4HMNA

Crystal structure of human 17beta-hydroxysteroid dehydrogenase type 5 in complex with (4-(4-chlorophenyl)piperazin-1-yl)(morpholino)methanone (24)
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
318
structure length
306
Chain Sequence
QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C3
publication title Morpholylureas are a new class of potent and selective inhibitors of the type 5 17-beta-hydroxysteroid dehydrogenase (AKR1C3).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 117
structure length 306
sequence length 318
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2012-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4hmnA00
4GACA 3CMFA 3H4GA 2ACQA 1OG6A 1JEZA 4WRHA 3VXGA 3BUVA 5AZ1A 1US0A 1T40A 3CASA 5DANA 4NKCA 1T41A 4JQ3A 3F7JA 2DUXA 5JH2A 1AFSA 5JH1A 3GHSA 4JQAA 3M0IA 4PR4A 2BGQA 1Z89A 3CV6A 4ICCX 4GABA 1RY0A 4FAMA 1MZRA 2J8TA 3LN3A 4PUWA 3ONCA 4F40A 1Z9AA 4G5DA 2WZTA 4XZNX 4YVVA 4XVEA 2IQ0A 3R8GA 3V0TA 4JTRA 5AZ0A 4HBKA 2IPJA 3LENA 4IGSA 2HVOA 4EXAA 1AZ1A 3UGRA 4YVXA 3UG8A 3U2CA 2ACUA 3KRBA 3MB9A 4XZHA 1AH3A 2PDGA 3ERPA 3M4HA 1C9WA 1RALA 3WCZA 4MHBA 4DBSA 2IKIA 2F2KA 1QWKA 2PDXA 3NTYA 1UR3M 3R94A 1IEIA 2IKGA 3LQLA 1MRQA 5LIKX 2IKHA 1HQTA 2IS7A 3BURA 2BGSA 3UFYA 4XZIA 3C3UA 3LZ5A 2I16A 4JTQA 1M9HA 4HMNA 2PDNA 4FA3A 2R24A 3R7MA 5C7HA 3V35A 3UWEA 4LB4A 3RX3A 4GQGA 5LIYX 1R38A 4JIHA 1AH4A 2QXWA 2INZA 4XO7A 2FGBA 1X98A 1Z8AA 3O3RA 3R6IA 1K8CA 3RX2A 3V36A 1Q13A 1AH0A 3ONBA 2FZDA 2HDJA 2F38A 5LIWX 4ASTA 3WBWA 1ADSA 4YU1A 2ALRA 1AZ2A 2PD9A 2PDCA 1XJBA 4GA8A 3V0UA 4JQ4A 4PMJA 4LAZA 3N6QA 2C91A 1YNQA 3DOPA 1VP5A 2PDPA 3B3DA 4JTAA 1QRQA 4PRTA 4FALA 4GIEA 4LBSA 2INEA 4DZ5A 3D3FA 3COTA 3EB4A 3O0KA 2PZNA 3Q67A 3CAQA 4JTCA 2AGTA 3UZWA 4H7CA 1ZSXA 5M2FX 2IPGA 3WBYA 2IKJA 4DBUA 1A80A 3H7RA 4JQ1A 4WDWA 4XZMX 1MI3A 2NVCA 3GUGA 1XF0A 3H7UA 2PDMA 1PZ1A 4OTKA 2P5NA 1IHIA 1YNPA 3P2VA 2FZ8A 3UZZA 2PEVA 4WEVX 1S1RA 2I17A 4RPQA 4DBWA 4FZIA 3BV7A 1S2AA 4XAPA 4GQ0A 4XZLX 2PDQA 1EF3A 2FZ9A 2PDBA 4WDUA 1VBJA 3GHRA 2PDJA 3CV7A 3UZYA 1PWLA 1S1PA 2CLPA 3R58A 3LZ3A 3FJNA 4QX4A 1YE4A 4WDTA 5KETA 4I5XA 2PDWA 3UZXA 3G5EA 4L1WA 4LBRA 4JQ2A 4JIRA 3WBXA 2HEJA 3LEPA 2HE8A 4Q3MA 3BCJA 5LIXX 2ACSA 1RY8A 1LQAA 3EAUA 3FX4A 2DUZA 4XO6A 3RX4A 3LNMA 3UP8A 1J96A 1Z3NA 4QBXA 2IPWA 1ZQ5A 4H8NA 2WZMA 3LQGA 1EL3A 4GCAA 3EB3A 1GVEA 1LWIA 2PDLA 3N2TA 2PF8A 2ACRA 1EXBA 4YVPA 5HNTA 2HE5A 3DN5A 4R9OA 5HNUA 4WGHA 1HW6A 3M64A 4PUUA 1X97A 3LBOA 1Q5MA 3G1RA 2IQDA 2VDGA 4YS1A 2HV5A 3S3GA 2A79A 2FVLA 4IJCA 1S2CA 3V0SA 4XVDA 2FZBA 3MC5A 2PFHA 4Q7BA 3T42A 2PDUA 2PDYA 3LUTA 1SM9A 3QKZA 2HVNA 3GHTA 4QR6A 1PYFA 4AUBA 4IJRA 2PDKA 1EKOA 2PDFA 3WG6A 4LAUA 3GHUA 4ZFCA 4QXIA 3CAVA 3R43A 5HA7A 2R9RA 2PDIA 3LD5A 4JTDA 1ZGDA 1YE6A 2IPFA 1FRBA 3R8HA 4JIIX 1XGDA 2PDHA 4L1XA 4LB3A 1PWMA 4PRRA 2BP1A 3Q65A 3UYIA 5LIUX 2ISFA 4WDXA 1PZ0A 2NVDA 1X96A 1ZUAX 2PD5A 4EXBA 4XK2A 2DV0A
chains in the Genus database with same CATH superfamily
4PMZA 2GUUA 2P8CA 3MI3A 4TMBA 2WW5A 2A3EA 3TJIA 2VZSA 3AI0A 4WJ8A 1CGUA 5T8GA 5AZ1A 2VL4A 4R34A 2G96A 4ZL1A 3POCA 1T40A 5LSMA 1T41A 3RPDA 1KWGA 2F2HA 5JH2A 1TJ0A 2XINA 3AROA 1GOIA 2WNQA 4Y6GA 3S1GA 1O5KA 4HSNA 3WF0A 2XWDA 4JN8A 4WGXA 2V81A 4MDOA 1DXFA 1C8VA 2PMQA 3T4WA 4O53A 5EBUA 4XVEA 3W1TA 4ZE4A 4ZOEA 2WBGA 3VE9A 1UUQA 3ITLA 1R47A 3GR4A 3K30A 2BXZA 5K9XA 1P6CA 2A7PA 1U1JA 1XFBA 3QW3A 3W29A 2P50A 4KCUA 1JRCA 4US5D 1SSGA 1X39A 4X3ZA 4XX6A 1V6TA 1XQLA 4P8VA 2J6XA 2O7SA 4KFNA 3UZ5A 3ZR6A 3IS4A 3QHOA 4DAFA 2A21A 3CLMA 3LHVA 2R6OA 5T9BG 3GDKA 2Y8VA 4J3ZA 1XM3A 5TIMA 1KO0A 2WVTA 4HU3A 3W1UA 2YW3A 4CQDA 2YKKA 2VOTA 1A49A 1TPFA 3H2FA 1OC5A 1U1UA 4FI4A 2PRLA 3C3UA 3EX6A 3HMCA 3PG9A 4KMQA 3CAWA 4HNUA 4HMCA 3CPGA 4HZ7A 1XYAA 3R7MA 1W2VA 1BF6A 4LNYA 3B9EA 3EWYA 3H7VA 3RX3A 5DY3A 1J93A 4NJGA 1HVQA 4S3JA 4GI8A 1ZFJA 3L4YA 2GQAA 2VTFA 3SURA 2XGBA 3RX2A 4JGDA 7XIMA 4UMCA 2ADAA 2ZTJA 4EACA 1XS2A 2J78A 4GI4A 1XRFA 2F38A 5ABFA 2OGYA 1ZB5A 1XIDA 4ERIA 2DZXA 1MMFA 1RBAA 1W5NA 1AZ2A 1NARA 1T8QA 3NQ7A 1F05A 4I7UA 3T8LA 3SQLA 1OJXA 1LG1A 4I9AA 4M1BA 1NJJA 5LKYA 1VP5A 2ZX5A 3PAOA 4GIEA 4GUGA 2INEA 4R7JA 1F8MA 4WF7A 1S2TA 3TXZA 2V8ZA 4JTFA 4CGTA 3A23A 4M6VA 4ZXLA 2D0FA 1PEZA 4LXFA 1HJXA 4FPSA 1WV2A 4JTCA 3MCMA 1Q6OA 3UZWA 3ZT5A 5K4ZA 3NG3A 4H7CA 4Q8UA 2VFFA 3DFYA 1ISWA 2G3MA 2O92A 3KL5A 1L6WA 3S5YA 3NAVA 4JPGA 5EMUA 3AYSA 4GE8A 3N9SA 3OEXA 3R0KA 6REQB 3HGRA 1MRAA 1YTKA 2ZUUA 4DO7A 6XIAA 4LNCA 4UTHA 3ID7A 5CQ1A 2CPUA 4WEVX 1N8WA 5E0KA 2WVVA 3N2BA 4L9ZA 1Y8BA 3RU8X 4HPJA 1Y5XA 3TWAA 2XYLA 3LMZA 1TV7A 1XHGA 1XX1A 3V1HA 1VBJA 3CV7A 3A9BA 5LXXA 3UZYA 1M3UA 4P7OA 1R3RA 1L2UA 3WEOA 4BFAA 1YE4A 2ZA1A 4BQ2A 4ZVJA 4WDTA 1R85A 5DN1A 3N2OA 1VAHA 1GYMA 5CG7A 2WMFA 4HSHA 5GPRA 3OVPA 2HVMA 3OVGA 3QW4B 1FP9A 1OABA 2CZ5A 3TTEA 3KL3A 2PGEA 1UD5A 3QQ0A 1MO0A 1R5YA 1P1XA 3H2NA 2Y4SA 3HG5A 4NZJA 4RDZA 1F5ZA 1AMKA 1YTDA 3NURA 3HPAA 1Y7VA 4UOZA 2DZVA 3GH7A 3FYOA 5HNTA 1XYLA 3TFCA 3FN9A 3VDHA 5CBBA 4GY1A 3LX9A 3BLIA 1TPH1 3G1VA 4GFSA 4OJYA 2B7OA 4M6QA 2YA2A 4FO4A 5I78A 2NVAA 2F6XA 1ENUA 3VIMA 4ZTXA 2PC8A 4BQ5A 4RE4A 3PB2A 3IVSA 4JXCA 3V0SA 4IIFA 4DIAA 3L4XA 3ZS4A 4NILA 4LV9A 3E0WA 3K8KA 2Y70A 1BTMA 5CZ0A 2CHOA 3NR0A 1M53A 1QMLA 2DZAA 5E1QA 4AX6A 3AO0A 1BRLB 3AISA 3VOJA 4ZA0A 4NAFA 3AYVA 3ATZA 1Z41A 3U57A 4S2BA 1W2PA 3H53A 2ZA2A 2ZX7A 5GJPA 3IV8A 4FOKA 3TU9A 3GDMA 4Z42C 1E4LA 2YCIX 4IISA 2EPKX 1QJWA 5I79A 4LT9A 3QY6A 3SFKA 4LS1A 2VVSA 1UR2A 2FPVA 1V3JA 2ISFA 4HYWA 2E9BA 4YTQA 4U5IA 1JR1A 1J6PA 4XIMA 2J7CA 5DO8A 2QDEA 3P8JA 3W1LA 1TQXA 3W24A 4ZQOA 4FNRA 1VIZA 3WDIA 1NP0A 3W02A 1WBHA 3P84A 4G7FA 3QMTA 3GTNA 1R8LA 3AMDA 4PUJA 3O15A 1PIIA 1ZPTA 4NAEB 3EZ4A 2BHUA 4NZCA 2AL2A 5BROA 3CJPA 3EYPA 4KEVA 4O1FA 1KRBC 5IM51 4AU0A 4PR4A 4S3EA 3OBEA 1Z89A 3WLLA 4ICCX 2VZOA 1FH9A 1LLZA 1US2A 3FGCA 3WMSA 4FR1A 3MDWA 2CZDA 3S0CA 3UERA 1CNVA 3ABOA 1JPIA 3KOWA 2NZLA 1LP6A 2AAAA 4QROA 3W2UA 3KE0A 2IPJA 5RUBA 2E5BA 3T78A 3GX9A 3IAQA 2PWUA 2YBTA 4XISA 1HTIA 3L4ZA 4E6MA 4JX5A 3KP1A 3M6YA 5AECA 4LQ1A 3U2CA 2VWSA 3ARSA 2TYSA 3FIGA 4G6CA 5HMDA 5BMWA 4MIMA 1Z44A 1EZ2A 2OFJA 1JDDA 4B16A 1EJVC 1Q45A 4B5SA 1JZ8A 1UYQA 2CERA 4FXSA 1DXEA 5CSRA 3T7VA 3PTMA 3A21A 1QWKA 3G1YA 3T81A 1X1NA 1DL3A 2WKJA 3BSGA 3LQLA 4OV4A 4HB7A 3AXMA 3V16A 3ZVHA 3TYBA 3NEHA 1KXVA 2NQHA 2PURA 1GCYA 2GUYA 2GVYA 2GJLA 1PB0A 3W27A 4Z2JA 2GWGA 3ITXA 4MFEA 2HS8A 2ANUA 2OG9A 3TH6A 2O55A 3V35A 4XSMA 4ATWA 2XIMA 1XBXA 2FHBA 4GQGA 2TODA 5EB8A 5EMJA 4PBGA 4E8DA 2V68A 4XO7A 4XZBA 3WNLA 4NJJA 3V5OA 3R6IA 3K2GA 1S5NA 3ZM8A 3LSCA 4IX0A 1XSKA 2XN2A 3WQ4A 3W01A 4A8LA 1AH0A 5LA0A 3NL3A 3ONBA 2OKTA 4IIDA 2FPYA 3W82A 4W5ZA 1VJZA 2PD9A 1GVOA 3M0YA 3BLOA 1IR1A 1U5JA 4LY8A 3NSXA 5IHSA 5GNZA 1JXKA 1QRQA 1KR0A 3T0AA 1BKSA 1SJCA 5D2VA 3GVWA 3Q67A 1BSLA 3CAQA 3JU2A 4QG8A 1VYSX 2OX4A 3DHFA 2Z1XA 1ZSXA 5M2FX 1KQZA 2ISVA 3DGBA 2OX1A 3DENA 4GYFA 3UA3A 3LHZA 4AMCA 4XAFA 4WDWA 1KFJA 1E9LA 1KW1A 1XD0A 2W67A 5LGZA 4L6OA 4LVDA 1DORA 3QR0A 2GPTA 1EP3A 4RNIA 2WZIA 5MKGA 3MMWA 4PB4A 4GG9A 2FZ8A 1EFZA 1FWRA 3U8GA 3TYDA 3UGVA 2E9LA 1KM4A 2X7VA 1KB3A 2GDUA 1G7VA 1EYEA 1TPUA 2BVTA 4H6RA 2QV4A 4DF1A 1GW9A 1V0NA 5CZKA 4XZLX 5LGXA 4OECA 4R9XA 4DO5A 1SJAA 3AS3A 4PB5A 3M0HA 4M6UA 3IIVA 4PMVA 1R46A 1OCNA 3WMBA 1FCUA 1TMHA 4KH2A 5K2ZA 1S1PA 3IGHX 4IL0A 4QM1A 4G7EA 3PZNA 5JIPA 1QBAA 2QHAA 2VR2A 1ME7A 5CAKA 1MVYA 3NQFA 3HFYA 3ABQA 3LRLA 3S4TA 2CZEA 3MANA 1Q65A 3K8LA 1TTJA 3SBFA 1J0HA 5CPQA 4CQ9A 4K7VA 1VBRA 2JGQA 4JNZA 4NRRA 1HJUA 4O52A 1J12A 1SU5A 4V28A 3S9IA 4PMOA 1Y65A 3RYSA 2RUSA 2H9AB 2C7FA 1YEYA 2PU0A 1LWIA 2E1DA 5E9AA 4A3RA 3WLQA 2HNEA 4K1GA 3N15A 1UR1A 2CETA 1EDGA 3OPSA 2HE5A 1V77A 5AVHA 3GR7A 5CSUA 1HNYA 1RK6A 3RCYA 2VFIA 3NQDA 4JFWA 1XLGA 3EXSA 4JEQA 2V5DA 3V5FA 3HPFA 1X8FA 2ABBA 2DQWA 1OFAA 2A79A 2PP3A 2V67A 5JVLA 1C8YA 2WMKA 1XWYA 4YPJA 4WSKA 3DDMA 3W53A 4GCXA 1HKWA 1DTUA 1J5TA 5CSSA 3SQMA 2X09A 1HX0A 1O60A 4OVXA 3KS6A 3L5AA 2FQIA 3ITYA 3ELFA 1UG6A 3QKEA 3NYDA 2OODA 3WNOA 4LWWA 1H61A 1YE6A 4YL2A 4XG1A 1I0BA 4TQTA 1W9PA 1W3JA 3PP7A 2ISDA 3R8HA 4ZO8A 3LCIA 2F61A 1JULA 4BY3A 4DLFA 4PC8A 1CIUA 1XYCA 5E0FA 1NTHA 4B5UA 1FCBA 2BFGA 3P5YA 2EG8A 1GUVA 5A6LA 1LTDA 4EAYA 1H7OA 5G5IA 2VX4A 4Z0SA 1QPNA 1PZ0A 3NQBA 3AC0A 1KD0A 1CENA 1LUCA 3LGEA 3AAMA 3DERA 2DV0A 1RH9A 4G8TA 5AHNA 3W3OA 1QNVA 1VQTA 1LBLA 2ICSA 2O4QA 4LS0A 5CZTA 1IWBA 1LQ0A 3DI0A 5CGQA 3CHCA 3A6OA 4HU8A 5HMFA 4U10A 4MPQA 2ZVRA 1OCJA 3TCSA 3D5HA 2F84A 4NG3A 3UXAA 4NXSA 4L4MA 4MNJA 3OTRA 3HA1A 3WK1A 3H21A 1PPIA 3NQEA 1B9BA 3OOQA 2D0HA 1JF6A 1KRMA 2C18A 4HA4A 4JCLA 4KCWA 1V03A 1AZ1A 2HPMA 1E1EA 3HJZA 1Z6KA 4NYUA 4RNHA 3SFWA 4GHRA 3IARA 3B8IA 2YXXA 1ECEA 4S3CA 2Y7GA 1YDYA 5GJMA 4HYVA 1ICQA 4E2DA 5D9PA 3URAA 2CNCA 3TK7A 4EPDC 2GL5A 4MYXA 3QOMA 3I3DA 3IPWA 3HZ3A 1MFVA 2GZXA 3LV6A 1ZHAA 3SSJA 3TC3A 1OADA 3KLKA 3NO1A 1ZP4A 2CHRA 2E7FA 1NWSA 4XZIA 2G3NA 5M17A 5HMSA 3AWOA 2FDMA 1M9HA 1EPVA 3HPZA 4DELA 4F9DA 5H91A 4FA3A 3LBMA 1NQ6A 4EX4A 4US6A 2PODA 1K8XA 4GZJA 3WH5A 5D2WA 4UB9A 3WQOA 3WLKX 3ZXWA 4FNQA 1VRXA 1X98A 1OGGA 3V75A 3A5VA 3AS0A 1AW1A 1K8CA 3PPFA 4Z17A 5BWAA 3R0DA 3F4CA 3AMKA 4LYQA 3MYOA 3SEPA 1BG4A 5DMYA 4OE7A 1KBBA 5HINA 2C6QA 4ZOBA 4B92A 2E5DA 5F2LA 4MF4A 2BB0A 3AHXA 2FZDA 2FKPA 2DGAA 3C3NA 3D6NA 4HD5A 3DFSA 3BGAA 1RK5A 4EWND 2VHLA 1XIGA 1NP2A 2WHLA 4L7ZA 3S5ZA 4JTHA 4XWUA 2XH2A 3DU0A 5HBFA 2PDPA 3CNYA 4JTAA 4PRTA 3WFAA 1W3TA 1E9YB 3KBJA 3MY9A 4R3UA 4UXDA 4HA0A 4HGXA 4YLWA 3VIFA 1A5LC 3TTOA 3N4EA 1F74A 1EJTC 1V7YA 3CL8A 3FEMA 2YOCA 2HWGA 1V4YA 4R85A 1GT8A 1JD7A 2VDIA 4PSRA 1M41A 3WH7A 3F4DA 3N17A 4DPQA 3HO8A 4MWAE 1NFBA 2IKJA 1ZAIA 2X1IA 1DTNA 4CQAA 1UD4A 3E0IA 3KTCA 2YB1A 3VIOA 4C6PA 3ZT7A 2XIOA 3MSDA 4KWVA 3DAQA 1DIEA 5IBXA 4FR6A 3WENA 3WK3A 3H2CA 1H1ZA 3AHYA 1UA7A 3CHDA 4C1LA 2Z1WA 1QK2A 1JPHA 1RR2A 3RU6A 4ECLA 3CYJA 2AMGA 3HIJA 3S8HA 3L2MA 2J9ZA 3HFTA 4PUEA 3LSBA 1Q6RA 5CBJA 1TUFA 2HROA 3QGVA 4GC4A 3C86A 1T5AA 5HWMA 1PWLA 2UY3A 4XKYB 4N6EA 3STCA 2Z7KA 2VCCA 2UWFA 2ZRWA 2AKZA 1KBLA 1LRQA 2ATSA 5EKYA 3NZ1A 1EH9A 3UZXA 1X6UA 4JIRA 3U0HA 1CGYA 2RDXA 1BGAA 4A8RA 4W85A 3SGUA 2VX6A 1PE1A 2PBOA 3SIMA 4I9JA 2EJ1A 4Q3MA 1TZ9A 3VDCA 1S39A 1E51A 1KA9F 2ZUSA 2V5CA 2VOMA 1HGYA 4O12A 2P8BA 1J96A 1VLWA 4PODA 3VKCA 1PKYA 2OYMA 1B31A 1RCQA 4WSHA 3VIKA 2IPWA 1GHSA 1TPDA 3EB3A 1TIMA 5IBXC 3XIMA 3CIWA 2R1LA 3CQKA 2Z00A 2A7NA 1LLWA 3MPGA 1OX4B 2Z2AA 3F2CA 3FJ6A 1MSSA 4NZ3A 1C3FA 3UYCA 3S2NA 1GKQA 4PUUA 3P60A 4ACYA 3DI1A 3WKZA 2J27A 2O0TA 3IANA 5HUOA 1ICPA 4HPNA 4YS1A 3N3MA 4HHLA 3PG8A 2WWCA 3PTKA 5CPMA 1OD8A 2FVMA 3PWAA 4LANA 1G4EA 3IJQA 3L0GA 2Q09A 1ADOA 1X38A 4ZSTA 1EJWC 1JPMA 2PWDA 3LXAA 1PZ3A 3S9YA 3M0VA 4U4MA 5CLTA 3LCWA 1HJQA 3LHUA 2E0PA 2PDKA 5E6YA 1B90A 1JG9A 4ZFCA 2VR5A 2DUAA 3RHGA 1M5WA 2VRKA 3FHAA 3PPGA 3P62A 3C5QA 3KCLA 2C14A 5IOBA 1FRBA 5A6JA 1OF8A 3CTTA 2ZXQA 2Y89A 4UZUA 5H8PA 1AW2A 2JFEX 3G3DA 3PWIA 2CIPA 2D2JA 2PWVA 2BP1A 4NUWA 4YTSA 2XWEA 2GVJA 3Q65A 1UKTA 4WDXA 4Z2IA 2ODOA 2J13A 3SN1A 1EBHA 2W92A 2GGGA 4A3QA 1TA3A 2O4MA 4IPJA 4H8HA 3BK0A 1SMDA 4OT7A 1ZY9A 4BI7A 2X7WA 1SO6A 3EOEA 4XSLA 1TREA 1FTXA 1E6XM 5DCDA 2QCEA 3CMFA 3H4GA 4U3CA 3PJUA 4X9SA 3KCJA 3CEUA 3S46A 1H62A 1FWNA 1WAUA 4W8LA 2GGJA 3CASA 5DANA 4JQ3A 3F7JA 1G94A 4O54A 1E0TA 4ROPA 4DY1A 2YDAA 4QCEA 1E40A 3U6WA 3I10A 5E0CA 3RAOA 4K38A 5HAOA 2J8TA 4GIRA 4WOZA 2G5WA 1R3QA 3AXHA 1G9HA 1XCWA 3MA8A 3TYCA 1TQJA 3VGHA 3R8GA 4UQ9A 2TSYA 4WY0F 3KBSA 3N04A 2DH2A 4JN7A 4N02A 1ESWA 2PTXA 3CMGA 4AHPA 2VKZG 3SCNA 5FEPA 3WNKA 4YVXA 3ZSTA 2GQ8A 4F0LA 1G4TA 3K4WA 4OU1A 4S3KA 3CB8A 3CU2A 1TV5A 3CL6A 4AY8A 4CQ8A 3HOJA 5FSEC 4QDWA 4MGGA 2D3LA 2DW7A 3KOXA 3WF4A 4AZCA 3PBMA 1S3TC 3AIQA 5ABFB 1PUDA 3ZMRA 2FTYA 1KXQA 1E6ZA 3VIIA 4MSSA 1KTNA 2F6UA 4M6PA 4I90A 3L4VA 5BXPA 1TRIA 4M3PA 1CXIA 3BICA 4BS0A 1UPPA 3K46A 4HMEA 2HRWA 3NQCA 1YDNA 3GBDA 1R7OA 4YTUA 1XW8A 3W7CA 1R0MA 4C6IA 3WJWA 4J3TA 1UP3A 2DZSA 1OZQA 3II1A 2WJFA 4C65A 2B31A 1WKEA 1GVYA 1O5RA 3EWXA 2PS2A 4B5VA 3Q94A 3DBNA 3PZUA 3BPWA 4IPNB 1W17A 2F8QA 2A3HA 3B03A 4B9ZA 2DZWA 4GD0A 3T2PA 5A8OA 3F4WA 2VEGA 1DJIA 4HK7A 2WVVB 5FEZA 4BF9A 2JIWA 3LCHA 3FDGA 3DGRA 4UFKA 3KVKA 5LA2A 9RUBA 4JQ4A 1B30A 4LAZA 3TVAA 1VFMA 2DSWA 3W1MA 3CV1A 3ZJ8A 3UWYA 2XIQA 3MYPA 4HSOA 4Y8FA 5KZEA 2IQTA 3EB4A 3WQCA 3QFWA 1NAL1 4H9YA 1KLZA 4G9PA 4DF2A 1T8XA 4GY0A 2QS8A 2ZA3A 4EXQA 1SUXA 2R1NA 2DP3A 3RM4A 3AQUA 4JKMA 1O5QA 4X0NA 1XUZA 3U7BA 3ORWA 3BWWA 4CNTA 1GZ1A 1VEOA 3TYAA 1Y5WA 3SW6A 1NWTA 1IHIA 1FXQA 2J7FA 5C9RA 1RCOB 1H1YA 3I4KA 1R30A 3PANA 3VCRA 1X6LA 3B8SA 2QZRA 4UC5A 4D1JA 2O7QA 1BF2A 5HDRA 2YSWA 4Q7NA 1U5HA 3VC5A 5A6KA 1J0KA 4GIYA 2DSVA 3S6TA 1LT7A 3FLUA 4MNLA 5F1VA 3I7RA 1VJSA 3OLIA 1VCGA 4D1IA 2W9MA 5CJNA 4D72A 4HHHA 4Y9AA 4I5XA 3L7RA 3BLEA 2YIHA 4EPKA 3EOLA 2DT2A 5EL1A 1RVKA 1KWKA 1SQ7A 4FF5A 1SZFA 4S39A 3RLUA 3N34A 5CGTA 4KS0A 3U48A 1VS1A 3GLCA 5G4EA 4ZQPA 1UD2A 1JI2A 2GQ9A 1EBGA 2V3DA 1S5MA 2VCBA 1V5XA 3EPOA 5XIAA 3GVQA 2V3FA 1WP6A 4NAFB 1LF1A 1DHPA 2FH6A 3B8TA 5BZAA 3ZLGA 4Q8TA 2QVNA 1GVFA 3IUIA 3GUWA 2JQXA 2CLMA 5IHRA 4IXHA 2Z2BA 2GSEA 4B5NA 3BJFA 2ONEA 3VCNA 7TAAA 3IRSA 3GNPA 4WGHA 3T0DA 3O6YX 1BGGA 3AZSA 3CBWA 3OIHA 3B4YA 3LB0A 4TX6A 3G1HA 2DU2A 2F6KA 2QAFA 4WXYA 2E4TA 3EWWA 1O5XA 4L4LA 1GOMA 2P1FA 1S2UA 2ZXDA 4PRWA 1UZDA 1GYNA 1NOFA 1UROA 3I7SA 4JCMA 2R1MA 4Q7BA 5D9MA 4KW2A 2PDUA 1MYRA 4J3XA 3SN4A 2ZUNA 2CLFA 4NF7A 1SM9A 3WQDA 2CFFA 2VELA 3R13A 1XG4A 4W87A 1JYXA 3W2LA 4FB7A 2PLCA 2AL2B 2H90A 1JDAA 3KFTA 3TA9A 2NV9A 4C6BA 2FJKA 5HA7A 4L1GA 1FHUA 3EDEA 3UZJA 3DHDA 2G0WA 2C13A 5AC5A 4KWWA 2VRQA 3FGCB 4IIGA 1PSCA 5FF2A 2OVLA 3NQ2A 4QS6A 3THDA 4LB3A 1MDLA 3W2MA 4MZ8A 3VD3A 4ADSA 1RA0A 1UB3A 3CYVA 3AIWA 1I2NA 5A6AA 3N14A 3TN5A 3F03K 1S38A 1VBGA 4UR9A 2X1SA 2W79A 3OGSA 4H83A 1NVMA 4Q8PA 1O1ZA 4UQCA 3ICJA 1UW9A 1J6OA 2X0YA 1BHGA 3N12A 3GC4A 1F3XA 4XZWA 1IT0A 3LA4A 4D71A 2PTYA 5FEWA 2J7HA 2OEMA 5DT7A 3ZVHB 1GEQA 1QATA 5TAOA 5EPDA 4NNAA 3GDBA 5JBFA 1KFKA 4JIEA 1GWJA 2YDRA 5LNWA 1PV8A 3M46A 4MJ4A 5C7VA 3VKKA 2D69A 4HQVA 4EOUA 3KRZA 4MDPA 1E0WA 3QTGA 1DYSA 2D0GA 1MUWA 4IGSA 3A3HA 4QEHA 4N4PA 3LV5A 1IZJA 1XSIA 3UJEA 1P6WA 3QC0A 2DVUA 3HQ1A 4OUIA 5E09A 2PWHA 4UQBA 4IF2A 4ZOCA 3KRBA 4M56A 3VMOA 2BGNE 3MSRA 3M4HA 2KZHA 1RALA 4CU8A 1W1IE 4TV6A 3RPTA 3USZA 2WMHA 4HK6A 2YBUA 2H8XA 3QMRA 1WA3A 3Q37A 2ZVIA 4AVOA 4YYCA 1IEIA 5G2IA 2IKGA 3ES7A 1GQIA 3DFHA 4GRSA 3PZVA 5ABHA 4PCPA 4PEEA 3BAYA 5D04C 3GNXA 4PULA 3VX1A 3PR2A 1HVXA 2V3GA 2WHJA 3IVTA 1FBAA 4PSPA 1JCMP 3KCOA 3HURA 4UTMA 4P7LA 4IMEA 1UUMA 4H4IA 5LIYX 4CQCA 4Q8NA 1GTHA 4RKAA 4IZGA 1H5VA 2E68A 1NIUA 4C6CA 4QHRA 2RHGA 3I68A 3WQWA 1XISA 3WUEA 1CGWA 3IK2A 5BU9A 2A6LA 1U1HA 3YPIA 1W1B1 1SZRA 1QHZA 3GDRA 3VFCA 5MKGB 4IG2A 5DXXA 3HG2A 1B3VA 1CB2A 3PHAA 4AYSA 4WHBA 1W1YA 2DVXA 1DJGA 2XIBA 3BE7A 5EA9A 3EWBX 1BFNA 3FA4A 5CGMA 3DKJA 1A3XA 4A6GA 2DW6A 4BKNA 3ZYZA 3N6QA 1W9DM 5C9WA 3MTWA 1TUXA 5D03A 3G0UA 1N8IA 5AY7A 1ZJBA 1FHLA 1ZALA 1VFFA 3CUJA 2DIJA 3PZOA 3B97A 3VMNA 4PZVA 5JUVA 3DFPA 2CLKA 5FAJA 1XH0A 4WXZA 1A4MA 2J62A 1UWUA 3W7MA 4DJDD 1UASA 3CHFA 5KSWA 4G7EB 1EX5A 3LERA 3OYXA 5HXMA 1FOBA 1VLIA 1ZP3A 4QJ5B 2YLLA 3LCFA 3AICA 3PK7A 2NVCA 3GUGA 2OR2A 1XF0A 2VEPA 3FAXA 1UMYA 2QGYA 1WUFA 3H24A 1WCGA 3UWZA 3KS5A 4YTTA 1LL6A 4C7FA 5EMYA 3AIVA 4QLLA 1TCDA 2VDHA 5DELA 3V5CA 1K70A 3RN6A 3SCTA 1ZNNA 3WEZA 5I6SA 2QCLA 3R2GA 2PDQA 4L9XA 4OGZA 3H54A 4DJDA 4E2VA 1V3KA 2NXHA 3ECQA 5FACA 3WDQA 2OCZA 4C6NA 3KP0A 4O4VA 4FS9A 4Y8EA 3TZNA 2DJXA 3Q58A 5AYIA 2GJPA 3UVIA 1TIWA 4K2SA 4HZ8A 4M82A 4MWAD 1QDSA 5D9NA 3SR7A 1WDRA 3VNIA 4KEMA 4S3GA 3GXPA 3OGRA 3QOKA 1LYXA 3NL6A 1F61A 1IV8A 3VD7A 3MMDA 3G2GA 2XZ9A 3LNMA 1VFTA 4LOCA 3NOYA 3GAYA 3NO3A 1KKOA 1TZ7A 2A7RA 4E3VA 2VFHA 4J1OA 2VX7A 3FVMA 2OTDA 2PTDA 1H3GA 3S2CA 4PTXA 2NT0A 3QLDA 3UWWA 1HO1A 2QKFA 1EXPA 4MB4A 3DN5A 1QUMA 3M64A 2EQDA 3SJ3A 4DWDA 4EF9A 3PZ9A 4KESA 4H19A 3MHGA 2CLEA 4DJDC 2YL9A 2EPLX 4CVWA 2POZA 2QPXA 4JAWA 1ZCCA 4N9BA 4BWLA 4GX9A 1S2CA 5T26A 4R27A 3ABXA 1DJXA 1JYWA 3HPXA 3GZAA 3JZEA 4FLOA 1LUCB 4DWSD 4ZQCA 2XG9A 4HZMA 2PI6A 4HOZA 4AZ5A 4ZSUA 3G77A 3MHUA 2MANA 1LROA 4DX3A 3STPA 4GH1A 3M1ZA 1UR8A 1VZWA 3GHTA 1D3GA 3CZGA 1WXZA 5LA1A 1VD6A 4K37A 1OM0A 1ADDA 3ZO9A 1JPDX 3ARQA 2PDIA 1DIDA 2WKGA 1UR4A 3WF2A 4FOUA 3KZPA 4REQA 3RRXA 1NDYA 4LH8A 2XIIA 3CEPA 2BBFA 1IGSA 2Y62A 1NDZA 1QHPA 2QCNA 2ZWZA 1Q6FA 3PUGA 1SW0A 3NDOA 4N4QA 3CZ8A 1ZJHA 4DWSA 2O56A 1KBKA 4MB3A 1L6YA 4O13A 4UR8A 1KNWA 3LDVA 1AUSL 4AXNA 2DZPA 2A4AA 4LYRA 4HPGA 4MWAC 3LTYA 1HKKA 3E0FA 4CU7A 3G8EA 5A3HA 4DI8A 1ZUAX 4B3ZA 4RDWA 1MFUA 3TX9A 3LCLA 3VOIA 2V5LA 1G1YA 4GACA 3G8RA 2BSLA 2R91A 3VXGA 5SWUA 3TSMA 1NWUA 3W84A 1NFGA 3NJ3A 1VCVA 4UUIA 3MZ2A 1H7XA 1M7OA 3UQNA 5A6SA 3OIXA 4MAVA 3I7QA 4OV9A 1U2YA 1I2RA 2Y61A 1UOKA 1VC4A 1XIFA 4CCEA 2WQDA 4N2YA 3W7JA 2YCJA 4JL2A 2YL5A 1EJUC 4AIOA 1EOKA 3R1ZA 2PGFA 1U5VA 3VMPA 3SADA 1FWBC 2XFRA 3QTPA 2VVNA 3QRHA 3CB3A 1UKQA 3U7VA 1OFRA 1BQCA 1XD1A 4NIRA 4CNUA 2POTA 5JXQA 4E0CA 4O1AA 4DWSC 3P8IA 2DY3A 3LU2A 3T2OA 4KWSA 4UFMA 1JD9A 4LS2A 2LLEA 1RLDA 1PKLA 3GB6A 1Q6GA 1WXYA 3C0JA 4QJ1A 3VFLA 4I5UA 3N2MA 3MKKA 4P8XA 2VMFA 1ODUA 3UWUA 3EOSA 3VOCA 3ZT6A 2F2KA 3QZAA 1G67A 3HB9A 2JEQA 1HP4A 5T9CE 1E56A 3KVJA 1RJRA 3S6OA 2NV1A 4WSJA 3G3MA 2IKHA 4C90A 2WC7A 4RCXA 3BZJA 2Z25A 3B8UA 3LNPA 3BG3A 4UOJA 3UPWA 3N18A 1IF2A 1QPOA 1KTCA 4IOTA 3W71A 1P5BA 3ARWA 3HGJA 4GNKB 2HSAA 4HTYA 3QJAA 2B7QA 1GQNA 3D46A 1YDOA 5BWFA 4IIEA 3PWGA 1US3A 3WLJA 1OK4A 4IP7A 1J18A 2WVSA 3E5BA 4YWIA 3WDJA 2R1KA 2OEKA 4WKFA 3BOXA 1ISYA 4JHMA 1W5OA 4GNJA 4MPKA 1DIOA 2VYOA 3U4FA 3RPMA 3V36A 3WEMA 3NVDA 1A5SA 2NQ5A 1QI3A 1RQEA 4ATDA 3ITGA 2WNNA 2XM1A 1FXPA 3W26A 3K1GA 5A8QA 5LIWX 2WCGA 3T4CA 3UJSA 5LHFA 3L0KA 3BQ6A 3L2LA 1K9FA 3SCOA 1MW3A 4W8AA 4D6FA 1E0VA 4KERA 5DCBA 4JX6A 4YTRA 4DZ5A 1XLAA 4JBRA 3FEQA 1U83A 1U30A 4GJ1A 3W25A 3WDHA 4B5TA 5HWJA 5FF4A 4LAOA 4HN4A 4CD5A 4HIBA 1ZL1A 4XTIA 2D22A 1QNSA 1A80A 5A1AA 2X2YA 1OYAA 2PCEA 2XN1A 5HR6A 3N4AA 1MEHA 1VENA 1DWAM 2OSYA 3WH9A 2WJZA 2ZRVA 2P5NA 4LV4A 3DHPA 4TO8A 1FFQA 1XP3A 1J5SA 3PUDA 3FDKA 2NLYA 5EMMA 1EP1A 1DEDA 2FZMA 3A47A 1FWDC 3QF0A 2BDQA 1F76A 1B0IA 3E5PA 3AXKA 1UZ1A 3BOFA 3W2JA 3MI6A 4BA0A 1GYLA 4WDUA 2OO0A 5HATA 1X1ZA 2ZZ7A 4OOZA 1XLHA 3JVAA 1PO9A 1A0EA 3R58A 1N82A 1IXQA 1S2VA 4PFMA 4IMAA 3NDZA 1PCWA 2J7GA 4CVUA 4Q8MA 1XBZA 3UXKA 4B91A 3VM7A 3INPA 3TCEA 1TFVA 1F3TA 3QC3A 1NH6A 2UZ9A 1XDMA 4AEOA 1V6WA 1ZBVA 3RMJA 3GG0A 1H7WA 4DF0A 1RY8A 2XFWA 5AHMA 5TNVA 4C6QA 3M43A 4QLJA 4KFOA 1CZ1A 5E70A 1K9EA 4GX8A 4M5PA 3W6YA 4DUWA 1KC7A 4IIHA 2SFPA 2NQZA 4BEQA 3QZ6A 1H41A 3LQGA 1EL3A 1WKYA 2GQ3A 5M5DA 4U33A 5D8ZA 1YPIA 1E6SM 1GVEA 3M47A 1EC7A 1WO2A 1XV8A 2QUUA 3NGFA 3L67A 5KZDA 4YXGA 1XLDA 5BW6A 3LHWA 1RJPA 2ZX9A 2E77A 5C2CA 1V3LA 1HW6A 3G18A 4I9TA 3EOOA 3B0UX 3D0CA 3G1RA 1WZKA 3MMUA 1IT7A 1JQXA 4WD0A 2FB2A 3MUXA 3TQKA 2FVLA 2ZE3A 3GXNA 3E9AA 3MQTA 1A5UA 1X6NA 1TA3B 2CLIA 2OQYA 2OYKA 1F6PA 3MC5A 2DPEA 2WXDM 3EMQA 1NELA 1WDPA 4GXWA 4D8LA 1ZCOA 2QF8A 4IQEA 4YWSA 5IFPA 1WBJA 4ZOAA 2J8FA 4IH3A 3W1PA 3EBVA 1J0YA 1EKOA 1DBTA 1RQBA 4LX4A 3LRMA 2ASHA 4HMDA 3N29A 2OU4A 3SCSA 2GJNA 4S3AA 1BLIA 4HKPA 4ZQMA 2B0MA 4UTTA 1XGDA 4EP8C 2PDHA 3PF3A 1HZYA 3LTSA 1UP0A 3E38A 3L21A 5TQLA 4JOMA 4RZ5A 4GQBA 1CX9A 2OZ3A 1K9TA 2OLAA 1TE6A 2ON3A 3EWCA 1I6NA 3W1AA 1ME8A 4H6QA 1JJKA 1Q85A 2XISA 4UTUA 4O28A 2OSXA 3QFEA 5EFFA 4HTBA 3EKGA 2Z7GA 1UR0A 2CXEA 2I1OA 4LSBA 4FNUA 4IGMA 2A85A 1GOQA 4JTUA 4KIRA 4AZCB 1OG6A 3QPZA 4QQ3A 3BSHA 1E0XA 4YN5A 2ZICA 3B8VA 2AKMA 3A64A 3SRHA 3VD5A 1TPVA 4DXXA 1XPGA 2GJRA 1W1A1 3BAJA 3CQHA 1OC7A 2DH3A 3NZQA 3B9OA 1D7KA 4XAGA 4NP7A 4M24A 2BGQA 5F4SA 5FJJA 1FDYA 1V3MA 1Q2RA 2Y63A 3U5YA 1ZJIA 3QV7A 1E9ZB 3GTHA 5B7ZA 4MUZA 2WNZA 3F5JA 3AIEA 4H04A 4FMVA 3NQAA 1PS9A 3G6MA 3GIQA 3OA3A 2P53A 3URNA 4UTTC 1OVDA 5K7JA 5I3JA 3PTQA 2ACUA 4QJ3B 1A50A 1TPC1 3D47A 3GVRA 4NZFA 5DBUA 5EMKA 1UKSA 1A5CA 1JZ4A 2CZFA 4NASA 3H26A 3CL7A 4GOAA 1XUUA 2DZTA 3AJ7A 2Z2UA 3TLLA 4C1KA 5JU6A 4DYKA 2QW5A 1UBSA 1EJXC 1NOUA 2BMBA 4V2XA 3BAXA 3FJLA 1SO3A 4B4FA 1RD6A 4OBTA 3BURA 2BGSA 4F2TA 4LVFA 3S83A 3UFYA 2G3JA 1WDSA 4Z2GA 4E4UA 4E3TA 3QPEA 1ONXA 4OQVA 1M03A 3GYEA 3AYTA 3BAKA 2O9TA 4RE2A 3T44A 1UD3A 2PZ0A 3UWEA 4DLMA 2BLEA 3H12A 2PLJA 4F0RA 1F3WA 1S2WA 1IWAA 4FIRA 3NNTA 4J28A 1TV8A 3M0JA 1CB7B 2C15A 5HNNA 4Q7IA 3SJNA 5CC3A 2VR4A 4EVZA 2HBVA 3KTSA 2QCDA 4AFYA 1TB3A 4LUTA 1BYCA 3DG6A 1ME9A 2RDUA 2ALRA 7ODCA 3ZJ6A 2CC0A 2P0OA 2QCFA 2CBUA 1VYPX 1V93A 2QDDA 2VEFA 3WZ0E 5A6MA 3KRUA 4P5UA 5BOOA 1TVPA 1SJBA 2R94A 4NHVA 2FPTA 4FALA 3D3FA 2EF9A 4QIUA 1LZOA 4P61A 3A4AA 4MADA 3IIOA 2PZNA 2V38A 2BOEX 5DLCA 1T96A 2FFIA 3FA5A 1YTEA 1E1CA 6PTDA 2EGZA 1VFLA 4D8AA 4AWEA 3LS9A 4ZEPA 4IM4A 2W61A 3GTXA 1WKDA 1QO2A 4DB7A 3ALGA 4ES4A 1ONWA 2WM0A 5H1WA 4W4QA 1EQCA 4L6HA 5CG0A 3N13A 3KOZA 1FWSA 3VI2A 4RDVA 1JNDA 3DYOA 2TPSA 3W07A 2ZXAA 3W0KA 1PL9A 4GVFA 4ACZA 2HS6A 4NX5A 1QPQA 4FZIA 3A4XA 3SUTA 4W88A 3AMCA 3WQEA 4FNSA 2QIWA 1QBBA 2XFYA 6ALDA 1IEVA 3SCQA 1VPXA 4BJHA 2EKCA 5M1TA 2GVLA 4J35A 1LLOA 1E6PA 2CLPA 1D3CA 2Q3RA 1PTDA 2VI0A 2D73A 2PU1A 3NPWA 3O63A 1OF6A 2BZNA 3DYPA 5KETA 1LWJA 5CC5A 4LBRA 2AL1A 1E4NA 4QRNA 4GO9A 4K68A 3VNKA 1GPFA 1E6QM 3V7PA 1OX6A 5LIXX 2WPBA 1MZHA 4FXFA 4MNKA 4KBXA 1H0IA 4A35A 3QV6A 2C71A 4H7ZA 3LHYA 4TV5A 5A69A 3F5KA 3DIPA 2JK2A 1DVJA 1LQ2A 3QV8A 1QW8A 4KRTA 2Y7FA 1CLKA 2QLYA 2VX5A 4BK9A 4H8NA 2VZVA 1K6AA 1R7AA 3M0MA 5K9DA 1VFHA 2YCLA 4XBKA 1FWHC 1K9DA 3UR2A 1XLIA 4PMQA 3C61A 3M5VA 2VWTA 3RUBL 2WSQA 2E67A 1RPXA 2H3BA 3TJXA 4YHEA 2VURA 2W91A 4D6CA 2HISA 2NQJA 2J88A 1V02E 1XH2A 2WC3A 4NJIA 1G6CA 4B5XA 2GGEA 4LU0A 3LM3A 2IMRA 3MO7A 2PA6A 1H50A 5A8GA 3W7PA 2V30A 1OFDA 3WUFA 5EU9A 3UF9A 1WB0A 2VP8A 4WOQA 5JBDA 1KCZA 3E6EA 4ONVA 1FWFC 1BAGA 2OJPA 4JYDA 3R10A 3RJYA 2NW0A 1IEWA 1PYFA 2QCMA 4R7WA 5I2UA 1KV8A 1RP9A 1S46A 2WMIA 4F2BA 3WG6A 3OODA 3EWUA 3R43A 4AD3A 2JALA 5BMXA 5C55A 4MJZA 2BXVA 1TCMA 4HN8A 1MUMA 3GH4A 3GRIA 4PTWA 2J6VA 4J3VA 4XIAA 1MQRA 1JZ5A 1UP2A 3VM5A 1PWMA 3WLTA 4XBJA 1EUNA 3DG3A 3BH4A 2WM1A 3UYIA 5CJ5A 3ZR4A 1AA1B 3EDJA 4UOQA 1H09A 4US5A 3LMYA 4O1DA 3GBEA 3IJ6A 5FIPA 1JZ3A 3P93A 3TN6A 1W3NA 2FVKA 2PLKA 3C2OA 3GC2A 3AYRA 4O50A 3MUAA 1AD4A 1CXFA 3LPOA 3OG2A 4O1BA 2TAAA 1I8JA 4V27A 4AVNA 3QQ1A 3MWAA 2J24A 5DMNA 1AFSA 4QQUA 4UCFA 5XIMA 5JH1A 5I3KA 2P3EA 2CESA 4MY1A 2GVGA 2VT0A 4R53A 3U2OA 2JE8A 3BSMA 1SSDA 1EWEA 4ERAA 1Z9AA 4I8YA 3ITCA 2BVDA 3AU2A 1G0CA 3CZJA 3W1XA 2E09A 1P43A 4FXRA 3LENA 3VA8A 4HK5A 4LVAA 1F3EA 2OQLA 3KTXA 3AWNA 1MXGA 3W7QA 3MB9A 2PDGA 4I7WA 1M65A 4F0KA 5FJPA 4FOJA 1QNRA 1YLVA 2YDQA 1BVZA 3N3TA 1H2JA 3GR8A 2D20A 4IG2B 4QS5A 2PDXA 1UR3M 2AAMA 3TDFA 4K36A 4K7YA 4JY8A 1H4PA 3H70A 3TN3A 3WLHA 4ZBCA 4O1EA 3OGVA 2IS7A 4NNCA 3HQPA 2C16A 3N4FA 3UG3A 5BNKA 1G69A 4E8CA 5GQBA 3EKLA 3OU8A 5G1MA 3BAWA 1LDCA 3U4AA 4DZIA 1OEPA 3L0NA 4TVCA 2YL6A 4ZFMA 3PPHA 3NPXA 5T91A 2I5IA 1LRNA 3AS1A 3UY7A 3VDBA 1PAMA 3T09A 1TR1A 4PL2A 3VGGA 1SZEA 2YPIA 1H7NA 4DBDA 2TRSA 5J04A 1DJNA 1CWYA 1JUBA 2V2CA 5XINA 2X0HA 1P0BA 2W66A 1ISZA 3NYZA 4KETA 4YU1A 3F2DA 1KTBA 4P8WA 2ZDSA 3OZMA 3IIPA 4E38A 5AHFA 3SY5A 4GA8A 5A95A 1WQ5A 1W9UA 1Z7AA 1GW1A 2C91A 4PTVA 3NQGA 1W0MA 2HXTA 2W5FA 1A5AA 4LEQA 4RV3A 4Z1CA 1SZNA 1AW5A 3ZSSA 3VCCA 2DIEA 1BXCA 2VUYA 5CAHA 1B57A 1GOWA 1K1DA 1ZS2A 1H7RA 2AGTA 2ZTKA 1UWAA 1R3TA 2VD9A 3JRKA 1FVPA 1WUEA 2YCKX 5ABTA 2W6RA 4WKHA 3WQ5A 1FCVA 1ONEA 1JGIA 3MDUA 7CGTA 5C0QA 1ZJAA 3NEVA 4ZQRA 4MFDA 3ANYA 1MW1A 5IRPA 5DCEA 2G3IA 4GYKA 3UZZA 1KGWA 4F0HA 3RIKA 5KEZA 3WUBA 1QO5A 4DVOA 5B80A 4B5WA 3NZGA 4QG6A 1YPXA 3MCNA 2XHYA 2BOFX 2FHFA 3M16A 5I3FA 1W1TA 2XPKA 1I4NA 3W81A 4MWAB 3MUY1 5LZLA 4QE4A 4ZQNA 3K4AA 4AZHA 4B3LA 1R3SA 1UD8A 3S5OA 5HPOA 1W37A 3DXIA 3G5EA 3WBXA 3MW7A 4AQLA 5D8WA 3RMEA 3G1DA 3GM8A 2DT1A 1BD0A 3MKCA 2YA0A 2DJLA 4CN6A 4ML9A 1YADA 4WLCA 3TWBA 4Q8OA 1OIFA 4GZIA 2E1WA 3DFTA 2NX1A 4GXPA 3S5NA 4XB3A 3PBGA 3H6OA 1IXPA 2WZMA 3REQA 3LLXA 3WSUA 3B4UA 3N6JA 3JS3A 4UZSA 2NXIA 4REQB 1KM6A 2PF8A 5FAGA 3PUOA 1EXBA 4X0VA 1CXKA 1V3HA 3K13A 3IK4A 1GGOA 5C6MA 2OKOA 4DBEA 4MKVA 2XVPA 4H1ZA 3AHTA 4BZYA 3FS2A 1FX6A 1OCBA 1W56A 5CH9A 3TNBA 3EB2A 3BW3A 3SO7A 4DWSB 3PJWA 1BG9A 1W6TA 4YYFA 1J9YA 1VF8A 3KXQA 1D9EA 1RLCL 4XVDA 2WPGA 3ARPA 1QOPA 3KX6A 4ZXOA 1MW0A 4RW5A 4P8UA 1OY0A 2IXVA 3VIGA 1I2OA 2V0TA 3H4XA 1AL7A 3TQPA 2FFCA 5DRCA 5KMYA 1U22A 2FGLA 3WK2A 3VK5A 1VCFA 1S3HA 3H2MA 3W7IA 1AJZA 4O8AA 4AD0A 4QXIA 3CAVA 1R9YA 4RDYA 5HQMA 3QHMA 2YFNA 4D2JA 4EPBC 1PCKA 1IGWA 5A5WA 3WQ8A 5DF0A 4Z08A 3E12A 5EBAA 1ELSA 4GBDA 4NJHA 5E9XA 4DEFA 3R11A 3N19B 3W00A 3HG3A 1F07A 2GLKA 4CD8A 1WDQA 4E4FA 4X60A 2V2HA 6CGTA 4NNBA 2XSXA 3S9ZA 4A21A 4NZ4A 4TXEA 2FIQA 1K4GA 1K7FA 1LJYA 3WD0A 4S38A 3SCWA 3H23A 4JNYA 1Y0EA 1GG1A 5CC7A 3S6DA 3WNNA 5FA5A 3BMXA 2XFFA 2OOFA 2V2DA 5JQ9A 3PZMA 4P7QA 4LJ3A 1UQZA 4GGBA 5I09A 4AC7C 3GIYA 4C7GA 4GZ7A 1DWFM 2ISWA 1OB0A 3TIMA 1F7BA 5BXRA 3VKAA 4W7UA 3RCNA 1WZAA 3W76A 1ZU8A 1DE6A 1G5AA 1KRCC 3W28A 2WZTA 1DJYA 1JIBA 1NEYA 3K4DA 2BOGX 1GONA 3GVGA 2QUNA 4D6EA 2EG6A 4CNOA 3GYCA 4JTRA 2HVOA 2QJNA 5H8UA 1YNYA 4Y9NA 3G1XA 4CU6A 3T05A 2Y7EA 3P67A 4U3AA 2EJAA 2ZUVA 3M0KA 4V15A 1HIZA 4GXMA 4C6JA 3CQJA 2XDFA 1LOSA 4O0KA 1RAKA 1REQA 4QFUA 2WZHA 2DFAA 3WCZA 1SZGA 2HCVA 3A5FA 3MHFA 2VGGA 5AKQA 1Y5VA 4CLMA 3BDKA 4PMDA 3R94A 2YGYA 2G50A 1RZMA 5BCAA 1H5YA 1HJVA 7ENLA 5K9CA 3M7SA 2NWSA 4KQNA 3G1SA 1CTNA 3ANVA 1HJSA 1TJ1A 3LZ5A 4O19A 2ATMA 3GD6A 2I16A 3DFNA 1JVNA 5FF3A 2FHCA 2V3EA 1QNQA 3WDRA 4O15A 4NU7A 4PTDA 1B3WA 1BQGA 1GZJA 1HJWA 3EWDA 4OUEA 3EA1A 3NZRA 3V1PA 5LNVA 3PSWA 1LBMA 5IFTA 1VGAA 1MDRA 3VNJA 1JCJA 5FKYA 1MQPA 8CGTA 1WPCA 1TVLA 2QAPA 2ZZ6A 3M9YA 3NQMA 1XRSA 4DQWA 1R9ZA 4J40A 4MUPA 4RXGA 4RXFA 3WX7A 3GNDA 5J5DA 4B3KA 4QDMA 4D6IA 3PY2A 4ROQA 1GQJA 3E0LA 1IZCA 1RA5A 2WZEA 5A94A 1VH7A 2QEZA 3F2BA 4M8UA 2W62A 1AQHA 3C2FA 1QVBA 1UD6A 4LBSA 4BQ4A 2QF7A 2OMAA 5HUPA 2X1RA 4S3FA 4Y9MA 2DSKA 2W4XA 4CCDA 5ABEA 4F4RA 4W84A 4BR1A 3UG4A 1LM1A 3ATYA 2ZCGA 3OVQA 3WD3A 1W91A 3IACA 1I2QA 4C7DA 4L56A 2OZTA 2XUCA 5D33A 5FD0A 2EPOA 2REQA 3IEBA 4ZB2A 4DNHA 4GUHA 4JFTA 4JX4A 1NU5A 3P14A 2G8ZA 5D30A 4C1NA 3AU6A 3L23A 1XLBA 4ORMA 3WDPP 4IXXA 4GNVA 4LC6A 1BTCA 3BV7A 4QE1A 1S2AA 3TJ4A 5FJOA 1E6RA 1EJ7L 3RG6A 3CQIA 4GQ0A 2J8GA 2CLOA 3TOPA 3KWSA 1FCQA 2XU2A 2FZ9A 2Y1HA 1I60A 4CD7A 1PKMA 3VNYA 1RVGA 2PTWA 1F2JA 3HGSA 3ZR5A 4EANA 1DJQA 3A24A 3TONA 2MUCA 4PGLA 3VDAA 2ZUTA 4RNFA 1KFCA 4QP0A 1DJWA 4J2MA 4OZOA 1DWHM 3ITOA 1RSCA 2ZC1A 3LLDA 5FF7A 2PLMA 1VPQA 2YZ5A 4XQ6A 4J3SA 4C6FA 2HE8A 4AHOA 1JAEA 4BHYA 2A3LA 2OELA 4J4KA 2WHKA 4HPXA 2RAGA 1AG1O 1MW2A 3E2QA 3KRSA 1K4HA 4NZ5A 3UP8A 1E3ZA 5I77A 2FGZA 4C6MA 2R14A 3HN3A 2GWNA 4W7VA 2AOSA 4H01A 5EYWA 1XC4A 3FYYA 4TVUA 2HPIA 1M04A 4ADUA 1TPWA 1GK8A 1A4LA 4PMRA 1GJWA 3B8WA 3TTQA 1ZTVA 1Q5MA 3QR1A 2QPUA 1OINA 1CGVA 5DRIA 1GHRA 1JYVA 3GU1A 1B3ZA 4JYEA 4Q33A 3NL2A 3TOYA 3L65A 3THUA 4IJCA 3C0SA 1C9DA 3MWCA 2PFHA 2KX9A 3BCFA 4HP5A 3VOHA 2VEIA 5CXPA 1AJ0A 2OWWA 3S47A 1HT6A 1AJ2A 4YCPA 1MXSA 1KKRA 3A3XA 4AMAA 5L9FA 1JUKA 2DT0A 1OGBA 2E28A 3W4RA 5FI8A 4URIA 3W70A 5AYXA 2HNHA 2FMNA 2AQWA 3TN4A 1VBHA 3MUZ1 1H1NA 5AFDA 2F9RA 4MMWA 3BGJA 5CCZA 3H2OA 3WBEA 5AC8A 4MY9A 3S1XA 3MUIA 3QR3A 2Y6ZA 3ITTA 1KFWA 3S1VA 2A2IA 2BY0A 4XK2A 5EFDA 1C7SA 2GGHA 3LBCA 4HT3A 5CPTA 3R79A 4JDBA 3NPVA 4PCSA 4E8GA 1HL9A 4JTIA 6XIMA 1ZAJA 1E73M 5AHEA 1YBQA 2PE4A 1QT1A 1HF6A 4IFKA 4JTKA 4NKCA 5BU6A 3GG1A 1UC4A 3L2IA 3GG7A 1TYGA 4RJEA 5FL1A 1W3LA 3HTWA 3CZEA 3O9NA 3QSRA 1UWQA 5A2CA 4N9CA 3BANA 4W5UA 3C2YA 1QOQA 2DSUA 3UR8A 4PN2A 2G4FA 4XZNX 3RF9A 1JRBA 1XYZA 2I14A 2Y5EA 2WV8A 5D4YA 2ZBTA 5C54A 3P80A 4J3UA 2H8ZA 1MEIA 4OBSA 2NV2A 2VQTA 1Q8JA 4A22A 4IWWA 3NVTA 1K8ZA 2QT3A 2PC4A 4GVIA 2Z29A 1BWKA 3MV01 1ZBWA 3N73A 3GXTA 4MVAA 1R87A 2QCDB 4LUTB 1ITXA 2I57A 1Q3NA 3FVDA 4MB5A 3K1DA 4OOUA 3W9ZA 3P7YA 3T40A 3O1NA 3WJXA 4HJWA 1HQTA 1AVAA 3WK0A 1XLFA 4PFHA 4NYYA 1VHCA 3UCDA 3WBAA 4L80A 2J47A 4QSHA 3VIJA 4M51A 4JFUA 5FJRA 3H8AA 5U7SA 3SI9A 3CIXA 1FWEC 5HWNA 4DHGA 2R24A 5D9OA 1C29A 1E1CB 1LG2A 2CW6A 4J2PA 2OOGA 2CLLA 1OFBA 4YCOA 1AH4A 4O14A 3RO6A 3TROA 3P5ZA 4U31A 2GDQA 4Z2KA 1H60A 4JS3A 1AODA 5LNSA 1SFJA 4CQBA 2E40A 3RO8A 3XINA 4PE8A 4GY7A 4CEXC 2HDJA 4RNJA 5G2WA 2C8NA 5HMEA 1A5KC 4Y2WA 1L6GA 3CZLA 2YA1A 4ACZB 2D2HA 3ABZA 4CNNA 2P88A 4PCFA 1H7PA 4H9VA 1Q7MA 2TMDA 1UA3A 4NZ1A 3OLDA 2ZZ1A 7A3HA 2WNWA 3UA4A 4PL1A 3UBPC 3MV11 1HP5A 1V6VA 3WD1A 4UFIA 4ERGA 3IJIA 6A3HA 3BG9A 4AWSA 4MJ2A 3VIPA 1SFSA 2Z6JA 3WBYA 1TELA 5I07A 3PZIA 4XZMX 2P0IA 3VINA 3O6AA 3VGFA 5DBTA 3GU9A 3KAOA 3SGZA 4GLEA 1R6WA 1UKOA 3IJ9A 3WJZA 4PYSA 1GKPA 2QCHA 4GJIA 1C91A 4W9TA 1S1RA 2X1TA 3FSUA 4AAJA 3IV3A 4RPQA 3FHQA 5I23A 4MM1A 4XAPA 1ITCA 1AK5A 2YCLB 1W8GA 2PDBA 3OB8A 1AL8A 1WOAA 1A47A 4YNGA 4U2YA 4GFIA 1LRTA 4H41A 3STEA 5HK4A 1AMYA 1KFEA 4F79A 1RJQA 3Q4DA 1TWIA 2WO5A 3LCXA 1KXHA 2NX3A 3MBFA 1JXJA 4WQ6A 1UH3A 4X2PA 5DQPA 2PDWA 4JICA 4L1WA 4JHZA 5A8PA 3P3BA 4TTGA 1L6SA 4UTIA 1A0DA 3BCJA 1YX1A 3RFAA 4ADTA 1I2PA 4AZ7A 4JTJA 3W22A 4Q4RA 3KVMA 1J11A 4C5ZA 2DUZA 4WJEA 4AD2A 2CWNA 5F1UA 1QOXA 5HJYA 1N55A 2WMIB 3TR9A 3VKDA 4Q32A 4K6AA 3QM3A 2J7BA 1KM3A 2PDLA 3PBYA 4FEZA 4UR7A 3WF1A 3MBDA 5D05A 2WAGA 5CPSA 4J7RA 3A3WA 4UNKA 1E1FA 1BXNA 3W7NA 4LPCA 1Q6LA 4KF1A 1FH8A 3N2XA 1RQHA 2V69A 3OJGA 4GKTA 1Q7QA 3W7KA 4GPNA 3CUHA 3W72A 4K8GA 1RD5A 1NM9A 5BXTA 4Q4PA 3IGUA 3WNMA 1UWSA 4LRTA 2VDGA 4CKQA 1VJIA 4AF0A 3I3BA 1GVQA 2QDGA 3QXBA 3W88A 1I0DA 3C6CA 4ORIA 4NX0A 2WQPA 2RGLA 1UQYA 1BWLA 5DXYA 3SSZA 3CUFA 8A3HA 3JW7A 1MNSA 1XI3A 3A22A 3E0VA 5A2BA 4JNMA 2WLZA 2WC4A 5JMUA 2G41A 5C9ZA 1TKKA 1N8FA 1NQKA 1V79A 2CYGA 3CUZA 3BMVA 4KPLA 4O4WA 1KGUA 3HU7A 2PDFA 4A3YA 3EXRA 3V18A 4D6HA 3EDKA 2R1PA 3I6RA 3FA3A 1Z42A 4QITA 4O0QA 2XIJA 2IPFA 1V0MA 4C6KA 3GKFA 3RK8A 3E2VA 3THCA 2CBVA 2X0SA 3IJDA 3NGJA 3W2KA 4L5ZA 3G1AA 2QJJA 2I7GA 1TJ2A 4IGNA 1OK6A 2CBIA 2ABAA 3IUHA 3L4UA 3AS2A 5I03A 5FJIA 1B1YA 2ZDRA 1XGEA 2YX0A 3T0CA 5REQA 3FFSA 3IJ7A 3WLPA 2VRJA 3W7HA 3LK6A 4Q4QA 1RBOB 4AZIA 3NL5A 5FF0A 1J8VA 3NXFA 3GSMA 4MJMA 4MLJA 2ZUMA 2RH9A 3FK4A 3O6CA 2J77A 5A2AA 4GK8A 1QWGA 1O4UA 4MYAA 1WXJA 4HHPA 3ZLFA 3QEZA 2VFEA 3GHSA 3OHMB 2XVNA 3M0IA 3NXLA 5BRPA 1FWWA 2QYGA 2WCAA 3WIJA 4UQAA 2ZZ5A 2P76A 2A5HA 3EKZA 4R5EA 4Z1BA 2NUXA 3ONCA 1EC8A 1SW7A 1FA2A 1L9WA 3CLWA 1JFHA 2BODX 4AISA 4O11A 3RLHA 1Q4NX 4HBKA 6TAAA 1O68A 4AZGA 1F73A 1VR6A 3VGDA 3FXYA 3RGTA 4W7WA 1OFOA 1PKNA 4DZAA 4DYJA 1VB9A 3FY1A 2I9EA 3UPMA 3R25A 1LOQA 4FLQA 4C6LA 1AH3A 2V63A 2YYUA 2ZRXA 3EX3A 1SYTA 4V1XA 5FL0A 4TX9A 3LPPA 1EPXA 3WJSA 2BVYA 2OT1A 1OYBA 3THAA 4UIOA 4FK9A 4DBSA 1SGJA 2YJQA 3EPMA 3LXBA 3HQNA 4M19A 1CXHA 4LFYA 4TMCA 3SCVA 1GNXA 3VVGA 1MRQA 1LCOA 2OXNA 2FH8A 3O07A 1FWGC 3FW6A 2VZTA 4G1NA 2DDXA 3GK0A 4GMEA 1WX0A 4N7QA 1ONRA 1QPRA 3N9KA 2EEXA 3CH0A 3AZRA 4Y90A 3STFA 4Q4OA 2DQXA 4D9PA 5KINA 2V5JA 5H8MA 3VOFA 2PDNA 4S1FA 4YMZA 4GBUA 5AC4A 3VE7A 1EJRC 4PUNA 1O12A 1W5QA 4I3GA 1ISVA 1DPMA 3PBVA 4HNLA 4A05A 2NLIA 2BY3A 1QU4A 1K8YA 2YBVA 4MNMA 4FSAA 2VC5A 2QJGA 1E72M 4ATLA 2OPJA 4B4HA 4GQRA 1XDLA 1YHTA 3GFYA 5TBOA 1XIJA 1Q2SA 2DZBA 1H11A 1IQ8A 3R0UA 4DPPA 4H2HA 5FESA 2FZNA 3VNMA 3W7RA 2ZXBA 4GH3A 4W8BA 4KIEA 1I45A 4F9JA 1W5PA 2B7PA 2ZADA 2GVEA 3BG5A 3SZ8A 4PUMA 3AXXA 4MLRA 4JKKA 4Z2LA 3SY8A 3B04A 4O57A 5E5CA 4V33A 5G4WA 4UNIA 3DEQA 2WBKA 1E5JA 1LWHA 5CBIA 3CGTA 3PZTA 3H7RA 4UTKA 2A3BA 2G37A 3EDFA 3DX5A 3WUGA 2PDMA 1PZ1A 1TZZA 4OTKA 1EDQA 2QUVA 4MY8A 4PMXA 2HBXA 5G4HC 4Q8QA 4L9YA 4Y7EA 3UNTA 1JDFA 1YNPA 3P2VA 1XICA 1B3XA 1JGMA 4QJ4B 3SDOA 2J7EA 3IGSA 3REQB 1CW2A 3GKAA 2NSXA 1SO5A 2XTKA 2X2GA 3C2EA 3GHRA 1P0NA 3WQPA 1TMLA 1VEMA 3R4IA 3TSDA 3RR1A 1XLLA 1O6IA 3M0ZA 5PTDA 1VFSA 4IUGA 3O7UA 2E8YA 3RM8A 3W74A 4CD6A 3OO2A 3QZEA 1VIWA 3UWVA 4C6OA 5K4XA 2J7DA 4HNCA 4AB4A 1XLMA 1E4IA 5FJUA 3ITVA 1FHVA 4OHQA 4C6EA 3GH5A 4UNLA 3VX0A 5CC6A 3O2LA 4HU4A 1XRVA 3RX4A 1N2VA 3STGA 1EIXA 3S2JA 1C8QA 5AYYA 2DEPA 4QAIA 1V08A 4I5RA 3TC7A 4JTTA 3RXZA 3W7DA 3VGEA 1BYDA 2VUNA 1KV5A 5F2IA 3IWPA 3N2TA 3AHVA 4ZO9A 1J0JA 1NDVA 3JUGA 8RUCA 1R3YA 4YVPA 3UCCA 1DE5A 3R8RA 3LPFA 1VHNA 3FXGA 5I3GA 4ZMGA 2ALDA 3OW1A 3QQWA 5GVJA 4Q6JA 4Q4MA 1ISXA 2VENA 4AD5A 3TW7A 8TIMA 3EPNA 3S3GA 1EO5A 4PBEA 4RL3A 4RX0A 3UXDA 3BW2A 5MHBA 2H3DA 1OC6A 3NIYA 3S42A 5DEZA 2PRMA 3O6DA 4HCLA 5D02A 3F1QA 1A3HA 3LG3A 1EGVA 3U5UA 4HNVA 3W83A 3OYZA 3HBLA 3L4TA 3BW4A 3G1FA 3HV9A 4JDYA 4UMAA 4QG9A 5HNRA 3E2SA 1QFEA 3HF3A 3LM7A 3TYZA 1PHWA 4K8HA 1M6JA 4S23A 2PSNA 1EF2A 3L12A 1P7TA 1ZGDA 3K8MA 1LL7A 3VILA 1DQWA 2X16A 2D2OA 1Z69A 4X9YA 2PCQA 1TJPA 2FJUB 1EYWA 3FOKA 3NA8A 3OP2A 3VUPA 3PZQA 1B3YA 1WDWA 3SCRA 9CGTA 2PWEA 4LY4A 2ZQ0A 1Z32X 2YYTA 2WVUA 4PBFA 7REQA 1U33A 4ICNA 1P4CA 5I06A 5C9XA 1O66A 1REQB 3H22A 5AOUA 3BUVA 1TV2A 1TWDA 1S5WA 4KGJA 2YB4A 4P2VA 3G6LA 3M5ZA 3H4WA 4O17A 3MSYA 4RV8A 5F4WA 1UMLA 1Q6QA 4H8VA 4CN1A 3S1WA 1A5NC 3GTFA 3VO0A 2GGIA 3DYMA 1PVNA 3ANUA 5DFAA 1GVSA 4DN1A 4IX2A 2WWDA 3PSVA 1UWTA 1XXXA 3EEZA 1XDJA 3BXWA 3DHUA 1W9BM 1YRRA 4X22A 1TV4A 1P48A 1TMQA 4PUKA 2Z27A 1YDVA 1F4HA 4KFPA 4AY7A 1YXDA 1WDDA 1XC6A 2ZKMX 4EF8A 3L68A 2VXNA 5TD4A 2YW4A 3LLFA 4ZR8A 3TQ0A 2JEPA 5K3VA 2E6FA 4GZEA 3HG4A 2J25A 1X7IA 3HJEA 1JDEA 1P0KA 1SJDA 2IXUA 1ZAHA 5LYRA 1HL2A 1MQQA 2JF6A 3EA3A 4JTGA 1IEXA 1W3KA 2E8ZA 1LOLA 4KCVA 4DM1A 4JEJA 4OWGA 4MZ1A 4KWOA 3CWNA 3W7GA 1MEWA 3F4NA 1TX0A 1EDTA 3W38A 2WOQA 3BLPX 4JTQA 4HMNA 4R33A 2INFA 4LUSA 1KM0A 2RDTA 1GKRA 1T99A 2QR6A 3ME3A 3T8QA 5D38A 3TW6A 1DWIM 5G1YA 2UY2A 2ZX6A 3AIRA 3B0YA 3PBWA 1SR0A 4LB4A 1I9CB 3SRKA 5DMMA 2JF7A 1T6MA 2HK0A 2Q6ZA 4XD3A 1W31A 2FGBA 1XG3A 2REQB 4B15A 1IR2A 4Z1YA 4AXKA 3WD2A 3TJLA 1Q13A 5B7YA 2WANA 2BTMA 3DC0A 3AHZA 4C1NB 3MSGA 3UT0A 4ZGYA 3VNZA 1VYRA 3GU2A 4WY0A 1PX4A 4PA8A 3GVVA 2DZUA 1SO4A 1BXBA 4D6GA 2BHZA 2GJXA 1K77A 2GUBA 2RGMA 3NQVA 3E3HA 4IMFA 3W75A 4DUXA 3LI1A 3GE7A 4XAZA 9XIMA 3T2QA 3AJXA 2Q3OA 3T0BA 2R8WA 1K03A 4K8EA 4MWAA 1GJPA 3LHTA 3MJMA 1FWJC 3CM4A 2A6NA 3O06A 3D3AA 4L6DA 1RPKA 1IIGA 3CQ0A 3GAKA 4QTGA 2WYSA 3T9PA 4KRUA 5BYWA 3RJXA 1OX5A 1XCFA 2UY5A 3F5LA 1EQPA 3CUGA 1B5TA 5FCZA 5I24A 1L2QA 6ENLA 2VM8A 4CD4A 2OQHA 2ZWYA 3PAJA 3EWZA 3N6HA 1LBFA 1ALDA 1A5MC 2Y24A 3H2AA 2EG7A 3VU2A 2Z0IA 2UY4A 1OWQA 2JKAA 1F6KA 4XAYA 5I02A 4UTJA 3MI2A 2PTZA 1D2KA 4O18A 4M7SA 1XLEA 1J4EA 3ZOAA 5ENLA 3RITA 2D23A 2ESCA 3BJSA 4IICA 4JTSA 3CXOA 2Y7DA 3CT2A 5A6BD 3APYA 1SW3A 4UCGA 4IHCA 3NSNA 4AY1A 3EXTA 3CS2A 3CUIA 4MG4A 3LEPA 2VJXA 4F0SA 2WMJA 2QDHA 2C19A 5CJMA 4GC3A 4B90A 2BG5A 1CT5A 3NDYA 1A53A 5IXEA 2ACSA 3PC0A 3SIZA 3DG7A 3M5YA 3FX4A 1PX3A 3UY8A 5DMLA 2L5HA 2Y5SA 5HJXA 3UD6A 4XO6A 3KLLA 4L4OA 3AFBA 1OFPA 4QBXA 3SUUA 4HOXA 1ZLPA 4LGXA 3SRDA 1H51A 3TMLA 3VZZA 3CUXA 3WF3A 4LUJA 2W27A 3CZKA 1QI4A 3Q45A 5A6BA 2QMKA 3Q2DA 4WX2A 3GXMA 4BEUA 4BQ3A 1W9VA 2RDWA 2V82A 1X97A 3LBOA 4LCRA 1GQKA 1Q8AA 3WNPA 3OBKA 3GDTA 4I9MA 3WLIA 1X8CA 1S5TA 4N6FA 4U2ZA 1ODZA 3TC6A 5DT5A 1IT8A 1CLXA 2E3ZA 2QV5A 4IQLA 4O8RA 1MXDA 3IAPA 1DP0A 3BARA 2Y85A 3DESA 1XKYA 1KCKA 4Y9PA 3WL0A 2X42A 3QKZA 1VFUA 1CGXA 1ZRQA 3PUEA 1UJPA 1YBQB 3KW3A 4AUBA 3MMTA 4IJRA 4AWTA 4NY2A 4IFKB 1EGZA 2W0UA 3UNDA 3EEGA 2ZZ2A 1XYBA 1IWPA 4PTMA 1EEPA 2OZ8A 4LVGA 4D6JA 1P6BA 3QBUA 4BF7A 4JTDA 4FNTA 1V0KA 4QE5A 4H6EA 4QCFA 2ZRZA 3UXIA 4LF1A 4L1XA 4M1RA 3TFXA 2VGBA 4GI6A 1ITUA 4LALA 3RLGA 4ZTYA 1XLJA 4RZ4A 3QPYA 4PTNA 2PGWA 4EIVA 1TTQA 4I6VA 3GQYA 3PTDA 1FP8A 2B4GA 4XTDA 4L4PA 2QJHA 3GXDA 1Z48A 3UG5A 1CYGA 3LYEA 3KBMA 4LTSA 1BKHA 4JY9A 3SQSA 1NFPA 1A5OC 4ZZ9A 5L6UA 3GO2A 2EHHA 2C1HA 3I6EA 4TTUA 4D6DA 1V0LA 3POHA 3S2LA 5GNXA 2X1UA 8XIMA 2V6AA 3WLMA 1OD0A 4MZYA 2BASA 4AD1A 4UWMA 3IJ8A 4H00A 1C92A 3ENLA 4K3ZA 1XBVA 4QNWA 1RY0A 2VC6A 1KM5A 2X40A 1KFLA 2QPSA 3ES8A 3LN3A 3N1AA 1LL4A 3HM7A 2PB1A 4YVVA 5J8LA 4GVHA 1EOMA 4E2BA 1Q6CA 2FMOA 3MZNA 4ZO7A 1EA9C 4F2UA 1TJRA 2OZ0A 1GOOA 3UG8A 2V5BA 4QLKA 1UHVA 2GOUA 1AQ0A 2RJHA 4ML4A 1JCLA 3UESA 4LF2A 1UCWA 2PGRA 4AX7A 1PX8A 4AD4A 1ICSA 2CEQA 3TYUA 3CT7A 3VKBA 1DQXA 4N9EA 1UZ4A 1XIEA 1R2TA 1UR9A 1H63A 1RBLA 4GVGA 4BF5A 3IGXA 3GTIA 2YLAA 4C5YA 1EB3A 1E15A 4TUFA 1DQUA 2HQAA 4HCHA 4QISA 4LYPA 3RDKA 2WSPA 1YPFA 1YQ2A 4R88A 4IPPA 5IDZA 4DYEA 3G22A 1EZWA 3KDOA 2QQ6A 4OIFA 1TWZA 4H2CA 4TIMA 3PNUA 1QI0A 3W6LA 4B2DD 4JIHA 1A5BA 5ABGA 3PFMA 4DXVA 2OO6A 5HOSA 1QI2A 4JYFA 4HA3A 5BOFA 1GTEA 3MUCA 4RZ6A 1YW1A 2XVKA 4FX8A 1ADSA 4LW7A 3OHIA 3HGOA 1B3OA 2X8RA 3PULA 2WLYA 3I65A 1WOBA 2J9YA 3AOFA 1RXOB 4PB3A 4JIQA 4CUCA 1G4PA 3WH6A 1EHAA 4G2DA 2EPMX 3COTA 2PP1A 3RM9A 1TVNA 2W3ZA 4B2DA 3LCGA 2BXYA 1D8WA 1JCNA 2FB3A 5CSYA 4IMGA 4NL1A 3OG3A 1JAKA 3BLFA 2QGHA 1VRDA 1FWTA 4JZ5A 2DORA 5F7UA 4U28A 4JQ1A 1AD1A 3V3WA 3ARTA 2CLHA 4L65A 1K6WA 2WK2A 4CCZA 3JR2A 2Y8KA 1BEUA 1NSJA 2E6DA 1TWWA 4R7OA 2XN0A 5H2ZA 1YYAA 2QVHA 4UTWA 3U2EA 2JKPA 3L5MA 3CV2A 3T0TA 3ZFHA 3TA6A 1W5MA 1V6UA 3BV4A 1HL8A 3OVRA 4DBWA 3S2MA 2YXOA 1JQVA 3UWQA 4ILSA 5ECUA 4LUYA 1TRDA 1T7LA 3CWHA 4WR3A 1KQYA 1BYBA 3M0LA 4LC8A 1E3XA 3VABA 2Q02A 3B8DA 3GFZA 2RFGA 4RPPA 4UQDA 1K7EA 1PTGA 1GZGA 1SMAA 3TYEA 1B4KA 5C5YA 3TE9A 3PBUA 3FJNA 4QX4A 2GFTA 4P7NA 1OBAA 5JBEA 4AF0B 3WFLA 3APTA 4HYRA 1N7KA 1PJ9A 3NM1A 5AB3A 2HEJA 3WLOA 3GDLA 4GWEA 2GK1A 4WIWA 4DM2A 1UIPA 3FCPA 2WSYA 1QI5A 3SECA 4MAZA 4Z1AA 3VGBA 3BAIA 2C1IA 3G0SA 2FYMA 3KBNA 3ZIZA 4IGHA 4M81A 1XIBA 3GY1A 1CDGA 1K3UA 3QY7A 1MUCA 4TX8A 4YIWA 3IIXA 4KEZA 2J75A 3TLQA 4BCEA 4UTWC 1OG0A 3MJYA 4RE0A 1LORA 4I7VA 5C2GA 4HVXA 1QXLA 4AIEA 1OIMA 4R9OA 5HNUA 2HJPA 1THFD 1R2RA 2EPHA 1UUOA 4WK9A 4Z0JA 2O9OA 5HR7A 1FHDA 4OBRA 5BRQA 2IQDA 2VFGA 3JZUA 3CAKA 2PAJA 2Z26A 1SFLA 4IFRA 2FTWA 5REQB 4X61A 3UR7A 3WLNA 3N11A 2GOKA 3GG8A 4NXKA 3WQFA 3MVTA 1WE5A 2EPNA 4HNOA 4ALDA 4G56A 3E96A 1XYMA 3VAVA 1UJQA 3GHUA 2JIEA 4LRSA 4AEFA 3C0QA 2CHNA 1OHLA 4S3BA 2NX9A 5D09A 1XGZA 3FJ4A 2Y0FA 4JN6A 1Q66A 3EOUA 3UU0A 1JZ6A 1OT1A 4NI8A 4LUIA 4XUGA 3KOFA 3EX2A 4PRRA 1XRTA 1KBJA 1SR9A 2DVTA 4IP4A 1OQFA 1V6YA 2Y5JA 2WCSA 5LIUX 1XIHA 4HZ6A 2E25A 1QNPA 5CLWA 3ARXA 3AALA 2PF0A 2NVDA 3BJTA 3P6LA 2PD5A 4FF7A 3UJFA 4JTLA 4LVBA 3GIPA 5MF5A 3L4WA 2CITA 3CO4A 2HXUA 3NM3A 2ACQA 3ISIX 4IPIA 4A3HA 4ZE5A 1O95A 2ZRYA 2E5CA 3VPLA 4KRZA 4JFSA 1JCXA 1A0CA 1YXCA 2O9PA 3EA2A 2HK1A 3A4JA 1QASA 3KM8A 3B0PA 4DNMA 1J01A 1QPKA 3W73A 3CHVA 4C91A 1CGTA 4FAMA 1MZRA 2P10A 5AHLA 2YXGA 4O16A 4PUWA 4FIQA 4F48A 4F40A 3NQ8A 1XL9A 4NRSA 3E49A 3UJ2A 1FWIC 4I6KA 5J5RA 1HKJA 2CZVA 4GUIA 1KM1A 1E55A 2D2GA 3V0TA 5AZ0A 4EXAA 1PTAA 1Q7ZA 2J4GA 2ZZ3A 3U2ZA 1M01A 3BQ5A 5CKSA 3W6MA 3GNRA 3O8AA 3OQEA 2OGJA 3QYQA 2GSJA 3BCDA 4XZHA 1UC5A 3DFOA 1NF7A 2XGIA 1W3IA 1W1VA 4NQ1A 4XD6A 4PUDA 3VUSA 1QAPA 3TAOA 2WJDA 1HFBA 2IKIA 4ENLA 4UFLA 1GEHA 1QTWA 4JD4A 5LXEA 3NPUA 3V4BA 4QEEA 3C4UA 1JL8A 1M7PA 4EK7A 3QYSA 3MT1A 2EKGA 2I5QA 1B9ZA 3TZFA 3QH2A 2VNCA 4KWUA 3TW9A 1JZ7A 3CPRA 4GUFA 5CPLA 3ZWTA 3AZTA 2WHMA 3FKRA 1F8IA 4H9UA 3C8NA 2J66A 1W8SA 4ZODA 1EWDA 3L9CA 3XISA 5KITA 5C7HA 3NUKA 4E4PA 3EMCA 4ZO6A 2DT3A 4X2RA 4MTVA 2INZA 1HKMA 2GSHA 3GXIA 1ZBKA 1TX2A 2RKXA 3AMLA 2KAUC 2OWXA 3AXIA 3B06A 4Y96A 3EDDA 2JGYA 1J2BA 3AUOA 1L0PA 1M1BA 4JFVA 1PIGA 3TR2A 3VTRA 4ASTA 3T07A 2QULA 3UEQA 2EAWA 1OT2A 3LGDA 3PJTA 1E6NA 1TSIA 3VNDA 1P0EA 5GJNA 1GOKA 4LBUA 1DKWA 5KZ6A 2EBNA 3V0UA 2ZIDA 4N0RA 4NVTA 5HJLA 4PMJA 5D2TA 4D8ZA 5HANA 4X63A 3DOPA 1Q6DA 1VKFA 4GGHA 4JL1A 3O05A 4O0ZA 1EP2A 3T6CA 1G4SA 4OFCA 1HN1A 2Z1VA 3A4WA 4J5NA 1E0UA 1IEQA 3T08A 4EKJA 3SUVA 3NWRA 4A8IA 4QSFA 3A9IA 1PZ2A 3H7UA 2A3CA 1B4EA 2QUMA 3HV8A 3HMJG 1X1OA 1FKWA 1QHOA 3B9DA 1CXEA 2Y88A 3TSBA 3WQ6A 1FQ0A 2X30A 1KM2A 1NDWA 2QJIA 3DFQA 1W1ZA 3OQ8A 3TNOA 6TIMA 3PFRA 4DUOA 4U5KA 3K5XA 2XZ7A 4FLRA 3AUJA 4CEUC 3QY8A 2ZOXA 1E5NA 3CWOX 1W1PA 4RW3A 2OEJA 4ZB5A 1WKFA 4PCTA 3HQOA 4S2CA 3VC6A 3N2CA 3PN8A 2NQ9A 3MS8A 1AQFA 4JQ2A 2G3FA 1PHQA 2XH0A 2ZC8A 3W1NA 4AHQA 1EO7A 1FH7A 2Q8ZA 4ZCWA 1FFRA 6REQA 2X05A 4GINA 4RUBA 2NUYA 2D3NA 1HGWA 2NXGA 8XIAA 3SAZA 2Z1BA 3S1UA 1TR9A 1V8EA 1ZQ5A 4GCAA 3NO5A 1CXLA 5DX7A 5LNUA 4CCCA 1P7TB 3FKKA 2PPGA 4V1YA 4PMNA 4YHGA 5BOEA 4A8NA 2QUTA 1L8PA 4DRSA 4NSBA 1F6YA 2OLSA 1M7XA 5H6HA 1TPB1 4KT2A 3P74A 1OFEA 3GXFA 1E71M 2E9MA 3B05A 2QNEA 3C2RA 4GI9A 2QCGA 1EA0A 3LI0A 2Y8UA 3URQA 1C8XA 3FNDA 5EY5A 1IE7C 4UQEA 1XFCA 7REQB 2BV9A 1S5VA 4UTLA 3LGGA 4A29A 3CTLA 1PBGA 1GVIA 1J10A 1HKIA 5I3HA 4HPHA 4Q6XA 3KVLA 3T55A 2XVGA 1YIXA 2Z1SA 3W7LA 2C0AA 1E4MM 4LCSA 1W32A 1UBPC 3KBVA 4S3DA 2IW0A 4DJED 4LAUA 2VQUA 3VD9A 3ARRA 5AN7A 2XSAA 3SGGA 4RE3A 2OWCA 5AYBA 3LXCA 2J9XA 3NQ6A 4WZHA 3BVJA 4LEFA 2EO7A 1TWSA 2I56A 3GW3A 1HO4A 5BXSA 1XSJA 4G1KA 2WB5A 4F3HA 3WN6A 4AVFA 4GIAA 1O7AA 4HOWA 2BWGA 1NY1A 1I1XA 3SUWA 4AIBA 1BYAA 3B0XA 1BSIA 2CWXA 1KCXA 3SM0A 4XZ9A 3DKLA 3W1RA 3MO4A 1X96A 1PXGA 1RCXB 5KTLA 1QNOA 2CXGA 1E9IA 1UWIA 3S5SA 4N9DA 4DXKA 3USBA 5AHIA 3WELA 3TEVA 4DJEA 1XH1A 1YXYA 3WMCA 1XR2A 1BRLA 1R9XA 3PVFA 4WRHA 1US0A 3PJXA 2E6YA 2HTMA 2XJ7A 5A6TC 1VEPA 4EAMA 1WYIA 5CPOA 2VFDA 3ABRA 3KZSA 7PTDA 2DUXA 1FY6A 3CO8A 3BLDA 2AQOA 1JNEA 4JQAA 4IPLA 4PMUA 2VD8A 2AMXA 4GABA 3M44A 3PZGA 1D3HA