3W74A

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with mii-4-139
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (fumarate)
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with MII-4-139
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 105
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2013-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w74A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w74A01
2ISWA 2CZDA 1M7PA 5CPOA 3W83A 3KRUA 1WXJA 3UPBA 4UFLA 2YZRA 4MLJA 4MIMA 3HPZA 4O57A 3T55A 2VFDA 4ZMGA 4FF7A 1W54A 3IEBA 5HR7A 2PRHA 3PF3A 3AJXA 1AL8A 4X2RA 1G67A 3IIVA 1LOQA 4Y6GA 3P74A 1GVRA 4A22A 1VLIA 1SZFA 2C1HA 5BOOA 3AO0A 1VHNA 3GKFA 2R8WA 3RNDA 2V81A 3GDKA 2YDAA 1TPWA 3O6CA 2V82A 2B0MA 3P61A 1TMHA 4O1AA 2Y85A 2B7OA 1U5JA 4K36A 2ISSA 2Y63A 3GXPA 1TPVA 4FEZA 4LS1A 3OVPA 1VZWA 3EX6A 3M0ZA 2C13A 4ZZ9A 3BARA 3LHZA 3FFSA 2Q3OA 3NQAA 2FB2A 3TX9A 3WJXA 1I4NA 5AFDA 3TMLA 2H8ZA 2P0OA 3HPXA 3TUUA 2Y70A 3ABSA 4FNSA 5F2LA 2CZFA 4I7UA 4UTKA 3G0UA 4N9DA 4NZFA 4M19A 3GYEA 4UR8A 1W31A 1N7KA 2HS8A 2JGQA 5EBUA 1U83A 1J2WA 1R30A 3IRDA 4BR1A 3CIWA 1WAUA 5D09A 4MFEA 4BWLA 3W70A 1TTJA 3T7VA 1RZMA 1SSGA 5J5DA 3W1AA 2ZZ6A 5BRBA 3LCWA 3MI3A 4JY9A 2PRMA 3C3NA 3M6YA 3HQ1A 3KRZA 5H2ZA 1UUOA 1Q45A 2NX3A 3HGJA 3PBWA 3FJLA 1SFLA 2QEZA 1PE1A 5AYZA 3QMTA 4UMBA 3C2VA 4GUIA 1OX6A 2J9XA 3THQA 1OK4A 4DF0A 3IIXA 4PFMA 4N6FA 3GNNA 2Y88A 2ZBTA 1G4TA 1TCDA 4LUIA 5AC6A 3F03K 1VHCA 2E09A 1FWSA 1JQVA 2NV2A 2ZZ2A 4KFOA 3NA8A 2LLEA 4A3UA 4NX0A 5EY5A 2ATMA 3A5FA 3LHVA 3QFEA 3RFAA 1CW2A 4FXRA 4CQ9A 4H4IA 1QPRA 3CTLA 1GWJA 3NQ2A 3EB2A 4JD4A 4BI7A 1ZHAA 2EF9A 2J9YA 4MYXA 1LZOA 3STFA 4AWSA 1OFQA 4UFJA 4DF1A 3SGUA 3O15A 3QEZA 1KTCA 4JXCA 4NJJA 5MHBA 1R2SA 3ELFA 2ZZ5A 2BWGA 3QZEA 4UXDA 5AHFA 2E1DA 1ME8A 3W23A 4DO4A 4FO4A 3MI2A 1H60A 3NQ7A 1TJPA 3E49A 5A8GA 1GJPA 3EX4A 3EX2A 4Y9AA 3M1ZA 3PUOA 4RR4A 1KV8A 3NVTA 3PSWA 3U8GA 2FJKA 3W1UA 3UZJA 3LM7A 1Z41A 2NWSA 2YCEA 1X1ZA 2GOUA 5CGQA 4ZQCA 2B7NA 1R47A 3M16A 2C16A 3G1FA 4A2SA 3BW2A 5LHFA 3G8EA 1OJXA 3STEA 3HG4A 2E5BA 3O1NA 1D9EA 2WO5A 4O14A 3QC3A 3TSBA 4M6PA 4HHPA 1UJPA 4JTJA 3CLMA 4XTDA 1W3NA 2ZRYA 3OVQA 4NJHA 2A0NA 1G6CA 1ZJIA 3NNTA 2ZTJA 3ABQA 3CT7A 1SO4A 1W0MA 3N73A 2PURA 2YW4A 1WBHA 4PC8A 3LDVA 4XBKA 1LRTA 4HNUA 5K3VA 5D2YA 4TU1A 2G5WA 3DI0A 4CCDA 4JTTA 3C4UA 4QAIA 5KMYA 2AQWA 3KFTA 1NVMA 3PG9A 3S9YA 3TQ0A 1KM1A 3Q94A 3W7JA 2VKZG 4Y8FA 1ZCOA 3UWZA 4PL1A 4WY0F 1GYNA 4R53A 4RLIA 1KFLA 4PCFA 4UCGA 1SFJA 1T96A 4FNRA 4UFHA 3IVTA 3L0KA 1VQTA 3EWUA 4Z1BA 1YPIA 2B7PA 2RFGA 3P5YA 4KWWA 1QO2A 2CLHA 3DBPA 3SECA 4O1CA 3NL2A 4LVBA 2X16A 3LXBA 3GXTA 3DHFA 4DXVA 1KM3A 3KXQA 2E6FA 3EXSA 2QCGA 3QSTA 5FF2A 1KBJA 3FEMA 2C6QA 1F73A 3H55A 4R33A 3W1XA 4O17A 4K39A 4LVGA 4TO8A 5F4SA 5G4EA 3HG3A 1NF7A 5FF4A 1JUBA 4FNUA 3L9CA 4MZYA 2Y61A 3CB8A 5I3FA 5A5WA 1DJQA 3CM4A 4WY0B 4E2BA 4JTEA 4O19A 1W1ZA 3M5VA 3NL6A 1UCWA 3PULA 1S5TA 3TJLA 3A21A 2A7PA 1TPB1 3BG3A 3BG5A 2GJNA 4FX6M 2EGZA 5DY2A 4FB7A 1NAL1 4JICA 1TSIA 4KWVA 3TE9A 3S0CA 2C0AA 5LHEA 4ZVJA 5EKYA 1LOLA 1YXDA 3PSVA 1L6YA 1V7YA 1YDVA 1S3HA 3PY2A 3LCFA 2I14A 4IMGA 4TX9A 5DELA 3W7LA 5LNWA 2E68A 2BTMA 2YXGA 3T78A 1TYGA 3W76A 3NOEA 5AB3A 4FIQA 2A6NA 2OX1A 4AWUA 3G1XA 3VCRA 3IIOA 1TV8A 4UFMA 1KM2A 1P0KA 1VYSX 4GJ1A 3N9SA 3NPUA 3TXVA 3EWWA 2ZCGA 4OE7A 3C52A 1XI3A 3W87A 3LTSA 3HOJA 1LCOA 3I6RA 3N34A 4CCCA 1IXPA 3CU2A 3A23A 3GKAA 1S5VA 3N9RA 3TAOA 4UIOA 2DZUA 3W71A 1SUXA 3NXFA 2FPTA 3MMTA 4LC6A 1OFRA 1QOPA 4EF9A 4K38A 4Z1CA 3EKLA 1BWLA 1OFAA 3OHIA 3MO7A 3MYOA 1F5ZA 4I7VA 3TNOA 1EUNA 3W22A 1NF0A 3DFQA 2BSLA 2ZZ7A 4JTLA 3STGA 3V1PA 4BWLC 1YPFA 2YX0A 3GX9A 5G4WA 3ABRA 1H61A 3A9IA 1K3UA 3RLVA 1XBXA 3I7RA 5D32A 1YTDA 3TXZA 1GVFA 1CX9A 2FIQA 4U28A 3PM6A 1I45A 4O13A 4ML9A 1J5TA 3LBCA 3C61A 5HWMA 1CI1A 3GDMA 2AAMA 3NM1A 3NPWA 4K7YA 1IXQA 1BEUA 4O16A 3WJZA 3SFKA 2VEMA 1HO1A 3W1NA 3QQ0A 3Q58A 3M5ZA 1SU5A 5DXXA 4C1LA 3QMSA 1JCYA 4MY9A 3PBVA 3C2OA 4O53A 1G7VA 3NQ6A 3SZ8A 3HG5A 3L0NA 3L66A 3M47A 3R5EA 4WQ6A 3S42A 3DFTA 2G97A 3P5ZA 1TREA 2CLOA 2ALDA 4EOUA 3HG2A 3PC0A 1P1XA 2X1UA 4N02A 1FXPA 2NLIA 2JKEA 3S1UA 2NUXA 4WZHA 2Z6IA 4UTTC 1GVOA 5DCBA 3C2RA 4EVZA 3NDOA 1KLYA 1MZHA 2QCEA 1RD5A 3N14A 3FYOA 1G4SA 2W79A 1O5XA 4FHAA 1LOSA 3W7CA 1F6PA 3TCEA 3LTYA 2DP3A 5K2ZA 2A85A 2QCDA 1PHQA 4LS2A 3CHVA 2EKCA 3VNDA 1K7XA 2GPTA 3ZWTA 3ATZA 4MJMA 4UTHA 1K8XA 2QJHA 1PVNA 2A4AA 4P61A 1WQ5A 5HINA 3CWNA 4JY8A 1QNVA 3LV5A 3O63A 2EAWA 4H6KA 3R8RA 2G95A 2Z6JA 4PTNA 4RKAA 1EEPA 1Q6OA 2ZDRA 4OHQA 1Q3NA 2GVGA 4JYFA 4L4LA 2QKFA 4NJKA 3MHGA 3GXNA 4HSOA 3W7RA 4X3ZA 1I2NA 5F4WA 1TPFA 4UNLA 2A21A 1EUAA 3SR7A 3USBA 1W5PA 4NXKA 5KZDA 1FX6A 3WK1A 4GWEA 2DORA 2A2IA 4JGDA 1O60A 1HFBA 3PWAA 3LRMA 3W7PA 1XDMA 5G1TA 1FCQA 3R12A 1QO5A 1BWKA 4JYEA 4M7SA 1UUMA 1QCWA 2H8XA 2QUVA 3DH7A 4RK8A 4EIVA 3MBDA 2CLEA 2DU2A 1XBYA 4E38A 3W7HA 1OYAA 3HJZA 4HPJA 5C54A 3G1YA 3SW6A 4Q32A 4BI6A 3W9ZA 3DU0A 5D03A 8TIMA 3LCHA 2W0UA 3UWWA 1T99A 1LORA 1KM6A 4UTJA 3P81A 4NNCA 2J88A 1FWWA 4TMBA 3NQMA 3E02A 1XUUA 3TAKA 3TH6A 5LNRA 3B06A 4DO6A 4JTHA 3P62A 2R94A 3LGEA 4LS0A 1OABA 5BMXA 4O28A 1OFDA 3S5ZA 1FUYA 4DEFA 4UTMA 1S5WA 1H7OA 3GK0A 3PB0A 1QR7A 2B7QA 4PH6A 1TB3A 4JX5A 3NR0A 5AHIA 1WOAA 3UXDA 2A7RA 2YSWA 2VFIA 1MEIA 1ZFJA 4QJ1A 4WD0A 1VRDA 3E12A 3LHYA 2PE4A 1FXQA 4OBTA 4TIMA 3DZ1A 4YCPA 3BV4A 1QMLA 4OV9A 4NQ1A 3NZRA 2X1SA 1H7PA 2WSRA 1RVGA 5E1QA 3A22A 5LZLA 2FQIA 3BGGA 4FNTA 5EPDA 5J5RA 4LC8A 1SO6A 4HIBA 1LTDA 3EWYA 1VH7A 2E6DA 2JK2A 1VCGA 2CLFA 4CQAA 1F74A 1XCFA 2IQTA 4WUIA 1IIHA 2WQPA 2ZZ1A 3EXTA 5HWNA 2I9EA 3TV8A 2FDSA 2P10A 4MZ1A 3W7GA 3LRLA 4RXFA 1ZAIA 2XN0A 4CNNA 5AC8A 4WXYA 3Q2DA 2Y89A 3NPVA 1SW7A 1RQEA 3WJYA 2PCQA 4AWTA 4AHOA 2NXGA 3TQKA 2GQ8A 4YLWA 5FEWA 1GOXA 1JCJA 4GNJA 3T40A 3IGSA 5CG7A 3W2MA 4HT3A 1K02A 4O10A 2E77A 3MYPA 3RMJA 4QISA 1EWDA 1W3IA 3JRKA 2C3ZA 3Q37A 4ZQPA 1NSJA 3O07A 3NQ8A 3WK0A 1DV7A 3QM3A 3N2MA 3V75A 3STCA 1GPWA 1F76A 2VOMA 1H63A 4TR9A 4HNVA 3L0GA 4MUZA 3OEXA 4IQLA 4Y90A 4YMZA 3P60A 5IBXA 2QCCA 2OJPA 4N9EA 1PCWA 3B0UX 4IGHA 3W72A 3D0CA 3W7EA 2DZWA 2Y7FA 3IGUA 2BZNA 4UTIA 4WOZA 1D3GA 4O50A 3W1QA 4NJIA 2X30A 3OA3A 4MY1A 1DKWA 3MBFA 5HWJA 2YR1A 4O4VA 3RF9A 1H50A 3L5LA 5K9CA 2J24A 2NZLA 1Q6LA 1YXYA 2FPYA 3VI2A 2WKJA 1GT8A 5I3JA 2VXNA 1YTKA 4IUOA 4XBSA 1H1ZA 1H5YA 4HPXA 5CPNA 2NXIA 4HNNA 4RXGA 1GQNA 3L67A 4JIQA 5CSSA 4LVAA 3TC7A 1O95A 3CQ0A 3E96A 1TTIA 3HPSA 1QWGA 3P80A 5D2XA 1KFCA 3HGRA 3HMJG 4N4QA 3PUDA 4AHQA 1W5OA 2QJGA 2RH9A 1SO5A 4S1FA 3G1SA 5D2WA 4IMCA 1AK5A 4K8EA 3OBKA 4QNEA 4ICNA 3EKZA 5LSMA 1O94A 1DORA 5LNSA 1UBSA 1GTHA 4IPJA 4NVTA 2CWNA 5FF0A 4MVAA 1FDZA 1SPQA 1G4PA 4NXSA 4AH7A 1B3OA 1PV8A 4B5NA 3QW4B 1YDOA 1W5MA 2VENA 1QOQA 3C6CA 4YXGA 3THAA 4KFNA 3B05A 4DBDA 1TV5A 4XWUA 4YCOA 4UC5A 1TRIA 5K9XA 4GRSA 3TFCA 4AXKA 1OG0A 1TO3A 2V2HA 3FA5A 1LBMA 5EL1A 5HULA 3TIMA 4UUIA 2GVLA 4ADUA 4GE8A 5D05A 4LW7A 4IMFA 3FKRA 3W7OA 1WDWA 3PR2A 4GUGA 3C8FA 4NUWA 3GB6A 1O4UA 3ZFHA 1ADOA 1ME9A 5F1VA 3P67A 3WFAA 3T44A 3BGJA 4JX6A 1LBFA 1N8FA 4WXZA 2XN2A 1A5BA 3S1VA 3T4CA 2Y7EA 3EWXA 4LU0A 1H7WA 3HB9A 4WOQA 1YYAA 1GYLA 1JUEA 3W75A 2EHHA 5EYWA 2E5DA 3G1VA 3L5AA 2WOQA 3G0SA 1WV2A 1JVNA 4MPQA 1IIGA 2UV8G 1X6UA 1AG1O 1C29A 3NG3A 1QAPA 2WPBA 3PB2A 3L21A 4JTFA 3R13A 3LXCA 2Y6ZA 4GUHA 5LGXA 3BLFA 3S1WA 3FIGA 4UTLA 2H3DA 3BO9A 5LNUA 3HO8A 1Z44A 5G1YA 2ATSA 2DZVA 2NUWA 3JR2A 5FEPA 1H51A 4WY0A 4Q4KA 4MY8A 2B4GA 1GG1A 3TROA 1VLWA 4RZ6A 4O54A 3EWZA 1VGAA 3PS7A 3DI1A 4C1KA 1LBLA 2Z2UA 5HMSA 1JCXA 4YL2A 3W1RA 1OX4B 4R34A 4O1DA 1OX4A 3OG3A 1VCVA 3G1HA 4HN4A 4GUFA 2GJLA 2X1RA 3TW6A 3E0IA 3P7YA 1B4EA 1RV8A 4GFSA 1C8VA 5U4NA 4EF8A 4NNAA 1L9WA 1AW1A 4NJGA 1EP2A 2CLIA 3GNDA 3QYQA 3GIYA 4PL2A 4UFIA 1KLZA 3CEUA 4QITA 4MYAA 2JGYA 2CFFA 3NM3A 3G3MA 2YFNA 1WX0A 4N9CA 2VFHA 1OHLA 3BW4A 3VE7A 5LGZA 5E0KA 1W3TA 2O7QA 5KZMA 4O0ZA 3W2JA 3KRSA 3WK2A 1ZAHA 2HSAA 4LWWA 4NNBA 4XKYB 3W1LA 1D3HA 3SGZA 2Z0IA 4OWGA 2J9ZA 3SJ3A 5ABTA 3RK8A 3FLUA 1MSSA 4UMAA 5KITA 4R7JA 2Y7DA 3HBLA 2QDHA 3GDRA 1DBTA 1FDYA 1YXCA 1I8JA 1W8SA 4IOTA 3K30A 4CQ8A 3LI0A 3GAKA 3QPZA 1SZGA 5E93A 4QIUA 1VCFA 3NQEA 1IF2A 3FOKA 4DELA 1B57A 2JKPA 4RZ5A 2RDWA 4FXSA 4MZ8A 4NT0A 4AMAA 4Q33A 1JRBA 3FKKA 1A5SA 5F1UA 2FLIA 3NQGA 1QPOA 3W1TA 1MEWA 1SO3A 3G18A 5F2IA 5CPMA 1AW5A 4BF9A 3L5MA 4UTUA 3ZWSA 4UNKA 2Y62A 2ISVA 4AEOA 2HMCA 2DZXA 4N4PA 3QH2A 3QSRA 2OCZA 2C18A 3LX9A 2DZPA 4X9SA 5D02A 5HUOA 3LERA 1IXNA 2NWRA 1TQXA 4LRSA 1VYRA 2QUTA 1B4KA 2YYTA 3TMQA 3UWUA 1W56A 4JTIA 3DHDA 1G4EA 4CCEA 5C5YA 3DFSA 1JCLA 2GUUA 1K7EA 3NAVA 2FFCA 2ZRUA 1R46A 3F1QA 3DKLA 3EX1A 2NXHA 3B0VC 3VE9A 1AW2A 2E6AA 4M6VA 4RZ4A 3RLUA 2DZTA 2E5CA 2BLEA 5DXYA 2ZRZA 1FWTA 1XC4A 4AF0B 4N2YA 1VYPX 3R89A 4ONVA 5G2IA 5AHEA 1YADA 1J4EA 4L4MA 3W88A 3M9YA 5D2TA 1SW0A 1ICQA 2CLLA 5KTLA 3QRHA 5FEZA 1X7FA 3OVRA 2J6XA 4XQ6A 5C55A 5D2VA 4H3DA 3NQVA 1M7OA 3S6DA 1DQXA 5AC7A 1JQXA 3LCLA 4KKXA 1I2RA 4RX0A 1HG3A 3W74A 1MEHA 3NPXA 1WA3A 2VEIA 1F05A 3MP3A 3G0XA 3BG9A 2V5BA 1YLVA 1UASA 1MO0A 4MJZA 3I65A 5H91A 3GZ3A 4E0CA 1TPDA 2QCMA 1A53A 4ZQRA 4D2JA 2E6YA 2Z1BA 1DOSA 3CWOX 1OYCA 3P84A 1EWEA 4JX4A 1ALDA 3UNDA 4JTUA 2QCLA 5CPLA 4S2BA 3W73A 1I2QA 1ZNNA 4JYDA 1SZNA 1XUZA 1H7RA 3NL3A 3O6DA 3ZR4A 1OYBA 1L6SA 2TPSA 2NV1A 4WJEA 5HQEA 3W7IA 4DBEA 5KSWA 1VPXA 4XZ9A 2YPIA 3F4WA 4O12A 5G2WA 4JN6A 4I7WA 2F84A 1E51A 3QPYA 2QAPA 2WSQA 1PL9A 4MKNA 5FI8A 4Z08A 3UXAA 4FNPA 3M44A 3LXAA 5D37A 1QDSA 3LBMA 3QJAA 2RDUA 4OGZA 3M5XA 3G1DA 4BFAA 1W37A 2P1FA 1P4CA 4JEQA 1K03A 3KVKA 1KW1A 1PS9A 4AB4A 3QMRA 3FS2A 2A1YA 2OT0A 1M6JA 1XBZA 4HSNA 1T8XA 2RKXA 4O15A 1BKSA 4FNQA 3W86A 4HNTA 4ADSA 1DHPA 4PEKA 4A29A 1LROA 4EWND 1Z48A 3G1AA 4UFKA 2CZEA 4IXHA 1DVJA 3LRKA 4ZQNA 2WJZA 3HGOA 1R2TA 3GR7A 4K8HA 1H1YA 3A5VA 4Z0SA 2ZRVA 1ME7A 1I2OA 1TTPA 3TW7A 4LY8A 1DL3A 3W2NA 1X1OA 4UTWA 3EX3A 3MHUA 3GDLA 3UWQA 3BVJA 3KVLA 1ICPA 3BLEA 1HUVA 5U7SA 4IWWA 1DJNA 3B03A 3KHJA 5D38A 3I7SA 1XM3A 1PIIA 1ZY9A 3W7QA 4Y96A 1LYXA 2ZA1A 1IXOA 3SSJA 2QAFA 2QDGA 4JTSA 5I3IA 5F2MA 2ABBA 3KX6A 1VJIA 4BI5A 2ABAA 1EPXA 4IJBA 1RR2A 3N3MA 4A21A 4BK9A 3H54A 2X1TA 2QCHA 4DO5A 3N19B 2D73A 4QQ3A 3BLIA 3PBYA 4M7TA 1GEQA 1IGSA 3LHUA 3LV6A 3I68A 2J27A 3DKJA 3TQVA 2WSYA 1TPUA 4AHPA 2QUUA 4MFDA 2VELA 3LOTA 4XTIA 2ZRXA 1K7FA 3G24A 4N6EA 4S2CA 1KFKA 4LV9A 2OZ0A 4K37A 3GLCA 3LCIA 2BX7A 3KAOA 1VS1A 1JJKA 4TMCA 2RHGA 3MWAA 2ZA3A 5EMUA 1BTMA 3CC1A 1WOBA 3NYZA 3JS3A 3KVMA 5SWUA 2O7SA 1QPQA 5KZEA 3ZS4A 5AOUA 2CZ5A 4U4MA 3W2KA 5K9DA 1F6KA 4GXMA 3ANYA 4Z0JA 2C14A 7TIMA 1KTBA 3NL5A 2DZSA 1H62A 4X22A 4DF2A 4DQWA 1SQ7A 2CW6A 2NX1A 4JNMA 4QM1A 5BNKA 2TYSA 5I3KA 1FWNA 3UQNA 3VKJA 3W2UA 2XFWA 3MW7A 3WK3A 1YTEA 5TIMA 1QPNA 4ORMA 4MLRA 3UD6A 1H7NA 2CLKA 5G2HA 5TBOA 1GVSA 3UZ5A 4LUJA 2VEKA 3E9AA 4O52A 4G1KA 3MI6A 1FCBA 3NQCA 4JTKA 5T26A 1NFBA 3SIZA 3LI1A 4MOZA 4UTTA 3O16A 4ORIA 1OF6A 5BMWA 5HUPA 4POCA 2ZFAA 4LOCA 1SZEA 2XN1A 5DY3A 4ZL1A 1PCKA 5CKSA 2JKAA 3NZ1A 3PBUA 4GBUA 4FX8A 3ABOA 2KZHA 3QQ1A 2I1OA 3CIXA 3O8AA 2F7FA 3NEVA 2ZRWA 4RCXA 1KBIA 4UR7A 6ALDA 4Z1DA 4FX7A 2AGKA 1GTEA 2TMDA 5F4XA 5EA9A 1T0OA 3G22A 1Z42A 3W07A 3B8DA 1LRQA 2ZTKA 3U2OA 2YYUA 1F2JA 2V9DA 3C2EA 1A5CA 3S5YA 3CPRA 5DBTA 4ZQOA 4YWIA 3TSMA 5GVJA 5HR6A 3DFNA 1ZAJA 3DFOA 2DJLA 1K8YA 3TU9A 3EWBX 1TRDA 1Q6QA 1TTQA 5C2XA 1YDNA 2FB3A 4O18A 3IIPA 3VFLA 3HIJA 3B0PA 3UY7A 4JTGA 3N2XA 4AVFA 4J9JA 3WJSA 4HKPA 3R2GA 3M7WA 1KFBA 2Q8ZA 3LTPA 4O0KA 5KINA 1LM1A 4IMEA 3L65A 1Y0EA 5HNRA 1JRCA 2JBMA 3TK7A 3LB0A 4O8RA 3W84A 1RPXA 2ZYFA 2W6RA 1ZALA 2OMAA 4QSHA 5DBUA 2V5LA 3BW3A 5L9FA 4KFPA 1JULA 4O4WA 2GQ9A 3W7NA 3DENA 4FIRA 3F4NA 3P82A 1KTNA 4JIPA 2YW3A 3WJWA 4IX0A 1XKYA 1EB3A 3TJXA 3LCXA 4P2VA 1G69A 3PAJA 4LV4A 4LTSA 1SR9A 3TC6A 1FDJA 4CNOA 1OK6A 5G5IA 3BPWA 3IIZA 2GQAA 3O06A 1FCUA 1OF8A 2A5HA 2QCFA 4ZQMA 2V2DA 2WV8A 3M43A 3W1MA 3W7KA 3EEGA 1B9BA 3W3OA 4OU1A 1N55A 3C56A 1GG0A 1KM4A 2ZA2A 3P8IA 1Q6RA 2C15A 3FJ6A 1PHWA 4I9AA 2WNZA 1F7BA 2H6RA 3UYCA 3W7DA 6TIMA 1EA0A 1W5NA 4NX5A 3OIXA 1TPEA 1OFEA 2H3BA 3C2FA 1TQJA 1JCMP 3KOFA 4OT7A 1OVDA 2V8ZA 2VC6A 4LVDA 1THFD 1EP1A 1L6WA 1P0NA 4Z1AA 4O11A 1DQWA 2R91A 4UTWC 1P5BA 3IVSA 2YFOA 1C9DA 4LVFA 2Q3RA 1ICSA 3G8RA 3NQDA 4JDYA 2HTMA 3IGXA 1A50A 2NUYA 3NQFA 1FWRA 1TPC1 3B4UA 3A24A 3MJYA 4JR5A 3UY8A 4XKYA 3L68A 1H7XA 3B04A 1ONRA 5FEXA 5AYXA 1R2RA 4O1BA 2VFFA 1K8ZA 2H90A 4IPIA 5BW6A 3GDTA 3LLDA 5DN1A 3W2LA 5FF3A 3IVUA 1GVQA 1AMKA 1LDCA 2WNQA 3ATYA 4UMCA 2NX9A 4CLMA 1X8FA 3TR2A 3P8JA 5AYYA 2TRSA 3W1PA 3M41A 4PA8A 5FF7A 4LT9A 3MUXA 1L2UA 1LP6A 3MHFA 5LNVA 2BXVA 3UWYA 4LRTA 1JUKA 5K4XA 1HTIA 1XBVA 1JCNA 3S5NA 5F2GA 5AHMA 3LLFA 3PVFA 2V2CA 3BK0A 3IV3A 2X2GA 5K7JA 5IBXC 1SSDA 2ZQ0A 1EIXA 4AAJA 1KA9F 1FQ0A 2QJIA 3PG8A 5CZ0A 4NZJA 3M5YA 3TKFA 3U6WA 1JR1A 1OFBA 5I3GA 2QR6A 4NU7A 5IM51 5AHNA 5DCEA 2HS6A 5AN7A 3GR8A 1UB3A 1M5WA 1RQHA 4OV4A 2PRLA 3LHTA 3HF3A 1MXSA 1HL2A 1ML1A 3QF0A 3DFPA 4JDBA 2A7NA 3DGRA 5AHLA 2EPHA 2QCNA 1FBAA 2DJXA 4AF0A 4DPPA 1WYIA 2ZZ3A 1XFBA 3TDFA 4ALDA 1XXXA 1VR6A 3UPWA 1TV7A 3W85A 3KVJA 3S1XA 4ADTA 1OFOA 1XL9A 4RV8A 4GUJA 2VFGA 3GAYA 4CNPA 5I3HA 4M5PA 3UWVA 2Y7GA 2QCDB 2R14A 4A2RA 1ZENA 3CEPA 1NEYA 4PODA 1V5XA 4W9TA 5D33A 5L6UA 1FCVA 2CU0A 1EP3A 5D30A 2OT1A 2VEPA 4K7VA 1LLWA 3SY5A 2FTPA 2G96A 3DAQA 3O6YX 1KM5A 3YPIA 2GVJA 4E2DA 2CLMA 3G3DA 4XUGA 1TJRA 1VC4A 4LNYA 1A5AA 5DLCA 4IMDA 1WBJA 4IXXA 3MP4A 3TFXA 3DXIA 5LKYA 2V30A 1I2PA 2Q8LA 2YGYA 1TPH1 1XDLA 3W6YA 1KM0A 3QW3A 3SI9A 3C0JA 2QF7A 1GZGA 4WX2A 5CZTA 2FPVA 1TIMA 5CZSA 5D04C 1KFJA 2PC4A 4GC4A 5HJLA 2RDTA 4RJEA 3HGSA 1HO4A 3I7QA 5K4ZA 3GVGA 1G7UA 3EXRA 1AL7A 2C19A 2ZZ4A 4IX2A 5C6MA 1RQBA 3FYPA 2WNNA 3LCGA 3W7MA 3NO5A 3NGJA 2A6LA 3MP5A 3TA6A 4DPQA 2V0TA 5CSRA 2TSYA 1KV5A 4OQVA 5CZJA 3S5OA 4N9BA 1LRNA 3RU6A 3TSDA 5DCDA 4M6QA 1SW3A 1W5QA 1FY6A 1LLZA 4JS3A 1OFPA 2VFEA 3L2IA 3S8HA 1KFEA 1QFEA 3INPA 3LHWA 1O5KA 1EX5A 1OX5A 4K6AA 3H53A 3O05A 3PUEA 4QNWA 5FESA 5TQLA
chains in the Genus database with same CATH superfamily
2ISWA 4E3VA 4QE5A 3KRUA 4GGHA 1U2YA 1KCLA 3U4AA 4L1WA 1R85A 3OTRA 4CN6A 3RM4A 3T55A 1C9WA 3N17A 4F0MA 3GQYA 1GJWA 5C7VA 5HR7A 2PRHA 4OVXA 4X2RA 1NOFA 2DFAA 3ZM8A 3P74A 1X8CA 2C1HA 1CTNA 6A3HA 5BOOA 1JZ6A 4GZIA 1VHNA 3GKFA 4WDUA 3UW6A 1WE5A 2BGNE 2YDAA 4OBRA 3O6CA 1J6PA 1XRVA 2B0MA 4I8YA 1MUCA 1TMHA 1KCKA 2Y85A 4PR4A 4I9JA 3GTNA 2ISSA 1T6MA 1TPVA 2I5GA 1E1CA 2XVKA 3EX6A 4GVFA 2OSWA 3LHZA 1I4NA 4J2MA 1WUFA 2P0OA 2BMBA 4CD6A 5A6MA 3TUUA 3UJRA 2Y70A 4FNSA 4HMCA 4J27A 4MGGA 3G0UA 4N9DA 1IZKA 2JGQA 4LANA 4WVXA 3IRDA 4V33A 3EOEA 3TWBA 3CIWA 3BURA 1AVAA 2I5QA 2O9OA 3B0XA 5J5DA 1SSGA 3N2BA 4I6KA 5BRBA 2PRMA 3C3NA 7REQA 3N6HA 2GWNA 3KRZA 1JGIA 1Q45A 5HNTA 4GXWA 4L61A 2FGLA 3WMSA 3SY1A 4WKHA 2XH4A 1PE1A 5AYZA 4FAMA 4LEQA 1O7AA 1OX6A 3AU2A 1UR1A 4L9YA 4NP7A 3IIXA 4N6FA 1R38A 2HVOA 1YRRA 4EAMA 3WUFA 1VHCA 4WF7A 1Q5MA 4M1RA 1RVKA 2NV2A 4KFOA 3A3XA 4DRSA 1VEMA 3B40A 5HQLA 4A3UA 1CWYA 3A5FA 3LHVA 3UR8A 2VEGA 3HJEA 4PMNA 2Z24A 4AY7A 3WMBA 2FGZA 3Q65A 1QPRA 3EB2A 2EXOA 4WDWA 5ABFB 4UFJA 4DF1A 4Y8EA 3QEZA 4JXCA 4NJJA 3QKEA 1R2SA 1JEZA 1RP8A 3ELFA 2ZZ5A 2Y8UA 3QZEA 2E1DA 1ME8A 5LA0A 4FO4A 3MI2A 4MUPA 4JPGA 2CBUA 1EJSC 1ZBWA 3EX2A 4Y9AA 3PSWA 3U8GA 4I5RA 3M0VA 1X1ZA 2GOUA 4ZQCA 3WF1A 3M16A 1F3WA 4A2SA 3G1FA 3WD0A 4F0KA 2E9MA 3HG4A 2KAUC 1P48A 2JALA 2VHLA 4HHPA 1HGYA 1NQ6A 4JTJA 2CYGA 3CLMA 2ZRYA 3ZLFA 2A0NA 1G6CA 7PTDA 4GISA 2DVTA 1ITXA 2VCCA 2ZTJA 3CT7A 1SO4A 3N73A 2PURA 2NSOA 4OTKA 4HTYA 5GJMA 3DHPA 5K3VA 4TU1A 3DI0A 5A6BA 4QJ5B 1VIWA 2AQWA 4AISA 3PFRA 3W7JA 2XIBA 1ZCOA 3IJIA 4XD4A 1DEDA 1GQIA 4WY0F 2WMGA 4PSRA 2GVYA 4AD0A 3SJNA 2PWDA 4GI6A 2QXWA 3IVTA 2X41A 1VQTA 3T0TA 3WD3A 5A8MA 3P5YA 4KWWA 3SECA 4O1CA 3NL2A 3GXTA 2VJXA 2OSXA 3DHFA 4QLLA 3RO6A 4A4AA 4DJDD 1CB7B 1KM3A 3KXQA 3W25A 1A5LC 1POJA 4GIRA 4L1XA 3TZFA 1TE1A 2QCGA 3QSTA 3COTA 4LVGA 5F4SA 4H6QA 1J18A 1NF7A 1XQLA 1GZ1A 4FNUA 5I2UA 1A80A 3CB8A 4V1XA 1XD0A 3ZJKA 3MS8A 4WY0B 5IHRA 4Q22A 3OGSA 3NFUA 3M5VA 2VGFA 1UCWA 4QGCA 1S5TA 2NVDA 3HQNA 4AMCA 3D47A 1UMLA 1OIMA 3KBWA 5A69A 1TPB1 2EGZA 2NQZA 1FWBC 3L4UA 4KWVA 3S0CA 1BG4A 1EL3A 4NYUA 5LHEA 4ZVJA 2EPLX 3PSVA 2XFFA 1V7YA 4AVOA 1YDVA 3PY2A 5LNWA 2I14A 4TX9A 4EPBC 3W7LA 1LQ2A 2E68A 1HJVA 2GSEA 2YXGA 2BY2A 4MG4A 5A2BA 3RJYA 3GNRA 3TP4A 3FA3A 3W4RA 3BLPX 2GDVA 4HPGA 1TWIA 2X2YA 4AWUA 3VCRA 2VC5A 3IIOA 4BJHA 1U33A 1B2YA 1VEPA 4I5UA 4OE7A 4LX4A 3VOFA 3HOJA 1XLFA 1IXPA 7A3HA 4WSJA 4KWSA 5BZAA 3N9RA 3TAOA 5A8OA 4UIOA 1D3CA 1ISZA 2DZUA 1MQPA 2PLKA 3FCPA 3RJXA 2J7FA 2VX7A 2REQA 1BGAA 1QOPA 3RXZA 4EF9A 4K38A 1OG6A 1BWLA 1EUNA 1HP5A 1NIUA 1NF0A 3DFQA 3STGA 3HFYA 3QTPA 1REQA 3GWQA 1YPFA 1BXCA 3CH0A 1E6ZA 5CAHA 3RLVA 1IEVA 1H0GA 1XBXA 5EFFA 1GYMA 4U28A 4V27A 1I45A 1V79A 1J11A 5HWMA 3GDMA 2QVHA 3VNYA 4FMVA 2VEMA 1HO1A 4Q8NA 1SU5A 4PCPA 1V6WA 5DXXA 3QMSA 1JCYA 2X1IA 1JZ5A 3WLTA 4MY9A 3V1HA 2RGMA 2GK1A 3HG5A 3NZGA 1MW2A 2HRWA 3M47A 3B9OA 2O9PA 1W9XA 3HG2A 3B8IA 1FFQA 4N02A 5CG0A 3AISA 3MPGA 2ZKMX 2JKEA 1JCTA 2NUXA 4WZHA 2ON3A 3NDOA 9XIAA 1KLYA 4IFKA 1E9LA 2QCEA 3N14A 4E8DA 1DIDA 1G4SA 2W79A 1O5XA 4FHAA 1LOSA 1F6PA 2WHJA 5K2ZA 1B90A 2H9AB 1HKWA 3QGAC 3GTXA 2EKCA 1K7XA 5FAGA 1HKKA 4Z2IA 3ZWTA 3CUZA 3R25A 2Y24A 3B9EA 1K8XA 4DWSC 2QJHA 4TXEA 2XM2A 2J74A 4P61A 3L4XA 5HINA 2GFTA 1QNVA 4P7OA 5HK4A 3R8RA 4BS0A 2NW0A 2GVGA 4JYFA 2I56A 4KWUA 4LPCA 4IIFA 4Z2HA 1XH1A 3WD2A 5HOSA 4PTDA 3RCMA 3H7UA 1W5PA 4NXKA 3AJ7A 2BY1A 1L6GA 3R8HA 3TN6A 2PDHA 2PTZA 1VFTA 2QPSA 1HFBA 5M03A 4ZXLA 3DG7A 5G1TA 3R12A 1BWKA 4NZ5A 1UUMA 3KHDA 1UKQA 1QCWA 2QUVA 5CBJA 3DH7A 4RK8A 4EIVA 3MBDA 4AYGA 1LL4A 2CLEA 3PZMA 4I9MA 4MNLA 5XIMA 1OYAA 2QVNA 3HJZA 5A6BD 1RA5A 2FZ9A 5D03A 3UWWA 1PXGA 2VDHA 1Z9AA 4GX9A 4UTJA 3P81A 3V18A 3KLLA 2J88A 4TMBA 4AZCA 3E02A 4QDWA 3TAKA 3TH6A 1QTWA 2PLMA 3URQA 4GGBA 4WR3A 2BB0A 1OFDA 4IIDA 3S5ZA 1FUYA 4DO7A 4DEFA 3H2EA 3VUSA 3DESA 1Q6EA 3DYPA 3DX5A 1TB3A 4JX5A 4AX7A 3NR0A 3BICA 1O1ZA 5AHIA 2BFGA 3WQEA 4WD0A 5FCZA 3QC0A 3F5JA 1QNOA 4TIMA 3ZT6A 1UR9A 2J77A 4YCPA 4LAKA 3LPOA 1OY0A 5HJYA 2HCVA 4J3UA 4CN4A 3VMOA 2EJAA 2Z29A 3BGGA 5EPDA 2O56A 4FOUA 3H2NA 2YA1A 4D6GA 3EGJA 4XV0A 1A5NC 2E6DA 3H2OA 5AZ1A 3A12A 1VCGA 3WQPA 2CLFA 4QDPA 4CQAA 1TUXA 3E3HA 2OWXA 2ZZ1A 3EXTA 3N2OA 1CB2A 3WQ5A 5T9CE 2P10A 3UCCA 3W7GA 3LRLA 4RXFA 2PF0A 4JFTA 2YCKX 4B3LA 5JIPA 1ZAIA 3WDHA 2XYLA 2Y89A 4J3VA 3WJYA 2PCQA 3S9ZA 4AHOA 2HPIA 1AJ0A 1QHOA 3TN3A 1MVYA 3CZGA 4R3UA 4BQ4A 1GOXA 3W2MA 3PPFA 2E77A 3MYPA 4QISA 1V3HA 1EWDA 3OLGA 3JRKA 4DB7A 3VC5A 1CLVA 1UMYA 4NRSA 4M6UA 3NQ8A 3WK0A 3QM3A 1CGVA 4TR9A 3L0GA 3TQPA 4MUZA 3OEXA 5TF0A 4Y90A 4YMZA 1SZRA 3OGVA 1L2QA 3G2GA 1FWAC 3AS0A 3V5OA 2XVGA 2QCCA 4HNCA 5HMDA 4QBXA 3D0CA 4NSBA 2Y7FA 2EQDA 2DIEA 1D3GA 3B8VA 2X30A 3OA3A 3MBFA 5HWJA 2ZC1A 2DIJA 3AC0A 3U0HA 3RF9A 2O9TA 2J24A 2NZLA 3L4VA 4IJRA 1YXYA 2FPYA 3ZR6A 2WWCA 3AS2A 1QK2A 2SFPA 5I3JA 3GU9A 4IUOA 2QYGA 1NWRA 4F79A 3GRIA 3RRXA 1GQNA 1M7XA 1K9EA 4QFUA 3HPSA 4WLCA 2PU1A 1KBLA 2ANUA 4RE2A 1W5OA 1SR0A 3GNOA 1AK5A 4DAFA 3EKZA 5LSMA 1O94A 1MUMA 1WKEA 2VL4A 5LNSA 1UBSA 2CWNA 2DZBA 3KLKA 1E15A 2RJHA 1G4PA 4NXSA 4MMWA 4AH7A 5AVHA 1B3OA 9XIMA 2I57A 2QMKA 4KEVA 2YCJA 3QW4B 2VENA 3THAA 4KFNA 4XWUA 4YCOA 1UKSA 3N4AA 1L0PA 1TO3A 4IJCA 1LBMA 3TIMA 2GVLA 4GE8A 1H41A 5CLWA 4C6CA 2GGHA 4GA8A 4DJFA 4ATWA 1O4UA 3H2AA 1HJSA 1AH4A 3E0WA 1ADOA 2DGAA 3MV01 4GIYA 1NJJA 4L4OA 3R4IA 1HN1A 4JX6A 5RUBA 2V3GA 2HXTA 1A5BA 1GVEA 2Y7EA 3EWXA 4LU0A 4S3BA 3C0LA 1H7WA 3HB9A 2PEVA 5FJOA 5AECA 4IQJA 1E0XA 3VD9A 2E5DA 3L5AA 1WV2A 3AYVA 1AG1O 3K1GA 3T42A 3NG3A 2WPBA 4J5NA 3M64A 3PB2A 3V5CA 3RGTA 4D6IA 4JTFA 4DNHA 3Q67A 4L80A 3LXCA 3BAIA 1BSLA 4XVEA 2H3DA 3E0VA 4C91A 4M82A 1TG7A 3EZ4A 3DHUA 3TYEA 3S2NA 2XVPA 1QK0A 4Q4SA 4H9YA 1DJYA 1VGAA 2W5FA 2E3ZA 3MV11 2ADAA 2D0HA 4L6DA 4GQRA 4R34A 2VWTA 3OG3A 3WBAA 3G1HA 5CLTA 3VZYA 2OZTA 4XZMX 4UOJA 3E0IA 3P7YA 2DT0A 1RV8A 4CQCA 2OYLA 3GXIA 2VRQA 4U33A 4UCFA 1ITUA 5BROA 3OIHA 2Z1WA 3G3MA 1VENA 1E6QM 3WF2A 3IJDA 2VFHA 2DSKA 1BPLB 3VAVA 3TN5A 1UYQA 1OHLA 2XGIA 1E71M 1L8NA 4L7ZA 4IPNB 3WK2A 2HSAA 4LUTA 1XYLA 3W1LA 1D3HA 1Z3NA 2W9MA 4HSHA 5C0QA 2J9ZA 5H6HA 5A1AA 3FLUA 1XIIA 3VK5A 4UMAA 4D1IA 4J3TA 5CXPA 3BTNA 3GDRA 3DERA 1S3TC 3N2CA 1E6NA 5A94A 3LI0A 3QPZA 1PZ2A 3EMCA 2Z00A 1XIBA 3FOKA 4AEFA 2QJNA 2ACRA 4D1JA 4BQ3A 1EJ7L 1KNWA 2XIOA 4Q33A 1JRBA 1GQLA 5EMLA 3AALA 4WDTA 1MEWA 1QI0A 4PMZA 1AW5A 2OLSA 1X6LA 4GNVA 2QHAA 4NKCA 1YE4A 4UTUA 4PRRA 3ZWSA 1EZ2A 2Y62A 2ISVA 4AEOA 2PLCA 3BH4A 3RILA 2C18A 3LX9A 1DTUA 4X9SA 1HW6A 5HUOA 3LERA 8RUCA 4IT1A 5A8QA 2OSYA 2QUTA 4GY7A 2XTKA 3KWXA 1MDRA 3DHDA 3TYUA 4R7OA 1FHLA 4TVUA 2GWGA 1JCLA 3H12A 3NAVA 2Y5EA 3S2JA 3F1QA 3DKLA 3EX1A 2E6AA 4RZ4A 2XGBA 2E5CA 3ISIX 3JW7A 2HISA 4JIHA 2ZRZA 3EOLA 1XYAA 3VKCA 1E4NA 3WDPP 4MKVA 4ONVA 1XIFA 4XZHA 4EX4A 2GSJA 3QHOA 5AHEA 2PDJA 3TYZA 4X0VA 1XW8A 4XVDA 1SW0A 4JCMA 1GQJA 1ICQA 2CLLA 3NSNA 1PB0A 5KTLA 3VU2A 5FEZA 3OVRA 2J6XA 3RPTA 4H3DA 1SFTA 4JQ3A 1JL8A 3UZYA 2XJ7A 5AC7A 1JQXA 2QNEA 3LCLA 4JZ5A 2XH7A 3VIHA 1MEHA 2Y2WA 5DX7A 3BG9A 4H7VA 2V5BA 3EEZA 1YLVA 1MO0A 4UQ9A 3GZ3A 5CSUA 1A53A 4LYQA 4KW2A 1DOSA 3A4XA 2YJQA 4YTTA 5BU9A 3J7HA 3P84A 1RCXB 3EKGA 4L6HA 2QCLA 2D0GA 3W73A 5D8WA 1I2QA 1ZNNA 4JYDA 1SZNA 2Y8VA 1XJBA 1PWMA 1EFZA 1WO2A 3UESA 3HFTA 1L6SA 2EEXA 1BAGA 4DJEC 2TPSA 5KSWA 3ITLA 3KDNA 3F4WA 1JZ4A 2YCLB 1MRAA 2F84A 1I0BA 1CYGA 3MKKA 1JPKA 1PPIA 3U5YA 3HQOA 3QPYA 4DYJA 2WSQA 2OYMA 4MKNA 4GVIA 4S3GA 3N2TA 5HAOA 5CJ5A 3LBMA 1NWSA 4OGZA 3WQWA 3M5XA 3ZLHA 3G1DA 4QEEA 1W37A 4UB9A 4KEZA 4RDZA 2G4JA 5FJJA 5M2FX 1S5NA 4DUWA 3S46A 5CCZA 3H6OA 4AB4A 3VKAA 5EMJA 2XVNA 1AUSL 4IZGA 2A1YA 2Y5SA 4IISA 1LG1A 1BKSA 4GJIA 4ADSA 1DHPA 4PEKA 4M3PA 4ACZB 1EPVA 3WQFA 2QIIA 3GDBA 3T2QA 4EWND 4Q8UA 4IXHA 2WJZA 3GUWA 3HGOA 1EDQA 3GR7A 4LB4A 2VTFA 4KQNA 2ZRVA 1ME7A 4JCLA 4RDVA 1B3XA 3WH8A 5LYRA 3GDLA 1B30A 3BLEA 5U7SA 4IWWA 1TVLA 2Z7KA 3VYLA 5HJXA 1PIIA 1JNDA 4OOUA 2ZA1A 4AX6A 1TKKA 5IFTA 2QAFA 2VI0A 5I3IA 1ZQ5A 3CUXA 1FH8A 3S47A 2ABBA 1FWDC 2BY0A 3TYDA 1QI5A 3WENA 4BI5A 2ABAA 4M24A 3QVQA 4IJBA 4A21A 1VBHA 4BK9A 4H00A 2QCHA 1QHZA 1UD3A 3PBYA 3PTQA 5GNZA 2XSAA 3F2DA 4XUYA 2WSYA 1TPUA 4PMOA 2IKGA 4YHGA 1ZRQA 3WO8A 4H1ZA 4QE4A 2V5CA 1XLKA 1VFUA 4FZIA 3GTHA 3WLHA 1WPCA 1C7TA 4HYWA 3LCIA 2BX7A 2RHGA 3MWAA 1K9FA 5EMUA 3IPWA 3CC1A 1L6FA 3KVMA 3U3HA 2O7SA 4ECLA 1QPQA 3ARQA 1WZAA 1E9ZB 4A6GA 3AYRA 4B3KA 4AZIA 4BF5A 2GJRA 3ANYA 7TIMA 1KTBA 2X0SA 4HJFA 3UGVA 1F61A 2WPGA 1P43A 4C1NB 1EC8A 2XSBA 3VGGA 3IAQA 4H8NA 4JN7A 4GH1A 1KWKA 2WK2A 4GIEA 3WF0A 3RN6A 1RPKA 5HPCA 1F8IA 7XIMA 1ZLPA 3VOCA 4Q4QA 1JDFA 1FCBA 4JTKA 5T26A 2WMIB 4G56A 1OF6A 4CQDA 2E40A 4MNKA 1SZEA 3OW1A 4V15A 4GBUA 4LCQA 3I3BA 3H23A 1C92A 3A13A 2XHYA 2FVMA 3NEVA 3XIMA 4U31A 5F4XA 1XYCA 3B8DA 2GDUA 2QUNA 3U7VA 1P1MA 3C2EA 1A5CA 3S5YA 5DBTA 2DV0A 5D9NA 1EX1A 5CPQA 5GVJA 3AYTA 5HR6A 4ZE4A 1ZAJA 3DFOA 2FHBA 3NVDA 3CUIA 3CV2A 3FGCB 1QNSA 5BXRA 5I0DA 1RY8A 2FB3A 4DI9A 4QG6A 4O18A 3IIPA 3VFLA 1GOIA 3N2XA 4IH3A 3M0JA 2PDPA 3AS1A 3M7WA 1QPKA 3LTPA 1KFWA 3MT1A 1SJAA 3WDIA 2PDXA 4O8RA 2FGBA 4ZR8A 3MDWA 3KEHA 2VD9A 1RPXA 2V68A 2W6RA 3WQCA 3UJSA 4PUEA 5I23A 3P6LA 3UU0A 3FA4A 4HNOA 4FIRA 2ZXDA 3P82A 3LNPA 4C5YA 3KZPA 1XKYA 1W1PA 1ISVA 1G69A 4QXIA 3VGEA 3T1GA 2AL2B 3EOUA 5G5IA 1E56A 3IIZA 3ZJ8A 3WLIA 4FR1A 3W6MA 1K6AA 1AA1B 2V2DA 3WH5A 1Z32X 4G7EB 4YS1A 4F9JA 2JIWA 1GHSA 4ZEPA 4FI4A 3TLLA 4NI3A 4I9AA 2WNZA 2ZUNA 1Y8BA 4L6OA 1F7BA 1YHTA 1FH7A 1PZ3A 1EA0A 1W5NA 3LPFA 1TQJA 3GVQA 3KOFA 3PJWA 2V8ZA 5I24A 3ZVIA 3A4WA 1L6WA 1P0NA 5HNUA 2HZGA 4Z1AA 4O11A 4HK5A 3OHMB 4DWDA 2YFOA 5ABGA 3LGGA 3NO3A 2Q3RA 2C7FA 4GCAA 4W5ZA 1MFUA 2VUNA 3CNYA 1BQGA 3A24A 4YTSA 4XZBA 2O55A 3AS3A 1EZWA 1H7XA 4DZ5A 3B04A 5AYXA 2NV9A 4AG0A 1XKJA 3KBSA 2VFFA 2H90A 5ABEA 3LLDA 2AAAA 2QGYA 5FF3A 4UMCA 1LDCA 2X42A 3ATYA 4JQ4A 4CLMA 3O2LA 4IP7A 1X8FA 3QV8A 3DC0A 3AAMA 3M41A 3ECQA 5FF7A 2MANA 4LT9A 2BG5A 2J7GA 3VA8A 4P7NA 1FWCC 5LNVA 1J10A 1D8CA 4LRTA 3WL0A 5K4XA 1WZLA 4GYPC 1JCNA 3D46A 3ERPA 1XH0A 1VPYA 3PVFA 3BK0A 3IV3A 2X2GA 3RAOA 3VXGA 5IBXC 1SSDA 2HDJA 1EIXA 4AAJA 1PTDA 3PG8A 4PMRA 2VQUA 2W27A 4WHBA 2V6AA 3EDJA 4OFCA 3WQGA 2QR6A 1UC5A 4NU7A 1VJZA 2WC3A 4GG9A 2HS6A 3NO1A 4ILSA 2XIIA 1HQTA 3HTWA 4UWMA 1HL2A 3DFPA 3WFLA 5FAJA 3R6IA 2WZIA 3TOYA 1M3UA 2ZZ3A 3ARTA 4RZBA 4PUMA 1J0IA 1M53A 1C8QA 4I8DA 1JZ3A 1XXXA 3UPWA 1TV7A 4ADTA 3UFYA 1XL9A 2J6VA 3BQ5A 1UKTA 4CNPA 3CYVA 5JH1A 1I9CB 2R14A 8A3HA 1ZENA 3R0DA 4B2DA 4MB1A 4LY4A 5D33A 1YEYA 3VIMA 3EDEA 1EP3A 2OT1A 1KKRA 1LLWA 1KM5A 2GYIA 3N6JA 1QI3A 2WWDA 4RDWA 4XUGA 1VC4A 2ZWZA 1DQUA 4O0QA 4IMDA 1WBJA 3CAWA 4JL2A 3GVVA 4PRTA 2YGYA 1TPH1 3LMZA 1KM0A 4JIEA 4AUBA 3DBNA 1XG4A 5J04A 2Y5JA 4DWSD 4WX2A 2FPVA 3MANA 3WNPA 5HJLA 5AC4A 4HZ7A 3HGSA 4NI8A 3GXFA 3I7QA 3QV9A 3VO0A 1YBQB 4HVXA 3PJTA 2C19A 4PZVA 1XSKA 4L1GA 3MZNA 3NO5A 4W5UA 3TJIA 2A6LA 2WSKA 3ZSSA 4E3TA 1TV3A 2TSYA 4PBFA 3O6AA 1A0EA 4L9XA 1SJDA 2RDXA 5CZJA 3S5OA 4YVVA 4N9BA 3RU6A 3A4AA 4OKDA 1N82A 2UWFA 1W5QA 4WIWA 2FZDA 5DMMA 3EB4A 1OFPA 3S8HA 1MZRA 3AWOA 1EX5A 4K6AA 4NRRA 4JTRA 4WGHA 4XD3A 5TQLA 2YA2A 1W9BM 5DEZA 2CZDA 1M7PA 2D3NA 4B5SA 1AJZA 1IEWA 1E6XM 1Q6GA 1XC6A 1DWFM 4MIMA 4ATDA 5FJTA 1KXHA 3B8SA 5BXTA 2FMOA 2WMJA 4O57A 2ZUVA 3L2LA 2OU4A 3SCQA 1W54A 3PZOA 3AJXA 1AL8A 4LF1A 2WW5A 2J75A 1LOQA 1X1NA 2EO7A 1VLIA 3M4HA 3WLLA 2O4QA 3AO0A 2R8WA 1B3ZA 2GSHA 3PTMA 4XZIA 4GQQA 4NZ3A 4O1AA 1W2VA 3CL8A 2CBVA 1UH2A 1EJUC 1MW0A 2Y63A 3GXPA 5LA2A 3RR1A 2BHUA 5AY7A 3M6DA 4LS1A 1P0BA 3M0ZA 4ZZ9A 2C13A 1Z89A 3FFSA 2Q3OA 3NQAA 3WJXA 5AFDA 4AC7C 2ACQA 2CXEA 5F2LA 4CD7A 1LUCB 4UTKA 1B0IA 4M19A 3GYEA 4UR8A 1XICA 1J2WA 2ESCA 1RHCA 1H5VA 5FJPA 4N0RA 1X98A 1U1UA 5BRQA 2QPXA 4X9YA 3DEQA 1FKWA 1RZMA 4W88A 3GHUA 3LCWA 4JTQA 4I6VA 4ZB2A 4OUIA 3PZNA 1KGXA 3FJLA 1CENA 3AIBA 3A9BA 1OQFA 3C2VA 4KIEA 2EKGA 1KR1A 4DF0A 1BSIA 1HP4A 3KCOA 4GNKB 4AU0A 4D8LA 1G4TA 3R94A 1D2KA 3WUGA 1CBGA 1R3SA 4QHRA 2ZX5A 1H49A 5EY5A 3QFEA 5AKQA 3KUMA 4FXRA 1UD4A 2C0HA 1IZJA 3WNLA 4H4IA 1GWJA 2PDQA 1FWFC 5GNYA 4BI7A 2J9YA 3AIUA 1OFQA 3O15A 1KTCA 5MHBA 3DYMA 5AHFA 5CJMA 2WZEA 2UBPC 4LAOA 2XVLA 4TV5A 4DO4A 3ANVA 4JN8A 3VOGA 1Q7QA 5A8GA 3B97A 3M1ZA 4UOZA 1PWLA 3W1UA 4MKSA 3UZJA 4HD5A 2YCEA 4C6LA 1MDLA 5CGQA 2B7NA 4AZHA 3RM9A 1OJXA 3STEA 5I79A 1PUDA 2VC9A 4E8CA 1D9EA 4ZO7A 3QC3A 4U3CA 1UJPA 3RX3A 4A3RA 1MWOA 2QV5A 3OVQA 4NJHA 4G2DA 4B2DD 3NNTA 3ABQA 2GQ3A 1W0MA 4IP4A 4C5ZA 3AXXA 4D6FA 4PC8A 1NFGA 4HNUA 3C4UA 5BU6A 1U5VA 3KFTA 1W1YA 1NVMA 3S9YA 1KM1A 2VKZG 1EOKA 1QI2A 1F3XA 4PL1A 1GYNA 4R53A 1KFLA 3ANUA 3SCNA 4U3AA 4DJDC 1BXBA 3EPOA 3L0KA 3GC4A 4Z1BA 4CU7A 1Q6CA 1YPIA 2DQXA 4HB7A 4MPKA 1KXVA 1OCJA 2RFGA 2CLHA 4Z2KA 1QJWA 1RJQA 3RM8A 2CKSA 1OD8A 4GZEA 3AZTA 4DXVA 5C8BB 4IP5A 3RX2A 3SRFA 3WQ4A 2YB4A 2X7VA 5XINA 3MVTA 1DJGA 5BRPA 3XINA 3MSGA 3H24A 4O17A 3HG3A 5FF4A 1JUBA 3L9CA 1SYTA 4N42A 3T8LA 4FS9A 5GNXA 3R58A 1DJQA 1GOQA 4YTRA 3NL6A 3PULA 2ISDA 4YTUA 2WAGA 3EAUA 3BG5A 1SMDA 1YDYA 3CLWA 3MWCA 4JICA 1KRBC 1TSIA 1GK8A 3GXDA 1UP0A 5EKYA 1LOLA 2VP8A 2ZXBA 3K8LA 3LK6A 1OWQA 3R10A 3N3TA 2NSXA 3QY6A 1JDAA 1L8PA 3PWIA 1FA2A 3VM5A 1E70M 3DC8A 3T78A 2C1IA 1TYGA 2OKTA 3OPSA 2A6NA 2OX1A 4HZMA 1MI3A 3G1XA 1CZ1A 1TV8A 1TVPA 3T6CA 3N9SA 3TXVA 4B5VA 3EWWA 4S3AA 1JZ7A 4JKMA 3GKAA 4E2OA 1GVYA 1V51A 4IIBA 5H8MA 3W71A 2DW6A 1DE5A 1OFRA 1HXJA 1OFAA 3OHIA 4I7VA 4MJ2A 3ITXA 4UQCA 4XAZA 1Z6KA 1FHUA 5BOFA 1XFCA 5G4WA 3GX9A 3ABRA 3A9IA 1K3UA 3KM8A 3I7RA 5D32A 1YTDA 3E5PA 3ZZ1A 1GVFA 1CX9A 2ZUWA 4PRWA 3C61A 5EMKA 1ZB5A 3NM1A 2I5IA 3NPWA 1ECQA 2QZRA 4K7YA 1IXQA 5A6SA 3OBEA 1BEUA 3KS6A 3CJPA 4O16A 3WJZA 3SFKA 2NQ9A 3W1NA 1P6BA 3M5ZA 3T0CA 4QDMA 3C2OA 4O53A 1TFVA 1UZDA 3L0NA 1J01A 3R5EA 4WQ6A 3S42A 4WKAA 1D7KA 2BOGX 2WMKA 4EOUA 2YDQA 1CLKA 3REQA 3PC0A 1P1XA 1EJVC 4NAEB 2VUYA 3ZVHB 2XIJA 1Z69A 1EC7A 2Z6IA 4WDXA 3GH5A 5DCBA 4YHEA 4IFKB 4HZ6A 3FYOA 3E2QA 2PLJA 3W7CA 3LTYA 1DIKA 3K2GA 2A85A 2QCDA 4HTBA 2WNWA 5IHSA 1H0IA 3VNDA 3ZOAA 3WCZA 5H1WA 3ATZA 3D5HA 1R9YA 3SUUA 5I06A 3DOPA 2VX5A 3IANA 1TA3B 4KMQA 1W1TA 2BGQA 1TZZA 3CWNA 4CU8A 4H6KA 2G95A 5T9BG 1ZCCA 1BYAA 1Q3NA 3GFXA 4RE3A 2OWCA 2WB5A 4CEUC 4HSOA 1LF1A 2HNEA 4X3ZA 4UNLA 3SR7A 4LBSA 2BV9A 5KZDA 1EKOA 1FX6A 4BEUA 1HIZA 3VNLA 2A2IA 2CZVA 4JGDA 1XRFA 3GG7A 3W7PA 2GGEA 2WVUA 4M7SA 3SRKA 1FHVA 2H8XA 3WQ8A 3T0AA 1O12A 4LCSA 1ZBVA 3H8AA 2WZMA 4XAFA 4Z17A 4D6DA 3W6LA 4TX6A 2L5HA 1K1DA 3S2MA 2W0UA 4AVNA 3FK4A 3LSCA 4DJED 1KM6A 4KS0A 1YIXA 4IG2B 3POCA 1W6TA 4U5IA 2WLYA 3UVIA 3ALFA 3DIPA 3B06A 4B15A 4DO6A 3NDYA 2R94A 4ZA0A 4E4FA 1Q66A 1UWIA 3GVRA 1OD0A 3B0YA 1BF2A 3KBMA 2Y1HA 4B4HA 4UTMA 1J9YA 1HJUA 3ORWA 1Q63A 4JHOA 2HE8A 1VBUA 4QEHA 1UG6A 1WOAA 3UXDA 1JDEA 2YSWA 1WDSA 2VFIA 1ZFJA 3IK2A 2WSPA 4C6DA 1UD5A 1POKA 2FZMA 1FXQA 1BYBA 2XM1A 5MF5A 1CXEA 1EYWA 1BVNP 3DZ1A 4PE8A 2CPUA 1VFSA 3NZPA 4EACA 4QS6A 3W37A 2PBGA 4B9ZA 4D8AA 3WNNA 4CKQA 3QLDA 4XO6A 3CPUA 5LZLA 3DFHA 3RLGA 4V2XA 2EG8A 3LY0A 4IUGA 1XCFA 2IQTA 5HWNA 2WQPA 3QOMA 2I9EA 3CUGA 1ZZMA 4M81A 5CSYA 1R3TA 1E3ZA 3UJFA 1O1HA 3Q2DA 1SW7A 3N4EA 4AWTA 1QWKA 3WDJA 4ZXOA 2R6OA 3UR5A 3MU7A 2GQ8A 5MKGA 5FEWA 3LBOA 1JCJA 2ZE0A 4GNJA 2WZTA 3IGSA 2EG7A 1HVQA 4HT3A 2ZX8A 4LQ1A 4Q8VA 2ZVRA 1E55A 3PHAA 3Q37A 1UR3M 3FJNA 1Z7AA 4GYPA 3N2MA 1IT0A 2ZUUA 1S46A 3V75A 1T41A 4BCEA 1H63A 4IQLA 3D3AA 1E0WA 5IBXA 3FAWA 1UWQA 4IGHA 4P8UA 4W4QA 2Z1KA 4WOZA 3W1QA 1XRTA 1G5AA 4AZGA 1LL7A 2PDBA 1YW1A 2QS8A 3H26A 3SCRA 4CCZA 2GZXA 4O4VA 1KBBA 2YOCA 1K8CA 3ID7A 1V02E 2WXDM 4J2PA 3W26A 3ZO9A 5ABFA 2QJMA 1QNQA 2VXNA 2GJXB 3IWPA 1H1ZA 1BLIA 2NXIA 3BZJA 1CPUA 4J3WA 5CSSA 4JIQA 4KRUA 3CQ0A 4F8XA 2PDNA 1FRBA 4JFVA 1NDVA 5D2XA 3IUIA 3HMJG 4AHQA 2QJGA 1SO5A 1LT7A 1JYNA 4R5EA 2W66A 3DUGA 4NVTA 1GOKA 2VZSA 2F61A 3K4WA 4HK6A 1PO9A 4FXJA 4B5NA 5IFPA 1YDOA 2OO6A 5FJUA 5FSEC 4DBDA 1TV5A 1TRIA 5K9XA 1ZL1A 4GRSA 1EO5A 3TFCA 2XG9A 3M0XA 3GY1A 4M1BA 3LYEA 4YPJA 1WCGA 4KCWA 1ELSA 2DT1A 4MB4A 3FKRA 4GUGA 1M9HA 4H83A 5XIAA 5HNNA 4K3ZA 2UY4A 1EBGA 3K8MA 4ZO6A 3P67A 4D6CA 3WFAA 2D1ZA 2R1LA 3BGJA 4O1FA 3OU8A 1N8FA 2XN2A 1P0DA 3T4CA 3OZMA 5GQBA 4QLJA 4JTCA 2ZC8A 1CLXA 3UEQA 1GYLA 2EHHA 4YIWA 2HV5A 4QJ4B 5EYWA 4UZSA 3SBFA 3BAYA 5DMNA 1JVNA 4MPQA 1IWAA 1NWUA 1DJZA 3U2EA 3V5FA 2VWSA 2V38A 4LAZA 1ENUA 3WKZA 3BLFA 4IGNA 5LGXA 3S1WA 4IL0A 3L12A 5LNUA 2CEQA 2DZVA 3DFYA 2NUWA 2HXUA 3AIEA 4GIAA 6XIMA 1DWHM 3V3WA 4WY0A 3KOYA 1VBGA 3OQ8A 1VLWA 3AMDA 4K68A 3EWZA 1WKYA 1UR0A 1KCXA 3DI1A 2R9RA 3BSMA 4LEFA 2A3LA 1MW3A 5BXPA 4B5TA 3A4JA 3SO7A 1VCVA 1E0TA 3KBNA 4H6RA 2GJLA 1WDPA 1B4EA 4HHMA 1XF0A 1VFLA 1R7OA 3SUSA 3WLQA 2BBFA 4GFSA 4PCNA 4NJGA 1E73M 1EP2A 3GNDA 3QYQA 3GIYA 1WZKA 3QPEA 3CEUA 4QITA 4MYAA 4HOZA 3NOYA 1V0NA 1WX0A 3RPMA 2AOSA 3CT2A 3PTDA 3C0QA 1T5AA 2BVYA 1LQAA 5LGZA 1PIGA 5DRCA 1ZAHA 3SGZA 3THUA 1EF2A 2Z0IA 1I6NA 3UA3A 5ABTA 5I78A 5KITA 5M5DA 4GZJA 2FYMA 2VX4A 1W1IE 1I8JA 5B80A 3K30A 4CQ8A 3BJFA 2DDXA 3TVAA 4KERA 3PJXA 1KCZA 3HM7A 2FVKA 1B57A 3T09A 4FXSA 4AMAA 3MSRA 5F1UA 2CC0A 4GABA 3G18A 4GC3A 1RCOB 1NOUA 4Q4OA 1BRLB 4PMDA 3ALGA 4UNKA 4RNHA 3QN3A 4RUBA 2HMCA 4W8AA 4C6BA 4PTMA 1E5NA 4MWAE 5DMYA 3M7SA 4PUNA 3ITGA 1Q7MA 4PB5A 3USZA 1IXNA 2NWRA 3C86A 1XYZA 1TMLA 3WMLA 1W56A 3E38A 5BXSA 3ZSTA 3DFSA 2ZRUA 1R46A 3PZTA 3STPA 3AXIA 5A6KA 4GX8A 4ZO9A 5PTDA 2J7DA 3DG6A 3RLUA 2A79A 4HBKA 2BLEA 3MMDA 1FWTA 4MDOA 1XCWA 4N2YA 3WELA 1CXKA 1VYPX 3SUVA 3BLDA 2VZTA 3R89A 3POHA 2ACUA 2H9AA 3FN9A 4GQGA 3UGRA 1H1NA 1YADA 4TVCA 5E09A 2BGSA 4Q3MA 3RCYA 1J4EA 3M9YA 3R1ZA 4ZBCA 1X7FA 4XQ6A 1M7OA 1BGGA 3SY8A 3S6DA 3KOWA 3LPGA 1HL9A 1I2RA 4KKXA 4PB4A 4RX0A 3W74A 1C8YA 1PZ0A 2PDMA 2VEIA 1VRXA 3BQ6A 3I65A 4N7QA 2QCMA 1AD1A 4D2JA 2Z1BA 1A4MA 3WQDA 2HPMA 3CWOX 4XIAA 4JX4A 4PBEA 4K2SA 3U7BA 1UWTA 5CPLA 4S2BA 1EQPA 3AMKA 3HN3A 3LS9A 5EB8A 3NL3A 3VTRA 2INEA 5AYIA 3VDGA 1QW9A 3KZSA 4XZNX 4WJEA 5HQEA 3W53A 4DJFC 1PYFA 3KCLA 2YPIA 5I6SA 3TTEA 5G2WA 4I7WA 1QRQA 3SRHA 1VFFA 2V3DA 2HVNA 4R9XA 1PL9A 3TYAA 2Z4GA 3UXAA 3VM7A 1BXNA 4A3HA 2VZUA 2RDUA 1ONWA 1P4CA 3GU1A 3H7RA 4IIHA 3WD4A 3KVKA 3WLMA 1MUWA 1PS9A 2A3BA 4MDPA 2QQ6A 2O0TA 1TUFA 1JD9A 1OT1A 3MUAA 4HSNA 3RCNA 3AU6A 5FIPA 1Y5WA 3TTQA 3ZYZA 4ERIA 3ZXWA 3LRKA 4ZQNA 2J62A 3UG5A 4LH8A 2ACSA 1R2TA 2J8TA 1ESWA 3A5VA 3UWEA 1DL3A 3AYSA 1V6YA 3KW3A 1PEZA 3ARVA 3EX3A 3MHUA 3H4XA 2AQVA 1F4HA 4NILA 1ICPA 2XH2A 3ABZA 3CQKA 3B03A 1HNYA 3B8UA 3I7SA 1R9ZA 1VBRA 1ZY9A 4PTVA 4Y96A 3UPMA 1LYXA 5EBAA 3CUFA 5A6LA 2W91A 2A3CA 2QDGA 3WH7A 4FLRA 4AQLA 3KX6A 1H4PA 3CH9A 1LWIA 8CGTA 1X97A 3ZJ6A 3ARWA 1S2VA 2Z26A 3N3MA 2DEPA 3H54A 1UBPC 3AMCA 1IYXA 3CPGA 4WCJA 1LWJA 3N19B 2D73A 3BLIA 3V0SA 3GNXA 3ENLA 3LHUA 3LV6A 2J27A 2XIMA 3DKJA 3TQVA 1EXBA 4NG3A 4MFDA 2VELA 3LOTA 4XTIA 3TJ4A 2GGJA 2PDWA 1VEOA 1KFKA 2VGGA 3K46A 4HA0A 5E0CA 5CEWA 1VFMA 5HANA 4HCLA 4HA1A 1JJKA 3JS3A 2IS7A 5FA5A 4Z2GA 4U4MA 4EP8C 5K9DA 1F6KA 4Z0JA 5KZ6A 3NL5A 1H62A 3CAKA 3MZ2A 2NX1A 4JNMA 2TYSA 3UQNA 3W2UA 2XFWA 3SRDA 1KR0A 3APYA 4F3HA 5C9ZA 4ORMA 4ML4A 3UD6A 4JOMA 2CLKA 5G2HA 1DYSA 3UZ5A 2QW5A 1XHGA 5GPRA 3E9AA 4O52A 5A2AA 4G1KA 1KC7A 1K4HA 4DM1A 1YX1A 4YTQA 3DDMA 4MOZA 4PCSA 1W9VA 4DVOA 4ORIA 3IK4A 4S3KA 4B3ZA 2DSUA 4J40A 2JKAA 3PBUA 1WAWA 5CKSA 2HJPA 2VM8A 5CC5A 1UD8A 1A4LA 4LCRA 3SADA 3QQ1A 1LQ0A 2I1OA 4TV6A 3O8AA 1EOMA 5JUVA 2WC4A 3MCNA 1F3TA 4UR7A 2BHZA 6ALDA 2AGKA 3G22A 4DWSB 1Z42A 1LRQA 3U2OA 1F2JA 1VF8A 2V9DA 2OG9A 3QYSA 3CPRA 4ZQOA 4YWIA 3BAJA 3UXKA 4PB3A 3IACA 4GI8A 1K8YA 3EWBX 1Q6QA 1TTQA 4UNIA 2W63A 4GKLA 1W1A1 4KT2A 4ROQA 3HIJA 3B0PA 3UY7A 1Q8JA 4JTGA 1V6XA 4J9JA 3FAXA 4HJWA 1KFBA 3GD6A 3RG6A 3HU7A 3FXYA 3L65A 3SN4A 2DVXA 2JBMA 3TK7A 4AW7A 4G1NA 1HX0A 3W84A 2HBVA 2ZYFA 3K1DA 4TUFA 4AWEA 2OPJA 4S3DA 3ITOA 3WQOA 2VO5A 1JULA 3VX1A 4JTDA 3DENA 3G6MA 2C8NA 1KTNA 3BMWA 4ZENA 2YW3A 3WJWA 4IX0A 4GO9A 3VIIA 4DUVA 1C90A 3PAJA 2PB1A 1SR9A 2X0YA 3LG3A 1OK6A 4HU4A 3O06A 1HJWA 3ARYA 3H2CA 1VIZA 2A5HA 4ZQMA 1XV8A 3ES7A 3OODA 5C71A 3M43A 3WSUA 4G9PA 3EEGA 2QV4A 4PSPA 1U1JA 3LENA 1KM4A 1TX0A 2ZA2A 1JG9A 1EDTA 1Q6RA 3P8IA 4HK7A 4AZ6A 3FJ6A 4XZLX 3AFBA 1ADDA 2H6RA 3W7DA 6TIMA 4TTUA 3S9IA 2YBTA 3OIXA 3O0KA 1TPEA 1OFEA 2H3BA 3IUDA 2R1PA 4US5A 3PUGA 2JF6A 2VC6A 3WZ0E 4B91A 1SVDA 1CXIA 2YCIX 3GFZA 2WMHA 3BMVA 1DQWA 4LVFA 1C9DA 1XLAA 4H9UA 4S23A 3G8RA 3NQDA 3IGXA 1A50A 2NUYA 2PD9A 3Q45A 3N29A 1TPC1 4JR5A 4PMYA 3WEMA 3ZLGA 3L68A 2VX6A 1RA0A 3WH6A 5FEXA 4UQAA 2VZVA 3GG8A 1R2RA 4O1BA 2PD5A 3DGBA 1K8ZA 1B3WA 2YZ5A 5BW6A 2W4XA 3IVUA 2VNCA 4REQB 2WNQA 2NX9A 2D3LA 3S6OA 2UY2A 4MSSA 1KRAC 3ITVA 2NVCA 3MUXA 3QR0A 1MW1A 1L2UA 4KEMA 4NAFB 5E6ZA 4AYSA 2ZWYA 4JQ2A 4MADA 3UWYA 2VC7A 3ITTA 1XBVA 3CIVA 5F2GA 1LJYA 4FPSA 1TV4A 4KPLA 2HVMA 3QXBA 3OBAA 2ZQ0A 4GY0A 2J7HA 3EDKA 4QJ3B 3M5YA 4FLSA 5HMFA 3VMPA 2NT0A 3WL1A 1EGVA 5DMLA 2BHYA 4MB5A 5AHNA 8XIMA 2DH2A 1KRMA 5CBBA 4D6EA 3FEQA 3SUTA 2WQDA 4AZ7A 4Z2JA 1M5WA 4OV4A 3QOKA 3IJQA 2OGYA 3W28A 2BVDA 3HF3A 1RALA 3QF0A 4JDBA 4C6PA 1US0A 3WLRA 5CGTA 1NARA 4DPPA 3TDFA 1U22A 4ALDA 3PP7A 2F6UA 2FZBA 5E5CA 4IGSA 2EJ1A 2VFGA 5I3DA 3TYBA 3GG1A 4FP1A 4PMUA 3UWVA 2Y7GA 2J47A 2WJDA 4A2RA 4GACA 4Y9OA 2YA0A 3AMGA 1NEYA 4QCEA 4PODA 4X0NA 4GYJA 1P7TA 5L6UA 4C7FA 2VEPA 4K7VA 2G96A 1YNQA 2KX9A 2ZX6A 3DAQA 4IFRA 2VRJA 2GVJA 3MUY1 1E5JA 3TFXA 1I2PA 2Q8LA 3W6YA 3ZT7A 3SI9A 3C0JA 2QF7A 3N13A 3F5LA 1GZGA 3VNZA 4S38A 3AI0A 4R88A 1J6OA 3GH7A 3G6LA 2PDKA 1B31A 4RJEA 5K4ZA 2QDDA 3GVGA 2BY3A 1GONA 3LD5A 1XYMA 4C6QA 4CD5A 3AHXA 1A3WA 2ZZ4A 1EA9C 5C6MA 3H4WA 1RQBA 3FYPA 3P93A 1X96A 3W7MA 2YCLA 4GQ0A 2DW7A 3NGJA 3MP5A 3TA6A 5CSRA 4I5XA 1EJWC 3KRBA 3LZ5A 1WKFA 1VKFA 3KP0A 2DIKA 5DCDA 1RLCL 1SW3A 3UETA 1LLZA 2VFEA 1KFEA 1O5KA 1E6PA 1UZHA 3PPGA 3GHTA 5FESA 5DQPA 5CPOA 4GVHA 1XLJA 1WXJA 3UPBA 1M41A 4UFLA 1JZ2A 3VKDA 4M80A 2YZRA 3NURA 4Z2LA 4MLJA 3OOQA 4ACZA 1JYVA 1YNPA 4KH2A 3CL7A 1A49A 2VFDA 3UERA 4ZMGA 3IEBA 3PF3A 3IV8A 3RUBL 3CQIA 1PDZA 2I7GA 4Y6GA 1GVRA 4A22A 3W00A 1SZFA 4AD2A 3N15A 5REQB 2IQDA 4PYSA 1S2AA 1MXGA 1TX2A 3GDKA 3EMZA 4RNJA 2VOTA 5JIWA 2V82A 2HK1A 3BXWA 3P61A 1W9DM 2B7OA 1U5JA 3ZR5A 1QW7A 4K36A 1C3FA 4DAIA 4GLEA 4UOQA 4FEZA 1W32A 2GLKA 3OVPA 1XYBA 2FB2A 3TMLA 4G7FA 2H8ZA 4CGTA 3HPXA 2IKIA 4L64A 4HZ8A 3TOPA 3NWRA 1OGGA 2HQAA 3CBWA 1A47A 4US5D 3ABSA 2P53A 3ZMRA 2CZFA 3ES8A 4ZO8A 5LIKX 3N04A 6REQA 3R79A 1W31A 3WQVA 5EBUA 1U83A 3RDKA 1WAUA 3TW9A 4BWLA 5HATA 1J12A 1TTJA 3NDZA 5D9PA 3W1AA 3MI3A 3LN3A 3GZAA 3M6YA 3OQEA 1AZ1A 1UUOA 3B3DA 2NX3A 4IFOA 2IPWA 1SFLA 3UR7A 4UQDA 4GYKA 3FDGA 3WUBA 3QMTA 5AC5A 4UMBA 1DWAM 1I60A 2J9XA 1OK4A 2E0PA 4IF2A 3AXMA 4LFYA 2ZBTA 3PZUA 2WVVB 1M01A 2CESA 5TAOA 4LUIA 5AC6A 3F03K 3QFWA 3THDA 2E09A 2J25A 3BANA 1FWSA 1JQVA 4HPNA 3NA8A 1A3XA 4YN5A 2CBIA 3KL3A 2IPFA 1GZJA 3OB8A 2ATMA 3AHYA 3TWAA 4QAWA 1VFOA 2G3FA 2UZ9A 4OBSA 4CQ9A 5M17A 4GBDA 2PFHA 5A6TC 2XFYA 2CNCA 2YIHA 4JD4A 3DG3A 1ZHAA 4MYXA 1G9HA 3STFA 4AWSA 4H9XA 3V0UA 4F40A 3RU8X 2BWGA 2JQXA 3K4DA 3NQ7A 2QDEA 5IXEA 1FKXA 1GJPA 1YQ2A 1OGBA 4LUYA 4RR4A 4YWSA 4Q8TA 2UY5A 2FDMA 2C16A 3T8QA 4PBGA 4F0HA 5LHFA 2PDCA 4IQDA 3EPNA 2E5BA 3O1NA 3BL3A 3VD3A 4NY2A 4O14A 4Q7BA 4M6PA 3K8KA 3UT0A 2ZIDA 4XISA 4XTDA 4ZCWA 3R0KA 4QR6A 2G37A 2QJJA 3THCA 3LDVA 2IXUA 3AIRA 1J2BA 1ZJBA 4LNCA 1V03A 4CCDA 2AL1A 2D22A 4QAIA 1QI4A 5KMYA 1LG2A 4Y8FA 2CIPA 2YDSA 1ZPTA 4FF5A 4RLIA 4PCFA 4UCGA 1SFJA 1AQHA 4UFHA 2G0WA 3EWUA 1WDRA 3QY8A 3V4BA 1S2WA 2V5DA 3DBPA 3N11A 1V8EA 1TJ2A 2X16A 3CV7A 3LXBA 3GG0A 1CGXA 5FSDC 3FYYA 2AL2A 4FALA 1XPGA 5H8PA 1W91A 5GJNA 5FF2A 4Y9NA 3EBVA 4US6A 1F73A 3FY1A 3H55A 1ZJHA 4K39A 4TO8A 5G4EA 3PPCA 4MZYA 2NQHA 4KGLA 1AQFA 1S38A 5EFDA 1W1ZA 4CVUA 4YVXA 4CD4A 1MQQA 2W67A 2CHOA 3A21A 2A7PA 1OGSA 1V77A 3BG3A 4FX6M 5A6JA 4GO8A 4K1WA 5DY2A 4DIAA 3GHSA 2C0AA 4C6KA 2PP3A 1YXDA 1L6YA 2YLLA 1S3HA 2PBOA 1A5UA 2PUZA 2Z1SA 3BAXA 1BWVA 4QE1A 5AB3A 4FIQA 3VIKA 1QUMA 3GS6A 4IPPA 4K1GA 4UFMA 1P0KA 4JHMA 3VIFA 4I3GA 3NPUA 5D9MA 2QMJA 3I6RA 1LCOA 3BMXA 3N34A 4WKFA 1UP2A 1S5VA 4IIEA 4ERAA 4AXNA 1F3EA 4LYPA 3LQLA 4AD1A 3MMTA 4LC6A 4Z1CA 1F5ZA 3W22A 2BSLA 4MWAB 1ISXA 3V1PA 3OLIA 1C8XA 4PFHA 1H61A 2CERA 4OECA 3MSDA 3TXZA 1XR2A 2FIQA 3PM6A 1R3RA 2FFIA 3UVAA 4O13A 3LBCA 4PUJA 2AAMA 2Z7GA 2V3EA 1KQZA 2PCEA 3NGFA 4KWOA 4B90A 1RH9A 2NLYA 3FX4A 4AD3A 3ZQ9A 1Q4NX 3C0SA 4C1LA 3UCQA 4QRNA 4Z1YA 4QSFA 3F7JA 3NQ6A 3SZ8A 2A3EA 4A8NA 3DFTA 4GPNA 1TREA 4DHGA 3KTCA 3REQB 2TAAA 1SMAA 3T05A 3T07A 3AIWA 3BJSA 1FXPA 2JEPA 2QGHA 3UP8A 1GVOA 4EVZA 3C2RA 1V0LA 1RD5A 4W84A 3ABXA 4F4RA 4ZGYA 2DP3A 2F38A 3WF4A 4U2ZA 4DN1A 1PHQA 3CHVA 2OQYA 3WNKA 5AYBA 5EGRA 1JYXA 2GPTA 1EHNA 3L2MA 4MJMA 3CUHA 3LLXA 3U4FA 4B5UA 4RE0A 1OCNA 3VINA 1PX4A 2A4AA 1WQ5A 4JY8A 3LV5A 3O63A 4B16A 2VVSA 5HA7A 3T2PA 3VDCA 4OOZA 3E1F1 5TD4A 1KO0A 4RKAA 3BCDA 3ZIZA 4OHQA 2UY3A 2V69A 4C7GA 1EGZA 3ICJA 3FV9A 4NJKA 3MHGA 2WM0A 4JQAA 5F4WA 1EUAA 3USBA 1XLIA 1YBQA 4FSAA 3WK1A 4EXBA 2DORA 1PBGA 3LRMA 5I09A 3QGVA 3TONA 1XDMA 4AIOA 1FCQA 2PI6A 1XIMA 4Q4RA 2DU2A 4S3JA 1XBYA 4EXQA 1K6WA 3W7HA 2BXYA 5HPOA 3G1YA 1ZS2A 3SW6A 4Q32A 3W9ZA 3SCOA 1T8QA 3BCJA 4BF7A 3LCHA 3OP2A 1LORA 3PN8A 1UZ4A 5ENLA 4DBUA 2XWEA 4DJFD 1Z8AA 3NQMA 2WJEA 3T81A 2WBGA 3URBA 5LNRA 4JTHA 4GJJA 3FSTA 4LS0A 1OABA 5BMXA 4O28A 1IT7A 1XLGA 4KIRA 3OLDA 1S5WA 1H7OA 4B4FA 4KRTA 3VDHA 4PH6A 3RLHA 2XUCA 1HJQA 2F9RA 4TQTA 2VR2A 4C7DA 2YDRA 2WYSA 3EWDA 1VRDA 2Q02A 4M51A 2PE4A 4PEEA 1V3IA 2BVWA 2J7BA 3T0BA 5G4HC 1E43A 2G4FA 1QMLA 4OV9A 2WM1A 4L4PA 3P2VA 4M8UA 4NQ1A 2Z1XA 2WSRA 3N1AA 3KOZA 4MAVA 5E1QA 3P14A 4U2YA 4FNTA 5B7ZA 1B54A 3N25A 1SO6A 4HIBA 1LTDA 1VH7A 3NCOA 1AH3A 2FJUB 4P8VA 1F74A 1LUCA 3GE7A 4U10A 4WUIA 3TV8A 1QT1A 1PAMA 1DP0A 2O92A 3PTKA 1JD7A 3UZXA 1TV2A 5C9UA 4DZHA 1DJIA 2ZUMA 3MSYA 3NPVA 4HOWA 1OZMA 1RQEA 5JBDA 2A3AA 2NXGA 3TQKA 4IQEA 3GR4A 4HYVA 5MKGB 2CWXA 3R0UA 3RITA 1B9ZA 4YLWA 1PSCA 2PWVA 4O10A 3PK7A 5TNVA 4HGXA 5LIYX 2C3ZA 1RJRA 3O07A 3H4GA 2PC8A 3E5BA 3WN6A 3VD7A 1UPMB 4RNFA 3BJTA 2OJPA 2PTXA 4N9EA 1DJHA 4QX4A 3B0UX 4BY3A 3VGHA 1PX8A 4FLOA 4P7RA 2BZNA 2Z2BA 1DKWA 2BNJA 2OTDA 3S4TA 1H50A 3L5LA 1ZUAX 1Q6LA 2G3IA 4PMQA 3NQBA 4WSHA 4LAUA 5BOEA 4C6JA 2WKJA 1GT8A 3C8NA 4LYRA 1YTKA 1H5YA 4HPXA 2FMNA 1MFVA 5HQMA 3QLLA 3BSGA 4RXGA 3U5UA 4E4UA 2Y4SA 3H70A 4LVAA 3TC7A 3IGHX 1MNSA 3E96A 3MUIA 3P80A 1BFNA 3F2CA 4N4QA 2PWHA 1HKJA 4ZFMA 4CEXC 2RH9A 4S1FA 3G1SA 3CZJA 4IMCA 4PCTA 4K8EA 4QNEA 4ICNA 1Q4WA 2DT2A 4EAYA 2X40A 1DORA 1CEOA 1GTHA 4IPJA 5FF0A 4MVAA 1FDZA 1SPQA 1A5KC 1PV8A 4HCDA 2XISA 1VPQA 1W5MA 1X38A 3C6CA 1JPDX 3B05A 7ENLA 4S3EA 1OG0A 3FA5A 5EL1A 3JVAA 4F0SA 4UUIA 4B5XA 2DPEA 1BTCA 5D05A 4LW7A 3TEVA 1WDWA 2PTYA 3PR2A 2VR5A 1CGUA 2PS2A 3GB6A 3ZFHA 4AY8A 1V4YA 1CNVA 5F1VA 4GOAA 4ASTA 3UNTA 4H9ZA 3UJEA 1UA7A 2PF8A 3O9NA 1JI1A 1LBFA 1UIPA 4WXZA 1MQRA 3S1VA 3JZEA 2J13A 4O8AA 2EPNA 4H8HA 4BZYA 1YYAA 1JUEA 3AQUA 2J78A 4ATLA 3G1VA 2PSNA 4Y2WA 1J0JA