5KZMA

Crystal structure of tryptophan synthase alpha-beta chain complex from francisella tularensis
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
269
structure length
260
Chain Sequence
MTNRYTTLFANLEKRNEGAFIPFVTIGDPNKALSFEIIDTLVSSGADALELGIPFSDPLADGPTIQEANIRALESGITPKDCFDILTKIRAKYPHIPIGLLLYANLVYANGIENFYQKCLDAGVDSILIADVPAHESKEFRDIAKKVGIAQIFIAPPDASESTLKQISELGSGYTYLLSRVGMPVEDVLTKLREYNAPKPVLGFGISKPEQVQQAIKAGAAGAISGSATVKIIQNNISNKQKMLNELTYFVKEMKAATLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptophan synthase alpha chain
publication title Crystal structure of Tryptophan synthase alpha-beta chain complex from Francisella tularensis
rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Lyase
total genus 80
structure length 260
sequence length 269
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2016-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5kzmA00
1KM5A 2R14A 3B0PA 2ZZ4A 3O05A 3SZ8A 1IF2A 3G18A 4WOZA 5C55A 2ZA2A 1PL9A 2RDWA 3GR7A 4IMEA 2RDUA 3NEVA 5G2WA 4PA8A 3HIJA 3NR0A 2YPIA 2YYTA 4FO4A 4BI7A 3NQVA 3CTLA 2QAPA 4UTTC 1KFBA 1ZALA 2NX3A 1BTMA 4YXGA 3NVTA 1XBZA 1DQXA 3OA3A 2JKPA 3IVUA 1FUYA 2VEMA 1KM4A 1VYPX 3M43A 1FCVA 3A9IA 4PEKA 2HMCA 4BF9A 5TIMA 1TV7A 1GVRA 1IIHA 4LV4A 1XL9A 5LNVA 3USBA 4NX5A 3DFSA 3STGA 5K9CA 3ABOA 3QC3A 2YXGA 4O19A 3W88A 3S42A 1BKSA 4ZQNA 3TNOA 3PY2A 4NJJA 5F4SA 3M41A 3G1VA 3TH6A 3TFCA 1ALDA 1U83A 3S0CA 3FYPA 5FI8A 4CQ9A 4DXVA 3TIMA 3EWWA 1VYRA 1E51A 1YPFA 1GVOA 1TMHA 1JQVA 4UTIA 3WJXA 1SSGA 3JS3A 4WXZA 2YX0A 1ZAIA 5G4EA 4EWND 4MYXA 2X1RA 3W7DA 3LBCA 2A5HA 3NZRA 1AW1A 3M44A 4HPXA 2B7PA 4K8HA 1VCFA 2OCZA 1QWGA 2CZ5A 2ATSA 3MP3A 3N19B 4TU1A 3VKJA 4KKXA 1JCMP 2EKCA 2TMDA 4I7UA 1H62A 1X6UA 3M0ZA 1O5KA 3TAKA 3G1SA 3LERA 4EF8A 4Q32A 3U6WA 1JCXA 1OFDA 1TREA 1YDOA 1TQJA 4PFMA 5EMUA 4LVBA 3MWAA 3ATYA 4LVGA 5HWJA 4LS0A 5CKSA 4C1KA 1SO6A 3N2XA 1JCNA 4Z1CA 5LNUA 3LCGA 1OX4B 2VEIA 5DXYA 2NX9A 5E0KA 2DORA 3FIGA 3MHGA 5FEPA 4WZHA 3HMJG 2ABBA 4CNPA 3FEMA 2PCQA 1ICQA 5LHFA 3MUXA 3HGOA 5TBOA 2HTMA 4GFSA 3LLDA 5FESA 1SPQA 2CLOA 2HS8A 4QM1A 1M7PA 3EX3A 1G4EA 4FNSA 3W71A 1XDMA 4AHQA 5HUPA 1QO5A 3W2NA 1YTEA 4QNEA 4RCXA 3C2EA 3P80A 2WV8A 3LHWA 3NQ2A 1SZEA 5BOOA 1JCLA 3EX4A 4MYAA 1SW3A 2E6DA 3DFPA 4NZJA 2C18A 1DOSA 2WPBA 3OIXA 4UFMA 5FF0A 1TIMA 1O60A 1ONRA 1Q6LA 4LW7A 1LORA 2Y7GA 4PH6A 1A5AA 3H54A 3P5YA 2FB2A 1F5ZA 1PCKA 4PL1A 3I65A 1JQXA 3LDVA 2QCHA 3QW4B 3HPZA 3GDMA 2YW3A 1T96A 1YXCA 1OYCA 2QCGA 1SO4A 4ZQMA 2YFOA 1K02A 2I9EA 4MJMA 4U28A 4O14A 2C14A 3HBLA 3MP4A 3QPZA 5DLCA 2GJLA 3PBUA 1ADOA 5EKYA 1KM2A 3F4NA 1JRBA 1JCYA 1QCWA 3HG5A 3DAQA 1VLIA 4O17A 3JR2A 4RXFA 1M5WA 3C2FA 1QPQA 3S5OA 4O52A 4LVFA 3WK0A 1Z42A 5F2LA 2H3BA 1RZMA 3NQMA 3LXAA 3VE9A 4K36A 1WBJA 1F2JA 4N4QA 5G1TA 3TDFA 5F4XA 2FPYA 3G1XA 3GNNA 3C6CA 5K9DA 4XKYA 4N02A 1LZOA 3B4UA 3W2MA 2TSYA 5CSRA 3NYZA 4O18A 2ALDA 4CCCA 2A0NA 4M7SA 1KW1A 2H3DA 1Z44A 2YGYA 3O15A 4AEOA 4FHAA 1D9EA 4X2RA 3TKFA 3PUDA 3DENA 1SO3A 4JTGA 3H53A 1BEUA 4UR8A 5MHBA 3EX6A 3W1TA 1GVSA 2ZTJA 3QSRA 1VYSX 1LLWA 3BPWA 3BV4A 3GXPA 3OBKA 1JR1A 1W31A 1CX9A 1FBAA 4LOCA 2FDSA 5H91A 3UXDA 3W1NA 2P10A 3W7OA 1OFEA 4K7VA 1RQHA 1W37A 2R94A 4GRSA 5KITA 1DJNA 3LX9A 2J9ZA 3W74A 2ZYFA 2E09A 2V9DA 5FEXA 3C2OA 4AAJA 4IMFA 3G1HA 1DVJA 1SZNA 2BWGA 1OFBA 3C0JA 3IGUA 5HNRA 4ZQOA 3E02A 3T40A 1JULA 5KZDA 2C19A 3TSDA 1P1XA 3W7JA 5AHNA 4UC5A 5G5IA 1W5OA 5U7SA 2ZDRA 3G8EA 1Z41A 4DO6A 1D3GA 1TQXA 2Z2UA 3W2JA 4DO4A 4UMBA 3T44A 4ALDA 2OX1A 5E1QA 1ZAJA 1HL2A 3A5FA 4O1BA 3C8FA 5F2MA 1I8JA 4UTUA 1OFQA 5I3GA 2VENA 4M7TA 3U2OA 4UFHA 3PM6A 2X30A 1L6SA 3RMJA 1WAUA 2H90A 3LCFA 4Q4KA 4GUHA 3NL6A 3LRLA 2IQTA 2VELA 3W1QA 2YSWA 2WOQA 3EEGA 4QSHA 1XI3A 4AHPA 4UTMA 3W86A 3LXCA 4WY0A 1FCQA 1DKWA 2Y89A 3NQEA 2FB3A 3ABQA 3L65A 1TTPA 4LVDA 4NNBA 1L9WA 1OVDA 4FX8A 3KX6A 5BRBA 3W2UA 3TJXA 1O94A 4C1LA 3L0NA 5HWNA 4G1KA 3BG9A 3QRHA 1SW7A 5AHFA 3S5YA 1TPC1 1KV8A 1MEWA 4UXDA 3DFNA 5F2GA 5AHLA 3CEUA 4A22A 5EBUA 1W3TA 3T55A 3S1WA 3KRZA 5FF7A 1KFLA 2VFEA 3IIVA 4HSNA 4H6KA 3FYOA 3DBPA 1H61A 2CZFA 3MI2A 5I3JA 2XN2A 1XBVA 1SQ7A 5CG7A 3PB2A 1HG3A 1H63A 1C8VA 3RF9A 2ZRVA 3GKFA 4JX4A 3UYCA 4D2JA 4JXCA 4CCDA 1XKYA 2E6AA 2Q8LA 1QO2A 3G24A 1H5YA 1K03A 4X9SA 1OJXA 3GAYA 2Q3OA 2QUUA 3QM3A 2HSAA 1J5TA 3TAOA 6ALDA 3P7YA 3ZWSA 3W3OA 2VOMA 1VC4A 3C4UA 1QDSA 1SUXA 2OMAA 4O1CA 4AWUA 2VFFA 1NEYA 4WJEA 4K7YA 2NXGA 1OF8A 1HO4A 5CGQA 3ANYA 4Y8FA 4E0CA 1VHNA 2H8ZA 3O06A 3DFQA 4UNKA 5G2IA 3S1XA 4MFDA 4CNOA 1S5WA 1P5BA 5DBUA 4MJZA 3IVTA 1I2PA 4LS1A 4YCOA 1QAPA 2ZZ3A 1YADA 4O16A 1PIIA 1DORA 1W56A 2Z0IA 3TXVA 3W22A 4IUOA 4O11A 4DQWA 5EY5A 1GT8A 3NA8A 1M7OA 4I7VA 3GZ3A 1BWLA 4XBKA 2CLMA 2QCCA 4WXYA 4FF7A 3B06A 2ABAA 3W2KA 4DPQA 1SZFA 1MEIA 5EA9A 3A23A 3PBYA 3GDLA 2ISSA 1VQTA 4GBUA 5D09A 5DCDA 1JUBA 1QFEA 1QOPA 4FXRA 2PRMA 3PWAA 4S2CA 4PODA 2YDAA 2QUVA 1PV8A 2VEKA 3M5YA 1GTEA 4KWWA 1KLYA 4RR4A 4M6VA 2PE4A 3QJAA 4N9EA 3HQ1A 4ZVJA 1TTIA 1GOXA 2YYUA 3M5VA 4AVFA 5KMYA 2A2IA 2ZA1A 3BLIA 3CU2A 4ZQRA 3M6YA 3W7KA 3DHDA 2RHGA 1Q6OA 3TW6A 1QOQA 3EWBX 3PVFA 4GUFA 3NO5A 2Y7EA 4UTLA 3CWOX 1KM1A 1LRQA 4EVZA 2GPTA 3GXNA 3LB0A 3S5ZA 1ZJIA 4JNMA 1FXQA 1HO1A 3LTYA 3UXAA 4J9JA 3PUEA 4AF0A 1MXSA 4JTIA 1W3NA 1EPXA 3N2MA 1TTQA 1XC4A 1EUNA 2E1DA 2GVLA 1B4EA 3PC0A 2E5DA 1JCJA 2LLEA 3G0UA 2J6XA 1VR6A 2TPSA 4QITA 3LCLA 1GJPA 4DEFA 3DGRA 2E5BA 2WSYA 2DZVA 5DN1A 4LVAA 1H50A 1ML1A 3EWUA 1F73A 1L6WA 3DKLA 5K4ZA 1FX6A 3TROA 5D05A 4N9CA 1P0KA 5DBTA 1VCVA 3LCHA 3NAVA 2AGKA 5F1UA 4BFAA 5HWMA 1GZGA 3O63A 3NL2A 4MY1A 4RZ6A 1F6KA 1RPXA 3NGJA 2WSQA 2CLLA 3H55A 3FOKA 4O15A 5K3VA 3L2IA 1DHPA 3QPYA 2C6QA 2EGZA 4GXMA 3N9RA 5D02A 3AJXA 2FTPA 1JVNA 2C0AA 4ML9A 2E6YA 2NZLA 3VE7A 2H6RA 3O16A 5KTLA 3THAA 2YR1A 4YCPA 3IVSA 3TMLA 4EF9A 3NPUA 3IEBA 2DU2A 3W1UA 2C15A 3W2LA 3B04A 3IIOA 3W7EA 4NU7A 4JTUA 1GPWA 2EHHA 1VZWA 4OBTA 2B0MA 2ZCGA 5CZSA 4HT3A 3MHFA 5D2TA 4A29A 2H8XA 1KM0A 3CHVA 2EPHA 1UJPA 4HPJA 3MBFA 1VRDA 3PG9A 3UPWA 4QNWA 2Z6JA 1HTIA 1OFPA 3KXQA 4JTKA 3UZ5A 4RZ5A 3CB8A 3NOEA 1RR2A 5LNRA 1X1OA 2B7NA 5KZEA 4KFNA 1TJRA 2A6LA 2W0UA 3G3MA 5HQEA 4FX7A 2AQWA 3MMTA 4LT9A 1UBSA 1XUZA 3DFTA 4TO8A 3CIXA 1IGSA 3BVJA 3UWUA 1K7XA 3QFEA 1RVGA 4GUGA 3RLUA 3ATZA 4XBSA 3Q37A 3W7NA 1PHWA 5L9FA 3P82A 5K9XA 5F1VA 3QF0A 5F4WA 3W87A 4WY0F 3FFSA 3OVPA 5LSMA 3EWYA 2A7NA 1UB3A 4ZZ9A 3TSBA 1V7YA 3QH2A 4LC8A 3TE9A 3FA5A 4FB7A 3GB6A 1EWEA 3VCRA 3UWQA 3R89A 2CU0A 4W9TA 4JTHA 1GTHA 2ZBTA 2Q3RA 1H7OA 3C61A 3KRSA 4LY8A 4IXHA 2X1SA 1YTDA 1VHCA 2V82A 1W5PA 2X16A 3W83A 5HUOA 4HSOA 2GQ9A 2Y61A 1GYNA 1TCDA 2A21A 3IIPA 1KM3A 1C29A 5I3IA 4BI6A 2NV2A 3CT7A 4O13A 3FKKA 4IX0A 1K8YA 5HINA 3UNDA 3NM3A 3SGZA 2D73A 3T7VA 1W0MA 1Q6QA 7TIMA 5IBXA 1VCGA 2JGQA 1ZCOA 1LROA 1TPEA 3BLEA 1FXPA 3B0UX 1XFBA 1FDYA 4UIOA 5I3KA 3E49A 4O4VA 3RU6A 1G67A 1MEHA 3M5ZA 4I7WA 3KHJA 3TQKA 4PTNA 4LU0A 4HNUA 4H4IA 4HKPA 1AG1O 4NXSA 3NPWA 1WXJA 4Y9AA 2ZZ1A 3OG3A 3B8DA 1VLWA 4JICA 3NPVA 3RNDA 3GAKA 3KFTA 2DJLA 3P60A 5FF2A 3IGXA 3W7PA 4O53A 1ICSA 1O95A 3VNDA 2ZTKA 2Y63A 5I3FA 2NV1A 3B0VC 1WBHA 4WUIA 4NJHA 1Q45A 1YXYA 1QPOA 1EX5A 3G1FA 3HF3A 1FWWA 2JGYA 1UASA 5BMWA 4CCEA 4Y6GA 4JGDA 1R2SA 3LTPA 3LI0A 1P4CA 3IV3A 3S5NA 5AYYA 5TQLA 2Y7FA 4ADTA 4FNPA 4FIQA 3LV6A 3VFLA 1RV8A 3S1VA 1VGAA 1PCWA 3WJZA 3NQFA 4QAIA 4O54A 3MYPA 3MI3A 4K8EA 4ADUA 4O12A 2V0TA 4X3ZA 1AMKA 3GDRA 3LOTA 2FPTA 3GIYA 4AWSA 2GQ8A 3B03A 3NQGA 5C54A 2TYSA 2V5LA 5LNWA 1OK4A 2QJIA 2Y88A 4K39A 3BARA 1LRTA 3A24A 3NQCA 3SIZA 3IIZA 3LHVA 1UUMA 3TC6A 2E5CA 3KRUA 4IXXA 1FDJA 2Y85A 3EXTA 1R30A 5SWUA 2FLIA 4KFOA 3EKZA 1K3UA 3W9ZA 4LRSA 3FLUA 5CZ0A 2AAMA 3ZR4A 4HNTA 3KOFA 3UD6A 5AOUA 2OT0A 3W07A 4XTDA 2QAFA 1YDVA 3G0SA 4A21A 3UWVA 4LV9A 5BMXA 4XQ6A 3TR2A 5LHEA 3O1NA 1TPUA 2ZRWA 3WFAA 4JYFA 4NQ1A 3KVJA 3WJYA 3TXZA 2F7FA 1J2WA 2DZPA 4ICNA 5AC8A 5CZTA 2DP3A 2RDTA 3LV5A 3QEZA 1ME9A 5CSSA 5E93A 3W76A 2A7RA 1IIGA 4A3UA 3D0CA 2JKEA 3NPXA 2B7OA 2DZSA 3BW3A 3Q94A 3TFXA 5A8GA 4S1FA 1UUOA 4O57A 3INPA 4K6AA 3BW2A 5D2XA 2DJXA 3W1MA 4MPQA 1TPB1 3SECA 3G22A 2E68A 4M6PA 1LBFA 1OX4A 1TRDA 3HO8A 1KFCA 2C16A 4CQAA 3NQAA 1SO5A 2V8ZA 1WDWA 5G1YA 2BXVA 2XFWA 3TU9A 1KLZA 2E77A 3NQDA 1ZNNA 1W1ZA 3UY7A 5KZMA 3CC1A 4UUIA 2QJGA 4GUIA 3STFA 2NX1A 1EWDA 2A85A 4DBDA 3F4WA 4IPJA 3T78A 1RQEA 4LWWA 2GUUA 3WJWA 2GVGA 2G5WA 1PHQA 2VC6A 4FIRA 3SR7A 1B4KA 2DZUA 1K8ZA 4XWUA 1ICPA 1I4NA 2XN1A 3LHZA 2NWRA 5H2ZA 4JTTA 3AO0A 1H7RA 4UTWA 4R7JA 4UTHA 2G95A 1T99A 4LUJA 3NQ6A 3K30A 3GNDA 1H7WA 2I14A 3TCEA 3ABRA 4MVAA 5DELA 4WX2A 5D32A 4HHPA 4JY8A 1TYGA 3W7QA 3LCIA 2JBMA 3HG2A 3W7CA 4RZ4A 1WQ5A 4UFJA 4ZMGA 3A21A 1W8SA 4H3DA 3W7GA 3LLFA 4DF1A 4ORIA 2NXHA 4L4LA 3R5EA 1DL3A 2FFCA 1EB3A 2ZZ2A 3R12A 2QCLA 4IMCA 4DF0A 2YZRA 3V1PA 1LTDA 2P0OA 4YL2A 2QCNA 1TRIA 3P62A 1IXPA 3W6YA 2VEPA 1OG0A 3MO7A 1ME8A 1NF7A 4O0ZA 1IXOA 4I9AA 2NUWA 3EWZA 1OABA 4JDYA 1A53A 1QNVA 5LGXA 3QW3A 2BZNA 3W1PA 3HGRA 1JJKA 1IXNA 4LTSA 1B57A 2PRLA 5DCEA 3EX2A 5AHMA 3TV8A 3RK8A 3W84A 1GG1A 3W75A 1F76A 1TV5A 2Z1BA 2B7QA 5BW6A 4HNNA 1TPWA 1G7UA 4NXKA 2QCFA 1ZFJA 4M19A 4U4MA 4AH7A 4M6QA 2QCDB 1V5XA 4OU1A 4WQ6A 3L5MA 3HPXA 1TO3A 4R33A 2KZHA 4FNRA 4O1AA 1NAL1 3W1XA 1A5SA 2GVJA 3G8RA 2A7PA 1KBIA 4BWLA 4LRTA 4PC8A 2QUTA 3MHUA 1TPH1 1SZGA 1EA0A 1H7NA 4X22A 2PC4A 3WK1A 3IGSA 3MW7A 4FEZA 3W73A 2J24A 4EOUA 3Q58A 1ZAHA 2A1YA 4Z1BA 1F7BA 1PE1A 5D30A 1FWTA 3TA6A 5AC7A 3HB9A 3ABSA 1FQ0A 1YDNA 4KFPA 3DKJA 1SFLA 4FNTA 3M9YA 2QEZA 3UWZA 3UY8A 5LGZA 4UMAA 4Y96A 4N2YA 1LBMA 4JX6A 2BSLA 3KAOA 4IMDA 3EB2A 3P8IA 1R46A 3CQ0A 3W85A 4JTSA 4O28A 2TRSA 4IX2A 4BI5A 3PG8A 3SI9A 5LNSA 1TSIA 2VFIA 1NFBA 3V75A 5LKYA 4XTIA 3TJLA 5GVJA 1X1ZA 1F05A 1KFJA 4MZYA 4AB4A 4BWLC 3O07A 3W1LA 1XUUA 2ZRYA 1LBLA 2OT1A 2QF7A 4OE7A 4GWEA 1H1YA 1X8FA 3ELFA 1LCOA 4JD4A 3E0IA 3R2GA 4KWVA 2ZZ6A 5D37A 3QZEA 3ZS4A 2RKXA 1G4SA 3W23A 1OX6A 1I45A 1N55A 4HIBA 1RD5A 1ME7A 1LOLA 3L67A 4JX5A 5I3HA 1OYBA 5AHEA 3LBMA 1S5TA 4N9BA 3RLVA 4MY8A 4O4WA 1W5MA 1WX0A 2FIQA 4XUGA 4OV4A 1TPFA 4NJKA 3TMQA 1RQBA 3N14A 3WK2A 4N6EA 3L5AA 4GUJA 4JYDA 4JYEA 3T4CA 3VI2A 2Y7DA 3C3NA 1I2NA 4XKYB 5AFDA 4O50A 1LP6A 4TIMA 5AHIA 1KTNA 1QPRA 1OFAA 3Q2DA 3C52A 1R47A 1LDCA 3L0KA 1U5JA 2ZQ0A 3ZWTA 2G97A 4NNCA 3STEA 3W1RA 1VS1A 4JR5A 3S8HA 5FEZA 3CWNA 2ZZ7A 1W54A 1YXDA 4B5NA 1OK6A 3PS7A 2CLFA 4FNQA 2RFGA 2ZZ5A 3CIWA 3P5ZA 4UFKA 2Y6ZA 1HFBA 4IQLA 3E96A 1NSJA 3QSTA 1YTKA 3OEXA 3LI1A 3LHYA 3LRMA 4Z1AA 2VXNA 3LGEA 3UZJA 4RV8A 1F6PA 5HR7A 3YPIA 1H51A 1EEPA 4JTLA 4NT0A 3THQA 4UTKA 1OFOA 3S9YA 1LOQA 4XZ9A 2CFFA 4Z0JA 1D3HA 3GVGA 3C56A 3G3DA 5C2XA 1TPDA 4FNUA 5K4XA 2ZFAA 5L6UA 1KA9F 3TUUA 3QMRA 3HGSA 1GYLA 3GKAA 1H1ZA 3C2RA 3MI6A 4WOQA 3EXRA 4GJ1A 3PAJA 5KSWA 1FWSA 1EP2A 2ISVA 1OFRA 2X1TA 2NXIA 1WOBA 2F84A 3NNTA 3DHFA 4R34A 4DBEA 3E9AA 3P81A 1KBJA 2Z6IA 1SW0A 1UCWA 2R91A 1C9DA 3B05A 5D04C 2CZDA 4OQVA 5BNKA 2DZWA 3P84A 3P8JA 3S6DA 4MFEA 4WY0B 3PR2A 4NJIA 2J88A 1QR7A 4DELA 3S1UA 3F1QA 2X2GA 2FJKA 4IOTA 4BK9A 4ZL1A 5A5WA 5CPLA 3P74A 5U4NA 5HJLA 4M5PA 2QCDA 1FDZA 4YWIA 4Q33A 2X1UA 5DY3A 1MSSA 1ZY9A 3WJSA 4OV9A 4JIQA 4YLWA 2QR6A 2WKJA 4FXSA 1B9BA 1FCBA 4TR9A 1EP1A 3NDOA 1GVQA 1H7XA 4CQ8A 3R8RA 4OT7A 2YW4A 3GK0A 1G69A 1PVNA 5LZLA 2EAWA 3IIXA 5DCBA 1OYAA 2V2CA 2PRHA 4RXGA 4MZ1A 3GDTA 2QDGA 3PSVA 1R2TA 4LC6A 4MY9A 4MLRA 4NUWA 2B4GA 4TX9A 3P67A 2J9YA 1LM1A 4IMGA 3TQVA 1TTJA 2CLIA 3W70A 3LM7A 3RFAA 1DBTA 1O5XA 3BGJA 3G1AA 3W7IA 5FF4A 3TC7A 5K7JA 3W1AA 3E12A 3F03K 2V2HA 3KVLA 4O8RA 1K7EA 5D2YA 5DXXA 3CPRA 3GX9A 2CWNA 2VFDA 5IBXC 3LTSA 5EYWA 1X7FA 1JUKA 2ZA3A 1KFEA 1N8FA 2V5BA 1H60A 3FS2A 5ABTA 5AYXA 5K2ZA 2QKFA 2VFGA 4JTJA 1YPIA 3N73A 4AXKA 4O1DA 4QIUA 3WK3A 3L21A 1Y0EA 2NLIA 2WQPA 1I2QA 1GEQA 1AW5A 2C13A 2QCEA 2I1OA 3SW6A 3JRKA 4O10A 3IRDA 3SGUA 1SR9A 1OHLA 1DQWA 4POCA 3LCWA 1XCFA 3M16A 5D38A 3HGJA 1XM3A 3M7WA 4TMCA 4IWWA 1MO0A 4NNAA 5G4WA 3EKLA 4P61A 3O6CA 5IM51 3I7SA 1AW2A 3BG3A 4UR7A 3PUOA 1KTCA 3DH7A 3L68A 3GLCA 1ZENA 1J4EA 5C6MA 3CM4A 3M47A 3BGGA 3EX1A 2WJZA 4HN4A 3LXBA 1EP3A 3CEPA 4ORMA 4UCGA 4AHOA 4JEQA 1VPXA 4Z1DA 3O8AA 1AK5A 3QQ0A 3G1YA 3SFKA 4QQ3A 1S5VA 3TX9A 3DU0A 2NWSA 1H7PA 1WOAA 5HULA 3U8GA 3HPSA 1YLVA 4UFLA 3DI1A 2O7SA 1EIXA 4AF0B 2E6FA 3LHUA 2V2DA 3TW7A 2NUXA 4JDBA 3R13A 1I2OA 2BX7A 1BWKA 4GE8A 4OHQA 4ONVA 1W5QA 3I68A 2DZTA 8TIMA 5FF3A 2O7QA 1SU5A 2WNNA 3TSMA 1CI1A 4LUIA 2CLKA 1KTBA 1FCUA 1MZHA 3DXIA 3LHTA 3N9SA 4IPIA 4GC4A 4BR1A 3MYOA 5C5YA 3PB0A 3C2VA 3BLFA 2YFNA 2JKAA 4UNLA 1AL8A 1SSDA 1QMLA 4RX0A 4MOZA 5AYZA 3QQ1A 4OGZA 3LCXA 5DY2A 4EIVA 1VJIA 3OVQA 5AB3A 1OF6A 2EF9A 1LOSA 1R2RA 4NVTA 4MLJA 2A4AA 3PBVA 4K38A 5CPNA 3UPBA 1A5BA 4MKNA 3DFOA 3KVMA 3HG3A 4ZQCA 2ZRXA 1SFJA 4PL2A 3W7HA 1DV7A 3FJ6A 2J9XA 1I2RA 1A50A 3SY5A 4P2VA 3LRKA 1FY6A 3L9CA 4DO5A 3I7RA 4IJBA 1VH7A 1XBXA 1GG0A 3MJYA 1TB3A 1AL7A 1DJQA 3NL3A 4O0KA 2W6RA 3HOJA 3ZFHA 4CLMA 4RKAA 4S2BA 2ATMA 3SJ3A 2YCEA 2QDHA 2ISWA 2ZRUA 1G7VA 1TPVA 2JK2A 3PSWA 1B3OA 1HUVA 5D2WA 4NZFA 4LNYA 1KM6A 2HS6A 2RH9A 4MIMA 3PBWA 3GYEA 2CZEA 5FEWA 4JY9A 1WV2A 4Z08A 3DZ1A 5G2HA 5D33A 3I7QA 2OZ0A 3OHIA 5EL1A 5CZJA 1W5NA 3P61A 4AMAA 4L4MA 1TV8A 3G0XA 5CPOA 1M6JA 1NVMA 4PCFA 2NUYA 3N34A 3L0GA 4NJGA 3A22A 4IGHA 1K7FA 2Q8ZA 4E38A 1JRCA 3DI0A 4A2RA 2BLEA 2GOUA 1O4UA 1EUAA 1L2UA 1T0OA 1A5CA 6TIMA 3M1ZA 3NQ7A 2P1FA 4QJ1A 4UTWC 1G4TA 2R8WA 3W72A 3I6RA 3UWYA 2WSRA 2BTMA 1F74A 2C3ZA 3GR8A 4OWGA 2VKZG 5KINA 1NF0A 3FJLA 2PURA 3L5LA 5T26A 3UWWA 4N9DA 4K37A 1P0NA 1G4PA 2UV8G 1LYXA 4GNJA 4MZ8A 2GJNA 1G6CA 5J5DA 1ZHAA 3O6DA 3BG5A 4CNNA 4DF2A 1Q6RA 3M5XA 3FKRA 1LRNA 2XN0A 5J5RA 3W7RA 1WYIA 4FX6M 1THFD 2VFHA 4R53A 4N6FA 4UTJA 2G96A 3O6YX 3BW4A 4TMBA 5F2IA 3NQ8A 4E2BA 3L66A 4RK8A 3EWXA 1KV5A 4JTEA 3HJZA 5HMSA 4LS2A 3QMTA 2OJPA 4QISA 2V30A 1WA3A 2QCMA 4UMCA 1GQNA 1LLZA 4DPPA 2Y70A 1KFKA 3NM1A 1FWRA 4NX0A 1XDLA 4MUZA 3MBDA 1OX5A 3KVKA 1W3IA 4RLIA 3MP5A 4JN6A 1T8XA 2DZXA 2FPVA 3QYQA 1XBYA 4YMZA 4A2SA 1S3HA 2CLHA 4RJEA 3W7MA 1IXQA 2V81A 3TQ0A 4JS3A 1Z48A 1L6YA 2CW6A 1YYAA 2W79A 1JUEA 3OVRA 1GWJA 3UQNA 3GDKA 1Q3NA 4E2DA 4JIPA 3TK7A 4HNVA 3QMSA 2WNZA 3NXFA 4WD0A 1TJPA 1FWNA 4Y90A 3A5VA 3STCA 2J27A 2FQIA 5CPMA 1GVFA 3G1DA 3EXSA 4ZQPA 3SSJA 4N4PA 4UTTA 3BO9A 1CW2A 3NL5A 2WNQA 1XXXA 5AC6A 5D03A 5D2VA 2WO5A 4JTFA 3BK0A 3NG3A 1QPNA 3PF3A 2GQAA 3W7LA 2QJHA 5AN7A 4Z0SA 2C1HA 4ADSA 3GXTA 2Y62A 4AWTA 1PS9A 2ZRZA 1N7KA 3NZ1A 3CLMA 3N3MA 4UFIA 3HG4A 5HR6A 3PULA 2A6NA 1K8XA 2CLEA 5EPDA
chains in the Genus database with same CATH superfamily
1KM5A 3DFHA 2ZZ4A 2Q71A 3SZ8A 3KBJA 2ZA2A 2RDWA 4QCFA 4E2OA 3BTNA 3RMEA 3F5LA 1BYCA 2YYTA 2ZDSA 2PWHA 4CGTA 4JQ2A 1TZ9A 1A4LA 4B92A 1EQPA 4I8YA 3CZEA 2NX3A 2BVTA 4YXGA 4AVOA 3MSGA 1I1XA 3SCOA 1FFRA 2AQOA 1J5SA 4H7ZA 2CEQA 4UOQA 3K1DA 5DF0A 3GDBA 2VEMA 1HL9A 1GCYA 3HM7A 1FCVA 3A9IA 1JGIA 5GNYA 4PYSA 1PTGA 1WZKA 4UZUA 4QLKA 3QC3A 4LGXA 4AD4A 1BKSA 4ZQNA 3T81A 3PY2A 3G1VA 4US6A 3TH6A 3DHPA 3H2CA 5FJPA 5CJMA 3LS9A 4CQ9A 4AWEA 1TMHA 1KBBA 3CAVA 1IEVA 1VEOA 3HPFA 2X1RA 3LBCA 1V6VA 3ZLFA 1JZ2A 1PJ9A 2CKRA 1KCLA 4LYKA 3M64A 4IPNB 4KQNA 2EKCA 4OKDA 5CQ1A 3UXKA 2OYMA 3SN4A 4EF8A 2VVSA 1OFDA 3EOUA 2XSAA 4LS0A 2YA2A 1AODA 4LCSA 1JCNA 3LCGA 4AZBA 3PJXA 4ZOCA 2NX9A 3VNJA 2DORA 1PTAA 4CEUC 2INFA 3BAIA 4IIDA 2ABBA 5I0DA 2PCQA 3SQSA 4E8CA 1ICQA 4GX8A 2FZ9A 3WNOA 4GFSA 3JU2A 2VRQA 3ZJ7A 1M7PA 2BODX 1G4EA 1MUMA 4FNSA 2WCGA 3TLQA 5HUPA 4YNGA 3KBVA 2VDIA 4AIBA 1H09A 1CDGA 4QNEA 5JMUA 3VD3A 3LHWA 4MYAA 3HURA 4ENLA 5CPQA 2C18A 6A3HA 3QLDA 1XGZA 1UP2A 1V03A 1TIMA 1A5KC 5CGMA 3BOXA 2Y7GA 1EFZA 1A5AA 1HP5A 3P5YA 1Q7QA 4DZ5A 1PCKA 3RG6A 3HPZA 3GDMA 2YW3A 5DFAA 1SO4A 4AZHA 2PDPA 4HMEA 4MJMA 5GJNA 4GIAA 2BP1A 3EDEA 5H8UA 2O9OA 3HBLA 3PBUA 1KM2A 3T0BA 1JCYA 1QCWA 1XG3A 1BGAA 1VLIA 3JR2A 3PZVA 4NASA 3C2FA 3EDDA 3S5OA 3M0MA 3SCQA 1UD4A 4FP1A 1Z42A 3D47A 1CNVA 1JNEA 4GC3A 1RZMA 3GUGA 3NQMA 3VE9A 2WMJA 2UY2A 3N17A 4B3ZA 1UMYA 3WNNA 4F9JA 1GQLA 5C9WA 1Z69A 4Y9PA 4C6MA 2J78A 5K9DA 4L7ZA 3M0JA 4XKYA 4GQRA 4IHCA 4MM1A 3R8HA 1CB7B 3MPGA 5CJ5A 1EDQA 1KBKA 1UMLA 3GIPA 4M8UA 4O18A 1U30A 1KW1A 4HK5A 4CQCA 4AEOA 2YGYA 3LZ3A 2I5GA 1Y5VA 2R6OA 3PUDA 1JAKA 3DENA 1ZP4A 3H53A 3QLLA 1BEUA 2QVHA 3UW6A 2C1IA 3GNOA 4H83A 2UY4A 2ZTJA 1H4PA 3SCSA 3OBKA 3RCYA 1W31A 4UQDA 1FBAA 4H2CA 1E0XA 3AHTA 1TWZA 5CLTA 2P10A 2GSHA 3W7OA 1XCXA 5A95A 1WKYA 5IOBA 3DYPA 4GKTA 4K7VA 4B5TA 4HZMA 1PX3A 5FEXA 3C2OA 3H26A 4GY0A 1REQB 3HQPA 5HNRA 4AD3A 3AXHA 1KRAC 1MMFA 3E02A 2X40A 3TSDA 3WQEA 1CXIA 3IPWA 3CZKA 3W6LA 1S5NA 1Z41A 1D3GA 3K8MA 1PZ0A 3K1GA 4UMBA 3VIPA 3A5FA 4NIRA 4GBDA 1EEXA 4MF4A 3TTQA 4K1GA 3O9NA 5A6MA 1OFQA 1AZ1A 4G7EA 5D9PA 4M51A 3PM6A 2DV0A 1L6SA 1WAUA 2H90A 3DG7A 3NL6A 3EEGA 1OCQA 1YNQA 2CBUA 4QSHA 1XI3A 3GU9A 4FPSA 3GXIA 1RALA 2WMHA 1J8VA 3L65A 1EQCA 1SJCA 4NNBA 1L9WA 1OVDA 4FX8A 3PPHA 4OBRA 4FMVA 3VC6A 1XYBA 3L0NA 3S5YA 3DFNA 5F2GA 5FJOA 5AHLA 3CEUA 4A22A 5EBUA 4L1GA 5FF7A 2PA6A 4GVGA 1UWSA 4P8VA 2X7VA 2CZFA 2XH0A 1V6YA 2XN2A 1D2KA 2BY0A 2DIKA 3F2BA 1HG3A 1H63A 1C8VA 2ZRVA 1EJRC 1WZAA 2QUNA 3A6OA 3V18A 1VPYA 4V1XA 4JQ3A 3OP2A 5HPCA 2Y0FA 1G0CA 1XISA 4R85A 1U33A 3TQPA 2VCAA 4P8XA 1K03A 2PS2A 2Q3OA 2QUUA 3S2NA 3GFXA 6ALDA 4Q4SA 4WGXA 2P88A 3ZIZA 8CGTA 3VGBA 2OMAA 3WD2A 4QGCA 4J3UA 1NEYA 4ZSTA 3PJUA 4OIFA 1FVPA 1OF8A 4HNCA 4XUYA 1JZ6A 4Y8FA 3EBVA 4E0CA 1VHNA 2H8ZA 4GGBA 1S5WA 1P5BA 5DBUA 1X7IA 1RP9A 4Z1YA 1I2PA 1RLDA 2QULA 4YCOA 4GISA 1QAPA 1IWAA 4PCNA 2VZVA 1PIIA 3W22A 1NARA 5EY5A 2FTYA 1GT8A 2WMIB 4GYPA 4DUVA 1K8CA 3EDFA 4NI8A 3UZXA 2E25A 4FF7A 4XZLX 2EJ1A 2PDXA 4AUBA 1SZFA 1JYXA 3CAWA 2E40A 2I7GA 4GKLA 4C7GA 1KQYA 5HK4A 4C7FA 2ISSA 4EXAA 1E6XM 1VQTA 4GBUA 1CWYA 5DCDA 1JUBA 1XIIA 4Q8MA 4FXRA 4PODA 1IZJA 2YDAA 4G8TA 2QZRA 2XPKA 1E55A 3LZ5A 4J3XA 1PV8A 1GTEA 1P7TB 1Z6KA 1KLYA 1R3RA 2ZWYA 4N9EA 1KWKA 3GXFA 1D7FA 2JF6A 3RPTA 4AVFA 1HKKA 1GQIA 3CU2A 2IPWA 1J2BA 3TW6A 3PVFA 2Y7EA 4EVZA 1KM1A 2GPTA 3GXNA 1PSCA 3LB0A 2QHAA 4AD2A 4AF0A 1MXSA 2QV5A 3N2MA 2D3LA 2EPKX 5AYBA 2GVYA 4QDMA 3G0UA 1V51A 1V8EA 2XUCA 3POCA 4B3KA 2E5BA 2DZVA 3GU1A 4LVAA 4LBSA 1DWFM 4LAMA 1F73A 3ARTA 4AISA 3TROA 4K1WA 1VCVA 3NAVA 5F1UA 5HWMA 1GZGA 3O63A 4MY1A 4Q4QA 4RZ6A 3WQFA 2OEKA 3RPMA 4IQEA 4IGSA 2VZTA 1CGXA 3H55A 3FOKA 5K3VA 5D8WA 5C9RA 2EGZA 1A4MA 1JNDA 2XISA 1J0IA 3AJXA 4BCEA 3K4WA 2FTPA 1JVNA 4ML9A 4LAZA 4EE9A 5A8QA 3CPUA 4AXNA 3CHDA 4XVEA 2PF0A 1HVXA 3OLGA 1NFGA 3SFWA 4EF9A 3IEBA 1HIZA 2C15A 3QY8A 2AL1A 3UR7A 6ENLA 2CBVA 1S1PA 1GPWA 4MNMA 2ZCGA 4PCTA 5CZSA 3MHFA 4IIHA 3CUZA 3N1AA 1KM0A 3KP1A 4BY3A 4JTRA 3MBFA 1R38A 2DQWA 4GHRA 3PG9A 1W1A1 1HTIA 3KXQA 5LNRA 4M6UA 5A3HA 1XLFA 2WKLA 5AKQA 3NUKA 5BXPA 4KFNA 3SUVA 3G3MA 2AQWA 2IXUA 4LT9A 2DW7A 3BVJA 3THDA 5IDZA 1E43A 2QV4A 4AYGA 1DE5A 7ODCA 3T2PA 4CD8A 1RVGA 4IIBA 4XBSA 4GCXA 2J4GA 3Q37A 2BOGX 3FVMA 1VB9A 1JZ5A 5F4WA 1ZRQA 3W87A 4WY0F 1FWDC 5LSMA 2OQYA 2IKIA 3ENLA 2FMOA 3EWYA 1UB3A 3WL0A 2WMIA 5LIUX 1FHUA 3GB6A 4FK9A 1EWEA 2CU0A 4W9TA 3RHGA 2MNRA 5J8LA 1H7OA 4LY8A 4RW5A 2X16A 4HSOA 4GI4A 4M81A 1GYNA 1TCDA 3AOFA 3O3RA 4IUGA 4XIAA 5I3IA 2PWVA 4K68A 1B54A 4IX0A 1K8YA 5HINA 2GUYA 1P7TA 3SGZA 2D73A 1E4LA 3KCOA 5A8NA 1Q6QA 7TIMA 5BRPA 1BQCA 1XHGA 1YE4A 5H6HA 1ZCOA 4DUOA 1SVDA 1KWGA 1PX8A 1FXPA 3B0UX 2OKOA 5GPRA 1XRFA 1LUCB 3MUZ1 3O6AA 3E49A 4O4VA 3M5ZA 4GQQA 3MKKA 4I7WA 1DXEA 3EEZA 4HNUA 4R7WA 4H4IA 4HKPA 4Q4PA 3UR8A 1E3XA 1EC7A 5FCZA 3E1F1 4ATLA 1XIMA 4Y9AA 2ZZ1A 4XKMA 3OG3A 3DN5A 3WDQA 3NPVA 1W17A 2ADAA 4IQJA 4YVPA 4DLFA 3H4XA 2BB0A 4MWAD 2NVDA 4MPKA 3NZQA 3P60A 1DPMA 5FF2A 4FS9A 3SRKA 3W7PA 4C6EA 2O4MA 3AIVA 4LEFA 2ZTKA 2Y63A 5I3FA 4LYQA 4GABA 1R87A 3AICA 4U5IA 3GVWA 4X9YA 3G1FA 1BSLA 4S3JA 3FV9A 2JGYA 1GJUA 4EXQA 3GW3A 5E9AA 4RPQA 4J4KA 3R8GA 1QW8A 1TA3B 2WB5A 1NFPA 3LTPA 4HGXA 3II1A 3POHA 1B3YA 3AALA 3DC0A 3S1VA 4H8VA 1EF3A 2XH7A 1ZPTA 3TOPA 5D8ZA 4O12A 1C8QA 1X1NA 2XGBA 1O1ZA 3LOTA 5CEWA 4AWSA 4GIRA 2OQHA 3NFUA 3NQGA 4IFRA 1XH2A 2RGLA 5E0FA 4B9ZA 3B9OA 3C0SA 3GS6A 3F4DA 2Y88A 3DYMA 1Q63A 1G01A 3A24A 3ARRA 3NQCA 3L12A 3LHVA 4CQBA 3TC6A 4DJED 4K8GA 1JI2A 4KFOA 3EKZA 5B80A 1GVEA 5CZ0A 2GJXB 4NI3A 3AS2A 2V67A 3SEPA 3W0KA 3UD6A 1JPMA 4XTDA 2QAFA 3WN6A 2DH2A 5LIYX 4GIYA 4HOXA 4PB3A 3TR2A 5LHEA 4PMUA 3MVTA 1D3CA 2YOCA 2XIJA 4P7RA 2ZUWA 4HZ8A 4H2HA 5AC8A 3IAPA 3LV5A 4KEMA 3W76A 4A3UA 3D0CA 3BW3A 2B7OA 2DZSA 2OZTA 4S1FA 3FAWA 2BASA 1JCTA 1AJZA 1NWSA 4MB3A 4JZ5A 1AA1B 3SECA 1BF6A 2J62A 3A4WA 3WF3A 4DWSD 5AZ1A 1KFCA 1L8NA 2OLAA 3NQAA 1ZBCA 1WDWA 5G1YA 1XPGA 2BS9A 2XFWA 1KLZA 1X39A 5C7VA 3MUIA 3CO8A 2E77A 2E9BA 3NQDA 2Z7KA 1W1ZA 3UY7A 1IWBA 3CC1A 3CV1A 4M29A 3M0VA 1EWDA 2J7CA 3P3BA 4WLCA 4IISA 3W81A 3F4WA 5EMYA 4QAWA 4IPJA 3CHEA 1EJUC 3W38A 2GUUA 3WJWA 1PKMA 2Z25A 1DHKA 2JIWA 3S46A 5CBIA 4GYKA 4I9JA 4Z2HA 3LYEA 3G1RA 1TR9A 3MDWA 1XRTA 1H7RA 1TMQA 4Q4RA 4R7JA 1ODZA 1T99A 3SUSA 2OYKA 3VNZA 2OSXA 3NQ6A 4FLSA 4S3FA 2DVTA 3TCEA 1EIBA 3B97A 1UHVA 4MTVA 3BUVA 4DHGA 2JBMA 4UBPC 3W7CA 1WQ5A 3RRXA 4ZMGA 4IFOA 3DEQA 5I00A 3LLFA 4HJFA 1R8LA 4QROA 1EB3A 4GGHA 4IMCA 3ALGA 4DF0A 2QYGA 1PPIA 7REQB 2OEMA 1YKWA 4GQ0A 2VEPA 3OG2A 1JZ3A 1IXOA 4CU8A 4JDYA 4RNIA 2VEFA 2R1KA 4HHHA 4ZB0A 2PI6A 1N8WA 3GYCA 2XYLA 4LTSA 4NYUA 2PRLA 4RNHA 3AIBA 3EOLA 5DT5A 5JBEA 2GGEA 3W75A 1OY0A 1F76A 4YVVA 4DWDA 1TPWA 3OGVA 4M19A 3GD6A 3SCPA 1E71M 4AH7A 2J13A 2D24A 1DQUA 2KX9A 1R3VA 3AU2A 1NTHA 1MXDA 2KZHA 3VCCA 4AC7C 2I5IA 2OWCA 4GQBA 1MUCA 5A6BA 5BCAA 2QUTA 4REQA 1NOFA 4X22A 4XSLA 4CKQA 4EOUA 3PK7A 5G4HC 3ARSA 3KBSA 2GJXA 1EO5A 2P8BA 1YDNA 4KFPA 2VCBA 1R0MA 3H2NA 5LGZA 4Y96A 4F0SA 1LBMA 4JX6A 4I8DA 5DMYA 4RW3A 1DIDA 3KAOA 1R46A 3ITVA 3W85A 4S39A 3MZNA 2TRSA 5EMJA 3PG8A 5LNSA 4XTIA 5GVJA 1WCGA 1X1ZA 4MZYA 5GNXA 3FHAA 2W61A 3PZTA 4MAZA 2GDUA 1H1YA 3RX4A 3ELFA 4GX9A 4RE4A 4XBJA 2XINA 4BQ4A 1GKRA 2ZZ6A 5A1AA 1G4SA 3W23A 2F38A 1C3FA 1LOLA 1T41A 1Q6FA 2HXUA 3NGFA 5AHEA 3XISA 9XIMA 3LBMA 1S5TA 3QTPA 1W5MA 2DIEA 1BXBA 3PAOA 4C6FA 2X0HA 3IV8A 4HVXA 4N6EA 4GUJA 4S3GA 3ORWA 1A5UA 2WMFA 4HMNA 2J47A 4O50A 1LP6A 2WMGA 1XGEA 1LDCA 4GZEA 4MB1A 5IHSA 1Y65A 1UPPA 3QGAC 2FVLA 4V2XA 2GGGA 3PS7A 4DYEA 4FNQA 2RFGA 2ZZ5A 2XVGA 1DP0A 5I06A 3WSUA 1I6NA 4L61A 2D2GA 2I16A 3ONBA 2HEJA 4Z1AA 2VXNA 4LY4A 2V5CA 3AMCA 4QG9A 3MKVA 3WD4A 2EPOA 4RE2A 4AZ7A 1XRVA 3ARPA 2W27A 4ZB2A 1OFOA 2CCRA 4G56A 3VGDA 4AZIA 2CFFA 4Z0JA 3C56A 3G3DA 5C2XA 4IJCA 4Y9NA 3TUUA 3GG7A 3PTDA 1GYLA 3GKAA 4EK7A 2CIPA 3C2RA 2WVTA 4DZAA 1HL8A 3RITA 2ONEA 1PKNA 3VOCA 1OFRA 1WOBA 4DBEA 4F0HA 2WZHA 4E4PA 3T0CA 1UCWA 3WBXA 1EZ2A 3MWCA 3PPFA 4MFEA 1J79A 3PR2A 1XLHA 2XVKA 1J0JA 2J88A 4DELA 3AU6A 2FJKA 3FX4A 1DWJM 4ZL1A 2QNEA 5CPLA 3P74A 5U4NA 4M5PA 1H11A 4I9MA 4Q4MA 3WNKA 5DY3A 4I90A 3CV6A 4OV9A 4JIQA 4YLWA 3D3FA 1W3JA 2FH6A 4KGLA 3I4KA 4X60A 2WKJA 4FXSA 1H7XA 3I4EA 4CN1A 5DMNA 3R8RA 1XYCA 4OT7A 3M0YA 3T0AA 2EAWA 4UWMA 5AVHA 3GDTA 2QDGA 3PSVA 4LC6A 1H2JA 4NRSA 4GYJA 2XIMA 5E6YA 2B4GA 2HVNA 1U5VA 4IMGA 3W70A 4EPEC 1CECA 4GO8A 3BGJA 3G1AA 3Q4DA 1FHVA 1IR1A 2IQ0A 2ODOA 5FF4A 5K7JA 5D2YA 5DXXA 3EKGA 3CPRA 3NDYA 3GX9A 4HZ7A 3QR3A 1X7FA 1WB0A 2R24A 1ZJHA 2HNEA 2Z27A 1U1UA 1UIOA 4B3LA 3APYA 3D5HA 1YPIA 3WLHA 3LPGA 3SUTA 3IJLA 4CNUA 3L21A 1NOWA 3B8SA 2P76A 2QUMA 1UQZA 2OQLA 3IRDA 4JNYA 3SGUA 2W92A 3CV7A 3SQLA 2J6VA 1XCFA 3S3GA 1GKPA 4TMCA 2RGMA 1FP9A 1MO0A 1KKOA 3CT2A 4HA4A 3O6CA 4WCJA 1AW2A 5I3DA 5DX7A 4X63A 1KTCA 3L68A 2C91A 3GLCA 1GEHA 1J4EA 3WFZA 1XQKA 7TAAA 1TELA 2HE5A 4GH3A 1ZGDA 3KE0A 4V1YA 1EP3A 4ORMA 2ZE0A 1BG9A 5CSUA 1AK5A 4DM2A 3TYZA 1VFMA 5CGTA 2BG5A 2ACQA 4P7NA 1LWJA 1YMYA 3ONCA 1UPMB 3HPSA 4F9DA 3MB9A 2O7SA 3QOKA 3QTGA 4MGGA 2V2DA 4GPNA 3TW7A 2NUXA 3R13A 3KZPA 4Y9OA 5T8GA 1E1EA 2BX7A 4GE8A 4L9XA 3K8KA 1QHPA 2DZTA 2QPSA 1QNQA 3OU8A 1LT7A 2REQA 3QGKC 1KTBA 1FCUA 3GNXA 4ICMA 4IPIA 4GC4A 4R27A 2PBGA 2Y1HA 5JH1A 2JKAA 4UNLA 1SSDA 3UZYA 3FYYA 2XGIA 4MDOA 2V3EA 3QY6A 1VFTA 1R2RA 1M65A 2WM1A 1LWIA 3PBVA 1X98A 1YQ2A 1UD6A 1A5BA 3HG3A 2ZRXA 3NYDA 3GZAA 5ABFA 1A50A 2OPJA 2QJNA 3WLRA 1W1IE 3LRKA 3L9CA 4QP0A 1N82A 3N6JA 3BICA 9RUBA 3ITTA 1XBXA 1UBPC 1EDGA 3BCDA 2ATMA 4MNLA 2ISWA 4HTYA 4Q4OA 1G7VA 4MMWA 2XM1A 3PSWA 2W67A 2VWTA 1HUVA 1PB0A 3GWQA 4NZFA 1GOOA 1DIOA 2NW0A 3GXDA 2DQXA 5I7GA 4PUMA 4JY9A 3PHAA 2XH2A 3IJ6A 3OYXA 4A3QA 1DXFA 1VBJA 3OHIA 1V3LA 1DWIM 2PFHA 1SFTA 3AMKA 3G0XA 5CPOA 1M6JA 2FZBA 1NVMA 3RLHA 3C86A 4PCFA 1J0YA 4UQCA 3B3DA 3PJWA 2BLEA 2AKZA 1L2UA 3RO8A 3KOZA 2BY1A 1ZP3A 3M1ZA 4HK6A 2P1FA 3QHMA 4KS0A 4QS6A 1U5HA 1JIBA 3QV9A 3P93A 1OD0A 2BTMA 3BAWA 1F74A 3AROA 1SM9A 1ADSA 3RGTA 1F3WA 2GSEA 3WEMA 3ZO9A 5D4YA 3GM8A 1P0NA 1E73M 3S9IA 1G4PA 1XGDA 2UY3A 4GNJA 4GY1A 1Q4NX 1ZHAA 2PD5A 3O6DA 1B9ZA 1V6TA 4C90A 3AHXA 4FX6M 5MKGA 1L2QA 2ICSA 1MYRA 4JTQA 3VM7A 3L4ZA 7ENLA 1FA2A 3IGHX 3UJ2A 3VZZA 4RK8A 4RDVA 3PBMA 2OLHA 3HJZA 4LS2A 1IEXA 2YB4A 1V0MA 4AVNA 4QISA 4IIEA 1L6FA 1LLZA 4JFVA 5GNZA 3LMZA 1FWRA 2RAGA 1B3VA 3MBDA 3FDGA 4TXEA 4I5XA 4KCUA 4Q7NA 4DJDC 1NDWA 1XS2A 2FPVA 4KWUA 4CD7A 4V33A 3TQ0A 1Q13A 3I3DA 3M0KA 2VOTA 3RIKA 2CW6A 4KCWA 1OB0A 3SJNA 1TX0A 3GDKA 5I5RA 1U1HA 2DSWA 4JIPA 3TK7A 4HNVA 3CH9A 4WD0A 1OIMA 4Y90A 3A5VA 3VIGA 2GJPA 2FQIA 4BS0A 4HQVA 3GHTA 4FI4A 3RUBL 3EXSA 4PMXA 4N4PA 1BGGA 1CW2A 2WNQA 1TV2A 2CHNA 1HX0A 3NG3A 1QPNA 2PC8A 4ADSA 3GXTA 4EKJA 1PS9A 3NZ1A 1CIUA 3EYPA 3LMYA 4UFIA 4FOKA 2VMFA 1Y5WA 3PNUA 3O05A 4XAYA 3BXWA 3G18A 4TX8A 3WDHA 5C55A 2FFIA 3GR7A 4IMEA 2Z1WA 3NEVA 3W25A 3NCOA 5B7YA 4ZGYA 4BI7A 3CTLA 3OJGA 2G4FA 3URAA 1BTMA 1XBZA 1JAEA 2BGNE 2VT0A 1DQXA 3FSTA 3IVUA 1R9YA 4XD5A 1KM4A 3M43A 2HMCA 4BF9A 1IIHA 5LNVA 4DI9A 1E9ZB 5FKYA 5K9CA 2J7EA 2YXGA 1XG4A 3S42A 3O7UA 4LJ3A 4NJJA 2WHMA 1M9HA 2WC7A 3VYLA 3S0CA 3FYPA 1EJ7L 3N9KA 4GZJA 4TV6A 2YCKX 3EWWA 1VYRA 4C6PA 5JBFA 1IR2A 3WJXA 1QPKA 4WSKA 2FDMA 1MNZA 2WZMA 1MFUA 1T6MA 1RSCA 4EWND 1ZJAA 3W7DA 3SRFA 3RX2A 4EACA 2YIHA 4IG2A 3TC3A 1QOXA 3MP3A 2W66A 3G2GA 3VKJA 1JCMP 1E4NA 1IHIA 2TMDA 4GXWA 4QDWA 1O5KA 2YBTA 3LERA 5CC3A 4BF5A 2PDBA 2WNWA 1TREA 1TQJA 3T2OA 4HU8A 3MWAA 3ATYA 1G1YA 4JHZA 1V6XA 3N2XA 1GZ1A 1NELA 4Z1CA 4C6DA 4A4AA 2UY5A 5DXYA 5E0KA 3NSMA 3MHGA 4WZHA 2WW5A 2OOFA 3FEMA 3ARYA 3VTRA 3HGOA 2D0FA 1HP4A 3LLDA 5FESA 4D8LA 3CMGA 1SPQA 2CLOA 4LANA 4C5YA 4X0NA 1T8QA 2HRWA 3EX3A 3ZVHB 4GYFA 1FOBA 2WWDA 2VR5A 4Q8VA 4KRUA 4B5UA 3P6LA 4NL1A 2WV8A 3NQ2A 5FAGA 4JHOA 1JCLA 5CBBA 1SW3A 3DFPA 1NP2A 3UP8A 3KZSA 2WPBA 1XDJA 3OIXA 3LNMA 5FF0A 1CGUA 3BLKA 5BROA 5A6SA 1XYFA 3FJNA 1Q6LA 4LW7A 1LORA 1PDYA 1TZ7A 3WD3A 1CGYA 2FB2A 3KOXA 2JQXA 4PL1A 3I65A 2I9UA 2QCHA 3QW4B 3LEPA 4DBSA 3OZPA 1FWFC 1T96A 3BC9A 1OYCA 5HJYA 1OG6A 2YFOA 1POJA 2ASHA 3OTRA 4V15A 1EKOA 4W89A 1V0LA 2C14A 3QPZA 3WYZA 1AH3A 3FVDA 4PTDA 4Y7EA 1JRBA 1TR1A 4PTXA 3VIIA 1VP5A 3HG5A 3ZJ8A 3ES8A 4O52A 4F2UA 3GHRA 3PWGA 1AH4A 5AZ0A 2YCIX 1KGWA 3LXAA 2J7GA 2ACUA 3FEQA 1W3HA 3TDFA 5F4XA 5TAOA 3AYVA 3G1XA 5A69A 3GNNA 3C6CA 2WJEA 4OBSA 1E40A 1K4GA 2BGQA 4N02A 3WLTA 3B4UA 3W2MA 3FA4A 4PULA 4JN7A 2TSYA 1B1YA 2OZ8A 4XAFA 4CCCA 1NDYA 2MUCA 4M7SA 4FHAA 4F2BA 1E15A 3IJ7A 3UGRA 1SO3A 4JTGA 1PUDA 1RH9A 3DOPA 3EX6A 3W1TA 1GVSA 2V38A 3L4YA 3EZ4A 3IAQA 1VYSX 3BPWA 1XC6A 2GDQA 4QJ5B 4DO7A 2I56A 1JR1A 1XIBA 1CX9A 4RZBA 5LA0A 3W82A 4OECA 4LOCA 5H91A 3VMPA 4XO6A 5M1TA 1CCWB 5KITA 2J9ZA 3SCTA 3W74A 3IJ8A 2ZVIA 1ZBWA 3C0JA 2XTKA 4DB7A 4CD6A 1Y7VA 3T40A 2C19A 1P1XA 3MMUA 2QXWA 4UC5A 4BQ5A 5G5IA 3V7PA 3E5PA 2Q8XA 1W5OA 1ZUAX 4ALDA 3W53A 1HL2A 1UD2A 5F2MA 2Y8UA 4ZFMA 5I3GA 2VENA 5CH9A 3RMJA 1WNOA 3BJSA 3LCFA 3OOQA 3LRLA 1ELSA 1UWIA 2VELA 3W1QA 4N0RA 2YSWA 2WOQA 4NZ3A 1RBAA 3U4AA 5A2AA 3RU8X 4LAOA 3W86A 2DUAA 1FCQA 4LBUA 1VIZA 1EYWA 1TTPA 4LVDA 4ZO7A 5BRBA 1CLKA 1RK5A 3W2UA 3DIPA 5C7HA 5ABHA 1X96A 2FHFA 2DEPA 1QI3A 1LF1A 6XIMA 3CV2A 3FXYA 3P0XA 3S1WA 1W3TA 7CGTA 4ACZB 2VFEA 2IPJA 3HTWA 1TCMA 3IIVA 4H6KA 3DBPA 3MY9A 1H61A 4CN4A 1LQ2A 1OQFA 1XBVA 4EANA 4HNOA 1AD4A 2R1PA 3QZ6A 4F8XA 3TVAA 3CPGA 4JX4A 1OZMA 3WLJA 1BRLB 3L2LA 4XB3A 2J25A 4QXIA 2IW0A 1H5YA 3JUGA 1TWDA 2PZNA 3TAOA 5T91A 3P7YA 2J8TA 1VC4A 3A4AA 3UNTA 4AWUA 1DTNA 4K7YA 2NXGA 5RUBA 2W9MA 3T4WA 4S3BA 2OO0A 3N3TA 3ANYA 2VGIA 2Z29A 4IFKB 3BAKA 3DFQA 1K6WA 1G5AA 4MFDA 3QHOA 3VIOA 4GK8A 2HJPA 2V3GA 4LS1A 1JDDA 3M4HA 1YADA 1DORA 3QQWA 3TXVA 4DQWA 2DZAA 1F3EA 3WNMA 2ZKMX 3NA8A 4PMRA 2BNJA 5T9BG 4XBKA 4XX6A 2CLMA 2QCCA 3WFLA 5HJXA 1XPYA 2HBVA 3W2KA 2GYIA 1YX1A 3A23A 1VFLA 4IPPA 2E8ZA 5D09A 4HMDA 3AIQA 3U2EA 1UC4A 1QFEA 1QOPA 2WKGA 2PRMA 1HKJA 3K8LA 3PWAA 1DIEA 3IARA 4EXBA 4Q8WA 4CN6A 3T9PA 4JTDA 2IXVA 1SGJA 2PE4A 4KEZA 4JFWA 4FLRA 3HQ1A 1V0KA 1X97A 2NVAA 4D6FA 2A2IA 4GIEA 3VD4A 4HB7A 4OTKA 3W7KA 4GYPC 1TWWA 3MSRA 3S5ZA 1ZJIA 4JNMA 1EC9A 1JGMA 3LTYA 5B7ZA 2PSNA 2D20A 2NVCA 2GWGA 4ATWA 3F2DA 1EUNA 1UKQA 1B0IA 2PGWA 1W91A 4UQEA 4L56A 2E5DA 4B15A 3QGVA 3SO7A 2G3NA 3BMWA 3EB3A 1VR6A 2QDEA 2TPSA 4G9PA 1CXLA 3AXXA 2ON3A 3UG3A 5DMMA 3M0LA 5JQ9A 3SUUA 2GL5A 3DKLA 4Z2JA 1FX6A 1FWGC 1P0KA 1S2WA 1XFCA 4DN1A 4BFAA 2HZGA 3UJFA 1GOKA 1RPXA 2Z2BA 2XVLA 5HAOA 3LY0A 4LFYA 3LENA 3AHVA 2CLLA 5I23A 4O15A 2CWXA 3L2IA 3QPYA 4QJ3B 2C6QA 4URIA 1BF2A 5F7UA 1BWVA 2PWGA 3FCPA 3O16A 1NWTA 3CLWA 5I24A 2BXYA 5C9ZA 3TMLA 1XLDA 2QIWA 3NPUA 1XLLA 4H9MA 4JKMA 4BKNA 3B04A 3IIOA 1BYBA 1VZWA 4OBTA 3UWEA 1EL3A 3R10A 1RA0A 5D2TA 3TYAA 2OX4A 3SN0A 2H8XA 3DDMA 3IANA 3CHVA 1BVZA 2ANUA 1RHCA 3NJ3A 2OR2A 4E3TA 3UPWA 3KEHA 2NQJA 4JHMA 2HBXA 3AXIA 4RZ5A 1X1OA 2B7NA 3RN6A 1TJRA 4FX7A 3MMTA 3NO1A 1US3A 3DFTA 3CIXA 3GW0A 4CD4A 2Z1XA 4WF7A 3UWUA 1K7XA 5PTDA 2QDDA 3QFEA 4MNJA 3UCCA 4MUPA 3MA8A 1PHWA 5F1VA 4HOWA 3ZOAA 3H7RA 1TVLA 3M0XA 1S2AA 3BLOA 3GXMA 4ZZ9A 1V7YA 1E5JA 4LC8A 5HQMA 4Z17A 2EKGA 1KD0A 3AQUA 3FA5A 4HCDA 1B5TA 1BFNA 4DJDD 3U57A 3VNLA 4J35A 3UWQA 1CT5A 1EOMA 4JTHA 4J3VA 2ZBTA 2Q3RA 2D2OA 3BH4A 1DIKA 1YTDA 4KWSA 1EHNA 2Y61A 2FMNA 1VEPA 1PYFA 1GGOA 1C29A 4FR1A 1ONXA 3TN6A 4IM4A 3CT7A 1RP8A 1F8IA 2ZUMA 1MRAA 2AOSA 4Z2KA 1AFSA 4C6OA 2GWNA 5H8PA 1RD6A 1NH6A 4TV5A 5LA1A 1V3JA 3LN3A 2WHLA 4ZB5A 2HPIA 4HU3A 1UROA 1TPEA 3BLEA 1XFBA 4L65A 4ROQA 4GZ7A 4ERIA 3LSBA 4UIOA 5I3KA 5BYWA 4TTUA 4WSJA 4HMCA 5LXXA 3MUY1 1SJDA 2DUXA 1KFWA 3RAOA 3WQ5A 4NAEB 1ZJBA 4GY7A 3B8DA 1VLWA 2PBOA 1O1HA 5LIKX 2F9RA 4KIEA 3RNDA 3VIKA 4F79A 2PP0A 3M0HA 1BVNP 3V1HA 3IGXA 2FYMA 4L1WA 3TOYA 4KCVA 3VNDA 2F6XA 4PFHA 2ZOXA 4MKVA 3B0VC 1YXYA 5HATA 1EX5A 3HF3A 2HDJA 1W9VA 1FWWA 2XZ7A 1UASA 4YPJA 4CCEA 4Y6GA 1A5MC 2YZ5A 3WQ8A 1NP0A 1R2SA 1V4YA 1P4CA 3PFRA 3IV3A 1M7XA 5AYYA 1PXGA 5E6ZA 4BEUA 4UQAA 2FHBA 1VGAA 1PCWA 3WJZA 3NQFA 4QAIA 3MYPA 3MI3A 4YS1A 1NOUA 4ADUA 3MZ2A 4GCAA 4JKLA 1BSIA 1U1JA 1AMKA 2JFEX 1TMLA 2FZNA 3B9NA 3GDRA 5C2CA 1GK8A 3F4VA 4MNKA 3DCPA 3GIYA 5DQPA 1FH7A 4YU1A 4LUTB 5LNWA 3THCA 1ITUA 1J18A 4HCLA 3BOFA 3SIZA 1V6WA 1FDJA 2Y85A 1PZ3A 3T0TA 2GGJA 3CWHA 1OC5A 3OVGA 3W9ZA 4LRSA 3FLUA 3R6IA 3OZYA 2F2HA 2HISA 2CYGA 2G50A 5AOUA 2OT0A 1OWQA 4J1OA 1FRBA 1E70M 3UWVA 4J5NA 5BMXA 4XQ6A 4H00A 2G3IA 2VGGA 2ZRWA 3SCRA 1WO2A 3WJYA 4LH8A 2OWWA 1J2WA 2X42A 5CZTA 2DP3A 2OELA 2RDTA 4QE5A 3ARXA 5CSSA 4JKKA 1EH9A 2PB1A 1KXHA 3NPXA 1H0GA 2WBGA 2QJMA 5A8GA 2NV9A 4FALA 4LALA 1C91A 3W1MA 1QNSA 3H2EA 4B4HA 2XM2A 2E68A 1LBFA 1JL8A 1OX4A 1TRDA 4C1NB 1US0A 5JBDA 1MQRA 2ZX5A 1UW9A 3T08A 2V8ZA 4W88A 2BXVA 5A8OA 4QFUA 1AH0A 2W3ZA 2WPGA 1BQGA 4DLMA 1YPXA 2J74A 2GVEA 4UUIA 3STPA 1O6IA 2QJGA 3JVAA 1JPDX 4O0QA 4C6JA 2NX1A 2QT3A 2A85A 1OGGA 1EDTA 1UP3A 4LWWA 3U7VA 2G5WA 3KP0A 1PHQA 2VC6A 3GC2A 3SR7A 3GRIA 5CXPA 2VGFA 2DZUA 4W5UA 1ICPA 4UOJA 2E67A 3V0UA 2VTFA 2W4XA 3QV7A 5H2ZA 3AO0A 1KXTA 1W8GA 4Z42C 2ZADA 2P50A 5T9CE 4AY1A 5DMLA 1BVWA 4AU0A 1K77A 1MW3A 3ABRA 3EDKA 3G6LA 4MVAA 4NILA 2ZUSA 1W9PA 3G77A 4NAEA 2CLPA 4JY8A 1EJSC 1R3TA 3MJMA 3HG2A 1TVNA 3DC8A 2VZOA 4RZ4A 1DJHA 4UFJA 5XIAA 4A35A 4PUWA 3W7GA 1FWIC 5FL1A 5EB8A 4MG4A 5BXSA 3ZR6A 1ZU8A 2NXHA 4L4LA 3E2RA 3R5EA 1VBHA 2ZZ2A 1DEDA 2QCLA 2DIJA 3AIEA 2P0OA 4YL2A 2QCNA 1TRIA 4LBRA 1M41A 3B0XA 4O0ZA 3WMSA 4E3VA 1QHOA 2ZIDA 4I9AA 2EQDA 1QNVA 4I9TA 1W1PA 1RXOB 4L6DA 5KETA 3HGRA 3C0LA 1B57A 3LPOA 2V63A 2CBIA 3C2YA 3TV8A 1V02A 1GG1A 2PAJA 3U5UA 4GVFA 4US5A 3FA3A 4U4MA 2QCFA 1YNYA 2GQ3A 5D9OA 4QDPA 3RX3A 1IQ8A 1O68A 5BRQA 4AX6A 2YA0A 3R79A 3HPXA 1MQPA 4FR6A 2OLSA 1TO3A 4H41A 2VDHA 1NAL1 4O1AA 1A5SA 2OSWA 1PZ1A 3TCSA 4BWLA 2IQDA 4LRTA 3OO2A 4PC8A 2KAUC 5HMEA 4CUCA 1TPH1 1H7NA 4KETA 2PC4A 3AHZA 4YHEA 3WK1A 3H70A 4AD5A 4GI9A 2V3FA 2PF8A 3Q58A 1F7BA 4YTTA 5D30A 4WJ8A 3HB9A 3SRDA 1FQ0A 3QFWA 2WWCA 3DKJA 1BXCA 2QEZA 3UWZA 2HVMA 4HPNA 3UY8A 4AIOA 4UMAA 1WZLA 2GSJA 2BSLA 3EB2A 3CQ0A 4O28A 4XD4A 4IX2A 4BI5A 4WEVX 4DXXA 2VFIA 3HQNA 1NFBA 3ITOA 5C8BB 5LKYA 3PPGA 2J7DA 1KFJA 4AB4A 3O07A 5CG0A 4XVDA 2YDSA 1XUUA 4W8AA 1LBLA 4AYSA 1X38A 4GWEA 2QJJA 1WDSA 4JD4A 3IJIA 1NDZA 4KWVA 2XFYA 5FL0A 4C1NA 2FH8A 1R5YA 3RCNA 1S2CA 1N55A 4L6HA 1RD5A 2UBPC 3L67A 5I3HA 2IMRA 3B9AA 1OYBA 2ZC8A 3E2SA 3B8TA 3WF4A 3RLVA 4MY8A 1QXLA 1WX0A 2FIQA 4FOJA 4OV4A 1TPFA 3KCLA 3TMQA 4JFSA 3N14A 3K46A 4PRRA 2POZA 3C3NA 1I2NA 3S1GA 1IT8A 4XKYB 1GORA 1KTNA 2YXXA 5TD4A 3E3HA 1LG2A 3C52A 1GOMA 3L0KA 2ZQ0A 3ZWTA 4AZCA 3W1RA 1VS1A 4JR5A 4LSBA 2PUZA 2NT0A 1CYGA 6XIAA 2CLFA 1W1TA 3CIWA 4AEEA 1XW8A 4LCQA 2Z1SA 4YYCA 1HJUA 4IQLA 4Q8NA 4PUEA 1WZMA 3TTOA 5GQBA 1EBHA 3HFYA 3OEXA 4ROPA 3BJTA 1F6PA 3ZYZA 5HR7A 5E09A 3E5BA 3OBAA 3THQA 3VGFA 2WVSA 1D3HA 4UNIA 1QJWA 2ZFAA 5BXTA 2F6UA 3GG0A 1C9WA 3ECQA 3ZLGA 3EXRA 3ITYA 6TAAA 5KSWA 1CENA 1FWSA 2ISVA 2Q09A 4Q8QA 1ZB5A 2F84A 3DHFA 3NNTA 4G7EB 3ZXWA 3E9AA 3P81A 1XSIA 4WKFA 4KMQA 2PTYA 3AZSA 2PEVA 5D04C 3S2MA 3WG6A 2P0IA 1X6LA 3P84A 2VP8A 1FKXA 1E0VA 1SFSA 3F1QA 4IOTA 4BK9A 3S2JA 3AFBA 5A5WA 1M7JA 2AMGA 2CZVA 1DJXA 1FDZA 3TYEA 3WH6A 1JZ7A 2DT1A 3UJSA 1OCNA 1B9BA 1FCBA 1YBQB 4GXPA 3NURA 1H1NA 3GK0A 1G69A 4XO7A 5LZLA 1I0DA 1OYAA 2V2CA 3CUHA 4MZ1A 1R2TA 1NU5A 2OODA 1UD8A 3CHFA 1XR2A 2J9YA 2DPEA 4GVHA 3TQVA 3F4CA 3MUAA 2CLIA 3VIJA 4H8HA 1UH4A 3TC7A 1XIFA 3W1AA 3E12A 2V2HA 3KVLA 1QHZA 3H23A 5HA7A 1UR3M 3A47A 3KL0A 1Y5XA 5IBXC 4H8UA 5EYWA 2OO6A 2ZA3A 3TONA 1H60A 3MV11 3FS2A 4W86A 4GNVA 5ENLA 1P6CA 5ABTA 2QKFA 2VFGA 4JTJA 3N73A 2JEPA 2WMKA 2XVNA 3HU7A 1XCWA 3N12A 3WK3A 3WQ6A 2JF7A 4KEUA 1ESWA 4NHVA 3VNYA 1I2QA 2FGLA 1F3XA 2C13A 2QCEA 4L5ZA 9CGTA 4XZMX 3R7MA 5I09A 3SDOA 4DI8A 2BOEX 4ZODA 1OHLA 1XIEA 1KB3A 1TJ1A 3LCWA 1XYMA 4ZOBA 4E5TA 1GVIA 1QWKA 1OGSA 1IZCA 5FSEC 1YDYA 3EKLA 4P61A 2OFJA 4B5SA 2BHZA 3W24A 3F2CA 3M7SA 2W63A 3E0FA 3MANA 4EPKA 3BGGA 3EMQA 5A8MA 4F0LA 3VC5A 4K2SA 3XIMA 3MV01 1PYMA 4S3DA 1VPXA 4C91A 4IICA 3O8AA 1JD7A 3AMLA 3G1YA 4QQ3A 1S5VA 1RUSA 3MSDA 3TX9A 3DX5A 2QPXA 1KCKA 4WKAA 3GBEA 1UG6A 1UH2A 1J96A 4V28A 1YLVA 4TOQA 3DI1A 1EGZA 4AF0B 4H9ZA 3LHUA 1VEMA 1ZTVA 4Y9MA 4GA8A 4QTGA 1I2OA 2B81A 5CC5A 4OHQA 4ONVA 1OC6A 3WENA 1Q8JA 3I68A 4S23A 3TP4A 4H6EA 4LF2A 3TSMA 1CI1A 4LUIA 1G94A 4OZOA 3DXIA 3N9SA 3PB0A 2SFPA 3BLFA 4QX4A 3WQGA 2O92A 2YFNA 2VX7A 5FIPA 4HPHA 1WUFA 4RX0A 3PZIA 4G1NA 3QQ1A 4PTWA 3FHQA 1TE1A 1UR4A 4EIVA 4EP8C 3UFYA 4Y8EA 1LOSA 3QC0A 4MLJA 2BBFA 4DJFA 2VM8A 3KVMA 1SFJA 3W7HA 1P0DA 1PIGA 1JEZA 2J9XA 3MSYA 4BQ3A 3SY5A 3GHUA 2F6KA 1JYWA 2VC7A 1F8MA 3I7RA 5I79A 1VH7A 3FNDA 2BXZA 4U3CA 3TN5A 1UR2A 3PN8A 1AL7A 1DJQA 3NL3A 1J93A 3HOJA 9XIAA 4XK2A 1YBQA 1VFOA 5C9XA 4ZTYA 3CUFA 1I1WA 2XGZA 1B3OA 2HCVA 5D2WA 5I2UA 2J77A 3IUDA 2HS6A 1IEIA 4FLOA 4LF1A 1OT1A 3RJYA 3GYEA 5KZ6A 2WC4A 2GGIA 2YL9A 1KRBC 4H9UA 2E7FA 3CQJA 5CZJA 4IPLA 1W5NA 4R88A 2ZC1A 1AVAA 3SM0A 2OTDA 2E9LA 1E72M 3L0GA 1YNPA 3A22A 1RY8A 3LLXA 1AQHA 3GH7A 1M04A 2IKJA 1EBGA 2GOUA 2WVUA 1T0OA 1A5CA 2WLYA 3NQ7A 3I3BA 3TYDA 4IL2A 4UTWC 1G4TA 2CHRA 4PMOA 2WSRA 2C3ZA 4PE8A 5A6TC 1NF0A 3KS6A 4D9PA 2ZVRA 3L5LA 1JYVA 4K37A 1LYXA 3R0UA 4U2YA 4MZ8A 1O5QA 5LYRA 1XLAA 1TFVA 3BG5A 4DYJA 1Q6RA 2BHYA 3FKRA 3R43A 5J5RA 3W7RA 1T40A 3IACA 2RDXA 4R53A 1N2VA 3O6YX 4PMQA 4R9XA 1P48A 2NLYA 3ANVA 4ERAA 3UJEA 3WDRA 3NQ8A 3WDIA 3L66A 3QZAA 2V5DA 1KV5A 4JTEA 3WIJA 5HMSA 5FJRA 1XRSA 2GUBA 2V30A 3E2QA 1WA3A 2QCMA 3P14A 2FJUB 1DJWA 4DPPA 3VIHA 1KFKA 3PZMA 1M01A 1M3UA 3UGVA 3BCJA 2G4JA 1DTUA 3DERA 4RLIA 4JN6A 2H9AA 2ZXBA 3SY8A 2O9PA 4YMZA 1LWHA 1IXQA 2V81A 2Z2AA 1ISZA 4KGJA 3EGJA 3AS3A 4FZIA 1L6YA 1YYAA 1JUEA 3OVRA 1Q3NA 1PBGA 3HA1A 2HE8A 1TJPA 1FWNA 3T09A 3W02A 3STCA 3WL1A 3I6EA 5CPMA 1DJGA 3NSXA 4ZQPA 3AZTA 3SSJA 5M3WA 2TODA 4UTTA 1XXXA 1I75A 5D03A 4HCHA 2WO5A 4JTFA 1L8PA 3PF3A 1HGWA 5HNNA 4F4RA 5A8PA 1B3XA 5AN7A 3M0IA 1QI0A 1XP3A 4D1IA 1D7KA 2Y62A 1E4IA 1OBAA 3SSZA 3TZNA 1N7KA 1ONEA 3N3MA 5CCZA 4C7DA 3HG4A 5HR6A 3UG8A 2HPMA 1FKWA 3TYCA 3REQB 3B9DA 3A9BA 4WOZA 1NWUA 2GK1B 3IJ9A 1ADDA 2RDUA 3OW1A 5G2WA 4DY1A 4PA8A 4JBRA 3LK6A 3HIJA 3NR0A 2YPIA 4FO4A 3WX7A 3BZJA 3NQVA 2O9RA 1K9DA 1QNOA 1KFBA 1ZALA 3EWDA 3NVTA 1AQ0A 3KDOA 5BXRA 5I03A 4DX3A 3ERPA 2EG8A 2JKPA 3MT1A 1FWAC 1XLKA 4E4UA 1GKQA 2DSZA 3C0QA 1VYPX 2ZUVA 4PEKA 5TIMA 2BOFX 3ZT5A 1XL9A 4BEQA 4NX5A 2VURA 1P6WA 4LUSA 3STGA 1R9XA 4O19A 3W88A 4C6BA 2QW5A 1ALDA 5FI8A 3GY1A 4DXVA 3TIMA 5HNTA 1E51A 4LEQA 1JQVA 4G7FA 2XDFA 3JS3A 3AIRA 3UBPC 4MYXA 3VFCA 3NZRA 1AW1A 3M44A 5E0CA 5C0QA 1KNWA 4CEXC 4YN5A 1ZQ5A 2Z24A 1BD0A 2CZ5A 2JIEA 2ATSA 3S6OA 4PB5A 3N19B 3KW3A 4TU1A 2ZXDA 2V68A 3VK5A 1X6UA 3MC5A 4JIHA 4JFTA 3AXKA 3U48A 3WKZA 4YIWA 4Q32A 1YDOA 1SJAA 4PFMA 5A2CA 5EMUA 4WIWA 4LVBA 3EOEA 4ZXLA 5HWJA 5JUVA 1O5RA 1XJBA 4PN2A 2ZE3A 3RPDA 2YXOA 3J7HA 1R6WA 1UQYA 2CERA 3HMJG 1UOKA 5LHFA 3MUXA 3VKKA 1AD1A 5TBOA 5IFTA 4R7OA 5A6BD 1WAWA 3W71A 1XDMA 3CL8A 1QO5A 3N2OA 3W2NA 1ZS2A 1YTEA 2WXDM 3ANUA 4RCXA 3O0FA 3P80A 2GDVA 1EJXC 2F61A 5BOOA 3H8AA 3BSMA 3EX4A 4ZXOA 1DOSA 4CU7A 2QPUA 3TZFA 4UFMA 3UA4A 1PO9A 4RE3A 1O60A 1ONRA 4Z2LA 3H54A 1JFXA 1JQXA 3OLEA 4H04A 4C6KA 4N7QA 4ZQMA 1B3ZA 4ACYA 5CJNA 1CGTA 4U28A 4NZ4A 1OSEA 4H9TA 1K9EA 5DLCA 3VZYA 4AY7A 4S3KA 1ADOA 3LGGA 3F4NA 3OLDA 3DAQA 4O17A 4MADA 4OFCA 1M5WA 5DRCA 4LVFA 3WK0A 3GVVA 1HJSA 5F2LA 2H3BA 2FHCA 1XYAA 4NZ1A 4MB4A 2PDFA 4N4QA 1K6AA 3REQA 8RUCA 2FPYA 1LQ0A 2GK1A 1RLCL 4W87A 1LZOA 1EF2A 3CQHA 5CSRA 3NYZA 2ALDA 2GOKA 1S39A 4AW7A 2QIIA 2H3DA 3O15A 1XLGA 5DO8A 2XWDA 5MHBA 1FHDA 1GOWA 3QSRA 2CITA 1LLWA 2GJRA 2XJ7A 3BV4A 3GXPA 4A3HA 1V3IA 2G37A 4R3UA 1QVBA 4REQB 3UXDA 3W1NA 1OFEA 3A12A 4B4FA 1W37A 4GRSA 1DJNA 3WLQA 3H6OA 1D8WA 2E09A 4J3WA 4IMFA 1DVJA 1SZNA 4MHBA 5XIMA 4ZQOA 1X6NA 2BVYA 4QR6A 5KZDA 3W7JA 5AHNA 3IUIA 4G5DA 5IRPA 3G8EA 2WK2A 3W2JA 2VC5A 5TF0A 1HKVA 2OX1A 5E1QA 1ZAJA 3T44A 2HQAA 3GIQA 1FWHC 4O1BA 4HZ6A 4UTUA 4M7TA 3U2OA 4FAMA 4FXJA 4UFHA 4D6GA 1V3HA 2OG9A 2PDWA 3VKCA 2IQTA 3ICJA 3AMDA 3RLGA 3H4WA 4XIMA 4BZYA 4AHPA 4UTMA 1KCZA 4WY0A 1DKWA 2Y89A 3NQEA 2P3EA 3HMCA 3ABQA 4QBXA 1TKKA 3T07A 1MDLA 2NT1A 2PWUA 4C60A 4C1LA 4G1KA 3QRHA 1SW7A 5AHFA 1TPC1 1MEWA 4UXDA 3NEHA 4DVOA 1AQFA 3GU2A 4NF7A 3FYOA 1AJ0A 2AKMA 2Q01A 3U3HA 5I3JA 2WYSA 4MKSA 1SQ7A 3WH8A 5CG7A 3EWCA 1VPQA 3GKFA 1MFVA 4L9ZA 3A3WA 3UYCA 4D2JA 5M17A 2E6AA 3EPNA 3HN3A 1OJXA 3ZLHA 3QM3A 1HN1A 1CGVA 4LCRA 1EXPA 5EFDA 3ZWSA 2FZMA 1W3KA 1W32A 5D9MA 4C6LA 4XV0A 1QDSA 1SUXA 1P6BA 2VFFA 3M6DA 2OGYA 3VDBA 4DAFA 3KOYA 3UA3A 1HO4A 5AYIA 1YE6A 5CGQA 3MU7A 4IJRA 2NSXA 3S1XA 1SZRA 4Q6JA 2A3BA 3HQOA 4MJZA 3IVTA 3ZM8A 6PTDA 3CHCA 4GZIA 2ZZ3A 4P8WA 3ARVA 4O16A 1W56A 2Z0IA 2FTWA 4O11A 5CAKA 3W6MA 1Q2SA 2DSVA 4JL2A 3AXMA 1M7OA 4I7VA 3GZ3A 1SMAA 2IPGA 3LD5A 2XSXA 3B06A 1G9HA 1KQZA 4DPQA 1JYNA 3T42A 2VQUA 2FVMA 1MEIA 3UR2A 3KHDA 4AZ5A 1Z9AA 1WKDA 2GFTA 3PBYA 2G3JA 3OPSA 1E1FA 3QR0A 2QF8A 2EXOA 1WXYA 2F8QA 5I77A 1OZQA 4KWWA 3WUGA 4QE1A 1J0HA 4RR4A 1TTIA 3IWPA 1GOQA 1GHRA 2YYUA 5KMYA 3BLIA 2ZA1A 1IGWA 1V3KA 4Z2IA 3Q67A 3M6YA 3NOYA 2YL5A 3DHDA 3B8UA 1QOQA 3EWBX 4AFYA 3NO5A 1LRQA 4NY2A 2PWEA 2NQ9A 4H6QA 3UXAA 4J9JA 3SIMA 5FSDC 1F61A 2E1DA 2GVLA 4DIAA 3ZT6A 2LLEA 2UZ9A 5AC5A 1O66A 3LCLA 3F5KA 1GJPA 3DGRA 5DT7A 3N15A 2RJHA 3BDKA 1H50A 3BE7A 3Q65A 5K4ZA 4X0VA 5D05A 2VL4A 4N9CA 1J12A 2FVKA 1Q4WA 3NGJA 4DBWA 2WSQA 5BOFA 3ZQ9A 4B2DA 3LQGA 4XAZA 1DHPA 4FSAA 3N9RA 1PIFA 1B30A 2Z1KA 4MDPA 1HKWA 1OC7A 1FH8A 2H6RA 2I17A 4PUNA 5CC7A 2YR1A 3GVRA 3A4XA 2PLCA 2OVLA 3W1UA 4RNJA 2PLKA 4MWAC 3W7EA 2O9TA 4JTUA 2D3NA 2EHHA 3QHNA 2B0MA 5BZAA 1KBLA 4HNLA 4A29A 3LUTA 2EPHA 4PMJA 2ZUUA 1UJPA 3PP7A 5A6KA 2GLKA 3RJXA 1FWBC 5J04A 1TIWA 2EPLX 5EFFA 4QNWA 4JIEA 1OADA 3SQMA 4GNKB 2Y8KA 1Z32X 4JTKA 4U3AA 3CMJA 3CB8A 1Y8BA 1RR2A 4D1JA 1NM9A 2DT3A 3K2GA 2ZX7A 5KZEA 2W0UA 5HQEA 4MJ2A 3N2TA 2FGZA 4LAUA 3LQLA 1UBSA 3CAQA 4TO8A 1HQTA 5FA5A 4O1EA 4V27A 3BMVA 4F0MA 1S2VA 4GUGA 2J7HA 1VIWA 3KL3A 3RLUA 1E6QM 1BG4A 1C8XA 6REQB 5HMDA 3VUSA 4C6QA 1IE7C 3AUOA 4HN8A 1R7OA 3FFSA 3OVPA 3B8VA 2REQB 4DJEC 5IFPA 3FK4A 3BQ6A 2A7NA 4JAWA 4G6CA 3QH2A 3TE9A 1Q66A 2DY3A 4FB7A 4IGNA 3N6QA 3DGBA 5FOOA 1EJWC 1T5AA 4H1ZA 1GTHA 3CL6A 3KLLA 3KRSA 1Z8AA 2X1SA 3CYVA 4HYRA 1W5PA 4W8BA 3W83A 4ZTXA 5HUOA 1H3GA 4PR4A 3IIPA 1E0UA 1I9CB 2YCLB 4BI6A 2NV2A 3TTEA 3FKKA 3EDJA 3TR9A 3UNDA 5ABFB 1EA9C 2XWEA 3W4RA 1V7AA 1GQJA 1MWOA 2Z26A 3ZR5A 2Z00A 4DZHA 5IBXA 4I6KA 1PTDA 1JDAA 1BLIA 2OSYA 3L4UA 3EA2A 4KRZA 4DWSC 4M0XA 4YHGA 1V77A 1JF5A 3BSHA 5BU6A 3GG8A 3RU6A 1ZL1A 5XINA 1MEHA 2VD9A 4M3PA 1VKFA 1CGWA 3KHJA 3TQKA 3V5FA 4LU0A 2DSUA 1AG1O 1KXVA 4LB4A 1VF8A 3NDZA 3BLPX 3TW9A 2W5FA 5MF5A 3GAKA 4ZOEA 3U4FA 2YA1A 3KFTA 2DJLA 4IT1A 4YYFA 2PMQA 3VGHA 1EOKA 3DESA 1WBHA 4WUIA 1QTWA 4NJHA 1Q45A 4QHRA 1QPOA 4ERGA 3QR1A 1VFSA 1WUEA 4RV3A 2PU0A 4IF2A 4J2MA 4JGDA 4JCMA 1MQQA 4PRWA 3L4WA 4QJ4B 4P7OA 3S5NA 4W8LA 5TQLA 2Y7FA