1UROA

Uroporphyrinogen decarboxylase
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
357
structure length
357
Chain Sequence
GFPELKNDTFLRAAWGEETDYTPVWCMRQAGRYLPEFRETRAAQDFFSTCRSPEACCELTLQPLRRFPLDAAIIFSDILVVPQALGMEVTMVPGKGPSFPEPLREEQDLERLRDPEVVASELGYVFQAITLTRQRLAGRVPLIGFAGAPWTLMTYMVEGGGSSTMAQAKRWLYQRPQASHQLLRILTDALVPYLVGQVVAGAQALQLFESHAGHLGPQLFNKFALPYIRDVAKQVKARLREAGLAPVPMIIFAKDGHFALEELAQAGYEVVGLDWTVAPKKARECVGKTVTLQGNLDPCALYASEEEIGQLVKQMLDDFGPHRYIANLGHGLYPDMDPEHVGAFVDAVHKHSRLLRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (UROPORPHYRINOGEN DECARBOXYLASE)
publication title Crystal structure of human uroporphyrinogen decarboxylase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 129
structure length 357
sequence length 357
ec nomenclature ec 4.1.1.37: Uroporphyrinogen decarboxylase.
pdb deposition date 1998-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01208 URO-D Uroporphyrinogen decarboxylase (URO-D)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.210 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 1uroA00
2INFA 3GVWA 3PPCA 4EXQA 4L61A 1JPHA 3GVVA 3L7RA 1U1JA 1R3SA 4L64A 3T0CA 4ZTXA 4L6HA 3RPDA 1R3VA 3CYVA 1U1HA 3BQ5A 1R3QA 1XR2A 2Q6ZA 3PPFA 1T7LA 1YPXA 4L6OA 1JPIA 1J93A 1XPGA 4L5ZA 1R3RA 3PPGA 1U22A 3PPHA 1XDJA 4WSHA 2NQ5A 4ZR8A 4AY8A 3GW0A 3GW3A 2Q71A 1UROA 4L65A 2EJAA 1R3YA 1U1UA 1R3TA 4QQUA 1JPKA 3BQ6A 3GVRA 4ZTYA 4AY7A 1R3WA 3GVQA
chains in the Genus database with same CATH superfamily
3TMLA 3KRZA 1KKRA 4LS2A 1Y7VA 2PDMA 1AH4A 4Q32A 4U5KA 1L9WA 1WPCA 4X22A 3FGCA 3IRSA 1HL2A 2FH6A 3THAA 3BAYA 4JOMA 1SW0A 4QG6A 2PDHA 4UR9A 4CNUA 5C2GA 7ODCA 5TBOA 3I3BA 3GNPA 2PMQA 2J6XA 4MMWA 3SURA 3UJSA 4ZO7A 3MDWA 4HPHA 1QW8A 1N8WA 3BJTA 2JF6A 3RJYA 4D71A 2Y85A 4F3HA 1NVMA 2GJPA 2CLMA 5HJXA 4F9DA 2QKFA 4AF0A 3T40A 3N04A 1J6PA 1ZL1A 1MUWA 3H4GA 1K7EA 3R8GA 4PTVA 3ZZ1A 4DZAA 3HO8A 2C79A 1KR0A 3G8EA 1B3YA 1HNYA 1I8JA 2OO0A 2WVVB 4G7EB 5CZKA 2OEMA 4J40A 1QI3A 4U3AA 1X97A 1IR1A 1ZCCA 3TN5A 4C7DA 1MFUA 4JTLA 3POCA 5CSUA 5I00A 2CEQA 1BQGA 3KUMA 4EAMA 1IEVA 1UG6A 3WQ8A 3DFQA 1EDTA 3W71A 1U5JA 3GW3A 4DJFD 1CTNA 2RFGA 4NX0A 4JS3A 2ZVRA 2PGFA 3NL2A 1ZAJA 1P6WA 3PPCA 3W82A 4F0MA 4W7VA 2O9PA 3AIBA 3T07A 3TX9A 4PFMA 1H7OA 1MW0A 5TAOA 1UZDA 4HU8A 2NVAA 4LBRA 1A50A 4KF1A 3DG6A 1UWIA 1YXDA 2EAWA 4PA8A 1QI5A 1NELA 2VWSA 2ZXDA 4L9YA 4UTTC 3WLQA 3WUGA 4EXAA 4LC6A 4BHYA 4PUKA 5C9ZA 3BWWA 3NGFA 2VFIA 1J96A 3HMCA 1UD3A 3EPOA 3QHNA 3D47A 3WL0A 3MP4A 4AX7A 2YCIX 4QNEA 3G1XA 1PKYA 2YL5A 1TZZA 1W3NA 1OWQA 3NEHA 3I6TA 2G3NA 3AMLA 4TQTA 2P8CA 3WMBA 5LIUX 1Y5VA 3HQNA 1U5HA 2ZE0A 1QVBA 3N6JA 4HMNA 4UOZA 5C70A 4BWLC 1S3HA 3AFBA 1W3LA 3N17A 4QDPA 2HNHA 1XC6A 4BF7A 3TROA 3KOYA 2ESCA 1GVRA 1V79A 1WX0A 3PTKA 3WJSA 2R9RA 3LPGA 3UERA 1J0YA 2QF7A 5LKYA 3DHPA 1XIMA 2PZ0A 4H2HA 4X2RA 2VI0A 2HPIA 1SZEA 4L56A 4QNWA 3T4CA 3QN3A 4C6MA 1BEUA 3C2VA 2HE8A 1W56A 2DFAA 4ROPA 4L7ZA 3BCJA 3G1AA 3LBMA 1K7FA 4RE0A 2B4GA 1XUUA 1A5LC 1ITCA 1HIZA 4TV5A 4O14A 5CKSA 4V1YA 3QPZA 5AB3A 3CXOA 3NG3A 4PZVA 3WD0A 4AW7A 3FNDA 3WFZA 3T6CA 1E70M 3TJXA 2R6OA 1YX1A 1ZFJA 1PZ3A 4JL2A 5CLTA 1O12A 3AS0A 1P48A 3EAUA 4IMCA 1KC7A 4ZE4A 2G37A 4IHCA 5DMLA 2WSKA 1LRTA 1M01A 4OQVA 1F8IA 3EB3A 3GG8A 3SUVA 3IUDA 2F6UA 3C61A 3ZFHA 5ABFB 1O5QA 4GLEA 2WM0A 3S2MA 1VFUA 3MUY1 4MZYA 3GUGA 4X3ZA 2QW5A 4XD4A 4AD0A 2VRJA 3GZAA 1E9LA 1ZB5A 1UR2A 4FNTA 1CIUA 2R1LA 1DWJM 2DZPA 3MPGA 5FACA 3IIPA 3B9NA 5C2CA 3UXLA 3GBDA 1KM3A 2VEFA 1S2UA 4MOZA 1L2UA 1HW6A 2B7PA 2D73A 2YDRA 4PTNA 1RP9A 2WMJA 1GQJA 2HROA 3PBYA 4FSAA 1E1EA 3AOFA 5E9AA 3JS3A 3LNMA 1JI2A 1A53A 3SRHA 1VRDA 4F66A 3VD3A 1SU5A 1K9TA 2P53A 3S42A 2YBVA 4F2UA 3H2FA 4AHOA 3IJQA 3NM3A 4ZO8A 3H12A 4FMVA 4IQEA 1IYXA 3LI1A 4D1JA 3GNRA 4OTKA 1UZHA 1HUVA 4RR4A 1F9CA 3V5CA 5AYZA 1PCKA 3UZWA 1XLIA 3PZQA 4HPNA 1ELSA 2ATSA 3AYTA 4F8XA 2MUCA 1W9VA 2FZ8A 3MBFA 1UMLA 3SJNA 4IISA 3N3MA 1NU5A 2OB3A 3MJYA 3HGRA 4LGXA 3TJIA 2PP3A 3M0MA 4ZQNA 1OFPA 3M0KA 5F2MA 3VIJA 3W7NA 1XIDA 3NURA 4UFIA 1EDGA 3E5BA 1EJWC 4H1ZA 1K7XA 3AUJA 3IK2A 4XAFA 4IIHA 2OXNA 4HU0A 2PWUA 1YIXA 2XJ7A 1T96A 5DN1A 3NDYA 4HA4A 3OZPA 1UD8A 3JR2A 1VBRA 1JULA 3DECA 3CL6A 2WHMA 3G3DA 3TJ4A 5GNZA 3CZGA 1C7TA 1D3GA 2Y7FA 4LAZA 3QHMA 4FEZA 4H8HA 5C6MA 2TYSA 4NJIA 4HA0A 3K4DA 3OVGA 3VDAA 4M81A 1TZ9A 1KFEA 3SUWA 1XH2A 4IGMA 4S23A 2WSQA 3L4WA 4HZ6A 4GI6A 2TODA 4KEZA 4G1NA 1J18A 1KQYA 4UFJA 3W70A 3WUEA 3RM4A 1R2RA 1VYPX 2HEJA 4KGLA 2RJGA 2UY3A 1XIFA 3BW2A 5HQMA 1Q8AA 2A7NA 4AY8A 4DJFC 2XWEA 3O6AA 4DWDA 4D8ZA 4W93A 3SGZA 1CLVA 5BRPA 4JTEA 2GVGA 3CUGA 1U30A 3LGGA 4JFTA 3R79A 2PCQA 4XBJA 3O6YX 3BOFA 2E9BA 5FJPA 3FHAA 1P0BA 1VPYA 1SUXA 1OG6A 2VX7A 2VTFA 2PD5A 4RJEA 1DJYA 2PU0A 4ENLA 3O16A 2Q09A 3UNDA 1EUAA 1LJYA 5HMFA 2YJQA 3S2JA 4UZSA 3KXQA 1O6IA 1FH8A 4GH3A 2OX1A 4DBWA 4NZ1A 4BEUA 5D38A 2XYLA 4ZXLA 4I90A 3KBWA 3REQA 4NXSA 2OOGA 3CZLA 5A2AA 4FAMA 4HYVA 1H7NA 3AXIA 1W3TA 3RPDA 3FEQA 3V5OA 1NDZA 3BLFA 4XUGA 3O6DA 4XZMX 2XGIA 4ALDA 2IQTA 1FY6A 3PWGA 1E6SM 2CBJA 5LA0A 3VTRA 7PTDA 2VGFA 4BK9A 1A0EA 1AL8A 2B7NA 3KOFA 2A6NA 3UYCA 1EIBA 1MNSA 3MP3A 1OFEA 4UTWC 3BXWA 4E3VA 4RE3A 4DYEA 4NZJA 3QEZA 3RDKA 3ICJA 3CUXA 3EB4A 3P74A 3SGUA 3JZUA 3ZJ6A 2FKPA 4WVXA 4IT1A 1X1NA 5CPOA 1B3WA 3Q2DA 3WSUA 2A2IA 4HNNA 4X2PA 4UQDA 9CGTA 1HVXA 1QI0A 2WCGA 1UUOA 3TCSA 3LG3A 3SADA 1H1NA 2DVTA 4ACYA 4JIIX 5BRBA 1QNQA 3TONA 3K13A 5AVHA 2E6FA 2OKTA 3LZ3A 3W7KA 2XZ9A 2CPUA 3C2FA 3PNZA 3WF3A 1UWUA 3H24A 3RFAA 3APYA 2BS9A 5A6SA 3S9ZA 3M64A 2Y89A 1RBLA 3URNA 3THDA 1FRBA 4R7JA 4AD3A 1YPXA 3EDJA 2QCGA 3SY8A 3OHIA 1DXEA 2ZRUA 2DH2A 5K4ZA 3GVGA 4E8GA 3I7QA 1E1CB 3C2OA 4MF4A 2ISFA 1QO5A 3IUIA 4KERA 3WF2A 2QYGA 4MZ8A 4NZ4A 3NSNA 3AMGA 5D4YA 2NT0A 5AKQA 3VIHA 3L0NA 3AMDA 2QDGA 1NFGA 1R9YA 4GVGA 3TYEA 4ZOCA 4C6JA 1NDWA 2JFEX 1K8YA 1EZ2A 1UD2A 3CGTA 5C0QA 2X7WA 4M51A 4E2DA 1DXFA 1V6TA 1LL4A 1XM3A 4NJKA 4PB4A 1ITXA 3S5NA 5D2VA 1HQTA 2PLCA 1G4SA 2PRLA 3CTTA 5E0FA 2G3FA 1J8VA 4S1FA 1V0KA 4FPSA 2NSOA 3A22A 1UKPA 3EX6A 2WWCA 1FKXA 2BB0A 2X1SA 5E6YA 5DCBA 4AAJA 1QOPA 1W91A 3NDOA 3BAJA 4Z2IA 4OVXA 4S3JA 1M9HA 4LYPA 5AHIA 2EHHA 3BLIA 5A6JA 3ES7A 3NPWA 2ZXAA 3PG9A 1UR3M 3SSZA 1BWVA 1EX5A 1ADOA 2O4QA 4LQ1A 2P0OA 4Q8PA 3TJLA 3NA8A 3A3XA 4Q8VA 5F1UA 4J28A 4WJXA 3NEVA 3S9IA 1HXJA 3UWWA 1LDCA 2RKXA 3LDVA 1VZWA 5HWMA 4NU7A 3N18A 2V5JA 4DXKA 3ZQ9A 1FWHC 1OB0A 2P10A 2ABAA 1TTQA 1H63A 4Y9MA 1BVWA 3OB8A 4Q7NA 1U83A 3Q37A 5C7VA 4GNJA 3CHFA 4K8HA 2VGIA 2JALA 3ABOA 1GOWA 1TUXA 3STCA 3DZ1A 4PTWA 4H6EA 1R3YA 4P61A 4MZ1A 4MDOA 1E6XM 1TE6A 4GOAA 1JZ8A 3RCNA 5ECUA 1X38A 4QLKA 2QHAA 3NPXA 1SZGA 1EYEA 1EJTC 4NYUA 1B57A 4GUGA 2PBGA 1GGOA 2RGMA 5JBDA 5AC7A 2FHCA 4MFEA 3IGSA 3WELA 5LIXX 2J62A 1J2BA 3N6HA 1T0OA 1V8EA 3GG0A 1JNDA 2E40A 4KFNA 1ZHAA 4GD0A 5CSRA 1TB3A 4MGGA 1V02A 3H53A 2EPKX 1RSCA 3UJRA 4MADA 2OZ8A 2CERA 3FSUA 2GK1A 4PUEA 2DUZA 1SJCA 3ARVA 4P5UA 4ZQCA 3M0XA 5HJYA 1O5XA 3WFLA 4TTUA 4K1GA 5CSSA 2REQB 1R3VA 3M47A 1PVNA 4LCSA 3SJ3A 4LU0A 3HGOA 1EDQA 5I3GA 4L1XA 3AUOA 4AX6A 3CJPA 4MVAA 3EX4A 4I9JA 5CXPA 5FEXA 2GVLA 3OZOA 1KTBA 2J7HA 4DF1A 4X61A 3T7VA 1GTEA 4GACA 1T8XA 4GIAA 5A2BA 4PCPA 3WCZA 1R9XA 2CLKA 3EWWA 1RPXA 2Z2BA 2BY0A 4GFSA 1SFTA 2Y70A 3EA2A 4UB9A 4HBKA 4AFYA 4QQUA 4Z17A 1L8NA 1OG0A 2VC6A 4MJZA 2YOCA 2CBUA 4L64A 2V5KA 4R34A 4PC8A 4XB3A 2BVTA 4UIOA 4HHMA 4YWIA 3EXTA 4CQDA 3HG2A 4HCHA 3TOYA 3VOCA 2A0NA 4XKYB 1ZAHA 4FX6M 1PJ9A 1H5YA 2X0SA 3B8UA 5FAGA 4HHPA 3PHAA 3V5FA 3U9IA 1YXYA 4TTGA 3QLDA 3LRMA 1W5NA 3FVMA 1GVQA 2J75A 1NQ6A 5MF5A 3NXLA 3ANUA 5CGQA 1E5JA 1SW3A 3UG3A 3HMJG 3N9RA 4YYCA 4NT0A 4OWGA 4GQBA 5T8GA 2OZTA 3TA9A 4MPKA 1Q6RA 3I3DA 1S1RA 2Z6JA 1VPQA 3RPMA 4O4WA 3M5YA 3GXDA 5IHRA 3BARA 4E3TA 4B3LA 4ERAA 4I6VA 5I3FA 4KESA 4PR4A 4J2PA 3PZNA 3IVTA 5A6LA 4GFIA 5D30A 1ML1A 4A2RA 3W1NA 2WBGA 2Z27A 4O1AA 3AIQA 2OLHA 4GHRA 3ITCA 1PDZA 7TIMA 2ZUUA 2I56A 1MQQA 3ZM8A 3BDKA 4BJHA 1JFXA 4M5PA 4PUUA 1OJXA 2G50A 6REQA 3TQPA 3ONBA 5SWUA 2OSWA 2POZA 4NP7A 4HNTA 2CIPA 1XLGA 3W6LA 1DYSA 3HU7A 4OKDA 4JTJA 3ENLA 1WKYA 1RP8A 3CUFA 3LMZA 1Z42A 4KIEA 3ZR5A 1DE5A 4YTUA 3AXKA 3PZVA 3SRFA 1WDQA 3LCGA 3U8GA 1K9FA 2ON3A 2W67A 3HIJA 1CGVA 1YPFA 3BC9A 2Y24A 3LN3A 3O2LA 3UR5A 4FX7A 3AIEA 1ZRQA 2CETA 4H9MA 1E6NA 3MWCA 2CZDA 1J01A 1ISYA 1R47A 2IXUA 5EU9A 4L9ZA 2XH7A 3EDFA 4AU0A 4G1KA 2Y2WA 3W7DA 1DIEA 4UMCA 4XSLA 3SIMA 2CFFA 1QNVA 1K77A 4NJJA 2C1GA 3P14A 1Q85A 3MBDA 1HZYA 1X6UA 2Z1WA 4I9AA 4RZ6A 1LOSA 1JXKA 2VX6A 3G1SA 5CG0A 2XN2A 5EPDA 1PZ1A 1TMLA 3R0KA 3SCWA 4DZIA 1QTWA 2P8BA 1KM1A 3SDOA 1XG3A 1R8LA 2P76A 1K8CA 4UTLA 1VFSA 4JX4A 1KB3A 4K68A 4GYJA 4ILSA 3PK7A 1QAPA 3SIZA 1EYWA 5A1AA 1LLWA 4O18A 5DX7A 4KFOA 2ZZ6A 4IG2B 5LXXA 3WNMA 1CGUA 1SZFA 2F84A 4GXMA 4UCFA 2VX5A 4MNMA 2YDSA 4HPGA 5IHSA 3M6YA 1PZ2A 2YYUA 1OFQA 3TLQA 3TN6A 3P84A 3IJ8A 3GD6A 1V0MA 1DIKA 2I17A 2GJXA 3C5QA 3ID7A 4BCEA 2J7CA 4ZO9A 4JTKA 3GDMA 4JFVA 3NQDA 4AMAA 1JYNA 4JTAA 2F61A 1P0NA 3COTA 4NASA 1ECEA 2Z1KA 3MTWA 1PUDA 4NHVA 3UGRA 4NAEB 1IWPA 2A3LA 4XO6A 3TYUA 4EXBA 2Y8KA 1AW5A 3AQUA 1XH1A 3WZ0E 3C2EA 1KWKA 2EQDA 4J3XA 1KRMA 3LV6A 1RJPA 3K4AA 3GIYA 2DV0A 1XIJA 4RV3A 4IP7A 3WEMA 4ASTA 2X41A 2BY1A 1IT7A 2E25A 3WDPP 1MUCA 2ACSA 1UA7A 1YHTA 4DO6A 2H8XA 2ZICA 2QUTA 1K9DA 1UZ4A 3MI2A 2FDSA 5KZEA 4M19A 2CBIA 3H2OA 1SR9A 1DTNA 2OX4A 1EHNA 5JVLA 3H70A 3R43A 4JAWA 2VURA 4LAKA 4DPQA 1I9CB 3AALA 3RLHA 3NO1A 4L4MA 4QR6A 3A3WA 3ZLFA 1G6CA 3LCHA 4PTXA 4YCPA 3N4FA 2E6YA 3G0UA 3NL5A 2DZBA 2E68A 2C91A 3AYRA 3H7RA 4KCWA 2Y88A 3JVAA 3W83A 4HSHA 1FDYA 3VDHA 1NSJA 5C8BB 3F1QA 2GPTA 2VEGA 4F2BA 3T0TA 4IPJA 4N9BA 1FOBA 3B9EA 2C3ZA 4D6GA 1POKA 2DH3A 4JTQA 3W87A 2V5LA 3V3WA 3BGAA 4EACA 3VYLA 3ZXWA 4Q8QA 3GH4A 2REQA 1WE5A 1TIWA 3S3GA 3JRKA 1WCGA 4CNSA 2VFFA 1CXEA 4NIRA 4KWUA 2Q71A 4MLJA 1BSLA 2QR6A 4R9XA 4AC7C 4IX2A 4GIRA 5LZLA 4UOQA 5JQ9A 5HK4A 1BVZA 1VJSA 2IPWA 3IJ6A 3HPSA 1B5TA 3LSCA 1FHUA 1PKLA 3QYSA 1VFMA 3QV9A 1KA9F 4UTUA 2V63A 5CGTA 4DX3A 3W7PA 1JEZA 1W9UA 5JH2A 2B81A 4H6RA 4B9ZA 1EOKA 2CLHA 1SO4A 1QWKA 2POTA 3N11A 5C5YA 3WD3A 8A3HA 2GUYA 1SO3A 3UVAA 4HIBA 3O06A 3GH7A 1Q66A 4ATDA 3PAOA 3S1XA 1LUCB 5CPMA 3BOXA 1UQYA 2YB4A 2A3CA 4N9EA 4U2ZA 4QFUA 4H83A 3MW7A 1BXCA 3STPA 1QBBA 1VHCA 4DIAA 2GQ8A 1RBOB 2P5NA 4NYYA 4PSPA 3LPFA 1A5NC 3NZ1A 1G4EA 4E0CA 1G67A 1V6YA 1TO3A 3NWRA 3NQVA 2G4FA 1S1PA 1QI2A 5CQ1A 4BFAA 2FGZA 1UR4A 2YL8A 1AJ0A 1BG4A 1JRBA 4XAZA 3HQPA 3RPTA 4I5UA 2GL5A 1EF2A 1XICA 2VMFA 1Q4NX 1ISVA 2DU2A 2B31A 1G94A 3VNMA 4XAGA 5LHFA 2GQ3A 3S1WA 4MKNA 4PEEA 5CPQA 2YDQA 4QRNA 4AISA 3BG5A 1QATA 1Q13A 1V0NA 4C90A 4WK9A 3ARSA 3FS2A 3W2UA 4NNBA 3BZGA 3RX3A 4KRTA 2CXEA 4OOZA 4O52A 4QBXA 7A3HA 1G0CA 1HTIA 3OQEA 1ODUA 1GYNA 1ISXA 1H50A 3QC3A 1UASA 1FDZA 3OPSA 1TPEA 4LEFA 2FZBA 2O56A 3W1LA 1IE7C 3DHUA 4HB7A 5DT5A 2E9LA 2XVGA 1CXLA 2IUZA 1H0GA 4TMBA 4W86A 3B8DA 1KNWA 4R88A 2NWRA 1PWLA 4UTJA 3QY8A 5HUPA 1NWUA 2DSVA 4DUOA 1QMLA 1DQWA 3VPLA 5M03A 4D6FA 3T1GA 4LUJA 4PH6A 2QT3A 3VAVA 1Q7MA 4TMCA 1XLFA 4C1NA 2AMGA 4A21A 1W2VA 1HO1A 1CGYA 2CZEA 1TKKA 3QHOA 1T5AA 4WY0B 1OF6A 2YBTA 2G3IA 2PLMA 3DX5A 5EMMA 2QCDB 2W0UA 3E0FA 1QNPA 4UUIA 3KWSA 1S2TA 3ZWSA 3B8VA 2X0HA 5LNRA 3TW7A 1Z7AA 3MMUA 3KTSA 4UXDA 3F2BA 4UFKA 5FJRA 4I9TA 3GXFA 4WKHA 2BWGA 3B8WA 5D8ZA 4XISA 1M03A 3VDCA 2VL4A 3B8SA 3PSWA 1HF6A 4FHAA 3VZXA 4EVZA 1TJ0A 3E5PA 3NFUA 3BPWA 5D37A 3W23A 2ZQ0A 4HN8A 3TTOA 1IWAA 1GVYA 2CLLA 3E2RA 4RW3A 1G9HA 3BG3A 4DM2A 1VEMA 5HMEA 1R30A 3W85A 2WQDA 1C9DA 1EEPA 4AZ5A 1M68A 5AYBA 1UWRA 1LQ0A 1TVPA 2AOSA 2BZNA 3ARXA 2C1HA 3OVQA 2ZRZA 3QGVA 1IHIA 5G1TA 1L6YA 1SZRA 2BXZA 4IOTA 4RCXA 1YW1A 4UZUA 1PTDA 3N19B 3TVAA 4ZL1A 4F40A 1CLXA 1RQHA 1M65A 3PUEA 4J4KA 5CBIA 4PBEA 4NAEA 3YPIA 2XGZA 1HFBA 4M24A 1FWBC 2Y5EA 1YNYA 4LVFA 4UNIA 5LYRA 2A85A 1XYAA 1KM2A 2INZA 1WKFA 4MPQA 5FD0A 1S2AA 2QUVA 4I7VA 1XGZA 3A5VA 4B91A 2BY2A 3GNDA 4IP4A 3QMRA 4XZIA 5EMYA 1W1TA 2CHRA 4EF8A 3MQTA 4MDPA 3QV7A 4ZA0A 3A4XA 5J8LA 1OFOA 3STGA 2ZXBA 1UIPA 3FJNA 1UROA 1DJWA 1RBAA 3WQFA 5M2FX 4JXCA 1MZRA 1D9EA 3I6RA 2ZA1A 2ZZ7A 3CEUA 3F5JA 4PMQA 1EJ7L 3AJ7A 3MDUA 4W4QA 4ADUA 4XTIA 4LUSA 1PHWA 2J88A 3GTHA 2Y1HA 3C2YA 1D3HA 3EOSA 4S2CA 2ZCGA 1JUEA 3ZMRA 3OA5A 3LQGA 1CXIA 1FTXA 2OTDA 3W26A 4O8RA 1KTCA 2ACUA 3MC5A 2NV2A 1G5AA 1VQTA 3AHZA 3IGHX 3S5YA 4DAIA 5U4NA 2G96A 3OYXA 3ZT7A 4QDMA 2J77A 3SSJA 1Q8JA 2Y8VA 3Q4DA 2VEIA 2Z0IA 3T0BA 1DBTA 4Q8NA 4JKMA 3W00A 1TVNA 2O7QA 4JCLA 5BXTA 2YLAA 3KWXA 1LT8A 1WUEA 1YDVA 5I3IA 4NRSA 1NP2A 3GQYA 2VZSA 3IJ7A 1J9YA 3WH7A 1IT0A 4H04A 5AYYA 3CUHA 1QRQA 3VCCA 4DJDC 2XINA 3QMTA 2YZRA 3UQNA 2GUUA 2E9MA 3B8IA 2V2DA 3Q45A 3OBAA 4ECLA 5CJ5A 4PUDA 4MUZA 3W1PA 1AZ1A 1HP4A 2V68A 3W74A 3F4CA 2HDJA 3E02A 5GJPA 4KWWA 2YA2A 9XIMA 2V2HA 2PWHA 2DQXA 4XZ9A 1AL7A 1B90A 1V3IA 2IQDA 4MSSA 3HURA 5D9MA 4FALA 3EPNA 3S8HA 3LM3A 1RJQA 2JGQA 3NQBA 5EL1A 3QF0A 3F4DA 3LV5A 4ZCWA 1PWMA 2VR2A 2PS2A 4NZCA 2Q6ZA 3IK4A 3N2CA 1SFJA 1DIOA 1XRVA 1S5TA 3HTWA 5A94A 2X7VA 3NXFA 4P8XA 5I7GA 4F9JA 3AIRA 1WZLA 1HO4A 2ACRA 2V82A 5F4XA 3LU2A 1H61A 2WVUA 2D3LA 3G24A 4KETA 2WSYA 3T44A 2WNQA 3UU0A 2DSUA 2WHJA 3EMCA 1WDWA 5I78A 1C8VA 1UC5A 1U2YA 1CPUA 1P1MA 3G3MA 3NCOA 1I2RA 3UWYA 3LTSA 1QW9A 2J7FA 3CMJA 2J7BA 4B4HA 4ZOBA 1TV2A 1UR9A 3C4UA 2AAAA 4RDZA 1W0MA 2PURA 1D8CA 3LHYA 1UUMA 2ASHA 5AC5A 2PDGA 3MKVA 3ARRA 1QPRA 4H9YA 1CW2A 3G2GA 2CYGA 3GDBA 3LA4A 3XIMA 3IJ9A 1QASA 3H2MA 2OT1A 3KW3A 3H22A 4Q4RA 5JBEA 4Z08A 4GQ0A 2DUXA 4AIEA 4H7VA 3SCVA 1DJQA 2V2CA 3EWUA 1EJUC 2FPYA 4CUCA 4MWAE 2KAUC 3PZMA 1ZU8A 4PMYA 2JEQA 1W31A 1A5SA 1AODA 4C6FA 2OEKA 3M07A 1KGXA 3DHDA 3VGHA 3L4TA 2A3HA 1I0BA 4RZ5A 1SVDA 3CH9A 4MYAA 4IICA 4N9CA 4S3FA 3W38A 4WY0A 4FLRA 4M6QA 1U5VA 4B5VA 3MZ2A 2WZEA 1KTNA 3NQCA 4EWJA 1V0LA 3WQOA 2X0YA 1MDRA 2H9AB 3EOLA 2X2YA 3U7BA 1AW2A 4KEMA 4AYSA 1DWHM 2OODA 2YYTA 3S6DA 3S2CA 4CQ9A 3TW9A 5DCEA 3EBVA 1QW7A 1B3OA 3UA4A 1S38A 4G8TA 1YBQA 4OGZA 1NDYA 1KD0A 5A6KA 3I65A 4S3BA 3T2PA 4B2DA 1XFBA 1LWHA 3FXYA 3PFMA 4I5XA 2MNRA 1F2JA 2G3MA 1PO9A 1MEWA 5F2IA 4AD4A 5I3KA 3UXIA 5D32A 4GNKB 3VINA 1EJSC 4D6DA 3L7RA 1AK5A 4GZ7A 4MJMA 1X98A 2AQWA 3CZ8A 3RX4A 3GWQA 1UJPA 3O8AA 4OBRA 3MO4A 2AMXA 4HA1A 2Z7KA 2R1KA 3WK1A 4XG1A 1GT8A 2O92A 2O55A 1WDPA 2E09A 5FIPA 1EP1A 1Q6EA 4GNVA 4HMCA 3SCQA 2JKEA 3JZEA 4N2YA 1CGTA 3GR7A 4JTDA 3MUAA 1SYTA 1PHQA 1YDOA 2XM2A 4B3ZA 4JN7A 3W29A 1TV8A 5XIMA 1QBAA 4S3GA 5HANA 3VMPA 5HMDA 3KBVA 2VZTA 2HV5A 2INFA 1XPYA 1O68A 4URIA 1JF6A 3NM1A 4LCRA 2QDEA 2NW0A 3DYPA 1KM0A 2C18A 4AZ7A 2NT1A 2ISVA 3DU0A 2O0TA 2BSLA 1JR1A 5FSDC 1GORA 2KX9A 1WDSA 2D2HA 3OZYA 5I77A 3GAYA 4Y6GA 4PMOA 2ZRXA 1O1ZA 3KBMA 1ISWA 4Q4MA 3MVTA 2GYIA 3MHGA 3W84A 3DESA 2VGGA 2OMAA 4ZENA 1XYMA 1TJ1A 1N2VA 3SQLA 1M7PA 4MHBA 2DT2A 3CB8A 2D2GA 3F2CA 4ZQPA 3CZKA 2WYSA 3K1GA 3S1UA 2OYMA 1THFD 3KP0A 3BH4A 1E0WA 4MNKA 1H51A 4O28A 3FHQA 2DZWA 1PB0A 2INEA 4Z2KA 3TR2A 4XKMA 1GVOA 3FYOA 4K39A 1HJXA 1VP5A 4U33A 4K38A 4MJ2A 1GOQA 3GXMA 2Q8ZA 4NILA 3VFCA 2VFDA 3GYEA 4Y8EA 4AZCB 1S5VA 1EPXA 4GABA 1UR1A 3PVFA 2UWFA 2NSXA 4CD7A 1M7XA 3SY1A 5IRPA 1ALDA 1GQNA 1Q63A 3W2NA 4IPPA 2OEJA 1PSCA 4M8UA 1FDJA 2NQJA 3RXZA 1OZMA 3A21A 1BGAA 2V3EA 3TYDA 2CLEA 3LK6A 1X7IA 2UY2A 2CKSA 2CLIA 4LALA 3S1VA 3MMDA 4PUJA 1SGJA 1I2NA 1VIWA 4LCQA 4BI6A 3FA3A 1VYSX 1FWNA 3RX2A 4LTSA 4ZQMA 3WMSA 4KEVA 3C52A 2YGYA 2DW6A 3LHUA 3NOYA 1MQPA 4UMBA 2AL1A 2V3DA 4FIQA 1X8FA 3QZAA 1D3CA 4DUVA 1HKVA 3MYPA 3U6WA 1I1XA 3UYIA 1R9ZA 3M0YA 3B0XA 2F7FA 2A21A 2PDLA 4AZGA 2ZZ3A 3WF0A 2PDUA 4N6EA 6TAAA 1DVJA 4B5SA 2Y7EA 3ZO9A 3GKFA 3WDQA 1FKWA 4W88A 2F6XA 3KCOA 4KRZA 1N8FA 2OFJA 1YYAA 4R53A 2WC4A 2PA6A 3NQGA 3UWQA 1US0A 4J2MA 4EIVA 3AZRA 1F74A 3PUOA 2VC7A 1U1UA 3ZLGA 1V3LA 1V93A 3POHA 1DJXA 3GHSA 2W79A 4AIOA 4UQCA 2X42A 3WD4A 1KCZA 3C0JA 4EWND 5DQPA 1OYBA 1TWZA 4WQ6A 5B7ZA 3CO8A 2P3EA 4CQAA 1F61A 4CNNA 1ITUA 1Y65A 2VCAA 4JFWA 1U1HA 5CAKA 2XPKA 1OM0A 5C9XA 3WG6A 4NJHA 1DJGA 3QOKA 1KXHA 5A8PA 1OYAA 3QLLA 1A3HA 1FWCC 2QJJA 3P3BA 4H6QA 3IV3A 4IGNA 4Q6JA 3WNOA 1KKOA 4PTMA 3B4YA 3GZ3A 4GY0A 2CLOA 4E5TA 3EXSA 1AJZA 1TA3B 5HUOA 2HSAA 3FW6A 4EPDC 3L67A 3BICA 1PXGA 1TPB1 3ZLHA 1RH9A 1H7WA 3QW3A 4AQLA 1Z8AA 1LCOA 1LLOA 2Q8XA 4PMDA 1O66A 5RUBA 1JDDA 2XFFA 4TXEA 3EWYA 3P67A 3QSTA 4GZJA 1UKTA 4OU1A 1RZMA 1RCXB 1R3QA 1OD8A 3L2LA 3MSYA 1US3A 3QH2A 2G95A 3ALGA 1D7KA 4AB4A 3F5KA 2W9MA 4HD5A 1B4EA 3GNXA 1O5RA 3E49A 1XLHA 5IBXC 1CB7B 1W1YA 2DZXA 4JTFA 1LZOA 3IAPA 4J3WA 4B5XA 1F76A 4NRRA 1CYGA 1W5OA 2EKCA 2NX3A 1RR2A 4GVIA 1G69A 3GS6A 2HE5A 4ZVJA 3TQ0A 3VM7A 2W6RA 3CT2A 2FQIA 1XKYA 4AZ6A 3AMCA 3PJXA 3I68A 2A4AA 1DXIA 1V6VA 2ZWYA 1Q6CA 5HAOA 2GWNA 3G18A 4AEEA 5AC4A 3B9AA 2PDQA 4F0HA 2ZRWA 4JD4A 3RM9A 4ERGA 2X8RA 5XIAA 1E73M 2CHOA 2W91A 3IIOA 1QU4A 3PZGA 1TPUA 2WO5A 4GMEA 1A5KC 1UHVA 3BURA 3FKRA 1Q7ZA 1VRXA 1WP6A 1TR1A 1M1BA 3WLIA 1OCBA 3ARTA 3TEVA 3CBWA 3KCLA 1W3JA 1L6SA 3DG7A 3BV4A 3GC4A 1R85A 3KDNA 3PB0A 3LGDA 2IW0A 4WD0A 3WX7A 3QQWA 4O16A 5I06A 1G7UA 4D8AA 3ZVIA 1ONRA 5E93A 1OY0A 4V1XA 2ACQA 3RCYA 1TV3A 2XIJA 3F4NA 3TNBA 3E3HA 3VOGA 2RDUA 3R8HA 4ZSUA 4JEQA 4HJWA 3ANVA 1TWSA 4GISA 4M7TA 4YIWA 5FF4A 2Z29A 1GOKA 5E0KA 2F9RA 3L21A 2RHGA 3N14A 1RPKA 3WNKA 1NFPA 4GXPA 3NTYA 1ENUA 2TPSA 3HJEA 4M3PA 3RAOA 3M1ZA 3LRKA 1JCYA 1DHKA 4ZGYA 3H4WA 7ENLA 5ENLA 2NUWA 3VNIA 4MNJA 3UVIA 2FGBA 1F05A 3FKKA 3FY1A 5GQBA 2ZYFA 4LH8A 5D2YA 3URBA 4AHQA 3FGCB 1I2QA 2VWTA 1HKWA 3AHTA 2GVEA 2HCVA 1ISZA 5G4EA 3CAWA 3PG8A 2C6QA 3TKFA 4WKAA 3UPBA 4JFSA 1WUFA 4MUPA 2VZVA 3HG4A 3RR4A 1Q6FA 3GXTA 1GQKA 1OD0A 4H19A 3UGVA 3T0AA 4Z1YA 3EEGA 4RNHA 4DO7A 5GJNA 1B1YA 2VCCA 4B16A 4K7VA 4CQ8A 4AF0B 1Q6QA 1X96A 2H8ZA 3C0SA 2I5IA 4ZTYA 1A3XA 4D6IA 1BTCA 4U3CA 4YVPA 1BYAA 1WAUA 1CZ1A 3TXVA 1GEHA 3EDKA 4GXWA 5CC6A 2JK2A 3UR7A 1AQMA 5FSEC 4I6KA 4RZBA 2D23A 2P88A 4LAOA 3WLMA 1B31A 2OWWA 3LEPA 4ML9A 3W1QA 3IVUA 1HJUA 1OCQA 1ZY9A 2Y6ZA 1PYFA 4YMZA 3ZSTA 1EUNA 4UFLA 4WR3A 3HZ3A 4YTQA 5FF2A 3W1XA 2YPIA 1VB9A 3OLIA 5A69A 1IIHA 5K3VA 2GJRA 3PB2A 3MS8A 2HZGA 1E15A 3EXRA 1TV7A 1IR2A 1GKQA 4D6JA 4FA3A 3ZOAA 3WUBA 3HV9A 1Z44A 2R82A 5DEZA 1AJ2A 4MAZA 3W02A 4I9MA 3P5ZA 3DH7A 3VIKA 1IGSA 2J8FA 2BP1A 1IF2A 1A80A 1GZ1A 1LWIA 2HBVA 2HS6A 4LS0A 3VK5A 3GFZA 3GTFA 4DRSA 1AD1A 5HA7A 3T8LA 3W1TA 2ONEA 5EB8A 3LXBA 4F0KA 2O9TA 5JXQA 1EO7A 1VR6A 1TPWA 2GZXA 3DG3A 3GDRA 4LV9A 3GVVA 4QSFA 1XYFA 5C2XA 1E43A 3W1UA 2X30A 4IXHA 4NI3A 6ALDA 3PULA 1PIGA 1I75A 2WZMA 3TTEA 4XZLX 3UWUA 4ONVA 1UPMB 5F2GA 1EA9C 3TTSA 3UG4A 3HPXA 3HG5A 1H0IA 2QCEA 1F3XA 2WV8A 3W53A 3WQDA 4DF2A 5JH1A 4W85A 1AQ0A 4TVDA 1WDRA 4JIPA 1G4PA 2V81A 3ABXA 1PX8A 3OJGA 3AYSA 1KXVA 3MSDA 4L9XA 5FL0A 2FGLA 3QKZA 3UZ5A 4B2DD 4UOJA 4YWSA 5KMYA 3CUIA 3KOWA 3KS6A 1A5CA 3DHFA 3U7VA 3PBUA 1MYRA 3FLUA 3HB9A 2OOFA 1Q65A 4HNUA 5LIYX 4DELA 3EOOA 3G0SA 3ZVHA 2FTPA 4YL2A 3SBFA 4FNSA 1ZZMA 3M4HA 3V36A 1ODZA 3CM4A 3RO8A 4L80A 1O94A 3NQAA 2ZRYA 4ZSTA 1GTHA 3IUHA 4IP5A 3D5HA 3UCCA 4FO4A 4ERIA 1ZUAX 3WFAA 4UC5A 4ZOEA 2PF0A 2GWGA 3NPUA 4KMQA 3RYSA 2ANUA 1KFKA 1E0VA 3MZNA 4MKSA 2J8TA 4QIUA 1P6BA 2ALRA 3SW6A 1JNEA 2RAGA 4GZIA 1LROA 4NZ5A 4G2DA 3PZUA 2I57A 3LPOA 2OG9A 1TMQA 3TC7A 5E6ZA 1VFLA 3STEA 8RUCA 1PX4A 3VXGA 5C9WA 3QGKC 3CIXA 2BXVA 4LVBA 3VX1A 3MSGA 1TJ2A 3GC5A 1SM9A 4JTIA 1TPC1 2E3ZA 1M6JA 4P7NA 4ICMA 2WM1A 3L66A 2EG6A 3VX0A 4RX0A 3WEOA 6CGTA 4PTDA 2V5BA 3MCOA 1A4LA 2V9DA 3MHUA 1NAL1 4H8VA 6PTDA 3NZGA 1ZNNA 3LUTA 1WZMA 5CZ0A 1XJBA 3FN9A 3WENA 2XIOA 4E2BA 1JUBA 1XD1A 1XLDA 3SQSA 2ATMA 2ZX6A 3II1A 4UTFA 2FZ9A 1NJJA 1IEXA 5BXPA 4OBSA 2WOQA 1LT7A 4IL0A 1D2KA 4W89A 3QFWA 1OC6A 5DMYA 5M3WA 4BKNA 2E5BA 3W3OA 4AIBA 2YBUA 1GJWA 1H7RA 2D20A 1WNOA 2Z1SA 4YHEA 3A6OA 2BMBA 1VD6A 1W9DM 2QUNA 3CASA 4A22A 2OU4A 1J79A 1N8IA 1NWTA 3ATZA 2GVYA 4DO5A 4CVUA 1V3JA 1UH2A 4C7FA 5AFDA 4AG0A 3GO2A 1TCDA 3ZWTA 2D24A 5FKYA 4RV8A 2NUYA 1PEZA 4A3RA 4YS1A 2I16A 2QNEA 3BZJA 4P7OA 3C6CA 2QQ6A 3VM5A 1JUKA 3ARWA 2GQ9A 3WYZA 3EKZA 1OF8A 2C8NA 2Y5SA 4YLWA 1J0ZA 4HU4A 1WB0A 2HVOA 2XIIA 4GYPC 3OTRA 3DDMA 3VGFA 4ZFMA 4RXFA 4A3UA 1KFCA 1KCXA 3CAKA 1YXCA 4H9TA 1F7BA 1H7XA 1FCVA 2C13A 3A4AA 1Q3NA 2XVKA 3TWBA 4RLIA 3RN6A 3UFYA 2V8ZA 3ALFA 3N2XA 3GR8A 4S3DA 4OECA 1I4NA 3GU2A 3TLLA 2D22A 3G1YA 2WSRA 1V03A 1PE1A 1XGEA 1XLAA 2AL2A 2ZTKA 1JPDX 3QPEA 5BOFA 1TPFA 4RNFA 3UCQA 4A2SA 2JKAA 2F2KA 1XF0A 3Q65A 4C6KA 2CLPA 3M41A 4IGSA 2DT3A 2BGQA 4HNVA 1R5YA 4TIMA 4M56A 1KBJA 1IEQA 3LXAA 2PB1A 1S5WA 2VVNA 3BLLA 5AHEA 4ZXOA 1UH3A 1O60A 1SMAA 1HKJA 1UQZA 4HSNA 2NQLA 2PRMA 2PWVA 4H4IA 3LHZA 1OFAA 4DO4A 1EZWA 3SUUA 1RHCA 3UCDA 2PAJA 4GX8A 2E1DA 2G41A 5DELA 4KEUA 3M7WA 1GYMA 4KIRA 3REQB 4ZMGA 2FIQA 4ZE5A 2UY4A 3DI0A 2E5CA 1EJVC 2E8ZA 3EOEA 1JGIA 2FMOA 2VC9A 2GFTA 2BVDA 1PAMA 1XXXA 1AFSA 2WC7A 3M43A 1P7TA 3V1PA 2FPTA 2PPGA 1CDGA 3OODA 2WHLA 4HNOA 1EBGA 1AH0A 5T9CE 3W75A 3OLEA 2WCSA 3P82A 1UR0A 1TWWA 4US6A 2HVNA 2CC0A 3N34A 4KT2A 1W8SA 1B54A 5KTLA 4WCJA 2XISA 4DHGA 1GG1A 3QR1A 2QMJA 4J9JA 3WJYA 3MU7A 1ESWA 4BQ4A 3KLLA 3UP8A 2EPLX 1TWIA 3PAJA 4O19A 4O0ZA 4TOQA 3J7HA 3TW6A 4B3KA 1IT8A 3EA3A 4UQAA 3B0UX 2W62A 4H6KA 2Q02A 4UTTA 2PFHA 5EFFA 4WDUA 3DIPA 4XZNX 3VIGA 3VU2A 2VO5A 4M6UA 4YPJA 1QUMA 4ICNA 1R2SA 4Z2JA 4C6CA 1GPFA 4CCEA 3HBLA 2W27A 2WPGA 1QDSA 5M5DA 4B4FA 3MP5A 4RK8A 2PZNA 3Q58A 3RLUA 4I7UA 3TQVA 4Z0JA 1KW1A 2L5HA 4QAWA 4AEFA 1XDJA 1DP0A 3WY1A 4IMDA 3VILA 3O6CA 3H2NA 4BEQA 4BWLA 1RJRA 1JG9A 3KEHA 4N9DA 4RUBA 4HMEA 4WF7A 3SN1A 3NYZA 2VQTA 1MQRA 5AYXA 3VCRA 3QR3A 1AZ2A 1JVNA 4XVEA 4ES4A 1ME7A 2CWXA 1M7JA 1OCNA 4NKCA 5D9PA 1MFVA 4WJEA 5BWFA 3QY6A 2PDXA 4BS0A 3W37A 2JBMA 1BLIA 5GNYA 1AW1A 1Q2SA 1DIDA 3SFWA 3CZEA 3LENA 4MYXA 4POCA 3GXNA 5IDZA 4ZBCA 3PNUA 5HNTA 3G6LA 1XYCA 2WSPA 4DBDA 4AEOA 3E0IA 2XSAA 5FA5A 1J2WA 4GC4A 4DWSA 4IQJA 2W92A 4D6CA 4D72A 3LCWA 5E70A 2PD9A 1H49A 1XL9A 2X09A 5A8OA 5HATA 3QFEA 3GX9A 1FFQA 2NLIA 2FHBA 2QJMA 3TA6A 3GVRA 3WK3A 3HPZA 4MB1A 4ACZA 2XN1A 4CGTA 4WGXA 1JQVA 3W9ZA 2PDCA 2ISDA 1IXPA 4KS0A 2VGBA 3H8AA 3QR0A 5BROA 3NYDA 3WKZA 4FXRA 1FWFC 1HX0A 2XM1A 3HOJA 1D8WA 3PM6A 3QTGA 3P93A 1OX4A 2QDHA 3B4UA 1ADDA 1QOXA 4LJ3A 2OKOA 4XX6A 4DF0A 4C7GA 4R5EA 1ZTVA 4JL1A 4FK9A 3GRIA 1TIMA 1LF1A 1LL6A 4JQ1A 2BDQA 3E0VA 4N7QA 2QAFA 3EGJA 3QZEA 4GI9A 1F8MA 5J5DA 4JQAA 2YL6A 2VDGA 2VCBA 1Q5MA 5I2UA 3CZJA 2ZIDA 1R0MA 3UEQA 4GGHA 1WXZA 5DFAA 3B0PA 4HNCA 2BGNE 4MM1A 1EEXA 2ZUNA 4UMAA 2YXXA 3M16A 2Y7DA 4Y96A 3WNNA 1BYCA 2R1NA 4WDTA 4WJ8A 3UA3A 5HMSA 7CGTA 4FIRA 2DIJA 4U5IA 3HM7A 5A95A 1AG1O 4ADSA 2VRQA 2G5WA 1BFNA 4Z1DA 4BI5A 1TCMA 4TO8A 1OFRA 1XRFA 4EF9A 3MI3A 4QS6A 3BOLA 4AMCA 3N13A 4TU1A 1C90A 1PIIA 2E77A 2VZOA 5CG7A 4TVUA 3BAWA 2WNWA 3MT1A 5I23A 4R27A 3VDBA 1DTUA 1EL3A 2QVNA 4OV4A 3C2RA 1TV5A 1ICQA 2DZUA 2DW7A 1UIOA 2Z1XA 4QJ3B 1V7YA 5CBBA 1MUMA 2BGSA 3MYOA 4GH1A 3ARQA 4C5ZA 4A05A 4GI4A 1B30A 2GK1B 4DEFA 2VNCA 4J35A 5JMUA 4BQ2A 1EJRC 4QXIA 1B2YA 5DLCA 1QHOA 2QCHA 3WJWA 3RMEA 1KGWA 4KPLA 1KR1A 3HGSA 4W7UA 3WN6A 3FX4A 2YA0A 3GAKA 4V2XA 2FZNA 2WJDA 3UF9A 2XH4A 2YA1A 1JD9A 1KCKA 1WAWA 4RDYA 3WLOA 1DWGM 4WOZA 2Y61A 1BSIA 4B5UA 3A9BA 3I6EA 4IL2A 2CZ5A 2XUCA 3MUIA 4WXZA 1EC8A 1JL8A 4ORMA 3A4WA 4Y9OA 2W61A 3IANA 1XPGA 2DEPA 1BRLA 3CIVA 2EO7A 4RDVA 1TR9A 3DEQA 4PFHA 1R3WA 3SM0A 3U57A 2XSXA 1GCYA 1QI4A 2FZDA 1XGDA 3SCSA 4IX0A 4F0RA 2IKHA 4OE7A 1B9BA 3MB9A 3EWBX 1J0IA 1OABA 1XSJA 3R58A 3AMKA 3W28A 3ABSA 5HDRA 1VFFA 4MB5A 5CEWA 5IFPA 1EHAA 1TMHA 1GZGA 4JTCA 2IXVA 1HKMA 3DYOA 4R85A 3WF4A 5F7UA 4GRSA 4JICA 3E74A 3STFA 3NQ6A 4Q8OA 4A35A 5KZMA 5LXEA 4F4RA 3OBKA 2DSWA 1F3EA 2ZUSA 1UP2A 2J8GA 1XLLA 4DLMA 1RAKA 3L65A 4PB5A 1UBPC 3ZJ7A 2DSKA 4EKJA 3R0UA 3KE0A 4NNCA 2XVPA 1ZENA 1H4PA 3ECQA 2VFGA 4UTWA 1QCWA 4LUYA 5FEWA 2WMKA 6REQB 3WH6A 2HK0A 5GJMA 3O63A 1TELA 4D9PA 3ERPA 3CU2A 2PLJA 3NQ8A 4OJYA 1FWSA 1TTIA 3R11A 3HGJA 3WDIA 3EA1A 4A6GA 1XIEA 1ZBKA 4GE8A 2ZC1A 1R2TA 1W37A 4JX6A 4HTYA 2FH8A 1NWSA 2VJXA 3S46A 1BG9A 3MSRA 4PCFA 1H1ZA 5M1TA 1E9ZB 1RQEA 5EA9A 3LBOA 3MJMA 3UBPC 4V27A 4CCCA 2OELA 3BCFA 4NG3A 1JAKA 5ABEA 4EK7A 4E6MA 2W3ZA 2R1MA 1TPH1 3G6MA 2BG5A 2YCEA 4KWVA 1SO6A 2QJNA 2J9YA 3KRSA 4PRRA 3KS5A 3KZPA 3N4AA 2Z00A 4WSKA 2Y8UA 3BMVA 4X60A 1C7SA 4UWMA 3N9KA 2FHFA 4G5DA 4JDBA 4A8NA 1FUYA 4L65A 1ZP3A 3BQ6A 3M44A 2OZ3A 1W1A1 1FHLA 4O4VA 4J3ZA 1S2CA 2IPGA 3ITTA 4ZTXA 4MY8A 2WBKA 2E5DA 4PL2A 4ZR8A 3GDLA 5K2ZA 2NVDA 1S2VA 3QXBA 1NTHA 4NZ3A 3R0DA 1UBSA 1E71M 4IZGA 5GVJA 4YJ5A 4P7QA 3S83A 3WQWA 3V75A 4CU6A 1VEOA 2EJ1A 2AKMA 9XIAA 5IM51 1UWAA 5G4HC 2NQ5A 3ITLA 3L4UA 5D2TA 5K9XA 3ANYA 5BYWA 4DY1A 5CZTA 4CNPA 4TX6A 2FB2A 4WDWA 2GJXB 1FCQA 1X7FA 4XZBA 1CXKA 3G1HA 4XD3A 2OSYA 3VD9A 5CH9A 3VFLA 1REQA 3HG3A 3ISIX 1BF6A 2H3BA 1FWEC 1KM4A 1A3WA 2WLYA 4LT9A 4CU8A 2DIKA 3SRKA 2VC5A 3EDEA 3N2OA 4B5WA 3MKCA 2OPJA 3WBYA 5C71A 1VJZA 3B97A 3WDHA 1YLVA 1JCNA 2PTDA 1Z89A 1A0DA 3TV8A 2EKGA 2ZWZA 2VT0A 1SPQA 4Q8UA 4I8YA 3IACA 1EBHA 3VA8A 4Q22A 1E56A 1X6LA 1DE6A 4CN6A 5I5RA 4CCDA 3CPGA 1NH6A 1CGWA 2AKZA 3B05A 3CWHA 4QTGA 3BLEA 1V6UA 5BZAA 4S39A 3KAOA 3VABA 2O7SA 4DJEA 4F2TA 4DBUA 1H62A 1KLZA 1UKSA 2VQUA 1M04A 3O7UA 4GINA 3AWNA 2ISWA 1PBGA 1A4MA 3LYEA 5F4WA 3QSRA 4L4LA 4OZOA 4FX8A 4L61A 4N4QA 4ADTA 1FHVA 1KRBC 3NIYA 3WQ5A 5AHNA 4JQ4A 3GXPA 4L1GA 1K4HA 4RNIA 2C15A 4PMVA 2ZE3A 4R33A 3NL6A 4H2CA 2FTYA 4WUIA 4XUYA 3DGRA 4IIGA 3FSTA 2E8YA 3CYVA 4FXSA 2V69A 1PS9A 1E72M 4IXXA 1VGAA 3W0KA 4NI8A 5HWNA 3PZOA 5FJIA 2V3GA 5ECVA 5FL1A 1KRAC 2J9XA 4LF2A 5ABGA 4TX9A 3ME3A 2YX0A 1C8QA 1J11A 3CHDA 2WMGA 2ZRVA 3GNOA 4HZ7A 3ARPA 2DDXA 2VUYA 4HJFA 4I7WA 5G1MA 1UUQA 3TAKA 3WH5A 4JNYA 2G0WA 3KVJA 3TSMA 4QM1A 4W8BA 3R7MA 4O1FA 2J4GA 3VUPA 8XIMA 4WZHA 3LRLA 2QV4A 4O57A 5DY2A 4GCAA 2PDKA 3FA4A 4X0NA 2X1IA 4IIBA 1U22A 5FESA 3APTA 3MMTA 1EX1A 3GW0A 3WEZA 2YDAA 2ZZ1A 4U31A 3O0FA 1OHLA 1SFSA 4J27A 4NJGA 3MHFA 4R7WA 5A6TC 1RVGA 4L6OA 3U4FA 1JPIA 1A47A 4LVGA 4YCOA 3EDDA 2D3NA 1G01A 3NQMA 3NOEA 1JYVA 1XD0A 3BAXA 1BAGA 2VFHA 3LS9A 3W6YA 4Y8FA 4YTSA 1LOLA 4S3CA 2HMCA 1MW2A 1RCQA 1NIUA 4C1LA 3KLKA 1TJPA 3EPMA 4KCVA 2TRSA 3ZR4A 2A3EA 2IMRA 1XDMA 3UXAA 1H1YA 1ZJHA 3TSDA 1EC9A 1PL9A 1G4TA 1JDCA 3GHTA 4J3TA 1WBJA 4LAMA 1MXSA 2CNCA 4CNTA 4EPBC 2B7QA 4GCXA 2I5GA 1E6PA 1FWDC 1TPDA 5JBFA 3SCUA 3FFSA 4L1WA 2QXWA 3BL3A 1S2WA 4IF2A 1TQXA 4DWSD 3THCA 3NZPA 3N73A 5TF0A 2XFWA 5AHFA 3CQIA 5T9BG 3AC0A 1Y5XA 1NF0A 4GK8A 5DY3A 1Y5WA 2WKJA 3WLLA 3DC0A 1P1XA 5BMWA 1E6RA 2PDWA 3QQ0A 4GUIA 4XWUA 1MRAA 3DXIA 4EANA 2V0TA 3MUZ1 3THUA 2TMDA 3ZYZA 1X6NA 5FOOA 4K36A 2WMIA 4JIEA 3CMGA 2WJEA 1W5QA 6TIMA 5D8WA 2BY3A 4C1NB 1MEIA 3EX3A 2QPSA 2BHUA 3CHVA 3RRXA 3AU2A 4E8CA 4TUFA 2CLFA 4AWSA 2VVSA 2EGZA 4H00A 1T8QA 1QHZA 4H3DA 3NQFA 4GBDA 4UNKA 2PDFA 1L8PA 2FVLA 2GOKA 3MI6A 1HVQA 1Z69A 1UD6A 3OQ8A 5U7SA 1FWTA 3QGAC 1DORA 1TWDA 2J66A 2H6RA 3DBNA 5DMNA 1Q6DA 2E1WA 4EP8C 1NY1A 3H7UA 1WOBA 1BYDA 4AC1X 4IUOA 2O9RA 1WBHA 1HJVA 4CD4A 3MUCA 3F5LA 5TD4A 4AD5A 3QPYA 5LIWX 5G4WA 2PODA 3TIMA 4U28A 4MWAB 1LORA 5H8UA 3P0XA 4LXFA 3WQEA 1DJHA 3KOXA 4FNPA 4AVOA 4KRUA 4C6DA 1BYBA 1A5UA 3L9CA 3K2GA 3UZYA 4JZ5A 1FXQA 2QPXA 2PTZA 4H9UA 3P0WA 3T9PA 2DSZA 3SGGA 2HXTA 1MRQA 3D46A 1Z32X 2PDBA 4U4MA 1R3RA 2Y0FA 3KDOA 1IZCA 3M0IA 2HTMA 1XIBA 1GUVA 1TJRA 1UP3A 1EP3A 2X1RA 3WK2A 1X1ZA 5F4SA 8CGTA 2YXOA 3OIXA 1YDNA 5K4XA 4Z2GA 2PP0A 1QK0A 2V67A 2PLKA 2W5FA 5FF7A 3FA5A 3W7LA 7REQA 3LHWA 4Q6XA 2WVSA 1QR7A 1XBVA 1EQPA 3LTPA 2G3JA 2OO6A 5EBAA 2V3FA 3SN4A 4PUNA 2I9EA 2QCFA 1IQ8A 2NLYA 1YE6A 3BGGA 1V3KA 5CSYA 1UC4A 4A3QA 4LUSB 3AHYA 2VEPA 4H9ZA 5T26A 1R38A 4QHRA 3PBWA 1EGMA 4NAFA 3A3HA 3DFHA 2I5QA 1C93A 4B15A 4O53A 1MO0A 2YIHA 3OVPA 3WIJA 2BX7A 4UTMA 4F0LA 2FFIA 4IQLA 3CYJA 2QS8A 3AHVA 3GHRA 1I2OA 5PTDA 1E6ZA 2QGHA 4YNGA 1JCXA 4GG9A 3HV8A 3ARUA 5F2LA 3O05A 4PCSA 5CC5A 3CLMA 5MHBA 3KTCA 1E40A 2LLEA 4QX4A 3R94A 2WZIA 2Z26A 4GX9A 2BOGX 3GE7A 4TR9A 1E3XA 5L6UA 4S3EA 3OEXA 2A7PA 4NF7A 1MW3A 3N1AA 4DPPA 4PMNA 4E8DA 1HJWA 2Q3RA 2IS7A 3T0CA 4IJBA 1OC7A 4CD8A 1RA5A 3B3DA 5IOBA 3AIWA 2UV8G 4ICCX 4U2YA 3IGUA 4DAFA 1GW9A 4H01A 3O0KA 3NSXA 2NQ9A 1P0DA 1TFVA 2X1TA 3PBMA 1E0TA 1VCVA 4QG8A 1JCLA 3PTMA 5G1YA 1VENA 1IV8A 2WMHA 3Q94A 4J3SA 1ECQA 1VBUA 3KBJA 3G77A 1CEOA 1HKKA 2OWXA 2EF9A 1Q6GA 1JZ5A 1W3HA 1XYZA 4KKXA 2V6AA 2Z24A 1XCFA 4H8NA 1JPKA 3VOFA 1UWSA 5LNUA 3MV11 3AU6A 1KV8A 3I7RA 3A9IA 3IIVA 3FIGA 3TN4A 4M29A 5DCDA 2VR4A 3CUJA 4RE4A 3UZZA 1ZAIA 4O54A 4WIWA 3DENA 4CU7A 4CEUC 1XG4A 3BCDA 4JCMA 3K1DA 1J0KA 2WB5A 3BO9A 5I3HA 7TAAA 5D9NA 1MXGA 2FJUB 4QP0A 3SUTA 2J9ZA 4QLJA 2Y4SA 4AY1A 5C9UA 4TVCA 1XI3A 3H2AA 3W2MA 3HJZA 3LY0A 2PUZA 3VOHA 5EY5A 1SJDA 4DWSC 4HSOA 4BF9A 3GNNA 3GU1A 3NO5A 1K9EA 3NNTA 2WZTA 3R1ZA 1A0CA 2FFCA 3WMCA 3DGBA 3ZS4A 4JQ2A 1H3GA 4GY7A 4XD6A 5E5CA 4G9PA 1HG3A 2VXNA 3AI0A 2VKZG 2ALDA 3PZTA 3VI2A 1LQ2A 5FCZA 4BQ3A 2HISA 1GZJA 1RK5A 1CCWB 4HZ8A 3CHEA 3ARYA 3PWIA 1H11A 2GSEA 5JUVA 1MI3A 4DN1A 3SB0A 3UPWA 2WWDA 3VIIA 4JIHA 4C91A 5H6HA 4QQ3A 4GQRA 5AVNA 3BSHA 2WVTA 2WK2A 3CK5A 5A2CA 5A6AA 3ITOA 5A3HA 3WBEA 3ATYA 1E9IA 2UY5A 4O17A 1AUSL 1NQKA 1KWGA 4ATLA 3VNLA 1RALA 1F73A 5KZ6A 1JF5A 1KFLA 3DFOA 2SFPA 4HA3A 4HOZA 4K6AA 1KBBA 2GJLA 2IKGA 4XZWA 4M7SA 5D33A 5CC7A 3EX1A 1PX3A 2J25A 4LWWA 2OT0A 1GPWA 1SSGA 1T41A 2D2JA 3W6MA 1SO5A 3VKAA 3F4WA 4K8EA 2TAAA 4JYDA 3S5OA 4DLFA 3S1GA 1R7AA 3U3HA 4JHOA 1ME8A 1XSKA 3E38A 5TNVA 3L2MA 4JTRA 5HR6A 2QV5A 4D8LA 3MMWA 1JDAA 4WLCA 3GM8A 3W25A 3S47A 2PTXA 2QLYA 4MLRA 2PWDA 5K9DA 2QEZA 3OG3A 2XN0A 2VHLA 3KOZA 4FF7A 3U5UA 4J3VA 2PGWA 1GVFA 2FZMA 2CCRA 3CL7A 5MKGA 2YCLB 4Q8TA 1UH4A 4YVXA 1YBQB 4XK2A 1CWYA 3QW4B 3UY8A 5BU6A 1XCWA 1EFZA 5D03A 1RCOB 2X40A 4C6PA 4MWAA 1EXPA 1GJPA 4JTGA 2WANA 3U48A 1JCMP 2ZZ5A 1SJAA 1W1IE 5FF3A 2WW5A 3K46A 4GO8A 2QGYA 3WBXA 4JTSA 2ZDRA 4GI8A 4DJED 1FWGC 4PCTA 3R5EA 1SSDA 3K30A 1JZ3A 4Q7IA 1LLZA 2CZFA 4AIUA 3ES8A 2EJAA 4PCNA 3NO3A 1Z48A 1TTJA 4KCUA 3P61A 1Y0EA 3RHGA 1E6QM 1GWJA 4DBEA 4WY0F 4Z1BA 3U4AA 1KFWA 1W1PA 3L4ZA 4LUTB 1TX2A 4W9TA 3ABQA 4L4OA 3E2VA 1S5MA 1BHGA 4PMUA 2WVVA 2XFRA 2XHYA 4G7EA 4AHPA 2FB3A 5CCZA 3WJZA 1TQJA 2ZUMA 1K6AA 4C6IA 3WJXA 3SN0A 3S2LA 2E6AA 4FI4A 4YXGA 2QAPA 2J13A 4IMGA 4Q4PA 2XG9A 2PP1A 3CQKA 3NPVA 4REQB 2BHZA 1DQXA 4C6LA 4FF5A 3CNYA 4ZZ9A 3W4RA 4O0KA 3GIQA 1OQFA 4FS9A 1IZKA 3W2KA 1UKQA 4O15A 3UG5A 3W27A 3WQ6A 5H2ZA 1XX1A 1L2QA 2E4TA 3MWAA 3UY7A 5DRCA 1EQCA 1PTGA 1N7KA 4CVWA 2E28A 4WKFA 2O4MA 4HVXA 3CHCA 3RLVA 2QDDA 2NXHA 4QEEA 3K5XA 3F4VA 2Z28A 3B0YA 4DXXA 1JRCA 4GWEA 4QCFA 3KRUA 1AQHA 4QROA 1FWRA 3CV1A 3TXZA 1ADSA 3UD6A 3EOUA 1B9ZA 3G1RA 2CKRA 1DWAM 4C6OA 3GDKA 3W22A 4OUEA 4A3HA 4H7ZA 3Q67A 4XAPA 2W4XA 1I0DA 3SCTA 3GH5A 3W7JA 1XLJA 4HQVA 1K70A 1NARA 3FDKA 4PUMA 2GGHA 1PKMA 1SJBA 3G1FA 5HQLA 2OYKA 4OFCA 4QJ5B 3AWOA 4O1BA 4GGBA 3L4YA 2WKLA 4P2VA 4JNZA 3UESA 4CN1A 5A6BA 1E0XA 1HJQA 2AQOA 3LMYA 3HF3A 1H41A 4IIFA 1RLCL 1S39A 2DY3A 1IXNA 3MCMA 2X1UA 3OOQA 4UTHA 3PR2A 3M9YA 2X16A 5I03A 3AO0A 1JDEA 2WNZA 4P8UA 4DJDA 1FWAC 3F7JA 1C91A 3TU9A 1YDYA 2A79A 3W7RA 3HN3A 4TV6A 2XDFA 1TVLA 4GZEA 3VVGA 2QPUA 3AXMA 4WX2A 5C54A 4B9YA 3S6OA 4GBUA 4J3UA 4P8VA 1CT5A 4LAUA 3TOPA 5BNKA 1OVDA 1WXJA 1K8XA 4LOCA 1W1ZA 3BTNA 4UTKA 3QV8A 3CEPA 2FPVA 2A6LA 4NXKA 1RVKA 4PMZA 3W01A 1F6YA 2NV9A 1HT6A 4LNCA 5D02A 5BRQA 3UZXA 4AD1A 3KM8A 3AISA 1L6GA 3WDRA 1HKIA 1FA2A 5CLWA 3N25A 1HGWA 5EBUA 3ZT5A 1UOKA 4MJ4A 1Q6LA 4UNLA 4RE2A 1RD6A 4W5UA 3PWAA 2CWNA 4DZHA 2YB1A 4N42A 3P81A 3GBEA 5ABFA 4JHZA 5CZSA 1V77A 3KL5A 1OGSA 2OLAA 1WKEA 4ZEPA 4XAYA 3DKJA 2VELA 3TYBA 4B5NA 1NOWA 3LBCA 4KCTA 3SCNA 4FLOA 4WDXA 1A5OC 1XYBA 4HZMA 3EWCA 3M5ZA 5GPRA 2XGBA 3KX6A 3AS2A 1CBGA 2EXOA 5LNSA 1CECA 4M1BA 4C1KA 2QF8A 1W32A 4GUFA 1JFHA 3FOKA 3CS2A 4KH2A 4UFHA 4GPNA 3SCRA 4EE9A 2GDUA 1W5PA 5FJTA 4NL1A 4FZIA 1NM9A 3BMWA 4GKLA 3WO8A 1O4UA 4QE1A 3WD2A 2HVMA 3UXDA 3VKKA 3HPAA 3ITGA 1J0HA 1FXPA 2XIBA 4QS5A 3LCXA 4ZO6A 1IWBA 2GSHA 3AZTA 1CXHA 3VMNA 3T2OA 4FB7A 2OCZA 4HU3A 3RM8A 1KRCC 3OGVA 3T08A 1MVYA 2QCMA 4DJEC 3AYVA 2FMNA 1FCBA 3JUGA 3G22A 1WQ5A 3TWAA 4I5RA 1N55A 2GDQA 4RPQA 3BLOA 1Q7QA 2C19A 4XZHA 4K37A 3QZ6A 4X9SA 3PC0A 2YCLA 4Y90A 1BVNP 3C56A 5HBFA 1V5XA 3M0JA 2GVJA 1W1VA 5I6SA 1GHSA 1W6TA 3NQ7A 3BG9A 4HOXA 1F3TA 5F1VA 1ZJIA 3IJDA 5D2WA 2QIIA 3M0HA 2FTWA 5B7YA 1WO2A 3VNYA 3SFKA 4G6CA 3OG2A 3UJFA 2WC3A 4NX5A 2R8WA 2DIEA 3KVKA 4YVVA 4Z1AA 4JNMA 2XTKA 3W2LA 4QG9A 3GVWA 3TE9A 1Z6KA 4Q33A 1XLMA 2WQPA 5HPCA 2EBNA 3OA3A 1EXBA 2VUNA 5KETA 2PDPA 4AWTA 3ITVA 2B0MA 1RD5A 2YFOA 3V0UA 4A29A 2OGJA 1LM1A 1XWYA 3UZJA 3DAQA 1XLCA 2I1OA 1E4LA 5EKYA 3BK0A 1P43A 4LV4A 4GKTA 3UR2A 4QJ4B 4LUTA 2GDVA 1GQIA 3GB6A 1L6FA 4IFKB 2H90A 3D3AA 3SR7A 4IPIA 4CN4A 4P7LA 4PULA 3RITA 1JYXA 3K8MA 3GLCA 2Z2UA 5CPSA 5AY7A 2D0GA 5H1WA 1EC7A 1BGGA 3KRBA 4RNJA 4REQA 4GVFA 4WRHA 2C7FA 4LC8A 2B7OA 2XVNA 3O07A 3L5AA 2D0FA 2VD9A 2CHNA 1ZBWA 3KVMA 4QE4A 5AZ1A 2YCJA 4NNAA 3URAA 3R6IA 3CT7A 4O11A 1E51A 2YFNA 4LSBA 4YYFA 3B03A 3PF3A 1F6PA 3G8RA 1IIGA 4IMFA 2WZHA 5LGXA 3T2QA 2VZUA 1E4MM 1W2PA 2VP8A 2ZUWA 2I14A 1W8GA 5HNUA 3FYPA 3PPFA 2PBOA 5AECA 1TZ7A 3QKEA 4AWUA 2CITA 1SZNA 1OADA 2VRKA 1LYXA 1TTPA 3AXXA 3VIFA 2R91A 3NL3A 3T42A 2D0HA 4GA8A 4R7OA 2PDNA 1HL9A 1OFBA 2W66A 3OGRA 3VGGA 3LERA 1JJKA 1JIBA 4LY4A 1LBFA 3FEMA 1XBYA 1RV8A 3M6DA 3TYAA 4HYWA 1KLYA 3T05A 1AH3A 1VBHA 3UWZA 3R2GA 1E0UA 3VNDA 3KTXA 4RL3A 4K2SA 2PTWA 1UCWA 4UCGA 3VO0A 5D05A 4AD2A 3O9NA 2Y7GA 4Q8MA 4HPJA 1GEQA 2ZOXA 5HXMA 4IMAA 3CWOX 4XD5A 3AICA 4LY8A 1XC4A 4PBFA 1OT1A 1OYCA 1YQ2A 2CBVA 6A3HA 1W54A 3C86A 5I09A 4GIYA 1H7PA 1XDLA 5G2HA 4WOQA 2A3AA 3W7QA 3LI0A 4CQCA 2DVUA 1I6NA 1QPQA 1K6WA 4OHQA 3CB3A 4QGCA 4LPCA 6XIAA 4PN2A 2OQHA 1E1CA 3B04A 3PFRA 2GQAA 1EGZA 1GKPA 1UB3A 3T78A 1GK8A 4P7RA 1XQLA 4NQ1A 5T91A 4HK6A 2YSWA 1H2JA 2DZVA 3VCNA 3GUWA 1T99A 1VFTA 2PC8A 4IFOA 1XSIA 2ZBTA 1RK6A 3WQCA 1CX9A 3P6LA 3QOMA 1DL3A 4KWSA 2A7RA 4A8LA 2EG7A 4X9YA 1DWFM 2PGRA 4D2JA 2WJZA 4KW2A 3BE7A 4S3AA 1WKDA 2IPFA 4OBTA 4C6BA 4LVDA 4W5ZA 1H60A 5CZJA 4IIEA 2EEXA 2VENA 3FK4A 4XV0A 5LSMA 3QC0A 3APGA 1L0PA 1VCFA 1WZKA 1W3KA 1V6WA 4A8RA 3TC3A 3CV7A 1RA0A 1KBKA 3A5FA 2DJXA 3CH0A 2DZSA 1TRIA 3LLFA 4S38A 5E0CA 1R87A 1XIHA 4AXNA 3BANA 2YW3A 1J5TA 3B40A 3L5MA 1LG1A 3URQA 4N6FA 4O10A 1QFEA 3HPFA 2F2HA 3V18A 2J7EA 1MSSA 4DNHA 3W7EA 5A8GA 1VH7A 4QEHA 2G4JA 1O1HA 2PI6A 2AAMA 1Z41A 1BWLA 1F3WA 3GTNA 4W8LA 3E2QA 4YU1A 4MWAD 1VFHA 2Q3OA 4Z0SA 1GG0A 2RUSA 1UMYA 1GNXA 3O3RA 1W9BM 4IH3A 5D04C 5BU9A 5ABHA 3PBGA 4HHLA 3BQ5A 5DXYA 1ITQA 5KEZA 3EKGA 4UQEA 3ZVHB 2Q8LA 3WLSA 1V02E 1WV2A 2CXGA 3VNKA 3LOTA 3MO7A 2HNEA 4D6HA 3ZIZA 3K8LA 4KWOA 4GYFA 2GGGA 2FVMA 4PE8A 4E4FA 1W17A 3KVLA 2DVXA 4O13A 1DWIM 1XW8A 4FNUA 1K02A 1QNRA 1PYMA 2GGIA 1TV4A 1EP2A 4HKPA 2A5HA 4M80A 3E12A 1C9WA 3GC2A 4IMEA 3T0DA 4PSRA 2ZA2A 3WLTA 2ZUVA 5FEPA 2HQAA 3NZQA 1OEPA 3RNDA 2HS8A 5C9RA 1T7LA 1VIZA 5E09A 4CQBA 3CAQA 2RDXA 1PCWA 2J7GA 3KHDA 4UBPC 1TUFA 3W7MA 1XHGA 3WQPA 3ABRA 3T81A 1J0JA 2Z6IA 1PPIA 4X0VA 2RDTA 1XUZA 2IPJA 3USBA 1ONWA 5DXXA 3PP7A 1XLEA 1IXOA 3EMZA 5IBXA 1OBAA 1UD5A 1OIFA 1FH9A 4ZFCA 1EH9A 1S5NA 3EWDA 4DUXA 3TTYA 2VX4A 3CQ0A 1VYRA 4DYKA 5E9XA 4N0RA 3L4VA 5EMUA 3U2ZA 4IPNB 7XIMA 1BD0A 4GC3A 4GQQA 2VEMA 3H54A 3VE9A 1GVSA 2ZDSA 3A47A 3SCPA 1GW1A 2P1FA 3DKLA 2NQZA 3DUGA 1DKWA 3N6QA 4FLSA 3B8TA 2XIQA 4GUJA 2PC4A 3K8KA 2HK1A 4IFKA 4XQ6A 3P60A 3T55A 3D3FA 3UG8A 3ABZA 2A1YA 5B80A 3SRDA 1ONEA 3H26A 3VIMA 4Y9AA 3TC6A 1IEIA 3R25A 3RMJA 3BJFA 4XIMA 5AN7A 4MKVA 1DJIA 1HN1A 3LGEA 5AC8A 5DMMA 2FDMA 1KFJA 4Y2WA 2ICSA 1UKOA 2XSBA 2J7DA 1RLDA 3M7SA 2DPEA 5HPOA 1XINA 1U33A 1MWOA 6ENLA 4UR7A 3V1HA 3S2NA 1J6OA 3VZYA 3BW3A 3OGSA 1UOZA 1ZCOA 1OK6A 1J93A 2ZZ4A 5DT7A 3TCEA 5A6BD 4XKYA 2DUAA 2J74A 1ZQ5A 2YKKA 2BLEA 3LXCA 4JN6A 4QE5A 4L4PA 2RH9A 3IJLA 1QNSA 4D6EA 3XINA 4I8DA 5KZDA 3W7OA 4AVNA 3RR1A 4ZB5A 4JIRA 3CAVA 2BFGA 2RDWA 4JKKA 3I4KA 1ZJAA 4MNLA 4DJDD 4FXJA 4WGHA 4Z1CA 3INPA 2ODOA 3LLXA 1JYWA 3HA1A 3OYZA 4LFYA 3KBNA 3LHTA 4XBKA 3WQ4A 3VZZA 1E4IA 2VOMA 4CLMA 2VM8A 2OLSA 3W1AA 3H2EA 3PUGA 5JIWA 5CPLA 4WHBA 2AGKA 1BPLB 5AZ0A 2DJLA 1VAHA 5CJMA 1E3ZA 3VNJA 4Y7EA 2Z7GA 1PZ0A 2ZX9A 3S9YA 4X63A 4B5TA 2Y63A 2AL2B 3C0QA 4WSJA 1XS2A 1UR8A 1B3XA 2JE8A 4JHMA 2OWCA 5I24A 3OIHA 4CNOA 4G7FA 4DYJA 5CPTA 2YXGA 3E96A 1UPPA 2R1PA 4QSHA 5HQEA 1JAEA 2UZ9A 1XV8A 4DB7A 3UPMA 1LRNA 4O1DA 3QV6A 1CXFA 3W1RA 4HTBA 1NF7A 4K3ZA 3N3TA 4K1WA 1O5KA 3DFPA 5XINA 4CEXC 1IXQA 3KFTA 3U2EA 4S2BA 2WXDM 3S4TA 3GHUA 4P8WA 5D09A 4Q3MA 1L6WA 4BQ5A 3DYMA 3GU9A 4JN8A 3UNTA 2QUMA 2I9UA 3FCPA 2NZLA 2ZTJA 1ONXA 1QK2A 4GO9A 2DGAA 3NDZA 4GQGA 1P7TB 4GJIA 2ZVIA 3IPWA 4PB3A 3WQVA 4H9VA 1B3VA 2V5CA 1J12A 2OZ0A 2XWDA 3PUDA 2XFYA 4F0SA 1KO0A 4J1OA 3PY2A 4EX4A 2C71A 5DBTA 1FWJC 4M0XA 2NX1A 4ORIA 4DI8A 1VJIA 3DFYA 4DBSA 3CWNA 3G5EA 1SFLA 4HGXA 4W87A 4RKAA 3B9DA 4EPEC 3BVJA 4UR8A 4RZ4A 1XBZA 3BJSA 4L6DA 3IAQA 1QPOA 4MWAC 3SI9A 4US5A 3NUKA 1JCJA 5C55A 3F2DA 4MTVA 1VFOA 1HL8A 2ZFAA 3RCMA 2G97A 1KBIA 3C3UA 3RO6A 3E0LA 3AIVA 3EMQA 4Y9PA 3WK0A 1TPVA 4IG2A 4NZFA 4XIAA 2ZX8A 2FLIA 3CO4A 1BF2A 1OSEA 3H23A 3IARA 5A8QA 5BCAA 3L0KA 4DM1A 2PF8A 5FI8A 2QCNA 3O1NA 3ARZA 1XRSA 3UR8A 4Q4OA 2NUXA 4ZOAA 1KXTA 2R94A 5EGRA 2PGEA 2E7FA 1POJA 5E1QA 4IGHA 3IEBA 1UZ1A 3R8RA 3KZSA 4R3UA 1B3ZA 2PEVA 2BNJA 3EWXA 1W5MA 2IQ0A 3PPHA 4HCLA 3BLKA 3BW4A 3N12A 3RJXA 5A6MA 1LBMA 4LX4A 3PN8A 2EPNA 1DEDA 3CIWA 4YHGA 3GDTA 5HOSA 1RXOB 3RU6A 4HMDA 3AIUA 4E4PA 2C16A 3VOJA 3NSMA 3EEZA 1UD4A 2HWGA 2O9OA 1XIGA 2ZXQA 2V30A 1UWTA 1W9PA 4DWSB 1EGVA 3P62A 3V16A 3N2TA 3R12A 4H8UA 1DV7A 1VEPA 1EPVA 1QWGA 3SCOA 3TTQA 4XBSA 4GUHA 4KBXA 2WKGA 3V35A 4ACZB 1E5NA 1F6KA 2BHYA 3D0CA 3GY1A 4JTHA 3OU8A 3TSBA 1B4KA 3GTIA 1NWRA 2BTMA 1RY0A 1ZBVA 2XVLA 4L6HA 1YE4A 1XQKA 1NOUA 1AMYA 3PPGA 4JEJA 4Q7BA 3TZFA 2GGEA 1ZPTA 1WOAA 2WPBA 3U0HA 4FR6A 3W7HA 1OX4B 2JEPA 2GSJA 4V28A 3P80A 3GR4A 3UJ2A 4MB3A 2J78A 4KQNA 1XBXA 3QM3A 3BSMA 2PDIA 1CNVA 3QRHA 2D69A 3EX2A 5DRIA 1EJXC 9RUBA 1JDFA 2ADAA 2DORA 4EOUA 5TQLA 1C8YA 3MKKA 3AJXA 2ZX5A 1CB2A 3TH6A 4H41A 5HINA 1GOOA 2DZAA 4ZQRA 2P50A 1MXDA 2CW6A 3RU8X 1OC5A 5CC3A 3WDJA 3TNOA 4FP1A 2NVCA 4IPLA 2XH0A 4MY9A 2BBFA 3WUFA 3DOPA 3HFYA 1GVIA 2JQXA 1EF3A 4QAIA 3L68A 1TX0A 3HQOA 2PWGA 1F4AA 1O95A 4JYFA 2NXIA 1XIIA 4DNMA 4D1IA 2J47A 1LUCA 2VD8A 1LWJA 5CPNA 4QDWA 3VKJA 4HPXA 5IFTA 1PDYA 5LA2A 2EG8A 2Z4GA 2WNNA 3DN5A 1NP0A 1C8XA 5LA1A 3N2BA 1V3HA 1ZALA 3GYCA 4LNYA 1H5VA 3IRDA 4B92A 3TZNA 1F07A 3PJTA 3DERA 4LUIA 3N15A 1FWIC 4AWEA 4K7YA 4JDYA 5DBUA 1K3UA 5REQB 3CPUA 3SAZA 1I45A 1VBGA 1G1YA 4GYPA 4IJCA 4AYGA 2PCEA 3WLHA 5IXEA 1PTAA 3LPPA 4PMRA 3E9AA 1OINA 5A8MA 4OUIA 5KITA 1P4CA 3RG6A 3NQEA 4M6VA 5HR7A 4NUWA 3GXIA 2NX9A 5BOOA 3SY5A 4R9OA 4M1RA 4LS1A 3VDGA 4O8AA 1V4YA 2BXYA 5EFDA 3RUBL 3BLDA 3H55A 1IGWA 2XZ7A 3IJIA 3NGJA 4FOKA 5IDIA 2EPMX 1BRLB 3KBSA 3A23A 3WNLA 1MEHA 2PSNA 4HT3A 1M7OA 3P8JA 4XTDA 4F48A 3OVRA 1M41A 4DI9A 2EPOA 1M5WA 4K8GA 1YMYA 4RXGA 2QULA 2ZC8A 4CKQA 3PANA 2OSXA 3TDFA 4JTUA 4BR1A 3LTYA 4GJ1A 4JY9A 1JXJA 1T6MA 4O50A 1BXNA 5AHLA 2P3ZA 3D6NA 1JZ2A 5J5RA 5H8MA 1EIXA 3LCLA 3LZ5A 4Y9NA 4GJJA 4IQDA 1DQUA 4Q8WA 5HNRA 3VD4A 4A8IA 1QOQA 4JIQA 2QCDA 3PBVA 4AZHA 5J04A 4LYKA 5CBJA 4J7RA 1VHNA 3W86A 5K9CA 4Z42C 4PMJA 5EMJA 4JYEA 3SUSA 1QT1A 1WA3A 1LBLA 3ZSSA 2TSYA 1C92A 1MW1A 4GY1A 3F03K 4HOWA 2QMKA 3AS1A 4HP5A 3NVDA 2GGJA 3GK0A 4AVFA 5G2WA 1JPMA 1A5AA 3L0GA 1XLKA 1IZJA 2ISSA 3ELFA 1UWQA 3FJLA 3IS4A 2BOEX 3L4XA 1DHPA 3CUZA 4INFA 5CJNA 3WBAA 1US2A 1GOMA 1DOSA 1LOQA 3W81A 5EMKA 3VKBA 1BKHA 2Y5JA 1BWKA 3R10A 1R3SA 5G5IA 1E4NA 4ATWA 5DANA 4L5ZA 1V6XA 3W24A 2BASA 1PKNA 1GVEA 3I4EA 1VF8A 2QJHA 3OW1A 5C7HA 3GKAA 4AY7A 4EAYA 1J4EA 1K4GA 3QYQA 2YR1A 1ZBCA 1S46A 4UQBA 3M5VA 1R6WA 1EWEA 4WXYA 1ZJBA 3C0LA 3VD7A 4C6NA 3H4XA 3BAIA 3FV9A 1CLKA 1I60A 4FXFA 4M6PA 3LB0A 2BV9A 1GKRA 5HWJA 2EPHA 4GVHA 1CENA 4JQ3A 2ZX7A 1R86A 1YTKA 3SQMA 3CV6A 4JPGA 1ZLPA 1M53A 3GVQA 2QIWA 3DBPA 4F79A 1RY8A 1DJNA 3TR9A 1U1JA 8XIAA 4QITA 3DI1A 4LANA 2PDJA 1C29A 1EA0A 1A5MC 3MANA 3UETA 1V7AA 1ICPA 3NJ3A 5JIPA 3BV7A 4J5NA 3ZJ8A 2RJHA 1E9YB 3BMXA 4JTTA 4LB4A 4IWWA 4HCDA 1S3TC 3B9OA 5FJUA 1NOFA 4A4AA 1K03A 3A4JA 1Q4WA 1Z3NA 3KCJA 2XU2A 4GIEA 3V7PA 3VMOA 2HJPA 4LW7A 3OHMB 4ZB2A 1GONA 1KGUA 3P7YA 3RK8A 3P2VA 4PGLA 3M0LA 3VIOA 3VUSA 1REQB 3M46A 1EKOA 1JZ6A 3E2SA 3AROA 3WH9A 2OQLA 3VOIA 3H21A 4W7WA 2Q01A 2YW4A 2ZA3A 3M5XA 3UWEA 3T09A 1IEWA 3ZR6A 3GFYA 1FWWA 4BI7A 1YKWA 4EPKA 1P0KA 1MMFA 5D2XA 4Z2HA 1J5SA 3A24A 3W73A 2GOUA 3E6EA 1VS1A 4M82A 3FYYA 1FP8A 3OZMA 3FAWA 4NY2A 3NZRA 3A13A 2PDYA 3TYZA 4C6QA 4JFUA 5LGZA 4AXKA 4C65A 3I3EA 1GJUA 2QJGA 2C1IA 2Z1BA 4DUWA 3RIKA 3LD5A 4JR5A 3K4WA 1XP3A 1JQXA 1NFBA 3BAKA 1W9XA 3WLNA 1XKJA 1FP9A 3V0TA 3A12A 2CU0A 3ORWA 3AZSA 3EZ4A 1LRQA 2QZRA 1PIFA 3WF1A 3KHJA 3U2OA 1TG7A 1HGYA 2PTYA 2OQYA 3FAXA 1MDLA 3GTXA 5I79A 3TFCA 3TYCA 2VOTA 4NSBA 3P5YA 5HNNA 3WL1A 2AGTA 3VGEA 2PWEA 1LQAA 5REQA 3H6OA 1XH0A 8TIMA 1LP6A 4JX5A 1LL7A 1P0EA 1KM5A 1X1OA 3R89A 1OFDA 5BXSA 2DZTA 5BW6A 2VR5A 1KM6A 3GFXA 1XYLA 5FEZA 1FQ0A 1YADA 3G1DA 4RDWA 5AHMA 3O15A 4MIMA 1J10A 4HYRA 1EB3A 5KINA 4DJFA 1VPXA 4RW5A 1YEYA 3MY9A 4US5D 1UP0A 3WLPA 4YTRA 3TP4A 2VDIA 5HJLA 4W84A 2HBXA 4FOJA 2Z25A 3TQKA 5I3JA 1JD7A 1VLWA 1VC4A 4YTTA 2DQWA 1YPIA 1SMDA 1OX5A 3C3NA 2X2GA 3OLGA 4LRTA 2IKJA 3FJ6A 4PRTA 5BMXA 4DZ5A 4ZQOA 3NQ2A 1KV5A 3QJAA 1V08A 1GYLA 1NDVA 3T8QA 4OOUA 5H8PA 4XVDA 5KSWA 2WCAA 1WZAA 4MY1A 2VFEA 1HP5A 1FBAA 3U2CA 5K7JA 3H2CA 4GYKA 2H9AA 3S0CA 1I2PA 1OX6A 3CC1A 3CTLA 3VGDA 2E0PA 1UJQA 4CD6A 2OR2A 3VD5A 1F5ZA 4BY3A 4LBSA 4MAVA 2E67A 2OGYA 2GLKA 5I3DA 4MFDA 4JKLA 1FCUA 2FYMA 3I10A 4Z2LA 2XIMA 3R13A 5D9OA 3LSBA 1AQFA 1B0IA 1CI1A 1AMKA 1T40A 3PTDA 3W1MA 3IWP