5KZMA

Crystal structure of tryptophan synthase alpha-beta chain complex from francisella tularensis
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
269
structure length
260
Chain Sequence
MTNRYTTLFANLEKRNEGAFIPFVTIGDPNKALSFEIIDTLVSSGADALELGIPFSDPLADGPTIQEANIRALESGITPKDCFDILTKIRAKYPHIPIGLLLYANLVYANGIENFYQKCLDAGVDSILIADVPAHESKEFRDIAKKVGIAQIFIAPPDASESTLKQISELGSGYTYLLSRVGMPVEDVLTKLREYNAPKPVLGFGISKPEQVQQAIKAGAAGAISGSATVKIIQNNISNKQKMLNELTYFVKEMKAATLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Tryptophan synthase alpha chain
publication title Crystal structure of Tryptophan synthase alpha-beta chain complex from Francisella tularensis
rcsb
source organism Francisella tularensis subsp. tularensis
total genus 80
structure length 260
sequence length 269
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2016-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5kzmA00
3F1QA 3TROA 3UXDA 3DFQA 3P82A 5I3IA 2X16A 4DO5A 4C1LA 1SO4A 3S42A 4A2RA 4AAJA 2YYUA 4BK9A 1PVNA 3NZRA 1C9DA 3LV5A 3M0ZA 4IMEA 2JK2A 1JCMP 1TYGA 2EPHA 3B4UA 2J24A 3E9AA 1TB3A 2RDTA 4LS1A 1FCVA 2OJPA 4CNNA 4GBUA 4JGDA 4ONVA 3DKLA 4MJZA 5D37A 5BMWA 3LXAA 3WK2A 1X1OA 2X30A 2VFFA 2V8ZA 1FDZA 3WK0A 2WOQA 2ZRWA 3NPUA 1LRQA 4JTKA 1FBAA 2GVGA 1GEQA 2Y85A 2VFDA 3O8AA 1IXOA 2Y63A 3HMJG 4MKNA 3P81A 3EX3A 1I45A 4JX5A 5D03A 3NQDA 4HHPA 4A29A 1AL7A 1O4UA 3WJWA 3QW4B 1W5QA 4UTMA 5G1TA 1Z42A 2VEKA 1OFDA 3NPXA 3LERA 3S5ZA 2V30A 1PCKA 1VCGA 2D73A 2CLLA 2WV8A 3EX4A 6ALDA 2NZLA 2OZ0A 4ALDA 4JX6A 3FJ6A 2HS8A 2V2HA 1IXQA 5EA9A 1ZFJA 1RV8A 4IMGA 3F4WA 1KA9F 3OHIA 1UUOA 4RV8A 5DELA 1DQXA 2B4GA 1YTEA 2FPVA 2A7NA 1OVDA 1VGAA 4GFSA 1W5NA 2QJIA 1YXYA 2QDGA 4XWUA 3G3DA 1K7FA 4JY9A 3FYOA 3W7NA 3GNNA 3L5AA 4UFIA 3RU6A 3QYQA 4NUWA 1DVJA 3V75A 4P2VA 3UWYA 4JTJA 2Z6IA 3R89A 4Y90A 2HSAA 1H7NA 4Y6GA 3FKRA 1KFEA 4H4IA 4LU0A 1SPQA 4UTHA 3N2MA 3ABQA 4JYFA 3OG3A 5LSMA 2O7SA 2ZZ2A 1LBLA 4B5NA 1BWKA 2DZSA 3OIXA 4LTSA 4FIQA 3W86A 2ZZ7A 2ISVA 3DKJA 1IXNA 2WNQA 1U83A 4LRSA 4BWLC 4KWWA 3LX9A 4O53A 1WQ5A 2DU2A 4UMAA 5HQEA 1W37A 1RR2A 1LP6A 3RLVA 3SGZA 1L6SA 1OX4A 3NDOA 4U28A 2ZA2A 1H1ZA 4Z08A 3MHUA 4I9AA 4NXSA 3W07A 1I4NA 1W54A 4O0KA 1DJNA 1JCYA 1SZNA 2ZFAA 3IIOA 4IOTA 4MUZA 5DY3A 3ATYA 3C56A 4IX0A 4K36A 4JIQA 3LCXA 4YWIA 1WAUA 2QCCA 4QQ3A 3BPWA 4IMCA 1KTBA 2QAFA 4EF8A 1QPQA 2A1YA 3ABSA 3C6CA 1AG1O 3EEGA 3NR0A 1OG0A 4XTDA 1LOQA 3HPSA 3EX6A 1H1YA 5I3HA 4KFPA 1FWSA 3P80A 1PE1A 3L67A 3G1AA 3JS3A 4UTIA 1ZAHA 1OFBA 4UMCA 3C52A 1TCDA 2V9DA 2Y6ZA 3IVTA 1MEIA 3C4UA 3WK3A 4FHAA 4N9EA 2E6AA 1UCWA 3GYEA 1RQBA 3YPIA 3NL2A 3LCLA 1GOXA 4HT3A 4LNYA 2B7QA 1R2TA 1ALDA 2BLEA 3ZWTA 1ML1A 3KFTA 1JCXA 2ZTKA 3FKKA 3WJXA 4WJEA 4O52A 4CLMA 3DFOA 3QMSA 4Z1AA 4JTSA 5LKYA 3GDMA 1KFBA 1U5JA 2P10A 4Z1BA 3FJLA 1FCQA 4QSHA 4MPQA 5E1QA 2E6DA 3M41A 1QPRA 5EYWA 1W0MA 4JYEA 4Z0JA 2VEIA 3S9YA 3M7WA 4O28A 2GQ9A 2VEPA 3F03K 4JY8A 1LM1A 3GNDA 1EWDA 2DORA 3CPRA 1Q6LA 1TTQA 3BARA 1D3HA 1EUNA 1KTCA 4HSOA 3PUDA 1BEUA 1S5TA 3NXFA 2A0NA 4X2RA 3PB0A 4KFOA 2VELA 4O4WA 3VKJA 2QUTA 4IJBA 5T26A 4MFEA 3FEMA 2XN2A 3MBDA 4ZVJA 2DZUA 5AHLA 3LBCA 1PV8A 1WOBA 4O4VA 4ZQCA 3SI9A 4FX7A 3TNOA 2Y7DA 4MZ8A 5DCEA 3W7IA 2A21A 2FB2A 3GXPA 1DOSA 5SWUA 3TDFA 4KKXA 1SW7A 1OX6A 3S1VA 3GIYA 3G0XA 2G5WA 5G1YA 5KMYA 1UB3A 2NLIA 3FFSA 4AWUA 5C2XA 2VC6A 3S5YA 5KINA 1JJKA 2VENA 4JTGA 4OQVA 1TPVA 1EB3A 3C3NA 1EPXA 2VFHA 3NM3A 5FEXA 4E38A 4IXXA 5F1UA 4QJ1A 4BF9A 1OYBA 3LHUA 4GNJA 5LNWA 3MBFA 2B0MA 1P4CA 2CWNA 5AHIA 2TPSA 3O6CA 4JNMA 4LVFA 4EVZA 1MXSA 4RXFA 5FF0A 4K7YA 1VYPX 2PRMA 1WYIA 3S5OA 3DFSA 3NM1A 1XI3A 3UXAA 3LXBA 4PODA 1VZWA 3DZ1A 1QO5A 4QNWA 4YLWA 3M47A 5AYYA 3W1PA 1QWGA 3IVUA 3S0CA 2VFIA 1FWWA 5TBOA 3W75A 4K6AA 3NQ8A 1G4TA 3KX6A 3ATZA 3T4CA 1OX5A 2C15A 2G97A 3QZEA 3UY8A 3EX2A 4O10A 3UWVA 4UTTA 2BX7A 3PR2A 1DORA 3S1XA 3KVLA 3HG2A 3NQ6A 3H53A 5CPLA 1XC4A 2DZPA 4FNTA 5FEZA 3TQVA 3G22A 3LI0A 3H55A 3M5ZA 3S5NA 2EF9A 4QIUA 1DV7A 1ZHAA 4WUIA 3NA8A 2X2GA 1JRCA 1BKSA 5DBUA 4YCOA 3W1XA 1G4PA 3BV4A 2ATSA 3N34A 4HNUA 4RJEA 1C8VA 4OV4A 3TW6A 2WO5A 3C0JA 5AN7A 2YFNA 1TPC1 1YTDA 5HULA 1YXCA 3UPWA 1M7OA 3QPYA 3DHFA 1EEPA 4FF7A 2PCQA 4KFNA 3W1QA 1Z41A 2WKJA 3W6YA 1A5SA 2A4AA 3NQAA 4AXKA 1OK4A 5AB3A 3FYPA 4DEFA 3GDTA 5FF3A 4WY0A 1DL3A 1QOPA 3MYPA 5IBXA 1JQXA 1O95A 2DJLA 4O0ZA 3DENA 1LCOA 4LC8A 3QPZA 2VXNA 1GTEA 3M43A 3LRLA 4JX4A 1F74A 1LOSA 2X1UA 1EA0A 3GR8A 4JYDA 1OFEA 1MEWA 3HB9A 3UYCA 3R12A 2Q8LA 4FB7A 2O7QA 3T40A 4WX2A 5EMUA 1OYAA 3W73A 1TPB1 3BW4A 1K8YA 1UBSA 2B7NA 3QEZA 1G4EA 4LC6A 5G5IA 3QM3A 4CCDA 3NL6A 1R46A 4CQ8A 5F2MA 3FA5A 4MYAA 2V0TA 1N8FA 4UMBA 1TPFA 2E5CA 3IGUA 5I3GA 4M6PA 3W1MA 2EHHA 2ZYFA 1SO5A 3EXSA 3R2GA 1H7PA 2NV2A 2R14A 3N19B 2YCEA 1AMKA 1F6KA 1L6YA 1LBFA 1F5ZA 3TV8A 2V81A 1OJXA 3W1LA 2Q8ZA 1FCUA 2EGZA 5BNKA 1H7XA 2QKFA 1YDVA 4Q4KA 3LCIA 4UTWA 4HNTA 3EWBX 2WQPA 1TV5A 1ZAIA 3HG3A 2H3BA 3HIJA 2YYTA 3C2OA 3MI6A 2E1DA 1FUYA 2F84A 1RZMA 4O1DA 3QMRA 1ZCOA 3EWXA 3DAQA 3CHVA 4N02A 5D2YA 4UNKA 2OT1A 3TFXA 1XM3A 3S1UA 1GVOA 3W1AA 4FEZA 2V2CA 4QITA 5CZJA 5LHFA 2RKXA 5L6UA 4R53A 5C55A 2VOMA 3N9SA 2OMAA 3HGRA 3HOJA 3BVJA 3QC3A 3I68A 3ELFA 3PG9A 2QCNA 4WD0A 4NNAA 3UZJA 3L21A 4LUIA 2GJLA 5K4XA 2ZRXA 5LZLA 2CLKA 4H3DA 4JTLA 2CLHA 3MMTA 3OA3A 1SZGA 4BI5A 2XN0A 1VRDA 4UTLA 2ATMA 4FNRA 3CIWA 4LT9A 1VJIA 3DU0A 3B8DA 4GWEA 3MP3A 2QCDA 4WY0B 3QQ1A 4XKYA 4AEOA 2JKPA 4MVAA 3T78A 4MOZA 3NYZA 4M5PA 1S5VA 4I7VA 3QSRA 1HO1A 1W5PA 2ZRZA 2ZA1A 2YFOA 5G2HA 3W2MA 3LHVA 3Q2DA 4N9CA 1ONRA 4TIMA 1XL9A 1B9BA 3I6RA 4FO4A 4PEKA 3W2NA 1XUZA 4AHOA 1SFLA 3MWAA 4N4PA 3RMJA 3G1SA 4UFJA 1H61A 1Q6OA 1KM4A 1TPWA 1VS1A 4MJMA 3ABRA 3TSBA 3W9ZA 1ZJIA 4ADTA 1DKWA 3PSVA 5D2WA 4NU7A 4E2BA 2H90A 3B0PA 4AWTA 3PBUA 2W0UA 5D09A 4O19A 4Y9AA 5C54A 1JRBA 3LOTA 4JICA 2BXVA 4NZJA 2V5BA 1YPFA 4TR9A 1BTMA 3NPWA 3L0GA 3KVMA 3FIGA 1ICQA 3EKLA 3B04A 3OVPA 1XDLA 5AC8A 3GB6A 1TRDA 5J5RA 5DN1A 4WOZA 1SSGA 1TREA 3TA6A 1JCNA 5K9XA 1QCWA 5FEPA 1VC4A 2A6LA 4UFLA 1GG1A 3LM7A 1K7EA 2Q3RA 1M6JA 4N9BA 1I8JA 4IMDA 3P62A 2QCFA 3VE9A 3FOKA 2J88A 1L6WA 3GXNA 3G1DA 1CX9A 1HUVA 3L2IA 3E02A 1O5KA 1YXDA 3TU9A 4RKAA 3W7EA 4AF0B 4PL2A 1VCFA 5IBXC 3W7JA 3FS2A 4U4MA 3T44A 2DZVA 1DQWA 3W74A 2PRHA 4FNQA 1A5AA 5CPOA 4NT0A 2CLIA 1GVSA 4R33A 3TKFA 4LVAA 3B06A 4ZQPA 1I2NA 3W70A 4X3ZA 1NEYA 1JUBA 1L9WA 1XBXA 2FPTA 4WZHA 1TPEA 5F2LA 4XKYB 3W22A 4UFKA 1OFOA 4RK8A 5HWMA 2WSYA 4N2YA 4OT7A 4XTIA 2A2IA 4DELA 2H6RA 1H50A 5C5YA 3WJSA 3P84A 3CQ0A 1MSSA 1T8XA 2Y61A 1EIXA 1TJPA 3C2FA 1TRIA 1VLIA 4JTHA 2DZTA 3HPXA 2C14A 3PBYA 5HJLA 3SSJA 4ZL1A 3MP4A 4RX0A 5G2WA 1SW0A 5FF4A 2FQIA 4GE8A 4LOCA 1GYNA 2Y62A 3IIXA 2Y70A 4BFAA 4O15A 2PURA 3IVSA 1TQXA 2Y89A 1ME8A 2NX3A 3B03A 5G4WA 4XBSA 4AMAA 1ICPA 4JTFA 5KZDA 4QAIA 2KZHA 2E6YA 1B4EA 1R30A 2NUXA 4NX0A 5C6MA 3TAOA 1GQNA 3DXIA 3NQMA 3NG3A 3RK8A 3LLFA 3HPZA 4N4QA 3E96A 3CT7A 4NNCA 2Z2UA 4UTWC 5LNSA 1B57A 3IV3A 5CSRA 3TXZA 5H2ZA 1K8XA 3DHDA 2VKZG 3Q37A 5ABTA 4AHQA 3MO7A 3CWNA 3VFLA 2C0AA 1OFQA 2CLFA 3ZWSA 3W83A 3KRSA 1TPH1 3USBA 4OWGA 2FLIA 3QW3A 4CCEA 5K2ZA 3TJLA 5AOUA 3G8RA 3TMQA 3UZ5A 2V2DA 5AFDA 3SZ8A 3C2EA 1KV5A 5A5WA 4L4LA 4M6QA 2P1FA 3TSDA 1FXPA 3PBWA 4OE7A 1RQHA 4BR1A 3M5VA 2ZRYA 1TO3A 1GJPA 4IQLA 4LUJA 1FDJA 3GZ3A 1VPXA 3NOEA 4IMFA 1GTHA 1ZENA 3KVKA 1KBJA 2V5LA 4O57A 1KLYA 1D3GA 5AHNA 3TMLA 5G4EA 5D33A 5EKYA 2Y7EA 3RLUA 2FDSA 3N3MA 5D2TA 4I7UA 3SY5A 3LDVA 4HKPA 2C3ZA 3PC0A 4UIOA 1XFBA 3WJYA 1W3IA 3N14A 2XFWA 2ZTJA 1DHPA 4POCA 2G96A 1X6UA 4CQAA 4R7JA 3IGSA 3IIZA 3M44A 3G1HA 1KM5A 3O06A 4ICNA 2YGYA 4NX5A 1OX4B 1ZAJA 3BGGA 1TPUA 4GUJA 5GVJA 1QAPA 1HO4A 1X8FA 4ORMA 3I7QA 1LLZA 1V5XA 2VFEA 1E51A 3MHFA 3NQEA 1SO6A 4LY8A 3M6YA 1TMHA 4NXKA 3MUXA 5EPDA 2Y7GA 4O13A 3QRHA 1F6PA 4FXSA 2H8ZA 1M5WA 5AYZA 3CLMA 1QFEA 1O60A 4ZQNA 4RR4A 3KHJA 2GUUA 3PUOA 3EXRA 3SIZA 3G0SA 3W1NA 4LVBA 3W2UA 5F1VA 2ZRUA 2WPBA 1HFBA 2BSLA 4Q33A 4Z1DA 1QMLA 3I65A 3KRZA 4RCXA 3SJ3A 4GRSA 3NQVA 3EX1A 1KLZA 3C2VA 1Q6RA 4KWVA 3LB0A 1YDNA 3EWYA 3SFKA 2I9EA 3F4NA 3GVGA 4BI6A 3TJXA 2B7PA 2C19A 4R34A 2G95A 3THQA 2H8XA 4X9SA 4JTUA 2Q3OA 3I7SA 3UY7A 1KM3A 1H62A 2X1SA 3C2RA 2RFGA 3QF0A 1QR7A 3NAVA 1N55A 1GVRA 5H91A 4UTKA 1VYSX 1OF8A 1HTIA 1SSDA 4O50A 5LGXA 3P61A 2PC4A 2E5DA 5DLCA 5AYXA 3TXVA 3UPBA 3W7GA 3HQ1A 4L4MA 4IUOA 2AQWA 1FWTA 2QJHA 3LCHA 1I2QA 4DBDA 3QFEA 2PE4A 4RZ6A 2ZZ5A 5D2XA 5KTLA 3B0VC 4NJIA 3BLFA 1VQTA 3LHTA 4EIVA 4TO8A 2A7PA 3NL3A 2QCEA 2TRSA 3HGOA 5D2VA 1GVQA 4PA8A 3HGSA 4M7SA 2ALDA 4O14A 2QAPA 5BRBA 1G6CA 3GAYA 3KOFA 4ZQOA 3PY2A 2ZCGA 5D32A 4M7TA 4S2BA 2FB3A 5A8GA 3IIPA 3EKZA 1WXJA 3W7HA 2YXGA 3GLCA 3PF3A 4DQWA 1P0KA 4NJHA 3JRKA 5K4ZA 1A53A 5CGQA 1TPDA 1GWJA 1W56A 1K3UA 2C18A 5LNVA 4QM1A 4I7WA 5LGZA 3NQ2A 1FDYA 4PC8A 4K8HA 3TUUA 2IQTA 1DBTA 1X1ZA 4GJ1A 2E5BA 3LRMA 3MI2A 2J9XA 3LTPA 3Q58A 1PIIA 2EKCA 3MHGA 3G0UA 5CZ0A 4AWSA 4TX9A 5BW6A 2QCLA 4HSNA 1Y0EA 3QJAA 3VNDA 5EY5A 2QF7A 3W3OA 1TJRA 3U8GA 2VFGA 5DCBA 1JULA 4DO4A 3W7RA 4YXGA 3NNTA 4LVDA 5HWNA 4O1AA 1QO2A 1FXQA 1SO3A 2NUYA 1KM2A 4Q32A 4MY1A 4IPIA 4AH7A 3HF3A 4BI7A 4GUIA 3LV6A 3TK7A 1EWEA 3HO8A 3E12A 1PL9A 3A23A 1YPIA 4DBEA 3K30A 2J6XA 1F7BA 3WK1A 3BO9A 2DP3A 4CNPA 2QEZA 1G7UA 4JN6A 2WNNA 1I2OA 3A22A 1PHQA 1VLWA 2GPTA 5FEWA 3W7OA 3TFCA 3IGXA 4DPPA 1H7RA 5G2IA 4BWLA 1DJQA 3INPA 2QUUA 1W5MA 3BG5A 1F05A 5BMXA 3O1NA 4RLIA 3W7CA 1WBHA 2JKAA 3ZS4A 3D0CA 4ADSA 1Z44A 1NF7A 1HL2A 3N9RA 3P5YA 2NXIA 3P5ZA 4IXHA 3CU2A 1FX6A 3O16A 5K9DA 1XBVA 1FQ0A 1EP3A 4PCFA 1I2RA 2R91A 1OHLA 3PVFA 3CM4A 2JGYA 4WQ6A 4NJKA 5F4SA 3RF9A 2V82A 3DGRA 1PCWA 3G1YA 4JIPA 5DXXA 1LORA 1ME9A 2GVLA 2CU0A 4A2SA 3MW7A 4LWWA 4LS0A 1B3OA 4O12A 4CQ9A 3M16A 2C6QA 4DPQA 3GAKA 2H3DA 4O11A 3CEPA 4D2JA 5KITA 3VE7A 5CSSA 4MLJA 1XDMA 3M1ZA 1SU5A 1XUUA 1J5TA 4TMCA 1P1XA 1UASA 3PM6A 1RVGA 2ABAA 1EUAA 4K39A 5AC6A 3B05A 3NL5A 3CWOX 4NNBA 2GJNA 1GG0A 5AC7A 4UUIA 4E0CA 1FWRA 2A5HA 1SR9A 1H51A 1S5WA 1OYCA 3GR7A 1SZEA 1EP1A 1SUXA 3TX9A 4RZ4A 1G69A 3B0UX 3T7VA 3LXCA 3S1WA 2ZA3A 2JBMA 1JVNA 4O17A 3ANYA 3R13A 3O05A 4O54A 3PBVA 3C8FA 3NQGA 5J5DA 2E68A 2RDUA 3LI1A 5F2GA 3BGJA 1JUKA 1SFJA 1KM6A 1YADA 4OGZA 1H7WA 3HJZA 1IIGA 3W7MA 4A22A 3H54A 3LRKA 5KZEA 1KM0A 4FX8A 2CFFA 4LS2A 3NQCA 3VI2A 2ZZ6A 3E49A 2FFCA 1LROA 3PWAA 3A5FA 3TH6A 3O07A 3OEXA 4O1CA 4FNUA 1LLWA 1NF0A 5EBUA 5DCDA 4N6EA 1OFPA 2I1OA 2DZXA 3KAOA 4MLRA 2FIQA 2ISSA 4HPXA 2PRLA 3IIVA 5L9FA 4S2CA 3LLDA 3EB2A 3DBPA 3W76A 4UTTC 3STFA 1MEHA 1VHNA 1UJPA 3U6WA 1F76A 5DBTA 5E0KA 1IXPA 4GUFA 5F2IA 4ZQRA 2EAWA 2J9ZA 3W7DA 5FESA 2FTPA 3M5XA 3BLIA 4DF2A 3W7QA 2E77A 1EX5A 2CLMA 2ZQ0A 1G7VA 4NQ1A 2W6RA 3FLUA 2FPYA 1KTNA 2LLEA 1IF2A 1T99A 5FF7A 4Y96A 1FWNA 1R2SA 4MIMA 1H5YA 3MJYA 3T55A 4HPJA 2ZBTA 3TC7A 1XCFA 5D38A 2Z1BA 3CC1A 4JEQA 4FIRA 3STEA 5I3KA 1LOLA 1VH7A 4A3UA 2NUWA 5KZMA 1QPOA 2QCHA 4YMZA 2NXGA 3QQ0A 3C61A 3GDRA 3WJZA 4NJGA 4UTUA 2YSWA 4JXCA 2NXHA 3NO5A 3NVTA 1W31A 3HG5A 4DXVA 4J9JA 2J27A 2TMDA 4ML9A 5HNRA 5BOOA 1K8ZA 2TYSA 3THAA 4GUGA 1XKYA 4JS3A 2GVJA 2QCDB 3GXTA 2GQAA 1YLVA 1OFRA 4XQ6A 4M19A 1WBJA 1V7YA 1I2PA 3N73A 3NPVA 5TIMA 5AHFA 4UFHA 3TIMA 5CG7A 3O6YX 1KW1A 1LYXA 3BG3A 1TV8A 1CI1A 4JD4A 1NSJA 1LDCA 4QNEA 4PH6A 4UC5A 1NVMA 2JKEA 1A50A 3CTLA 4IGHA 4ZZ9A 2NWSA 3AO0A 4WXYA 3PB2A 1TQJA 3UD6A 2AAMA 2UV8G 2NV1A 3MYOA 4IWWA 3RNDA 5I3JA 3SR7A 2C13A 1QNVA 5F4WA 1KFJA 1QOQA 3KVJA 3O6DA 2C1HA 3NQ7A 3WFAA 1G4SA 2ZZ1A 1RQEA 2A7RA 2CZFA 4OU1A 3A24A 3W1RA 4JTTA 3U2OA 1OF6A 5FI8A 2NX9A 3G24A 3G1VA 4TMBA 1L2UA 2YZRA 3OVRA 3EWWA 1GPWA 1B4KA 4PL1A 1RPXA 1KFLA 3LHZA 1Q6QA 2CLEA 4FNSA 3L66A 1H63A 3S6DA 1T0OA 3ABOA 3TR2A 2RHGA 3G3MA 3W23A 4XZ9A 3P8JA 1LRNA 1SZFA 3W88A 2Z6JA 4RZ5A 4GXMA 3BLEA 5TQLA 3PUEA 4LVGA 5F4XA 1GZGA 1GVFA 1WA3A 4PFMA 2TSYA 1LBMA 4UR7A 3JR2A 3LCWA 4K38A 1FY6A 5LNRA 2GQ8A 3TE9A 2NWRA 1WOAA 8TIMA 1AW2A 1M7PA 1PS9A 3G1FA 5HR7A 4WY0F 4NJJA 2J9YA 5K9CA 2YR1A 1IGSA 4XUGA 2E09A 1O5XA 4HIBA 4WXZA 4XBKA 5D05A 3GX9A 1G67A 3LCFA 4RXGA 2CLOA 3QSTA 2R94A 3L9CA 4MZ1A 1TV7A 3PS7A 1JQVA 1VR6A 3A21A 3TCEA 1WX0A 2QDHA 5CPMA 3GKFA 1JR1A 2CZDA 4YCPA 3G18A 1TTJA 2YPIA 5DY2A 4UTJA 1O94A 2P0OA 4AHPA 1KBIA 3OVQA 1KM1A 4UCGA 4EWND 4MY8A 5AHMA 3TW7A 4ZQMA 2DZWA 3BW3A 3ZFHA 3A9IA 3UWZA 3QMTA 1JCLA 5D04C 1ZNNA 4ADUA 1Z48A 4O8RA 4QISA 1EP2A 5D30A 5U7SA 2BZNA 4EOUA 2YW4A 3STGA 4JR5A 3TQKA 1WDWA 4WOQA 1W8SA 5HUPA 5I3FA 1TTIA 2ZZ4A 1BWLA 5HINA 4MZYA 1VHCA 3HBLA 3M9YA 2NX1A 2WJZA 3BK0A 1ME7A 3TSMA 3MP5A 5KSWA 3CEUA 4Z1CA 4NVTA 3GDKA 2Z0IA 3BW2A 4S1FA 4DF1A 5HMSA 5LHEA 3BG9A 1NAL1 3W87A 5U4NA 2QR6A 1K03A 1C29A 2B7OA 2X1TA 4O1BA 3PSWA 3A5VA 3UWQA 1YTKA 3HG4A 4O16A 3W72A 3UWUA 4DF0A 3DI0A 4LRTA 3UQNA 5HR6A 2HTMA 1X7FA 1QPNA 4LV4A 4K37A 1NFBA 1W5OA 1YDOA 1KFCA 4X22A 2WSRA 3UNDA 3W7PA 2Y7FA 1VCVA 5HWJA 4N6FA 3HGJA 3KXQA 3STCA 4CNOA 4AVFA 1W3NA 4DO6A 2OCZA 1R47A 4JDYA 4FXRA 4ORIA 1F73A 1A5CA 1A5BA 4AB4A 4A21A 1WV2A 1OABA 2HMCA 2QUVA 4HN4A 5IM51 1LZOA 1J2WA 3L68A 3L5LA 1SQ7A 5CZTA 2QCMA 3IEBA 1SW3A 3QH2A 4UFMA 1W1ZA 4E2DA 3O63A 1THFD 2W79A 4M6VA 1ICSA 2YW3A 1ADOA 2I14A 4JTIA 4IX2A 1VYRA 3IRDA 1AW5A 4C1KA 1IIHA 3P60A 1JCJA 3P74A 5CPNA 3LTSA 3CB8A 1H60A 1TIMA 1R2RA 2C16A 4UXDA 1JUEA 3W2LA 4ZMGA 1FCBA 2DJXA 1KV8A 1KFKA 2AGKA 1OK6A 1LRTA 5LNUA 4JTEA 2ABBA 3LCGA 4OHQA 5CKSA 1TSIA 2GOUA 2A85A 4FNPA 1D9EA 3TC6A 2A6NA 4N9DA 3DFNA 2FJKA 1AW1A 2WSQA 1N7KA 1MZHA 4JDBA 4HNVA 1LTDA 4LV9A 3NGJA 1ZY9A 3TAKA 1YYAA 4H6KA 2ISWA 2X1RA 3OBKA 2QJGA 1ZALA 2JGQA 3N2XA 3R5EA 2CZEA 3E0IA 3EWZA 3SW6A 4MYXA 4P61A 3G1XA 6TIMA 2YDAA 3DFTA 4YL2A 3KRUA 2XN1A 3DFPA 3P67A 1GYLA 3ZR4A 1AL8A 4MY9A 2RH9A 3W84A 1T96A 2ZDRA 3W7LA 1H7OA 4HNNA 4O18A 4K8EA 3W1UA 1AK5A 1MO0A 5FF2A 2CZ5A 1S3HA 3DH7A 4FX6M 3EWUA 3O15A 7TIMA 1XBYA 4UNLA 3L0NA 5MHBA 4G1KA 3LHWA 1K7XA 3NQFA 4UR8A 3GKAA 5D02A 3AJXA 3CIXA 3PG8A 3P8IA 1Q45A 3W2KA 2ZZ3A 3VCRA 1K02A 3SGUA 5K3VA 1J4EA 3NEVA 3S8HA 3LBMA 2BWGA 3PULA 5E93A 1XXXA 3W7KA 4LW7A 3LGEA 3M5YA 1UUMA 2YX0A 3L5MA 3NZ1A 2RDWA 5DXYA 2R8WA 4K7VA 5EL1A 4GUHA 4EF9A 2HS6A 1GT8A 3P7YA 2OT0A 1CW2A 4OV9A 5K7JA 3DI1A 2Y88A 1XBZA 4OBTA 4Z0SA 3LHYA 2E6FA 3L65A 3TQ0A 3W2JA 2BTMA 4PTNA 3GK0A 1P5BA 3UWWA 1OFAA 2CW6A 4NZFA 5HUOA 3V1PA 3G8EA 3R8RA 2F7FA 4MFDA 3GDLA 1TTPA 3PAJA 1Q3NA 2ZRVA 1RD5A 3W85A 3Q94A 3LTYA 3I7RA 2QCGA 4GC4A 4W9TA 3W71A 3EXTA 3SECA 1QDSA 1PHWA 1HG3A 5CZSA 5AHEA 4AF0A 2WNZA 1P0NA 1F2JA 1W3TA 2VEMA 4CCCA 4Y8FA 3RFAA 3L0KA 3W1TA 3MI3A 4IPJA 2OX1A 4TU1A
chains in the Genus database with same CATH superfamily
3DFQA 1WCGA 4MB4A 5AC4A 3L7RA 4DO5A 1S46A 3S42A 1FH9A 4RW5A 1VBHA 3M0ZA 3ABZA 3GG1A 5A6KA 2PZNA 2DT3A 4GO8A 4H8VA 1FCVA 1EDGA 3MUY1 1W3KA 2GGJA 4D8LA 2AGTA 5FJIA 3DKLA 4MJZA 4LAMA 2X30A 4P7OA 3GC4A 4FLQA 1XINA 3UG4A 1W9BM 3NPUA 3PANA 3TOPA 2VFDA 1MWOA 4HHHA 3ZLGA 4OFCA 1I45A 5D03A 1NDWA 3NQDA 4JOMA 4QS6A 2WYSA 4HHPA 4A29A 4TTGA 4JTAA 3PK7A 1AL7A 2YL5A 1SJAA 3WJWA 1W1YA 3NPXA 2ALRA 4IJRA 5BOEA 4LAKA 2P53A 4UB9A 3IJIA 1PCKA 5IHSA 1UBPC 3CPGA 4C7DA 2A3BA 3UR2A 3W28A 3O2LA 3LG3A 1UPPA 5JQ9A 1V8EA 4JX6A 1LL6A 5C9RA 1IXQA 1RV8A 3EMCA 3OHIA 5DELA 1DQXA 1H4PA 4U3CA 4AXNA 1ELSA 2Z1XA 1OVDA 1VGAA 4WHBA 1FFRA 1ISXA 1V93A 2YBVA 3GDBA 1B2YA 1I0BA 3THCA 3HJEA 4OOUA 2VI0A 1CCWB 4DNMA 2WKLA 3AXHA 3VMNA 3CO4A 1J11A 7REQA 2XIJA 3BZJA 4UFIA 4ZCWA 1OIFA 4JTJA 3N9KA 1Q7QA 4TV6A 5FOOA 4FR1A 1HJUA 4Q3MA 2Y8KA 3VZXA 1KFEA 2RAGA 3NEHA 5LSMA 1A47A 2VEFA 2DZSA 3WD0A 1EH9A 1NP0A 3F4CA 1JAEA 2WNQA 4F9JA 4KWWA 3LX9A 4GISA 4O53A 4QSFA 1E15A 1W37A 2WKGA 1RR2A 3SGZA 1L6SA 4BKNA 3K4AA 1QOXA 4S3GA 4U28A 4XO6A 4QCEA 4BQ2A 1Z9AA 3W07A 5JBFA 1W54A 4GZ7A 3CHDA 4IOTA 5DY3A 1PX8A 4IX0A 4JIQA 3LCXA 3VX0A 3ZLFA 4JHOA 4KEVA 2QCCA 4A8LA 3NUKA 2PDBA 4P7NA 4NYYA 3ABSA 2ZE0A 3EEGA 2PWEA 1LOQA 3UCDA 3EX6A 2YKKA 2DT1A 4KFPA 4IPLA 3L67A 3G1AA 4GQGA 4UTIA 3N17A 1J12A 3S9IA 1IZCA 3C52A 1VFUA 2IKIA 3IVTA 1MEIA 1B31A 2FHBA 4N9EA 2E6AA 2YJQA 3E6EA 3WELA 3YPIA 3AOFA 2FMNA 2IPGA 1BYCA 1EOKA 4J3TA 3ZWTA 1JCXA 5BXPA 1BVZA 2JIWA 4O52A 4CLMA 5EMYA 3VDHA 4JTSA 1G0CA 3O0FA 1KFBA 2J7DA 2NLYA 4DZ5A 4MPQA 5E1QA 2E6DA 1JF5A 4B5UA 3TYBA 4GY1A 4JYEA 3NVDA 2GQ9A 2DVUA 1PIGA 1TVLA 5C2GA 1KTCA 2J77A 4NIRA 2FZBA 1NQ6A 3L4VA 1XPYA 2BNJA 1ITXA 1PTGA 2VELA 2QUTA 1RY0A 4Q7BA 4MFEA 4UQBA 1ZBWA 3FEMA 4CD5A 1GVEA 5AHLA 1EQCA 4ZQCA 1LWHA 3N12A 2BOEX 4G2DA 3SURA 5CC7A 1GONA 5C8BB 2DY3A 2A21A 1GQKA 5PTDA 4P7QA 1FOBA 1DOSA 2POZA 2V3DA 4PTDA 2Z7KA 2A3EA 1OX6A 3FV9A 4WDXA 5G1YA 5KMYA 5FJUA 4JIEA 3MPGA 2NLIA 1ZCCA 2VC6A 2VENA 3ZSTA 1T8QA 4CD4A 5FEXA 4P8VA 6A3HA 3EDDA 3VOHA 4CN6A 4JNMA 4CN4A 1W9VA 4J27A 4PRWA 1MXSA 4OJYA 4CU7A 4RW3A 2E67A 4G9PA 3SCPA 4HNCA 4K7YA 4CVUA 2PRMA 4O0QA 2Z28A 2ON3A 1WYIA 3S5OA 4MKSA 3B40A 1V6XA 3A64A 4HOWA 4YLWA 4QRNA 4WRHA 1HJXA 1J0IA 4PBGA 2OEMA 1G4TA 3KX6A 5HQLA 3T4CA 2C15A 3UY8A 3EX2A 3WZ0E 4DZAA 1PZ2A 4C7GA 1DORA 2X42A 3AS0A 3H53A 4W88A 1XC4A 3AS2A 2DZPA 4FNTA 3S5NA 1BF2A 4QIUA 3NA8A 3FDKA 2V3GA 1JRCA 2XTKA 3VD4A 1J79A 3CPUA 4RJEA 3UCCA 3TW6A 1I75A 3VIGA 2UZ9A 1YXCA 1M7OA 4EK7A 3TQPA 2PF0A 4JKLA 4KFNA 3QV8A 3KDNA 2XDFA 4L6OA 1A5SA 1BPLB 4PRTA 2NQHA 3VNZA 3GWQA 3NQAA 1RK6A 3GNOA 3FYPA 3PZMA 1DL3A 1QOPA 2HRWA 3MYPA 1JQXA 4LC8A 1JGIA 1GTEA 3WO8A 1XYMA 4JX4A 1J18A 3RO6A 1VFHA 3KCLA 3HB9A 3FAWA 3ZVHA 2DT0A 3TW9A 1X7IA 3GNRA 1XIMA 3W73A 3BW4A 1FKWA 1RPKA 4UZSA 4LC6A 3CMGA 3OGRA 4CCDA 1MZRA 4ACZB 5F2MA 3BJFA 3SCSA 4MYAA 4UMBA 3E2VA 2EHHA 4QDPA 3PN8A 3EXSA 2GDQA 2YCEA 2OGYA 1KGUA 1AMKA 1Z8AA 1XD0A 3W1LA 2Q8ZA 1FCUA 2EGZA 2J47A 1FA2A 1O6IA 3LCIA 1Y8BA 3NXLA 2H3BA 1OZQA 2OQLA 2YYTA 2QHAA 2GUYA 3QHMA 3C2OA 1MYRA 4V2XA 2ACQA 2QS8A 1TA3A 3SUSA 3CHVA 1OC7A 1KC7A 1XM3A 3S1UA 4D6IA 3SGGA 1VP5A 2V2CA 5LHFA 2BGNE 5C55A 2OMAA 1ISVA 1K9FA 3QC3A 3I68A 4GBDA 3ELFA 1KRCC 5C9UA 3L21A 3EYPA 6REQA 4HJWA 3MMTA 2AMGA 2XN0A 1ITUA 1GEHA 3JU2A 3CZJA 4AFYA 3CIWA 2WWCA 3MP3A 2YLLA 4GC3A 2DVTA 3T78A 4TVCA 4MOZA 4M5PA 4I7VA 4CNUA 1UQYA 2XH4A 4PUKA 2WCGA 3P93A 5G2HA 3Q2DA 4N9CA 5GJMA 2CBJA 4TIMA 4PEKA 4NZ1A 4Q7IA 4P5UA 1YNQA 4I9TA 5BCAA 3ZJ8A 3ZSSA 1F61A 1KM4A 3K8MA 2X1IA 3OPSA 4C91A 3W9ZA 3CQKA 4TXEA 3THDA 4ADTA 1P6WA 5HMFA 3R10A 4E2BA 1TVPA 4HZ7A 4GHRA 1A5KC 4PUMA 3MA8A 4GNVA 1QW7A 5CSYA 3DFHA 1NFGA 2G37A 5C54A 3PJWA 3GFXA 4R9OA 2NV9A 2V5BA 2ESCA 4XX6A 4TR9A 3L0GA 3VNJA 4H6EA 2GFTA 3PZTA 1PJ9A 3CAWA 1TRDA 3ME3A 4J40A 5A8NA 1XWYA 1JCNA 4J28A 4G5DA 5K9XA 7A3HA 3VVGA 2A6LA 4UFLA 6XIAA 3LM7A 4L1WA 4N9BA 3P62A 4PMNA 2VGBA 3IV8A 1YNYA 1JAKA 1GQLA 3BUVA 2GWGA 3WF4A 2VZTA 3E02A 3PBMA 1YXDA 3W7EA 4PL2A 3RX2A 5IBXC 1E70M 5ECUA 1ISWA 3T44A 4L1XA 2DZVA 4MHBA 1XIGA 4PUNA 1GVSA 4WSHA 1BG4A 4H01A 1M7JA 2MANA 1GOMA 4PMOA 1BVWA 5I09A 4Z2IA 3SQMA 1WDSA 1ZJAA 2H6RA 3WJSA 1TJPA 3W6MA 3TZFA 3ITXA 4S38A 1QNPA 3N04A 1A5NC 2XU2A 4ZL1A 3MP4A 4RX0A 3II1A 3L12A 1H09A 1BQCA 2OWCA 1B3ZA 3AUOA 3QR0A 3DFYA 3B03A 5G4WA 1CGWA 4XBSA 2CKRA 3GG8A 3GH5A 1SR0A 2E6YA 4NX0A 5C6MA 5IFTA 5D9MA 3NQMA 3RK8A 3LLFA 4IPNB 1Q6EA 1P0BA 3CT7A 3MMDA 4IH3A 4NNCA 4XVEA 2Z2UA 3UJRA 3I6TA 3E0WA 2W61A 3ANVA 3TXZA 4GYFA 5H2ZA 3N6HA 2VKZG 4HHLA 2WHLA 2AAAA 3TNBA 2FFIA 2RGMA 2C0AA 5CGTA 3VOGA 3QY7A 3M0KA 5G4HC 2XGBA 2YL6A 3C2EA 4PMUA 5LIWX 2J79A 4M6QA 4PZVA 3TSDA 1TMQA 3SN4A 4AEEA 3QN3A 5CEWA 1U5HA 4IQLA 3NOEA 2WJDA 2IXVA 4KRZA 2IQDA 4DZHA 5AHNA 1D3GA 3AWNA 5G4EA 5D33A 3WUFA 2Y7EA 4PRRA 3W6LA 1CENA 4LCRA 4IPPA 3ZVIA 2DIKA 1EGZA 4EX4A 3SY5A 2NVAA 4HKPA 2Y5SA 1TWIA 3PC0A 3QFWA 4J2PA 1LL4A 1J6OA 3N14A 2ZTJA 2A79A 4NAFA 4ZENA 4A35A 4R7JA 1FHUA 5HQMA 3IGSA 4NRRA 1UR8A 2TAAA 1EL3A 1YX1A 1ZLPA 3IIZA 3M44A 1KM5A 3V36A 3H2EA 4ICNA 1ZAJA 3CMFA 4XVDA 1DTUA 4KCUA 3TYUA 3HU7A 4MMWA 1DWFM 1E51A 4NZCA 3M6YA 1XIEA 4GKLA 1DJYA 2Y7GA 1UIPA 1BG9A 1F6PA 4FXSA 1QFEA 4GZJA 1TE1A 4JFTA 3SEPA 2ZX5A 3L4YA 3VGEA 4J2MA 4LVBA 3W2UA 4PGLA 3AHVA 3I65A 3SJ3A 4GRSA 2XFRA 3M0YA 3EX1A 4KWVA 3RM8A 5FIPA 4WKHA 2I9EA 3F4NA 4QLKA 4BI6A 3TJXA 1LG1A 4KW2A 4JL1A 2DUXA 1GK8A 2G95A 3LBOA 1ONXA 4JTUA 3QLDA 3UY7A 1ITQA 4EE9A 4AZIA 3FSUA 3WL1A 3TYDA 1L8NA 2GQ3A 4H41A 1E0TA 5FAJA 9XIAA 3PHAA 3BAJA 3IRSA 4CEUC 1UWQA 1RJPA 1E4LA 4MF4A 1SSDA 1XIJA 4ZXLA 3VFCA 5LGXA 3AXMA 5AYXA 4IGSA 1GORA 4IUOA 1FWTA 3OZPA 5A8MA 5CBIA 3QFEA 2AL2B 4C6QA 3T6CA 1RP8A 3B0VC 1ODZA 1VQTA 4KESA 5E0FA 4TO8A 5A8QA 2A7PA 3HGOA 1GVQA 2VC7A 2V63A 2BHYA 3M4HA 1G6CA 3VC6A 3WQWA 2ZCGA 4S2BA 1XIIA 2PDMA 3EKZA 3CUJA 2W67A 1XC6A 2YXGA 3PF3A 2PU1A 2BGSA 3DDMA 1P0KA 1VJSA 3ARZA 1A53A 3E2SA 3IJ8A 4B5TA 1R3WA 4I7WA 1UWUA 3NQ2A 1WNOA 1CGYA 3TUUA 1ZTVA 2VVSA 1V77A 2JEPA 3ZR6A 2EKCA 5AYBA 4GI8A 3G0UA 3UR8A 2BASA 4AWSA 3FW6A 2QCLA 2QF7A 2XHYA 4WVXA 1HGYA 4FPSA 4YXGA 4LF2A 4LVDA 1QO2A 2I17A 1JG9A 1KM2A 2GGGA 2X0YA 4G6CA 4BS0A 4HK7A 4XV0A 4LF1A 4MY1A 5BWAA 1DYSA 5I03A 3KBWA 3E12A 3A23A 4DBEA 3BO9A 2DP3A 4JN6A 1I2OA 3A22A 1PHQA 4I90A 4BEQA 3LY0A 3IGXA 4IL2A 4DPPA 1H7RA 4ATWA 1KWKA 3BG5A 1F05A 4WGHA 3O1NA 4IIGA 3BXWA 1UWAA 4ADSA 3GNXA 3P5YA 2NXIA 3RHGA 1AQFA 3WLPA 1E5NA 5DQPA 5M03A 1VFOA 4MUPA 2PBGA 1CBGA 3TCSA 3CL8A 2JGYA 4JQ4A 2V82A 4MNKA 3LA4A 3TN5A 1EGVA 1LORA 2VD8A 3SY1A 4KRUA 2V38A 4LWWA 1N2VA 2OSXA 4CQ9A 3HN3A 3U5UA 4W4QA 4DPQA 3PPCA 3GBEA 2PP3A 3AICA 2XH7A 2H3DA 2PDNA 4INFA 4O11A 2QVNA 4JIIX 3E3HA 2IPJA 3M1ZA 1SU5A 3E0LA 3WQVA 1J5TA 4ZTXA 2PTYA 4UTFA 4I8DA 1UASA 1PZ1A 4AW7A 5IRPA 4DLMA 5A6AA 5REQA 3CV6A 1J2BA 5AC6A 3BC9A 3NL5A 5AC7A 2D0GA 1EZ2A 1UP2A 4GI6A 1F6YA 1H51A 1S5WA 1VBRA 1OYCA 1EP1A 2PDXA 2FZ9A 4OKDA 4MAVA 3LXCA 3UNTA 3VK5A 3QC0A 1F9CA 3S1WA 2JBMA 4D6GA 1XH2A 1JVNA 4O17A 3ANYA 4O54A 4FSAA 2PGFA 1V51A 3UJ2A 3W38A 3NQGA 4WDUA 1X6LA 3APGA 5F2GA 1SFJA 4OGZA 3HJZA 4MNJA 1IIGA 3V35A 1T6MA 3H54A 3LRKA 1RHCA 1KCXA 4A22A 5KZEA 4KBXA 4FX8A 2FGZA 4C65A 1KCZA 3E49A 5T9CE 2IKJA 1LROA 4W89A 5CLWA 3A5FA 3O07A 3OEXA 3O7UA 4O1CA 1EC9A 4E4FA 1XICA 5EBUA 1PDYA 3PJTA 1NOFA 2I1OA 2XM2A 5FA5A 5LXEA 1OM0A 2FIQA 2ISSA 4YHEA 3IIVA 3SCOA 5L9FA 3LLDA 1BYAA 2XSAA 3DBPA 5LA0A 2XH0A 1MEHA 1F76A 1IXPA 4Q22A 1KRMA 1PTAA 1F8MA 3OLEA 2WZEA 3M46A 4D6DA 5RUBA 3VKAA 1V3IA 3HQNA 3OU8A 1DP0A 2P3ZA 1W17A 2J7BA 3W7QA 1NDVA 1EX5A 1EXPA 2CLMA 1G7VA 1M65A 4R5EA 4LXFA 1UMYA 1IF2A 4U3AA 1S3TC 3IK4A 5AZ0A 3JZEA 2I5GA 3POHA 1EBGA 3WLSA 4S3BA 1L0PA 3CGTA 1A3WA 4FIRA 1I0DA 4D6EA 4DO7A 5A8OA 5KZMA 3DGBA 3DYOA 1UD5A 2Z24A 1QT1A 5CZKA 2YB1A 1WP6A 3GDRA 4NJGA 4UTUA 2YSWA 2XVPA 4G8TA 3UG8A 4DUOA 3GVVA 3HG5A 4DUWA 2J27A 2TMDA 4OOZA 4G7EA 5HNRA 4CVWA 3GTFA 5BOOA 2TYSA 4GUGA 5DRCA 3VA8A 1NWTA 1IEIA 3GXTA 1GHRA 2GQAA 1RALA 1OFRA 4XQ6A 1X8CA 2BMBA 4M19A 1W3LA 2DDXA 4H9VA 5TIMA 3V0TA 1Z69A 2O92A 4U5KA 1JZ6A 3O6YX 1LYXA 4S3CA 3POCA 3OOQA 2VZUA 3H70A 4W8BA 2ZUTA 3CIVA 2R24A 4NI3A 5HPCA 4F2BA 2JKEA 4LGXA 3WDIA 3AO0A 4HK5A 1W6TA 1IQ8A 3UG5A 3M6DA 1DEDA 2VP8A 1CB2A 3GIPA 1FHVA 3AISA 2P0IA 2QUMA 1G4SA 3N4EA 1E40A 1RA5A 3W1RA 3U2OA 1OF6A 2BG5A 3OQ8A 3G24A 3G1VA 4TMBA 1SFSA 4X2PA 4AD2A 3EWWA 2P88A 2Q6ZA 4PL1A 3CBWA 2CLEA 3GXDA 1H63A 4LBRA 1TVNA 1T0OA 3G3MA 3E5PA 3W23A 3P8JA 2TODA 1LRNA 3DHUA 3W88A 2OO0A 3V4BA 1JYWA 1HNYA 3C0LA 1GVFA 3V0UA 4PFMA 2PCEA 1A0DA 1FY6A 2C7FA 3WH7A 4GLEA 5BU6A 3G1FA 1KGXA 4NJJA 1NELA 2X7VA 4RDYA 4XBKA 2A3HA 1C8YA 4US6A 3LMZA 4AX7A 1RXOB 4B5XA 4PCTA 1IV8A 1UR9A 2BVYA 5CPSA 4G7EB 1HF6A 3GKFA 3WSUA 3G18A 2J25A 1TTJA 4ZGYA 4UTJA 4MTVA 1R38A 3VNLA 4JPGA 1DJIA 4H9MA 3TW7A 3BW3A 1KQYA 4LB4A 3UWZA 2D2GA 3QMTA 1JCLA 4LH8A 4NZ4A 2R1MA 3MWCA 4IG2B 1EP2A 1K1DA 5U7SA 3GFZA 3QHOA 4WOQA 4ATLA 3N6QA 3PNUA 1V3JA 5E0CA 1EJVC 3LSCA 4MG4A 4MB3A 2IQ0A 2NX1A 2VJXA 1ME7A 4FA3A 3GR4A 3SUWA 3N15A 2FVLA 4LANA 4DF1A 4XAYA 4W7UA 1QHPA 2OTDA 3W87A 1TWZA 2QR6A 3GTIA 4O1BA 1US3A 2W91A 3UWQA 3ZJ6A 1CGTA 1DWAM 4O16A 2VGFA 3W72A 5HR6A 1QPNA 4K37A 3GHUA 4X22A 9XIMA 4DM1A 1Y5WA 3RLHA 3STCA 4AVFA 1W3NA 3H21A 4JDYA 1Q13A 4C6NA 4JQ2A 1F73A 4AB4A 1WV2A 1OABA 1POKA 4HN4A 3A3WA 3K4WA 3L68A 3T1GA 2IKGA 5A8PA 1JDFA 4E2DA 5I0DA 1JDCA 2HBXA 4JNYA 1ADOA 1XR2A 3CV7A 1NH6A 4GIYA 3CL7A 4IX2A 2IMRA 3FN9A 1IIHA 1CLXA 3TWAA 1X38A 3KRBA 3LTSA 4Q8OA 4ACYA 2G8ZA 1KFKA 4M82A 3QV7A 1TSIA 1MNSA 2PP0A 1TZ9A 3PPFA 1FH8A 1Q6GA 4AWEA 1N7KA 2DT2A 3URBA 1SGJA 1RLCL 3DN5A 1OGGA 1VPYA 1LG2A 2FH6A 4DXKA 1ZJHA 3R5EA 1YNPA 3E0IA 4QP0A 4MDPA 1FTXA 1GYMA 2YDAA 3DFTA 1BAGA 1GYLA 1KR0A 4MY9A 1QK0A 1Q8JA 4JQ3A 2QVHA 2Z1WA 3H2OA 2HROA 2ZIDA 4B92A 3MSYA 4K8EA 3LEPA 1AK5A 2R9RA 3LGGA 5FF2A 3DH7A 4HA3A 2AQOA 3EWUA 1ESWA 3H4GA 1S2AA 3N13A 4F66A 3Q65A 1PWMA 3NQFA 3GKAA 3CIXA 2H9AB 2ZZ3A 4D8AA 5IOBA 3AYVA 1IWPA 3NEVA 2CERA 1XXXA 4LW7A 3MY9A 5C7HA 3LGEA 3M5YA 1Q6FA 1YKWA 2Y8UA 2YX0A 4HMNA 5JMUA 2RDWA 2R8WA 5EL1A 4K68A 2VQTA 3UJSA 3AMLA 3WDQA 1XH0A 1XW8A 4DWSB 4OV9A 4Q8PA 3UXLA 4L64A 2X05A 2JALA 3A3HA 2XG9A 4GIEA 2CESA 4JFUA 3H8AA 4HPHA 3L65A 1O5RA 4PTNA 4E5TA 3WLTA 2VWSA 1OFAA 4AIEA 3EA1A 3G8EA 2VGIA 1Q3NA 1E56A 2D0HA 2QCGA 1QDSA 2CETA 3LMYA 1QJWA 5CZSA 5AHEA 2DSUA 3L4TA 5DX7A 3V16A 2A3LA 2D3NA 3KOXA 3NFUA 2X0HA 4IPJA 3QKZA 4TU1A 2R1KA 4PUWA 3UXDA 1IHIA 2X16A 4C1LA 4BK9A 1PVNA 3WMLA 3B4UA 4DJDA 2UY5A 1E72M 1GUVA 1KXVA 2RDTA 4LS1A 3K8KA 2OKOA 4JGDA 5BMWA 1X1OA 2VFFA 3BQ5A 2E28A 3WK0A 4C5YA 2OLSA 2VMFA 1LRQA 4JTKA 1FBAA 1GEQA 2Y85A 4GQRA 3HMJG 2E4TA 5FJPA 3P81A 2P8BA 5GJNA 2OZ8A 3KL0A 2PC8A 1Z6KA 5ABEA 3ECQA 3VGGA 1O4UA 3KWSA 3QW4B 1W5QA 1WXYA 2VEKA 3OGVA 3EOSA 2V30A 3TWBA 3WLNA 1E9YB 5DANA 4QG8A 3WNMA 4IISA 3EX4A 4CNTA 3PZOA 3ENLA 3DERA 1FRBA 4ALDA 3FJ6A 5A6LA 2V2HA 5H8MA 4JKMA 3F4WA 4MNMA 4RV8A 1DXEA 4DM2A 2B4GA 3VO0A 3H2FA 1RA0A 2FPVA 1XD1A 1R9XA 2QDGA 4ZOAA 3DOPA 2G3IA 2OGJA 4PMJA 2XIIA 3G3DA 1BXCA 1J01A 4JY9A 4CGTA 1EPVA 2X0SA 4V27A 3FYOA 4TV5A 4M6UA 3W7NA 3WBAA 1IT7A 3HV9A 3L5AA 3RU6A 1DVJA 4LX4A 1Q6DA 2I16A 3UWYA 2Z6IA 3S2JA 2QPUA 4Y6GA 5C71A 3FKRA 4H4IA 1X96A 3SIMA 5EGRA 3VDCA 2O7SA 1XLJA 4XG1A 2ZZ2A 4YJ5A 4B5NA 1BWKA 4P7LA 1R3RA 1IWAA 1DIDA 2E40A 4QG6A 1BRLB 1LUCB 4LRSA 5C70A 2PWDA 3UG3A 3L23A 2J8FA 1W9PA 1LP6A 1H1ZA 2G0WA 2Y24A 4GXWA 1E0XA 3VIFA 4NXSA 1I4NA 2P8CA 2ZX7A 5M5DA 3VIOA 1ZU8A 4GX8A 1IGWA 2YXXA 1HXJA 5H6HA 2ZFAA 3IIOA 1PUDA 3ATYA 3C56A 4HMEA 3K1GA 4YWIA 5FJOA 4E6MA 1WAUA 3AZRA 1HVXA 1SJBA 4Z2KA 3PZ9A 4QQ3A 1BXBA 3W26A 3IJ9A 1KTBA 4EF8A 3WIJA 4HPNA 4PMRA 1AG1O 3WLQA 3VABA 3NR0A 5A6BA 3ZYZA 1OG0A 4XTDA 3VDGA 3NSMA 5CJ5A 3UR5A 3HPSA 1H1YA 4WKAA 1PE1A 4AEFA 1WO2A 2D69A 1V79A 3BLPX 2Y6ZA 2V9DA 3RX3A 1UKOA 4URIA 1EJRC 3A4AA 1IWBA 1J0JA 4KWSA 1UCWA 3GYEA 8RUCA 3LCLA 3VIHA 1GOXA 5AYIA 4LNYA 2B7QA 2HPIA 3R4IA 3E1F1 3KFTA 4ERGA 4H9ZA 5HATA 3PFMA 3FNDA 3FKKA 4B3ZA 4Z1AA 3M0IA 4S3AA 1XIDA 3G2GA 3GDMA 3WBYA 3VNKA 4Z1BA 5KZ6A 1FCQA 3QVQA 3HZ3A 1E6NA 4Z0JA 1UUQA 3EB4A 3PWIA 1O1ZA 4O28A 3QXBA 3DIPA 3W24A 4JY8A 3GNDA 4DYJA 2DORA 3KZSA 3VCCA 1Q6LA 3BARA 4EP8C 2YCJA 1TG7A 4HSOA 4LBUA 3PTQA 3H2AA 1O1HA 2A0NA 4KFOA 4O4WA 4IJBA 5T26A 3MBDA 2PTXA 2DZUA 4J3WA 2PPGA 4O4VA 1O66A 4IQDA 1IEVA 1OQFA 2XFYA 3TNOA 5DCEA 4WLCA 2QW5A 2FB2A 3GXPA 5CJNA 3GVRA 1XLEA 3S1VA 2G5WA 3K4DA 1OZMA 1UB3A 3DHPA 2VR4A 1JJKA 2C79A 1LQ0A 4QS5A 3C3NA 2NT0A 1EPXA 2ZXDA 4E38A 4PYSA 2CWXA 3S9ZA 4QJ1A 5DMMA 3LHUA 4GNJA 3MBFA 3EPMA 2TPSA 5CLTA 1XRFA 3O6CA 4EACA 5BXRA 4JL2A 4EVZA 1DHKA 3OHMB 5FF0A 1VYPX 3IJDA 2DUZA 3WH6A 3NM1A 1XI3A 4PODA 1PO9A 4AIOA 4DAIA 1QUMA 3S47A 4NILA 4AMCA 1GQJA 3BAIA 3CUGA 1UQZA 1EEXA 1ZUAX 3M47A 3IWPA 1KCKA 2RDXA 2VFIA 5TBOA 1RCOB 3SADA 3I4EA 1MUMA 4K6AA 1EF2A 4QE5A 4U2YA 3UWVA 1F3XA 3T0TA 3PR2A 4GMEA 1CXIA 5CPLA 5HA7A 3IUHA 3ARXA 5FEZA 3T4WA 3UWEA 1D7KA 1DV7A 4WUIA 1LT7A 4O1EA 2X2GA 4QJ5B 4LUYA 2IKHA 4YCOA 2HK1A 3BV4A 3N34A 1C8VA 1JZ8A 5A6JA 2OOFA 2WO5A 4NSBA 4B3KA 3REQB 4GX9A 3QPYA 4PMYA 4FOKA 3AYSA 2V3EA 2YZ5A 5BU9A 3B9AA 4FF7A 5CAHA 3LQLA 3W1QA 1Z41A 1GQIA 3IAQA 4ZEPA 3QOKA 4Z1YA 1W8GA 1KR1A 4AXKA 4XD4A 5AB3A 5JU6A 3TEVA 2GOKA 5FF3A 2FTWA 4A8IA 2DJLA 4S3FA 3DENA 5TNVA 4QFUA 2VXNA 1AD1A 3GC5A 2AOSA 4XSLA 4EAMA 3FXGA 1F74A 2W62A 1LOSA 1J0HA 3CASA 1H41A 4IMAA 2Q8LA 4DN1A 2ACSA 4FALA 2O7QA 2JF7A 1S1RA 3FXYA 4HYRA 4FF5A 4A05A 3G5EA 3WNOA 3KCOA 1TPB1 1K8YA 2B7NA 3GE7A 3QEZA 5G5IA 1OT1A 1R46A 1JFHA 3CHEA 1JYNA 3D47A 3FVDA 2E5CA 1D3CA 4M6PA 1SO5A 1XCXA 3MVTA 5JUVA 2NV2A 2R14A 3N19B 1ZQ5A 1MDLA 3HTWA 4QROA 1RBLA 4C1NB 5BRQA 3N18A 2V81A 3S5SA 1XIBA 1YDVA 3AQUA 4Q4KA 1RY8A 4RPQA 4UTWA 1UR4A 3P3BA 3EWBX 1TV5A 4K8GA 1ZAIA 1J8VA 3WF1A 5DO8A 3MI6A 4DJEA 4AC1X 4KT2A 1RZMA 4O1DA 4DYEA 3QMRA 3EWXA 1G1YA 3GU1A 3WN6A 2PEVA 1V02A 4UNKA 2OT1A 1GVOA 4FEZA 5L6UA 1HJSA 3V5FA 3N9SA 1EYEA 3HGRA 1QI4A 3BVJA 3SCWA 3WD2A 3WQOA 3VMPA 4CQBA 3PG9A 3MZNA 5E09A 4NNAA 3UZJA 5K4XA 5LZLA 2BGQA 4JTLA 1PX4A 1CXEA 3I3DA 2CLHA 3OA3A 1NJJA 4BI5A 2C1IA 1ITCA 2VNCA 3L4ZA 4UNIA 3BAXA 4AZGA 5HPOA 4LT9A 2GJRA 4S3KA 3B8DA 3OO2A 2PI6A 2XZ9A 2JKPA 3BV7A 1T5AA 4MVAA 3M0MA 3NYZA 4DJFA 2BODX 3GH4A 4CN1A 3GTHA 3AIBA 1HO1A 1W5PA 4HYWA 1ONRA 1B9BA 1Q5MA 3I6RA 4FO4A 1GOKA 2GJXB 2OG9A 1TWWA 4N4PA 1WDRA 1TFVA 1XH1A 3G1SA 4DRSA 1H61A 4I6KA 3APTA 2CCRA 1BSLA 1XLIA 1AFSA 1VS1A 1J96A 2PBOA 2EPMX 1ZJIA 2NT1A 1XJBA 1UD2A 4DAFA 1ADSA 2E8ZA 3B0PA 4LUSB 3E0FA 2XVKA 1Q63A 3AIWA 3STPA 3KP0A 3FVMA 4DB7A 3B9OA 1IEQA 1JRBA 1N8IA 4PEEA 1WE5A 2PTZA 4JICA 4J5NA 1FH7A 3KVMA 2GUBA 1ICQA 1V6YA 2PUZA 2NQZA 3EKLA 1AMYA 3TR9A 5AC8A 3SAZA 5DN1A 1S38A 4WOZA 1SSGA 1TREA 3TA6A 1US0A 3PTKA 1VB9A 1VC4A 1K8CA 4U10A 1K7EA 4CNSA 4M3PA 5C2CA 2QCFA 2EJAA 3FOKA 1TJ2A 3UXIA 3AIRA 1JI2A 1L6WA 3GXNA 3G1DA 3UGVA 1HJWA 1HUVA 3D3FA 4V1YA 1O5KA 3TU9A 3QGKC 1PIFA 1W2VA 4C7FA 1FHLA 3AMDA 4S3JA 1VCFA 1XGZA 4W8LA 3GBDA 1YE6A 4U4MA 4A8RA 4R33A 3TKFA 4IFRA 3E5BA 2J7GA 4PUDA 4ZQPA 1I2NA 1L9WA 2FPTA 4WZHA 1KGWA 4JFSA 3I6EA 1EJ7L 4RK8A 5HWMA 4N2YA 3M64A 2YA0A 3NYDA 1MSSA 1T8XA 2Y61A 3CQ0A 3EOUA 3C2FA 4RNHA 1TRIA 4JTHA 2DZTA 2HDJA 4IJCA 3WF0A 2IW0A 2C14A 4M29A 4UOZA 1XS2A 5G2WA 1SW0A 5FF4A 2FQIA 2Y70A 4BFAA 2HK0A 4IFKA 3IVSA 4OTKA 3URAA 1U5VA 4LJ3A 1ME8A 3LZ3A 3CAQA 1ICPA 1LL7A 5KZDA 2NUXA 1B4EA 1R30A 1ENUA 2V67A 3NG3A 2ZXAA 4Z2HA 4L7ZA 5CSRA 3EEZA 1YMYA 1DJHA 4MWAA 2WCAA 3Q37A 1Y65A 5CH9A 3VFLA 1G01A 3VOFA 3W83A 1TPH1 3W25A 3USBA 2FLIA 3S2MA 3KUMA 3T08A 1BWVA 3M0JA 3TJLA 5AOUA 3TMQA 1X6NA 3TN6A 1S2VA 4HHMA 2ZRYA 1TO3A 4QLJA 4KS0A 2REQA 4TUFA 3WD3A 3N2OA 3KVKA 3MTWA 1KLYA 3ZO9A 4ECLA 4LNCA 4JTCA 1KO0A 4DJDC 4XB3A 2C3ZA 1UWSA 1GOOA 3MUIA 4UIOA 1XFBA 3RGTA 2O4MA 2FHFA 2XFWA 4POCA 4AIUA 2G96A 3R1ZA 3KLLA 4AG0A 1PKMA 1JD9A 1SMDA 3SRHA 1OX4B 3BGGA 3UR7A 3CUHA 1HO4A 1X8FA 4PCSA 5EMLA 2CHRA 3MHFA 1K70A 4LY8A 3MUXA 1OC5A 5EPDA 4XZBA 4LUTB 2HVNA 4PMQA 5AYZA 4ZQNA 4RR4A 4IM4A 3N2TA 2BSLA 4Q33A 3T9PA 4Z1DA 4MNLA 4CCZA 1KLZA 1Q6RA 3LB0A 3S2NA 3EWYA 4A3QA 3FYYA 4QLLA 1OCNA 3K46A 2DH3A 2B7PA 3CZEA 2ZADA 3ARVA 1MW3A 1ZBVA 2HXUA 3AMGA 1I1XA 2IPFA 2Q3OA 4Z17A 5CC5A 3C2RA 1MW1A 2B81A 5HNUA 4UOJA 4HSHA 3OVGA 1EJWC 3BSGA 2EG6A 4O1FA 2CIPA 4BEUA 1GVRA 1OF8A 2ZX6A 2E5DA 4GQQA 2HVMA 1BKHA 1RJQA 3HQ1A 2O56A 5E70A 2WZIA 3NCOA 3WX7A 2P3EA 2WNWA 4FOUA 1V7AA 2OODA 5FCZA 2PWGA 1U1HA 3CYVA 3GXIA 3CUXA 1UW9A 4RZ6A 5D2XA 3RG6A 5KTLA 4HQVA 4PTXA 1CB7B 1W3JA 3QZAA 3LHTA 5CXPA 3R94A 5KETA 2YL9A 4GY7A 2ALDA 2QAPA 3ARSA 3GAYA 4F40A 5D32A 1FHDA 4NJHA 3JRKA 4PSRA 2OX4A 5K4ZA 4NAEA 3HPAA 3CNYA 2R1PA 3UJEA 4OUIA 1EJTC 2C18A 1K3UA 4E8CA 4QM1A 5LGZA 4H83A 1REQB 4GJ1A 3LRMA 3MI2A 1XF0A 3LTPA 3VM5A 1MDRA 2PDYA 1TWDA 3QY8A 2R6OA 2VFGA 1FP9A 3LENA 4PFHA 3W7RA 4UCFA 5A2BA 3DX5A 4MWAD 4O1AA 3PP7A 1FXQA 2NUYA 1UKQA 2CXEA 4OBRA 5T8GA 3TZNA 4UQ9A 4PUUA 3G1RA 3HF3A 3LV6A 1Q4NX 2X2YA 3ARQA 1YPIA 2J6XA 3NJ3A 4REQB 3WK1A 2EPNA 4RDZA 3AHTA 3VMOA 1KXHA 1UG6A 1TWSA 2WNNA 4RPPA 1VLWA 2GPTA 5MF5A 3W7OA 1AQHA 3TFCA 5G2IA 4BWLA 3BAKA 2QUUA 1C92A 3MB9A 1W5MA 3WF2A 3H4XA 3W7CA 2JKAA 3ALFA 3ZS4A 3D0CA 5T91A 1Z44A 2J7FA 1GHSA 1AODA 1UA7A 2W92A 1JNEA 3P5ZA 3DESA 4IXHA 5M2FX 2D24A 3CU2A 1FX6A 1RAKA 5K9DA 2PU0A 3KL5A 3LN3A 2R91A 2F6UA 3CM4A 4IL0A 1RUSA 2BY3A 2WWDA 3RF9A 3D46A 3G1YA 1ME9A 3W0KA 4LYKA 4M0XA 4A2SA 4LAUA 4O12A 1B3OA 3M16A 2C6QA 1ZP4A 3N2CA 3E38A 3VD5A 2FJUB 1XDMA 1WZMA 1J0KA 3WQCA 1FKXA 1P1XA 3RO8A 2G4JA 4HU0A 3H12A 5AY7A 1R3YA 4PMXA 3GRIA 3B05A 1NWSA 2G41A 1ZSXA 3CWOX 1CPUA 1GG0A 2VRJA 4L5ZA 5CBBA 3GR7A 1M3UA 2QMKA 3RCMA 2O9RA 3FHAA 1K77A 4R85A 1E0VA 1NY1A 1A4LA 3IS4A 3VPLA 1AA1B 1YBQB 3C8FA 2VUNA 2HPMA 6XIMA 3N29A 4AY7A 2WJFA 3BGJA 1QPKA 4YHGA 3RILA 4DBUA 2VR5A 2ZZ6A 5KEZA 5CPTA 5ABGA 1RJRA 3ALGA 4N6EA 2V5DA 2ZWZA 3A4WA 2XFFA 3T2OA 2QIWA 3DECA 2QXWA 3MT1A 2ASHA 4HPXA 4S2CA 4KQNA 2J75A 1UC5A 3HQPA 3EB2A 1TE6A 2Q71A 3TTOA 3U6WA 4DI9A 4GUFA 5F2IA 2BB0A 2W66A 4ZQRA 1M04A 1UR1A 1HN1A 2J9ZA 4XD6A 3R8HA 1DE6A 3BLIA 1XHGA 4LALA 2E77A 3T09A 2WMHA 2ZQ0A 4NQ1A 4J3VA 2W6RA 3WLMA 1KTNA 2LLEA 1W9UA 3T55A 4Q7NA 4IP4A 2RJGA 1MQPA 7PTDA 2RGLA 3RCYA 2Z1BA 1ODUA 5I3KA 1VH7A 1FWHC 1EGMA 3B9EA 1NP2A 2J74A 1ZPTA 2BVTA 5DT7A 3QQ0A 1T40A 3KBMA 3NO5A 1XLLA 3UESA 2J13A 5XIAA 3LPFA 1XKJA 3THAA 1XKYA 4JS3A 1Q4WA 2GVJA 2QCDB 4W87A 1YLVA 1AD4A 1WZLA 1VBUA 1WBJA 2BHUA 3QR1A 3N73A 3NPVA 1E4NA 4J3UA 8XIAA 4LCQA 4GVHA 1W2PA 2EBNA 4JD4A 1NSJA 4IGMA 4QNEA 4PH6A 4UC5A 1A50A 4ZZ9A 3AYRA 5AECA 2UV8G 3MYOA 2GL5A 2OQYA 3T42A 5D8ZA 3SR7A 5A69A 2C13A 1QNVA 3B0XA 1KFJA 1QOQA 1XGEA 3VIIA 3NQ7A 1NDYA 4PMDA 3V0SA 3AIVA 3WFAA 2PP1A 1RQEA 2A7RA 4OU1A 2DSZA 2PLJA 3AXKA 1D8CA 3A3XA 5FI8A 3VYLA 1XLDA 1ONWA 3WLJA 3FA3A 4H8HA 1WUEA 2XJ7A 1KFLA 2WQDA 3LHZA 4KH2A 4ES4A 3UW6A 1GW1A 2FTYA 4JN7A 3NDZA 4GXMA 1XISA 5TQLA 3PUEA 5F4XA 5EMJA 1GZGA 1WA3A 1NWRA 1OADA 2CBUA 7ODCA 2HCVA 1ISZA 1BTCA 3TE9A 2NWRA 2VT0A 3GHTA 3WQEA 4WY0F 1IZKA 5K9CA 5G1MA 1IGSA 4XUGA 2E09A 2R1NA 1E55A 3GX9A 1F3WA 4RXGA 3F5LA 3A21A 3AIEA 1K6AA 2CZDA 4YCPA 2XSXA 3IUDA 5E6YA 4XK2A 1C93A 1OT2A 3DCPA 4NG3A 4WIWA 4KEUA 3WQFA 4MY8A 5AHMA 2DZWA 4Q4QA 4H8NA 1RSCA 1X39A 3A9IA 2WBKA 4HJFA 1QW9A 1Z48A 4B9ZA 5D30A 5MKGB 4EOUA 5AKQA 3SQLA 2YW4A 3STGA 1JGMA 3EDFA 3AI0A 3IAPA 1W8SA 4ZFMA 1C7SA 2IUZA 3TC3A 3VKDA 2PDKA 5HINA 3RPDA 2J62A 3RM9A 3HBLA 2PDGA 2QV5A 3M9YA 3E74A 5A94A 1AH4A 3TJIA 2WMJA 4GH1A 1KKOA 3GDKA 4ATDA 2Z0IA 1VFLA 1KWGA 4J3ZA 1K03A 1C29A 2YB4A 3NZQA 4OBSA 4WSJA 2FH8A 3B8IA 2INEA 5CPQA 4XAPA 4H9UA 5A2CA 4Q4SA 1NFBA 3UXKA 4AZ5A 4ACZA 2Y7FA 2EPOA 1GKQA 4S23A 1VCVA 3VNMA 3G6MA 3GU9A 3KXQA 4CNOA 2WZHA 3PBGA 2V6AA 1L8PA 4C6PA 3P14A 4XIMA 5ABHA 3B9DA 4A21A 1E3XA 2V69A 2HMCA 2QUVA 1V3KA 4XZLX 2YCLB 4WR3A 4MJ2A 1J2WA 3WDJA 3WDPP 3WF3A 5CZTA 1XG4A 3O6AA 4UFMA 3D5HA 4RE4A 4M6VA 2I14A 4JTIA 3RIKA 2HVOA 3IRDA 4C1KA 1E3ZA 3KBNA 3P60A 4UZUA 1XV8A 3AWOA 3OW1A 3P74A 1TIMA 4UXDA 1R2RA 2FGBA 1JUEA 1E71M 2BXYA 4AZCB 4LBSA 1KV8A 2RJHA 4WEVX 2WVVB 1FWEC 1LRTA 1UA3A 2ABBA 4HVXA 3S83A 2GOUA 2A85A 1LQ2A 4HU3A 2A6NA 4A3RA 3ZLHA 2EPLX 2QJJA 3DFNA 1TIWA 2FJKA 2WSQA 4HNVA 3NGJA 3K2GA 4MWAC 1ISYA 1YYAA 3GQYA 2VCCA 2QJGA 1YHTA 3NZPA 2Z7GA 3RX4A 3N2XA 2NW0A 1JIBA 4KGLA 3CMJA 4P61A 4PUJA 6TIMA 4YL2A 1TV2A 3DFPA 3TP4A 2PDQA 4Q6XA 5ABFB 3CXOA 4AD1A 3W84A 2XPKA 2ZDRA 3RCNA 3GUWA 1E6PA 3W1UA 4DXXA 1S3HA 2I7GA 4G1KA 4UR8A 2QUNA 4PR4A 3VCRA 3B3DA 3EWDA 2FGLA 1NOUA 3PFRA 1QW8A 3W7KA 4NP7A 3PUGA 1UUMA 4HOZA 4IP5A 2OYLA 3WBWA 1J9YA 2DGAA 2OSYA 4Z2LA 1Z89A 4C6KA 2R82A 1MRQA 4K7VA 2VDHA 5JH1A 1CW2A 2VZSA 4AIBA 1IT0A 3W37A 1XBZA 4OBTA 3LHYA 3R43A 2EXOA 1W1IE 3PJUA 1OINA 5D4YA 1P5BA 1R5YA 4NZFA 5IDZA 3V1PA 2VO5A 3RJYA 4ZB5A 3GDLA 2PDJA 1TTPA 4B16A 4KPLA 4BCEA 3Q94A 4ZO9A 1B3WA 3W71A 3K1DA 4C5ZA 2CNCA 4ZOEA 3MMWA 1M53A 4Y9MA 1AQ0A 2PD5A 2WNZA 4KERA 3WUEA 4Y8FA 3RFAA 5I06A 3L0KA 3CH0A 2E0PA 5EMMA 4BZYA 3LNPA 4D6FA 3UBPC 3F1QA 3TROA 4J35A 4I5UA 3FA4A 3UZZA 2FZ8A 1Q65A 1SO4A 4AAJA 4A2RA 3IANA 3NZRA 3LV5A 1TX2A 2GSEA 4GACA 1JCMP 1HT6A 1TYGA 3QYSA 2J24A 1JZ7A 1NQKA 3E9AA 1TB3A 1L6FA 4H2CA 2GGIA 4ONVA 3UA4A 1CTNA 1GPFA 3LXAA 1HP5A 4PULA 2PFHA 2V8ZA 4Q4OA 2GVGA 4E8DA 3O8AA 1UKTA 2Y63A 1F8IA 2IS7A 4MKNA 1AH0A 3EX3A 4HA0A 3WBXA 2QLYA 4JTRA 3VKBA 4UTMA 3PZVA 3LERA 3KW3A 1RLDA 3S5ZA 1VCGA 5I07A 3V7PA 2CHNA 1V03A 1S2WA 1D2KA 6ALDA 4HA4A 4L4OA 4RDWA 1QVBA 4JQ1A 2NZLA 2WMGA 1RH9A 1P7TB 3UJFA 2R1LA 4GA8A 2CYGA 4IMGA 4L80A 4LY4A 3V3WA 1KRBC 1BF6A 3E0VA 2WPGA 3SCRA 2A7NA 1RVKA 4H8UA 1W5NA 2QJIA 1YXYA 4GKTA 4XWUA 1KBLA 1W91A 4GI9A 3NQBA 2C8NA 3QYQA 4LAZA 4NUWA 3V75A 4C6DA 3WY1A 1VEOA 3HPFA 2HSAA 3EGJA 4B91A 5GNYA 2QV4A 4IGNA 3DG7A 5GNZA 4GXPA 1SPQA 7CGTA 3ABQA 1HVQA 2V3FA 3OTRA 3MDWA 1LBLA 3OIXA 4LTSA 3W27A 2Z1SA 2EKGA 2VEGA 3W86A 2ISVA 1Q6CA 3WKZA 1HKVA 1WUFA 1IXNA 1U83A 2Z2BA 4BWLC 1J0ZA 3N2BA 1JZ5A 3OZYA 4OZOA 5HQEA 3VDAA 2GK1B 8XIMA 3RLVA 3MJMA 4W93A 5A3HA 3NDOA 4IICA 3ITYA 3MHUA 4I9AA 1XYCA 4B5WA 2FMOA 3OYXA 1JCYA 4PB3A 1R3VA 3BJSA 1SZNA 1EFZA 3K5XA 3LLXA 4MUZA 1S2CA 1M03A 1V02E 2P76A 4K36A 2OWXA 4OECA 2Y5EA 2QAFA 3MUAA 2A1YA 3SCVA 3C6CA 3VGFA 4IIFA 2OU4A 3VZZA 3PPGA 3WK3A 3KWXA 1R86A 1W1A1 1M7XA 5BXSA 2ZXQA 5CQ1A 2DQXA 1NOWA 2BBFA 3KCJA 3NL2A 4PCNA 5CJMA 3CUIA 4HT3A 4GZEA 2BOGX 2JIEA 2BLEA 1QBBA 4HPGA 2EG8A 1I60A 1BYBA 1V3HA 4S3EA 3DFOA 3QMSA 5CC3A 5LKYA 2AL2A 2ZVRA 4L9XA 1U5JA 3TA9A 2YCKX 3FJLA 2O4QA 5AC5A 4QSHA 1UD3A 3RM4A 1QPRA 1W0MA 2WC4A 3NIYA 1E1CB 3QY6A 2VEPA 1A3HA 3A12A 5B7ZA 3WD1A 4H19A 3BLKA 1EWDA 1UP0A 1D3HA 4HA1A 1A4MA 4KIRA 1BEUA 3LZ5A 3WLOA 1S5TA 2HNEA 2D2HA 3NXFA 1V0NA 4XSMA 3PB0A 4QBXA 2XN2A 3LBCA 3EMZA 1PV8A 3N3TA 4FX7A 1UH3A 3CUZA 4M56A 2Y7DA 3GVWA 1GJUA 1LF1A 3RPMA 3WEMA 4L9YA 4Y8EA 5E6ZA 1MW0A 3UVIA 5SWUA 3TDFA 4KKXA 3GIYA 3G0XA 1QNQA 2QDEA 3S5YA 3BL3A 1E0WA 4JTGA 2ISDA 2I5QA 3AS1A 5F1UA 3BJTA 4BF9A 1IEWA 2DZBA 4FAMA 3GC2A 2B0MA 1P4CA 2CWNA 5AHIA 4LVFA 3EB3A 3DG3A 2BVDA 4RXFA 4FR6A 3SQSA 1CT5A 1P43A 4RL3A 1R7AA 1TZZA 3OIHA 2AKMA 4JIHA 3T0DA 3LXBA 3XIMA 4L61A 1VZWA 3DZ1A 4GYKA 4QNWA 2XIOA 5AYYA 4W7WA 3W29A 1E43A 1R3TA 1I1WA 3IVUA 2VWTA 3S0CA 4GJJA 3W75A 2ZUVA 2GVYA 3ATZA 3W02A 1OX5A 4TVDA 2F9RA 4O10A 3VUPA 4UTTA 2IXUA 3KVLA 3NQ6A 4CEXC 3TQVA 1HZYA 2VYOA 1F3EA 2EF9A 1QI5A 2QULA 2F2HA 3T05A 2PD9A 1MVYA 4H7CA 2ZUUA 5DBUA 3SUVA 3RDKA 3NURA 2DEPA 2ICSA 3AZSA 2ATSA 4ZSTA 4HNUA 4GH3A 4MWAE 4D1JA 3C0JA 4ZB0A 4CQDA 1TPC1 4AQLA 3UPWA 2ZDSA 3DBNA 1EEPA 2PCQA 4NY2A 4HB7A 1FWCC 2WKJA 2WB5A 4WDTA 1U22A 3AS3A 4PBEA 4US5A 1QNRA 1OK4A 2XUCA 4DEFA 3PWGA 5IBXA 4RE3A 1E9IA 1E0UA 1LCOA 1QI2A 3QPZA 3BWWA 4GCXA 3FY1A 3QHNA 4A4AA 5BZAA 2PDHA 3S1GA 3AROA 1GKPA 3KTCA 1IYXA 4KEZA 2OYKA 2YBUA 3R12A 4FB7A 4CD6A 2DFAA 4MJ4A 4H6QA 1XX1A 1OEPA 2VZOA 1UBSA 3B0YA 4ILSA 4CQ8A 3FA5A 3AIUA 4P8UA 2V0TA 4Q8UA 1TPFA 1LWIA 1A49A 2ANUA 3R2GA 1H7PA 3VD9A 1NU5A 3WMCA 4BQ3A 1V0MA 3U4FA 1F6KA 1L6YA 1F5ZA 1OJXA 5I5RA 4Q8MA 5CGMA 1E4IA 5BNKA 1H7XA 2QKFA 4E3TA 1JPMA 9RUBA 4HNTA 3OLDA 2OQHA 2DPEA 4D71A 2O0TA 4IIDA 5CC6A 4K1GA 1UROA 3T0AA 1LWJA 3ZXWA 2E8YA 3DUGA 4NI8A 1FUYA 4GZIA 3KEHA 4GOAA 5C9ZA 1ZCOA 3TTQA 1YPXA 4F9DA 1MXGA 1DJGA 5D2YA 3BLLA 3TFXA 5GPRA 1XLHA 3KOZA 4QITA 2RKXA 3MC5A 2PWUA 4R53A 5LA2A 1XLCA 2PDWA 2VOMA 1MXDA 5HJXA 5HNNA 3UP8A 2NQ9A 3TLLA 2UWFA 2QCNA 2PGEA 2GJLA 5TF0A 1MI3A 5FJJA 4UTLA 1VRDA 1UWTA 3PTMA 4AY8A 4PN2A 5GJPA 4DI8A 2YA1A 4UQEA 1KBKA 3QQ1A 2ODOA 3C0QA 4B90A 4GK8A 3T07A 4DBWA 5LXXA 3GW0A 3GYCA 3H23A 2ZRZA 2ZA1A 2YFOA 3W2MA 3LHVA 3C0SA 1M01A 1E4MM 4F4RA 2QIIA 3W2NA 3UT0A 1XUZA 3EMQA 1SFLA 3MWAA 1ADDA 3RMJA 3SN1A 4UFJA 2GSJA 1EKOA 1Q6OA 3MVIA 4HBKA 4FK9A 4RNIA 3TSBA 4V15A 3CB3A 1Q85A 1CLVA 1UIOA 2PA6A 2QJMA 3R0DA 1UOKA 4ZO7A 3MMUA 1VIWA 3PBUA 2W0UA 3QLLA 4O19A 2F2KA 3DYPA 3MQTA 1A0EA 3KP1A 4NZJA 1QHOA 2XINA 4LYQA 5ENLA 3NPWA 1R9ZA 5ECVA 5FSDC 2F38A 3RRXA 1Z3NA 3B04A 5EB8A 2WHMA 3GB6A 4A3YA 4GD0A 1PXGA 5J5RA 3B97A 3GHRA 3PZNA 4C90A 5FEPA 2ZUMA 4KCTA 3U7VA 3CTTA 3WYZA 2Q3RA 4MB1A 2E1WA 4EANA 3TLQA 1M6JA 1I8JA 1JF6A 1HJVA 3VE9A 2GVEA 2X09A 4KEMA 2J88A 4KGJA 1TUXA 3WUBA 2ZVIA 1JPHA 4US5D 4C6MA 1UYQA 1CX9A 4JFWA 1CXLA 3MV11 2WZMA 3ZQ9A 3NDYA 4RKAA 4AF0B 2G50A 1BGGA 1JD7A 3VU2A 1XQKA 1VD6A 1DQWA 3W74A 2PRHA 4QE1A 4U5IA 5DT5A 4XO7A 5CPOA 4E8GA 5LIUX 4NT0A 1TR9A 3RR1A 2CITA 3CLWA 3W70A 3K13A 1JUBA 1XBXA 3VILA 1TPEA 4UFKA 2FKPA 2WSYA 4OT7A 2PDLA 3BOLA 3A4XA 2WMIA 4DELA 3QGVA 3KOWA 3P84A 3VNYA 4A3HA 1EIXA 4ASTA 3UGRA 1RBAA 5HJLA 3SSJA 3UETA 3WQPA 4IG2A 1GYNA 2Y62A 1DJZA 3IIXA 4M8UA 4O15A 2GGEA 3CZLA 3LSBA 2GDUA 4GGBA 2PF8A 2Y89A 2NX3A 4W5UA 3L2LA 2PODA 4JTFA 3W4RA 3KTSA 1GQNA 3DXIA 3O9NA 3HPZA 1H5VA 2VL4A 1PEZA 5LNSA 1B57A 3IV3A 2WLYA 1K8XA 5TD4A 3V5CA 4ZE4A 1J6PA 5ABTA 2D1ZA 3MO7A 1OFQA 3KRSA 2ISFA 5IDIA 3WFZA 4OWGA 2F6KA 1E6SM 5K2ZA 3UZ5A 4ML4A 2V2DA 1UP3A 3WEZA 1H3GA 5I79A 5AFDA 5DFAA 3SZ8A 4F0MA 1S2UA 1N82A 1KV5A 5A5WA 4L4LA 4L6HA 2P1FA 1PKNA 2OB3A 2QQ6A 1FXPA 3QQWA 3PBWA 1CYGA 4OE7A 5BXTA 3ITOA 4BR1A 1DXIA 1GJPA 3J7HA 1YIXA 3GZ3A 1VPXA 1H1NA 4IMFA 7REQB 1HKMA 1V6VA 3MS8A 1ZENA 1KBJA 2V5LA 4O57A 3WLKX 1QI0A 5XINA 1OGBA 1H49A 3TMLA 5EKYA 2E3ZA 3A47A 3RLUA 3WMSA 2FDSA 4GYPA 3N3MA 3R25A 5H1WA 1O7AA 3LDVA 5FD0A 4Q8NA 2C0HA 3UVAA 2PDUA 4UWMA 4HMDA 1IR2A 3CZKA 1W3IA 4HN8A 3GVQA 3T8QA 1H0GA 2QJNA 3SO7A 4CQAA 3O3RA 2QMJA 3G1HA 3VM7A 5A95A 1WZAA 1K4GA 4ZTYA 2WMIB 3EA2A 3O06A 3L4WA 2YGYA 3AMCA 2D2JA 3SRDA 4GUJA 5CCZA 1QAPA 1VENA 1KCLA 4ERAA 3HV8A 3OODA 1V5XA 2VFEA 1RK5A 3NQEA 1SO6A 3PAOA 1TMHA 2VHLA 1M5WA 2QGHA 3PUOA 3SIZA 4Q4PA 4PTVA 2WSKA 3UCQA 2ZRUA 2WPBA 3M0VA 4RCXA 1J5SA 2B31A 4R7WA 1NFPA 1YDNA 3PZUA 3SFKA 1UC4A 3AMKA 4X9SA 8CGTA 3I7SA 1KM3A 2ACRA 3UU0A 2RFGA 1BSIA 1BQGA 5I23A 2DIEA 1QR7A 4S3DA 4YS1A 4OVXA 3NAVA 4WSKA 2XZ7A 1HW6A 4UTKA 1VYSX 1HTIA 3DG6A 4O50A 2VUYA 3P61A 2PC4A 5DLCA 3TXVA 3UPBA 3W7GA 2H9AA 3ES8A 5D9PA 4CU6A 2AQWA 1R87A 3QBUA 3WUGA 1RD6A 1FWFC 2XVGA