3LTYA

Crystal structure of the mutant v182a,i218a of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with inhibitor bmp
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
214
structure length
214
Chain Sequence
b'DVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGAGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGAIESIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
molecule tags Lyase
source organism Methanothermobacter thermautotrophicus
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: "remote" residues that stabilize the active conformation.
pubmed doi rcsb
total genus 82
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2010-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ltyA00
4BI5A 3CWNA 2KZHA 1KBJA 3LHTA 3T44A 3YPIA 1PL9A 3HGRA 3TAKA 4JGDA 1HUVA 2J24A 1OF8A 2FPTA 3KVMA 1LP6A 4OT7A 2WV8A 1OFDA 1VQTA 2R94A 1ZENA 3LCWA 2QCHA 1TYGA 5KSWA 3MI2A 2Y88A 5D30A 3MP5A 1PVNA 2WKJA 2GQ9A 2YX0A 1Q6OA 3DXIA 5G1TA 3TW6A 3HMJG 1WAUA 2C18A 3L0NA 2NXGA 3TH6A 3N2XA 1X6UA 4KFPA 1MSSA 1ZALA 4RZ5A 3BLFA 3GIYA 3VE7A 3L5MA 3FEMA 3E49A 1UBSA 2Z6JA 3F4WA 1W5MA 3QMRA 1JUEA 1JRCA 5CG7A 3RFAA 4K8EA 2YW4A 3W74A 4Y6GA 1W56A 4DO5A 1KLZA 4WX2A 5D05A 4QISA 4KKXA 4O1AA 4UTTC 1T0OA 1W5PA 1VLWA 1LOLA 4AXKA 1X1ZA 3T55A 4FIQA 4BK9A 1H7XA 3T40A 4N9EA 2QKFA 1JCMP 4LVAA 2Y7DA 5AYYA 4EWND 1O5KA 1G4SA 2GJNA 1RQEA 4WZHA 4XBSA 3W7KA 3M43A 2CLIA 1RQBA 3QSTA 4U4MA 3S5YA 2QCCA 3C2FA 1X7FA 3TSBA 3W7HA 3DBPA 3L0GA 4Z1AA 4JX4A 2X1TA 4ZL1A 2BTMA 4AEOA 5IBXC 1VHNA 3HF3A 2ZZ2A 3W2KA 2ZRYA 2G96A 1IF2A 1A5SA 3KXQA 4JDYA 3LHZA 4HN4A 1LRTA 2PRMA 4LRSA 5AC7A 4IX2A 1M5WA 1SFJA 1TTQA 5D09A 1KM5A 5BMWA 3PC0A 1H60A 2XN1A 4N9CA 3TXZA 1VCGA 6ALDA 5F2IA 3PBWA 1GPWA 1EX5A 4QAIA 2ZZ3A 3PB2A 1RVGA 4YLWA 1LRQA 3JR2A 4HNVA 2LLEA 2QCFA 3W1NA 3GB6A 4KWWA 3SW6A 4X9SA 3KRSA 1F6PA 3KVKA 4NJGA 2QCEA 3LHUA 3SGZA 3GXPA 2FLIA 3A24A 5AHMA 4JTJA 2AQWA 3HB9A 3E02A 1OHLA 4NUWA 4RX0A 4IMCA 4O4VA 5FI8A 1MO0A 4WD0A 3TFCA 1C8VA 5D2WA 3THAA 3BW3A 1AW5A 4UFMA 3C2RA 4R33A 3SGUA 2OX1A 3I65A 1TMHA 4GXMA 2V2HA 4DF0A 2TMDA 4UTHA 5EMUA 5LNUA 3QRHA 4EIVA 1QO5A 3T78A 3WJXA 3P62A 3O15A 1GG0A 5F1VA 4CCEA 1SSDA 4MFDA 2HTMA 4GE8A 2A85A 3NQ6A 4ZQCA 2DORA 3GKFA 2Y85A 3LXCA 5LGXA 1AW2A 3G0UA 2V9DA 2VFFA 3GNNA 3H55A 2NZLA 1KM1A 2O7QA 3O6CA 3NNTA 5DY3A 3OIXA 5L6UA 4DPPA 4TIMA 4KFNA 2A21A 2QDGA 3SFKA 1OFPA 3W2UA 1SQ7A 4BWLC 1HO1A 2JKAA 3S0CA 4LVDA 3ELFA 1YYAA 1LLZA 2DZXA 4S2BA 3HPZA 2FPYA 4FO4A 4TMCA 2C13A 1U5JA 2F7FA 3QFEA 4O57A 2QCNA 3BG5A 3LRLA 2QJIA 4LS0A 3G3MA 1C29A 1UB3A 1YPIA 3S6DA 4E2BA 3S1VA 3LXAA 3S1WA 1HO4A 3PM6A 3A22A 1OABA 3I6RA 1F2JA 5AHIA 2DZPA 2QCGA 5G2WA 1OX4B 2ZYFA 1JCNA 3PAJA 4ADTA 1D9EA 2DJLA 3JRKA 3FS2A 2A5HA 1XCFA 1XI3A 2EF9A 1G6CA 5CSRA 5I3JA 3OBKA 3W1AA 5AYXA 5SWUA 1SFLA 4JYFA 4ALDA 1L6WA 1XKYA 1W3IA 3LX9A 1IIHA 2ZRXA 5FF3A 1ZJIA 3LBCA 2QR6A 1OX4A 4UTTA 4RCXA 4IOTA 3BG9A 3B0PA 3P7YA 4LY8A 4BI6A 1F73A 4E38A 5DCDA 5CSSA 3P5ZA 5D33A 3TDFA 3WK2A 5TQLA 1THFD 2OT0A 2X1SA 3SR7A 1QCWA 1EB3A 3THQA 1SR9A 2OCZA 1U83A 1W31A 3W1MA 1WBHA 2PRHA 4FNRA 2Y7GA 3VNDA 1YADA 1ML1A 4GNJA 3DI0A 2V2DA 3RF9A 3GKAA 2EPHA 3L65A 2A0NA 4JEQA 5D04C 4UTUA 1OJXA 3M5XA 3TW7A 3IVTA 1FDZA 1K8ZA 3DAQA 3W84A 5DN1A 4FF7A 2FTPA 2ZFAA 2ZZ1A 3C2OA 3C56A 1FY6A 1XM3A 2FDSA 3HPXA 3NM1A 4QNEA 1VLIA 5FF7A 1NAL1 4MJMA 1F76A 4ADSA 2G5WA 3TQVA 3UY8A 2NWRA 1T96A 4UMCA 2ZTJA 1QOQA 3UZ5A 3SY5A 5BOOA 2TRSA 2ZZ5A 3W1RA 2VFIA 4LS1A 1R2RA 5I3HA 1VYSX 1TV5A 3DFTA 1KM6A 1TCDA 4X22A 5HMSA 5K2ZA 1O95A 1Z48A 2BLEA 3EEGA 3PG8A 1OFRA 3M5YA 3NQGA 3PVFA 1LM1A 4CLMA 2G97A 3O1NA 4R34A 4LVFA 3TA6A 7TIMA 4FNQA 1W37A 2RKXA 3DENA 3KFTA 3C61A 2Y7FA 2JGQA 3Q58A 4NNCA 4FNTA 1H50A 2HMCA 2CZEA 2YXGA 3W7JA 2X1UA 1P0KA 4KWVA 1QR7A 3MHFA 1UUMA 3DKLA 1FXQA 3IVSA 1S3HA 4MZYA 2YYUA 3KAOA 4DBDA 4NJJA 4OV4A 3L9CA 5U7SA 1KW1A 3Q94A 3T4CA 5H91A 3USBA 5A5WA 3N9RA 4RXGA 4FHAA 2CFFA 1K7FA 4K8HA 3OVPA 1I2OA 3V75A 3CHVA 2C1HA 1I4NA 4H3DA 2QCDA 3BLIA 3IEBA 2OZ0A 3NQDA 3W75A 4HNNA 5D2VA 3TFXA 4M5PA 4MUZA 1I2RA 3LHWA 4YCOA 4UFIA 2DP3A 2J6XA 4AWSA 2P1FA 3FA5A 4O11A 1FWWA 1DJQA 1W5QA 5GVJA 3QQ1A 2AGKA 4XKYB 2NV2A 2QCDB 2CLMA 1K7XA 3NPWA 3EKLA 1G4PA 5DBUA 5LNRA 2RDWA 4NNAA 1CW2A 5E93A 4Z0JA 3FJ6A 3NPXA 3O06A 4B5NA 1I45A 1AL8A 1L2UA 3ZR4A 1YTKA 5A8GA 5DBTA 1LCOA 4Y9AA 4BR1A 3B06A 1TREA 3PWAA 3CEUA 4AB4A 3GDLA 2QCMA 3F03K 4AWUA 3A5FA 2NUXA 1XC4A 2ZTKA 3S5OA 1FUYA 4ML9A 1AL7A 3QMTA 4N2YA 4RZ4A 5HUOA 3W3OA 2YGYA 3M9YA 5CZJA 3STGA 3STFA 2Y62A 3GR8A 1SUXA 3LTYA 1FBAA 3MHGA 4PL2A 1KA9F 3HJZA 5K7JA 1JULA 3C0JA 2H6RA 3W1PA 1LTDA 3L0KA 2VEKA 1K02A 3MBFA 1KFEA 3SJ3A 2C16A 1A53A 3WJSA 5HINA 4UIOA 4JX6A 3W86A 4FNPA 1JCJA 3H54A 3TV8A 4TO8A 2FQIA 4XUGA 3NA8A 2Y63A 3GDRA 3UXAA 1AW1A 1J4EA 2YR1A 1SW7A 3M5ZA 4WY0A 3GXTA 4O4WA 2ISSA 3UWWA 2X2GA 2E6YA 2H8ZA 3LBMA 4IPJA 4YCPA 4S1FA 5BNKA 4CCCA 4LS2A 1FWRA 4BI7A 3BPWA 1Y0EA 2ABBA 4WY0B 4HNTA 3B4UA 4ZQMA 5K9XA 1TPH1 1SO6A 4XQ6A 3M44A 1AK5A 3TQKA 2ALDA 2WNNA 3M41A 3NQEA 3CEPA 1G69A 2CZFA 4LUIA 2FJKA 4P2VA 2DZSA 3S9YA 2CLLA 2WSRA 4BFAA 1B9BA 3WJYA 2GQAA 1FXPA 1MZHA 3AO0A 1Q45A 3N9SA 4UTIA 4IX0A 2E77A 3FYPA 4Q33A 3QMSA 3GZ3A 1SZEA 1SU5A 2ISWA 1IXOA 2HSAA 2PE4A 4O53A 3DFQA 1F05A 3I7QA 2B7QA 3ZS4A 4UNKA 4MFEA 1FDYA 3P74A 3P84A 1XL9A 3OA3A 3B03A 2CZ5A 4O50A 2YPIA 3B04A 3N3MA 3QM3A 3PB0A 1QMLA 1VYRA 3HIJA 3NOEA 1P5BA 4E0CA 3TJXA 1ME7A 4IUOA 3HQ1A 5HWMA 2FB2A 4A21A 1W3TA 1LBLA 3UWVA 5F2GA 1TIMA 1NFBA 1B3OA 1BKSA 1H51A 1TJRA 4EOUA 1GJPA 3O6YX 4LW7A 4JY8A 3A23A 1KFCA 1WQ5A 1YTEA 2J88A 2QUUA 3A21A 3K30A 3TMQA 4UR8A 5FF0A 1IIGA 4O28A 1AG1O 1A5BA 2X1RA 4JR5A 3BGJA 2ZA1A 1PE1A 1VYPX 2FPVA 4ZMGA 3DU0A 2DZWA 2ZCGA 1ICPA 4FNUA 1YXDA 4BWLA 4LV9A 5K4ZA 2A7RA 3GNDA 3FKKA 5KTLA 1ZAHA 3G3DA 3P67A 4O52A 2WSYA 2I14A 1JCLA 4O1DA 1WA3A 4N4QA 4JTIA 1KTNA 4Z08A 4DPQA 2GUUA 4HPJA 5CZSA 4C1LA 1XUUA 2ZA3A 3HO8A 3R8RA 1D3HA 3G0XA 5LGZA 5IBXA 4MY9A 3P8IA 4LC8A 1KFJA 1K03A 2J9ZA 4OGZA 4UXDA 3C3NA 3GAKA 1W3NA 3NL6A 1H1ZA 4N9BA 1YDNA 4QIUA 1H62A 1FCBA 1G4EA 1IXPA 4A29A 1F74A 1ZNNA 4Q32A 5LSMA 2ZQ0A 3ATZA 4JS3A 3VE9A 2HS8A 5HNRA 3ZWTA 3MYPA 3EXSA 1GZGA 3W87A 3OHIA 4NT0A 3PUDA 5G4WA 2EAWA 2GOUA 2FIQA 3LI0A 4UTLA 3VI2A 1BTMA 3MP4A 3EX6A 2J9XA 2C0AA 4JTKA 2EHHA 1N7KA 1L9WA 4DF1A 3QPZA 4NJKA 2W79A 2G95A 2Z0IA 1GTEA 3G8RA 3NZ1A 2PCQA 4FX6M 1JRBA 2TPSA 3PSWA 3STEA 5I3GA 4Z1CA 1KFKA 5L9FA 3PUEA 4HT3A 4NX5A 2BSLA 1LOSA 2HS6A 1TTJA 4ZQRA 1QWGA 1KTBA 4JTUA 4GWEA 3GVGA 3B0UX 1HTIA 5AYZA 5G1YA 4M19A 4R7JA 3TU9A 4WJEA 1I2PA 1G4TA 1ZY9A 2Z6IA 4TMBA 1EA0A 1QO2A 2ATMA 3W76A 4LWWA 3PBVA 1H7PA 1RZMA 1KM2A 4HSNA 4JYDA 2JBMA 4CNOA 3TR2A 1H5YA 3QSRA 4LT9A 3LERA 1S5TA 3NVTA 3EXRA 1OYAA 5CGQA 4UC5A 3LV5A 3IGSA 5HWJA 2CLOA 4CNNA 5FEWA 2E1DA 3RMJA 1GYNA 3BLEA 4RK8A 4AHOA 3W70A 4UTMA 2E6FA 3DGRA 3LDVA 4HIBA 4I7WA 1VPXA 3UY7A 1UJPA 4DO4A 4DXVA 3NPVA 1R2TA 3PBYA 5EA9A 1TPUA 1ICSA 1EP2A 4MLRA 2OJPA 3UD6A 4UTWC 1FWNA 4MYXA 1TPC1 4NX0A 3LLFA 3L68A 2H90A 3NQMA 3QPYA 1W54A 3QZEA 3QC3A 3CM4A 3QJAA 3G18A 1KFBA 4MY1A 2ZZ7A 4JX5A 1PCKA 3ZFHA 1TTPA 4FXRA 2B7NA 4FX7A 3JS3A 4FX8A 1TPVA 3QEZA 2WSQA 4UTWA 4JTFA 1KV5A 2ABAA 5C54A 3EB2A 1HFBA 3GAYA 3W83A 3U2OA 1PIIA 3M6YA 5CKSA 1JR1A 4NJHA 2P10A 1NVMA 2H8XA 1JUKA 5G2IA 4IGHA 4HNUA 4IQLA 4M6VA 3GK0A 4UFJA 3CPRA 2V30A 2JGYA 3CT7A 4D2JA 3MI6A 4MY8A 1YXYA 1QPRA 5E1QA 4O18A 2E5BA 1FCQA 3NM3A 4JXCA 4WQ6A 4JTGA 4UFKA 4O15A 3L2IA 4O10A 4C1KA 4PFMA 1I8JA 3SI9A 4Y8FA 2VFHA 2NXIA 1QPQA 3DKJA 2OMAA 3W1XA 5G5IA 5DXXA 4XTDA 4QSHA 2ISVA 2ZRWA 3MWAA 2VFGA 1Q6RA 4LRTA 2D73A 5FEXA 3STCA 4O8RA 3NYZA 4ZQOA 3HGSA 2E6AA 1UASA 4IMGA 1TPB1 2E5CA 4ORMA 3R12A 5KZEA 4YWIA 3LCLA 4OE7A 4FNSA 3CC1A 3FJLA 5H2ZA 5G2HA 5DLCA 3DFNA 1EP3A 2I1OA 3NL5A 2C14A 2ZRUA 5FF4A 1WBJA 3G22A 1OFQA 2XN0A 4UFLA 2NX3A 5HQEA 5KINA 3GX9A 1H63A 2QUVA 4N6EA 3MMTA 3HG5A 3O6DA 4DF2A 3MHUA 3MI3A 1NF0A 2DZVA 5D2XA 4OQVA 3PULA 3LTSA 4DEFA 3NEVA 4EVZA 4QM1A 4ADUA 1SW0A 3W7CA 3DHFA 1DQWA 2BWGA 1ZHAA 3MYOA 4K7VA 5HWNA 3PSVA 2WJZA 3C8FA 5HUPA 3KHJA 1KM3A 5C6MA 5LNVA 4QQ3A 2H3BA 3ABQA 3M47A 3G24A 3NQ7A 1LRNA 5EKYA 3R89A 3L21A 4RZ6A 4GFSA 1G7VA 3O07A 2ATSA 1VC4A 3O63A 2CU0A 3R13A 3P60A 1B4KA 3W23A 4Y90A 3I68A 4N6FA 1O94A 3FOKA 2J27A 3W2JA 1V5XA 3F4NA 5DY2A 1YDOA 5I3FA 1I2NA 5KZMA 4O1BA 4I9AA 3W7GA 3O8AA 4L4MA 3NL2A 2RFGA 4L4LA 3R2GA 4LC6A 1SO4A 3S1XA 2CZDA 5CPMA 3TK7A 4PA8A 4PH6A 4MZ1A 3NQCA 3SECA 5CPOA 2Y7EA 2V0TA 3W1QA 4LV4A 1XDMA 3LV6A 1P4CA 1TRDA 4PL1A 2CLFA 1EUNA 1ME9A 4IXXA 2V5LA 3W2MA 3W22A 3NQ2A 4K7YA 3UWZA 1X1OA 3CQ0A 4XZ9A 1QNVA 3M0ZA 3I7RA 4NVTA 1GTHA 2QAFA 1JVNA 1OVDA 3B05A 3E96A 4WOQA 2Q3RA 1OFBA 4YMZA 1K8XA 4M6QA 1CI1A 3GDKA 3KOFA 5K3VA 1MEHA 2B0MA 3OG3A 4AF0A 1C9DA 4A2RA 1GG1A 4JTLA 1Q6QA 2WNZA 4UNLA 2NUYA 3U8GA 3PS7A 1A5CA 3BARA 4K38A 2QCLA 3W1TA 1Z41A 3CIWA 2WOQA 4UMAA 1F7BA 1AMKA 5E0KA 1FQ0A 3CLMA 3QQ0A 5C2XA 4ORIA 3P80A 5C55A 1F6KA 1VGAA 3W7LA 1MEIA 2E68A 2QEZA 4YL2A 1VHCA 4MZ8A 1YLVA 4QJ1A 3S1UA 3QF0A 1TSIA 4NU7A 3UYCA 4JTHA 4JY9A 4XKYA 4WY0F 2V81A 3SIZA 5LNWA 1DVJA 1A50A 1ONRA 3UPBA 4MOZA 3RNDA 1P0NA 1SZNA 2CWNA 4O0KA 3S42A 3DHDA 3UWYA 4IMFA 2TSYA 3GDTA 5ABTA 3LRMA 2ZRZA 5D37A 1VRDA 2RH9A 1M6JA 1YPFA 5CZTA 1VH7A 5F1UA 4LTSA 4RR4A 3G0SA 3LRKA 4PCFA 3NGJA 3S5NA 3HGJA 3TUUA 2R91A 1O4UA 3ANYA 1W5NA 2PURA 2A7NA 5IM51 5HULA 1FWTA 1X8FA 1PHQA 1TJPA 1DOSA 1JCYA 3TC6A 4AHQA 2DZTA 1GVQA 4O13A 4K39A 3M1ZA 4PEKA 5F4SA 2XN2A 5EYWA 1VR6A 4K6AA 5TIMA 3W71A 3PY2A 3WK3A 3DZ1A 2YW3A 3CB8A 4RV8A 3A5VA 3CU2A 4GBUA 2X30A 3TE9A 3EX3A 1PS9A 3LM7A 4GUHA 2NV1A 1SSGA 2ZRVA 3EX2A 3UZJA 1Z42A 3D0CA 2V5BA 3PBUA 4DELA 5D2YA 3L5LA 3PR2A 3MW7A 3U6WA 2WNQA 5LHEA 3HG4A 4GUJA 3UWUA 4IJBA 1PHWA 3R5EA 3EWUA 3FFSA 3G1FA 4CQ8A 3NL3A 4GUGA 1RPXA 2EKCA 1WX0A 3PUOA 4ZVJA 1GEQA 2DJXA 3WK1A 1LBFA 5AFDA 3A9IA 3P61A 4WXZA 5J5DA 1RV8A 1OK4A 1KBIA 4PC8A 5D03A 1XBVA 1XBXA 5D02A 3UPWA 4AVFA 5FESA 3TMLA 5EL1A 1DBTA 2YYTA 3IIPA 3Q2DA 5EY5A 1OFEA 1FWSA 1VCVA 3W7RA 2V2CA 3C4UA 2E5DA 2YFOA 4LNYA 1N55A 5LZLA 2A6NA 3W7NA 4R53A 3WJZA 5LHFA 1WV2A 4RKAA 5FF2A 2J9YA 3LOTA 3KRZA 4O54A 4OWGA 1D3GA 5TBOA 4JTEA 2F84A 3EX1A 3EWYA 4UMBA 1RD5A 4UCGA 1JUBA 4WOZA 5K9CA 5CZ0A 2R14A 3GLCA 3RK8A 5DCEA 2VELA 2DU2A 2VC6A 1H7WA 3LHVA 3DFOA 1CX9A 3EWXA 1LZOA 3BVJA 1DQXA 2VFEA 3EWWA 1YXCA 5K9DA 3W7IA 3E9AA 3RLUA 1XXXA 1Z44A 1H7RA 1QFEA 3GDMA 3MUXA 1G67A 4FIRA 1LBMA 3MBDA 3FKRA 2C3ZA 3TROA 3UWQA 4AAJA 2NXHA 5DXYA 2E6DA 3HG2A 4JNMA 1WDWA 4K37A 5F4WA 2VKZG 2A4AA 4LU0A 3LCGA 2ZZ6A 1R47A 1SZFA 3P81A 1YDVA 4U28A 3LCXA 3OEXA 3L67A 1B57A 1P1XA 5FEPA 4M7SA 3TJLA 3W88A 1EIXA 1VS1A 4PTNA 1L6YA 2Y70A 3AJXA 3TQ0A 3BGGA 2GVGA 4FB7A 1W8SA 3LGEA 1V7YA 1RR2A 3NO5A 1W1ZA 4AHPA 1VZWA 4JD4A 5LKYA 5AHLA 1KM4A 1TRIA 4LUJA 3T7VA 1A5AA 3WK0A 1QAPA 3W7EA 4J9JA 5LNSA 4X3ZA 4Q4KA 1J2WA 4JICA 1E51A 1S5WA 3W7PA 3BK0A 3IGUA 3W9ZA 2FFCA 3EKZA 1LORA 1WOAA 2YDAA 5BW6A 2P0OA 4UR7A 1SPQA 3NR0A 3G1YA 4JIPA 3UXDA 2VXNA 4PODA 5AOUA 1N8FA 2A2IA 3CTLA 4IWWA 3LLDA 2YCEA 2B7PA 4LOCA 2Z2UA 1GT8A 2WO5A 1LLWA 5J5RA 5G4EA 2OT1A 2QDHA 2Y89A 4LVBA 1TPEA 3N14A 1WXJA 3L66A 3EWZA 2NWSA 5K4XA 4K36A 2RDUA 1K3UA 4IMDA 3IIOA 2ZA2A 4JTSA 5T26A 3C2EA 1XBZA 2VEIA 4NZFA 1JQVA 2CLHA 3TIMA 8TIMA 1GVOA 3V1PA 1EWEA 3NQVA 3DFSA 1TTIA 3IVUA 3EXTA 3PG9A 2GPTA 1SO3A 1K8YA 2E09A 1M7PA 3CWOX 3EWBX 1FDJA 1IXNA 3OVQA 2BX7A 5DELA 5AHNA 4CQAA 3OVRA 3NG3A 3HPSA 4O1CA 2A1YA 4AH7A 4QNWA 2Q8LA 1EEPA 3W2NA 1T99A 1H7NA 1Q3NA 1SZGA 2GQ8A 1ZFJA 3C52A 4ZQNA 2QJHA 2C6QA 2Z1BA 3ABOA 1B4EA 1TV7A 5MHBA 5EPDA 3ZWSA 3B8DA 6TIMA 1DV7A 3P5YA 2QJGA 4G1KA 1J5TA 3CIXA 3ATYA 3Q37A 5EBUA 4CCDA 3W1UA 2GVJA 4RXFA 4TU1A 5KITA 4HKPA 3SZ8A 3HG3A 1SW3A 3TAOA 3LCFA 3VFLA 3FYOA 1LYXA 4X2RA 5AC6A 1DORA 2WQPA 5BMXA 2TYSA 2A6LA 2EGZA 2R8WA 2NUWA 3G1SA 3TSDA 4QITA 1OYCA 1GVRA 3N73A 2WPBA 3G1VA 1W5OA 3TKFA 4O0ZA 4HHPA 3KVLA 3F1QA 3IGXA 1SO5A 2A7PA 3W2LA 3KX6A 5D2TA 2DZUA 4AWTA 5FEZA 4WXYA 4JYEA 5HJLA 1TPFA 3BG3A 4GUIA 3G1AA 1QOPA 5KMYA 1NSJA 4Z1BA 1ME8A 2VENA 4UUIA 3LXBA 3N19B 4JN6A 4MYAA 4NXKA 2NX9A 4CNPA 1H7OA 2Y61A 3W6YA 1MXSA 1OFOA 4O17A 3G1DA 4OBTA 1FCVA 2VOMA 4AF0B 1NF7A 5F2MA 1O5XA 2JK2A 3HOJA 3WJWA 1ZAIA 2FB3A 3NAVA 1PCWA 1JCXA 1HG3A 2VEPA 2X16A 3G1HA 3G1XA 3W7DA 3C6CA 1ZCOA 4GC4A 5HR6A 2RHGA 2C15A 3C2VA 4CQ9A 1W0MA 3TNOA 4YXGA 3TX9A 2UV8G 3W7MA 1XFBA 4NJIA 3IV3A 1LDCA 1RQHA 4M7TA 2NLIA 3W85A 1LROA 2YSWA 3O16A 2ZBTA 3NDOA 3NPUA 4IMEA 1GVSA 5AHFA 3W1LA 4I7UA 3NXFA 1GQNA 1GOXA 3IIZA 4IPIA 1EUAA 3TSMA 3QW3A 3NQ8A 3NQAA 2NX1A 4NNBA 4GJ1A 1T8XA 4N02A 4N4PA 3P82A 2H3DA 4LVGA 3BW4A 3GR7A 3PF3A 2JKPA 5I3IA 1M7OA 3LB0A 4BF9A 4UTKA 4HSOA 4N9DA 3G8EA 2W0UA 3INPA 1OX6A 2V82A 4A2SA 4I7VA 5DCBA 1TB3A 3W72A 5KZDA 4O16A 1JJKA 3IIXA 5C5YA 1TPDA 3BV4A 4OV9A 2IQTA 3KVJA 2QUTA 4ZZ9A 1ZAJA 3LCHA 2ZDRA 4UTJA 3MJYA 4XWUA 4NZJA 2V8ZA 4E2DA 1XBYA 4A3UA 1IGSA 1FCUA 1XUZA 3QW4B 1DKWA 2JKEA 1H1YA 2CW6A 2Y6ZA 5CPNA 2XFWA 5F4XA 1MEWA 2QAPA 4P61A 3IIVA 1IXQA 5F2LA 3E12A 1OG0A 1EP1A 3ABSA 4MPQA 3W7OA 1KLYA 3E0IA 3S8HA 1O60A 1DHPA 1VCFA 1ICQA 3HBLA 1UUOA 3EX4A 3SSJA 4GUFA 1DL3A 2W6RA 3LHYA 4MLJA 4MJZA 3UQNA 2ZZ4A 1TPWA 1KV8A 4MVAA 1K7EA 1OK6A 4WUIA 3M16A 2VEMA 4FXSA 4O12A 1Q6LA 1DJNA 3DI1A 2CLKA 3IRDA 3ABRA 2C19A 4Z1DA 4JIQA 2YFNA 3TXVA 4EF9A 3VCRA 1HL2A 4XTIA 4ZQPA 3FLUA 5HR7A 1QPOA 5D38A 3S5ZA 2PRLA 2AAMA 4DO6A 2BZNA 3TCEA 3BO9A 4NQ1A 3VKJA 1ALDA 3P8JA 1QPNA 3L5AA 1S5VA 5AN7A 1KM0A 3M7WA 3MP3A 4KFOA 4Z0SA 2GVLA 3H53A 3RLVA 4TX9A 3UNDA 1EWDA 1PV8A 1R46A 4DBEA 3GXNA 1GWJA 4W9TA 1OX5A 1TQXA 3LCIA 1TO3A 1NEYA 4IXHA 2YZRA 3I7SA 4Y96A 1XDLA 1ADOA 1R2SA 2RDTA 5U4NA 4RJEA 5I3KA 3RU6A 1OYBA 1TQJA 5AB3A 1YTDA 3BW2A 1QDSA 4AMAA 3WFAA 4H6KA 4FEZA 1OFAA 3DFPA 2O7SA 4DQWA 3MO7A 4H4IA 5AC8A 3W73A 4ICNA 4OU1A 1TV8A 4MIMA 4M6PA 4MKNA 2PC4A 3HGOA 1GYLA 5AHEA 1H61A 3W7QA 5CPLA 1BWKA 1BWLA 4NXSA 1G7UA 4POCA 4ONVA 3GYEA 1OF6A 1GVFA 2B4GA 3O05A 3M5VA 1VJIA 2CLEA 5BRBA 4O14A 3LTPA 4TR9A 4A22A 1I2QA 4EF8A 4UFHA 3N34A 1WOBA 2Q8ZA 2I9EA 3LI1A 3W07A 3N2MA 2QF7A 4OHQA 1LOQA 3B0VC 1FX6A 4RLIA 2Q3OA 4S2CA 3NZRA 1WYIA 3QYQA 1R30A 4JTTA 1KFLA 3FIGA 1JQXA 2VFDA 3KRUA 2GJLA 1BEUA 1F5ZA 3QH2A 2B7OA 4O19A 4JDBA 3NQFA 3DH7A 4XBKA 1EPXA 3TC7A 4GRSA 5D32A 4HPXA 1KTCA 1L6SA 2BXVA 1UCWA
chains in the Genus database with same CATH superfamily
2VHLA 4BI5A 2I57A 3LHTA 4HN8A 3T44A 2XFYA 3TAKA 1OF8A 2FPTA 1TA3B 3TWBA 4CD5A 4OT7A 2E25A 1UMYA 3H2FA 4RW5A 5I02A 1VQTA 2R94A 1UR4A 3VIJA 1ZUAX 2XVKA 1RCXB 4LAUA 2VX4A 2YX0A 2C18A 2NXGA 9XIAA 3TH6A 3ZZ1A 3N2XA 4UQ9A 1TA3A 4A8NA 3FEMA 3PTMA 1JRCA 5CG7A 5C7HA 1XLEA 4JFVA 3RFAA 3W74A 4DBUA 4WX2A 3IK2A 3VNLA 1RUSA 3ITVA 1BYCA 5H8PA 3RILA 1LOLA 3T55A 1B5TA 1DWIM 1PZ1A 1KGWA 4N9EA 3ARUA 1JZ6A 4AMCA 4JIHA 5AYYA 2EJAA 3V36A 1O5KA 3W7KA 3LK6A 3A3WA 1GW1A 1IZJA 1W3JA 3B40A 3NFUA 4KERA 1U1JA 3C2FA 5AVHA 3DBPA 3LPFA 4D6JA 4JX4A 4PUUA 4AEOA 3HF3A 2D3LA 2G96A 1A5SA 3OIHA 4REQA 4TUFA 1LRTA 1ZBWA 2PRMA 3CH0A 1M5WA 5I6SA 2YL8A 1KM5A 3VD3A 2IW0A 3NQBA 3HTWA 6ALDA 3PBWA 3H2NA 1QU4A 3ZO9A 1F9CA 2W27A 3HPAA 3PB2A 3NJ3A 1RVGA 2EPLX 3JR2A 3UF9A 1Z8AA 5JIWA 3T09A 1UQZA 2W62A 3C2YA 2CESA 2QCFA 4D1IA 5AZ1A 1OZMA 4X9SA 4B3KA 4MWAC 4PTMA 4CUCA 3S3GA 2P3EA 2QCEA 3SGZA 2FLIA 3FYYA 1X8CA 3DC0A 3A24A 4ZBCA 3PZNA 3UYIA 2AQWA 4HZ8A 3WD0A 2TODA 1OHLA 4NUWA 4O4VA 5FI8A 1Q65A 4BJHA 1C8VA 2EJ1A 5IFTA 3THAA 3BW3A 1AW5A 2DIEA 3VXGA 4QXIA 3PZUA 3SGUA 4B9ZA 3I65A 3CAQA 2V2HA 2PF0A 2OLAA 5CJMA 3PJXA 4EIVA 4S39A 3EMZA 3T78A 1GG0A 3MJMA 3NQ6A 2VRKA 1UKPA 1L6GA 2PD9A 4ZQCA 3PJUA 3GKFA 2Y85A 4TQTA 1AW2A 4PMNA 1OWQA 2FVLA 3WLSA 4KS0A 4MWAA 4JL1A 4US5A 1A0DA 3A3XA 2W67A 1XP3A 3OG2A 2WZIA 4BQ3A 3OIXA 4CN1A 1R3YA 5L6UA 4LALA 2V3FA 2A21A 3W2UA 1XLGA 1SQ7A 3GNOA 3WD1A 4BWLC 4JTCA 4LVDA 1M7JA 3L4XA 1LLZA 1UWAA 2DZXA 4S2BA 5JVLA 2FPYA 4FO4A 2WXDM 4HU4A 3SCUA 1ISVA 2F7FA 1CB2A 2VEGA 2MUCA 2DH2A 3AMKA 3G3MA 1C29A 2DT1A 2OB3A 2PDFA 4E2BA 3S1VA 3LXAA 3QHOA 1HO4A 4MWAD 1OABA 3I6RA 2XIBA 4B4FA 1OX4B 4MKSA 4KEVA 4CNSA 1XYCA 2RJHA 3JRKA 1XCFA 1G6CA 3XINA 3GIPA 5CSRA 3MPGA 1Z3NA 3W1AA 4U2YA 4QE4A 4GIRA 1XKYA 2CYGA 1ZJIA 3BJSA 4E8CA 1OX4A 1RSCA 4JOMA 3CUXA 3AYTA 5DFAA 4C6EA 4E38A 3H70A 3P5ZA 5D33A 4RUBA 1V6VA 4IH3A 4YHGA 2OT0A 4TV5A 4XBJA 1KXHA 1BD0A 2PEVA 3VD9A 1PBGA 5LYRA 5CLWA 3KBJA 1N2VA 2F38A 3W6LA 4GNJA 2V2DA 4KMQA 5GJMA 2EPHA 3W02A 4BQ4A 4M80A 4C6BA 1OJXA 3M5XA 3TW7A 1FDZA 2VRQA 3QOMA 1K8ZA 1X38A 3C86A 2ZXQA 3AZTA 2FTPA 4HHMA 1ITUA 2IXVA 1XIEA 3K4DA 3WFLA 3ZJKA 1C8XA 3BV7A 1JZ2A 1NAL1 3EEZA 1XINA 1TWZA 1K70A 4AWEA 1I75A 1FP8A 1AZ2A 1JAEA 3I4KA 1QOQA 2TRSA 2HV5A 1JYWA 3MO4A 4DWSC 1R2RA 1TV5A 3REQB 1TVNA 3GM8A 3TR9A 1Z48A 1FWIC 4NZ5A 3PG8A 3WQVA 4C91A 3NQGA 3PVFA 4J2MA 1KNWA 3UBPC 7TIMA 3GQYA 3C61A 1J0YA 4YS1A 2IKJA 3APTA 4IG2A 1J9YA 3PUGA 2X2YA 2YXGA 3W7JA 1O12A 1P0KA 1HP5A 1W8GA 3QV8A 4TX8A 1UUMA 3SUUA 3OW1A 1S3HA 2YYUA 1X97A 3KAOA 4NJJA 4OV4A 4C5ZA 1D7KA 3WQ4A 3L9CA 1JPKA 4I5XA 2Y5EA 2Q09A 1ESWA 4M81A 3USBA 4RXGA 2CFFA 3ZR5A 3V75A 2XPKA 1I4NA 5AECA 2YLLA 2PDIA 4M5PA 4MUZA 3AUJA 4FS9A 1RJRA 2QDEA 4XAPA 2DP3A 4LCRA 4AWSA 3V7PA 1P7TB 3ARTA 4RNIA 2PWHA 2OU4A 3H2CA 4ZTXA 4AD4A 5LNRA 1A5NC 5CPTA 1IEIA 1VEPA 3WH5A 1AL8A 1P6WA 3ZR4A 1WE5A 3RPTA 2D23A 4Y9AA 1LCOA 2ZICA 4IF2A 3PWAA 1VFMA 3CUHA 4AB4A 4IP4A 7A3HA 2Q8XA 3PAOA 1DJWA 1XC4A 2OKTA 2ZTKA 3NYDA 3QGVA 4Z42C 3A47A 1AL7A 4N2YA 4PRTA 2HPMA 1EBHA 2WCSA 4DWSA 1GVEA 2O4QA 1XIFA 3STGA 3STFA 3OTRA 2Y62A 4Q4MA 1FBAA 3MHGA 4GYJA 4DJFC 5EFDA 3WCZA 2H6RA 6A3HA 1LTDA 1Q4NX 3WELA 3L0KA 1K02A 2OOFA 3K8KA 3NXLA 4ZFCA 1PYFA 3LY0A 1IGWA 4UOJA 3W86A 4FNPA 3FJNA 3WQWA 3CAKA 3TV8A 4XD3A 1MI3A 3GDRA 3UG4A 4PUJA 5GNZA 2YR1A 1SW7A 7CGTA 1OC7A 4LCQA 1K77A 4WY0A 3HJEA 3UWWA 3OBAA 2X2GA 2E6YA 4IPJA 1BYAA 1JI1A 3D5HA 4YCPA 3EMQA 4CCCA 4GI8A 3M0VA 3R8GA 4ATDA 4DJEC 3BLPX 4BI7A 4CGTA 6PTDA 1VJZA 3DG6A 2PDUA 3H2OA 4WY0B 4HNTA 4ZQMA 5FOOA 1TPH1 4RPPA 4H7CA 4JFUA 2ACUA 3KBWA 5A94A 3M41A 3CEPA 4LUIA 1TE6A 3AO0A 1S39A 4YPJA 3TN3A 4Q33A 2UY5A 3UA4A 1SZEA 1BRLA 3N15A 4I8DA 1ZCCA 1IXOA 3WNKA 1PKLA 4UNKA 4MFEA 3OA3A 5A95A 4YTTA 2RAGA 2YPIA 3B04A 3VO0A 3DDMA 3I6TA 4IICA 1O66A 3H4GA 3MKVA 2DQWA 3HIJA 1EO7A 4E0CA 4MB1A 1RPKA 5HWMA 1I1WA 2FB2A 4H04A 3HV8A 2QNEA 1BKSA 2HVOA 4TVUA 1TWIA 4HMDA 4D6DA 1EPVA 1KFCA 4G6CA 4CN6A 1UPMB 4UR8A 5A6BD 1RALA 1IIGA 2YDRA 1AG1O 1XRVA 1CXEA 3KOWA 1YBQA 5XIAA 3DUGA 1PE1A 3N25A 4NY2A 2DZWA 1UWQA 2ZCGA 4LV9A 2A7RA 3I4EA 3FKKA 5C9UA 5KTLA 1K4HA 5HPCA 4O52A 2WSYA 1UC4A 3TEVA 1WA3A 1Y65A 4DPQA 2GUUA 4HPJA 4AZIA 1XUUA 4F48A 5IFPA 3OZOA 1DWHM 3AWNA 3J7HA 3G0XA 3GFZA 1S2TA 3P8IA 5LA0A 1DYSA 1KFJA 4LC8A 1XCXA 1UZDA 1O68A 2PWEA 5D9PA 4UXDA 1F3XA 3BLLA 5B7ZA 1W3NA 3N29A 4N9BA 4GFIA 1YDNA 4QIUA 1FH7A 4DJDD 4LYPA 3R11A 3K5XA 2JF6A 1EGZA 2ZQ0A 3ATZA 2J7BA 3HQNA 4LANA 1V0MA 3FXYA 4GXWA 4DXKA 3OHIA 4NT0A 2EAWA 4YN5A 5EU9A 3LQLA 3ITCA 3S4TA 3GTXA 3MP4A 3TTOA 3EX6A 2BY1A 4JTKA 2VR2A 1B3WA 1WPCA 2G95A 1KD0A 2Z0IA 3G8RA 3VDCA 3GS6A 1ZGDA 3RX3A 5CC5A 3AZRA 2TPSA 3PSWA 4J3VA 2ZXDA 1F07A 2GGHA 3ME3A 5C9WA 1TX0A 3DN5A 3PUEA 3ITOA 4HT3A 2BSLA 4ZQRA 3W6MA 4L6OA 4JTUA 2YXOA 4QFUA 3ZT7A 3HFYA 4GWEA 3GVGA 1HTIA 4M19A 4R7JA 3TU9A 4WJEA 2PDNA 1I2PA 1G4TA 4B4HA 4RDZA 3UJ2A 5A6SA 4LAMA 4B5SA 2NLYA 1H7PA 1XH2A 4PB5A 1H5YA 2VM8A 1S5TA 1LUCA 3EXRA 1OYAA 4UC5A 3IGSA 2DZBA 2CLOA 4CNNA 4DZHA 4RE2A 4RE3A 1K1DA 3JVAA 1DWJM 3W37A 5KEZA 1E6PA 2XWDA 4AHOA 2KAUC 3W70A 4UTMA 3DGRA 3LDVA 3EOEA 4HIBA 3UFYA 1VPQA 4ZOCA 3P6LA 3UY7A 4DO4A 1J11A 3E2RA 5EA9A 2BY2A 4HNOA 4LEQA 1E72M 2G3NA 3M0XA 4YNGA 2Z2AA 3LLFA 3VIPA 2DVXA 3QPYA 3QZEA 3CM4A 3QJAA 2Z1XA 1KFBA 2FVKA 3ZFHA 5E0CA 4LB4A 4IFKB 2BVDA 4FX8A 1J0IA 4I8YA 2I5QA 4F2UA 5HJYA 4UTWA 3A4XA 1A4LA 1EL3A 1KKOA 1OCQA 1KCXA 1HKIA 1EA9C 2P10A 3WUFA 1NVMA 3E5PA 1J0KA 4IQLA 3GK0A 4UFJA 3GXMA 3UZZA 3S9IA 3WMBA 4D2JA 3GC2A 4MY8A 4W5UA 1QPRA 1OD0A 3TW9A 2OSXA 3DGBA 4O10A 2HWGA 1I8JA 2PSNA 5FAGA 1CLKA 2XSAA 3F2BA 3WBAA 2PLJA 5G5IA 4EAMA 1BLIA 1Q6GA 1PO9A 1S1PA 1LLOA 1O7AA 1GJWA 1CXHA 2ODOA 2OELA 2WHLA 3PZOA 2D73A 5FEXA 2OYKA 4O8RA 4Q6XA 5GJPA 3HGSA 4ORMA 3VKAA 3BL3A 4XZBA 4EXQA 5KZEA 4EWJA 3N6QA 4OE7A 1MMFA 4J2PA 2QJMA 3VZXA 4J3ZA 1N8WA 3CL8A 2ZE0A 3TYBA 3IACA 1WBJA 1OFQA 3UR2A 4GY0A 2WVVB 5HQEA 1B30A 4JZ5A 3LUTA 1H63A 1GHSA 4Q3MA 2E9BA 2BASA 1V93A 1WP6A 3O6DA 3MI3A 1C3FA 1WXYA 1C93A 4EVZA 3S2LA 4QEEA 1W9VA 3MYOA 3C8FA 5MF5A 5HUPA 5C6MA 4JPGA 4QQ3A 3NQ7A 1LRNA 1V03A 3R89A 3L21A 3S9ZA 4GOAA 2DGAA 3O07A 1J0ZA 2ICSA 2PU0A 4PBFA 1FH8A 3O63A 3SRFA 4GGBA 1OG6A 3CPUA 3OHMB 5GNYA 3I68A 5AC4A 1UWRA 2NQHA 1O94A 1FHLA 2QXWA 4L80A 3GNXA 2EG8A 4AY7A 5I77A 1BGGA 2AL2B 4NHVA 4L4MA 3NL2A 4PB3A 1GJUA 2VR4A 4Q4OA 4L65A 5CPMA 3TK7A 1LG2A 3GTIA 3MDUA 3SECA 5CPOA 4ZXLA 5IOBA 3LV6A 5XIMA 3CNYA 3QV6A 4IXXA 4RNFA 1IWAA 4WEVX 1HJSA 1QNVA 3M0ZA 5HK4A 3SCWA 3POCA 3F4VA 1AVAA 2QAFA 3UWEA 1JVNA 3B05A 1OFBA 1QI3A 5A6BA 3ITGA 2GOKA 4XZIA 4M6QA 2G3FA 7REQB 3KOFA 1MEHA 3OG3A 1UKQA 1C9DA 4A2RA 3WDRA 1GG1A 2NT0A 1Q6QA 4YHEA 1DP0A 4UNLA 1EFZA 4RNJA 3BARA 2J7GA 3SCVA 5BOEA 2QCLA 2HEJA 4X63A 1ZBCA 2E3ZA 1ZP3A 3CLMA 4ORIA 1BF6A 3P80A 1F6KA 1W3LA 3BAJA 3KM8A 1F4AA 3LM3A 2NW0A 2QEZA 5DMLA 2WWCA 1XSJA 1VHCA 1Z6KA 1YLVA 4QJ1A 3S1UA 1A3HA 1UZHA 1XIDA 4GI4A 3ZYZA 2PDPA 4WY0F 1K9FA 1TE1A 1XG3A 3CZGA 3RNDA 5TD4A 3Q67A 4DJEA 3AIVA 4WIWA 5BWAA 1KCKA 3MANA 4PR4A 1E6QM 5CZTA 4AW7A 2D24A 4DAFA 3AJ7A 4LFYA 3BAWA 2XZ9A 3KRBA 3KL3A 4OVXA 4OTKA 4FR1A 1RCOB 3MKKA 2QPXA 2CBVA 2W92A 1FWTA 4FF5A 1PHQA 1TJPA 1DOSA 1JCYA 3CV6A 2DZTA 2AMXA 2FZMA 2B81A 3GTHA 3P2VA 2VZOA 1IEVA 3THUA 4DJED 1SGJA 1YE6A 7ODCA 3KCLA 3R43A 4RV8A 3CB8A 2AQOA 3WLIA 4DM1A 3A5VA 1EJUC 3CU2A 4GBUA 2DSVA 3TE9A 1PS9A 4GUHA 2NV1A 3EX2A 1PKNA 1Z42A 3PBUA 5D2YA 4EP8C 3PR2A 2A79A 3AYSA 3HG4A 3NEHA 2D2HA 2P0IA 4H9ZA 4GUJA 3FK4A 2OQHA 3WX7A 1F6YA 4IJBA 3MSGA 3G1FA 1C90A 1HGWA 2EKCA 1WX0A 4ZE5A 4XX6A 1LBFA 3A9IA 1A5LC 4WXZA 4CVWA 1CXKA 5D03A 4GQBA 2GUYA 1XBXA 1MW2A 5BU6A 2OXNA 3O3RA 2VGBA 5EL1A 1OFEA 1FWSA 2YCLB 3EWDA 1VCVA 3M0JA 3W7RA 2V2CA 1YNPA 3C4UA 2OSWA 3W24A 2YFOA 4LNYA 4C1NA 3L2LA 2A6NA 3W7NA 1VKFA 3IUIA 3GVWA 5LHFA 3LMYA 3LOTA 4LBRA 3GHTA 1UWUA 3FGCB 1GKPA 2E1WA 2PDWA 1LL7A 4ROPA 4MMWA 4JTEA 1RD5A 1EEXA 2IPFA 1WUEA 2VELA 4H2CA 1BWVA 2VC6A 3MKCA 1W6TA 1XIMA 1E3ZA 1OGSA 4QLKA 1DQXA 2V5DA 2VFEA 1YXCA 3PFRA 4LYKA 3BAKA 3CPGA 3LENA 4BEUA 3RLUA 5IHSA 2WLZA 4XVEA 4ZO8A 4A8IA 2R82A 3MBDA 3FKRA 5FIPA 4AAJA 5F4WA 3WLHA 2A4AA 1YDVA 3LCXA 3E2VA 1K9TA 1B57A 4PMYA 2INEA 3IS4A 3UG8A 1ZS2A 3W88A 1EIXA 1VS1A 2XU2A 1L6YA 2BP1A 2Y70A 5DMNA 1UR8A 3AJXA 1YNQA 3EA3A 1G9HA 3BGGA 1NDZA 2QGYA 2INZA 2NQZA 1W1ZA 4RNHA 4QS5A 4ML4A 1B2YA 5LKYA 5AHLA 1TRIA 3WK0A 4Z2KA 1NWRA 1DHKA 1E51A 2FZNA 3NWRA 3TLLA 2VC9A 2FFCA 3VIIA 3GXDA 4C6MA 3N9KA 2WMIB 4UQCA 2BVTA 3H23A 5DANA 3POHA 4AD2A 3G1YA 1IE7C 2VGFA 3R8HA 3MV11 4YYCA 1C7SA 2PP0A 1UUQA 1N8FA 3ARWA 4GYPC 1QW7A 3LLDA 4KRZA 2YXXA 1VEOA 4KIRA 4HNLA 1H3GA 2FFIA 2WBKA 1PIGA 4LUSA 5CJNA 2R1MA 2PLKA 3BLDA 2ESCA 1V79A 3K1DA 2NWSA 4K36A 4ZSTA 3NZQA 1XBZA 2WJFA 4K1WA 4J3SA 1MUWA 1SJAA 1QT1A 1JQVA 1KQYA 1XC6A 3T0BA 3QZAA 1EWEA 3GU1A 1IQ8A 4K68A 4KBXA 1TTIA 3IVUA 2TAAA 4U5KA 4AZBA 1E40A 2D0GA 3PG9A 3WFZA 1X6LA 4U31A 1YIXA 3AS0A 1K8YA 4KCWA 3MUAA 1TFVA 1PZ0A 3CWOX 2HBVA 1BTCA 1GYMA 4H7ZA 2BX7A 4CQAA 3OVRA 4IJCA 3KEHA 3K4AA 4YVXA 4QNWA 4H9UA 1E4NA 1NDWA 4PCNA 5C0QA 4AD0A 5BRQA 4NAEB 4HA1A 1B4EA 1GOKA 1TV7A 3E0VA 4ES4A 1PTAA 3ZWSA 3HFTA 2NQ5A 1DV7A 2OG9A 1FWEC 4F9DA 1SMDA 3T8QA 1I60A 4RXFA 4TU1A 1JF5A 2WMJA 2W91A 1V3JA 2TYSA 2NUWA 3VVGA 3TSDA 4QITA 1OYCA 4D6HA 4LY4A 1XLCA 3G1VA 2ACQA 1KFWA 4O0ZA 4W7UA 4HHPA 4F0SA 3N1AA 3F1QA 1ZJBA 3IGXA 3W2LA 2Z29A 5C7VA 4WKFA 3EZ4A 2WWDA 2YDSA 3CK5A 4PUWA 5HJLA 3BG3A 1NSJA 4W7VA 3ALFA 4Z1BA 2OOGA 1SYTA 4L1XA 3N19B 4JN6A 3N6HA 3ITXA 4CVUA 3IJ8A 1TMQA 1MDLA 1OFOA 3CL6A 2VNCA 3N12A 3GHSA 4OBTA 1XHGA 4D71A 3S5SA 1CECA 4FOJA 4N7QA 4PN2A 1O5XA 1ZAIA 3WBEA 2NV9A 1JCXA 3AIEA 1HG3A 2VEPA 2ZWZA 3KTCA 3BC9A 2DPEA 2QVNA 2YCIX 1NWTA 4AUBA 2FH8A 3ZR6A 3T07A 1A5MC 2UV8G 1JFHA 3IJDA 3W7MA 1TJ0A 1ENUA 3SCNA 2OLHA 4IMEA 3PBMA 3C5QA 4OOUA 3NXFA 4LUTB 1GOXA 4IPIA 3TSMA 2FH6A 3QW3A 3NQAA 4AD5A 4BHYA 4LAKA 4NNBA 1TR9A 1PTDA 4N02A 3CAVA 3P82A 3APGA 1WDPA 4PMZA 1H5VA 3GR7A 4UZSA 3GH7A 5I3IA 2YOCA 3IAQA 1M7OA 3WLNA 4BF9A 1CB7B 5LXXA 4GACA 3VC5A 1S5NA 5DCBA 1TB3A 4A3YA 5C5YA 1VPYA 3MUY1 4WGXA 4OV9A 2QUTA 1J8VA 3MJYA 4XWUA 3U0HA 2BDQA 1VBUA 4IGMA 3QW4B 1DKWA 1H1YA 1R3RA 2CW6A 2Y6ZA 3UT0A 1D2KA 4PUKA 4PMXA 2QAPA 2DSKA 4HGXA 5F2LA 4CNTA 1JDAA 2CBIA 1OG0A 1EP1A 1IWBA 4MPQA 4JN8A 3W7OA 4QP0A 3W4RA 2F9RA 3HBLA 1UUOA 1DL3A 1EXPA 1MYRA 3LHYA 3UESA 1TPWA 5HNTA 3QZ6A 2XH0A 4MVAA 1K7EA 2GL5A 3H12A 1I0DA 3CUFA 2JQXA 2DUAA 3TZFA 2V5KA 3T8LA 3C8NA 1E0WA 3ARVA 5EFFA 4US6A 4ZO6A 1LT7A 3CHCA 1UR2A 1HKKA 3TXVA 3QHNA 3UZYA 4XZWA 3LZ5A 4ZQPA 4TVDA 3FLUA 4IL0A 2DY3A 2J7CA 1DTNA 2NT1A 2J77A 4LEFA 3TCEA 4CEXC 5CLTA 3P8JA 1QPNA 5F7UA 1XR2A 2FZ9A 1KRAC 1Q13A 3FCPA 4Z0SA 4XAYA 1XLMA 5CEWA 4TX9A 3UNDA 5C9ZA 1R46A 3GXNA 4GNKB 1X6NA 3LCIA 4IXHA 2YZRA 2DZAA 1LQ0A 2EPOA 2JF7A 1R2SA 2POTA 5AB3A 3B9EA 3SSZA 2BOGX 3FSUA 3WFAA 1EH9A 2PMQA 3UCQA 4XSLA 1OFAA 2Z1SA 1ZBKA 3CBWA 3V16A 4M6PA 5FAJA 1VF8A 2PC4A 1XD1A 2QUMA 1CZ1A 5A6MA 4Q8PA 2YL9A 5AHEA 1NWUA 4A6GA 1C8QA 2X40A 2XG9A 4D9PA 3WD4A 3GHUA 4IIFA 2PWUA 4POCA 1GVFA 1SJDA 4KWOA 2OODA 1HL8A 2B4GA 5XINA 3M5VA 4KIEA 4A22A 1E6NA 1I2QA 1FFRA 2GK1B 1WOBA 2I9EA 4HZ6A 4DAIA 2Q3OA 3A4JA 2FTWA 4S2CA 2VFDA 1BEUA 4AVOA 2B7OA 2PGEA 4E3VA 3MT1A 4JDBA 3NQFA 2MNRA 3SB0A 3WBXA 1JFXA 1KTCA 4AIUA 2BY0A 2P8BA 1MUMA 1O5RA 2KZHA 1KBJA 4CD4A 3YPIA 1AFSA 4C6KA 1HUVA 2J24A 4O1FA 2WHKA 1NELA 3KVMA 4IMAA 3AROA 1W17A 3MI2A 3MP5A 1PVNA 3RN6A 1NDYA 5I09A 1Q6OA 5EMLA 3L0NA 1A47A 1S5MA 1X6UA 3BLFA 3M46A 1RY0A 1UBSA 2QIWA 3QMRA 5CSUA 3PFMA 4JIRA 5D05A 4KKXA 2J75A 1Z7AA 5M3WA 1T0OA 1W5PA 1FVPA 5E6ZA 1CWYA 2PDYA 1X1ZA 4FIQA 1H7XA 2WM0A 2G8ZA 2JFEX 2QKFA 4D72A 4C7GA 5CH9A 4AFYA 1NM9A 5M5DA 1G4SA 4XBSA 3ICJA 4WZHA 4E2VA 1XYBA 1E5JA 2AMGA 4U4MA 3S5YA 5A6AA 2QCCA 3FXGA 5MKGA 4M82A 3V0TA 3K13A 4ZXOA 2ZZ2A 4E2OA 4IUGA 2BY3A 1IF2A 1OQFA 4DYKA 1BVZA 1TTQA 5BMWA 3PC0A 3KBVA 2ZE3A 2XFFA 4QJ4B 1XX1A 3QGAC 4L1GA 4AZCA 4P7OA 4KWWA 4LCSA 4NAFA 2DV0A 3MCNA 4AIOA 3KVKA 3PZGA 2OQLA 4JCMA 3P14A 3N2TA 4Z2LA 3LHUA 1JZ4A 4JTJA 2Y5SA 3HB9A 5B7YA 4IMCA 2PTYA 2BVWA 4WD0A 2W5FA 3FV9A 5HMDA 3HA1A 3WQ6A 4UFMA 2F6KA 1RXOB 1TMHA 2V6AA 4GXMA 4UTHA 1VBRA 3DYPA 4S3FA 4V28A 3RR4A 3WYZA 2DSWA 1EGMA 3BCFA 4X0NA 3P62A 3O15A 3UCCA 5F1VA 2ZX8A 4TOQA 1Q8JA 4LXFA 3WF4A 3E1F1 4GK8A 2Q6ZA 3LXCA 4L4PA 5LGXA 2C91A 3V18A 3H55A 1HVXA 2NZLA 1KM1A 2O7QA 3O6CA 1UQYA 1KRCC 1J18A 2ISDA 4YU1A 1AZ1A 1PWLA 4DPPA 3LQGA 5LA1A 4KFNA 1B9ZA 1VFSA 3E0LA 3KP1A 1S46A 2JKAA 4MNKA 3ELFA 3MB9A 3CS2A 3ZT6A 2VGGA 3LPOA 1GVIA 2QCNA 4F3HA 1JGMA 4C65A 3E2SA 1UB3A 4LUSB 1PB0A 1JPHA 4WKAA 3S1WA 1RCQA 2Q02A 3A22A 4K3ZA 4HOWA 2V3EA 3QQWA 3ZQ9A 3P3BA 4GZIA 8XIMA 3CUGA 2Z4GA 4YTUA 4GKLA 1F3EA 1D9EA 2WAGA 4HB7A 1DJXA 2DJLA 3FS2A 2A5HA 4M24A 2EF9A 2QQ6A 3WBYA 1O1HA 3H6OA 5AYXA 5SWUA 1W3IA 3LBCA 1V6YA 2QR6A 4UTTA 3P7YA 4LY8A 1V7AA 5DCDA 4S38A 1HJUA 3NDYA 3CV1A 2FGZA 5HATA 3SR7A 4F0HA 6CGTA 1QCWA 1EB3A 4XB3A 2OCZA 3OLIA 3H7VA 4Q7NA 1OY0A 2ZXAA 3EA1A 1WBHA 4FNRA 2Y7GA 4HU3A 1E0VA 1YADA 3SRKA 3DHPA 1Q8AA 3OGVA 3DI0A 4P8XA 4PMVA 4WF7A 1V51A 3GKAA 3RPDA 1W2VA 2A0NA 3L65A 2EPNA 4R9OA 1Y7VA 2YB4A 3UZXA 3QV7A 1QTWA 2ZZ1A 4I9MA 1FY6A 3ITLA 4Q8OA 2FDSA 3HPXA 3NM1A 4I3GA 1E4IA 5T9CE 3ZLFA 3AYVA 3SUSA 6XIMA 3UY8A 1JEZA 3FA3A 2WVUA 3D6NA 1FA2A 2Z1WA 2ZTJA 4DUXA 3SY5A 3GO2A 1M04A 2ZZ5A 1DPMA 2HJPA 3W1RA 5I3HA 1GQLA 1P1MA 3DFTA 3AS3A 1KM6A 3AHVA 4X22A 1O95A 2NQLA 4X60A 3AAMA 5DF0A 3WLJA 3M5YA 1LM1A 3W28A 4Q8VA 4CLMA 3O1NA 4BQ5A 1UW9A 4LVFA 1PTGA 1XPGA 1IYXA 1FFQA 3GHRA 4NNCA 4Q8UA 2BNJA 1F3WA 1TWWA 5FSDC 2BGQA 1LL4A 5ECVA 1M03A 1EXBA 1V3MA 4KWVA 3TNBA 2X0SA 1QR7A 2I5IA 5FJOA 4E5TA 5B80A 4DWDA 3DKLA 1FXQA 2P50A 3N11A 2OGJA 5CPQA 5JIPA 5U7SA 4KRUA 1VP5A 3Q94A 3IAPA 3L4WA 5H91A 1AUSL 4HYWA 3AXIA 3QFWA 4FHAA 2OKOA 2OPJA 3CHVA 4KEZA 5E5CA 1CLXA 2BXYA 2OZ0A 3VGBA 3W75A 4HNNA 4R5EA 4BEQA 1T7LA 4GCAA 1I2RA 3LHWA 4RE0A 4KQNA 4UQBA 4YCOA 2J6XA 3FA5A 1V77A 1E4MM 1FWWA 3B9NA 3W01A 1RBLA 5A6JA 2QS8A 3WNOA 2QCDB 2Z7GA 1G4PA 3KOYA 4Z0JA 2V5CA 5HQMA 3NPXA 1L2UA 1QK0A 4KH2A 5DBTA 4BR1A 3VOHA 1NP0A 1S2AA 2QCMA 4AWUA 3A5FA 1GGOA 3GNPA 3QBUA 4ICMA 5GNXA 2VZTA 2NUXA 2CC0A 4X2PA 1FUYA 3V0UA 5HUOA 3W3OA 2QVHA 3M9YA 3SAZA 5CZJA 4DHGA 1P48A 3LTYA 4PL2A 1JULA 3W1PA 3F2CA 1NH6A 1EJ7L 3QTGA 1TR1A 1TELA 3KL5A 1KFEA 2C16A 1A53A 2IQ0A 5HINA 5M17A 4TO8A 3T0AA 2FQIA 3NA8A 4G8TA 2Y63A 3T6CA 3UXAA 3W38A 3CZEA 2E4TA 1AMYA 1H2JA 3M0YA 4GVIA 5A8QA 5LIXX 3VUSA 3V5OA 4HNCA 4S1FA 3U48A 1V3IA 1VFTA 3ZXWA 1A49A 2R9RA 1MNZA 3CZJA 1YQ2A 1Y0EA 4A8RA 2ZWYA 2V38A 5A8NA 5K9XA 1TKKA 3PZMA 1E0TA 3WZ0E 1SO6A 4X9YA 2F2KA 2EG7A 2ALDA 3UA3A 3Q65A 1XG4A 4QQUA 4P2VA 2FJKA 3QR0A 4LSBA 4M1BA 1MZHA 1Q45A 4F0LA 3SUTA 5CC3A 1HVQA 1QNQA 2ISFA 2ACRA 4H1ZA 1VFOA 2ISWA 4JQ4A 2HSAA 3G6MA 4O53A 2WCAA 3I7QA 2I7GA 1FDYA 3P74A 3P84A 4UBPC 3B03A 3KS5A 2CZ5A 4O50A 1V6TA 3N3MA 3GG8A 4R88A 4OKDA 1PEZA 1VYRA 1B3XA 2CITA 3NOEA 3WEOA 2Y8KA 1FRBA 3HQ1A 4A21A 1W3TA 5F2GA 1H51A 4P7LA 2D2GA 3VGGA 1J12A 3A23A 4GO9A 1YTEA 4I5RA 1TZ7A 1A5BA 4JR5A 2KX9A 3OLEA 1UD5A 1ICPA 4R3UA 2FZDA 5AC5A 2I14A 3RYSA 4D8ZA 4TTUA 4C1LA 2ZA3A 3MA8A 3HZ3A 5CGTA 3MDWA 3URNA 5IBXA 5H6HA 2J8TA 1K03A 2J9ZA 4LF2A 3GAKA 3WDJA 3PJWA 1H1ZA 5FJJA 1H62A 1FCBA 1FWBC 1J10A 4A29A 1F74A 5CC6A 5LSMA 2OYMA 3WLOA 4JS3A 2HK0A 3BCDA 3SCTA 4DLFA 3PHAA 4ERAA 1UKSA 3W87A 2F2HA 4QEHA 5G4WA 1DWGM 2FIQA 3LI0A 3OJGA 2NSOA 4UTLA 3VI2A 3M0MA 2ADAA 4XK2A 2CWXA 4IZGA 2QV5A 4KCVA 2QF8A 2EHHA 3KBSA 4GC3A 4FX6M 3RRXA 3A9BA 3UPMA 3STEA 1HQTA 3PTQA 4GQRA 5I3GA 1KFKA 5L9FA 1LOSA 5GQBA 1Q7ZA 2GDUA 5A8PA 4JHZA 3AMLA 4NZ1A 3B0UX 1ZBVA 5CXPA 5LA2A 1CT5A 2DH3A 4GABA 3B3DA 3GH4A 1QO2A 4XV0A 2VTFA 4AEFA 4LWWA 1XLBA 3CZ8A 4F2BA 4JYDA 3SQSA 4NYUA 2JBMA 5TAOA 1X98A 3QSRA 2EO7A 2YBUA 5CGQA 3LV5A 4HA0A 5C8BB 1NOWA 1UA7A 3DFYA 1H1NA 3TJIA 4W84A 1GYNA 3BLEA 1XIBA 4RK8A 1FWGC 1JNEA 3UG5A 2HCVA 2E6FA 1UP3A 2WHJA 4DXVA 3NPVA 4C1NB 1JI2A 1R2TA 1ICSA 4NG3A 1EP2A 4MLRA 3UD6A 3JZEA 4NX0A 1TPC1 3L68A 4HMCA 4O0QA 3NQMA 3AWOA 3L12A 3QC3A 4X0VA 1WNOA 3AXMA 2ZZ7A 3LNMA 2RUSA 1PCKA 1TTPA 3M0HA 2PZNA 3CUZA 4ZE4A 2B7NA 3H26A 4FX7A 4XZLX 4NASA 1Z9AA 3LYEA 1E9ZB 2ABAA 3EB2A 1HFBA 3I3DA 4OZOA 2EXOA 3W83A 4KT2A 3N18A 2H8XA 1JUKA 1ELSA 1ISXA 4HNUA 1PXGA 1MW3A 2PP1A 8RUCA 1YXYA 5E1QA 4WQ6A 1FCQA 1XGEA 2VQTA 4JTGA 4GZEA 1LQ2A 3SI9A 1QPQA 3A13A 2PWGA 1EDQA 3R7MA 4XTDA 1LF1A 1BYDA 3MWAA 1DXEA 2VFGA 4FOUA 4LAOA 3T9PA 3T2OA 4ZQOA 1HZYA 1SMAA 4IMGA 3WDIA 2E5CA 2J8GA 1XSIA 4YWIA 4JIIX 3K8LA 4QE1A 5G2HA 5DLCA 3DFNA 1EP3A 3H2AA 1E9IA 2I1OA 1G01A 1RK6A 4GX9A 4UFLA 3GFXA 2QUVA 4PTXA 4N6EA 1R0MA 3MHUA 2DSUA 4YTSA 2PP3A 1NF0A 4OQVA 3PULA 3NEVA 3S2NA 1JF6A 1SW0A 3BSMA 1PDZA 3ZVIA 3DHFA 4K7VA 5HWNA 2V3DA 2E7FA 3VOIA 3R79A 3DG3A 3KHJA 5LNVA 1B1YA 4ERGA 1J01A 3M47A 3CQJA 3G24A 3VINA 4QGCA 4V33A 4RZ6A 3BGAA 4GFSA 1QRQA 3SFWA 1G7VA 2WMGA 5E6YA 5JU6A 1EOMA 1QWKA 3BURA 3N6JA 2YCJA 3B4YA 3BMWA 1EDGA 1HGYA 4O1EA 4GMEA 2I5GA 1TVLA 3VOCA 2Z7KA 5DY2A 4O1BA 3RHGA 1IHIA 1HKVA 2RFGA 3DFHA 1SO4A 2CZDA 2O56A 3NQCA 4MZ1A 3UVIA 1E4LA 2Y7EA 2WYSA 1TRDA 3BSGA 1ME9A 1K6WA 2Z27A 2V5LA 1MFVA 3W22A 3NQ2A 1X1OA 1NQKA 3I7RA 1GTHA 1R3WA 5DRCA 3OU8A 3UJEA 1MFUA 2XVNA 4IFKA 1OVDA 3E96A 2Q3RA 4S3BA 4YMZA 1K8XA 1Q66A 2OGYA 3WQPA 1JZ8A 4H9VA 3GDKA 5EMYA 1F61A 5K3VA 1TV4A 2WB5A 1JG9A 1UD4A 4BF5A 3NSNA 4GQGA 3DC8A 2NUYA 3U8GA 3PS7A 1A5CA 3RX2A 5BYWA 4PMOA 1KXVA 4OBRA 3W1TA 1Z41A 1L6FA 3DYMA 3CIWA 4L4OA 2WJEA 2WOQA 3IRSA 4AIBA 4DIAA 2GK1A 1MVYA 2WC3A 3TN4A 3L4ZA 4FLQA 1P6BA 4HVXA 1VGAA 4XUYA 2YA2A 3SQMA 1MEIA 1K6AA 4Y2WA 2E68A 2PTXA 3FEQA 3MSRA 4HYRA 3QF0A 1TSIA 2XH4A 4NU7A 4JTHA 5BXTA 2V81A 1XRTA 1CTNA 2PA6A 1OD8A 3VU2A 3DHDA 3UR7A 1S2UA 4JQ1A 4IMFA 5DO8A 3GDTA 4ACZB 4UNIA 5D37A 4DX3A 1E43A 1M6JA 1WUFA 2PTWA 1VH7A 2WSKA 4H8UA 3GIQA 2QV4A 4AC7C 2Y4SA 3WDQA 3LRKA 4PCFA 3HGJA 1V0KA 4ERIA 3UCDA 1WKFA 3VMOA 4Y9MA 2R91A 3TUUA 3L4VA 3ANYA 3O0KA 2A7NA 5IM51 5HULA 3BAXA 1E1FA 1X8FA 1VAHA 3TC6A 4JCLA 1WDSA 3WH7A 1R38A 4RDWA 2XN2A 3VX1A 2EPKX 3V3WA 2AOSA 4Z2HA 1SZRA 1GOOA 5TIMA 2PGWA 2XISA 3W71A 3ARQA 4B5TA 3PY2A 5ECUA 1XLDA 3U7BA 3WK3A 3IGHX 2X30A 2XTKA 3EX3A 3LM7A 1RY8A 1SSGA 3DECA 3EDKA 3UZJA 3D0CA 1EF3A 3RO6A 2HPIA 1TMLA 4E8GA 1W1TA 4HCHA 4C6CA 3ARXA 3IJQA 3EWUA 4GUGA 1RPXA 1BGAA 3NO3A 3PUOA 5H1WA 3VKDA 3ONBA 5J5DA 3GVVA 1OK4A 4XO6A 1EJRC 1NJJA 2ZOXA 4PC8A 2IUZA 1G1YA 1XBVA 5D02A 2ZKMX 1NTHA 3UPWA 1R9ZA 3BQ5A 4IJRA 3IIPA 1YHTA 3LZ3A 3FN9A 1MRQA 3Q2DA 4EPBC 1MUCA 4CNUA 3PPGA 2WK2A 4ECLA 4ZOEA 2Z26A 4LH8A 1UIOA 3GBDA 4UOQA 2BHYA 3OLDA 1AD4A 1UD3A 4BF7A 4ZB2A 2NQ9A 3IJLA 4OWGA 1D3GA 3M6DA 1KQZA 5TBOA 1AJ2A 3CO8A 3EX1A 3EWYA 3T4WA 1IEXA 4UCGA 1JUBA 3NSXA 1UWSA 4YJ5A 5CZ0A 3RK8A 3DIPA 3WMSA 4P7QA 1H7WA 4GYFA 3TA9A 1KBKA 3DFOA 3VKBA 1LQAA 3N2OA 4H00A 4IP7A 1M3UA 3FW6A 3RDKA 1PDYA 3E9AA 1XXXA 2VO5A 3CQKA 3MUXA 1G67A 4F8XA 3CUIA 2QW5A 4FIRA 2XFRA 2C3ZA 3TROA 3UWQA 4MG4A 2E6DA 4GKTA 3RAOA 1WDWA 2J7HA 3AISA 2H9AA 2VKZG 3KWXA 3TTYA 2IS7A 2X0HA 4B15A 2ZZ6A 1R47A 4AIEA 4U28A 3P81A 1L8PA 3VIGA 3VDBA 1QI2A 5FEPA 2PC8A 4M7SA 1IWPA 2WMHA 4PTNA 1RD6A 3FDKA 4WRHA 2PDMA 1DXFA 1LG1A 4WDTA 3TQ0A 4MJ4A 1W8SA 3LGEA 4IGSA 2UZ9A 2WMIA 4UR9A 5E0FA 1Q85A 3KCJA 3GUGA 1KM4A 1OGBA 1KWKA 1A5AA 4DRSA 1QAPA 5IHRA 4J9JA 2BHZA 4Q4KA 2VX5A 1J2WA 4GISA 1QBAA 4AD1A 3BK0A 4MDOA 4AVNA 4PUEA 1WOAA 4U5IA 2YDAA 3QTPA 5BW6A 3MUCA 4TV6A 1SPQA 2O9TA 1OINA 4Z2JA 4R7OA 5AKQA 1A0EA 4LUYA 4PMJA 2VXNA 5AOUA 4IWWA 5CAHA 2B7PA 4LOCA 3R0UA 1U1HA 2WO5A 3AU6A 1GONA 2OT1A 4KGJA 3ARPA 1TPEA 1XS2A 5HMFA 4RE4A 1K3UA 1ONXA 3IIOA 2ZA2A 4JTSA 1V8EA 3EDFA 1YRRA 2VEIA 4R9XA 4NZFA 5A2CA 1GK8A 3GXFA 1UD2A 3TCSA 1UH4A 1GVOA 1BYBA 3V35A 1KO0A 2EEXA 1UWIA 3LMZA 1AQFA 3DFSA 2YL6A 2E09A 3OO2A 1M7PA 5IDIA 3EWBX 4Y9OA 1KB3A 3OQ8A 5DELA 3GRIA 3NZPA 1XICA 5AHNA 1S38A 4REQB 1RP9A 5D9OA 3UGVA 1EYEA 3LU2A 4DN1A 1S1RA 3FVDA 3RX4A 3HQPA 1Q3NA 1SZGA 2XGBA 1XLLA 1ZFJA 2QJHA 3ZOAA 2Z1BA 4I9TA 2JEPA 5MHBA 4QG6A 2J4GA 3P5YA 3BJTA 3OYXA 3CIXA 2VOTA 1DJZA 5EBUA 3F5JA 3IWPA 1XQKA 1YE4A 5IXEA 4A3HA 2XH2A 2GVJA 3E3HA 1Q7MA 4HKPA 3SZ8A 1SW3A 3VFLA 4X2RA 5BMXA 1DORA 3OP2A 3EOOA 4R27A 2A6LA 1SFTA 3N73A 2XHYA 5CZKA 3KVLA 3EBVA 5FJPA 2ONEA 2OVLA 1SO5A 5D2TA 3WUEA 4WXYA 4JYEA 2C1GA 1E73M 3PZTA 1HJQA 3AIBA 2DIJA 1KXQA 4GUIA 1QOPA 1Q6FA 4NAFB 1EOKA 1ME8A 3GG0A 4MUPA 2GJXA 4MWAE 3LXBA 4MYAA 1RA5A 2PWVA 4CNPA 1H7OA 3W6YA 2GZXA 1NQ6A 2OLSA 4MAZA 5BCAA 4HOZA 1V02A 3G1DA 1M68A 1FCVA 4AF0B 1SJBA 1NF7A 2PODA 3GR4A 5LIYX 3DX5A 1BKHA 2JK2A 3HOJA 3GG7A 1OADA 3NAVA 1PCWA 2X16A 6TAAA 3T0TA 3WNLA 5FCZA 2RHGA 2PD5A 1LJYA 1XFBA 3N4AA 4NJIA 3IV3A 1RQHA 4M7TA 3OPSA 3QVQA 2VDGA 3F7JA 4WSJA 4GPNA 2YSWA 4MNJA 3NTYA 3NDOA 4MGGA 3NPUA 3W1LA 3IIZA 2ZUMA 3SIMA 1Q2RA 2FKPA 3ALGA 4NRSA 3W27A 4GJ1A 1T8XA 3VD7A 4LVGA 2JKPA 2VCAA 4F40A 4MTVA 1R3QA 3KCOA 2WLYA 4IGNA 4UTKA 4J40A 3OYZA 1EJTC 2PDXA 4Q7IA 3INPA 1JZ7A 1CCWB 1OX6A 4A2SA 5TNVA 4O16A 3G2GA 4AYSA 1LL6A 1TPDA 1RLCL 3OVGA 4DBWA 1PIFA 1DEDA 1EX1A 4P8VA 3LCHA 4F0MA 4NZJA 1Y5VA 2V8ZA 1H0IA 2J25A 3WNMA 1FCUA 1S3TC 3UEQA 1J0JA 2XM2A 2A3LA 2XFWA 2XH7A 5DT5A 5F4XA 3A3HA 3R10A 2REQB 4WR3A 4Q6JA 4P61A 2CBJA 2OZ3A 4JKLA 1XW8A 3E12A 3ABSA 3PJTA 4Q4RA 3M0IA 4MF4A 1O60A 1VCFA 5JH1A 4Q4SA 4S3CA 3EX4A 3SSJA 4JQAA 3F2DA 5E9AA 3R0DA 2ZZ4A 2WMFA 5D9NA 3UJFA 4CD7A 4NYYA 2WZEA 3S46A 3FVMA 2QMJA 4NZCA 4XZHA 2AL1A 4FXSA 4O12A 2BOFX 3GU9A 4UWMA 4GLEA 1PX8A 1ZRQA 2FHFA 2CLKA 3FSTA 3ABRA 5REQA 4NKCA 4JIQA 4EPDC 5EGRA 3SN4A 1UR9A 4EF9A 3REQA 4PEEA 5HR7A 4FSAA 2IKHA 4ZA0A 1FTXA 3WD2A 3ZLGA 1VFHA 4NRRA 3UXKA 5JBFA 5BU9A 4LB3A 5BOFA 3VKJA 2GGJA 1ALDA 1JYNA 2SFPA 3L5AA 4MSSA 1KM0A 4KFOA 2GVEA 1CYGA 2GVLA 1JNDA 3LGGA 3H53A 1PV8A 4PE8A 4CQBA 4Y96A 1ADOA 1K9EA 4H83A 2RDTA 4XISA 4B3ZA 4Y9NA 1WKYA 3QKEA 3RU6A 4EKJA 1CBGA 2FMOA 1TQJA 3FAWA 1YTDA 1OC6A 3BW2A 3SO7A 1QDSA 4KW2A 4RV3A 4AMAA 1FP9A 1NWSA 1O6IA 2X7WA 4W7WA 3DFPA 3T0DA 4DQWA 1IZKA 5ABFA 3MWCA 5HA7A 4GJIA 1R9XA 4ICNA 1TV8A 1FWAC 3HGOA 1ADSA 4YYFA 4U3CA 2CHNA 1ZLPA 5CPLA 3DCPA 1BWKA 1GVYA 4IFOA 4QG8A 3CV2A 1GKQA 1PX4A 1BWLA 3UERA 1WZLA 5C2GA 2VDHA 3U4FA 3KLLA 3I3EA 3O05A 3B0XA 3PTDA 3TOYA 1VJIA 1E6XM 3LTPA 1BVNP 2XGZA 4QROA 3VGEA 3LI1A 3MUIA 2YKKA 4KCUA 3N2MA 1E0XA 4F79A 1FX6A 3WENA 4RLIA 1WYIA 1R87A 4JTTA 3FIGA 3AALA 2DVTA 1F5ZA 3QH2A 3AOFA 5FA5A 2DQXA 3HV9A 1MQPA 3DH7A 4XBKA 1M7XA 4H01A 2OZTA 2OO0A 4GRSA 2DUZA 1L6SA 1UCWA 1TZZA 4CU8A 2O9RA 1XFCA 1XF0A 3HM7A 2C71A 3DG7A 3HGRA 1QI0A 3L7RA 3HURA 4ACZA 1O1ZA 3CGTA 1LP6A 5I79A 1SM9A 1POJA 2WV8A 3BANA 2AAAA 4DJDC 1OM0A 3VCNA 2QCHA 1TYGA 2PDQA 5KSWA 2IPGA 2Y88A 2VVNA 2XIIA 2WKJA 1XLAA 3VILA 2GQ9A 5G1TA 1WAUA 4CU6A 1ZALA 3VE7A 1GKRA 3L5MA 3E49A 3GW3A 2XIMA 4Y6GA 1W56A 4DO5A 1JXJA 1KLZA 1T41A 4O1AA 1K4GA 4K1GA 1VLWA 4AXKA 1DQUA 4KGLA 5FACA 1JYXA 2Y7DA 1E1CB 4EWND 4JKKA 3QSTA 3P93A 3GXIA 1X7FA 2G4JA 1IZCA 1KRMA 4Z1AA 2J7FA 2ZXBA 3WLPA 4F0RA 2HISA 2QHAA 5IBXC 4A8LA 3W2KA 1XYFA 4S3DA 2Y8UA 4JDYA 5CPSA 1PJ9A 1SFJA 5D09A 4A3QA 1JDCA 2BG5A 1H60A 4N9CA 3IJ9A 3D46A 5F2IA 5AZ0A 1FWDC 4GVHA 1FHUA 2ZZ3A 4QAIA 2CERA 4DY1A 1CGYA 4PGLA 4TX6A 3W1NA 3GB6A 3SW6A 5H8MA 1F6PA 2X41A 1P0EA 1P6CA 1V3LA 1IEWA 2YBTA 3VNIA 4DUOA 3M4HA 3E02A 2VX7A 1WDRA 4HPGA 4RX0A 5C71A 4HBKA 2PGFA 5ABGA 4GJJA 4HHHA 4ASTA 3MC5A 5EMUA 3QRHA 1QO5A 4XO7A 1XKJA 3B8IA 2WVTA 1EJVC 2HTMA 2A85A 2GGEA 3QN3A 5EB8A 1QI4A 5T91A 2V9DA 2VFFA 2PLCA 3NSMA 2PDKA 2XDFA 5DY3A 1T40A 1FWJC 4J3WA 4TIMA 2QDGA 1OFPA 3EGJA 5FSEC 1HO1A 2FGBA 4EACA 3S0CA 4G5DA 4AU0A 3HPZA 5CBBA 1JD7A 4B92A 2VCCA 1PWMA 1MW1A 3GTFA 4B5WA 3BG5A 3MQTA 3QR1A 3LRLA 3EMCA 2QJIA 2QT3A 4GYPA 5LXEA 3A6OA 3S6DA 3D47A 4HCDA 3CZLA 1F2JA 4J3XA 2QCGA 5ENLA 4F9JA 1JCNA 4XKMA 2DFAA 3AIRA 4ADTA 4ENLA 1UKOA 2ZVIA 1FWFC 5I3JA 3OBKA 4XVDA 3O0FA 3WNNA 3AZSA 1L6WA 4H6QA 5FF3A 2WC7A 1UZ1A 3IV8A 3MY9A 3BG9A 3B0PA 4FI4A 3BTNA 4BI6A 1KGUA 1PYMA 1MXGA 3WK2A 4H9TA 5AY7A 3DOPA 4PCTA 1THFD 3EKGA 3THQA 1SR9A 1U83A 4AZ6A 1W31A 3NO1A 2PRHA 3WLKX 5A8MA 1XIIA 4FXJA 3PPHA 2W9MA 3CO4A 3ZMRA 4G7EB 3KBNA 3PZIA 4G56A 2I16A 4UTUA 4M8UA 1UBPC 3DAQA 4QRNA 3TP4A 3KOZA 3WSUA 4D6CA 4FF7A 4OOZA 2ZFAA 4HU0A 1ZB5A 2C79A 2HVMA 1JDDA 2XVGA 1HW6A 3C2OA 2DEPA 3K4WA 5CG0A 1XM3A 3NGFA 2QIIA 3VM7A 1G94A 1A5UA 2J8FA 2WKLA 4MJMA 1F76A 3TQPA 2G5WA 3TQVA 2VX6A 3H7RA 1KBBA 3FX4A 2NWRA 3WQ5A 1BQGA 1BF2A 4UMCA 1B3VA 3ONCA 3UZ5A 3GW0A 3PTKA 1XDJA 1UD8A 1TCDA 2YA1A 2NVDA 4H8HA 1LUCB 5K2ZA 4HPHA 3U57A 3G6LA 2BLEA 5GJNA 3U2CA 1OFRA 1TX2A 2YL5A 4R34A 4XAGA 3TA6A 4FNQA 4ZB0A 1QPKA 1W37A 2RKXA 3DENA 2Y7FA 4ZENA 4FNTA 1TUFA 1D8WA 2HMCA 2PF8A 2CZEA 4DYJA 3V4BA 2X1UA 1YKWA 2BB0A 3BCJA 3IVSA 3PWGA 4RDYA 3PZQA 1KW1A 3T4CA 2GQ3A 4QE5A 4EXBA 1XYMA 3GBEA 1JIBA 3ISIX 4IP5A 1K7FA 2UWFA 3EOLA 1GCYA 3KP0A 4C90A 2C1HA 4FK9A 2QCDA 1FWCC 3BLIA 5PTDA 4ACYA 3TYAA 3VD5A 5D2VA 4H6EA 2GDVA 1OEPA 6REQA 4UFIA 5M2FX 3UVAA 3APYA 5A3HA 3RUBL 2AGKA 2NV2A 2CLMA 2VGIA 2EKGA 1RJQA 3EKLA 3USZA 5DBUA 2RDWA 4NNAA 5E93A 4M56A 1I45A 1ZZMA 1YTKA 1PX3A 3AU2A 3ES7A 1BAGA 2W61A 3PZ9A 3B06A 1TREA 1PZ2A 3EPNA 2HBXA 2WZMA 3GDLA 2AQVA 4BA0A 2W63A 4IHCA 3QMTA 4RZ4A 5I78A 2ZUVA 4DBSA 3XISA 3VM5A 1ZQ5A 1ADDA 1QATA 1DTUA 1KA9F 5K7JA 3MBFA 2BHUA 3SJ3A 1C7TA 2XSBA 4JX6A 1B54A 3B9DA 3MMUA 4WSKA 3GNRA 3M5ZA 2CHRA 4J4KA 3GXTA 4O4WA 2AL2A 3U7VA 3L4TA 2H8ZA 3FJ4A 5HNUA 3LBMA 3B9OA 1GOIA 3AIUA 1QNRA 1UA3A 4LS2A 3U2EA 1TUXA 1FWRA 1FH9A 3S2MA 3BPWA 5HNNA 4BS0A 3KZSA 2ABBA 2HZGA 5LIUX 2D2JA 2BXZA 2ANUA 2VL4A 1QOXA 4GI9A 3TVAA 4DI8A 3CASA 4XQ6A 3M44A 1AK5A 1R8LA 2FYMA 2WCGA 2WNNA 1EQCA 3NQEA 1G69A 2CKSA 2PDGA 2CLLA 4BFAA 2GQAA 1P0DA 3AXKA 3II1A 1EC8A 3H7UA 4LAZA 2E77A 2VRJA 4G9PA 3FYPA 4PUNA 3B8VA 1V6UA 3GZ3A 1SU5A 3TYCA 1RP8A 2PE4A 1F05A 3ZS4A 3Q45A 3TOPA 3VNKA 3VK5A 3S6OA 1J93A 2OEMA 5HPOA 4MWAB 1R3VA 4UQDA 2D69A 1P5BA 3VKKA 2PS2A 3CYJA 1ME7A 1LBLA 3UWVA 3R0KA 1TIMA 4BCEA 1B3OA 1TJRA 4DM2A 4EOUA 3VNJA 1GJPA 3O6YX 4JY8A 3CYVA 4IPPA 1WQ5A 2QUUA 4YVVA 2E0PA 3K30A 3WQDA 4EPEC 3TMQA 5FF0A 3W53A 3XIMA 2VEFA 2X1RA 5C70A 1Q2SA 3BGJA 3M64A 3WBWA 1J2BA 8A3HA 3WKZA 3VKCA 4EK7A 3DU0A 3H4XA 4FNUA 5K4ZA 4DB7A 6ENLA 1OGGA 2F6XA 1TWSA 1ZAHA 4LBUA 3G3DA 3P67A 1JCLA 2GSHA 5EMMA 3GZAA 4JTIA 4Z08A 2CBUA 5CZSA 1E71M 1V08A 7ENLA 1W32A 4C7FA 4Q8TA 3I3BA 4GQQA 2WPGA 5LGZA 4MY9A 5D9MA 3ZSSA 4OGZA 3S83A 4NL1A 4HK5A 1QNSA 2R24A 3VIFA 3AIQA 4JTAA 4KEUA 1W1B1 4U10A 1EIBA 2OX4A 4Q32A 3W0KA 3QC0A 4NP7A 4CN4A 1S2VA 3VE9A 3WMLA 2HS8A 5HNRA 5E70A 1GZGA 3PUDA 3E0FA 2WHMA 2DSZA 3WN6A 3PWIA 1GNXA 4NZ4A 1RA0A 2G4FA 5FL1A 3GC4A 4MNLA 3K2GA 2J9XA 3O6AA 1MW0A 3AXHA 1L9WA 4DF1A 3QPZA 4NJKA 2W79A 3QPEA 2QJNA 3NZ1A 2PCQA 1YEYA 1IT0A 5MKGB 4D6IA 3QLDA 4W85A 2JE8A 4Z1CA 2GVYA 1DXIA 2YIHA 2YA0A 3FHAA 2XVPA 1J0HA 1CXIA 3W29A 1KTBA 3FDGA 4LNCA 3QR3A 5AYZA 1GOWA 1ZY9A 1EA0A 1VBHA 3GSMA 3W76A 2IPWA 5ABEA 4RDVA 4AISA 2YJQA 1HXJA 1RZMA 1KM2A 4HSNA 4JL2A 2A3AA 1CXLA