4HMNA

Crystal structure of human 17beta-hydroxysteroid dehydrogenase type 5 in complex with (4-(4-chlorophenyl)piperazin-1-yl)(morpholino)methanone (24)
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
318
structure length
306
Chain Sequence
QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Aldo-keto reductase family 1 member C3
publication title Morpholylureas are a new class of potent and selective inhibitors of the type 5 17-beta-hydroxysteroid dehydrogenase (AKR1C3).
pubmed doi rcsb
source organism Homo sapiens
total genus 117
structure length 306
sequence length 318
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2012-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4hmnA00
1Q5MA 3FX4A 3H4GA 3B3DA 3FJNA 4Q7BA 3DOPA 4GIEA 4DBWA 3GHTA 4YS1A 4H8NA 4H7CA 2WZMA 2CLPA 3UYIA 1US0A 3ONCA 2F2KA 3UGRA 4FZIA 1FRBA 3S3GA 4XZMX 2PDGA 2PDHA 2J8TA 3UP8A 2NVCA 3MB9A 4I5XA 2ACUA 4GABA 4DBSA 1SM9A 4Q3MA 2FZ8A 1JEZA 2PF8A 3LQGA 1VP5A 4JQ2A 3V0SA 1RY8A 1S1RA 3GHUA 1AZ2A 2IPJA 4JTCA 4L1XA 3F7JA 2PDFA 4OTKA 4XO7A 4YVPA 3V35A 4JIIX 3EAUA 1Z89A 2PEVA 5JH2A 2DV0A 3C3UA 3U2CA 2QXWA 4PUUA 2PDLA 2PDXA 5LIUX 2IKGA 1ZSXA 1LWIA 4ZFCA 1J96A 1PWLA 3H7UA 3ERPA 2PD5A 2INZA 2FGBA 1Z9AA 2WZTA 2IPWA 3LNMA 2FZDA 1YE4A 2IKIA 1ADSA 3EB4A 4PMJA 1T41A 5KETA 3ONBA 2IPFA 1GVEA 4JIRA 1ZUAX 4R9OA 4WGHA 1UR3M 1XJBA 1PWMA 1MZRA 2PDMA 4PUWA 1AFSA 3GUGA 2ACQA 3WCZA 3BCJA 3COTA 4XZHA 2PDIA 1EKOA 1IHIA 1PYFA 2BGSA 4YU1A 2R9RA 3CAQA 4YVVA 2PDJA 4GQ0A 4PRTA 4XAPA 4GQGA 3KRBA 3LUTA 1Z3NA 3LBOA 5LIKX 2HVNA 1EXBA 1X96A 3WBYA 1OG6A 2IQ0A 2PD9A 4JQ4A 4EXAA 4JQAA 1S2AA 4LB3A 5AZ1A 2INEA 2PDYA 3D3FA 1X98A 1K8CA 4GA8A 5LIYX 3CMFA 3UZXA 3UZWA 1AH4A 4LBRA 3LENA 2ACSA 3O3RA 3CV6A 2PDUA 2AGTA 4RPQA 1HW6A 4QR6A 1S2CA 3NTYA 3V36A 4LB4A 4HBKA 5JH1A 1VBJA 4L1WA 1ZQ5A 2BGQA 2PDWA 2C91A 3Q65A 3R6IA 4LAZA 2ALRA 2NVDA 4HMNA 4QX4A 3G5EA 4GCAA 4WEVX 3M64A 3R8GA 2I17A 5HNTA 1ZGDA 3WG6A 3M4HA 3N6QA 2PDKA 4WDTA 3LQLA 4ICCX 1RY0A 4WRHA 5C7HA 3H7RA 4WDUA 3O0KA 2P5NA 2HEJA 2ACRA 2FZBA 5HNUA 2PFHA 3BURA 4PR4A 3VXGA 2I16A 1YNQA 4IJCA 4LAUA 4IJRA 1QRQA 4XO6A 3V0TA 3V0UA 1MRQA 1YE6A 2PDPA 3WBWA 1Q13A 1EL3A 1IEIA 2FZ9A 3CV7A 1YNPA 3LN3A 3N2TA 1QWKA 1EF3A 4F40A 2HVOA 2PDBA 3LEPA 2ISFA 4JTDA 3R43A 3R7MA 3EB3A 3RX2A 4G5DA 2HDJA 3R58A 4JQ1A 4FAMA 5LIXX 4XZIA 1AZ1A 1AH0A 3BUVA 3LZ5A 3DN5A 4XZNX 5LIWX 4XK2A 4FALA 4DZ5A 4LBSA 4XVDA 2DUZA 1MI3A 4XVEA 3R8HA 4YVXA 2PDQA 3WBXA 3UWEA 1R38A 2HV5A 2PDCA 4WDWA 4PRRA 1RALA 3GHRA 4FA3A 2IPGA 4NKCA 1XF0A 2PZNA 4JIHA 4QXIA 3LZ3A 4MHBA 4DBUA 5DANA 3UG8A 4GACA 1M9HA 3GHSA 4XZLX 1A80A 3UZYA 3T42A 4ASTA 5HA7A 2DUXA 3LD5A 3UZZA 3RX4A 3M0IA 4QBXA 3R94A 2IS7A 1XGDA 1AH3A 1C9WA 3MC5A 2IKHA 4JTAA 3P2VA 4WDXA 4JTRA 4AUBA 3Q67A 2VDGA 4EXBA 1PZ1A 2HE8A 1LQAA 1T40A 4JQ3A 3BV7A 2F38A 2FVLA 2PDNA 3CAVA 5AZ0A 2IQDA 2BP1A 1X97A 3G1RA 2HE5A 4JTQA 3RX3A 2IKJA 1PZ0A 3QKZA 1S1PA 5M2FX 2A79A 3UFYA 2R24A 4IGSA 1HQTA 1Z8AA 3CASA
chains in the Genus database with same CATH superfamily
4C6LA 4F0RA 1YRRA 3O6CA 1OF6A 1N82A 1P43A 2QJJA 3LSCA 5FF7A 3BJSA 4DZIA 4MZ1A 1KM3A 2HCVA 1TTJA 3WNLA 1FWRA 3LCWA 2NQZA 1ZJBA 1B5TA 2AQVA 2D2HA 5GQBA 4TV5A 3B8TA 2PSNA 3T40A 1REQB 3EX6A 2CLFA 2WC4A 2CXGA 4WY0A 1PCKA 2CLKA 2V5JA 1FRBA 3H24A 4AZCA 5G4HC 2TODA 3W76A 4MYAA 2I5IA 1E3XA 4A8LA 7REQB 4O19A 2NXIA 4DBEA 4HU0A 3E96A 3CJPA 4W5ZA 4LVDA 1KO0A 1XLDA 1OWQA 1J79A 2IQTA 2V5CA 5GVJA 5A6AA 4KWOA 1U1UA 4S3DA 3P81A 4YVPA 3V35A 3IRDA 1XLAA 2FH6A 3HPFA 1XIFA 2PLJA 3LPFA 3QHOA 2DGAA 2QXWA 4DRSA 4IL0A 4JTGA 5EFDA 4NJJA 4C6KA 5LIUX 3TK7A 4KGJA 4LH8A 4TX8A 4GO8A 3NSNA 2HZGA 3GDKA 3TAKA 2PGEA 1LP6A 2PU1A 2QCFA 1SJCA 1UCWA 3E0WA 3ONBA 1GVEA 1U22A 1ZUAX 4S1FA 3LCIA 3GB6A 1Q2SA 3ZIZA 4HZMA 1XJBA 3HO8A 1U5HA 3PG8A 3LTPA 5A6SA 1UIPA 3ZYZA 9CGTA 1PYFA 1UUQA 2YB4A 2Z25A 1O4UA 5KEZA 3Q45A 5BOEA 3SJNA 4EOUA 1IR1A 4GGHA 3ABOA 4DO5A 2PLKA 1NWRA 4ORMA 2GSJA 3QC3A 1U30A 3NGJA 1TX2A 1UKOA 4FI4A 5H6HA 3CHEA 3MP4A 3MV01 4C6PA 2AAAA 2RHGA 1HP4A 1X98A 4J3TA 1CECA 3WLIA 1ZTVA 5E9XA 4HMDA 3AZSA 2CKRA 2V30A 3ZT6A 1K9TA 1B54A 3AS3A 4R85A 3CQ0A 2WXDM 1E9IA 1XLKA 2RDXA 3GXFA 4RPQA 1V8EA 1HW6A 2ZBTA 3S1UA 1KM2A 2OEKA 2V9DA 1KFWA 6REQB 1S2CA 2ICSA 3CTLA 2WHMA 5HNNA 3C52A 1VCVA 3BMXA 4F0HA 3H2OA 6XIMA 1VCGA 1BRLB 3VX1A 4B4FA 1WDRA 1A5CA 2I17A 4LXFA 5C0QA 1KM6A 3R0DA 3U6WA 4D2JA 1R86A 3L4ZA 2J88A 1HL9A 2GVJA 2VZTA 3VCRA 3K5XA 5AHEA 4WDTA 3LQLA 3NR0A 4OOUA 4OBTA 4M80A 3WX7A 4WRHA 5D9MA 3GVWA 4Z0JA 5M17A 3DIPA 3B9NA 2OVLA 5BROA 1W9VA 4FNTA 1DIKA 1E71M 3TTEA 4LGXA 3H26A 4E3VA 1EHNA 4C6EA 1MEHA 3E0VA 1UP0A 3VIIA 4S3FA 4DPPA 4CD6A 3LHUA 1W5OA 3L5LA 3WF1A 1IWPA 2VEKA 2O55A 1GJPA 4N02A 1BGAA 3HA1A 3ISIX 2ZVRA 6XIAA 2ZIDA 4YTUA 3RCNA 3HM7A 2FJKA 4PB3A 2V67A 3IUHA 4MUPA 1W3JA 3I3DA 3CPGA 1OK4A 3C0QA 3S8HA 4JTDA 1A4LA 3GE7A 4H2CA 5FF0A 2A3BA 3TSMA 1N8WA 3S5NA 2QEZA 3WLHA 3AJ7A 4UFHA 1I0BA 5EFFA 3USBA 3CWNA 4CUCA 2V81A 5CCZA 2V3GA 4LF1A 4Z2JA 1TPVA 1GUVA 2XH2A 3LCHA 3AS2A 4JAWA 3LZ5A 2Y7GA 3B8UA 1S38A 3CUXA 1FCVA 2D69A 3MDWA 3OVGA 1EGVA 3P0XA 4E38A 4GBUA 1XLIA 4GXWA 3ITOA 2O9PA 2CBJA 3WBXA 5K7JA 3NZGA 3W84A 3CWOX 3VD9A 1ISVA 1Q85A 3TNOA 4E0CA 4O57A 2Q71A 4S3EA 2O9RA 5C8BB 4KRUA 4QXIA 4REQB 5A3HA 1XLJA 4DBUA 1ZRQA 2CEQA 3AALA 1L2QA 3LV6A 3WZ0E 2QDDA 3CXOA 3T42A 1VFMA 3TZNA 1E4IA 3G18A 3UZZA 3HU7A 4EX4A 1UD5A 1C9WA 2MNRA 3PBYA 4W7UA 1KBIA 3ID7A 4NX5A 3KBJA 1RV8A 5FEZA 1NTHA 3SUSA 1YYAA 1MNSA 2ISWA 2HS6A 3T78A 4JIPA 4JX6A 2PDNA 1J93A 4O12A 2OMAA 1IZJA 4CGTA 3JU2A 2WVUA 3TROA 4GVIA 2ZUMA 4LC8A 3AISA 2OQHA 4DBDA 3DBNA 3T08A 5KITA 3C56A 1WDDA 1PS9A 1ZALA 4AZ6A 2A7PA 4Y8FA 4X2PA 1QO5A 1RQHA 2F61A 1QPQA 4FLQA 4YXGA 3TLQA 3H2FA 1KQZA 1QI0A 1K1DA 3BMVA 4PA8A 1B4KA 1OY0A 3F4CA 2RFGA 1PTAA 3APYA 3FJNA 3GTNA 5T9CE 1KFCA 4XISA 1OX5A 3DOPA 1EQCA 3M07A 1OFOA 3VA8A 2JGYA 4W8LA 1I6NA 3KBMA 1SMDA 4YLWA 1T0OA 5AC8A 4H7CA 1RJQA 1P5BA 2Y8VA 1HZYA 4A05A 1SFSA 2EJAA 1GVIA 3IANA 4UTIA 2Z24A 1UKQA 7PTDA 3NIYA 2Y7FA 1ZNNA 3ZLGA 2ONEA 2YDQA 3C8NA 3L23A 3MB9A 5AYYA 2MUCA 2ACUA 1W9XA 3DFYA 4AD5A 5C2GA 1SM9A 2Z7GA 1BAGA 4B5XA 3GW0A 1HKWA 2PF8A 4NIRA 1W1PA 3SRKA 2OFJA 1SO4A 2BXYA 2XTKA 2GSHA 1N55A 1O1HA 4ZE5A 2Y88A 1QPKA 3W83A 5DRCA 1IYXA 1DWIM 1UD3A 5A6LA 4LNYA 4O13A 2OX1A 3SIZA 3U9IA 5K9DA 1U5VA 2D20A 1I1WA 2CYGA 3DFQA 4PCSA 1LWIA 4ZFCA 3LRLA 4DVOA 3BW4A 5MKGB 3CIVA 5E0KA 4AU0A 3HG5A 2X2YA 4DY1A 1WAWA 1AD4A 4ZFMA 3GIPA 1JG9A 2EG7A 1JD7A 2J25A 4Z0SA 2J78A 2GJXA 2J6VA 3LXCA 4NASA 4GIYA 2XGBA 2ZC8A 4JTHA 4XD6A 3STFA 2GSEA 2PWFA 4AHPA 3TMQA 2DW7A 1HT6A 2X1SA 4XZHA 3SCTA 4PUDA 1VIWA 4YU1A 2ZXBA 1LBLA 3TC7A 3EZ4A 3N17A 3URBA 3NO1A 3KW3A 1PIFA 4HVXA 1FFRA 2WC3A 3W1PA 3VU2A 2V2CA 3S47A 5D04C 4PFHA 1HUVA 1X6NA 4I8DA 3MKKA 1TE6A 3A24A 4TOQA 4DB7A 2ZUVA 4L56A 1GCYA 3QF0A 3F4WA 1XX1A 3HGOA 1V5XA 1RBAA 4NI8A 5HUOA 1M6JA 2E0PA 4PBGA 3CZ8A 3NDOA 5CPNA 4QNWA 2ZUUA 3MO7A 4B5VA 1J12A 4H6RA 3WNPA 1TWIA 3NCOA 3M1ZA 1AH4A 3QR3A 1EX5A 5G1TA 4AEFA 3LM3A 5T8GA 3FA5A 4QDWA 3L2LA 1ENUA 2ZRWA 3B8DA 2QDHA 1OHLA 4M19A 1UH2A 4N9DA 4NRSA 1E4LA 4QR6A 2ZWYA 4IICA 5FL0A 3HPAA 3OP2A 5DO8A 5JIPA 2GWGA 4ICNA 2PB1A 4L1WA 2J8GA 1KFEA 3TYUA 1MZHA 4NG3A 5HOSA 4AW7A 4E4FA 1JCXA 3TVAA 3LCLA 1GGOA 1S2VA 4B3KA 1WDWA 1NWUA 1EWEA 1FDZA 3QZ6A 1EWDA 2A85A 2GK1B 3RAOA 1EB3A 2H3DA 3AYTA 1HKKA 5H1WA 4UCFA 3WK1A 3OB8A 3S5SA 1UOKA 3CU2A 1ML1A 1V6XA 1CXEA 4G7EA 1O5KA 5FEXA 1NOUA 3A5FA 3G1AA 4IJCA 4Q4SA 2C1GA 2B0MA 3LA4A 3VD4A 3TV8A 1M65A 1BWVA 2PDPA 4GH1A 3PBGA 4MNMA 4UTUA 1P6BA 3NZRA 1FWAC 3L2MA 4GQBA 1UYQA 4GXPA 2XM2A 3WIJA 2D0FA 3MYPA 3QEZA 2I7GA 1POJA 1E70M 2AKMA 3OJGA 3W7NA 4C60A 5DMLA 1V77A 2X1IA 4IXHA 3EX4A 3SUUA 4HHLA 1JZ2A 3IGHX 1KBKA 4AXKA 4CN4A 3M7WA 3HN3A 1NFBA 5HQMA 2V38A 1EDTA 3UW6A 2OJPA 1B1YA 4XZIA 3TJLA 3CPUA 2WNNA 1L0PA 5AYZA 3S5ZA 3K46A 5JUVA 1B57A 3EA2A 2G41A 4NZFA 4H9MA 5CGMA 4EP8C 2HBVA 2ABBA 4XK2A 1EJRC 4ZOCA 4GNVA 2DUZA 5IM51 3T0BA 4AVNA 1A5SA 2PDQA 1FWDC 4GISA 4XBSA 3UJ2A 2WSQA 4NJHA 4X63A 4GZIA 3VIMA 3G22A 4D71A 2R94A 3N12A 4DJEC 4R53A 1OG0A 3HZ3A 2P10A 4A2RA 1XG4A 2Z1WA 1LT8A 4HNOA 4L6HA 1WUEA 2QGHA 3MCOA 4B5WA 4L61A 3NM3A 2XIQA 3AHYA 3UXKA 4GUHA 4RNHA 3LD5A 1FWIC 3QZAA 3VFCA 2BVWA 3VC6A 5A8NA 3T0DA 4WDXA 5XIAA 4KEMA 4W4QA 5C9XA 1GOKA 1H7RA 3KBSA 4S3BA 4B3ZA 5AHLA 2Z1KA 3DHDA 1K70A 3HQNA 4F3HA 2QV4A 3I65A 4ZMGA 4JTQA 5AOUA 3V1PA 1XV8A 2QCCA 3TSDA 1PJ9A 4E4PA 4OE7A 1TSIA 1FY6A 3CASA 3DFTA 1TG7A 2RJHA 4JIEA 4LCQA 7TAAA 3N3MA 5XIMA 5AVNA 4E2VA 3PFRA 1C8QA 3VE9A 4UTJA 2VGFA 4M3PA 2PS2A 3HFYA 4PUEA 1A5UA 3W85A 3CLMA 3PJXA 4LPCA 3WUGA 3O06A 2NW0A 5DMMA 1X1ZA 3PPHA 4UQCA 4ZBCA 1X39A 4FLOA 2WVVB 3WK3A 4RE4A 1KM1A 4UFIA 1PL9A 3MT1A 2WJEA 4FZIA 3UBPC 3AU6A 3PUGA 2EF9A 1K02A 1DE6A 3CB8A 3L65A 1HF6A 4IQDA 3VNDA 2JBMA 3ITTA 3MQTA 3FJ4A 1EPVA 2EQDA 1BXCA 3EMCA 3A3XA 3DCPA 3VIJA 3LPPA 3EDFA 4BI5A 3DZ1A 3HJZA 1VP5A 2UY5A 4I9JA 3EXSA 5BXSA 2EHHA 1RY8A 1S1RA 3S1GA 2ZQ0A 1XP3A 4F0SA 3OBEA 5LHFA 4J3XA 3LTYA 2AMGA 4Q8TA 2Y70A 2Y4SA 3DC8A 2X1UA 1XYFA 3SI9A 1GOOA 2PTWA 3IGSA 3N25A 3NSMA 3B9EA 4TX6A 1TB3A 5D2YA 1MNZA 4PUUA 5J04A 1EZ2A 3HPZA 4JFTA 2DPEA 3N2XA 3TR9A 3H7UA 1DIDA 1OGSA 3DG7A 2Y85A 3E49A 2WMIB 1V6VA 1GVYA 3H54A 1F74A 2R1PA 5DT7A 1VZWA 2G96A 4GBDA 5A6JA 3EGJA 3WQ5A 2UBPC 2QUNA 3WJSA 3EWBX 1ODUA 2WQPA 4MTVA 2PUZA 2WKJA 1UZDA 4EXQA 1W3LA 1VPXA 3DGBA 3W81A 1F7BA 4XAPA 4LUTB 1HJVA 3BXWA 3T1GA 3FLUA 5FJJA 5HMSA 3LBOA 4ZODA 1EXBA 1DWJM 1Q66A 4NAFB 2VEIA 2WBGA 1AQFA 5A6BA 3BAYA 1SFTA 4FPSA 4LAOA 2PODA 4PSPA 4QISA 4ORIA 4FX8A 1EUNA 3P61A 4DN1A 4H8UA 3F5JA 2C1IA 3F5KA 1XIJA 1DVJA 1A3XA 5I0DA 4W85A 1P0EA 3OQ8A 4E2OA 1GZGA 3VK5A 3IK4A 2BHYA 5U4NA 1XIDA 4NJGA 4OIFA 1PBGA 5EYWA 3DECA 4HU3A 3FY1A 1ZCOA 1WUFA 4QEEA 4AWUA 2GGJA 2R6OA 1UJPA 1EJSC 2BBFA 5FJRA 2YW4A 2NVDA 4GI8A 1UWTA 3LGGA 5D02A 4HGXA 4MG4A 3VNJA 1ZGDA 4CQDA 3QLLA 3QKEA 4FNUA 3MP5A 3N6QA 3A47A 3PTQA 1YLVA 4R7OA 2C7FA 3I3EA 5LA2A 3S5YA 2VX4A 3MVIA 3INPA 3O0KA 2QF7A 2HEJA 1W5NA 4K7YA 4X0NA 5GNYA 2ASHA 1QOPA 3HURA 1TO3A 2BLEA 1UR1A 3QW4B 1G4TA 3IIPA 3WBWA 3GG8A 3ARZA 3M0YA 1C91A 4B9YA 4U3CA 4NXSA 1YBQB 5CZTA 2BODX 1M1BA 2RDWA 3S46A 3VZXA 1E3ZA 5KSWA 1HP5A 1CXLA 1ZCCA 5EB8A 4MPQA 1CT5A 1DQUA 1OFAA 3QGKC 1QWKA 4JTKA 4RNFA 3PM6A 3VOHA 4RDZA 4WXYA 3W9ZA 3DYMA 1F2JA 1GOWA 1MMFA 2EXOA 4O0ZA 3P80A 5E9AA 2Y8UA 1ONEA 2HISA 2O92A 3IGXA 4I3GA 1WQ5A 2V3EA 1DIOA 1ISYA 3EOUA 3E2QA 3DN5A 1EYWA 1MQPA 3M5YA 5LIWX 3TQKA 3CNYA 3B8IA 2NQJA 4JTLA 2PBGA 4AX6A 1MQRA 3ZVHB 3C2VA 3GUWA 3R79A 1I2OA 3N9KA 4RE0A 1Q6DA 1RVKA 2OO0A 4DUOA 3DFSA 4Q8UA 3QLDA 1TPUA 1LOLA 3WDRA 3WDIA 4ECLA 3MUXA 2PZNA 1LWHA 2OG9A 1MEWA 3MZNA 3C2OA 2DFAA 4YTSA 2AL2A 3CLWA 5DANA 4Q4OA 3QQ1A 4MKNA 3T05A 3EXRA 2FTWA 1KKOA 1A47A 4L1GA 3UESA 2WKLA 4CQ9A 1NQKA 5EMJA 1QOQA 2G0WA 4US5D 1XR2A 4TXEA 4LNCA 1FWNA 3ZT5A 3L9CA 3VZZA 3BGAA 1FHUA 4RUBA 4QQUA 1GT8A 5CG7A 4DLFA 3PWAA 1PZ1A 3BL3A 1A5AA 2GQ8A 2F38A 4GYPA 3N19B 4N0RA 4O50A 3PB2A 1IWBA 4KWUA 1H4PA 1G9HA 1OIMA 1B90A 4PMDA 4DO4A 3WD0A 1RBLA 1UWRA 4NYYA 1FWCC 3OZOA 3RX3A 2IKJA 2AL1A 4QS6A 2RKXA 2A5HA 2AQOA 2A79A 5CGTA 3SAZA 1PIIA 3A3HA 1W9PA 4KCTA 1KGXA 2EPNA 3CH9A 1UB3A 3UWUA 2DUAA 2J74A 4PMUA 3MU7A 2HQAA 2VTFA 3CYJA 3C3NA 3FDGA 4G1NA 1JAKA 1BTCA 4XV0A 1XLFA 2F6UA 3EWYA 2Z1VA 1J8VA 3BLFA 2WOQA 3B9OA 4BQ5A 1UWSA 2LLEA 1C7SA 5D2VA 1YTDA 3UGRA 3PBWA 4HZ6A 2YX0A 3QYQA 1J10A 2ZICA 2PDHA 1ZAHA 4RZ4A 3N1AA 4WK9A 1XYLA 4ZOAA 3UP8A 4G8TA 4GABA 2HXUA 1E1CA 1FWSA 3VGFA 3FHQA 3RNDA 2ZUSA 4JQ2A 2CHOA 5FJUA 3N6HA 3ATYA 3MA8A 3WLSA 2JIEA 4GVFA 2VZVA 4MDPA 1XBVA 3QQWA 1F3EA 1BQGA 1N8FA 3BOXA 4MY1A 4QS5A 1UBSA 1WKYA 1H1NA 4LRSA 3ZVIA 1KRMA 1EH9A 3GVQA 1WZAA 5D05A 4NX0A 4IH3A 4ERGA 4C6JA 5JVLA 4KIEA 2PD5A 5DCEA 1SFJA 3Q94A 2OZ8A 1W54A 1R2RA 4JBRA 4JEJA 1V3HA 4YL2A 2Q02A 1TV2A 3GYEA 3ES7A 1QPNA 3NQ7A 3W6YA 2ZZ5A 3UQNA 5CPQA 3W7QA 1JNDA 3GX9A 3G8RA 3KOWA 3ARRA 1W5MA 2PWVA 1QI3A 4MNLA 2FTPA 2EKGA 2BX7A 4XSMA 2VDHA 3OVQA 1RUSA 1BD0A 3BJTA 2J9XA 5DLCA 4PRTA 1UH3A 4GQGA 4MAZA 3VGHA 3UCQA 1OABA 3CGTA 5HANA 1O7AA 3O1NA 1CLKA 2W3ZA 5F4SA 1FVPA 4IMFA 4MADA 1MDRA 3UWQA 3V75A 4JQAA 3UR8A 3WH5A 1K7FA 4PRWA 4LS1A 2X05A 3KVLA 3NQBA 1XIEA 3FK4A 1US3A 1M68A 1Q2RA 1KCZA 4IPLA 1F76A 3GG1A 3UZXA 3BGJA 3UGVA 3VKJA 3UJSA 5JU6A 2NSXA 3QV6A 3VNKA 4GLEA 1LRTA 3KTCA 3EMQA 4MLRA 4N7QA 8RUCA 4RKAA 5BW6A 3I3BA 2HBXA 3MUCA 1IEWA 1FFQA 3MYOA 3E12A 2QCMA 3BLKA 1JF6A 1OCQA 3VGGA 4YWSA 4GY1A 3S0CA 1OX4B 4UC5A 4PBFA 3ZS4A 2OQLA 4BEQA 1LRNA 2I56A 3NGFA 3V5OA 2YBUA 4H7ZA 2QW5A 4GJIA 5BOOA 4FR6A 3NZQA 2OXNA 3ARSA 2RH9A 1LQ0A 1SSDA 2WNWA 1DJIA 4ROQA 3PTDA 1P7TA 1GW9A 3GBEA 3KL5A 3SQSA 4WX2A 4QGCA 1RY0A 1ZJAA 2H90A 3QM3A 2DZSA 4GOAA 5C7HA 1I9CB 3AWOA 3VIHA 2OZ3A 5AVHA 1PX3A 1CGVA 4PR4A 3VXGA 3ABXA 5C6MA 5TNVA 1V3KA 1QRQA 4LQ1A 1JZ6A 5BOFA 3W38A 3EEZA 5F2LA 1RCOB 1SU5A 3RLVA 2ZUNA 3R10A 4PCPA 4DYEA 2YLLA 3SO7A 4NAEA 4HHPA 4PMNA 1TIWA 3PZGA 2FMOA 1FKXA 5I79A 1P1MA 2XFRA 2Z29A 4IIFA 1L8NA 4Y2WA 4MJMA 2F9RA 3NZ1A 3DG6A 4PMYA 1OFQA 4O17A 2HVOA 4J28A 1SJBA 3LCXA 4Z1BA 1AJ2A 3XISA 1QDSA 3ARVA 5D38A 4WSKA 1TWZA 1YPXA 3B05A 2QAFA 1PCWA 4W89A 4UUIA 1R3VA 2XIIA 5AECA 4O53A 3I4EA 3U7VA 3VD5A 4GO9A 4TTUA 4FALA 2INFA 4IIHA 2R8WA 3BW2A 4L4OA 4XVDA 5F4XA 1BQCA 1UD6A 4A3HA 5F7UA 1MI3A 2WM0A 2EO7A 3WLRA 2HV5A 3R2GA 4GY0A 2GJRA 3NQAA 4GUIA 3ZJ6A 1BVZA 1FH9A 4W7VA 2Y5SA 5A5WA 3A6OA 3GYCA 1PV8A 2A1YA 3GO2A 2YA1A 3LZ3A 3L66A 1MFVA 3VDCA 1WB0A 3M6DA 4A3QA 5LNWA 3VKAA 1FWJC 3UWYA 1XD0A 3B97A 1KQYA 3P67A 4L80A 4QBXA 8A3HA 2OX4A 4UQBA 4DZHA 1SR9A 4DYJA 4WJXA 1NOFA 5FEPA 1H63A 4JTAA 4ACYA 4HNCA 3PPCA 5LNVA 2PBOA 1QNPA 5BXPA 4JTUA 4Y9NA 2VMFA 2DP3A 3IJDA 3W87A 1W6TA 3JVAA 3H21A 4JQ3A 5D2TA 1MO0A 4IMCA 4DNHA 7ENLA 4HNTA 2DORA 2P76A 3DUGA 1OC6A 2XFWA 3WF2A 5HQEA 2J8FA 4MJ4A 2R82A 2OCZA 4S3CA 2AMXA 1H1ZA 1V02A 3O15A 1SSGA 5I6SA 5HJLA 3VNLA 4LWWA 3C2YA 1TJ2A 4MLJA 4Q22A 1ZBKA 3B4UA 2ATMA 4N2YA 1I75A 4PCFA 4ADTA 5F1VA 3RGTA 1H60A 4XD4A 3WL0A 1UKTA 1TQXA 3WK0A 3MJMA 2F6XA 3GHTA 1JCNA 3HPXA 2WMKA 2BMBA 1ZBWA 4QLLA 5GPRA 2XZ7A 1US0A 3VKCA 3KOXA 3ZXWA 4K1WA 4D72A 5B80A 5KINA 1P6WA 2V68A 2NVCA 2OSWA 4FEZA 4Q4KA 4G2DA 1KM0A 3GTFA 5TD4A 1R85A 4YTRA 2NWSA 3RUBL 1TA3A 4HJWA 2ODOA 1E1EA 3OLIA 3UF9A 4H04A 2QHAA 4B5UA 1IT8A 1G1YA 5D32A 2VCBA 1XINA 3VMOA 1XXXA 2WMHA 2WMFA 3WNKA 3IJ8A 4IP5A 4WJ8A 5A6TC 3CHCA 2G4JA 1F6YA 3SGUA 3WMLA 4HKPA 3W3OA 3W53A 5I3FA 4PTWA 3O7UA 3TJIA 2JKPA 4KBXA 5JH2A 3QR1A 4J3ZA 3TTSA 1KXQA 3KLLA 4J27A 5AYXA 4UQ9A 2BSLA 2JK2A 1IZCA 1H09A 4D6HA 2IXVA 1HNYA 4W93A 3LLDA 4HB7A 2INZA 3CQKA 2BGNE 1IGSA 3R1ZA 3LNMA 2VFGA 4L9ZA 2GVGA 3RU8X 5DELA 1OK6A 4W87A 3NPUA 1JZ5A 1AODA 1K4GA 1T41A 2E6DA 2FQIA 3G3DA 5FD0A 2DSKA 1SZFA 4WGHA 3U2EA 1OF8A 1GONA 1M41A 4E8CA 3PF3A 3QMTA 2W66A 3AYSA 1PWMA 4O18A 4NILA 4QEHA 3EOLA 1M01A 3CUHA 5CPTA 1W2VA 1IGWA 3ALGA 1AFSA 1CIUA 4L6OA 3IJLA 1K6WA 4N9CA 4US6A 3VKBA 4FNPA 2CCRA 2CBUA 3QV7A 1E9LA 5PTDA 3WQFA 2VGGA 4WY0F 1VFOA 2PRHA 2ZDSA 1BYBA 4LU0A 1RCXB 1W3IA 1BVWA 2OYLA 4IL2A 1PSCA 4K68A 3QR0A 4MWAA 1W3TA 2ZWZA 3STPA 4JOMA 4PUNA 3TXZA 4WXZA 2WHJA 3QPYA 2R1LA 1EJTC 5LIKX 5REQA 2H3BA 2CETA 4ZO9A 3CUIA 4HN4A 1ITCA 3GDMA 4K38A 3VDAA 5LA0A 1XGZA 4PBEA 2QCDA 2QYGA 3VMPA 4GE8A 2INEA 1RBOB 3VINA 3CMFA 4O10A 3UCDA 5HMEA 4GH3A 3RRXA 1BWKA 4N6FA 2A3LA 1ZLPA 2BXZA 1EDQA 3YPIA 3W27A 1QPOA 1X1OA 2J6XA 4WQ6A 1VBUA 1H7XA 2VXNA 5FACA 1W5PA 4N4QA 3PZUA 1WDSA 5TF0A 3M0KA 4M6VA 2YL9A 2CBIA 2VUYA 4ZZ9A 2P8CA 1A5MC 4LYQA 2GVEA 3THAA 4QX4A 1GOXA 1XIIA 1EOMA 3RK8A 1PB0A 2BDQA 2GOUA 3M4HA 4IX0A 2JQXA 3B0XA 4CNPA 3WQPA 3FGCA 2NUWA 2YA2A 2VGIA 2GWNA 4I9MA 3MS8A 3VD3A 2FTYA 2J47A 2NUYA 2QJMA 1HJWA 2AQWA 4D9PA 2A6NA 1Q6RA 1OT1A 2J7EA 4JNYA 4BF9A 3VIKA 2VR5A 3PWGA 2E40A 2GQ3A 1C8VA 1MRQA 3AC0A 4DWSA 1WXJA 2ZA2A 2CU0A 4CQ8A 3REQA 1XC6A 4A8NA 5HMDA 4CQBA 4ZQCA 5D8WA 4IT1A 4BF7A 1PE1A 5CSUA 4WZHA 4H9VA 4H00A 1QHZA 5DBTA 2IUZA 1VFSA 1IXPA 2BNJA 1NH6A 1K6AA 3TN6A 4AD2A 2OO6A 4PL1A 5LIXX 3G1FA 1V6YA 2J9ZA 4U2YA 1S2UA 4GK8A 6ALDA 1OZQA 2VRQA 4HZ7A 1Y65A 1OC5A 4DZ5A 2BFGA 4HK7A 1YQ2A 4EPKA 2VD8A 3BV4A 2NQ9A 2GJXB 3GNOA 1R38A 3RF9A 4AX7A 1LBFA 4WDWA 1UASA 1LM1A 1WKEA 1V6UA 4HYWA 4ROPA 3NOYA 1XBXA 2E9BA 4GRSA 4NKCA 1OYCA 2QJNA 3B0VC 3QFWA 5DFAA 5FJPA 5HWMA 2L5HA 3AUJA 5BXTA 1JDFA 4U28A 3GHSA 5AC7A 4H8VA 2X8RA 4XZLX 3OA5A 4AISA 3IJQA 2H9AB 3TWBA 3WSUA 3BH4A 1R3YA 3RX4A 3M0IA 4NJKA 2E68A 2JF6A 1FHVA 1OADA 2CHNA 4L9XA 3P2VA 2QF8A 3JZUA 1D3GA 2QVHA 4I90A 3GW3A 2PTXA 4MKSA 1U1HA 2ATSA 3BMWA 2GVLA 3W7MA 3ARWA 1KM4A 1OT2A 4W88A 3B8WA 4KT2A 1E6RA 1B9BA 4EAMA 3UETA 4AD4A 5G2HA 1W1TA 3EOSA 3FNDA 3W00A 2YBTA 1V6WA 1QMLA 3TCSA 2A7NA 3SCWA 3GTHA 2Q6ZA 1R3QA 2B81A 3WNOA 4OHQA 1JPHA 4CD5A 3OHIA 2HK1A 4LANA 4O28A 3APGA 1OIFA 1QPRA 2P3ZA 1A0DA 5D8ZA 2A0NA 4LUJA 3DI1A 1BG4A 1FCUA 4PULA 1EIBA 5EGRA 4IP7A 4U2ZA 3BAXA 3ZOAA 4YYCA 3NOEA 3WLLA 3M5VA 3OG2A 3N14A 1J18A 6A3HA 4ZOEA 1E0UA 1PXGA 4UFMA 1S3TC 4GD0A 1LG2A 2JEPA 5D03A 2WZHA 3AIWA 1K3UA 2D73A 4G7EB 1UOZA 3UERA 3W1NA 4LBUA 1W1IE 4FF7A 4UMCA 2DT0A 3W28A 1HKMA 1QK0A 3JW7A 4P8WA 3GTXA 1G5AA 2G3IA 4K39A 3RIKA 1Q65A 5E5CA 2WZIA 1HG3A 4ZE4A 1R47A 4ML9A 2OGJA 3NG3A 2W6RA 1S5VA 1SGJA 4HPXA 3GR8A 3F1QA 1I1XA 3EWWA 3G8EA 2X7WA 3RLHA 3GNPA 3F4NA 3POHA 1W3HA 5DX7A 4KETA 3L4WA 4RW3A 1V3MA 4GIAA 4XG1A 3M44A 1CXIA 5I3IA 3HQOA 2XWEA 3TYCA 1KLYA 1FTXA 1WZKA 4EPBC 2JALA 2VVSA 1J96A 2VQTA 3MUIA 4EANA 1IZKA 1GG0A 1H62A 2Z2AA 4X9YA 1RA5A 4H9YA 3UXDA 1Z9AA 5IOBA 1CGXA 5CLTA 2QS8A 4JIRA 3F4DA 3VTRA 3GC5A 4QAIA 1CGYA 3FCPA 1QW9A 2FHBA 4F8XA 2Z1SA 2Z28A 4KFPA 4RR4A 3BOFA 3M0HA 3RLGA 6TAAA 1VYRA 4KS0A 2E5BA 2XHYA 5CZKA 1CB7B 3LBCA 1QVBA 1CENA 4W9TA 1F6PA 2P88A 1W9DM 4KPLA 1RK6A 1Z3NA 2ZZ6A 5BYWA 3WEMA 1X96A 1JUKA 2XISA 4JZ5A 2NQLA 5D9PA 2YLAA 2UZ9A 3C2RA 4L4MA 3KOYA 4QJ5B 1S5NA 4CU6A 1AD1A 3TX9A 1XUZA 2EGZA 4ZO7A 4K2SA 5I77A 3VILA 3T4WA 1YDOA 2J75A 1SO6A 4ZGYA 5AHNA 4X2RA 2G3NA 4BI7A 1K7EA 4B5SA 3VGBA 2PC8A 4I7WA 5C2CA 2P50A 2P0IA 1K9FA 2VR2A 4Q32A 1EBHA 4KEVA 2DH2A 2W4XA 3QOMA 4GJJA 2TYSA 4BHYA 3GXIA 1TTQA 2VI0A 2QPXA 3A12A 2EKCA 2V3FA 1B3WA 3JZEA 3HQ1A 3W2MA 1E6PA 2EJ1A 3MMDA 4QJ3B 4DJFD 4M24A 4IMEA 4UTLA 3THCA 4B2DA 4D8LA 1IF2A 5HNTA 3TEVA 3M6YA 3C6CA 3U5UA 8XIAA 3C5QA 1FWTA 4POCA 1L6SA 3WN6A 4UQDA 3P62A 5CKSA 2QQ6A 4BK9A 3TTYA 1FOBA 3WQEA 3H2EA 4D8ZA 3NUKA 2FZBA 4AVOA 3ECQA 3AIBA 2OSYA 3U2ZA 3UZ5A 1OD8A 2DEPA 4LY4A 1WV2A 2DJLA 2XDFA 1MYRA 1UKSA 2G8ZA 4O11A 1K8YA 3PS7A 4LV9A 3E38A 5AKQA 1XUUA 1H7WA 4GZEA 4CCZA 2CLIA 4J3UA 3E3HA 3S2LA 4ERAA 3UA4A 3KX6A 3GXTA 1YNPA 4GVHA 3NM1A 3P84A 2G37A 1V3IA 2AOSA 3LEPA 1KXTA 1D2KA 3TKFA 2XGZA 4NXKA 2VEGA 4Z1YA 4S38A 2DVUA 3O2LA 4C6DA 4DXXA 4R7JA 3PPFA 2WSYA 3LCFA 2VENA 1JCMP 3CM4A 3MHGA 4H41A 3WO8A 1BKHA 1QK2A 1YDYA 1TVNA 2HSAA 3HFTA 4DJEA 3WH7A 5CGQA 3PZNA 3VNYA 3OEXA 2WAGA 1BYAA 3QPZA 1QO2A 2XH7A 3R8HA 4HPNA 2WMGA 4HNUA 2V0TA 1W31A 3TYAA 2XVGA 4I5RA 4IMAA 1BF2A 4IFRA 5FF3A 1Y5WA 1AQ0A 2PI6A 1MW0A 2QUVA 1QUMA 4PE8A 1H0GA 2B7QA 2Z2UA 4FA3A 4K7VA 4RJEA 2XFYA 4GCXA 1Y5VA 1TWWA 4O8RA 4LS2A 1YADA 3CT7A 1XCWA 5D4YA 3K8LA 2I9EA 4J3WA 5F1UA 4PMZA 5GJPA 1DXEA 1K8XA 4C6OA 3E2SA 2CZFA 4XD5A 2CXEA 1SW3A 5ENLA 5FCZA 1REQA 5G2WA 3C0LA 3SUVA 4AUBA 2VKZG 3QFEA 4B9ZA 4UTFA 4I6KA 3FXYA 1Y5XA 2NLYA 5J8LA 4FNQA 1T40A 4OBRA 3RU6A 2NT0A 5ABEA 1NSJA 3KCLA 2HMCA 5LHEA 4OQVA 1B9ZA 2WYSA 3VNMA 3WD3A 1M53A 2GUYA 1KRBC 2Y7DA 2DW6A 1W2PA 3B0UX 1SFLA 5C70A 2IXUA 1C90A 2J9YA 1FP9A 1HJSA 1E51A 5D2XA 3LHYA 1JZ4A 4AG0A 5CZ0A 4EIVA 3KE0A 3CIXA 2CERA 1UA3A 1XLGA 3SN4A 3WH8A 1BEUA 2W0UA 3EDDA 4JY8A 1R7OA 4DM1A 3M47A 4FX7A 1ITXA 1V6TA 3D0CA 2Y7EA 5D30A 4H8NA 8CGTA 2VC6A 3AROA 1YPIA 4N4PA 1F4HA 4C5ZA 4BQ4A 3M0LA 3RR1A 2FVKA 2PRLA 2YCLA 4AY1A 3C8FA 4AC1X 9XIAA 3GU2A 3GG0A 1VBRA 3VX0A 2WHLA 4E6MA 2NX3A 5CJNA 4MDOA 1XKYA 2QJIA 4QCFA 2FZ8A 3TC3A 3VGEA 4FOKA 3KTSA 3BSMA 1OCBA 4NF7A 5CSSA 3NEHA 3TYDA 2CZVA 2VCCA 4UOQA 2C19A 4HQVA 1M3UA 3B03A 1Z44A 1XIGA 4R9XA 4WHBA 2Y5JA 2PTYA 3ZR4A 4QE4A 1CGUA 1NARA 1PAMA 3CV2A 4EACA 4O14A 2PP3A 2PDXA 2G97A 3BAKA 3SY8A 1UD2A 5E6YA 2QJGA 1HO4A 3H4WA 2FGBA 2JIWA 2WZTA 2B7OA 1DXIA 3KEHA 3EYPA 4HPHA 4R9OA 1OFRA 3KHDA 2I14A 3FEMA 3KVJA 1MZRA 3LGDA 2PDMA 1OFEA 3E0IA 4WR3A 5DT5A 3WCZA 2I5GA 4BS0A 4IMDA 2DT2A 1YKWA 2XJ7A 4XD3A 3U3HA 1YMYA 1XSIA 3NWRA 5BCAA 3N73A 2DSVA 4MF4A 4BWLA 5DCDA 4JICA 4HPJA 3TTOA 3UG3A 5I03A 1OG6A 2E77A 1O12A 3T0TA 3AJXA 1MEIA 1NP2A 1TPC1 1VR6A 4W84A 3VKKA 4Q4QA 2CLEA 1RQEA 3FXGA 5E6ZA 5F4WA 3TDFA 3O6DA 4Q33A 1U33A 4YYFA 3L0KA 3MSYA 4GA8A 4X0VA 3OODA 4AF0B 1KRAC 1XYBA 4BA0A 2E9MA 3IUIA 4FOUA 1XH0A 3ZSTA 3BLDA 1J11A 1XGEA 2ADAA 3VOIA 2FFIA 3LENA 4DXKA 2ZX7A 3QOKA 3AMCA 3TA9A 2DIKA 1TZ7A 2GYIA 3N11A 1NP0A 2QV5A 2YPIA 5EMLA 5CEWA 1CBGA 2G3JA 4GIRA 3OZYA 4EF8A 4K8GA 2V5DA 4QJ1A 5F2IA 1JCYA 3G1VA 3NTYA 4H1ZA 5B7YA 3W02A 1VBJA 3PTKA 4HMCA 3RN6A 1A0CA 4IG2A 5H8PA 4JFVA 4IMGA 3R8GA 1MUWA 4FNRA 3AI0A 2J7HA 1TPH1 3L2IA 3PR2A 5GNZA 3OZMA 3CEPA 1UA7A 3UU0A 4RE3A 3W1LA 3W37A 3L12A 3GH7A 1J9YA 3WEZA 1DJZA 2I9UA 3HGJA 4FB7A 1UJQA 1ME8A 1KW1A 3WMBA 1UR0A 4NZJA 3BW3A 1TKKA 3RPTA 1G69A 5L6UA 3WJZA 4LAUA 1FWEC 4KFOA 2Y8KA 1T99A 3TR2A 3DGRA 5JIWA 1YE6A 3GWQA 1JIBA 1JFXA 4RDVA 3PBMA 1E1CB 4KCWA 3W6MA 3QMSA 4REQA 4PFMA 2V5KA 2V63A 4LY8A 4B92A 4H4IA 1JQXA 2XH4A 3VM5A 3PWIA 3K8MA 3IAQA 5IDIA 4TTGA 4QITA 3TN3A 4F40A 1E43A 1DKWA 1P0BA 2FZNA 2RJGA 1UROA 4HZ8A 4XQ6A 1K9DA 5HBFA 3G77A 3G6LA 2E4TA 4U4MA 1ALDA 1RA0A 4HT3A 3KDOA 1F3WA 3NQCA 4FNSA 3W29A 5M1TA 2NWRA 4PH6A 4D6FA 2VNCA 2WKGA 3AXHA 1V0NA 3H6OA 2V6AA 3P7YA 4MFDA 1CB2A 1Q6LA 4J4KA 3AIQA 3IJ7A 3G1SA 4UZSA 1FUYA 2HNHA 3KS5A 1IIHA 4AIEA 1EGZA 4IIDA 1Q45A 3S2JA 1IWAA 1RVGA 4B4HA 3WF3A 2ZXDA 1Q4WA 5C7VA 3BCFA 3NPWA 1QASA 4GACA 5AFDA 2HJPA 2J24A 3AHTA 4S2CA 1EEXA 3O16A 1J0ZA 3FHAA 2WSKA 1FCQA 1T7LA 3DHPA 3W2UA 3LLFA 1TIMA 2ZADA 4PTMA 3AIUA 2C3ZA 1TJ0A 3SUTA 1Q6OA 4LEQA 2ZZ1A 1MVYA 3P74A 2Y5EA 1ZJHA 5IFPA 4P8XA 1TR9A 3TE9A 5CC5A 1FA2A 1E0WA 2C8NA 2X30A 1VENA 5DMYA 2E1DA 2Q01A 1P0KA 1UQZA 2PGWA 1VFUA 4KMQA 4PTVA 1B3OA 3ITLA 2B31A 2XIJA 3KRSA 3A5VA 1G0CA 3WLQA 1HX0A 4LCSA 4PGLA 4QNEA 1XIMA 3RRAA 3RJXA 3E1F1 4DIAA 3NL2A 4LS0A 5HQLA 1KBJA 1EPXA 5D9NA 3AMGA 2XU2A 1YTKA 3FX4A 1EC8A 3C0SA 5T91A 2XZ9A 4HOXA 2ZRZA 3MI6A 1B3VA 4UTMA 4PUJA 3VUSA 5MKGA 4XZBA 4AB4A 1SZEA 2YZ5A 4JHOA 4HOWA 3FV9A 3GKFA 2CLPA 4WOQA 4HU4A 2F2KA 3N4AA 3UJRA 3OBKA 2BS9A 1OYAA 4CVUA 4H19A 4RZ6A 4IJBA 3QY8A 4R33A 2OKOA 4FLSA 1A5LC 2YXGA 4P7QA 3DKLA 4RX0A 1R3SA 1PZ3A 4UNIA 4MPKA 4W5UA 1XM3A 1VHNA 3LXBA 3BQ6A 5HPCA 1HJUA 1JUEA 3HJEA 2ZE0A 3PJTA 4IUGA 4XSLA 3NURA 1P4CA 2WVSA 1LROA 2NX9A 2PF0A 4DELA 3PNUA 3MZ2A 4JTCA 3B0PA 4GZ7A 3V1HA 1DOSA 1KLZA 4IF2A 2CIPA 4LAMA 1E4MM 1TX0A 4MB3A 4Q7NA 2GQAA 4XAZA 5F2GA 2W9MA 3MUAA 1Q7ZA 4ZR8A 3DC0A 3U2CA 4O1FA 3QHNA 4RZBA 1HL2A 2XN0A 1ZSXA 4HA4A 3QSTA 1PWLA 2VZOA 3UY8A 3ME3A 4EVZA 5C54A 4UTWA 2YR1A 3HBLA 4Y7EA 2PRMA 2OKTA 2WJZA 1NJJA 2WZEA 1QI2A 3DFPA 1R46A 2VUNA 4OU1A 2IPFA 2TSYA 1UD8A 5JQ9A 4BFAA 1NFGA 4NVTA 3VUPA 2D2GA 2GOKA 3ITVA 4FXJA 3U8GA 4P8UA 4JFWA 5BRPA 3QGAC 4F2TA 3ZMRA 4ZQMA 3GUGA 5FKYA 3PVFA 3COTA 1YIXA 1G7VA 1MDLA 1IHIA 1AK5A 1X8FA 2Q8ZA 5A94A 2OYKA 4IQJA 1GVOA 4GFSA 3RPMA 4MB4A 2WW5A 2CZDA 4UQAA 4K8EA 1WDQA 3A4AA 5E93A 5IHSA 1JUBA 3BWWA 2GK1A 1R9XA 4MZ8A 3PSWA 2WPGA 2IQ0A 3CK5A 5ECVA 1ZAIA 4AAJA 1EJXC 4Q8VA 4UTTA 2IMRA 3N9SA 4HNVA 4O4VA 3NA8A 4V1YA 2W62A 2E5CA 2VOTA 1Q6FA 3DFHA 3UWWA 1D7KA 3L21A 2X09A 4YHEA 4D6IA 4Z2IA 3BLPX 3F2DA 1QT1A 3LRMA 4BQ2A 3HTWA 2V5LA 3RCMA 1RLDA 2HWGA 3NQGA 4C7FA 2PCEA 2FLIA 4DAFA 2HRWA 1AMYA 2VC9A 3S2CA 3VD7A 1Q6EA 2CLMA 1TCMA 2QDGA 3VIPA 1X8CA 3WJYA 2CESA 2DIEA 2TAAA 3LDVA 4D8AA 4S3JA 1ZQ5A 3W7DA 5BU6A 3WQWA 4H9XA 2VFFA 1UD4A 2C91A 4LAZA 4ZXLA 3CIWA 1KR1A 2DZAA 1RAKA 3MUZ1 4XKYB 1F3XA 1ZBCA 1D3CA 2QPSA 3UYCA 3LCGA 4ZTXA 5J5RA 4ILSA 4RLIA 3NQDA 3FDKA 4UOJA 4JTEA 1I4NA 3WENA 3ANVA 3R25A 4C7DA 4ATLA 1VKFA 4A3UA 4AC7C 3UJEA 3G0XA 5LNRA 1PKNA 1EJWC 2YCEA 1CXFA 1H7PA 2GZXA 4M5PA 3E5PA 2GDVA 2VWSA 1YW1A 2SFPA 4GJ1A 4MGGA 1OQFA 4JFSA 4XUYA 2DZBA 1WOAA 3LN3A 1E4NA 3STGA 1OEPA 2PDBA 1UW9A 2WC7A 3HG3A 3W75A 1QI4A 1V0MA 4UR9A 3H70A 3EB3A 1TV8A 1A5NC 1UR8A 2HDJA 5GJMA 1RD5A 1H1YA 1LORA 2FHFA 4NRRA 1QBAA 3UVAA 3BO9A 2DT1A 3LM7A 1IEXA 1AJ0A 4DJFC 1U2YA 3PZOA 5KMYA 1CEOA 2TPSA 1V0LA 3IVUA 4DM2A 4LVFA 5E70A 1JZ8A 2C1HA 4YVXA 4ZA0A 1PTGA 3LI1A 4FK9A 3DESA 4BKNA 1U83A 4DO6A 1W3NA 3RXZA 3GXPA 4FSAA 4NL1A 5AC6A 2OEMA 2ZZ4A 1UMLA 3WK2A 4ONVA 4MWAB 1LL6A 2GJLA 2X16A 1F07A 3ZO9A 3WLKX 2PA6A 4BCEA 3CZGA 1ONWA 4B3LA 2ZX9A 4LFYA 3EA1A 3FW6A 4RXFA 2JKAA 2QCDB 4Z2GA 2Q3OA 1RK5A 2Z7KA 1JXJA 1LQAA 1K7XA 2FVLA 4YIWA 2BOEX 3GR4A 3NDYA 4I8YA 1TJRA 1HXJA 3RR4A 4HIBA 4PMXA 4GQRA 2HE5A 4AD3A 1XFBA 1E40A 3H53A 2WLYA 4QCEA 4WCJA 4UMAA 3TQPA 2G4FA 2ANUA 3BLOA 2R24A 1E6SM 1TPFA 1LTDA 2OT0A 5ABFB 1UBPC 4JEQA 3M0VA 5HR6A 1BSIA 1Q5MA 4GY7A 4LUSA 1MW1A 3H4GA 3TYEA 1JI1A 3LLXA 2Z4GA 3CHVA 3GR7A 2BY1A 4F79A 2BY2A 3GH4A 1EJ7L 3AHZA 1FX6A 4ZXOA 4J1OA 3FGCB 5FAJA 1UZHA 1BHGA 4KERA 4YS1A 3CWHA 3SCOA 1DJHA 2VHLA 4BY3A 5CAHA 1RQBA 2G95A 1EC7A 1TTIA 2VFIA 2P53A 1KNWA 3NPVA 4WIWA 4HTBA 5AHFA 3P5YA 4QTGA 1JDDA 2YBVA 5D33A 1ODZA 3W0KA 3CQIA 4DWSB 1HJQA 2PTZA 4KFNA 1BG9A 3WL1A 4LX4A 2CFFA 1XLBA 4Q3MA 3REQB 5I24A 4K37A 3P93A 4R88A 4GNKB 4M82A 1LLWA 3NVDA 4BEUA 1D9EA 1GORA 1GW1A 4GUJA 4J2MA 7ODCA 3MY9A 5I5RA 3GLCA 1WNOA 2GFTA 3MJYA 1KRCC 2J7DA 4JIIX 2ABAA 5CXPA 4QQ3A 3NYDA 1BYCA 3SCNA 2BVTA 3K4AA 1EA0A 4AIUA 3ARPA 4JTTA 3SB0A 2JGQA 3TW7A 2O7SA 2PE4A 4ZB5A 4XTIA 4EKJA 4RNIA 4C6FA 1ECQA 3NNTA 4N9BA 5CPLA 1FHLA 3TIMA 2J62A 4PMJA 3AIVA 1NOWA 3M0JA 4LVGA 4JGDA 4GINA 1IXOA 3WBAA 2ZX6A 1A3WA 3QBUA 2YSWA 1AL8A 2J77A 3ARYA 4GYPC 4TIMA 2QCGA 1YDVA 2Q09A 2HVMA 1I2RA 4DI8A 5I2UA 4DI9A 1OD0A 2OSXA 2IW0A 1JRBA 2BOGX 5A69A 3EWZA 1LUCA 3A4JA 4E5TA 4IX2A 3GNXA 4ZTYA 1OZMA 1NFPA 3KOZA 3J7HA 2YW3A 4HU8A 1JFHA 3KHJA 3LSBA 4ZO6A 4FIRA 5IHRA 3NQ2A 4XB3A 5AZ1A 1XRSA 4JPGA 3RO6A 1DJQA 2XGIA 3M0MA 1GKQA 3OYZA 3VDHA 4O0KA 4R3UA 1C9DA 2VRJA 4EK7A 4DPQA 3QMRA 3URNA 3GVRA 4HD5A 3EB2A 4JX5A 3TSBA 1EF2A 1YXDA 1ZL1A 1EA9C 5BMWA 4F0MA 1Q8AA 2XSXA 3VM7A 3O3RA 3QSRA 4Q8NA 3N4FA 2GLKA 4EPEC 4TU1A 3FSTA 1RR2A 3ZJ7A 1W8GA 4M6QA 1HN1A 1Q63A 4WOZA 1EGMA 1VLWA 3P14A 3CHFA 5G2IA 1FDJA 4G9PA 4AMAA 3BE7A 1DWHM 2B4GA 3HG4A 3KWSA 1E5NA 2PDWA 1Y0EA 1E56A 3GS6A 1ZPTA 3QVQA 5HWJA 3L4XA 4GWEA 4JYDA 1RJPA 2FPVA 1PDZA 1H7NA 2XPKA 1GHRA 4KWSA 5T9BG 4CEXC 1JCJA 3QPEA 4JFUA 4O0QA 4DUXA 2ACRA 1XG3A 1W3KA 3ZVHA 3GXDA 5BWAA 4XAYA 5HR7A 1E6XM 5I3DA 1ITUA 4H7VA 1DWAM 4CN1A 4J3VA 1AL7A 5FF2A 2XVKA 1NU5A 3TONA 3KZSA 3PHAA 4IIBA 4NT0A 5CZSA 1QW8A 4GGBA 3P8IA 3P8JA 4MYXA 3GDTA 2PGRA 1W56A 1NF7A 3N2TA 4Y9AA 3W1QA 1LL4A 4AQLA 2WVTA 3D47A 3AXXA 5M5DA 3HOJA 1QJWA 4HCDA 3RX2A 3KCOA 3SURA 3SECA 4JQ1A 3GAKA 2NV2A 1GEHA 5CPMA 1WYIA 4KRTA 2B7NA 2VFHA 5H8UA 1EIXA 3IARA 4XZNX 1OYBA 3VZYA 5LYRA 1XYZA 1UUOA 3BGGA 3NO5A 4CQAA 1TMQA 3ZT7A 3AUOA 2JFEX 1KV5A 3W23A 5LNUA 1P48A 3S1VA 4NI3A 3MTWA 4WVXA 2CNCA 2ZXAA 4TX9A 3W74A 4JS3A 3GAYA 1BXBA 3W1MA 1Z42A 3QTGA 2VEPA 2YL5A 3RM8A 2OT1A 3W1TA 1CDGA 2H6RA 4OJYA 3WLJA 3OLDA 1O5QA 3B0YA 3RITA 1W9UA 4HSNA 4JXCA 4Y6GA 3NQ8A 5TAOA 3ZWSA 3T2PA 4X60A 4R27A 1JGIA 4ML4A 4MVAA 1FWFC 2XVPA 3WQCA 1KXHA 1EFZA 3NXLA 1FWGC 4CN6A 4M1BA 3L0NA 5CBJA 2VURA 2KX9A 1CPUA 2VDGA 4QDPA 4MNJA 4J35A 1S3HA 2VZSA 2WBKA 4QDMA 3BAWA 5C2XA 4J7RA 1XLMA 4Q8MA 5DXXA 3WD2A 1RP8A 3WLOA 2EEXA 3VOJA 1PHQA 3R8RA 1H3GA 3BANA 3QKZA 5LNSA 4FXSA 1R9ZA 3UFYA 4PCTA 4WF7A 3P60A 3FVMA 1H51A 2QNEA 1QAPA 3IIXA 3BARA 5E0FA 3TW6A 5HNRA 4PCNA 2QMKA 1UR2A 3HGSA 3N3TA 3W26A 2WK2A 2WLZA 1TPDA 5EBAA 4LF2A 1GEQA 3OA3A 1CGWA 1E0TA 4US5A 1TFVA 4RK8A 3IAPA 4YHGA 2DU2A 5HDRA 3NSXA 4PL2A 4I9TA 1XRFA 3LX9A 2JF7A 1DTUA 4H6KA 1N8IA 2DY3A 1VRXA 3HG2A 1DORA 2X1TA 3BC9A 1H0IA 3ES8A 1HKVA 5C9WA 1GYNA 2XUCA 1P1XA 2J8TA 3SSJA 3CAWA 1EOKA 2HTMA 1CLVA 5EKYA 3ALFA 4WSJA 2GGGA 4G1KA 1M5WA 2GJNA 1FDYA 1K9EA 2EPLX 1JPMA 4IQEA 4O1EA 3HIJA 1V4YA 1RXOB 1AZ2A 3UPMA 4L6DA 1C8XA 1EDGA 2OOFA 1VIZA 7TIMA 5KZ6A 5H2ZA 4NZCA 3MMWA 4PTNA 4RCXA 3G1HA 3C0JA 3UWZA 1Z89A 2WCAA 4K8HA 3C3UA 1R87A 1FWBC 5KZDA 4DQWA 1H50A 3UG5A 3V5CA 1NWSA 3BTNA 2Z6IA 2J4GA 4YNGA 1ITQA 3ERPA 1JULA 2BWGA 3CZKA 4HSOA 1ZENA 1YE4A 1IXNA 4OKDA 2KZHA 5EY5A 3T81A 3GNRA 4I7VA 3W7IA 4GPNA 3KBVA 1B4EA 1S5MA 1XYAA 3EKLA 1A5OC 2FHCA 3T7VA 1JCLA 4UTHA 1SUXA 2PGFA 1EKOA 1BKSA 3AO0A 2POZA 3MO4A 1KFKA 4YCPA 3ORWA 3WKZA 3ENLA 5LGXA 2RDTA 1SQ7A 4H6EA 4GQ0A 3A64A 3IGUA 1ZP4A 4PODA 3VDBA 3GIQA 1EBGA 4MAVA 4ZQNA 3KZPA 4GX8A 1D7FA 4A2SA 5I06A 3ITGA 1NF0A 1TRDA 3N9RA 4XTDA 2BHZA 1EZWA 3DHUA 3U57A 3WQ8A 3AAMA 3ZJ8A 4DJDD 5G1MA 4M6PA 1PKLA 3OU8A 1GK8A 3MBFA 5IBXA 4KCUA 4PSRA 2PLMA 2ESCA 3MMUA 4IIGA 4JTJA 4NY2A 4EF9A 3FJ6A 5HJYA 2D2OA 1LZOA 3LG3A 3T09A 1THFD 2ZCGA 3CAKA 3W4RA 3ARQA 3DFOA 3I7RA 3U0HA 1XIHA 1UWUA 3QQ0A 2ZUTA 1KGUA 3ZJKA 1T8QA 3AIEA 1D8WA 1JVNA 5K4ZA 1UHVA 5JBEA 2NXGA 2D1ZA 1X1NA 2PWGA 5K9XA 1KTNA 2FKPA 1DHKA 3LERA 2YOCA 3R6IA 2CLOA 3GD6A 2YCIX 2XYLA 3R5EA 5DRIA 4GXMA 5CAKA 3AYVA 2VYOA 1A0EA 2W79A 3CUJA 4H01A 4TVUA 1V93A 4NP7A 3B8VA 2QDEA 3GXNA 3HGRA 4ICCX 1XDLA 4LRTA 3TC6A 4B5TA 1TVPA 2VX7A 3LI0A 4L4PA 3UVIA 4G7FA 4WDUA 3VO0A 2WCSA 1G7UA 4F2UA 3TMLA 1AJZA 5K3VA 2PFHA 3CZEA 4M1RA 4AVFA 5ABTA 4IFKA 2YCLB 4IJRA 1GQKA 1NDWA 3JUGA 4OBSA 4B16A 3UG4A 5H8MA 4CNOA 3TU9A 2VFDA 4FX6M 3FOKA 3Q4DA 3S42A 3H55A 1FH8A 2VJXA 3GNNA 4PEEA 3F03K 3V5FA 4AFYA 3MBDA 2P3EA 3DU0A 2FPYA 3WQVA 1VBHA 4OECA 1JNEA 2Q8XA 3E02A 1VPQA 2HK0A 2XSAA 3WQ6A 1S2TA 1TV7A 1J0YA 3KP1A 2VVNA 1WBHA 4Y96A 3LYEA 1GOQA 2WM1A 4OV4A 3QH2A 4DXVA 1ICPA 7XIMA 4HCLA 4GVGA 1KB3A 4H83A 5EBUA 1F8MA 4AZIA 3ARXA 3BG5A 3LHTA 4MWAC 3SY5A 4UFLA 4IGNA 3HV8A 3NL5A 2C16A 3DH7A 5LA1A 5AHMA 2G5WA 3ZSSA 1H11A 3D3AA 3MWCA 1E6ZA 1RSCA 3UWEA 4UNKA 1G4SA 4C6NA 3TZFA 4A29A 1RALA 1W8SA 1MQQA 3EPNA 4AEOA 3DFNA 3NQMA 3QRHA 2RUSA 1R9YA 2OTDA 5HJXA 1YEYA 3RM4A 3ZM8A 2C6QA 3CC1A 5FL1A 4A4AA 3BPWA 3DG3A 2ZUWA 2FB3A 4QSFA 4NZ3A 4MFEA 3PSVA 3TWAA 5K2ZA 2D24A 4JHMA 1AA1B 1UH4A 4KEZA 2IS7A 3R94A 4ENLA 3GVVA 4MY8A 4CD8A 3ELFA 4ATWA 1DJNA 2X7VA 4F9DA 1XSKA 9RUBA 2QPUA 4LC6A 3E0FA 4DUVA 1UR4A 3G2GA 4YWIA 3A13A 3O9NA 3W1AA 2QZRA 3KBWA 4H9UA 4F0LA 2OLAA 1CYGA 1ISWA 3NPXA 4IZGA 2QMJA 3IIVA 1WA3A 3SGGA 3RMJA 4V33A 4JNMA 3N29A 4OOZA 2EPMX 1GJWA 3XIMA 3GDBA 3LHZA 4B91A 1FQ0A 4C6CA 3PBUA 2NV1A 3ITXA 2DQWA 1MUMA 4G56A 3SADA 1A3HA 3E2RA 2YXOA 4NZ5A 5BMXA 3EDEA 4DWSC 5I3HA 4IG2B 2O9OA 1WCGA 1X7FA 3MCNA 2QAPA 2C0AA 3DKJA 3KS6A 4XAFA 1J0IA 1AVAA 4ZCWA 4D6EA 3NDZA 2WNZA 5G4WA 4GIEA 1CXHA 1VB9A 3AICA 4JCMA 2ISVA 5FESA 1WE5A 2I1OA 3TA6A 5LGZA 1LLZA 2WSRA 1WX0A 1VJSA 1I8JA 4QAWA 2XVLA 4JN6A 2V2DA 1LYXA 1DTNA 1JRCA 1QNOA 1MW2A 8XIMA 3NQFA 3CL6A 2QCEA 3ZZ1A 1NELA 1WPCA 2GUBA 1T6MA 3OO2A 5FSEC 3GM8A 4C1NB 1R3WA 3FEQA 3N34A 1R0MA 3V0SA 2FZMA 2IPJA 1W1ZA 2Y63A 1WXYA 2OOGA 3FN9A 2VWTA 3MUY1 4QG8A 4H9TA 2WJFA 1L6GA 3W70A 1KFBA 3L4TA 3UNDA 3F2CA 2UY2A 3A23A 1EJUC 3EAUA 1DL3A 1XL9A 4XIMA 4AHOA 3I7SA 1KA9F 2RGLA 1ELSA 4C65A 1GNXA 2NQHA 1MSSA 3VVGA 1NM9A 3PK7A 3LK6A 1V03A 2CBVA 1LRQA 4P8VA 2Z1BA 4FS9A 4RZ5A 3EB4A 1F4AA 1JF5A 1MRAA 3W7EA 5KETA 4WY0B 1OGGA 3STCA 2G50A 5TQLA 4AZCB 2OELA 1YXCA 3WLPA 3VFLA 2FDMA 4LUIA 1OBAA 1TTPA 3AHXA 1R2SA 2ACQA 2FDSA 4TUFA 4Z2KA 3H2AA 3IJIA 1EP1A 2J7FA 1R8LA 4A8IA 3WUEA 5C9ZA 1B31A 1ICQA 3QGVA 3CAQA 1XI3A 3EA3A 2WMJA 5CQ1A 3WYZA 4WLCA 5FOOA 1SO5A 3LUTA 3WEOA 2V8ZA 3O6YX 4QG6A 3BLLA 2Y1HA 5A95A 3L5MA 1GHSA 3QYSA 3IEBA 4AIBA 3TYBA 2YDAA 1HIZA 5LIYX 1VJZA 2E5DA 3IJ9A 1QNQA 3GK0A 1XPGA 3F2BA 1Y8BA 4KKXA 1MUCA 2VDIA 2VX6A 4M7SA 4E3TA 3L4YA 2BASA 4NHVA 2NXHA 5I7GA 3TYZA 3KP0A 3PZMA 3TJ4A 4E8DA 2YDSA 1W17A 1ZZMA 1VFHA 4CNUA 4UQEA 5KTLA 4O1BA 3V36A 1JCTA 5JH1A 3EPMA 5DCBA 4KRZA 4F4RA 4KW2A 3WD1A 4IWWA 3B40A 3MVTA 1DP0A 2DIJA 2ZA1A 3C2FA 4UBPC 4HPGA 1WKFA 4NSBA 3NFUA 4WEVX 4ICMA 4YMZA 2YGYA 3TUUA 3ANYA 2PDKA 2AKZA 4DEFA 3DYOA 4FO4A 1M7PA 5D2WA 1S2WA 3WBEA 4FXRA 2FB2A 4UZUA 5G1YA 4AHQA 5CH9A 4MM1A 4Y9PA 7A3HA 5T26A 3W22A 1TPWA 2I16A 1YNQA 5HAOA 3S9YA 4XX6A 1TZZA 3QHMA 3TQVA 4P7RA 4LJ3A 1CTNA 1CCWB 4LAKA 1Q13A 3CL7A 1I2NA 3CUZA 2DZPA 1BXNA 4JTSA 1SVDA 2WB5A 1E0VA 1Z48A 1OC7A 3CV7A 4TV6A 2J66A 1H7OA 4C1LA 4X22A 1YDNA 1KV8A 4W86A 1TPB1 2H9AA 4JKLA 2RGMA 5FIPA 4QSHA 2VC7A 2W92A 1WKDA 3R43A 2GGHA 3VCNA 1RH9A 3SUWA 2OZTA 3K2GA 4HSHA 1US2A 1QOXA 1AH0A 3EXTA 3LHVA 3W1XA 4GC3A 2OU4A 3DX5A 3G1XA 4B15A 1TMLA 5XINA 1NVMA 2QULA 4LBSA 5EMYA 1J0JA 3VIOA 1UZ4A 3OVPA 3KRZA 3BZGA 3WQGA 3UJFA 3W7GA 4YN5A 4MJZA 3DHFA 4OVXA 2ZRVA 4M7TA 2QCHA 3DYPA 1X6UA 1ECEA 5D37A 3MKCA 1XDJA 3UR7A 1AW1A 3AOFA 1ISXA 2IPGA 3KRUA 2PU0A 1X6LA 4Q4RA 2X42A 4ZQPA 2A7RA 1IEQA 1FCBA 1UC4A 2FGZA 1KWGA 1O66A 3LV5A 4A8RA 4NJIA 4EPDC 4RW5A 4TO8A 2R1MA 4JL2A 5I02A 1XKJA 2C71A 5HA7A 1XGDA 4A35A 5ABHA 3UZJA 2IKHA 1TVLA 4E2BA 5AC5A 3N2BA 3AYRA 4XBKA 2Z2BA 1JGMA 4ZB2A 2OYMA 3FSUA 1VEMA 4O1AA 5C55A 3MP3A 4UMBA 3VCCA 4IISA 4PMQA 2YFNA 2BOFX 5A6MA 3VOFA 3G1RA 3E74A 4AWEA 2VQUA 3IACA 3OGVA 2XFFA 3BICA 1EO5A 4GI4A 2OWWA 1BWLA 4IGSA 5BWFA 4N9EA 1GTHA 1WDPA 3EOEA 1MFUA 5BRBA 1G67A 3QTPA 3MKVA 3TW9A 2DSZA 1DWFM 1I60A 3B3DA 1OFBA 2Y61A 3EKGA 4OFCA 3OBAA 1BVNP 4JNZA 2NSOA 3UXAA 1QTWA 3UYIA 4EE9A 4AWSA 4K6AA 4O4WA 4LYRA 3EEGA 1C7TA 3UEQA 2DZTA 1VAHA 4AXNA 3M41A 3V7PA 2XSBA 4LUYA 3U48A 3A4XA 4M0XA 1EC9A 3E2VA 3GU9A 4A6GA 4DBSA 4PUMA 4Q8QA 1XRTA 1JL8A 3D5HA 1NDYA 1SMAA 1XH2A 3S2MA 4AZBA 3FKRA 1MW3A 1J0HA 2A3CA 1UZ1A 1ADOA 1RPKA 3SDOA 3N2OA 4BQ3A 3ABQA 1DJYA 1RPXA 4L1XA 3QV9A 1Z7AA 4YJ5A 2PDFA 4C6MA 1OGBA 2QR6A 3FIGA 1C29A 4EAYA 1LJYA 2G3FA 4JR5A 3U7BA 1DIEA 3WH6A 3LMZA 3CZLA 1XQKA 2Z00A 3S9IA 3GH5A 2CHRA 2W67A 1E72M 1V0KA 2IKGA 2OEJA 3PJUA 1YNYA 5C71A 3BAJA 1C92A 2GGEA 2IPWA 2FZDA 3GZAA 1V3LA 3AXMA 2TMDA 3OLEA 1OSEA 1RJRA 1L6YA 3T9PA 1ME9A 2ZRXA 4NNAA 4RNJA 1G6CA 2BTMA 1O68A 3BCJA 4HOZA 2PDIA 3W7KA 4O1CA 1T96A 4KIRA 4S3AA 1YXYA 4P61A 1R3RA 1DHPA 1P0DA 2O4MA 4QJ4B 3D6NA 5IXEA 4YVVA 1IEVA 2NZLA 3W1RA 3IV3A 1V51A 1BSLA 1ZJIA 2NUXA 1XLCA 1JYXA 4OGZA 4IIEA 1DBTA 2D0HA 3U4FA 1QU4A 1A53A 3H4XA 2HVNA 3CH0A 4ACZA 4MUZA 1JI2A 3E0LA 3UXIA 3GKAA 4JQ4A 3M0ZA 4M56A 3VKDA 4EWND 3IK2A 3SCUA 3UT0A 3DAQA 3D3FA 4C5YA 1HO1A 2ZFAA 4WSHA 4GNJA 1E55A 3KFTA 4TR9A 3BJFA 4LBRA 2ACSA 5FJTA 2C79A 2PP0A 1XDMA 1H41A 4NQ1A 5HATA 3VGDA 3QY7A 3SQMA 3S83A 1QHOA 4WGXA 5FA5A 3AMKA 3VC5A 4AH7A 5U7SA 4NU7A 5IDZA 5K4XA 1VPYA 2W5FA 4W8BA 3W73A 1W32A 3T2QA 1F73A 2ZRUA 1PX4A 3G3MA 3KUMA 3EDKA 4LUSB 1I2QA 3I6TA 2PTDA 4LCRA 3IV8A 3ITCA 3WUBA 1XCXA 2Z1XA 4C7GA 2E28A 5CSRA 3EKZA 3L5AA 2PWHA 2FYMA 3WFAA 2VP8A 1TE1A 4OT7A 1G4EA 3SCSA 3T0AA 1VYSX 1Q6CA 2VM8A 5I78A 2WV8A 1TWDA 4FIQA 1PIGA 2HPIA 1V7YA 3V16A 5LKYA 1EX1A 1HGYA 3H7VA 1F05A 3PNZA 1FKWA 5EA9A 1WZLA 4AYGA 4L9YA 4I9AA 5HINA 4W8AA 1JQVA 4RE2A 4GG9A 3QW3A 4DJDC 4ERIA 1FHDA 1O5RA 2X0YA 4QFUA 1EF3A 4O16A 3DENA 2GPTA 2NX1A 1TELA 3UD6A 2YL6A 3EOOA 3S2NA 3SN0A 4DJFA 1R2TA 5K9CA 3GZ3A 3L67A 4L64A 5C9UA 1GPFA 3R7MA 4UFKA 4HA0A 3D46A 2YKKA 2W63A 3CUFA 1HVXA 4PTXA 2YXXA 1EUAA 4ZSUA 3G1YA 3A9IA 4HMEA 3S6DA 4D1JA 3W2NA 4BWLC 1JR1A 1JYNA 2YYUA 1TR1A 2HPMA 1S5TA 1TJ1A 2XIMA 4MJ2A 3T44A 3UXLA 2YCJA 1CZ1A 5TBOA 6ENLA 1R3TA 2PDCA 1QHPA 2YIHA 2QKFA 1G4PA 3A21A 1LDCA 4HYRA 1TV5A 1L2UA 4Q6JA 1OCNA 4MHBA 3GFXA 1J01A 1EXPA 3CEUA 1A80A 2F7FA 4MKVA 4NYUA 3IIOA 4H2HA 1LUCB 1FWHC 2DT3A 1L9WA 3MC5A 3GDRA 4GKLA 1KXVA 3Q67A 3UY7A 5I3GA 7CGTA 1H49A 1GWJA 1PKYA 1W37A 2Y6ZA 1PDYA 4W7WA 4BI6A 4QE5A 3CBWA 1VH7A 4CLMA 4PYSA 1V08A 2PAJA 3C4UA 4AZ5A 4M8UA 4A3RA 1PZ0A 3WMCA 2AAMA 2QJHA 2W61A 4LEFA 4JKKA 4YTTA 3WDQA 3W2KA 4UIOA 3GFYA 4V28A 3SQLA 2OGYA 3MI2A 3UCCA 3WLMA 1VEPA 1H61A 4HA1A 1M04A 1DWGM 1XICA 1C93A 3W2JA 1HFBA 4IPIA 1XLHA 1ONXA 3QJAA 5LXEA 4UR7A 5F2MA 3S5OA 4Q6XA 5CZJA 1OM0A 3PZ9A 1KC7A 2VOMA 2YCKX 1YX1A 2WZMA 2ISDA 4LYKA 1RP9A 4QE1A 3N2MA 2E67A 3G6MA 3CYVA 3T0CA 1CGTA 2Q3RA 4N42A 3HV9A 4YTQA 3G0SA 2FVMA 3DBPA 1BTMA 4JDYA 1VBGA 1TQJA 1V02E 1DJGA 1ZS2A 4I5XA 4NNBA 3PP7A 4CNNA 4Z1CA 1MXDA 5CC7A 1LQ2A 1JEZA 3FYOA 1W1B1 3BK0A 3PANA 3H2CA 1LG1A 5EPDA 5BXRA 2OZ0A 4J40A 2E9LA 5A6KA 1M03A 3GRIA 4WKAA 5B7ZA 1D8CA 2F2HA 5FEWA 5IFTA 4U5KA 1PVNA 3KCJA 2E7FA 1WBJA 3R12A 2X2GA 2Y24A 3FKKA 2EG6A 3V18A 2XINA 3P0WA 4C91A 3OPSA 4LVAA 2XIOA 2DZWA 4D6GA 5A6BD 2PDLA 3OGSA 3M43A 3FS2A 2YFOA 4R34A 1SO3A 1X7IA 3GC4A 4AF0A 4JTFA 4ZQOA 1GQLA 1QCWA 2XN1A 2GQ9A 5J5DA 1NEYA 2A4AA 3WDHA 3B06A 1RD6A 4MB1A 4RL3A 1BLIA 1LT7A 1Q7QA 5M03A 3S6TA 2XIBA 5I09A 2HS8A 4Q8WA 1E9YB 1TJPA 3MPGA 2EPHA 2REQA 2DDXA 4NZ4A 3A3WA 4ZO8A 4AZGA 3UR2A 1VJIA 4IOTA 2BHUA 4ZQRA 3K1DA 3RLUA 1NIUA 1CX9A 4V2XA 2H8ZA 1GKPA 3W86A 2A6LA 4F9JA 2D0GA 3QZEA 4EXAA 3VNIA 4GX9A 4HJFA 4DF1A 1SZGA 1A50A 1XHGA 2A3AA 2PDYA 1Q8JA 3EWDA 1K8CA 1QATA 1BFNA 3SRDA 2P8BA 4PEKA 2Z0IA 3AQUA 3SCRA 1YPFA 3NQVA 2GL5A 2Z27A 1UC5A 1IQ8A 5G4EA 3ICJA 2AGTA 1XBYA 3OIHA 3RM9A 5DY2A 3WQOA 1KBBA 1GQIA 4MWAE 4YPJA 2QIIA 2MANA 1CI1A 3VPLA 1F61A 3L68A 2GDUA 3O63A 1OINA 1GQJA 1U5JA 3NQEA 1CXKA 3G5EA 5HULA 3KXQA 2VR4A 1XLLA 4F2BA 1DPMA 3CO8A 2I57A 2FH8A 3N2CA 2W91A 2X40A 1EYEA 1XFCA 4AD0A 1Z41A 3H7RA 3B8SA 2FGLA 5AC4A 5GNXA 1VFLA 1JDCA 4KF1A 5HNUA 4M29A 1AW5A 2CWXA 4HA3A 4S23A 3HMCA 1O95A 4C1KA 1Q7MA 3JR2A 3IUDA 3AXKA 2X1RA 2E1WA 3LTSA 4IGHA 3PBVA 4XIAA 1K77A 3Q37A 4O1DA 3DI0A 4UTWC 7REQA 1FXPA 3SRFA 4U3AA 2R91A 2V2HA 3VOGA 4OZOA 2VFEA 2Y62A 3O0FA 3PN8A 1E0XA 1VQTA 4O8AA 2WQDA 2O9TA 3WLNA 1LOQA 2WPBA 3HQPA 4D6DA 1Q4NX 1B3XA 3PUDA 2FPTA 2ZX5A 1SW7A 4AWTA 4G5DA 4UOZA 2EPKX 2W27A 4A3YA 1S5WA 3N04A 4A21A 2PZ0A 4D6JA 1AUSL 1K8ZA 4JYEA 1F5ZA 1CLXA 1TCDA 3THQA 4XZ9A 1FXQA 4AYSA 5DBUA 1F8IA 4ATDA 2E09A 2F6KA 5CBBA 1GYLA 3BOLA 4LTSA 3TNBA 3W88A 4UTTC 1S46A 3DEQA 3W7PA 3N6JA 1VLIA 2ISSA 2D23A 2XH0A 2FMNA 1XF0A 3R11A 1FWWA 1JYWA 1QWGA 3EBVA 4KESA 3SCPA 1B30A 1OVDA 1HTIA 5CPSA 4RPPA 1VYPX 4IM4A 3EX2A 1YTEA 4IXXA 3CTTA 5AYBA 3UZYA 4M51A 2YL8A 1XQLA 1QXLA 4HN8A 1O5XA 2O7QA 2X0HA 4Q4PA 5CC3A 2ZZ2A 3UA3A 1AH3A 1SZRA 1KWKA 1N2VA 3I68A 1W1A1 4JTRA 3T07A 1Q6GA 1MXSA 5LXXA 1QW7A 1J6PA 1UKPA 5DF0A 2HE8A 2PP1A 4WKFA 3PB0A 2ZZ3A 1FH7A 3O05A 3W7OA 1WP6A 1ZB5A 2ZE3A 3K8KA 1F6KA 2BP1A 4A22A 4XBJA 3GQYA 4JCLA 3GNDA 4MOZA 2YB1A 3AU2A 3C86A 1VEOA 3PZIA 3K13A 5DXYA 1GKRA 6REQA 1Z8AA 3QXBA 3GSMA 3S1WA 1J2BA 3AHVA 3MV11 3PTMA 5HK4A 3OGRA 3IVSA 4FF5A 3U5YA 2AL2B 1BRLA 4HHMA 1TUFA 1Q3NA 3N15A 2Q8LA 3GTIA 3RG6A 4MSSA 4QIUA 4Q7BA 3BSGA 3UR5A 5I3JA 2P1FA 3BLIA 3BG3A 1E6QM 3EX3A 5DY3A 5EMMA 2NVAA 1VS1A 4AZHA 3KTXA 1TPEA 4ALDA 3CL8A 3WQDA 2PDGA 1W91A 2YYTA 4XUGA 5G5IA 2FJUB 4TMCA 4IFKB 3ZWTA 1BPLB 3ITYA 3NYZA 4ZEPA 2JEQA 3EX1A 3WJWA 2D2JA 3PAJA 1XCFA 2O4QA 3NXFA 1Z6KA 3LXAA 1J4EA 3AFBA 4RDYA 2GJPA 3FA3A 1K03A 3WFLA 1ONRA 3LHWA 5AYIA 3HF3A 2JKEA 4PB4A 4BF5A 1A5BA 1SJAA 4JD4A 3PZQA 2OQYA 2DV0A 3THDA 1X38A 5LSMA 1HGWA 3PPGA 1RLCL 1R5YA 5CG0A 2NV9A 1VCFA 2C18A 3RMEA 1VF8A 3PFMA 4DUWA 2R14A 1A5KC 4O15A 2ZTJA 3MSDA 2GUUA 4OUIA 4XAGA 4Y9MA 4P2VA 3G0UA 1V3JA 1PX8A 3OHMB 3VYLA 1L8PA 3BLEA 4PUWA 3JRKA 2FFCA 2BY3A 2H8XA 3THUA 3K30A 1G01A 3NO3A 3CPRA 3FA4A 2GDQA 2EPOA 3RILA 5AHIA 5FI8A 1VFTA 4UFJA 4QM1A 1PKMA 4D1IA 2Z6JA 5EMUA 2D22A 5A8GA 2VD9A 1VD6A 3SEPA 2WWCA 2PDJA 3PUEA 4XKYA 1GJUA 3ZR5A 3KRBA 2PLCA 3DDMA 5EL1A 1RHCA 3I7QA 2PD9A 1O1ZA 1F3TA 3A9BA 1KBLA 1S2AA 3LPOA 1NY1A 4Z1AA 2UWFA 3AXIA 3PY2A 3W24A 3IS4A 1RZMA 4XKMA 3UZWA 3BG9A 4ZOBA 3GVGA 1ESWA 5CBIA 1M7JA 6CGTA 2PDUA 1QBBA 4AZ7A 1PEZA 3BVJA 1B0IA 5FJIA 4Y90A 3E6EA 5BRQA 4Y9OA 2OPJA 1UPPA 4JHZA 4UTKA 1LCOA 2C14A 5GJNA 1KTCA 4C90A 4IPPA 1UIOA 3BSHA 1XW8A 2CKSA 3EWXA 2A2IA 1VHCA 3W7RA 1TWSA 1HL8A 1SPQA 1OX6A 3Q65A 3EMZA 2ALRA 4IUOA 1CW2A 3RCYA 2VX5A 3GG7A 1GVSA 1AW2A 3SSZA 1W5QA 3VABA 4KWVA 3WG6A 1HJXA 1A49A 2A3EA 1CWYA 4I7UA 3TFXA 3VIFA 3W1UA 2DZVA 4CD7A 2ZYFA 5CSYA 1S39A 2P5NA 3SZ8A 1DYSA 3B04A 3W6LA 3ZFHA 3MDUA 4RDWA 5CJ5A 3TJXA 3W82A 3OG3A 2QIWA 3N13A 1AQMA 5HWNA 1B3ZA 2V5BA 1XBZA 4HCHA 2WWDA 3SJ3A 4XWUA 5A2AA 4HK5A 4FOJA 4MIMA 4IPJA 4Q8PA 4MB5A 3H23A 2OWCA 3W25A 4V15A 4AEEA 4TVCA 1LLOA 3W72A 4B5NA 2QUUA 3M5ZA 2Z26A 1UQYA 4PZVA 3NEVA 3R0UA 3OYXA 1VGAA 1FBAA 4L5ZA 1BF6A 2ISFA 1R30A 1I2PA 1KTBA 4C6IA 1J6OA 4K3ZA 1QI5A 2QUMA 1J5TA 3L4VA 1ZBVA 5BZAA 1F9CA 2UY3A 3V4BA 1AZ1A 4LSBA 1JJKA 2XVNA 4LALA 2DJXA 1E6NA 1TUXA 3BUVA 3CS2A 4C6QA 3O07A 1P7TB 1W1YA 4AY8A 3SN1A 3I4KA 2ZDRA 2CZ5A 4DF0A 2JE8A 1UMYA 3JS3A 5E0CA 4KQNA 1JDAA 1BGGA 4L7ZA 2UY4A 3KOFA 5DEZA 4AIOA 1K4HA 4PRRA 4H6QA 3OLGA 4GYKA 3LOTA 3T2OA 5ABFA 1JDEA 3G1DA 4E4UA 1JD9A 1E5JA 4KEUA 1WO2A 4JIHA 2WCGA 4NAEB 2XM1A 3GIYA 4IP4A 3VMNA 8TIMA 3H2NA 4ADSA 3UG8A 4FXFA 1OFPA 2E6FA 5I07A 1JYVA 1M9HA 5SWUA 3O6AA 3E9AA 2X41A 1DXFA 4ASTA 4HTYA 3TN5A 1E15A 2V82A 3SCQA 1KM5A 1TZ9A 4DAIA 5I3KA 4M81A 2ZTKA 4H3DA 5TIMA 2DH3A 3VE7A 4PMOA 2PMQA 3W71A 2C0HA 2PPGA 3II1A 4EXBA 3LGEA 1O6IA 5JBDA 4PC8A 3MANA 3MW7A 1EO7A 2P0OA 4R5EA 2VRKA 3KLKA 5AZ0A 5CC6A 3U2OA 1X97A 5ECUA 1QFEA 3FVDA 3M5XA 3RHGA 3T55A 3ZQ9A 3TQ0A 1JZ7A 3MHFA 1DQWA 1EJVC 3AZTA 2DQXA 5D9OA 3FAWA 4KWWA 4OV9A 3B9DA 2CITA 4U10A 4GQQA 2F8QA 4QRNA 4X9SA 3W7CA 3POCA 4I5UA 3CO4A 1V7AA