3WCZA

Crystal structure of bombyx mori aldo-keto reductase (akr2e4) in complex with nadp
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
307
structure length
307
Chain Sequence
AVQAPCIQLNDGNTIPIVALGTGRGTAKESDSIDEVRQAVYWAIEAGYRHIDTAAVYQDEEQVGQGIAEAIANGLVTREELFVTTKLWNDKHARDQVVPALQESLKKLGLDYIDLYLIHFPIATKPDDSPDNIDYLETWQGMQDARQLGLARSIGVSNFNATQITRLVSNSYIRPVINQIEVNPTNTQEPLVAHCQSLGIAVMAYSPFGFVVSRGQTGAPPPRSDDPTLTALANKYRKSVGQILLRYLIDRGLIPIPKSTNKQRIAQNIDLFDFQLTFEEVAAINQFNKNHRVIDISDWKDYPNYPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Aldo-keto reductase 2E
publication title Identification, characterization, and crystal structure of an aldo-keto reductase (AKR2E4) from the silkworm Bombyx mori.
pubmed doi rcsb
source organism Bombyx mori
total genus 111
structure length 307
sequence length 307
ec nomenclature
pdb deposition date 2013-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3wczA00
1EXBA 1J96A 1Q5MA 1X96A 1HW6A 2J8TA 3VXGA 2R9RA 3LZ5A 3RX4A 2ACRA 2PDIA 4I5XA 4JQ4A 4YS1A 2IPJA 1MI3A 1XF0A 3D3FA 4LBSA 3RX2A 3CASA 1QRQA 4GA8A 2DV0A 3LEPA 2PDPA 1Z3NA 4H7CA 1ZGDA 3GHRA 4FA3A 4XZIA 3GHTA 4JIIX 4XVDA 1SM9A 3ERPA 3R8HA 5LIWX 1EL3A 3RX3A 2FZDA 1IEIA 2FVLA 4WEVX 2FZBA 3R94A 3LZ3A 4XZHA 4H8NA 4RPQA 2ACQA 3R58A 4ZFCA 3CAQA 3N6QA 1RY8A 4DBUA 5M2FX 2INZA 4DBWA 1PYFA 3LQGA 1AZ1A 2HVNA 2CLPA 1ZSXA 4LB3A 3P2VA 1S1PA 2PFHA 1T41A 2WZTA 3UGRA 2BGSA 2P5NA 2ACUA 2IKIA 2HEJA 4F40A 2PDYA 2QXWA 3CV6A 5HNUA 3V0SA 5HA7A 4PRTA 4YU1A 2IQ0A 3LBOA 4QXIA 3V36A 1GVEA 4WDXA 3UZXA 1LWIA 4XAPA 2PD9A 3U2CA 4WDTA 4Q7BA 3O0KA 3ONBA 3WG6A 2HDJA 2IS7A 3GHSA 5DANA 4GACA 2PDFA 2FZ8A 2IQDA 3UYIA 2PDJA 3N2TA 2R24A 4JQ1A 3CAVA 4YVXA 4XZNX 5LIKX 4IJRA 1ADSA 1S1RA 4JIHA 2ACSA 3H7UA 5LIXX 4LAZA 3LUTA 1S2CA 2IKGA 4GQ0A 4L1XA 3QKZA 1X97A 2DUZA 1AFSA 3M4HA 4FZIA 2PDMA 2BGQA 4MHBA 5LIYX 4PMJA 4R9OA 4JIRA 3UZYA 1VBJA 3LQLA 3UG8A 3NTYA 2I16A 3UWEA 2I17A 2AGTA 4XZMX 3O3RA 1K8CA 3R7MA 1XJBA 1EKOA 1PWLA 4JQAA 3GUGA 1EF3A 1FRBA 4L1WA 1YE6A 5AZ1A 3FJNA 3WBXA 2ISFA 3EAUA 4WDUA 4XZLX 1AZ2A 3WBYA 4LAUA 2ALRA 1MRQA 1PZ0A 1Z89A 1XGDA 1QWKA 4GCAA 3UFYA 5JH1A 3V0UA 4WRHA 2IPGA 2HE5A 2IKHA 3R6IA 3V0TA 5JH2A 4Q3MA 1A80A 3H4GA 4OTKA 1R38A 3UZZA 3UZWA 2HE8A 3ONCA 4JTRA 2PDCA 4NKCA 3EB4A 4JTAA 4WDWA 4IGSA 2PDNA 1PZ1A 4JTQA 3CMFA 4QR6A 4HBKA 4LBRA 4QBXA 3BURA 3C3UA 2IKJA 2PDWA 4JTCA 4LB4A 2F2KA 3T42A 4G5DA 4PUUA 3MC5A 2PDUA 2HV5A 5KETA 1PWMA 4DBSA 2FZ9A 3BUVA 4XVEA 1Q13A 3M0IA 3Q67A 4GQGA 5AZ0A 4DZ5A 3WBWA 2A79A 1X98A 4YVPA 4PUWA 2PZNA 3COTA 4HMNA 4JQ3A 2IPWA 1JEZA 4XO7A 4JQ2A 1C9WA 3GHUA 1YE4A 3R8GA 1VP5A 1HQTA 4GABA 1MZRA 2PDHA 2PDXA 1AH3A 4YVVA 1YNQA 3S3GA 3CV7A 4WGHA 4PR4A 1ZUAX 3DN5A 2PDGA 1AH4A 1M9HA 2PDLA 4PRRA 1S2AA 1Z8AA 4JTDA 3LNMA 3G1RA 2PEVA 2IPFA 1IHIA 5HNTA 5LIUX 1RY0A 3KRBA 2VDGA 2PDQA 1Z9AA 3BCJA 3LD5A 3V35A 1RALA 1AH0A 3R43A 3Q65A 2PF8A 4ICCX 1T40A 4GIEA 2HVOA 3G5EA 3B3DA 4IJCA 3BV7A 3FX4A 1OG6A 4ASTA 4XO6A 5C7HA 1US0A 3MB9A 2NVDA 2PDKA 2INEA 3UP8A 3H7RA 4EXAA 3DOPA 1ZQ5A 2C91A 2F38A 1YNPA 4FALA 2PDBA 2PD5A 2BP1A 3LENA 3WCZA 2FGBA 4FAMA 2NVCA 1LQAA 3LN3A 2DUXA 4QX4A 2WZMA 3EB3A 3F7JA 4EXBA 1UR3M 3M64A 4XK2A 4AUBA
chains in the Genus database with same CATH superfamily
3W0KA 4EF9A 3T0CA 3NQ6A 4JFWA 1XCXA 2TRSA 4W4QA 4OBSA 1OIMA 2GSEA 4DYJA 3R2GA 4D6HA 1OHLA 3RMJA 2DZXA 1PX4A 1KBIA 3LHUA 1ZY9A 2EKGA 1W56A 1SJCA 3L7RA 4Y9PA 1PHWA 3O16A 2UY2A 4DF0A 1OSEA 4MTVA 4F0LA 4HA4A 3OIXA 5DXYA 3S8HA 1XYFA 2SFPA 5BRBA 4F3HA 5LGXA 1J0YA 1SM9A 1LZOA 3ERPA 3FOKA 2YW4A 3KDOA 4HTYA 4OHQA 2A3LA 3NYDA 3RPDA 3NQMA 1DWHM 4RPQA 3GFXA 4JZ5A 2ZXQA 4O13A 3ITVA 4A4AA 1J0IA 1AZ1A 3KTCA 4ROPA 4UFJA 1PX3A 2P50A 4WXZA 1JPDX 4W8AA 3QMSA 1RCQA 4LAOA 4CNPA 4LC6A 3MCMA 3VU2A 3QOMA 3WNPA 4KFPA 1MFUA 4ICNA 2FGZA 2IKIA 4P7LA 5FJTA 2D2GA 5A6BA 4MY1A 4IMFA 3V0SA 2YXOA 1CZ1A 1Y65A 3RF9A 2J7DA 3W3OA 1UR1A 3EDDA 5HA7A 3VGEA 2WMGA 3PZNA 1XQKA 4EAMA 3P3BA 2E5BA 3UXAA 4S3EA 5FSDC 3CT7A 3GDLA 3VINA 1Q8JA 2P53A 3VCNA 2V5KA 1QNPA 3UZXA 3QFWA 4C6LA 4AQLA 2CC0A 3FVMA 1US3A 5D03A 3U8GA 4ZOCA 4HCDA 2NXHA 4QAWA 2PDFA 4FF7A 5JBEA 2PDJA 4E4PA 1XDMA 4TVCA 3R0DA 3T6CA 4YTTA 2B0MA 1QW8A 1S1RA 1J6PA 3HQOA 4XX6A 1BXNA 4IPNB 5DY3A 4GIYA 4PSRA 4R53A 4XTIA 4GRSA 4IFOA 3SIMA 3O05A 4M7SA 1VLIA 3SCUA 3SI9A 2NT1A 2DH2A 3BAIA 4AIEA 1JDEA 2Z1BA 4UNKA 2JBMA 1I2QA 1KXTA 5CC5A 3N1AA 2FVMA 1C90A 2ZUMA 3LQLA 3NTYA 4LS0A 2DSZA 4IT1A 5E0FA 3VOGA 1FA2A 2G37A 2OZ8A 4H4IA 3H2FA 1R30A 1JL8A 3SFKA 3CIWA 1ISVA 3GUGA 4HNLA 2Z25A 2V82A 5J5RA 2HRWA 3VC6A 2AAAA 1PTDA 5LZLA 1S5NA 4XAZA 1CXHA 2OEJA 1ITCA 5CKSA 4H9TA 4NASA 3O8AA 3R10A 2G3NA 3SSZA 4AX6A 3LMZA 3DHPA 4H9UA 3VKBA 3MV01 2UWFA 4IISA 3VOIA 1GQNA 4GJJA 1UIOA 2FTWA 1R87A 2HE5A 3L12A 4GBUA 4XKMA 4A8NA 4DXVA 3V0TA 2YCLA 2NLYA 5AC6A 2YCIX 3I6EA 3QW3A 4BZYA 4OTKA 1TPC1 3W37A 2ZA2A 2E4TA 2QEZA 2HE8A 3I6RA 3ONCA 1I8JA 3WK3A 4QGCA 2E6DA 2H8ZA 5ABTA 3W1QA 2FFCA 3HURA 1TJRA 5G2IA 3C3UA 5HMFA 2DGAA 4UMCA 4EP8C 2JGYA 4DBEA 3OLGA 2DIJA 3VNLA 3SB0A 1TIWA 4G1NA 4C91A 3M41A 1YIXA 1THFD 1WE5A 3KVJA 3WQ8A 1T6MA 3EPMA 4PUUA 1VFFA 4RXFA 2CLKA 5CLTA 4ZTYA 2G97A 3THCA 3NO1A 3MKVA 3QM3A 3RLVA 2QS8A 1EJRC 2ZWZA 3IUDA 1VPYA 2ZXAA 4QS5A 2YDAA 4HK6A 3TC7A 5K3VA 5DCEA 1A5AA 1K8YA 3W1NA 3DC8A 3T0DA 3LBMA 1TTJA 4YTUA 4YHGA 5IBXA 4US6A 4MB1A 3GH4A 3NSXA 1GOIA 3WNKA 2BG5A 2GJLA 1DEDA 2VR4A 4YVVA 1YNQA 5BXPA 4DVOA 1XYCA 3TN3A 3UG5A 1UKQA 3PFRA 3CQHA 4H6EA 2A0NA 3FAXA 3TYCA 4B3KA 4RZ5A 3RAOA 4IP7A 1P0EA 5E5CA 5GPRA 4UR9A 2IPFA 4JN7A 3H22A 5KZ6A 1UWQA 1XDJA 2NQZA 3MYOA 3EEGA 1JF6A 1RALA 1IEQA 4FXRA 1HO4A 1QFEA 3N2XA 4RX0A 1RXOB 1JYNA 1DHKA 2HVOA 2VC5A 4ZOAA 3GB6A 3A9BA 3GW0A 2WAGA 5C7HA 3W7EA 3A4JA 4S3DA 1UKPA 1VEPA 3QV6A 1TVNA 3TOPA 3L5LA 1ZQ5A 4FALA 1JRBA 4K8EA 1HUVA 5KSWA 2PDBA 5PTDA 2WKJA 3A24A 1XYAA 2PLMA 4I5RA 3RG6A 2PLJA 3IJ6A 4U4MA 5CZTA 1E6PA 5CBBA 2A7NA 2ANUA 5HOSA 4A2RA 2C14A 1ZALA 5EBAA 4LH8A 4AUBA 1TQXA 2FH8A 2PSNA 4C90A 2OKOA 1JCXA 4DJED 1TE6A 3QYQA 3E0WA 1ONXA 4HHHA 1Q5MA 2YYTA 4ZO6A 3QZAA 2ZZ2A 1A5LC 2Q71A 4PMNA 3O6AA 4PB4A 2GDUA 1KM1A 1ISYA 1PCKA 2GQAA 5LNWA 5H6HA 4X63A 4HYRA 1GTHA 3GXMA 1EC9A 4I90A 4QG9A 5C2GA 1TWSA 3ARUA 5A95A 2G3MA 4NY2A 2QNEA 3QR3A 4H7CA 3LX9A 4BQ4A 1XLLA 3ZZ1A 2V5CA 3BLPX 3VIOA 4N9BA 4XZIA 1LOQA 2GVJA 1C7TA 4JIIX 2G95A 1LL7A 2ZADA 2PTYA 3GXNA 2RFGA 2XH0A 4FMVA 4Z17A 3QW4B 3M0MA 2J74A 2WJDA 3NZPA 1UBPC 3N6QA 2JF6A 1PYFA 2TMDA 2XISA 4JL2A 3KAOA 1TJ0A 1KR0A 5FCZA 3S2MA 1W91A 4RNFA 5AHIA 5BRQA 3U6WA 3USZA 5K9CA 1XLHA 1W8SA 2ISSA 2VGGA 1S5TA 3UGRA 1CGUA 4ATDA 3L23A 1E3XA 2Y88A 1SFSA 1MUCA 2HEJA 1YPFA 1VR6A 4FF5A 1QCWA 4PUEA 2V2HA 2XYLA 1DJYA 4HCLA 2X42A 1S5WA 4GGBA 2DDXA 3W9ZA 3H24A 2ZE3A 6XIAA 1UD6A 4GNVA 1KCXA 3CHVA 5M17A 5TNVA 4FLOA 3LBOA 3APTA 3RJYA 1GEHA 5FF0A 4QXIA 1EHNA 3U2EA 2OWXA 5B7YA 4U33A 1TTQA 3N11A 3O0KA 4FXFA 3ZT7A 1FH7A 5JIWA 4PTMA 4QDWA 2MANA 2XVPA 1MW1A 3CIXA 3W53A 5FL1A 3W1LA 3UBPC 1B2YA 4UB9A 4H8UA 1RR2A 2BZNA 2JKAA 4NQ1A 4K2SA 2ZRVA 4HK7A 3W26A 1NELA 2NX9A 4D6GA 4Z2IA 1BF6A 1E51A 4JIHA 1CNVA 1GVYA 3URQA 4IMAA 1OINA 3GD6A 1EEPA 2OVLA 4J3SA 4QS6A 3QGVA 4N7QA 4BY3A 3BL3A 5GNZA 2YBUA 4GX8A 5CJ5A 1AFSA 4GY7A 5FEPA 4XTDA 3C0LA 1SJBA 3D0CA 4MHBA 1OT2A 3N29A 3FDKA 1H7WA 3P93A 3PNZA 1YDVA 1IYXA 4S3AA 3QSTA 1IT8A 1FP8A 5LXXA 1CWYA 2Z4GA 1UA3A 3L4TA 4MOZA 3W22A 1ZENA 1PWLA 1A3WA 4IMDA 4AMCA 1R2TA 5D9MA 3OP2A 3DGBA 4LS2A 3FJNA 1OF6A 3A3WA 3GBEA 4QTGA 1LBMA 1RPKA 2Q01A 1HJSA 2C1HA 4JHOA 3JUGA 2BASA 1PDZA 1VGAA 3LXBA 4Q6JA 2EPNA 2YDSA 2A1YA 2A2IA 2F6XA 5CPQA 3TYAA 1UR2A 3UFYA 1GYLA 3RM4A 1K4HA 8XIAA 1HP5A 5IFTA 1O4UA 4M56A 4OOUA 1GONA 3U5YA 3L4WA 3VCRA 4KEMA 1GPFA 1FDZA 2QULA 1A0CA 4RR4A 3G1FA 2ZTKA 4XSMA 2W66A 1DOSA 5AYZA 5MKGB 3TA6A 3W07A 4NKCA 4JTAA 1OZQA 4WSJA 2HCVA 4ACZA 3DHUA 3W28A 3NQFA 4M19A 1TWWA 4PTWA 3BURA 4H9YA 1BXBA 1LUCB 1IGSA 1Q6RA 4GYPC 6CGTA 4G5DA 3C8FA 3R1ZA 2ZKMX 3KOZA 3S0CA 1GOXA 4WKAA 2WMIB 1XH0A 2CBJA 1W9PA 2YL6A 1VCGA 1KGUA 4Z0JA 1BYAA 3W2KA 1P7TA 2EQDA 3W71A 1ICPA 3MPGA 5C71A 3TKFA 4E2OA 4JQ3A 2IPWA 3VZYA 3NO5A 3AIEA 1HGYA 2JQXA 4B5UA 1XLCA 1MVYA 1QNSA 1IXNA 3RRAA 2XN0A 3QQ0A 1MZRA 4V28A 2BLEA 1VBHA 1ZUAX 3UR8A 4O0KA 4JTTA 1KGWA 1S46A 3LTPA 3I7RA 1YW1A 1XFCA 3SURA 4J2PA 1W9DM 3GBDA 1NOWA 3TU9A 4D6IA 3L21A 1XIMA 2VDGA 4AZBA 4ML4A 1BXCA 3V35A 1T96A 1V4YA 3V16A 3S46A 1IXQA 3TW7A 4IG2B 1GVOA 4O10A 1TE1A 1FHVA 1E4NA 4B15A 4MZ1A 1V8EA 2X8RA 1AMYA 1BGAA 3LV5A 3GDTA 3NIYA 1B57A 2E7FA 1TV4A 2INEA 5FAGA 3DX5A 3PZIA 1GCYA 3ICJA 3RLGA 5BW6A 1F2JA 4NVTA 2RKXA 1FWSA 2FGBA 4M5PA 1J0KA 3ZR4A 1UWRA 4NILA 3K5XA 2VZTA 1NF0A 4S39A 3WQPA 1WXJA 2DSVA 1NOUA 1WUFA 2ZE0A 4D2JA 1QJWA 3AIWA 3RITA 4C6OA 2ZRUA 3FJ4A 3LERA 3JVAA 1KM5A 3BK0A 2GPTA 3AXHA 4MWAD 4NJGA 2V30A 4PEKA 3NEVA 4W86A 3OQ8A 1MI3A 3GY1A 3UJSA 2OMAA 2WMIA 3HF3A 2O9TA 1NDVA 3OIHA 2Q6ZA 1BQCA 3NOEA 3IWPA 4XKYB 4ZQPA 1ZBWA 4CD7A 1FX6A 3W87A 3GHRA 3G0UA 1YQ2A 3QRHA 3IPWA 3WDHA 1QATA 3M16A 5LIWX 1QNQA 2FKPA 2QW5A 1KBLA 2I5IA 1UA7A 1LG1A 2AL2B 2XTKA 3EX1A 4NAFB 1GQKA 4GBDA 1P48A 4H8NA 3W85A 2ATMA 4I6KA 4DF1A 4DBWA 4M6VA 3RIKA 4AH7A 3WLQA 2JEQA 4I5UA 2XM1A 2YOCA 4A35A 1T41A 1V3IA 3S1GA 1KRAC 5CBJA 1PJ9A 3B8UA 2AGKA 3A4WA 3EA1A 4WJEA 4LAMA 3D46A 2QXWA 4RE4A 1T8XA 3WNNA 3UPMA 2QCMA 3O06A 2VYOA 3BVJA 1ICQA 1FWAC 2FVKA 4UFIA 4F4RA 1LJYA 4R33A 3UYCA 1B9BA 3UWWA 2XVGA 3N9KA 4OFCA 3RLUA 3UJRA 2OYKA 1Z44A 3PG8A 1XC4A 3BJFA 3PAJA 3RPMA 2DT0A 1L6YA 1A3HA 1EWEA 2FZ8A 5T9CE 1G94A 1C8YA 1GOMA 1B0IA 3IIXA 1RUSA 2DFAA 1JDAA 2A7RA 2NWRA 3KP0A 3FJ6A 3GDBA 4D1JA 4Z2KA 1CI1A 3L68A 2ISWA 3KL3A 4XZWA 1ME8A 2ACSA 3H7UA 4L6HA 3QMRA 2ZZ4A 4H6QA 3T2PA 3MDUA 2VEPA 5D30A 4O1FA 2OB3A 1R46A 2E5DA 4LSBA 3N73A 2C0HA 3O07A 1WKYA 3H23A 1WBJA 5GJMA 2PURA 1TX0A 4ORIA 3PAOA 4ZCWA 5JU6A 4D8AA 2QPUA 1TPVA 4AZ6A 4PL1A 5D2XA 4O54A 4EWND 2J13A 3OBKA 3RK8A 1VIWA 4US5D 1L0PA 4AC7C 1E0TA 1VBGA 1XC6A 1A4LA 2E77A 1YEYA 1W1B1 3UU0A 1GQIA 3QGKC 1GJPA 3VDHA 2FHFA 1ISZA 1G5AA 5T26A 3OYZA 5AZ1A 1R6WA 4N9DA 3OZMA 4M6UA 1KM3A 1OGSA 3T07A 4LWWA 4R7JA 3CWNA 3L0KA 1V0LA 2Y70A 5D33A 1XGDA 2BY2A 3GVQA 3WBEA 4NAFA 1MEHA 2ZRZA 2VOMA 4RNHA 2DZVA 3DYMA 1VPXA 2IPGA 3J7HA 3O6CA 4B5NA 1B31A 1QWGA 3MW7A 3SN0A 1J12A 4Q4KA 4KCTA 2WLZA 4JCMA 1JI1A 1TCDA 3H4GA 1W5QA 4PCFA 1OFRA 3WQGA 4JTRA 1FHLA 4S3BA 3LGDA 3ZM8A 4UCFA 1X6UA 1RA0A 9CGTA 2J7HA 4K1GA 2PDNA 3KCLA 3TE9A 2UZ9A 3FVDA 1H7XA 4IXXA 4QG8A 3AMCA 2ODOA 3EX4A 4LYPA 3W1UA 4FB7A 4GG9A 2F2KA 4HU4A 1R9ZA 3NNTA 5J04A 1JRCA 3UGVA 3ZT6A 2WWDA 4W89A 3ZVHB 1ME7A 3PZUA 1ZAJA 4B4FA 3G24A 1PWMA 3S1VA 5KITA 1IQ8A 2VCCA 3T4CA 4O16A 4D6EA 4GQGA 5AZ0A 3SO7A 5H8UA 4JN6A 4PUWA 3LLXA 3BO9A 3W7OA 3W29A 1UKTA 3DFOA 3BQ5A 1TPEA 4JNYA 2EBNA 4ERGA 5G1TA 4G56A 4QIUA 3RJXA 3VIFA 5EFDA 1OY0A 3A5VA 2Y61A 4GVIA 2FPTA 5DX7A 1F9CA 1AQ0A 1M9HA 1JYWA 4JOMA 4RXGA 4AD5A 4S23A 4PRWA 1NWUA 2DZSA 2E6YA 1VJZA 2YL5A 1K7FA 1Z9AA 2Y85A 3BCJA 2J9YA 3W72A 4WQ6A 2NQJA 1PKNA 2PRMA 2W27A 4FEZA 4JX5A 2XH4A 4I9MA 2PBGA 1WDDA 1IZJA 5T91A 1WAWA 2QDGA 3SN1A 4DJDC 2WBGA 2YLAA 3NA8A 1KRMA 6REQB 2VX6A 1ZPTA 4KETA 1CCWB 3KZPA 2ZCGA 4PBEA 4PULA 4CU8A 3UY7A 3MKCA 2X0HA 4H9ZA 3JU2A 1WCGA 3GNDA 3VO0A 2GJNA 4PMYA 4J1OA 4U28A 3TP4A 4MVAA 3RO8A 1PZ2A 4WVXA 4LT9A 4PODA 2WKGA 2BP1A 3LXCA 1BGGA 3KRSA 5DCBA 2DUXA 4QDPA 3F2DA 4ZVJA 2WZMA 3F7JA 4NF7A 4MZYA 4QJ1A 4XAYA 4FIRA 4NU7A 2QV4A 4DPQA 1UIPA 4L4MA 3OODA 3F2BA 1FH8A 4UFMA 2Q3OA 2VGFA 3U48A 4DX3A 3SSJA 7XIMA 3KVLA 4LEFA 3W4RA 4LF2A 3B0XA 5JMUA 5I0DA 4GO8A 4Q33A 4Q8VA 5CH9A 2DW6A 1TZ9A 1T0OA 1UR8A 3TLLA 1V6WA 4A3QA 4DJFC 4REQA 3CT2A 1YADA 2ZUNA 3O7UA 3S4TA 5G1MA 4JFTA 3W2JA 1DJXA 4XG1A 3VOCA 1XF0A 4ZQRA 3FHAA 4GQRA 2VR5A 1V3KA 1ISWA 3AMDA 1YX1A 1PZ3A 4DYEA 1MW0A 3LCXA 5CJNA 4FK9A 3UR5A 4UQBA 2QCDB 3TW6A 1FCVA 4P8VA 3WLTA 1TR9A 3NZGA 2INFA 4WZHA 2HK0A 5G2HA 4D1IA 1GORA 1KFBA 3F5LA 1HGWA 1ZLPA 3RRXA 1CXLA 1SZNA 2FVLA 1XBXA 4BEUA 1OX6A 3AMKA 3N25A 5JUVA 3LZ3A 4YJ5A 3XISA 3R58A 2KZHA 3MMTA 3CAQA 1AW2A 1VAHA 2CPUA 5I09A 4ZB2A 3WNOA 1GWJA 1PCWA 1XG4A 1WKDA 2VGIA 4K6AA 3OHIA 1PXGA 4A29A 4IMCA 4GIAA 1H5VA 3DXIA 3BW4A 2XPKA 3PBVA 4XD6A 1S5VA 1UQZA 3C86A 3VD4A 1A53A 1UUOA 2JALA 1CGWA 2HNEA 1K7XA 2BY3A 3GXIA 4FNPA 2QF7A 4FI4A 1QTWA 5K9XA 3AO0A 4LCQA 4YU1A 2ZX8A 5A2AA 3GYEA 2CHOA 4Y8EA 3STFA 4W7WA 1S3TC 4BQ3A 1DVJA 4NRSA 1XGEA 1EJTC 2PD9A 1E0VA 1JZ5A 3NZQA 2HBXA 3U2ZA 1GW1A 4PTXA 5D09A 1VIZA 5FF2A 4NZ3A 1I2RA 2HS8A 4TTGA 2IQDA 1VFMA 5A6AA 1IT7A 2WHLA 1Q85A 1RCXB 2ZC8A 2GFTA 1W32A 2O9PA 2PODA 4ZE4A 1GG0A 1L8PA 1B9ZA 3HGJA 1E6QM 3H4XA 1FKXA 4A21A 5CG7A 3POHA 2IQTA 1E15A 3KOWA 1O5RA 3NG3A 5AY7A 3W7RA 1SGJA 1ISXA 4RZ6A 4ICMA 4LAZA 4Q8TA 3URAA 3QEZA 1OCQA 3SR7A 3VIKA 1X97A 1XR2A 3ARRA 1MXSA 4S2BA 4TUFA 5DLCA 3STPA 6ENLA 3WYZA 4BFAA 1H1NA 4Z08A 1CXEA 1U5JA 4C6QA 3DFNA 1VBJA 4NHVA 4AB4A 1FWFC 4DHGA 4ZSTA 4MPKA 2J47A 2FHBA 5E1QA 1J01A 3FEMA 2GGIA 3NL6A 3O3RA 3NR0A 3E02A 1NDZA 4DJEA 1FRBA 1HKIA 3B4UA 5CAKA 1DXEA 1TPFA 4A8LA 3UF9A 1EJVC 5D2YA 2D1ZA 2EHHA 3GW3A 1AZ2A 1P6CA 3ZQ9A 2P1FA 1KW1A 2ALRA 3B8TA 1H3GA 3KVMA 5HAOA 4GCAA 5JH1A 2OT1A 1UWUA 4NZ5A 4H04A 2P8CA 1QOQA 5A8QA 3CWOX 1TCMA 3M43A 1PX8A 1D9EA 1I2NA 3K2GA 3UCDA 1LRTA 4HOXA 4INFA 4WKHA 4C1LA 3MVIA 1VFUA 4J3TA 3P6LA 3KL5A 1QI4A 3BTNA 4UR8A 4ZOBA 2HWGA 5CAHA 1GGOA 4P7OA 3WH7A 2WO5A 2PDCA 4QJ4B 4B5SA 3KOXA 3JRKA 3GDMA 2PGWA 4LBRA 5A6SA 3ZJ7A 2O55A 3ZO9A 1DKWA 3BMVA 4LB4A 3URNA 3T42A 4NRRA 4PE8A 1REQA 5G1YA 3ITTA 4LV9A 4O17A 5A8OA 3OLIA 3EGJA 4FPSA 2CLIA 4L9ZA 3ARYA 3FAWA 3BC9A 1DIKA 4RCXA 1F8IA 4GI6A 2CLHA 4UQEA 1OWQA 2QCLA 2UY4A 2WPGA 3M0HA 3V7PA 3SM0A 1ECQA 1PVNA 3E96A 8RUCA 3LY0A 4TX6A 5A6JA 1DORA 5H8PA 3K1DA 1EDQA 1JFXA 1FXPA 2AL1A 2J66A 3I65A 3WIJA 1NY1A 1HKVA 5IOBA 2C0AA 3VILA 2Y4SA 1KBKA 3UCCA 4PYSA 3WLMA 2PS2A 3B97A 3I7QA 3RR1A 3QN3A 3W7QA 3N17A 2XH7A 2VJXA 4PRRA 1C29A 1EX1A 1Y8BA 3QV8A 3VX1A 1F6PA 4ILSA 1TWZA 1E9YB 1OYBA 1X6NA 4U2ZA 4UTFA 2QQ6A 3GNRA 3PWGA 4UTJA 3KRBA 3S2NA 3WQ4A 3ALFA 2QCGA 4C6BA 1CECA 3IIOA 2TYSA 3KBJA 2WZIA 3AC0A 2NVAA 1XYLA 3FX4A 3E5BA 1ZS2A 1FWBC 2PDKA 3IV8A 1W9VA 1XLEA 1LRNA 3VNKA 3T05A 1UR4A 1U30A 1QMLA 1VBRA 1FVPA 1A5SA 3CLMA 3MSYA 2FFIA 1GVIA 2P8BA 3AIUA 5IHSA 5REQA 4FAMA 3V4BA 1KRBC 1XYBA 2XUCA 3ABOA 2R6OA 1KQYA 3Q45A 1NJJA 3G3MA 1E9ZB 2BSLA 2R91A 1TJPA 1SUXA 1R3WA 4P8XA 4Q4SA 2VHLA 4HMDA 2VOTA 4DWSD 2I9EA 3LXAA 2VM8A 4C6MA 3FY1A 3TJLA 5AVNA 2V81A 2ZXBA 2GVEA 4PH6A 1Q6GA 3CH9A 4C7FA 1IZCA 1OX4B 2J9ZA 3BV4A 3M9YA 4L7ZA 4OKDA 3B0UX 4IOTA 4OIFA 2DY3A 1Q4WA 4DUXA 1JVNA 3KOYA 1BHGA 1P6WA 4NZ4A 1UMLA 3E1F1 3M07A 1UD4A 4MWAB 9XIMA 3VGDA 1VH7A 4H1ZA 1CDGA 1TZ7A 3P74A 4IIFA 3ZR5A 3P67A 3AXIA 2J75A 2FZNA 3CLWA 2G0WA 3BWWA 3NAVA 3R94A 1A5NC 8A3HA 1E5JA 1E1CB 2XJ7A 3MO4A 1MNSA 3GAKA 2JF7A 4U5KA 1ZSXA 2PE4A 1T8QA 1TPWA 1TWDA 2PFHA 1JXKA 1JJKA 2VUNA 3EDEA 4GIRA 4X61A 4B2DD 4B91A 5ABEA 4F40A 3DBPA 1MZHA 3NM1A 3MSRA 4C6DA 3CV6A 2WHJA 4JTGA 1UKSA 3S5NA 2ZUSA 3VNYA 4UZSA 3W7PA 4GZ7A 3UZ5A 1A0DA 5ABFA 3PWIA 4DAFA 1IE7C 1ZAIA 4YTSA 5I00A 1UWIA 3VAVA 3TYDA 2Z7GA 1PKMA 3I4EA 1POKA 5D8WA 4XQ6A 4CNUA 1OK6A 4JYFA 3UEQA 1A50A 3VIHA 2CLLA 1A4MA 4ZXLA 3R0UA 1P0DA 3GM8A 1HZYA 4GY0A 3EXTA 1DWIM 2CWNA 5AHMA 1W3NA 1RK5A 5FSEC 3CTLA 3G22A 3KS5A 1MRAA 1HG3A 2I56A 4MIMA 4GQ0A 4GC3A 3W75A 2VI0A 5BWFA 3VA8A 4IICA 3E49A 1RQHA 3OA5A 2CBIA 1DQXA 2DZWA 2NT0A 3GU9A 2W9MA 3DESA 2XSBA 5I79A 1X7IA 3AU6A 4LV4A 3IJ9A 1HJVA 1PV8A 3ITXA 1X8FA 3ARWA 1Q66A 2PB1A 4MKVA 1OGGA 2C8NA 3N15A 3LHZA 1XJBA 3NZ1A 1V0KA 4JQAA 3K8KA 1FWIC 3CZKA 2Y2WA 3CEPA 1M41A 4BF5A 2VZOA 1K1DA 1ONEA 3FA3A 3HA1A 1W54A 4LAUA 3EXSA 1MRQA 1TV3A 4HKPA 3AQUA 5I3KA 4O4WA 3M44A 4O15A 3DG6A 4ZFMA 4C65A 4NT0A 3NQBA 3V0UA 1E1CA 1LLZA 5LA1A 3MZNA 2A4AA 4C6PA 3ANVA 1CGXA 3TAOA 4DAIA 1AG1O 4UTKA 1WA3A 3A13A 2GLKA 3P5YA 1X8CA 3DIPA 4AISA 1MSSA 1JAEA 2ZQ0A 1NVMA 3NGFA 1JFHA 3RNDA 2V6AA 4KIEA 4YN5A 2XIMA 4WOZA 3WD0A 2CBVA 5AYIA 1EJWC 4EIVA 5HJYA 1BF2A 5B7ZA 1UJPA 3NFUA 3WQ6A 1EBHA 2Z1WA 4IHCA 5FEZA 2QMKA 5AHLA 3U0HA 3U57A 3BUVA 3IUHA 1E0XA 1W5MA 2PBOA 5A2BA 3WF3A 3T8LA 3WENA 2OQLA 1RVKA 5DMMA 3Q67A 1PKYA 2VZVA 4CEXC 4DZ5A 4GI8A 4YVPA 1Q6CA 1CGVA 3F5KA 3BCDA 3BPWA 5AHFA 3GHUA 4OV4A 4MY8A 3OBEA 3IVTA 3C5QA 5F2GA 4NAEA 4DJDA 4AHQA 1RCOB 2BVTA 2VDHA 5G5IA 3AYVA 4UTLA 3TQ0A 1XIFA 3HM7A 1KFEA 5JIPA 3T8QA 2HK1A 3A5FA 1S2AA 2RDWA 3N12A 3G1RA 3IS4A 2X30A 4MDPA 1XLKA 1JGMA 5LA0A 2PAJA 3S9ZA 2D2HA 3PTMA 3SGGA 3DBNA 3NM3A 3C61A 4PL2A 2BHUA 3UERA 1EUAA 5TD4A 1TELA 4DZHA 1OG6A 4LQ1A 2C1GA 3S9IA 1KM4A 3G8EA 2Y89A 3CUHA 3WN6A 2EPOA 1UJQA 4H7ZA 4IGMA 4RDVA 5I06A 1DJWA 1W1IE 4V33A 3R79A 3UP8A 2VO5A 1LLWA 3H7RA 1MDLA 4G8TA 4Q7NA 4CN1A 4NNCA 2EKCA 3B8DA 3U9IA 1O1HA 1ZP3A 4US5A 1FWCC 4C6IA 2PD5A 2A5HA 1WBHA 3HG2A 3T1GA 2OYLA 1XKJA 3AZRA 2HTMA 5ENLA 4EXBA 2OFJA 3HU7A 4QQ3A 5A8NA 4DBDA 1TSIA 1UWTA 5HUPA 5HMEA 3CL6A 3L4UA 1VLWA 4IIEA 3W00A 2DT1A 3DG3A 3L2IA 3MUIA 5H8MA 4C6CA 3H70A 1QPNA 4O11A 4RV8A 4S2CA 4GUFA 1J96A 2VFGA 1O12A 2XH2A 4QCEA 3W84A 3RM9A 9XIAA 3STEA 3N6JA 4I9AA 3STCA 3GDKA 4H19A 1OB0A 1IEVA 4CD8A 2BOEX 4UNIA 3HQNA 1KA9F 2Y6ZA 3RU6A 3RX4A 1WOBA 5D2VA 1GYNA 3CUXA 4HU3A 2IPJA 1FBAA 2G3JA 4ERAA 3KW3A 3UCQA 2VT0A 2WMFA 2X1RA 1AQHA 4WSHA 3MHFA 1R2RA 3FA5A 3KHJA 3C2RA 1AQFA 3P80A 1XBYA 3UWQA 1I4NA 4J27A 1EL3A 1QVBA 2DVUA 2BY0A 2WQPA 2WSPA 3MCNA 4KKXA 3PBGA 3W76A 5C0QA 3D47A 2J77A 1Q63A 7REQB 2O4MA 1Z48A 5D05A 1QU4A 1EH9A 4HTBA 1N2VA 1EPVA 2Q8XA 1IEXA 1HKJA 4DI8A 3CZ8A 4JDYA 2BGSA 2BGNE 4O52A 1D3CA 3IGXA 3TSMA 4RNJA 4DO7A 1KTBA 4RZ4A 1KFCA 5GNYA 3DENA 3H8AA 1B5TA 1XRFA 3EZ4A 2JKEA 2GJRA 4JYEA 3VFLA 2Z6IA 3RM8A 2WZHA 1WV2A 3C56A 3KXQA 4KRTA 3V36A 2ZUUA 4J5NA 1RBLA 3TSBA 3VD3A 1EPXA 3FFSA 2WCAA 3M47A 2X7WA 3FCPA 2EF9A 4HN8A 1XCFA 1ENUA 1FDYA 1V6XA 1EIXA 2IS7A 2VEKA 3CQIA 4ADSA 4W7VA 2Z24A 1E6RA 3HOJA 4QISA 3G1AA 1UD8A 3O0FA 1YRRA 3OVRA 2CESA 1ADOA 2G4FA 2WC7A 2J8GA 3EPOA 3GSMA 2QJHA 4B3ZA 1G1YA 3IJQA 5KEZA 3AHZA 1FWWA 1V6VA 2WC3A 3M0KA 4PMXA 3RDKA 2CYGA 3WLPA 3NVTA 4JX6A 2O92A 3E9AA 2BTMA 1QDSA 1TJ2A 3EWWA 1UP0A 4WOQA 1T7LA 3ARSA 3ZLFA 5EFFA 3GXPA 2Z0IA 3RGTA 4Q8NA 1H1ZA 4CCCA 3TYEA 4HOZA 2VL4A 2HXUA 1A49A 1F3WA 4YTRA 1RK6A 1S3HA 1W3LA 3IAQA 3LRMA 3S5ZA 3QGAC 4IX2A 4GXWA 3MI6A 1FWTA 4B9ZA 5MHBA 3BG5A 1J4EA 4WDUA 4PGLA 4XZLX 3WBYA 4GFIA 3OQEA 4J7RA 3IGUA 3GXFA 2ADAA 3KP1A 4A3RA 4O1BA 3BAJA 2OOFA 2Y7GA 4MADA 3EMZA 3WLHA 4B92A 5GJPA 3N6HA 3PN8A 1E70M 2QVHA 2FJKA 4NJIA 2X41A 3N18A 2Y7EA 4KEVA 4AF0B 5BXRA 1SO4A 2IKHA 3MWCA 3F2CA 5I3DA 4F66A 7REQA 5FJJA 2XZ7A 1Q6LA 1Q65A 4UTTA 1BAGA 1ZNNA 2DP3A 3D6NA 3V5FA 2VC7A 3LS9A 2O7SA 2UV8G 1W1PA 4YLWA 5H1WA 4ZO7A 2V3FA 2FDMA 3B9AA 2R1NA 4HZMA 1DXIA 3HJEA 4JTQA 3GTIA 3LGEA 3D3AA 3GR8A 3THQA 2NV2A 1XP3A 1NDWA 4LYKA 1XS2A 4PUNA 1JQVA 3L67A 1H11A 3TC3A 1EA9C 1XD1A 4N0RA 3GC4A 2Y5SA 2HV5A 1GJUA 2RUSA 4ZQMA 2I1OA 4AIUA 4J40A 2E1DA 2ZTJA 3E0IA 3CNYA 2GVYA 3IGHX 4TQTA 3O9NA 3QJAA 2FYMA 4JQ2A 1UC4A 1EO7A 1UCWA 2DEPA 4JTIA 3UG3A 4D8ZA 1PDYA 4WY0B 1IV8A 3EX2A 2CETA 5AC4A 4AZCB 5EMJA 3ZOAA 1HKWA 4Q7IA 3KS6A 3S3GA 1Y5VA 4WGHA 3VOHA 3WBAA 4JIEA 4PR4A 5LA2A 4NXKA 1AH4A 2CLMA 2D23A 1QHOA 3SW6A 3EMQA 1U83A 1CT5A 4NJKA 1ZJAA 2VEIA 1XPYA 1QXLA 1OFOA 1JNDA 3GTHA 3W1RA 4BI5A 1IF2A 1DWFM 1FH9A 4GIEA 3NQGA 1MW2A 1I9CB 3REQB 4ASTA 1U1JA 2W0UA 3CHDA 2QIIA 1ZL1A 4QSHA 2WNNA 1GZJA 4DM1A 1UASA 4A3UA 4JTSA 3EWCA 7CGTA 3C2FA 2CFFA 3F4VA 2XFWA 3WQ5A 3JZEA 3WNLA 3LK6A 4LUSB 2QJGA 3DAQA 4O0QA 1ZP4A 3FKRA 4UBPC 3AMLA 4C1KA 7A3HA 3IIZA 1XIJA 1QI3A 3AJ7A 3B8SA 1SZEA 3TXZA 5BXTA 4R88A 5A1AA 1NARA 4Z1AA 3CUFA 3S1XA 3QY8A 1VFHA 4HSNA 4E8CA 1IEWA 4HCHA 3MQTA 1Q6FA 3QMTA 5C9ZA 1A5UA 1XICA 4DY1A 3FKKA 1EXBA 1QW7A 1XL9A 3W2MA 3W25A 2X1SA 1FFRA 3AXKA 4Y9MA 3UR7A 1OFAA 2HXTA 1KFKA 3LCFA 4AW7A 4M6PA 3A64A 1XBVA 3VXGA 2H90A 4U31A 1EX5A 4ZQCA 2J6VA 3CHFA 1AD1A 4XWUA 2WVUA 3B9OA 1X1OA 1F74A 4EPEC 2QUMA 1TPDA 3CK5A 4R9XA 4RPPA 2PWEA 5LHFA 3U4FA 1G67A 2QUVA 5CPTA 1Z32X 3N2CA 4LUTB 3EOLA 1D2KA 4DUOA 3BLOA 3LSCA 2ASHA 1W1VA 3FEQA 3HMJG 1X38A 2CZFA 3V3WA 1PTAA 1TMLA 3HJZA 3I6TA 4Z2HA 1KD0A 2BX7A 3KL0A 1JF5A 3AS1A 1IEIA 2VFHA 1B4KA 5HUOA 3OGRA 4IM4A 2ACQA 4HA0A 4AEEA 3GKFA 4PZVA 4BA0A 1S2UA 2ZUWA 1ITXA 1CGYA 1QOXA 1TPH1 5AKQA 3OTRA 1R7AA 5FJUA 4AZCA 1JYVA 1NQ6A 4AYSA 4K3ZA 4MLJA 1H2JA 3MA8A 2GJXA 1EP2A 3WQEA 4L80A 3N4FA 3UW6A 4UXDA 1W5OA 1N8WA 5EGRA 4S3CA 3A9IA 1XPGA 1EDGA 3DFPA 3TNOA 4FP1A 3L66A 4WSKA 4TXEA 2OCZA 1E43A 1KFWA 4Q6XA 2PLCA 1MQRA 1MMFA 3ALGA 4UC5A 4IUGA 5A8GA 4CGTA 4UR7A 5A8MA 4HK5A 5KINA 3JS3A 4O19A 2F9RA 3WQVA 1HJQA 4LFYA 1GVEA 4B90A 2FDSA 4AYGA 4OU1A 4XBJA 3OYXA 2E1WA 4WDTA 4UIOA 4AD2A 4E3TA 5FAJA 4UQ9A 5GQBA 3WUFA 4ES4A 1O5KA 1QO2A 4GACA 2WXDM 2GK1A 5HMSA 2BHYA 2J79A 3RXZA 1OQFA 3M7WA 2OLHA 1OCBA 1R3RA 2OO6A 3EOOA 4UTWC 4QCFA 3L9CA 1JCTA 2REQA 4UMAA 2NQHA 1QASA 3U4AA 2FPYA 3QKZA 5DBUA 5C2CA 2VEGA 1JPMA 3R8RA 3S1WA 1NWSA 3UT0A 5AYBA 3LM3A 2BGQA 2ZICA 3ZR6A 4PMJA 4R9OA 1PUDA 4I3GA 4DZIA 5IM51 1TIMA 4PCNA 1IXPA 8CGTA 2BVDA 3V18A 5FESA 1RJQA 2OXNA 4NYUA 1JG9A 1J6OA 3RO6A 4EOUA 1N7KA 3GFYA 4M8UA 4PBGA 4BKNA 4CU6A 4UTMA 2WNWA 3BAKA 4O0ZA 1E6SM 3F4WA 3WQFA 3QPZA 2ISFA 3M0XA 3EAUA 4DWSA 3M46A 4F0RA 3TN6A 4GNJA 1WXYA 4OJYA 4IIHA 3FW6A 3I10A 5F2LA 1NWRA 3ARXA 1HKMA 4A3YA 1HIZA 2AMGA 1P0KA 3OW1A 2J7BA 3LRLA 2WMHA 1VFSA 5EMYA 1DQUA 2QJIA 2CHRA 1XIGA 3IANA 3PBYA 2W67A 2XIQA 4HHLA 1LROA 2Z29A 2XDFA 3IACA 4BI6A 1X1ZA 1B3VA 2VZSA 3W02A 1D8WA 3HFTA 2HMCA 3NL2A 5EMLA 3SRDA 1UZ4A 4DLMA 3W7LA 4R27A 1XHGA 2E28A 4QFUA 5HR7A 1XIHA 3WJZA 2G3FA 1FHDA 3MP5A 4C60A 4L6OA 2ZDSA 4BR1A 2J24A 5DEZA 3PZVA 5BMXA 2H6RA 3BCFA 1YDOA 3A4AA 1UW9A 4B2DA 1BRLA 3OGVA 1QO5A 1JULA 2CBUA 3C4UA 1E0WA 2ZYFA 3WH5A 4XD4A 3N2MA 4ERIA 1DL3A 3EDFA 4K1WA 3M0LA 3O2LA 3C2EA 2VX4A 4GD0A 3IJIA 1BYCA 1XIEA 2P0IA 3AWNA 4P8UA 3WH9A 2X1UA 3W88A 4HT3A 5CPMA 2WZEA 2J78A 1E6XM 4KW2A 1EP1A 3XIMA 2QCCA 4OBTA 1S39A 5FD0A 4IZGA 5CZSA 3MVTA 1LM1A 2YDQA 3G3DA 3RCYA 2YXXA 3LLFA 1JCMP 1E4MM 2I57A 3S5OA 4QSFA 3GIPA 3CXOA 1FWEC 5HWNA 4DXXA 4AFYA 1VD6A 4H9XA 2I9UA 3M5VA 3LD5A 4KEUA 2IMRA 1DE6A 2YCLB 3R43A 4C1NB 2WV8A 4K37A 1ELSA 4M7TA 2WSRA 4ALDA 4F0MA 1C8XA 3TJ4A 2ICSA 4LUYA 2G96A 3F5JA 2GUUA 4BF7A 2ZZ6A 4Y9NA 5E93A 3VIMA 4X60A 3LPFA 2C91A 1R85A 3WQDA 2VXNA 2YZRA 3NPWA 2GWGA 5LNSA 1K8XA 2PGRA 3K8MA 1VZWA 4E0CA 1E56A 1AJZA 4BCEA 3WLLA 4EF8A 1B3WA 1US2A 4ML9A 4GLEA 1JD9A 3SCPA 3HGSA 1DWAM 3W7DA 3APGA 2DQXA 4FLSA 1P1MA 2E6FA 3GIQA 3WLOA 1DTUA 4HB7A 5HNNA 3DI1A 2D2OA 1TPUA 3EKZA 3VNJA 3P0XA 4WX2A 4QE1A 3AHVA 3SGUA 4JKLA 1W9BM 1YTEA 4JFVA 3RR4A 4DZAA 5ECVA 1PB0A 2XGIA 1OD0A 4UOZA 1GKQA 1OYCA 5FKYA 3BSHA 2ZZ3A 1I0BA 3OG3A 3CIVA 1GW9A 5BWAA 1KRCC 2QF8A 4GKLA 2B4GA 1XGZA 4S3KA 2PCEA 2WM0A 1ZGDA 4AWEA 1Q6QA 3PSVA 4DELA 3GTFA 5I7GA 3HV9A 4CU7A 3V75A 5CSSA 4IJBA 4J4KA 2XWEA 4WKFA 4HPJA 2J27A 3W1TA 2D2JA 3WDIA 4UMBA 2QIWA 3NCOA 3NXFA 3WJSA 4QNEA 4MJMA 4GUJA 1RY8A 3HPAA 3GRIA 1BVNP 1H0IA 1FWDC 3BW3A 5A69A 2VX7A 1RPXA 4D6FA 4GUGA 5HQEA 5BROA 1EF2A 1NEYA 3C2YA 1NH6A 4IXHA 1DWGM 2WZTA 2ACUA 2YKKA 5CCZA 1QNOA 3OZOA 3CS2A 2F6KA 1MFVA 3VD9A 4G7FA 2NXIA 4C1NA 1TV2A 3PK7A 5HULA 4PMVA 3G0SA 3WLKX 2E67A 1A5OC 2OWWA 3FN9A 1F73A 4IMGA 2A21A 4XAPA 2X0YA 3FYOA 2C79A 3LMYA 4WK9A 4AHPA 3K46A 2P3EA 1ZFJA 3OVGA 2C16A 1RP8A 5XIMA 1UBSA 3GAYA 3V5OA 3IRDA 1SVDA 1W9XA 4F0SA 3KCJA 3GUWA 5FIPA 2PWGA 2XVKA 3ARTA 1M53A 3CWHA 1W0MA 4NI8A 4A3HA 3N14A 1ADSA 2NX1A 2QT3A 1WX0A 1EGVA 3TZNA 2GQ8A 4QRNA 3PANA 5HBFA 4HNUA 2HBVA 4P7NA 2EPLX 1EUNA 3GNPA 4L1XA 5JXQA 1KNWA 1NOFA 4TX8A 2DPEA 3MMWA 4IP5A 5LIYX 4JTKA 5C9XA 4PTNA 3CQ0A 4IX0A 4P7RA 1NF7A 4KS0A 4QLLA 4YYFA 5I2UA 1LG2A 3SCTA 2V5DA 2AGTA 4Z1CA 3UVAA 3PVFA 4QHRA 3R7MA 3R89A 3SIZA 4S3FA 3AXMA 7ODCA 3SQLA 2QVNA 2VKZG 4O4VA 4JEJA 3K13A 3TZFA 2XFFA 1GPWA 3SZ8A 3ZT5A 1SMAA 4JDBA 1L6WA 1E6ZA 1HVQA 3EX3A 4OT7A 1JDFA 2F8QA 4YYCA 1JZ3A 2XFYA 1HO1A 2RAGA 1B3YA 4ZL1A 3RYSA 5E9XA 3TYBA 5M1TA 2E3ZA 1PIFA 2G41A 2GSJA 5LXEA 3PTKA 3WFAA 3IVSA 5B80A 4LVAA 3NJ3A 4EX4A 2RDTA 2VFDA 3KRZA 3I3EA 3MUAA 3B8IA 3H2EA 3FNDA 3P84A 3FXYA 2QDEA 3HZ3A 3DH7A 4FHAA 3UVIA 4JTHA 1KCZA 4IIDA 3INPA 1WZAA 4LU0A 3VNDA 1K77A 4H8VA 4ACYA 1KC7A 3EWUA 3PR2A 1JCYA 3W81A 2P3ZA 5LSMA 3LCIA 3DUGA 1I2OA 1BQGA 4K36A 5F4WA 4XD3A 5D9PA 4JAWA 2V3DA 2BOGX 2G8ZA 1LQ0A 3URBA 2I5QA 1EZ2A 2V2DA 5TBOA 1KLZA 1XLAA 4EACA 4ZA0A 1EJUC 2FPVA 1UUQA 3O63A 3SRFA 4PMOA 2FZMA 1G69A 1BYBA 1W1A1 4L1GA 1EA0A 4Q4OA 3SUUA 1OX5A 4NSBA 4J9JA 5K2ZA 5HNRA 3LCHA 1Q13A 1OFPA 1SW7A 3M0IA 4HJWA 3UZJA 2ZX6A 3W7IA 1K9TA 3PUOA 1KFJA 5I3FA 2OEKA 2PZNA 2OODA 4ZOEA 3VKCA 2PWUA 2C71A 5KZMA 4PUKA 1J2BA 1JEZA 3PB0A 1UWAA 1QR7A 1H50A 4UQDA 3KLLA 4C6KA 1HQTA 4CNNA 1R3TA 4HD5A 3SJNA 4BF9A 2ZXDA 3MO7A 1Q2SA 3TDFA 1E0UA 4ZZ9A 1U1HA 2PDGA 2V5JA 1FWRA 1WKFA 2VURA 1TVPA 1Z8AA 4PB3A 4H3DA 2PEVA 1C93A 1QPOA 3P8JA 7PTDA 3UJEA 5HNTA 5LIUX 4LY8A 3W7NA 1FXQA 3GH5A 3S5YA 2Y1HA 3VDGA 1EO5A 1AH0A 5C8BB 2A3EA 1G7VA 5HPCA 4E2BA 3B3DA 4CQAA 2POTA 1UH3A 1G4TA 4BK9A 3TK7A 1I1WA 1H60A 4LS1A 3KX6A 3B06A 4C6JA 1XLBA 4ACZB 3TV8A 3MHUA 4O28A 4X9YA 5K4ZA 3GC5A 1OC6A 1YDNA 3L4YA 2FH6A 3VM5A 5JQ9A 3WELA 3DEQA 2E9MA 1RHCA 3UR2A 3Q37A 3T7VA 3MTWA 1I45A 4UNLA 3L5MA 1K03A 3TQKA 2TAAA 3LN3A 5D02A 4KPLA 4MF4A 3APYA 1BWLA 3PPGA 3C6CA 4KGLA 3V1PA 5K9DA 3M64A 3QF0A 3SCSA 3TSDA 1P7TB 4L4OA 4K39A 1H51A 4BEQA 2J7EA 1XLDA 4OWGA 2BVWA 3AJXA 1PYMA 3KCOA 2HZGA 3TTOA 4LX4A 2R9RA 2VVNA 3BG9A 1AQMA 2D0GA 3T0AA 4FR6A 4Z2LA 4I5XA 3EOSA 4C6EA 3A12A 4DNHA 1PS9A 2YA0A 1LRQA 1VHCA 1OVDA 3D5HA 1PEZA 5XIAA 1QRQA 1TTIA 1VYSX 1QHPA 1RD6A 3USBA 4F0KA 1IIHA 1Z3NA 1SSDA 5G4HC 1B30A 1G0CA 1YXDA 1UD3A 1SU5A 4Y9OA 1TQJA 3SY5A 1MQQA 4AD3A 2E68A 3W82A 4QLJA 2D0FA 1TUFA 4B5WA 2BXYA 3R8HA 2FMNA 4BQ5A 4FO4A 5CZJA 4G7EB 4LUJA 3RMEA 4D72A 3H2MA 3S6TA 2ZX7A 2DVTA 3TC6A 5IBXC 5KMYA 2NQ9A 1H7NA 1Z69A 1MXGA 4E2DA 4ECLA 4DQWA 1U2YA 4W7UA 4MFEA 1B3XA 3QLDA 4IL2A 3P2VA 1CXFA 4FXSA 1W3TA 2VC9A 2NW0A 2NUWA 1AA1B 3WX7A 3LHVA 5CPLA 3TTYA 4V27A 1GHSA 3KM8A 3O6YX 1BG4A 5AC8A 5HWJA 5RUBA 3PJTA 2NZLA 4PC8A 4JR5A 2XZ9A 3LA4A 3MY9A 3ZJ6A 1JZ8A 5C7VA 3ZJKA 1YLVA 4WDXA 4IL0A 1J0HA 4B4HA 1YBQA 3F4DA 2DIEA 3U2CA 4MB5A 3N9SA 4Y6GA 4I9JA 4QEHA 2HDJA 4P7QA 3SFWA 4WJXA 2OQHA 4EKJA 1SO5A 1XKYA 4L4PA 3PM6A 3BMXA 1MNZA 2QMJA 4X22A 6TAAA 4A6GA 2NV1A 2ZA3A 1XIIA 2D20A 4C5ZA 1EJXC 2QYGA 3NUKA 5LIKX 3U7BA 2V8ZA 4GY1A 3GG0A 1OADA 4PN2A 1TTPA 3QBUA 2OX1A 3WLNA 3AIVA 3TMQA 2WSKA 3W1XA 2O9OA 4ZENA 4DB7A 3GR7A 4Q4RA 4HYVA 2IUZA 3GTNA 3QZ6A 4CUCA 1LT8A 3M4HA 3DC0A 1BPLB 3GE7A 3LDVA 5FA5A 2Y24A 2BODX 3KBVA 3UZYA 1WOAA 2VFIA 3YPIA 2Z1XA 4UFHA 2CNCA 3UWEA 3KBSA 1TG7A 1UYQA 1K8CA 4CVUA 4NYYA 1OT1A 5DMNA 2YPIA 1M7OA 1SFJA 1FOBA 1F8MA 5I78A 5DMYA 4CD6A 2X1IA 3EKLA 2NXGA 2E8YA 1QI0A 3A3HA 3A4XA 3Q94A 5HMDA 4ZO9A 2ZRXA 3ATZA 2B81A 3MI2A 4G7EA 1H61A 1TA3A 2EO7A 3NL3A 3IARA 3PUGA 1RD5A 3W23A 2ZZ5A 2ZVRA 1DWJM 3G77A 3TFCA 4AY1A 1ODZA 3UWYA 3NQCA 1GOQA 2QJMA 5C9WA 1U5HA 5BU6A 4DF2A 3AALA 4HGXA 4RLIA 4H9MA 1OC5A 2R1MA 4H2HA 1WNOA 1L6GA 3ZLGA 4Z1BA 2B31A 2Z2AA 1W8GA 3W70A 1HJXA 2VD9A 1J8VA 4K38A 2Z1SA 2IXUA 5DO8A 1ZCOA 4LEQA 4LRTA 3UETA 4LXFA 4R85A 3TN4A 3K30A 3NZRA 1C92A 1I2PA 1AJ2A 1AMKA 3CQJA 1HP4A 3MCOA 2VRQA 2VENA 2XGZA 2QR6A 3ZFHA 3I7SA 4GYJA 3H12A 3C0QA 5EL1A 2QAPA 3LGGA 1E9LA 1V02A 3UD6A 2OTDA 2QJNA 3AMGA 4PTVA 3UPWA 5I5RA 3IGSA 1IR1A 3BLIA 3N3TA 2GUBA 4O1CA 1JGIA 1NDYA 2BBFA 1M03A 2PDHA 2PDXA 4J3VA 5BNKA 5LHEA 3NQAA 4QE5A 2OLAA 1NWTA 3E6EA 4KCUA 4LYQA 2FQIA 1GKPA 1SMDA 3AUJA 4IIBA 5H91A 3P5ZA 4LVDA 3FLUA 1VENA 4P2VA 3VVGA 3BJTA 2QCHA 2VD8A 2WM1A 2OLSA 1RBOB 5LNVA 3BSGA 1R3SA 1JI2A 3GG8A 3DFQA 1RY0A 2AQVA 1DQWA 1J5SA 4ZB0A 4WUIA 2WNQA 3T40A 1FY6A 1GKRA 2P0OA 3L0NA 1XINA 3LU2A 1KFLA 2ZZ7A 3FXGA 2R1LA 3H2OA 5HK4A 2FB3A 3R5EA 1US0A 2VP8A 2QLYA 4S38A 3DZ1A 1ZRQA 2QHAA 1GVFA 2YFOA 2PTDA 3PZTA 4Y96A 2F38A 1YNPA 1C91A 4NUWA 2EPHA 1HL2A 2QCEA 1GOOA 3G6LA 5H2ZA 2ZBTA 2HISA 3VIIA 1V3JA 5DFAA 1VFLA 4GZJA 3GH7A 5D04C 3N2BA 4FOJA 4GXPA 1UR3M 4DJDD 1SJDA 4XISA 3QYSA 5DRCA 1SPQA 1Z42A 3ATYA 4KF1A 3MDWA 1K3UA 3NQ7A 3CGTA 4N2YA 3CAWA 3ARPA 2D22A 3PWAA 3LCWA 3TJXA 1GYMA 2O0TA 1XUZA 2OGYA 3PBWA 4RE2A 4UOJA 3ELFA 5A6LA 2WYSA 3A22A 1IIGA 3KOFA 4YS1A 2C19A 3MBDA 3ZWTA 1P5BA 1EIBA 3IJ8A 4KCWA 5A6KA 1HT6A 3EWDA 2TODA 3PPCA 4QE4A 2TSYA 4LVFA 5DBTA 2EG8A 3SCNA 4K8HA 1NQKA 3VE9A 1X6LA 1B1YA 1V3LA 2XN2A 4GNKB 4HHMA 2WCGA 2YDRA 2J4GA 3VDAA 2GVLA 2V38A 5CEWA 4KERA 3MHGA 4DJFD 4RZBA 2OEMA 1UP3A 4I7WA 1ALDA 2GDVA 4M0XA 2CITA 1M7XA 1R0MA 4XUGA 2FJUB 1MUWA 3PJXA 1W5PA 4IQLA 1E55A 1AL7A 4WF7A 3DKJA 4G6CA 4LBUA 4R3UA 1F6KA 4XBKA 3IJDA 3OB8A 3QFEA 4NJHA 2JE8A 1WXZA 1VEOA 2ZX5A 2NWSA 1H7OA 1UHVA 2VQUA 3G18A 2GWNA 2IQ0A 2UY3A 1KV8A 2MNRA 3DYOA 1V08A 3G6MA 5M3WA 1VRDA 1M1BA 4C7GA 4O18A 4Q7BA 5G4WA 5EB8A 3BOFA 2B7QA 3VNMA 1UP2A 3E0LA 3VYLA 1UZ1A 3QV9A 1R9YA 3WJWA 3ABSA 1TVLA 2Q02A 4REQB 5C54A 5D9NA 2XHYA 6ALDA 1B4EA 2DORA 1BYDA 3HG4A 2NLIA 4A05A 1J2WA 5HANA 2WNZA 4AWSA 5CJMA 3O1NA 3CJPA 3PSWA 3CHCA 3AICA 3QHMA 1EQPA 2OSYA 1J0ZA 2V5BA 3LHWA 4F9JA 2DUZA 1W3JA 2CXGA 1KLYA 4K7YA 4M51A 1Q8AA 1UH4A 1XSJA 1TJ1A 5DMLA 3ZXWA 5A6TC 4IQJA 3KZSA 4P61A 3DG7A 3VIGA 1TRDA 5I3GA 4A2SA 4O1DA 2Z1VA 1OFBA 2J9XA 1GEQA 4TV6A 3BGJA 1OG0A 4LC8A 2ZC1A 4AZGA 1SYTA 2ZUTA 4W5UA 1EF3A 1GUVA 3FIGA 3VGGA 2ZDRA 1E9IA 1GVSA 3II1A 3MJYA 1PZ0A 4TIMA 1ECEA 1QBAA 4TVDA 5M03A 1QWKA 3MMUA 3SEPA 3VD7A 4WR3A 1RLCL 3QTPA 4X9SA 1EEXA 2H9AA 1TREA 4WRHA 1MWOA 3MWAA 4MFDA 4OQVA 1V02E 4AXNA 3NO3A 4E8DA 4R7WA 2O9RA 4GFSA 3V5CA 3QTGA 4AWTA 3WD3A 1EQCA 5CZ0A 3KBWA 1QPQA 4H41A 2CZEA 3BJSA 4CQ9A 5JVLA 3ANYA 1QNRA 1D8CA 4H83A 3WDRA 2D69A 4ATLA 3UY8A 2YA1A 5CC6A 5E6ZA 1LLOA 2E40A 3SCRA 1H62A 4FIQA 4KCVA 4J3ZA 1RJPA 4AZ7A 1NSJA 4ZQNA 4FX6M 4KQNA 1WZKA 4XIMA 5I07A 1CPUA 1N55A 3FK4A 2A79A 4J2MA 3AS3A 3AIRA 4H9VA 1RBAA 1C7SA 4FNTA 4MM1A 3OHMB 3B9NA 1EHAA 5FF3A 1ZU8A 3WSUA 4EXQA 2WB5A 5D2WA 2DIKA 3KWSA 3W27A 1O1ZA 2G5WA 4GABA 4KRZA 1F4AA 4ZTXA 1F5ZA 2V2CA 3CV7A 1ICSA 3ITCA 3L2LA 2YR1A 4AHOA 2X1TA 3G1VA 4N4QA 5HXMA 3VOJA 4DUWA 3BE7A 2FLIA 3R0KA 4RNIA 1VKFA 4GUHA 4YCPA 3N19B 2GGHA 5KZDA 4UOQA 4HZ8A 4AVNA 1CLKA 4WCJA 4ZE5A 1P0NA 1LL6A 4IPJA 3WMLA 4YNGA 2WJFA 3ANUA 2GUYA 1K7EA 6PTDA 2JK2A 2NUXA 3OLDA 3W73A 2YB1A 3F1QA 3NDOA 5ABHA 2Q8LA 4E3VA 5D37A 1HJUA 4GOAA 1V03A 3WFZA 1REQB 1WQ5A 3WCZA 5I6SA 3NDZA 4EANA 1LQAA 3HBLA 3NPVA 4FNUA 4DYKA 1KB3A 4BJHA 5F2IA 4LY4A 3SUVA 2DZPA 3BLKA 4E2VA 5IDIA 3WK0A 3T0TA 4MAVA 3OJGA 3C3NA 1QK2A 5HJLA 5G4EA 1N82A 1C8QA 3CMJA 1OM0A 3VC5A 3ITLA 3NWRA 2PP0A 7TIMA 1P4CA 1XIBA 2X05A 3HG3A 2DZAA 2EG7A 4GINA 2DUAA 2ACRA 2XG9A 3T2OA 2EG6A 5CGMA 2WW5A 4GZEA 4AVOA 2PDIA 3NQDA 3A6OA 3UESA 3SN4A 4FNQA 1ONWA 3NL5A 3D3FA 4LBSA 3LM7A 4DLFA 4KIRA 2WBKA 4UTUA 2WJEA 2EXOA 5HPOA 3QXBA 3S42A 3RPTA 4MNKA 3LEPA 4N6EA 3BSMA 1A5BA 4FA3A 1L2QA 4KT2A 3MI3A 1OF8A 2CZDA 1O6IA 3RCMA 2RDXA 2J25A 4AD1A 3GFZA 1M3UA 1Q7ZA 4TV5A 3ARZA 7TAAA 4POCA 2EJ1A 3TA9A 2J7GA 1LTDA 3S2CA 3W83A 1GG1A 3EA2A 1RLDA 4AXKA 4QAIA 1RVGA 5E6YA 4ZXOA 2OT0A 1FUYA 3LG3A 3NYZA 3E2VA 1LWJA 4E4UA 4YL2A 1E71M 3L0GA 4OECA 2XIJA 2PPGA 4MZ8A 3B8WA 4JKMA 4PTDA 2P5NA 3TVAA 1VFOA 3GVRA 5JBFA 2F2HA 5HATA 3MT1A 1KKOA 1OFDA 4GYPA 5HNUA 5REQB 4ZMGA 4IPIA 3KDNA 4LNYA 1OBAA 5J5DA 3I4KA 1I6NA 3L5AA 1G4SA 4GJ1A 4ADTA 1Q6DA 2NQ5A 4H8HA 1DV7A 2BXZA 3K8LA 3W86A 1F6YA 4PUDA 1YKWA 3PZGA 1OABA 3CUIA 3TAKA 2O56A 4HNOA 3TCEA 4QDMA 4MYAA 3ONBA 1HFBA 2YSWA 3VDCA 2OWCA 3CQKA 3LSBA 3LHTA 1W3IA 3TOYA 1B54A 2R24A 4ROQA 3ORWA 1F76A 2AQWA 4PA8A 3K1GA 1YPXA 2DJXA 2GQ3A 4GYKA 2GGGA 1J5TA 2XN1A 2RJGA 3VGHA 4QROA 4Q8OA 3WJYA 2YL9A 1KM2A 3B04A 1ZBKA 3PULA 4ZR8A 3W01A 3TQPA 3GIYA 4JCLA 1UOZA 5KZEA 4QG6A 3LPGA 2DW7A 2ZUVA 4F2TA 3QSRA 1KXQA 4A8IA 1JYXA 1EZWA 1H49A 2WVVB 3QQ1A 3VTRA 1OFEA 1EP3A 3T4WA 1L2UA 4QM1A 1JNEA 4MNMA 2VELA 5DXXA 1K6AA 4B9YA 1CLXA 4PUJA 3M6YA 1FCQA 3WF4A 3CPRA 5DF0A 4N42A 1E3ZA 1YMYA 6TIMA 4LRSA 1VPQA 3HPFA 3OG2A 4RDYA 5I3HA 5CQ1A 1RSCA 3ITGA 3CL7A 2A3CA 3CM4A 3NOYA 1XYZA 2PRHA 5ABFB 2BXVA 3WZ0E 1LP6A 3SECA 4TU1A 3PS7A 3WL1A 3UZZA 3TLQA 3UZWA 3TYUA 3T0BA 4A8RA 1PTGA 3SUTA 1E40A 2YCJA 5U7SA 4CQDA 2RGMA 3QVQA 3NSNA 4JICA 3W74A 2QDHA 3CV2A 4IGSA 3CAKA 3KVKA 1YXYA 3CMFA 3PTQA 3M0JA 1E1EA 2AOSA 2IKJA 4Z1YA 3AIQA 4JTCA 1BVZA 4Q8MA 1V6TA 5AECA 1CXKA 4JFSA 3BZJA 5CG0A 1SR9A 1HL9A 3HFYA 2QV5A 2AQOA 4F8XA 1LYXA 5BXSA 4L65A 1K9FA 5CBIA 1UZDA 3SY8A 4GISA 2V3GA 1QBBA 3C2VA 3SY1A 1JZ2A 1UD2A 2ZX9A 1VF8A 2EEXA 2VGBA 3AFBA 1P6BA 3QQWA 4JTFA 3MUCA 3VNZA 5FEWA 2YX0A 3E74A 4ATWA 4GZIA 3GWQA 4FOUA 3VKKA 1XISA 1VC4A 3VX0A 1TR1A 3QZEA 1XH1A 2WMJA 1PIGA 2EPKX 1DIOA 4AU0A 3AHYA 3KBMA 1SZRA 3WEZA 4DUVA 4Q8PA 3QV7A 4FR1A 3TROA 2WSQA 4NL1A 5BCAA 1ADDA 1A5CA 2PDQA 2WVVA 2WQDA 1BFNA 2PA6A 5BOFA 3TONA 1QI5A 2PF8A 3WMCA 2XIIA 5C6MA 4L6DA 4IJCA 4IH3A 4ZSUA 4GH1A 3QPEA 1POJA 1QK0A 3VMPA 3W1PA 4GVHA 3AI0A 1UOKA 3BICA 3G1SA 3QY7A 1CLVA 4DJEC 1ZAHA 4E6MA 4EXAA 2Z00A 4OOZA 1UB3A 4M6QA 4H00A 3W6LA 3IUIA 4HMEA 2F84A 3WUGA 1OCJA 4I7UA 5CC3A 4LCRA 3OZYA 2PRLA 3LENA 5FEXA 3STGA 4TTUA 5DT5A 4MY9A 3UJ2A 1YDYA 1WAUA 4Y90A 5F1VA 3CEUA 3NURA 3VZZA 3S6OA 3CB8A 1XI3A 4X2PA 1CYGA 4LALA 3AS2A 1Z7AA 1WZMA 2Y63A 3TTQA 3WMSA 4IFRA 2V67A 2HQAA 1J93A 3OVQA 4KRUA 1W6TA 3HMCA 2VWSA 1AW1A 4LTSA 2VEMA 1PAMA 1RH9A 2WVSA 2X16A 4GHRA 1GJWA 5IXEA 3LZ5A 4J3XA 3FHQA 5BMWA 1M04A 3MJMA 4NAEB 4XBSA 1VRXA 4IUOA 4YXGA 1UR0A 3WMBA 4GVGA 3CASA 2DZTA 4PMQA 3FDGA 4MUPA 2RJHA 1O7AA 4KFOA 3ZWSA 3W24A 1U1UA 8TIMA 1AUSL 1OEPA 4ENLA 1V77A 4ADUA 3ENLA 4PFHA 4XVDA 3H55A 4LGXA 4M82A 5AVHA 5T8GA 5DRIA 4PB5A 2I5GA 2FZBA 3G1YA 1TYGA 4ZFCA 3POCA 3UG4A 3CYVA 1E6NA 4WHBA 3GO2A 4EWJA 4JXCA 3S83A 2XGBA 1NP0A 4LANA 2H3DA 1KQZA 3HGOA 3IIVA 4LB3A 4I9TA 4W8LA 1RQEA 1OC7A 4PMZA 2WHKA 3RCNA 3N4EA 3E5PA 1GQJA 3AXXA 1TWIA 3CPGA 5A5WA 4G2DA 4XUYA 2A3BA 4K8GA 2J7FA 3A47A 1OGBA 1UPPA 5TAOA 2BHZA 1M7JA 5I3IA 1KXHA 1VCVA 3VKDA 4PRTA 3T2QA 3TN5A 4WXYA 1XV8A 1VJSA 4MPQA 5ECUA 4Q8WA 3MBFA 1KCKA 3VE7A 4MDOA 2JIWA 2W61A 3I68A 2XU2A 5FL0A 5AN7A 5MKGA 1M5WA 4TMCA 4C7DA 4GJIA 3ZLHA 1IWBA 3P62A 3MUZ1 4HNNA 3UYIA 1H41A 1QW9A 3GVGA 4OE7A 4IJRA 4YPJA 3MYPA 1LUCA 4JYDA 1B3ZA 1IGWA 3A21A 3KTXA 2JIEA 3W2UA 1S2VA 1XQLA 2YBVA 2J8FA 2X40A 4DWDA 3PPHA 4YWSA 1XYMA 4RUBA 3SRHA 5KTLA 2L5HA 1UG6A 3PTDA 4NZFA 4WIWA 3DGRA 1PHQA 3IK2A 3CU2A 2VZUA 3BOLA 4CN6A 4GKTA 1R47A 4DNMA 2CXEA 1F07A 4MGGA 2BVYA 2DJLA 1VHNA 4W84A 5CLWA 4M29A 3UNTA 1X7FA 4CD5A 1YNYA 5C2XA 2A7PA 3TIMA 4MKSA 4DO4A 1MO0A 3MU7A 2DU2A 5HJXA 4CLMA 3R25A 3W6YA 3L65A 4RL3A 4XD5A 3K4AA 2YFNA 1E4LA 4OVXA 4LOCA 3Q58A 2YA2A 2E0PA 1L8NA 3ECQA 5EMKA 2CEQA 5CSRA 3T55A 3SCWA 3CO8A 4N9EA 3FSTA 2JEPA 1G4PA 3LI0A 5CZKA 2YIHA 3AISA 3R6IA 3S2LA 4CKQA 4DO5A 1ZJHA 4IG2A 2NX3A 3SUWA 2D0HA 4BWLC 3UXDA 4S1FA 9RUBA 3ABXA 3WQCA 3GX9A 4DJFA 3ME3A 1EYEA 4J28A 3E2SA 4QR6A 1DBTA 3O6DA 2VMFA 3PBMA 1PKLA 4AWUA 4UWMA 5D4YA 3LRKA 2BNJA 1I60A 1O5QA 3C0SA 1JCNA 4AG0A 5BZAA 1VS1A 1XLIA 4CQ8A 3H53A 2VQTA 5KETA 2B7NA 4YCOA 4WGXA 1JPIA 1NM9A 2WWCA 2YL8A 1VB9A 2DSUA 1ITQA 4AIOA 3KE0A 3GC2A 3W7JA 2DH3A 1FHUA 2CKRA 4HU8A 4IQEA 4CN4A 4W87A 3EOEA 4N02A 1C9WA 5AYXA 3BGGA 4AZIA 4TX9A 1TMQA 1V7AA 1YE4A 2HVMA 4U5IA 1JZ4A 4NI3A 2CERA 2CWXA 1GVRA 1KM0A 1TKKA 3ES7A 2QZRA 3DCPA 4KWVA 5GNXA 4YIWA 4BS0A 5FJPA 1MDRA 3VPLA 3WLIA 1UKOA 2YJQA 4XKYA 2PDLA 1MEWA 3FS2A 3U7VA 1QNVA 3LNMA 2QPSA 1OCNA 1MUMA 4QNWA 2OOGA 3JW7A 2QGHA 3B03A 3LBCA 2AL2A 4GK8A 4PUMA 2PGFA 3Q65A 5DT7A 5HWMA 1T40A 3IK4A 4Q4QA 2C3ZA 3VKAA 1VYRA 2J88A 4B5VA 4L9YA 1BTCA 3V1HA 4JN8A 5FOOA 4GMEA 4CEUC 2NVDA 3M5ZA 2QDDA 3MP3A 4XZ9A 2F6UA 4LUIA 1U33A 2XWDA 3M1ZA 1DJIA 4MWAC 2BS9A 3H26A 4OV9A 2QUNA 3PZMA 3E2RA 3T44A 5I3JA 4DPPA 3LCGA 3PZOA 2CKSA 4QX4A 3TFXA 5K7JA 1Y5WA 1E72M 3H4WA 3P82A 1L9WA 2AAMA 4IGNA 2W4XA 2AKZA 2E5CA 3BXWA 3PZ9A 3UQNA 1EB3A 2UY5A 4PMUA 1RZMA 3U5UA 1N8FA 2DZUA 3WH6A 1B3OA 2J8TA 4MB3A 3E38A 3Q2DA 1SQ7A 2BY1A 2VTFA 3EDKA 4OGZA 5I23A 3QC0A 3DHDA 1AW5A 5FJOA 2DSWA 2ZVIA 2YYUA 3P14A 1ZCCA 3CZLA 3L4ZA 4D6JA 3KRUA 3H2CA 3VGBA 4XB3A 1O5XA 2JKPA 4GA8A 3F4NA 3TUUA 3CZEA 2WC4A 3PP7A 2CIPA 3L4VA 1EYWA 3GHTA 3OO2A 4JL1A 3N04A 4PEEA 2PTWA 2ZZ1A 1KTCA 4B16A 4JBRA 2Y7FA 3DECA 4IFKB 5DQPA 1GZ1A 4G1KA 4JKKA 5M2FX 3KWXA 2INZA 3O15A 2DSKA 3F4CA 1TO3A 3HO8A 4HA1A 2VX5A 3W7CA 1EBGA 4NZCA 4JEQA 4KFNA 4OZOA 2NSXA 2DQWA 3KUMA 4FLRA 3TR2A 2HJPA 1PO9A 1EGMA 4N9CA 2CZ5A 3S2JA 1K02A 4N6FA 1V7YA 3AS0A 4NG3A 3AHXA 1FCBA 2ATSA 3MSDA 4F2UA 4LCSA 2YXGA 2WLYA 3SQMA 3CUJA 2HNHA 1Q7QA 1IR2A 3ARVA 5LGZA 1O68A 4QITA 2AKMA 2DT3A 1DIDA 2I14A 4KWOA 3C52A 5IRPA 2XFRA 2EJAA 5D8ZA 4UTIA 1KV5A 1S5MA 1XRSA 2V9DA 1SO6A 5I03A 1H63A 1V79A 3DU0A 3H7VA 3AUOA 1XFBA 2VFFA 4HIBA 1CB7B 4DIAA 4MMWA 3AAMA 2MUCA 4PSPA 4WY0F 3WG6A 2PWHA 4L56A 3BLLA 4R7OA 4R34A 4NZJA 4RW3A 4JQ1A 2V5LA 4GUIA 4HNVA 5EPDA 5HR6A 4B3LA 4XZNX 2A6LA 1QHZA 1OJXA 4PCSA 4TO8A 1H7PA 1PBGA 2B7OA 2XSAA 3M5YA 4Z2JA 4F79A 3XINA 3AZSA 4GGHA 2V69A 3ZVHA 2DVXA 3LUTA 1IZKA 2IKGA 3F03K 3CZJA 3WF0A 3VFCA 1F05A 4AZHA 4MJ4A 1FWJC 2PU0A 2XSXA 1SZFA 5HQLA 4M24A 1DHPA 3G2GA 3WLRA 4JHMA 1J11A 3UG8A 3R4IA 4MUZA 4X0NA 3HQPA 2NQLA 3EB2A 4XZMX 1B90A 1K8ZA 2GJXB 3M0ZA 3L4XA 4FSAA 3PUDA 2X0SA 2A3AA 2QUTA 3NGJA 1FQ0A 5DELA 3P60A 5TF0A 4NNAA 3BW2A 2E09A 1Z89A 1DP0A 4Z2GA 3WH8A 3WK1A 4IFKA 1ESWA 4JNZA 1ONRA 1K9DA 4JIQA 4OBRA 3B05A 4JHZA 3IRSA 1F3EA 2UBPC 3NXLA 4K7VA 3GNXA 1NIUA 4Q3MA 4MJZA 2VEFA 4AEOA 4KESA 1XRTA 1OZMA 3WF2A 4DO6A 3ABQA 2GVGA 4P8WA 3VUSA 5CPOA 4Q22A 5LKYA 3B9DA 2HSAA 2PP3A 4ZBCA 1WYIA 2W3ZA 2V63A 6REQA 4HJFA 1BSIA 5E0KA 3GKAA 3CC1A 1TRIA 2GK1B 2OELA 4QBXA 2XM2A 3SDOA 3SRKA 1Y7VA 3WK2A 4YWIA 8XIMA 2TPSA 3NSMA 3CUGA 3DHFA 3DDMA 1EC8A 4X0VA 4W9TA 4H6KA 2REQB 2GL5A 2A85A 3OEXA 1Q2RA 3WFLA 4WLCA 1I0DA 2KAUC 1G6CA 5CSYA 5AOUA 2POZA 5I02A 3LPOA 3EOUA 4ZB5A 1HTIA 4B5TA 1XUUA 3C8NA 3HPXA 1QUMA 4KMQA 1JCJA 5IHRA 1WDSA 5CPNA 1VFTA 5DCDA 1X98A 4FS9A 3VZXA 3COTA 3PJUA 3DERA 4BHYA 2YGYA 4AIBA 1DJQA 2Y62A 3UJFA 3CHEA 4DRSA 3CTTA 2C7FA 4O50A 3WKZA 2RGLA 2Z28A 1KWKA 2VUYA 1XBZA 3HB9A 2GOKA 4C5YA 4DWSB 4IP4A 3SJ3A 4ZO8A 3DN5A 4O1AA 1R5YA 3PC0A 4RDZA 3WY1A 2CW6A 5AYYA 5EA9A 4JY9A 2QCDA 1RAKA 1JAKA 1LBFA 4GYFA 2R8WA 1ZBVA 1JR1A 2BOFX 2F61A 3ID7A 5EBUA 2X2GA 3N2OA 3NDYA 4GXMA 5SWUA 2PZ0A 4NX0A 3P8IA 1WO2A 2P76A 1NAL1 3T78A 3OA3A 4UUIA 3OPSA 3LLDA 7ENLA 4E4FA 2C15A 3EXRA 3TCSA 2A3HA 1HX0A 2HS6A 3BLEA 4H2CA 3ZIZA 4RDWA 3EEZA 4AD4A 2W62A 3MV11 1LCOA 4QLKA 2V68A 4PMDA 3GZAA 5F4SA 2NVCA 4X2RA 1RA5A 3M5XA 3QKEA 4GVFA 1QPKA 4W88A 1BRLB 4DM2A 1Q4NX 2G50A 1FKWA 4KWSA 2XINA 4XK2A 3S6DA 4WD0A 4HNCA 4Q8UA 4AEFA 1SO3A 2E6AA 3WEMA 5HDRA 1WUEA 2OG9A 4H7VA 3LNPA 3VCCA 4UTTC 1HNYA 1K9EA 1GZGA 4MYXA 4HQVA 4X3ZA 1NU5A 2OYMA 5D32A 3S5SA 4AC1X 3TX9A 3QHOA 2PI6A 2ABAA 3DKLA 1DPMA 4HOWA 4Y7EA 3SCVA 3TR9A 4CQCA 3NQEA 2GJPA 5L9FA 2P88A 1X1NA 4HVXA 4HPHA 3LOTA 2FTYA 2PTXA 4JQ4A 4MNLA 3HTWA 5CXPA 4F9DA 1JPKA 1WPCA 3E0FA 5LYRA 3S47A 1G01A 4EVZA 2WHMA 1XLGA 1WP6A 4EK7A 3OLEA 3MS8A 1KBJA 3RX3A 2WOQA 2PWVA 4AZ5A 1CXIA 2C6QA 4WJ8A 2HROA 3BMWA 5GVJA 4BI7A 1TB3A 3PBUA 3EKGA 4EPDC 1NP2A 1O95A 3HGRA 4E5TA 2Y7DA 4Z42C 1O60A 3N34A 1MQPA 1V5XA 4I8YA 2CCRA 1DJNA 1MW3A 3HIJA 1V93A 1BD0A 4O8RA 3VABA 2Q3RA 3SGZA 3WEOA 4HPXA 4I7VA 5EMUA 4HA3A 1EDTA 3BQ6A 5I24A 1GNXA 1HF6A 1TUXA 5D9OA 1BLIA 1MYRA 1DIEA 1QOPA 1ZJBA 3ITYA 4TOQA 3R12A 5DN1A 1IT0A 4XAFA 3W7HA 4V1YA 3VIPA 5A6MA 1AL8A 3H2AA 2P10A 1JDCA 3B9EA 1A5KC 2VWTA 1O94A 3N13A 2O4QA 3A23A 1UROA 4FXJA 4QP0A 2PWDA 3N3MA 3K4WA 1LWIA 3CMGA 3TTEA 1O66A 3GZ3A 3PPFA 4L64A 2X09A 2QUUA 1XWYA 4LYRA 3RFAA 3TYZA 5AC5A 3WUEA 2O7QA 2YCKX 2J62A 5DANA 3MUY1 2XIBA 3QPYA 1EC7A 1K4GA 1W2VA 4YVXA 2KX9A 4RV3A 3LCLA 4TR9A 4W5ZA 4AY8A 3WL0A 2PUZA 1JZ7A 1TV7A 2W91A 4Q4PA 3ZVIA 4H6RA 4XSLA 1J10A 2HPIA 4UQAA 2GGEA 4O12A 2QKFA 3WD2A 2LLEA 3UNDA 1P43A 4HYWA 4L61A 5C5YA 3IVUA 1OYAA 2I16A 4P5UA 3GTXA 1BKHA 3NQ8A 4M1RA 2I17A 2RH9A 2V0TA 1CW2A 4BWLA 3VDBA 1VJIA 1UPMB 2ZFAA 3W2LA 3P61A 4NP7A 1ODUA 1LT7A 1HL8A 2VRJA 3GYCA 3AROA 4L1WA 3GNOA 2H8XA 1JUEA 1I75A 3TEVA 1A0EA 1FWHC 1W9UA 4Y2WA 4GE8A 4CNTA 2Q8ZA 5CSUA 4I8DA 5A94A 1WDQA 3LI1A 3CL8A 1PPIA 4PMRA 4F0HA 2GDQA 2ESCA 4MSSA 1A80A 3LHYA 4RW5A 3TW9A 1W5NA 3FV9A 2OZ3A 1EFZA 1L6SA 1KBBA 3G0XA 1TV5A 3LPPA 3ZJ8A 3EB4A 5L6UA 4AAJA 4WDWA 1T99A 3MMDA 2OZ0A 3PF3A 4O53A 4GO9A 2VNCA 3H21A 5C70A 1FP9A 1LWHA 2QAFA 1AD4A 1XLJA 2C1IA 3B40A 6XIMA 2G4JA 4JPGA 4TMBA 1EWDA 1ITUA 1OFQA 4CNSA 4LW7A 1M65A 2RDUA 2FZ9A 4XVEA 1SW3A 3PG9A 2VCAA 3U2OA 3W1AA 1SZGA 4ZGYA 2QCNA 2WSYA 1XCWA 3G1XA 2E8ZA 4L9XA 3WBWA 3R13A 2BV9A 4U2YA 4HMNA 4HZ6A 3VK5A 1DYSA 5LNUA 3E3HA 4W8BA 4XZBA 5TIMA 5A6BD 3WD4A 1R3QA 4D6DA 1ZZMA 3TQVA 4F2BA 1QAPA 1VP5A 4RK8A 5I77A 4FX7A 3MKKA 2ABBA 3TWBA 2ALDA 3LYEA 3VMOA 2V3EA 1OX4A 4ZQOA 1TZZA 1R9XA 1HN1A 1Y0EA 5AC7A 3ZSSA 1F61A 1GTEA 4JTDA 4ZODA 4EPKA 4MWAA 1TMHA 1G7UA 1CGTA 3QC3A 1RP9A 1LORA 5BU9A 3IV3A 1E5NA 2OKTA 1EXPA 3W1MA 2BMBA 4GX9A 3WLSA 3WD1A 2BWGA 3UXIA 4ICCX 4IGHA 3PZQA 4O8AA 5E0CA 2ONEA 3QHNA 3BV7A 3UXKA 1V6YA 5AFDA 2D24A 5A8PA 4XO6A 4JS3A 3MB9A 4CVWA 3T09A 2PGEA 4O57A 3WQWA 1KO0A 4LVGA 1W1TA 4DWSC 3HQ1A 3RU8X 4EE9A 1IWPA 4E38A 2WK2A 5IFPA 3N4AA 4IPPA 1AK5A 2CLEA 3GXTA 4NXSA 3OBAA 1M01A 1XXXA 4GQQA 3MZ2A 3IEBA 3E0VA 4XV0A 5E70A 3FSUA 3KFTA 2ON3A 3IIPA 4QJ5B 4AX7A 1R86A 4KWWA 2EPMX 3CB3A 3I3BA 4OUEA 3T81A 1P0BA 1TX2A 4UFKA 4NIRA 3UWVA 3WDPP 1V0MA 1JIBA 1XSKA 1RV8A 4AVFA 1WDPA 3LTSA 3P0WA 3VKJA