3W74A

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with mii-4-139
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Dihydroorotate dehydrogenase (fumarate)
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with MII-4-139
rcsb
source organism Trypanosoma cruzi
total genus 105
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2013-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w74A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w74A01
2B7OA 2V82A 3P80A 3QSTA 2RKXA 3P67A 1HG3A 1IIGA 4GWEA 3O6DA 1TPFA 3GIYA 3EX2A 4JTFA 3STGA 5D2WA 1GVOA 1GYNA 1K3UA 3ATZA 1WQ5A 2DJXA 4DPPA 4YCOA 3W2KA 3CIWA 1OF6A 4UTIA 3NQ6A 3P82A 4H3DA 3QYQA 4DO5A 1S5TA 3W1UA 5DXXA 1C9DA 1FWNA 1ME8A 1GVFA 5LHFA 1JCXA 1EP1A 4LWWA 1KLYA 4MY1A 5BOOA 4UCGA 4OV4A 5KZDA 4UC5A 4G1KA 3DKLA 3SFKA 5F2MA 1PV8A 3NL2A 3UXAA 1YXDA 2DORA 3W2NA 3NA8A 5KSWA 4DPQA 3QQ1A 4BFAA 3L2IA 3R13A 1XI3A 2ZCGA 1NVMA 2B7PA 4N2YA 1MXSA 3CWOX 2GJLA 3FJ6A 2J9YA 4N6FA 3W9ZA 2JGQA 2DZWA 2ABBA 4HNUA 3L5LA 1VZWA 4O16A 4O0KA 5KINA 1ALDA 1LROA 3DI0A 3CHVA 4P2VA 1QPQA 1DJQA 2NXGA 3O15A 3E02A 1K02A 4WJEA 5MHBA 3M43A 1UUOA 4JTTA 5F2IA 5DCDA 2VC6A 5DN1A 3W71A 4QM1A 3W23A 1LORA 5K9DA 2RDWA 5L6UA 3PBVA 4O11A 2VFDA 3NPXA 4N9CA 4NT0A 3P8IA 4A2SA 3W88A 1Q6RA 4HSNA 1K8XA 4LW7A 3SI9A 1XBYA 4Z1BA 3LCHA 2EF9A 3S1VA 3RMJA 2V2DA 1RVGA 1MO0A 2R8WA 2FLIA 4IPIA 1FCBA 1B9BA 3L9CA 2P0OA 2YSWA 4LRSA 1U5JA 3L65A 3W7PA 3MP3A 4DQWA 4NNCA 3KRUA 4MOZA 1ML1A 1DVJA 1OFOA 1YXCA 4HIBA 3WK0A 4CQ9A 3U2OA 4HSOA 1EEPA 1KTNA 4IX2A 4XKYA 2H8ZA 1SPQA 3G1YA 2CFFA 2RHGA 2V5BA 5AYYA 1LCOA 4K36A 3PSVA 1O95A 3S42A 2VFIA 4NZJA 2X2GA 1GOXA 4EOUA 1TPB1 2OZ0A 3PB2A 1DQWA 1H61A 1ICSA 4O15A 3C6CA 3HF3A 5I3FA 4O10A 3O6CA 4NXSA 4R53A 3P81A 4JTIA 1T96A 1NEYA 5GVJA 2CU0A 1S3HA 1VLIA 2Y7FA 5G4EA 3L0NA 4X22A 3NQMA 2XN0A 3NG3A 4QQ3A 1L6WA 1SR9A 4FXSA 2J88A 4S2BA 4MKNA 1DQXA 4ZZ9A 4XUGA 3IVUA 1LRTA 2H8XA 1J2WA 4HT3A 3LM7A 4I9AA 1C29A 3W7JA 5G2IA 1KM3A 4FIQA 1WOAA 1PE1A 4O53A 3HG2A 4BR1A 3KVLA 5H91A 4MFEA 1Y0EA 1X6UA 1XDLA 4XBSA 4JTSA 3W6YA 3CT7A 1KTBA 2ZRZA 4ZMGA 3T7VA 3SECA 4HPXA 5E1QA 4H6KA 2CLEA 1I8JA 4Q33A 4UMCA 3DFQA 2H90A 3FKKA 5TQLA 1H50A 4EVZA 1JUBA 2VFHA 4N4PA 1W0MA 2DZUA 2J27A 3EX1A 2VFEA 3TXZA 3S5OA 4GRSA 5E93A 3TAKA 3W2MA 3PBWA 2QCMA 1WBHA 4Y9AA 3C3NA 2E6AA 2HMCA 1L2UA 1JQXA 2EGZA 4XTDA 3W84A 3LDVA 2R94A 5F4SA 4EIVA 3DI1A 3O1NA 2YCEA 1VPXA 1G7VA 1VQTA 2TSYA 1VC4A 3EXTA 3PM6A 5DY3A 5FEWA 1IXPA 2FFCA 1FXPA 2V8ZA 1RR2A 3S9YA 1IF2A 3W7GA 1T8XA 2A6LA 1EX5A 5J5RA 4MYXA 1AK5A 4ZQNA 1W54A 4UTTC 4O19A 2ZBTA 7TIMA 1I2NA 3P5ZA 5LHEA 4TX9A 2Z0IA 1YLVA 2ISVA 3S5NA 5SWUA 1QDSA 4ORIA 3KRSA 4OBTA 1F5ZA 2XN2A 4NUWA 4JGDA 3W7LA 3TSBA 2YZRA 3LRKA 1B57A 3CM4A 3LI1A 4UR7A 3WFAA 2OMAA 3PAJA 1MSSA 3FFSA 3EWBX 4FNSA 1HFBA 4ADTA 1XM3A 3G1XA 3C2OA 1SQ7A 5LNRA 1T0OA 3E49A 1T99A 3PSWA 2DZTA 2V81A 4UTTA 1SU5A 4NJIA 4KFNA 3HJZA 4UTKA 1RZMA 3QMRA 3KXQA 2X1RA 3R2GA 1XUZA 3DHDA 2CZDA 5D37A 5CZSA 4Z1DA 2GQ9A 3TSDA 1VCGA 4LY8A 1ZJIA 3D0CA 2R91A 1SZFA 3KX6A 3STCA 3H53A 3L0KA 1JCMP 4HPJA 1VRDA 5KZMA 4WOZA 2JGYA 3W1XA 3HB9A 4GXMA 1FCQA 4OGZA 5C55A 1HO4A 3NR0A 1F73A 3IIVA 1Z48A 1TQJA 5LNSA 2ISWA 5D2YA 3P5YA 4E2BA 2EKCA 3W7CA 4RXGA 4AHOA 1ADOA 1BWKA 1GQNA 3GXTA 4FNTA 3MHGA 1YTEA 2ZA2A 4JY8A 4JX6A 3EB2A 2BWGA 4PEKA 2HTMA 1SW7A 5K9XA 4BK9A 1EP2A 3W1TA 1YDNA 4JS3A 1QFEA 4XKYB 3V75A 3WK2A 1M7PA 3GDRA 4N9DA 1XL9A 2CW6A 2NLIA 5HWJA 2JKAA 1I4NA 4LS2A 1W31A 3TA6A 2P1FA 2Y88A 3BLEA 4RR4A 4BI5A 2E5BA 4NNAA 2OJPA 2AQWA 2A0NA 2CLKA 3LB0A 3PUOA 4DBEA 3S0CA 2RFGA 3G8EA 3MJYA 2CLIA 3LBCA 4ZQRA 5LGXA 3BW4A 3W7HA 3JS3A 1O5KA 5FF0A 1SSGA 3K30A 4N4QA 4M6VA 4FX7A 4K7VA 4MZ1A 3KFTA 2TPSA 1FXQA 3C2EA 5D02A 1NFBA 3VE7A 4GUGA 1I2RA 1JUEA 3TIMA 5BRBA 3SZ8A 2ZRXA 2QUTA 3LRMA 1YTDA 1FCVA 3SR7A 4LV4A 5BW6A 1GT8A 4O57A 1N8FA 4LU0A 3P61A 4Z08A 3M44A 4RZ6A 2QAPA 4O4VA 4U28A 1XBVA 4XQ6A 3UWZA 1CX9A 2ALDA 3STFA 4DBDA 4JEQA 5AOUA 6ALDA 4HHPA 1OFAA 3MO7A 5I3GA 1KM5A 1G4TA 1EP3A 3F4WA 3E9AA 1OG0A 3Q94A 4RKAA 1QPRA 4RCXA 5DBUA 2PC4A 5CPMA 3TW6A 4A22A 1D9EA 4JDBA 1G6CA 2WKJA 1TTJA 5F4WA 3LRLA 3C56A 3PUEA 1OFPA 1F2JA 2YFNA 1ZCOA 1WBJA 1X7FA 5CPOA 1WYIA 4L4LA 3UWQA 1M6JA 4JTKA 1WA3A 4FIRA 1M7OA 4LC6A 3SIZA 2W79A 3NEVA 5E0KA 1PCWA 1H7RA 1PHWA 4LTSA 4FNPA 1WOBA 2H6RA 1I2QA 3DHFA 1MEHA 2ZZ1A 3QF0A 4LVAA 3M5VA 3ANYA 3TCEA 4DXVA 4S2CA 3Q58A 1S5VA 2QCNA 4QISA 3LTPA 4MJZA 3WJZA 2VXNA 1CI1A 4RJEA 4WQ6A 3KVKA 3MI2A 3OEXA 4QITA 3TX9A 3W73A 4LUJA 3FYPA 3DBPA 4TIMA 3P84A 3QPYA 3ABSA 4RK8A 1TPWA 3NL3A 5DELA 3TQKA 3B0UX 5HR7A 3HOJA 1W3TA 3W7NA 1QNVA 1QPNA 3UWUA 4O8RA 3ABRA 1QWGA 4HNNA 4K8HA 3G3DA 1W8SA 2CLLA 3UXDA 4LRTA 3IVSA 5H2ZA 1D3GA 3C52A 5AB3A 1RD5A 1VHCA 4CNOA 5AHLA 1P5BA 1SZEA 2NXIA 3EXSA 4Y8FA 2GPTA 1OJXA 4IMGA 2LLEA 3HGRA 4L4MA 3HPZA 3FOKA 3E96A 4PTNA 3LXAA 3QZEA 4JYDA 3NYZA 1K7FA 3RNDA 3A24A 3PBUA 3UY7A 4FXRA 4K39A 2C1HA 3RFAA 2NX1A 4HN4A 1HO1A 3I7SA 1YYAA 4XTIA 1XUUA 2WNZA 4CCEA 2P10A 4ZQCA 3L5MA 2C19A 1A5AA 1QR7A 1VYRA 2DZSA 5TIMA 3MUXA 2V30A 1SUXA 3NL5A 5C5YA 5U4NA 2NZLA 3B05A 2Y7GA 3A23A 2QCLA 2DZPA 3NNTA 3UPBA 1J4EA 3F4NA 4DO4A 2ISSA 1Q45A 1GWJA 2Q8LA 4AWTA 3M0ZA 5F2GA 3G0SA 3W76A 3G22A 3L5AA 3W1MA 4U4MA 4B5NA 5I3HA 3R5EA 4GUIA 3G1SA 4LNYA 3EWUA 4PODA 1TQXA 4PL2A 3TAOA 3A5VA 3C4UA 3S1WA 1ME7A 3L66A 3BPWA 3PULA 1BKSA 2QKFA 3SGUA 4WXZA 4YMZA 5AN7A 3PBYA 1XCFA 1XBZA 1G4SA 4ZL1A 3NM1A 1GG0A 1KW1A 1W1ZA 2HSAA 1LOQA 4I7UA 2IQTA 4LVFA 5LNVA 3WJWA 1KFLA 1THFD 1H1ZA 4JIQA 1OX5A 5ABTA 1NSJA 1XKYA 1G7UA 1DHPA 4MVAA 3ABOA 1QO5A 3P7YA 3ZR4A 1O60A 4UTUA 4TMBA 3N14A 3OBKA 3B06A 5AHMA 3NQAA 1H51A 1PIIA 1SO4A 1UCWA 4Z0JA 1UB3A 5C54A 3FA5A 4JD4A 5BMXA 1FWRA 2FDSA 3QMTA 3THQA 2VEKA 4GUFA 5AYXA 2Y61A 4Z0SA 1J5TA 2EPHA 1I2OA 1SSDA 3MMTA 1H7NA 3SGZA 4AVFA 4AHPA 2C0AA 5EYWA 4FO4A 4CCCA 2QAFA 3W70A 4HNVA 2C3ZA 2QCCA 4Z1AA 3STEA 4MLJA 3I7QA 2VFFA 1H60A 2YX0A 4M7SA 3M5ZA 3W1LA 5D30A 1ICQA 1BTMA 4UFIA 1FBAA 3EWYA 3QPZA 2YR1A 1G4EA 2FQIA 4FNUA 3W86A 3CPRA 1EIXA 1G4PA 4FX8A 5LZLA 5K4XA 3OVPA 3W07A 2HS8A 1IGSA 4AMAA 3GDKA 1ZENA 1H7PA 3IIZA 3WK1A 3DFPA 4OWGA 1PCKA 4JX4A 4Y90A 2CWNA 1V5XA 3DFSA 3QFEA 1AW5A 4K6AA 4Q4KA 2BSLA 1QOQA 1R30A 3LERA 1OFDA 3SJ3A 4CNNA 2QCGA 3Q37A 2Z6JA 5I3JA 4FEZA 5CPLA 5AHEA 2OCZA 3W7RA 3TH6A 1TPUA 3RLUA 4GUHA 1KFKA 4JXCA 2R14A 3LX9A 2DZVA 2Q3OA 3TUUA 3T44A 1B4KA 4O54A 5AHIA 2YW4A 4MZ8A 5FESA 2ZZ2A 1YDOA 3H54A 1RQBA 3GR8A 2NX3A 5F1UA 2FIQA 3U6WA 3P74A 2NWRA 3RF9A 3NPWA 3W1NA 1P1XA 1TIMA 4N02A 1KTCA 2ZDRA 3HBLA 4LVBA 4XWUA 5D05A 3P62A 3DKJA 1XFBA 4NU7A 1UUMA 1OF8A 3LTSA 1BEUA 4OHQA 5DCBA 3FYOA 4WY0A 3W83A 5FEXA 1Z44A 3VI2A 4O0ZA 5U7SA 3UQNA 4RX0A 3IGSA 4JX5A 5CKSA 3NQFA 3GDMA 2JKPA 3CU2A 4A3UA 5HMSA 1W5NA 5HR6A 3E0IA 4I7VA 1F76A 1SZGA 1TJPA 5CSSA 3S1XA 1YDVA 3GXPA 4X2RA 3LBMA 5D03A 3LI0A 1VYSX 1KA9F 4IJBA 3PB0A 2QJGA 2NV2A 3CIXA 4MY9A 1Z42A 5K2ZA 3LHUA 6TIMA 4O28A 4GJ1A 1EPXA 5HUOA 2EAWA 3MI6A 3GXNA 1DORA 1EUAA 4ADSA 3PR2A 2CLMA 3PC0A 3ABQA 2ZZ7A 3FJLA 3BLFA 3DZ1A 1OFQA 3T55A 2NX9A 3TQ0A 3HGOA 4O1CA 1SW3A 1TO3A 4O52A 4NJKA 3LXBA 4BI7A 4DELA 1E51A 1LBMA 3BV4A 1KV5A 2YFOA 3A22A 1W3IA 4EF9A 3L67A 5FF7A 4RXFA 3QMSA 1A5SA 4FNRA 3G1AA 2ZZ3A 3W7KA 1O4UA 3NO5A 4IXHA 1EA0A 3NQDA 2I9EA 4YLWA 2BXVA 1R2SA 4J9JA 3AO0A 1KV8A 5K7JA 2QCFA 4AEOA 1L6YA 1VH7A 3G3MA 3LV5A 3QH2A 1P0NA 5G1YA 1K7XA 2B7QA 5G5IA 3MYOA 5L9FA 2ZTKA 3TMLA 5HUPA 3B4UA 2YGYA 5HJLA 4W9TA 3C61A 3VNDA 2Y89A 3O05A 2O7SA 4MZYA 4QAIA 1MZHA 1RQEA 1GVQA 1VCFA 1FDYA 2BX7A 3I6RA 4IX0A 5IBXC 3LOTA 3LXCA 3CC1A 3EX4A 4K37A 4LS1A 5DY2A 3W7IA 4WZHA 4PH6A 2OT1A 3NPUA 3TR2A 4R7JA 1VLWA 3TQVA 5F4XA 5CZ0A 1GEQA 2BZNA 4MY8A 2B4GA 3QSRA 5C6MA 3BG5A 3TW7A 3W22A 3G24A 2ZYFA 1OK6A 3LCXA 3CLMA 3SY5A 4LV9A 1GZGA 2E5CA 5I3KA 5FF4A 3NQCA 3V1PA 4OV9A 4OT7A 4JNMA 5EBUA 3EWWA 2B0MA 3NPVA 3F1QA 2C13A 4DEFA 2A21A 3M6YA 5IBXA 5TBOA 3C8FA 2B7NA 2ABAA 3USBA 4K8EA 4QNEA 1G69A 1RPXA 3N9SA 1TTPA 1VGAA 3TNOA 3QRHA 1JRBA 4JTEA 3W1AA 1K8YA 3BO9A 3GKAA 2NV1A 2NWSA 1YTKA 3NQGA 4OU1A 5AHFA 2XN1A 2JK2A 2C14A 3CTLA 1NAL1 1FY6A 1A53A 5CG7A 1KM4A 3ATYA 2DU2A 1XDMA 1Q3NA 2C16A 4JICA 1QPOA 3QW3A 4IWWA 3TDFA 3ELFA 4NX5A 3FIGA 1PS9A 2ZZ6A 3LCLA 2Z6IA 5HULA 1HUVA 1OFBA 2NXHA 2WSQA 3LLFA 5G2HA 3KOFA 1Q6LA 2WNNA 1FQ0A 4AAJA 3FKRA 4XZ9A 4O17A 4O4WA 2RDTA 3L21A 3NQ2A 2J9XA 3UYCA 3QEZA 1AL8A 3BLIA 3M16A 1GJPA 1TRIA 1GVRA 1ZAJA 3ZS4A 2QCDA 2C18A 4O12A 2VEMA 4GUJA 1JCYA 1TPEA 2QUVA 2QJHA 3O8AA 1IXQA 4UMAA 1VS1A 5IM51 4WY0B 3GDTA 1FWSA 2KZHA 3G1FA 4UIOA 5I3IA 2YYUA 1DV7A 5LKYA 3G1VA 3TC6A 4JTHA 2TYSA 1TPH1 3IRDA 3QJAA 3TJXA 1TPDA 1GYLA 5D2XA 3R8RA 4TMCA 4MLRA 1PVNA 3SW6A 5DBTA 3HGSA 1WAUA 2DZXA 1OYCA 3I7RA 1OX6A 1FWWA 4KFOA 2WPBA 2A7RA 3IIXA 3DFNA 1TYGA 3G0UA 1H7XA 4IXXA 2YPIA 5HINA 3DAQA 4O14A 3EX3A 4AF0A 2W6RA 4ZQOA 3HQ1A 4R33A 4O18A 1LM1A 4IUOA 1W5QA 3HPSA 1AW1A 5KZEA 4UFKA 1TPVA 1JR1A 5D2TA 2A4AA 3NQ8A 4KWWA 3ZFHA 1XXXA 2A6NA 3S1UA 4PC8A 4JY9A 4BI6A 5F2LA 3HG5A 4CQAA 1FCUA 4XBKA 2O7QA 1KM6A 4JTGA 1YADA 1K8ZA 1YPIA 3LV6A 3W1QA 1Z41A 2AGKA 3MWAA 4YCPA 1TV5A 3S5YA 2CZEA 4Y6GA 3B03A 1MEWA 3O07A 3UWVA 4JR5A 3FEMA 5D38A 1B4EA 4HKPA 3CEPA 4IMCA 2DJLA 4A21A 5F1VA 2ZRYA 1W37A 3OA3A 3UWWA 1AW2A 5CZJA 3GX9A 3I68A 3BW2A 3W85A 1N7KA 5D04C 2HS6A 4LC8A 2A1YA 3BW3A 3RK8A 4YXGA 5EL1A 3EEGA 1RV8A 4ALDA 1X1ZA 2D73A 4UMBA 3LGEA 3M1ZA 4PFMA 1QCWA 3DENA 3OIXA 3HIJA 3NXFA 4Y96A 2E5DA 3UZ5A 1PHQA 2E6YA 3UD6A 1H7WA 1GG1A 3G0XA 4Q32A 1H7OA 3TXVA 3IIPA 1SFLA 3N19B 4E2DA 2YDAA 1VCVA 1DL3A 3LHVA 2Y70A 4ORMA 3LCIA 3LTYA 2WO5A 1QOPA 1F05A 1O94A 1R47A 4LUIA 4DF1A 4DO6A 4S1FA 3W7OA 4NZFA 2A7PA 4RLIA 2G97A 1JCNA 3IGUA 3L0GA 2V5LA 1ZAIA 3GNDA 2WNQA 1IIHA 4O13A 3EXRA 2VOMA 1W56A 3MYPA 3M41A 3G8RA 3GDLA 3INPA 4A29A 4HNTA 4ZQPA 2OT0A 4O1AA 3LHZA 4K7YA 2PRMA 4YWIA 3F03K 2YXGA 1SW0A 5FI8A 1JVNA 4MUZA 4NJHA 3BG3A 3OVRA 1SO6A 2E6DA 1C8VA 4OQVA 5HNRA 4R34A 1UBSA 2Q3RA 3LCWA 2QEZA 3QW4B 4P61A 3BARA 3BGGA 1SFJA 1TCDA 3I65A 1KFEA 5DCEA 5LSMA 2PRLA 4POCA 3W7MA 5FEZA 5EA9A 1DBTA 1ZY9A 3GNNA 5EY5A 3TKFA 5DLCA 4EWND 3NM3A 2CZ5A 1ZHAA 1TRDA 3KRZA 3Q2DA 4QSHA 1OHLA 2PURA 2BTMA 1V7YA 3IVTA 1DKWA 4IGHA 3HGJA 3LLDA 1CW2A 3HG4A 3W75A 1G67A 2QCDB 3TK7A 4QJ1A 2E77A 2J6XA 1X8FA 4KFPA 4MJMA 3GAYA 3PF3A 4UXDA 1B3OA 4TU1A 1FDZA 1GTHA 2V2HA 3B8DA 1N55A 1TPC1 4LOCA 1LTDA 3JRKA 4GE8A 1AG1O 4WY0F 3PS7A 2A2IA 3AJXA 4JYEA 2FTPA 4O1BA 8TIMA 3N3MA 1KM0A 1LRNA 2A7NA 2QDHA 4AHQA 3GKFA 1FUYA 4UFMA 2CLFA 3NL6A 1EUNA 3DU0A 3MBFA 3TC7A 3N9RA 1AMKA 4LT9A 1H63A 3MHFA 2VEIA 1TV7A 1TREA 3HG3A 5D2VA 1HL2A 3ZWTA 1X1OA 4BF9A 4YL2A 4UNKA 4JTLA 3L68A 4A2RA 2QCEA 3TROA 3NOEA 2GJNA 2TMDA 3KAOA 4AF0B 1KFCA 1QMLA 2OX1A 1IXNA 3KVJA 2ZA1A 1TV8A 3C2RA 2C15A 3S8HA 4CQ8A 3GR7A 2FPTA 1OYAA 4AWUA 1LP6A 3S5ZA 2X1SA 3GVGA 3C2FA 3N34A 2ZFAA 2ZRWA 3MBDA 4CCDA 1TB3A 3BK0A 3W2UA 2J9ZA 1R2RA 1OFRA 4NXKA 3NAVA 4UTLA 1K7EA 3WK3A 1JULA 1FWTA 2V2CA 1KFBA 4NNBA 2E1DA 1MEIA 5G4WA 3A21A 1H1YA 4WD0A 3W2JA 1LDCA 4E38A 4H4IA 5AFDA 3OVQA 2Q8ZA 5CGQA 5A5WA 3DH7A 3C0JA 1QAPA 3O06A 2Z1BA 3M9YA 4C1KA 1OFEA 1LOSA 1W5OA 1A50A 1LYXA 4ZQMA 2Y7EA 4AWSA 1ZAHA 5J5DA 3MP4A 2V0TA 4BWLC 5K4ZA 2PE4A 2QCHA 2ATSA 5AC7A 1JCJA 5EMUA 1JCLA 3BG9A 3GB6A 4LS0A 2GVLA 1UASA 4AB4A 4IMEA 1DJNA 3W2LA 4NQ1A 2Y7DA 4MIMA 2GUUA 3NQVA 5C2XA 3W1RA 3C2VA 2E68A 3DGRA 3VE9A 5AC8A 3QM3A 3W7DA 2ZQ0A 4IPJA 1WV2A 2Y63A 4NX0A 3TU9A 2BLEA 3G18A 4IOTA 4KWVA 5LNWA 3W74A 4MFDA 1UJPA 4UFHA 4CNPA 1LLWA 1GVSA 3W7EA 4EF8A 2CLHA 4BWLA 3KHJA 1P4CA 1HTIA 4K38A 5HWNA 3OHIA 4GFSA 4M6QA 4JN6A 3WJSA 5D33A 2ATMA 4IMDA 1YXYA 3LHTA 3VKJA 1M5WA 2C6QA 1SO5A 5KMYA 1FDJA 3B0VC 5FF2A 1OX4A 2ZRUA 3LHWA 3MHUA 1A5CA 3NZ1A 3LCFA 1VYPX 1H5YA 1Q6OA 3LHYA 3TE9A 2W0UA 2Y6ZA 3PG8A 4O50A 5CZTA 1AL7A 1LBFA 1JRCA 2XFWA 2FJKA 3MP5A 1KM1A 3CWNA 4RZ5A 2WQPA 4LVGA 2F84A 1F74A 2DP3A 3W7QA 4NJJA 1ME9A 2ZA3A 3TFCA 3NVTA 1A5BA 2EHHA 3TMQA 1KBIA 2VENA 3TFXA 3M47A 3KVMA 3M5YA 2J24A 1VJIA 1VR6A 2WSYA 1GTEA 4M6PA 4AXKA 3YPIA 4M5PA 3PG9A 2X1UA 4MPQA 4CLMA 2QR6A 1LBLA 4GBUA 5EKYA 3N2XA 3VFLA 1ZFJA 5K9CA 4UTJA 2I1OA 4WOQA 3PY2A 2G95A 1QO2A 2PCQA 2PRHA 3GLCA 5D09A 3HPXA 2NUXA 3WJXA 4GNJA 1KFJA 2H3BA 2QDGA 1LRQA 3TSMA 2QF7A 1I45A 1TTIA 2NUWA 3GK0A 4TO8A 2GQ8A 3IEBA 1P0KA 1LOLA 3TJLA 4JDYA 3HO8A 1NF0A 5G2WA 2Y85A 3DXIA 2UV8G 3MW7A 2YW3A 3H55A 1R46A 4N9EA 5BMWA 4JYFA 1JJKA 3PUDA 1JQVA 2VFGA 3JR2A 2X16A 2FB2A 4JTUA 5LNUA 5DXYA 4DF0A 4UTMA 3FLUA 4C1LA 3G1HA 1TTQA 3IIOA 4ZVJA 4FX6M 4UFJA 1ONRA 4UTWC 3EWZA 4NVTA 1L9WA 3CQ0A 1IXOA 1OVDA 1Q6QA 4NJGA 2QUUA 4TR9A 2JKEA 4FNQA 3DFOA 4IQLA 3BGJA 1F7BA 1XC4A 4UUIA 2GOUA 3N2MA 4WX2A 4PL1A 5AHNA 4UFLA 3UPWA 3WJYA 5HWMA 2WOQA 3UNDA 1OK4A 4Z1CA 4QIUA 4N6EA 3NDOA 1K03A 3QC3A 3PVFA 3T40A 3CB8A 3N73A 4M7TA 4FHAA 1LLZA 4ICNA 3FS2A 3RU6A 5KTLA 5AC6A 3OG3A 2F7FA 4M19A 3O16A 2WJZA 3VCRA 2RDUA 4UTWA 4X9SA 5D32A 1H62A 2CLOA 2CZFA 1RQHA 3NZRA 4N9BA 3THAA 3EKZA 5A8GA 2FPVA 2V9DA 2A5HA 2WSRA 3B0PA 4I7WA 3W87A 1EWEA 3B04A 4LVDA 1ZALA 4QNWA 3UZJA 2H3DA 1SO3A 1O5XA 1PL9A 4MYAA 5LGZA 3E12A 3EKLA 2ZTJA 1EB3A 3DFTA 1WDWA 4RV8A 4DF2A 1EWDA 1KM2A 4ML9A 2G96A 4E0CA 4UTHA 3A5FA 2FPYA 4JIPA 2JBMA 3GAKA 1S5WA 3R12A 3R89A 1SZNA 5CSRA 1FX6A 2A85A 2Y62A 4OE7A 4PA8A 2YYTA 3IGXA 2E6FA 3EWXA 3CEUA 3O63A 5AYZA 4PCFA 4X3ZA 3SSJA 3W72A 5KITA 3EX6A 3M5XA 2Z2UA 4ONVA 3M7WA 3TV8A 2E09A 1W3NA 2GQAA 2ZRVA 1D3HA 1R2TA 3IV3A 3T78A 2QJIA 5K3VA 1F6KA 4ADUA 4WXYA 2X1TA 3U8GA 1ICPA 3ZWSA 1WX0A 1U83A 3BVJA 3A9IA 2VKZG 1KBJA 2ZZ4A 1BWLA 3W3OA 1GPWA 4KKXA 3MI3A 4WUIA 4IMFA 2I14A 2AAMA 2GVGA 3P60A 3S6DA 3UWYA 5CPNA 5FF3A 5HQEA 1OABA 3QQ0A 4UNLA 1NF7A 1JUKA 2ZZ5A 1OX4B 3UY8A 1OYBA 5BNKA 1YPFA 1VHNA 4GC4A 3P8JA 2GVJA 3GZ3A 4O1DA 2RH9A 3NQ7A 5G1TA 4FF7A 1ZNNA 3G1DA 4JTJA 3GYEA 1W5MA 5EPDA 2WV8A 1F6PA 2VEPA 3HMJG 3T4CA 4UR8A 3O6YX 1W5PA 3W1PA 2TRSA 3PWAA 3NQEA 3RLVA 2FB3A 2X30A 1L6SA 4FB7A 1TMHA 1WXJA 2G5WA 1I2PA 2VELA 1LZOA 3LCGA 3NGJA 5FEPA 1TJRA 4AH7A 2NUYA 1XBXA 1KLZA 4RZ4A 5T26A 1DOSA 1TSIA 4D2JA
chains in the Genus database with same CATH superfamily
2G8ZA 3P67A 1HG3A 4G6CA 1B31A 4JTFA 1WKFA 1IWAA 1BVWA 5XIMA 5D2WA 2ZXBA 4JKKA 1H49A 1KD0A 1U1JA 1M9HA 2PB1A 2FJUB 1A5KC 3NQ6A 4H3DA 3LMZA 3W1UA 1OC5A 5DXXA 4NZ5A 1FWNA 1HKKA 3P0WA 1HXJA 1EP1A 1KLYA 1RBLA 4BY3A 3GE7A 4OV4A 5BCAA 2FFIA 1BLIA 3ITLA 5A6TC 4ZSTA 4L1GA 5F2MA 2VURA 1NOUA 2DORA 3W2NA 2ZE3A 5KSWA 1A0CA 4BFAA 2WM0A 3L2IA 2WVVB 2B7PA 4XO6A 3EA2A 4LBUA 1MQRA 2JGQA 2PTZA 2ABBA 1RVKA 2RDXA 4Y8EA 4WHBA 1ALDA 5C9UA 1A3HA 1LROA 1U33A 3CHVA 1DJXA 1VAHA 2CXGA 4P2VA 3BSMA 4GIYA 4LUTA 1XYLA 1BQGA 1K02A 3R4IA 6A3HA 4HSHA 2ASHA 5ECUA 4QM1A 5K9DA 2XZ7A 1LT8A 4O11A 4NT0A 3TZFA 2OPJA 1RLDA 3W24A 3PUGA 3VK5A 3ITTA 1Q6RA 1XFCA 4HSNA 4LW7A 3ITXA 3KBMA 2OYLA 3EWDA 3H2OA 4RDZA 5FA5A 4MDPA 1NWUA 1EZWA 3BCFA 2R8WA 1FCBA 1B9BA 4GABA 2P0OA 3GTHA 4AXNA 3L65A 3W7PA 4J4KA 3MP3A 2GJXB 2JEPA 5A6AA 3KRUA 3MY9A 4U10A 1DVJA 4ILSA 3QC0A 3WK0A 1XRSA 3N29A 2JF7A 4HSOA 4AW7A 4IX2A 4GD0A 1SPQA 2FMOA 1O95A 1YBQB 4NZJA 1QK2A 2X2GA 2XSBA 4M3PA 3KBVA 5C9XA 4PTDA 1ICSA 1EC9A 1FWCC 2ZX9A 1CWYA 2D0HA 5HPCA 2YL5A 4IZGA 3MUAA 3NZGA 1P6BA 4X22A 1BG9A 3NQMA 3IK4A 2XN0A 4HQVA 3ZT7A 5TD4A 2XIIA 1I0DA 3OGSA 2E25A 3WDPP 2DH2A 2VYOA 1LRTA 3IVUA 4J40A 1J2WA 3LM7A 1C29A 1KM3A 4NRRA 4JQAA 4JFTA 2BS9A 4HVXA 1UMYA 1Y0EA 1X6UA 1M01A 4XZMX 2F6UA 1J2BA 3GUGA 2ZRZA 4ZMGA 3RJYA 5E1QA 2X0SA 3B40A 1P48A 2I5QA 4P7LA 2G0WA 5JU6A 3FKKA 2VZOA 1H50A 3D6NA 2CBJA 4N4PA 2FYMA 3BOLA 3NZPA 1QTWA 3S5OA 4LBRA 1HN1A 3VZXA 4GG9A 5DANA 4GRSA 5E93A 3PBWA 3FVMA 2WBGA 4UOZA 2QCMA 2VVNA 2HMCA 4PGLA 1L2UA 1O5RA 4FXJA 2XVPA 3DFYA 2D0GA 3EDKA 3KOZA 3WYZA 4RDYA 4C6JA 1XR2A 2QIWA 1W91A 1UP2A 3PM6A 1Y5VA 4EAYA 1IXPA 1FXPA 3IJ9A 4DJFA 3W7GA 2XSAA 2A6LA 1JZ4A 4MYXA 3BCJA 2PC8A 4ZQNA 1W54A 4XVEA 3SAZA 4Z17A 1QWKA 1JI1A 5LHEA 5A3HA 1BVZA 3VGDA 4TX9A 1A3WA 1B3VA 1QDSA 4HN8A 1NJJA 1GQJA 3KRSA 2B31A 4OBTA 1UQZA 4JGDA 2D2JA 2VCCA 4V1YA 1JNDA 4UR7A 2INFA 5CBBA 4EXBA 1K1DA 2Z1KA 1HFBA 1J6PA 1RBOB 1Q4WA 2J78A 2ZUSA 2WC4A 2E40A 3TYAA 1R7AA 1T40A 1AJ2A 2Y2WA 4HA3A 3TR9A 4Z1DA 2GQ9A 4LY8A 2R91A 3NOYA 4WVXA 1SZFA 3DYMA 3WY1A 5GNZA 4QJ3B 1JCMP 2OQYA 4HPJA 1Q13A 3AYVA 2JGYA 3HB9A 4F0MA 4Q8MA 1A5UA 1RJRA 4GZIA 3IIVA 1WUFA 4HCHA 3P5YA 4E2BA 2J66A 2EKCA 3W7CA 4AHOA 4H41A 2F38A 1GQNA 3GXTA 4JHZA 3GM8A 4HMEA 4L9XA 3MHGA 3RO6A 4QJ5B 4B2DD 2A79A 1EBGA 1NELA 5CQ1A 1B5TA 3EMZA 4A05A 3WUGA 1HJXA 1EJRC 1M7JA 4XKYB 1YDNA 1W9BM 3WK2A 1XG4A 2NLIA 2VC5A 1B3WA 3GH7A 2JF6A 2OSXA 4UTFA 1OQFA 2P5NA 3O0KA 4NNAA 2A0NA 3W37A 3S0CA 2RFGA 3G8EA 3MJYA 3FY1A 4ZQRA 1O5KA 1KC7A 3LK6A 3CHEA 3K30A 3CZKA 2J62A 4FX7A 4MZ1A 4ATDA 3G77A 4F66A 1NFBA 2YB4A 1KCKA 4GGHA 4PBEA 4L65A 2FZDA 2QUTA 1P0DA 1YTDA 3SR7A 1EXBA 4LV4A 5LA2A 1GT8A 4O57A 4ZOAA 3P61A 4Z08A 3R10A 4U28A 1XBVA 3ZXWA 1FHUA 1EGVA 4HU4A 3STFA 4EPEC 4JEQA 2CLPA 5AOUA 1U30A 3MO7A 4LB3A 4Q6XA 1EP3A 3F4WA 4R7OA 1XW8A 1X98A 4QLLA 2D2OA 4LBSA 1G1YA 2BGNE 2YBTA 2ZXDA 1CLVA 3B8SA 3TW6A 3T08A 2BVDA 4M24A 1XIJA 3SB0A 5CBJA 1D9EA 2AKZA 4I6KA 2WBKA 4WCJA 3PUEA 1WBJA 1RALA 3UWQA 1DWAM 4FIRA 1ZPTA 1OC7A 1OD0A 3CZ8A 2QIIA 4R9XA 4LTSA 4ZFCA 1JPDX 1KRMA 3DERA 4I3GA 4LVAA 5E09A 3GY1A 3U4AA 1DIKA 2Z2BA 4C6CA 3E1F1 4BQ2A 1S5VA 5H8UA 4HK6A 3LTPA 1UWUA 3W6LA 3WJZA 1CI1A 2Q09A 3KVKA 4B4HA 3VFCA 3HQPA 4L4OA 3CUJA 4CVUA 1QI2A 3DBPA 3P84A 1UR9A 1DHKA 4KIRA 4RK8A 1TPWA 3CL8A 3MKVA 4DVOA 1VBJA 3LEPA 4BF7A 2X7WA 3S2LA 4PEEA 1R85A 2FGLA 1XSIA 1QPNA 9CGTA 1QWGA 5AYIA 3ZT6A 3U7VA 3UXDA 2VNCA 3COTA 5GQBA 4B3ZA 2ZIDA 3U0HA 3OYXA 4IL2A 5AB3A 1HL9A 2GDQA 2DQWA 5AHLA 4HBKA 3WLOA 1SZEA 2JALA 3EXSA 4Y8FA 5HBFA 4IMGA 1B3ZA 4LJ3A 4ICCX 5A8PA 3E96A 1OGBA 2HJPA 3MQTA 4IFOA 4XSLA 3EEZA 4UQDA 3UY7A 4FXRA 4K39A 2C1HA 4HN4A 1D2KA 4EK7A 3P2VA 3MDWA 3I7SA 3RRAA 3S1GA 3GFZA 4XTIA 4CCEA 1VYRA 3M0HA 4RDWA 3IJLA 3NL5A 1GEHA 3B05A 4S3BA 3NNTA 2DZPA 1J4EA 3F4NA 3T09A 4GXWA 4DO4A 1CENA 4G7EA 2UWFA 2EJAA 4AWTA 5F2GA 2I5IA 4IIEA 4B5NA 3N2TA 3G1SA 3R11A 4PODA 3ZJKA 2EG8A 4Q7BA 4D8LA 4BF5A 3AYSA 1ME7A 3L66A 1XS2A 4YMZA 2J7DA 5FJJA 1XCFA 2GL5A 4JFUA 2ALRA 4ZL1A 3E38A 3WNMA 1ADDA 3V3WA 2WC7A 4GXPA 1H3GA 4TUFA 4WSJA 4IIBA 5LNVA 4WKHA 2BY3A 1EDTA 4NILA 3I6EA 3ABOA 1QO5A 2VGBA 3P7YA 1E6PA 1H5VA 1UWSA 1L8PA 1UC5A 4J35A 1RY0A 5AHMA 3NQAA 1PBGA 1H51A 1E40A 1UCWA 1UB3A 1Q8JA 4GLEA 4DRSA 1JGIA 4L80A 4RNIA 1OD8A 5IFPA 4GUFA 3CHFA 4JKMA 4I9MA 4LUYA 3KWXA 4MPKA 1X8CA 1H2JA 3BGAA 3RCMA 4E8GA 1V3KA 4CCCA 4F2TA 3SUVA 4HNVA 2C3ZA 5BU6A 1FFRA 3KBJA 3IJIA 3I7QA 2QUMA 4L1WA 4LCSA 4B3LA 1V77A 3BH4A 1JF6A 5D30A 4KMQA 1ICQA 3DCPA 3R7MA 4XX6A 2YDRA 3WDQA 1RPKA 5A2CA 3CUGA 4L7ZA 2D1ZA 4KCTA 1EIXA 1G4PA 4BKNA 3EPOA 5K4XA 2O92A 3W07A 1ZENA 1H7PA 3IIZA 1EO7A 3DFPA 4YYCA 1UD4A 4OWGA 1PCKA 4JX4A 5CC6A 5ENLA 1ADSA 3DFSA 4ICMA 1E43A 2BSLA 3JVAA 4GVHA 3SJ3A 3NJ3A 5I3JA 4FEZA 4L5ZA 1TJ1A 3W7RA 3TH6A 1TPUA 3GBEA 4GUHA 4JXCA 2R14A 7PTDA 4EXAA 3A9BA 4CU7A 5FESA 3WQWA 1YDOA 1EJ7L 2NX3A 1DXEA 3AQUA 2CCRA 4WLCA 2VHLA 5A6BD 3RF9A 4OKDA 4N02A 1KTCA 3CAQA 3HBLA 4XWUA 3AIQA 3P62A 3R79A 4PMVA 1EZ2A 4HMNA 4ACYA 1AH4A 4Q8PA 3AZRA 2MUCA 5CJ5A 1ZGDA 2PLJA 4EXQA 3SY1A 1Z44A 3VI2A 4XIAA 3IGSA 5CC5A 3C8NA 2JKPA 3CU2A 1Z9AA 3N4FA 1AD4A 2ZADA 3E0IA 1F76A 1SZGA 1MW0A 3S1XA 4AIUA 7ODCA 3LBMA 1DJGA 1VYSX 2YCKX 3PB0A 2X41A 3OBAA 5K2ZA 1Z42A 2O9OA 4EACA 3HN3A 3E0VA 6TIMA 4LYPA 4MWAC 2HVNA 3AZSA 1EPXA 3I10A 3N2OA 4O1FA 3O0FA 3T05A 4HNOA 1EUAA 3BAXA 1AQMA 4BCEA 3S2JA 1ZJAA 3ABQA 3V5CA 1UIOA 3TQ0A 4ZXOA 4LF1A 4NJKA 2OEKA 2OB3A 3BV4A 2WWCA 1KV5A 3CTTA 4M29A 2J7CA 2YFOA 5FF7A 3THUA 1S46A 1HKIA 1A5SA 1D3CA 4M80A 2ZZ3A 1O4UA 2I9EA 4FZIA 4H8UA 2EQDA 1E6RA 1PX4A 2GGEA 4IGNA 3CJPA 3WQGA 5HPOA 1HGYA 2DW6A 1EJUC 2XIOA 4J3XA 3HPFA 5HUPA 2GOKA 2PFHA 2UY2A 1TV2A 1UP0A 3C61A 3VNDA 2Y89A 1E6NA 3RPTA 4EP8C 2CHRA 2WCAA 2BX7A 2C71A 4B91A 3LOTA 2CIPA 4YTTA 4OOZA 4K37A 2AAAA 4JOMA 4FR1A 4PE8A 4EWJA 4PH6A 1PZ2A 3TR2A 1VLWA 4HCDA 2H9AB 1GEQA 2BZNA 3WD3A 2HDJA 5C6MA 4JTDA 1WAWA 3G24A 2ZYFA 4IG2B 3CQJA 1TUFA 3W4RA 3CLMA 3GHUA 3V1PA 4I8YA 5EBUA 1KBBA 4G9PA 2PEVA 1GW9A 4C6IA 3WMLA 3UU0A 3MUCA 3R1ZA 1GQKA 4CD4A 4XAFA 2PI6A 4DEFA 5TBOA 1I6NA 4O1EA 3R8GA 1HT6A 2XFFA 1G69A 2I57A 3N9SA 2IQ0A 1HJQA 1K9FA 3DC0A 2DZAA 1JRBA 1W2PA 4JTEA 3H12A 1K8YA 3BO9A 4XZHA 2NWSA 2BOGX 5DMLA 1E4LA 3OW1A 4GNVA 3CTLA 4DJDC 5CG7A 1KM4A 5E70A 1XDMA 2PWEA 4MJ4A 3LCLA 5HULA 4HU0A 5A6MA 2WNNA 4PSRA 3UCCA 4AAJA 1T41A 2RDTA 2FTYA 3PZOA 1IEWA 3CPGA 4URIA 3CGTA 3R6IA 5AZ0A 3S5SA 3M16A 4IHCA 1LUCB 1GVRA 2QCDA 4C6EA 3FN9A 4S3CA 4U3CA 2J7HA 2Z7GA 3PZMA 2J8TA 3O8AA 3R43A 3WD1A 1VS1A 4WY0B 2FHCA 3BLKA 3GDTA 2KZHA 4UIOA 2J7FA 1DV7A 5LKYA 4LALA 1ZBCA 4ZO6A 3M0JA 1TPH1 3IRDA 3H4GA 3TJXA 2PAJA 3LQGA 1UZ4A 3KTXA 4D6DA 4ZE5A 3HGSA 2DZXA 1OYCA 3I7RA 5E6YA 4W5UA 2WPBA 3IIXA 3NO1A 3DFNA 2BVYA 4IXXA 4DB7A 5BOFA 3RM4A 1V8EA 4Z2IA 2YBUA 4ZQOA 4RPQA 4R33A 2BOFX 4O18A 3H4XA 1LM1A 3OZOA 1XLAA 3RR4A 3SRHA 1TPVA 1JR1A 1V51A 5D2TA 4PBGA 4AY8A 3VMNA 4PC8A 3ENLA 5FSEC 4ZE4A 3VKAA 2BHZA 4R85A 4GIAA 3O3RA 4XBKA 2E67A 4DBUA 5CBIA 2CBUA 4GQRA 1Z41A 1TV5A 3MUY1 2CZEA 3CQHA 4PRTA 3NURA 2G3NA 4IP5A 9XIAA 1B4EA 4HKPA 3CEPA 4A21A 4DWSD 3SCUA 4HHLA 5DF0A 3MU7A 4W8LA 1VBHA 3ZLFA 3UWWA 8XIMA 1UPMB 2PGWA 1N7KA 2HS6A 4YJ5A 3KS6A 2PDHA 3BW3A 3VNZA 3RK8A 4G8TA 1JG9A 5EL1A 3EEGA 1RV8A 3PZUA 1W9DM 4ALDA 3WQ5A 1QCWA 3GIQA 2WQDA 2E5DA 2YIHA 3UZ5A 5CXPA 1H7WA 3V7PA 5AY7A 1SM9A 1GG1A 3G0XA 1UH2A 3QLLA 4Q32A 2GUBA 1H7OA 2J74A 3T42A 3F4CA 3IIPA 3APTA 1SFLA 2ACQA 4C7FA 3SURA 3AHYA 4HNLA 2WO5A 4D8AA 1T5AA 1ITUA 2HBVA 1S5NA 1IT7A 3QR3A 4LAUA 1JCNA 2V5LA 1EL3A 2WNQA 1IIHA 3WLHA 2PP0A 2QPUA 3EXRA 4UWMA 2POTA 3G8RA 4DNHA 3LUTA 3VIJA 4A29A 1WO2A 3UR8A 3V4BA 3WH5A 1DE5A 4HNTA 1VFHA 1M3UA 2DVTA 3URNA 4MADA 2BY0A 3UZXA 4H83A 4HU3A 2ANUA 4NJHA 1VIZA 1SO6A 3AIUA 3WQDA 3WNLA 4ZODA 4R34A 4H8NA 3VMOA 1T6MA 4D6IA 2FH6A 3D47A 1EPVA 3BGGA 2VCAA 1KFEA 1PKYA 5DCEA 5FEZA 1KGWA 4L4PA 3GNNA 2Z1SA 3WNPA 3KRZA 2A3BA 5A8NA 1V7YA 1PKMA 1F4AA 2BFGA 4A35A 4H6RA 1XD0A 4C60A 3HG4A 1G67A 2J6XA 4US5D 4UXDA 1B3OA 5TNVA 3V36A 3B9EA 3TOYA 1GKRA 2WB5A 1FDZA 1GTHA 2V2HA 3B8DA 1TPC1 1TCMA 1US0A 1V3LA 2NQLA 1LTDA 4IJRA 4W89A 2WJDA 1AG1O 3PS7A 2A2IA 1A4MA 3UGVA 8TIMA 3T2PA 1EIBA 3FGCB 4PN2A 3GD6A 3EB4A 3GG8A 3GKFA 3BAKA 2CLFA 3MBFA 1E70M 2C0HA 1H63A 1VIWA 3HG3A 2ZUUA 4IM4A 5AECA 2FDMA 3A47A 2ZC8A 3UPMA 3R0DA 2QCEA 4I5UA 1UOKA 3EMCA 3KVJA 1FH8A 3CMJA 3IACA 4JL2A 5I79A 5REQB 5A6SA 5BWFA 2A3EA 3GR7A 2FPTA 3MCOA 1OYAA 1AUSL 3AAMA 3BUVA 2ICSA 4AWUA 4IP7A 3TTYA 5HMEA 1FWIC 3GVGA 4GO9A 3N34A 3W2UA 1OGGA 1R2RA 2J9ZA 1MZRA 4V1XA 3NAVA 4S23A 2V2CA 1KFBA 3PJWA 2X42A 4RDVA 3A12A 2BY2A 1UKOA 3PFMA 4AD5A 1JI2A 5RUBA 3ALGA 4E38A 5AFDA 2GGIA 3OVQA 3C0JA 1E9IA 4F2BA 1GOQA 2V0TA 4ROQA 1R3YA 5AC7A 1OCJA 4LS0A 2GVLA 4IMEA 1VFLA 5IDIA 4MIMA 1RJPA 3CAVA 2WAGA 3DIPA 5C2XA 3WDIA 2J75A 1GUVA 3C2VA 3CO4A 2J8FA 3VE9A 3DBNA 2PDCA 3H2CA 4KRZA 1FP9A 1WV2A 2Y63A 3TU9A 4GY1A 3UCDA 4IIGA 2AL1A 3QN3A 1LWJA 1NU5A 3QFWA 3T2OA 1OIMA 2UY5A 2WANA 1GVSA 4S3GA 1R9XA 2VQUA 1S2WA 1DJZA 2J7BA 2Z7KA 4A3YA 4BWLA 1P4CA 3OHIA 1TVLA 1QOXA 5D33A 3CQIA 4OTKA 3LHTA 4CNUA 2WM1A 4LCRA 2XGZA 1FDJA 3B0VC 1UBPC 3LHWA 3TJIA 2XGBA 1Q6OA 3C0QA 3AS1A 1PX3A 3B97A 2WMHA 2Y6ZA 1JRCA 2XFWA 4I9JA 2X05A 1VJZA 3RCNA 5CC7A 4LVGA 2F84A 4NJJA 1QW7A 2ZA3A 1R9YA 4B15A 1P7TA 1CECA 1KBIA 2WYSA 3M47A 2J24A 3QOKA 1IE7C 3HURA 1W3LA 4M6PA 3DC8A 2XH7A 1FKWA 4M5PA 1XLHA 4CLMA 2QR6A 3LGGA 2RUSA 3UG4A 1LBLA 4GBUA 1DEDA 3XINA 1ZFJA 4WOQA 2I1OA 4KEUA 2PRHA 5D09A 5C9RA 2H3BA 3SCRA 1MUMA 3M6DA 4NY2A 1I45A 1A49A 4ZFMA 1HP5A 5G4HC 1TTIA 1HVXA 2OOGA 2ZX6A 4V33A 1E1FA 3LZ5A 3C0LA 1HX0A 4MKSA 3SRDA 1D8WA 3ICJA 2YW3A 2CKRA 4ATLA 2VOTA 4JYFA 1JJKA 1JQVA 4JTUA 1V0MA 2WVVA 5DXYA 4DF0A 1F6YA 3TN6A 1RCOB 2OGJA 1TTQA 3EWZA 1V6UA 1L9WA 3CQ0A 1IXOA 1FHDA 2JKEA 4IQLA 1VEMA 3WENA 3N2MA 3AFBA 4FS9A 3K13A 4PL1A 4EPBC 1E55A 3UPWA 4HHMA 1OK4A 4Z1CA 2BHYA 1W3HA 3A6OA 1TMQA 4JAWA 3VDBA 1F07A 3QC3A 2GVEA 3EZ4A 3EOEA 4KESA 7TAAA 1K6WA 4JIHA 2BGQA 5B7YA 4H9UA 3O16A 2WJZA 4OECA 2RDUA 1V4YA 3KWSA 4UTWA 4X9SA 1H62A 3TQPA 2PODA 1RQHA 3JW7A 1WKEA 4N9BA 3H6OA 3V5FA 2GJXA 5A8GA 2V9DA 4I7WA 5DO8A 4QNWA 1ZALA 2XH0A 3UZJA 2H3DA 1O5XA 4MYAA 1F8IA 2WCSA 3DESA 1WDWA 1ZJHA 4RV8A 3WF1A 1KM2A 2VVSA 3H70A 1YBQA 3M0XA 3D3FA 2O0TA 2XG9A 1DJHA 1S5WA 3S83A 3R12A 3CK5A 4YIWA 2NQHA 3R89A 1SZNA 5ABEA 1W2VA 4LCQA 5CSRA 1A0EA 2A85A 3E2QA 3TTSA 1UKQA 2GFTA 4PA8A 3GG0A 3IGXA 3CEUA 1HIZA 3NYDA 5D4YA 4PCFA 3SSJA 4A8IA 4WSHA 4GYPC 2FTWA 1HJVA 2F8QA 2ACUA 1V6TA 2ZRVA 1R2TA 3T78A 3ZJ8A 5K3VA 1F6KA 1A80A 1BG4A 2J7GA 2X1TA 3BVJA 3Q45A 3EOOA 3DN5A 3IJQA 4DZ5A 3W3OA 2W4XA 4HK7A 3MI3A 3NWRA 4WUIA 3AUOA 3UG8A 2I14A 3P60A 3F4DA 3UXLA 3OVGA 5FF3A 1OABA 3QQ0A 4PR4A 6TAAA 1JUKA 2ZZ5A 1OX4B 5BNKA 1VHNA 2GVJA 4S3DA 3NQ7A 4NZCA 4KS0A 3G1DA 1XWYA 1UH3A 5EPDA 1SMDA 2XH2A 1XISA 3TW9A 3RR1A 1ISVA 1Z32X 5CLTA 3UCQA 2GQ3A 3VGHA 2PDLA 3PWAA 5LXXA 2FB3A 4FB7A 3GXIA 1I2PA 4PTXA 3OP2A 2VELA 5A6LA 3LCGA 4CEUC 4Y9OA 3DG7A 4H9ZA 3EWCA 3EDFA 4WKAA 3IARA 3WD2A 2B7OA 1CIUA 4Q7IA 5I0DA 1IIGA 1E56A 1TPFA 1G01A 3CXOA 3GIYA 1UA7A 3EX2A 3MT1A 3STGA 1GVOA 1ITCA 1GONA 3JU2A 4DPPA 1NDYA 3CIWA 2QJJA 7CGTA 3NUKA 3I3BA 3GHTA 2XDFA 3V0UA 3GW0A 5LHFA 4Q4OA 3N18A 5KZDA 4UC5A 1RA0A 4W8BA 3TJ4A 3PP7A 1BSLA 1MQPA 4ZB2A 3E5BA 2GSEA 3UXAA 1E0VA 4E4FA 4QP0A 1X6NA 1XI3A 1NVMA 4DNMA 1T8QA 2Z27A 1EJTC 1SFTA 4F79A 3FJ6A 3ARVA 4N6FA 4YYFA 3DFHA 2DZWA 4P5UA 1Y65A 3L5LA 5KINA 2FZMA 3RYSA 3DI0A 4LXFA 3ARYA 3O15A 2YA1A 1UUOA 1BAGA 1LL4A 4FP1A 5DN1A 1Y7VA 3S2NA 1ONXA 4WEVX 2FKPA 1XIIA 1VPQA 4BHYA 4F48A 1EKOA 1MRAA 1PIFA 3NPXA 1BHGA 1W1YA 1MW3A 3URBA 5CH9A 3W88A 1PO9A 4ZTXA 1OB0A 1ISWA 4Z2LA 1XBYA 3UZZA 4E6MA 3OLEA 2X7VA 1CGTA 1HQTA 3GU9A 1KRBC 4IPIA 1UKSA 2D24A 2YSWA 5D9MA 4DQWA 3MKCA 2TAAA 3RDKA 4MOZA 4AWEA 1M41A 1ML1A 3OQEA 3TN4A 3UT0A 5E9XA 3RX3A 4Y9MA 3BLPX 2DV0A 2OLHA 1KTNA 4XKYA 3G1YA 1R7OA 2V5BA 5AYYA 1LCOA 4K36A 3N2CA 3WDHA 3S42A 1OWQA 1Q2SA 1TPB1 2A3LA 1H0GA 1UR4A 1VRXA 3U4FA 3GG7A 4ES4A 4NAEB 4IFRA 3C3UA 5HA7A 3PTMA 4FLQA 4WDUA 3IJ8A 1UKTA 1VLIA 5G4EA 4AZ7A 3THCA 2PF8A 2Y1HA 4CD5A 3C0SA 2V5JA 3WF0A 1L6WA 3PZQA 3T1GA 4MKNA 1DQXA 1NQKA 1UD2A 4XUGA 4QDWA 4HT3A 6ENLA 1PX8A 3VNJA 2GSHA 2Z29A 5G2IA 3CMFA 3VIFA 1W1VA 4DYKA 4JPGA 3HG2A 4BR1A 3KVLA 1CDGA 5H91A 4YHEA 2AMXA 4Q4QA 5HMFA 2HCVA 5M03A 5I2UA 1XDLA 1YIXA 2NVCA 3W6MA 3CWHA 1TFVA 4MG4A 5B80A 3SECA 4CCZA 1X39A 3WLJA 1QNRA 4DJFC 3F7JA 3OG2A 2HPIA 4KWSA 4UMCA 1IEQA 1Q7ZA 5TQLA 3B0YA 1JUBA 3FJ4A 1Q63A 1IR1A 2DZUA 2VFEA 4PMQA 3ZLGA 2VI0A 2PDFA 3AMKA 2OXNA 1KBLA 1TZZA 1XLEA 3T0TA 3C3NA 1NY1A 5T8GA 4GYFA 2EGZA 1WUEA 1RLCL 2R94A 5F4SA 3DI1A 2XTKA 2R1PA 1VPXA 1VQTA 1VC4A 2FGZA 4XUYA 5DY3A 5FEWA 3QR1A 4G56A 2FFCA 1SGJA 2V8ZA 3PBGA 1MQQA 2DGAA 3S9YA 2HNEA 1EX5A 5J5RA 1PXGA 1D7FA 5FJIA 3AUJA 1JZ6A 4HA0A 3FYYA 3P5ZA 3KCOA 1JDFA 4C7DA 4MNMA 1RK5A 2Z0IA 2GVYA 2ISVA 3S5NA 1XICA 2PWDA 3DEQA 1V03A 4ORIA 5I78A 1CB7B 3AU6A 4I90A 3LRKA 3WH8A 4GC3A 3CM4A 4OOUA 3WFAA 4ENLA 3TWBA 3GR4A 4IICA 3SRFA 1E9LA 3G1XA 1CGUA 3VD4A 1SQ7A 4QG6A 3SCNA 3RU8X 4FALA 1T0OA 1BKHA 3E49A 1T99A 3PSWA 2V81A 4UTTA 1JF5A 2QLYA 2BXZA 1A4LA 4NJIA 4KFNA 3HJZA 1XGDA 3R2GA 4ZO8A 2CZDA 5HDRA 3EPNA 1BXBA 1VCGA 1ZJIA 4H9MA 3KX6A 5LA1A 3EB3A 3H53A 4OJYA 4NAFB 1RCXB 3UJSA 4GY7A 3CZEA 2OVLA 1FCQA 4OGZA 5C55A 3NR0A 1UA3A 1F73A 2FZ8A 1TQJA 4KWOA 2ISWA 2ISFA 4QFUA 8CGTA 4B5XA 1YTEA 3S9ZA 4JY8A 1CBGA 4PEKA 2HTMA 5K9XA 1RJQA 1EP2A 4JS3A 1P0EA 5BXTA 1EJVC 1M7PA 3ALFA 1XL9A 2JKAA 1S1PA 2ONEA 2P1FA 4RR4A 1K4HA 4BI5A 4C6PA 3I4EA 2W66A 2OJPA 5FKYA 3OBEA 5BWAA 1W32A 4DBEA 3AS2A 3BW4A 3W7HA 2PZNA 1SSGA 2JIEA 5CJMA 2PGEA 3GHRA 4M6VA 3T0AA 4EAMA 7A3HA 1I2RA 4HZMA 2NLYA 4KERA 4XK2A 3LRMA 3CZLA 3WF3A 3M44A 3L12A 4O4VA 3UJRA 1CX9A 2ALDA 4DBDA 1B9ZA 2ZX5A 3G5EA 4Q3MA 3B9AA 1E0TA 5I3GA 3CV6A 3E9AA 3LNPA 1JFHA 4RKAA 4HTBA 1R3TA 3S6OA 5D8WA 1XQKA 2PC4A 5EMJA 4MWAD 5CPMA 2BDQA 3WQCA 2V67A 3UFYA 2GGGA 5E0CA 2DUZA 3CL6A 3VA8A 1U22A 1WXYA 4JIIX 1OC6A 1X7FA 4AIOA 1E0XA 1AQFA 1TJ2A 5HANA 4AUBA 1M7OA 3NSXA 1M1BA 4LC6A 3SIZA 5MF5A 7XIMA 2W79A 1PCWA 1H7RA 3QKEA 2H6RA 1I2QA 1U1UA 3DECA 2WZMA 1UWQA 4DXVA 3ZIZA 3B8IA 5I3DA 3UJEA 2J79A 3G6MA 4MJZA 1TA3B 1FWGC 1B0IA 2VXNA 3GWQA 5FAGA 2YCLB 4QAWA 4QITA 1E0UA 4B5SA 5CEWA 4LUJA 4TIMA 2EG6A 3ABSA 5HJXA 3VIMA 4QLKA 4J27A 1I1XA 3HOJA 4Q4MA 3W7NA 1WZAA 4O8RA 3QHOA 3ABRA 2PLKA 1EYEA 3UVAA 3NO3A 4K8HA 8RUCA 1W8SA 2CLLA 3UERA 4LRTA 1ZB5A 5H2ZA 1GOMA 2WMFA 1RD5A 3RX2A 2PPGA 4PRRA 1P5BA 4FLRA 4MHBA 1HKJA 2LLEA 1N2VA 1UKPA 2DIEA 3HPZA 4W7VA 2BY1A 4HMCA 3MSYA 4Q4RA 3U2CA 3RIKA 3T6CA 2F2HA 3LXAA 3QZEA 4K1WA 3NYZA 4JTAA 4K2SA 3RNDA 3A24A 4QQUA 2RGLA 2NX1A 1A0DA 1ISZA 1YYAA 1XUUA 2P10A 4S3KA 3L5MA 3WLKX 1A5AA 1QR7A 2DZSA 5TIMA 3MUXA 2Q6ZA 2V30A 2W5FA 5IOBA 5U4NA 3TTQA 3USZA 3A23A 4DI9A 1YDYA 2DZBA 1IEXA 4HZ6A 1Q45A 2O9PA 3AS3A 1GWJA 4AZIA 3M0ZA 2WVSA 3G22A 3L4XA 3WQOA 3L5AA 4U4MA 4DJDD 5I3HA 1K9EA 1ZL1A 2Z1WA 3EWUA 4JKLA 1TQXA 4K68A 4PL2A 2AL2B 3WLMA 2EO7A 1WPCA 2QKFA 1R3QA 5AN7A 1KWKA 3IRSA 4PCSA 3BJFA 1XBZA 1IT0A 3UR7A 3W02A 1GG0A 2PCEA 4Z2KA 1PSCA 1LOQA 3QHNA 2HEJA 3KL5A 1E73M 4JIQA 3KDOA 1XKYA 1G7UA 4I6VA 5JBEA 5EFFA 1WKDA 5T9CE 1QU4A 3STPA 4UTUA 5EMLA 3N14A 2BBFA 5AC5A 2C7FA 2H9AA 3UESA 1VEPA 4PMJA 1WCGA 2EXOA 2UY4A 3HZ3A 1XLFA 5BMXA 1FWRA 2FDSA 3QMTA 2OLSA 2VEKA 5AYXA 3QXBA 3HTWA 4IG2A 5FAJA 2G4FA 1GK8A 2GZXA 1J5TA 4QG8A 3MCMA 3MMTA 4U33A 4AVFA 3LG3A 2GK1B 8A3HA 4FO4A 1K9TA 4KF1A 4MJ2A 3ZLHA 3STEA 2AQVA 2VM8A 3ES7A 4JEJA 5CPTA 4S3JA 3SN0A 2VFFA 4L6DA 4OUEA 3RITA 1XX1A 4DZAA 3GS6A 4M7SA 1O5QA 4C6DA 2CPUA 3QV8A 1BTMA 4RE0A 3PJUA 3EWYA 3QPZA 3F2CA 2YR1A 4HYRA 3W86A 5LZLA 4FX8A 4XB3A 5HOSA 3OVPA 1IGSA 4AMAA 1PIGA 1BD0A 4MNKA 4GGBA 1QNSA 5ECVA 4Q4KA 3VOFA 1QOQA 1R30A 1L8NA 2PTWA 1OFDA 3LERA 4CNNA 4D6CA 5B7ZA 1CCWB 3DHUA 2ZC1A 2Z6JA 3H24A 2VUYA 2PWUA 1G0CA 2F6XA 3RLUA 1GVIA 1ZQ5A 3GW3A 1KFKA 2KAUC 3NGFA 1MNZA 2V38A 3E0WA 2YXXA 3GR8A 2X1IA 5F1UA 2FIQA 1QBAA 3GBDA 2XUCA 3P74A 1CEOA 2NWRA 4XD3A 4CD7A 3NPWA 1P1XA 2ZDRA 4HPHA 3DKJA 6REQB 1VFSA 1EF3A 1IT8A 3LTSA 1BEUA 3PPHA 2J47A 4WY0A 1J0ZA 4Q8NA 4A3UA 3S4TA 5HMSA 3AS0A 4PMYA 5HR6A 4I7VA 1YDVA 4X2RA 3LI0A 4IJBA 2QJGA 5HQMA 1J93A 2XJ7A 4U2ZA 3CIXA 3H2FA 4MY9A 5EB8A 3ZSSA 3LHUA 2WMKA 4GJ1A 3GNPA 5HUOA 3KS5A 1W3KA 3PHAA 4X9YA 4G7FA 4D6JA 1DORA 1Q6CA 3PC0A 4I9TA 3BLFA 1XIFA 3VNYA 1DWJM 1OFQA 2P8BA 1SW3A 2BVTA 1KXQA 3EDDA 3LXBA 4QE4A 5T9BG 4E8CA 4XD5A 2ZICA 4PMUA 4S38A 1TVPA 3NFUA 5HATA 1W3IA 4RXFA 1W9UA 4JTCA 3TZNA 3W53A 4MM1A 3VVGA 4YLWA 5A69A 3JUGA 1W1PA 4M56A 4J9JA 1BXCA 4MSSA 3G3MA 4H6EA 2OG9A 3QH2A 4HD5A 4W87A 3WUFA 1K7XA 3KEHA 3PJTA 4DBWA 5G5IA 1ZTVA 3RGTA 3B4UA 3V1HA 4XZLX 3O05A 4QAIA 3N11A 3D3AA 1GVQA 1EEXA 3CV7A 3I6RA 1BSIA 1JZ7A 2Y8VA 3HV8A 3EX4A 4ATWA 3W7IA 2EG7A 4A3RA 1RCQA 1KO0A 1NIUA 3W26A 2OT1A 4U31A 2NW0A 4UQBA 5CZ0A 3H22A 4D6GA 1MVYA 4HHHA 4CU8A 4DJEA 3R0KA 4P7NA 2PP3A 1C92A 4S3EA 5FF4A 3FA4A 2NV9A 1CT5A 4OT7A 2B0MA 3BICA 1T7LA 3F1QA 1JXJA 2C13A 3RAOA 3TP4A 6CGTA 3BC9A 2P0IA 2ABAA 3USBA 4QNEA 4NIRA 2BMBA 1TTPA 4LF2A 1CXLA 3S9IA 1WXZA 1WDPA 3GKAA 3NQGA 1YTKA 4OU1A 2R1KA 4HK5A 3VM5A 2G37A 1NAL1 1A53A 3ATYA 1FWJC 4MDOA 4FSAA 2ZWZA 2C16A 5MKGB 3QW3A 1N8WA 4IWWA 3QGAC 1P1MA 4U2YA 1OFBA 2NXHA 2WSQA 3LLFA 4XAPA 1FQ0A 4GVIA 1BYDA 1GVYA 2J9XA 4GBDA 3UYCA 3VD5A 1QHOA 1AL8A 1QXLA 3UF9A 4EE9A 4NHVA 4FOUA 1B3YA 5D9OA 3CZJA 3GC5A 2QXWA 2OQLA 4A8RA 4XZWA 2VEMA 3VIOA 1TPEA 2ZVIA 1IXQA 5EFDA 1FWSA 3H2EA 1RBAA 3OLDA 3TC6A 2TYSA 3B9OA 1E6QM 5TF0A 1CB2A 3VOGA 1RK6A 3QJAA 3FGCA 2I7GA 1TPDA 5BOEA 1F3XA 3IUIA 3AIBA 1PVNA 3FNDA 3SW6A 3V35A 3BMXA 5EMKA 5DBTA 1GHRA 3AWOA 1OX6A 1S3TC 2A7RA 2QZRA 1EC7A 2WHMA 1H7XA 3AMLA 1IZJA 2VJXA 2YPIA 1E4IA 3DAQA 5HINA 1U5HA 2W6RA 1QBBA 5H8MA 3BANA 3RLHA 3EA1A 4IUOA 3ITYA 4U5KA 5REQA 5JH1A 5KZEA 3QYSA 1AQHA 3SN4A 1XG3A 4AZCB 3ZJ7A 4KWWA 3ZFHA 1XYCA 4JY9A 5F2LA 3U3HA 2VZTA 3IANA 1YADA 1K8ZA 3LMYA 4F2UA 4KCVA 4IP4A 3W1QA 2ZWYA 4TQTA 2AGKA 3PZ9A 5BROA 3MWAA 3SCVA 1AJZA 4YCPA 1ENUA 3B03A 1LT7A 4IPNB 1US3A 4PUEA 5D38A 2W9MA 4E3TA 2DH3A 4QRNA 4YVXA 1KR0A 2BGSA 5I07A 3OA3A 4K8GA 1AW2A 4M8UA 3I68A 3FSTA 4UB9A 4UZSA 1SVDA 2X0YA 4YXGA 4IQJA 3LGEA 2C1IA 2EPKX 3OIXA 3HIJA 4Y96A 1BTCA 3ME3A 1E6ZA 2OZTA 3ES8A 1FRBA 3LYEA 2QVNA 3CYVA 2YL9A 3TXVA 1UR3M 3N19B 3CV2A 1EDQA 1XLMA 2Y70A 4ORMA 1QOPA 3L4VA 2VO5A 4LUIA 2OR2A 4DO6A 3EYPA 4NZFA 3HMCA 3TYCA 1R0MA 4X0VA 4O13A 3SUSA 2VOMA 4OBRA 3MYPA 3BZGA 3LNMA 3F2DA 4C6OA 4O1AA 1BYBA 1P6WA 1LL6A 3A3WA 3W81A 2YXGA 4IGMA 2Q01A 1HF6A 2WKLA 3H2AA 3VZZA 2RAGA 3OVRA 4QDMA 2GJRA 4P8VA 4G2DA 4W7UA 2QEZA 3VOJA 4XD6A 1U1HA 3SIMA 4W8AA 4I5RA 1D8CA 1MDRA 4CNSA 5LSMA 2PRLA 4POCA 3M7SA 2FVMA 1DYSA 3PZVA 2P76A 5DLCA 4EWND 2JQXA 3NM3A 2BTMA 3IVTA 2Y0FA 2OO0A 3HGJA 1XCXA 2VC9A 4KEZA 3WBXA 4HOWA 2XPKA 2IKHA 3W75A 4F40A 4NYUA 3ARSA 4QJ1A 3GAYA 3PF3A 4TU1A 3CASA 3K5XA 3OPSA 1UD3A 1N55A 1OT2A 1WNOA 3O6AA 4UBPC 1MXGA 4WY0F 2P88A 3AJXA 4O1BA 2VL4A 2WMGA 4Q8OA 2QMKA 1EUNA 3N9RA 4MB4A 3GIPA 2VEIA 3K2GA 3O9NA 2PMQA 4FLOA 1QJWA 1W9VA 4Q8VA 3OU8A 4QEHA 4UNKA 1GVEA 3ARRA 3NOEA 2GJNA 2TMDA 3N3TA 1KFCA 2OX1A 1IXNA 3IAPA 2ZA1A 3A3XA 1UR1A 2XIQA 1UMLA 3C2RA 3BMVA 3N25A 1XJBA 2QGYA 4QROA 3S5ZA 2WSKA 1UWTA 3VC5A 4RE2A 2X1SA 2ZFAA 1CLXA 2ZRWA 3MBDA 1TB3A 1XLJA 2DUXA 4R27A 3BSHA 1FWTA 2PD5A 5CPSA 4XV0A 1IGWA 3LLXA 3A21A 1TJ0A 2VP8A 4WD0A 1EGMA 1BGGA 2CITA 1R86A 3FW6A 1XYFA 1QAPA 3O06A 2Z1BA 1OFEA 3BJSA 1OM0A 1QVBA 1W5OA 1A50A 1LYXA 3J7HA 4QE1A 3SGGA 1ZAHA 3MP4A 4BWLC 5K4ZA 4ZTYA 3VUPA 1NTHA 2QCHA 5BRQA 2V69A 4NL1A 1I0BA 3NDYA 1XRVA 3GB6A 1UASA 2ZUWA 4B5TA 1SR0A 2P8CA 4D1JA 3PZGA 3ITVA 2E8ZA 2GUUA 4C1NB 1WP6A 3LSBA 3W1RA 3HV9A 2POZA 2J25A 3HM7A 5AC8A 3QM3A 4J28A 4NX0A 1DP0A 2BLEA 3G18A 4IOTA 5DQPA 3W82A 3BCDA 1UJPA 1YX1A 4CNPA 1DXIA 2GSJA 3DGBA 1Q65A 3PK7A 4EF8A 3FEQA 2PDXA 1EBHA 1HTIA 5HWNA 3SY8A 4ASTA 4RV3A 3GNOA 3WJSA 2ZE0A 3AXIA 2YDQA 4MB5A 1FWDC 2ISDA 3EDJA 3VKJA 3ARWA 1M5WA 2FHBA 5E6ZA 2XFRA 1OX4A 3CHDA 3LCFA 1LLOA 3H26A 4WSKA 1H5YA 1YNQA 3CZGA 3PG8A 1DQUA 1M68A 5CZTA 1POKA 1LBFA 5A1AA 3MP5A 1EOKA 1KM1A 4GI8A 4H2CA 1UHVA 1VFUA 2G3JA 5HNTA 2GGJA 4LYKA 3TFCA 5BRPA 3WQ8A 1V93A 2VENA 8XIAA 2CHNA 1GORA 2X1UA 4MPQA 4HPGA 1GJUA 3VABA 3AXKA 3PY2A 2G95A 3GLCA 4PUNA 3WEMA 1KFJA 3QGVA 1LRQA 3U9IA 1UROA 2DUAA 3E6EA 2NUWA 4Q4SA 2VZSA 2GQ8A 1XF0A 1DTNA 1HKMA 4EPKA 4HA4A 3VNIA 1NF0A 5G2WA 3H55A 1LWIA 2CWXA 3CBWA 1C7SA 3PUDA 3JR2A 1MFVA 2X16A 1EXPA 1JDDA 3ABZA 1K4GA 4GI4A 3IIOA 4ZVJA 3FAXA 1UQYA 2VR4A 4UTWC 4NVTA 3TEVA 1OVDA 4NJGA 4TR9A 1EF2A 2QUUA 4FNQA 4JFVA 3DFOA 3L4ZA 5C9ZA 1XC4A 1E5JA 3LU2A 4WX2A 3WJYA 5HWMA 3E0FA 1K03A 4JN8A 3CB8A 1BYCA 4DJFD 3QY6A 4FHAA 1LLZA 4CU6A 4IIFA 1TV3A 4ICNA 1ECEA 2F7FA 4M19A 4CQDA 1QI5A 4AISA 1IR2A 1Q2RA 3UR2A 4JQ3A 2CZFA 4WJ8A 3NZRA 3AHTA 3THAA 5DEZA 3B0PA 3W87A 4PUKA 4LVDA 1LWHA 2QVHA 1C8YA 1SO3A 3WQEA 1PL9A 3DDMA 2VGGA 3N17A 4AD3A 2ZTJA 3TWAA 4DF2A 1EWDA 4ML9A 4GI6A 1JD7A 3PZNA 3GTIA 4AVOA 5FL1A 4NAEA 2J4GA 4CQBA 1FX6A 2Y62A 5HK4A 2NSXA 2E6FA 1UZHA 3VKCA 2G3FA 5LIUX 3EWXA 4NZ3A 3W72A 3ONBA 4AVNA 3M7WA 3W38A 2E09A 5CPQA 1BVNP 4K1GA 3NTYA 1TX0A 1OZQA 3U8GA 3ZWSA 4Q8TA 2VKZG 2X40A 1JPIA 2ZZ4A 2D3NA 4NG3A 1QHPA 2EEXA 1LG1A 3CUHA 3VOHA 1TR9A 2GVGA 3PZTA 3APGA 1NF7A 4H8VA 1OYBA 1YPFA 4GC4A 4RPPA 4W86A 3P8JA 4CD8A 5G1TA 1ZNNA 4JTJA 1YW1A 3GYEA 1R8LA 2VEPA 3CUZA 4JZ5A 1W5PA 1OCNA 4D9PA 3UG5A 3RLVA 1WXJA 4DXKA 5FEPA 1B90A 4PB3A 4PCPA 3UG3A 2V3FA 4JCMA 4J3TA 2DY3A 2V82A 3QSTA 4LH8A 2OEMA 1GYNA 3ATZA 1WQ5A 3M0YA 1RH9A 3PAOA 3Q67A 3WO8A 1JCTA 3TVAA 1EFZA 1OF6A 2IPGA 3P82A 3L2LA 3U7BA 4GX9A 1QATA 1C9DA 4QCFA 1ME8A 4JIEA 4MY1A 1DIDA 5BOOA 4UCGA 3CB3A 4G1KA 1Z6KA 4GY0A 3VZYA 3SFKA 4IQEA 3QTPA 1JZ2A 4DPQA 2ZCGA 2VUNA 4N2YA 1MXSA 2DT3A 3CWOX 3W9ZA 4DWSB 4HNUA 3CMGA 4C5YA 3TLLA 2RGMA 3FXYA 1DJQA 2YDSA 2NXGA 3E02A 3WD4A 3WNKA 4IT1A 1GOIA 4WJEA 3F5KA 4TV5A 5F2IA 4JTTA 4W4QA 1NQ6A 2MANA 4TVDA 1KKOA 1LORA 5L6UA 3PBVA 2VFDA 3P8IA 3L23A 1AVAA 2INEA 1R6WA 3SI9A 3VGBA 4V2XA 3OTRA 5KZ6A 3VXGA 2FZNA 4Z1BA 5I24A 2OEJA 5CAHA 2EF9A 3K4AA 4KQNA 3RMJA 2V2DA 1RVGA 3KP0A 2FLIA 4C7GA 2W67A 4J5NA 3QPEA 4LRSA 2GDVA 1U5JA 3WH6A 4NNCA 4CUCA 1JYWA 1ZLPA 3OO2A 1OFOA 3I6TA 1YXCA 3TYUA 1YE4A 4CQ9A 1EEPA 2H8ZA 1OG6A 2CFFA 2RHGA 3B8UA 1C8QA 2YL8A 2PDWA 3PSVA 4D6EA 4IPLA 3ARQA 2VFIA 3IGHX 3KUMA 1XLCA 5DT7A 1QI0A 4QE5A 4EOUA 2OZ0A 3II1A 3LD5A 5FACA 1DQWA 1H61A 1Q5MA 3VYLA 3OYZA 2FZ9A 4AX6A 4O10A 3O6CA 2EBNA 4NXSA 4R53A 3P81A 3VM7A 1GOKA 4JTIA 3SFWA 4E3VA 1T96A 1NEYA 1XKJA 2CU0A 1S3HA 2Y7FA 4TX6A 5GNXA 3VO0A 1SR9A 4X2PA 4FXSA 4S2BA 3TTOA 4DY1A 4ZZ9A 1Z8AA 1WB0A 2H8XA 5D8ZA 4I9AA 3R94A 5E9AA 4FIQA 3ZT5A 1WOAA 1R3SA 1TZ7A 1Q6DA 3PANA 5J04A 4O53A 1JDCA 1MUCA 3WF4A 4MFEA 4P8XA 2ZOXA 4XBSA 4JTSA 1EH9A 3W6YA 4IFKA 3WQ4A 4GKTA 3CT7A 3AIRA 1EHAA 3S46A 3MTWA 4JL1A 3NEHA 2Z1XA 4QLJA 4H6KA 4TVUA 2CLEA 4Q33A 3DFQA 4GZ7A 2PTYA 5A6JA 2VX5A 3MCNA 4EVZA 2VFHA 3WCZA 5FIPA 1VFTA 2D2HA 4KRTA 4NASA 3EX1A 1PYMA 1WZMA 4DM1A 1MWOA 4HU8A 3WNOA 2R1NA 3TAKA 3W2MA 2W92A 2X09A 2E6AA 3B8TA 2DIKA 2DT0A 3BOXA 2GDUA 1PTDA 1JQXA 4YN5A 5D9PA 4A3QA 4OFCA 2C79A 2YCEA 4YTRA 1G7VA 2TSYA 3EXTA 1UYQA 2PLCA 3K4DA 1AK5A 1M03A 2BOEX 4UTTC 4O19A 1TA3A 7TIMA 3GVQA 4EPDC 1QHZA 2YCLA 4IISA 4AEFA 3KZSA 2DIJA 5CCZA 1H1NA 4QDPA 3PN8A 3FCPA 1TWIA 1F5ZA 4NKCA 4RNFA 1Z69A 4NUWA 3W7LA 3TSBA 1CXFA 1B57A 5BXRA 3M0MA 5A8QA 3LI1A 1HZYA 2OMAA 3GVRA 3PAJA 4I5XA 2YCIX 5C7VA 3EWBX 4ADTA 3C2OA 3V16A 1Q6EA 5LIXX 5LNRA 3TNBA 2DZTA 2GJPA 3SN1A 1CGYA 1RZMA 3QMRA 1MFUA 3WD0A 3LN3A 5CGMA 1VFFA 3U5UA 3WN6A 3D0CA 3STCA 1G5AA 4D6HA 1TZ9A 3L0KA 1FP8A 5KZMA 3N6QA 4WOZA 1R38A 3W1XA 3GUWA 3LSCA 3F5LA 2PF0A 1BFNA 5LNSA 3K8LA 2PZ0A 1PTAA 3MV01 2W62A 1ADOA 4W85A 1VBGA 3JZUA 2ZA2A 3KBWA 3EB2A 3VTRA 1PUDA 2BWGA 1SW7A 2AL2A 3W1TA 1OIFA 1HP4A 3GDRA 4A8LA 2CW6A 4HMDA 4LS2A 1K70A 4UOQA 3REQB 2C8NA 3ID7A 5I6SA 3CT2A 1X6LA 2Z2AA 4AZ5A 4TOQA 2E5BA 3K4WA 2AQWA 3ZYZA 3RHGA 3PBMA 3V18A 2BXYA 3PUOA 4W5ZA 2J8GA 4M1RA 3ZMRA 3LBCA 5PTDA 3JS3A 4H01A 5FJPA 4N4QA 4Q4PA 4A4AA 4IMAA 3KFTA 2TPSA 1FXQA 3C2EA 1ZP3A 5GJNA 5D02A 3VE7A 2OLAA 2YA0A 4B16A 3TIMA 5BRBA 3H4WA 4F9JA 3MZNA 1QT1A 2CXEA 4NI3A 1B1YA 5CSUA 1N8FA 4LU0A 1CZ1A 4QEEA 4RZ6A 2EJ1A 3KLKA 1F61A 3AHVA 3UWZA 2YLAA 1W9PA 2D23A 1BRLB 3UA3A 6ALDA 1OFAA 1KM5A 2OSWA 2GK1A 3Q94A 2A3CA 3LGDA 4QCEA 4RCXA 5DBUA 4XISA 2ZKMX 2DEPA 1SJBA 1G6CA 2WKJA 4UNIA 4YTUA 2C91A 5EU9A 3WDJA 3ZSTA 2NSOA 5F4WA 4JQ1A 3C56A 1F2JA 4IL0A 2YFNA 3NZQA 1ZCOA 2GLKA 1V0LA 1PKNA 4LX4A 4L4LA 3TN5A 1M6JA 1TWSA 5LA0A 1JNEA 4G1NA 2QGHA 1QUMA 4PBFA 1WA3A 3RILA 1V7AA 2QULA 2AOSA 3NEVA 1PHWA 2PDJA 4L9YA 4FNPA 3RO8A 3DHFA 5CG0A 5I00A 3CAKA 1YE6A 4FR6A 5CC3A 1RUSA 2VX7A 1W1B1 1KCLA 3KZPA 5DFAA 5LIKX 4RJEA 4WQ6A 3ARUA 3AICA 1MI3A 3OEXA 1XH0A 1DE6A 3TX9A 2PDYA 3VIPA 3FYPA 2DFAA 5A8OA 3EPMA 2YLLA 3NL3A 2OYMA 1ZZMA 3WMBA 3TQKA 6REQA 3B0UX 1KFWA 1TIWA 3BMWA 1W3TA 1XIEA 1PB0A 1V79A 3SQLA 1V0KA 2QQ6A 3PZIA 4B5UA 3C52A 4CNOA 2NXIA 2VRKA 2W63A 3CUIA 2OKTA 4ZOEA 3HPAA 3UR5A 3FOKA 2CNCA 1NWSA 4TV6A 3BOFA 3TA9A 1FWBC 4JYDA 2JEQA 2WNWA 1ONWA 3NCOA 3PBUA 5M3WA 1EQPA 4D71A 1FWHC 1GZ1A 2C19A 1W17A 3ZQ9A 1GQIA 2QUNA 5C5YA 2NZLA 2Y7GA 3UPBA 2P50A 4DI8A 4GIEA 4F8XA 3OGVA 2XWEA 1EYWA 4UQEA 3UP8A 2OSYA 4ZB5A 1J79A 4MB1A 3ORWA 3W1MA 4B90A 4LNYA 4GH3A 2OX4A 1JAKA 3A5VA 2PD9A 3C4UA 4WR3A 1LF1A 3S1WA 4CVWA 2KX9A 1XYZA 3N15A 3PULA 1XLGA 3OODA 1HJUA 1JEZA 1E5NA 4BS0A 5A95A 3PBYA 3WLRA 2E28A 2B81A 4M82A 3NM1A 4IGSA 1V6VA 2VCBA 1KW1A 1W1ZA 2WMIB 4I7UA 1S2AA 2IQTA 3WJWA 2F2KA 1VPYA 1THFD 1SJDA 4YU1A 1H1ZA 4GIRA 5ABTA 1NSJA 3TYZA 3B4YA 4C5ZA 3MVIA 3GQYA 4MVAA 3EAUA 3P14A 4TMBA 3T0BA 3WBWA 3OBKA 4QTGA 3B06A 4L6OA 3VAVA 3WH7A 5C54A 4IF2A 1EOMA 1FHLA 1I2OA 1UD5A 2PP1A 1H7NA 3SGZA 3G1RA 3WQVA 4AHPA 5GNYA 5EYWA 5ABFB 3E3HA 2QAFA 3W70A 1O6IA 1JPKA 4LEQA 4KCWA 4C6NA 2XIJA 2ODOA 4GA8A 3RM9A 2HV5A 3LS9A 4FOKA 3MA8A 4ROPA 3MPGA 2HZGA 4W84A 4E8DA 3M5ZA 3W1LA 5JH2A 1JYNA 4UFIA 1TWWA 4PUDA 2FQIA 4FNUA 1F8MA 3CPRA 1V3JA 2PGRA 2HS8A 3GDKA 4FLSA 3WK1A 2QJNA 3E2SA 4HP5A 4Y90A 1DPMA 1V5XA 2DT2A 3QFEA 5BZAA 1AW5A 5MKGA 3EOUA 2E7FA 5CPLA 1UZDA 2D22A 2OOFA 1AD1A 2IKIA 3LX9A 2DZVA 3K1DA 3TUUA 4H00A 3T44A 3WLPA 1B4KA 5AHIA 2YW4A 4MZ8A 1H11A 2DSUA 2ZZ2A 1VD6A 1Q66A 4ZB0A 1TR1A 2XISA 3W1NA 1TIMA 1VFOA 4LVBA 2VC7A 1GKPA 4MWAE 3ANVA 4B2DA 3AIVA 1XFBA 2DVUA 1OF8A 1BWVA 3WDRA 5DCBA 3FYOA 4HB7A 3QKZA 5FEXA 5M1TA 4O0ZA 3QQWA 5U7SA 3UQNA 2OKOA 4JX5A 4IH3A 5CKSA 1LL7A 3NQFA 2XHYA 3SM0A 1W5NA 4C6MA 1TJPA 4CQCA 1XGEA 2A3HA 2EKGA 4NRSA 4XBJA 1KA9F 4NYYA 2YCJA 2D20A 4WGXA 1DJYA 4J2PA 2VZUA 4O28A 2E9LA 3GXNA 4H9XA 3PR2A 1ODUA 1DJWA 2ZZ7A 3TYEA 2VMFA 3B0XA 3FJLA 4MAZA 3T55A 2NX9A 3AOFA 3RPMA 3SBFA 7REQB 4RE4A 4AZCA 1H41A 4GX8A 3S47A 5G1MA 3GC2A 1MNSA 1UWRA 4EF9A 3L67A 1S2UA 1I9CB 1KNWA 3QMSA 4YPJA 3VKBA