3WCZA

Crystal structure of bombyx mori aldo-keto reductase (akr2e4) in complex with nadp
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
307
structure length
307
Chain Sequence
b'AVQAPCIQLNDGNTIPIVALGTGRGTAKESDSIDEVRQAVYWAIEAGYRHIDTAAVYQDEEQVGQGIAEAIANGLVTREELFVTTKLWNDKHARDQVVPALQESLKKLGLDYIDLYLIHFPIATKPDDSPDNIDYLETWQGMQDARQLGLARSIGVSNFNATQITRLVSNSYIRPVINQIEVNPTNTQEPLVAHCQSLGIAVMAYSPFGFVVSRGQTGAPPPRSDDPTLTALANKYRKSVGQILLRYLIDRGLIPIPKSTNKQRIAQNIDLFDFQLTFEEVAAINQFNKNHRVIDISDWKDYPNYPN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase 2E
publication title Identification, characterization, and crystal structure of an aldo-keto reductase (AKR2E4) from the silkworm Bombyx mori.
pubmed doi rcsb
source organism Bombyx mori
molecule tags Oxidoreductase
total genus 111
structure length 307
sequence length 307
ec nomenclature
pdb deposition date 2013-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3wczA00
4FALA 2AGTA 2WZTA 4R9OA 3LENA 2PD9A 2BGQA 2PDXA 1S2CA 3CAQA 3C3UA 4QR6A 3U2CA 4Q3MA 3V36A 5LIYX 2PDQA 2IS7A 5HA7A 4WDWA 4JQ3A 3Q65A 2ISFA 1S1PA 3R7MA 4JTDA 3V35A 1PZ1A 4PR4A 4G5DA 3UZWA 2CLPA 2INEA 4GABA 1T41A 2ACUA 4YVVA 4FZIA 2IQ0A 4ZFCA 3FJNA 2I17A 4GIEA 4WGHA 2IPGA 2F38A 4IJRA 1QWKA 3UZYA 2HDJA 2PZNA 4LB3A 1A80A 3GHTA 3R8HA 3F7JA 3MB9A 2DUXA 3O3RA 4LBRA 4DBSA 3GHUA 4DBUA 2PDCA 4DZ5A 2FZDA 3B3DA 3R94A 1M9HA 4H8NA 4YVPA 3M0IA 4PUWA 3CV7A 1EL3A 4EXBA 3FX4A 4GQ0A 2ACRA 4XZMX 4I5XA 3Q67A 2HEJA 3VXGA 5JH2A 3EAUA 2R9RA 3R58A 3EB3A 4XAPA 5HNUA 5HNTA 3D3FA 2PDYA 3GUGA 4GACA 5LIXX 3T42A 4JQAA 3LQLA 3BUVA 4HBKA 4WDXA 3S3GA 1AH3A 4GA8A 1YNQA 3UFYA 2DV0A 1MI3A 4PRRA 1AH0A 2IKJA 4LBSA 3GHSA 3UP8A 5LIUX 5LIWX 4XZNX 4JQ1A 1GVEA 1IHIA 3CV6A 4F40A 1YNPA 2PDPA 2PEVA 3KRBA 3COTA 1XGDA 2HV5A 2R24A 2J8TA 1EF3A 2HVOA 3R43A 2NVDA 3R6IA 4XK2A 1IEIA 1EXBA 4XZLX 1ZSXA 3H7UA 4FA3A 2PDNA 4XO6A 1S2AA 3WBWA 1AZ2A 2PDLA 4XVDA 3UGRA 1X96A 4QBXA 4OTKA 2FZ8A 3UZXA 4NKCA 3UZZA 1Z8AA 4GCAA 2PDGA 1RY8A 4ICCX 3WG6A 1YE4A 2PDIA 1EKOA 3RX4A 1S1RA 4H7CA 1PWLA 3UG8A 3NTYA 3N2TA 4IJCA 2DUZA 2ACQA 4JQ4A 4JTCA 1SM9A 4WDUA 1Z3NA 2FZ9A 4JQ2A 5M2FX 1MZRA 3MC5A 4LAZA 4XO7A 2PDWA 1UR3M 4L1WA 3RX2A 3ERPA 4DBWA 1YE6A 2C91A 2WZMA 3UYIA 4LB4A 1ZGDA 3LEPA 4XZHA 4YVXA 1ADSA 3CMFA 1T40A 4JIRA 2PD5A 1AZ1A 2FGBA 2VDGA 3G5EA 4JTQA 1Q5MA 3M64A 3RX3A 1AH4A 2P5NA 1JEZA 1R38A 1ZUAX 3WBYA 4JTRA 2QXWA 3BV7A 3BCJA 2IKIA 3H4GA 1MRQA 5KETA 1X97A 1ZQ5A 4IGSA 1QRQA 1PWMA 4PRTA 4L1XA 3EB4A 1C9WA 2FZBA 4MHBA 2IPWA 4YS1A 2NVCA 2IQDA 2PDBA 3UWEA 4JTAA 4JIIX 4GQGA 2HE8A 3CASA 3WCZA 3GHRA 1RY0A 3WBXA 2PF8A 2PDJA 3N6QA 1VBJA 3P2VA 3V0TA 2PDHA 2IKGA 3ONCA 2PDMA 2F2KA 3V0SA 4FAMA 1XF0A 1LQAA 3DOPA 3G1RA 2PDFA 1AFSA 3DN5A 3O0KA 1K8CA 2A79A 4XVEA 4QXIA 1LWIA 1US0A 3LZ5A 2IPFA 4WEVX 1XJBA 1HQTA 3LD5A 2HVNA 4AUBA 5AZ1A 1Z9AA 4WDTA 2BGSA 4PUUA 2PDUA 5C7HA 4ASTA 2PDKA 1Q13A 2PFHA 2INZA 2IPJA 5JH1A 1PYFA 4WRHA 1J96A 1FRBA 4JIHA 3V0UA 1VP5A 1X98A 4Q7BA 3H7RA 4LAUA 3CAVA 4XZIA 1Z89A 4QX4A 4YU1A 2ACSA 2IKHA 3LBOA 4HMNA 4RPQA 5LIKX 2ALRA 3LUTA 3R8GA 2HE5A 1OG6A 4EXAA 1RALA 2I16A 4PMJA 2FVLA 3M4HA 3LZ3A 1HW6A 3ONBA 1PZ0A 3QKZA 2BP1A 3LQGA 3LN3A 3LNMA 5DANA 5AZ0A 3BURA
chains in the Genus database with same CATH superfamily
3LBCA 3SO7A 2Z1KA 4UIOA 1W2PA 1D3GA 1K9EA 2XM1A 5E5CA 4HYRA 3UXDA 4OE7A 1PS9A 5D9OA 3H2EA 4CN4A 3GQYA 3U2CA 3TTSA 4FMVA 2NT1A 1K1DA 2DVUA 3T40A 1XC4A 3JZEA 4Y9PA 4ZOEA 3EX4A 4ZQPA 4C6QA 1GJWA 4YTSA 4I9MA 5F2MA 4AEFA 1B5TA 1AK5A 1KFJA 5K7JA 1P48A 4JZ5A 3B9OA 4N6FA 3BJTA 4F8XA 4GIRA 3IIOA 4GIEA 5K9XA 3U0HA 1O60A 1XD0A 4Q4PA 1HVQA 3GIQA 3W2MA 1GONA 2PWVA 4TTGA 5A6AA 1I60A 3H6OA 3BL3A 4O8AA 3FEQA 5I00A 1ZP4A 4GVIA 3I3BA 1SFSA 3GHUA 1QOPA 2J66A 2J9YA 1QNPA 4XQ6A 5E0CA 3NM3A 3S2JA 4AZ6A 5FAJA 4EE9A 2QUUA 1K70A 4OECA 3M46A 2FMNA 2X09A 4UCGA 2R94A 3PY2A 4HMEA 4O52A 3SJ3A 4DWDA 1KGXA 1VRXA 1TKKA 3WNOA 4MVAA 3OQ8A 1ZJAA 4WKFA 5JH2A 3MV01 1JPDX 4JFUA 3CQIA 1ZJBA 4I7WA 5BU6A 3CQJA 1LT8A 4PEKA 4LVGA 1XLJA 1E4LA 4JHZA 4J40A 3S6DA 1V6YA 1XQLA 3MT1A 1GHRA 2CBUA 2OWWA 5JIWA 4XKYA 4MKSA 3REQA 1V6VA 3UD6A 2V5CA 1QDSA 4H8VA 3AS2A 3W7MA 1FVPA 4G7EA 4MFEA 2QVNA 1YXYA 4MZ8A 4UCFA 1QWGA 4J2MA 4DB7A 2DQWA 3HV8A 1VFUA 3FV9A 3A9BA 1GVEA 1XYAA 3L4WA 1F3WA 1MEWA 2PC8A 4AZCB 5F4XA 4NASA 1K9DA 4KEZA 4MNJA 4QAWA 4JTGA 1CENA 3FSUA 1OY0A 2R24A 3VPLA 3FA4A 4FLSA 2XFFA 4EP8C 1FWEC 1JUKA 1M6JA 1WYIA 4DNHA 4LUTB 2BFGA 1W8SA 3MWAA 4PSPA 4XVDA 1NVMA 1J18A 4QJ3B 2W5FA 2X41A 2VGGA 3TN5A 2I5QA 4HU4A 3WH9A 1ELSA 1UASA 4D6DA 3FYYA 2IQTA 2X16A 1XIGA 4H1ZA 2PTWA 3QN3A 1ISXA 1KLYA 1US3A 1JULA 1DYSA 2XFRA 1E51A 1QNQA 4J28A 3FAXA 3ZJ6A 3AS1A 5FCZA 3GZ3A 3MCNA 1QR7A 2FZ9A 2ZRWA 3EEGA 1A3WA 1XV8A 4PCNA 1SZGA 4X61A 3DC0A 3NYDA 4S39A 4J3XA 3HG3A 4MFDA 4V15A 3ZMRA 2OELA 4LB4A 1PV8A 3LEPA 3BSGA 1ADSA 2H90A 3VD3A 3URBA 3UXLA 3P80A 4LVFA 2VDGA 1A4LA 4AHOA 4N02A 3W76A 2Y7FA 5MF5A 1R38A 1X1OA 1M68A 3G6LA 3BLOA 1SFJA 4JTRA 3H21A 4AZBA 5C6MA 5FL0A 1KBLA 2WSKA 1UD5A 4IGSA 3TJLA 4LUSA 4DIAA 1VPXA 4HB7A 3A3XA 1W1PA 3G8EA 1OFOA 3W25A 4PUEA 3TC3A 1OGSA 3WL0A 3RPDA 2EKGA 4Q8TA 3PK7A 1OCQA 5EMJA 3BWWA 3U8GA 1ITXA 4DLFA 1NF7A 3ONCA 3S2LA 2ON3A 2ANUA 1Z32X 3M47A 4FAMA 1XF0A 3DOPA 1TQXA 3SY1A 3G1RA 2PDFA 1PCWA 4XUYA 3IARA 3L5AA 4JXCA 1T7LA 3AU2A 4O0ZA 1XRTA 3OEXA 5G4HC 1H63A 1HN1A 4XVEA 1PPIA 1V6XA 4RLIA 4ACZA 5HMFA 3AWOA 1Z9AA 3LLXA 1ZBKA 4GI6A 4O19A 2BGSA 3N13A 4U4MA 5D2WA 4PMZA 3VCRA 5A8QA 1FWNA 4KRTA 1J96A 3W23A 4DUWA 4KFOA 3QJAA 4LAUA 4O4WA 4FR1A 4FNTA 1XLBA 1FCBA 1EJUC 2DJLA 2YB1A 3MY9A 3PFRA 1EJ7L 2E6FA 3L65A 1KD0A 2HE5A 1W1A1 3WNLA 4AD2A 3BAJA 1SR9A 4K8GA 2YZ5A 1JQXA 2XIMA 5HWJA 4GFSA 1VH7A 3W6LA 1QHZA 1BTCA 2C15A 4M19A 2CW6A 1OYAA 4MM1A 4WLCA 3TWAA 4EVZA 4X22A 5A6LA 2ZTJA 3MCOA 3MP5A 2OMAA 5DANA 2Q8ZA 4P7NA 4R85A 1QATA 3I7RA 4MNLA 4JYEA 3EBVA 1DORA 1PKLA 3JRKA 3S1UA 1XLKA 4RZ5A 2DQXA 4O57A 5EY5A 3G3MA 1BSIA 6XIAA 3VOIA 3MS8A 2BSLA 4DQWA 3GG7A 1KM5A 1Y5XA 3UXIA 4EWJA 5IBXC 3GXDA 1JF6A 4Q8OA 4GUHA 1KFKA 5IFTA 1PZ1A 2A0NA 4TV6A 4DF1A 2D24A 3UZWA 3L67A 2GGEA 4I7UA 3AYVA 1Y5VA 2JKPA 4FZIA 1TUFA 3KBVA 4HTBA 3I3EA 1B31A 3VIFA 3VZXA 1XUUA 1H7OA 3BLPX 3GR4A 1OFEA 3VD4A 5CBIA 2VURA 2NV9A 1BQGA 1KTBA 3AIUA 1P0DA 3UZYA 4B5TA 1IZJA 3QTGA 2PB1A 4ZGYA 3SUWA 1A80A 3R8HA 3DFQA 4LNYA 1ZAIA 4NJJA 2RDUA 2ZOXA 3W86A 4DO6A 3KRZA 3I3DA 1AW5A 4LBRA 1Q8AA 2BOGX 1OX5A 3W1NA 4PB3A 5A2AA 5C9UA 3IJIA 1B3OA 3ITLA 3QPYA 3RRXA 1NAL1 1NWTA 1R87A 4LFYA 4QNWA 3V18A 1IT7A 4HQVA 4QLJA 3T4CA 4DJDA 4NP7A 1WZAA 3GAYA 4N4QA 3AIEA 4W7VA 1OCBA 5C2XA 1KV5A 3ENLA 3EAUA 5HR7A 1R46A 2P0OA 4Y9AA 4QJ4B 1JZ2A 6REQB 3UG3A 4XAPA 4U33A 3G0SA 2EAWA 5HMDA 4GACA 4O17A 3G24A 1UR0A 4YN5A 3BGGA 2NX1A 6ALDA 3AS3A 3T05A 1YW1A 4FLRA 2YGYA 4XIMA 3IEBA 4M6QA 1UB3A 1YX1A 4WDXA 4WGXA 5IFPA 4MTVA 4JFVA 2BGNE 2DV0A 3IRSA 5CAHA 2YX0A 4RUBA 1TPUA 3MVIA 5E0FA 3GH4A 3GFXA 3K4AA 1W9UA 4NZ3A 3KE0A 1IHIA 2EF9A 4L65A 4UNIA 3QV9A 2W63A 2MUCA 2WV8A 3CO4A 5A6JA 1EFZA 3MDUA 1U83A 3T6CA 4F3HA 1NWRA 3W82A 1ZP3A 1S2AA 1IR2A 3UERA 1HGYA 1XBYA 4OTKA 1AQMA 2VR2A 1UH2A 1XYLA 4ICCX 3E2RA 3WG6A 3V5FA 3ATZA 4KCTA 5DT7A 5KITA 1VEOA 1DBTA 2EPMX 3IV3A 4ROPA 1A3HA 2CETA 4GUIA 4HHHA 3N11A 4KGJA 2ABBA 3PPHA 5A94A 1MZHA 1SZNA 3QHOA 2PP1A 3L4XA 1SM9A 1K8YA 4ZE5A 1BYCA 3VIIA 1ENUA 1HL2A 3TCSA 3H7VA 3MC5A 3VKBA 4LAZA 3LCFA 1WUFA 4DBWA 3KXQA 2AKZA 1A5LC 4A2RA 4E38A 2A3BA 4ADTA 1W8GA 3WFZA 2XN1A 3R12A 3E0IA 1ICPA 2ZQ0A 4G6CA 4QRNA 2F2HA 4WXYA 2OQHA 2OT0A 4JGDA 4IPNB 1AD1A 1EUAA 3DHFA 2I5GA 5D33A 4F0LA 2ZBTA 4MNMA 3WQ8A 4F9DA 3KX6A 2JGQA 4KCWA 3N2XA 3WBYA 4AD5A 1DJZA 1K6WA 1XIJA 4EF9A 1IEQA 3U57A 2WO5A 1VC4A 3R89A 3B8IA 3WLMA 3WF4A 1LT7A 4B5VA 1U30A 4MB1A 5DRCA 3T2PA 2ZYFA 3BGJA 3S46A 1A0DA 2IXVA 2VEFA 2XWEA 3E0VA 4TIMA 4KWSA 1PEZA 4CCCA 3T0AA 4DBDA 4Q7NA 3OBEA 1V4YA 1DWJM 4RXGA 3V0TA 5KMYA 1NDVA 2BASA 4LQ1A 2A7NA 2GGIA 4JFWA 2BY0A 1AL8A 2Y0FA 3LSCA 3WD3A 1A3XA 1W3TA 3AU6A 1J2BA 1VYSX 4IZGA 4P7OA 2Y63A 3M44A 3AXIA 1TWWA 3R25A 4J3VA 2PSNA 3C86A 4JY9A 1DP0A 3BARA 3HG4A 4GI9A 1P1XA 2P0IA 1XKJA 4KCVA 3QFEA 4JDBA 3SCSA 1C93A 1TE1A 4UTTC 3NCOA 3GDBA 5AHEA 1TWIA 3DYMA 3UA4A 3DUGA 4UNLA 1W5PA 4IMGA 5CGQA 4UWMA 4ATDA 3O06A 4DEFA 4AWSA 4CQCA 3AYSA 3CV2A 4DM2A 1FBAA 1LOQA 4OKDA 2WWCA 2XWDA 2GJNA 3G3DA 1XLGA 2DZVA 1VD6A 4PCSA 2B4GA 3ZQ9A 3SY8A 1GQNA 4Y9MA 4PB4A 3MI3A 1EO5A 1IIHA 5CC7A 3WNNA 4HMNA 4NX0A 4PL1A 1TMHA 5CEWA 1GPWA 1V77A 1TVPA 1C29A 1WKFA 4O1DA 3TK7A 1MYRA 1LORA 5HMEA 3NO1A 4Z1DA 4A3UA 2EKCA 4UFMA 2OGJA 1RK6A 1ZY9A 4B90A 1Y7VA 4QE4A 3H23A 3B8WA 3Q37A 1F05A 2QJGA 3DZ1A 1PKYA 3WUFA 2J6XA 4MB3A 3UZJA 2AGTA 4KH2A 4GWEA 3QEZA 1YXCA 1RJPA 3LI1A 1OK6A 5LHFA 4PRWA 1J8VA 4O16A 2W6RA 1W3HA 4CVUA 1FDJA 1EEPA 4MIMA 4JTLA 3GY1A 2B31A 4BS0A 3KP0A 4GZJA 1S1PA 3ARRA 3M0KA 3NURA 4H9ZA 4QEEA 4XTDA 1PZ3A 3SIZA 1G94A 2GL5A 4ERGA 3LCHA 1Z41A 3G1DA 2WBKA 4FF7A 2H3DA 1EGMA 3VNJA 4LAOA 3NDOA 2F38A 1ZENA 1QWKA 1IGWA 3GTHA 2ZE0A 3MMUA 4CD8A 2YA2A 1UD2A 4E6MA 4HPHA 1XUZA 1J0JA 2VR4A 3TNBA 3B3DA 1XG3A 2VGIA 3P74A 1W6TA 3E3HA 2GYIA 1OINA 3ITGA 2VC6A 2WNWA 3PM6A 3PVFA 1M1BA 5A5WA 3WFAA 4NUWA 3DYOA 1UBSA 2VEIA 1ZL1A 3KRUA 2NQLA 3L7RA 2PTYA 4H8UA 3O6AA 2GGGA 1XYFA 3ABXA 3K1DA 3WLIA 2OOGA 3BPWA 4C6KA 1KNWA 3DGBA 3IJ6A 2BWGA 4MYXA 4Y7EA 1PXGA 2P10A 3EPOA 1LG1A 5EYWA 4MNKA 3TZFA 3GTNA 2OYMA 3EEZA 5F7UA 4JTIA 3DAQA 1JYXA 3S47A 1RH9A 3QQ1A 4H7ZA 4JYFA 3YPIA 1E0VA 2XISA 2DIKA 2GUUA 3HU7A 5D2XA 3TYAA 3IVTA 3VCCA 4J3TA 3OZOA 1IEVA 1UKOA 3T09A 4ONVA 4YMZA 4CD4A 3TX9A 4UUIA 3WQOA 1TSIA 3CAKA 1OB0A 2JEQA 3A4AA 1VFOA 1JDDA 1XS2A 1FWCC 1DQUA 1UPPA 1OK4A 2VEMA 3ANVA 3BOFA 3NO5A 1UHVA 1Z44A 2C19A 1I2QA 1WDRA 4KPLA 1L9WA 4Z2IA 3M1ZA 1FDZA 4FOUA 4X0NA 1EJXC 1DV7A 2A7PA 3R43A 1H0IA 4I9TA 3BVJA 1HJQA 3PTKA 4ZB5A 3CT7A 1MEIA 4KERA 3HIJA 1ZSXA 3S0CA 1E0TA 4TTUA 2UZ9A 4GYPC 1E3XA 3KAOA 1WOAA 2C79A 3H53A 2XU2A 4DJDD 4MOZA 1Z8AA 4GCAA 1LROA 1ECQA 1C8XA 2GFTA 4Z1CA 2YKKA 3GWQA 1DJHA 3PTQA 2V3DA 2Y8VA 4DHGA 5CSSA 1I8JA 2XIJA 3M43A 7TIMA 1WXYA 1J79A 2X0YA 3N1AA 1UW9A 2NT0A 2OEMA 4I6KA 5DF0A 4XKYB 3QXBA 1DWHM 1AVAA 3PTMA 2ZKMX 4NXKA 1UR3M 2J62A 1SO4A 2J79A 5LSMA 4G7EB 1QU4A 1VENA 4US5D 4AD4A 3WLRA 4CQ8A 2PCQA 3EWWA 5BZAA 4PN2A 3H22A 3AHVA 1ITQA 5FOOA 4J3SA 3KVJA 2XSAA 4YPJA 4BA0A 3BXWA 3T0DA 1VZWA 1AH4A 2PI6A 2JKAA 1AL7A 4HNUA 5JQ9A 2Z26A 3JUGA 2QZRA 4WK9A 1KKRA 4DJFA 1WAUA 3FSTA 4MY1A 4C6JA 3UWWA 1KM4A 3VOGA 2WW5A 3MDWA 4Z42C 1LQ2A 2QMKA 2DZAA 3B4YA 4L61A 3UVIA 1OX4A 2FDSA 1SW7A 1DJIA 4ZOBA 2GOUA 4G8TA 3ID7A 3VUPA 3PBVA 2CCRA 1VBUA 1WOBA 3MHGA 1OZMA 1I4NA 1ZRQA 4AWUA 1QK2A 3GK0A 4GD0A 2DFAA 3NQ2A 8A3HA 3EMCA 1K9TA 1ITUA 4XZBA 3OIHA 1ZHAA 1BYAA 3SR7A 1JGIA 2CWNA 2J88A 4PSRA 2OU4A 1W91A 3C52A 3NYZA 4HNNA 4IQLA 5EMKA 4X3ZA 3NGJA 1H1ZA 3GVQA 4UMBA 1ME9A 4TUFA 3FY1A 3E2SA 3DFPA 4M0XA 4O18A 3VGBA 5MHBA 3O0KA 3EXSA 1JCTA 3LZ5A 1J4EA 3TU9A 3WF1A 2AQWA 1G9HA 1HJSA 5AYYA 2Y24A 1CNVA 1CGUA 3CV1A 2CKRA 2YXOA 5G2IA 3Q4DA 4ILSA 4UZSA 3WD2A 4GGHA 1YMYA 5JH1A 5CJ5A 3KVMA 4RNJA 8TIMA 4Q7BA 3WJZA 2XH7A 3U6WA 4LUSB 5U7SA 1A5KC 4HU8A 4JX5A 1KBIA 1TV2A 2IKHA 3VGDA 3GXNA 4GUGA 4DYEA 1WZMA 3LOTA 3W71A 3WIJA 3LMYA 2BDQA 4EXAA 1RALA 4PMJA 1RJRA 3T0TA 3NZ1A 4A2SA 1QPKA 1C3FA 3JVAA 3CH0A 2Z0IA 1XIMA 5H8PA 2YCIX 3GFZA 1UD6A 3SCOA 2VX7A 3ZM8A 1KBKA 3A47A 5HNNA 3U48A 2CZ5A 4H3DA 1TV3A 4Q8MA 3Q58A 5E0KA 5I3HA 4KFNA 1HJWA 1EA9C 1DJYA 1EDQA 2FGZA 3GTIA 4GZEA 3M5ZA 4IFOA 3LENA 5T9CE 2HNEA 1OIFA 1NP2A 1E6QM 1TR1A 2HK0A 3PZTA 2VOTA 3P14A 4QR6A 3DYPA 1GOIA 3B03A 3AWNA 2QHAA 3ARPA 3V35A 2WCGA 3LHVA 4O0KA 3NQ8A 2WJEA 4CCEA 1YPXA 1IEXA 1FP8A 4GHRA 5H6HA 1DWFM 3LV6A 1R85A 3NL2A 3F4NA 2ZZ3A 5DBUA 2VEKA 2GDVA 3E38A 5F2IA 3K30A 4A8NA 1FCVA 2CHRA 2NWRA 3TQKA 4WCJA 3GHTA 3C2FA 3AO0A 1TCDA 1QMLA 1L6GA 1TPDA 3O15A 1XSJA 2R91A 3UETA 3WX7A 3EWYA 2ZDSA 4IUOA 2Z7GA 2AAAA 4O1AA 1CLKA 1NU5A 3D5HA 3HPFA 2WLYA 5LGXA 3O9NA 1MNZA 1RXOB 3UF9A 4B16A 3TW9A 3MKCA 3WNPA 1PIGA 5CZJA 3SECA 4W85A 3DECA 4GI4A 2A3CA 3BO9A 3DESA 3A4XA 1UP2A 5G1TA 3UJFA 4CQBA 4LYPA 3T81A 4L1GA 1TTQA 3V1PA 5JMUA 1W32A 1QI5A 2WJZA 2XIOA 3GXMA 2BXVA 5LXXA 3CNYA 4RZ6A 1T96A 3UCCA 4UMAA 2MANA 4XZ9A 3WENA 2O4QA 1BG4A 2EG6A 3TKFA 1XG4A 2F6KA 4FNQA 1IIGA 3H4XA 1LL6A 4ALDA 4NZ4A 4GA8A 1AODA 2HK1A 3DHUA 4GNJA 1MI3A 5I09A 4QDWA 2CERA 2F9RA 4CGTA 3THQA 1W3JA 3F2BA 2D1ZA 4NYUA 3U7BA 3N4FA 5GNZA 4JQ1A 4MJMA 1YLVA 1Y65A 2AKMA 1GVIA 2V6AA 1EEXA 3H2OA 2VC9A 2PDPA 3MW7A 1R5YA 2FFCA 3APTA 3AICA 2HVOA 4IPJA 5XIMA 3N34A 3PBGA 1QVBA 1SJAA 4GFIA 3LHZA 3L4UA 3OOQA 2ZC8A 3OLGA 4MB4A 4PUNA 3HBLA 1AZ2A 1QNSA 3ARQA 1WNOA 3LXCA 2P88A 5BRPA 3URAA 3N29A 2GJPA 5GNXA 3IAQA 4JIPA 1B9BA 5BXRA 3GXIA 4CNOA 1CB2A 3NTYA 2WNQA 4XWUA 3MJMA 3QV8A 1FWSA 1YNYA 4EIVA 4I5RA 3WH8A 3ZO9A 4CU8A 3MA8A 3AI0A 2EPOA 2PUZA 2Z1WA 3S5NA 4US6A 3H2CA 1K03A 1LQ0A 5AYXA 1R9XA 1YE6A 3E5BA 4L9YA 4JL1A 2Y7GA 1JDAA 5DMYA 1AG1O 3AIWA 3GFYA 1G6CA 4YVXA 4I6VA 1PCKA 3CMFA 2O7SA 1WV2A 3H8AA 4JTJA 4TX8A 3QLLA 3SGUA 3A23A 2BG5A 4IX2A 1BWVA 1JUEA 2QF7A 4QFUA 3CZ8A 1M7PA 4IJBA 4IX0A 4FLOA 1A53A 3P84A 6A3HA 3SEPA 1QRQA 1ZBWA 3S6OA 3T2OA 4XD6A 3CC1A 4S2CA 2ZZ1A 4HHPA 1OT2A 3RMJA 4MHBA 3EB4A 1F6PA 1DJQA 1WBJA 1JVNA 4ZFMA 1AW2A 5DY2A 2XH4A 1EF2A 4DXKA 2ZWZA 2B7PA 3UWEA 1LL7A 4DAFA 3VNDA 1RCQA 4H19A 4PZVA 2FKPA 4LCSA 2V3FA 3N6QA 1LBMA 3K2GA 3DBPA 3SI9A 3PNUA 4QDMA 5U4NA 2Z6JA 3JW7A 2G4JA 5AOUA 4UQAA 2EG8A 4BWLA 1EZWA 1LQAA 1BFNA 4M6VA 4LUIA 3POHA 3EWDA 4B15A 3R5EA 2EBNA 4FNPA 1JZ4A 4U10A 1KW1A 3GG0A 1E5JA 2X1UA 4HHLA 2HRWA 5JBEA 5CZSA 1US0A 3ISIX 4A3RA 3B8DA 1UP0A 3NR0A 4WY0F 3HPAA 4M51A 2HVNA 1XPYA 3NPWA 4AUBA 3IJ7A 5D2TA 1KR1A 1ZU8A 5G1MA 1CLXA 2ONEA 4P8UA 5TNVA 4X60A 2ZX7A 2MNRA 4IXXA 1EOMA 4DJFD 1DQXA 1KO0A 2R1LA 1RVKA 5AC5A 2GQ8A 1QOQA 3CAVA 3F4CA 2OG9A 1R7AA 1H1YA 3HPSA 3VE9A 1O5XA 1X1NA 4GBDA 1D2KA 2ATSA 3LHWA 2JALA 1EHNA 2WBGA 2CLMA 3SDOA 3FXGA 4PA8A 3NSMA 1FX6A 4IIGA 4NX5A 4LCQA 8XIMA 2G3MA 5CKSA 3NZGA 4OFCA 1FCUA 2FVLA 5I3IA 3WMSA 3KEHA 3MQTA 4Q4RA 3N19B 3TMLA 1JNEA 1RD5A 3BDKA 2E6DA 2A2IA 1UWSA 4GRSA 1CXHA 4EANA 4IG2A 4U3AA 2A3HA 3W6MA 3G1VA 1EBHA 4A4AA 1P6CA 5AZ0A 4I8YA 2QCDA 1BYBA 1NIUA 3QQWA 3RILA 4XUGA 1Z48A 3U7VA 1VFFA 1NWSA 1WDSA 1GTHA 1X38A 3UU0A 3LTSA 2PDXA 1OC7A 5D2VA 5C5YA 1F73A 1YTKA 2A21A 1R9ZA 4ERIA 3L4TA 4NZ1A 2FPYA 3HQ1A 4JQ3A 3AIBA 4XAYA 3APGA 4Q6JA 3M5VA 1W1TA 4NF7A 3HGJA 4F0KA 4R33A 9CGTA 1B3WA 1W2VA 2INEA 1B2YA 1XRSA 3BMWA 1G01A 1R3TA 3SY5A 2NV2A 4MDPA 2NUWA 1VBRA 1L6WA 1E56A 1E72M 1B3XA 3GYEA 4LSBA 4PMVA 3LXAA 1XBZA 3E02A 1YRRA 4BF9A 3TYUA 2YDQA 3U9IA 1AUSL 5CCZA 1K4GA 2J7DA 4HMCA 3C6CA 3NVTA 4FNUA 3W2LA 3UJ2A 2DSZA 2ZICA 4GC3A 4MWAE 3LA4A 1P0BA 2PDCA 2Y62A 3AHXA 3QQ0A 1QI2A 4F48A 1RP8A 2X30A 3TR9A 1RUSA 3RJYA 4EXBA 6TIMA 3CL6A 5A2BA 3ATYA 4RNFA 4FXJA 5C2GA 2W91A 4QM1A 3S5YA 3AZTA 3VIKA 7ENLA 5H8MA 1HX0A 1UR4A 4OU1A 4M82A 3CWHA 1TPB1 1GJUA 2X0HA 5IHSA 2DZBA 3ZWTA 1RPXA 2RJHA 3EWXA 4F4RA 2Z2AA 4QG6A 2B7QA 5TQLA 1RQHA 4RXFA 1M7JA 1F4AA 1A50A 2DY3A 4UQBA 3LQLA 3TA6A 3KLLA 4HBKA 3G1XA 3DFHA 3K46A 3IWPA 1YNQA 3UFYA 4WY0A 2D20A 2FJKA 3OB8A 5D2YA 1Q6OA 2V5JA 5C7VA 4GZIA 4KRZA 4P7RA 1FQ0A 3RM8A 3UW6A 2ZWYA 1CYGA 5HJXA 4MWAA 4ACYA 4CQDA 2O56A 2FTYA 3W7PA 3HG2A 5IOBA 3WMBA 1E1CA 5HK4A 1CGWA 1UA3A 4ZSUA 3RNDA 2C8NA 4AY7A 4OUEA 3G77A 2Z28A 2EGZA 3K1GA 2HV5A 3L5LA 4E8DA 4GY1A 3QR1A 1DXEA 2J8TA 3ZR6A 5LXEA 2J75A 2IMRA 3RYSA 3FW6A 4IFKA 4PBFA 3T8QA 4IMCA 1E6PA 2PAJA 1IE7C 4HIBA 2A1YA 3W7LA 3BOLA 1W9DM 3VABA 1QPRA 2PDLA 3RCMA 2ZA2A 4HNOA 4WF7A 2ATMA 4LT9A 3M0JA 1EPVA 4RW3A 3G22A 2Y8KA 1MO0A 1XLFA 3RM9A 4Q33A 3MU7A 5T26A 4GINA 1H7WA 5HQEA 2FZNA 1XL9A 3N2TA 4Z1AA 1W9VA 1XIFA 3LXBA 4O10A 5FD0A 1V0KA 1ZAHA 3N9RA 1HNYA 3RGTA 3TW6A 3PWGA 3KCOA 3W81A 1BXCA 1D9EA 2WZMA 1NDZA 3GU2A 5CSUA 2GQ9A 5DBTA 3W70A 3AJ7A 3D0CA 5EKYA 1RZMA 2FGBA 3M0YA 3S5OA 4JTQA 1Q5MA 1KCZA 1Q65A 3HV9A 4EPDC 2X7VA 3BG3A 4DZAA 5ABEA 5M03A 1ADDA 4HN4A 3UVAA 1EGZA 4DJDC 4OIFA 5JXQA 1K3UA 3T9PA 3AMLA 5GJMA 1M04A 1PE1A 2GZXA 2ZZ7A 2A3LA 2PLKA 1IWBA 1QI0A 2EJ1A 1SZFA 3T0CA 1DOSA 4D2JA 1FFQA 1ONEA 4UXDA 5A2CA 3P0XA 4L1XA 2VO5A 3CUIA 5FEWA 4O1EA 2ZCGA 4LAMA 5I02A 3KDNA 3VNZA 1I1XA 4ZCWA 4TMCA 4XBSA 3IK2A 2WJDA 3DFNA 1SO6A 1FCQA 1NELA 2E67A 2GPTA 5A8OA 4C1LA 3WBXA 3RF9A 2VWSA 1UD8A 3HQOA 2DT2A 3HFYA 1A5BA 4C6NA 3MSGA 4JX4A 3IJ9A 2PDMA 4CD6A 1E6XM 4K37A 5DXXA 1XRFA 3EZ4A 3L5MA 3VIMA 2BNJA 5BOOA 4EKJA 1DTNA 3UEQA 3VM5A 4HPGA 2R6OA 3N3TA 4JN7A 1QW9A 1SJDA 1DIKA 1U5VA 2C1IA 4B91A 2TAAA 3N2BA 3E5PA 2QJNA 2Q3RA 4AX7A 4Y90A 4NU7A 5FACA 1ISZA 3WJWA 1ZALA 1NOFA 2PFHA 2INZA 4DYJA 3F2DA 1EJSC 2WMIB 4WRHA 4PH6A 1UWAA 4Z2GA 1OX4B 4NZJA 1GG1A 4PEEA 3B0YA 3FDGA 1EBGA 4QTGA 4W4QA 4B3KA 2QDDA 1JPKA 5CC6A 2QUNA 1XSIA 1K8XA 4FLQA 3U2ZA 3V16A 1KRMA 3G1AA 2D3LA 2CNCA 2DZXA 2PRLA 1S3HA 3EDJA 3L9CA 4MMWA 3IUHA 3VFLA 4PB5A 5AVHA 1YHTA 1OFRA 3AHZA 1PHQA 3ABZA 3CH9A 3VGGA 4BKNA 2C18A 4LV9A 2VI0A 1F5ZA 2E0PA 4QG8A 3WEZA 2AL2A 1R2SA 3NQFA 1V0LA 4HZMA 2OEKA 4N9CA 3HOJA 3RK8A 3P67A 5AN7A 1TIMA 3C2OA 2Z2BA 3F5LA 3OBKA 2E3ZA 1XFCA 2ZADA 4C6BA 1RBLA 3QGVA 1EDGA 1YQ2A 2HWGA 4R9OA 1KRBC 1LDCA 3STGA 4Q8UA 4LW7A 1AW1A 2NXIA 1TQJA 4XV0A 1XGEA 3V36A 3BSHA 2GQAA 2J8FA 2C14A 7PTDA 2ISFA 1FY6A 1M5WA 5GNYA 1Q7MA 3M7WA 2EQDA 1DJGA 2D22A 3BLLA 4AVFA 3PTDA 1KWKA 5CSRA 4K1WA 1T41A 2L5HA 1VF8A 1OGBA 4IH3A 1E0UA 3SCRA 4LPCA 3OJGA 4HD5A 4NNAA 4B4FA 5I3FA 3GNDA 4X9SA 3NDYA 4NILA 1RD6A 2V68A 4IOTA 4IJRA 4H2CA 2C1HA 3BMXA 4WKHA 3MMDA 4UTKA 2YFNA 1KA9F 2OYLA 2VFIA 3CHEA 2QPUA 3QV6A 3M0MA 3WLNA 3VGEA 3CB3A 2VMFA 1Q7ZA 4ADUA 5A6TC 3CHDA 3FX4A 3PSWA 3BOXA 3THCA 1QNVA 2WNNA 4LS1A 2ACRA 4DJEA 3BZJA 1T8QA 3W87A 4DY1A 2D2GA 3FAWA 5FJIA 3B9EA 5BOEA 2E5BA 4LYKA 1Z7AA 4MG4A 1T8XA 3GB6A 1Q2SA 4O15A 1OEPA 2HXUA 4AVNA 1FXQA 4WIWA 4ML4A 3LTPA 1F8IA 3OYXA 1M01A 2HBVA 1H7NA 4YTQA 1IXQA 3VGFA 1SYTA 4QISA 3OVGA 4WSJA 3RDKA 3DKLA 1LWHA 1GOKA 2ZXBA 1C90A 3RUBL 3KL5A 4CD5A 2OX1A 2P8CA 4LBSA 3V75A 3IV8A 4N4PA 3ZJ8A 4B3LA 3GDTA 5I3JA 3IACA 1P7TB 4NSBA 3OVQA 1P6WA 3TYZA 2GDQA 5JBFA 1WX0A 4PTVA 1EC7A 2WXDM 3UGVA 2F84A 1MRAA 3NG3A 2QGYA 4XAZA 4ECLA 1OD0A 4NJGA 2GSHA 1OX6A 1KFWA 2CC0A 1WKDA 2NLIA 1G69A 1JI1A 3L4VA 4JKMA 1WZLA 4J1OA 2NVDA 1ONXA 1H3GA 5FF3A 4PMXA 3CUZA 3OGRA 4UB9A 4B3ZA 5F4SA 4M80A 2YR1A 2WSPA 2Y85A 4C1NA 2XZ9A 1X96A 1RVGA 4AG0A 3UZXA 4NKCA 1UP3A 3BSMA 2A4AA 1F6KA 3CYJA 4AX6A 3C2EA 4PBGA 3LCLA 3IJDA 5HULA 3W0KA 2W92A 1BXNA 1GUVA 2GVGA 5EL1A 2DH2A 4OOUA 4Z0SA 3UWYA 2XIIA 4C5YA 3WJXA 3N9SA 3BE7A 4PCFA 2BHUA 3AMCA 3TDFA 5KZEA 3EKZA 1K7XA 4FHAA 2PLCA 3P61A 1ZGDA 3G1YA 3PANA 3KDOA 2UY2A 4RPPA 1E6SM 2PD5A 2V81A 3CUHA 1TTPA 2HISA 4JDYA 4A05A 4C7GA 4ML9A 3ARVA 2D2HA 3B05A 2Y1HA 5AHIA 5I0DA 4TVUA 2OZ0A 2Q8XA 4M1BA 4YTRA 4ADSA 4X9YA 1CGXA 3EPMA 4KS0A 1OWQA 2GSEA 4FSAA 4MJ4A 4HCHA 1S5WA 3TCEA 3HJZA 4NI8A 3OP2A 2E7FA 2W9MA 2X2YA 4HTYA 4D6IA 3OLIA 2PDBA 4EAMA 4IP4A 1KLZA 1UA7A 7REQA 4DWSB 1KM0A 2WSQA 2R1MA 3FKRA 4B5XA 2QJMA 5C9ZA 1UZHA 3B8UA 3WQPA 3PZMA 2E1DA 1WDWA 1GOWA 4BHYA 1K6AA 5EPDA 3B8VA 2RGLA 3CPUA 3ALGA 3UYCA 3APYA 3EDDA 1KWGA 5F4WA 3VC5A 2R1NA 2A79A 4S2BA 2RAGA 1Q6DA 3USZA 3T4WA 5HOSA 4IT1A 3ARUA 3VYLA 1EQCA 3TIMA 1YBQA 4E4FA 2JKEA 3WDHA 5C7HA 1LYXA 1E9IA 1ECEA 1OT1A 1IWPA 1B0IA 4DM1A 2RFGA 3N6JA 1UUOA 3OO2A 4H6KA 1JZ3A 4PCPA 3W00A 2E25A 3GXFA 8RUCA 3NQAA 3LHUA 1H5VA 3TQPA 1GJPA 4BCEA 3MBDA 5J5DA 4S3KA 4IIBA 5HUOA 1E1FA 4YU1A 2YCLA 1SVDA 4U2ZA 1NQKA 1UIOA 4KEMA 3BCDA 2J4GA 2DT1A 3GNPA 2QCHA 3QPEA 2LLEA 3TTOA 2YA0A 3LNPA 3VZZA 3S42A 2ODOA 1QPNA 3IIVA 3CJPA 4P2VA 3M4HA 1XR2A 1QOXA 4M3PA 1I2RA 4NZCA 4KT2A 2OOFA 5EMLA 3ABQA 4MJ2A 1FWJC 2JQXA 1THFD 3AYRA 4LGXA 1QPQA 5I3GA 1TZ7A 5K9DA 1E0WA 7XIMA 4K36A 4ZEPA 4HNTA 1K4HA 3EKLA 1W56A 4MAZA 1HUVA 1Y5WA 1KCKA 1M65A 1XFBA 3SN4A 4Y8EA 3S5SA 5ABGA 1UR2A 4Q3MA 4RW5A 4H8HA 4BEUA 2PDQA 3TN3A 5HA7A 2HTMA 4D8AA 2R1PA 1A5AA 1JCNA 2W27A 1H5YA 2CZEA 2WLZA 4H01A 3FXYA 3CB8A 4WUIA 1GVRA 3QMTA 3QW4B 3S9YA 3AROA 2F6UA 3EWZA 5DLCA 2GDUA 5D30A 2IQ0A 1JRCA 1ONWA 1HJXA 2I17A 3KVKA 1WA3A 3O6CA 3GTFA 2VEGA 3KFTA 2JK2A 1JI2A 3PBUA 1BD0A 4GY7A 1E6NA 4DBSA 3CZKA 4IG2B 3OBAA 3WQVA 3KTCA 3B0VC 3S1XA 5DCEA 5BRQA 3NSNA 3NQVA 1MXDA 3WD1A 4UFLA 4ZO7A 2VP8A 1G67A 2YYTA 1TRDA 3SADA 3BG9A 2ZX8A 1B3ZA 5EB8A 4A6GA 4I5XA 3Q67A 3EA1A 3O63A 4RDWA 3DX5A 2GWNA 3VVGA 2PDYA 4HHMA 1XYBA 3RRAA 4GQQA 4NJKA 1JCLA 5B7YA 4PMOA 1AJ0A 1VEMA 4Q4SA 1FXPA 4QGCA 1FWGC 1NQ6A 4IP5A 3GKFA 4YHGA 3R10A 4B5NA 1GT8A 3GKAA 1AH0A 4B5WA 2IKJA 1GYNA 3W7HA 3GHSA 2YPIA 4DF0A 4XSMA 4AMAA 4MY8A 1O95A 3XINA 5CSYA 3KS5A 1E4NA 4AF0A 2OO0A 4IPLA 3U5YA 1DVJA 1GOOA 1NFGA 3CO8A 1R2TA 4FX8A 1DHPA 3WQ5A 4FI4A 1UH3A 2VGFA 2WM1A 1UROA 2QEZA 1W3IA 3KL3A 2RUSA 2Z1VA 4AISA 1GPFA 4XK2A 4F2TA 4FO4A 1CW2A 3TQ0A 5TF0A 3CMJA 5L6UA 2DZUA 4XKMA 4DJED 3WBWA 3CQ0A 3TVAA 3T8LA 4X0VA 3DI0A 5IRPA 3H2MA 2GVLA 3UZZA 2GLKA 4S1FA 2J47A 1Q45A 3HM7A 2PDIA 3VA8A 4IQEA 5AYIA 4IGHA 3RX4A 4KBXA 4H7CA 2HJPA 3PN8A 2VC7A 3P5YA 4CNTA 4HNVA 5FI8A 5KEZA 1S2WA 3H26A 5D9PA 3TOPA 1LWJA 1MZRA 5T91A 1SFLA 2YB4A 1JZ7A 4WY0B 1MUMA 4AD1A 1QI4A 1QW8A 3VK5A 4GJ1A 2C91A 5DCBA 1AMYA 1QNOA 4MWAB 1Z6KA 4DPPA 1GW9A 4CU6A 1RLDA 5EA9A 3BAWA 1E1CB 2QMJA 4UNKA 1G0CA 1GVQA 2O9PA 4ZVJA 5HDRA 2W67A 3LRLA 1VYRA 1FHUA 3G5EA 4WX2A 1CECA 2FVMA 5PTDA 3TNOA 5GPRA 1NH6A 3A24A 3OQEA 1L6SA 1JYWA 3LMZA 1N8IA 5FA5A 3H24A 2XZ7A 1MRQA 5KETA 4GCXA 1TB3A 3LGEA 1TPEA 3THUA 3W2NA 1PDYA 2G3NA 3PC0A 1Q7QA 3GLCA 4BF5A 4IL2A 1IZCA 1PBGA 4W8AA 3R2GA 2OJPA 4A8LA 4H9YA 2J7EA 2FDMA 1EP3A 1BSLA 2Z27A 3JZUA 3KCJA 4UBPC 1DXIA 4CEUC 4GVHA 3DI1A 3WBEA 3P82A 4W7UA 2YA1A 3GU9A 3PNZA 2PDHA 3SQMA 3SIMA 4A35A 1W1ZA 2ZUUA 1O6IA 2YSWA 4AZGA 3DFYA 1TV5A 3BLEA 3PG9A 3VTRA 1O1HA 1JFHA 2DVXA 4E5TA 2XDFA 1LWIA 5CPOA 4R27A 3S2MA 3TR2A 3NOYA 3C56A 3GDMA 2XFYA 3KWSA 4YTTA 5AECA 2OVLA 1UWIA 3WQWA 3BV4A 1TPC1 3DEQA 4AAJA 3U4FA 2WCSA 5DX7A 3UWUA 1JZ6A 1Q3NA 2F6XA 2R8WA 2BY3A 4H83A 3OW1A 1VP5A 3GVVA 1O66A 4IF2A 1X98A 2GQ3A 1TJRA 3L68A 4LVDA 3L0NA 1Z89A 1E40A 1HL9A 4DWSC 4ZTXA 3GO2A 4DF2A 4IGMA 4BJHA 5LIKX 3MJYA 1QUMA 2H8ZA 3R8GA 6ENLA 1W1VA 2I16A 4FEZA 2VKZG 4W8LA 1UYQA 1S2VA 4WKAA 3S1WA 3SUVA 5FJRA 1MW0A 1EOKA 2CLFA 5BMXA 1QPOA 3S1GA 4DO5A 5IBXA 1VFLA 4NQ1A 1XWYA 3ZOAA 4FALA 4S3JA 4IMEA 3WEOA 4H6EA 3FJ6A 5HBFA 4L9ZA 2NX3A 4DO4A 1W1IE 3WZ0E 4D6GA 3VZYA 1KM6A 3C3UA 2Y6ZA 5CPTA 3WY1A 2IS7A 5HJYA 1TMQA 1W9PA 3KL0A 4GX9A 2PE4A 4MADA 1A0EA 1EJVC 4XD3A 4LJ3A 4PR4A 2FIQA 1J11A 3BLDA 4G56A 3OZYA 2CLPA 1IQ8A 1L8NA 4MGGA 3SURA 1VFTA 3T44A 3LY0A 4QLKA 3PZOA 2VVSA 2EPHA 4KQNA 3MSYA 1KKOA 2D2OA 4INFA 4QROA 3W1QA 2PZNA 3F03K 4W5ZA 1W9BM 5LA0A 1UR1A 2HS6A 1XQKA 2HCVA 3FJLA 1UKPA 2AL2B 2DUXA 1KFLA 1OIMA 1NARA 5CPNA 4DVOA 4HSNA 1ZAJA 4JNMA 1M9HA 2REQA 4YHEA 4F9JA 1VCGA 1HKWA 4CNNA 1EL3A 2J7GA 4L4MA 3V1HA 2WMHA 4NXSA 3S5ZA 1QCWA 4JICA 4PTNA 3ZLGA 2W4XA 2VQUA 3PJXA 2HZGA 4LS0A 4E2VA 4V1YA 3UESA 5FEXA 5HR6A 1TPH1 3M9YA 4D6JA 3GXPA 2NVAA 4FNRA 4H9MA 2X1TA 1V8EA 2XUCA 3ZSTA 3BQ5A 2Y89A 2ZVRA 2E9MA 2DZTA 3GXTA 2BVWA 3OODA 3W2UA 1OFDA 1FOBA 1B4KA 3SCTA 3L2LA 3SFWA 1S39A 3CLWA 2GGHA 2WK2A 3SJNA 4PRRA 4C90A 3QY6A 5D8ZA 3NQ6A 5IXEA 2CFFA 3QZAA 1LCOA 4BFAA 1S2UA 3CV6A 4HPXA 4PC8A 4O11A 3QC3A 1XCFA 3PPCA 4N9EA 1VR6A 1PTGA 4ORIA 3FHAA 1XGDA 4R34A 1NP0A 3H2NA 5AHMA 3ARZA 4JKKA 1WXJA 2ADAA 1EXBA 4NAFB 4XZLX 3BANA 1MQPA 3H2FA 4PL2A 5DMMA 4E3TA 3UXKA 3L4YA 3AAMA 1X6LA 3IGSA 4L9XA 1TWDA 4OQVA 3WLJA 5M17A 5J5RA 5KINA 4AEEA 2CLHA 4AZCA 2O9TA 3KOFA 4GH1A 2D0GA 2IW0A 4IJCA 2PRHA 1QFEA 4UTWA 5A8NA 1VFHA 2D3NA 3ZT6A 4I9AA 3WL1A 4LUTA 2BY2A 2Y70A 3P3BA 2EPNA 4ENLA 4JBRA 3D6NA 2YCEA 1XH0A 2PODA 2TYSA 2PCEA 4E2OA 2NX9A 1PVNA 1XGZA 1ZZMA 1JL8A 1TE6A 4HA1A 5GJNA 1AZ1A 4FIQA 3AYTA 3E6EA 4ZO9A 4IM4A 2X42A 4W93A 2H9AA 3BLIA 1XICA 1JEZA 1KM1A 1YTDA 2E8YA 2WHMA 3MVTA 3WQFA 3TAKA 2IKIA 3CZEA 2QUMA 4PCTA 2C3ZA 4GC4A 4FXSA 5ECVA 4Q8PA 1I2NA 2Q8LA 2VT0A 5CZTA 2ZIDA 4PUKA 2PMQA 3KBJA 3PP7A 3P0WA 1GOMA 2NVCA 3C2VA 3OVRA 5EMMA 3WDRA 4C6PA 4AIOA 2GGJA 4H04A 3PFMA 1W3NA 3BC9A 5D03A 1PTDA 2VR5A 4AFYA 1W37A 4HU3A 1VBJA 3JS3A 2ZX5A 4B9YA 4A21A 1AMKA 4MWAC 3WEMA 2YDSA 4LXFA 2Z2UA 4PTDA 5AVNA 4Z0JA 1TZZA 4UR9A 1MQRA 3NAVA 3C0LA 2W66A 3W74A 4JL2A 2NXGA 3WDPP 3DFTA 1TPWA 2D0HA 2IPFA 4L4LA 4WEVX 4I8DA 4L56A 4I3GA 1P0NA 5AYZA 5LNUA 1J0IA 1RBOB 2QCFA 2OLSA 4WDTA 1F76A 8XIAA 3TN6A 3HQPA 3M0XA 2J7BA 3WH7A 1W5OA 1KFCA 3DIPA 4LX4A 2WSYA 1V7AA 2V69A 3TSBA 1MXSA 4C6FA 3AISA 3BLKA 5C54A 5FJUA 2PWFA 2C1GA 1XH2A 3SM0A 4DUVA 3VIGA 3ZYZA 4PTMA 3ZLFA 4JTUA 1DTUA 3HPZA 2IXUA 3LUTA 3NGFA 7REQB 2CKSA 3BG5A 4FOJA 1OG6A 2NQZA 2X8RA 1FH9A 2Q02A 3W7NA 3H12A 1V3MA 2QKFA 1YYAA 4D6EA 1R0MA 2E40A 2WMFA 3AUOA 4M7SA 2DW6A 3A5VA 4AIBA 2I1OA 4JR5A 1BLIA 1EJWC 1Q2RA 4PTXA 4Z1BA 2VM8A 1H7RA 1XH1A 3TN4A 4AB4A 3SRKA 1YBQB 5I2UA 1H4PA 4US5A 5LA1A 3CTTA 3EOSA 1VB9A 4GYKA 1R30A 2YXGA 3TMQA 2PF0A 1OC5A 3VNIA 2TMDA 3LGDA 3VKAA 3GD6A 3OGSA 2PU1A 2Q3OA 3C3NA 3SN1A 2WVUA 1ZS2A 2ZUMA 2ZZ4A 5A8GA 1V6UA 2CPUA 1HP5A 1OBAA 3BGAA 4LVAA 2QV5A 3W84A 1LOLA 2VZTA 3WK0A 4YVVA 4LRSA 3RR4A 1ZJHA 2YCLB 2ZUVA 3GM8A 1OZQA 2BBFA 1BKHA 2FLIA 1OQFA 3MUAA 2WQDA 4B5UA 1UZ1A 1RQEA 1LRNA 3GC2A 3TH6A 2X7WA 4WGHA 4HT3A 1A5NC 3MSDA 3TOYA 3HG5A 1OF6A 2OSYA 3B0PA 3CHVA 2HDJA 1NWUA 4OBRA 4LB3A 1GOQA 1ADOA 3PB0A 3LERA 3TA9A 4KFPA 3NSXA 4LC6A 3W1MA 2E77A 5BW6A 1UZ4A 2WVSA 3V5CA 3TROA 2NUXA 3LCIA 4E2BA 3HMCA 4JTFA 4B92A 5J8LA 3T08A 1N82A 3R79A 4GQ0A 5I79A 5FAGA 1EP1A 3QKEA 1O94A 4HOZA 2E8ZA 1J9YA 4WOQA 4R53A 3CWNA 1P1MA 4RV8A 7CGTA 1YEYA 1I2PA 1DIDA 5BCAA 2HEJA 3VXGA 4PMYA 1JYNA 3TSDA 1JDEA 2YL5A 5E6YA 1TJPA 3PHAA 4Y6GA 3NQ7A 4ZOAA 3SUTA 1BHGA 3M0HA 4JPGA 1TA3A 4UTLA 2WPGA 3GSMA 2O0TA 2G3JA 4YIWA 1S5TA 3FCPA 2PTDA 1ZNNA 4C1KA 3W26A 1BF2A 3RIKA 1V0NA 1VBHA 3LGGA 3QH2A 1HT6A 3BZGA 5C0QA 4X63A 3HB9A 2V3EA 5LIUX 1ITCA 3GVRA 4MSSA 2Y5SA 4GYPA 3T07A 3UR8A 3FN9A 5EU9A 1F2JA 3XIMA 2DSWA 2PBGA 3ANYA 1L2UA 2PEVA 4FK9A 3L2MA 1Q85A 5DN1A 4P61A 3OYZA 3I6TA 1EF3A 3P81A 3W72A 2V2DA 2XVPA 2SFPA 5I06A 1IEIA 1AJ2A 1J01A 3TYEA 4D71A 2WM0A 4WZHA 4FA3A 2CBJA 1H7XA 1W3LA 2QUTA 1VEPA 3LG3A 1PX3A 2BODX 4XISA 5HPOA 3W1LA 4LNCA 3WYZA 1KM3A 2OSXA 5MKGA 1DIEA 4MAVA 4OUIA 3G6MA 1FWFC 2ZXAA 3W75A 4Y96A 4H6QA 3A3WA 3URNA 3G8RA 4LYQA 1XDMA 3GDRA 2G4FA 1GYLA 1IEWA 4DUXA 1HKMA 2QCMA 1A5UA 4E4UA 3WUBA 3AXMA 4E2DA 1HIZA 5FJOA 3DC8A 2OFJA 4OHQA 4MLJA 5CZKA 4GG9A 2W0UA 4YCPA 1A49A 1X39A 1UG6A 4GQBA 2FHCA 5FF2A 4DNMA 3TFCA 5K3VA 2WPBA 3TFXA 1ML1A 5F1VA 3RHGA 1WKYA 1UMYA 3ITYA 1L8PA 3IJLA 3GIPA 3KP1A 3EX2A 3F2CA 1YPIA 4F0MA 3ZR4A 4DJEC 5HJLA 1TFVA 3WQ6A 1LLWA 1UWQA 3BICA 4J5NA 5KZDA 2DSVA 1ICQA 1H62A 1S2TA 2HROA 2J7HA 4LALA 3HGSA 4ZMGA 1JYVA 1V02A 3C4UA 1UKTA 1JXJA 1EGVA 4UR8A 1RJQA 2NLYA 4MKNA 2EG7A 4AU0A 4UTUA 4YJ5A 4C6EA 4NJHA 2C6QA 4ZQRA 4A3QA 3S8HA 1TPVA 4HJWA 4L4PA 4GVGA 5ENLA 3ABSA 1EH9A 5CJMA 1G5AA 4ZA0A 3FYPA 4HA4A 5T9BG 9RUBA 4X2RA 5H2ZA 4MY9A 1UKSA 4ZQMA 4K8HA 4AYGA 1TCMA 1D3HA 2RH9A 3IVUA 4M81A 5E1QA 5I3KA 1HKJA 3W7DA 5EMUA 4WD0A 3C2YA 5LNRA 2JGYA 1DEDA 3LPFA 4KWWA 2QGHA 4Z1YA 1K9FA 4EWND 1UUMA 3W37A 1E4IA 4JTHA 4XBJA 5AY7A 4B2DA 3OA3A 4EPBC 4NT0A 5BXTA 3WUEA 2PDUA 2DUAA 1GKQA 2XYLA 3NXLA 1KQZA 5RUBA 2GK1A 4OBSA 3NDZA 1TREA 5CPLA 3E0LA 1G4PA 1OFPA 1XIDA 2WZIA 4QE1A 1YDVA 3VFCA 5I24A 4NVTA 4QX4A 1VJIA 3URQA 4JD4A 1Q6RA 1PIIA 1JCXA 4M7TA 1RA0A 4YNGA 3U2EA 3PF3A 1CX9A 5HMSA 3W7JA 2HBXA 2FH8A 2PP3A 3WNKA 2VWTA 2QS8A 1UQZA 1QJWA 5DMNA 3SUUA 3P93A 1O68A 3NZQA 4JIQA 3I7QA 1S5VA 2Z4GA 5LHEA 4AVOA 4OV4A 4HU0A 3PUGA 1KBBA 2Y5EA 3VX1A 4C6IA 2C13A 1NOUA 1LZOA 4YYFA 2VXNA 3V5OA 1R3QA 3MUZ1 3NVDA 3N4EA 4QAIA 1WE5A 3PG8A 1HXJA 4J27A 2TRSA 2Q6ZA 3VDBA 3K5XA 4EXQA 1FHLA 5GJPA 3PULA 1ISYA 4C91A 1JR1A 3SRFA 3CAQA 1FWAC 2ZZ2A 3R11A 1GW1A 2Y8UA 1BG9A 3ITTA 3FLUA 1CGVA 4JIEA 4G5DA 5XINA 4TVCA 1ME7A 2DU2A 2VX5A 2ACUA 3QPZA 3VU2A 1YDYA 3ZJ7A 2Z7KA 2YCJA 2FVKA 1VCVA 4OJYA 5C9WA 1EB3A 4HPNA 1MW2A 1NFBA 4S3EA 3W53A 1SZRA 1YTEA 4AYSA 3ITVA 4D1JA 2J6VA 3MB9A 2VZOA 3IGXA 2ZUNA 1J2WA 5BMWA 3GNOA 1IT0A 1ODZA 5A3HA 2ESCA 5A6BA 2XVLA 1XIIA 2OODA 5LZLA 1W3KA 3GIYA 4Q4KA 1IT8A 2PGEA 3EMQA 2P76A 3REQB 3GW0A 3NEVA 3TTQA 1RA5A 2Y61A 3AOFA 3TV8A 1US2A 2I9EA 4Q22A 4DELA 5BROA 4IHCA 2Z6IA 2FJUB 5HATA 1CGYA 1JD7A 2C0HA 2Y4SA 3L12A 4O8RA 3DFSA 3R58A 4IWWA 4MPKA 5HNTA 4AZIA 2VYOA 1KFBA 1R86A 1GVYA 2KX9A 2P3ZA 3QMSA 4GNVA 4GYJA 1XLMA 4LY4A 2NUYA 1DJXA 1EIXA 5D04C 2G97A 1OADA 1AH3A 5CAKA 1KQYA 3PAOA 3V4BA 3QLDA 3FDKA 1H60A 1UPMB 3OHIA 5AFDA 2VCCA 1E4MM 3LM3A 3NEHA 4UZUA 4JTSA 5HPCA 1PX8A 3N73A 5H91A 1Y8BA 5FEZA 4UQDA 5BWFA 2VENA 2REQB 3RPMA 3ME3A 3N6HA 1TIWA 2PLMA 3R6IA 3C5QA 4WR3A 3M6DA 3A5FA 3LSBA 4J3ZA 1RR2A 3KTXA 2QIWA 2QNEA 2GWGA 2OSWA 2BOEX 4W84A 2AMXA 3UWVA 4CN1A 1RCOB 2V9DA 5TAOA 2EJAA 3PUEA 2EPKX 1LG2A 4O54A 2NWSA 3IGUA 4GXWA 2P3EA 2PDGA 4L6DA 1XD1A 2YLLA 1CPUA 2D2JA 3M5YA 3BK0A 4TQTA 4AC1X 4U3CA 1EKOA 3RO8A 2P1FA 5AKQA 3TYDA 2J25A 3UG8A 3W9ZA 3WMCA 4LCRA 2E6AA 2HPIA 3UG4A 3MTWA 4W89A 5AB3A 1UBPC 1R6WA 2ICSA 4LF2A 4KKXA 4M1RA 3II1A 5I7GA 1YDNA 4AIEA 2BVTA 2CLIA 4GBUA 3RX2A 3W27A 1GQJA 1KFEA 4IQDA 2Y5JA 3UYIA 1ZBCA 1F4HA 5IDZA 1T40A 3LDVA 4F0HA 3UA3A 4AC7C 3QOKA 1GCYA 4MKVA 3SAZA 2PS2A 1TO3A 4XG1A 4E4PA 1SZEA 1SMDA 3VOCA 4D8ZA 4HK6A 1R3SA 3C0QA 3KBNA 3S1VA 4IGNA 3UG5A 1A5CA 1TMLA 3VUSA 2ZXDA 2WVVA 2UBPC 5C71A 3SZ8A 1ZQ5A 2NSXA 2RHGA 3ORWA 1JF5A 3NPVA 4HZ6A 4JTEA 4ZBCA 4YS1A 2ZA1A 3JR2A 4X2PA 5CJNA 3KOWA 3PPFA 5HUPA 4ACZB 3W1AA 3QVQA 4JIIX 3EXTA 4PUJA 3C0JA 1GTEA 4M6PA 3TTYA 2YZRA 4QQUA 4P8WA 5DCDA 1RY0A 3GVWA 2PF8A 4FXFA 2PDJA 4IICA 4M6UA 3VE7A 1QNRA 1GZ1A 4J3UA 2QQ6A 2V30A 2I57A 3N4AA 4MZ1A 4HCLA 3IANA 1AFSA 3E2VA 3BAIA 3LM7A 3VIHA 3W85A 5FEPA 3VKDA 2B81A 4L80A 1KXTA 1NSJA 2KAUC 2EXOA 3VAVA 2WKJA 3PZIA 3F4WA 2GOKA 3AXKA 1OHLA 2UY4A 1GGOA 3DG6A 1LTDA 4KWOA 3KLKA 2H9AB 5D9MA 3VKKA 3C61A 1X6NA 1E70M 3NQBA 3PBMA 4KESA 1I6NA 1Q13A 5HINA 2IPJA 2NXHA 3HF3A 2YYUA 4C6DA 4YLWA 4AIUA 4JIHA 1RQBA 3DG7A 3M0LA 3NPUA 3HTWA 3KM8A 1RCXB 2AQOA 1H49A 4M56A 2QDEA 1X7FA 1W54A 1BEUA 5REQA 4Q7IA 1LUCA 4LS2A 1V3LA 1MDLA 2GJXA 2ZUWA 3GR7A 3NJ3A 2ALRA 4BY3A 2XSXA 2QCEA 4OT7A 2QDGA 3IUDA 4HYVA 1HW6A 2CU0A 2G8ZA 2VD9A 2D23A 2O7QA 4D6FA 3HQNA 1P5BA 2CBVA 1FHVA 3QKZA 4AMCA 2UY5A 1G4EA 1UC4A 2DPEA 2FHBA 4BEQA 3AHTA 3CPGA 1J6OA 3DKJA 3EOUA 4EPKA 1WAWA 3B40A 3TP4A 4A29A 2XIQA 2V3GA 5D32A 3NUKA 1G7UA 3CPRA 3OGVA 2PD9A 3M5XA 2HSAA 1PKNA 4BQ5A 1JJKA 3LBMA 2JF6A 1POKA 1EYEA 1FWBC 4B2DD 1WPCA 4A22A 3ZLHA 1QASA 1MQQA 3GYCA 2E68A 3B04A 4BI6A 1VS1A 2YW4A 1JUBA 4Q8VA 3E49A 3MP3A 1GQIA 2CYGA 2YFOA 3BW2A 4H9VA 3UPBA 2VD8A 2ASHA 1GORA 1QHPA 2YBVA 2DJXA 4AD3A 5JU6A 3KCLA 4ZFCA 4JY8A 3ES7A 2NQHA 4WXZA 1FUYA 4PMRA 4IIFA 1LM1A 4GZ7A 4YWIA 4AY1A 2Y7DA 3OLDA 3FVDA 2ZRXA 3IIXA 3CTLA 2CLOA 2CZVA 6TAAA 4CUCA 5FESA 2VFFA 1PHWA 6CGTA 3M0IA 1QK0A 3WLPA 3MPGA 4GO8A 3RITA 1OCNA 1XLLA 5IHRA 5CC3A 1N55A 3CEUA 1SSDA 2W62A 1R8LA 3TZNA 2W3ZA 4LWWA 4AWTA 4HZ7A 4L6OA 4B4HA 3BCFA 2R9RA 4Q4MA 4V27A 2J74A 3W6YA 2KZHA 2V5DA 1J6PA 2DDXA 3KBMA 4LOCA 1TX2A 4JFTA 2NSOA 5LIXX 3PWAA 3GAKA 1EX5A 1B4EA 3PJUA 2HPMA 2WHLA 1VLWA 3N2CA 5HWMA 5M1TA 4GPNA 2YJQA 5CXPA 2ZVIA 1CT5A 3S3GA 4GUFA 4LTSA 4H9UA 4QG9A 5EBUA 5HQMA 3CIXA 1E55A 3RPTA 4K39A 2OWCA 5A6SA 2J77A 3BH4A 5A8MA 5I23A 5KZMA 5I77A 4ZENA 3WFLA 5CH9A 4KWUA 4D6HA 4TVDA 4RCXA 3EWBX 2ZRUA 4JTTA 4XD5A 3E12A 3OZPA 4OWGA 1C7TA 3VMPA 3B8SA 3VM7A 4P7LA 3VC6A 5A6BD 1A5OC 2BVDA 2G3FA 3FA5A 2X40A 3CS2A 1E6ZA 5CLTA 1XX1A 5I6SA 2GVJA 3PWIA 4XTIA 4JTKA 3CK5A 3EB2A 3P6LA 4J2PA 4QJ1A 1XXXA 4ZB2A 4JFSA 3NM1A 2QYGA 1OYCA 2B7NA 3GE7A 5D37A 3AZRA 3KOZA 3LV5A 1W9XA 1GKRA 4TX9A 1XDLA 2I14A 1LLZA 3GW3A 1M41A 3N14A 2GVEA 3R13A 3AC0A 1T5AA 1TA3B 4A8RA 4LBUA 4PBEA 4ES4A 1FHDA 1UKQA 4CQAA 1F07A 2QT3A 5M2FX 1GG0A 1R47A 4MPQA 1LJYA 1V03A 5GQBA 4M29A 1XI3A 2ZTKA 2XM2A 5TBOA 3WMLA 4K38A 1RK5A 4DBEA 4F79A 3PZUA 1WDDA 3LK6A 3AZSA 3B9AA 3QGKC 3R4IA 5CC5A 3FS2A 1BYDA 3NL3A 4RZBA 1BVZA 5F1UA 3M64A 2E28A 4DUOA 3IIZA 1ESWA 5LKYA 1LRTA 3W7GA 2XINA 5ABHA 2QXWA 1XYZA 3OG3A 2BX7A 1VPYA 3FEMA 3H4GA 4MUPA 4PULA 4GISA 4ZZ9A 2PGFA 4N42A 4U2YA 4PRTA 4V2XA 4RNHA 4LEFA 2J13A 2PRMA 3O6DA 3MMWA 3KOXA 4HCDA 2DZSA 2HS8A 5MKGB 1HJVA 4HPJA 4WQ6A 3GZAA 1FWTA 3CMGA 1GWJA 1KXQA 3DERA 3TC6A 1JZ8A 3RCNA 4H4IA 3E96A 4O1FA 4KIEA 2CIPA 3K8MA 4JHOA 2C71A 2G0WA 2CWXA 1OG0A 4Q6XA 4GH3A 1LP6A 3V0SA 1ODUA 5FF0A 4QLLA 4QJ5B 1KM2A 4WJEA 3CWOX 2YCKX 4YCOA 2J24A 3ELFA 3DN5A 1OVDA 4NIRA 5A69A 2V82A 1QXLA 1GQLA 2XVKA 4F0RA 5EMYA 4KGLA 3OTRA 1AA1B 3S9ZA 2WKGA 3ARSA 4JNZA 3A21A 1RBAA 1BF6A 3WLOA 5LYRA 1TVNA 1EUNA 1SSGA 2YDAA 3USBA 3W4RA 1JZ5A 3CIWA 1IR1A 2WWDA 2H6RA 2ISSA 3I10A 2ACSA 5A1AA 1HZYA 5D09A 3KHDA 2DT3A 3F4VA 4UTWC 3NNTA 3QSRA 4MZYA 4W88A 5TIMA 2WMKA 4IL0A 4RL3A 3OLEA 3B8TA 3QY8A 3LI0A 3PZNA 3WELA 2A3AA 2WJFA 2UV8G 1PZ0A 3AIQA 1S38A 1Q6CA 2PPGA 3W1RA 4MUZA 1ZB5A 2BP1A 1WXZA 1D7FA 3UJRA 3LN3A 3WH6A 4JCLA 4YL2A 3AMGA 1EPXA 3WLTA 3T55A 3UPMA 3NWRA 4HA3A 2OT1A 3N17A 4UQCA 5CLWA 1WQ5A 2ALDA 2JF7A 1PJ9A 1TV7A 3UR2A 4H9TA 1W5MA 1VPQA 2OR2A 4GXPA 2ZDRA 3ABOA 1V0MA 1CWYA 2GK1B 3QF0A 3QMRA 2X1RA 4QS6A 3QRHA 1VJSA 1BVWA 3MUIA 5G2WA 2YW3A 2Q71A 1MW3A 3PZQA 5H8UA 3O7UA 3WD4A 3SGZA 4DX3A 4WSKA 4AXNA 4EACA 1UR9A 4E0CA 2BVYA 1W5QA 3GNNA 4G7FA 4B5SA 3N25A 4XX6A 5DQPA 2OO6A 2FZMA 1I0BA 5B80A 3W7KA 2IPGA 3UR7A 4CCDA 4ZR8A 3A22A 3OG2A 1WKEA 1ONRA 1MSSA 4BQ3A 3OIXA 3I4KA 4BI5A 2WANA 4UFJA 3UJEA 3WF3A 4H8NA 2DIEA 4LANA 4MYAA 5C8BB 1U1HA 5BWAA 1W31A 1AD4A 4S3GA 3MUY1 4HP5A 4GUJA 2FTWA 1OSEA 3QBUA 1E6RA 1XLIA 4V33A 1PTAA 4QNEA 1CTNA 2AGKA 3LLDA 1SR0A 4BQ4A 1UWRA 4NNCA 3VINA 5HNUA 3CAWA 1ZLPA 3NQCA 4Z2JA 1G4SA 1J0HA 5D4YA 5FL1A 4H00A 1ISWA 1AJZA 1PSCA 4DZIA 1LL4A 3F1QA 3GRIA 3TE9A 4ZL1A 3LRKA 3UJSA 3LPPA 2OX4A 4N9DA 2UWFA 3QC0A 2EEXA 5C70A 1RLCL 3W07A 3H2AA 5B7ZA 2WKLA 4GI8A 1W5NA 1U5HA 4POCA 2WHKA 1RSCA 4CVWA 4DYKA 3TEVA 2PWUA 1JDFA 4BR1A 1MDRA 2O9RA 1SJBA 3CT2A 2VNCA 4JEQA 3WLKX 2E4TA 2OXNA 2YL8A 2VVNA 2PGRA 4JAWA 4F40A 4IUGA 1IWAA 5JIPA 3CGTA 1K77A 1N7KA 2A85A 4KMQA 5CQ1A 1NDYA 3CLMA 2BV9A 5H1WA 3ARYA 3H70A 3PJTA 1CXEA 2TPSA 5K4ZA 3GH5A 4U28A 3HGOA 1D7KA 2OB3A 2XGIA 1RY8A 5AC6A 3OZMA 4DPQA 2E1WA 4KIRA 3SQSA 2P50A 4REQA 1BWLA 6PTDA 5G4WA 3VD7A 5HXMA 2XSBA 1D8CA 4QCFA 2WQPA 1E71M 4XIAA 1PO9A 2O4MA 3VX0A 4JTCA 4ZOCA 2POZA 1HG3A 3BJFA 1IV8A 1NEYA 5ABFA 2TSYA 4XO7A 1P0EA 5CGMA 5SWUA 1FH8A 1H61A 5DXYA 3N12A 5XIAA 3ALFA 3ERPA 1EA0A 1R3VA 1FA2A 2D0FA 4RV3A 1LBLA 4LVBA 1XLHA 3PAJA 3WJSA 3EX3A 4AD0A 1ZJIA 3VMNA 3W01A 3ARXA 1TV4A 1F8MA 2X1SA 3QYQA 5C9RA 2OEJA 5I3DA 4N0RA 1DWAM 4M5PA 2PLJA 1OYBA 3DXIA 3Q2DA 4RE4A 3RX3A 3SB0A 2XTKA 3EDEA 2OTDA 4W86A 3LHYA 4NHVA 3BV7A 3Q94A 2GJRA 4RR4A 3KBSA 3DHDA 2BB0A 3TLQA 1HKVA 3CXOA 1H2JA 3SCUA 3VIOA 2JIEA 1C9WA 2FZBA 5BYWA 1UMLA 1WUEA 3RJXA 4TR9A 3HJEA 5DEZA 8CGTA 3U3HA 3A6OA 2W61A 3HMJG 2JEPA 2A5HA 2ZXQA 1TV8A 4Q8NA 3ICJA 3MWCA 4L7ZA 3HPXA 5TD4A 2V5BA 4QP0A 3FOKA 1KV8A 2QW5A 3P2VA 3HA1A 1FTXA 4XSLA 3VIPA 4FXRA 1GZGA 2H8XA 2QCLA 4CNPA 3VOFA 4A3HA 3WSUA 1NF0A 3W7CA 2WC3A 2F61A 1M03A 3I65A 2VZUA 4HJFA 3AMKA 3WQDA 1XPGA 3BAKA 4NZ5A 2VEPA 3NL6A 2QV4A 4QXIA 3RO6A 3G1SA 5DFAA 3MUXA 2Z1BA 1HKKA 3IS4A 1EQPA 3N15A 2GJLA 3QV7A 3W38A 3K13A 1XIBA 4NY2A 3W2JA 4QCEA 1XIEA 1L6FA 1ME8A 2A6LA 4CKQA 3A4JA 1EDTA 3AXXA 3NZRA 3V0UA 2WVVB 3A64A 1UC5A 3H55A 4TV5A 3H7RA 1XW8A 1DHKA 4AHQA 3A13A 2E9BA 5BOFA 2DIJA 3OU8A 4K8EA 1H11A 4YTUA 1VHCA 4FS9A 4ICMA 3KZPA 3AJXA 3S2CA 1XYMA 1JPMA 4RNIA 3ZIZA 1B3VA 2OZTA 3QM3A 3STFA 3R8RA 4S3DA 4XAGA 3W7IA 3G0UA 1EIBA 5BXSA 4E3VA 3LYEA 1GEHA 1XYCA 2NV1A 5M3WA 1JCJA 2WMIA 3W7OA 1HF6A 4C6OA 1BRLA 2OLHA 3ZVHA 2QDHA 2DSKA 1E0XA 3AS0A 4GXMA 3MCMA 3LNMA 3VD9A 4I7VA 1FDYA 2Z29A 1GK8A 1B3YA 2ISVA 2E5DA 1UUQA 1PUDA 4RDZA 1YKWA 2XPKA 1MXGA 5HANA 3P7YA 1VCFA 3GBDA 4FNSA 3GX9A 1H7PA 3KHJA 4JTDA 3O0FA 1B9ZA 2XN2A 4KETA 3EXRA 3SGGA 3STEA 4S38A 4PTWA 5F2GA 4GABA 5REQB 1RV8A 3CU2A 4AWEA 2OYKA 1LUCB 1PX4A 3O16A 1B30A 2A6NA 5E6ZA 2GJXB 3ZS4A 3FJNA 1VFSA 4D1IA 3DFOA 4GJIA 4D8LA 2PWGA 3IK4A 2OQYA 3UNDA 3EGJA 3LB0A 4GNKB 1HGWA 4UFIA 1C8YA 1ALDA 4ZXLA 3I7SA 1B57A 4QHRA 3ITXA 2FGLA 3E0WA 2FZDA 2BHYA 3DENA 4MB5A 2VC5A 4PUDA 3R94A 2DW7A 2Z00A 3CV7A 1EX1A 5CBBA 3MV11 4JOMA 1FWWA 3EOLA 1WBHA 5J04A 4E8CA 4NJIA 3DBNA 3W73A 1F3XA 1ISVA 1YADA 3PZVA 3W1XA 1MVYA 3L21A 4FOKA 3THDA 3PJWA 5EBAA 5HAOA 4AY8A 4NYYA 4K7VA 4AEOA 4L64A 3C2RA 3EB3A 4HNCA 1TRIA 4NAEA 1L2QA 4LY8A 5CPSA 4C6LA 3GUGA 3IJQA 4GK8A 4C5ZA 1KXVA 3FNDA 1QW7A 1V3IA 1V3JA 4GQRA 2I5IA 3NQDA 1R3RA 4Y2WA 2C7FA 4Z2KA 2FQIA 1XRVA 3BUVA 3H4WA 3QR0A 4JN8A 1NTHA 4DAIA 1MFUA 1B1YA 1GHSA 4S23A 1JPHA 1CCWB 1BAGA 1E1EA 4O28A 2VRKA 1UR8A 4QE5A 3EOEA 4Q8QA 1FWDC 4UC5A 3WQEA 4J35A 3ITCA 1F3TA 1HL8A 2VFEA 1R7OA 3O07A 5KTLA 2C16A 3DDMA 1BXBA 1JDCA 3QGAC 2QPSA 1EWDA 1QHOA 1RP9A 4E8GA 4GMEA 3LPOA 1O5RA 1O4UA 1UH4A 3S4TA 3EWCA 5E09A 4C6CA 1SPQA 2OPJA 2AOSA 4LAKA 1JD9A 2GSJA 2ZZ6A 4XO6A 4LV4A 5C2CA 4K2SA 4QITA 4CQ9A 3MKVA 2VX4A 1KBJA 1YPFA 4O4VA 2JIWA 1P7TA 3WLHA 5BU9A 2FZ8A 1O1ZA 2QULA 1DJNA 2BMBA 1G7VA 4RK8A 2QLYA 4DRSA 3O05A 3NXFA 1X6UA 2WC4A 5I78A 1J93A 4J3WA 3GUWA 1VRDA 4HSHA 4JQ4A 3K4DA 4IISA 4HZ8A 1KCLA 4R7OA 2ZC1A 1K7EA 3TSMA 3W1TA 2FFIA 4L1WA 4O12A 1SW3A 4MDOA 4V1XA 3KWXA 2I9UA 3B0XA 1XHGA 3IJ8A 4P7QA 3EA2A 3KZSA 4ZO8A 1RAKA 1GKPA 3RLGA 1F74A 2V0TA 4FX6M 5LA2A 1EO7A 4PFMA 3VNMA 1Z42A 4N2YA 3R0UA 3S2NA 2VUNA 7ODCA 3BLFA 3RU8X 5FSEC 3JU2A 1I9CB 5CPMA 3HO8A 1K8ZA 2D73A 1VJZA 1L6YA 1CXKA 3GBEA 4RX0A 3FK4A 3TUUA 1F6YA 4IXHA 4Z17A 2WYSA 4IMAA 3W88A 1PWMA 2CZDA 3LRMA 1VHNA 3STPA 1BTMA 4LRTA 2INFA 2OKTA 3QZEA 4LEQA 1HFBA 1HJUA 1KRCC 3U5UA 3C8NA 1VIZA 3A4WA 1VBGA 4R3UA 4DJFC 4JTAA 5CZ0A 4GQGA 1KR0A 4NRRA 3WCZA 4JYDA 1C91A 3S83A 3KBWA 4Q4OA 2TODA 1XLAA 2BTMA 4OV9A 4FPSA 2IKGA 5G5IA 1SGJA 3QSTA 4BI7A 4GJJA 4YWSA 4BZYA 4K1GA 3DH7A 1OCJA 4GGBA 4U5IA 5AHLA 9XIMA 1VQTA 1N2VA 2ISWA 2VGBA 1DWGM 4LYRA 3AHYA 2BOFX 5M5DA 2RDWA 4O1CA 3FKKA 3LD5A 1WDPA 4R7WA 4WVXA 4DWSA 1KTNA 3CEPA 3MMTA 1A5SA 1EC9A 1U1UA 4HNLA 1R3WA 2WC7A 4FIRA 1PL9A 3MI6A 2X0SA 1UIPA 3W2KA 5D05A 2PP0A 3VNLA 1UJPA 5AC8A 1A47A 3OHMB 4GKLA 5ABTA 2YXXA 2QCDB 2QAPA 1SMAA 4PE8A 4BQ2A 1YXDA 1XSKA 4U31A 2GVYA 1P6BA 1E3ZA 4QQ3A 3LBOA 4W5UA 3TAOA 3KUMA 3WQGA 1XCXA 2GUBA 2JBMA 2DSUA 5G1YA 1JG9A 5E9AA 5EGRA 3LCWA 2EO7A 2PWDA 2E9LA 2FTPA 3CZLA 2FH6A 4KWVA 5HNRA 1R3YA 4RKAA 3M07A 3TONA 3DCPA 3SQLA 2VL4A 4AQLA 4JCMA 3L0KA 3W28A 2HXTA 2VELA 3TYBA 2CXEA 3W7EA 1IYXA 2Z1XA 3POCA 4LC8A 1IXNA 1J10A 5A6KA 2BGQA 2RGMA 1S46A 2G95A 1JIBA 3SSZA 1S2CA 2WZEA 1FWHC 1XLCA 4WJ8A 4MF4A 3VMOA 2RDXA 4WDWA 3F4DA 3NFUA 4M8UA 4A3YA 3PS7A 4UOJA 1V79A 4QSFA 4IQJA 2NQ5A 4DN1A 1HP4A 3G2GA 3O2LA 1B90A 1DJWA 4LUJA 3RLHA 1IGSA 2I7GA 4UTIA 4O1BA 1EXPA 3FGCA 1F3EA 2QCNA 2PURA 1H50A 2WNZA 1RPKA 2R1KA 3RCYA 4OGZA 3ZFHA 1D3CA 1MW1A 4D9PA 4Y9OA 2ABAA 1DL3A 3KS6A 2PU0A 2R82A 4AH7A 3BTNA 2F8QA 2VZVA 3E2QA 1TZ9A 2OCZA 1N8WA 1UD4A 3O3RA 4O53A 4DBUA 3VIJA 1T0OA 4UTHA 2XVNA 3TJXA 2XFWA 1P4CA 4YYCA 5FJJA 2G3IA 3D46A 4MLRA 2BZNA 1FP9A 3U2OA 3B9NA 2V67A 1V08A 3Q45A 4N9BA 1V3KA 3I6EA 1PYMA 1W1YA 3KTSA 4L6HA 5FIPA 1NFPA 3R1ZA 4DXVA 5A8PA 1WO2A 3RR1A 3PBWA 4EPEC 3D3FA 3VDCA 5I5RA 3ZJKA 1E9LA 4YXGA 1XBVA 3J7HA 3B0UX 4G2DA 1O5KA 3K8LA 3SCVA 4IFKB 4XB3A 3GDLA 2ZRVA 2HVMA 1C92A 1LOSA 4RE0A 1U22A 1MWOA 3T0BA 5CGTA 3WK3A 5IM51 2QJHA 9XIAA 4GYFA 1CIUA 4HN8A 1MEHA 5LIWX 3AIRA 4XBKA 1A5MC 5CG7A 3BJSA 2PA6A 1FH7A 4UMCA 4R7JA 3QYSA 5AHNA 4P5UA 4MJZA 3KRBA 2Q01A 2WCAA 2NQJA 2WAGA 2VDHA 5T8GA 1TVLA 2OGYA 4HOWA 3EA3A 1XBXA 2X05A 4WOZA 4JHMA 3UT0A 4DXXA 4M24A 2CESA 4WHBA 4ICNA 2XN0A 3WQ4A 4TU1A 4D6CA 2VJXA 2Z24A 3TJ4A 1REQA 1QT1A 1V7YA 3NQEA 4EK7A 1CGTA 2VRJA 3FHQA 4UTFA 2WMGA 2VFHA 1IZKA 5JBDA 2CHOA 3GNRA 1LRQA 2XJ7A 1I2OA 5FSDC 3PZGA 3M7SA 4UOZA 3CUJA 3GR8A 2DUZA 1L0PA 3LLFA 3DG3A 3UCDA 3SN0A 4WDUA 3RG6A 1EYWA 1H0GA 3ZR5A 4JQ2A 2VFGA 3B97A 4EF8A 1E73M 4S3BA 4H7VA 3N2OA 2CZFA 3RMEA 4D72A 2A7RA 3AUJA 4AZ5A 4I9JA 1UZDA 3WO8A 4V28A 4C65A 2ZRZA 3UCQA 3TW7A 4JIRA 3ZT5A 2QCCA 3TLLA 1E15A 3L2IA 3MZNA 1BVNP 4S3FA 3WK2A 4QSHA 2P5NA 4RJEA 3P5ZA 3RLVA 3ARWA 3A12A 1E9ZB 4ZQCA 3C8FA 1U5JA 1OABA 1KB3A 4QIUA 1SJCA 1V5XA 3HFTA 2PTXA 4TMBA 4QEHA 3UQNA 2YBUA 1QI3A 3NIYA 1WCGA 2VRQA 2ZFAA 1CXLA 3WF0A 3MKKA 4GIAA 3A3HA 2BS9A 2IPWA 4IPIA 3WLSA 4KW2A 1FWRA 2HMCA 3QHNA 4QDPA 4REQB 1VGAA 4PYSA 3VGHA 1WZKA 2WHJA 4S3CA 3CASA 1PKMA 3GHRA 3SCNA 1JQVA 3IVSA 2XG9A 2EHHA 2X2GA 3RXZA 2B0MA 2VTFA 3EX1A 3LCGA 4R9XA 1VKFA 5ABFB 1Q6GA 3ABRA 1TPFA 3WF2A 4LH8A 1GVFA 2XGBA 1KXHA 4ZXOA 4Z08A 4LF1A 1CI1A 5IDIA 1T6MA 1U33A 3MHFA 1OF8A 1RHCA 3STCA 3WDQA 3CIVA 1NJJA 4S3AA 1XCWA 2DEPA 1XC6A 3TYCA 1U2YA 3LHTA 3D47A 4Z2LA 4BWLC 4ASTA 3IPWA 3GS6A 3CYVA 5D02A 3SCWA 3EDFA 3IGHX 4C7DA 2XVGA 1DKWA 2E6YA 1FRBA 3NQGA 1XLEA 1VIWA 3RN6A 2QIIA 5BRBA 5K2ZA 1JAKA 4DI9A 2IUZA 3R0DA 1PDZA 1JAEA 3WJYA 1NY1A 2Z1SA 2WZHA 4BF7A 2QF8A 3PB2A 1OGGA 3O8AA 4C6MA 3V3WA 2W79A 4AZ7A 2ZZ5A 3LZ3A 3NZPA 1IF2A 3SBFA 3UR5A 3MI2A 1BWKA 3ITOA 3ONBA 1X8CA 3NL5A 1Z69A 5JUVA 4Z2HA 4TX6A 1SFTA 4ORMA 3L66A 2G50A 3FYOA 1J5SA 5E93A 3PUDA 3I4EA 3QZ6A 4W87A 1TUXA 1UJQA 2WZTA 1CBGA 3W1UA 2P53A 1C8QA 2CLLA 1UWUA 4DWSD 3M0VA 3XISA 2F7FA 1OFAA 5D38A 1CEOA 4GKTA 5AHFA 3R7MA 2XHYA 3VDHA 5DRIA 3MSRA 3ECQA 5K4XA 3M0ZA 1UOKA 5G2HA 3HZ3A 4P8VA 4FB7A 3G18A 2J78A 3MHUA 3CQHA 3MP4A 2DP3A 1GOXA 1SW0A 3VNKA 1Y0EA 4XD4A 3B9DA 3O6YX 4WJXA 2QJIA 1PAMA