3W74A

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with mii-4-139
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (fumarate)
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with MII-4-139
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 105
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2013-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w74A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w74A01
4GRSA 3CEUA 3PY2A 2WOQA 2VEMA 5AHIA 1X8FA 3TW6A 3THAA 3P8IA 4FNRA 3MI6A 2NV1A 1VRDA 2PRHA 4MJMA 3DHDA 5KZEA 3W84A 1YTDA 4O1BA 5DN1A 1XDLA 4JTFA 1OF8A 4PEKA 1W5QA 4E0CA 3M5ZA 1VLWA 4O10A 4O8RA 4O16A 4TO8A 1VYPX 3ABSA 4O13A 2G95A 3QMRA 3TKFA 1EA0A 4DO5A 4ZZ9A 4FF7A 4PODA 4Y6GA 1H5YA 4BI7A 1TO3A 3W73A 3BGGA 1AL7A 4KWVA 2CFFA 3MP5A 2ZRYA 3W1MA 2GJLA 5EKYA 1X1OA 2R8WA 3NNTA 2B7OA 1KM6A 4WY0B 3O8AA 4CCDA 1LM1A 2PCQA 4HKPA 3M5XA 2DJLA 1IGSA 1B57A 3UWWA 4WX2A 2C18A 4NX0A 1VR6A 2V5LA 5D32A 3PAJA 3FEMA 3IVSA 3DU0A 3O06A 5F1VA 3SIZA 4PA8A 1OF6A 1W31A 1I2RA 1LRNA 2A85A 3IGUA 2ZZ7A 1U83A 5LNWA 1N55A 4N6FA 4K38A 4L4LA 2FJKA 5TQLA 3INPA 1V7YA 4YXGA 3E9AA 3RMJA 4O50A 3TQVA 4DXVA 3W1AA 1VC4A 4GNJA 1VHNA 3MO7A 2QAFA 3OHIA 3PUDA 1H7RA 3L21A 3STFA 1G7VA 3DFSA 1LLZA 3W23A 4PCFA 3W87A 4B5NA 3E02A 2DZXA 3TJLA 2V2CA 1H1ZA 1AW5A 4I7VA 4UTWC 3AJXA 3TSBA 3W7OA 4AF0A 4O11A 3LHWA 2NXHA 1B4KA 4OHQA 4AMAA 2BXVA 1RPXA 3ZWSA 4OGZA 2GQAA 5AB3A 3PF3A 3TSMA 1V5XA 4MZ8A 2VFDA 3HF3A 4DBEA 1MEHA 4ADTA 3VE9A 1BTMA 1PCKA 2V81A 4N2YA 3BO9A 4M7TA 2ZCGA 2VFIA 1TSIA 5HWMA 4DO6A 1GG1A 3EWYA 3P67A 2JGYA 4BI5A 4UMCA 2FIQA 2Y62A 1GT8A 4IXHA 4UNLA 5G2IA 3S1XA 1Z44A 1S5WA 3G1DA 4RXGA 5DBTA 2Y7EA 1IIGA 2ZZ3A 3NL6A 3HJZA 1LLWA 3DI0A 3G24A 1I4NA 3B04A 3P80A 4IX2A 4M6QA 1JR1A 2QDHA 2WV8A 3IIVA 3QZEA 5DXYA 2PC4A 4RZ5A 3P5ZA 3NQAA 3STGA 1L6YA 4RCXA 4JD4A 4NXSA 3UPBA 1X1ZA 5K7JA 4NX5A 3OA3A 4EF8A 4NQ1A 4LVGA 5K9DA 1PS9A 2FPTA 3GYEA 4XZ9A 3S1UA 3H53A 4JX6A 1FCQA 4EOUA 1TTPA 2A7NA 3TJXA 5CSRA 4ICNA 4QNWA 4WJEA 3UWZA 5F1UA 2QEZA 5AHEA 2FDSA 2J9YA 2WNQA 4CQ9A 3MMTA 4IMFA 2WSQA 2B7QA 4LVAA 2C13A 1P5BA 1KA9F 1KV8A 2E1DA 4MUZA 1FDYA 3LBCA 5G4WA 1R2RA 3KAOA 1TRIA 2Q3OA 1VS1A 4GBUA 4QISA 2H3DA 4NNAA 1Q45A 3TK7A 2ZZ5A 1JCJA 1G4SA 3D0CA 4A3UA 3GX9A 2HSAA 4AEOA 1X7FA 2AAMA 4O57A 3MYPA 4TIMA 3I7RA 1LOSA 2V2HA 1K8XA 1JQXA 3W71A 1YTEA 2E5DA 5H2ZA 3L5MA 2CLFA 1QO2A 3C3NA 2ZZ1A 3F4NA 3G3DA 3E96A 4UR7A 3QEZA 1ZCOA 4K6AA 3W83A 1ZFJA 2E5BA 4UFKA 4ML9A 3G0SA 1WX0A 5AC7A 3BW4A 3IV3A 1ZJIA 1GG0A 3N3MA 3LCHA 4JX4A 1OYAA 5DY2A 3LCLA 4K37A 3DXIA 3HO8A 2X1RA 4FNPA 1SU5A 4JYDA 3WK3A 4O0KA 3C2VA 1Q6LA 4R33A 5F2MA 3GDTA 1AL8A 2A2IA 3LHUA 4WOZA 1LYXA 5F2LA 5BMWA 3O6CA 3HBLA 3NAVA 4I7WA 4JY9A 4IMGA 5CPLA 1TQXA 3NQ2A 2TYSA 2C0AA 2CLEA 4O14A 3M6YA 5LKYA 5HR6A 3KVKA 1DJNA 2QJHA 1LCOA 1QR7A 3IEBA 4N6EA 1GZGA 4NUWA 2A4AA 3QC3A 3A5FA 1YXYA 3LHYA 2NXGA 3ABRA 4U28A 3SGZA 1W54A 3TA6A 4NJJA 1QPQA 3JR2A 3G1VA 5FF0A 3STEA 5CZJA 4GUJA 1QMLA 4BWLA 1TQJA 4RXFA 4WD0A 2DZPA 3NPVA 3LXCA 1F73A 2J27A 3I65A 2Q3RA 4WXYA 1B3OA 4GXMA 3BLEA 5H91A 4WUIA 3TC7A 1YDNA 3OVRA 1YYAA 4IJBA 3LCWA 3MHFA 2PE4A 1KFBA 4HSOA 2P1FA 4JTKA 5AYXA 5I3JA 4LU0A 2A21A 4UUIA 3W72A 4TX9A 5FEWA 4FX6M 3DFTA 1L2UA 4GUIA 1YLVA 3HPSA 3W86A 1A5SA 4O52A 5T26A 4H4IA 4LRSA 1OFAA 2QCFA 2YX0A 1HFBA 2GOUA 2C1HA 3P62A 5G2WA 3S42A 3GXNA 4NVTA 3QW3A 4LT9A 1XUUA 4OBTA 2YCEA 4IWWA 3C6CA 3RNDA 3S5YA 1JCXA 4E2DA 1F74A 2H3BA 2PRLA 2Y63A 4C1KA 1H7OA 2CU0A 3LRKA 2VKZG 2QCLA 3PM6A 4FX8A 3EWBX 3FA5A 1HUVA 1WOAA 3UXAA 3M16A 4O28A 4DO4A 3FLUA 2TMDA 1VJIA 3GXPA 1K7FA 4IOTA 4NU7A 3LBMA 1F7BA 3GB6A 4YLWA 1FXPA 2WPBA 3O16A 3SJ3A 1G4EA 1KFCA 3H55A 2HTMA 5CKSA 3NVTA 3W7HA 1XBVA 3R13A 5D09A 2GVLA 1KM1A 4O15A 3NQFA 5K9XA 2WKJA 3M43A 3FYOA 1OX4B 2ZZ6A 1VYRA 4N02A 2VENA 5AHFA 1H7XA 4M6PA 3P61A 1SW7A 1EUNA 1HG3A 3PWAA 4K7YA 4O4WA 1TPEA 4Y90A 3SGUA 3W9ZA 3K30A 3LHTA 1LTDA 1OG0A 2YW4A 1H1YA 5KSWA 2VFEA 4HNVA 4DF1A 3W22A 1WA3A 1YTKA 3EX6A 3LCIA 4YL2A 3USBA 4A21A 2R94A 5DY3A 4UTMA 1QNVA 2BX7A 3C2OA 3U8GA 2EAWA 3NA8A 3EWZA 1P1XA 3P82A 2VEIA 3BVJA 1SR9A 5FF2A 1QPOA 3Q2DA 4UR8A 2Q8ZA 3WFAA 1AK5A 5D04C 2OCZA 3NYZA 3PG8A 1K3UA 5FEXA 3JS3A 4XBSA 2CZFA 1KTNA 1QOPA 4PC8A 1GYNA 3W7NA 4S2CA 3W88A 3IGSA 4IUOA 1EWDA 2IQTA 5HULA 1DQWA 2G96A 4YCPA 4HNNA 1NSJA 4O12A 5FI8A 1ME9A 3A23A 4MYXA 3NQ6A 2YFOA 4JTIA 2BWGA 3EKLA 3HGRA 2Y89A 3T7VA 2RKXA 3NL3A 1G4PA 2J6XA 2QCHA 3W1XA 3V75A 5D03A 3NM1A 3B0PA 4Z1DA 4RJEA 2Y6ZA 5LHFA 1OVDA 3MWAA 4IXXA 3G1XA 4QITA 2ATMA 4NJIA 4TMBA 2X2GA 1XDMA 5HUOA 1Z42A 1SFJA 1OABA 3B03A 1F05A 3OVQA 5U4NA 2ZA1A 1ZAIA 5AC8A 2RHGA 1TMHA 2DZUA 1XUZA 4NNCA 3EWWA 4LY8A 2A7PA 2ZFAA 4O1AA 1FQ0A 1KTCA 1TRDA 4OU1A 4ZQNA 4AHQA 1EIXA 1WV2A 2X1TA 4O1DA 4AH7A 4A29A 3A9IA 1RQHA 3LCXA 3W70A 4YWIA 3PBYA 5I3IA 2QJGA 1H61A 2FTPA 4N4QA 3LCFA 5AYYA 4NJGA 1JRCA 4ZVJA 4NZJA 5KTLA 1NEYA 3LXAA 4GE8A 1GPWA 4WY0A 4MYAA 1KTBA 3KX6A 1ZY9A 3MW7A 1P0NA 2GUUA 3PUEA 5TIMA 3QQ0A 2ZA2A 3NXFA 4JTUA 3RLVA 5D2TA 4NJHA 3G18A 2VOMA 2GQ8A 5C6MA 1SUXA 5J5DA 4BK9A 1R46A 3G1YA 3LM7A 1J2WA 2Z1BA 3L0NA 3IIXA 2QCEA 4MIMA 1SSGA 1IIHA 1T8XA 1PCWA 3TROA 1W3IA 3Q94A 5FEPA 5DCDA 3W76A 2I1OA 1IXQA 1XBZA 3UZJA 3CT7A 2EGZA 5HQEA 5K2ZA 3CU2A 3W2KA 3KXQA 4FNSA 2D73A 3MBDA 1XI3A 2B0MA 4NNBA 4JTLA 3W7EA 4JN6A 2Q8LA 1B9BA 4HNUA 3JRKA 3DFPA 3OEXA 3V1PA 2EKCA 4I7UA 4Z1AA 1QPRA 3M44A 4UMBA 2TSYA 3GZ3A 3LDVA 5E93A 3W1TA 3TE9A 3FFSA 4CNPA 3MHUA 1F6KA 4TR9A 5KITA 1SW3A 1GQNA 1H7NA 1R2SA 3QW4B 1H60A 4DBDA 1IF2A 4N9CA 1R2TA 3G0UA 2F7FA 3L68A 1VLIA 4JIQA 4MOZA 5AYZA 1ONRA 3F1QA 4X9SA 4HNTA 3MI2A 3N9RA 3G1SA 2J88A 3S5NA 4UTTA 2VELA 3TFCA 1PE1A 3KVMA 5LNUA 4GC4A 4IMEA 3O15A 5HWNA 3NPWA 4UFHA 4OV4A 3RU6A 5D37A 1TPB1 1TJPA 3NQ7A 3TSDA 2AQWA 4Z0SA 3T40A 1D3HA 4LUJA 3PULA 1Z41A 4N4PA 3NQMA 3MI3A 2CZEA 4LV9A 4UTUA 1FCVA 3Q37A 3DFQA 3LTYA 1DVJA 3PBWA 1A5AA 2QR6A 2F84A 2NX9A 3BG5A 1L6WA 3CB8A 4O19A 3M7WA 5HR7A 2NLIA 5G5IA 2ABAA 5D2YA 1W5OA 3W7DA 3RFAA 4ALDA 3STCA 4KFOA 3CTLA 4P2VA 4K8HA 2WQPA 4RLIA 3W7IA 2ZBTA 3N14A 3R5EA 2J9ZA 3GR8A 1SZFA 1UBSA 3W7KA 4L4MA 2H6RA 3C4UA 5FESA 5DELA 1W56A 3NOEA 1F2JA 1LOQA 3TFXA 1LROA 1OX5A 1UUMA 3N73A 4LVDA 1FWWA 5MHBA 3N34A 3I6RA 3VNDA 3UPWA 4AAJA 2DZVA 3W2MA 1O4UA 2NX3A 2ZRUA 4O4VA 4LRTA 3GNNA 5DCEA 1LRQA 2ZA3A 4RK8A 4UNKA 1GTHA 4BF9A 5FF7A 4KKXA 2QCMA 5I3GA 3L66A 2C6QA 3QFEA 2C19A 3UZ5A 1RQBA 1W8SA 3IVUA 3FJLA 1QDSA 4FNUA 5EBUA 5EMUA 3DKJA 1BKSA 3VCRA 4BWLC 5F2IA 1ZAJA 3HPXA 3T4CA 3EWUA 1OFRA 3GAYA 3O63A 3THQA 2V5BA 5HJLA 3L5AA 1YPFA 1KBJA 2I9EA 1TCDA 1JUKA 1PHQA 3PG9A 3BLIA 1EWEA 5J5RA 4M5PA 3NR0A 3NO5A 1G6CA 3E0IA 2DZTA 1MEIA 1NF7A 5K4XA 4ZQRA 4XQ6A 4QSHA 3PBUA 4JTHA 1B4EA 1QWGA 5G1YA 2YR1A 1TPDA 4MLJA 3QQ1A 1JVNA 4HSNA 4QIUA 3CC1A 3EB2A 3IGXA 3OBKA 2VC6A 2C14A 3W7CA 3GDMA 3W7RA 2ZZ2A 5FF4A 1JUBA 3NQCA 1TPWA 4S1FA 3QSTA 3TMQA 4PTNA 1TREA 2CZ5A 4IQLA 3DAQA 4N9EA 4FEZA 2QCDA 3ABQA 1OFBA 1MO0A 4EIVA 1BWKA 1YDVA 5L6UA 2Y7DA 4I9AA 3RLUA 1HL2A 1W5MA 3P5YA 3QPYA 1AW1A 4Y96A 4OWGA 1FX6A 5CPNA 5E1QA 2QUUA 1YADA 3FOKA 4XBKA 3W2LA 3SZ8A 1WBJA 3CIWA 2RDTA 1FUYA 5IBXA 1W0MA 3NQEA 3WJYA 3PUOA 4MFEA 1SSDA 1VGAA 4UFJA 4JEQA 1UASA 3FJ6A 3OVPA 1F5ZA 3TMLA 3BLFA 4XKYB 2P10A 1N7KA 2I14A 3L0GA 3PS7A 1W37A 5F4XA 4LVFA 2RH9A 1P4CA 5K9CA 2VEKA 3W1UA 3HGSA 1ZALA 5FEZA 3SECA 3LB0A 1XBYA 3PSWA 3KVLA 3TC6A 1EP3A 4K39A 3L0KA 4JYFA 1FWSA 5LGXA 1QCWA 3B05A 3BW3A 3LI1A 3HGJA 1F76A 4KWWA 4JTGA 1WXJA 3A21A 2KZHA 3MHGA 4CCCA 3R8RA 2QCDB 1O94A 3F4WA 4UMAA 1UJPA 1D3GA 1A50A 5CGQA 5HWJA 1I2NA 3M1ZA 1OX4A 2X16A 3LCGA 3UQNA 3CQ0A 4IPJA 4YCOA 3NL5A 1QO5A 3CIXA 2G5WA 3O07A 4PL2A 3M47A 1FDZA 3FS2A 1BEUA 1OJXA 4QAIA 4JDBA 1BWLA 3IIZA 4FNTA 3HG4A 5EL1A 5I3HA 3VE7A 5D05A 1M7OA 4LTSA 4FIRA 5F4WA 3R89A 3LTSA 5TBOA 2TRSA 4DF0A 2YW3A 3PB0A 4CCEA 4GWEA 5D30A 4ZQPA 1HO1A 2J24A 2FB3A 2AGKA 2ZZ4A 3HG2A 1SZNA 2E77A 3WJZA 2Y70A 3B06A 3LLFA 1L6SA 5F2GA 2CLLA 1GTEA 4J9JA 1SZGA 4JDYA 5BW6A 2PURA 3GK0A 4AVFA 5D33A 3W75A 1K8YA 3W2NA 3QSRA 2Y7GA 3W3OA 4AWTA 2C3ZA 3M41A 3GLCA 2O7SA 3M5YA 1ZHAA 1NF0A 4JIPA 2V8ZA 2DJXA 4MLRA 1X6UA 3UY8A 4ZQOA 1SFLA 4QQ3A 4FB7A 1TYGA 1YXCA 2VXNA 4EWND 4O1CA 1T96A 1K03A 3NQVA 2VFHA 1KLYA 4JTEA 4MFDA 4ORIA 4W9TA 1FY6A 3ATYA 2DZWA 1ML1A 2P0OA 4LC8A 4X2RA 3EX3A 3M9YA 4LWWA 1LDCA 2CLOA 3DFOA 3QH2A 1HTIA 1KM3A 5E0KA 4JNMA 1KV5A 2H8ZA 1FCUA 2V0TA 3GXTA 4UTIA 4XTIA 3LRLA 4XWUA 4JGDA 1W3TA 1AG1O 2E6FA 1I2PA 1Z48A 1DJQA 2VFGA 1VCFA 2Z0IA 3PC0A 5K4ZA 5EY5A 1Q6RA 1A5BA 4AWUA 3W1QA 1UUOA 4WY0F 2NV2A 4A2SA 4UIOA 3NPXA 4DF2A 1OFOA 3G8EA 2GVGA 1JUEA 1H63A 2RFGA 1I8JA 1VPXA 2XN2A 2H90A 1C9DA 4UFIA 4IMDA 1KM0A 1GEQA 5AN7A 2FQIA 2ZDRA 2A7RA 3EX1A 1FWTA 3UWYA 3T44A 4LS0A 5HNRA 3U2OA 3I7QA 5BRBA 1H7PA 2QCNA 1WYIA 2A5HA 3PB2A 3DFNA 1OK4A 3P84A 2NWSA 2NZLA 4TMCA 5AHMA 2WJZA 3GDKA 3C2FA 3MUXA 1H51A 4UXDA 1MSSA 1DKWA 3CEPA 2YDAA 2YPIA 4MPQA 4E2BA 1OYCA 3S9YA 3O05A 2Y88A 3T78A 3FYPA 1TTIA 4JICA 3I7SA 4S2BA 2RDWA 2HMCA 1EEPA 3NDOA 4KFPA 4FIQA 1QPNA 3TV8A 4MY9A 3IIOA 1THFD 1KM2A 5IM51 1XKYA 4UTTC 1RQEA 1XC4A 1OFPA 2NWRA 1XFBA 3TIMA 2RDUA 5EA9A 1OFEA 2GPTA 3BARA 4ADSA 1G67A 3DBPA 3W7GA 2WO5A 3N19B 4GJ1A 4EF9A 3UD6A 5LGZA 4U4MA 3FKRA 1W3NA 1ME7A 2YYTA 1TV7A 1G69A 2GVJA 1WOBA 4LW7A 2E6YA 3OIXA 3BG9A 4ADUA 1XBXA 1I2QA 5KINA 1MZHA 1SPQA 4UCGA 3I68A 1TTQA 2VFFA 1EP2A 2YXGA 4OE7A 2CLKA 4Q32A 4X3ZA 1R30A 3GR7A 3L9CA 4UTHA 3P8JA 1TPUA 1VH7A 5D02A 3UXDA 4UTJA 3LOTA 4QNEA 4AHPA 1T0OA 2DZSA 4LC6A 3BK0A 3N2XA 4X22A 4R53A 3GVGA 4AWSA 4RV8A 1P0KA 3U6WA 1K7EA 3NGJA 4WXZA 3ATZA 2Z6IA 5CPMA 3MP4A 3B0VC 3DI1A 3IRDA 1FDJA 3DGRA 4LVBA 2NX1A 1AW2A 1PL9A 2A1YA 5DLCA 3LV6A 5LZLA 3TQKA 3P74A 3G0XA 4M6VA 1R47A 1M6JA 2YFNA 2A0NA 4JR5A 5D2XA 4CQ8A 3GNDA 3GKFA 2WNNA 3EX2A 5CZSA 3B8DA 3SW6A 3GDRA 3NZ1A 4ONVA 2HS6A 4ORMA 3ZWTA 1K8ZA 3N2MA 1ADOA 1UCWA 1PVNA 3RK8A 4MY8A 3KRUA 5C2XA 4E38A 1JULA 4HT3A 1XM3A 1W5PA 3QM3A 4XTDA 3N9SA 2VEPA 3NQ8A 4ZL1A 3GAKA 3E49A 2W79A 4UTLA 4JTTA 3KVJA 3GIYA 2QJIA 1JCYA 4LV4A 4R7JA 4N9BA 2XN0A 1GVRA 3QMTA 3NQGA 3NG3A 4WOQA 3HG5A 3HQ1A 1OHLA 2JKPA 2XN1A 5DXXA 1RVGA 2ZQ0A 5BOOA 4K36A 1E51A 4QM1A 2V82A 5HINA 3FIGA 4UFLA 2OMAA 2NXIA 4HHPA 1QFEA 1OYBA 1EB3A 1KFEA 1TIMA 5GVJA 4RZ4A 4MVAA 1GOXA 2ZRVA 3S1WA 3B4UA 3TW7A 5A5WA 1TPC1 1Q6OA 1PV8A 1UB3A 1C8VA 1JCMP 2YYUA 2ISWA 2W6RA 1I45A 1LP6A 2QF7A 1C29A 2ZRWA 3LV5A 4Q4KA 1EUAA 2NUWA 3LX9A 4O18A 5HMSA 1WAUA 4MZ1A 4JYEA 3VFLA 2ISVA 3S5OA 4BR1A 4AXKA 4Z08A 2QCGA 2X1SA 2B7PA 5SWUA 4OQVA 2GQ9A 3H54A 2ATSA 4LS2A 4O54A 3TQ0A 3TCEA 1KFLA 3G22A 3DH7A 3S5ZA 4PL1A 4IGHA 3MBFA 2WSRA 3WK1A 1HO4A 4BFAA 1ICSA 4CNNA 2WNZA 1O60A 2H8XA 4R34A 3EWXA 3CHVA 1QAPA 1M5WA 3UWVA 3TXVA 1JCLA 3W1LA 4AF0B 3W74A 1KM5A 5IBXC 4D2JA 1LBLA 4NXKA 2FPYA 1S5VA 3R2GA 2ISSA 2YSWA 2QDGA 2HS8A 3ZS4A 1SO5A 3VI2A 2C15A 4AHOA 1DOSA 2QUVA 3TH6A 5A8GA 5I3FA 2C16A 4MKNA 3MP3A 1XCFA 3W1NA 2ZTJA 3C61A 3KRZA 3LRMA 2E5CA 4Q33A 2OT0A 3W6YA 4LNYA 1J4EA 4RKAA 1GVFA 3QRHA 2BZNA 3LI0A 3P7YA 4N9DA 5D38A 1KM4A 4UTWA 3NL2A 3C0JA 1I2OA 3EXTA 2CLHA 4O17A 2ZRXA 2YGYA 4EVZA 2JGQA 2YZRA 3CWOX 1KLZA 4XKYA 4WZHA 5C5YA 1KW1A 5U7SA 4KFNA 2GJNA 1TPFA 3W85A 3SFKA 2Z6JA 3G1HA 1O5KA 4NJKA 1OFDA 4Z1CA 5HUPA 3RF9A 3WJSA 3CWNA 1A53A 5AHNA 1H50A 1DQXA 2JKEA 4DPPA 4HN4A 2QCCA 3PVFA 1O5XA 1IXOA 2BLEA 4HIBA 3EXSA 4OV9A 3IIPA 5CG7A 3KRSA 2EPHA 1KBIA 3M5VA 2A6LA 3PBVA 4LUIA 3KOFA 3LXBA 4A22A 1CX9A 3BW2A 3QPZA 3LTPA 1RZMA 4Z0JA 1YDOA 1FWNA 5I3KA 3UWUA 4H3DA 1Y0EA 3CLMA 1WDWA 2JK2A 4UFMA 1SZEA 2V30A 4BI6A 5LNRA 1ZAHA 1LOLA 2R91A 4K8EA 3T55A 1J5TA 4UC5A 1FBAA 4ZQMA 5LNVA 3G8RA 3HIJA 5BNKA 2DORA 3W7JA 3BG3A 3VKJA 5CZ0A 1ICQA 3UWQA 4FHAA 1FCBA 5KZMA 2ZYFA 1VZWA 3HB9A 3LHVA 8TIMA 1G7UA 3S6DA 1VCGA 4TU1A 2BSLA 2ABBA 1VHCA 4FXSA 4WQ6A 4JTJA 4JXCA 1OFQA 3AO0A 4OT7A 1TPVA 3DHFA 1NVMA 3NPUA 2NUYA 2CZDA 1SO6A 3B0UX 5BMXA 2EF9A 1IXPA 1EPXA 3LLDA 1LBMA 1OX6A 5D2VA 1LORA 5G4EA 2NUXA 1DV7A 3GKAA 4DPQA 1VQTA 4M19A 1GVSA 1W5NA 1SO4A 2LLEA 2V9DA 1S3HA 1Q3NA 3ANYA 1F6PA 1ZENA 4MJZA 4FNQA 3TU9A 3NQDA 3UNDA 4O53A 3MJYA 4RZ6A 2J9XA 2ALDA 3HOJA 2E6AA 4P61A 2E6DA 4IPIA 3HG3A 3KHJA 3W7PA 3A24A 4QJ1A 4GFSA 3OG3A 4JS3A 5C55A 1JRBA 1DL3A 3P60A 4POCA 4K7VA 3C2RA 4NZFA 1ICPA 3G1FA 1XL9A 3QF0A 1JCNA 3ABOA 3C52A 2PRMA 2FLIA 3YPIA 2B4GA 1TTJA 3L67A 2B7NA 3EKZA 3UY7A 3TUUA 3HMJG 3S1VA 2OJPA 1DBTA 1OK6A 1RV8A 3CPRA 2EHHA 2W0UA 4YMZA 1N8FA 3DZ1A 4PH6A 3L5LA 4C1LA 2BTMA 3NEVA 5D2WA 1TJRA 3W2JA 2OZ0A 2Y61A 3R12A 3W7QA 4M7SA 1VYSX 3SR7A 1PHWA 1WBHA 3EXRA 1L9WA 5LNSA 1VCVA 3QJAA 1NAL1 5K3VA 2O7QA 3L2IA 3BV4A 4XUGA 1SW0A 2JKAA 4LOCA 2CW6A 3QMSA 4CNOA 2G97A 1T99A 5FF3A 1RD5A 3TAOA 1K02A 5F4SA 3W1PA 2CLMA 2X30A 3O6DA 2QKFA 3WK2A 5AFDA 4MY1A 4Y8FA 1TV8A 2X1UA 3TDFA 4Y9AA 5CPOA 3WK0A 5EPDA 6ALDA 4GUGA 3W7MA 4JTSA 1WQ5A 3TNOA 2Y7FA 4JY8A 3QYQA 4JX5A 2TPSA 3UYCA 1NFBA 3A5VA 4HPXA 1K7XA 4Z1BA 1FWRA 1YPIA 3F03K 5G2HA 4CQAA 5ABTA 1U5JA 5KMYA 5AC6A 2V2DA 1S5TA 2Y85A 5C54A 6TIMA 1D9EA 3NZRA 4AB4A 3DENA 2OX1A 3ZFHA 3EX4A 3NM3A 3PR2A 3BGJA 3LGEA 3SSJA 3BPWA 1KFKA 1H62A 4FXRA 1GVQA 5AOUA 5LHEA 1LBFA 5DCBA 5LSMA 2E09A 3KFTA 3O6YX 7TIMA 3Q58A 2A6NA 3GDLA 1MXSA 1CI1A 1JJKA 4NT0A 3S0CA 3LERA 1M7PA 1SQ7A 1GVOA 2E68A 4LS1A 3WJWA 4O0ZA 5CSSA 3DKLA 1AMKA 4FO4A 2Z2UA 4ZMGA 1W1ZA 5G1TA 1DORA 4DEFA 3W7LA 3SY5A 3G1AA 3A22A 1ZNNA 3C2EA 4GUFA 2QUTA 3EEGA 4IX0A 1EX5A 1TPH1 2QAPA 3C8FA 1CW2A 1Q6QA 4A2RA 4FX7A 4RR4A 4DELA 1DHPA 1XXXA 3L65A 4DQWA 2FB2A 3WJXA 4G1KA 1KFJA 3P81A 3ZR4A 3HPZA 2ZRZA 5KZDA 3TX9A 3TXZA 1SO3A 3C56A 3S8HA 3SI9A 1GJPA 3M0ZA 4RX0A 2ZTKA 1TV5A 3W1RA 2OT1A 1G4TA 1ALDA 1A5CA 1TB3A 3O1NA 1LRTA 1GYLA 2JBMA 4GUHA 3LHZA 2CWNA 3E12A 1JQVA 2R14A 1H7WA 3FKKA 1PIIA 2CLIA 3TR2A 2XFWA 3W07A 3W2UA 1FXQA 1ME8A 3CM4A 3IVTA 5DBUA 2FFCA 3PSVA 3ELFA 4H6KA 3MYOA 1GWJA 1YXDA 4UTKA 1O95A 1IXNA 1LZOA 1MEWA 2DP3A 4PFMA 3TAKA 1QOQA 4HPJA 2DU2A 4CLMA 1RR2A 5CZTA 4MZYA 3HGOA 5EYWA 2FPVA 3G3MA 2WSYA 5L9FA 4ZQCA 5AHLA 1EP1A 2UV8G 4IMCA
chains in the Genus database with same CATH superfamily
2WOQA 1FH9A 1X8FA 3TW6A 2OLAA 4HA3A 3RLGA 3P8IA 3UA4A 1V3KA 5KZEA 2NLYA 4XD3A 3U5YA 5DN1A 1CGXA 1EXBA 5DQPA 4HMCA 4E0CA 2BVTA 1QWKA 3BJFA 3EPMA 5CQ1A 3QTPA 1VYPX 4KEMA 4QG9A 4XAPA 2VT0A 2CZVA 3URNA 4PTWA 3NYDA 4FF7A 4Y6GA 1AD1A 3WQCA 2QZRA 4BI7A 3U48A 1A0DA 3W73A 1TMQA 2QUMA 4KWVA 3U2ZA 2GJLA 5M5DA 1FP9A 1IZJA 3GS6A 2IPFA 3D3FA 3DFYA 4LFYA 5HJXA 4CCDA 3M5XA 3GH5A 3UWWA 4WX2A 5T8GA 4AVNA 2V5LA 1XLHA 2QMJA 5F1VA 1EJVC 1R3WA 1SJBA 1I2RA 1LRNA 3IGUA 2Z25A 2ZZ7A 5LNWA 1W9DM 2GGGA 2VD9A 4N6FA 5HMEA 5HAOA 4M51A 2FGZA 4L4LA 1EEXA 2FJKA 1J18A 1V7YA 3M4HA 4DXXA 5MF5A 4H2HA 3RMJA 2CITA 4O50A 1XFCA 3MO7A 2QAFA 3PUDA 3RXZA 1NIUA 3BOFA 3STFA 3BLLA 4C7FA 1LLZA 4ERAA 3AMLA 4PCFA 2DZXA 4KIRA 3MB9A 4I7VA 4XK2A 3W7OA 1HNYA 5E0CA 4E6MA 3LHWA 4BQ5A 2NXHA 3HU7A 3UWEA 1RPXA 2V5CA 4EXAA 4OGZA 3PF3A 4FMVA 1W9UA 3C86A 1EIBA 5I6SA 4OIFA 2VFDA 1GOOA 3IV8A 3HZ3A 5CJNA 4I9JA 4Q8MA 4M7TA 5HWMA 3T81A 1GG1A 3MZ2A 4BI5A 2FIQA 2Y62A 5HA7A 4TV6A 4PULA 3BV7A 2REQB 2ZZ3A 1LLWA 2A3LA 3G24A 4D8AA 2F6UA 2V3FA 2W5FA 3EZ4A 3QZEA 5DXYA 5DMYA 5EU9A 4RZ5A 5CAHA 3NQAA 1L6YA 2VZTA 1X1ZA 1UR3M 3EDEA 4LVGA 5K9DA 5DT5A 2FPTA 3GYEA 1V0LA 1FCQA 3OGVA 5LIUX 4F4RA 5A3HA 4DIAA 4QNWA 3CAKA 3G6MA 3N1AA 3GW3A 2YL5A 4QE4A 2ZC1A 2WSQA 3LENA 3UJEA 2Z24A 4TTUA 3ZSTA 2E1DA 1JEZA 5A1AA 4GBUA 2OKOA 3GNPA 2C79A 1JCJA 4HU0A 3L2MA 1SYTA 4I8DA 4A3UA 3ZJ8A 2PPGA 3GX9A 2HQAA 4AEOA 4D6JA 4YHGA 4XBJA 2FH8A 1US0A 2BY2A 3S2CA 3UZZA 3NDYA 4PUEA 4RZBA 1ZCOA 4YU1A 4ML9A 1QNOA 5BOFA 1RSCA 3BW4A 1ZJIA 3N3MA 5JBDA 2VOTA 3LCHA 5DY2A 3DXIA 3CUXA 2X1RA 2XHYA 3UXKA 3WK3A 4O0KA 3ONBA 1Q6LA 3MJMA 3P3BA 3RX4A 1LYXA 3TONA 1OIFA 3HBLA 4I7WA 4LUTB 3WNPA 4IMGA 1TUFA 1XYBA 1TQXA 1XQKA 2CLEA 4J2PA 3KVKA 4Q8OA 3DIPA 4S3AA 1BG9A 1QR7A 4GKTA 3IEBA 3SGGA 3A5FA 1YXYA 1RBLA 4NJJA 1SMDA 2HVMA 2J66A 1BYAA 5AKQA 4XB3A 4S3DA 1TA3B 5CZJA 3P2VA 4GUJA 1EQCA 4BWLA 4RXFA 4UQ9A 2B31A 4C6QA 4BY3A 3CJPA 3VABA 4W93A 3LCWA 2PE4A 1KFBA 5AYXA 3GG0A 3KOZA 4TX9A 5FEWA 1TX0A 3DFTA 4NF7A 1L2UA 4WIWA 4MADA 3ME3A 3WMSA 3UCQA 1EGMA 3CH9A 2QGHA 2YX0A 1HVQA 2QPSA 4GI6A 2GOUA 2C1HA 6A3HA 3S42A 4PRTA 4NVTA 3EOLA 3QW3A 2YCEA 4H19A 3UPMA 2OSYA 1DTNA 3O2LA 4ACZA 2PRLA 2PLMA 2ZADA 4UCFA 2QCLA 3EWBX 3UXAA 1FWHC 6XIAA 3M16A 4O28A 2W66A 3ARQA 1VJIA 3VNKA 4XAFA 2QJJA 4NU7A 3KCLA 3E2VA 1O12A 3EWDA 3VNJA 4Q8VA 3UJRA 1F8IA 3AMDA 3C2YA 2HTMA 3PPFA 1TVNA 3W7HA 2VGBA 3R13A 4IGNA 3VDCA 3VDBA 1W32A 4JFVA 4NI3A 1H2JA 2DUXA 4L5ZA 4QJ4B 5LXXA 4YPJA 2WMJA 3GDBA 2VENA 5FACA 1H7XA 2G3JA 3DECA 4XSMA 4GLEA 1NFPA 4K7YA 1TPEA 4Y90A 3SGUA 3LNPA 1W1A1 3W9ZA 3K30A 4KT2A 1FA2A 2O56A 4WK9A 1H1YA 2BS9A 5KSWA 4HNVA 4DF1A 1UWIA 4DY1A 2Z1KA 3EX6A 3T2QA 4H9XA 5LIXX 2QJNA 3N4FA 5DY3A 4B90A 1HXJA 1P0DA 2G41A 3BVJA 3U5UA 4LBRA 3CIVA 2R9RA 5D4YA 3NYZA 4QTGA 1K9EA 4D6GA 3JS3A 5FAGA 4CCZA 5BZAA 4IUOA 3WO8A 4HTYA 1DQWA 4LGXA 3GHSA 1ME9A 4CD5A 3WH6A 2WJEA 2BWGA 3PAOA 3EKLA 2X2YA 2JIWA 3HGRA 1IWAA 3W1XA 1R6WA 3V75A 2A79A 4GA8A 1U5HA 3QVQA 4Z1DA 3ITVA 4HZMA 3ONCA 1IGWA 5CCZA 3WQEA 4W7WA 1LG1A 1Q66A 4ZXOA 2HNHA 5U4NA 2ZA1A 1ZAIA 1XUZA 4NNCA 1TJ1A 3KBWA 2OQLA 2V38A 5D9PA 1Z3NA 1MNSA 4QXIA 2J4GA 2ZFAA 5I00A 3N4AA 3JU2A 4OU1A 1WV2A 2X1TA 1Z7AA 1IZCA 4AH7A 4A29A 4PTVA 4R27A 1XF0A 2D22A 3A9IA 4GJJA 1RQHA 2PI6A 4N42A 5BRPA 3D46A 4LX4A 2VHLA 5I3IA 1PYFA 3ZSSA 1Q85A 2FTPA 1BSLA 3PJUA 3CAQA 5JH2A 2EPKX 1FH7A 4NZJA 5I09A 1GPWA 3LPOA 1P0NA 5TIMA 3WLNA 4D6CA 2WC3A 3N6QA 1UKTA 2VP8A 1A49A 5D2TA 3G18A 4RUBA 2PDYA 3R25A 3WFZA 4K1WA 8XIAA 1CENA 1J2WA 2Z1BA 3RM4A 3IIXA 2VUNA 1JGIA 1T8XA 1PCWA 1XIMA 1ZJHA 5TD4A 1U1JA 4ZO9A 1IXQA 3CT7A 3CU2A 1UKOA 3W2KA 3KXQA 1GJUA 3DX5A 4NNBA 2E9MA 2X8RA 5FL0A 4JN6A 3OEXA 3CBWA 1V0NA 2EKCA 3M44A 4UMBA 3SUUA 1J11A 3GZ3A 1XYAA 3LDVA 1GKQA 3DDMA 3MHUA 1MFUA 3LPFA 1CB2A 4GY1A 1ZBWA 1SW3A 2ONEA 1GQNA 2ZOXA 3QW4B 4P7LA 1J0HA 2BXZA 1H60A 4DBDA 2HCVA 2EQDA 4UQCA 1J79A 4LCSA 3L68A 3MSDA 1UWRA 3AXXA 4Q8NA 2CHRA 3F1QA 2W4XA 4WGXA 5A95A 4GH3A 3G1SA 2VELA 1VPYA 3H7UA 5LNUA 4IMEA 1OINA 3RU6A 5D37A 3NQ7A 3TSDA 1AFSA 4XO7A 4LUJA 1XLJA 2A3BA 1EF3A 1Z41A 4N4PA 3TVAA 2CZEA 1FCVA 3Q37A 3TYAA 1EOKA 4PUNA 4PBEA 3JUGA 5CG0A 1IYXA 3BG5A 2F84A 3HQOA 1RH9A 3RUBL 3M7WA 3QHMA 2NLIA 2ABAA 1LWJA 3N17A 3CTLA 3SCRA 2XM2A 1QRQA 3NURA 2WQPA 2FZNA 3S2NA 2ZIDA 2YB4A 3GR8A 3LPGA 2YLAA 1SZFA 3W7KA 3C4UA 4HN8A 3CMJA 4ECLA 1ZTVA 3TFXA 1UMYA 1OX5A 2C0HA 2V3GA 3APTA 2QMKA 1C92A 1R7OA 1Q2SA 1JAKA 3W0KA 1BWVA 2EBNA 3WQWA 2POTA 3GNNA 4XISA 3GXFA 3QGKC 1K6WA 4UNKA 1LF1A 1KBLA 3THUA 3ZQ9A 4QDWA 1OT2A 5DO8A 3T4WA 4FP1A 5AZ1A 1GW9A 3MDUA 1AZ2A 2C19A 1W8SA 3TYCA 1HW6A 1QDSA 3OQ8A 4BWLC 5JH1A 1ZAJA 1KBKA 2NVCA 3QC0A 3HPXA 3I10A 3OZYA 3A64A 4KRZA 1OFRA 1P6CA 3L2LA 3KS5A 3O63A 2V5BA 3U57A 3BJSA 1BG4A 3T05A 4PMVA 2YCKX 1PHQA 3PG9A 1N8WA 4PCTA 2WQDA 3CQKA 2WMKA 3TN4A 1JDFA 5LIKX 3V5FA 3UCDA 3C3UA 1B54A 3VTRA 4HOZA 1LLOA 5K4XA 2EPLX 1J2BA 1JVNA 4QIUA 3IGXA 1H0IA 5BRQA 2P50A 3W7CA 3CT2A 3GDMA 1PZ3A 3W7RA 2ZZ2A 5FF4A 3H22A 4LAMA 4XG1A 3AZSA 4S1FA 3TMQA 4PTNA 1FH8A 1TREA 1UWQA 2YCIX 3AMGA 3DAQA 4B4HA 2WZTA 5DX7A 4AY8A 3RILA 1SVDA 2FKPA 4ZBCA 1EJXC 1YDVA 9XIMA 5L6UA 2Y7DA 1AW1A 1Q6CA 3OLGA 5J8LA 1FX6A 5CPNA 1P43A 3B9DA 2CXEA 1RAKA 2IXVA 2QUUA 3FOKA 3L4WA 3W2LA 3WLSA 3SN1A 2RDTA 3K4AA 1W0MA 3WJYA 4MFEA 4UFJA 1OG6A 4QR6A 3AMKA 2P10A 4LB4A 3L0GA 3PS7A 3S83A 4C91A 1P4CA 4HNLA 5K9CA 1MUMA 4PB5A 3HGSA 3HM7A 1ZALA 2A3AA 3PSWA 3TC6A 1EYEA 4K39A 3B9EA 1R0MA 3L0KA 4I6VA 5LGXA 2VTFA 2YDQA 1OB0A 3B05A 1QUMA 1PKLA 3W25A 2OSWA 1R3RA 3AU2A 1WXJA 3A21A 3SRFA 3AIQA 3SRDA 4YNGA 4UMAA 4YTUA 1WP6A 1CIUA 1ZBCA 5HWJA 3JZEA 3UQNA 5EMMA 1ZJAA 3M47A 3TYDA 4IPNB 4JDBA 4YWSA 4FNTA 5GNZA 5I3HA 2DSWA 4FIRA 5BXTA 2PDCA 3QZ6A 4J3VA 2PP3A 3R89A 5TBOA 2XFYA 3WLRA 1UBPC 1ZU8A 4HPGA 5DRCA 4I3GA 1FWCC 2H9AB 4XAZA 2ZZ4A 1SZNA 2E77A 4MWAB 2AMGA 4ZTYA 3LLFA 2WBKA 5F2GA 4JFUA 1A5UA 4J9JA 3V1HA 1SZGA 3TA9A 3CV2A 5BW6A 3TW9A 3GK0A 1WXZA 1AZ1A 5D33A 1YRRA 3W75A 1XISA 1QTWA 3QSRA 4HK7A 3QV9A 1BYCA 4B5XA 4CN1A 1VAHA 2C3ZA 3BLOA 1XD0A 3M5YA 4BQ4A 4M24A 2VL4A 2UWFA 3E1F1 4AG0A 1W1TA 1NOUA 4ZQOA 4QQ3A 3HQNA 2VXNA 3GH7A 1T96A 2BGQA 3NQVA 1KLYA 4MFDA 1CTNA 3PP7A 4NAFA 5A8PA 2RAGA 3EX3A 3TTEA 3CPGA 3DFOA 1B3WA 2D24A 3GW0A 5E0KA 1K9FA 4JNMA 2H8ZA 3UZYA 1J5SA 2E3ZA 1JIBA 1YPXA 4UTIA 4XTIA 3GR4A 3GTXA 2PLJA 1K8CA 1NARA 4XWUA 4XZWA 4E3TA 3CQJA 2W92A 2XVKA 1V3MA 1I2PA 1Z48A 1TWZA 1GZJA 1IEQA 2Z0IA 5K4ZA 3LM3A 5GJMA 5IOBA 5EY5A 4PEEA 2PDLA 4A2SA 5FD0A 2HPIA 3QY8A 3G8EA 1JUEA 1VPXA 1K1DA 2ISDA 2J6VA 1EOMA 3G5EA 3ITCA 5AN7A 1XCWA 5ABHA 2CETA 5AC4A 1S2TA 2HV5A 1FWTA 3UWYA 1WKFA 5BRBA 1H7PA 2X1IA 3HJEA 2A5HA 3VOJA 3DFNA 3PZIA 1RUSA 3P84A 2NZLA 3VIKA 3TN3A 3HN3A 3C2FA 2WVVA 1DJZA 4M8UA 4X2PA 1UWUA 2YPIA 1KQZA 3SIMA 1UD5A 2ZKMX 4E2BA 3CZEA 3N2TA 3KM8A 3S9YA 2QV5A 3O05A 1ENUA 2Y88A 1P0BA 3B97A 4GZJA 4MWAD 4Y9MA 1TTIA 1QBBA 3RO8A 3SUWA 2RDWA 3NDOA 3UR8A 4FIQA 3GIQA 3TV8A 2WZHA 2OB3A 5AYBA 2GPTA 5A6MA 1OGBA 5HOSA 3SN0A 4ADSA 5KETA 4AVOA 2WO5A 4NSBA 4GJ1A 2WC4A 5CH9A 2OOFA 1CDGA 3VKDA 4MG4A 3BG9A 4IPLA 4ATLA 1MW0A 3HQPA 1MZHA 4C6KA 4UCGA 1CYGA 2AL1A 4IFKB 4WDWA 4U3CA 5IRPA 4YHEA 1R30A 4UTHA 5IXEA 3P8JA 5MKGB 1AMYA 1WZMA 1GOMA 3TJ4A 1VH7A 3UXDA 4UTJA 2XM1A 1YNQA 4IJCA 1BRLA 4AHPA 3BAYA 2J74A 4CEXC 3BK0A 3H70A 3O9NA 3K46A 2Z6IA 4Q4RA 1P7TA 3IRDA 4LVBA 3ZZ1A 2GK1A 1AW2A 3TQKA 3BZJA 4AY1A 1R47A 1RHCA 4Z1YA 4JQ4A 2A0NA 5D2XA 4U33A 2XIJA 3B8DA 3VOCA 1W9VA 4HB7A 1EHNA 4HU4A 4JIHA 3GNRA 1JULA 1TJ2A 1XM3A 1F4AA 4QS5A 2OVLA 2VEPA 3NQ8A 5FKYA 3S9ZA 3GAKA 4G8TA 1XYZA 1E1CA 2DSVA 3KVJA 3QHNA 4CU7A 1Y5WA 4QE1A 3IS4A 1JCYA 4LV4A 4AZIA 3VZXA 3CUIA 3MA8A 2NQLA 3IWPA 3QMTA 3MDWA 1E6QM 2AL2B 1QHPA 1EJSC 5HMDA 5A8MA 3CNYA 1Z69A 1BXNA 1EKOA 1YKWA 4UFLA 4Q4QA 7ENLA 1QFEA 2XSXA 1R3YA 1KFEA 2QUNA 4P8WA 1PX8A 1XLMA 4MVAA 1JZ8A 4R3UA 3BE7A 4UZUA 3BAXA 1B5TA 4FLRA 3TW7A 4AC1X 3RRXA 1PWLA 4JN7A 1K4GA 4S23A 2W6RA 1C29A 2IPWA 1LQ0A 4Q4KA 3KZPA 1WDDA 3T0TA 2BY3A 5KZ6A 3QGAC 1XIEA 1NQKA 2UY5A 4FR6A 5A94A 4IT1A 4C65A 2R82A 3GFXA 3H21A 1JI1A 2QNEA 1HJUA 3TQ0A 2DVTA 1M7XA 3KWSA 2OODA 1O68A 3S5ZA 4PL1A 1RBOB 3BH4A 2WSRA 2BV9A 1HO4A 1E9IA 4BFAA 3ZLFA 2XGIA 5PTDA 4W86A 3TXVA 1GCYA 3W1LA 5I0DA 4AF0B 4D2JA 1E4IA 3ZS4A 1SO5A 1E9ZB 3DYPA 3DUGA 5I3FA 2V69A 5T9CE 4GQBA 3MP3A 1XCFA 1YDYA 3MVTA 3LRMA 3SN4A 3WL1A 2OZ3A 3PN8A 4MWAC 5FJPA 3LS9A 2BZNA 5D38A 4UTWA 3C0JA 3EXTA 4O17A 1JPMA 4IZGA 4EVZA 3E74A 1OT1A 1KLZA 1A5LC 4IG2B 4HZ7A 1XYCA 1UR1A 2GJNA 2D1ZA 3WQ6A 1O5KA 2BOEX 2ZX9A 4CU6A 4NJKA 3NO3A 5AY7A 3RF9A 3WJSA 3VIIA 2P88A 1GZ1A 1TVLA 3TYUA 4QLKA 2W63A 1QHZA 3R0DA 3IIPA 3OGSA 4X61A 3SB0A 3TQPA 3PBVA 3KOFA 4W84A 4A22A 4AUBA 2G50A 4AYGA 4Z0JA 3UWUA 2JK2A 4HNOA 1FRBA 2VRKA 3T55A 4J40A 1OY0A 3WF0A 3VIGA 3T8QA 4R5EA 2DORA 4V2XA 3VKJA 2WANA 2Z1WA 5A2AA 2YDSA 1ICQA 2J7FA 3UWQA 1DWJM 3QKEA 6CGTA 6XIMA 1VZWA 1XW8A 5D9MA 3OP2A 3GG7A 4HNCA 1L0PA 1VCGA 4WKAA 4EE9A 1VB9A 4FXSA 2QULA 3GBEA 1G1YA 4OT7A 4LBUA 4CU8A 4S3BA 3WQ5A 2DVXA 4DO7A 3QFWA 1UP0A 2PSNA 1A3XA 1EPXA 3LLDA 5FJJA 1OX6A 1HKWA 4GIEA 1NY1A 4UBPC 3VGEA 1I1XA 4EXBA 1FKWA 3RPMA 1VQTA 1KWKA 3S1GA 1BXBA 1W5NA 1W9PA 4PMZA 1RCXB 4I8YA 1Q3NA 4IH3A 3ZXWA 1JYWA 1A5MC 3ANYA 3WNMA 4FNQA 3CH0A 1V51A 1UIOA 3HOJA 3UF9A 1J9YA 3PNZA 3RR4A 3GO2A 1E40A 4JS3A 1C91A 5C55A 4JTCA 3HFYA 3ISIX 1U2YA 3H6OA 1ICPA 1XL9A 3TLQA 4L7ZA 3C52A 2PRMA 4BKNA 2B4GA 1TTJA 1OCBA 3L67A 3TUUA 4UOZA 1OK6A 2EHHA 3WLKX 2WNWA 4PH6A 1NTHA 2Z1SA 3H2NA 4UOQA 4KGJA 1JZ6A 3D3AA 3W2JA 2D20A 4WSKA 4MNKA 3W7QA 4M7SA 4P7QA 1W1B1 4IP5A 1MW3A 1P48A 3AISA 2XUCA 4E2VA 2PDQA 3KP1A 1SW0A 2JKAA 4RE3A 3S6OA 1C90A 1JI2A 2G97A 4HHMA 5CC6A 4AIOA 1Z9AA 5F4SA 2X30A 3IJ6A 2QKFA 4Z2GA 3WLLA 3NOYA 1FFQA 1GOWA 3VMPA 1ZUAX 3AHYA 4Y8FA 4KWUA 3UXIA 4Y9AA 1NDWA 5CPOA 3N4EA 4F8XA 4GCXA 2G4JA 2GYIA 1WQ5A 2VRJA 4I5RA 4NAEB 2WYSA 4PZVA 3LBOA 3QYQA 1D7KA 1H41A 1F3TA 2XIOA 3AQUA 1NFBA 3A5VA 4HPXA 4Z1BA 3WLHA 1XQLA 2OZTA 4CQAA 7PTDA 5HK4A 3CZKA 3VD5A 3DBNA 5C54A 4AIEA 6TIMA 3T2PA 2HVNA 2OX1A 3ZFHA 4DWSB 3PR2A 4V33A 4REQB 1F61A 3EMCA 3UG4A 3REQB 1E6NA 2PDXA 5EMYA 4D6FA 3KFTA 3GG1A 3KL3A 3SCOA 1XYLA 2Z28A 1QI2A 3MZNA 2FMOA 3WMCA 5XIMA 2E8YA 4HYRA 4QCFA 3WJWA 3DHUA 1JYVA 5CSSA 4GZ7A 2J8GA 1OZQA 2QJMA 4ACYA 1DP0A 3D47A 1DORA 2VEFA 4DEFA 2J7BA 2O55A 5G1MA 2QUTA 3BLKA 1BKHA 4A3QA 1EHAA 1KXHA 3AS0A 3EA3A 4A2RA 5E70A 1XC6A 2Y0FA 4PFHA 1XXXA 1E0TA 3OU8A 1T41A 2HISA 1DXFA 1XIDA 2XH4A 5KZDA 1TR9A 3TX9A 3S8HA 3SI9A 2ZTKA 2OT1A 5ABFA 1ALDA 1BVWA 1M7JA 2HWGA 3O1NA 3FCPA 3PZTA 2CWNA 2WVSA 3ZVIA 1H7WA 3W2UA 4MNMA 2EXOA 1OBAA 3PBMA 5GNYA 4UTKA 3URAA 1IXNA 2DP3A 3TAKA 4HPJA 4ZOBA 4CLMA 1XICA 1EA9C 4MZYA 2WK2A 5EYWA 1CXFA 2FPVA 2WJFA 3CV7A 2WSYA 4D9PA 5L9FA 4UQEA 4ZQCA 2OXNA 5AHLA 1EP1A 3M07A 4KGLA 3F2BA 1QXLA 5AHIA 1VEMA 1XCXA 3THAA 1G5AA 3FN9A 4GIRA 3VXGA 1X7IA 1WXYA 3VDGA 4WKFA 3MI6A 2NV1A 1XLCA 4GI9A 3DHDA 4HPHA 1YTDA 3QR3A 1TELA 3JVAA 1W5QA 3AFBA 8RUCA 4J2MA 4O10A 4O16A 1MQRA 1TWSA 3MQTA 1A5OC 1QOXA 3VOFA 3TKFA 2PGWA 3B4YA 4OFCA 4AFYA 2VUYA 4DWSD 4B2DA 3L4XA 1HKIA 4FXJA 3W1MA 5EKYA 4D6DA 2R8WA 4JEJA 3NNTA 4WY0B 4HKPA 2Z2BA 2DJLA 3L12A 3PAJA 3FEMA 1DE5A 3O06A 3PFMA 1Q4NX 4PA8A 2FZ9A 1DWGM 3TZFA 3NSNA 5I03A 1N55A 4ES4A 2GLKA 1UA3A 4Q4MA 1AA1B 4RDVA 1U22A 2VYOA 5T9BG 4YXGA 4V28A 1XIFA 3VGGA 4A8NA 1BQCA 2CWXA 3OHIA 1VEOA 1CZ1A 1E9YB 2G8ZA 3L21A 5BYWA 3QLDA 3W23A 3MWCA 3W87A 1DWAM 4FOJA 4UTWC 1ELSA 1OC6A 3V5CA 3TTYA 3PWIA 3KCJA 1B4KA 4OHQA 4AMAA 2BXVA 2XVNA 3ZWSA 5FJUA 3W81A 3UP8A 4MZ8A 3T42A 5C9RA 3HF3A 4DBEA 5FAJA 1MEHA 4ADTA 2R6OA 3V18A 3VE9A 2V81A 2OTDA 2ZCGA 1TSIA 2WB5A 3BSHA 1UOZA 3A13A 3EWYA 2JGYA 4UMCA 1D8CA 4QSFA 2CNCA 2XYLA 1W1PA 1GT8A 3BDKA 3S1XA 1Z44A 1S5WA 1EDGA 1REQB 4CEUC 5IHRA 1IIGA 4BHYA 2JEQA 4A6GA 1EO5A 3B04A 4M6QA 5JIPA 3ZLGA 3IIVA 2DUAA 2OX4A 4JD4A 1HL8A 1N82A 3J7HA 4XZ9A 3S1UA 4I6KA 3CQIA 4JX6A 4JKLA 4NG3A 4QFUA 1W3LA 4HYWA 3D6NA 5A2CA 1ZCCA 1HQTA 5AHEA 4ICMA 2J9YA 5I02A 3B8SA 4CQ9A 2E7FA 1PWMA 4GD0A 4GX8A 1BQGA 2B7QA 1E6PA 5FSEC 2TODA 3G2GA 4CKQA 1KA9F 3AMCA 5DRIA 4MUZA 2EKGA 5G4WA 3AWOA 1VS1A 3EBVA 1TJ0A 4QISA 2H3DA 1Q45A 3TK7A 2HBVA 1JGMA 3VZZA 3D0CA 2HSAA 4H1ZA 4Q7BA 3SURA 2AAMA 4B92A 1S5MA 2V2HA 1GQJA 3K13A 2E5DA 2CHNA 3C3NA 2ZZ1A 3G3DA 3QEZA 2PS2A 2YLLA 2E9BA 3LCLA 3N13A 3KTCA 4EWJA 2CCRA 5F2MA 4R33A 1UKSA 1TR1A 1AL8A 1ODUA 3O6CA 4IIDA 3NAVA 4KCWA 2TYSA 2C0AA 2ESCA 2NQ9A 3M6YA 3WN6A 3CYJA 3S9IA 1DJNA 5BWAA 1LCOA 3KWXA 2P3EA 3WNNA 2A4AA 5HQLA 2C1GA 2AOSA 4DWSC 3ABRA 4U28A 3SCVA 2Z00A 4IP4A 3AS1A 8XIMA 4MB3A 1CB7B 1QMLA 4Q8UA 1TQJA 1ZL1A 4WD0A 2DZPA 3LXCA 4H6RA 3I65A 2Q3RA 4WXYA 3RM8A 1B3OA 3PTDA 3FGCB 2DPEA 1YDNA 3OVRA 4IJBA 2AMXA 5I7GA 3MHFA 2BP1A 2Q6ZA 1GOIA 1JZ2A 4UUIA 3CAVA 4IUGA 4F9JA 3BCJA 1KKRA 2VGGA 3IJQA 1YLVA 4O52A 3B9NA 1CXIA 5T26A 1V3JA 5LIWX 2C91A 2DIJA 3P62A 2ZVIA 5G2WA 4BF5A 4AISA 2G4FA 3RR1A 1J6PA 2DEPA 4J4KA 4LT9A 1XUUA 5A6AA 2OWWA 4DUOA 4IWWA 4E3VA 2WSKA 5CBJA 4RE2A 3AYRA 1RK6A 4JTRA 1Q65A 1A3WA 3LSBA 1WZKA 1M04A 2QVHA 3WLJA 3PM6A 1QW8A 1HUVA 4DZIA 5CBIA 1WOAA 2VRQA 3WQ8A 3WF4A 1JYXA 4DO4A 4C6LA 1UYQA 2C1IA 1PXGA 2ZUVA 3VD7A 4F2UA 2QLYA 4PUMA 4M29A 1F7BA 3SJ3A 1Q6FA 1G4EA 1KFCA 4H9TA 5CKSA 1C9WA 1UR4A 1XBVA 3ABZA 2Y8VA 5D09A 4RPPA 1J01A 2GVLA 4MB4A 4EACA 5EGRA 1KM1A 1M53A 5JQ9A 2D0GA 4O15A 5K9XA 4OJYA 3M43A 3QKZA 2ZZ6A 1VYRA 4N02A 5AHFA 2D2GA 4E2OA 3I6TA 2DSZA 1SW7A 1XDJA 4QLLA 1HG3A 1MXGA 2G3IA 1EX1A 7XIMA 1IV8A 1OG0A 3R94A 2YW4A 4ZSTA 3LN3A 2VFEA 4A35A 3W22A 3AIBA 3WYZA 2VX4A 3A4JA 4YL2A 3USBA 1QI5A 2WAGA 4A21A 2D0HA 4UTMA 1QNVA 3U8GA 2EAWA 5DF0A 3NA8A 3P82A 2VEIA 4UQAA 1ZRQA 5FF2A 3VD3A 1QPOA 1AK5A 4LAUA 4I9MA 3WMBA 3EMQA 3CGTA 2CZFA 1QOPA 1Q8JA 4PC8A 1GYNA 2XVPA 3W7NA 3N25A 3W88A 3IGSA 1J0IA 1EWDA 2IQTA 2DT1A 2G96A 4GCAA 4IPPA 4AD1A 1NSJA 5FI8A 2YFOA 1AH0A 4JTIA 4AX7A 2RKXA 1G4PA 3W27A 1JXKA 1MYRA 5LHFA 3MWAA 3VX0A 4D8LA 4MDPA 2ATMA 4NJIA 4TMBA 9CGTA 5HUOA 1SFJA 3CUFA 1UPMB 1OABA 3B03A 1TV4A 1F05A 3OVQA 3OLDA 4LY8A 3VIHA 3QOMA 1FQ0A 1QI3A 1RA5A 3Q67A 4O1DA 3WDPP 4PUJA 4KERA 3W70A 2HNEA 3PBYA 1ECEA 3BCDA 3LCFA 4EP8C 3A4WA 3PTKA 4ZVJA 4LSBA 4GE8A 1KTBA 2DIEA 4PMXA 3MW7A 2OYMA 1E72M 4ATDA 2OGYA 2QVNA 4JTUA 3RLVA 4O8AA 4NJHA 2J7GA 3FY1A 4BK9A 3H2FA 4GIAA 2MUCA 4B3ZA 1A47A 1PB0A 1CLKA 4MIMA 3PANA 2WHJA 1GJWA 4KRUA 1W3IA 5CPTA 3CMGA 1KR1A 1UD4A 1UR8A 1IEIA 2OWCA 5HQEA 4AY7A 3VNZA 4EANA 2OR2A 4E4UA 3MBDA 4GO8A 1XI3A 4LH8A 3ITOA 3JRKA 4J35A 3WG6A 4G7EB 2TSYA 4E4FA 3AYSA 4XX6A 2NSOA 4CNPA 1F6KA 4J3TA 1MDRA 5KITA 3A6OA 2D2HA 2UY4A 5XIAA 3CUGA 1V08A 1M41A 2ZUUA 2ZWZA 4L9YA 3PJTA 1LUCB 4C6EA 5CLTA 2BOFX 1VLIA 4JIQA 3GTHA 4KEVA 3MI2A 1XLEA 4UTTA 2O92A 4PMQA 4PUUA 3K4DA 3O15A 3CUJA 4UFHA 4ZOAA 2RJGA 2AQWA 3ARWA 3T40A 1JCTA 1UZ4A 5EFDA 4GPNA 5AVHA 3PULA 3NQMA 3KRBA 4RDYA 1WUEA 3SAZA 3LQLA 4UTUA 4S3KA 3CZ8A 3DFQA 1KRCC 1DVJA 3SDOA 1A5AA 4XSLA 2QR6A 1BHGA 4WGHA 2VZOA 2D69A 1KQYA 5HR7A 3OHMB 5G5IA 5D2YA 4MSSA 1A80A 7ODCA 3U4FA 3VC5A 5E9AA 4P2VA 4GOAA 4LALA 3N14A 4DRSA 1O6IA 6ENLA 2VNCA 4Z2KA 1KCZA 3V0SA 3I4KA 5LA0A 4B5WA 2I57A 5FESA 3ZLHA 3CLWA 2B81A 2YCLB 5BU6A 1POKA 1F2JA 1LOQA 4LVDA 3UEQA 1R7AA 1VBGA 5MHBA 3P6LA 4JTDA 3I6RA 3VNDA 3UPWA 2OU4A 4CN4A 5A6KA 1O4UA 2BMBA 3H23A 2NX3A 2ZA3A 4AD2A 4RK8A 4MPKA 1L8PA 1GTHA 3TCSA 5FF7A 5I3GA 4MUPA 2NT1A 2DDXA 3MS8A 1RQBA 3IVUA 2NQHA 4FNUA 5EMUA 1LWHA 3DKJA 1BKSA 5A69A 5F2IA 4AZ7A 3T4CA 2X05A 2WZEA 1GNXA 3THQA 1K77A 3L5AA 4XZHA 5HBFA 1A5NC 1TCDA 3C8NA 1RCOB 4ZTXA 3M7SA 1EWEA 1VBRA 4OKDA 5EBAA 1JPHA 3RAOA 3NR0A 3NO5A 3H7VA 3E0IA 3WF1A 4A8LA 4ZQRA 5CEWA 3PBUA 4JTHA 1QWGA 3UETA 3PUGA 1OZMA 3CC1A 3EB2A 1A0EA 1C7SA 1LWIA 2C14A 1JYNA 1YHTA 3OB8A 4DWDA 1VIWA 4QG6A 2XTKA 5JU6A 2VWSA 1TPWA 1BVNP 2CZ5A 2XZ9A 3II1A 3TEVA 4L9ZA 3TWAA 3DN5A 3M0YA 2QCDA 2V5DA 1KGUA 1OFBA 1MO0A 4H41A 1BWKA 1V0MA 3B8IA 3ITXA 2OGJA 3WEMA 3RLUA 3UZWA 3GQYA 3V35A 4V1YA 1YQ2A 1YADA 1WBJA 1IWBA 5IBXA 4L80A 1OIMA 1SSDA 3SCQA 3W6LA 3FJ6A 3IPWA 4OBSA 4IQEA 4XKYB 2UY3A 4M0XA 1EFZA 4J28A 1W37A 4FR1A 1XGDA 4ATWA 4DJDA 1UD6A 2VEKA 4W88A 3DERA 3LB0A 2WLZA 1XBYA 2F38A 4Q22A 1OCJA 4JQ1A 3IRSA 3BAWA 4JYFA 1FWSA 1V3LA 4LY4A 2XU2A 4W4QA 1QCWA 4X0NA 3WQOA 4PMUA 1F76A 4F0MA 4JTGA 4LYQA 3N6JA 4GZEA 1R86A 2PEVA 2FJUB 2QCDB 3R79A 3AHTA 4Q4PA 2Z26A 1WDQA 1I2NA 1OX4A 2J75A 4YCOA 3ARXA 3NL5A 3EYPA 3CIXA 4S3FA 1FDZA 2Q02A 4PMOA 2GSHA 4LYKA 5D05A 2EG7A 5JXQA 3LTSA 2O9OA 1IE7C 2YW3A 5FJOA 2C71A 1VFSA 1M01A 2FB3A 3KCOA 3PTMA 5FSDC 3T0CA 2ZXBA 1ZP3A 4JDYA 3N15A 3P14A 2PGFA 3AXIA 4S38A 3W3OA 4YVXA 2VO5A 2O7SA 4PCSA 4G56A 1ZHAA 5M3WA 1MZRA 2V8ZA 3CO4A 4IICA 1X6UA 4QJ3B 4FB7A 1YXCA 3RU8X 7CGTA 4ORIA 3WLIA 3A9BA 1HF6A 4LWWA 2V6AA 4OVXA 5E0FA 4ZFCA 4TUFA 3ITYA 3QH2A 4H7CA 4M3PA 1FCUA 3GXTA 1JDEA 3BJTA 1GOKA 2DH3A 1GQLA 4Y9OA 2BHZA 5AZ0A 5FJTA 1DJQA 1VCFA 3EDKA 3EEZA 3E0VA 4ZENA 3WBEA 3V7PA 1JPDX 4HA0A 4DF2A 4AX6A 4W8BA 1T6MA 4F0HA 1V93A 4LAOA 4GIYA 4KW2A 4B5TA 1H63A 1I8JA 2XN2A 1I0DA 1C9DA 2H90A 2VURA 4UFIA 4F0SA 1KM0A 3GSMA 3M64A 2VEGA 3WBWA 1S2VA 2WM0A 1PUDA 4NZ1A 2QW5A 1GHSA 4EX4A 4GVHA 4LS0A 3NDZA 3U2OA 3I7QA 2G3NA 2QCNA 3WENA 4E8DA 1JD9A 3OZMA 1WYIA 3EOOA 5A8QA 1XIHA 2J7EA 2FZDA 1S3TC 3MUXA 1H51A 1ISWA 1IT0A 3IUIA 1Q4WA 1MSSA 1J0YA 2XPKA 1DKWA 2YDAA 2YCJA 3QBUA 4MPQA 2XFRA 2XWEA 3WNLA 4GI4A 5B80A 1KRAC 2Y4SA 4DJDD 4AZ6A 3T78A 3CZLA 3FYPA 3VIPA 3I7SA 4S2BA 4GHRA 1TV2A 2ZUTA 2RJHA 1EEPA 2J62A 4Q8QA 4GNKB 2YBUA 3GU1A 3ES8A 5IM51 2EEXA 4UTTC 1VBJA 1IEVA 1XFBA 5EA9A 1W1VA 5EB8A 4DZAA 5HQMA 1RALA 3N19B 3IK2A 3UD6A 1BPLB 1RLCL 4U4MA 1W3NA 4YIWA 1ME7A 3QY6A 1G69A 3NEHA 4J3SA 2EJAA 3MY9A 1E43A 3THCA 1B3ZA 3KZSA 3I68A 1EP2A 2YXGA 4OE7A 2J7CA 4X3ZA 1KCKA 4LNCA 3LOTA 1T0OA 2DZSA 1RCQA 3NWRA 3N2XA 5HANA 5C7HA 1K7EA 1BYBA 3ATZA 3MP4A 2PZNA 3DI1A 3VK5A 1FDJA 4GVIA 2PF0A 4MTVA 1TX2A 1MRAA 3LV6A 3WH5A 1E1EA 2HXTA 1LL7A 1M6JA 2YFNA 4WF7A 5CC7A 4PUKA 3GFYA 3GKFA 3EX2A 3PFRA 3SW6A 3NZ1A 1GVEA 1T5AA 4ORMA 3MUIA 4US5A 3N2MA 1H49A 1UCWA 3K4WA 4L61A 5C0QA 1C8XA 2KX9A 3UR7A 1HT6A 4HT3A 3SCTA 3R0UA 2EO7A 2ZC8A 4ZL1A 3E49A 3GUGA 3E5PA 4HQVA 2QJIA 1QNQA 1PKNA 1GVRA 3TYBA 1Q63A 1OHLA 2JKPA 2XN1A 3PJXA 1RVGA 4NZ4A 5BOOA 1XS2A 2MANA 3NTYA 2OMAA 2NXIA 1ZGDA 1EB3A 1Q7QA 3AAMA 1TIMA 4HPNA 4JAWA 1TPC1 1Q6OA 3A3XA 3F5LA 1SJDA 3KBSA 2YYUA 1GHRA 3WELA 3ARRA 4M80A 1GUVA 2QF7A 4PTXA 3MO4A 3O7UA 3FA4A 3RDKA 1W3JA 1GYMA 4MZ1A 4JYEA 1RA0A 2J8TA 4AXKA 2J77A 4Z08A 3RM9A 4UNIA 1OSEA 4WDUA 5JUVA 4ZFMA 3M0HA 5SWUA 4OQVA 1JPKA 4A3HA 4L56A 4LS2A 4O54A 4C60A 3WLTA 4EKJA 2O4QA 3DH7A 3W53A 1PEZA 1DHKA 3WK1A 4C6PA 1O60A 3OBEA 2H8XA 4R34A 4GGBA 4MAVA 5GNXA 3L23A 4IIEA 3ENLA 4DZ5A 1JCLA 3UNTA 4MGGA 5IBXC 4HP5A 1LBLA 8CGTA 3USZA 3PZNA 1LG2A 3UG5A 3AHXA 3R2GA 2YSWA 4AHOA 3V5OA 5A8GA 4RPQA 3N04A 4DJDC 2JFEX 3ID7A 2G0WA 1UP2A 2ZTJA 4RW3A 1XLGA 3KRZA 1J4EA 1GVFA 3WQVA 4PRRA 1JPIA 1I1WA 1KM4A 1QJWA 3S46A 3E2SA 3AJ7A 4GXPA 2YGYA 2JGQA 2XDFA 2PF8A 3WBXA 5C5YA 1U33A 4YTQA 1U1UA 1W3HA 4IISA 1KRBC 4KFNA 1TPFA 5H8PA 2WLYA 3SQLA 3G1HA 4J3WA 1S39A 4XIMA 1ONEA 1XLDA 1A53A 1I9CB 4LUSA 3VUSA 2QCCA 4KIEA 1IXOA 2BLEA 4HIBA 4W87A 4WJXA 2EPHA 2A6LA 1M65A 1E15A 3LXBA 1FWAC 3BW2A 3QPZA 1RZMA 4GG9A 5I3KA 4XVDA 1Y0EA 1LT7A 3ZIZA 1J0KA 2DIKA 1SZEA 2V30A 2R91A 2DV0A 3H2MA 4UC5A 1FBAA 3AC0A 2FGBA 5I24A 2I5QA 3W7JA 3RYSA 2WM1A 3B40A 1TIWA 4B91A 4FI4A 4C5YA 3HB9A 4US5D 2Y8UA 3SY8A 4MM1A 1V8EA 1HIZA 3W6MA 2CPUA 4TU1A 2BSLA 2PBGA 3H24A 3SM0A 3V4BA 3IUDA 2PDKA 3NZGA 1VEPA 3AO0A 2VZSA 1AUSL 3FHQA 3QQWA 1E9LA 3B0UX 3AU6A 2FZMA 1XIGA 1IXPA 3EPOA 1LBMA 3RG6A 5G4EA 1DV7A 3PJWA 2WMHA 1GVSA 3FX4A 1VJSA 4FOKA 3WDQA 2V9DA 4TV5A 2JEPA 1F6PA 5LA2A 4S3EA 3TU9A 4O53A 4EAYA 3MJYA 2ALRA 1C8QA 1S1RA 4P61A 2E6DA 2JF6A 4IPIA 3F5KA 3VU2A 2HK1A 1X39A 3A24A 4AEFA 4H6EA 2XVGA 5LYRA 2Y5EA 3VPLA 3MVIA 1XRSA 4K7VA 3C2RA 3RIKA 3QF0A 4QP0A 3VCCA 4HOWA 3HMJG 1H11A 2EG8A 2E4TA 1RV8A 3CPRA 4Z2JA 1B90A 2WMIA 2X0YA 1N8FA 3DZ1A 2AKZA 3L5LA 5H8MA 1UZHA 4KF1A 2BTMA 3NEVA 1UD3A 5D2WA 2V68A 2OZ0A 2W62A 3SUVA 1WBHA 4P7OA 3AXKA 2YL6A 1W9BM 2OYKA 1AH3A 3QMSA 5KEZA 2V67A 1S1PA 5FF3A 1RD5A 4Z42C 1WNOA 4JBRA 3TTQA 3W1PA 4RDZA 2O9PA 1VFHA 2CLMA 1PIFA 3W01A 4MY1A 1UIPA 1F9CA 1TV8A 4U2ZA 3TDFA 1HKJA 3WH8A 1XPYA 1US3A 4KPLA 3BANA 1IT7A 4ACZB 6ALDA 5CSUA 4DUXA 3W7MA 1JDCA 2Y7FA 4P5UA 3NXLA 3UJ2A 2YA0A 1RBAA 2Y2WA 1YPIA 1E6XM 3F03K 5G2HA 4HHHA 1GOQA 4D6HA 4HSHA 1EYWA 4JQAA 3NZRA 3DENA 4DB7A 3EX4A 3NM3A 3LGEA 4MNLA 1US2A 4H6QA 3BPWA 2VD8A 2VX6A 1H62A 1GVQA 1XWYA 3EA2A 3UGVA 3Q58A 3BL3A 3KS6A 4IQJA 1GGOA 1WO2A 2INEA 3S47A 5GPRA 4PUDA 2QGYA 4LS1A 4L64A 1XINA 4UWMA 1PYMA 1O5QA 3W7LA 1H3GA 3C5QA 3SY5A 3G1AA 1PZ0A 1R9ZA 4YN5A 5HNUA 4IX0A 1TPH1 1E3ZA 1CW2A 1Q6QA 4GI8A 5C71A 4DUWA 1XKJA 2NQZA 2HE8A 2OQYA 3L65A 3ZT6A 5FOOA 4G1KA 1KFJA 1EBGA 3P81A 3O0FA 3DG6A 2J7DA 1SO3A 1GJPA 3M0ZA 3BZGA 2E0PA 2P53A 3W1RA 4D6IA 1TB3A 3SQMA 1VIZA 3I3BA 2J25A 1H5VA 1PIIA 1M03A 2MNRA 3H2CA 3BURA 4C7DA 3TR2A 4QEEA 1FXQA 1ME8A 3IVTA 3KBJA 2PBOA 1AVAA 1KCXA 1F8MA 3M0KA 1Q6DA 1GWJA 1YXDA 4G7FA 1MEWA 2IMRA 1QOQA 3IAQA 1WKYA 1RR2A 3VA8A 4LAKA 4RL3A 1CBGA 5CZTA 2PDMA 2FFIA 3BMXA 3N3TA 3WD3A 1V3HA 3TNBA 2UV8G 2GDVA 4IMCA 5DMLA 4GRSA 3CEUA 3PY2A 2VEMA 3KP0A 2C7FA 5XINA 4H8UA 1MUWA 1DPMA 1VRDA 4MKSA 2PRHA 4XIAA 3CK5A 1SFSA 1XDLA 4JTFA 1OF8A 4PEKA 1QW9A 1O1ZA 3LG3A 3ORWA 3C0SA 5A8NA 3OIHA 3FHAA 4O8RA 4PSPA 4TO8A 2G95A 3ARZA 3QMRA 2PFHA 1UR0A 1E6SM 1G01A 4DO5A 1DIKA 4PODA 1TO3A 2CFFA 3MP5A 2ZRYA 1FWDC 1X1OA 2NSXA 2VDGA 3UESA 2B7OA 3CV1A 3O8AA 1LM1A 4LJ3A 2D3NA 2FHCA 4TX6A 4MDOA 1B57A 4NX0A 1VR6A 3FVMA 1PKYA 1EQPA 3IVSA 3DU0A 4RNIA 4GZIA 3SIZA 2FTWA 2BGSA 4B16A 4A3YA 2PDGA 1U83A 3HPFA 5CAKA 4K38A 4WRHA 2PDIA 1VFUA 3SCWA 4PBFA 3OODA 2CXGA 3EOEA 4DXVA 3W1AA 1VC4A 1VHNA 2PZ0A 1KRMA 1H7RA 3U7VA 1G7VA 3VOHA 2PP1A 4TVCA 2DQXA 3DFSA 1B31A 2CKRA 3E02A 3TJLA 2V2CA 2RGMA 2R1LA 3NZQA 3AJXA 4HBKA 3TSBA 2CLPA 4O11A 3MU7A 3OOQA 4UQBA 2AGTA 2P76A 2GQAA 3NZPA 1AQHA 5AB3A 1D2KA 2HRWA 3GTFA 1XGZA 3E2RA 1PCKA 4N2YA 3BO9A 3CV6A 1PTGA 2BB0A 3PWGA 4DO6A 2RUSA 3OQEA 4NP7A 4D8ZA 3P67A 3IJLA 4YTTA 3RCYA 1UZDA 3TOYA 1E0WA 2DQWA 2PDPA 1N8IA 1WZLA 2ZX6A 3G1DA 1EJ7L 4AYSA 4RXGA 3KUMA 2YA1A 4B4FA 3HJZA 3DI0A 1NWRA 1I4NA 4IX2A 1JR1A 2QDHA 2P5NA 2WV8A 2PC4A 3GHTA 4AU0A 3GU2A 3P5ZA 5CC3A 4NXSA 3WEOA 3OVGA 2OSXA 4EF8A 4HZ8A 4NQ1A 2WPGA 3DOPA 4PRWA 4FALA 3GUWA 3H53A 1MI3A 4KETA 4EOUA 4AD0A 2A7NA 4GKLA 1EL3A 4WJEA 1E3XA 2FDSA 2XIIA 1ISXA 5DFAA 3UG8A 2C13A 3AALA 1PKMA 3LBCA 1R2RA 4QX4A 1GW1A 1G4SA 5BCAA 5IHSA 2R1PA 1X7FA 4PCPA 4TIMA 4ZR8A 3I7RA 1LOSA 2DFAA 1K8XA 1SGJA 1JQXA 1YTEA 2ZXQA 3LEPA 4LF1A 4NY2A 3L5MA 3F4NA 5HATA 4UR7A 4K6AA 3W83A 2PTZA 1OC7A 1ZFJA 3G0SA 5BROA 4AIUA 3B8TA 2PTDA 1WKDA 1WX0A 4JX4A 1E0VA 1UZ1A 3HO8A 1SU5A 1V6XA 4JYDA 2XSAA 3C2VA 5ABEA 1RD6A 3H2EA 2BGNE 2A2IA 1RPKA 4WOZA 1X97A 5BMWA 1UD2A 2OO0A 4UOJA 4HCDA 1XYMA 4L4OA 3M0MA 5HR6A 3KOWA 4M81A 4LBSA 1UR2A 4NUWA 3QC3A 3A4AA 3LHYA 2I9UA 1X8CA 2NVAA 1W54A 3TA6A 3EDDA 3G1VA 3ZO9A 4HU3A 5FF0A 4ZB0A 1LL4A 4XZMX 5M2FX 1S2AA 4Z17A 5A6BA 4WJ8A 1F73A 3WH7A 1XSIA 2J27A 4NKCA 3LUTA 4GXMA 3BLEA 3MSRA 1SR0A 3CHCA 4I5XA 1P0EA 1W3KA 3MUY1 4HSOA 2P1FA 5I3JA 4V15A 2A21A 4RDWA 4P8UA 1FWFC 4FX6M 4H8VA 1A5SA 3B8UA 5HPOA 1V03A 3QOKA 1H09A 1OFAA 2PGRA 3A3HA 4ZSUA 2FVKA 1HFBA 3GVWA 3WNOA 3GTNA 3GXNA 1F3EA 4OBTA 3ARYA 4YYFA 3T07A 4LYRA 2VGIA 3GRIA 3POCA 1U5VA 1UG6A 3K8KA 2H3BA 3GZAA 2Y63A 2PUZA 4PMDA 2BG5A 4C1KA 1H7OA 3LRKA 3W24A 1UH2A 2HJPA 4FLQA 4FX8A 3KOYA 1T7LA 2PDNA 1BGAA 3NIYA 2ANUA 1FWBC 1CXLA 3FXYA 3GXPA 3K8MA 1NJJA 1XIBA 1K7FA 4IOTA 4JCLA 1TCMA 4AD3A 1EO7A 5DT7A 3OZPA 3AWNA 3EOSA 1EDTA 1UWSA 1FXPA 2WPBA 3LPPA 4TX8A 3H55A 3FAXA 2WMGA 3NVTA 4HVXA 3WF3A 3BCFA 4TQTA 5C70A 1JL8A 1CEOA 4K8GA 2OG9A 3NQFA 4C6IA 2WKJA 5H1WA 5LXEA 2BVYA 3GXMA 4KBXA 2QDDA 4XV0A 3PWAA 2CEQA 4O4WA 3S2JA 2VR2A 5C7VA 2QXWA 3Q65A 1WA3A 1YTKA 2Z7KA 4HJWA 1I60A 2R94A 3KLLA 4A3RA 5H6HA 2GJXA 3C2OA 3EWZA 1P1XA 4MB5A 3KTSA 2NQJA 4R85A 4JQ2A 3Q2DA 3F4CA 1OCQA 4DZHA 4GC3A 2OCZA 1XLKA 3PG8A 1K3UA 5FEXA 1Y5XA 4B9ZA 4XBSA 1HGYA 4LF2A 1U30A 1OD0A 4S2CA 4NI8A 5HULA 4HNNA 4U3AA 2HZGA 3LZ3A 3A23A 3NQ6A 1HJVA 3COTA 3LQGA 1XSKA 1RVKA 1CNVA 3K5XA 1F4HA 3VGFA 3T7VA 3M0LA 1XYFA 2QCHA 3VMNA 3FDGA 4OUIA 3APGA 3NM1A 3B0PA 4NAFB 4RJEA 2Y6ZA 1KBBA 3APYA 4ZODA 3G1XA 4QITA 4Z2IA 1R87A 1EC9A 3VGHA 2FVLA 1FWGC 1Z42A 5D8WA 1UC4A 4DHGA 5AC8A 1AODA 3ZJ6A 1TMHA 2DZUA 2A7PA 1TKKA 1O5RA 3UJFA 4O1AA 2VGFA 3GVRA 4PBGA 1TRDA 5A6BD 1E5NA 4ZQNA 2FHBA 1EIXA 3TTOA 1XJBA 2XH0A 4GYFA 1XH1A 3IJDA 1GQKA 4W89A 3LNMA 3FDKA 2QJGA 2Q8XA 1E1FA 4CD7A 5AYYA 2FZ8A 5KTLA 3LXAA 2VZVA 1OQFA 4MYAA 3KX6A 2GUUA 3PUEA 1UA7A 3QQ0A 2ZA2A 3NXFA 1P1MA 4B15A 2GQ8A 1KCLA 1SUXA 7TAAA 5J5DA 3LM7A 1NDYA 1MUCA 1RJQA 4JIEA 1OGSA 4KWOA 3BQ6A 5ENLA 2HVOA 2QCEA 2ISFA 2JE8A 4L6OA 1SSGA 4JKKA 1B30A 5LIYX 4MHBA 2GOKA 2WVVB 3TROA 4ZO6A 5FEPA 3WBYA 4OOUA 1XH0A 4HCHA 4XD4A 2EGZA 5K2ZA 4DX3A 3URBA 2FYMA 2ACUA 2B0MA 1EJTC 3R0KA 4G9PA 4ZO7A 2Q8LA 1B9BA 4HNUA 3F2CA 3DFPA 2YIHA 5E6YA 4Z1AA 2VDHA 4LPCA 4P8VA 4Q8WA 4IMAA 4K2SA 5E93A 4CD4A 3W1TA 3FFSA 1XHGA 2GJPA 3AIEA 1H7NA 4XKMA 5FL1A 3FSUA 4ZE4A 3VNMA 1IF2A 4NHVA 2UY2A 3AIUA 3G0UA 3UCCA 2F7FA 3U9IA 3DEQA 2QHAA 3EOUA 4U5IA 4HD5A 4GQGA 4X9SA 2HDJA 4HNTA 4GABA 1CGVA 1EF2A 2ON3A 3N9RA 2J88A 3S5NA 3TFCA 1V02E 3VO0A 2REQA 4GC4A 5HWNA 4M1BA 2FHFA 1IT8A 3GXDA 4YYCA 3CL8A 3H2AA 3WUEA 2XH2A 3MI3A 4DM1A 1VBHA 1BRLB 9RUBA 1OWQA 4AQLA 1DJWA 3PBWA 3ECQA 1Z32X 3UXLA 4O19A 4WR3A 3GNXA 2DZAA 1P7TB 3BC9A 2FTYA 3WY1A 2GK1B 3AIVA 5CGMA 3RFAA 4KFOA 4K8HA 4RLIA 3W7IA 2ZBTA 2INFA 3VIFA 4JN8A 1QW7A 4UQDA 2J9ZA 1UW9A 3L7RA 4RV3A 2XFFA 2H6RA 3WDHA 1D8WA 4V1XA 1XLBA 3NOEA 3TR9A 3GWQA 1FWWA 4CQCA 2ASHA 3N34A 1B0IA 1W6TA 2I16A 1E1CB 1HKKA 2ZRUA 1HN1A 4LRTA 1RP8A 4JFWA 1E56A 1LRQA 5DCEA 3NSMA 4KKXA 3T09A 1OEPA 2J13A 4ZB2A 2BASA 3IUHA 4ERIA 3QFEA 5HPCA 1UD8A 3UZ5A 3ZM8A 3F2DA 3TLLA 2OQHA 4W85A 4LUTA 5CBBA 2IPJA 1JF5A 4KCUA 4ZO8A 3TN6A 3WBAA 2QPUA 3I3EA 3GAYA 5BOEA 3CHEA 3UR2A 5HJLA 5TF0A 1YPFA 1KBJA 1JUKA 3N12A 3MV11 4M5PA 3AXMA 4F40A 4U31A 1TA3A 1G6CA 4KEZA 1JF6A 2ZVRA 4R9OA 2ACQA 1NF7A 4L1XA 3SO7A 2ZWYA 4XQ6A 4QSHA 5G1YA 2YR1A 2OLSA 1TPDA 1DEDA 3QQ1A 1I6NA 4NYUA 3IJ7A 3EA1A 5FJIA 4ZGYA 3QV8A 3OBKA 2VC6A 1SFTA 3LGDA 4Q6XA 1QASA 1MWOA 1JUBA 1ZP4A 2GWGA 2AAAA 3QHOA 3FEQA 4N9EA 3OTRA 4EPEC 3E6EA 4EIVA 1NH6A 5M1TA 4I9AA 1WCGA 1W5MA 3GY1A 4Y96A 4PE8A 4OWGA 3WNKA 2DVUA 4DI9A 2ZUNA 1KWGA 2WCAA 3NSXA 3SZ8A 2PWHA 1NU5A 3WQGA 4J1OA 1M1BA 3CIWA 1FUYA 3WUGA 3NQEA 3SRHA 2I5GA 3PUOA 3QLLA 5JIWA 1V6UA 4JEQA 1UASA 3OVPA 3TMLA 3KW3A 1N7KA 5F4XA 2RH9A 1DXEA 3PPGA 4W8LA 2FMNA 5I78A 4PR4A 2BFGA 5FEZA 3ITTA 2OEKA 4PCNA 4M56A 3VDHA 3KVLA 5IFTA 4E4PA 2PWVA 4L6DA 4E8CA 4KWWA 1NWUA 2XIQA 4J5NA 5AECA 2KZHA 3MHGA 5DANA 5GJNA 1O94A 2PDWA 4H2CA 5CGQA 1YEYA 2QPXA 3LCGA 4IPJA 2BDQA 3GIPA 2G5WA