3LTYA

Crystal structure of the mutant v182a,i218a of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with inhibitor bmp
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
214
structure length
214
Chain Sequence
DVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGAGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGAIESIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: "remote" residues that stabilize the active conformation.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
total genus 82
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2010-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ltyA00
3LGEA 4WZHA 3N2MA 5HWMA 2V2DA 3BLFA 3ZWSA 2XN0A 2QDHA 5BW6A 4IJBA 2E77A 3L5MA 1JULA 2ABBA 3C2FA 1B4KA 3S5OA 1TTJA 3BW2A 4NNAA 1IXQA 1XXXA 1ZJIA 2PC4A 1P5BA 4O8RA 1EWEA 3LBMA 4IQLA 4CQ9A 5TQLA 1JCYA 1M6JA 1HL2A 4TR9A 3LHWA 4PL1A 1OK4A 4UCGA 3CTLA 4AHQA 4UNKA 2EKCA 3W7OA 4DO6A 1JRCA 1KM4A 1GPWA 1L6WA 4JTHA 4RZ4A 4LRTA 3LRMA 2VENA 4Z1AA 2VFDA 3TAOA 3W23A 2NZLA 3RLVA 3WK3A 4DELA 5DY3A 5KINA 1LRQA 1VGAA 1EP2A 1VS1A 3Q94A 4JY8A 1QDSA 3NYZA 2YR1A 3T55A 4UTJA 4YWIA 3GKFA 4FNSA 1QR7A 4OU1A 4UTKA 1T99A 4Y9AA 3P60A 3BV4A 3SW6A 5LHEA 2ZA3A 3S42A 3TNOA 2V2HA 4IMDA 2BTMA 3GNNA 3W7KA 4JTUA 4JYEA 3GB6A 4XWUA 3M41A 3TDFA 3DH7A 3L68A 1H1YA 5E1QA 3LI0A 3IGXA 3NVTA 2ZRVA 1SZEA 3L65A 3DFSA 3PULA 2HTMA 3LCLA 5F1UA 3HMJG 5CKSA 3R12A 3LHVA 4AEOA 4O50A 2P0OA 2AGKA 4JICA 2FIQA 4WY0F 4OV4A 1TTIA 1JVNA 5AC6A 3PY2A 1OX4B 4K7YA 1FWNA 1TPC1 1H61A 3DHDA 3TR2A 1PHWA 3LHTA 2GJNA 2QCHA 3B06A 3NAVA 2QDGA 2A0NA 1YLVA 3QF0A 2CLKA 8TIMA 5K3VA 4N9CA 3HGRA 3TQ0A 5DN1A 3B8DA 3BK0A 3M5XA 1SO3A 2PRHA 5AFDA 4N9BA 3TSMA 4KKXA 4JTIA 3O06A 4ZQMA 3NQ7A 1PV8A 2G5WA 4RXGA 3FEMA 5LGZA 5CPMA 3KVKA 3DZ1A 5I3JA 1OX4A 3EWWA 4K6AA 3G24A 2DZXA 3A23A 1LRNA 5I3GA 2VKZG 1TB3A 1ZNNA 5D32A 3VE9A 4GC4A 1B3OA 3HIJA 2B4GA 5K7JA 4P2VA 1GOXA 4NZFA 4LVAA 2D73A 2ZZ7A 3GDLA 5D09A 2CLOA 3NPUA 4TU1A 2Y62A 3RFAA 1VJIA 2YSWA 1K03A 4WX2A 4N2YA 3TFXA 4FX8A 4DO4A 3STFA 3W07A 1O94A 2QCLA 4CCDA 4JS3A 1OX5A 5KMYA 2EAWA 4OBTA 4UC5A 1R47A 3E49A 2WNQA 3T78A 3HG4A 4Z1DA 2EPHA 1YTKA 2PE4A 1KTBA 4JGDA 2NX9A 3UWQA 5LNVA 1WAUA 2YYTA 3GYEA 4KFOA 1MSSA 3S9YA 2OX1A 1GG0A 3B0PA 4YLWA 1SFJA 1W3NA 1A5SA 4O54A 3VNDA 1F7BA 3W7EA 2Q8LA 1QPNA 1KM6A 2CW6A 2X1TA 3NM1A 1B9BA 3MBFA 1QO2A 1L9WA 1OX6A 5AHLA 1QWGA 5G2WA 5HINA 4K39A 1HG3A 4UTIA 3A5FA 1DKWA 1H50A 3NQFA 2QUVA 3W2MA 2CLLA 2OT1A 3W88A 4EWND 2YGYA 1Y0EA 3PBUA 5GVJA 4UXDA 3T4CA 1H7OA 1O60A 4Y90A 2CZEA 2JKAA 2W79A 1W1ZA 4K8EA 4O14A 4ZQRA 1TV8A 1ICQA 4ADUA 2CU0A 1W54A 4U28A 1GQNA 1ZHAA 1YTEA 3TX9A 2VEIA 3C2RA 3EEGA 3IVUA 2A7PA 5BMXA 3L0KA 4N6EA 3AO0A 4JTSA 2B7QA 4LOCA 1AL8A 4ZVJA 3NQAA 2V81A 3KRSA 2TSYA 4HT3A 4LVBA 4OT7A 2FB3A 3SY5A 1P4CA 3FA5A 3G1VA 2PRLA 1TSIA 2DJLA 2HMCA 5KTLA 3HG3A 1WDWA 2JK2A 1SU5A 1KFBA 3A5VA 3L2IA 4DF1A 2ZTKA 4UFJA 3BG5A 3W7LA 3LTPA 3NDOA 3W1PA 3HJZA 3TIMA 1F05A 1KFJA 4DPPA 1SZGA 2H90A 4TIMA 3L66A 3F03K 3S1UA 3SSJA 4JEQA 1AL7A 1OFBA 2H6RA 1ZAJA 1YXYA 3W1UA 4Z08A 3W86A 5LZLA 2BX7A 1NSJA 2X1SA 3NL5A 4LRSA 5AOUA 4UFKA 3W7MA 1K02A 1GZGA 4FIQA 2FDSA 3EX6A 5FEWA 3H55A 2KZHA 4IWWA 5DCDA 2BZNA 3PAJA 3L0NA 4HKPA 4LVFA 1K7FA 4JX4A 3M5ZA 4UTWA 5I3HA 1RQBA 2C1HA 1EWDA 5AC8A 1ONRA 4BFAA 2ISVA 5HNRA 5J5DA 1TPDA 5CZSA 3GXNA 2GOUA 3RF9A 5BMWA 1PHQA 4JTFA 2JBMA 4O28A 3DAQA 2QUTA 5I3KA 3RNDA 5HJLA 3NG3A 2ZRZA 2J24A 2WO5A 3N14A 3E0IA 1KFKA 3DI0A 2YX0A 1ME7A 3CEPA 3QZEA 4OGZA 1W37A 4A22A 1QPQA 5DBUA 4FNUA 1Z42A 3IIZA 3I65A 1OF8A 1B4EA 1WYIA 3CLMA 3A9IA 4Y6GA 4GUGA 3P82A 1SUXA 4ZZ9A 4ORIA 4JXCA 1DJNA 3BO9A 3EX2A 2FJKA 1YYAA 5C2XA 4LC8A 3MP5A 3PBWA 3W71A 1X1ZA 3W7CA 4M6QA 4MZ1A 3EXTA 4ZQNA 1X6UA 1S5WA 3TJXA 2YYUA 4O1AA 1TPVA 3CM4A 1GYNA 2ZRUA 1FCUA 3EWUA 2JKPA 2A21A 2W6RA 4BI5A 1EX5A 2C16A 3JRKA 3E96A 4UMBA 1I2RA 4K8HA 1X7FA 4E0CA 3LDVA 1FQ0A 3P5YA 4JR5A 4HNVA 5CZJA 4LC6A 1EP1A 1U5JA 2E1DA 4JY9A 4L4LA 1V5XA 3N3MA 5D05A 1GVSA 1YPIA 1W5QA 4MOZA 2OT0A 3L0GA 3ATYA 5CSSA 1G4TA 5L9FA 1GVRA 3GX9A 4HNUA 5K9DA 3NXFA 3EWBX 4DF2A 3W1TA 2CLIA 4HIBA 2ZA1A 1CX9A 2V9DA 3W22A 3LLFA 3N9SA 4DO5A 3ABSA 2FPVA 4KWWA 1XBYA 4AAJA 2O7QA 1TJPA 2YW3A 2F84A 3UWWA 3NQMA 4UTWC 1C9DA 1YDVA 1LCOA 5F2LA 4AB4A 1TV5A 2J9YA 3O8AA 1IXPA 5HWNA 1SO6A 4S1FA 3AJXA 2W0UA 4UUIA 1S5VA 2E09A 1R30A 2V82A 2A4AA 4FNRA 1T0OA 3PUOA 1RQHA 2WNZA 1M7PA 2BSLA 2ZZ4A 1RV8A 1C8VA 1SZFA 1TO3A 2J6XA 2GQ9A 1P0NA 4RXFA 1H7WA 2QJIA 4NQ1A 2A7RA 1NF0A 4LS0A 3OVQA 3LB0A 4M7TA 3NQVA 1DVJA 1KW1A 2FTPA 4TX9A 4J9JA 1TRDA 1DQWA 4RX0A 1W5NA 3C2EA 4RZ6A 4O13A 2DZTA 2Y85A 1G4EA 2YDAA 3VKJA 3KRUA 3H54A 1ADOA 3PSWA 1NFBA 3G1HA 2Y6ZA 1VCVA 1QO5A 3W2KA 1DHPA 3NZ1A 3MJYA 3EXRA 3CWOX 4GUHA 3LCHA 1JCNA 1FY6A 1WBJA 3CHVA 1QPRA 1RZMA 1LORA 4GBUA 5D2YA 4ADSA 5KITA 5SWUA 3NL2A 2O7SA 3ABQA 4HNNA 4Z0JA 3TW6A 3P5ZA 2WSRA 3C56A 4N4PA 3W9ZA 3VFLA 4Y8FA 1MO0A 1QFEA 5AHFA 4UTTA 1THFD 3USBA 4RKAA 3A22A 2R91A 5AB3A 5D04C 1OYCA 3G8RA 1HTIA 4UR8A 1SQ7A 2X16A 1FDYA 4RR4A 3PVFA 4M6PA 4LWWA 4O0ZA 2X1RA 3C52A 4ZQPA 3OVPA 4QJ1A 1LRTA 3S5NA 4JDBA 1H60A 5FESA 4EF8A 4IMEA 3TSBA 4O0KA 4O16A 1YXCA 2Y70A 2Z0IA 1VYSX 2C14A 3YPIA 2RHGA 4E38A 2LLEA 4HN4A 5LNRA 1OFQA 4UTLA 2DZPA 4N02A 5K4ZA 1QCWA 4MIMA 1H7RA 1G4PA 1EEPA 4LV9A 3TXZA 4NU7A 4DPQA 5EYWA 4W9TA 4LS2A 1X8FA 4H6KA 3LTSA 4TO8A 4OV9A 5D33A 4GUFA 1BWKA 1NF7A 2GVGA 4O1CA 3HQ1A 3NOEA 1LZOA 2E5BA 5MHBA 2PCQA 4IPIA 3LXCA 4HNTA 3SFKA 3WJSA 3CU2A 4UMAA 2ZZ1A 1A5BA 4BWLA 5AHIA 2A85A 4CNOA 4R7JA 1KTNA 4GRSA 3R5EA 5E93A 4GNJA 1KA9F 5K4XA 3HGOA 1LDCA 4N6FA 5EY5A 3FOKA 1PIIA 3FS2A 3UYCA 5IBXA 1JRBA 4Z1BA 3FYOA 1LOSA 4QNWA 1JR1A 2QCFA 1T96A 2RDTA 2B7OA 1KM0A 1G4SA 4LT9A 3C61A 2Y7GA 4QQ3A 1BEUA 1U83A 2DZUA 1KM1A 3W1MA 5DCBA 3JS3A 4Q33A 2G95A 5K9CA 4OE7A 4UTTC 1K7EA 1OK6A 1J5TA 1H7XA 2XFWA 1OG0A 3EWXA 1M5WA 1SW3A 2XN1A 1Z44A 4UFHA 4BI7A 1K3UA 3MP3A 1QOPA 3KVJA 2ZQ0A 1LROA 1Q6QA 5K9XA 1KM3A 3G1SA 3LX9A 2QCEA 4ONVA 3W1LA 1TPFA 3P62A 3TROA 4EVZA 4ZL1A 1W3IA 5HWJA 3W7JA 4UTUA 3B4UA 1R2SA 1VYRA 4EOUA 5C6MA 1LBMA 4OQVA 3HPZA 1Z41A 3LOTA 4XUGA 1R2RA 4YMZA 3WJZA 3LCIA 4FXSA 4QITA 3BLEA 1UJPA 3WJWA 4LVDA 2Y88A 2Y7DA 3GVGA 3Q2DA 1WX0A 1VLWA 3NR0A 4R53A 2QCMA 4UTHA 1LOQA 1I2PA 2RFGA 5ABTA 3KAOA 5D37A 3N34A 2QJHA 3R89A 1G69A 4WUIA 3NPXA 1IF2A 1GTEA 2GQAA 4MY8A 1OYAA 1CI1A 3W7HA 3VI2A 1QOQA 4A21A 1OJXA 2B7PA 1ICSA 1VHCA 1ZAHA 2B7NA 1JCLA 2GUUA 4A2RA 4BWLC 3GAKA 4K36A 1D9EA 1M7OA 3CIWA 5C54A 2WJZA 2BXVA 2C18A 1VR6A 2VFEA 2FQIA 2DZVA 1B57A 2FPTA 3TC6A 4ZQOA 3TE9A 3MBDA 3ZS4A 1F5ZA 4O18A 4JYDA 5IBXC 3ABOA 5AN7A 4O10A 2ZZ2A 4H4IA 1FDZA 4AH7A 4S2BA 3G1YA 3O05A 3SJ3A 3QM3A 3DFOA 5DELA 3MO7A 1H63A 1I2NA 1DBTA 1IGSA 1L6YA 3QFEA 3W7NA 1F6KA 1ZENA 4PC8A 4POCA 4AVFA 5HULA 3W7QA 5EBUA 4C1LA 2DU2A 1WOAA 1LYXA 5FF3A 3V75A 3G1AA 1FCBA 3O6DA 3TU9A 4XQ6A 3O16A 3B03A 5KZMA 3O1NA 4XTIA 3FKRA 2Q3RA 2WV8A 3MHGA 4C1KA 3W83A 4FEZA 4PCFA 5EL1A 4ML9A 4GJ1A 5CPNA 3FFSA 3ZFHA 1NVMA 5HUPA 2UV8G 5AYXA 4JX6A 4MJMA 5EPDA 2Y7FA 2R94A 3M5YA 1SSDA 3QH2A 4IMCA 3QW4B 1H51A 3W74A 3P8JA 2GPTA 1OFRA 3TJLA 3O07A 3M44A 4O52A 1KBJA 1PCWA 4ZMGA 2CLMA 5F1VA 3R2GA 3MHFA 1RVGA 3TSDA 3VCRA 1IIHA 3PB0A 4GXMA 3L67A 1PS9A 1UUOA 2QF7A 4AWUA 2YW4A 4O4VA 3IGUA 2QCCA 5G4EA 1WA3A 3TKFA 2Y61A 5LNWA 1JCMP 3W72A 2FPYA 2H3DA 1H62A 3GR7A 3CPRA 1Q45A 2ZZ5A 4XBSA 3BW3A 1A5CA 4NX0A 5DCEA 3QMRA 3QYQA 3W6YA 3K30A 1MZHA 2QCGA 1JQVA 2YPIA 2JGQA 1TTPA 4O1DA 1TREA 4PA8A 3ABRA 1VZWA 3KFTA 4UFIA 3S6DA 2HS8A 1FCVA 4NT0A 3DFPA 2A1YA 2ZRXA 2E6AA 1AMKA 3A24A 2ZRYA 4PODA 3UPWA 3PBVA 3TQVA 1TPH1 3LHUA 4JTLA 3BPWA 1L6SA 3SZ8A 1EIXA 1O4UA 3KXQA 3TQKA 3C2OA 4PTNA 1RQEA 3NQCA 2I9EA 4GWEA 3W1NA 3E9AA 3L9CA 1LP6A 4PFMA 3G3MA 1OVDA 1R46A 2RH9A 3W7DA 3DFNA 4I9AA 3KVMA 3NZRA 4JTKA 1ICPA 4MPQA 4XKYB 5TBOA 3EKLA 3P7YA 2CZ5A 3KVLA 4UMCA 4QISA 5FI8A 3W1XA 3R8RA 1JJKA 3QEZA 2VOMA 3D0CA 1XDMA 4HPJA 4QSHA 3E02A 4O15A 3KX6A 3MI2A 3GNDA 3NM3A 1QMLA 3W2NA 4RJEA 4M6VA 4O4WA 1JUEA 4UFMA 3UWZA 2E6YA 4GUJA 3TMLA 3G0XA 4JD4A 2WNNA 1SO4A 1A53A 4PEKA 2NXHA 2VEMA 3LCGA 2J27A 2Z1BA 3LXAA 3M43A 4FXRA 3OIXA 3A21A 4I7UA 2F7FA 4E2BA 5HQEA 4AWSA 3F4NA 1DQXA 3W2JA 2Z2UA 5CPLA 1AK5A 1MEWA 5CGQA 3THQA 1QAPA 5D02A 3DI1A 5I3IA 3UNDA 1VYPX 2ZRWA 2RKXA 3EX3A 1KFEA 4QIUA 3W85A 3G1DA 5CZTA 3WK1A 4WQ6A 1FCQA 1V7YA 2ALDA 2H3BA 3CT7A 5G1YA 3QQ1A 4LUIA 4YCOA 3TK7A 3W1RA 5D2TA 1ALDA 3QQ0A 4K7VA 3IGSA 5D30A 2C3ZA 2PURA 3PUEA 3KRZA 3I7SA 3UY8A 4CCCA 4UFLA 3GZ3A 3BGGA 3TXVA 4CQAA 3TH6A 3MUXA 3T40A 1H7NA 2YXGA 4NZJA 1JCXA 1PVNA 3C8FA 4XTDA 3VE7A 4MYAA 1P1XA 1SO5A 4JN6A 1OFPA 5U7SA 2YFNA 5E0KA 4K37A 3OHIA 1YTDA 1IXNA 3CQ0A 4ICNA 3PC0A 5H2ZA 3WJYA 4CQ8A 1IIGA 5FF2A 4WY0B 3STCA 5AHEA 4KWVA 3W7GA 2CLFA 1KLZA 2Y63A 1I8JA 1ME9A 1OHLA 2VFHA 4MJZA 4NJIA 1GWJA 3Q58A 3STGA 3DGRA 5HR6A 4IOTA 2QEZA 3HPXA 1MEIA 1W56A 3HB9A 3M9YA 1GVFA 4JIPA 1N8FA 3ANYA 3B05A 3M0ZA 2J9XA 3PSVA 4D2JA 4HHPA 1XDLA 4LU0A 5DLCA 2NWRA 1G7UA 1DL3A 2BWGA 2OCZA 2NLIA 2CLEA 4NJGA 4WY0A 3NO5A 1O5XA 3TV8A 3W87A 3GK0A 4RZ5A 2NXIA 3G0SA 5A5WA 5CG7A 3V1PA 1TJRA 2H8ZA 5A8GA 1DV7A 4DEFA 2DP3A 3S5YA 3UWUA 3LXBA 1W8SA 3BGJA 3IIOA 3G8EA 3LM7A 4X22A 2ZYFA 1JUKA 3HG5A 2YCEA 1I2QA 5AYYA 5KZDA 3OVRA 2VC6A 3CIXA 3QW3A 3QRHA 4MY9A 4JNMA 3GIYA 1BKSA 2VELA 2ABAA 3UZ5A 4E2DA 4A2SA 4RCXA 1TQJA 5G5IA 3PUDA 3HOJA 1XKYA 4IMFA 1LTDA 3SR7A 4ALDA 4TMCA 4LNYA 1KBIA 1JQXA 3GDMA 5IM51 3FLUA 1IXOA 1UCWA 2CZDA 4Q32A 5F4XA 3TFCA 1XBZA 3M6YA 2I14A 3CWNA 4NJJA 3W70A 4CCEA 4DBEA 1A50A 1BTMA 4NVTA 5T26A 3MHUA 1K7XA 2Z6JA 5HR7A 4JTGA 2YFOA 3W76A 3QSTA 3NPVA 4M5PA 1OFEA 1W5MA 1OFDA 1F76A 5C55A 4O57A 2AAMA 1Q3NA 2Z6IA 3P80A 1WXJA 5EA9A 2NX3A 2P1FA 3EWZA 1TIMA 4P61A 2NUYA 2VFGA 1XUUA 5BRBA 1FWSA 4HPXA 3S5ZA 2E6FA 3B04A 4JTJA 3DXIA 3S1XA 4UR7A 4N9DA 3L21A 1F6PA 1P0KA 1K8YA 2NWSA 1LBLA 3NQ2A 3MYOA 4IX0A 1PCKA 5BNKA 1FX6A 3N19B 1W5OA 1HO1A 3DENA 3GLCA 3T7VA 3UQNA 3NPWA 2AQWA 5CPOA 2WOQA 3RLUA 1RD5A 1EPXA 4O19A 5TIMA 1X1OA 3I6RA 1E51A 4GFSA 1NEYA 4NJHA 4WOZA 3RMJA 5D03A 3C0JA 1FXQA 3DHFA 3QPZA 1HFBA 3OEXA 4JTTA 4DQWA 2FLIA 1K8ZA 2V8ZA 4B5NA 3HGSA 4IX2A 3M7WA 1WBHA 1TTQA 3LLDA 5AC7A 3Q37A 3GR8A 3LRKA 1FBAA 4JDYA 2B0MA 2OZ0A 4LY8A 1CW2A 3LCFA 4Q4KA 4NX5A 2RDWA 1XM3A 2ATSA 2E5DA 4WD0A 5G4WA 1BWLA 4FNQA 1FUYA 2A6NA 1ML1A 1N7KA 4Z0SA 5FF0A 3DKJA 1OF6A 2A2IA 4BR1A 4HSNA 3NL3A 3TMQA 3NQGA 5HUOA 3GAYA 3BG3A 4FO4A 2VXNA 1TV7A 2VEPA 1XI3A 4QNEA 1WV2A 1I45A 3NL6A 2QR6A 1OYBA 3LCXA 5D2WA 1L2UA 3EXSA 4EIVA 3NGJA 3W84A 4YL2A 1OABA 1KTCA 3W7PA 4WXYA 4IMGA 3LERA 1GVQA 3MW7A 3WFAA 1LBFA 1WQ5A 1W3TA 3QSRA 3PR2A 3N9RA 4JIQA 3SI9A 2E5CA 3G0UA 5LSMA 4MKNA 1AW2A 2TPSA 4ZQCA 1H7PA 3PWAA 2R8WA 2TYSA 3GXPA 3HBLA 3OBKA 3UY7A 3C3NA 4NNCA 1EA0A 3HF3A 4FNTA 4MFDA 3LCWA 4MFEA 4GUIA 5CZ0A 4I7VA 1EP3A 4MY1A 2NV2A 4DBDA 4M7SA 3HPSA 3MWAA 5D38A 1LOLA 1GTHA 1H1ZA 4O1BA 2CLHA 3LV5A 3P81A 3THAA 1C29A 1ZFJA 4FHAA 1ZCOA 3P61A 3GDKA 3EB2A 4I7WA 2VFFA 1RR2A 4O12A 4YXGA 2A7NA 4L4MA 3UWVA 2X1UA 3S1VA 1KFCA 1TPB1 1J4EA 4UNLA 3C6CA 3N2XA 2TRSA 3HG2A 3FJLA 3GDRA 1D3GA 4JTEA 5G2HA 2E6DA 3QC3A 3O63A 1T8XA 1VC4A 2ATMA 1GJPA 2FFCA 5I3FA 1PL9A 2GVJA 4AHOA 1S5TA 2ZZ3A 1W0MA 2FB2A 4N9EA 1NAL1 2GQ8A 1F74A 2OMAA 3BARA 3F4WA 4YCPA 1DJQA 3LHZA 3O15A 4MLJA 3DFQA 1FDJA 3CEUA 2Q3OA 3IV3A 1MXSA 3LRLA 3SECA 2A6LA 3OA3A 5FEXA 1O5KA 4JYFA 2QCDB 1R2TA 2Y89A 3MMTA 1SPQA 2G97A 4FX6M 3RU6A 1UB3A 1OFAA 2V30A 1VCFA 4OHQA 5F2MA 3WJXA 5F2IA 3W7IA 1LM1A 2YZRA 1MEHA 2QCNA 4KFPA 1G7VA 2ZCGA 5DXYA 3UXAA 2V0TA 1AG1O 2C19A 2NV1A 4O11A 3EWYA 1XBVA 3LI1A 1JCJA 1KLYA 3INPA 2JGYA 3U8GA 1FWTA 3CB8A 4G1KA 4ADTA 2ZFAA 3RK8A 3BVJA 3S1WA 2OJPA 1AW1A 3G18A 2QCDA 3IVSA 5D2VA 3ZR4A 3EKZA 2NUXA 1YADA 3PBYA 3SGUA 2CZFA 3QJAA 5FEZA 3M16A 5K2ZA 1AW5A 5DXXA 4O53A 4WJEA 3NA8A 3I7RA 1ZY9A 2HSAA 2ZDRA 5HMSA 3W3OA 3L5LA 3TA6A 4NNBA 4FF7A 1Z48A 2EGZA 1TQXA 1GYLA 3U6WA 2ISWA 1S3HA 4AXKA 5CSRA 5FF7A 5LNUA 1GT8A 3C4UA 1N55A 3TAKA 4R33A 1ME8A 1KFLA 3R13A 1SW7A 4LUJA 2ISSA 2ZZ6A 4RK8A 3P67A 5EMUA 1KV8A 1WOBA 1ZALA 4LW7A 2WKJA 3G22A 3SIZA 2IQTA 1XL9A 2WSQA 4XBKA 1JUBA 2QAFA 1UASA 3UD6A 3ELFA 3P74A 2C15A 3IVTA 3W73A 1SSGA 4NUWA 4XZ9A 2WSYA 2R14A 2V5LA 5F4WA 4RLIA 4UIOA 3UZJA 3NQEA 4Y96A 3TCEA 1G67A 2BLEA 3LV6A 1XC4A 4H3DA 3G1XA 3LHYA 3CC1A 2J9ZA 3FIGA 1GVOA 3PS7A 4HSOA 3WK2A 1DOSA 4RV8A 1LLWA 3W7RA 2DZSA 2V2CA 3BG9A 3U2OA 5KSWA 5AYZA 3M47A 1UUMA 1EUNA 2ZA2A 1TMHA 5U4NA 4R34A 2GJLA 3HGJA 4GE8A 3QMTA 4CLMA 5F2GA 3TUUA 1TPWA 2NX1A 1K8XA 1GEQA 3S0CA 4OWGA 3JR2A 1DORA 2X30A 1TRIA 1I4NA 4NJKA 7TIMA 4MVAA 4XKYA 5L6UA 4CNNA 2EF9A 3PG9A 3DKLA 2ZBTA 3I68A 3UWYA 3BLIA 1GG1A 3TW7A 3BW4A 1UBSA 4TMBA 2Q8ZA 3H53A 4MYXA 3FYPA 4FIRA 3P84A 5AHMA 4QAIA 1HUVA 1TPEA 3NQDA 3N73A 3DU0A 3WK0A 2RDUA 5DY2A 3NNTA 4IXXA 3IIVA 3L5AA 1TYGA 4FNPA 3UXDA 3IIXA 3HO8A 3P8IA 1Q6OA 3G3DA 4X9SA 1LLZA 3ATZA 3NEVA 2XN2A 1YXDA 4PL2A 4LS1A 3EX1A 4N4QA 3GKAA 2PRMA 4X2RA 2TMDA 1XBXA 3W1QA 2JKEA 5C5YA 3IRDA 3TC7A 5FF4A 4AWTA 2G96A 2DJXA 1TCDA 1PE1A 4O17A 1FWWA 1TPUA 5LGXA 2H8XA 3M5VA 4X3ZA 1VRDA 1I2OA 1SR9A 4A29A 2GVLA 1XUZA 2J88A 3W75A 5EKYA 4BF9A 2CWNA 4DF0A 5AHNA 1FXPA 1QNVA 1D3HA 1J2WA 4U4MA 5KZEA 5F4SA 2C6QA 4NXKA 4JX5A 5D2XA 5DBTA 1VLIA 4KFNA 1VCGA 3PG8A 2DORA 4WXZA 4CNPA 4IGHA 1G6CA 1O95A 4UTMA 5LHFA 4QM1A 3FJ6A 2C13A 3O6YX 3DFTA 3S8HA 1W31A 1F73A 3M1ZA 3MYPA 5G2IA 4LV4A 4MLRA 1VPXA 3PF3A 1ZAIA 2NXGA 1FWRA 4M19A 3PB2A 4IXHA 2X2GA 2E68A 4K38A 2QKFA 1SW0A 2QUUA 4MZ8A 4MZYA 2EHHA 5LKYA 1VHNA 2WQPA 1VH7A 1XCFA 5G1TA 5H91A 3I7QA 4WOQA 4BK9A 4AF0B 3KOFA 3F1QA 3EX4A 3B0UX 1YDNA 3IEBA 1SZNA 3SGZA 1EB3A 4A3UA 1W5PA 3W2UA 6TIMA 3G1FA 4Z1CA 4FX7A 3W2LA 3T44A 4FB7A 4AHPA 4MUZA 3MI6A 1HO4A 2HS6A 2WPBA 4NXSA 3QPYA 1KV5A 4ORMA 2NUWA 5LNSA 3QMSA 1Q6RA 2QAPA 3MI3A 1YDOA 2ZTJA 1VQTA 3GDTA 1KM5A 2QJGA 4BI6A 3STEA 4AF0A 1OFOA 4IUOA 2VFIA 3W1AA 3ZWTA 3LTYA 3LBCA 3B0VC 2P10A 2I1OA 5FEPA 2VEKA 3O6CA 3OG3A 4DXVA 2DZWA 3PM6A 3NQ8A 5J5RA 2V5BA 4AMAA 3KHJA 3UPBA 1EUAA 1F2JA 4LTSA 6ALDA 2Y7EA 1KM2A 4LVGA 3IIPA 3C2VA 1RPXA 3E12A 4S2CA 4EF9A 3DBPA 2CFFA 5BOOA 3GXTA 1SFLA 1XFBA 2A5HA 1H5YA 1A5AA 3MP4A 1QPOA 3FKKA 4PH6A 1YPFA 4IPJA 3NQ6A 2C0AA 1Q6LA
chains in the Genus database with same CATH superfamily
3LGEA 4WZHA 5JBFA 3H22A 5HWMA 3GVVA 3AYSA 4QE5A 3ZWSA 2UY5A 3ZIZA 7XIMA 2J7CA 1CGUA 4GYPC 3C2FA 1B4KA 4PTWA 2VX7A 2D22A 2PC4A 1XYBA 3NZQA 4O8RA 1EWEA 1XQKA 4ZEPA 4QDMA 5AYIA 4GGBA 2PTZA 5TQLA 1LUCA 4QG8A 1M6JA 4TR9A 2QQ6A 2FTYA 4MWAD 2EKCA 3AIRA 3KBSA 1R86A 4AC7C 4OUIA 4U31A 1KM4A 1GPWA 4XZLX 4JTHA 4RZ4A 4Q6XA 4AZGA 5LIKX 5M3WA 3W23A 3RLVA 4TX6A 4G9PA 3WK3A 4DELA 1LRQA 1VS1A 1BRLB 1J5SA 2YR1A 2OWCA 4YWIA 1C7SA 3S2JA 1PIGA 4WVXA 3SW6A 4ZXOA 5BCAA 3R11A 1A3XA 9CGTA 3PJTA 2V2HA 3EMQA 4JTUA 1IT7A 5E1QA 3LI0A 1KB3A 2ZRVA 1SZEA 4B9ZA 5F1UA 1XIMA 3AHZA 5CKSA 1WDQA 4O50A 2DW6A 1ZPTA 2FIQA 4WY0F 3H24A 3HU7A 4OV4A 1TTIA 3FK4A 1TWZA 2RJGA 1DWHM 1H61A 4Z2IA 3KBJA 1PDZA 3GW3A 2GJNA 1PX3A 2QDGA 3QF0A 4XUYA 3MVTA 3MSDA 5K3VA 5DN1A 1HVQA 2ZXDA 2QZRA 1T6MA 3B8DA 3TSMA 4JTIA 3RJYA 1XLMA 2O55A 3KDOA 3O06A 1PV8A 3WH9A 4NAEB 3PPFA 1UA3A 2GK1A 3SUUA 2XDFA 3KVKA 2Z1VA 3M0JA 1VPQA 1PJ9A 4NI8A 2DZXA 1DJGA 3A23A 1LRNA 1NFGA 4H9XA 4UZUA 2X41A 4M0XA 1L8NA 1TB3A 3GUWA 3HIJA 4PGLA 5K7JA 5D09A 3ITCA 1K6AA 4H2CA 4Z2KA 3RAOA 3RILA 4LH8A 1JXJA 1KBLA 4IM4A 4ZOEA 1R3SA 4L6OA 4DO4A 4DJEA 3W07A 3EDJA 3SN0A 4JS3A 4C91A 1M3UA 1NDVA 2EAWA 2G50A 2X7VA 4AZIA 4XK2A 4Z1DA 2CERA 2P8BA 5A1AA 1EJUC 1YTKA 2PWHA 2HBVA 3VCCA 2YYTA 2QIIA 1ONWA 1K9DA 1A5SA 4O54A 3CHDA 5XINA 2YB1A 4LUTB 3BAYA 1QPNA 3E0FA 6XIMA 4WHBA 4DWSC 1XCXA 2HXUA 2NQZA 3BAJA 2QUVA 4G7EA 1Q65A 5GVJA 4ACZA 4FSAA 1PWLA 3ARXA 3TONA 3CIVA 4Y90A 2PP1A 2W79A 1W1ZA 4IL0A 4O14A 3QR0A 1OGSA 1PDYA 3LPGA 4IP7A 4ADUA 3KTSA 2G3NA 1EJWC 1UP3A 5FJUA 2VEIA 2A7PA 3SCNA 3EPNA 3GC5A 4PCTA 1GOQA 4ZVJA 3QGKC 3NQAA 4WDXA 3JW7A 2YDRA 3ZYZA 4HT3A 1JPDX 1KRAC 4OT7A 1NOWA 2EJAA 1FWIC 1WE5A 4LANA 2DJLA 3CTTA 3HG3A 1EX1A 1UQZA 1WDWA 1J0HA 5LXEA 3HJEA 1HJVA 3TIMA 1F05A 2G3JA 4DPPA 2H90A 3UXLA 1J2BA 1D3CA 3MCOA 3S1UA 3SSJA 4S3EA 1VAHA 1AL7A 3MO4A 7REQA 2AMXA 1XLHA 5HK4A 3D47A 1YXYA 4ZODA 3W1UA 5BU9A 5HANA 5LZLA 3UW6A 2ZWZA 4F0MA 1HGWA 3XISA 3EX6A 5FEWA 3H55A 2KZHA 3B8TA 3LU2A 3VPLA 1ZQ5A 4LVFA 1EF2A 3M5ZA 5FJJA 4L9YA 1TPDA 2EO7A 2GOUA 2PLMA 5I23A 4YHEA 1XLAA 1WPCA 1MDLA 2XYLA 3WNKA 5I3KA 5EBAA 4OECA 4JCMA 5ECUA 5HJLA 2AKZA 2VTFA 3U57A 4V1YA 3GU2A 5GJPA 3VNKA 3E0IA 1JYXA 1IEXA 1I1XA 4PUNA 4W84A 4AW7A 3KTXA 1OF8A 3SFWA 3T2QA 1VB9A 3CLMA 4Y6GA 3CXOA 4FMVA 2PLCA 4ORIA 3WENA 5C71A 2DVXA 4FF5A 1SJCA 1JGIA 1YYAA 4B15A 4LC8A 3W71A 1E9IA 3W7CA 1CGTA 4MZ1A 3EXTA 1TKKA 3DERA 1AJ0A 2ZRUA 1FCUA 1XLFA 4ZB0A 2W6RA 4BI5A 4R9OA 1EBHA 3RX2A 5AZ1A 3ERPA 4WDWA 4BF7A 3E96A 4UMBA 4YTTA 4Q22A 1I2RA 2DIEA 3FJ4A 3LYEA 5DANA 3LDVA 1U22A 5CZJA 1EP1A 1FWFC 4L4LA 3N3MA 5D05A 3GBEA 1YPIA 1AH3A 1UH3A 4CD7A 4IQJA 5CSSA 1HKWA 1GZ1A 1GVRA 1QHPA 4HNUA 1LF1A 3NXFA 4DF2A 1R9ZA 4CNSA 1CX9A 1PO9A 2OEMA 4ZOAA 1S2TA 1XBYA 4PTXA 4M8UA 4H01A 2YL9A 3V4BA 1EZWA 2EPOA 4QXIA 4YWSA 2D3LA 4HZ6A 2J9YA 1SO6A 3TCSA 3AJXA 1SJBA 4HZ7A 4MTVA 2XH2A 3QR1A 2V82A 2Z2AA 3DFYA 3N2BA 4FNRA 1T0OA 3PUOA 1TFVA 2WNZA 1JDAA 1RV8A 2BGSA 4UQEA 1H5VA 2PDIA 4CUCA 3CYVA 1TRDA 1W5NA 4O13A 1QK2A 3KZPA 1UD4A 2Y85A 2OWWA 1W9VA 4P8XA 2J47A 1H0IA 1ADOA 3PSWA 2POTA 2Y6ZA 1VCVA 4C6DA 3W2KA 2PWGA 3NZ1A 4GUHA 4F0LA 1JCNA 1FY6A 1RZMA 4I6KA 1LORA 3R8GA 3T9PA 4KRUA 4ADSA 5KITA 3NL2A 2O7SA 1P48A 3TW6A 1JYVA 3W9ZA 2XG9A 4AIBA 4MNLA 3VFLA 1QK0A 4F2BA 2W67A 2J78A 1IYXA 4MNKA 3EKGA 1W32A 5AHFA 1J0JA 4UTTA 2VC7A 1XV8A 1D2KA 1GOMA 3AXXA 5D04C 5AYBA 4QCFA 4UR8A 4RE4A 5C9RA 2Y5SA 9XIAA 4Q4QA 3PPHA 4D1JA 2X1RA 4QJ1A 1LRTA 4PFHA 3S5NA 5FESA 4EF8A 4IMEA 3TSBA 1RALA 1YXCA 5HNNA 2Z0IA 3DGBA 1UKPA 1ZTVA 1KXQA 4ZXLA 2LLEA 1OFQA 5TD4A 3ORWA 3WH6A 5K4ZA 2Z1KA 5I03A 4DPQA 3EB3A 3UG8A 4W9TA 4UOQA 1O5RA 1UWRA 1HQTA 4OV9A 4GUFA 1XG4A 1V02E 2GVGA 2D2HA 3NOEA 1LZOA 4HPNA 1ZP3A 5BOFA 5MHBA 1WZLA 2XVNA 3N29A 3WNOA 3TP4A 4Q8TA 4IGSA 4C6PA 3CU2A 4UMAA 2ZZ1A 1A5BA 5AHIA 1XIHA 3OYZA 2A85A 4CNOA 3SB0A 1KTNA 3K4WA 4GRSA 5A8NA 4GNJA 1KA9F 3NDZA 4PCPA 5K4XA 1XYAA 1J9YA 3IGHX 2PDQA 1V02A 3AJ7A 4J7RA 5IBXA 4UQDA 2E28A 3WN6A 5B7YA 3BUVA 4KBXA 4QNWA 1JR1A 6PTDA 1QNPA 1CXHA 2Y1HA 4F9DA 3BAXA 4QQ3A 3CQIA 3MKCA 1BEUA 1F61A 3CQHA 4I9TA 1KM1A 3W1MA 4Q33A 5REQB 1UZ4A 5K9CA 3WLLA 3TYCA 1OADA 3I4EA 1M5WA 3ZT7A 1DWJM 3MP3A 4E2VA 3HV8A 4BJHA 1JZ4A 3WF3A 2F9RA 3G1SA 4IQDA 4ONVA 3W1LA 5M5DA 3P62A 4EVZA 1W3IA 3B4UA 4DZ5A 2ACRA 3V16A 2OO0A 3WF1A 4EOUA 5C6MA 1LBMA 4OQVA 3HPZA 3R94A 2E67A 1KKRA 2WBKA 3BLEA 3WJWA 4LVDA 2Y7DA 4TTGA 3FDGA 1VLWA 2QCMA 4MB1A 4MMWA 1LOQA 1I2PA 1RJQA 4WEVX 1QI5A 4AD2A 4D9PA 4R5EA 2QJHA 4WUIA 3UETA 2GQAA 1OYAA 3VKAA 4L61A 2J66A 4U3CA 3TYEA 1PX4A 3H21A 2NVCA 2E9LA 3EOOA 2FQIA 5EFDA 3U7VA 1B57A 4ZQOA 3MBDA 3LA4A 1Q5MA 1QI3A 3NCOA 4H4IA 4AH7A 1VBJA 1RBAA 2XGBA 3SJ3A 1ZBWA 4N7QA 5DELA 3B9OA 3PJUA 4HGXA 3W7NA 1XSJA 1JDFA 5HULA 3ZLHA 1WOAA 4GNKB 1H0GA 1E6PA 3VD9A 3ABXA 3O16A 4YN5A 2YCKX 4S3JA 5HMEA 1XLIA 3O1NA 2FZMA 2Q3RA 4NG3A 4OFCA 1TJ1A 3A12A 1OD0A 2WV8A 3U48A 4J1OA 1OGGA 1LWIA 4PCFA 5EL1A 2I56A 5BOEA 4CU7A 3QH2A 3GE7A 3QW4B 1H51A 2WZIA 1OFRA 1BF2A 1AA1B 1FH8A 3LMYA 2BODX 4J27A 4G1NA 1DWFM 1B2YA 3R2GA 3TSDA 1RVGA 3VCRA 4GXMA 1LQ2A 1F3EA 1M41A 3L67A 3A3HA 1KGUA 2I9UA 4S3AA 2AL2A 1Z89A 4PB4A 4PB5A 1DIDA 2D1ZA 3C8NA 3W72A 3L23A 3I6TA 2V38A 4CCZA 4LAMA 1TJ0A 3BW3A 1A5CA 5DCEA 3GG7A 1JL8A 3IANA 3QYQA 3B9DA 3ZZ1A 5HMDA 1JQVA 2YPIA 1TREA 3B8WA 1IZCA 1E15A 3QPEA 4H8HA 1VZWA 4UFIA 2QUMA 5CC5A 4NT0A 3BSHA 4KIEA 2ZRXA 1FWJC 3CUGA 2PDHA 1C93A 3JVAA 3UPWA 4JTLA 3ITLA 1YEYA 2OXNA 3M7SA 5M03A 1S38A 3WMCA 4GWEA 3L9CA 4PFMA 4ERIA 1R46A 4GIRA 1TA3A 1CXEA 1ICPA 2NLYA 4XKYB 1O12A 5TBOA 3FCPA 3EKLA 3EDFA 2D69A 1UOKA 2CZ5A 4UMCA 4QISA 5FI8A 2HRWA 1JJKA 2VOMA 3V36A 4AEEA 1V3JA 3ITVA 4QSHA 1YW1A 3E02A 4KGLA 2WHJA 3KX6A 3WFZA 3C5QA 1E43A 1HXJA 3HQPA 2UY2A 4GJIA 1XGZA 2RGMA 1K4HA 1JUEA 3BQ5A 3VKBA 3UWZA 4C6MA 3G0XA 2WNNA 2VEMA 2VQUA 1HGYA 2DSWA 2XSXA 2Z1BA 2O4QA 3UCDA 2QVHA 3CLWA 4AWSA 3F4NA 1LT8A 1SJAA 1UR9A 3KBWA 3UZYA 1IGWA 2Z4GA 3BH4A 3W2JA 2Z2UA 1DWGM 5CPLA 1E72M 1QAPA 3DI1A 4LYKA 5H6HA 3LNPA 2XM2A 4KCTA 4M6UA 3W85A 1FCQA 2WLZA 1V7YA 3CT7A 3W1RA 1X7IA 4B3ZA 4BEQA 3V0UA 1OC6A 2C3ZA 3FA3A 3VKCA 1UMLA 2DSVA 4UFLA 3QGAC 4C1NA 1GQJA 2AAAA 1H7NA 2YXGA 3MY9A 3VK5A 3E6EA 2OSWA 1BYCA 1KR0A 2O9PA 2YBVA 4JN6A 1L2QA 2NQLA 4K37A 3OHIA 3CQ0A 4ICNA 4MJ2A 3N04A 3T2OA 1YDYA 3WJYA 2J8FA 5FF2A 5AHEA 1V77A 2CLFA 3E2VA 2PGRA 2VFHA 4LY4A 3Q58A 2ZWYA 4LBSA 3DGRA 1ZS2A 3SN4A 1W1VA 2X09A 3HPXA 4ROQA 2NW0A 1MEIA 3M9YA 3VX0A 4DNHA 4JTAA 3AHTA 4D2JA 4JKLA 2F6KA 4LNCA 4LU0A 2O0TA 2NWRA 1FWHC 4NJGA 4M80A 3CMGA 3VZZA 1OY0A 1ISVA 2NXIA 1RH9A 5A5WA 5CG7A 1TJRA 2HWGA 4DEFA 2QYGA 2WVSA 2DP3A 1E56A 3B4YA 3KP1A 4K2SA 5A6MA 3W38A 3LXBA 3N6JA 1OBAA 4GVHA 3FSUA 1ELSA 1HJXA 1BF6A 3IIOA 3H4XA 2VP8A 4KESA 5MKGB 4OTKA 3WBWA 3G1RA 3HG5A 2DY3A 2YCEA 4UTFA 1XQLA 4WKHA 1Y7VA 5KZDA 4OBRA 1IT0A 3QRHA 1RBOB 4WF7A 1MNZA 1KR1A 1TQJA 3PUGA 3PUDA 4U2ZA 3SR7A 2PC8A 4ALDA 3UR5A 2WPGA 4MKSA 4HMCA 4TMCA 4US5A 3CK5A 4GACA 3MKVA 5GJMA 3CHEA 4E4PA 3GDMA 5IM51 4Q8UA 3ZT6A 5T8GA 5AKQA 2I14A 3DIPA 3BAKA 4NJJA 4M1BA 1QRQA 1JZ6A 1XS2A 1A50A 1F9CA 1E5NA 1BTMA 4M3PA 1E6XM 2C8NA 3W76A 3COTA 5EMMA 1V6XA 3NPVA 4M5PA 1Q6DA 2BMBA 2VRQA 1R8LA 3K1DA 4JIIX 3VKKA 4H8UA 4ZOBA 2FHBA 2WQDA 3TW9A 1WXJA 1RCOB 2F2KA 1XIGA 2PDPA 1W3HA 1RCQA 2NUYA 4W88A 1XUUA 1FWSA 3S5ZA 4JTJA 4UR7A 3HV9A 5LXXA 2EQDA 3W4RA 1ZBCA 2NWSA 5CQ1A 1I60A 3BV7A 3MYOA 4ROPA 1PCKA 5BNKA 2ZUNA 1FX6A 1UH2A 3DENA 3WG6A 2AQWA 1CXFA 3UJ2A 3WLSA 3I6RA 3N2CA 3WQPA 4NJHA 3R25A 3RMJA 4B5UA 3IS4A 3AQUA 3ZR5A 1FXQA 2DQWA 3WD1A 3S47A 1E71M 4JTTA 2FLIA 1TMLA 2V8ZA 3RRXA 3M7WA 1EXBA 1WUFA 3GR8A 3LRKA 4RL3A 4JDYA 4PBFA 4HA4A 1CW2A 3LCFA 3GHRA 1MUWA 1MFUA 4I5RA 3UPMA 2YLLA 2PWDA 4IICA 5G4WA 4INFA 1QNOA 4FNQA 4H1ZA 1LLOA 1N7KA 3CPUA 3WLMA 3DKJA 1OF6A 6CGTA 1C8XA 1DJWA 5HUOA 2VXNA 1TV7A 6ENLA 2UY3A 2NVAA 2QR6A 4KF1A 3QTGA 3W84A 4YL2A 4D72A 4EXBA 3W7PA 4WXYA 4IMGA 1GVQA 2GJXB 4PTMA 4S3DA 1F6YA 3NYDA 1RBLA 2J25A 2GYIA 4CEXC 1XYZA 2JIEA 5JUVA 1IWAA 2DGAA 4HYRA 2R8WA 4YPJA 3THUA 3GXPA 3UY7A 4FNTA 4AD1A 3OLGA 3LCWA 4MFEA 4GUIA 5CZ0A 2C1GA 1EP3A 1IQ8A 3HFYA 4DBDA 1ADDA 1QI4A 1JI1A 5H8MA 3GXIA 5D38A 3PFRA 2VDHA 1LOLA 5FL1A 1GTHA 1H1ZA 2AL1A 1C29A 4IL2A 3EDEA 3NWRA 1ZFJA 2QV5A 1ZCOA 4FHAA 3ZJ8A 3GDKA 4O12A 4I7WA 1RR2A 4YXGA 3S1VA 3N2XA 2TRSA 4JTEA 3RM4A 3HTWA 5A8MA 4P5UA 1FP8A 2HNHA 4JN8A 4KCUA 1REQA 4X61A 1BQGA 3QQWA 3G5EA 1NH6A 1F74A 3VMNA 4YCPA 4J35A 1DJQA 3LHZA 4WJ8A 3G2GA 1HF6A 3MWCA 4GX9A 2XWDA 4ICCX 1QI0A 3R6IA 4HCDA 1WXYA 3SECA 7ODCA 2DV0A 5FEXA 1O5KA 4JYFA 3RU6A 1UROA 4F66A 1UKOA 3E5BA 1Q2RA 4OHQA 3WJXA 2F6UA 3W6LA 3EWCA 5F2IA 2YZRA 4Q8MA 3LZ3A 2WMIB 2PD9A 3S2CA 4E3TA 2E8YA 2RJHA 4D8ZA 3SO7A 1UOZA 2WC7A 2HVMA 5DXYA 2PU0A 2NV1A 4O11A 2PDXA 4IFKB 1XBVA 4KS0A 1JCJA 1HL8A 2JGYA 1OGBA 1AW1A 3ZR4A 2PF8A 3EKZA 2NUXA 3B9NA 2PDWA 2HCVA 3MCMA 2IKGA 5FEZA 3M16A 4REQA 4IHCA 5DXXA 4O53A 4RE2A 4PUDA 3KCOA 4GCAA 1ZY9A 5HMSA 3UESA 4DUOA 3TA9A 3C0LA 4FF7A 1Z48A 2EGZA 1TQXA 5DRIA 3RCMA 4D8LA 5FAJA 1S3HA 5FF7A 2PDJA 5LNUA 1GT8A 2AQOA 1EO7A 3LMZA 5I79A 4HJWA 2ZZ6A 2IKIA 3P67A 3LG3A 2WKJA 4OIFA 3VIGA 1XL9A 3CUXA 2C1IA 2FGLA 1EYEA 3ELFA 1UC5A 2C15A 3W73A 4NUWA 4C6NA 4XZ9A 2OZ8A 1CGXA 4IJRA 2V5LA 4RLIA 1CXLA 4UIOA 3UZJA 1C9WA 2UY4A 3TCEA 1G67A 1BKHA 3WIJA 1XC4A 1MRAA 3LHYA 3MJMA 3SUVA 3WK2A 2Z29A 5CG0A 2DZSA 2R1LA 5KSWA 3OGVA 2Z27A 3DBNA 3M47A 1R7OA 2GSJA 2XIQA 4Q4SA 2W4XA 3HGJA 3N18A 8XIMA 1BYAA 4GE8A 5F2GA 1QJWA 4JHZA 1UD3A 3MSYA 4ZGYA 1MRQA 4C6IA 4NJKA 1XIEA 1EDQA 3CH9A 3PG9A 3FXGA 4GLEA 1UBSA 3ANUA 3H53A 1XRVA 4GBDA 5IFPA 1ITCA 3P84A 4XAPA 3R10A 1HUVA 3N73A 1CGVA 1VFSA 5D4YA 4FNPA 4GI4A 3WQ6A 5AY7A 3N11A 1LLZA 3ATZA 1DTNA 4LS1A 3EX1A 3L4VA 1VFUA 3GKAA 1EJTC 4HN8A 2OGYA 1D8CA 2PRMA 4X2RA 2TMDA 3CUHA 3V3WA 2JKEA 3UA4A 2GGJA 1UWUA 1Z9AA 3IJ9A 3TC7A 1YBQA 3M4HA 5FF4A 1A5NC 2G96A 3N15A 5C7HA 4TXEA 1MQQA 3FAWA 1UR2A 3GO2A 3LPFA 1VRDA 4PZVA 1SR9A 3WLKX 2J88A 4XD6A 4DIAA 2QLYA 4KEUA 1FXPA 1QNVA 1D3HA 2HROA 4U4MA 4C5YA 2C6QA 2OKTA 5D2XA 5DBTA 3WBYA 3ZVHB 3QBUA 3VNZA 1EDGA 2DORA 4WR3A 4CNPA 4IQEA 3L4TA 5LHFA 1GNXA 3TYDA 3FJ6A 2C13A 5T91A 1UD8A 1W31A 1F73A 1VPXA 4GYPA 4HPHA 3OZMA 4M19A 1PB0A 3CPGA 2E68A 2QKFA 1DIOA 3GUGA 4NAFA 3VX1A 3T1GA 5LKYA 1VHNA 2DDXA 5H91A 4XD4A 3TTOA 3KOFA 3KM8A 1YDNA 1M68A 3IEBA 4ZO8A 4M56A 4A3UA 2CKSA 3W2UA 4Z1CA 2NQ9A 2YL5A 1KRMA 4MUZA 1R3RA 2V5JA 4DJDD 4PE8A 4IIEA 2BY1A 1J6OA 3MI3A 2DUAA 1KM5A 1YRRA 1AQHA 2CBJA 1OFOA 3GU1A 3S83A 1UR8A 3CS2A 2VGGA 3LTYA 4M24A 3SAZA 5DMYA 5FEPA 3A3XA 5FACA 2BB0A 3IJIA 3OG3A 1I6NA 1HJWA 3KHJA 3M0YA 1FP9A 1EUAA 4AUBA 3CZGA 4UWMA 5ECVA 2DW7A 3RR4A 1RPXA 4KETA 4NASA 4QQUA 3SCQA 3D6NA 3DBPA 1LUCB 3C86A 1H5YA 1MW3A 4J4KA 1A5AA 3S46A 4JQ3A 3S2NA 3FKKA 1VFFA 1EGZA 2PZ0A 3TTQA 3LS9A 3VILA 2C0AA 2DIKA 3ARZA 3BLOA 2QDHA 2ALRA 3MZNA 4GOAA 5CC7A 1SMDA 3S5OA 4NNAA 1HVXA 1IXQA 3LBMA 4IJCA 4IQLA 1NJJA 4CQ9A 4E8DA 3RLHA 1JCYA 3VABA 3GC2A 1HL2A 3RXZA 3ABZA 1VFOA 3W7OA 3BJTA 3WKZA 4DO6A 3CGTA 3IUHA 2DVUA 3E38A 1DIKA 4H6RA 2NZLA 1JZ3A 5DY3A 5KINA 4QJ3B 5CPQA 3KE0A 3Q94A 1DYSA 3NYZA 3T55A 1TR1A 4OU1A 1QR7A 4UTKA 3BWWA 3P60A 3BV4A 5LHEA 2ZA3A 4TV5A 2BXZA 3S42A 3MUAA 4MWAE 1W9PA 4IMDA 2BTMA 4MB4A 3GB6A 4XWUA 3TDFA 1TV3A 3USZA 3L65A 3DFSA 1FVPA 3MC5A 2G0WA 3HMJG 1CGYA 1XINA 1VFMA 3LHVA 4AEOA 4DAIA 4L6HA 2CITA 3UF9A 4DWSA 2BV9A 5AC6A 1O6IA 3PY2A 4K7YA 4WDTA 1FWNA 1Q6CA 3TR2A 1PHWA 3LHTA 1A0DA 3NIYA 3B06A 3NAVA 4B5WA 3SCSA 1QASA 4LAOA 2ACUA 3HGRA 1Q63A 2JIWA 4L80A 3UEQA 4Q6JA 1UUQA 2VDGA 2OZ3A 2WVVA 3NQ7A 3C2YA 4S38A 3AWOA 2G5WA 4CQDA 4W87A 1JNEA 4PUJA 4DXXA 3AI0A 3FEMA 5LGZA 3NDYA 5CPMA 3R43A 1E1EA 1OX4A 4XD3A 3G24A 5I3GA 1E6SM 2VKZG 2OYMA 2VM8A 3WUEA 3SQMA 5A6SA 5D32A 3CYJA 4P2VA 4NZFA 1DWAM 2ZZ7A 3PHAA 1JAEA 4WGHA 4JIHA 3KBNA 5FJIA 2J8GA 4YYCA 4LB3A 3IAQA 2BBFA 4J3WA 4IIDA 4WX2A 4ZTXA 2VJXA 3BSMA 1H1NA 3IJ8A 2QCLA 4CCDA 1KRBC 3AIEA 3D3FA 3T07A 1CENA 4UC5A 2CXGA 3C0QA 2WNQA 5A95A 4Y9PA 1XLEA 5CXPA 3AICA 4ERGA 4AEFA 3SEPA 1KTBA 5JU6A 1TUFA 4C6KA 2YBUA 4PMYA 2KX9A 2PTDA 3HQNA 4G7EB 4ATDA 5DT7A 1T40A 4KFOA 4IH3A 1A5KC 3FN9A 3EA1A 1W1YA 4JFSA 4ACZB 3GD6A 4IGMA 2GGIA 2BVWA 3MSRA 1MYRA 3BURA 2Q8LA 2ZUSA 2WK2A 3LGGA 2X1TA 3A9BA 3NM1A 3SURA 3ES8A 3OGSA 1OX6A 1XP3A 5AHLA 5G2WA 5HINA 1RJPA 4B92A 4UTIA 1BTCA 2CNCA 4MDPA 4QCEA 1DKWA 1H50A 2PGWA 4NP7A 3BQ6A 1NFPA 2CLLA 4HB7A 3W88A 2R1MA 4JQAA 4EWND 2V3GA 3AIBA 1IZKA 5HNUA 4PRWA 1O60A 3RGTA 1TV8A 1ICQA 4CD8A 3A6OA 1W54A 2FH6A 4E2OA 3EEGA 2GVEA 3IVUA 5BMXA 3L0KA 3LSBA 4N6EA 2WMFA 5GPRA 4ZO9A 2BVYA 3BOLA 2WMHA 4PMXA 3E0LA 1GQKA 2CKRA 2V81A 1B3YA 2TSYA 1PIFA 1LG2A 3DHUA 3CAVA 3ALGA 4CQCA 2WCAA 1VKFA 4PUUA 4DJFC 3H7VA 1UPMB 1GKRA 2PDCA 3L2IA 4DF1A 1R6WA 2PWUA 2ZTKA 3FX4A 3AYRA 1E0WA 2OVLA 3W1PA 4EAYA 2EG8A 3FY1A 3LD5A 1KFJA 5FOOA 4F8XA 3VIJA 1QATA 4J3ZA 4J5NA 3NO3A 3TJ4A 2H6RA 2CHNA 2BX7A 3ARYA 1E0UA 1RCXB 4LRSA 1JI2A 3I3DA 1JD9A 4D6DA 4UFKA 1UKQA 3CV1A 3FVDA 3W7MA 3BCJA 2XFYA 4QAWA 4IWWA 1EZ2A 2BZNA 4HKPA 4HSHA 5I3HA 1RQBA 1EWDA 5HNRA 4QRNA 3VD7A 3RF9A 4EPBC 1GONA 1PHQA 1KBBA 2PDNA 2WJFA 4H7VA 4O28A 3VMOA 4HA3A 3VGGA 1OCJA 1K6WA 4GABA 4NKCA 2J24A 3OIHA 2WO5A 1Q13A 4XZNX 4HHLA 3WQEA 3DI0A 1A5LC 1KBKA 2QMKA 2YX0A 1ME7A 3CEPA 3QZEA 5I09A 1ZRQA 4A22A 1QPQA 5DBUA 4FNUA 1GGOA 3KWXA 1WYIA 2OQYA 1E4IA 5E9AA 4GVFA 3SUSA 4JXCA 2ZUVA 3HPAA 5C2XA 1X1ZA 2PFHA 4M6QA 1ITXA 4AWEA 1KXHA 3ARSA 1X6UA 1S5WA 4D6JA 3VZYA 2JF6A 4O1AA 1TPVA 3CM4A 2EKGA 3EWUA 4Q4PA 2JKPA 2A21A 1EX5A 2C16A 2J7BA 4MG4A 4K8HA 4P7RA 4AMCA 2E1DA 4K1WA 3H8AA 4JY9A 1HW6A 3SADA 3OVGA 2OT0A 3L0GA 1TZ7A 4DXKA 3F7JA 5I06A 3M6DA 2ZC1A 3V35A 3WLHA 2DT1A 3W1TA 2CLIA 5I24A 2ZA1A 7CGTA 1PKYA 3S4TA 3ZT5A 2DUZA 3HN3A 2O7QA 1TJPA 3CL6A 4GKTA 4BQ3A 3ZMRA 2AGTA 3PNUA 4CQBA 4JCLA 2EBNA 1HZYA 1Y5WA 1A0CA 4B5VA 4IIGA 2VZSA 4UUIA 3IV8A 5XIAA 2E09A 3P3BA 3GYCA 2PEVA 1R30A 4YHGA 1Q7QA 3FVMA 1H11A 2WCSA 1HKVA 1RQHA 4FLRA 2IW0A 1X39A 1ZBVA 5CPSA 4F4RA 1R87A 1TO3A 5C9XA 4LQ1A 4C7FA 2QJIA 4S3KA 4NQ1A 2A7RA 7TAAA 1JDDA 4M82A 2BOEX 3P93A 2FTPA 1QOXA 1B1YA 1XSKA 2Y0FA 2GJRA 4GI9A 2IQ0A 4Y8EA 3AALA 2DZTA 3N17A 3KRUA 3H54A 3TVAA 4MUPA 1B54A 3SCRA 4HOXA 1QO5A 3R1ZA 1DHPA 2QT3A 1Q66A 3MJYA 3ARVA 1WCGA 2I5IA 3CWOX 2J79A 3LQGA 1WBJA 1QPRA 5D2YA 3FYYA 1PUDA 1KQYA 4HNNA 1F8MA 3U4FA 3P5ZA 1UD5A 4Y8FA 1TZZA 1CLXA 4KMQA 2HXTA 5E6ZA 1T8QA 1BAGA 3WH7A 3A22A 1UR1A 2R91A 3B9EA 1HTIA 3GVWA 1S2UA 1SQ7A 2X16A 1FDYA 4JFWA 4O0ZA 1WO2A 1NELA 8XIAA 3CO4A 4JDBA 2BOFX 3VOHA 1YHTA 2CEQA 3UG3A 2Y70A 4RDZA 4EAMA 2C14A 4H7CA 2RHGA 2CESA 1TR9A 2FKPA 4B90A 1EGMA 1QCWA 1L8PA 4LV9A 3UR7A 3TXZA 4GJJA 5EYWA 4LS2A 5ABGA 3ISIX 5D33A 3FV9A 1LWHA 4IPLA 3AZSA 1Q7MA 1PZ0A 4WK9A 1XC6A 4L7ZA 1U5VA 3DYPA 1GORA 3W25A 4IG2A 1EDTA 1XR2A 3SN1A 2XZ9A 3WJSA 1OG6A 2ESCA 5E6YA 1M9HA 3KUMA 3OLDA 3W6MA 2XIMA 4HK7A 4DBUA 2EEXA 3HGOA 1TG7A 3EEZA 5EY5A 4GQRA 1WKFA 5HMFA 3UYCA 4XD5A 3VOGA 1OD8A 1JRBA 3FYOA 3IK2A 2B7OA 1V6UA 4RPQA 4LT9A 3C61A 3ITOA 1BPLB 2DZUA 5DCBA 2G95A 1B3VA 2VHLA 4DJED 1K7EA 1CBGA 2YCJA 3VGDA 1IEWA 4GZ7A 3VGFA 1J5TA 1H7XA 1RLCL 2WHKA 3MUIA 1SW3A 3OZPA 2XN1A 1Z44A 4UFHA 4BI7A 1K3UA 1XYFA 5D9MA 1Q4NX 1BLIA 1CPUA 4Q7NA 1Q6QA 5K9XA 4GG9A 1OC5A 3TOPA 3TROA 3F5KA 1POKA 2O9RA 3LOTA 1R2RA 3N3TA 2GDQA 1JPHA 1MQRA 2Y88A 1Z6KA 3OYXA 1M65A 1WX0A 1ONXA 4R53A 1WKEA 3CMFA 2P8CA 2CCRA 5D37A 3UXIA 5E9XA 4EKJA 5BWAA 3LLXA 2BOGX 4BKNA 1IF2A 1GTEA 1XLGA 1VBRA 3W7HA 3VDCA 3THCA 4DBSA 1OJXA 2DEPA 1ICSA 1ZAHA 2GUUA 3GAKA 3UJFA 1M7OA 5BXSA 2C18A 2VFEA 4J3SA 4WKFA 5E5CA 1OB0A 3H2NA 4X60A 1ISWA 3SQLA 4W5UA 2WLYA 3ABOA 3M0IA 1TX0A 1UA7A 3O05A 3QM3A 3WCZA 3T6CA 3L4UA 2WCGA 1UD6A 3GQYA 1H63A 1X6LA 1IGSA 4L1GA 1L6YA 1F6KA 4P7OA 4PC8A 2G41A 4C1LA 3ONBA 3MPGA 4Y9NA 2FDMA 2P76A 3G1AA 2HK1A 1N82A 2QMJA 4GD0A 4XQ6A 1AZ2A 3B03A 3WX7A 2ASHA 2GJPA 1PSCA 4YNGA 4NRSA 3EA3A 4YIWA 2AL2B 2J6VA 3GRIA 4QG9A 3EOSA 4FEZA 3WSUA 3E3HA 3VC5A 3FFSA 3SCTA 1EOMA 3T8QA 5I02A 1XYLA 5EPDA 2Y7FA 2J77A 4QR6A 4IMCA 2VVSA 4IIFA 3TJLA 3O07A 4QP0A 1KBJA 3WDIA 4Q8OA 4PTDA 3T09A 2CLMA 3E5PA 1KNWA 4ECLA 2DSZA 2PS2A 3ME3A 2QJJA 4AWUA 4O4VA 1GCYA 3TKFA 1JYNA 1EC9A 2BG5A 2RGLA 4C5ZA 1H62A 5CJMA 2O9TA 3D3AA 4RW5A 1CLKA 1GK8A 1Q45A 2E8ZA 2D2GA 1YNQA 4NX0A 1VFLA 3H6OA 2Z26A 3W6YA 4W85A 3K30A 1MZHA 2JGQA 1TTPA 3H12A 3MQTA 4PA8A 4C6BA 3ITGA 1TA3B 3CQJA 1VEPA 4RNJA 1DE5A 3U5UA 3KFTA 3S6DA 2HS8A 1FWEC 1WP6A 2PDBA 4U3AA 2XIIA 4ILSA 4HK6A 4W8AA 2A1YA 2G4FA 2CHRA 1AMKA 3A24A 1C90A 1W1A1 1ZLPA 2R1NA 1CXKA 1TPH1 2DH3A 3BPWA 3LHUA 4GCXA 2FVLA 1O4UA 4PBGA 1KCLA 3KXQA 3C2OA 4PTNA 2IPGA 3NQCA 2HVNA 4C65A 2J7DA 3W1NA 4CN1A 2WYSA 4GIAA 2WMJA 3G3MA 2RH9A 3DFNA 1KXVA 1J12A 3NZRA 4JTKA 5LIYX 4MPQA 1W1PA 4FOJA 1KKOA 4YVPA 1TX2A 2EG6A 3P7YA 4GI6A 3KVLA 5BU6A 1TVPA 3W1XA 1WDSA 3R8RA 4WCJA 4QTGA 4YTUA 3D0CA 1Q4WA 5M17A 4HPJA 4LCSA 4KQNA 1TWWA 5B7ZA 4AZ5A 3GNDA 1QMLA 1MI3A 3BOXA 1W17A 5A6BA 4O4WA 1EJSC 2E6YA 2PMQA 4JD4A 4PBEA 4AY8A 3CQKA 1JGMA 2O4MA 3H2EA 1RK5A 3GFXA 1EXPA 4P7NA 1HN1A 1OZQA 1IEQA 2F7FA 4E2BA 3W53A 5DRCA 1ZZMA 1AODA 1AK5A 3F4VA 5CGQA 2BGNE 5D02A 4HTYA 2ZRWA 2W62A 1OM0A 2RKXA 4QIUA 2CXEA 3KBVA 3PZTA 3HZ3A 2ALDA 1UP0A 3QVQA 4LUIA 3QQ0A 4K7VA 1RJRA 3UWEA 3IGSA 5D30A 4F0HA 1DJZA 1X97A 3STPA 3I7SA 3ONCA 1OCBA 3WBEA 3CAQA 3GZ3A 3TXVA 4CQAA 1NTHA 3OQ8A 3DN5A 3MUXA 1MMFA 1L0PA 1JCXA 4XTDA 4MYAA 2PP0A 5U7SA 3MT1A 5E0KA 5IDIA 1IXNA 1WDPA 4W5ZA 4C6FA 1G0CA 1W1IE 2VC5A 3STCA 2WZTA 1UWTA 1ODUA 1S2WA 4J3VA 3BMVA 2Y63A 5LA0A 3PBMA 1ME9A 1OHLA 3T0DA 4NJIA 1EBGA 1GWJA 4ASTA 3STGA 5HR6A 3HB9A 2REQB 4A3HA 1VD6A 1RSCA 4JKMA 3M0ZA 3OPSA 1QHOA 3RMEA 3KOXA 5DLCA 2R1PA 1BYDA 1G7UA 2OCZA 3WF0A 2CLEA 2D2OA 4F0SA 1O5XA 3B8UA 3GDBA 1XRFA 3SGGA 4I9MA 3V1PA 3QOKA 2ISFA 1CCWB 5A8GA 1DV7A 4OJYA 4AVNA 2ADAA 3R0UA 1OZMA 2J7EA 4KRTA 2ICSA 4DB7A 3G8EA 3CUZA 2C7FA 4X22A 2ZYFA 3OVRA 4CEUC 1DJHA 4MY9A 3WFLA 1BKSA 2Y24A 3UZ5A 4XSLA 3FSTA 2PD5A 4LNYA 2VC9A 3IJLA 1JQXA 4R7WA 3V7PA 1UCWA 3ANVA 5F4XA 2DT3A 4CCEA 3W70A 4DO7A 1DJIA 5T26A 2VCBA 3NZPA 5HR7A 3BSGA 4HMEA 4CN6A 3QSTA 3VZXA 3WDRA 1NWRA 1O5QA 1W5MA 1F76A 2PP3A 4O57A 5C55A 4Z17A 3VXGA 3CMJA 2Z6IA 3UGRA 5EU9A 4AISA 2NX3A 2P1FA 4H9UA 2BXYA 2BY0A 5BRBA 4HPXA 2E6FA 3Q65A 1I75A 3WD4A 1GOKA 2GUBA 4GZIA 3WQGA 2Z28A 2OSYA 1LJYA 2PBGA 4ZOCA 3T2PA 3JUGA 4H9ZA 1TJ2A 1IR1A 1ZBKA 3N19B 1W5OA 3GLCA 1EF3A 3T7VA 2VRJA 4GXWA 4HZMA 5CPOA 1RD5A 5A6TC 4O19A 2XFRA 1E51A 1Z7AA 3UFYA 4AZBA 1NEYA 4NZ5A 1RAKA 1JF6A 5D03A 2E9MA 3AAMA 3QPZA 1HFBA 4DQWA 4NRRA 3SDOA 1Q7ZA 4GA8A 3EDDA 4IX2A 2NV9A 3Q37A 1P6BA 3L4ZA 2OZ0A 2Z1WA 1S39A 1BG9A 1FTXA 2ATSA 2E5DA 3PWIA 5AC5A 2WSKA 2A6NA 4U5KA 4U10A 1F4AA 5FF0A 4BR1A 4F3HA 3NL3A 4HU4A 3CBWA 4B9YA 1KD0A 2QNEA 2R82A 3GAYA 3BG3A 4LYPA 4DUXA 3EMZA 3OA5A 1XLLA 3OBAA 3V5CA 1R0MA 4XB3A 4KERA 4M29A 1I45A 2VX5A 3NL6A 3UG4A 3FGCB 1KTCA 4LEFA 1XW8A 2ZUMA 3E2RA 3LERA 3R8HA 3DESA 3MW7A 3PZUA 1FHUA 1W3TA 3QSRA 3WH8A 5KETA 3OTRA 3G0UA 5LSMA 1QNSA 3LNMA 1HL9A 4MKNA 4CNUA 4GX8A 2Z1XA 3BXWA 3GSMA 4L4PA 1H7PA 4ZQCA 4PMOA 4HCLA 1HKKA 2TYSA 3HBLA 3C3NA 3GNPA 3VAVA 3HF3A 5CAKA 1AH0A 4KPLA 3RPMA 3QXBA 2YOCA 3HPSA 5A6AA 1HT6A 1REQB 4DY1A 2XPKA 3A13A 3P81A 5E70A 3THAA 1OEPA 5LIWX 3HPFA 4H83A 3RHGA 2XH4A 4FS9A 3D46A 1DE6A 4GIEA 3EB4A 1TVNA 2QJMA 3EB2A 4NZCA 2A7NA 2QPXA 3N13A 4L4MA 3KLLA 3UWVA 3GHSA 3HG2A 3GDRA 3T8LA 4NZ1A 4D6HA 1LL6A 5DEZA 3QC3A 3O63A 1T8XA 1VC4A 4ERAA 3PTQA 4W8LA 5I3FA 4XBJA 2Z2BA 4Q8QA 4UQBA 3AISA 1W0MA 2FB2A 3T81A 3F4WA 2YXOA 4G7FA 4H9VA 3PN8A 4GI8A 3OA3A 3ARRA 4W8BA 2J75A 3AU2A 3MMTA 3KL3A 2BP1A 1VENA 1OFAA 2V30A 1VCFA 3F4DA 2CBVA 4REQB 2XINA 1LM1A 5D9NA 4MWAC 1MEHA 1G7VA 1XLBA 2C0HA 2OELA 3NSMA 3IACA 1S1PA 4YJ5A 3TTEA 2XUCA 1K70A 4XISA 3BCFA 1G01A 2J62A 3LI1A 1NWTA 2GGHA 1UW9A 1FWTA 4C6OA 3C3UA 3AIWA 3BVJA 3S1WA 5D2VA 1GOIA 3GHTA 3PBYA 3OOQA 2CZFA 3QJAA 4ATWA 1AW5A 1POJA 2WMKA 1K1DA 4ZB5A 4C90A 3I4KA 1J10A 2ZDRA 2HSAA 2V5CA 3W3OA 3VDAA 1J11A 2R24A 4NNBA 1OCQA 3VOJA 1PPIA 1DJYA 1GYLA 2DSUA 3PAOA 4S39A 3QHOA 2ISWA 3U6WA 1XIIA 2PTWA 3VUPA 3C4UA 1N55A 4LSBA 2WW5A 4RNHA 3R13A 1KFLA 3CZJA 3B3DA 4LUJA 5EMUA 4LW7A 1KV8A 1WOBA 1EQPA 1ZALA 2IQTA 4FXFA 1F8IA 4H6EA 1X8CA 2AOSA 3WQCA 3IVTA 4P7QA 3MMUA 1SSGA 2BVDA 3GIQA 3OGRA 3T42A 4B5SA 2PDLA 3ZSSA 1MW1A 1NP2A 3NQBA 4QBXA 2VNCA 2VZUA 2J9ZA 4GYKA 1LL7A 4QG6A 4DAFA 4MADA 3W7RA 4HU3A 3IJQA 3QFWA 1EUNA 5U4NA 4QSFA 5GNYA 2GJLA 3ICJA 4HK5A 3U2ZA 3QMTA 1S46A 4I9JA 1TPWA 3N25A 2NX1A 4DZIA 3S0CA 1GJUA 2X30A 1TMQA 1A3WA 4URIA 1DQUA 1I4NA 4G8TA 7TIMA 4XKYA 4W7UA 1N8IA 3DKLA 1V6YA 1AQMA 1ONEA 4M1RA 2WSPA 3TW7A 2A3EA 2E1WA 2I7GA 3SBFA 1UC4A 1TPEA 3O6AA 3WK0A 2RDUA 1Q8AA 3NNTA 5F7UA 2DPEA 3N6HA 4MNJA 2HEJA 1H4PA 1TYGA 4PRTA 1GVIA 3CJPA 1R3VA 6TAAA 3G3DA 4H7ZA 2NT1A 3NEVA 1GUVA 4PL2A 2W27A 1RA5A 4C6EA 1XLKA 1FWCC 5D8WA 3AXKA 2W61A 3RPDA 3VKDA 3T0BA 3TEVA 2ZX5A 3IRDA 1VBGA 1JG9A 4GFIA 2TODA 4V28A 4KW2A 2EG7A 3SIMA 4HA1A 1TCDA 3VIFA 4O17A 1FWWA 1TE1A 4D6IA 3RYSA 2ONEA 1JFHA 3CZKA 2W63A 4X3ZA 1I2OA 4EE9A 2GVLA 2XSBA 1GPFA 1B90A 4NAFB 5EKYA 5D9OA 5AHNA 1J0YA 1TWDA 4US5D 5F4SA 1BHGA 4NXKA 2BDQA 4JX5A 3M0LA 1VLIA 3PG8A 1HJSA 2HE5A 3GNRA 4UTMA 4QM1A 4H8NA 3O6YX 2W9MA 3DFTA 3M1ZA 5G2IA 4LV4A 1ZAIA 2NXGA 1FWRA 2X2GA 7ENLA 3L4XA 4K38A 3SRFA 1SW0A 2QUUA 3TYAA 3K8LA 4MZYA 2EHHA 1XCFA 3I7QA 2PU1A 4WOQA 4M81A 1P43A 4BQ2A 3F1QA 3VD4A 3SY1A 2WB5A 2FVKA 3OP2A 1UPPA 2VWTA 4UNIA 6TIMA 3G1FA 3MUY1 3QV6A 4FX7A 3CO8A 1C7TA 2DT2A 1EH9A 3T44A 1E4NA 3AIUA 5BXRA 4PB3A 1U30A 4PULA 1KCZA 3MI6A 1HO4A 1E9YB 4E8CA 4J3UA 3CL8A 2W3ZA 3U4AA 1JZ5A 1B3ZA 2NUWA 1A5UA 3BL3A 1Q6RA 2QAPA 4I8DA 1W3LA 2PDUA 3GDTA 1A5OC 2DH2A 4Y2WA 1MNSA 4BI6A 4AF0A 3UG5A 5HPOA 1F4HA 4ICMA 4FA3A 2I1OA 1DP0A 1C91A 2VEKA 3ES7A 2DZWA 5J5RA 3NUKA 1JPMA 4AMAA 4NL1A 4K8GA 3O9NA 1OCNA 2HVOA 4PTVA 1KM2A 4LVGA 3C2VA 2NT0A 4ZE4A 3RUBL 2CFFA 3O0FA 4FOKA 2YA1A 4IFRA 2A5HA 4MB3A 1VJSA 3MP4A 2WM0A 3ID7A 1XIFA 3VGHA 1ECQA 3BLFA 5FJRA 3H2FA 4IJBA 2EPNA 2E77A 1R3TA 3A47A 1UIPA 2ABBA 3J7HA 3UGVA 3G6LA 3F2DA 1TTJA 4G5DA 2OOFA 1ZJIA 1E1CB 1XXXA 5H1WA 3NZGA 5FJTA 1XH0A 3MZ2A 1OK4A 3EYPA 3KTCA 3CTLA 4AHQA 2PDKA 3FJNA 5C2CA 1JRCA 4IISA 4LRTA 5LYRA 2YJQA 1JDCA 2BFGA 4Z1AA 3TAOA 2A3BA 3LK6A 4MJ4A 3GZAA 5BYWA 2BVTA 1YE4A 3N12A 3A4JA 4BZYA 2ZXQA 4UTJA 3WO8A 4GHRA 3GKFA 3KOZA 4FNSA 1YIXA 4IPNB 2PODA 3RR1A 1RVKA 3FNDA 3TNOA 3V0TA 1C8YA 3OHMB 1EC8A 2NQJA 3W7KA 3M41A 4Z2JA 3DH7A 3UVIA 5HQMA 2WVVB 4A3RA 4UZSA 3R12A 2PBOA 3H70A 2P0OA 4S3BA 4E6MA 1OX4B 3EPMA 4XO7A 1TPC1 4UQCA 3GNOA 4AD0A 4KIRA 2R6OA 2QCHA 2VR4A 2ZE0A 8TIMA 4HOZA 1A5MC 3TQ0A 1ZSXA 1RK6A 4C6CA 1SFTA 1SO3A 2PRHA 5AFDA 4KKXA 4DLFA 4MAVA 4TV6A 4ZQMA 3NGFA 1EHAA 4QGCA 2VR2A 3QGVA 3DZ1A 4WJXA 3OJGA 2VOTA 4K6AA 1UQYA 3B40A 5CC3A 5T9BG 4ZCWA 1ZNNA 4GC4A 2B4GA 2ZVIA 4LVAA 2D73A 3GDLA 1GJWA 4DJFA 2CLOA 3NPUA 4TU1A 2Y62A 4NIRA 1VJIA 3AMLA 1NDZA 4N2YA 3H2MA 4EXAA 8CGTA 3STFA 5FSEC 4I3GA 5I0DA 1B3XA 3VIHA 1OX5A 5KMYA 2PF0A 8A3HA 2Q02A 2OG9A 3HG4A 2IXVA 2IMRA 4PMDA 3N2OA 2EPHA 3ZJ6A 4IGNA 2PE4A 2XFFA 4JGDA 1TE6A 1O1ZA 2OX1A 4YLWA 3BCDA 3I6EA 1W3NA 4ZTYA 1F7BA 5I3DA 3W7EA 1XCWA 1PKMA 1IWBA 3PK7A 2F2HA 5CEWA 4MGGA 3MBFA 1HP5A 1CYGA 1L9WA 1QO2A 5BXTA 4CN4A 1ZUAX 2HV5A 1QWGA 4K39A 1HG3A 2G3MA 3A5FA 1WZAA 3VDHA 3NQFA 1CEOA 2IUZA 4DX3A 4HMDA 3UJEA 2OT1A 2YGYA 1Y0EA 3PBUA 3LQLA 4UXDA 1MWOA 1Q8JA 3EPOA 2CZEA 3XINA 1IE7C 4K8EA 3SUTA 3QY7A 4IMAA 3SRHA 1PWMA 2DVTA 1JFXA 1GQNA 1ADSA 1ZHAA 1YTEA 5HDRA 4G56A 4GKLA 3C2RA 1K9TA 2CETA 4AZCA 4JTSA 3AMKA 2B7QA 1AL8A 1SM9A 3SCWA 3I3EA 4GIYA 3Q45A 3E1F1 3KRSA 2GOKA 4GNVA 4LVBA 4L64A 2FB3A 4HNLA 1WDDA 1P4CA 2X1IA 3FA5A 3G1VA 3AROA 4FLSA 4AD3A 1TSIA 2HMCA 4RDYA 2WMIA 4XAGA 3N9KA 3N2TA 2JK2A 1KFBA 3A5VA 4NZ3A 4UFJA 4IFKA 3W7LA 1VFHA 3P6LA 3HJZA 3WEOA 3PWGA 1SZGA 4H04A 3L66A 3F03K 1CECA 3PZGA 1GW1A 3BZGA 5EB8A 1P0EA 4EANA 1M53A 1ZAJA 2FYMA 3IK4A 3TYUA 1EOKA 1NSJA 4J40A 3L2MA 4A05A 5AOUA 1S3TC 4FIQA 5DCDA 3PAJA 5XIMA 1K7FA 1IV8A 2C1HA 4BFAA 2DQXA 2ISVA 4RPPA 2P88A 5CZSA 3BZJA 3GXNA 5CC6A 1QU4A 1OQFA 5BMWA 1EA9C 2YCIX 1BD0A 3WDJA 3DAQA 2QUTA 3WBAA 4IIHA 2PPGA 2ZXBA 4XIMA 4HA0A 2V69A 3VFCA 4B91A 3N14A 1KFKA 4XX6A 2CZVA 4QLLA 3VDGA 4HMNA 3IIZA 5A2AA 2FZ9A 3WD3A 1E3ZA 3A9IA 3BOFA 3P82A 1SUXA 3RDKA 1DJNA 3BO9A 4QFUA 2FJKA 1V7AA 2YDSA 2OX4A 3ZO9A 5CBJA 4ZQNA 3MA8A 2C79A 3TJXA 5I2UA 2INZA 3OQEA 1RHCA 1HJQA 1UG6A 4D6FA 1R9XA 4XKMA 5CZKA 5CGTA 1IEVA 3GTXA 1L6FA 1X7FA 1QW9A 4E0CA 1FQ0A 1TV2A 4LAZA 4HNVA 3VUSA 1V5XA 1GVSA 4WSJA 4F2TA 1W5QA 3ZXWA 1UWQA 4AZ7A 4PCNA 1G4TA 1HIZA 2VDIA 4LAUA 3WMBA 3QYSA 3EWBX 1E6RA 4PUEA 4HIBA 2V9DA 3W22A 2Q8XA 3MU7A 1RA0A 2QIWA 2OPJA 2FPVA 4KWWA 1AQFA 1MW2A 3R0DA 3TYZA 2YW3A 1O68A 4HTBA 3UWWA 4KCWA 4UTWC 1W2VA 1YDVA 3OODA 5F2LA 4AB4A 5HWNA 3O8AA 4TX8A 1IXPA 4S1FA 3R0KA 2W0UA 2X2YA 3GXDA 3RJXA 3WZ0E 3H4GA 1DWIM 4W7WA 2A4AA 4QEEA 1VBUA 5CCZA 3TLLA 1M7PA 2BSLA 1H2JA 2ZZ4A 1SZFA 2J6XA 2XGIA 4PN2A 1P0NA 4RXFA 3GS6A 5ABHA 3TTYA 1NF0A 4LS0A 3OVQA 3LB0A 1B5TA 3NQVA 1KW1A 4LXFA 1T7LA 3H2AA 5E0CA 4J9JA 2L5HA 3PNZA 4DM2A 1CNVA 3GU9A 3T0AA 4RZ6A 4H19A 1NIUA 4JTQA 3U9IA 5EMLA 3R79A 1KGXA 1V08A 3VD3A 3T0TA 2WZEA 4ATLA 1XLDA 3JU2A 3EXRA 2VCAA 4MNMA 1XPYA 3WNMA 4GZJA 2FVMA 4XZHA 3T05A 2IKJA 1UHVA 3C56A 2Y5EA 3XIMA 1TVLA 3LY0A 1NY1A 2YDQA 5E09A 1QFEA 3W01A 5HPCA 3ZSTA 2XJ7A 4RKAA 2D2JA 5AB3A 5M1TA 1GOWA 3N6QA 1JF5A 4JL2A 4BF5A 4LWWA 4O0QA 5FKYA 2VWSA 4XAFA 3C52A 3OVPA 1UWAA 4XAZA 1V8EA 1H60A 4O0KA 1VYSX 1P1MA 3T08A 3YPIA 4HN4A 4F9JA 5LNRA 2WWDA 2DZPA 3K4DA 1EEXA 1QWKA 4GQGA 2GZXA 1LQ0A 2E3ZA 4NU7A 2OO6A 4DWSD 1X8FA 2WNWA 4H6KA 2XH7A 4TO8A 1RLDA 1NF7A 1KQZA 4O1CA 2ZIDA 3POHA 4HCHA 1A80A 1R7AA 5BZAA 2PCQA 4IPIA 3B8IA 4HNTA 5HJYA 1VPYA 2CYGA 2X0HA 3SFKA 3FHQA 2X05A 4LJ3A 2PCEA 3OZOA 5I77A 1EYWA 4FXJA 1PZ2A 3A64A 2B31A 4PEEA 2PUZA 2C91A 5E93A 4CVUA 3KOYA 2YIHA 1J01A 4N6FA 4JEJA 1PIIA 2GWGA 1XIDA 4PUWA 4ZFMA 3K1GA 4Z1BA 2PWFA 1VBHA 2QCFA 2PDYA 1W9BM 1KM0A 1JAKA 1MFVA 5TNVA 1J8VA 4YU1A 3BLKA 1UZ1A 1XPGA 2I17A 3JS3A 4GZEA 3AUJA 3TLQA 1OK6A 2XFWA 1OG0A 1AD4A 3EWXA 1IEIA 2VD8A 1L6GA 1BWVA 1W2PA 3LPPA 3KRBA 2ZQ0A 4R3UA 4LBUA 3LX9A 3VINA 1NDWA 3EA2A 1TPFA 2E4TA 4ZL1A 5A6JA 3W7JA 5A3HA 4UTUA 1BSLA 1J0IA 3ARWA 3AMGA 2PZNA 4QEHA 4XUGA 4YMZA 4QITA 1UJPA 1XICA 3GVGA 3Q2DA 4A8LA 1JNDA 5FAGA 1JIBA 4UTHA 2W91A 2CBUA 3M07A 4S3CA 4U33A 4TOQA 3KS6A 1AJ2A 3R89A 4NYYA 1DIEA 1QBBA 4B4HA 3NPXA 4FLOA 4BS0A 3NSXA 1F3XA 2OU4A 4FZIA 4BQ5A 4MY8A 1CI1A 1QOQA 4A21A 2B7PA 3A4AA 1UR3M 1VHCA 2V3DA 2MANA 1VF8A 4BWLC 1AJZA 3L4YA 4K36A 3TR9A 3JZUA 5AZ0A 2WJZA 2BXVA 3SCPA 1EJ7L 4JFTA 4B5TA 2DZVA 4JQ4A 3TE9A 3ZS4A 5LIXX 5AN7A 3KCLA 3WUFA 3TN5A 1E3XA 3N4EA 3LUTA 3G1YA 4FPSA 3RX3A 3MUCA 4GO8A 1MXDA 1T5AA 3H2CA 5BXPA 3CV6A 3MO7A 4DVOA 4JNZA 1HKIA 3N4AA 1PTDA 3QFEA 1ZENA 1TWIA 3KDNA 2QV4A 5EBUA 1EJRC 1LYXA 3V75A 2OEJA 4DNMA 2PI6A 1FCBA 4KRZA 2YBTA 2X8RA 4XTIA 4ZE5A 3FKRA 1UYQA 1YKWA