4IQDA

Crystal structure of carboxyvinyl-carboxyphosphonate phosphorylmutase from bacillus anthracis
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
290
structure length
290
Chain Sequence
NKQSTQEELANRFRALVEANEILQIPGAHDAMAALVARNTGFLALYLSGAAYTASKGLPDLGIVTSTEVAERARDLVRATDLPVLVDIDTGFGGVLNVARTAVEMVEAKVAAVQIEDQQLPKKCGHLNGKKLVTTEELVQKIKAIKEVAPSLYIVARTDARGVEGLDEAIERANAYVKAGADAIFPEALQSEEEFRLFNSKVNAPLLANMTEFGKTPYYSAEEFANMGFQMVIYPVTSLRVAAKAYENVFTLIKETGSQKDALSNMQTRSELYETISYHDFEELDTGIAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Carboxyvinyl-carboxyphosphonate phosphorylmutase
publication title Crystal Structure of Carboxyvinyl-Carboxyphosphonate Phosphorylmutase from Bacillus anthracis
rcsb
source organism Bacillus anthracis
total genus 93
structure length 290
sequence length 290
chains with identical sequence B
ec nomenclature ec 4.1.3.30: Methylisocitrate lyase.
pdb deposition date 2013-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13714 PEP_mutase Phosphoenolpyruvate phosphomutase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 4iqdA00
2OLSA 2X0SA 1Z6KA 1DXFA 1XG4A 4IP7A 3HQPA 1T5AA 4KCTA 4IMAA 3E5BA 3HQNA 4IQEA 3QV9A 1F3WA 1PKNA 1O66A 3EOEA 3PUGA 1PKMA 3T0TA 3N25A 1A49A 1OY0A 3KTXA 3H6OA 2DUAA 2VWTA 3R4IA 3MA8A 4B5SA 3ME3A 1PKYA 3I4EA 4KCWA 4B2DA 1S2UA 4JPGA 1F3XA 2KX9A 2VGGA 1AQFA 3T05A 1S2WA 3GR4A 4DRSA 1MUMA 1E0TA 1SGJA 2HJPA 1VBHA 3SRFA 1U5HA 1UJQA 3KHDA 1A5UA 3VAVA 4B5UA 4B5XA 1DXEA 4B5WA 1KBLA 1S2VA 3FA3A 1F61A 1F8MA 4LSBA 4L9ZA 1JDEA 3QQWA 1PKLA 3QLLA 2XDFA 4ROQA 3LYEA 1ZJHA 2HRWA 1IZCA 4FXJA 4TV5A 4HYVA 1XG3A 4KS0A 4KCVA 3U2ZA 4QGCA 4L7ZA 3OYZA 3B8IA 3OQ8A 4WJ8A 1M3UA 4MG4A 3SRKA 3FA4A 2VGBA 2G50A 1A3WA 3EOOA 3G2GA 3SRHA 3EZ4A 1E0UA 3T07A 1A3XA 1F8IA 1IGWA 2XZ7A 3GQYA 1ZLPA 2HROA 1PYMA 4YJ5A 3BJFA 2QIWA 1DQUA 4YNGA 3HQOA 4B5VA 4G1NA 1KC7A 4KCUA 3PP7A 1S2TA 2VGIA 4FXFA 3GG8A 2R82A 5JVLA 2WQDA 4B2DD 4TV6A 4MF4A 1GGOA 4B5TA 3QV7A 4QG6A 1O5QA 1OQFA 3E0VA 1M1BA 4QG8A 1DIKA 3QV8A 2XZ9A 1U5VA 2HWGA 3LG3A 3OYXA 3P0XA 2L5HA 2VGFA 4IQDA 2ZE3A 3E0WA 3M0JA 3EOLA 3QV6A 2V5JA 3M0KA 2V5KA 3QTGA 4KRZA 3SRDA 1VBGA 4QG9A 4L80A 3IS4A 4L9YA 2DIKA 2BG5A 2VWSA 3BJTA 1O68A 4HYWA 2E28A 5TAOA 4RPPA 3QZ6A
chains in the Genus database with same CATH superfamily
5H8UA 2I14A 3W7IA 1H5VA 1X38A 1ZPTA 4IMAA 1ITCA 4IQEA 1FCUA 1OX4A 2P0OA 3LBMA 1A49A 4YVXA 4NNAA 3CQJA 2G3NA 3NIYA 4FOJA 4W89A 2QUMA 3HV8A 3RO8A 3EWCA 3MSGA 1TELA 1XD1A 1NWSA 2XFWA 2QPSA 1SUXA 1VLIA 3TKFA 2PB1A 3KRSA 3DFPA 4B5XA 1EJSC 1SQ7A 3UJFA 2Q8ZA 1O94A 4CVWA 3RFAA 4JHZA 3HGJA 2O92A 4D8LA 3A4XA 5CBJA 3VKDA 3PPHA 4M6UA 1OFOA 1R38A 3UP8A 2WMIA 3ABQA 3WQ4A 3MO4A 4C6CA 1YXDA 2ZX5A 1QOXA 2GOKA 1F5ZA 3O63A 1TB3A 2GSEA 1W6TA 4W5ZA 4H83A 4ZTXA 4RNHA 4GUHA 2DVXA 3GO2A 3W2MA 3GY1A 1ITUA 1K6WA 3CV2A 3BH4A 2HBVA 4GLEA 2ALDA 1R9XA 3MTWA 4H4IA 1GZGA 1YLVA 5BROA 3M47A 5AHIA 1C8YA 1PTAA 3IVTA 3WUBA 1VRXA 3E02A 3S42A 2XGZA 1U33A 3POHA 2Z1SA 3PUDA 3I3DA 5F1VA 5T9BG 3TDFA 6TAAA 3FA5A 4ZMGA 4DJDD 1VF8A 1UWSA 3D5HA 5ECUA 1S1PA 2Y89A 2YL5A 3R4IA 3T8LA 4DO5A 2C8NA 7ENLA 1M7OA 1VPYA 2DZBA 1SJDA 3W9ZA 1E0TA 4OBTA 2X0HA 5DY3A 4LCRA 4TO8A 2EPHA 3FSUA 5FESA 4QE1A 1F76A 4W86A 3M07A 5DELA 5M03A 1ZUAX 1TV7A 2YKKA 3WD4A 2PDKA 3CAWA 3W38A 2FJKA 1KFKA 3TTSA 4CN6A 4FP1A 1OC5A 1M3UA 1V3HA 5EL1A 4O1AA 4C6BA 3N6QA 3LS9A 4WDTA 3AICA 2ODOA 5FEPA 2OPJA 3U4FA 2ZE0A 1FCVA 4L64A 3QEZA 3N2BA 1UD5A 3DXIA 3UZZA 1W1VA 2P8BA 5DBUA 1KLZA 5RUBA 1JQXA 4LF2A 4XZBA 5XINA 3ZLHA 2OFJA 2NUWA 4KT2A 2A21A 3N3MA 1S3HA 1W9XA 4GYJA 1BG9A 1KM2A 3DYPA 4PMDA 1KKRA 5LKYA 3AS1A 4LVAA 4AIOA 2WSRA 4AHPA 2NSOA 4S3CA 1WOBA 1W5OA 4QNEA 4S3GA 3HZ3A 4JTLA 4LWWA 4LEQA 2E9BA 3TQKA 1Z41A 2I9UA 4P2VA 4GX9A 3STEA 4ZODA 3GZ3A 4Q4KA 1R3WA 1FFQA 3G6LA 4J9JA 3VNLA 5CSSA 4P7NA 5HPOA 4TX9A 3JS3A 9CGTA 9XIMA 2P1FA 1MUCA 4C6PA 1A5CA 1MUWA 4WSKA 2PU0A 4B5UA 4ORMA 1J4EA 4PMZA 3VDGA 2VTFA 5FD0A 6REQB 4NQ1A 2VMFA 3ALGA 5LYRA 5FSDC 3CQIA 3ZJ6A 1SZRA 4MJZA 5AY7A 4C1KA 4MKVA 1RY8A 2YXOA 3W87A 4I3GA 3W02A 1JZ4A 1XH1A 3A22A 3BGJA 4M6PA 5D30A 3W82A 1TZ7A 1KWKA 2FH8A 4R3UA 1MEIA 1EC8A 4GGBA 1I9CB 1KCZA 3RX3A 4H3DA 1UWQA 2PRMA 1RBOB 3HN3A 3W7MA 1G5AA 1UW9A 2CZFA 4BHYA 1VBRA 1FWNA 1Y5XA 1VKFA 4V1XA 4ZB2A 1UOKA 5A6AA 5JBFA 4I5RA 1PO9A 5FF4A 4PUDA 3TOPA 2C7FA 4C91A 4K3ZA 3R10A 1SM9A 3KBWA 3VX1A 4KEZA 4UCGA 1IEXA 1XIMA 2F2KA 1XGEA 3SO7A 2V5KA 3LHUA 4JQ1A 3WBWA 3GVQA 1LQ0A 3GSMA 4M6QA 5EU9A 1R47A 2TAAA 2NVCA 1XJBA 2OLSA 4O14A 2EKCA 5EPDA 1BXCA 1Q6LA 2D1ZA 4GC3A 3WEMA 2ZX7A 1JUBA 1DJIA 2P8CA 3O6DA 1J8VA 4IIHA 2O56A 1DIDA 3VNDA 1A0DA 3WQGA 2DUAA 4HSHA 1HJQA 1LRNA 3FHQA 2FKPA 3PZVA 4JQ4A 1CWYA 1DJGA 1ZBWA 4JD4A 1HJVA 3MV01 2OX4A 3C3NA 2A79A 4LNCA 3CB3A 3SN0A 4E2OA 1TMHA 3ZSTA 4ALDA 1NARA 2HE5A 2EEXA 2CZEA 3UZXA 3JZEA 1IWAA 4JDYA 1OF8A 3VD9A 4Q4PA 3PB2A 4H9VA 3VC6A 1QRQA 4CD4A 1F3EA 1CGVA 4KRTA 1KC7A 2FLIA 5HA7A 5U7SA 1MW2A 1E9LA 1DXIA 1EQPA 4DPPA 2HMCA 2VR2A 3W7NA 3M41A 4C6LA 1QVBA 2DORA 3IWPA 2QF7A 4KESA 1OD8A 1TZ9A 2XPKA 3BAKA 3WEOA 3VM5A 4PMXA 4QSHA 2GPTA 4OFCA 4IMFA 1EUAA 4D6FA 1LWHA 2TPSA 2GSJA 4AY7A 4N02A 1KR0A 2NQZA 1KBBA 4TTGA 3GFYA 4RJEA 3N17A 3W84A 3NTYA 2INEA 2NLIA 4N9DA 3HJEA 4YTQA 7XIMA 5G4EA 3UJEA 3WY1A 1JYXA 3NPWA 4QEEA 1SR0A 2VRKA 3NQ8A 4FALA 3B9NA 1TPC1 2VUYA 1HKVA 5K9CA 4MLJA 5AN7A 2IKJA 3KBNA 3QKZA 3OB8A 5LGZA 2V3EA 5ABEA 2V3FA 4O4WA 3LLDA 1XLAA 3PNZA 8XIMA 3VFCA 4UZSA 4NZJA 2YCEA 3PB0A 3CH0A 3C2YA 3BLIA 4Z17A 3BOXA 1QPNA 3HPSA 1CT5A 1E72M 1TMLA 2TRSA 3GVGA 4UTMA 3WQOA 3C3UA 1ZCOA 5G2WA 4MJMA 3EWUA 3DFQA 2NSXA 3JW7A 1PZ2A 4DUVA 4Z2IA 3U9IA 2J8FA 5XIAA 5CC6A 3SCOA 4JTTA 5AFDA 2P10A 4KRZA 1QOPA 4UQCA 4OUEA 3MKVA 2OU4A 4WR3A 1SJAA 1JQVA 3GDBA 1VQTA 3AYRA 2Z1VA 1XIEA 3P81A 3S1WA 3PUGA 1AK5A 3W7PA 3C5QA 1BG4A 3W00A 3SIZA 3F4VA 1KM1A 4F0RA 4O12A 1HT6A 1BLIA 5IM51 4UOZA 1W9DM 2P50A 4K68A 3WMLA 1G69A 4EVZA 1XPYA 4N4QA 5K4XA 3ID7A 4Z0JA 2A3EA 2IQDA 4GINA 3WK1A 1H2JA 2FDSA 4LXFA 1XS2A 5TBOA 1IQ8A 1RY0A 4UMBA 4UTKA 3LZ5A 5EY5A 1F73A 3DHUA 1H50A 4Z1CA 3MMTA 1OADA 3VI2A 4IT1A 2O9OA 2EAWA 4V28A 4GE8A 2V63A 1HO4A 3CO8A 3ITXA 1AMKA 1YXCA 4DZHA 2WJZA 4JFWA 3PP7A 2WJDA 2YFOA 4E4UA 4M80A 1W56A 3JU2A 4X3ZA 1WX0A 2Z2AA 3LCGA 3RPMA 3UBPC 2Q71A 1W1B1 3ABRA 1SZNA 1QK2A 3UWZA 3K30A 1VPXA 1U5VA 1XCFA 5FI8A 4XZIA 1SW3A 3E0WA 3S3GA 3K5XA 1E1CA 4C6NA 3OEXA 4Z2GA 4QG9A 2D24A 1RBLA 3LXAA 2VZTA 5TAOA 2BFGA 3ZOAA 1X1OA 1JGIA 4INFA 1XWYA 1G7UA 4NYYA 3MZ2A 5D38A 3TW9A 3HPZA 3NQGA 4CQBA 1DYSA 1OC6A 2BOEX 3AAMA 2CYGA 4LUSA 1E1FA 1JZ5A 1HP5A 3WK3A 2DY3A 1EBHA 3GXPA 3DBNA 4ZOEA 3FNDA 4AC7C 4XZMX 1TFVA 4ML4A 3ONBA 1AQFA 2JE8A 3GD6A 3ZS4A 2O4MA 4PUKA 3IJLA 4FXRA 1TX2A 1Y65A 5KSWA 5EKYA 1NF7A 4D6CA 3STGA 4S3BA 1K9TA 5IXEA 1KTNA 4CNPA 1U30A 3MWCA 3LB0A 3U2ZA 4LUTB 3GYEA 2G50A 3URBA 4JCLA 3ARSA 2DJLA 3B06A 2W4XA 3H2MA 1TVPA 2HS8A 3UR8A 4GHRA 3NQBA 2JQXA 2WO5A 3LCHA 1D2KA 3SSJA 1M7JA 4BJHA 4Q7BA 4CN4A 1O5QA 4WZHA 3UYCA 5D2XA 1MNSA 1T8XA 2PZ0A 1TYGA 2VXNA 3APYA 3W23A 3THUA 1Q6CA 2PDPA 4P8UA 4JTDA 1GEQA 4Q6JA 4JY9A 3PZUA 2P88A 2PP3A 5E93A 3D3AA 3STCA 3K8MA 3NJ3A 5E0CA 2R1PA 4PBGA 3UGRA 3AYVA 4EP8C 3MSRA 1ADOA 1PX8A 1EA0A 4JIHA 4DYEA 2PDIA 3SCWA 4Z2JA 3WUFA 1ZP4A 3LGGA 4PSRA 4A05A 3W28A 5AOUA 2FGLA 4TTUA 2JBMA 5C8BB 1QASA 3S2MA 1DXEA 1EA9C 5D2YA 2PP0A 3AQUA 3UETA 3NSXA 4E3TA 2EHHA 1J9YA 1VYSX 3OBKA 3TA9A 5DMNA 3QOKA 4DUOA 4HMEA 1UA7A 3N1AA 1QBAA 5D33A 1UC4A 2BTMA 2XVPA 1EH9A 5JBDA 1JAEA 2XINA 4GVGA 1ZTVA 1ME7A 2DIJA 1GVQA 2ZZ4A 3BUVA 1JD7A 1Q4NX 1JCMP 2R24A 3CMFA 3PUOA 1FY6A 2FZBA 2A7RA 1NY1A 5A2CA 3T09A 1EEXA 1ICQA 1L6SA 4Y7EA 2E6FA 4GPNA 3VDCA 2QVHA 1BHGA 3V4BA 5JH1A 5DMYA 2QNEA 2OYMA 2NV2A 1G0CA 5AC7A 3QMRA 4PSPA 2O55A 1PYFA 2Z4GA 1FKXA 5K3VA 1UG6A 3UZWA 1J5TA 1RCOB 3ZR6A 2VX7A 3SUWA 1GWJA 3WH9A 2VEIA 2JF6A 3RLUA 1Q4WA 1YTDA 5LHFA 1SZGA 1I4NA 1TRIA 3GS6A 3SSZA 5D32A 3DIPA 3S4TA 2RFGA 5I3DA 4O0ZA 4A2SA 4EF9A 1A47A 3VOJA 4DZAA 5BOEA 1WKEA 5AC5A 4ORIA 2F7FA 5DCDA 4WY0B 3PTDA 4AIBA 2DZXA 2WBKA 3OTRA 1AVAA 1Z89A 2DH2A 4JKLA 1SJCA 1DJHA 3BOLA 1VJSA 4UIOA 3PZ9A 2X1UA 1JCNA 3K13A 3R8HA 1E1CB 2CU0A 3B8IA 2E7FA 4JXCA 4CNNA 3M5YA 3TTYA 2EF9A 3IGUA 2ZXDA 4ATDA 2CLEA 3GWQA 5D03A 2X1SA 2HCVA 3S2CA 4IOTA 1FWEC 3HU7A 3T0CA 2WBGA 2QCDA 1XRSA 4RDVA 3L4VA 3W1LA 1UP2A 1AJ0A 5FJJA 1EZ2A 3T7VA 2ZZ6A 1UBSA 3ERPA 3FVMA 1S3TC 3RMEA 3CJPA 4ZVJA 1T5AA 5I6SA 3TJ4A 1VYPX 1TSIA 2VYOA 2GGEA 1PVNA 3C0LA 4WIWA 1W31A 2NX1A 1UOZA 1KRMA 1KA9F 1EBGA 4P7OA 3BCJA 2NQLA 1V02A 1WDRA 3BCFA 4KEMA 5FIPA 1ZB5A 3RM4A 1EJWC 3AS0A 3TA6A 6CGTA 2WHKA 3IJ7A 4LVGA 1DJXA 1UZ4A 3PBGA 3KTSA 3V1HA 3CPUA 4UUIA 4BY3A 1CZ1A 1TWIA 4UTJA 2YL9A 4A3YA 4REQA 1E6QM 2ZIDA 1TWZA 3ZQ9A 4GIRA 1QHPA 5HNUA 5HWMA 1N55A 3SCUA 3ARRA 3C52A 4U2YA 1OT2A 3USBA 1XDMA 4BWLC 2HNHA 3PTQA 5HANA 2QJNA 1H7PA 3C8NA 3GDRA 2W61A 2PPGA 3BLLA 1XV8A 3W7OA 3IVUA 3S2LA 3BLDA 3M16A 4H9YA 2OQLA 1WBHA 3G2GA 4GRSA 1UC5A 1IEWA 3M46A 1CXFA 4HSNA 4F0HA 2RHGA 1WO2A 4AD2A 1AD4A 2SFPA 3UCDA 4X63A 3T8QA 3OLIA 4HA0A 3VGFA 1XIGA 4FX8A 3IVSA 1SO3A 4XAGA 4DJFD 1BQGA 2XH2A 2D3LA 4HPHA 4DNMA 3GW3A 4O57A 2JKEA 5MF5A 3OP2A 4QRNA 5H8PA 3IIXA 3ZLGA 4BF9A 4M1BA 1J0KA 3TROA 3WBEA 2NT0A 3FAXA 4H8HA 1XI3A 1M03A 1M04A 3QR3A 4MZYA 3Q45A 2B31A 1JZ3A 2OKTA 1X39A 2IS7A 3P14A 1QOQA 3OVRA 3ZR4A 4PYSA 1IV8A 3WFZA 3SN4A 3F4CA 3LM3A 2ZXBA 1QPKA 2BGNE 4G5DA 3W6YA 1UUMA 4BQ2A 2W5FA 2VFIA 1QNRA 5CC5A 3GU1A 1XLIA 4UQ9A 2XWEA 4HYRA 1RR2A 2ZRYA 3G18A 4ZB5A 1J93A 2A3LA 3H2EA 3NEVA 3N4FA 3BPWA 5EYWA 1V08A 3CYJA 1RBAA 3O0KA 2WHMA 3ES7A 4IP5A 3MHUA 1QATA 3MMDA 4HVXA 3CPGA 1BGAA 1RA0A 1W3JA 1MW0A 1KQZA 9RUBA 1UWTA 4E38A 5CGMA 4JZ5A 2WCSA 1ITXA 3OZYA 1QW8A 3NQ2A 4C6MA 1LL7A 3ZVHB 1W3TA 4RUBA 1EGZA 1EP2A 3QV6A 3WDJA 5GPRA 5BRPA 2PMQA 1LRTA 2V9DA 3MB9A 6ENLA 3AHZA 4GG9A 4N9CA 3GX9A 1XRTA 3Q37A 1BGGA 1CB2A 4I9MA 4TXEA 4WSHA 1XYFA 3SUSA 4QCEA 3S83A 2BVWA 3W7LA 2ZUVA 1R46A 2EO7A 2NQ9A 1IIHA 3U57A 3GHTA 2JIEA 3ORWA 4CU8A 4B5SA 1UR1A 2JEPA 3PN8A 3UYIA 1QAPA 4QS6A 3C0JA 1P1XA 4M1RA 3PF3A 2VX4A 3KE0A 4AWEA 3ARUA 3DYOA 3W88A 4ZENA 3MP4A 3CUGA 2YDAA 2YXGA 3AIVA 2QCDB 3TR9A 4QXIA 3EX1A 1LJYA 2HVMA 3PS7A 3GNXA 2NWRA 3PJWA 2PC8A 2QAFA 5DBTA 4AQLA 3ZJKA 4UMCA 3STFA 1UUOA 4CQCA 1E55A 4GCXA 1I45A 3W1QA 4HHHA 1TV4A 3DCPA 1Y8BA 2DJXA 1QPOA 2Y63A 5DN1A 1BVNP 4ERGA 4NVTA 1LT7A 1FP8A 3LG3A 4HCLA 3WD1A 3N2CA 4MSSA 2X2YA 3SRDA 3GVVA 1WE5A 2V2HA 3SCQA 2GOUA 2MUCA 2R94A 1XIHA 3DN5A 1Z6KA 3T0DA 4O1DA 2CESA 2Z28A 3BVJA 3VIJA 4H9MA 3TJXA 2J47A 2ZCGA 4AZGA 2PDJA 3FXGA 3T2OA 1GZJA 2H6RA 4XD4A 3WNOA 1QI4A 2WLZA 3HGSA 4IFKA 1TQJA 1SO6A 1O5XA 1GHSA 1DPMA 1SYTA 5AZ0A 1SGJA 2OCZA 1YPIA 3VAVA 1LOLA 3BZJA 4H9TA 4UQBA 1A80A 5A2BA 4RDYA 5GJPA 4W8AA 4AF0A 1XG3A 1W91A 3DEQA 4RNFA 3F5KA 3OYZA 4FLSA 3GIYA 3ZZ1A 4KH2A 1IGSA 3IUHA 1QXLA 1TV3A 2Y62A 4BEUA 2PDNA 3GNPA 2ZUUA 4FS9A 4GY0A 4ZXLA 3SY8A 4WXYA 2F6UA 2FMOA 3B8TA 1LLZA 3HMCA 3VX0A 3RJXA 2WMHA 4UWMA 2PLJA 4US6A 3DFOA 4KCUA 4I9TA 3WENA 1UKQA 3AWNA 1IXOA 2X05A 9XIAA 2G95A 2P3EA 2ZZ3A 5KZEA 4LAOA 2XFYA 4ICMA 1MRQA 1Q2RA 2B4GA 2J25A 5D02A 2CBJA 1EDTA 1BQCA 4UFIA 4UTFA 1C29A 3VIOA 3LCFA 4L80A 1YTKA 1F4HA 3VFLA 3WN6A 4IUOA 2Y0FA 3SJ3A 3P2VA 4DEFA 5CGTA 2EQDA 1JYWA 1BAGA 3BAWA 3HQPA 4CCDA 1RK6A 3L21A 2E4TA 4PCSA 1GQNA 5HUOA 4IQJA 1J01A 1LL6A 1XH0A 3G1SA 4MPKA 2FPYA 3TQPA 3TSMA 2CZVA 2HK0A 5AYYA 5K9XA 1CB7B 3G1XA 5MKGA 1XP3A 4OE7A 1EUNA 3FGCA 3QSRA 1TIMA 1S2WA 1D3GA 1D8CA 1NQ6A 1M7PA 2GK1A 1C9WA 2I7GA 2I5IA 1QK0A 1PIGA 3PAJA 4GFSA 1AH0A 4KBXA 2G41A 1E73M 3SN1A 4PBFA 3FA4A 4TVCA 1UWUA 1KM0A 3BCDA 3GNOA 1XYZA 4PB3A 5EMKA 1KNWA 3TV8A 1M9HA 2PBOA 3CXOA 4JN6A 4HA1A 1B3OA 2UY4A 3FHAA 4C90A 2DSWA 2J77A 5EFFA 3ZFHA 1K8CA 4MIMA 1BVWA 5BMXA 4QJ5B 1XKYA 2OJPA 1EX1A 3VABA 3P0XA 3TTEA 3RO6A 1JYNA 4G56A 3NSMA 4YCOA 2XGBA 1YE6A 1PHWA 1VGAA 3MCMA 1A5MC 4C1LA 3WMBA 1GOQA 3NEHA 3AI0A 5A3HA 4JTCA 5G4HC 4HA3A 1X1ZA 4GQQA 3KRBA 6XIMA 1PZ1A 3NG3A 5I06A 5A95A 3CQ0A 2DDXA 5EMUA 2Z7KA 3OIHA 3ARZA 3XINA 1W3IA 4LB3A 1QTWA 4AY8A 1RQEA 2QW5A 4AWTA 2PGEA 2Y7FA 3QC3A 4ADUA 1VBHA 3W1NA 3WBAA 1DWAM 1UD8A 1SFJA 2DFAA 2CIPA 4PRWA 4WVXA 2XDFA 3T0BA 1XYMA 4ROQA 4X2PA 1YYAA 2XG9A 1PUDA 2QLYA 3W7KA 3WLPA 3S5SA 1ADSA 5XIMA 3TTOA 5A6TC 4ICCX 4DO4A 4JQAA 5EGRA 4C6OA 4Q4QA 4JHMA 1WZLA 3GC2A 3VOFA 2V3GA 3G22A 3H70A 3NPXA 4DBDA 1QNOA 1GVEA 1LRQA 1VIWA 2PBGA 5EMYA 1GGOA 1H09A 1TCDA 3O8AA 1BSIA 1M53A 3IK2A 2ZUMA 3TLQA 4F79A 4DAFA 2PWVA 3URNA 3W7CA 3MU7A 2HSAA 1NFBA 1UD6A 2ZX6A 3V0TA 1SSDA 1VBGA 3T40A 3H2NA 4ICNA 5AYXA 2BVTA 1RV8A 4NJKA 4IX0A 3KOYA 2QCNA 4HZ7A 1Q65A 2F9RA 1OVDA 1PHQA 1GW1A 2FHFA 2OEKA 1BKHA 4K8HA 3SGZA 1QI5A 2J7DA 3MBDA 2PGFA 2PTDA 2ASHA 2HPIA 2GUYA 3V3WA 5C7HA 3LA4A 4RXFA 1W5QA 3WQDA 4K8EA 4QDWA 3KL0A 4AZHA 1MUMA 2HJPA 4NJGA 4S3AA 3LHYA 3G3DA 1KBLA 4U3CA 2YX0A 1Q7ZA 3QH2A 3NZQA 3GBDA 3C2RA 5TD4A 1B31A 4PMVA 1JFHA 4F0SA 4HCHA 1WKYA 4KS0A 3TXVA 3TSDA 3T9PA 2HNEA 3W1UA 4IGMA 3SUTA 4NX0A 1TPUA 1HKKA 2R6OA 2F38A 1POKA 1R7OA 1W1ZA 4PULA 4YJ5A 1PXGA 4ZSUA 4V1YA 4G1NA 4TMCA 5C2CA 1HN1A 3KOZA 4BWLA 1FWSA 3THDA 1EP1A 3WF3A 1H0IA 4MLRA 3NPVA 3OQEA 4LV9A 3VOGA 4O54A 1DIKA 2OWCA 2OOGA 2G97A 1XSKA 3KUMA 1GOWA 1PJ9A 5T8GA 4A3HA 2ZA2A 5AC6A 3RU8X 4Q3MA 3THCA 4R34A 4XTDA 1P7TA 1O68A 4PUWA 1W54A 4AEOA 2WANA 7ODCA 4ZZ9A 2X0SA 2WW5A 1JYVA 1FP9A 2Y7GA 4J3XA 4K1WA 2PDYA 2HV5A 3LLFA 1QT1A 1P6CA 2D23A 3G77A 4EPDC 1ZAJA 1GNXA 3R58A 1V6YA 4C5ZA 4HT3A 1S2UA 4O8RA 4GVIA 4KQNA 3TYAA 4BKNA 1V79A 4D6GA 3WL1A 2J62A 2J74A 3KW3A 1JCYA 3H8AA 1I2QA 2VX6A 1TQXA 2CLFA 3SBFA 3VK5A 5C55A 1FWRA 1C93A 2W9MA 3GXIA 2WSYA 3PZQA 5GNZA 1QMLA 4JICA 1WAUA 1TREA 4MPQA 1Q6EA 1JCTA 3SFWA 5C9WA 3SI9A 2ZKMX 4Y6GA 3ZT5A 1VFUA 3KL5A 4I6KA 4IM4A 3Q58A 5C0QA 3FYPA 4XVEA 3UG8A 2OWXA 2ZA3A 3AS3A 2Z25A 1DJWA 3IGXA 3A21A 4S1FA 4ZE4A 3RLHA 5KINA 2PTZA 4OUIA 2CBVA 1AQMA 2MNRA 5BMWA 3GXMA 4DNHA 2OQYA 1TR1A 3P61A 2ZOXA 5BXTA 1UMLA 4Z2LA 1SJBA 4JL1A 4JTEA 1HJXA 3W7QA 1EO7A 8CGTA 1LOSA 1ZRQA 3C2VA 3FVDA 3PSVA 4Q8WA 4PGLA 3TYCA 3UWWA 3LV5A 2B7QA 4QLKA 5K7JA 3KOXA 3PFRA 4GIAA 5G5IA 3IIOA 3FDKA 2ZADA 1FWDC 1B3WA 2XIBA 3M0MA 4U10A 1KRCC 1IIGA 3R43A 1ONWA 2ESCA 3V75A 4B91A 4UCFA 4MUPA 3EWDA 3ZWTA 1XLKA 2GGJA 4K1GA 1TPEA 4QE5A 3UXKA 4A8RA 2VT0A 3BAYA 5CCZA 4PBEA 2Q09A 1QBBA 3W7GA 1KXTA 4JX5A 5REQA 5DMMA 4JFTA 1ALDA 1NJJA 1U1JA 4OKDA 5D37A 3P7YA 1QHOA 4NRRA 1OYBA 3G1YA 3MYPA 1C91A 5D9OA 5LA0A 1R0MA 1OGGA 5FF0A 2WXDM 3LQGA 3VIKA 1R9YA 3H23A 4CU7A 3A9BA 4GOAA 2DT2A 3NL6A 4U5KA 3UR7A 5J5RA 1D9EA 1AW2A 4N4PA 3ARVA 2IPFA 2F8QA 3MUAA 2Q8LA 3O3RA 4PC8A 3G5EA 5A8NA 4OVXA 5I3HA 3GZAA 5DRIA 5LIWX 4RPPA 2ACQA 4LQ1A 2W92A 1ZJAA 1UIOA 4O0QA 2E6AA 3KVMA 3NQVA 3AZRA 4GUJA 3GU9A 3EWZA 4UTTA 3A5FA 1NSJA 2ZVIA 2PTYA 4I8DA 3RX4A 4XZ9A 4YYCA 2ZICA 2PDFA 1UYQA 1GOIA 4U28A 1JNDA 1S46A 3P67A 4Z1YA 1U22A 3L4YA 4WEVX 1OK4A 3ZO9A 4HTYA 4GI4A 3VDHA 1LCOA 1K9FA 4XK2A 1FTXA 1VFFA 2G3FA 3CUJA 3VIMA 4JHOA 2QF8A 3RK8A 3N6HA 2GDUA 5CPOA 4RV8A 4E2DA 1NVMA 3ITVA 1OFDA 3LCXA 2QDHA 1P7TB 2BS9A 3EA1A 4KFPA 4CQ9A 3VYLA 4BS0A 3SQMA 4MGGA 3FY1A 3LPFA 3W1MA 5BXPA 3TYEA 4DO6A 2QJGA 2NVAA 5CZ0A 2G96A 4H1ZA 3G24A 3VPLA 4MB3A 4OTKA 3AWOA 1OBAA 5HAOA 3W1XA 4ACZA 1V51A 3M7WA 1TWWA 3DERA 3G3MA 2J7FA 2A3HA 4DBWA 4YXGA 2WAGA 3V5CA 3WDIA 2DW7A 2E6YA 2W66A 3AXIA 3OG2A 3TQVA 2V5LA 5C9XA 1Y5WA 1XBXA 3DH7A 3UY8A 1W32A 3A64A 1FH9A 4TVUA 1N7KA 3UJSA 1F07A 3UA4A 1UB3A 1VJIA 4AZBA 4XD6A 3GXNA 4HD5A 3PBMA 1G67A 1ZALA 1RUSA 3UPWA 2J78A 4C6EA 1JEZA 4GUIA 1R3YA 5I79A 1XYBA 4B3ZA 3ISIX 1CPUA 1EFZA 3LM7A 1G4TA 4AD1A 3CB8A 5D05A 1XCXA 4P8VA 4M5PA 3W7DA 1DIOA 1HG3A 3P93A 1SZEA 5BXSA 2VZVA 2ZXAA 4RZ5A 4MMWA 1K4HA 2AQVA 2ZRWA 3KS6A 1X97A 3EKLA 1EJUC 3WKZA 3H2CA 5KZDA 4J2MA 4W88A 1E15A 1MXSA 3VGDA 2OZ0A 1XM3A 3RJYA 2VZUA 4F0MA 5AKQA 2QS8A 2INFA 2GYIA 3EPNA 1EEPA 3F2DA 4JTKA 1WBJA 4G7EA 4FAMA 2Y61A 2AKZA 4A2RA 1YHTA 4X2RA 3IS4A 1IXQA 3BLFA 3O6YX 4ZR8A 4W5UA 3ITGA 4LY4A 3FJ6A 2BHUA 2TMDA 2EPLX 5I24A 1Q6GA 4Z08A 1NP0A 1DWJM 3B9EA 3HQNA 1QWKA 5CG0A 3ZMRA 5REQB 2VVNA 1GPFA 4NILA 3P8JA 5IFPA 1PTGA 3KVJA 2UV8G 3KOWA 4JNYA 1YDVA 2PWFA 2CFFA 1RALA 3CZJA 2E67A 2LLEA 3I6EA 2EGZA 4CCZA 4OIFA 1SFTA 4RE0A 4RZBA 4X60A 1TJRA 3WLHA 1MYRA 1F7BA 1PKLA 4UB9A 2HEJA 3A4AA 1F74A 5CEWA 1W1IE 4YVPA 1HJWA 5AVHA 1WUEA 2E9LA 5A8QA 3AUJA 3WH8A 3GG1A 1I60A 4KFNA 4W7WA 2EG7A 3FEQA 3VD7A 4PMRA 2QIWA 2IKIA 2AKMA 3DECA 1IWBA 3P82A 4ZQNA 3KCOA 3PWAA 1S5NA 1ZJBA 1VEPA 4JX6A 5DCBA 4J7RA 3FAWA 1POJA 5LA2A 5EMJA 3ENLA 4XQ6A 4HPNA 3LQLA 1RJRA 4FNUA 3GG7A 3L4UA 5TNVA 4GNKB 2L5HA 4MTVA 1ZQ5A 1Q2SA 1FFRA 1GONA 2XIOA 5BOOA 3NQEA 1E6ZA 3C86A 1GVOA 2YDQA 3AXMA 2Y2WA 1H3GA 3MQTA 4JR5A 5AYIA 1BKSA 1H7OA 3RYSA 2OYKA 2IQ0A 3H7UA 4JY8A 4QX4A 1OFQA 2D73A 4NASA 3B04A 3O16A 1AW1A 3NR0A 3T42A 4YYFA 2MANA 4XISA 1DQXA 3CAQA 4JDBA 3KP1A 3ZT6A 1R2TA 4PTNA 3ANYA 3I7RA 4IIEA 5HQMA 1E6NA 2XUCA 2BP1A 1KCKA 1WZKA 3GLCA 5LA1A 4JKMA 4GZEA 3CM4A 1GZ1A 4MB5A 3L4TA 2QGHA 4HNNA 4PTWA 1C90A 1J5SA 3QR0A 5DANA 2A6NA 3I6RA 2V68A 4E8CA 1O5RA 3OGSA 4WJ8A 2CPUA 2CCRA 1NM9A 4HZ8A 3EZ4A 3LV6A 1S2AA 3WDPP 1UCWA 3C6CA 2JKPA 3ITYA 4QHRA 5CZKA 4E2VA 4DJED 3LRKA 1W5MA 1ZBCA 3W2KA 5A6BA 3NYDA 3RF9A 2J6XA 5K2ZA 4Y96A 3UWEA 2VC9A 5CPQA 2WZEA 2YLAA 2YCLA 2FPVA 4EPEC 1KR1A 4FR6A 3EDDA 3L0NA 2XWDA 1XIDA 1PZ3A 2NX3A 4NL1A 3PJUA 2AGTA 3TK7A 2FTWA 3ZT7A 1B57A 4N42A 3VMOA 1E6SM 3NWRA 2O9PA 3H6OA 4AAJA 3TCSA 2YA1A 4MFEA 1BTMA 1PKYA 2R1MA 1GYMA 1Y0EA 4KWWA 3TONA 1H41A 4HNCA 1ZBKA 1GOOA 3GIQA 2HE8A 4TMBA 1RPXA 3HURA 2VCCA 2XGIA 2BZNA 3AJXA 3M5XA 2P5NA 4GO9A 4KGLA 3M0HA 4C6KA 1J6OA 4G7EB 1ZJHA 2YOCA 3GH7A 1WZAA 4PRTA 3UXDA 5M5DA 1RCQA 4MNLA 3LMYA 2Z00A 1FKWA 1WA3A 2A85A 3WNPA 2UY3A 5L6UA 4G1KA 3URAA 5D9NA 2J13A 4XZNX 3B4UA 4KERA 1Q6OA 1XYLA 2PA6A 4AFYA 3WMCA 4AH7A 3L5LA 4QJ4B 1V77A 5JH2A 1V5XA 5HULA 4QG8A 4DN1A 3IV8A 1BXBA 1W3NA 4L4LA 4LV4A 2B7OA 1W5NA 3TJLA 3M0KA 1CX9A 3BMXA 4OBSA 2WSKA 1REQB 3UGVA 3G1DA 1TPH1 5FCZA 4LOCA 3XIMA 2VEFA 2TODA 3PPFA 1P48A 4LF1A 2RUSA 4GYKA 1J2BA 3TTQA 4US5A 1YNPA 2RH9A 1VBUA 1O66A 2CXEA 2FYMA 6PTDA 4NHVA 1VEOA 2C15A 5C71A 2QHAA 3EXSA 4FLQA 1CGWA 8RUCA 2QGYA 4PMUA 4B2DA 3R11A 4MVAA 1VLWA 2PDLA 3DUGA 1RQHA 3SR7A 4W84A 4AC1X 3N6JA 2FZ8A 4L1GA 2EXOA 3NGFA 4V2XA 1FXPA 4NU7A 4JL2A 4J2PA 2XIQA 4L6HA 1EHAA 5LSMA 3AU6A 4LS1A 4PUNA 1DE5A 3YPIA 2NXHA 2WMKA 1YDNA 3NVDA 3GC5A 2D2JA 2Y4SA 3PY2A 4J3TA 1CEOA 4HNVA 1CYGA 3EPOA 2O9TA 4B3KA 3WZ0E 1XKJA 3ARTA 2E1DA 1GG1A 1US2A 2ZYFA 3SQLA 3LK6A 3CLWA 1J79A 1W9BM 3KLLA 5KETA 4NT0A 3M5ZA 3BG9A 4B4HA 1AZ2A 1AQ0A 2R8WA 3CWNA 2IMRA 1RAKA 5HUPA 3KRUA 3NXLA 1R87A 3AXHA 3RRXA 4LTSA 4JYEA 4DWSA 1JRCA 4QAIA 1GVIA 2GUBA 3BQ5A 8XIAA 4WHBA 1YPFA 2Y7EA 3CV6A 1V0MA 1XFCA 4H8UA 2DSKA 2NLYA 4J3WA 1G7VA 1KM4A 1UIPA 4EWND 3BDKA 4JYDA 1OGBA 2OZ3A 5AC4A 3O7UA 4XWUA 5HOSA 1EIBA 1FWBC 4DM1A 1LBFA 1OK6A 1V8EA 4WDXA 4DIAA 5C9UA 3QYSA 1E70M 4AVNA 3UU0A 1Q45A 3R8RA 4QQ3A 1JUEA 3A3HA 4FX6M 3LHTA 4B16A 2DV0A 1LUCA 4IGHA 1L9WA 2YA2A 1J96A 1L8NA 1XFBA 1XCWA 4ZOCA 1U5JA 3UF9A 1R6WA 5EB8A 2BHZA 1TWDA 1UKSA 2V5BA 2ZZ5A 2R1NA 4XVDA 1BYCA 2YIHA 2QAPA 4MYXA 1LL4A 3GU2A 1B3YA 2WVVA 2Y85A 4RNIA 4Q7IA 4A8LA 3RLGA 3M43A 4JOMA 5CZJA 2FB2A 1OIMA 2YZ5A 3DGBA 3BC9A 2QV4A 2YBUA 2ZXQA 5DQPA 1NAL1 3O05A 3DYMA 1DIEA 4FO4A 5DCEA 1B90A 1JL8A 2FPTA 3LTSA 1Q66A 4QM1A 1HZYA 3AUOA 1E5NA 3VILA 3U5YA 2AQWA 4Y9PA 2J27A 3GTXA 2FMNA 2JIWA 3FCPA 3W27A 1TO3A 3MW7A 1N8FA 5JIPA 2VQTA 2J9XA 2IPWA 3NXFA 4YTTA 3MC5A 4JN8A 3N2MA 1VHCA 5BW6A 2YCJA 4AHOA 3SEPA 3REQA 1UR9A 4LT9A 3H24A 2RDTA 3SIMA 3CT2A 4GQBA 4M8UA 2I17A 2Y8KA 3PZTA 3BXWA 5CH9A 4NAFA 2BDQA 4JIRA 3NOEA 4X9YA 2P53A 3UNTA 3RNDA 5FOOA 4O1CA 1XDLA 4MKNA 4R7JA 1RHCA 4GD0A 2NQJA 2WNWA 3UG3A 3WD0A 1RQBA 3SGUA 3H26A 2QDEA 3P74A 4MM1A 5G1YA 1RD5A 4L1WA 6TIMA 3AS2A 2DUZA 3ZVIA 2Z1KA 3VIFA 2VCAA 4ZTYA 2HK1A 3S6TA 3LHVA 1WDSA 4YHGA 1MZRA 2TYSA 1XH2A 3CK5A 4ZXOA 2XVNA 4NUWA 4MY8A 2VFEA 2NT1A 4CQAA 5AHEA 1D3CA 5E70A 1IT0A 4QCFA 3DHPA 4AYSA 3BZGA 3R0DA 2HWGA 5FEXA 4IPJA 2J7HA 1PZ0A 4I8YA 5LGXA 1UR3M 1KFWA 5AECA 2KAUC 1B1YA 3FDGA 2WC7A 4F0LA 4AZ7A 1JAKA 3LBCA 3IGSA 3LMZA 4UTWC 4LAKA 4XB3A 2OOFA 1AFSA 1SSGA 4GQGA 4QLJA 4UC5A 1GG0A 4WD0A 2V81A 2PURA 3F5LA 2BXVA 4C1NA 4PMQA 1BPLB 3WBYA 1KXQA 3WYZA 1B9BA 5C2XA 4MAVA 3QQWA 3S1XA 1X8FA 4HU0A 1V7YA 1FCBA 7TIMA 4AD3A 4DWSB 1B30A 4DJDC 4HOXA 3M5VA 2O0TA 2YW4A 2WQPA 5AHMA 2NW0A 1LM1A 2WCGA 2PSNA 2WZMA 4LYQA 4O17A 3PZNA 3EMQA 1EDGA 3DG7A 2ZX8A 4R53A 4DVOA 1QI2A 5SWUA 3M44A 1XUZA 3BAIA 5ABHA 1J0HA 4YHEA 1C7SA 3K4WA 5HQEA 3N9SA 2GJRA 3W4RA 2C13A 5B7YA 3PSWA 2E0PA 2VELA 1V3JA 3S0CA 3O1NA 3LRLA 1HL8A 2PLCA 4H04A 4IQLA 3WG6A 4LBUA 1L6YA 4IGNA 5FF2A 1LQ2A 1EC9A 4NAEB 3NQCA 5A94A 3LEPA 2GUUA 4LCQA 1ISYA 3BLKA 5D9MA 3VKCA 1R2SA 4UFLA 2WKGA 3W7JA 4WJEA 3M6DA 1QNSA 3NAVA 2WVVB 2FJUB 1TR9A 3GB6A 3GXDA 4UMAA 3SCVA 1UD3A 3WJWA 3CIXA 4CCCA 4D72A 2BBFA 4MOZA 4PTDA 2VEMA 3WUGA 2FDMA 2BY3A 3GXFA 4F48A 3GE7A 1VEMA 2VJXA 1W9UA 4AIEA 5DT7A 4JX4A 1Z42A 7A3HA 2EJAA 2YDRA 2DZPA 4HNTA 2CLKA 2BNJA 4OOUA 2F2HA 3MKKA 2QMKA 1QW9A 5J8LA 2J75A 1H7NA 2VEKA 4FK9A 4YNGA 4LW7A 1MNZA 1Q6RA 1A53A 1H0GA 1KBKA 1B2YA 4Y9OA 4GMEA 1MW1A 1AL7A 4ZOAA 1S2TA 3H12A 1TWSA 2BVYA 1JCXA 3VU2A 4Q7NA 1TPWA 4AEFA 3G8EA 3S5ZA 4KFOA 3E0VA 3G0XA 1ZY9A 4X0NA 3T4WA 1KV8A 4WY0F 4CLMA 4DXKA 8TIMA 3GH5A 4FHAA 2ZE3A 3C2EA 3MZNA 2WHLA 4NAFB 3M7SA 4PL1A 4JTFA 4XSMA 3DBPA 2RDWA 3OVGA 3NZ1A 1RZMA 4W4QA 2REQA 2VO5A 2VFGA 2RJGA 1VFHA 3MKCA 3L0KA 4KRUA 1X7IA 4MWAA 3Q67A 4LNYA 2BX7A 1ICPA 3CIVA 4GC4A 1AD1A 5LXEA 2QR6A 4AVOA 3UA3A 3LNMA 1GKPA 2DU2A 3VNKA 1LF1A 1Q6QA 4O50A 3W2JA 4PCNA 4JBRA 1DHKA 1LOQA 4B5WA 2JF7A 4JIPA 1R3TA 5IOBA 1MFUA 2J8GA 3GK0A 4H7CA 2JKAA 2O9RA 2BXZA 2O7SA 4LGXA 2C16A 4ZQMA 3MMWA 1FWCC 3BMVA 1PTDA 3RR4A 2PWUA 4I7WA 3AZSA 3A24A 2QVNA 3VC5A 3CL8A 2PDBA 1ME8A 5EMLA 4US5D 1ZS2A 3VM7A 5C70A 2ZRXA 4ZQOA 2H8ZA 1UPPA 1BXNA 2W62A 4DLFA 1TPFA 1LWJA 3CEPA 3UY7A 4QSFA 4B2DD 3E96A 3RIKA 4A6GA 4GIYA 5I09A 4JN7A 4Y2WA 3V36A 4Q32A 4C1NB 4HU3A 3CHDA 1LYXA 1R3VA 4R33A 3LNPA 3W85A 3I4KA 3GG0A 2VOTA 2RGLA 1OEPA 1JF6A 1JDDA 4M29A 4PCTA 3OOQA 1G94A 1MRAA 4L65A 1KFEA 4JFVA 1ISZA 1JD9A 1Q7MA 4M82A 4AZ5A 2FFCA 1H1YA 4GFIA 2GJLA 1F3TA 3RR1A 4W8BA 4MZ1A 1BWKA 3BLPX 3CV7A 1GVYA 2POTA 2FGZA 5CSUA 4F66A 1LWIA 1V6UA 3VD5A 1HGWA 3B8SA 4G6CA 4RZ6A 3T05A 3KBVA 4C6DA 1OYCA 4FXSA 5E9AA 1V3LA 4FOUA 3T44A 5F2IA 1I2RA 1GW9A 1KGUA 3FA3A 3SUVA 3UNDA 4XKYA 2XSAA 3LYEA 4DWSD 4JTSA 1OX4B 3F7JA 4QDPA 2IPGA 4TX8A 4TIMA 3KAOA 3TAOA 2G5WA 4QISA 2HVNA 4R9OA 3O07A 4YTSA 3H7RA 4W8LA 1XXXA 5ENLA 3FKRA 3QF0A 4AIUA 3UZJA 1EPVA 1NDYA 3BQ6A 1YBQA 1YADA 1DWHM 1UWIA 3TN4A 4E8DA 1X1NA 3CQHA 2ICSA 4FXFA 3OZOA 2DT0A 1TZZA 3WO8A 4TV6A 3SQSA 3BL3A 5M3WA 2YZRA 1GJUA 3CLMA 2Y5SA 4GQ0A 2YR1A 3RU6A 1VCFA 1GTEA 3GDKA 2WMIB 3N3TA 4HNLA 3AMKA 2B7PA 3QKEA 5LNWA 4CD5A 3W1AA 1DL3A 4PFMA 3BGGA 1Q6FA 3OW1A 4CCEA 3OZPA 4Y8EA 3QW4B 3TN6A 1K77A 3UJRA 1DEDA 3NO3A 4UQAA 3Q65A 3AIQA 1OY0A 3ONCA 2D2GA 2AOSA 2BOFX 3MBFA 3GC4A 3ME3A 3F4NA 1UKPA 4H00A 1T8QA 1J18A 3T81A 1JCLA 1RH9A 3IPWA 5F1UA 4Z1DA 1AG1O 3GHRA 2A2IA 8A3HA 4C7GA 2Q8XA 1CGYA 1OYAA 5E5CA 5CJMA 4YLWA 4FLRA 2GJXA 4GGHA 4D1IA 3IAPA 1OCJA 4WX2A 4ZCWA 2NUXA 2VURA 1W5PA 4F9JA 4M0XA 1XDJA 3WDRA 3W01A 3B8UA 1WNOA 4GY7A 1XLCA 1UWRA 1W37A 2Z1XA 4YS1A 2REQB 1TVNA 4ZA0A 3KTCA 4IX2A 4MWAB 2PCQA 3LPPA 1GPWA 1NH6A 4P7RA 3VINA 1FOBA 3QV7A 3BGAA 4RXGA 1H7WA 4EWJA 4ZL1A 1OFRA 3SB0A 3CNYA 4NXSA 1NDWA 3EB4A 1D8WA 3K2GA 3M0JA 4H01A 2OQHA 4E4PA 3TX9A 2V82A 4IZGA 4UTHA 4ACYA 4DYKA 3O0FA 4UTIA 2DZUA 3BLEA 4I6VA 3S1VA 4N9EA 5BNKA 1CIUA 2X40A 4KWSA 1WV2A 4AW7A 1CXKA 3GUGA 4NJHA 3QRHA 3LI1A 3CHEA 1ISWA 3WLQA 4NSBA 5LIYX 4GI6A 2X0YA 3W37A 3AFBA 3HJZA 1WDDA 3CZEA 5CAHA 1GEHA 3KLKA 3K8KA 2DZAA 4P7LA 1QNQA 1VPQA 3PTMA 3APGA 3E0FA 5FAJA 5AYZA 1UZHA 1HQTA 2FZ9A 1RP8A 3NUKA 1KCXA 1RCXB 2X7VA 3LRMA 5M1TA 1E43A 2X1RA 3MVIA 4GYPC 4MUZA 3LZ3A 3MANA 3EGJA 3T2PA 1L8PA 2OO0A 1ICSA 5FJIA 4IL2A 2DSUA 1SW0A 1TTJA 2VR4A 3VDBA 3MT1A 3V5OA 4H6EA 2NXGA 2RDUA 2E8YA 4KIEA 3E2VA 4QTGA 2ATSA 3WK0A 2E40A 3LENA 5HMDA 3CTLA 3CUIA 5LIKX 3VGEA 2Q3RA 1UH2A 1MMFA 1KFBA 3GHUA 4HSOA 1FWHC 3E3HA 1KBJA 4HU4A 4XKYB 4K7YA 3W1TA 1JZ6A 4PL2A 2E28A 3P62A 3BSHA 3QZ6A 2FZNA 4WGXA 3N13A 1EHNA 3DOPA 4EXQA 1UR0A 4ZO7A 3N2XA 3P84A 1FWAC 1R30A 4QDMA 2PDGA 4M51A 1YIXA 1MQQA 2YA0A 1TUFA 2YL8A 4LVDA 1A0CA 3LSCA 4HMNA 3E2RA 1NDZA 2C0HA 2XIMA 4GA8A 3AMGA 5ECVA 4F8XA 1I2PA 2YJQA 2GVEA 5B7ZA 1ZZMA 4L9ZA 1XIFA 4UTWA 3DFTA 3QVQA 4Q8TA 3DI0A 3NQ6A 3SRKA 4GJJA 3BK0A 4UNIA 3VNMA 3HFTA 3ZM8A 2YW3A 3R89A 1XUUA 4DUWA 5KITA 3PZGA 3C0SA 5F2LA 2BWGA 3S47A 3LCLA 2BMBA 3RITA 3ZJ7A 4L56A 2G3MA 2J24A 1XRVA 1W0MA 3VGHA 1S2CA 2Y5EA 2DIEA 1YKWA 2E6DA 4WDUA 4JIIX 2X42A 1GJPA 1M5WA 2XZ9A 2G4FA 2Z29A 4U5IA 4DJDA 3M0ZA 1T96A 4XO6A 3QTGA 1E1EA 1JNEA 4L9YA 2Z1WA 3NL2A 2GJXB 3NYZA 3WNLA 1H49A 3WNNA 4RPQA 2J7GA 4HPGA 3BWWA 5C6MA 5C2GA 1EYEA 3B9OA 3UQNA 3AIUA 3NGJA 1HGYA 4DBSA 3IRDA 2GVJA 3E0LA 3FXYA 4RV3A 4WXZA 4ZFCA 1ZCCA 5EMMA 2PRLA 3SCTA 1XIBA 3MPGA 4JEQA 4NZ1A 2YCKX 1FWFC 1FDZA 3ICJA 5HBFA 1EWEA 3WQCA 1OHLA 4GKTA 1P5BA 2QEZA 3EOUA 4J4KA 4IXXA 4MWAD 4JQ3A 1TPVA 1ZLPA 4W87A 2WLYA 3QJAA 2ZTKA 5F4SA 4M56A 4OWGA 2J7BA 1XC4A 2GDQA 4EOUA 1N8IA 1EGVA 1H5YA 5E6YA 4B9ZA 1UQYA 4C6IA 2DEPA 1BYBA 2ZUSA 3TZNA 3W76A 2Z1BA 5I02A 3NZRA 2PI6A 4H41A 5C9ZA 2B81A 4J35A 1DP0A 4HJWA 3S46A 4TX6A 4XIMA 3UWVA 1X8CA 1YDYA 1I1XA 1QR7A 4PEEA 5G1MA 4B9YA 2VWSA 3O6CA 2ZRZA 2CLIA 3D0CA 3O9NA 3HG5A 3S8HA 3VCRA 3QFWA 4MNMA 3EEGA 4MHBA 2OTDA 2JALA 3MHFA 4DELA 4O52A 3NL5A 1K4GA 2E3ZA 5IHSA 3O6AA 4CNSA 5HK4A 1FXQA 1UQZA 4LU0A 5ABFA 1V6VA 1LROA 3HIJA 4K8GA 5A1AA 1I6NA 3K4DA 2OEMA 3KX6A 4UFJA 4UOQA 1XIIA 2QV5A 4GBDA 4E3VA 3L23A 2I16A 1GQKA 4ILSA 3KWXA 1ME9A 5HR7A 2QJJA 4YU1A 4O28A 1ITQA 2OVLA 3PVFA 1H7XA 4P8WA 1U83A 3RRAA 3MP3A 3WDHA 1U1UA 3IJ8A 1K3UA 5E0FA 3IRSA 5CPLA 2WQDA 3KRZA 3MV11 2R91A 5CSRA 5LIXX 2H8XA 1I2NA 1XBZA 4AX6A 3UVAA 5HNRA 4KGJA 1FHDA 1WZMA 5H91A 3PWGA 1P0NA 1SMDA 3U2CA 3UD6A 4GI8A 4FF7A 4H9UA 1US0A 4E2BA 4XBJA 2ACSA 2C14A 2OO6A 2QPUA 3T6CA 4L61A 1B4EA 3LSBA 4KCTA 3WLMA 3CZLA 4IPNB 2Z2UA 1SO4A 4XV0A 4HQVA 2PC4A 2ISWA 4DF0A 4R7WA 2IKHA 3BURA 3L2MA 4JTQA 3NFUA 1JPIA 4DJFC 1X6LA 3ALFA 4D2JA 5HATA 3GAKA 2WNNA 3EWBX 2XM2A 3KL3A 2E25A 4NIRA 3CHCA 4E6MA 3LI0A 3TLLA 4GQRA 2WC3A 4DXVA 2WMJA 4LUSB 4Y8FA 1OGSA 3WBXA 5MHBA 5A69A 4N6FA 2B7NA 2BLEA 2WMFA 3VOCA 3L4WA 1JG9A 3T07A 1Q63A 3CL6A 3VD4A 4HCDA 2XZ7A 1EWDA 4GH1A 2A5HA 4LX4A 1XLEA 1S5WA 4FNPA 3OBAA 1JDFA 4PUEA 7CGTA 5DO8A 4CUCA 1GOMA 3KXQA 5I7GA 3S9YA 4XX6A 1XGDA 1KXHA 3MSYA 3IEBA 4IMDA 3WQPA 3P6LA 2VGFA 3NL3A 3TXZA 3A4JA 3MVTA 3EOLA 4IIBA 4JTAA 4QEHA 4L6OA 3B9DA 2ACUA 4M24A 3AMDA 1T0OA 5KTLA 4MDOA 3EWWA 2OLAA 4PA8A 3TNBA 1AL8A 1B4KA 4M7TA 2CITA 3IJ9A 2BV9A 5HMSA 5HMEA 3C2OA 3TFCA 4BF7A 4LUYA 5CC3A 2PD5A 3CWHA 2JEQA 2PFHA 4JEJA 3I4EA 1J0YA 4FNQA 2PDWA 2H9AA 4Y9AA 2NV1A 3SRFA 5DMLA 2EG6A 1HL9A 5I3FA 4O4VA 4LCSA 3WJXA 3GDLA 3RMJA 3H2FA 3GIPA 4F9DA 5EBAA 3ABOA 1Q6DA 1XGZA 3W6LA 1EF2A 3CMGA 4UOJA 1BVZA 1TPDA 4KEUA 3CMJA 2C1GA 3PUEA 4EACA 3LERA 4ENLA 4LAZA 1O60A 3W81A 3CH9A 3CUHA 1YXYA 2A7NA 5HDRA 1DJNA 4M7SA 4R27A 2V38A 2BODX 3G8RA 1VIZA 1NWTA 1ZENA 2G37A 2HVOA 3GAYA 3GYCA 2J66A 3W7EA 1E71M 3AMCA 3KVKA 1UASA 2GSHA 2V30A 4KMQA 2EPNA 5U4NA 1GYNA 1CLXA 2ZWYA 2VRQA 4WLCA 5IFTA 2QJMA 4AUBA 1PB0A 1YPXA 4IHCA 5C7VA 5A2AA 2HXUA 3KZPA 3U8GA 1B3VA 1EIXA 1KGWA 1SW7A 3SCNA 3LDVA 3EMCA 3B05A 1UUQA 1IF2A 3OHIA 2ZDRA 4LS0A 1AJ2A 2X1IA 3E49A 3K1GA 4LJ3A 4EXAA 2ANUA 6REQA 3I10A 3R12A 3SUUA 3GW0A 4FA3A 1T7LA 3IIZA 5DFAA 1HL2A 3HPXA 2XM1A 2XHYA 3WEZA 3U4AA 3L5MA 1QNPA 1KW1A 3AIRA 3B8DA 2AAMA 5JMUA 4C6FA 4BI5A 4W7UA 1YNYA 4XAZA 2DQWA 2OSWA 4Z2HA 1A5NC 4IMCA 4P61A 2GWGA 2POZA 3UZ5A 3N04A 5H1WA 4MG4A 2E1WA 1KRAC 5FL0A 3E9AA 4BQ4A 3KBMA 3GQYA 3H21A 7PTDA 5AVNA 2AL2A 4D8ZA 3IJ6A 1EJ7L 3OBEA 2PWGA 5M17A 4H8VA 1R3RA 3WLOA 3LLXA 3MI2A 3SGGA 1E4IA 1O4UA 4AD4A 3C61A 3V0UA 3CASA 3RAOA 3N29A 4GYPA 1WUFA 1HW6A 1TJ2A 4I5UA 3WQ6A 4TU1A 3WFLA 3BSMA 3PBVA 3IIPA 4LUIA 5KEZA 1DKWA 3GDMA 5ABTA 1DORA 1JR1A 3MUZ1 4Q4SA 1V6XA 1CXEA 4EAMA 3L9CA 1VD6A 3GTNA 2XTKA 1NELA 1WPCA 1GOKA 1V7AA 5D2TA 3W2LA 3KVLA 3T1GA 4D6JA 1WP6A 3ZSSA 3LPOA 3MSDA 3MP5A 1UH3A 2OYLA 4XIAA 1X6UA 3UT0A 1K1DA 1A0EA 3HPFA 5DXYA 3WH5A 2WPBA 3PULA 4O16A 4RE4A 3DFHA 3G1AA 1W8SA 5FACA 3VNJA 4EE9A 4PFHA 2VFFA 3EPMA 1FDYA 3C8FA 1H11A 3VIHA 1J0JA 1P0DA 4UQEA 3WD3A 4AXNA 5TIMA 4REQB 1CGUA 1F6YA 5A6SA 1XYCA 1XLFA 3M0XA 2GVLA 4MJ2A 3GBEA 5I07A 2JFEX 1L2QA 3VUPA 2VD8A 1OZMA 4MZ8A 4D6DA 2H9AB 1KM5A 1HTIA 1TCMA 4HP5A 5D04C 4RZ4A 1CXLA 4A35A 3UW6A 2XIJA 2WNQA 4AVFA 3SZ8A 4JAWA 4ZO8A 3NQDA 4AYGA 1HXJA 1SPQA 1OIFA 3BW3A 5I3KA 1E3XA 2D3NA 4DM2A 2CWNA 1IT8A 3IANA 1GOXA 2WWCA 3VKJA 2J9ZA 3R0KA 3PBUA 1GVSA 1UMYA 3IUIA 3WH6A 4F2BA 2PF0A 1VH7A 4LBRA 4O19A 4PZVA 4XUGA 3LTYA 1DJYA 3TEVA 4IFOA 4AZ6A 3E2QA 1VENA 3RHGA 4LSBA 3W6MA 1Q13A 3LGEA 3T78A 3DG6A 1CCWB 4J1OA 4DZIA 4L4OA 4DHGA 1XBYA 3BICA 2BSLA 2WVTA 2HQAA 2A6LA 5CJ5A 5F7UA 3NQFA 2CHOA 2YPIA 5J5DA 1UR2A 1CDGA 2Z2BA 4RX0A 1YNQA 2CNCA 1ESWA 4YTRA 1T40A 4JNZA 2WKLA 4CD6A 2W91A 1MDRA 4Z42C 3PM6A 3EA3A 3CZKA 4AWUA 1M7XA 3QW3A 4L9XA 2VEPA 5F4XA 1TKKA 2A7PA 4PRRA 3V0SA 2W6RA 1OG0A 4IMGA 2ABAA 1OABA 4YWIA 5I77A 1F05A 4S23A 3PK7A 3E1F1 1EKOA 3DX5A 1CTNA 1V3KA 3BE7A 3OVPA 3A13A 1QPRA 1WXZA 3UPMA 5FEWA 1EZWA 3PG8A 3WF2A 4S2BA 3GNDA 2DIKA 1SU5A 2GQ9A 4AISA 4HPJA 3AJ7A 2DVUA 5GVJA 3CZGA 2E8ZA 4PMNA 5T26A 3QBUA 3GUWA 4D6EA 4PODA 3CUXA 2A3CA 3GNNA 2FGBA 2VFDA 3SM0A 1M68A 2AL2B 2FVMA 3LN3A 3F2CA 2WVSA 1P6WA 3NZPA 3GNRA 2ZRVA 3NDZA 3A3WA 1RP9A 2Z24A 3W07A 3WL0A 3VA8A 1V0KA 3TUUA 3LU2A 4F2TA 3DESA 1VFOA 4EF8A 1ZNNA 2FZDA 4DAIA 4IF2A 1DWIM 3CAKA 3L7RA 4FMVA 4CKQA 1PX3A 4R5EA 1QI0A 3ZLFA 4CQDA 4UQDA 2QCHA 1B3XA 4Q8MA 3R0UA 4C60A 3GR7A 2R82A 3GTIA 2Q02A 5EBUA 3AIEA 2DPEA 3CU2A 3EXRA 3TZFA 3W0KA 1KB3A 3ES8A 5D8WA 3F4WA 3R2GA 5IBXC 1PX4A 4X0VA 1J6PA 1U1HA 4JFUA 3M6YA 4WOZA 4IG2A 2JGYA 4QFUA 3O15A 4DZ5A 5I3JA 3WF1A 5D09A 3LUTA 3QHNA 3EXTA 1FHLA 1IZJA 1EF3A 1FWTA 4JTUA 2BY2A 2W0UA 1SO5A 4MB4A 1MI3A 3AXKA 3UG4A 4LUTA 3GVWA 2WV8A 2VFHA 3BAXA 4PN2A 1MSSA 3NURA 5AHLA 2XISA 4PTVA 2HPMA 3SW6A 3B0PA 3QY7A 5J04A 1QUMA 3WX7A 4GXWA 3VE7A 3ARXA 2YDSA 4FNTA 3WQEA 5F2GA 1PAMA 1G4SA 4FB7A 3W22A 1UP0A 2EPOA 7REQA 3W2UA 3MJMA 3THQA 3UR2A 4IFKB 4EIVA 1XISA 4DJFA 1Q7QA 4BI7A 3DKLA 2GJPA 4YVVA 4B3LA 2X09A 1CLKA 4LVBA 5E1QA 4JS3A 1XQKA 4JQ2A 2DP3A 2OB3A 1YQ2A 2F6XA 2ISSA 2QUNA 5HMFA 3RG6A 2VZSA 3BLOA 4AF0B 2VD9A 1JPHA 4Z1AA 1GVFA 2WPGA 3N14A 3PWIA 1TG7A 3QXBA 2WVUA 4HMCA 1E6PA 3ARYA 1RVKA 1L6WA 4O1FA 1JGMA 3VVGA 1WXYA 3N15A 1E3ZA 2ABBA 4UFKA 4UR7A 4S3JA 2RAGA 3L65A 2QUVA 4LB4A 2ZZ2A 4OOZA 5DX7A 2X2GA 3F1QA 1JXKA 4QJ1A 5CZTA 5JU6A 1QDSA 3IJIA 1FBAA 3QN3A 3UESA 4JGDA 1XSJA 2PLKA 1KWGA 3TIMA 1R8LA 3L66A 1B0IA 1CI1A 4D1JA 3EX6A 5FF3A 1JDEA 4GISA 3LBOA 3CWOX 4J3VA 3TYBA 1XW8A 3N18A 4NI8A 2WCAA 4U33A 3ECQA 1PBGA 2VEGA 5ABGA 1AA1B 5MKGB 2ZUNA 2PU1A 1PDYA 3FGCB 1OB0A 3W53A 2QIIA 5B80A 2OXNA 2EBNA 2GK1B 2QCGA 1AH3A 3P5YA 1GT8A 1IHIA 3VZYA 1XR2A 2ZZ7A 1PSCA 2ZX9A 2EJ1A 2GFTA 2PODA 4LALA 4Y9NA 1L6FA 4EANA 4J3SA 1FWWA 3L4XA 3G0SA 4HIBA 3QPYA 4NZ5A 3RGTA 1EXBA 5BWAA 2CHNA 1KM6A 4FNSA 3WIJA 2OSXA 3SY1A 1BD0A 4BCEA 4CVUA 3UWUA 4QIUA 1NOWA 4WY0A 3G1FA 2QCFA 3U0HA 1WOAA 4D71A 2FHBA 2ZBTA 4A22A 4S3FA 3L67A 4IUGA 4RE3A 2GGHA 4OT7A 2CLPA 4FPSA 4N2YA 1HKMA 1VP5A 1A5AA 4FIQA 4OGZA 2KX9A 4AMAA 1U5HA 3LXBA 3R8GA 3PJTA 4XZLX 1S2VA 5HQLA 1TV2A 1EB3A 2J4GA 1O6IA 4WK9A 3WLRA 2XVLA 3P5ZA 3N11A 2FB3A 2PDHA 3DFNA 5GJMA 2VL4A 1W2VA 4JTJA 4N6EA 5H6HA 2FVKA 2VQUA 1H4PA 3PANA 4PMJA 2NXIA 5F2MA 5FEZA 4IG2B 3ANUA 3NCOA 1LP6A 4LC6A 2GQ3A 3TJIA 1E56A 1KO0A 4TOQA 1E0WA 3OPSA 2C18A 5D2WA 3OO2A 1CNVA 3M9YA 4U4MA 3UCCA 2V2CA 3A4WA 5A6JA 1AW5A 4A8IA 3IGHX 4A3QA 4HTBA 4LUJA 2ZA1A 1ELSA 3W75A 2ONEA 1B3ZA 1FHVA 4ATWA 1XX1A 4M19A 2WZTA 4B4FA 2AAAA 3TW6A 1FQ0A 3ATZA 4AX7A 3W83A 3WK2A 3OGVA 4H9ZA 5DRCA 3VKKA 2UY2A 7REQB 3GKFA 2DSZA 7TAAA 4MY1A 1R3QA 4TR9A 5AHFA 2E77A 1ISXA 3OZMA 5FSEC 3EDJA 2JK2A 3HM7A 5HINA 3VIIA 1QO2A 2ZDSA 3BW2A 1QCWA 2Q01A 3UZYA 1A5UA 3HA1A 4GABA 3NO5A 4XAPA 4IMEA 1NP2A 1UD2A 3ITLA 3PFMA 2CZ5A 2PDUA 4XBKA 1DV7A 3QLLA 1O1ZA 3S9IA 4HGXA 1HVXA 2V0TA 2A3BA 5GNYA 4S3EA 1OJXA 1MO0A 3EX2A 1TIWA 1HNYA 3FV9A 1O5KA 4I9AA 4AHQA 1E9ZB 2P3ZA 3A23A 3DI1A 1PPIA 4KF1A 4W9TA 1R7AA 4BQ3A 2WSQA 3B0YA 4QITA 1E4MM 4Z0SA 1OCQA 4LY8A 3BTNA 5C54A 1ML1A 3JZUA 4JYFA 4DQWA 1RVGA 1AMYA 4S3KA 2CBIA 1FDJA 1KV5A 1M01A 4EKJA 1VR6A 4HHMA 3S6DA 5DY2A 2DQXA 3UEQA 3UWQA 4LRTA 1V0NA 2H90A 3HGOA 3UCQA 4GNVA 5JIWA 3TE9A 3M0IA 1XIJA 1JULA 4HOWA 2Z0IA 3PJXA 1JPKA 3DZ1A 3UFYA 1N2VA 2VR5A 3VKBA 1PS9A 4QROA 2VVSA 4YCPA 5C5YA 4H2CA 1YDOA 1SZFA 4FIRA 3VZZA 2R1LA 3WLJA 1QHZA 3OJGA 1MQRA 1HUVA 3LX9A 1AODA 1C3FA 1DWGM 1WQ5A 2VWTA 3T2QA 1Z8AA 3AISA 3QMSA 2VOMA 3GM8A 4KWVA 3U48A 3V18A 3A47A 1RD6A 1J0IA 1TTPA 3RDKA 3PBWA 4LRSA 3N9RA 4JTHA 2XIIA 3HQ1A 5LNRA 1Z7AA 3BW4A 4IISA 2CLHA 2J7CA 1JRBA 1FWJC 4MNKA 3NA8A 3ZVHA 3U5UA 4IICA 1RJPA 5EFDA 3I7SA 4BZYA 1W9VA 1EPXA 4B92A 1HX0A 4H6QA 3R79A 4A3UA 1PDZA 1XLJA 1ZU8A 3S6OA 1ZFJA 4S38A 5JVLA 1M41A 3STPA 2PS2A 4ZO6A 3MI3A 3B03A 4POCA 3RCYA 1A3HA 3TWBA 3UERA 5D2VA 4WF7A 1WDQA 3KDNA 3AIWA 4HJFA 3VIGA 1RJQA 4FSAA 2BGSA 4PCFA 1F6PA 2YFNA 3W86A 3RM8A 2GWNA 3AOFA 4CNUA 1T6MA 1HO1A 1WB0A 3VOHA 2D2OA 3MA8A 1PIIA 1TX0A 1F4AA 1OF6A 3CHVA 2YL6A 4KW2A 4G9PA 5CGQA 3QMTA 4CNTA 5E0KA 1JI2A 4E8GA 1FA2A 3TR2A 2J9YA 1ZGDA 4IIGA 4Q33A 3IARA 3A12A 5CBIA 3CC1A 4ADSA 2DUXA 3W25A 1KFLA 4G8TA 4QGCA 4NX5A 1W3HA 3E74A 2OMAA 2X41A 3EOOA 6A3HA 2VC6A 4IWWA 4UR9A 3VXGA 3QPZA 1Q3NA 3NZGA 2OODA 3TN3A 3P60A 4NZ3A 2CEQA 3KS5A 4D6IA 2QJHA 2FHCA 4GJ1A 4JKKA 3DHDA 1GCYA 5FJTA 1NEYA 2QXWA 5I00A 4AWSA 1LG1A 1UBPC 1UJPA 2Y70A 4K38A 4MDPA 1XPGA 5FAGA 1HFBA 3F5JA 1C9DA 4JIEA 3PHAA 4UNKA 3S1GA 1EDQA 2VDHA 4UFHA 4HPXA 1R3SA 1LLWA 4Q8PA 5IRPA 3T55A 4R9XA 4URIA 4Q8NA 1E51A 4DUXA 4R88A 4F0KA 4QS5A 3QZAA 1XSIA 4K36A 3TQ0A 1HKWA 3QOMA 2XYLA 4RLIA 4DJEC 5TQLA 1E0VA 3B97A 2I1OA 3Q2DA 3V1PA 2X16A 4Q4MA 1KFCA 3FIGA 5IBXA 1E9YB 2CBUA 4ZOBA 3PC0A 2ISDA 3S2NA 4DO7A 1KTBA 4DRSA 1PWLA 4I7UA 1JDAA 1UJQA 1IR2A 1MXGA 3ABZA 6ALDA 3KOFA 4IIDA 1F8MA 2XJ7A 1I75A 4Q6XA 4S39A 1EC7A 3D3FA 4J3ZA 3NSNA 4NZFA 4FXJA 4RDZA 3WDQA 2C1IA 2WB5A 1E9IA 1VFSA 3JVAA 1K70A 1E40A 1AH4A 1V3MA 1A3WA 4AEEA 2DSVA 2OEJA 3FX4A 3GFZA 1AUSL 2NQHA 1MZHA 2TSYA 2V2DA 1K9DA 3FS2A 3COTA 2FFIA 2E5CA 4KPLA 1XC6A 5DT5A 1X98A 4FZIA 4B5NA 1JFXA 3SJNA 3ATYA 3I3BA 2I56A 1OQFA 1M1BA 1ZHAA 1VCVA 4R85A 2OT0A 2WJEA 4WOQA 3CUFA 3FEMA 4I9JA 3ARQA 5HJYA 1NQKA 5I2UA 4RE2A 2FVLA 4NRSA 3CAVA 4IFRA 1G4EA 1I1WA 3QGKC 4V33A 3G6MA 4WKHA 1G01A 2PD9A 4EK7A 2GZXA 1P6BA 1IYXA 2FTYA 2ATMA 4JTRA 4G7FA 3DHFA 3EEZA 4ACZB 2FIQA 2PUZA 4OQVA 4XD3A 3OODA 2VGGA 1Z3NA 2OGYA 3KBSA 1GORA 1NWUA 2Y7DA 3UXAA 4W7VA 1TE1A 4IXHA 3N2TA 4GNJA 2WHJA 2ALRA 4L1XA 3PR2A 5GQBA 2Z6JA 4CQ8A 1H7RA 1GUVA 3F03K 1P4CA 5HR6A 3EA2A 4WKAA 5G2HA 1ZP3A 4PTMA 1SFSA 4DI8A 3MUIA 4XD5A 5I78A 1FHUA 1UKOA 2D0FA 2YB4A 3LY0A 4NNCA 3JRKA 2ZQ0A 4QE4A 1UD4A 5AYBA 3TYUA 2YYUA 3FFSA 4M81A 4CEUC 4ZGYA 2YCIX 2GGGA 2D20A 3PZIA 3FN9A 4I90A 1K7EA 2V5JA 3WLLA 4G2DA 5DXXA 2DZWA 1VJZA 3C4UA 4HYWA 1FH7A 1IXPA 4O0KA 1IEIA 4Z1BA 3PG9A 3T4CA 1FRBA 3PPGA 3OG3A 2XVGA 1C7TA 3AHYA 4UTTC 1OC7A 3GKAA 2D0GA 2WWDA 3SY5A 1OFBA 2C19A 2HBXA 1X6NA 5H8MA 3DG3A 3R13A 4WRHA 2B0MA 1MEWA 4LC8A 4S3DA 3KZSA 4J5NA 3XISA 1OFPA 4UFMA 3H7VA 4DF2A 3S9ZA 3TMQA 3WQ8A 2I5GA 1V3IA 4DXXA 3FJLA 2CW6A 4RDWA 5I23A 1S5MA 3APTA 2XN0A 2HS6A 3WLIA 4WJXA 1E6RA 1A5KC 5FJOA 4I5XA 2E09A 4XBSA 3LD5A 1EJRC 5KMYA 1ONEA 2D22A 2KZHA 4HK5A 3K1DA 4LEFA 5L9FA 1US3A 1A5BA 3WF4A 4KKXA 3QSTA 5A8MA 1Y5VA 2PTXA 5BU9A 3TC7A 4XAFA 3HBLA 5CZSA 3GG8A 1E4NA 2V69A 4C7DA 4V15A 4F2UA 3LTPA 3M0YA 4ZEPA 3V35A 2OX1A 4O11A 4GZJA 1Z32X 3PNUA 4AXKA 4J3UA 4IJBA 2F84A 2ZVRA 3HTWA 3G1RA 2IXUA 3S5YA 1J2WA 1V4YA 2FZMA 1RSCA 1WDPA 4OECA 1KRBC 3AHVA 5BYWA 2CLOA 3L4ZA 3Q94A 1VBJA 2E5BA 3FK4A 5IDIA 1SFLA 3OU8A 1JI1A 4DI9A 1BYDA 2XN1A 2WOQA 1NFPA 4NJIA 1K8YA 3IAQA 1EO5A 4CD7A 3SFKA 1X7FA 3MDUA 3N2OA 3RPDA 4NYUA 4HA4A 4CNOA 4L4MA 4E5TA 1ZSXA 1E5JA 2WZIA 2VX5A 3M64A 3TW7A 4F3HA 2BVDA 1K7FA 1TE6A 4P8XA 2NX9A 4TUFA 1FCQA 5AHNA 3QYQA 4PR4A 4C5YA 3EWYA 1S38A 1QWGA 3OLEA 3QTPA 1FVPA 4LVFA 1EOMA 5H2ZA 1F6KA 4HK7A 3C56A 2DW6A 3VDAA 3A9IA 2OELA 5IDZA 1JPDX 1UHVA 3ABSA 4X9SA 4FR1A 4B5TA 1THFD 4UTUA 5F4WA 1VFLA 3WQVA 1T41A 5E6ZA 5FKYA 4GVHA 4B90A 1GQIA 2Y8UA 2CXGA 5FA5A 2HTMA 3ITTA 3D6NA 4MWAE 2PZNA 3ITCA 3MUXA 2D69A 2H3DA 4CU6A 3UJ2A 1OM0A 2WYSA 2ZC8A 5CQ1A 3TCEA 1VC4A 3R25A 1DXFA 4BI6A 1R9ZA 4GZIA 4J40A 1TVLA 2QCEA 1XLGA 4V27A 4PUMA 2H3BA 4NF7A 4HMDA 3RUBL 3NOYA 1JXJA 1MDLA 2X8RA 4NZCA 2WNZA 2YCLB 2J6VA 5A8GA 4FLOA 1OSEA 4MYAA 2YBTA 1D7KA 3CQKA 2PTWA 3OIXA 1Q5MA 2X30A 2GL5A 1JUKA 1KBIA 1UA3A 3W7RA 4NJJA 4ML9A 3VGBA 3HG3A 1DJZA 2PLMA 1M65A 3EDKA 1H60A 2G3IA 1GTHA 3DC8A 5FF7A 3WJZA 1DQWA 2Y8VA 4DB7A 1IWPA 2BB0A 5IHRA 5DLCA 3GTHA 2ZC1A 4LH8A 3SAZA 3W71A 2QQ6A 3QC0A 4IJRA 3SDOA 4L4PA 4C6QA 3MCOA 4NZ4A 1PYMA 1J0ZA 3HG4A 3MWAA 1L2UA 1DTNA 5T91A 4MY9A 3EMZA 4JCMA 1EOKA 2Z26A 5FJPA 4MF4A 4QAWA 2BOGX 4CD8A 2D0HA 1VRDA 3IIVA 3WJSA 3DDMA 2PWDA 3E5PA 4BK9A 1EJTC 2HISA 5BWFA 3TC3A 3SECA 3QGVA 2C91A 3TSBA 1EP3A 4H6RA 1E4LA 4H9XA 2PWHA 2X1TA 3GHSA 4IPPA 3GR8A 3W70A 2Y5JA 4HB7A 2VC7A 3VCNA 1QPQA 2VENA 1AJZA 2VP8A 3OGRA 2J7EA 3H4WA 3HG2A 3WQ5A 4RCXA 2JGQA 3BSGA 1W2PA 3IUDA 1R86A 4PUUA 6XIAA 4K7VA 3FSTA 1XINA 3L12A 4NXKA 4O15A 3CT7A 1OG6A 4GKLA 4GI9A 3W24A 2C79A 2IW0A 3EYPA 4PH6A 3BV7A 2CHRA 5CAKA 2PDQA 2YXXA 4W85A 1DHPA 2YYTA 4QQUA 3VNZA 5BU6A 2O7QA 1UR4A 4HNUA 1RLCL 4ATLA 4D8AA 3DFYA 2RGMA 3IJQA 2PF8A 1WKDA 3VIPA 5HNNA 5I03A 3WQWA 2PGWA 4PCPA 2CLLA 3U6WA 1ADDA 2WSPA 2PEVA 2DVTA 1E6XM 1OWQA 5BRBA 4ZFMA 1W3LA 2WM0A 2PGRA 4TQTA 4HOZA 2GVYA 1HKJA 2DT3A 1SVDA 1XL9A 4K6AA 3U7VA 4RW5A 3WH7A 3AHTA 1JCJA 3E5BA 4BF5A 4AMCA 4LYPA 4EAYA 1PKMA 3W74A 1CBGA 4ZQPA 2VRJA 4YTUA 2C0AA 4AU0A 3GVRA 1W1A1 1WKFA 1C92A 4KCWA 1NFGA 2DH3A 1G1YA 4FOKA 3GR4A 1KGXA 2UWFA 4NG3A 3RM9A 3NPUA 3S1UA 2J79A 4LBSA 2QPXA 4HZMA 1XLDA 1RK5A 2E68A 2EG8A 3TN5A 1KXVA 3QQ1A 3EKGA 3AHXA 3N73A 1CECA 3EDFA 4AZCA 4ZSTA 3CZ8A 4DJEA 2W79A 3I68A 5LIUX 3ZIZA 5KZ6A 2PE4A 2QZRA 4OV4A 4NI3A 3NNTA 3O2LA 3KP0A 4W93A 4XZHA 3RPTA 5BOFA 3RILA 1GKQA 1H51A 1A50A 3N4AA 4YIWA 1LUCB 2X7WA 3A5VA 1SR9A 1IXNA 3MO7A 3P8IA 1HJUA 3RN6A 3VD3A 4H8NA 3BAJA 3E6EA 3CS2A 1GVRA 1OINA 2QKFA 4GIEA 4GX8A 1O95A 1CXIA 4S2CA 3TAKA 4M6VA 1DE6A 1KM3A 1D3HA 2FQIA 2PCEA 1UZ1A 5LNUA 1V6WA 4PUJA 3QM3A 5A6BD 5LHEA 3BJSA 4IJCA 3C2FA 3TU9A 4JNMA 2W67A 3UG5A 4WGHA 2IKGA 4LAUA 3MCNA 3ITOA 1MXDA 2Z6IA 3LHWA 1ISVA 1VYRA 3U2EA 1O12A 1TJPA 1TUXA 3N34A 5G1TA 5EA9A 4AD5A 4BQ5A 4L6DA 2PRHA 5I0DA 3VMPA 1VFMA 3E0IA 3AYSA 3NO1A 4PE8A 2ACRA 4RKAA 3HOJA 2OZ8A 4Q8VA 1H1NA 1OZQA 1XYAA 3M1ZA 3VKAA 1LBMA 2GVGA 2PDXA 4HZ6A 1GYLA 1WDWA 3J7HA 3WLNA 1I0BA 3E12A 3WQFA 2A4AA 4XUYA 4HHLA 3N9KA 3H4XA 5CLWA 4D6HA 3REQB 4OZOA 4NNBA 3TYZA 4UNLA 3IK4A 3WCZA 4ECLA 1W9PA 1FUYA 4K37A 3CO4A 5CSYA 2QDDA 2QCLA 2NWSA 2BGQA 3SCRA 1FWIC 5M2FX 4QLLA 4LS2A 3D47A 2WZHA 2W63A 2G4JA 4GJIA 4ZE5A 3WLSA 3U3HA 5D4YA 4AZIA 4O10A 4DWSC 1I2OA 3MUCA 1P0BA 4P5UA 4ZQRA 1R2RA 1C8VA 1ONXA 3AALA 1DVJA 2XU2A 3H2OA 2DZTA 4MJ4A 2ZTJA 1W1TA 4LYKA 4QP0A 1XG4A 1QJWA 1PEZA 4PMYA 3W3OA 3VO0A 1GKRA 3LCIA 4I7VA 4A4AA 3F4DA 5AC8A 2GDVA 3OLGA 3EX4A 5HWJA 3UWYA 4GCAA 1MFVA 2HZGA 1G6CA 1XLMA 3M0VA 1UPMB 3VMNA 4K39A 3KHDA 1F9CA 3G1VA 3M4HA 5I3GA 1BRLA 4Z2KA 3ANVA 2XFRA 4FNRA 3WFAA 1KCLA 1IZCA 2XSXA 3WLTA 5E9XA 5HPCA 4GZ7A 1M6JA 3L2LA 4CEXC 1GJWA 1S5TA 4L7ZA 4ZQCA 2OT1A 2QCCA 1ECQA 3H53A 2DGAA 2Z7GA 3NQAA 3M0LA 2FH6A 1Y7VA 4DWDA 1A3XA 1F8IA 2VUNA 1A5SA 5CPMA 3H54A 3LCWA 3R6IA 3BANA 3LGDA 4JTIA 3CL7A 1RXOB 2I57A 4NKCA 3B9AA 1ENUA 3CIWA 1OX6A 3G0UA 1CXHA 5CPNA 2V67A 1D7FA 1XRFA 2YLLA 3KFTA 2C1HA 4U31A 4IGSA 1HJSA 1IEQA 5C9RA 4J28A 2VZOA 4BR1A 5JUVA 4BA0A 1ECEA 1FWGC 4C65A 4H7VA 3NDOA 4E0CA 2PDMA 1O7AA 1EX5A 4PB4A 2NUYA 2XFFA 4XSLA 4DLMA 3BJTA 2ON3A 2WM1A 1Z69A 3HO8A 3POCA 4AZCB 3QHMA 5BRQA 3WLKX 2GGIA 4TVDA 1G9HA 5CKSA 4WDWA 2OLHA 3EX3A 4PMOA 3QV9A 1PKNA 1EQCA 1BYAA 3U7BA 4ZO9A 3T0TA 2G0WA 1EYWA 4Q8UA 4X22A 3MS8A 3R1ZA 4KEVA 1ODUA 3NQMA 1CGTA 3HV9A 3H2AA 3FLUA 3BG5A 4DBEA 2VM8A 1XBVA 4GBUA 2DZSA 2OKOA 3LPGA 3II1A 3QQ0A 3E2SA 3KCJA 4ADTA 2OR2A 3B4YA 3VNYA 3SCSA 1MEHA 3OLDA 3GXTA 3MMUA 3B8VA 1L0PA 3EOSA 1EGMA 1NU5A 1CW2A 3JUGA 2VGBA 4NY2A 2ZZ1A 1I8JA 3B40A 3AIBA 1CLVA 3LOTA 3EDEA 1HP4A 1OCNA 1UKTA 3FKKA 4YN5A 4A29A 4JFSA 4DX3A 5I5RA 3SCPA 3QHOA 4YMZA 2O4QA 3IV3A 4Q8OA 1K02A 3CHFA 1K7XA 1VCGA 4XAYA 1ZL1A 4DPQA 3QR1A 2GJNA 3Q4DA 1VB9A 4KETA 1N82A 2EPKX 2YBVA 5JBEA 3L2IA 4ZBCA 3I6TA 5HJXA 5LXXA 3VTRA 1JF5A 2I9EA 4A3RA 1EL3A 5FJUA 3QLDA 3ELFA 2ZFAA 1F2JA 1XLHA 4MNJA 1U2YA 1EJVC 5GNXA 1TV8A 4LAMA 2PAJA 3VNIA 2QDGA 4IIFA 3KEHA 4O1BA 1UZDA 1MVYA 1YEYA 1MWOA 4RW3A 4GXMA 2XVKA 1B9ZA 4FI4A 4WSJA 4DF1A 2CKSA 3ZYZA 1PL9A 1X96A 2NVDA 1Z44A 2AL1A 1KKOA 2V8ZA 1JPMA 2HRWA 1TTIA 1V93A 3ZR5A 1DBTA 2XH7A 1NOUA 3W29A 2YB1A 3RCNA 1HVQA 3UXLA 3TH6A 1H63A 3RX2A 3OA3A 3W1PA 3A3XA 2PDCA 1IGWA 1REQA 1H1ZA 2Y88A 1OFEA 2HROA 3IJDA 4GK8A 4B5VA 1K03A 4HBKA 4HN4A 2Y6ZA 1LLOA 4UZUA 2OWWA 4WCJA 1TMQA 2P76A 4LANA 1A5OC 2WC4A 3INPA 3DC0A 3AO0A 4H7ZA 5CXPA 1ZAHA 2J8TA 3W7HA 2ZWZA 1K6AA 3PZOA 1BRLB 4UTLA 1LG2A 1B54A 2OG9A 4QNWA 2F6KA 1V6TA 1ODZA 2EKGA 3WJYA 5LZLA