4HMNA

Crystal structure of human 17beta-hydroxysteroid dehydrogenase type 5 in complex with (4-(4-chlorophenyl)piperazin-1-yl)(morpholino)methanone (24)
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
318
structure length
306
Chain Sequence
QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C3
publication title Morpholylureas are a new class of potent and selective inhibitors of the type 5 17-beta-hydroxysteroid dehydrogenase (AKR1C3).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 117
structure length 306
sequence length 318
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2012-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4hmnA00
2I17A 3M0IA 2VDGA 3BV7A 4H7CA 3UYIA 5AZ1A 4H8NA 2PEVA 1YNPA 3CV6A 4WEVX 5C7HA 4XZIA 1US0A 4JQ4A 4QX4A 3LQGA 3V0SA 2AGTA 4XZMX 2FVLA 3GHTA 4QBXA 3BCJA 1YE6A 4MHBA 3WG6A 3M4HA 4FA3A 3R6IA 1ZGDA 3R8HA 5HNTA 2ACSA 2DV0A 5LIYX 1LWIA 5LIKX 4XK2A 3EB4A 3GHSA 3D3FA 3GHUA 4HBKA 2HE8A 4GIEA 4WGHA 3N2TA 3LN3A 3UZXA 1VBJA 4JTQA 3DN5A 2PD9A 4GQ0A 5HA7A 3H4GA 1PYFA 1ZSXA 3G5EA 3V0UA 3WCZA 4IJRA 1X98A 4EXBA 4I5XA 3UG8A 3LZ5A 2DUZA 4JQ2A 2PDNA 2PDQA 4FZIA 3LQLA 4G5DA 4ZFCA 5LIWX 2IPJA 3RX2A 2HDJA 2PDCA 1Z3NA 4LBSA 2FZ8A 4JQAA 4DZ5A 4XAPA 3LENA 3GUGA 3UFYA 2I16A 3R43A 1EL3A 1ADSA 4JIRA 4EXAA 1AZ1A 1ZQ5A 2A79A 4YVPA 2PDLA 4QR6A 2ACQA 4JQ1A 3V0TA 4YVXA 5JH2A 4IGSA 3F7JA 3Q65A 3R8GA 3LD5A 1M9HA 3O3RA 2DUXA 4R9OA 1HW6A 3CAVA 1JEZA 2FZDA 1IEIA 3CMFA 3QKZA 2WZTA 1MRQA 4PUWA 2IPGA 2PDUA 3LEPA 4XO7A 3LNMA 1OG6A 2IKJA 2IKIA 1Q5MA 4HMNA 3G1RA 2R9RA 1VP5A 2PDIA 3EAUA 1C9WA 4JIIX 4RPQA 3T42A 3UZYA 3RX3A 2ALRA 2PDHA 3S3GA 5AZ0A 3KRBA 3LBOA 4AUBA 1Q13A 2R24A 1S1RA 4WDTA 1XGDA 3V35A 1EF3A 4WRHA 2PZNA 2PFHA 4OTKA 4F40A 2HEJA 3O0KA 1ZUAX 2FZBA 2HVNA 3COTA 4JTRA 4XZLX 1FRBA 2NVDA 2IKGA 4L1XA 3EB3A 1IHIA 5DANA 3LUTA 1S1PA 5JH1A 2PDGA 1QRQA 3NTYA 3VXGA 4LAUA 3MC5A 4Q7BA 1RALA 1Z89A 3UWEA 4DBWA 2NVCA 1XJBA 1R38A 3N6QA 4YU1A 3R94A 1AH4A 1YNQA 1K8CA 3UZWA 4JTAA 1RY0A 3V36A 3WBXA 4LBRA 1RY8A 2IQDA 2BP1A 2C91A 1A80A 4ICCX 4GA8A 2IPFA 4Q3MA 1MZRA 2IKHA 1HQTA 1PZ1A 3FX4A 4JTCA 1J96A 3CAQA 2ACRA 4XZHA 3Q67A 2F2KA 2INEA 3LZ3A 1LQAA 1PWLA 5LIXX 2WZMA 2J8TA 2FGBA 4FALA 1S2AA 4QXIA 4LB4A 3ONBA 1PZ0A 4PUUA 4LB3A 3FJNA 1EXBA 2PDMA 2IQ0A 2FZ9A 4GABA 4DBUA 4WDXA 3H7RA 1S2CA 4XVEA 4JTDA 1EKOA 3BUVA 5M2FX 1SM9A 3U2CA 2PD5A 4ASTA 4LAZA 4JIHA 1MI3A 4XZNX 2F38A 1AH0A 2HE5A 3R58A 2HV5A 1T40A 3GHRA 4GQGA 2ISFA 1Z9AA 3WBYA 1AH3A 4YVVA 4IJCA 2PDFA 2P5NA 5HNUA 4DBSA 4L1WA 4WDUA 2BGSA 1Z8AA 1AZ2A 1GVEA 1YE4A 2PDPA 1X97A 2PDKA 4PRTA 1T41A 4GCAA 3WBWA 4PR4A 4WDWA 3P2VA 1AFSA 3BURA 1XF0A 3C3UA 1X96A 4GACA 2PDJA 3H7UA 4YS1A 2HVOA 5KETA 2PDXA 3DOPA 2INZA 2BGQA 4NKCA 3ONCA 1QWKA 3RX4A 1PWMA 3CV7A 4XO6A 3UGRA 3B3DA 3UP8A 2PDBA 4JQ3A 2ACUA 2IPWA 3M64A 4XVDA 2QXWA 3R7MA 3UZZA 3ERPA 3MB9A 1UR3M 2PF8A 3CASA 2PDWA 2CLPA 4FAMA 2IS7A 4PMJA 2PDYA 4PRRA 5LIUX
chains in the Genus database with same CATH superfamily
1R3WA 4EKJA 1XW8A 2Z2BA 2DSZA 2O9RA 1S3TC 1M68A 2P8BA 3GR8A 4GZEA 2X42A 3GG0A 3EXTA 1KR1A 2WKGA 3NL3A 1M03A 1G69A 1Q7QA 1JYVA 9CGTA 3U5UA 2A1YA 4FX6M 4XZMX 1EX5A 1QOPA 5FJPA 2J24A 3APGA 4MB1A 3FVMA 1V02E 3SR7A 4FLQA 4Z0SA 2NLYA 3C8NA 3FIGA 5CC5A 3NPUA 1EA9C 3M5VA 3G18A 1YKWA 3NZRA 4KGJA 2QJNA 2IMRA 4OJYA 3ITVA 4CLMA 3OOQA 2ISWA 3EKGA 3F2DA 1XGZA 2J66A 3AROA 3LLXA 5HA7A 3ZSSA 1TTJA 4CU6A 2JGYA 3KVJA 3GD6A 4GE8A 4MB5A 2NX9A 1HGWA 5KZEA 3WH5A 4BK9A 2J8FA 1UYQA 2ZADA 1GOOA 2RAGA 3CUJA 4GKLA 4H41A 1CXLA 3S0CA 1X98A 4U33A 4LALA 4IQDA 3IANA 4ICMA 2DZXA 3RLVA 1QFEA 2PU0A 3T9PA 5ECUA 4JY8A 4DWSD 1GORA 2G97A 2WMIB 4XZ9A 4DUVA 3HQOA 3IJQA 5FAGA 5CSYA 2PDCA 3I7SA 1KW1A 1E4LA 3O6YX 2F6KA 1VQTA 1R47A 4LAOA 3BGGA 1XPYA 3LENA 2VJXA 3DBNA 1OZQA 3GUGA 4QJ5B 2YXGA 3GR7A 3TV8A 3U6WA 3CO4A 5GJPA 3O06A 2FFCA 1SJBA 3AMKA 3MA8A 2BZNA 3B8VA 4Y9OA 3I6TA 3PVFA 1EWEA 2PAJA 4XSLA 2VHLA 1Q45A 3L0GA 1ZJIA 3P14A 4JFUA 2ACQA 3V0TA 3E2QA 1MWOA 4GI6A 4DJEC 4C6DA 2BBFA 1P6WA 2WHLA 4QHRA 1OEPA 1WOAA 3LS9A 3ABXA 4BWLC 3QKZA 4O13A 1EYWA 2PUZA 2BDQA 4Q8VA 3LNMA 4PFMA 1O95A 1DWIM 5L9FA 4GUIA 1OG6A 2OYKA 5HMFA 2ATMA 4B16A 1R3SA 1ZS2A 3A47A 8XIAA 4MWAB 1FFQA 3I6EA 4O17A 1J0IA 1Q6DA 5I23A 4NI3A 2GUYA 1NOWA 4PUKA 1PSCA 4YHGA 2YBTA 1MNZA 3ZJ6A 2WSRA 1XGDA 5DXXA 2CLIA 2PTWA 3M16A 2HEJA 2EXOA 2FH8A 4PUMA 1GVFA 1ZUAX 2HVNA 1IZKA 1ITQA 4NZJA 3CK5A 1KFJA 1K03A 1VFLA 5C2XA 4B4HA 1JZ3A 1BTCA 1BLIA 5K4ZA 2Z7GA 5A6BA 3MC5A 1XI3A 3VI2A 4LW7A 4P7NA 1FP9A 3KL3A 4PODA 3B0PA 4JTAA 3KS5A 3WBXA 5E6YA 3H53A 4DF2A 5TIMA 1JPIA 4BHYA 3QY6A 4L61A 1KKRA 4MOZA 1TPB1 4WKAA 1BG4A 1YW1A 1HKKA 1JI2A 2WM0A 2WCSA 2WKLA 2EG8A 2OKTA 3DZ1A 4I9AA 1VIWA 3LSBA 3PJWA 4KEZA 2E8YA 4RNJA 4A21A 3PP7A 2OWXA 2OELA 2XN0A 1E4MM 4F2BA 1E5NA 4DAFA 3O05A 4B5WA 3L2LA 2Q3OA 4MJ4A 1K02A 5LNUA 3P0XA 1TV8A 3PUDA 3P60A 1MXDA 4KIRA 8A3HA 4PSRA 1OCJA 5M2FX 2W27A 1DOSA 1SM9A 2WK2A 3HQNA 4ASTA 2EAWA 4NILA 1G9HA 6REQB 1M1BA 1D7KA 3VX1A 5E0KA 4H9XA 4M8UA 2CETA 1HJVA 3W23A 3B97A 3CUZA 2VENA 2F61A 3A3WA 3TWBA 1V6WA 1CGUA 3MMDA 3QTGA 3QRHA 2QT3A 3QYSA 1UD8A 4JN8A 3W02A 3FVDA 1W3TA 2VX7A 4TQTA 3GFZA 5IBXA 1K8XA 1HO1A 4UFHA 3ANVA 2ZFAA 1DTUA 3TYCA 1NQ6A 3KS6A 4XSMA 4WGXA 1UIPA 3L5LA 2UY5A 4AHQA 3AHVA 1JYNA 2ZTJA 3ITTA 2J9XA 1J9YA 3PS7A 3IJLA 3ITCA 3MP5A 3ZJ8A 4EP8C 1DIEA 4LPCA 4C6QA 4FO4A 3CO8A 1WKFA 2CZEA 4KESA 1FHUA 2O9OA 3MV01 2ISDA 3O8AA 2WV8A 2CLMA 3ZOAA 3KHDA 4M6VA 3WF3A 1E1CB 4NHVA 1ZBVA 2D24A 3AO0A 3UZZA 4FAMA 2WLZA 1NARA 3FYOA 4KWSA 4PMJA 4GXMA 1TIMA 4RZ5A 4PRRA 3HMJG 2J78A 1DWFM 5CSUA 2TAAA 2VX6A 3UYIA 1NDVA 3BJTA 5EMJA 1XXXA 5REQB 1TO3A 4K1WA 4FB7A 3FV9A 1VBHA 2A4AA 5C7HA 4S3JA 1W1IE 2UY2A 2Q71A 2GWNA 1JFXA 3VIGA 3GU9A 1D3CA 3T8QA 3DHUA 1QAPA 1KTBA 1RQEA 1K1DA 3MHFA 3OB8A 3EOLA 3IIXA 4HU3A 2XH2A 1GG0A 2NQ5A 4MY1A 5HPOA 4H2HA 1A5AA 1T0OA 2CZFA 1AQHA 1J0YA 5I3JA 3QN3A 1MFVA 1IYXA 4KCTA 4HBKA 1JCXA 2HE8A 2P53A 3UNTA 3N2TA 3ITOA 1ITCA 4CQCA 1QNSA 2VP8A 3DN5A 2EKGA 4GQ0A 4MJMA 1X39A 5ABTA 3IACA 1TPUA 3S2JA 3TDFA 4D6CA 4IJRA 3O63A 2RUSA 1UR4A 1E0TA 1O12A 3L0KA 3W84A 3EEZA 2WKJA 3N04A 3LERA 4C6LA 5J5RA 4F0SA 4TVUA 3VINA 2VRQA 3PZVA 3T78A 2NQ9A 4I7VA 1SW3A 4LEFA 4XX6A 1TPDA 4LBSA 3WBAA 2JIEA 1CENA 1OD0A 4GYFA 5E6ZA 5F2LA 4Z08A 1E1CA 1OC7A 2BODX 2V3DA 1GVSA 4AEFA 1JZ2A 3KX6A 1UP0A 3NNTA 4GO8A 4GMEA 4WXZA 2OWCA 3A5FA 3S6OA 3T40A 3ARRA 2JF7A 1EL3A 4UTLA 1CCWB 4L56A 5K9XA 1UR1A 3UEQA 3CMGA 3TSDA 1Z48A 1WKYA 3MUCA 3GW0A 3DG6A 3AXKA 4JQ1A 2W61A 4J3SA 3MSRA 1GPWA 2YZRA 3VOGA 3OZMA 2D73A 2FZDA 2AGKA 2V0TA 4GC3A 1JDFA 1H1ZA 1L8NA 3T2QA 3U9IA 5I6SA 3EPOA 3W7DA 2YYTA 1TCDA 1AW1A 3W1MA 5FIPA 2VQTA 1CXHA 4UQEA 4O54A 2CHNA 5T9BG 1UMLA 2DGAA 4JIIX 4QQUA 1ITUA 2I5QA 1WQ5A 1REQB 2WZEA 5FJIA 6ENLA 4FXSA 4AZ5A 2QDHA 3TR9A 4K38A 3WQGA 1I2QA 1BVZA 1MQQA 3S9ZA 4OBSA 3P80A 1JZ4A 3GVWA 3PZTA 5XIAA 5I09A 4UFLA 3DECA 2V81A 2QZRA 4MFDA 1Y5VA 4UOJA 1KLYA 4M80A 3NTYA 1Q2SA 2Y63A 2FTYA 3CEPA 1QWGA 3RU6A 4WZHA 1W3LA 1UWTA 3G77A 3QOMA 4CU7A 2OZ8A 4K2SA 4LJ3A 5IHSA 3G6LA 2H3BA 1U33A 1EC8A 1FWEC 1XFCA 3LPPA 3NR0A 1K9FA 1EC7A 4UTIA 1A80A 2VR4A 4ADSA 5EMMA 4GA8A 4IXHA 1XLLA 2J62A 4QCFA 3PSVA 1HKWA 3FX4A 2GVLA 4FPSA 4RW3A 3LZ3A 1V79A 3RRXA 1DL3A 3H2CA 4KCUA 1ZP3A 4PUUA 1DQWA 4C7FA 4CKQA 4AYGA 1CW2A 4AIOA 3ECQA 4MKVA 4O18A 3RF9A 1CEOA 3GDKA 5DRCA 4RLIA 3S5YA 4PCSA 2J7EA 4PCFA 5F7UA 1WB0A 2YIHA 2UV8G 2WHJA 4GY0A 3DX5A 3LLDA 3QHMA 3OW1A 4C7GA 5HJYA 2X1TA 1REQA 1QNPA 3MVTA 3UR2A 1FWGC 2GQ3A 3R12A 2Y88A 1NEYA 4M6QA 3UR8A 3BMXA 2EKCA 2R1KA 4GHRA 4L1WA 3GH5A 2XHYA 5HMEA 3H21A 3TW6A 1UASA 3CBWA 4DZAA 2VRKA 5A2CA 2E5CA 2DZTA 1W1YA 3WF4A 2PGRA 3NUKA 1PX4A 2ZTKA 4GPNA 1Z69A 3AFBA 1K3UA 3VC5A 2EPNA 1IT8A 1T5AA 2CBJA 2CWXA 1W9BM 2EF9A 5L6UA 1MYRA 1QW9A 3ZR6A 5TF0A 4BEQA 4CN6A 1HKMA 2INZA 5HNNA 3EWWA 4NKCA 5HANA 1QWKA 5DMYA 3UJSA 5IFTA 1MDLA 1M04A 3KDOA 3OIXA 3UP8A 3RILA 4EPDC 2ACUA 1SMDA 5C55A 3WNKA 3WSUA 3ISIX 4DWSB 1XLHA 4NYUA 4XZIA 1RAKA 3FEMA 2QJIA 3LGGA 2YCJA 5XINA 4D6IA 2VZSA 3ZT5A 2P1FA 3QC3A 2OB3A 3WDQA 1TG7A 1EDQA 1TPFA 2YDQA 1GVYA 4E8CA 1GNXA 2WMGA 4G2DA 3JUGA 4QDPA 4QBXA 4GRSA 1KM5A 4RE3A 5LIKX 4XK2A 1PHQA 3EB4A 1ZALA 5HJXA 1PKLA 2POTA 3NVDA 1XRVA 4MWAE 2E68A 5FL1A 2Z6JA 4HJFA 1V6XA 3SO7A 2VGGA 3OLGA 1C7TA 2HXTA 2BV9A 4HYVA 4CN1A 2XFFA 1A5KC 2OLSA 3F2CA 4BI5A 1YNYA 3B8DA 3C0SA 4Q7NA 4CEUC 1VRDA 2H8ZA 4O16A 1B9BA 1XLCA 2QCLA 3HV9A 3UG8A 3EKZA 4JQ2A 1MW0A 5BRBA 2E67A 4C91A 3SCVA 2HVMA 2J7FA 3UVIA 2NT1A 5D2WA 4C6JA 3SCQA 3VD5A 2EPKX 1L8PA 8CGTA 1XSKA 3QV9A 3SECA 3WIJA 3CZKA 2V30A 2V2DA 1TPVA 4IGHA 3PZOA 4RW5A 4WY0B 4W89A 3VMNA 3TWAA 4LAMA 3WDHA 1XPGA 3B9DA 1DHPA 1D7FA 3GQYA 4QS5A 2ZWZA 4LH8A 4OBTA 4JS3A 3DUGA 5LNSA 3BSHA 1L6WA 1YDYA 4ZSUA 1W32A 4HT3A 2OSYA 2QAPA 2ZXQA 2NWSA 5DBUA 5EMLA 3Q65A 4HPNA 3VC6A 1BRLB 4AEEA 5DCEA 3VGFA 3H55A 3W9ZA 4FNQA 4HHLA 3M41A 3CAVA 1SZRA 3M43A 2G3FA 1WXJA 1Q6EA 5E1QA 1WPCA 4K7VA 2DVXA 1DWHM 1WBJA 2OTDA 2WO5A 2NV2A 4KW2A 2WVUA 3DH7A 3TYUA 3SB0A 3KVMA 3MSDA 3DENA 3H6OA 3P6LA 3VTRA 1AQ0A 2PDIA 4Q22A 4AFYA 1MXGA 1C9WA 2Y6ZA 1X1OA 1YEYA 1P0DA 3LU2A 4G7EB 1GQNA 2YX0A 1XBVA 1EQCA 5AC4A 3V7PA 3BLPX 3NO5A 4JCLA 1DXFA 1KM1A 2D2HA 4PBGA 1PX8A 1WAUA 2R24A 6XIAA 2NUYA 2QCEA 4IL0A 4Z1CA 1J6OA 4IUGA 4JTIA 1EXPA 3OYXA 4A35A 3KE0A 1M7JA 4F0MA 2NUXA 2G41A 3M7SA 3HPXA 4N4QA 4H9MA 1V03A 2ZUWA 1F4HA 4JNZA 2IKGA 2TYSA 3MSGA 3KP1A 3DFNA 3ZLFA 3PZ9A 1YRRA 3FA3A 1EO5A 1VLIA 1QPQA 1T8QA 2WJDA 4A8NA 4LVDA 1GKPA 5D9OA 1VJIA 4X9YA 1HN1A 1S2UA 2E25A 4V33A 2ZUSA 2VCAA 2ZOXA 3VGHA 4G1KA 2BX7A 1FA2A 2FVMA 4MPKA 3WLOA 3TVAA 2DFAA 3CV1A 1UZDA 4NF7A 4QEHA 2DVUA 4MFEA 3LB0A 3TTOA 2VZTA 5CQ1A 2VL4A 4XZWA 4BZYA 2W6RA 3G8RA 3N4AA 1BRLA 2DSKA 3CWNA 5D2XA 2A0NA 4XZHA 5H2ZA 2Y5SA 3BOXA 5A6KA 3HQPA 5BZAA 1DJZA 2ZZ3A 3M9YA 4QJ3B 3KOYA 3BH4A 2DZBA 3KRZA 4GVGA 1H5YA 1S2AA 4LB4A 3V18A 5DXYA 1DKWA 4GVFA 4LB3A 4X63A 1S38A 1YDVA 3MBDA 4PRWA 4PEEA 1EB3A 3BCDA 4O15A 3KL0A 1KC7A 1EKOA 5CJNA 1E6PA 5C8BB 1B4KA 5C9RA 4CNTA 3QPZA 2D69A 2ZZ4A 3OJGA 1SGJA 2OO6A 1UUMA 2AQVA 4LS1A 1VPYA 2VYOA 4NX5A 4AD0A 1Z9AA 3U2ZA 1UQYA 1H7RA 3UR5A 1T8XA 2FB2A 3ZVHB 1J10A 4C6OA 1A50A 4QM1A 3CPUA 4HZMA 4B4FA 3Q2DA 4QCEA 2XIMA 5EYWA 4W85A 2QAFA 3V5OA 4EIVA 1KCXA 4FIQA 5FF4A 1TWZA 2JKAA 1QCWA 3RK8A 4DX3A 1OF6A 4NRRA 3LRMA 3V16A 2B7NA 1XYBA 1I2RA 5J8LA 2WHMA 5EY5A 3KOFA 4IMEA 4EAMA 4DJFA 3RM9A 2HPIA 4Y2WA 2PDXA 3DOPA 4FLOA 3T2OA 1HJQA 4QAWA 3NQFA 1VB9A 2BGQA 2WCGA 1DIOA 2BXZA 2J7CA 3ITGA 1LCOA 3CPGA 6TIMA 4XQ6A 1DWGM 1RXOB 3R7MA 2CKRA 3LK6A 2PF8A 3VFCA 1W1TA 1Q6LA 1QJWA 3N25A 4AIBA 3GNOA 3TUUA 2V67A 5AHLA 5EBUA 3AIWA 3ARYA 1DVJA 3QQWA 5DY3A 3W2LA 2X2YA 1YHTA 4IP5A 3C6CA 3VOHA 3FYPA 4UQ9A 4AVOA 1VJZA 3MI6A 3FW6A 4OQVA 4PCPA 1VYPX 3KFTA 3OIHA 3W7KA 3FYYA 3LRKA 3SUUA 4MYXA 4MHBA 1KGXA 3KWSA 3WQ4A 1UWSA 1GT8A 2Z26A 4H9UA 2FHFA 3R8HA 3STCA 1ISWA 1L6GA 1FQ0A 2C7FA 5D05A 4XBSA 3RMEA 4KGLA 4OGZA 1FHVA 1TJ1A 2CLOA 2H8XA 5CZTA 3NWRA 3RMJA 3NSMA 3CQJA 1BGAA 3B8IA 1TR1A 1VFFA 4S2BA 4MSSA 1ZNNA 3HO8A 5T8GA 4GI8A 3KVLA 4S23A 3WCZA 4JHZA 4ZOBA 5G4WA 3L2IA 2GJLA 1B0IA 4GY7A 1NELA 1W9PA 3GDMA 4EXBA 1FWAC 2ZX7A 5LZLA 1J0JA 1E51A 3S2NA 2CLFA 1TELA 1PO9A 2GVJA 5FJOA 2PMQA 5AVHA 4F9JA 1F6KA 1Z3NA 2O92A 3G3DA 3NL5A 1QBAA 3VIHA 1UR2A 3EDFA 4DZ5A 3Q94A 3GTHA 1LBMA 2PTYA 3E2VA 3BQ6A 1QO2A 4OKDA 1KA9F 5CH9A 4KWVA 3WY1A 2FFIA 5ECVA 4GZ7A 2VOTA 2I16A 3F4WA 2QPXA 4GC4A 4KCWA 3TJIA 4D6FA 4E2OA 4UTHA 1U5VA 4UIOA 1AK5A 4JNMA 4AD3A 1XG3A 1J12A 3TA6A 3NFUA 4LUJA 2RGMA 5JH2A 4BEUA 2HISA 2ZX9A 2HZGA 3L4YA 4XBJA 4R9OA 3ZJ7A 5FEZA 3ABZA 1VCGA 2VC9A 3AIBA 1SPQA 4GVHA 2PDUA 4M82A 1SO3A 3S4TA 2FLIA 1J8VA 3GTNA 1E15A 3ANYA 4KRZA 2R82A 3CL6A 3AYSA 1PYMA 4HA4A 1FCQA 2VO5A 3FK4A 3E0VA 1B3ZA 1PKMA 3OU8A 4NX0A 2VD8A 2DIKA 5A69A 3ARXA 1BTMA 3NQEA 2WVSA 2QDGA 2G0WA 8XIMA 3G1YA 2EEXA 2FH6A 4HTBA 4OHQA 4DPPA 2PDHA 3QV6A 3C2YA 3WQCA 1NH6A 3NQGA 3V4BA 3S1VA 1Q13A 3UD6A 1AMKA 4FX8A 1GVQA 3MTWA 4WCJA 1WUEA 1CLVA 3UWZA 1IF2A 1NVMA 3GB6A 4HP5A 5D32A 5DMLA 2VEMA 1N8IA 3W38A 3PBUA 3VKBA 3ZJKA 3ZLGA 2PDGA 4ACZB 3NPXA 4I9MA 3SW6A 4YYFA 3WK1A 2OR2A 2F9RA 4RNHA 3AUJA 3VGBA 3TQ0A 5BU6A 2GOKA 4S3FA 2NV1A 1JCMP 3UWYA 3KDNA 3UZWA 4H7VA 3LCWA 2JFEX 3FJLA 4R5EA 1V3LA 4LTSA 4IP7A 4M7SA 1NOFA 3WJZA 4EXQA 2IPFA 2ZXAA 3MWCA 5ENLA 1W91A 1HQTA 2AQOA 3TAKA 4R34A 1PTAA 3PZNA 5BU9A 1J96A 1E6NA 3NPVA 3REQA 3VGGA 3GVGA 1P6BA 2FZNA 4OUEA 2PBGA 4HVXA 1LQAA 2Z27A 4AXNA 1V6TA 2CXGA 3P67A 1SR0A 3GIQA 1WNOA 4AMCA 4V1YA 2IQ0A 1ZJBA 3H2EA 3KOWA 4O10A 4B5SA 1O5QA 4FX7A 3TTQA 3URNA 4J3WA 1JCNA 1FKXA 3CIXA 3S5SA 5KZDA 2C16A 4WOZA 3IAQA 3CLWA 3WF0A 3CT7A 3OLIA 4NY2A 5M03A 2OLHA 2F2HA 1H7WA 2AMXA 4IXXA 1P1XA 1FWNA 3NDYA 3UWVA 3GZAA 4N02A 3W2UA 4IJCA 1A5LC 4TTGA 1SSGA 2VELA 2P76A 2G50A 2VI0A 1Y8BA 2Y7GA 1S46A 4C6MA 3L68A 1UD4A 1Y5XA 3PWGA 4R3UA 4JTUA 2DSVA 2PGEA 2QQ6A 4U5IA 5A6JA 2WQPA 3ZT7A 3SGUA 1G67A 2VCCA 5CPMA 1B2YA 3O7UA 4GUHA 3WQDA 1AVAA 1EEXA 5CGQA 4PR4A 4WDWA 1K8ZA 3W26A 2GK1A 4C1KA 3GXNA 2E5DA 4PMXA 1HJWA 1K7FA 1S2TA 1A3XA 1T96A 1CLKA 1GOIA 2BVYA 1KR0A 3C8FA 5KETA 1AODA 1VCFA 4W7UA 4H8HA 1UC5A 2DIJA 1UOKA 2BY2A 1R9YA 2JEQA 1XLKA 3BXWA 3ME3A 4XTDA 3PUEA 3AU6A 2QMKA 5HAOA 4XO6A 4AC1X 1OT2A 1UKOA 4XIAA 1XV8A 2Z24A 5D2YA 1ODUA 2CESA 1NAL1 3WD0A 1E71M 4A3YA 2QCCA 4DYKA 2IS7A 2CIPA 1DYSA 3ZIZA 1MEIA 1VYSX 3ALGA 4AWUA 4R33A 1JULA 2FVKA 3QMSA 1G4EA 4JTEA 3PZUA 4EVZA 3ENLA 3CUIA 5IDIA 1IZCA 4IT1A 4E2BA 4LV9A 3QR1A 4GNJA 1TVNA 4B15A 4JN6A 3M44A 3ARTA 4LC8A 5A1AA 2CHOA 3KZPA 1XINA 3PFMA 1P4CA 3EX1A 3L23A 1H60A 1FCUA 4LU0A 4IGNA 4D71A 3TOYA 2GQ9A 1TMLA 4FSAA 4J3UA 4NAFB 2A3AA 2O4QA 3G22A 3W75A 3GHUA 1EDTA 3LHVA 3MT1A 2IQTA 4YL2A 1S5VA 1UMYA 2PD9A 5D8WA 4JEJA 4ML9A 4J3XA 1R6WA 2Y85A 3OPSA 3G6MA 4GZJA 3UJRA 3W85A 2O7SA 4LXFA 2E77A 4QROA 5I00A 4P61A 3LY0A 3W2JA 3KBNA 3N11A 3LCXA 3Q4DA 3W1TA 4US5A 2GLKA 4A05A 4GYJA 1EBGA 2PDQA 2YB4A 3MI2A 4Z0JA 3QZEA 1JPDX 1CBGA 4Y8FA 4C1NB 3APTA 2IXUA 4AVNA 3ARSA 4DJDC 2REQB 1Q7MA 1XCWA 2I5GA 1Y7VA 1JF6A 1GKQA 4H8VA 1NDYA 4EE9A 1JPKA 3AIUA 4QE5A 2BS9A 4GI4A 3R43A 4WKFA 3M0LA 1G6CA 3HQ1A 5LA2A 1JJKA 1ZQ5A 5CCZA 2C0HA 4W88A 3WENA 1XKYA 3ARPA 3DKJA 3F5LA 3AALA 5G4EA 2OKOA 4H4IA 4S1FA 1XR2A 1K7XA 1VEOA 2ZUVA 2B7OA 3M0JA 3HJEA 3FEQA 5BWAA 2XN2A 4PMNA 3VIFA 3RO8A 3VM5A 3PTQA 4A29A 3TW7A 2HK1A 1S2VA 1O66A 5H8UA 3W7JA 1RD5A 4UTFA 3WBEA 5HJLA 4KRUA 1O1ZA 4UFMA 3NQ7A 4BF5A 2D22A 1D3GA 2IKIA 5LSMA 1CDGA 2QEZA 2WSYA 1UG6A 2XIOA 2R9RA 4ENLA 5C6MA 3WLPA 3ARQA 2X05A 4W8BA 2VFGA 1RCXB 1LP6A 1VLWA 5HK4A 1EIBA 3R79A 1R3YA 3N2OA 3OLDA 3GDTA 1JDDA 1B1YA 4DWDA 3EMQA 3OQEA 2Y8UA 3VNJA 3EB2A 1J4EA 2L5HA 2V38A 1KQZA 4P7QA 3KL5A 1OF8A 2QVHA 2OYLA 1S5MA 2ZXDA 2ZUNA 5J5DA 4X2RA 5AHMA 1S5WA 2B81A 2WBGA 3RGTA 5IRPA 3SM0A 1JG9A 3CC1A 4YHEA 1NIUA 4WHBA 1K9EA 2P0OA 2WCAA 4DY1A 3M1ZA 1M01A 1YYAA 4LAUA 4C1NA 1PBGA 2REQA 3TYZA 2GGHA 1XJBA 1G0CA 1ME7A 1W5NA 2E6AA 5H91A 1YNQA 3RR1A 2E6DA 3CZLA 1TWWA 2VGBA 3V36A 3QV8A 3H4XA 3MMWA 3TU9A 2UWFA 4D6JA 2ABBA 1CTNA 2OVLA 3FXGA 1ML1A 1BF6A 1JXKA 4IMAA 3IV8A 3W6LA 1W8GA 3O0FA 4AD2A 1XLMA 3KBWA 3NDZA 5I2UA 2V3GA 1UA7A 3T55A 2Y70A 3BLOA 3QHNA 4IJBA 4MUPA 2PTZA 4PL1A 2GGIA 2P3EA 1W54A 3QY7A 5EB8A 1ZTVA 4LCRA 4AY1A 5D38A 2TODA 1C8YA 1PZ2A 4QS6A 3E49A 1XKJA 3QMRA 1K6AA 5BOOA 1IEVA 4UQCA 2OT1A 3VNYA 3K4DA 4P7RA 1OK6A 1H62A 3CS2A 3STFA 1UWRA 2CKSA 3VGEA 4GYPC 1AD4A 4FNPA 4S2CA 5KITA 2AQWA 3E02A 1GVIA 4C6NA 4ML4A 1XIDA 1J5TA 1ZU8A 3EOUA 1TMQA 2DZAA 4DNMA 3N6JA 1JR1A 1BF2A 1O4UA 1ZCOA 4AWTA 1ZAIA 3U7VA 2NWRA 1TWDA 1PVNA 3TJLA 4MM1A 4JTSA 3SEPA 3M6DA 4NZ5A 1JZ7A 3LHYA 1ONWA 2WQDA 5HNUA 3URBA 3G1SA 4WOQA 4KPLA 3T6CA 1ONXA 2ZA3A 1FDZA 4M19A 4QFUA 3T81A 1W3JA 1KXHA 1CB7B 4POCA 1YXYA 1W5OA 2PTXA 1Q6OA 1H3GA 4PMDA 3UG4A 3VKKA 1ICQA 3LGEA 1X97A 2PDKA 2XWEA 2D3NA 4ZQCA 2XVKA 3V1PA 5GQBA 2C14A 1E43A 3T4CA 4INFA 4D8LA 1AFSA 1HGYA 4A4AA 5C9XA 4WJXA 4MF4A 3GIYA 3WLQA 2VURA 1THFD 4MKNA 4HMEA 3WEZA 2ONEA 1KFKA 1GGOA 2YLAA 4HNVA 4XVDA 3W01A 3T07A 1CYGA 4DJEA 1Q65A 3VPLA 3MYOA 4MIMA 5CSRA 1GQJA 3KBVA 4I9TA 1SJAA 3GSMA 4BWLA 4LYKA 1IIGA 5CBBA 4Y6GA 4Y7EA 3AUOA 4GH3A 4X2PA 1TRIA 3F4CA 1SUXA 1YNPA 2Z29A 2Q8LA 3STGA 3UWQA 1O68A 1QPOA 4AF0B 2FVLA 6XIMA 4QP0A 1N8FA 3BZGA 1WZMA 1D8WA 3H22A 3UY7A 3QV7A 3UERA 2PP0A 3UPBA 4NU7A 2D0FA 2VVSA 4ZFMA 4U10A 3UY8A 1W2PA 3TN4A 4MPQA 2C15A 3GG8A 2J7DA 4V27A 4WGHA 4CGTA 5CG0A 1LLOA 4RNIA 4QLLA 3R10A 1VBJA 4IUOA 4XKYB 5AKQA 5A2AA 3F4VA 3T8LA 5A6BD 4PSPA 3BAWA 2PRLA 2WPGA 3IGXA 4U3CA 1E0WA 3UG5A 1EP1A 2WC7A 1RBLA 1LL6A 3IIOA 5LNVA 4IISA 1VFHA 2ZRZA 1UD2A 4ATLA 3HPSA 4NNBA 2QNEA 1BHGA 1BKHA 2EPOA 1UH2A 5G1TA 1U22A 3L0NA 1W9XA 2ZX8A 2FB3A 1XIIA 4FP1A 1HKJA 3MU7A 2W66A 1TPH1 1UR8A 1NWUA 2PGFA 4K1GA 3W1UA 3U0HA 1RHCA 3UFYA 1GJWA 2J88A 4JHOA 5B7ZA 3C4UA 5CBJA 1JAEA 3UCDA 2XWDA 3NOYA 4HNLA 2VT0A 3EDJA 3NQBA 1SFSA 2NX3A 2X0YA 3W6YA 3PR2A 5DX7A 1I9CB 4TUFA 3EDEA 4OOUA 1B54A 2QCGA 2ZRUA 1UBPC 3GNDA 2VFIA 1ISZA 2PC8A 3MUIA 3AC0A 3SCWA 2GUBA 2OT0A 4DPQA 4AF0A 4HNOA 1GZGA 4IG2B 3EBVA 3WLKX 4LUTA 4HNCA 1JIBA 2CZDA 2CZVA 3WD2A 5BMWA 1MNSA 5AYBA 4J2MA 2C0AA 3G1RA 1YTKA 5HUOA 1M3UA 2QGHA 3TR2A 2J4GA 5FD0A 1W1A1 2XVPA 3BMVA 3KHJA 3W7NA 2FGZA 1IEXA 4E4FA 1UZ1A 3KRBA 5EA9A 2GQAA 2BG5A 3V35A 3DHDA 5FEXA 4D72A 4J3TA 5AHNA 3U48A 4GIYA 4U31A 1V08A 2E9BA 2WBKA 2QV5A 4UB9A 4XZLX 1A5BA 4CVUA 3H2NA 2Y7DA 1GQIA 4UXDA 3FA5A 1YTEA 2NVAA 1QVBA 1EGMA 4JTKA 3M0YA 4TU1A 3H2FA 1RD6A 1H5VA 1BQGA 3DG7A 2BHUA 3H70A 4ZTYA 5C71A 3ARVA 1HFBA 5LNRA 2VD9A 4JIEA 1C92A 5H8PA 3S1WA 3VNLA 1GEHA 4L4MA 4URIA 3NL2A 1TTIA 2ZZ7A 3S9IA 4PGLA 2O56A 3GFYA 2E6YA 4AIEA 3EX3A 4ICCX 3GXDA 4EPKA 4ZODA 3I7QA 1E56A 2JQXA 5F4XA 3VNDA 1WDPA 3A9BA 4MNKA 1R7OA 2B31A 2QUTA 4MY9A 3QZAA 2RJGA 1X1ZA 2XFYA 1UJQA 1F3WA 3IK2A 2F2KA 5IFPA 3VIIA 2J6XA 3QGVA 4Z2JA 3H24A 1XLDA 5FSEC 4ES4A 4ROQA 1MW1A 3SUWA 4IG2A 1UJPA 2FQIA 3BWWA 5EMYA 2XISA 4U4MA 3FJNA 3UXDA 4TR9A 2X0SA 2J7GA 4GABA 4K8HA 3JRKA 2V5KA 1S2CA 4Y8EA 2XSBA 3PNUA 1I6NA 4HB7A 3OBKA 4C90A 4HNTA 3U2CA 4JBRA 1MI3A 1V0MA 5HNRA 3XISA 1T40A 2ISFA 3GG7A 3MVIA 1LG2A 4XD4A 1XQKA 1NU5A 1Y65A 3WBYA 3LHZA 3LMZA 2IXVA 3N73A 1NJJA 1Y5WA 1PIIA 1RCQA 4IM4A 2NSOA 4AY8A 1BXCA 3UPMA 4TV6A 4UC5A 4UQBA 4JL1A 1VENA 1OFAA 4AVFA 3WH7A 4WDUA 3GX9A 1SQ7A 1E6SM 2FIQA 5CGTA 2NXHA 4HA0A 4DHGA 4P5UA 4JFVA 4CCZA 2A5HA 5A8OA 1E5JA 1WX0A 1FWBC 3A64A 1CB2A 1DBTA 4XBKA 4N6EA 4TV5A 3QF0A 1KGUA 4GKTA 4HK7A 3RPTA 2Q3RA 3HG3A 1QNRA 1VHNA 3L5MA 3SY8A 2H3DA 3AS0A 4OUIA 3K8KA 3CHEA 5A6MA 3IUIA 1W9VA 2WAGA 3CAWA 2OGYA 4DM2A 1H63A 3Q58A 3B4YA 4H9TA 1T99A 3RX4A 1PE1A 3A3HA 2QF8A 3BJSA 3BAJA 3KBMA 1HXJA 2GJXA 4ZB0A 1XHGA 2XGIA 4K3ZA 1E9ZB 3BLKA 3KRSA 4KF1A 1GW1A 4DI8A 4A8LA 4DVOA 3GDLA 3LPOA 4IH3A 4UBPC 4XWUA 4NYYA 3R5EA 1F8MA 2ICSA 4HSHA 2XVNA 5C7VA 1X1NA 2MNRA 4L9ZA 3WMBA 3MW7A 3CV6A 4O50A 1L6YA 5FCZA 4HCDA 3MANA 3ITYA 4E38A 3HM7A 3QZ6A 4JQ4A 4FHAA 2Z28A 3MYPA 3DYOA 3GC5A 1JZ6A 2G3IA 1LLWA 3BAIA 3W00A 3WELA 1Q6CA 2OEMA 4LY8A 3AZTA 3WKZA 8TIMA 2EPLX 3M0KA 4RDVA 4F4RA 2VGIA 3POHA 1XIFA 4AXKA 4O11A 2CW6A 1H4PA 4QITA 1U5HA 4BF9A 4BQ5A 3AQUA 4Y9NA 2NUWA 1F5ZA 1OZMA 3RYSA 1O1HA 3W7PA 3MI3A 1XYLA 4HSOA 4ZB5A 2OFJA 2GSEA 1OCQA 3HTWA 4RV3A 4DO4A 7XIMA 5B7YA 5DT5A 2PWDA 3CTLA 3L4ZA 3VNZA 4D9PA 3M0VA 2PLCA 2A6NA 1RK6A 3FS2A 3SCOA 2V2HA 1V77A 1US3A 1I4NA 1TSIA 3WZ0E 2BWGA 5I3HA 4H1ZA 1FWCC 2X7VA 4JTTA 4M24A 3TYEA 1NWRA 4QGCA 4EX4A 3NXLA 4UZUA 4B5TA 2YPIA 1F9CA 2Y8VA 4TXEA 3PAOA 4KETA 3RX2A 1UP2A 3WDRA 4ALDA 2OX4A 4Z2IA 1U1JA 2Y61A 4PA8A 2VZUA 4OZOA 2PLKA 3T7VA 2QKFA 3NQCA 4F2TA 1EX1A 4ADUA 2YA0A 4FOUA 1YIXA 4NT0A 1WXYA 1XLAA 2WMKA 3NQVA 3GTXA 1QHOA 5A8NA 2BXVA 3I68A 4Y90A 4HPXA 3SAZA 3CZEA 2F8QA 3CXOA 3TEVA 3PPFA 1XC4A 1L9WA 4IFKB 8RUCA 1KBKA 5G5IA 2BY3A 2XGBA 2XYLA 2YA1A 2BY1A 1E6ZA 4JFTA 3N12A 5B80A 2PB1A 3WNNA 2WZTA 2PE4A 4RJEA 3BG3A 4EPEC 1DWJM 1M7XA 4ECLA 5BRPA 2V5CA 3BDKA 1MZHA 5C9UA 3C2RA 1R2TA 3VZZA 4CQDA 1TPEA 1G7VA 4F3HA 4Y9PA 1TMHA 1UR9A 4M5PA 4ZXOA 1H49A 3BICA 4GZIA 1G01A 3O16A 1I2OA 2GDUA 1GW9A 3NPWA 3RXZA 1QI3A 1R9ZA 2PBOA 4H9ZA 1O94A 1O7AA 1KFEA 1UR0A 2NV9A 5A6LA 1L6FA 3B8WA 5A3HA 4N7QA 3O15A 3S47A 1HG3A 1H1NA 1TWIA 1ZP4A 4GJIA 2ZX6A 1ME9A 1MFUA 2ZCGA 1B3VA 4BKNA 2J9YA 3OVPA 1XL9A 2C1IA 3SSZA 4NL1A 1R8LA 4RKAA 3GDBA 3VGDA 2CYGA 3WNOA 2KZHA 1E70M 3SY5A 2G96A 1W9DM 5KZ6A 3MHGA 4JAWA 1Q6QA 2RFGA 3CAKA 4YWIA 4E8GA 1ZAJA 3SRKA 3GK0A 3NGJA 3M5XA 2DQWA 4IMDA 1EJUC 1LZOA 2Z1KA 4UTMA 1OSEA 2BTMA 1IV8A 1J6PA 4ZR8A 5BXTA 1B3YA 4Y9MA 2W63A 3S5NA 1JQVA 5FF7A 1PEZA 3ZWSA 1HJSA 2WZMA 3V5FA 4PUEA 3B03A 1QATA 1LORA 1CIUA 1UKQA 1XH2A 1H2JA 1RQHA 4XVEA 4PE8A 2D1ZA 2GYIA 4JTDA 3MP4A 3TTYA 4DF1A 1X6UA 1ZCCA 3TK7A 2PD5A 3ITXA 3MHUA 2OG9A 2PODA 1AUSL 4XZNX 3U2OA 1UH4A 3D3AA 4L7ZA 4C60A 1EO7A 1VFTA 5IXEA 1KM0A 1DIKA 4ZBCA 3E0WA 3M6YA 4ZXLA 3WUGA 3LHTA 5ABEA 3SUTA 3KRUA 3P82A 3EX4A 4B90A 1PDYA 4C6IA 1TV2A 3LHUA 1DJGA 2ESCA 2R1LA 3ZFHA 2PZ0A 1BPLB 2XVGA 2CLKA 3GXFA 1VH7A 4JFSA 1BWLA 2RDTA 3P62A 2J9ZA 2VQUA 2Y7FA 1ONRA 4CN4A 1Q7ZA 1UB3A 4KRTA 2PDPA 3LOTA 4NG3A 4I6VA 1QK2A 3AJXA 3ATYA 1R85A 4GCXA 3RPDA 1KGWA 1CGTA 3UR7A 1F3EA 3A12A 4GBUA 4PUDA 3RR4A 3UZ5A 3W28A 5A8MA 4XZBA 4HOXA 3U7BA 3VZYA 4B3KA 3L4WA 5DFAA 1HKVA 2D20A 1RJQA 3NSNA 4O4WA 2CBUA 3W7EA 2BSLA 2VNCA 2ZIDA 3G8EA 1EZWA 2HXUA 3PBMA 3B3DA 4HU4A 3CGTA 4LV4A 1U83A 3BOLA 3MB9A 1EJWC 4YTTA 2CC0A 3F03K 4MZ1A 3WLIA 3C2VA 4YIWA 3N14A 2Z7KA 4X61A 4ZOCA 2DDXA 1CPUA 1X7FA 1FTXA 3JVAA 3CUHA 4DO5A 1L0PA 3PPGA 4AG0A 4D6EA 4E3TA 2Y5JA 4HQVA 2VZOA 1I8JA 3O1NA 2MUCA 1LYXA 1V4YA 1OX4B 2YCKX 5I78A 3K8LA 3TXVA 3AS1A 5FF0A 3AMGA 4UTTA 1I2NA 1WYIA 3GHTA 3W87A 3JR2A 3KAOA 2W0UA 4ZCWA 2WSKA 4HYWA 3M4HA 3OTRA 2O0TA 1QR7A 1QT1A 1RPKA 3OVQA 4ICNA 2C19A 3WD4A 1S5NA 5LIYX 1CGVA 1KNWA 2ON3A 3L2MA 1RBAA 1ZFJA 2F6XA 1XIEA 2WOQA 3PJXA 4PTXA 5G2IA 1VEPA 3AWOA 1C93A 1J0ZA 3R1ZA 4XV0A 4ZSTA 4JXCA 2HCVA 4O4VA 4A3UA 3FHAA 5F4SA 3CYJA 2Y24A 3PTKA 2XIBA 4NJIA 1XLFA 2DZVA 3P5ZA 4IFRA 4AH7A 2WVVB 2WW5A 4RE2A 3ZQ9A 2DW6A 3VD4A 1GOKA 5T9CE 2P50A 1NWTA 4CNSA 1HO4A 1QI0A 3E38A 1A3WA 2QJMA 3CB8A 4MYAA 4FZIA 4UTJA 1XGEA 3G0UA 1CXFA 2HDJA 3AYRA 3KCJA 1FBAA 2Y0FA 4P8XA 1DJQA 1SO4A 1PL9A 4NUWA 3BLDA 2VEIA 4HHMA 3VDGA 1F3TA 4CEXC 5RUBA 5FJTA 1IR2A 1VBRA 4M56A 4AEOA 1HL9A 3I3DA 4PUJA 4D1JA 2J6VA 2PURA 4XAGA 3VDCA 2G37A 2NXIA 4O12A 1XIHA 3KVKA 2JKEA 4HMDA 1K9DA 5HQLA 2AOSA 4RZBA 1JDEA 1H7OA 2QV4A 2D2OA 3SUSA 4BF7A 3NZ1A 3DFPA 4KFNA 3O6CA 1OX4A 4M1BA 1FKWA 1R9XA 3HG4A 2DSUA 4HD5A 4N0RA 3OODA 5BNKA 2FHCA 2QVNA 2DSWA 1E0VA 3USZA 3K4AA 5LYRA 4AQLA 3XIMA 4HZ7A 5FAJA 2ZQ0A 2ZRYA 3TJXA 1E3XA 1KRBC 2FPTA 1XISA 1B9ZA 3HA1A 3OG2A 1TYGA 2POZA 3IK4A 4LVAA 5K9CA 4JYDA 4QLJA 3UT0A 4MTVA 1G5AA 3A5VA 1TB3A 3TNOA 1OJXA 3H7VA 1US2A 3EWCA 1W2VA 4GO9A 3R2GA 3WFLA 3STPA 4FNUA 3G1XA 3RCNA 2HMCA 1K77A 1JCYA 3E6EA 1GOMA 1Q8AA 2V3EA 4WDTA 4E5TA 2FYMA 3N4EA 2INFA 2WVVA 3V1HA 5BWFA 5I07A 1QPKA 2C13A 4DJFD 4PB5A 1UBSA 1SVDA 2RDXA 2TSYA 2YL6A 1W8SA 4JTRA 2NVDA 1R5YA 1A3HA 4YMZA 4IIBA 2ZE3A 3OVRA 3T08A 3WQWA 1GUVA 1DE6A 1OIMA 1Z42A 2PU1A 5AC6A 1WXZA 3DFHA 2P88A 4UNIA 3IARA 1EJ7L 3PBWA 3OA5A 3HGRA 3UWEA 3W1XA 4DBWA 4WSHA 1LTDA 3E2SA 3N6QA 2ZDSA 4FOKA 1TRDA 3UNDA 1UW9A 4AAJA 3A4JA 1ICSA 1ZRQA 5D2VA 5K7JA 4U3AA 3HGJA 5D8ZA 3I4KA 4LBRA 1XDMA 1PTGA 3BARA 3MCMA 1LBLA 4C6BA 3CQHA 2BP1A 2C91A 1EQPA 3CIWA 2CLHA 1XSIA 2YB1A 5CXPA 3GNXA 3SI9A 3VOIA 3VD9A 2UZ9A 1W3IA 3J7HA 4H9VA 4H8UA 4B92A 3GKFA 3SRDA 3E0LA 3TC7A 4D1IA 1R0MA 2VFHA 2WWDA 4K36A 1P0EA 3B8UA 1OK4A 5D09A 1V0LA 4GK8A 4NNAA 4JTCA 3SJNA 1E0XA 4DZHA 3CAQA 2ACRA 5A5WA 4Q6JA 1H0IA 1VBUA 2QUNA 3VU2A 3EWXA 1DJYA 4NXSA 3DYPA 4EWND 2GJRA 4AD4A 1VZWA 2OO0A 4MB4A 3SFWA 2A7NA 1F4AA 4D6GA 1TIWA 3HFYA 1R46A 2WXDM 3THUA 3ONBA 1NM9A 3LTYA 1IZJA 4O8RA 3G2GA 5CG7A 3RAOA 2QCDB 1NDZA 1KCZA 4I7UA 4UQAA 4DBUA 2BLEA 4D8ZA 1FDYA 5K4XA 5AECA 1BWKA 4Y9AA 1RP8A 3W1AA 1I75A 3RIKA 3AHXA 3MDWA 3ZXWA 1QUMA 5TNVA 4TX6A 5CAKA 4HNUA 4LAKA 4Z2HA 1EOMA 4M3PA 4BQ4A 3GHRA 1NF7A 1A49A 4HPJA 1RZMA 3IVSA 3QKEA 1LT7A 5CPNA 1LL4A 3NQMA 2QS8A 5K9DA 1BSLA 1RK5A 3IPWA 4Z2LA 1TPWA 4S39A 2BGSA 1XCFA 2VEFA 4OIFA 2PS2A 2GGEA 2AAAA 1SZGA 1YE4A 1XSJA 2ZXBA 4IWWA 5HWNA 4R53A 1JZ8A 3TQVA 4UQDA 4A6GA 4KKXA 2QPSA 3CHDA 3U57A 4K6AA 4AYSA 3EA2A 4CQAA 3PSWA 3SGGA 4EANA 1RVKA 5FJJA 1ZHAA 3IJIA 2X41A 4AD1A 3WLMA 4ZO6A 3WEMA 3OZPA 2BOGX 4CD8A 3THDA 4NSBA 4H3DA 2R6OA 3TW9A 3A22A 4LF2A 4GFSA 4JFWA 3CV7A 3VYLA 6TAAA 3GVVA 3BOFA 4X0NA 4JQ3A 3RLHA 3LXAA 4I5RA 1GTHA 3PHAA 3ERPA 1YLVA 2HK0A 2YDAA 1PJ9A 5E9AA 4PTVA 5J04A 3P0WA 2PDYA 2BVDA 1D9EA 4MADA 1FWIC 1CLXA 2VDGA 4GXPA 2RGLA 1LQ2A 3T0BA 3W7MA 2QCDA 2QPUA 3VVGA 1BQCA 1JPHA 1BYCA 3A24A 1VIZA 4NVTA 2PLMA 4JCMA 3GU1A 2IUZA 4XISA 4DYEA 4KWWA 3BCJA 3RDKA 2CNCA 3F4DA 1TJPA 1FOBA 1XQLA 1YQ2A 4CD6A 1ZGDA 1W1PA 3E0IA 5HNTA 4KFPA 1YPFA 1OYAA 1XIBA 3BPWA 1OWQA 2WMHA 2V8ZA 1V0NA 3GS6A 1MUWA 4ZEPA 3M07A 3LBCA 1NTHA 1TUFA 3PANA 3BW4A 1SFJA 4KCVA 4LYQA 3ZYZA 1B90A 2BOFX 2FKPA 1F74A 4C6FA 3NEVA 3AHTA 3SSJA 4RXGA 3BC9A 1HTIA 1YMYA 6CGTA 4WSKA 1TVLA 4IMCA 4PN2A 4O19A 5D04C 3XINA 5KEZA 2ZUUA 5A2BA 1BYAA 1W3NA 4PYSA 4JDBA 3GH7A 5U7SA 1GTEA 1GHRA 4C6PA 9XIAA 1OQFA 1EUNA 1JDAA 1X7IA 3BL3A 3C86A 4MLJA 2PSNA 2OCZA 5BOEA 4Z2KA 3AI0A 1P1MA 1D8CA 3T0DA 1JYWA 1FCVA 2DZPA 1H50A 4KT2A 3AMDA 2DP3A 4K68A 3GIPA 1F3XA 3ATZA 1FFRA 4N42A 4A3QA 3ORWA 4XTIA 1NY1A 3QR0A 5H6HA 1HP4A 3CHFA 2BHYA 4JNYA 4CD5A 2DEPA 5CZJA 3QFEA 2W5FA 3QGAC 2YL5A 2NQHA 3ARWA 2A2IA 4LFYA 4F79A 1DTNA 1ELSA 1Q4NX 4BR1A 1KKOA 4RDWA 1GCYA 3O6DA 3TCSA 5JBDA 3B8SA 5CPQA 1HL8A 1WKEA 2PDLA 4YVPA 3U8GA 1OM0A 3LTPA 1ISXA 1XC6A 2J79A 4X60A 5C9ZA 2ZKMX 3R8GA 1JCTA 3LD5A 5DMNA 2NW0A 5LA0A 3O3RA 2DUXA 5G1MA 1AQMA 3SCUA 2O7QA 1XLBA 2E5BA 2BVWA 3GBDA 3P81A 4ATDA 3NQAA 1U5JA 2H6RA 3S2CA 2JKPA 1P0BA 4XO7A 3B0UX 3VIOA 5A8PA 1GQLA 3P61A 1XH0A 4FLRA 4W93A 2D2GA 5XIMA 5E09A 3HN3A 4L9YA 4JTGA 3K46A 2WHKA 1TFVA 1AW2A 1GOQA 4J5NA 3PULA 4LUSA 4S3GA 4GLEA 1L6SA 4I8DA 3KOZA 4IX2A 2V3FA 1I0BA 3II1A 1XLIA 4L4LA 3HMCA 1UD3A 4JN7A 2OGJA 5D37A 4ZA0A 1Z6KA 4IIGA 7A3HA 1JYXA 4IFOA 1OFRA 2OODA 1EDGA 1ZL1A 4AMAA 2FZBA 3QC0A 1KWGA 4MAZA 2X40A 3IRSA 3OG3A 4WJEA 2FMNA 1C91A 3W86A 3FCPA 2YCLB 1OGBA 5TD4A 2FGLA 4L1XA 1UUOA 5HR7A 1F61A 1S1PA 1XYAA 3I3EA 1WCGA 3GE7A 4LCSA 4QAIA 3QGKC 3WUEA 1IEWA 1GK8A 1DEDA 3S9YA 1P43A 3HG5A 3RN6A 3E1F1 1RY8A 4EWJA 4H7ZA 4QG6A 2Y8KA 1H11A 5D4YA 3NAVA 3B0YA 3W82A 4UFIA 1TV3A 1LOSA 4IPJA 4WX2A 1ZJHA 1HNYA 4LX4A 3MUXA 3GVQA 3WDPP 5EMKA 1PZ1A 1BVWA 2ZZ5A 4P8WA 2GJNA 4OBRA 5AY7A 3W7IA 2VFEA 1RP9A 4O1DA 2I56A 4FS9A 2X1UA 3QY8A 1MUMA 3UJ2A 3LX9A 3WDJA 5MF5A 4IIFA 2RDUA 1PTDA 2FZ9A 3VKJA 4GINA 2XM2A 3PUOA 1TA3A 3BUVA 1UKSA 3QQ0A 3AHYA 1G4TA 4NZ3A 3EA3A 1LRNA 2C6QA 2JIWA 3CQIA 1L2UA 3HBLA 4G7FA 1OD8A 3OP2A 4US5D 2HWGA 1F6PA 4YYCA 2XJ7A 4AX7A 1PDZA 3AISA 4C65A 2P5NA 3CWOX 3RFAA 3B0XA 1KFCA 4GIRA 3WF1A 2DORA 5D9NA 3W3OA 4JTLA 2WC4A 2YCLA 3QR3A 1Q6FA 4GWEA 4QSHA 2WWCA 5I24A 4B3ZA 2VRJA 3TA9A 2JBMA 1OCBA 5GNZA 1OFQA 1T7LA 1E1FA 1OY0A 2VUYA 3DKLA 4DJDA 2A7PA 3EA1A 4XAFA 3W27A 4M81A 1BAGA 3R0UA 4MG4A 1JL8A 4S3KA 4JTHA 3W53A 4GACA 5HATA 4JDYA 4J28A 5AB3A 2VTFA 3SQMA 5DBTA 5I3IA 2GUUA 2DT0A 2ZUTA 4W84A 4F0RA 2QXWA 3QHOA 4JYEA 3LXCA 1F07A 1UR3M 3POCA 3VE9A 3K1DA 3MJYA 3V75A 4RZ6A 5HMDA 1H7PA 5EFDA 3SCTA 2Y7EA 5CBIA 4O28A 2BNJA 1CX9A 1PX3A 4ZMGA 5JQ9A 3RM8A 5CZSA 1P7TA 4Q33A 1OX6A 4NZ1A 1KV8A 4Q8MA 3OVGA 1FH7A 2HS6A 1KM6A 2Z1XA 4C5YA 1HKIA 1N2VA 1W3KA 3W0KA 2YZ5A 3ALFA 4N6FA 3C56A 1OINA 4L4PA 1A0CA 4RNFA 1UWUA 5CJ5A 3GHSA 3KBJA 4UTTC 2VGFA 4HK5A 3S83A 1KXVA 4QLKA 1GG1A 2QMJA 2X1SA 2VC7A 2G8ZA 3RO6A 3DYMA 4U5KA 4GG9A 4L4OA 1QOQA 2PCQA 4EK7A 1WDWA 4ORMA 1R7AA 3VKDA 3FAXA 3RLGA 4OOZA 2PF0A 2QJJA 4E8DA 4PEKA 1VKFA 4V28A 4WR3A 5FEPA 2Z0IA 2OQHA 3DHPA 4H9YA 2BOEX 4PZVA 5DY2A 4I5XA 3LA4A 5F2MA 4G6CA 5HOSA 3TOPA 1Y0EA 3S8HA 3WK2A 5LIWX 3IWPA 4LRTA 4I3GA 3S1GA 4I9JA 1DJWA 4XD6A 4J1OA 4Y96A 2FDSA 2EPHA 5ABGA 4UTWC 4W8AA 1OFEA 3SN4A 3KM8A 4H83A 3TZFA 5LHFA 1A5OC 3W74A 3W7OA 1ADSA 1XRTA 2GOUA 2EJAA 3KZSA 3P84A 4J4KA 1Q4WA 4NJJA 2Z25A 2PWEA 1XWYA 3VABA 1N7KA 1EJTC 3NM3A 1ZBCA 3DERA 3R25A 4UTUA 5I3FA 3VIKA 2YDRA 5HR6A 1XIMA 2E1WA 2SFPA 2V2CA 3W76A 4WVXA 1HW6A 3JZEA 1JEZA 3H23A 1IEIA 1X38A 4GYPA 1S2WA 5BRQA 1FDJA 1C7SA 2IPGA 1LRQA 4HZ8A 1ISVA 2YW4A 2XSXA 1HIZA 2NQJA 3VKAA 3MKVA 3PWAA 1Q5MA 1NP2A 4GX9A 5BXRA 3APYA 2FZMA 5DEZA 2GZXA 1Q8JA 4EAYA 3EXRA 3KWXA 4REQB 1XD1A 5EGRA 4QDWA 2P0IA 5MKGA 3AXHA 4HMCA 2Y4SA 3LBOA 4PTDA 1TJRA 4G1NA 5KMYA 4AISA 4WRHA 1MEHA 2YXOA 1JRBA 4G56A 4QE1A 5JMUA 5KINA 3WFZA 3HF3A 1IWBA 3S5ZA 3TP4A 2V82A 1ZB5A 1WZKA 2WMJA 4UNKA 4I6KA 3WH6A 2F84A 2CLLA 4XIMA 5SWUA 1LROA 2XIIA 4WKHA 1DXEA 1GJPA 2I1OA 2J27A 1IHIA 3TTSA 4ERGA 5JH1A 1TZ7A 5H1WA 1OYBA 3IJ6A 1RALA 3P74A 4MZ8A 1AJ2A 1R38A 4DJED 4A2SA 1M7PA 1VFUA 4UMBA 5A8GA 4K37A 4J2PA 4LYPA 3GNNA 3N2MA 2GFTA 4UR7A 3MY9A 4HU8A 4ZE4A 4A3HA 1V3KA 2YBUA 2HTMA 3IUDA 1X6NA 1UUQA 4RE0A 2WSQA 2VX4A 4JPGA 4WSJA 3CZ8A 2WNQA 3SN0A 3H2OA 3MO7A 4ZE5A 4G9PA 2OWWA 4PUNA 1XD0A 5AOUA 3VDAA 3LV6A 3N9KA 2INEA 3PPHA 3CZJA 1QNOA 4MKSA 4BJHA 1PWLA 3NA8A 2CEQA 3MBFA 3L66A 1Z44A 1BSIA 2XDFA 3PPCA 5KSWA 2X8RA 1EXBA 3DG3A 2VFDA 1W1VA 1AL7A 3LCHA 5CJMA 2FDMA 1IR1A 1W1B1 3SBFA 2HQAA 4Q8UA 4DNHA 2X1RA 1EPVA 3U4FA 2A6LA 3GWQA 2PC4A 3DGBA 4C7DA 1AH0A 2J47A 3I6RA 3V5CA 4REQA 4BY3A 3A13A 1XLGA 3MCOA 1MUCA 3OBAA 3WQ6A 3WL0A 3L12A 3N3MA 5EMUA 2PDFA 2DZSA 3B04A 1OFPA 1VEMA 4NZ4A 1ZBKA 3U5YA 1W1ZA 2AAMA 2YR1A 4DUOA 2XN1A 5I5RA 5AC5A 2Z6IA 1JZ5A 1IXNA 3UESA 1TVPA 2QCNA 2WMIA 1Q2RA 2OZ3A 3ZT6A 2ANUA 1GKRA 1P5BA 2CU0A 3CV2A 3RITA 4HKPA 3CQ0A 3SDOA 1J0KA 3STEA 4IHCA 3EYPA 3E12A 4FNRA 4O8AA 5JIWA 4B2DA 4DEFA 2DH3A 4K39A 3W1QA 3KLKA 1GEQA 4D8AA 2BASA 3C2FA 3W4RA 1PUDA 3H7UA 3GC2A 5EFFA 4NJKA 4BQ2A 1JUBA 4H00A 5JIPA 3OO2A 5TAOA 1K4GA 1RLCL 4GUFA 1QU4A 2OQYA 4Q4QA 1ISYA 2AKMA 1V3MA 1X6LA 3F1QA 2VDIA 2ZZ1A 3MV11 1WDDA 3UZJA 1XYFA 3BAXA 3M0ZA 2PWHA 3LCIA 1EJVC 3IRDA 2I17A 2W4XA 3BV7A 3D46A 3VMOA 5LHEA 5A94A 2NX1A 1W5MA 3T4WA 5JBEA 4AZ7A 3C0LA 2CHRA 2PWUA 3K4WA 3REQB 2ZZ2A 3O6AA 1EC9A 4CU8A 3AMCA 2UBPC 3VD7A 4GXWA 2YFNA 1WBHA 2AGTA 2Q8XA 4WK9A 3TIMA 5IOBA 4MWAA 3N2BA 5DT7A 3WQ5A 4J40A 1YE6A 3EWDA 3PAJA 4HCHA 4AW7A 4WD0A 1AG1O 3FKKA 1RSCA 3W2KA 1EH9A 1OIFA 3I10A 2VC6A 4WQ6A 4E4UA 3ICJA 2ADAA 1RH9A 2EG7A 3EEGA 5M3WA 4GFIA 1DXIA 1POKA 2QLYA 3WJXA 2ZE0A 1XCXA 3G1DA 1Q6RA 5EPDA 1PZ3A 1ZSXA 3G5EA 3V0UA 4B5VA 1UOZA 4U2ZA 3UXKA 3OBEA 5K2ZA 3S42A 1X8FA 4QEEA 3PY2A 1UWQA 5CSSA 3VE7A 3K5XA 2HS8A 2JE8A 3GAYA 2ASHA 1E9LA 2DUZA 3UG3A 1FWRA 1OB0A 2CLEA 3SURA 4G5DA 5GNXA 3AYVA 4KEVA 2R91A 1JNDA 2EO7A 2R1MA 3HPFA 4O0KA 1CWYA 4LS2A 4GUGA 2FZ8A 1CZ1A 2WMFA 4BS0A 2AMGA 1VFOA 5A6AA 2GK1B 1FWFC 2FJKA 4DBDA 2PWVA 4XD5A 4X3ZA 1UKPA 4B91A 3L4UA 3TJ4A 2Z00A 4J9JA 1VRXA 4Z2GA 1ESWA 3K8MA 4EXAA 3QW3A 3W7RA 3WUFA 3S6TA 2V5LA 4F9DA 1XRFA 2A79A 1KRMA 1EP3A 1W6TA 3SRHA 3N18A 4D2JA 1T6MA 1QPNA 5G1YA 4LNYA 4ZB2A 2JALA 1RA5A 1W56A 4IX0A 3PZGA 3H8AA 4IP4A 5FF2A 5A95A 3IGHX 3PFRA 2DJXA 3DBPA 5FKYA 4YNGA 1EF2A 1GYNA 1ZJAA 4LS0A 2A7RA 5HPCA 3TYAA 2X16A 2Y5EA 3BE7A 6REQA 1JXJA 2ZBTA 4ORIA 3NOEA 4DUWA 3TYBA 7PTDA 4J35A 4WIWA 4FF5A 2E1DA 1QI4A 2ZYFA 1PIGA 1VP5A 2PP3A 3RCMA 4HN8A 2HNHA 1ECQA 4QNEA 4JIPA 1EUAA 4AZGA 4HCLA 1E9IA 4CVWA 3LI0A 3S3GA 5LNWA 1JI1A 1EHAA 2A3LA 4AUBA 1GVRA 1KBJA 1KRAC 2PFHA 4OTKA 2O9TA 1VFSA 2W62A 3W7QA 3ZZ1A 4IIEA 4N9CA 3OZOA 1XH1A 2W3ZA 4FXJA 3UVAA 1GOXA 3W1LA 4F0KA 4FIRA 3GNPA 4B5UA 4A8RA 4CNOA 3C2OA 3CT2A 1QRQA 2DU2A 4J3ZA 1Z89A 2BFGA 4UR9A 3VCCA 2NVCA 2P10A 2WVTA 5D30A 4LT9A 3M7WA 3AMLA 3JZUA 2VX5A 4P7OA 1B57A 3WQPA 1JRCA 1YPIA 5D9MA 3EOSA 1DJHA 3SJ3A 1MZRA 3AZRA 1VYRA 4Z1AA 3UCCA 1TKKA 3KTXA 1WUFA 2IKHA 2O55A 1FH8A 2BB0A 1KCKA 1KBLA 4FNSA 5FI8A 4ACYA 1N82A 5REQA 1FX6A 3KTSA 5IHRA 1UC4A 1FWSA 3G1HA 5FEWA 3B8TA 5AHFA 4HPGA 2VVNA 2QIIA 1RUSA 3PF3A 3U2EA 1HVQA 3RUBL 1SJCA 1PAMA 4FALA 4QXIA 1KCLA 2ABAA 4ZQRA 1JGMA 4DUXA 2QR6A 4DM1A 4P2VA 4PMRA 5CGMA 4WJ8A 3H7RA 3CPRA 3EWYA 4ZOEA 3A23A 3OA3A 3IGSA 3W7LA 3QJAA 1C8XA 3DIPA 1JCLA 4EACA 2ZRVA 4JIHA 3C0JA 3LYEA 4M6PA 3GBEA 3N4FA 2F38A 4HA1A 4QQ3A 3P8JA 2VFFA 1DQXA 4ERIA 2PGWA 3BCFA 2OOFA 1CNVA 5LKYA 3DXIA 1GYMA 3WUBA 4FMVA 4E0CA 2I9EA 5I0DA 1PCWA 1SFLA 3FLUA 4KBXA 3IJ9A 4RCXA 1LRTA 1I0DA 1D3HA 2P8CA 4KMQA 1H7XA 1M41A 3ABSA 5TBOA 4JEQA 2XIJA 4O14A 2DJLA 2DPEA 4CQBA 5LXXA 3N9RA 1KBIA 3WH9A 4YCPA 3GFXA 1V3JA 1RVGA 3UXIA 2E3ZA 1FWWA 4L80A 3TE9A 1MDRA 3L67A 3NO1A 5DQPA 3NURA 2Z4GA 1RBOB 1X96A 4XB3A 2YL9A 3RHGA 4M7TA 3FNDA 4IQLA 2YKKA 4UUIA 1ENUA 3WD1A 1NP0A 2CBVA 4JX6A 1QW7A 1SW7A 2A3BA 2PDBA 1AMYA 1B30A 1V7AA 1EEPA 2QCHA 3WLTA 3UXAA 3DDMA 4ILSA 3RCYA 2QDEA 5FACA 4GOAA 4Q4MA 4OE7A 1TPC1 2CITA 9RUBA 2W79A 2OZ0A 2A85A 4V15A 4WEVX 1I1XA 5FJUA 4ZGYA 1I1WA 3AHZA 4GUJA 5E70A 2BY0A 2PP1A 3LQGA 3MO4A 3WLNA 3A4XA 3GXMA 4R88A 4EF8A 3DAQA 3LG3A 1HF6A 1VF8A 2CERA 3H4WA 1K9TA 5CPSA 2XFWA 1UH3A 1AJZA 1ITXA 2G3MA 1B3WA 5C2GA 2GL5A 1QXLA 2NQZA 5C70A 4PTWA 3R8RA 4GIEA 4L6OA 3NM1A 2ZRXA 3VNMA 4X0VA 3IIVA 1W9UA 3T0AA 4CUCA 1B5TA 3TN6A 1XX1A 1E73M 3MS8A 4GQRA 2E09A 3G1FA 2PCEA 2ZZ6A 2DT2A 4NXKA 3OHIA 3JW7A 1J18A 2J7HA 3ID7A 4AWSA 2VWSA 3QMTA 3HGSA 4FF7A 4Q8WA 3UBPC 1E0UA 3BJFA 5F1VA 1D2KA 1LDCA 1KB3A 2B7QA 3S2LA 4ZFCA 1ONEA 2C1HA 3N6HA 2I57A 4HZ6A 4YTQA 2IPJA 3CHVA 3SQLA 1OX5A 3LSCA 3BLIA 3BLEA 1WA3A 5I02A 1UZHA 3F4NA 3Q37A 4AY7A 1U1UA 2OJPA 4KIEA 3MMTA 5TQLA 3FKRA 5EBAA 3U3HA 3EPMA 1BVNP 2LLEA 1SZFA 4JY9A 3AXMA 4Q8OA 5I7GA 4H6RA 2Y1HA 4QE4A 1AZ1A 1UZ4A 3BZJA 1F8IA 3BSMA 3W25A 5BCAA 4IGSA 4Z1DA 2G4FA 3F7JA 3UJEA 3WQOA 3BW3A 3KXQA 5HDRA 5GJNA 3JU2A 1W17A 2CPUA 4DXKA 4XUGA 2VCBA 3CL8A 3AOFA 4Q8NA 1MRQA 5A6TC 2DT3A 3WNMA 3OEXA 1KTCA 4QNWA 2IKJA 1XBXA 5GPRA 4XG1A 2ALDA 1M6JA 2XUCA 3LI1A 3GO2A 3TNBA 4W7WA 4O0ZA 4GVIA 4R9XA 1OC5A 3ARUA 3OLEA 2XINA 2DT1A 1LQ0A 4IZGA 3NQ6A 1DIDA 3TAOA 5I3DA 4TX8A 3AYTA 3B9EA 1XS2A 2OZTA 1EF3A 4MVAA 2CFFA 4F40A 3GYCA 5AYYA 4HU0A 3MZ2A 3O0KA 3RJXA 1MSSA 5EL1A 1DWAM 3CJPA 3PBVA 1FWDC 3A21A 2XH0A 1LT8A 1EIXA 3WEOA 1MXSA 1FUYA 4MZYA 2ZC1A 2XH4A 1G94A 4B9YA 2OSXA 3HPZA 2VZVA 4PBEA 1WDSA 4YU1A 4LYRA 5FJRA 1LJYA 2Z1WA 4WF7A 1PKYA 4ZOAA 3W83A 4Q4RA 2RHGA 5G2HA 4KQNA 3RG6A 3NYDA 4JX4A 1XBYA 4AIUA 2ISVA 4W5ZA 1R86A 4DO6A 3EMCA 1E6XM 1RJRA 4PMQA 1HZYA 4DWSA 1XICA 4YCOA 2E40A 3PJUA 5F2IA 5CC7A 5E9XA 3VCNA 1EHNA 3KW3A 3WLSA 1P0KA 4QTGA 2XH7A 4O53A 3TC6A 3MQTA 4NI8A 1H7NA 3EWZA 1QASA 3W29A 1Z7AA 3QTPA 1CGXA 4AD5A 2Z1SA 4Q4SA 3UWWA 4IMFA 4EOUA 1OADA 4AZBA 2PDMA 2NLIA 3NZGA 1PIFA 2WC3A 2HNEA 3A4AA 2HPMA 5F2GA 2Y2WA 3P5YA 2Q02A 1J2BA 4LBUA 4IPLA 1SO5A 3EGJA 1MEWA 4JKKA 3R4IA 2OPJA 2ZWYA 2HE5A 3L4VA 3EOOA 1DJNA 5CKSA 4LUTB 4NRSA 3E74A 2YSWA 3PG9A 4AZHA 1XLJA 2HV5A 2VR2A 3HZ3A 1KV5A 1XIGA 1KFLA 3FJ4A 3FOKA 1LL7A 3PTDA 1VPXA 4DLFA 1JQXA 5GJMA 2E4TA 3IJDA 1IT0A 2ZRWA 3W71A 1OGGA 4IQJA 4DBSA 2EHHA 1MQPA 1H61A 1QBBA 1SO6A 3NDOA 1AZ2A 2QW5A 1FY6A 2FPYA 4TMCA 2J13A 3QOKA 1T41A 3WBWA 1J5SA 3B9OA 4O1BA 2GSJA 1EPXA 1CXKA 1QPRA 3P2VA 4DYJA 4L64A 3KEHA 4WY0A 3QFWA 1A4MA 5IDZA 5GNYA 5DMMA 2OYMA 2X30A 1MRAA 1TR9A 4YS1A 4I7WA 4UWMA 3ZM8A 2QUVA 3AIQA 3LDVA 4M51A 3F2BA 4OV4A 2DZWA 4J27A 1YPXA 2PRMA 5BMXA 2YBVA 3W2MA 2XIQA 2V68A 3M5ZA 4BQ3A 2PDWA 3CWHA 2VOMA 4R27A 3K2GA 3MWAA 4OU1A 1VC4A 3M5YA 3AIRA 4QDMA 4H7CA 3LMYA 2JK2A 2E6FA 3WX7A 1W5QA 4AX6A 3QSRA 4Z17A 3BG5A 1WZAA 2PEVA 4UZSA 3NIYA 4B9ZA 1ICPA 4D6HA 1TZ9A 4LVGA 3EOEA 4AZCB 1B4EA 5G4HC 1XM3A 4Z42C 3WLRA 4G7EA 3SCNA 4YN5A 4MLRA 3WG6A 4HHPA 3DEQA 4ZO9A 4GQQA 4RDYA 1BKSA 5DF0A 3R6IA 4DAIA 3BLFA 3WO8A 3GDRA 1LOLA 4GISA 1XYMA 2YFOA 4Q8QA 1QMLA 4DRSA 3D3FA 4MWAC 4O1EA 2UY3A 5HWJA 2VEKA 4MGGA 3VDBA 4L6HA 1DPMA 1YXDA 2WZIA 1QK0A 1YDNA 4IPNB 3TROA 3RPMA 1J2WA 2DW7A 1PYFA 4I90A 4N9EA 1GQKA 1VD6A 1C3FA 3N1AA 3W88A 3HIJA 1C8QA 3G1AA 3UXLA 3T44A 3AXXA 1YTDA 2WJFA 3LLFA 1FXQA 3FXYA 3TYDA 3VUPA 4BI7A 1A5SA 5IBXC 1P0NA 1EGZA 2OQLA 1F7BA 2PDNA 4UR8A 4DN1A 1TTQA 4X22A 5JBFA 2ZA1A 4FEZA 2QF7A 5LGZA 1ZZMA 3VM7A 1G4SA 1IXPA 1S5TA 4N4PA 4CCEA 1NDWA 2NT0A 3PM6A 3W1NA 1Z41A 1VHCA 3G3MA 2DIEA 3WH8A 4H2CA 4JD4A 1F76A 1PB0A 4NP7A 2XZ9A 3W72A 1DE5A 2BVTA 2R8WA 4MUZA 3I65A 4GIAA 5IM51 3N17A 3PJTA 3EDKA 3VA8A 3N19B 4YVXA 4MNMA 4PB3A 1G4PA 1J79A 2GJXB 1EWDA 1OC6A 3BVJA 3TSMA 4AZCA 3SADA 3PC0A 5DRIA 3VNKA 5HUPA 1SR9A 1NFPA 4GJ1A 3BANA 4O1AA 4HGXA 1LM1A 1AA1B 3NL6A 1G7UA 1TUXA 3LHWA 3FDGA 3PN8A 1ZENA 1SFTA 1UD5A 2O9PA 4A3RA 3MZNA 1OGSA 4ZO7A 1E9YB 1HVXA 3EXSA 4HMNA 3PG8A 2OSWA 3TONA 3RNDA 2DQXA 4RXFA 3EAUA 3ZVHA 4Z1YA 3WLLA 1WE5A 3T42A 1E3ZA 4Z1BA 4OFCA 3CTTA 3UZYA 5C5YA 4CNPA 4YLWA 4YJ5A 4RX0A 4F66A 1KLZA 2J75A 3T05A 1YDOA 3DC0A 2ZICA 1A4LA 4LY4A 4WXYA 5LGXA 5HULA 3I7RA 3T0TA 1V6UA 1QDSA 3COTA 1LF1A 3DCPA 3C61A 2W67A 1XUUA 3LV5A 3WFAA 1VR6A 4MNJA 3UGVA 3SIMA 2WNNA 3PZQA 3TLQA 1XFBA 1QOXA 5DELA 4MDOA 2A3HA 4LQ1A 4TIMA 3WQVA 3WNPA 2VKZG 4LNCA 1AQFA 4DZIA 3DFYA 2VWTA 3DI0A 3EKLA 4P8VA 3BSGA 2E9MA 2V5JA 1JGIA 5K3VA 4L65A 1QNVA 4FOJA 2JF6A 3DGRA 4PMUA 2XGZA 1QHZA 4W7VA 4A2RA 3TH6A 1TJ0A 4ZQOA 2ZDRA 2UY4A 4ZENA 2PI6A 1ZBWA 3E5BA 1TWSA 4YXGA 2QHAA 4K8EA 2VUNA 4BCEA 3S1UA 2Q09A 3ABQA 1K7EA 1FWHC 3CH9A 3KP0A 5D33A 5E0FA 2ISSA 2B4GA 4IICA 3MUY1 5HXMA 3THAA 3M0HA 4NASA 3NSXA 3H54A 2PLJA 4XKMA 3URQA 3HJZA 3WMCA 1UD6A 3QM3A 4FXFA 4C6KA 2G5WA 1RV8A 2E8ZA 5F4WA 2CXEA 4GQBA 4OWGA 3N29A 4ZVJA 1O5RA 1M7OA 3HFTA 3WDIA 1BXBA 2P3ZA 4UMAA 3PBYA 2NSXA 4B5XA 5BYWA 1UP3A 1QW8A 5T91A 1A53A 1J01A 4ZQMA 2GPTA 3SN1A 1H09A 4OVXA 3W07A 2OU4A 1GVOA 4RZ4A 4ZZ9A 1JVNA 3NGFA 1Z8AA 1V51A 3NVTA 5AFDA 4MY8A 3E5PA 1RR2A 3TMLA 1AD1A 2E7FA 7ODCA 3KTCA 4LEQA 3HV8A 3AIEA 5ABHA 4PMOA 4Q4KA 2VEGA 3S1XA 3G0SA 4GCAA 3EMZA 2WNZA 3W70A 3B9AA 4U2YA 4RL3A 5AYXA 1MQRA 3L5AA 4HOWA 5C0QA 5FF3A 5BW6A 1XG4A 1VPQA 1XF0A 4O1CA 4FR6A 4HSNA 2PDJA 2EQDA 2HRWA 3QPEA 3W24A 4DIAA 3MUAA 1W3HA 1VJSA 3TC3A 5G2WA 2BXYA 4DXXA 4EF9A 5EU9A 1IGWA 2Q6ZA 3S46A 3CYVA 1WAWA 2QJGA 3LPGA 1TCMA 2C18A 1Q66A 1VBGA 3M64A 1IWAA 4GNVA 3SZ8A 4TOQA 4F48A 2Z1BA 3OZYA 1IGSA 6ALDA 4QG8A 1CT5A 4KS0A 3M0IA 2OMAA 2R14A 2C1GA 1POJA 3HU7A 4C6EA 3A9IA 1XIJA 7TIMA 3RM4A 4C6CA 3IUHA 5I03A 2R94A 4HTYA 3E2RA 1LUCB 1UWIA 3UW6A 4PH6A 3V0SA 3LRLA 3FSTA 1A5MC 7TAAA 4PBFA 5HMSA 4QIUA 2GQ8A 3QEZA 4V2XA 2QDDA 3DFQA 3H12A 3BLLA 3N13A 4WY0F 2X1IA 4B5NA 1LWIA 1VCVA 1IQ8A 3LPFA 4L5ZA 5FSDC 4IGMA 3AICA 4JR5A 7CGTA 3DC8A 2FHBA 4R7WA 3UZXA 4JTQA 5AHEA 1E6RA 5AYZA 4BA0A 3H4GA 4ONVA 3FDKA 1R87A 3MDUA 4PMYA 4PB4A 2I5IA 4ACZA 5LXEA 3W37A 4FI4A 1KRCC 1TREA 5D02A 2OOGA 4UFKA 1K6WA 3BGAA 4CNUA 3AAMA 4Q8PA 3CHCA 3W1PA 1IEQA 3LZ5A 4MB3A 3ZMRA 3LGDA 3ZWTA 1C9DA 3FGCB 1GHSA 2TPSA 3BK0A 3PBGA 3UPWA 3SQSA 3KOXA 5JU6A 2C3ZA 4H6KA 3R0DA 1V7YA 4ADTA 3R13A 4CD4A 2EBNA 2VR5A 4QISA 3GNRA 5M5DA 1E6QM 2GDVA 4S3BA 3VILA 2J74A 1V5XA 1UPPA 2JGQA 2EJ1A 2A3EA 1CGWA 3ZR4A 2RKXA 2TRSA 4JIRA 3UETA 3AXIA 1PHWA 2YOCA 1O6IA 1PS9A 1UPMB 1GONA 3IEBA 4QJ4B 1JF5A 3FJ6A 3EWUA 3IJ8A 3WYZA 1PCKA 4Q4PA 1CXIA 3WJSA 2C71A 3SCPA 4ERAA 3TTEA 3D0CA 3GC4A 1IT7A 1LUCA 1B3OA 2EG6A 5A8QA 3GKAA 4NJGA 4JYFA 3WNLA 3CMFA 4KWOA 1V3IA 1RQBA 1KD0A 3VOFA 4KH2A 3F5JA 5C54A 1DJIA 3FHQA 4HNNA 3AS3A 1C90A 3VDHA 3P8IA 5FL0A 7REQB 1W5PA 1C29A 1W31A 2E28A 2AKZA 2G4JA 4E2VA 4F0LA 1N8WA 1OT1A 3JS3A 1V6VA 4RPQA 5JXQA 4PFHA 4F8XA 1RJPA 4A8IA 1OABA 1TE6A 2ALRA 3D47A 2I14A 3CIVA 1DV7A 4P8UA 3GXTA 2OEJA 5AZ0A 3W7HA 4DJDD 1DHKA 3P3BA 1XYZA 3H2MA 1OFBA 2PZNA 3NQ8A 3QQ1A 4Q8TA 4G8TA 2HSAA 3VOCA 3QPYA 4UOZA 3BAKA 3CLMA 3GTFA 1FRBA 5I3GA 2D23A 1HJUA 3FGCA 3FAWA 2ODOA 5JVLA 3TFCA 1E4NA 2D2JA 3R11A 4H04A 5AC8A 4GJJA 4TO8A 2DVTA 3R89A 3GZ3A 4Q7BA 4I5UA 3WK3A 3MKKA 1M65A 4YWSA 2ZX5A 5M1TA 3R94A 3MSYA 3ABOA 3H26A 4MJZA 4DQWA 2NZLA 3TCEA 3CB3A 4W8LA 1WV2A 3VIJA 2G95A 3PWIA 2GVGA 1A0DA 1GZ1A 5KTLA 3MCNA 2YGYA 4LSBA 1EJRC 1GJUA 3WQ8A 4DELA 4DO7A 3FY1A 2HBXA 5HQMA 4JTJA 4PTMA 2J7BA 1MVYA 1TV7A 3QBUA 2D0GA 4DBEA 4NZFA 4CQ9A 1WDQA 3Q45A 2R1PA 1R30A 4DWSC 2GSHA 2AL1A 3SFKA 2WJEA 2I7GA 1V93A 1R3VA 1JUKA 3VZXA 3QW4B 1XYCA 5DO8A 2FGBA 3WLHA 4E2DA 4EPBC 1V0KA 5HWMA 4XAYA 3L7RA 7REQA 4WDXA 4TVDA 2OEKA 4NAFA 3D6NA 4US6A 1JNEA 4JOMA 4LAZA 4TTUA 4GYKA 3TN5A 3VD3A 2RH9A 4XAZA 3S2MA 5T26A 4GQGA 1GPFA 3L65A 5BROA 3O07A 3LM3A 3P7YA 3QVQA 3FN9A 3GXPA 3GU2A 4V1XA 2CCRA 2GVYA 2FTPA 3CU2A 1F2JA 4UFJA 3B40A 4JKLA 2OLAA 1TX2A 1BD0A 2H9AB 2JEPA 1ME8A 4GX8A 3DFTA 3N2XA 3VMPA 1CECA 1PPIA 1FP8A 1MO0A 2V63A 4S38A 1XDLA 3ZO9A 2J8GA 5I06A 1UA3A 4GH1A 1MW2A 4JKMA 1GVEA 1SYTA 4LOCA 3MMUA 3HG2A 3VIMA 3VFLA 1NSJA 3SCSA 1TQXA 4UTWA 3V3WA 3GW3A 4NNCA 2B0MA 3MP3A 3OGSA 2Z2UA 5AYIA 3AJ7A 3EX2A 1S3HA 1I45A 4CNNA 4WLCA 3W7GA 1H41A 4DXVA 4AZ6A 3INPA 4TMBA 4BI6A 4S3AA 1PKNA 1RPXA 4ZTXA 1YXCA 2IPWA 3EWBX 3CNYA 2TMDA 3TQKA 2HJPA 1A5UA 1DQUA 3CASA 3L4XA 1V3HA 3PNZA 5KZMA 3KCOA 4U28A 1J0HA 5HINA 4R85A 1OCNA 3IAPA 3UJFA 3WJWA 4RDZA 3N2CA 1K70A 1A47A 1N55A 5AZ1A 5AN7A 1AW5A 1R2RA 2YA2A 4OT7A 3TKFA 2Y89A 5CC6A 1KBBA 1O5KA 1RCOB 4TVCA 2D3LA 2QIWA 4QX4A 4MNLA 1SZEA 3ZSTA 2GGJA 1HX0A 1C8VA 1TV4A 3MPGA 3KCLA 3ELFA 2VEPA 4N9DA 2HBVA 1OVDA 4FA3A 5FOOA 3LNPA 3WJYA