3WCZA

Crystal structure of bombyx mori aldo-keto reductase (akr2e4) in complex with nadp
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
307
structure length
307
Chain Sequence
AVQAPCIQLNDGNTIPIVALGTGRGTAKESDSIDEVRQAVYWAIEAGYRHIDTAAVYQDEEQVGQGIAEAIANGLVTREELFVTTKLWNDKHARDQVVPALQESLKKLGLDYIDLYLIHFPIATKPDDSPDNIDYLETWQGMQDARQLGLARSIGVSNFNATQITRLVSNSYIRPVINQIEVNPTNTQEPLVAHCQSLGIAVMAYSPFGFVVSRGQTGAPPPRSDDPTLTALANKYRKSVGQILLRYLIDRGLIPIPKSTNKQRIAQNIDLFDFQLTFEEVAAINQFNKNHRVIDISDWKDYPNYPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase 2E
publication title Identification, characterization, and crystal structure of an aldo-keto reductase (AKR2E4) from the silkworm Bombyx mori.
pubmed doi rcsb
source organism Bombyx mori
molecule tags Oxidoreductase
total genus 111
structure length 307
sequence length 307
ec nomenclature
pdb deposition date 2013-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3wczA00
3LZ3A 1R38A 1VBJA 2I17A 1EKOA 1YNQA 2PDQA 3LD5A 3LZ5A 2WZTA 3N2TA 4G5DA 2FVLA 4GQGA 4R9OA 1FRBA 1Q5MA 3NTYA 1HQTA 3LBOA 2CLPA 3EB4A 4WRHA 4JTRA 3V35A 3DOPA 4FALA 3M64A 4PRRA 3BV7A 3EAUA 4DBUA 3WCZA 3BURA 3R58A 1SM9A 1S1PA 1AH0A 2NVCA 3DN5A 1T41A 2ISFA 5LIUX 3GHTA 4QR6A 5JH1A 1YNPA 3LEPA 2ACQA 4DZ5A 2INZA 1PZ1A 2PDHA 4WDUA 3WG6A 3FJNA 1MZRA 2PDNA 3D3FA 2PEVA 4QBXA 4L1WA 1UR3M 4XZMX 3ONCA 3LUTA 2PDUA 4ICCX 2BGSA 2A79A 1EF3A 4JIIX 2C91A 4GA8A 2ACUA 2ACSA 2J8TA 3T42A 2PDJA 4XVDA 1IEIA 1Q13A 2PF8A 5JH2A 2FZ8A 5KETA 4WGHA 1LWIA 4ASTA 1J96A 4LAUA 4JQ4A 4JTAA 2IKJA 3H7RA 3U2CA 4JIHA 1Z89A 3H7UA 3COTA 2PDMA 3UG8A 2NVDA 1XF0A 4XAPA 1US0A 2FZBA 2IQ0A 4GIEA 3RX2A 3S3GA 3UZYA 4RPQA 3M4HA 2DUXA 2FZDA 3WBYA 3O3RA 3WBWA 2PDCA 4XO6A 3UYIA 4PMJA 4YVPA 4JQAA 3RX3A 5M2FX 2R24A 3UZZA 4JQ1A 2DV0A 3ERPA 2BP1A 3G5EA 1MI3A 3FX4A 2PDIA 4FA3A 1ZGDA 3B3DA 2WZMA 3GHSA 4LBRA 3R8HA 2PDFA 1MRQA 3BUVA 3R94A 3WBXA 4LB4A 4XO7A 3V0UA 2VDGA 1RY8A 2IKGA 3ONBA 3UFYA 1PWMA 1A80A 3MC5A 2IQDA 3LENA 1T40A 4WDTA 3C3UA 2PDBA 4XZNX 5HNUA 3UWEA 3GHRA 3V0SA 4L1XA 3V36A 3VXGA 4Q7BA 4Q3MA 3CV6A 2PD5A 4IJCA 2DUZA 2PD9A 1LQAA 4FZIA 1ZQ5A 4XZLX 1YE6A 3LN3A 3EB3A 5HA7A 3V0TA 1JEZA 4LAZA 4QXIA 4XZHA 2IKIA 2F2KA 2IPJA 2BGQA 4IGSA 2IKHA 5LIWX 4LBSA 4QX4A 1S1RA 4HBKA 4ZFCA 4XZIA 3R7MA 4DBWA 3CAQA 4YVXA 4IJRA 1Z8AA 1PZ0A 4GQ0A 1PYFA 3CAVA 2PDLA 4LB3A 2PZNA 4I5XA 1M9HA 3BCJA 4YVVA 2I16A 3LNMA 2HE5A 1AH3A 1OG6A 1VP5A 2INEA 3RX4A 2ACRA 1RALA 4YU1A 1PWLA 4FAMA 4PR4A 1AH4A 2HV5A 2PDPA 2ALRA 2PDKA 1X96A 5AZ0A 5HNTA 3Q65A 1QRQA 2PFHA 1K8CA 4PUWA 1AZ2A 1Z9AA 1EL3A 1Z3NA 3F7JA 3UZWA 1GVEA 3Q67A 1ZUAX 3QKZA 2IPGA 2HVNA 5LIKX 3UZXA 4WDXA 3CV7A 1AFSA 5C7HA 3GUGA 1AZ1A 4H8NA 1ADSA 4PRTA 4F40A 1IHIA 1RY0A 2AGTA 2PDYA 3KRBA 2HEJA 4XVEA 4EXBA 2IPWA 2QXWA 4WDWA 4YS1A 2FGBA 3CASA 2HDJA 3M0IA 4JTQA 4GACA 4JQ3A 4NKCA 5AZ1A 3UGRA 1XGDA 4OTKA 2HE8A 2IS7A 1C9WA 4GABA 3LQLA 4PUUA 1S2AA 3R6IA 1ZSXA 4EXAA 2PDWA 3R8GA 2P5NA 3MB9A 4AUBA 2HVOA 2F38A 1XJBA 1YE4A 2R9RA 1EXBA 4WEVX 4JTCA 2IPFA 3N6QA 1X97A 3H4GA 5DANA 3CMFA 3R43A 3UP8A 3G1RA 3GHUA 5LIXX 4DBSA 2PDGA 4JQ2A 1S2CA 3O0KA 1X98A 4H7CA 4JTDA 1HW6A 4MHBA 4XK2A 2FZ9A 4GCAA 3LQGA 4JIRA 4HMNA 5LIYX 2PDXA 3P2VA 1QWKA
chains in the Genus database with same CATH superfamily
2DZBA 1K8ZA 4Q8QA 4RDYA 2WKJA 3L4TA 3FAXA 1ZBCA 4EACA 2F61A 4HMCA 3VNJA 1I2OA 1SMAA 4IWWA 2Y2WA 4CD6A 3F4NA 3STGA 5HR7A 5EA9A 2CLPA 2DJLA 5E0CA 2HXUA 3TQPA 4JYFA 2Y4SA 3VNYA 2ZDRA 5AC8A 2AKMA 4A2SA 5GPRA 3O07A 1C92A 3WUFA 4J35A 3M46A 4QAIA 4QS6A 3M07A 3C8FA 2HROA 1F73A 4REQB 4ZBCA 3CIVA 1LBLA 1KXQA 3W72A 2QUMA 2C1GA 5JH1A 2V8ZA 1NH6A 2QCDB 4DZ5A 4W84A 4MNLA 4PTXA 4GD0A 4KPLA 4JN8A 4P8VA 1I2QA 3JVAA 3SURA 3P8IA 3STPA 2PEVA 4QBXA 1K7EA 4ZE4A 4AHPA 3SQSA 1V0LA 3A4WA 4ICCX 3TLQA 1C8VA 3EDDA 2GOKA 3W70A 1BYDA 3TTQA 4C6KA 1VHNA 2WCGA 4ICNA 2ZA2A 3L2MA 3H54A 1LF1A 4US5D 1KXTA 3T7VA 2C13A 3CH9A 2XFRA 1LWIA 2HBVA 5CSYA 4ASTA 3PN8A 3L4YA 2QPSA 3IJIA 3J7HA 5D2TA 2UBPC 4JIHA 3BSMA 4AZ5A 2A3LA 4D8LA 5FF0A 3TSMA 4RPQA 5HK4A 1Z41A 2G3FA 3VKBA 1V51A 2F2HA 4PMUA 3SO7A 2ZXAA 4LUSA 3STFA 3MI3A 1OF8A 3LB0A 3BCDA 5CH9A 2OELA 3FOKA 1L6GA 5C0QA 3BICA 2PWEA 1F3TA 1NFGA 8TIMA 1WNOA 1BD0A 4ZTXA 5A6AA 3NZQA 1JPIA 2PWUA 3KBJA 5CEWA 3GG8A 1V79A 1GKPA 1DPMA 3F2BA 3VD9A 3MYPA 4RE0A 3CGTA 4Q4OA 4FX6M 1ZJHA 4YTUA 2BS9A 3R8HA 5A8OA 3HQOA 1CLKA 4ATLA 1ICSA 1E3XA 3CZGA 1Q6GA 3ZM8A 3SR7A 1O4UA 2WQPA 2UV8G 3NZ1A 3PZTA 2R6OA 2OGJA 2YR1A 4HNNA 3GZ3A 1V4YA 4BEUA 4HZ7A 2G0WA 1TMHA 4PCTA 3VOJA 5J04A 2DH2A 1QNQA 2BOGX 1YEYA 5H8PA 2VGGA 3T0AA 5J5RA 1YTEA 3EA1A 1O6IA 1HO1A 4H9MA 4O11A 3BQ6A 3KDOA 4M80A 3B8IA 4IGMA 2YPIA 4QCFA 4DXVA 2WSYA 2OMAA 3LYEA 1PKNA 4IJCA 2ZBTA 4X22A 3QJAA 3O16A 4UC5A 5DY2A 3KVKA 2VC9A 3N25A 3O63A 1E72M 1X39A 4IPIA 1L0PA 4WY0A 5AHNA 1HP4A 1XUUA 4S1FA 5BOEA 1L8NA 1HJQA 4AD1A 1TWIA 1NDWA 3FJLA 3WKZA 4HJFA 3IJQA 4O1AA 4FXSA 3HG3A 1S1RA 4HBKA 4M1RA 3GNDA 3A4XA 2OXNA 4L61A 3QGVA 1KCLA 3URNA 3RLUA 1J01A 3S2CA 1IQ8A 1QO2A 3QN3A 2ZVIA 5EMJA 2A3AA 5ABFB 4IG2B 1EBHA 2VFFA 4ZCWA 4R27A 5T91A 3S2MA 3K8MA 4JAWA 3HGJA 2UY5A 3RNDA 3M5XA 1ENUA 5A69A 3WLLA 2ZUNA 4I8DA 3M5VA 4W93A 2WHMA 1K7XA 1E9IA 4XZBA 1GHSA 1EEXA 1BYBA 1KM3A 2X30A 1X1OA 3DFQA 1W17A 4LPCA 4Q33A 5E5CA 3WFAA 1AD4A 2C79A 5AZ0A 1RJQA 4C6NA 3W25A 2D69A 2IW0A 2PTZA 1LL4A 2XFYA 1BLIA 2GGIA 4JTGA 3G1FA 2CIPA 3M47A 5AKQA 1CEOA 1TE1A 3DHPA 3VU2A 4CN4A 1LLWA 4WDXA 3RM9A 1HKMA 3MUXA 3VC6A 2DU2A 2FPYA 3AHTA 3ITYA 2WPBA 4WSHA 1D8CA 1UIPA 1O1ZA 4UWMA 4O28A 3VMOA 2CBUA 2FDSA 1KBIA 2ZUVA 3H4XA 1OJXA 1OK4A 4E3TA 1DWHM 3N04A 2J13A 3UGRA 4C91A 1VKFA 1XBYA 3II1A 3VINA 1LBFA 4OTKA 1SJDA 2HE8A 2UY4A 3D46A 2VVSA 3R12A 3LQLA 1YBQA 3FDGA 3VGEA 1V03A 1J79A 4GE8A 5AC7A 1Q7ZA 2OG9A 2XJ7A 1DIDA 3GQYA 1K6WA 3MB9A 3EX1A 3PP7A 2YCJA 1NWUA 3U7BA 1F6KA 1HXJA 2CWNA 4FPSA 3UWWA 4IMEA 1H11A 3PZMA 3S42A 4Z1DA 4NYUA 3W1NA 1LYXA 1OABA 1H49A 1QWGA 3NGJA 2GJXA 5LIXX 1W9VA 3GNNA 3F5JA 4MJMA 3H22A 3I7RA 3AZSA 1TJPA 1FVPA 2MNRA 1OFDA 1V0KA 2PP1A 2J9ZA 1EPVA 2WHKA 1GG0A 3IGUA 1SYTA 4JBRA 1L6SA 1UD8A 1QHOA 5IHSA 1VBGA 4MHBA 3B97A 3W7JA 4W5UA 2FGLA 2P3ZA 3GVGA 1S5NA 5K4XA 2G3MA 1MW3A 3KTXA 3PTQA 3SGUA 1K7FA 5HDRA 3RF9A 2BVWA 3HTWA 3MQTA 2HNEA 2XFFA 4MNKA 2PDQA 4QNEA 1WZKA 2X1RA 3MHGA 4CU6A 2OODA 5D30A 2RHGA 1PCWA 2D2OA 4U31A 4GQGA 3INPA 2AQWA 2HXTA 1V0NA 1WZLA 3TC7A 4EF8A 3IANA 1VEOA 3M64A 3LNPA 1JZ5A 3RJXA 1OIMA 3EWCA 5CCZA 5BCAA 1XI3A 1XLDA 5I00A 4AG0A 1UUMA 2V69A 3RGTA 1CNVA 1REQA 2YL8A 3UETA 3BVJA 3GDKA 4PCSA 5C55A 3AC0A 4KF1A 3W7PA 3GR8A 5CXPA 3RYSA 4CVWA 3R0DA 4AF0A 2PTWA 1IT0A 3WQWA 5BROA 2KX9A 2PDHA 2BVTA 3NDZA 2E68A 3FJNA 2JBMA 3CWHA 4YNGA 4U28A 4C1NB 3C8NA 4ZODA 4C6BA 1B3WA 1O5XA 1V02A 1JPDX 4LCQA 3I3BA 1IWBA 1Q13A 2PF8A 4HPHA 3RK8A 4I7UA 1SW3A 3UPMA 1W5QA 4JTAA 1TPEA 3GYCA 3VNMA 1IR1A 2Z7GA 2FZBA 3LLXA 1FP8A 6TAAA 2D0HA 2CHOA 2VJXA 4ECLA 3KBNA 3UWUA 3G0XA 1G94A 3KBWA 4JL2A 4PB4A 3UG5A 3EKLA 3GR7A 4PB3A 3E49A 3LPFA 1JGMA 1JFHA 2F9RA 5D8WA 1OM0A 1ITXA 1S3HA 3CQ0A 1CI1A 4Z0SA 4JOMA 1XCFA 1MI3A 4QCEA 1VCVA 2PURA 2OO0A 1F3EA 3D3AA 1P5BA 2VX6A 1JULA 3IRSA 3EB2A 4H01A 3KLLA 1ISXA 3VTRA 4DXXA 1EOMA 3VD3A 3WBXA 4E8CA 1P7TA 3ZVIA 1V3JA 1UR0A 3E9AA 3UXLA 3IWPA 1QTWA 3PY2A 3HMCA 1SZFA 1QI0A 3GAYA 1EJVC 4K1WA 3ZLFA 1BWLA 2ZZ2A 1UR8A 1KCXA 1A3XA 1OC7A 2PWFA 1H7XA 2NV2A 2OWWA 4CCEA 1NY1A 2RDWA 1HJXA 1TMLA 4B16A 2NUWA 4PEEA 3KP1A 3OA5A 1BKSA 3W76A 3W29A 1YHTA 2CHRA 2E3ZA 3GK0A 4BKNA 1WP6A 2VURA 1NDZA 4PUKA 3A9BA 4E6MA 1B90A 3KX6A 1B4EA 5F1UA 2FTWA 4FZIA 2JE8A 1XFBA 3N9RA 1P6BA 2GVGA 1VLWA 3EX3A 3IIPA 3AS3A 3QC0A 1JDFA 2YBVA 4N4PA 4D6FA 1ISYA 2C15A 2X1SA 1Q66A 2B7NA 2R1NA 2Q71A 2ZA1A 1JZ3A 2PS2A 3GG1A 4DIAA 3PZUA 4HNVA 2JF7A 3ZJ8A 3CB3A 4MB5A 3W1PA 1UMYA 3IVSA 3ZSTA 1OYAA 1QPRA 4S3KA 2WOQA 1Z8AA 1PZ0A 5XIAA 2GQ9A 4O1EA 9XIMA 4LAKA 2JIEA 3QSRA 3KFTA 4BY3A 3CHCA 4JR5A 5BW6A 4KEUA 1G4PA 3BCJA 2V82A 3W7HA 2XVLA 2V5JA 1GVFA 3VKKA 4H7VA 2OWCA 3BDKA 3SN4A 1FX6A 5BU6A 1S5VA 3AO0A 1H62A 4REQA 4C60A 1V6TA 4H9XA 1LL6A 3OODA 5I78A 2QCDA 1CTNA 2Y7DA 4F2TA 4HHPA 1SMDA 3IIZA 1I2NA 2J7GA 2ZWYA 4WJXA 2PRLA 4O8AA 3UCCA 5AYXA 2EG6A 3JU2A 3CEUA 1AH4A 2DT3A 3VABA 5A94A 2VP8A 4DYJA 3N4FA 3NNTA 2QAPA 3QQ0A 3L7RA 4Q8PA 5HNTA 3POCA 1MUWA 3DC8A 4Z1BA 3CM4A 5I79A 3GTHA 1EL3A 5I3DA 2BFGA 3Q4DA 4DZHA 3H23A 5DLCA 1HKWA 2CCRA 1QBBA 2X16A 2VR5A 5C7HA 3VKAA 4H9TA 3WD4A 3P60A 4CN1A 1FWIC 3TJLA 5CPOA 2PDYA 1GJPA 4RZBA 4ZO7A 1SO5A 1WDWA 3SQLA 4RE4A 3S1GA 3WLJA 2HWGA 2FMOA 4CLMA 3TAKA 3LCLA 5BMWA 1BG9A 2HDJA 5A95A 3GAKA 3MV11 2HK0A 2OWXA 2XIIA 1QPOA 2QIIA 3A21A 2YCIX 4GZ7A 1H1NA 4LAOA 3GDLA 2QDDA 1JNDA 4D8ZA 2X0SA 3S4TA 3FVDA 3UF9A 3FSTA 1TVPA 1L9WA 4D9PA 2FJUB 3QBUA 4Z2LA 1K02A 2X09A 2X2GA 1UJPA 3W7EA 1MDLA 3QPZA 3BV4A 5EMKA 1PL9A 4D2JA 2YBTA 2OU4A 1EC9A 3SM0A 4QSHA 4KERA 3WQGA 4WEVX 1DXEA 4UOJA 2VCBA 3BLEA 3PWAA 5DXYA 1JF6A 1AW5A 3UP8A 1I1XA 1FWWA 2GDQA 3T4CA 2I5IA 4WCJA 1OT1A 4RZ6A 3D47A 4PB5A 1TREA 2FFCA 4AEFA 1L6FA 1XYAA 4HPGA 5I3IA 2EPOA 3WK1A 1QATA 2FZ9A 2GUBA 1W5MA 3WLNA 4TUFA 4NYYA 3G1SA 3C0LA 1O66A 4X2PA 1AJ0A 3BAIA 1SUXA 3JR2A 2J7CA 1BSIA 3S2JA 2EAWA 1WBHA 5EY5A 1IR2A 5FEWA 1W3NA 3EEGA 3MZ2A 4BWLA 4LJ3A 4G2DA 1L2QA 3ZT6A 3BJTA 1LBMA 3G1DA 4DNMA 1K3UA 3S5YA 2VOTA 5FJOA 5EMLA 3AXIA 1G1YA 2X1IA 4IFRA 5BXRA 4PSPA 1XISA 3WJXA 2Z26A 5JMUA 2DZPA 4CNTA 3V5OA 2Z2UA 1T41A 1CZ1A 3BSHA 4AXKA 1UWTA 1BHGA 2VQUA 2XWEA 1NWRA 3CQJA 2YGYA 4HZMA 2Y24A 3B9NA 4U5KA 3ITOA 2E40A 4IGNA 1QXLA 1UASA 5C70A 5JUVA 3AZRA 2XIOA 3QVQA 4AEOA 2A79A 1EF3A 1QT1A 1OFRA 2ACSA 1T5AA 4J27A 4QE5A 2E4TA 3WF1A 4QDPA 3LPGA 4F0SA 2DIJA 3FA3A 2E5CA 2E1DA 3G77A 2QUNA 5HJLA 4GH1A 2WC4A 3SDOA 1J96A 3CV2A 4US6A 2PWGA 2HJPA 3U2CA 1JL8A 5JBDA 4XAPA 2Y0FA 2VZVA 4WLCA 1R86A 5AY7A 1NAL1 5C71A 3NO3A 3IIOA 4EE9A 3M44A 4MZYA 3NQCA 4O10A 1MNZA 1QHZA 2VEGA 3MKCA 3APYA 3APGA 2XH2A 4XO6A 3VDAA 1KLZA 5IDZA 3N18A 3RM8A 2NX9A 2BXVA 4J9JA 3PBMA 4JQ1A 1V77A 1ONEA 4C6DA 1S5WA 4YHGA 4ZXLA 3FX4A 3VVGA 4DJEA 4B9YA 1V6UA 4NNBA 3AROA 4MFDA 1TCDA 1VJIA 3A3WA 4EPDC 4MJ2A 4TX6A 5J8LA 1C8QA 1ISWA 1MRAA 3RPMA 3H2EA 2GK1B 3P80A 1KLYA 3TZNA 1R2TA 4KS0A 2W91A 2NUYA 4LS1A 5FI8A 4ZZ9A 1FWFC 2NQJA 4A2RA 3WDIA 1XLGA 3KM8A 1RY8A 3ONBA 4TVUA 3UJ2A 2QR6A 3HU7A 2OT1A 1E1EA 2YW4A 5FF7A 1M7XA 3AQUA 1CX9A 2QPXA 3H2NA 3HGRA 4J2MA 1XGZA 3OBKA 2PGEA 2CXGA 2XVGA 3M0KA 1DVJA 5HJXA 3TYCA 1XSIA 4NUWA 3L67A 3OBEA 2GGHA 4BR1A 1DQUA 1EBGA 5AHEA 3ZLHA 4IQLA 4GYPC 3W6MA 5A6MA 2WHLA 4L1GA 5C54A 3N4AA 4Z1YA 1W3LA 2F2KA 3N2CA 3TYZA 3MYOA 2WKLA 3QQWA 4F66A 1JZ8A 2QDEA 1GONA 5AVHA 1V6VA 3UWZA 1O12A 3ARSA 7PTDA 3W81A 4GQ0A 3SCVA 2ATSA 2PDLA 1ELSA 3H12A 2RAGA 1OFEA 3O6YX 4A05A 4TO8A 1A4LA 4I9AA 1WDRA 3IVTA 4GJJA 2WAGA 4LEQA 1OG6A 1E0TA 3DG6A 3L5LA 3L0NA 4MSSA 3EBVA 3S1UA 1WDDA 3WQFA 2VEFA 3IGHX 1B57A 3BQ5A 3R25A 1FWRA 1QI2A 1LG2A 3LTPA 5LKYA 4W89A 2FIQA 4JTLA 3LXAA 3T55A 3H26A 3TTSA 5BMXA 4URIA 2WMHA 2OKTA 4MZ1A 3EWXA 4MLJA 4NX5A 3QR1A 4WY0F 3SFWA 4US5A 1GWJA 2G37A 5CC6A 1SO6A 3UZXA 3JUGA 3LHVA 1ADSA 3ECQA 1J18A 1UIOA 2HEJA 3S1XA 2RFGA 3LHWA 5KSWA 2O55A 2GJPA 3B06A 1KD0A 2TPSA 1RQBA 1XC4A 1KXVA 1DJHA 3N34A 1UZHA 4HA4A 3P61A 1SFJA 1TTPA 2OOFA 2XZ7A 2A5HA 4QDWA 4GY7A 3WH7A 1Y65A 3W2UA 1SQ7A 1JJKA 2VR2A 4M51A 4PMZA 1IIHA 2WNZA 3H2MA 3AHXA 2ISDA 4HYWA 3DI1A 5D2VA 4YXGA 4MTVA 2Y70A 3TN6A 4ZQRA 1JI1A 1C9DA 3WLTA 4UR8A 3EEZA 1C8XA 1EXBA 1B3VA 2G50A 2TYSA 4ZQNA 3FV9A 2H9AA 3XINA 3LHZA 1TYGA 3GXPA 4FLRA 3GHUA 1VD6A 2FKPA 3WIJA 5HPOA 4FR1A 1FBAA 1BVZA 3F4WA 2Y61A 2YXGA 3IIXA 4UMCA 4TVDA 2REQB 1KM1A 2ZZ1A 5DCBA 3PG8A 3OVRA 4ZOEA 1WOAA 3TYBA 3AHYA 4XBJA 1OINA 1RCQA 4UOZA 4K8GA 3F4DA 1JG9A 3PZ9A 4A4AA 4YPJA 1DKWA 3WQ8A 3B05A 1CDGA 1JXJA 3EX4A 3VNZA 3E2QA 3SGGA 3LTYA 4JFVA 3VX0A 2Y5EA 4FSAA 3RO8A 3LD5A 1MO0A 2WZTA 4J40A 3T2OA 3WEOA 2GGJA 3N2TA 3CAWA 2C1HA 1HJWA 2BY2A 2YB4A 1CPUA 1RVKA 4IISA 1KNWA 3NVTA 4EIVA 3UYCA 1TMQA 3G6LA 3NSNA 1KV8A 4H6EA 2CBJA 4DJDC 1VQTA 1F76A 3BV7A 2XUCA 4AEEA 3T2QA 4JYEA 3WCZA 3EXTA 1AJZA 4F0KA 3MZNA 3W01A 4MJZA 4FX7A 2WMGA 1X8FA 1VFSA 4QE1A 3TKFA 5K9CA 4O1DA 4UFHA 3W7OA 2AGKA 1XCXA 4CKQA 1RBOB 1ME7A 1WAUA 1Z44A 4HNUA 3UWYA 3H2FA 4FIQA 3P7YA 3WG6A 4ACZA 1DQXA 1QI3A 2OT0A 4UQBA 3KS5A 4A3YA 4O13A 5A8NA 4K8HA 2J8TA 2ZX9A 4JTKA 5HAOA 4GK8A 1EDQA 6PTDA 3BOXA 3SBFA 3U4FA 4IMFA 5FJIA 2NX3A 4HSOA 4J1OA 1M7JA 4BS0A 4F2UA 3EA3A 2QULA 3OHMB 3FA4A 5E0FA 1NF0A 2PDMA 2BY0A 4ZQPA 1RR2A 4LY4A 2W5FA 2G3JA 2IQ0A 1RLDA 4UFJA 2BOFX 4RUBA 3SB0A 3QSTA 4UFKA 3B4YA 1KCKA 3DGRA 4GGBA 5MF5A 3TW9A 3WH8A 2EJ1A 4J3VA 3S1WA 2VEKA 5DMYA 1G5AA 4Y9OA 1HKKA 4EPBC 2DV0A 1I0DA 4AIBA 1K4HA 2ZYFA 3VILA 3NEVA 3T07A 3GG0A 1EOKA 2P10A 4LBRA 2NLYA 2I1OA 1WB0A 3NIYA 1E1FA 1UZ1A 4IIEA 2ZE3A 3FXYA 3LXCA 3GIYA 1KTNA 3C3NA 2RDXA 3QV8A 4GFSA 4RK8A 3TROA 3PR2A 4F0MA 1WYIA 1Q63A 4XO7A 3PS7A 3O2LA 1PZ3A 1Q45A 2AAAA 2O7QA 1GKQA 4JFSA 5T9BG 4KWVA 3PK7A 1R3VA 3EDEA 3BMXA 4CD4A 3L12A 1H2JA 3C3UA 1TB3A 5HNUA 1DWJM 2J62A 4H9YA 4RL3A 3TWBA 1FCVA 3RN6A 4UCFA 4Q7BA 4IZGA 3W7CA 2RJGA 3TONA 4NJGA 3LBCA 4AZGA 1J2WA 1GK8A 1S3TC 2ZUWA 3GFYA 2I14A 2ICSA 2XIMA 3MHFA 3DESA 4LU0A 3W7RA 1JQXA 2XVPA 3S46A 2P88A 3W37A 2OGYA 3VAVA 5LIWX 4OQVA 1HGYA 3P14A 3LRMA 2W61A 1TO3A 4ZFCA 4I5UA 3AAMA 1W1B1 4TIMA 4XB3A 3VM7A 3ZYZA 2G3NA 8A3HA 4JTFA 4YJ5A 4H3DA 1RA0A 4UTIA 3RLGA 2DEPA 2XYLA 4U4MA 3RFAA 4NZ3A 4I90A 5DCEA 2OSYA 4YVVA 1NQ6A 1KA9F 1VHCA 2ONEA 3BLLA 1PE1A 5FF3A 5KINA 5MKGA 3W2NA 4S3AA 2QT3A 3TA6A 2XWDA 2INEA 4AY7A 1ISZA 1W9UA 2D24A 2HPMA 4DJFD 1SJBA 4V15A 4DWSD 3N6JA 4YU1A 4NG3A 4FAMA 4HPJA 2D3NA 1GW1A 2A4AA 3AISA 5D05A 1OHLA 3SCOA 3W2LA 4KIRA 3SUWA 4HMDA 3QRHA 1K8CA 5CPSA 2WNNA 3NWRA 4A29A 4ZE5A 1E0XA 5K3VA 2DORA 4U3CA 1K77A 4WXYA 5DY3A 4UBPC 1P6CA 3VD4A 2WQDA 2XIJA 5I3KA 5M5DA 1TV5A 4C6JA 3WK3A 3K2GA 3W7NA 3KWXA 1VR6A 4AZBA 4XVEA 2QUVA 1W2VA 3UY8A 3PZVA 1CENA 3IACA 4Z2HA 3CHEA 3FKRA 2ZC1A 3M0IA 5DBTA 2Z1XA 1QOPA 1ZCCA 3PPFA 4KETA 1FCUA 4LC8A 4HU8A 4DRSA 2E6DA 2D3LA 3UR5A 1IWPA 4LYRA 4F2BA 2OCZA 3VIMA 3WEZA 2JALA 4A3HA 1RSCA 1GKRA 3O7UA 1T99A 1IXNA 5G4WA 4QG8A 2XSBA 2QQ6A 3VE9A 3ZQ9A 3LRLA 1W1PA 4PH6A 1F74A 3PFRA 3V4BA 4U3AA 3B0PA 3T1GA 1M65A 1Y0EA 4JTCA 3WQEA 1UD4A 4CQBA 2SFPA 3S9YA 2GK1A 4LGXA 3QC3A 2VUYA 1EC7A 4UTKA 4E4FA 1J12A 1AW1A 3PFMA 1UD6A 4C5YA 3TFXA 1G67A 4O16A 1NFBA 1H63A 1X1ZA 3JS3A 5AHMA 4PN2A 1A0DA 1VGAA 3BOFA 4Y96A 2QMJA 3T4WA 2BY3A 4WOZA 4O4VA 4JFTA 5FEZA 3WNLA 4F4RA 2V2HA 1WKFA 1FWTA 3IV8A 4NF7A 3HPSA 1J6OA 4GI9A 2GYIA 4YL2A 3LZ5A 3TOYA 1OD8A 3LCFA 5A6BD 2FB2A 2FVLA 1T8QA 3CYVA 1HQTA 4XWUA 3K1DA 1A5KC 4WRHA 1EWDA 1I60A 1UA3A 3ZR5A 1HL2A 2VGBA 2DVTA 1OYCA 4XG1A 3W24A 1AMKA 2C1IA 4N9CA 5GNYA 7ODCA 1NARA 2NX1A 2FYMA 5TIMA 1IE7C 1XL9A 2W6RA 5D02A 3GB6A 3S2LA 3CZJA 6ENLA 2JKEA 5HOSA 2YFNA 4HQVA 4DUOA 1PUDA 1R9YA 1W54A 1TWDA 2Y1HA 3PPHA 3D3FA 4O50A 1G4TA 1A47A 5C7VA 1UH2A 4J3SA 4OFCA 1ZAJA 2BGSA 4X9YA 1B3YA 4WOQA 2JGQA 1W3KA 3B8WA 1EEPA 3TZFA 3JZUA 4PCNA 1R30A 2PGFA 1IV8A 1W5OA 3BGAA 3CUFA 3ABZA 3VDGA 5FKYA 3U0HA 4ALDA 3M0YA 1W9PA 3PJTA 4FI4A 4JTIA 2Z28A 5AC6A 3LBMA 2ZTJA 3ARZA 3M4HA 5D04C 4LAMA 4EANA 4F8XA 3OZMA 3WBWA 2VFIA 5BXSA 2CWXA 3QLDA 5D38A 1LTDA 2D73A 5KMYA 4V1XA 1LLOA 4YVPA 3R89A 4B91A 3OP2A 3WFLA 5FJUA 6REQB 3LI0A 2DIEA 5D4YA 3T0CA 4JFUA 1CGVA 4MY1A 3ITGA 4QJ5B 3L4WA 1I4NA 7REQA 4FA3A 4GNVA 3SIZA 3K1GA 2WWDA 1I2PA 1RD6A 3B3DA 1WO2A 1Q6QA 2QJNA 3M0ZA 4LOCA 3GTXA 4JTUA 3O06A 3PHAA 1R46A 3TQKA 1F5ZA 1VB9A 3C2VA 2WZHA 3A12A 3WZ0E 2EGZA 2VZTA 3W9ZA 3V0UA 2X41A 3EMCA 2Y5SA 4RDVA 1EXPA 4GRSA 3UERA 4HJWA 1JYXA 4RDZA 4BQ5A 1TR9A 3MC5A 2FH6A 2IQDA 3NZRA 4C6CA 5HUOA 1WZMA 4PTDA 3G1HA 3KBMA 1H61A 1UWSA 3CUXA 1EGVA 3ABQA 4EKJA 1DXFA 5FSDC 3AMKA 3SQMA 4Y9AA 1S2UA 1QPNA 4ROPA 2GQ3A 3V36A 3RUBL 3CQIA 2REQA 4D6EA 5B80A 4PBEA 1J0ZA 3GXFA 5J5DA 1ZQ5A 1MFUA 5A8MA 3TIMA 4MVAA 1E6ZA 1AODA 3HMJG 3Q94A 1Q6CA 3GLCA 4OJYA 4NILA 3PJXA 4NY2A 1IEVA 2IKIA 4K39A 5JBEA 2RDTA 4MWAE 5CC3A 1WBJA 4QFUA 4ORIA 3R7MA 4XAZA 2WM1A 4I5RA 3HZ3A 1B31A 3PBGA 1UMLA 1XPGA 4C6PA 1TE6A 2E0PA 4NSBA 1HJUA 1MW1A 4LUJA 3QZAA 1JUBA 3GZAA 3H24A 2INFA 1E51A 4JCLA 5LA1A 3CH0A 2NSXA 3TMLA 5BXPA 3PSWA 2ALRA 4DWSB 4KIEA 3DBNA 3LHUA 1OX4A 4B9ZA 1EJXC 3DZ1A 4JTEA 1E55A 4PL1A 4BK9A 1Z3NA 3VOGA 5E09A 4QSFA 1KGXA 1ZBVA 5BZAA 1KGWA 1H4PA 4FXJA 2FQIA 2BVYA 4J28A 5AC5A 3VDCA 1FDJA 4TV5A 1PXGA 2P53A 3OLEA 2PU1A 2RUSA 4CNPA 2DJXA 3HPXA 2C18A 3CZLA 5CKSA 3WENA 1YMYA 1M1BA 3O05A 4PODA 4HOXA 4U10A 1XGDA 3MHUA 3BJSA 3FHQA 4GVGA 4MF4A 1XIHA 4WSJA 1P1XA 2GWGA 3IUDA 1FDYA 2VFDA 2QCNA 2UY3A 1X7FA 4GGHA 5PTDA 2DIKA 5IM51 2WBKA 2CPUA 2BX7A 2P0OA 3TX9A 3P81A 5D8ZA 5K9XA 1J0YA 3H2CA 2DH3A 1DHPA 5A6SA 1E6PA 2Z25A 2XN1A 3NURA 4AH7A 4ZQOA 1BWKA 3QTPA 3VI2A 2XFWA 3MUZ1 1Q6OA 4ZOAA 1DYSA 2PDGA 3RO6A 3LM7A 4DAFA 3ABRA 4UTTA 1OFAA 3TYDA 2PA6A 4AAJA 3A9IA 3W7KA 1YXYA 3GM8A 1R9XA 4MIMA 1CT5A 3G1XA 5I3GA 4GISA 5FESA 4F79A 4PCFA 2QAFA 2I17A 5HWJA 3UJSA 1OVDA 2V81A 2FFIA 4JNYA 3VZYA 1PJ9A 1B3XA 4NI3A 4IUOA 3N2BA 3E0IA 1EJRC 5HMSA 1FRBA 2O92A 4B5NA 4DX3A 4DXKA 3P93A 3SCRA 5EU9A 4R33A 4TMCA 1PX3A 1NDYA 1Y8BA 1U22A 4N9DA 4Q4PA 4Q4RA 4HK6A 4XX6A 3GDBA 3BW3A 4MWAD 1AH0A 4ZVJA 4FK9A 3DN5A 3A4JA 4KKXA 3NL5A 4POCA 4C5ZA 4UCGA 2J7BA 3U7VA 3CEPA 2PC4A 2V5LA 5G2WA 1R8LA 3TQVA 4O4WA 3C0QA 5D2WA 3DFNA 4OOUA 2A0NA 4C7FA 2PDNA 1BXBA 5EFDA 4AD3A 4L1WA 2Z2BA 3NXFA 1YXCA 1CBGA 3IEBA 3NZGA 2X0YA 3WH6A 3NAVA 1XYZA 5CSRA 4CGTA 3HJZA 1SZRA 1O5RA 2FLIA 2YYTA 3AALA 3M0XA 4XBSA 1HJVA 3IJ9A 3S47A 4OBRA 3NPXA 5H8MA 2WLZA 4H1ZA 5I07A 4KT2A 3QHMA 4B15A 4HVXA 2JQXA 1US0A 2R1PA 3AFBA 1JFXA 3VD5A 2DVXA 3G8EA 5BRQA 2X2YA 3JZEA 1OD0A 1H7PA 4H6RA 3FVMA 2HPIA 2Y7GA 4E4PA 3BCFA 3W7GA 2GQ8A 1DJGA 3OQEA 3TR2A 1NIUA 2WMFA 5AYZA 3KVJA 3EYPA 1V08A 5M2FX 3UZZA 4QP0A 5DCDA 3O9NA 5CPMA 1UH3A 5AHFA 3GW3A 3PBUA 1E6XM 4NRSA 4RX0A 1XM3A 2DT1A 5F4WA 3WQ6A 4YWIA 5LNWA 5DRCA 5SWUA 1GOMA 1XV8A 3W3OA 5M1TA 4IPPA 1QFEA 1QPKA 2H90A 3KDNA 5HWNA 5FEXA 4AWEA 1AJ2A 1GZJA 3PUDA 1TPDA 1C3FA 4L4MA 4OHQA 1THFD 1O94A 2VDGA 1WXZA 2PF0A 3E5PA 1WA3A 3RRXA 4KRTA 3WUEA 4RW5A 3SSJA 4LUSB 3CIXA 5BNKA 2FTYA 2O4MA 2BXYA 1MQRA 2YZRA 3R11A 3MMTA 3M0MA 2GZXA 4DPQA 3ARVA 1GQJA 1IXQA 1EX1A 4CCZA 1Q8AA 2XIQA 3PWGA 3RAOA 2CLLA 3PTMA 3ITCA 4D6DA 1BQCA 1DJYA 4E2BA 4PMNA 2J77A 1TZ7A 1GYLA 4PL2A 3FDKA 5EFFA 5CC7A 4L7ZA 3URBA 2W27A 3GIPA 1OT2A 4PMXA 4LVGA 1D7FA 3QHOA 4N9BA 1A5BA 3B9AA 3NQ2A 2G4JA 8RUCA 3A23A 4WKHA 3GDMA 3NCOA 1PIFA 3WD2A 3VDBA 5GJPA 5C5YA 4V28A 3NQFA 3ANUA 3U9IA 4JHOA 1ODUA 2O9RA 3PBWA 1PPIA 5FL0A 4N02A 3TJXA 3BG5A 2ZRYA 2W66A 3C61A 3CL7A 3OIXA 1VP5A 4ZSTA 4ZTYA 4GX8A 4Z2JA 3MMWA 4FR6A 3KBVA 4M81A 3ITXA 1F05A 5I3HA 1MVYA 3LI1A 2R82A 3ICJA 3L9CA 3GKFA 3CZ8A 2FMNA 3FGCA 2WWCA 1DV7A 1FA2A 4CD7A 3BLKA 4HA1A 1VBUA 1ZUAX 3LPOA 3N9SA 3NEHA 1AZ1A 1VCGA 3BMVA 4GO9A 5AOUA 3N29A 1OGSA 2BASA 1EGMA 2IPWA 3R0UA 4RDWA 2F6XA 5A6TC 4IP5A 5HMFA 1CWYA 1FY6A 1TPFA 1K6AA 2V2CA 3DGBA 4NKCA 4ILSA 1AG1O 2PLKA 1GORA 2E6FA 6REQA 4GABA 1ECQA 4N9EA 3USZA 1R3YA 1BVWA 1S2AA 3W2JA 1BVNP 3DHUA 3AIVA 1RP9A 2XVNA 5FAJA 1C7SA 4NZ5A 4AX7A 2P5NA 3OGSA 2YXXA 4KESA 2WC3A 4YTTA 2WMKA 3CZEA 4AXNA 1GOKA 1RJRA 1WZAA 2VO5A 1MW0A 3GH5A 4GIYA 4MYAA 3A47A 3H7VA 4JX6A 3T8LA 3L2LA 5CG0A 1CGTA 2HK1A 5CPLA 5CAKA 2WMJA 3JW7A 3L21A 2XH4A 3L66A 2BG5A 4HU3A 4JTDA 3TYUA 1F8IA 1XDMA 4H4IA 1SO3A 3CHFA 5ABHA 1ZALA 2A7PA 2NXHA 1ICPA 3W1AA 2NZLA 2PTXA 2RJHA 4EK7A 4K6AA 4TXEA 4FP1A 1JR1A 4UXDA 2O9PA 3A3XA 4N42A 3MDWA 5FD0A 3HM7A 2PU0A 4AX6A 4ZL1A 3NXLA 2Q8ZA 3HO8A 3FSUA 4PUDA 4BFAA 3URAA 3TNBA 3FYYA 2PC8A 3DOPA 1EA0A 1TV4A 4ENLA 1TSIA 1QVBA 4ICMA 4HNOA 3EAUA 3RCYA 5A6LA 4E8GA 4WQ6A 1ZL1A 1HUVA 3WLPA 3QMTA 1US2A 4CEUC 3BL3A 1S1PA 3P8JA 1ALDA 3DDMA 2XN0A 3SJNA 3WNNA 2H8XA 4Z2GA 2ZRXA 3SCTA 2CLHA 4M19A 1JDEA 4MWAB 1UA7A 2WKGA 4AISA 4D6HA 4P7OA 4EPEC 4IIBA 1LOQA 2EPNA 4WDUA 2BY1A 3WLMA 2CU0A 3RU6A 1CGYA 1I9CB 3T44A 2PCEA 3I65A 2PRHA 3URQA 4DYKA 2XVKA 4AD4A 3B0UX 2PDUA 5G5IA 1VIZA 1QK0A 4L9ZA 5CJMA 4JIIX 1JCJA 4W9TA 3W71A 4DJFA 4DWSA 2DP3A 4M3PA 4OU1A 2XIBA 4IL0A 3NSMA 4HIBA 1WAWA 1VYPX 3DYPA 1TV8A 1BTMA 3LSCA 4OKDA 3WSUA 2E7FA 4TU1A 4GC4A 3GC2A 4BF9A 4K3ZA 1ML1A 1XCWA 3PC0A 4AYGA 3MCMA 3COTA 1TR1A 4GY0A 1XF0A 4QJ4B 3OZOA 4GIEA 2QNEA 3UZYA 2EG8A 1HKVA 1REQB 2GVYA 2FZDA 1V3IA 1N55A 3FK4A 1T96A 3WD1A 3VO0A 4E3VA 5E1QA 3SI9A 1FP9A 3D0CA 2B81A 4L6OA 4QAWA 4M24A 1B9BA 3CB8A 3E0FA 3A64A 3BAYA 1UD5A 4QQ3A 1DIEA 4RXFA 1SVDA 4DVOA 1HNYA 1NM9A 3Q45A 2R1LA 4AZCA 3GHSA 1DWAM 2P3EA 7A3HA 1S2VA 5A8QA 1MRQA 1M01A 4RW3A 3K46A 3CT7A 3ZIZA 1YADA 4IHCA 4UTMA 4Q8VA 3QTGA 3QOKA 3SCQA 4W5ZA 1TIWA 1EIXA 4C6LA 4LNYA 1CGXA 4P61A 2E9BA 1PBGA 1G7VA 5AYYA 2FVKA 5F2LA 2TAAA 1CW2A 4RE2A 4XKYA 3P0WA 2BGNE 1L6YA 2C3ZA 4MNJA 2J4GA 4NXSA 1Q7QA 2BB0A 1E4IA 3BW4A 3E0WA 4WZHA 3T8QA 3QY6A 3OW1A 4OBTA 2QF8A 1RCXB 3UR2A 1XBXA 5DN1A 4GHRA 2CKSA 3WH5A 1PVNA 4P7LA 3V1HA 3E3HA 3THCA 1YE6A 4KEMA 4HT3A 1GPFA 1RPKA 1CECA 6TIMA 1W8SA 4V1YA 3GVVA 3W73A 3QY7A 2CZFA 2Y88A 4B5TA 4XZHA 1HX0A 1PYMA 3FCPA 1IWAA 1SZGA 3WQ5A 4AIEA 3PBVA 5A6BA 4WXZA 4DAIA 1AW2A 3TNOA 5EL1A 1W91A 2BMBA 2J66A 3GC4A 5F7UA 3ABOA 4L80A 5A6KA 1CXLA 5AYBA 1Q4WA 2A3EA 3PTKA 4R85A 4QNWA 1VAHA 2E9MA 4S3EA 4R3UA 1VFTA 3DKLA 3PF3A 2I16A 3B8DA 3HPAA 4NAEB 3L0GA 4XV0A 1SJAA 2DSVA 1JVNA 4ONVA 3NQBA 5IDIA 4RNIA 4GKLA 4FO4A 4LC6A 3W83A 4H8HA 3LV6A 1R5YA 2PLJA 3SCUA 5A8PA 1WUEA 1DE6A 1KRAC 4TV6A 1LORA 3IJ8A 3WNMA 2FPVA 3DCPA 2NQ9A 2PFHA 3BG9A 1J9YA 1PV8A 3N11A 4OWGA 5HJYA 3Q67A 2GSEA 4BI6A 2XGZA 1DTNA 4FNUA 4LNCA 4I3GA 4MUZA 3M6DA 3U6WA 4Q8NA 3BLPX 2ZZ3A 3UG3A 5AVNA 5KZDA 1L2UA 1UD2A 1CGUA 2AGTA 1Y5XA 4BZYA 1BFNA 4WDWA 3TCEA 2EHHA 3IS4A 2PE4A 4DEFA 1PIIA 2YL6A 2WSPA 4QIUA 4JTQA 3U48A 3WYZA 2CLEA 3BZGA 2ZXQA 4YCPA 1MEWA 3P3BA 3GXDA 5DRIA 3OTRA 1LROA 1W9XA 3V18A 3QYQA 2PDWA 3W6YA 2DVUA 3CNYA 4XAGA 3R5EA 1KQZA 3QFEA 2DY3A 1RBLA 4AZIA 3TFCA 3UWQA 3FXGA 1UWRA 4AVFA 1OB0A 4UTJA 3LCXA 2JK2A 3ATYA 4RV8A 4AWUA 1OBAA 4AYSA 2AL1A 1K8XA 1F8MA 4LY8A 2A6NA 3P62A 4OOZA 1Y7VA 4YWSA 3ZR6A 5HUPA 2PI6A 4KQNA 3PPGA 4LV4A 1XKJA 4XAYA 4GCAA 2IUZA 3V1PA 3W1TA 4INFA 1LUCB 4ZOBA 4LVDA 3P2VA 3CXOA 1E6NA 2MUCA 3AOFA 4BQ4A 3LZ3A 3DFTA 3HQPA 2VVNA 4HKPA 4KCTA 1YNQA 1WDSA 1GOWA 3DI0A 1FDZA 1FWGC 2Z7KA 3CQHA 4ZGYA 5LA0A 1Q5MA 4LSBA 3FAWA 1OCQA 4MPKA 1QHPA 4JTRA 5EKYA 4M29A 1XYFA 3ARTA 3O6AA 9XIAA 3M0LA 1V3HA 1XLIA 5CLWA 5LSMA 3T09A 1D3CA 3VOHA 2JIWA 4MAZA 1RZMA 2NVCA 2DSKA 3FW6A 3QXBA 3VX1A 1XLCA 4JX4A 2H3DA 1ISVA 4WD0A 1DWGM 1JF5A 4KCUA 4GQRA 2C0HA 5D9PA 3KTCA 3CZKA 4E5TA 1SFLA 4KMQA 3MUIA 1V6XA 5TQLA 4HSNA 5DBUA 5JBFA 2Z0IA 1UKPA 3ISIX 1GYNA 3N73A 4UNKA 3T08A 1UR3M 1JD7A 3SY1A 3S1VA 3ONCA 2G5WA 1XBZA 1ZAIA 2OOGA 2EO7A 1CB2A 1UH4A 1XRVA 5CBJA 1UKQA 3VNIA 4ES4A 4N6EA 2TODA 3G6MA 3A3HA 5KETA 1E70M 2J8FA 4DBEA 4L64A 4ML9A 2WNWA 1GUVA 1XW8A 3SY8A 2OZ8A 2QGYA 2NVDA 3FKKA 3UPWA 4A8NA 5F2MA 1A53A 1HZYA 1J4EA 3VM5A 1A0EA 4XTIA 1YW1A 3BANA 3GIQA 1FFQA 4AY8A 5FJTA 1WKDA 4G7EA 2BODX 2CZEA 3UYIA 4S2CA 4NASA 2V3GA 2YJQA 1W5NA 2EPMX 4RE3A 1EHAA 5LXEA 4JZ5A 1F61A 2OPJA 1N2VA 3OYZA 4HHMA 3W28A 2ZKMX 5C2GA 4B3LA 1JCXA 1UP3A 4H9UA 3IGSA 1H7RA 1MNSA 4HD5A 1UQYA 3WDQA 1XLHA 4LXFA 2EKGA 1ZB5A 2VTFA 1XRTA 3PZOA 3AWOA 3FJ4A 4JKMA 2VOMA 3E12A 1F3WA 1J10A 4BA0A 4JIEA 2YA0A 4ZENA 4DQWA 4R7JA 4QG9A 3MSYA 2GDVA 3VNLA 1VBRA 3RIKA 3CHDA 1LZOA 2BOEX 3DYMA 3DECA 4GJ1A 4CU7A 1XD0A 4A3UA 4W87A 2OZ3A 2E8ZA 2ZC8A 3O1NA 2HS8A 3W0KA 2VC7A 4C1KA 2Y85A 4WJEA 4PRWA 1JDCA 1ADOA 1GEQA 4XZLX 5TF0A 3LN3A 1OWQA 3OEXA 4BF7A 3THUA 1NF7A 3GU1A 5I5RA 5F4SA 3WQPA 1LJYA 4FEZA 3W7MA 2DZXA 2IKHA 1NU5A 2QZRA 4C1LA 4QX4A 1ZENA 1E15A 1T6MA 4YVXA 3W7QA 4JTHA 1EO7A 1MXGA 2J8GA 1Z32X 2PZNA 3FIGA 2GSHA 1EJSC 1UJQA 4AWTA 1V3LA 4GZEA 4A6GA 2QCMA 1IZJA 2QDGA 4L65A 4Q4SA 2O7SA 3QM3A 1E6SM 3UVAA 4R7WA 1S46A 3W87A 3GSMA 1OFQA 5JIPA 4E38A 4MWAA 3W75A 1O95A 4YCOA 4ZA0A 1WV2A 2ACRA 4DELA 2GJRA 3ZWTA 1H5YA 4W7UA 4KRUA 1BYAA 2GUUA 4HNTA 2WSRA 3VZZA 2QYGA 4Q8MA 1RHCA 3VIGA 4PR4A 2ATMA 3HQ1A 4OZOA 1DQWA 2BNJA 3GW0A 3WL0A 3RRAA 5FCZA 3TN4A 5LNSA 5HPCA 4LH8A 1P6WA 1M41A 4A21A 2VELA 4Q6JA 1Z9AA 2GVLA 4DF1A 4W7WA 1GVEA 4FLOA 1VPXA 2YW3A 5CJNA 4D1IA 3EWBX 3QGKC 4DLMA 2WZIA 4GUIA 2FVMA 3PSVA 1S2TA 1OY0A 5AHIA 1HIZA 2BDQA 3FY1A 3NFUA 1X8CA 3G1VA 2CC0A 1U5JA 3K13A 3SRHA 1QJWA 2A7RA 2JKAA 1B54A 2V3EA 5FEPA 5TAOA 1UPMB 1XLMA 3ITLA 4JDBA 1CXIA 2NUXA 3WK0A 3LMYA 4M56A 3TE9A 1WQ5A 2RKXA 3GKAA 3WL1A 1E9YB 3ATZA 1UG6A 4JFWA 4OUEA 4LYQA 1WDQA 3CT2A 3L2IA 3TDFA 2QMKA 5CGMA 1XYBA 2CKRA 4I7WA 3N2XA 3R8GA 2VI0A 3UXKA 4HN4A 3AMLA 3UZ5A 5GJNA 3A5VA 1GEHA 1EA9C 2V3DA 3PB2A 3QPYA 5FACA 4MKSA 1UWIA 3FEMA 1OYBA 1X97A 3K8LA 3R43A 4HHHA 3ZO9A 1EO5A 3MPGA 5I6SA 2ABBA 2E1WA 3CO8A 2I56A 3DENA 3W74A 2OSXA 2GGEA 2OVLA 4N0RA 2XG9A 4WSKA 2XN2A 4FB7A 4D6JA 1X98A 2Q8LA 3HG4A 3MSDA 4Z2IA 3WO8A 2O56A 1HW6A 5T26A 4FNRA 1C90A 1PHWA 4JIRA 4P2VA 1QOQA 3ORWA 3VOCA 4HOWA 3B9EA 1I75A 3VKCA 1E5JA 1JUKA 1QI5A 3SUTA 4M82A 4AD5A 4CN6A 1Z6KA 2A2IA 3WUBA 2C14A 4ZR8A 3GH7A 3WLOA 1ZY9A 3KCOA 4IQEA 4C6MA 4H6QA 3EXRA 4AQLA 4HSHA 4ADSA 4TMBA 4GOAA 1JCLA 2PP0A 3CAKA 5FIPA 2B0MA 4UFIA 1POKA 2F6UA 2IMRA 2H9AB 2W4XA 1Q6DA 3BXWA 4J3ZA 4DM2A 3SIMA 4ORMA 4UTWA 2ODOA 4UTUA 1EYWA 1XWYA 3ALGA 2C6QA 4ZQCA 1YNPA 5LNRA 1KXHA 1ZBWA 3MJYA 3VGHA 4RZ4A 3W86A 3AIBA 1TPH1 3UR7A 7TIMA 3T40A 4NAEA 1IEQA 4LYKA 2ZX6A 3BLDA 2W0UA 2CHNA 4NJKA 5IBXA 3M6YA 1LM1A 4QM1A 4A3RA 2DT2A 2ZZ6A 3NQVA 4KGLA 3W53A 3RLHA 1P0BA 2FZNA 3FFSA 3SAZA 1NOUA 2AMGA 5EPDA 3LLFA 3UU0A 4UB9A 1PTGA 2QJHA 3MT1A 1XLAA 4HGXA 4MFEA 1S2WA 1G9HA 4FOJA 3WDHA 3GFZA 5F2IA 3N9KA 2FTPA 1MSSA 1GTEA 4WIWA 1RXOB 4F3HA 3NM1A 2Z6JA 3SSZA 4BHYA 2RGMA 2VUNA 3RCNA 3R1ZA 3AU2A 2PDCA 4XZWA 1KW1A 3R79A 1E0UA 3EDKA 1JYVA 4GI8A 4PUNA 3T2PA 3ITTA 4ACZB 3K4AA 4Q4MA 4IUGA 5I02A 1VYRA 3MV01 3VOIA 1XIGA 3NQDA 3C2OA 3KAOA 5LZLA 4GNJA 1UR2A 1XIFA 4GUJA 1SFSA 4PUMA 2ZZ4A 1HP5A 5A8GA 4E2OA 4EWND 1V6YA 3E0VA 3ES8A 4JNMA 4WGXA 4ZO9A 2FHFA 1A50A 2QPUA 5CSSA 2MANA 1W32A 3DG7A 3WDJA 3L0KA 3AXKA 3BZJA 1H1ZA 5AFDA 3NUKA 1J0IA 4QRNA 1ZZMA 5KEZA 1FHUA 3KCJA 1KTBA 4G9PA 1GVYA 3PBYA 4S2BA 3L23A 1NVMA 1PSCA 4L1XA 2XU2A 2PD9A 5K9DA 2V5BA 3LA4A 1H3GA 3LRKA 1LUCA 4PBGA 2VGFA 4H8VA 3RXZA 1UP0A 2BXZA 5I0DA 1FWEC 4H83A 4UIOA 1XC6A 4IIDA 4RZ5A 1IF2A 4GIRA 4ROQA 1GPWA 3UBPC 3LM3A 2D0FA 3GS6A 1W1IE 1R87A 1V8EA 3BOLA 2Z1SA 4Y9MA 1JD9A 2XINA 3CAQA 4IJRA 3NO1A 4Q7NA 5CSUA 2YDSA 1S38A 3UA4A 3C0JA 1VCFA 2GVEA 4GJIA 4D72A 1NEYA 1JPMA 3SRFA 2HE5A 4HA3A 3VGFA 3U8GA 2ZFAA 4LWWA 3TTEA 2D2JA 2EBNA 1KFJA 2X0HA 1SO4A 3POHA 1GOQA 2WJFA 4EAMA 5HBFA 2OQHA 3DFPA 2VRJA 3MSRA 2HTMA 1FQ0A 2VNCA 1F07A 4MB4A 5KTLA 4AWSA 3BAKA 2YKKA 3E1F1 2VXNA 1WUFA 3A5FA 4IMCA 1PCKA 5I24A 2CEQA 2PLCA 1PIGA 3DYOA 3Q65A 3PUEA 3VIHA 2OO6A 4B90A 3MWAA 1CLVA 3S9IA 4NZFA 4OBSA 4S3BA 3WJWA 4DWDA 1AFSA 2ZX8A 3GVQA 2CBVA 3GUGA 4H8NA 3W7DA 4QLLA 1WE5A 4HNLA 2VM8A 5DT5A 5EB8A 4KRZA 3HFYA 4KWOA 2EF9A 4DPPA 5DF0A 5MKGB 4J2PA 2WANA 5CZ0A 3C52A 3I6EA 1N8IA 2V30A 5ABTA 5DFAA 3UPBA 1QAPA 5AZ1A 5AECA 1IEXA 1I45A 4YYCA 4Q4QA 5FSEC 1CCWB 2A85A 1TTQA 3S5OA 2GWNA 4DJDD 1HTIA 4Z0JA 3R6IA 2WVVB 4AHQA 4QLJA 4R53A 1E3ZA 1Q6LA 1TPB1 2DSZA 4JY9A 5LA2A 4Y9PA 4X3ZA 1Q6FA 4JTJA 1TELA 5FAGA 3SZ8A 5ENLA 2CZ5A 2F38A 3PWIA 3MTWA 4FNTA 1SGJA 4IF2A 3CMGA 4IFKB 3WDPP 3HQNA 5I06A 4L4OA 5EBUA 2A7NA 4EWJA 4GUGA 1JRCA 2DZSA 3TSBA 1UB3A 2CLOA 4ZO6A 1TKKA 3WLIA 1SFTA 4IOTA 3SGZA 1YDOA 3O0KA 2XISA 3WN6A 4BEQA 4UZUA 3GG7A 2ZWZA 4GQBA 2PTDA 3WQ4A 3I68A 3N15A 1ITUA 1K03A 4GVIA 3N3MA 5E9AA 4HMNA 2IQTA 3OYXA 2AQOA 1I1WA 3PZQA 2NV1A 1HFBA 5H91A 3I4EA 2C8NA 3MDUA 4LX4A 3JRKA 3MKKA 1XPYA 3E02A 1HJSA 1FHVA 5DO8A 4R9OA 1GVOA 1G6CA 4JIPA 2HZGA 1K1DA 4GZJA 1UROA 3OB8A 5HULA 5XIMA 3U2ZA 1POJA 3EDFA 2PODA 2VX7A 1UHVA 2BSLA 4NNCA 4M1BA 1MFVA 3H21A 4X2RA 3WQOA 4GBUA 1XQLA 3VIKA 1WPCA 7XIMA 1GG1A 3P67A 4P7QA 4D8AA 3G3MA 1NJJA 3MWCA 1WOBA 4LF1A 6CGTA 3LXBA 3KE0A 3SJ3A 2QEZA 3WLRA 3U4AA 4V2XA 1BGAA 2INZA 4M0XA 1FWHC 3XISA 1H0GA 2WJEA 2DZAA 3NL6A 3WLQA 4B4HA 2I5GA 1GJWA 1EUAA 5A1AA 4IPJA 1P4CA 4XZMX 2VR4A 3KCLA 2OSWA 3LUTA 4L9XA 3MI6A 1LP6A 1VS1A 2AL2A 3MCOA 3LDVA 4GA8A 5CZKA 3HG2A 1X7IA 3OBAA 1X6LA 3WNKA 2B31A 4UZSA 2C7FA 4Q8TA 1RBAA 3EX6A 3UD6A 4WGHA 3APTA 4XZ9A 3MSGA 3UWVA 4B5VA 1B4KA 1TQXA 2HNHA 3W1MA 2IKJA 1U1UA 4S38A 3MUCA 2NXIA 2YFOA 1AQ0A 1PX4A 3UG8A 5C8BB 1Z7AA 8XIAA 3RX2A 2WV8A 4HYVA 4KEZA 3CUIA 3OZYA 3DXIA 3O3RA 4CQ9A 3AZTA 4X0NA 1A5NC 3EMQA 4JD4A 3KOXA 2QGHA 3IK2A 2HSAA 2WVSA 1V7AA 1XX1A 1A5AA 1J0KA 5IRPA 3ARXA 1U83A 4RJEA 3KEHA 3WDRA 4QS5A 2WCAA 2PDIA 3DX5A 4N7QA 1W37A 3IIVA 4EF9A 4GLEA 2V0TA 1TPWA 2WZMA 1X38A 1RAKA 3FYPA 1OFPA 5C9ZA 3AMGA 3PB0A 3F5LA 4TR9A 3K30A 5KITA 2O0TA 3ARPA 1WKYA 2CLKA 1GYMA 2J7DA 4B5UA 3UNTA 1KKRA 4RNJA 4LCSA 3GE7A 4CQDA 1E43A 2PDBA 3QY8A 2J25A 3THQA 3ZT7A 1A49A 4K7VA 4KCWA 4IIHA 3VFLA 1I0BA 3AS1A 3VXGA 3GRIA 2A3HA 3F4VA 1ZJAA 1E9ZB 4PE8A 2QW5A 4K8EA 4MNMA 2VZSA 2PD5A 1ICQA 4O1CA 1H7OA 5A2BA 3PVFA 4TQTA 7REQB 4AD2A 1IGWA 1C7TA 2Y62A 3EB3A 4W4QA 3S5SA 2J6XA 2Z24A 1EP1A 3PNUA 1B2YA 3KVMA 5D2XA 4LAZA 4QXIA 1U1HA 1XG3A 3CV1A 4QEEA 3TEVA 1YPIA 2EKCA 2G97A 1W1ZA 2OYMA 3QKEA 4NVTA 4PMOA 5T9CE 1AL7A 3T78A 1MXDA 4WKAA 2WM0A 2BHUA 2DT0A 3VKJA 4B5WA 3LGDA 3QEZA 2O9TA 4IQJA 1P0EA 4JEJA 4C65A 2QVHA 1XDLA 4X63A 3CLWA 4XTDA 3KRSA 1EZ2A 5U4NA 3C6CA 4O1BA 4RCXA 4ERGA 2OLHA 4B3ZA 1XXXA 1ZAHA 2P1FA 3VDHA 3DFOA 1FH7A 4UQEA 4ZB2A 4S3JA 4N4QA 3CUGA 4I6VA 4OECA 2PMQA 1F6PA 4ACYA 5G1MA 2WC7A 4IP4A 1J2BA 4EP8C 3HV9A 3OO2A 1LWJA 4PUWA 4O54A 4BWLC 3CPGA 4FX8A 3NQ6A 3O0FA 1J6PA 3QKZA 4GPNA 1Q3NA 5LIKX 1JZ4A 3EPNA 4LRTA 3KOFA 1YDVA 4PRTA 1H1YA 4A8RA 1J0HA 4MLRA 1YTKA 3PJWA 1UP2A 4EXBA 3PUOA 3R13A 2I9EA 2BTMA 1BF6A 1K9DA 2VDHA 2FHCA 3ARYA 2QV5A 3MY9A 4RNHA 4AB4A 1XIIA 2UZ9A 4IFOA 2IS7A 2F6KA 4WR3A 1DEDA 1TIMA 3HN3A 3A6OA 1E1CA 4J7RA 5IXEA 4MADA 1TUFA 4P8UA 5BXTA 1DL3A 4M8UA 1OX4B 4DO5A 3EMZA 3R8RA 3UG4A 2Y8KA 1J0JA 1VYSX 2RGLA 3LK6A 1VPQA 1S39A 3L68A 3UXDA 2W79A 4AC7C 4M6PA 3NR0A 5LYRA 1MWOA 1FH8A 2ZQ0A 1GVQA 3S5NA 2A3CA 4LW7A 2Y63A 2WZEA 5REQB 2VL4A 3BGJA 4H9ZA 2XSXA 1O60A 1TWWA 2EG7A 2YIHA 1D3HA 1KBKA 5HQMA 4MMWA 1AVAA 1JYNA 4CVUA 1QO5A 4HK5A 5A3HA 2A1YA 3P84A 1VH7A 1GHRA 4NT0A 1A5LC 4MDOA 1E56A 3AYTA 2RH9A 3C5QA 2VMFA 2V5KA 3BJFA 3CTTA 1HO4A 3SECA 2OEKA 1XGEA 3IV3A 1XRSA 3G0SA 4MM1A 1BYCA 2ZXDA 2GJLA 3FEQA 4Z1CA 4V27A 1R7OA 2R1KA 2GDUA 3CMJA 4DJEC 1A4MA 3GNPA 2F8QA 2QIWA 3QR0A 3ZSSA 4UR9A 1S5MA 4Q8OA 1SPQA 3H70A 3TYAA 3LBOA 5DMNA 1BG4A 5CZSA 3ID7A 1IT8A 2BLEA 3VC5A 4K37A 2PZ0A 3AICA 3ZT5A 1DE5A 3BURA 4I9MA 1QDSA 4CNUA 4WVXA 4YTQA 1JDDA 3AIRA 4D6GA 2WB5A 3B4UA 5EYWA 2WPGA 5LIUX 2ZXBA 3LGEA 3LSBA 3B9DA 2CZVA 1TPVA 4ZB0A 2QLYA 1R2SA 2DSWA 1F3XA 4NJHA 2NW0A 5EMMA 5H6HA 4IMAA 4HP5A 4HK7A 3GC5A 1TRDA 4TTGA 3AMDA 3OQ8A 3ARWA 5K4ZA 3QW3A 3T42A 4XVDA 3T0BA 4WJ8A 1HN1A 3VD7A 2OX4A 3Q37A 3C4UA 4H8UA 1DP0A 2ON3A 3SN1A 2WYSA 1EJUC 4JQ4A 1YYAA 4ZFMA 1IXOA 3H7RA 3W1RA 1RQEA 2VD8A 1WXJA 1U2YA 3M0HA 4LF2A 4PFHA 1OC5A 3ENLA 1KBBA 4DYEA 2DPEA 1OEPA 5I7GA 2WSKA 3I3EA 2NQHA 3TC6A 1UUQA 1TJ2A 3W4RA 4LQ1A 1MQQA 3FS2A 2VENA 2BP1A 2QVNA 3OIHA 3M9YA 3ZJ6A 3W82A 1NSJA 3M16A 3N3TA 1PTAA 1ZGDA 1CXHA 1F6YA 2Y89A 2ZA3A 3S6DA 2P76A 4WX2A 2YDAA 2E77A 3WQDA 2WVVA 3KL5A 1EDGA 3O6CA 3SEPA 2CESA 4X60A 3BAJA 1KM4A 4DHGA 1EJ7L 1CB7B 4IL2A 4XQ6A 2UWFA 4BF5A 3RILA 3V5CA 3GY1A 4UTLA 1BXCA 3ABXA 4IIFA 2R1MA 3QOMA 2OKOA 1RA5A 1KV5A 3WNOA 4IFKA 4ATDA 5JU6A 4HTBA 4UQAA 2W92A 3LG3A 3MUY1 4LBUA 1VC4A 4LUYA 4TVCA 1R2RA 3SY5A 2P0IA 1YLVA 2P8BA 1XLFA 1DIKA 2CETA 3AHVA 3PZNA 4C6QA 1MYRA 4H00A 3AYSA 4IJBA 3V0SA 1M04A 2Z29A 1DBTA 1W3HA 4PGLA 4WHBA 2OLAA 4Q3MA 3ZLGA 3WMLA 1TTIA 1CYGA 3GR4A 1FWDC 3VGBA 3UR8A 6XIAA 1HVXA 2VC6A 3D6NA 1FWJC 4ZQMA 4IQDA 2JKPA 2Q3OA 2QCCA 3GWQA 4O1FA 2BV9A 4IXXA 3TJIA 1W3IA 2QUUA 4GMEA 3ARRA 3IAPA 4IH3A 4CEXC 1F9CA 2P8CA 4F0RA 3GX9A 3LGGA 3WNPA 3NPVA 4PFMA 5EMUA 1EYEA 4UFMA 4NL1A 4XSMA 1TRIA 1KWKA 1PTDA 3BSGA 4NI8A 4LFYA 4LB3A 3DFSA 4LALA 1VRXA 2C71A 2QS8A 1A5SA 3P6LA 2TMDA 1JPHA 4IPLA 3B03A 1ITQA 3KL0A 2VT0A 3QF0A 1AH3A 2YSWA 1P0NA 1SW7A 2W63A 3EOUA 1K9EA 1HGWA 1XLJA 2YA2A 4WK9A 4MY8A 3L4UA 4S3GA 3RCMA 5AB3A 4C6OA 3S2NA 3VZXA 4YTSA 4X0VA 1ZU8A 4GX9A 5GVJA 1TA3B 2VFEA 3TXVA 2A3BA 1RH9A 4WUIA 1B3ZA 2D1ZA 2YCLB 2HRWA 1ZP4A 1XSKA 4NZJA 3UESA 2DW7A 1HL9A 3WFZA 3HGSA 3NM3A 2F7FA 3C2FA 1KBJA 3AYVA 2HVNA 3WJYA 4TX8A 4Q8UA 2FGZA 4Z1AA 4MB1A 4O18A 2Z1BA 3B0VC 2R94A 1ZBKA 5G1TA 4HHLA 4RLIA 2QXWA 2O4QA 3I7QA 3AU6A 2NQZA 3PM6A 1EGZA 1OCBA 4IMGA 4YS1A 1U5VA 1SJCA 2PBGA 4XD4A 3TAOA 2PUZA 1MW2A 3AS0A 5KZMA 2ISSA 4ZB5A 4C6FA 5E70A 3QYSA 1FTXA 1W1A1 4P5UA 4KWUA 4LUIA 4GYPA 5BRBA 5TBOA 1E9LA 3W2KA 3BC9A 2OYLA 1P48A 4ADTA 5CC5A 3L5AA 3U2OA 3CL8A 4Z08A 4JL1A 3FGCB 4QE4A 1A3WA 4UQDA 1EDTA 2VCCA 1GJUA 4GIAA 2Z27A 1A5UA 4XISA 2P50A 2KAUC 1D8WA 1TV7A 4NJIA 4G1NA 2Z2AA 5CPTA 4RNFA 4LVAA 4MYXA 5G4EA 4GCXA 3S6TA 1DORA 2ZE0A 2V63A 5DEZA 1GZGA 4H7CA 3G18A 1CLXA 2GSJA 1Q7MA 4UQ9A 3SUVA 1UR1A 3LQGA 3PJUA 2VC5A 2FPTA 2JF6A 2OTDA 1SZEA 1LOSA 3DIPA 4DLFA 4KFPA 4Z17A 2XM1A 1KCZA 2V3FA 3TYEA 5A2CA 3C86A 4CNNA 4JHZA 1GT8A 3HA1A 3NL2A 1XDJA 1FH9A 3B0XA 1PDYA 1MDRA 3TR9A 1JGIA 4BI7A 1HKJA 4LUTB 2QCFA 3V35A 1QBAA 5HQEA 1TCMA 3LOTA 4FALA 1EP2A 2POTA 4HZ6A 2VRQA 4PRRA 1BXNA 1HF6A 3S9ZA 1M3UA 3S0CA 1GQIA 1GQNA 2QCLA 3TC3A 3LHYA 1BKHA 1RJPA 1W56A 3KXQA 5GNZA 3GHTA 4R34A 1XBVA 1BGGA 1XQKA 2YBUA 4FXFA 1XS2A 5JQ9A 4NNAA 2WSQA 3KOWA 1VPYA 3MMUA 3KBSA 2G4FA 1ZPTA 4V33A 2NWRA 4DO7A 4G7FA 4PCPA 4D1JA 3WJSA 4RXGA 4U33A 1LG1A 4UFLA 3HPZA 4H19A 3SUSA 1CXEA 4GYJA 3DG3A 3HIJA 4F48A 5C2CA 2ACUA 3GNRA 1H60A 4J4KA 4DBDA 3AUJA 3NA8A 3GXTA 3Q2DA 2VYOA 4FNSA 1JPKA 2GQAA 5AC4A 2NQ5A 3P74A 1EIBA 2OR2A 4FHAA 4GUHA 1H0IA 2E67A 1KWGA 4W8AA 1EUNA 4YHEA 1KFLA 3VIFA 4JKKA 4CQCA 2JEQA 4AZ7A 1N7KA 4O57A 1QCWA 3HPFA 1DJXA 1YKWA 2DUXA 4M7TA 4GFIA 2J7EA 5I09A 3IAQA 4AW7A 3W1LA 1FOBA 3RHGA 5CPQA 1FKXA 1ZS2A 2IXUA 1VRDA 1XYMA 1B1YA 3PNZA 1DJZA 1UZDA 4Z42C 1TZ9A 2G3IA 4PZVA 3V3WA 3U5UA 2WMIB 3DU0A 3MP5A 1VIWA 1H7NA 5B7ZA 1YTDA 5JIWA 1YDYA 5I23A 2ZRVA 4QTGA 3M5ZA 2J24A 5BWFA 1G01A 2WVTA 4OE7A 4KCVA 1R3RA 1E73M 4DJDA 3R94A 2QCGA 1J93A 1LOLA 2X7VA 3NPWA 1PAMA 3BK0A 2DFAA 3MA8A 1PDZA 1DJQA 3WLHA 3TQ0A 2I57A 3RR1A 5REQA 1ZTVA 3KOYA 3UFYA 5K2ZA 4JX5A 4ZMGA 2YB1A 7ENLA 1A80A 3K5XA 3CTLA 3GXIA 3LENA 4CCDA 1E71M 1RLCL 3TW7A 2B7PA 5ABFA 4IG2A 3N14A 3KLKA 5FJJA 1UKOA 1OADA 1K9TA 1EH9A 1JNEA 1OC6A 3NDYA 3NQ7A 4XD3A 2E09A 2C19A 2GVJA 1TG7A 3LY0A 1GVSA 2E28A 3MP3A 5T8GA 1V5XA 2DUZA 5LNVA 5G1YA 1SU5A 3O8AA 3V7PA 4L4LA 5LXXA 1MXSA 3GU2A 5MHBA 5HA7A 2OB3A 4K68A 5CZJA 4BJHA 3OJGA 3VNDA 1R0MA 4AZCB 1LRNA 3KW3A 4IGHA 1A5OC 5L9FA 1P43A 3CUHA 3IPWA 1LL7A 3N2MA 4XUYA 3EWYA 1KRMA 4X61A 1A3HA 3C2YA 3SCNA 3WMCA 4Q6XA 4RR4A 4FNQA 1M68A 4BI5A 1W5PA 3BW2A 1RVGA 1AQHA 4F9DA 3E96A 4NP7A 4XZIA 3GTFA 4X9SA 4HTYA 3AHZA 3DFHA 2ZICA 4ADUA 1HG3A 4C6IA 2QCHA 3PG9A 3GBEA 2Y8VA 4XKYB 5CZTA 1L8PA 4B2DA 2HMCA 4JTSA 3LNMA 2J75A 4GVHA 3CU2A 3H2OA 1XYLA 2QHAA 1BQGA 3AXHA 3ZVHB 4WF7A 5AN7A 2B7OA 2YLLA 1YX1A 5E6ZA 1AUSL 3RX4A 4HYRA 4UTHA 1Q2RA 2TSYA 3EOSA 2R91A 4C7GA 2E25A 1R3WA 1J5TA 2J27A 4UTFA 2VHLA 2HV5A 4LCRA 2PDPA 3GNOA 4EOUA 1A5CA 4R5EA 1VFOA 2PDKA 4CD8A 1XINA 5M17A 5B7YA 5JVLA 4NJJA 3L4ZA 1V3KA 3ABSA 4J3XA 2ZADA 4P8WA 4J5NA 1NOFA 4QISA 1D2KA 3UZWA 3LLDA 1UQZA 1V0MA 3F03K 3M43A 8CGTA 3W88A 1KFKA 2D20A 3GDTA 5LNUA 2OYKA 1ODZA 3HF3A 1QNRA 1TQJA 1BPLB 3T05A 1W8GA 2NT0A 1GOIA 2V5DA 1G69A 2JGYA 1KFBA 2FGBA 2XHYA 4S23A 2XGIA 3N12A 4NZCA 1C29A 4GACA 4JQ3A 3BAXA 4M7SA 4PTWA 3S83A 2VRKA 3OVGA 4Q4KA 1C9WA 2AAMA 5DQPA 4ERIA 4W88A 4W8BA 1H51A 1F4AA 4ZO8A 3P0XA 3B8TA 4PMRA 3N4EA 3IJ7A 3MBDA 1DXIA 4M6QA 1WCGA 2J78A 1TWZA 4QG6A 3TK7A 3KL3A 1EX5A 4A35A 1PB0A 3GTNA 3IRDA 5C9RA 1UC4A 3OU8A 7CGTA 4OV9A 3KRZA 2OEMA 3OG2A 3ZWSA 4LV9A 2IPFA 4ERAA 1OSEA 3H4GA 3CMFA 1WDPA 3UZJA 4S39A 1E4LA 3G1RA 4XKMA 1QU4A 5BRPA 1HVQA 1QNOA 3B40A 1WX0A 1ZHAA 3R4IA 4JDYA 4JTTA 1F7BA 5BOFA 1QR7A 3VKDA 2VX4A 2E9LA 3U2EA 1ZLPA 5I77A 2X1TA 2V9DA 3DUGA 3R10A 3RLVA 3NQMA 4KEVA 1JAEA 2PDXA 3CL6A 3MANA 2G95A 1W6TA 4C1NA 1R38A 2X05A 3TTYA 2YDRA 4ML4A 3E6EA 3B9OA 3TH6A 5D9MA 5FA5A 2QJJA 4FOKA 1V93A 4K2SA 1R7AA 4EAYA 4IM4A 3H55A 1OGGA 2PCQA 1O7AA 3KOZA 3G3DA 4CCCA 5HQLA 1TVNA 1RK5A 4NU7A 1GTHA 1R47A 1P0DA 2V67A 3LMZA 1KB3A 2PPGA 3DC0A 1M03A 3TP4A 2CW6A 3GU9A 1XR2A 2ZCGA 3MU7A 1EZWA 3P82A 1KFCA 1SR9A 3HV8A 2HQAA 2G41A 2QKFA 4AU0A 3UNDA 3CLMA 1PZ1A 2OZTA 4P7RA 3QW4B 3CC1A 4RV3A 2VX5A 3AIQA 3PAOA 1MZRA 3RM4A 3GBDA 1U5HA 4GVFA 3RMJA 1MEIA 3EKGA 1FWNA 2C91A 4MAVA 4MPQA 1ZJIA 2PDJA 4DI8A 3AIWA 3W1QA 1TA3A 1H5VA 1R3TA 2FZ8A 1XIDA 5FJRA 4CQAA 5CQ1A 5HINA 3UGVA 2QJIA 2XZ9A 1TV3A 2PWDA 2YCLA 4Y8EA 4F9JA 3A13A 1E0WA 4PUJA 4MOZA 3QHNA 1X6UA 4GY1A 1EF2A 1Z89A 2R14A 3KTSA 3ZR4A 3W22A 1U30A 3NO5A 5CG7A 3S3GA 4B5XA 2ZX7A 1R85A 1OFBA 1LDCA 1KM6A 3WY1A 3WBYA 3NQAA 5C2XA 5KZEA 1BWVA 2Q8XA 2PGRA 4LT9A 4GO8A 3RX3A 4GC3A 2DDXA 2BVDA 1XRFA 3BLIA 1VJSA 1O68A 3O6DA 3LPPA 1AD1A 2Q3RA 1Z42A 3N19B 4AVOA 2WBGA 4Q22A 1BEUA 3MUAA 4PBFA 2ZUUA 1B3OA 3LCIA 3C0SA 5G2HA 2PDFA 3G8RA 3I7SA 1IIGA 4AIUA 1ZRQA 4IXHA 2W9MA 4JN6A 4GI6A 1NELA 3ZS4A 3GXNA 3RPDA 1EP3A 3HOJA 4AFYA 2ZVRA 3W1UA 4CNSA 4JYDA 3V5FA 2YDQA 3C2RA 1JZ2A 3CQKA 1TPUA 4QITA 1TX0A 2H8ZA 1PWMA 4UMAA 2ESCA 4GH3A 1KFEA 1KGUA 3OGRA 2CLFA 2VWTA 1SW0A 3UY7A 4XZNX 3VUPA 4G7EB 3UWEA 1UWAA 3GHRA 1VFLA 3CS2A 2XSAA 4PTVA 1W3TA 1DJNA 1GVIA 5BOOA 4I7VA 1ZCOA 1H7WA 1G4EA 4OVXA 4PTNA 4W85A 1Y5VA 4EVZA 1SZNA 3LTSA 3GH4A 4LVBA 4IGSA 3R0KA 3USBA 1LQ2A 3STCA 4LUTA 5FL1A 3TTOA 2YCEA 4AVNA 3S6OA 4KFNA 4MG4A 3CAVA 3RITA 1J11A 3NQEA 2E6AA 4I5XA 2OFJA 4MDPA 1B30A 1M5WA 4QROA 3FLUA 3KZPA 3LX9A 4DO4A 3EX2A 3UT0A 1R3QA 1UWUA 3CPRA 4UTTC 3NVDA 3QH2A 2AQVA 2GOUA 2GPTA 8XIMA 3P5ZA 2Q09A 1FWCC 1PWLA 3GYEA 1RP8A 5IFPA 3RDKA 5CGTA 1X6NA 3WK2A 3I10A 1OX5A 2QV4A 3H2AA 1UCWA 1QNVA 3UA3A 5HNNA 3LCGA 2PWHA 4LANA 4AIOA 4BQ2A 1E5NA 1UZ4A 5CGQA 3VMNA 3KUMA 3IUIA 2DGAA 3KHDA 4FF7A 4E4UA 5LGZA 3E2VA 1XLBA 3DKJA 3MCNA 3ZJKA 4JN7A 1FHLA 4HNCA 1F2JA 3TJ4A 4BQ3A 2ASHA 2DQXA 4ZOCA 3E2SA 5RUBA 3MVIA 1KR0A 2AKZA 3BPWA 1NWTA 2VZUA 2C0AA 2EEXA 5F1VA 1KM0A 1LT7A 4XD5A 1P0KA 4KWWA 2ANUA 3WQVA 1C91A 1LWHA 5TNVA 4DY1A 1NWSA 3WUGA 3VGGA 3LV5A 2WLYA 1XH1A 1KC7A 1EQCA 2HBXA 2A6LA 4ZSUA 3L4VA 2ZOXA 4FMVA 2WMIA 3VK5A 4B5SA 3C2EA 3CHVA 1JDAA 3G24A 3FA5A 1IT7A 1JCYA 3WH9A 1JCMP 1US3A 3M41A 4L6HA 4CU8A 3VUSA 5IFTA 3NZPA 1RPXA 2G96A 3N1AA 3LERA 3N6QA 4DF0A 3EWWA 3A4AA 1OCNA 1PZ2A 3E5BA 4Q8WA 2PTYA 4BCEA 4NIRA 1PX8A 5IOBA 3W85A 1UR9A 1T7LA 4C7DA 1W2PA 4LVFA 1S2CA 4O0KA 3TXZA 1FCBA 4E0CA 3RR4A 2NSOA 4FNPA 1DTUA 1QASA 4XK2A 1G0CA 4B4FA 1VJZA 1QOXA 2Y5JA 1Z69A 2C16A 2B4GA 3EA2A 4Y2WA 4DUVA 4J3TA 1XH2A 4XAFA 1K4GA 2Z00A 3RPTA 1FWSA 3ME3A 2BWGA 1YIXA 3WEMA 3MJMA 3O15A 3WF3A 3QV9A 1VF8A 4UNIA 2J47A 9CGTA 1VBHA 1Y5WA 3M0VA 4GUFA 3CUZA 3NYZA 3HURA 1PO9A 4JS3A 4GXWA 1G7UA 4CD5A 3DEQA 1FWAC 1DIOA 3IK4A 5CBBA 1BAGA 1TJRA 3DERA 3IJ6A 1DWFM 3AIUA 4FS9A 2ACQA 3MP4A 2FDMA 1B9ZA 1U1JA 3RMEA 1O5KA 4DUXA 3ZVHA 4LS2A 1IYXA 2CYGA 3TLLA 1K70A 4HMEA 4NAFB 5BU9A 3N2OA 3K8KA 3TMQA 4JHMA 4H2CA 1E40A 1K9FA 3PZGA 1BF2A 1CXKA 6ALDA 1LRTA 1AQFA 4DZIA 1W9DM 3CJPA 3WD0A 3DBPA 2DW6A 4LAUA 3AI0A 1ZNNA 2Z1WA 1UKSA 1UBPC 1GZ1A 3E38A 4I9JA 1C93A 5ECUA 1ME8A 4W86A 1TZZA 4J3WA 5F4XA 1UD3A 5D32A 3RJYA 3KVLA 4IPNB 1M7OA 1H50A 2CERA 3WMBA 2E5DA 3VE7A 5ABGA 3KZSA 2B7QA 1O5QA 4O0QA 2YX0A 4JQAA 4GBDA 3PAJA 1EC8A 2ZIDA 1MMFA 3ERPA 4O19A 3PULA 1NP0A 4AMCA 2ZUTA 3W84A 1PS9A 2ADAA 3U5YA 3HGOA 5D37A 1E4NA 1JI2A 1CIUA 3OGVA 3AXMA 3L5MA 2VZOA 4EX4A 2XH0A 2DZUA 3GUWA 1BRLB 2Z6IA 5H2ZA 1LT8A 3UJRA 3ELFA 3SN0A 2IKGA 3QGAC 5K7JA 4GNKB 3TA9A 4OUIA 3NQGA 3HJEA 3W7IA 4NHVA 4WDTA 1ECEA 2VKZG 2D0GA 2PB1A 4DB7A 3I6RA 4Y90A 2BBFA 3E74A 2A21A 3F5KA 2OZ0A 1LQAA 1ONWA 5CPNA 2PRMA 3SCWA 1UW9A 4R9XA 2WW5A 3T0DA 3AS2A 3EOLA 3W07A 2Y7EA 4Y9NA 1V7YA 4WKFA 4HN8A 3BE7A 1YXDA 1KM5A 5I3JA 3IUHA 2PLMA 3BG3A 3PZIA 2H3BA 1EWEA 5HANA 1QUMA 2XTKA 2HVMA 4PMDA 3VOFA 3XIMA 1JCTA 5G4HC 1XIEA 1HKIA 1NTHA 3S5ZA 3UQNA 1KM2A 2HCVA 4MB3A 2GUYA 5BWAA 1HT6A 4DBWA 1EB3A 1O1HA 3GO2A 1MUMA 3OA3A 5F2GA 3G2GA 2ZRZA 3AIEA 5L6UA 3RG6A 3SW6A 2ISWA 3IJLA 4IICA 5M3WA 4DM1A 1GQKA 1UOZA 4HB7A 3NJ3A 4DNHA 4ATWA 3M7WA 1SSGA 3CWNA 2Y6ZA 1LLZA 2YZ5A 4O12A 1YPFA 4GYFA 1AA1B 3WF2A 1RALA 3C56A 1B0IA 1ITCA 3G1AA 3QMRA 1TPC1 3ITVA 1WXYA 1FWBC 3TVAA 4LEFA 2NWSA 3CYJA 4HCDA 2POZA 1Q6EA 4H6KA 2ZRWA 3D5HA 2PGWA 4PMQA 2WK2A 4Z2KA 3F7JA 4B92A 2PBOA 4O52A 3GNXA 3AUOA 4G56A 2OX1A 3A22A 2IXVA 1VEMA 1XP3A 4G8TA 3MO7A 3AJXA 3DFYA 5C9XA 4Q32A 3U3HA 1OFOA 1W0MA 5I3FA 2OQLA 1OIFA 3QQ1A 1PKLA 5M03A 4K36A 1VZWA 3LS9A 1QNSA 1IEWA 5U7SA 3CASA 3WLKX 3NOYA 3DHFA 1EJTC 4XSLA 4KWSA 4QEHA 2I9UA 4G6CA 1GCYA 2XDFA 4XIAA 3HFTA 4Y7EA 2D22A 5IHRA 1CGWA 3SFKA 3V75A 1AK5A 1ZSXA 1NOWA 4EXQA 4EXAA 4FLQA 3VGDA 1XIMA 4QHRA 2J7HA 4DJFC 2NXGA 4DWSC 4AUBA 1XLKA 3VPLA 2HVOA 1VEPA 4E2VA 3M7SA 1QW9A 5DANA 2YA1A 4K1GA 2VEPA 4IP7A 2I7GA 4IX2A 5H1WA 4NZ4A 3OG3A 4N6FA 3FYOA 4LRSA 1HL8A 3TUUA 2Y8UA 3H6OA 3B8SA 5HR6A 2GGGA 3ANVA 3TCSA 3ZOAA 1MUCA 5A2AA 4M6VA 1Z48A 4QJ3B 1YRRA 3TWAA 1H09A 4M5PA 1VBJA 3CWOX 1EKOA 2VWSA 1QW7A 5FF2A 1Q65A 5LHEA 4G5DA 4OV4A 2CNCA 1GGOA 2NQLA 2ZUSA 4RPPA 3SCPA 2CZDA 3EDJA 3AWNA 3S8HA 1FFRA 3OLGA 3TN3A 2D2HA 2D23A 2FB3A 1GW9A 4R88A 3A24A 3OVPA 1KBLA 4GG9A 3R58A 1V3MA