA 2WNQA 3UW6A 1HJUA 3SCPA 3PPCA 4F0HA 4MZ8A 3UWQA 3H2AA 4A8RA 4FR6A 3MTWA 1TREA 4K68A 2GQ8A 3CYVA 1B9BA 1GJPA 1CTNA 2E1DA 3FYPA 4HK6A 3BWWA 4L9XA 3G3DA 1BLIA 1QHPA 5AHLA 3D3FA