4W7UA

Crystal structure of xaccel5a in the native form
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
313
structure length
313
Chain Sequence
HMLKYVGVNLSGAEFNSRKKPGTLFKDYTYPAASDFSYFAGKGMNTIRLPFLWERVQPELNGPLDQAQLGLIKKSLEAAKANKQYLILDLHNYATYSGKRIGTSDVPAGALADLWRRLALEFKDDKAVIFGLMNEPNGISAPDWANAAQGTITAIRKTGAKNLILVPGTAYTGAHSWRSTSYGVSNAKALEILKDPGNNLAFEAHQYLDKDYSGTKPVCTSDSVGQEKLQGFTSWLRENKQKGFLGEFATANNPVCDKALEGMLTYMEKNSDVWLGWTWWAAGAWWKPDYPFTVQPGKDGSDKPQMAILSKYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of XacCel5A in the native form
rcsb
source organism Xanthomonas axonopodis pv. citri
molecule tags Hydrolase
molecule keywords Cellulase
total genus 122
structure length 313
sequence length 313
ec nomenclature
pdb deposition date 2014-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4w7uA00
1KGUA 3GXFA 4JHOA 3RILA 3HJEA 2CPUA 1UWTA 2WCSA 1HKMA 3CUFA 3FN9A 2WVTA 3CIVA 4PMRA 4UOZA 1NQ6A 2FH8A 4TVDA 4MNKA 4JAWA 4FLOA 1N82A 3B9EA 2BY2A 3BLPX 4PTVA 5DT5A 3RO8A 5AYIA 1PZ3A 3WNNA 1UG6A 2XIBA 2NT1A 3K1DA 5A6JA 3VD3A 4X9YA 1WP6A 1W1PA 2B31A 3AHTA 1V6YA 1NH6A 3TA9A 1QHZA 4WSJA 4ACYA 2WPGA 4UFIA 1B9ZA 6TAAA 3ARZA 4W89A 5JIWA 3BAWA 1GZJA 4QCFA 3AISA 4IM4A 7CGTA 3WDIA 1QI3A 4CCDA 4Z2GA 1E3XA 4GKLA 1YQ2A 4CN4A 5BXTA 3AS2A 3IK2A 3WNKA 4ML4A 5IFPA 3J7HA 2EPMX 5A6KA 3W26A 2EPKX 3ZJ6A 2AAAA 3A4XA 5ABFA 4TUFA 4D6HA 1JIBA 1TR1A 1UWIA 5I77A 1B31A 3K8MA 5DEZA 5FCZA 1H49A 2F2HA 2VL4A 3VDBA 1LG1A 1GOMA 2VMFA 3UG5A 3OG2A 1W2VA 4QDMA 2PB1A 3RDKA 4PTXA 1C8QA 3MMWA 3TP4A 1W3KA 1UR4A 4AWEA 1G9HA 2W61A 1V3MA 4OBRA 3ZSTA 1WKYA 4E4PA 4F9JA 5JIPA 1JNEA 2E9MA 3L2MA 3WNLA 1UR1A 5AY7A 3LPFA 2E9LA 4UQDA 3A47A 3MSDA 1QW8A 4UCFA 1GOKA 3VM5A 3FNDA 4MJ4A 2IUZA 3TONA 4EKJA 1CPUA 2DSVA 1J0JA 1UKSA 4M82A 3K8KA 4MB3A 4P7RA 4BA0A 1H41A 1OD0A 2XGIA 1MXDA 1E40A 5LYRA 1E1EA 4F8XA 1MW1A 1Z32X 3MV01 2WM0A 3WD0A 5A6AA 1D2KA 1FH7A 1BYBA 3KL0A 2O9RA 2A3BA 2GDUA 4QP0A 1AQHA 1B3WA 2VQUA 1C8XA 1MWOA 2OWXA 3CBWA 1R8LA 1V3IA 3BAIA 2VUYA 1QHPA 3CO4A 1WAWA 1JXJA 5CSUA 3EDFA 3PZOA 2OYMA 1EO5A 4JKMA 2JFEX 1E6XM 1OGSA 3GH7A 3AHVA 2PBGA 2WVVA 1P6WA 4P8VA 3W4RA 3VGGA 4JFSA 5ABHA 2VX4A 1MQQA 3WDJA 3WMCA 1BF2A 1ITCA 3CZKA 2J7DA 1BAGA 4CUCA 3DHUA 1EXPA 3AICA 2FH6A 4PRWA 4N42A 3IJ8A 1HJVA 3VU2A 4NF7A 2BHUA 1HKJA 1K9FA 1KXVA 3M7SA 1UR8A 1W3JA 3W29A 4GI6A 5CZKA 2VZUA 4DWSB 5CGMA 4MAZA 4Z2HA 3ZOAA 4NI3A 3KZSA 4UQAA 4GI9A 4ACZA 1PIGA 4H41A 4AW7A 1QPKA 3W82A 4P8WA 4LYQA 4P7NA 1UKPA 4NRRA 4HOWA 2WSKA 4FK9A 3L4WA 1SR0A 3T2QA 1E70M 1E71M 4U3AA 3SUSA 4YHEA 1GOWA 3EDKA 4LX4A 3EBVA 2BV9A 5LA0A 2O9TA 3M6DA 2PWDA 1CLVA 4W8BA 1NWSA 3TOPA 1ISVA 4R27A 1CENA 2CIPA 1O6IA 4AIEA 1VJZA 2O9PA 4MTVA 1WDPA 4LYPA 4D72A 5A1AA 2OWCA 4WIWA 1R7AA 4AZCA 4M80A 1LLOA 5GNYA 1E5NA 5BRPA 3MV11 5BXSA 1Q6EA 1VFFA 2QMKA 2PI6A 3AIQA 1ZBCA 4MNLA 2EBNA 2VVSA 2BVYA 1QNRA 4DWSA 5CJ5A 4P7LA 2WVSA 5KZ6A 2CKSA 3VIHA 4D1IA 2J47A 3VD4A 1V3JA 1W9BM 3A6OA 1HN1A 3O2LA 1ISXA 3NJ3A 1Q6GA 2WZIA 5D4YA 4OBSA 4PMXA 1EQCA 2WKLA 1HNYA 2J7HA 3GH5A 1MXGA 4PEEA 2XVNA 2X1IA 2W62A 2X0HA 3F4VA 3OA5A 4HP5A 5FOOA 1E15A 1OIMA 3MS8A 3RCNA 2A3HA 3O6AA 1JYXA 1MQRA 1ODZA 2BHYA 3U5YA 4L4OA 3RM9A 1K9DA 1XCWA 4P7QA 1OWQA 1R7OA 1SYTA 2CHNA 1V02E 3ARTA 1KGWA 3WENA 1UH2A 1MFVA 2JEPA 2IXVA 1B3XA 3BMWA 1GPFA 2D22A 4DUVA 2WK2A 4MNJA 3WF1A 1OT1A 1FFRA 5A8OA 4D71A 2WSPA 2DSWA 2FDMA 1ZBVA 1GORA 2DIEA 2WXDM 3QOMA 2GSJA 2FHBA 3ARPA 2V5DA 2WWDA 1OM0A 3WH8A 4HZ6A 4B3KA 3MMDA 1GQKA 3OIHA 3VGBA 4CD5A 2VVNA 2D1ZA 2IXUA 5HDRA 3E1F1 4W93A 1BSIA 3F5KA 1JYVA 2QPSA 3VIJA 4AD1A 4BZYA 4CD4A 2W66A 4PMYA 4MB4A 4JFTA 4JL1A 3CPUA 1H09A 1UQYA 4FLRA 3CLWA 1CXFA 1C7SA 3OB8A 2XVPA 3GYCA 4RE3A 1CLXA 2GJRA 1H11A 1B3YA 4PUDA 1CNVA 1TCMA 4GQRA 3U7VA 4KGJA 2W92A 3RMEA 3WBAA 2BY1A 1UYQA 3CZGA 4HA3A 2XFYA 1C92A 3QOKA 1FP8A 1TVNA 1ECEA 4V28A 1OCQA 1KQYA 1QI2A 2V3FA 1JD9A 4GO8A 5CPQA 1TMQA 4W7VA 3UETA 2E40A 1RP8A 3RJXA 4M24A 3RJYA 1E6RA 4H8UA 4KH2A 4JFUA 3SUTA 4UTFA 3SUUA 4PSPA 1Q6DA 4YPJA 2WAGA 4WKAA 1KR1A 4C7GA 3ZJ7A 4CU7A 5C8BB 2WZEA 2V5CA 1WB0A 1OSEA 4MJ2A 4FLSA 1HJWA 4CD8A 1QI0A 2BS9A 2ZX6A 3SURA 2YL8A 2OYKA 1FHDA 1FP9A 1R85A 1W3LA 4OZOA 4UNIA 3WF0A 4U2YA 3ZJKA 5A8MA 4ATDA 1CGWA 3OGVA 4LYRA 3APGA 5EFDA 2VX5A 4DUWA 1B3VA 1UOKA 2DGAA 3T0DA 3VMNA 3S2CA 4E8DA 3BAKA 1QNSA 1JZ3A 4TTUA 1I1WA 1KXTA 2ZWZA 1CZ1A 4X0NA 2XVGA 5EBAA 5FL1A 1EHAA 4H8VA 4KMQA 3MO4A 4AZCB 4WF7A 3N18A 2GK1A 2W67A 1JI1A 3AHZA 3A3HA 2JF6A 3K4AA 2WBKA 2EPNA 3EDDA 3VGHA 1E5JA 4IPNB 2PC8A 1ISZA 3W24A 4W7UA 3WL0A 1OD8A 4OOZA 1ZL1A 1QI5A 1WNOA 1MYRA 3W6LA 3ARSA 2YL5A 4U2ZA 1OBAA 1MW3A 4PMZA 2DQXA 4P8UA 2AMGA 1JZ8A 3CZ8A 1QI4A 4CGTA 4AZ6A 2G41A 1E6QM 2GJXB 2YA2A 4AMCA 1J0YA 4UOJA 4H7VA 3L4TA 2D20A 3AIVA 2DIJA 2UWFA 1GW1A 2WZHA 4FF5A 3NUKA 2BVTA 2GVYA 2OSWA 1W9UA 1NWRA 1ISYA 1IZKA 5AC5A 1TUXA 4AEFA 1V0MA 1J0ZA 3MUAA 1HXJA 1PBGA 3BAYA 2YLAA 1EO7A 2D3NA 2J7FA 3EDJA 1XHGA 1HL8A 5IHSA 1US3A 2XJ7A 2ZICA 3SCRA 2X09A 1X1NA 2E8ZA 4W87A 3ZJ8A 1GNXA 1H5VA 4QFUA 2PWEA 1OT2A 1EQPA 5ABEA 1LL4A 1FH8A 2VR4A 3I3BA 4M29A 2DSUA 3I3DA 1OGBA 1V6UA 1JI2A 3A4AA 1XRVA 2XVKA 2J79A 1JYNA 3ARWA 3W53A 1CGTA 3N13A 2J7EA 3QHOA 1O7AA 2Y8VA 1M01A 1ZJBA 4GO9A 3AZRA 1E3ZA 4NRSA 4OOUA 2YBTA 2DH2A 2DEPA 2J74A 2JALA 3FAXA 1WO2A 4U31A 3SCUA 4LPCA 1IZJA 4MB1A 1XH1A 1MW0A 1ZBKA 2GJPA 2ZXBA 4CN6A 4PMQA 4GPNA 2YL9A 4MAVA 4J3UA 3AROA 3DECA 4W88A 3WUEA 1PZ2A 2CESA 3RPMA 3VDCA 1AVAA 1G94A 2EEXA 4HOXA 4GI8A 2WW5A 3L2LA 1JNDA 1HVXA 1WCGA 1UHVA 4Y7EA 3IAQA 1EOKA 1H0IA 1KXQA 1CXEA 3PTQA 3WELA 1WZLA 2CCRA 3POHA 4AZ5A 4V27A 1M7XA 1HT6A 5ABFB 2WHLA 4AIUA 3SCNA 3SCTA 1AQ0A 4AY1A 1PIFA 1RPKA 3WDPP 5FD0A 3W6MA 4A4AA 4W7WA 4IUGA 3N04A 2YDRA 1ISWA 4AIOA 5IHRA 1EHNA 2XUCA 1C8YA 5I6SA 1HJSA 3O9NA 4BQ4A 4MB5A 2NSXA 3WEOA 3B9AA 1VB9A 2YJQA 1BTCA 4R5EA 3NSNA 4GINA 1BVZA 4TVCA 2CEQA 3CZJA 1GUVA 4PMDA 5I2UA 3I3EA 3W25A 3NSXA 2J4GA 1C90A 1CGVA 2WMIA 3VD5A 1V02A 4AD4A 4QLLA 1JXKA 2D3LA 4HMEA 4RE2A 3OGRA 3SEPA 3GH4A 4ACZB 2X2YA 3UCQA 1JFHA 4J3TA 2J7BA 1VF8A 1HIZA 1ODUA 2JEQA 4HA4A 1KWKA 1KGXA 3PZIA 3U57A 1PX4A 6A3HA 3W0KA 1SMAA 1I75A 3WH9A 3VOCA 4FLQA 4UQCA 3QHNA 4PMVA 1E72M 3WUBA 1K9TA 2F8QA 4DWSD 2ZXQA 4OUEA 4D6DA 3WQ4A 4IISA 1EOMA 3ZR6A 1KCKA 3K46A 2W63A 2CBVA 4ATWA 4OIFA 3MUY1 1VAHA 3AQUA 2WMFA 2TAAA 3FY1A 1JZ5A 2BHZA 2BY3A 4W5ZA 2WC4A 3PZUA 2OLHA 3WH5A 1V0NA 1YHTA 5A6MA 1ESWA 3BLKA 3HU7A 4U3CA 2E8YA 1G01A 3WF2A 1UUQA 2VCBA 1BYCA 2JF7A 1UD8A 4UFJA 3CUJA 2VO5A 3GZAA 3GDBA 5A6SA 4U5IA 1H1NA 1NOWA 4ZE4A 3FAWA 3PTMA 2CETA 2G3JA 5A8PA 4GXPA 2X05A 2VURA 6CGTA 3GTNA 3VTRA 5CLWA 3VGDA 3FHQA 4F79A 4J3VA 4B16A 3MUIA 2Y4SA 1UD3A 3UEQA 1SMDA 1MQPA 5E70A 3VVGA 3K4DA 5E0CA 1B1YA 1IT0A 2YDQA 1E0XA 3NCOA 4J27A 1KBKA 1Q6FA 3AMKA 4W84A 1HVQA 5HPOA 2CBUA 5D9MA 1KWGA 2GJXA 2GDVA 5A2AA 2XM2A 3ARUA 1KCLA 2ZUSA 1E6SM 1F4AA 3WNMA 1GJUA 5M5DA 3FXYA 4C7DA 5FL0A 2J7CA 1CXKA 4PUEA 4BS0A 2E9BA 1UD2A 1NOFA 1EDQA 2UY2A 2V3DA 1XCXA 2ZX7A 3LPPA 3CTTA 3PTKA 3BAJA 3POCA 4CVWA 2VI0A 3EMQA 3TTOA 5DMYA 3AMLA 3GNOA 1E6ZA 5I78A 1ZJAA 3EMCA 4AD5A 1WDRA 3VIKA 3BCFA 3AXHA 3EYPA 3N11A 4KGLA 1V0KA 2VC9A 1GCYA 3GXDA 1X6NA 4TVUA 1B90A 2VNCA 4AZGA 1E4MM 4UZSA 3VD9A 2D0GA 2VX6A 3NDZA 3AS0A 2WLZA 3AHYA 5CPSA 1JDCA 1J12A 2ZUMA 3CMGA 1R87A 3ARRA 3DYPA 3OLIA 3T08A 1LWJA 3VIIA 7A3HA 1M53A 1W1VA 2ESCA 2XYLA 3PN8A 2XWEA 5HNNA 1UWRA 3KWXA 1FFQA 4GQQA 4HZ7A 4H8HA 3ZIZA 1CGUA 3WKZA 3VKKA 2WVVB 2WKGA 1Y7VA 1R86A 3BXWA 1DWAM 2NT0A 4UQEA 2XG9A 2ZX5A 3T2OA 5CXPA 3F5LA 2YL6A 2VCCA 2VTFA 4PMNA 2CHOA 1J18A 1AMYA 1QNOA 3IJ9A 4WLCA 4D6EA 2DT2A 5IXEA 1WZKA 5I3DA 1JFXA 1BFNA 2C0HA 3N17A 1XGZA 1E0WA 4YHGA 1OINA 3WNPA 1VRXA 5ECUA 4MDPA 1UKOA 3QGVA 4DM2A 2G4FA 3BC9A 4W86A 1UA3A 2W91A 5BRQA 3OZOA 1VFOA 1VIWA 1VEMA 3PZVA 1XYFA 2GFTA 2NW0A 1XV8A 4URIA 3CHFA 1MFUA 2Z1KA 4JHZA 4HU0A 1W2PA 1KFWA 4JFWA 2XFFA 5JBFA 3L4YA 3WEMA 2XFRA 2DH3A 8A3HA 5E6ZA 2OSYA 4RE4A 2VOTA 1E4LA 3GBEA 4WKFA 1HX0A 4A3YA 3G6LA 1VEPA 2ZOXA 4XV0A 1G1YA 4DWSC 3CUGA 4JFVA 1WPCA 2O92A 1NWUA 2HISA 3TTYA 3VNYA 1XYZA 4BQ2A 4H2CA 4JCLA 1BQCA 5CQ1A 4Z2LA 4Z2IA 1UH4A 5BROA 2XPKA 3W27A 3PBGA 1VBRA 3UR7A 3BCDA 4W85A 5HPCA 2VCAA 2J78A 4CD6A 2UY3A 2WMKA 3L4UA 2WC7A 1J9YA 2EPLX 5I23A 5CPTA 4D6CA 1CDGA 1WZMA 4EE9A 1FHLA 1TFVA 1E4IA 5A69A 3AZSA 3MKKA 4EK7A 5JBEA 5A6LA 1TE1A 1Q6CA 4E2OA 3SCOA 1UKQA 1V03A 3DYOA 4M1RA 1LL7A 2WBGA 1UKTA 5A8NA 3GXIA 2YLLA 4TOQA 1B0IA 4TX8A 3CUIA 3WUGA 3RM8A 3WQ8A 1CTNA 1V6WA 1XH2A 3LMYA 1WDSA 1DTUA 1A3HA 3PZQA 1XD1A 5EB8A 3SCPA 4UQ9A 1XSIA 2ZUUA 3RM4A 4CVUA 1CYGA 3W38A 1VJSA 4BQ5A 2V38A 4KWUA 3JUGA 2EJ1A 4CCEA 4P7OA 3HMCA 2WMGA 1JDDA 3EMZA 5A6BD 4D6JA 2C8NA 5I0DA 3UESA 1HL9A 4K68A 2BXYA 4M56A 3ARQA 1JF5A 3AFBA 3N9KA 5EMYA 1SFSA 1V3LA 4AC1X 3CHCA 4PSRA 2FGLA 2ZUVA 3PZMA 4QLKA 1NARA 2J25A 2ZWYA 4CN1A 3UG4A 1DWFM 1W3HA 1EDTA 3ARVA 5I24A 3DYMA 4C7FA 2YDSA 1G5AA 2W4XA 1Q4NX 3ZM8A 3AS3A 3VIFA 4LXFA 5CLTA 1TVPA 2PF0A 1HJUA 4MADA 1XSJA 1E43A 2WYSA 3PHAA 4B15A 1ZS2A 5DO8A 1J0HA 2BY0A 3PZTA 5BWFA 2AOSA 5FKYA 3ZT6A 2VZVA 2EO7A 2FHFA 3MANA 3ALFA 1V08A 2XVLA 1W91A 3AI0A 2XHYA 1RH9A 2Q8XA 4YN5A 5A95A 1E0VA 3BAXA 3F5JA 1JZ2A 2W5FA 1JAKA 1BGAA 4RL3A 5GPRA 2ZE0A 3N15A 1NOUA 3KL3A 1V6VA 1E56A 3BSHA 2J75A 5I5RA 2WCGA 5GNZA 1DWGM 3VILA 3B8SA 2DSZA 1QOXA 3WEZA 1US2A 1UZ1A 3WF4A 3KEHA 5D9PA 2XTKA 4V2XA 3GBDA 2QHAA 4PCSA 4LGXA 4B3LA 2J77A 3AMCA 4ZFMA 2DT1A 4HOZA 3BGAA 1RD6A 1JGIA 1BYAA 5A2BA 1HJQA 2V3GA 1UR0A 1GOQA 3FW6A 1B30A 3G6MA 2CYGA 2WLYA 4AZHA 3WIJA 4AEEA 2CBJA 2D23A 2J7GA 1U2YA 1J11A 2XWDA 1HP4A 5D9OA 1HKKA 1HF6A 1XC6A 1GQLA 2JIWA 4NSBA 3GM8A 3WFZA 1QW9A 5CG0A 3MU7A 2A3EA 4GZJA 5DT7A 1I1XA 4AXNA 4KRUA 3OLDA 3VMPA 1GHSA 3II1A 4AD2A 3ZT7A 4HTYA 3UR8A 4A3HA 2E4TA 2Y8KA 1BHGA 2CBIA 3WQ5A 1D3CA 4S3JA 2J8GA 1EDGA 3NSMA 4PMOA 3AIBA 2HVMA 4B9YA 2G8ZA 1J10A 4AZBA 1HP5A 3T09A 3VIGA 4EANA 2VJXA 4D6IA 3TTSA 2MANA 3CHEA 1PX3A 2DSKA 1OB0A 1CXIA 3T2PA 3OBAA 1GVYA 3WDQA 4UFHA 4NZCA 2C7FA 4JKKA 3AXXA 2VZOA 1GOOA 1U33A 1JZ6A 1WZAA 3SCQA 1J01A 1F4HA 2EQDA 4M81A 1PAMA 3IANA 2O9OA 1W9PA 1FH9A 4TX6A 1E6NA 1WE5A 3AIEA 4D6FA 2WHJA 3VD7A 4ZEPA 2BXZA 1TZ7A 8CGTA 3GXMA 1V3KA 1UD4A 1XD0A 1H4PA 5A2CA 3CHDA 3AIUA 4WKHA 2RGLA 2VQTA 2D0HA 1W9DM 2DDXA 2GUYA 1D7FA 4OKDA 2WB5A 3WFLA 5C71A 2VRKA 3KL5A 3WH7A 1W1YA 3T0BA 1PJ9A 4BQ3A 5DF0A 5F7UA 2BVDA 4PBGA 3AJ7A 1KBBA 3D5HA 1E55A 1LQ0A 2JE8A 1UD6A 3DHPA 2ZX8A 2CXGA 4CU6A 3VIMA 5LA1A 2VZTA 2ZUNA 1GQJA 2CNCA 1PPIA 2VT0A 1AQMA 1C91A 3MSGA 1CGXA 3TTQA 2WWCA 1OIFA 4XB3A 5E09A 1QBAA 1W9VA 2YBUA 1GOIA 1WDQA 1C7TA 1W9XA 1DWJM 1ZB5A 1K6AA 2J62A 4JCMA 5A8QA 3OLEA 1VFMA 3VINA 2XSBA 4AZIA 3UG3A 1BG4A 1BG9A 2PWHA 1LF1A 3OZPA 3VDHA 5D8WA 2Y2WA 5HXMA 5A6BA 4XX6A 4PYSA 1UWSA 3AZTA 4HMCA 4AISA 1LL6A 3AIRA 3SUWA 1VBUA 4J7RA 1HKIA 2D0FA 5M3WA 2WCAA 2E0PA 3WF3A 4QAWA 3LPGA 4PMUA 3VPLA 1LG2A 1KXHA 1ZBWA 3GNRA 2Y5EA 4JL2A 3AMDA 3SCVA 3W81A 4LQ1A 1CIUA 4OJYA 4AYSA 1BPLB 1PEZA 3IAPA 4ATLA 1DHKA 1E1FA 2QV4A 4E8CA 1S46A 3WQWA 1BVNP 2CKRA 1H2JA 1UWQA 4XZBA 3ALGA 4W8LA 3PZ9A 5A3HA 3CGTA 4PCTA 3VX0A 1JL8A 4X0VA 1B2YA 1DWHM 3AOFA 4D1JA 4HMDA 3AMGA 4WK9A 2UY5A 1UR2A 1GHRA 3WUFA 2WNWA 1V3HA 2ZX9A 2X8RA 3HN3A 4GZEA 5AYBA 4XUYA 4PN2A 1FOBA 2VZSA 1M04A 1QNPA 2A3AA 1V0LA 2DT3A 3IJ7A 2WHMA 3VM7A 1DP0A 1IV8A 3ZQ9A 4HPHA 2FGZA 2CERA 1NWTA 5HOSA 4UR9A 2EXOA 1ITXA 2Y24A 3WD3A 2XGBA 4Q22A 4GZIA 5GNXA 3WD2A 3AYRA 2E3ZA 3W28A 3L4ZA 1GVIA 1UH3A 3W37A 3GNPA 1A47A 3WBEA 5CGTA 1PX8A 2VRJA 4MPKA 4KRTA 2XIIA 1GJWA 2WMJA 2YOCA 4EAMA 3WNOA 4WJXA 4CKQA 3S6TA 4CCCA 5JBDA 3A4WA 1JYWA 2DPEA 3EDEA 2D24A 4HPGA 1G0CA 4N0RA 3SUVA 4W8AA 4L4PA 1CECA 2YKKA 1UQZA 5D8ZA 5JUVA 4IPLA 3B9DA 1E9LA 5D9NA 5IFTA 3MMUA 3THCA 3CMJA 2WMIB 3WL1A 4J3XA 3CZEA 1CEOA 5EFFA 2VX7A 2PWFA 3ZO9A 1J0KA 4BF7A 3UERA 3ZMRA 1MW2A 4F9DA 3QR3A 2UY4A 1NM9A 1E6PA 1H3GA 3DC0A 1QVBA 2EPOA 4Q7NA 1JZ4A 1C93A 1JAEA 3VUPA 4JIEA 3WSUA 1DEDA 1X6LA 3BH4A 3WQVA 2A3CA 5BXRA 1LJYA 3CZLA 4MDOA 3VIPA 1VEOA 4HA1A 1QBBA 1GQIA 5ABGA 3VGEA 4QCEA 1BGGA 1FA2A 4HZ8A 5E0FA 4MNMA 3NDYA 4DM1A 3N1AA 1V6XA 3AIWA 3M07A 3VDAA 1TA3B 3SCWA 2RGMA 4AD3A 4S3KA 5I79A 2GK1B 2XSAA 5IDIA 1EIBA 2BFGA 1KQZA 1JZ7A 4CD7A 3KE0A 3VMOA 5AC4A 2PWGA 3ARYA 4P8XA 3U7BA 3ZR5A 4Z2JA 2BNJA 5LA2A 1W32A 1TA3A 1W1TA 3OGSA 4UOQA 9CGTA 4UQBA 2VRQA 1JG9A 2YA0A 4JZ5A 5GQBA 5M03A 7TAAA 1UWUA 1J0IA 1C3FA 2QLYA 2ZUTA 2G3MA 1DWIM 4BCEA 3M46A 4ZE5A 5BXPA 2WVUA 3NIYA 4H04A 3ZSSA 3OLGA 5M17A 1TG7A 1L8NA 2G3IA 3ECQA 3VGFA 3VNZA 4D6GA 4AZ7A 1E73M 4UFLA 4XZWA 4QLJA 2G3NA 3AS1A 1ZU8A 5A94A 2QPUA 4J3SA 4GIAA 1JF6A 4TXEA 3MUZ1 3T0AA 2DT0A 4HU8A 4ZXOA 3CUHA 3WMSA 2Z1SA 3WDHA 2WC3A 3WN6A 1XH0A 2ZIDA 1GONA 1U30A 1LWHA 4UZUA 1BYDA 1QHOA 1HJXA 5C70A 4FMVA 1K9EA 2XM1A 5BYWA 2CITA 3WDRA 4DUXA 1UR9A 1NP0A 3BMVA 3VIOA 3N12A 3PZGA 2OYLA 5DFAA 5BCAA 2X0YA 2WMHA 4U5KA 1BLIA 2PBOA 2OWWA 1EA9C 3QHMA 4PTMA 4UFKA 3WD4A 2QMJA 4W5UA 3SCSA 3WD1A 1UZ4A 2OSXA 3K8LA 2ZUWA 3VX1A 2VR5A 1CXHA 3THDA 3BSGA 1CGYA 1H0GA 1RP9A 1UA7A 4Z2KA 1QNQA 4CU8A 2JIEA 4B9ZA 1JDAA 1OGGA 2YA1A 3VO0A 2F61A 2D2OA 5TD4A 3WH6A 2WHKA 3L4VA 1CWYA 3AXIA 1JD7A 5E9AA 1EGZA 3NYDA 3L4XA 3PZNA 1MVYA 4WSKA 4ZXLA 5E6YA 3LPOA 5CSYA 1KR0A 3ZT5A 2QF8A 4ZENA 4F66A 1M03A 2ZXDA 4U33A 3RIKA 4JKLA 3WY1A 4J28A 1EH9A 1CXLA 1VENA 3AHXA 2V3EA 3AYSA 1B3ZA 5HBFA 2ZXAA 3ARXA 3SIMA 3D3AA 4TTGA 4AD0A 5FIPA 1XSKA 1NP2A 4M8UA 2WANA 4J3WA 3WQ6A 3WMBA 3FHAA 2FHCA 5KEZA 1VFUA 4UFMA 1L0PA 2J8FA 3CH9A 4PTWA 1UD5A 1CBGA 2YIHA 1E4NA 1KB3A 3U5UA
chains in the Genus database with same CATH superfamily
1VH7A 5B7YA 4QIUA 5H1WA 3QTGA 2WCSA 2OX1A 3NAVA 3CIVA 2NVCA 1J5TA 1I4NA 1U5JA 2ZRZA 3R79A 3TR9A 1OCNA 2REQB 1SQ7A 4PTVA 5DT5A 3RO8A 1EPXA 4LS1A 4QG8A 4ROPA 3LHTA 3QY7A 3GAKA 1UG6A 4Y9PA 1S3HA 4RXFA 4IMCA 4JTKA 1YTDA 1Q6OA 2B31A 1ITQA 2J9YA 3PB0A 4N6FA 3AALA 4UFIA 3ARZA 4PB4A 3ME3A 4W89A 2XZ9A 1VPYA 5LNWA 3BLOA 1GZ1A 2VYOA 1U1UA 3BAWA 2UV8G 4QCFA 4RK8A 5C2CA 1A4MA 4YWSA 3ZVHA 3MUCA 2PDJA 4GKLA 4HVXA 1UPMB 5GJNA 1I9CB 3QZ6A 4C6IA 3D47A 1W3TA 4KFOA 1EEXA 1K1DA 3LM7A 3ZJ6A 4JTGA 4AX7A 4JPGA 3KM8A 3UQNA 1OX6A 1Q6RA 1TR1A 4C6PA 4GZ7A 1B31A 2HVOA 1NAL1 4ICCX 2HV5A 3WLJA 1GOMA 1W2VA 3KOXA 4PTXA 5HINA 1UZHA 1H61A 3EWCA 3TP4A 1EBGA 4AWEA 4RPPA 2AGTA 1AZ2A 1SZFA 4QHRA 2J6VA 4K6AA 1JNEA 2VGBA 4JTLA 3QH2A 3WNLA 4PL1A 2FJKA 3A22A 4E2VA 1ZY9A 3LPFA 3H8AA 1K03A 1CT5A 1JPDX 3VM5A 3TONA 3CL6A 4EKJA 2DFAA 1CPUA 5DMLA 3HURA 1J0JA 1UKSA 1DXEA 3U4AA 3AAMA 1OD0A 4GX9A 1D8CA 1PZ0A 1F3XA 1YLVA 4XBSA 4F8XA 1MW1A 1OF8A 3WD0A 1D2KA 1BYBA 2O9RA 7REQB 1L6GA 1S39A 1IF2A 1MWOA 2J9XA 1XIFA 2IPJA 1R8LA 5FEPA 1V3IA 5CBBA 2VUYA 2WNQA 4GH3A 4LF1A 3P3BA 2CLFA 4R9XA 3Q2DA 4JKMA 2PF8A 4P2VA 4C1LA 4DELA 1E6XM 2WNNA 3LSBA 1PKMA 3GH7A 3VGGA 2PP3A 3OOQA 3LS9A 1YE6A 3AXMA 1BF2A 4OECA 3H2AA 1BAGA 3AICA 2JKEA 3IJ8A 3BLIA 4NF7A 2BHUA 4GCAA 2V6AA 3OYXA 2CFFA 3M7SA 3T4CA 4GI6A 3UCDA 8XIMA 3PJUA 3ZOAA 4ACZA 1F61A 1QPKA 1KRAC 1Q7ZA 4J9JA 1J2WA 4HOWA 2WSKA 4ZTYA 3HZ3A 4I90A 4FNPA 3T2QA 3HBLA 1E70M 1E71M 4U3AA 4YHEA 1DJXA 1GOWA 5JVLA 3EDKA 3EBVA 2BV9A 3BJFA 3M6DA 3FOKA 1NWSA 3TDFA 3BE7A 3EGJA 1GKPA 3BICA 1Z48A 3DX5A 1XBYA 4AIEA 5A1AA 1F2JA 2YCIX 4JNZA 4HK5A 5BRPA 1E5NA 1LYXA 3G1RA 1YE4A 4EP8C 3OHMB 3B06A 1VFFA 1N2VA 1ZBCA 4MNLA 3S2JA 4DWSA 3HGSA 3BGGA 1W5QA 2SFPA 2NQHA 2PDPA 3O15A 3VIHA 5KINA 1DJNA 1OC6A 1K7FA 1W9BM 1H7PA 1OC5A 2DZSA 2C6QA 1B57A 4N02A 3T6CA 1Q6GA 3PVFA 2ACSA 4PMXA 3TKFA 1JCLA 2V69A 5FEWA 1HNYA 2AQOA 5H8UA 3GH5A 2FZ8A 1MXGA 2X1IA 2W62A 2X0HA 3UP8A 3QKZA 2BHYA 4D8LA 1XXXA 4L4OA 3RM9A 5FJUA 3C3UA 3EOEA 1XCWA 5TIMA 1OWQA 3UWWA 5J5DA 4IF2A 4HD5A 1ZUAX 1DORA 2IXVA 1B3XA 3ITCA 4C90A 1DQXA 3BMWA 3EXSA 1R3RA 2WK2A 4K8EA 4MNJA 3P60A 5AVHA 2V2HA 3HQPA 4DXVA 2CWNA 5G4HC 2DIEA 2GSJA 2FHBA 2V5DA 2WWDA 2VFHA 3C3NA 4MZYA 3GR4A 1W5MA 4A8NA 2HE8A 3BURA 1DE6A 4GIEA 5HDRA 3TW9A 2ONEA 4M51A 3F5KA 5EMJA 3VIJA 2ANUA 3L66A 2PODA 2YYTA 4JL1A 5AHFA 5LSMA 3U3HA 4MVAA 3E5BA 2DUZA 2Z6IA 1UIOA 3UVIA 1QOQA 1RJPA 3GYCA 4C5ZA 4RE3A 3NVDA 2GJRA 3BLFA 3LTYA 4KBXA 1CNVA 2V5JA 1P7TB 4TMBA 1FWDC 5AHIA 1HKVA 1M6JA 3OU8A 3FA3A 3WBAA 2BY1A 1XG4A 4O17A 1UYQA 3W1TA 3QOKA 3B4YA 1F05A 1FP8A 1V51A 3NOEA 1YDOA 4K2SA 4V28A 1OCQA 1KQYA 5D33A 5HJYA 1VYPX 1XIEA 4GO8A 2E40A 3GO2A 1OX4B 2C3ZA 1YXDA 2HTMA 3TYDA 4M24A 4V15A 1MI3A 3I68A 4LS2A 2ZZ4A 5HATA 2Y7EA 3SUTA 3IWPA 5BWAA 3O8AA 1R3QA 1Q6DA 2WJZA 1ENUA 2WAGA 2YDAA 5FJIA 2C15A 1OSEA 1BTMA 4ADTA 1HJWA 2AL1A 2BS9A 2JBMA 5C7VA 1FHDA 1W3LA 5HMDA 1Q63A 4UNIA 4U2YA 3ZJKA 1CGWA 1PTGA 1V8EA 1UIPA 4H00A 2HS8A 3NQGA 3VMNA 4E8DA 1JZ3A 4TTUA 1I1WA 1L9WA 2NLIA 1VYSX 1XCFA 3HG2A 3QPZA 5EBAA 4KMQA 4BKNA 3MO4A 4AZCB 5EMMA 4LAUA 4RUBA 2GWNA 2F6UA 4NJJA 4XG1A 2WBKA 3QEZA 1LOLA 8RUCA 4XO7A 4HU3A 3P8JA 4IPNB 4OOZA 3MTWA 1GVRA 2CHRA 3T07A 3ARSA 2IQDA 1UR3M 1JZ8A 4QROA 4Y8FA 2RKXA 4AMCA 1J0YA 3KBVA 3IEBA 2D20A 3AIVA 2DIJA 3KFTA 3PSWA 3NUKA 2QXWA 2GVYA 4D2JA 3WQFA 1GVEA 3CB8A 4DLMA 3BV4A 3W74A 4B5WA 4IGMA 4DF1A 2B7QA 3OBEA 1TB3A 3HQ1A 3VOGA 3VI2A 2VENA 1A80A 1SM9A 3UR5A 4IP4A 3EKZA 3GZ3A 1PBGA 1RQBA 3EDJA 1XHGA 3GFYA 1US3A 3RF9A 4JQ1A 2XJ7A 2ZICA 3ZJ8A 2E8ZA 4RCXA 4OV9A 1EQPA 2PDXA 4LT9A 3TR2A 2ODOA 4AYGA 5C0QA 1FH8A 1QO5A 2VR4A 4M29A 5A8GA 4F0MA 3W7OA 4KWOA 5FJOA 3WQEA 4Z1DA 4PZVA 3KHJA 1JI2A 1H1YA 2J79A 4HSNA 1IQ8A 4Q8WA 4QS5A 3S9YA 1CGTA 1FWBC 1UP2A 3WX7A 1ALDA 1GKQA 3DFSA 3ABOA 3BLLA 3EWDA 4UTTA 1MZHA 4Q8MA 4DO6A 2Y7GA 1O4UA 5D02A 2DH2A 2J74A 3M5XA 1IZJA 4I8YA 3N9RA 1QPNA 2PTDA 1OZQA 2GJPA 2HRWA 2ZXBA 1XLKA 4GPNA 4J3UA 4JTHA 4LOCA 3KZPA 3W75A 4W88A 1PZ2A 3VDCA 4GUGA 3MB9A 1AVAA 1EC7A 2WW5A 3P5ZA 1MUCA 1HVXA 3TN4A 4GC4A 1WCGA 2CZDA 4IX2A 1KCZA 3DENA 3GVRA 5KZEA 4NYYA 3KAOA 3QQ0A 1EOKA 4V27A 1M7XA 1HT6A 4AIUA 4HNUA 3HV9A 3SCNA 3RLHA 2YXOA 1IWPA 2YDRA 1ISWA 2QUUA 5IHRA 1ZQ5A 2XUCA 1C8YA 3G24A 3WEOA 5XIAA 3B9AA 4GNVA 2QUNA 4HT3A 1BTCA 3LOTA 3NSNA 3L12A 3CZJA 4KS0A 4KPLA 3GHRA 4DAIA 1RSCA 1P0KA 3I3EA 3UF9A 3KVJA 1C90A 3W1PA 3DCPA 1V02A 1SR9A 3Q58A 3G0SA 1ZP4A 3G1DA 2FFIA 3OGRA 1YBQB 4ACZB 1EJUC 3E0WA 4LEFA 1O1HA 1PXGA 2PD9A 4AB4A 3LQGA 4IP7A 4GNKB 4QJ5B 1JFHA 1SW7A 2J7BA 4FX8A 2ACUA 3E5PA 3HO8A 1PX4A 4IIHA 1E72M 2I56A 2Z1XA 5BMXA 2ZXQA 1H50A 2NV9A 3WLNA 4RV3A 4MWAB 5IBXC 1LRTA 3MY9A 1EOMA 3A64A 1O5XA 3E96A 2UBPC 1VJIA 4FXFA 4OIFA 2VGGA 1NY1A 3R43A 2WMFA 3HPXA 2BBFA 2XH4A 4RZBA 5AZ1A 1LBMA 2P53A 2WC4A 3PZUA 2OLHA 4ZQCA 1KBIA 4O4WA 1PVNA 3BLKA 3DC8A 1UD8A 3GDBA 3OZYA 4F0HA 4ZE4A 1POKA 4YTUA 2CETA 3LDVA 3TOYA 1W5OA 3MW7A 3M44A 2O7SA 3CEPA 2VFIA 3GTNA 3VTRA 3ANUA 3FHQA 1WDDA 2GVLA 3N2TA 3NOYA 4B16A 1UD3A 1SMDA 5E70A 5E0CA 3RHGA 4GQBA 1E0XA 1KBKA 1HGWA 3DBPA 2CLKA 3ITYA 5C54A 2GJXA 3H4WA 5BZAA 3ARUA 5T8GA 2BP1A 1XQKA 3NGFA 5LIUX 1REQA 3NQAA 5FL0A 3TC7A 1YNPA 1IHIA 3M64A 3OPSA 1AFSA 4UTMA 2DZBA 5U4NA 2QKFA 3POCA 5G2WA 2QW5A 2WV8A 2ICSA 1QRQA 5CKSA 1E6ZA 3VKDA 1US0A 1WDRA 3WYZA 1H51A 2VC9A 5EPDA 1RZMA 4N9DA 4FX7A 3GXDA 5F4XA 3W07A 3OW1A 4TVUA 1EWEA 4QITA 1ZNNA 2QR6A 3OIXA 2VFGA 4O19A 3VD9A 1VPQA 3NQ7A 4LV4A 1PCKA 1TPWA 3CIWA 3LYEA 3ARRA 3DYPA 2DVXA 3DUGA 1YADA 3TN6A 5D2WA 1K8XA 3O3RA 2FZ9A 1E0UA 2QDDA 2ESCA 2XYLA 3CAQA 1UMYA 2DW6A 5HNNA 1XIMA 1UWRA 1FFQA 5F2IA 3TWAA 4Z1AA 3EEZA 4H8HA 3PFRA 3ZIZA 3M4HA 1CGUA 4Z08A 5TBOA 2WVVB 1EX1A 4K7VA 2OLSA 3T2OA 3WJXA 3V0SA 1UROA 1A5NC 3F5LA 1WKEA 2VCCA 3TN5A 3V5CA 4O54A 4R88A 2V8ZA 3LN3A 1QNOA 1V7YA 1ZFJA 4H9TA 2DT2A 4GACA 3UNTA 1JFXA 3R0UA 2VHLA 1OYBA 2C0HA 1W6TA 3PULA 1OINA 3A3WA 2QIWA 4E4FA 2QJIA 1TQXA 4NL1A 1R2RA 1UKOA 3KBNA 3M0LA 3QGVA 2G4FA 1A4LA 1UA3A 4BHYA 5BRQA 1DKWA 3TYEA 3PZVA 4H9YA 2OT0A 4AMAA 1XYFA 2VWTA 5TAOA 3SJNA 3GVWA 1R46A 1XV8A 2I57A 3LCXA 1MFUA 1SU5A 4HU0A 4DPPA 2ZZ5A 1KFWA 4LUJA 1K8CA 2PEVA 3GBEA 1GEHA 4A3YA 4DJED 4UC5A 2VR2A 3CUGA 5HQLA 4O13A 1NWUA 2HISA 3TTYA 4BQ2A 2ZKMX 4XKMA 1KBLA 3UCCA 1G6CA 4C6CA 4Z2IA 1TV7A 4Y8EA 2VGIA 2EPLX 4ONVA 5CPTA 1TE6A 3P6LA 3FFSA 1E4IA 1PDYA 1O5KA 4Z1YA 3RGTA 3LLXA 5A6LA 1TE1A 1Q6CA 4NAEA 5CJNA 5FF7A 3DYOA 4J3ZA 3SCOA 4FIQA 4LB4A 3SRKA 3ZFHA 1B0IA 3CUIA 4G9PA 4O8RA 2ZCGA 4MKNA 2R91A 3ANVA 1V6WA 4JTQA 4LUYA 4MYAA 3SCPA 4UQ9A 2Q3RA 4XBKA 3RM4A 4H3DA 1MMFA 1VJSA 1Y5WA 1Q65A 3N6JA 4KWUA 4P7OA 2WMGA 3EMZA 2A6LA 3F1QA 4FNQA 2B7OA 2HNEA 1YBQA 4XQ6A 4IJRA 2C8NA 3NZRA 3O0KA 4DEFA 3UESA 4M56A 3ARQA 1JF5A 1DXFA 4K38A 5EMYA 3L2IA 4AC1X 1TZ9A 3BWWA 3T78A 3MKVA 2NZLA 1CW2A 4Q32A 2C79A 3V1HA 4R85A 4XZLX 3MUXA 3M5YA 5CAKA 2VDGA 3UG4A 1EDTA 3MO7A 1XIBA 4C7FA 3TEVA 4B5NA 1X8CA 3MJYA 3ZM8A 3TJLA 4L80A 4TU1A 4GQGA 2FB2A 3EWUA 5G2HA 2D69A 3EX1A 1XSJA 4YVXA 1AL7A 2P8CA 4C6DA 1SUXA 3ZT6A 5FKYA 4JHMA 5IDZA 2VZVA 2EO7A 3PY2A 3PK7A 4M7TA 2GOUA 2POZA 1W91A 3USBA 1SZGA 1H7OA 4PRRA 3RU8X 1TPEA 4UNLA 2E28A 3F5JA 1B3OA 1JAKA 1BGAA 3W1MA 3PR2A 1E9IA 3LCFA 3TAOA 1DBTA 2KZHA 3FEMA 4EOUA 1V6VA 3BSHA 1DWGM 1TWSA 3GU2A 4AWTA 3WG6A 4FNUA 3WEZA 4TIMA 3P67A 3PAJA 4JTCA 3GBDA 4PCSA 1MSSA 3KRUA 5K9DA 4LAZA 3B03A 3BGAA 3MBFA 3FW6A 2G37A 2VUNA 3KP1A 2CYGA 2WLYA 4IIFA 3TX9A 4AEEA 2CBJA 1U2YA 1J11A 4NX0A 1HKKA 1XC6A 2JIWA 5IBXA 4AF0B 3K1GA 1QW9A 1PDZA 3B3DA 5CG0A 1GVOA 3T55A 4WJEA 1I1XA 2MNRA 1GGOA 1P0DA 1RJQA 1GHSA 1TWIA 1RCOB 2E4TA 2Y8KA 4S3JA 3NSMA 4PMOA 3ZYZA 3BCJA 2FFCA 2TMDA 5M1TA 2G8ZA 3SI9A 1HP5A 3GR7A 3RITA 5TNVA 1AA1B 1OB0A 3DI0A 2NQJA 3N4EA 1F3WA 2P5NA 3O6CA 3WK1A 4LAOA 4UFHA 2VZOA 1WZAA 2Q8LA 1XLEA 1EWDA 4TX6A 1E6NA 1IR1A 1WE5A 1SW0A 4D6FA 3BG9A 1RBAA 2ZDRA 1PWLA 1V3KA 1W17A 1XD0A 5DN1A 2QJHA 2Z2AA 4H6QA 4WZHA 5A2CA 3BQ6A 2VQTA 3MP3A 2PU1A 1D7FA 3S6DA 2JKPA 1Q2RA 2WB5A 3WFLA 1SGJA 3V18A 2Z1WA 3GDRA 1BWVA 3DKLA 3KL5A 4BQ3A 3N6QA 1EFZA 1PV8A 4IFKA 2BVDA 4QDPA 1LT7A 2X2GA 4DBDA 4RLIA 1Q5MA 1YNQA 2JE8A 1UD6A 4M7SA 3DHPA 1XQLA 2CXGA 1T5AA 5F4SA 4PE8A 4CU6A 3VIMA 1GQJA 1YDYA 1Y5VA 1PPIA 2OR2A 1D9EA 4G7EA 1OIFA 5E09A 4GYFA 1AJ2A 1TWWA 1X6UA 1XUZA 4ECLA 3G1YA 2J62A 4JCMA 3VE9A 3CYVA 3G8EA 1PZ1A 3O05A 1VFMA 3G1SA 3QRHA 3OZPA 3FKRA 4GBDA 3WLLA 3CQHA 3R8HA 3F4DA 1UWSA 4GVGA 3A9BA 4B5UA 1VBUA 3PPCA 3GC2A 1E1CA 2OB3A 4Y9AA 1XIGA 3VPLA 1AD4A 3GNRA 2Y5EA 3AMDA 4S23A 5K2ZA 4AYSA 5LZLA 4XWUA 3ALGA 4W8LA 4WJ8A 3CGTA 4PCTA 3VX0A 1TELA 1B2YA 3R6IA 1Q66A 4UNKA 3MI3A 3NR0A 2UY5A 1UR2A 1GHRA 1WV2A 2O4MA 3WUFA 3M16A 1Y0EA 3HM7A 1RLDA 1SZEA 4ZOAA 4JQ3A 1PYFA 2ZZ2A 5T26A 5HNUA 3TJIA 3IJ7A 4J2MA 2WHMA 2VM8A 4N4PA 3I6TA 4JIPA 3ZQ9A 2VFDA 3BW3A 2CERA 4QNWA 3KVLA 1XLHA 2QDGA 4NX5A 4UR9A 3HOJA 2EXOA 4NAEB 3CNYA 2IMRA 3W2MA 2GJNA 3TXVA 3S1XA 4GZIA 5GNXA 3VFCA 3AYRA 3W28A 3L4ZA 2XIMA 1GVIA 3HMJG 3QR0A 4LH8A 4R9OA 1PX8A 2VRJA 4MPKA 1KTBA 1FDYA 4IGNA 5LHEA 2FTYA 3M0KA 3C56A 3CIXA 4IL2A 3WNOA 4DYKA 2BZNA 4CCCA 1UUOA 1YTKA 2AL2A 1JYWA 1R9YA 1CLKA 1G0CA 1Z9AA 2PSNA 4K39A 4KIEA 4DZHA 3D3FA 1XPYA 3GIYA 1CECA 3VKBA 1UQZA 1E51A 3UGRA 5JUVA 3W73A 2HQAA 1QTWA 4RE0A 1VPXA 4K8HA 2HE5A 2QJNA 1CEOA 1JR1A 1IYXA 1MUWA 2RDWA 3A13A 1KFLA 3U2ZA 4XZ9A 1PHQA 3STFA 1FXPA 1FWCC 4WOZA 3QR3A 2QQ6A 4PTNA 1F6KA 3GLCA 1R9ZA 2INEA 4MKVA 1PO9A 2PFHA 1VD6A 1POJA 2GUUA 1XIHA 3DG6A 2C1HA 3W6YA 1TRDA 3BH4A 1ZCCA 1LJYA 3VA8A 3CZLA 1BRLB 3VIPA 3V4BA 5L9FA 4UXDA 3KOFA 3MWCA 2I16A 5K4XA 3CU2A 1KO0A 5E0FA 3T7VA 3VXGA 4DM1A 4U4MA 2E67A 3URQA 1TA3B 3NL3A 1TMHA 4AD3A 1XLGA 3W02A 3ZZ1A 2BGNE 4JX4A 1KQZA 2V5BA 4H7ZA 2VEIA 1S1PA 3M7WA 2PDIA 3G0XA 2I1OA 2PWGA 4P8XA 5FSEC 3SN0A 4HA0A 5LA2A 1CX9A 2ISSA 1GYMA 4S3BA 3BK0A 1QW7A 2YA0A 4LUTB 1EJ7L 3S42A 5M03A 3COTA 1YEYA 3M1ZA 1UWUA 1J0IA 2ZUTA 2G3MA 3M46A 5BXPA 4MY8A 4HN4A 3I10A 3P84A 4YCPA 5AC7A 4H9VA 1BWLA 5M17A 1A0EA 1XFCA 3VNZA 4YYCA 4O14A 3LHUA 3NQVA 5XIMA 2DUXA 5A5WA 3MUZ1 4ZXOA 3CUHA 3PS7A 4GD0A 4GHRA 4DBWA 1J93A 1UMLA 2JGQA 1M7JA 1PTAA 1S3TC 3LK6A 3RG6A 4GUFA 4UZUA 3S1GA 2PGFA 3G1XA 5C70A 5AYZA 4EWJA 1LRQA 2YFOA 2CITA 3VK5A 1DQWA 4JR5A 4IQEA 4AWSA 3IPWA 3WLTA 4KEUA 2ZE3A 5C9WA 1F76A 1F6YA 2WMHA 2E5CA 4WOQA 1IXQA 1XUUA 3QHMA 4UFKA 3GHTA 5H8MA 3FX4A 3VYLA 4CNNA 5FESA 4GXWA 1H0GA 1RP9A 1QNQA 4KEZA 2F61A 3WZ0E 4Q7BA 4A6GA 1CWYA 3AXIA 4H7CA 5E5CA 2OLAA 1A5MC 3UZZA 1MVYA 4OT7A 4XAPA 4O0KA 1N8FA 1XDMA 1XIJA 4TR9A 3ZT5A 1ML1A 1TR9A 4OBTA 4J28A 1EH9A 3OQ8A 2AKZA 2V3EA 3AYSA 4QEEA 1B3ZA 2ZXAA 2QUTA 1XINA 5FI8A 2R1LA 3B8VA 4AD0A 1I0BA 1XSKA 4M8UA 4RJEA 4J3WA 3WMBA 3UXKA 4Q8QA 5JQ9A 4RDZA 4LUSB 1L0PA 3CH9A 4PTWA 3W1NA 1VHNA 4M3PA 2QGYA 3LENA 3S5ZA 4PC8A 1P48A 4H2HA 2RDXA 4JHOA 3RILA 5REQB 1HKMA 3CUFA 3U6WA 2D73A 1D7KA 2HS6A 1WYIA 2IKJA 4PMRA 4UOZA 2FH8A 1N82A 2RDTA 4MYXA 2CW6A 3GVVA 3QBUA 3AXKA 2BY2A 3PWIA 1KFCA 1DHPA 1XBXA 4LTSA 2V30A 4PFMA 4EXAA 3VD3A 4X9YA 5FJPA 1WP6A 3QV6A 3AHTA 3TA9A 4GIRA 1LM1A 4WSJA 4O1CA 3TQVA 1XFBA 2NLYA 2C0AA 2VC6A 7CGTA 3WDIA 1TWZA 3RK8A 3IK2A 6REQA 1MUMA 1T41A 4QE5A 4JQAA 5A6KA 2EPKX 2AAAA 3A4XA 1CCWB 2WNZA 1JIBA 4J2PA 1LCOA 4E5TA 3MI2A 3LLDA 3IUDA 4FNTA 3RUBL 5BOFA 2CLLA 2W27A 3VDBA 2VMFA 2PB1A 1DIKA 3RDKA 3BL3A 1C8QA 3MMWA 4IQDA 1L8PA 3EB2A 2PRMA 1OFRA 2Z26A 2GVEA 3IVSA 4GCXA 3C0QA 4NNBA 5F4WA 4E4PA 2H9AA 1LOSA 1UR1A 2Z27A 3LM3A 4FS9A 2P1FA 3MSDA 1QW8A 3FNDA 4MJ4A 3I4EA 2EAWA 3SM0A 4GX8A 1IR2A 2DSVA 4M82A 4B92A 1XI3A 1H41A 3H2MA 3M0YA 4F0SA 2I14A 2V5LA 3BSMA 3UZWA 2XGIA 1E40A 1TPUA 3UYIA 3PJXA 4NUWA 3BQ5A 3UPMA 1E1EA 3TFXA 1I45A 1DXIA 4X60A 3WQPA 1TPH1 3N29A 3KL0A 3LERA 3FLUA 4QP0A 4S38A 3NA8A 1AQHA 4RNHA 4QGCA 3CBWA 1EJVC 3OHIA 4ICNA 2ZA2A 5CSUA 5KMYA 4B5XA 1U1JA 2G0WA 1EO5A 1LTDA 2FB3A 4ZQPA 2OMAA 4IXHA 4CQDA 2PBGA 3S4TA 1IGSA 4JFSA 5ABHA 4V33A 3WMCA 1RR2A 1ITCA 3CZKA 2J7DA 3SBFA 4CUCA 3DHUA 4PRWA 1RPXA 4N42A 5CCZA 4LVGA 3Q94A 2ACQA 1A0DA 4UTWC 2OZ0A 4DAFA 1UR8A 3GXNA 3QN3A 4GKTA 1W3JA 3JZEA 3ZS4A 4DWSB 4G1KA 4NI3A 1PTDA 3KZSA 4GI9A 3WO8A 3W82A 1HKWA 1UKPA 5HUOA 3BOXA 4ERIA 4O11A 4FOUA 1V79A 4Q8UA 1YW1A 4AXKA 3MWAA 2REQA 1P6BA 5LA0A 2O9TA 4MIMA 1ISVA 2CIPA 2J27A 3FA4A 3TVAA 3M5VA 3UFYA 1VJZA 3S2MA 1WDPA 3O1NA 3QGAC 1GVSA 1PWMA 4AZCA 3TYUA 3EKLA 2I17A 5CH9A 5E1QA 1NIUA 2PI6A 2EBNA 2VVSA 3WCZA 4O1AA 3UGVA 5CJ5A 2WVSA 3QTPA 3RRAA 5KZ6A 1ADOA 2J47A 2JGYA 1XDLA 3NJ3A 3K13A 3TE9A 2CU0A 1F5ZA 2WZIA 5D4YA 3GD6A 1TYGA 5C9ZA 1EQCA 3W85A 2WKLA 2J7HA 2NWRA 1AQFA 3TNOA 3M43A 3LI0A 4PEEA 3TQKA 3OA5A 4HP5A 3W7GA 3MS8A 2A3HA 3C2EA 3O6AA 3TQ0A 5DLCA 2CLMA 1QASA 4P7QA 1NDYA 2XINA 1SYTA 3ARTA 4QXIA 4I7WA 3WENA 4MJMA 1XW8A 1MFVA 2A2IA 3KCJA 4DLFA 1GPFA 2D22A 3UPWA 1V4YA 4JTFA 1BVWA 3P2VA 2QCDA 4B90A 3TYBA 2ZTKA 3WF1A 1OT1A 3GTXA 2CLIA 2WSPA 3SN4A 2IKGA 2PDUA 3FEQA 4PCNA 2FDMA 1ZBVA 4N4QA 1GORA 2WXDM 2DZUA 3ISIX 3WH8A 4JTJA 4HZ6A 2VELA 1VQTA 1GQKA 3H6OA 2V67A 4X63A 4CD5A 3BDKA 2HEJA 2VVNA 2D1ZA 2QUMA 1N8IA 2PDKA 4RZ5A 1BXNA 2QPSA 4AD1A 5C9UA 4QG6A 2W66A 4QR6A 3RPTA 4JX6A 4MB4A 4JFTA 1H09A 4FLRA 3UR2A 3CLWA 1VCGA 5FSDC 1OFPA 1C7SA 2GDQA 4GABA 4PBEA 4Q3MA 3V0TA 2VOMA 3W2UA 4IIGA 2ZZ6A 2I5IA 5I3HA 1QPOA 1F3EA 1NSJA 3RMEA 3W3OA 2R6OA 2F38A 2E1WA 1NDVA 4HA3A 1MEHA 3T8QA 3M47A 1JUEA 3AO0A 6REQB 3LLFA 1JD9A 3GIPA 5CPQA 4F3HA 2QCFA 4F4RA 1RP8A 3EPOA 4DX3A 3PSVA 4GRSA 1XPGA 1PKNA 4H8UA 4MZ8A 3EWXA 3CB3A 4LC8A 1EUNA 4YPJA 4WKAA 3ZJ7A 5KZDA 4HPJA 3VAVA 5C8BB 2WZEA 4G7EB 4RDVA 4YMZA 3OVQA 2YZRA 2ZX6A 3AU2A 1L2UA 3W22A 3SURA 4G6CA 3KBJA 1OABA 1XLMA 2E68A 3F2CA 4G1NA 4LYRA 1UB3A 3ITVA 1MO0A 5I02A 4L4MA 4UB9A 3GX9A 3A21A 1B3VA 1EZ2A 2Y8UA 3H12A 3T0DA 5EMUA 2OVLA 1KXTA 3PPGA 4F40A 1XIIA 7ENLA 1SJAA 1CZ1A 4X0NA 3DG7A 2XVGA 3S5SA 4BEQA 4WF7A 3NTYA 3UJFA 4S3EA 1MEWA 2J9ZA 3A3HA 3KBWA 2EPNA 3OTRA 3VGHA 4LWWA 3DKJA 2PC8A 1ISZA 2NV2A 3TZNA 3VCCA 4EXQA 3WL0A 3GHSA 1ZL1A 1WNOA 1MYRA 5LKYA 1OY0A 3FS2A 1F3TA 2YL5A 1OBAA 7TIMA 2MUCA 2QJGA 4P8UA 2O4QA 3CZ8A 1TPC1 4CGTA 3W7CA 5D04C 4O12A 2G41A 2NQ9A 3L4TA 3CAKA 1C9WA 1NVMA 2INFA 3WQDA 2UWFA 1T8QA 2AMXA 4J5NA 2A1YA 4FF5A 2ZC8A 3PNUA 4QQUA 3HG3A 2BVTA 2OSWA 1UW9A 2Y88A 2IS7A 4RKAA 1K7XA 3KP0A 1JCYA 1ISYA 4A8LA 1TTQA 1HG3A 1J0ZA 1AODA 4BR1A 4YCOA 1EO7A 2D3NA 1A50A 5H8PA 3SCRA 1XISA 3RX2A 1GNXA 3IGSA 4O0QA 1RK5A 4BY3A 1A5OC 1LL4A 2RAGA 4LVDA 5HR6A 3I3BA 2DSUA 4G8TA 4DJEC 3I3DA 1OGBA 3LZ3A 4EAYA 1V6UA 2OFJA 3EOOA 1JYNA 4Q8PA 3W53A 5D38A 4CCZA 4H8NA 4M1BA 1R47A 1O7AA 1JPKA 4S3AA 4INFA 1M01A 1ZJBA 2A6NA 6TIMA 2YBTA 4J35A 3SCUA 4LPCA 3GG7A 4LUTA 4IQJA 4CLMA 1ME8A 4MB1A 4MUPA 1MNZA 1MW0A 1FWSA 4B4FA 4Y90A 4PMQA 5E9XA 2YL9A 3TW7A 3AROA 4JYFA 1U83A 1VFHA 1W1IE 3RPMA 3HIJA 2EEXA 4FXRA 3CPRA 1TX0A 1U5VA 3L2LA 4YJ5A 3S5YA 3IGXA 1TV3A 4ZO8A 1YPIA 3TLLA 2DUAA 2OU4A 3N34A 4LCQA 1H0IA 1CXEA 1XRTA 3N73A 3FDKA 3LI1A 5G1MA 3HPFA 4H4IA 1Q6QA 4RX0A 1ZSXA 3UXDA 2WHLA 5J8LA 1NF7A 3SCTA 1AQ0A 1X8FA 4LRSA 1PIFA 1J2BA 2VFFA 5FD0A 2E1DA 3W6MA 4W7WA 2OZTA 5CBJA 2Z7GA 1LBLA 4AIOA 2WJDA 4QJ4B 4QSFA 5CG7A 1HJSA 3GTFA 3PBMA 4YS1A 4P5UA 1VB9A 4GUJA 1BVZA 2CEQA 4O50A 5EMLA 3NSXA 2J4GA 4RNIA 4TV6A 4KEVA 3GS6A 1T96A 1LDCA 4AD4A 3H54A 4QLLA 1JXKA 4HMEA 3A4JA 4NXSA 3V1PA 3MP4A 3TV8A 2PDWA 2G95A 3C0JA 2Y5JA 4MFDA 3DI1A 2GL5A 2PRHA 5DXXA 1KWKA 6A3HA 3TYZA 3W0KA 1A5CA 4OVXA 1SMAA 3KBSA 3VOCA 2XH2A 1ZPTA 4IFKB 2J8TA 4UQCA 1ITUA 4PMVA 1K9TA 4S3FA 3UBPC 4OHQA 5LIWX 1Z8AA 1KFEA 1B4KA 5JMUA 3WQ4A 4IISA 1TVLA 4JYEA 2B81A 1KCKA 2W63A 4JTAA 4H9XA 3BPWA 3P8IA 4I9JA 4FALA 3MUY1 2XFWA 2BHZA 4X2RA 1QATA 1V0NA 3ZLFA 3ERPA 2X7VA 3KS6A 4JDBA 4ENLA 3HU7A 1G01A 3WF2A 1UUQA 4XAGA 3BANA 2VCBA 3WLRA 2VKZG 4ROQA 1BYCA 2JF7A 3GZAA 5C5YA 5A6SA 3BOFA 1NOWA 5A8PA 4GXPA 3SQSA 1YX1A 3K5XA 6CGTA 2VURA 3ZVIA 3VGDA 5HMFA 4J3VA 4L1WA 2Y4SA 4AC7C 4LCRA 4IIBA 4QE1A 4R34A 4CNOA 1IT0A 2Z7KA 4B2DD 3NCOA 2IPFA 1K8ZA 1Q6FA 1HVQA 2CBUA 1VBGA 4ZO7A 2WZMA 4YTRA 1KCLA 2NQZA 2X42A 5HJXA 1WBJA 4C7DA 2PURA 1CXKA 5DRCA 4BS0A 1KLZA 1UD2A 1EDQA 2BTMA 1NTHA 4UBPC 4DZ5A 2ZX7A 1L6YA 2R94A 3DEQA 3MKCA 1S2VA 2E25A 4MKSA 3BLDA 3N2CA 2VI0A 3HV8A 5DMYA 5K4ZA 5I78A 1ZJAA 4HSOA 3VIKA 3AXHA 1DJZA 1FCBA 2PDLA 1PE1A 3N11A 4UWMA 1GCYA 1W54A 4S3DA 2ZZ7A 4HNCA 2VNCA 2RUSA 5AHMA 1AJZA 3NDZA 2WLZA 3NPVA 1JDCA 3ITLA 1J12A 3LXAA 3FGCA 2YR1A 4XVEA 3GQYA 3JVAA 3T08A 3GSMA 1M53A 1H5YA 1TIMA 4WRHA 3LHWA 3U2EA 1W1VA 3E6EA 3PN8A 2XWEA 1QK0A 1AW2A 1R86A 2NT0A 4UQEA 3P82A 2B4GA 1TIWA 2XG9A 2ZX5A 4HIBA 2VWSA 4F2BA 5CXPA 3VKJA 3EX4A 3PAOA 3QM3A 5IRPA 2GLKA 3VNKA 4BI5A 3IJ9A 4D6EA 4I8DA 2DZWA 5I3DA 1BFNA 4ZOCA 4H6EA 1VRXA 4MDPA 1RQHA 3CQ0A 2NVDA 3QJAA 1SFLA 4G7FA 4NAFB 3EEGA 1VEMA 3MYOA 3TTEA 1YIXA 3SGUA 2PLMA 1DTNA 4URIA 1ECQA 1OQFA 5C9XA 5EMKA 5LHFA 4N6EA 3SRDA 2DP3A 1W2PA 1I0DA 3DERA 4MLJA 4JFWA 2NX9A 2OSYA 4DXKA 1KBJA 2VOTA 5LNRA 3TA6A 1HX0A 1I2QA 1VEPA 3G6LA 2PC4A 4XV0A 2OEKA 4HJFA 1WPCA 1U22A 4F48A 3KDOA 3VNYA 1ZAJA 3LGDA 4JTEA 4H2CA 1BQCA 5CQ1A 1YMYA 3L67A 4Z2LA 3C2YA 9XIAA 1MRAA 1VBRA 3E2VA 4LCSA 3UJ2A 2QCGA 2OQLA 1J9YA 4M6VA 5I23A 1XP3A 5DCEA 4LC6A 1R2SA 2J24A 3IJDA 2VDIA 4PUUA 4EK7A 4GIYA 4E2OA 3UWVA 3LBCA 1LL7A 1K70A 3GXIA 2POTA 3K2GA 4MWAA 4O8AA 4ZB5A 1CTNA 1XH2A 1IIGA 3GB6A 1DTUA 1A3HA 4POCA 1VFLA 4HTBA 3T42A 4C6KA 4WY0A 2ZUUA 3M6YA 4BQ5A 1PUDA 2EJ1A 4CCEA 3HMCA 5A6BD 4IHCA 4EXBA 4R3UA 5LNVA 3LCWA 5H6HA 4O1DA 1UOZA 5I0DA 2G50A 5BOEA 2IPWA 4NNCA 2LLEA 2CZFA 4ZGYA 1W1ZA 3DH7A 2J25A 2G96A 2H6RA 4IGHA 1DWFM 1W3HA 4K8GA 5MHBA 1FWHC 5I24A 3DYMA 3ITGA 1G5AA 2Y63A 4LUSA 3VIFA 5CLTA 1RY0A 1XYBA 1TVPA 2ZVRA 3HFYA 2FZBA 3PB2A 3W7LA 2WYSA 3PUEA 2BY0A 3UWQA 2EF9A 4XZHA 4JTIA 5HULA 4DZIA 4Q8NA 1S5WA 2XVLA 4Q8TA 4YN5A 5A95A 1JZ2A 4ILSA 4KKXA 5GPRA 3Q37A 2VEKA 4JN8A 4NIRA 1SO4A 4NASA 4HHHA 3M41A 2J75A 1TZZA 2WCGA 5GNZA 3WMLA 2XDFA 2DSZA 1QOXA 5AC8A 4ZO6A 1UZ1A 1GPWA 4GK8A 2TSYA 2PP1A 4KWWA 4L9XA 4KCTA 4B3LA 1VR6A 3AMCA 3DZ1A 1LOQA 3RLVA 1BYAA 4N9EA 5A2BA 2BODX 2Q71A 4RPQA 1GOQA 2VDHA 1SJDA 2QCMA 1OCJA 3ITXA 1RK6A 3SY5A 4NT0A 2EG8A 4ZQMA 1O5QA 3W1LA 1J5SA 4XSMA 2XWDA 2O0TA 3NZ1A 2X7WA 1TPFA 3T05A 3NQ8A 3WFZA 2GQ9A 1IWAA 1GZGA 2PWUA 3VNLA 2OEMA 3STEA 4AXNA 4KRUA 2NWSA 2Q6ZA 2EHHA 2OGJA 4AD2A 2YW4A 3IACA 2GQ3A 4HNLA 3RYSA 3UR8A 1G7VA 3WQ5A 1D3CA 1KM3A 4KCWA 4B9YA 2GVJA 4AZBA 1I8JA 3T0TA 4D6IA 3C86A 3D6NA 1BD0A 2HVNA 4KCUA 4FR1A 3T2PA 1LP6A 3OBAA 1GVYA 3T4WA 1ZHAA 3W7NA 1C29A 2C7FA 3NNTA 3NQMA 3SCQA 1F4HA 3IANA 4QTGA 3I7SA 1IEVA 2WHJA 4FXSA 4UUIA 3W7MA 3DG3A 2VC7A 3W1XA 1P1MA 3VD7A 4GWEA 3P81A 1TZ7A 4ZEPA 3GXMA 1ZGDA 1UD4A 3OQEA 1M68A 2FLIA 2QCLA 3TMLA 2FPYA 3CHDA 2XU2A 3QMTA 2QCDB 4OKDA 2V0TA 3HTWA 3NG3A 4E38A 3QV9A 3W86A 2VRKA 2X30A 1AUSL 1XBZA 3VE7A 1X38A 1W1YA 3T0BA 2NUWA 2V63A 2OEJA 3STGA 5F7UA 4PBGA 4HNOA 3VOFA 2DJXA 4ZODA 1RBOB 3D5HA 1C8VA 4DO7A 4QSHA 4DYJA 2VZTA 2ZUNA 2CNCA 3NVTA 2PS2A 4FNSA 1RA5A 1UBPC 3RCMA 2WWCA 3GNDA 1J79A 5FEXA 1C7TA 1ZB5A 4HK7A 4XK2A 1JUBA 2X16A 4LUIA 4F0KA 2NQLA 3LCGA 1TKKA 2F6KA 5A8QA 3OLEA 3UG3A 1BG4A 3P0XA 4EPDC 1EP2A 3SDOA 3E0LA 5D8WA 4UTTC 3NM1A 3H7VA 4XIMA 5A6BA 2Z6JA 1THFD 4HMCA 5FJJA 2FVKA 2GSEA 3AIRA 5CZTA 1RY8A 3H4GA 3R0DA 5M3WA 3N4AA 5CPLA 5CC7A 2E0PA 4IP5A 2PDMA 2ZBTA 4QAWA 3LPGA 3WLIA 1Q8JA 1TJRA 4LQ1A 1BF6A 4IMAA 1BPLB 1GEQA 4ADUA 1I2OA 4ATLA 1XLJA 4LS0A 1S46A 3WQWA 2Z25A 3JU2A 2CKRA 2VEGA 2PUZA 4UTJA 4XZBA 2WSRA 2YPIA 3PZ9A 3M0VA 3JZUA 1JL8A 3IIPA 3BLEA 4HMDA 3GXTA 1V6TA 2Q09A 3NQCA 1YPXA 5F2LA 1YRRA 3GDKA 4DZAA 1UJPA 1IT7A 2X8RA 1A53A 2GPTA 3RR4A 2BOEX 3VCNA 4L6OA 4JS3A 4AHOA 4FX6M 4JN6A 3FK4A 2EGZA 1FOBA 3BW2A 2XISA 4F0LA 1VYRA 3CUXA 1IV8A 5KSWA 2W6RA 2BSLA 3HA1A 5KTLA 2Z00A 2E3ZA 2DU2A 1EB3A 1JEZA 3ABSA 1A47A 1OK4A 4GXMA 2IKIA 2XIIA 4NY2A 1GJWA 4GG9A 4QE4A 3QSRA 3H7UA 4EAMA 3GDLA 3P62A 4WJXA 4CKQA 1EKOA 2D24A 3H2CA 4HPGA 4N0RA 3IIXA 1OFOA 2R1KA 3IJ6A 4Q8OA 2PDCA 2YKKA 2NSOA 5D8ZA 4IPLA 2EJAA 4MOZA 3R7MA 1E9LA 3EOUA 3VKAA 4ZOEA 4JQ4A 1PHWA 1EP1A 2TODA 3RX3A 4LVBA 3K4WA 1T8XA 1DYSA 3LBMA 4L1XA 3U2CA 3NZPA 4C6BA 4PTDA 2W3ZA 2QPXA 1MW2A 4F9DA 3PG9A 3UPBA 2UY4A 4XTIA 4REQB 3DC0A 2HJPA 4F0RA 4RDWA 2EPOA 4KWSA 4Q7NA 3MA8A 3KUMA 1WUEA 4GISA 4CNUA 3WSUA 4L1GA 3TN3A 1X6LA 2A3CA 1XLLA 4I9TA 1VEOA 1GQIA 4BJHA 1FA2A 2HMCA 4FA3A 4HZ8A 3E0VA 3NDYA 4S39A 3N1AA 1V6XA 3H23A 1T99A 1EPVA 1RCXB 3FJ4A 5K3VA 2RGMA 4S3KA 2GVGA 3DN5A 3S8HA 3UNDA 2J66A 5IDIA 4YU1A 1QWKA 2BFGA 2FZNA 3KVMA 4HK6A 5DCDA 4O1EA 2Z2UA 3H2EA 2RDUA 4CD7A 4LJ3A 6ALDA 1UBSA 4XAZA 1G4PA 2ZA3A 3KRZA 2ZADA 1W1TA 3IJLA 4XD5A 2OELA 1B5TA 3OGSA 4GMEA 4UOQA 4FEZA 4ERGA 4UQBA 3ABZA 2VRQA 3R10A 4B3ZA 3N19B 3R58A 5GQBA 7TAAA 1C3FA 2QLYA 3A5FA 2I9EA 4BCEA 4ZE5A 3OG3A 1PL9A 2RJHA 5DBTA 2WVUA 4H04A 3ZSSA 4DJDC 4X61A 1KRCC 4Q4MA 2G3IA 3ECQA 3VGFA 4D6GA 4TMCA 4XZMX 1OG6A 1Q13A 2G3NA 2XSXA 3THAA 3UJEA 3B9OA 1J4EA 3HB9A 1OJXA 4HU8A 1NDZA 1Z42A 2DT0A 1ADSA 3VC6A 1KRBC 3G1AA 4OE7A 5AOUA 3TU9A 2WC3A 3WN6A 2ZIDA 1GONA 3QXBA 3R94A 3S3GA 1LWHA 3OVPA 1BYDA 4RZ4A 1EA0A 2XM1A 1DIDA 3AYTA 4DUXA 2HXUA 4AH7A 3N12A 1PKYA 3PZGA 3GG0A 3W87A 5BCAA 2X0YA 3CQKA 4HNTA 4GJJA 3WD4A 3N3MA 3CQIA 3K8LA 2FGBA 1OG0A 2ZUWA 3VX1A 5CBIA 1CXHA 3THDA 2Y85A 4LU0A 3O16A 3BSGA 1EXBA 2YA1A 2OTDA 3V5OA 3WH6A 1EJRC 2WHKA 3L4VA 3CASA 1JD7A 1BXBA 3L4XA 1QU4A 3CXOA 4TO8A 3LPOA 3LCIA 4ZENA 4F66A 4KERA 3RR1A 4E8GA 4JTTA 4N9BA 1GG0A 4IG2A 4NG3A 2F7FA 1XKYA 2PLKA 3VUSA 4WDTA 2P0OA 1XIDA 4S3GA 1ZCOA 3MSYA 3ARXA 3SIMA 2IKHA 3D3AA 1A3XA 4TTGA 3OYZA 4UFMA 1W5PA 3GK0A 3NXLA 4Q4KA 1R2TA 4GYJA 3WNPA 1KB3A 3U5UA 3GXFA 4JIHA 1X7IA 4DJDD 1UWTA 2J6XA 3SGGA 3FN9A 4EPKA 2WVTA 3B8TA 4BF5A 4JAWA 4FLOA 3B9EA 4OQVA 5AYXA 4DIAA 3PPFA 2F2KA 4GYPC 1SFTA 5AYIA 1MXSA 2DVTA 2WO5A 2XIBA 5LNUA 2EKCA 3URBA 2E5DA 4GVIA 4DBUA 4OU1A 4V1XA 2DV0A 2GQAA 1FBAA 4ZTXA 1NH6A 2CZ5A 4I7UA 1MEIA 1QHZA 1RAKA 1SVDA 4B91A 5EGRA 4NZ1A 1AJ0A 1LROA 3B0UX 5JIWA 4JGDA 2TRSA 3LUTA 3AISA 1ICSA 3HPAA 3PP7A 4KCVA 4Z2GA 4W4QA 3CC1A 3IGUA 3M0JA 3HFTA 5BXTA 1T7LA 1OCBA 3WNKA 4IWWA 3J7HA 2Q3OA 2BLEA 5CEWA 1M7PA 5ABFA 4D6HA 1TJPA 3SB0A 3IRDA 1UWIA 3K8MA 1HQTA 3A9IA 4UTLA 3S9IA 3E38A 5FCZA 3LTPA 2NX3A 2VL4A 3ITOA 2W9MA 1ZLPA 1AW5A 6PTDA 3L23A 3OG2A 4QDMA 3FYOA 5B80A 4O4VA 3CLMA 3WJSA 4U10A 1W3KA 2ACRA 3QZEA 1H7NA 4OBRA 1X39A 3ZSTA 1WKYA 2P10A 2E9MA 3L2MA 4NZ5A 3W7KA 5AY7A 2E9LA 4UQDA 3A47A 1PCWA 4UCFA 1GOKA 3DFPA 2IUZA 3H70A 4JTRA 2O56A 5EU9A 3FV9A 5BU6A 4WDUA 4BA0A 1IXPA 5H91A 3HG5A 1AW1A 5MF5A 1MXDA 2Y5SA 4JYDA 1FWNA 3MZ2A 4LALA 2A7PA 1Z32X 3MV01 1P0BA 1QAPA 3U8GA 4ORMA 4ZSTA 4AY7A 5CZ0A 1FH7A 2YGYA 1JPHA 2A3BA 4IT1A 4E4UA 4H01A 2OWXA 3CT7A 1EF3A 1VLWA 3BAIA 1ONEA 3QPYA 3CO4A 1WAWA 1JXJA 3TW6A 3QMRA 3KLKA 3GKFA 2OYMA 4UTKA 5G1YA 2QNEA 1Q3NA 1OGSA 3IV8A 1MNSA 3AHVA 1P6WA 3PBVA 2VX4A 3WDJA 2QAFA 3FXGA 4E6MA 1TCDA 2C14A 2FH6A 4GUIA 2OT1A 1TSIA 1HKJA 1K9FA 3QY6A 4XUGA 3F2DA 2NXIA 1K77A 4XD3A 1KXVA 3W29A 2VZUA 5CGMA 4MAZA 2PTWA 5F1UA 3W84A 3OBKA 4NAFA 4UQAA 4H41A 2QV5A 1ICQA 2XIOA 4LYQA 4P7NA 4FK9A 3GU9A 4V1YA 1SZNA 4WGHA 2WKJA 3SUSA 3UWEA 4LX4A 5AC6A 1CLVA 2P3EA 4US6A 4W8BA 3F03K 4DN1A 4HJWA 1CENA 5LXEA 3CT2A 3VOJA 1T6MA 1O6IA 1FVPA 4PULA 3S2LA 4RW5A 1ME7A 4HYVA 4LYPA 4D72A 2PTYA 1D8WA 1SO3A 4PCFA 4M80A 1RV8A 3MV11 4JTSA 3GFZA 4WQ6A 3E2QA 3AIQA 4AVOA 1PSCA 3REQA 3B97A 4GY1A 4WR3A 3NPWA 5A6TC 3F7JA 4MUZA 4FPSA 3O6DA 3B0XA 1FWFC 3DESA 3VD4A 1V3JA 4BI7A 3NEHA 5ABTA 1HN1A 3O2LA 1ISXA 2X40A 4DF0A 3TIMA 2OODA 1R3TA 3NZGA 4OBSA 2R24A 4GBUA 3C8NA 2RJGA 3CV1A 2ISVA 2G4JA 1VLIA 3W00A 3NL6A 1QO2A 2CWXA 3T44A 4IMFA 2C1IA 3RCNA 4P61A 1VRDA 1JYXA 4D8AA 3U5YA 4KT2A 4K1WA 3TSBA 1K9DA 4DRSA 4L64A 1S38A 3URAA 2XH7A 1ONWA 2CHNA 1Y65A 4ZQNA 1V02E 1KGWA 1FCVA 1UH2A 3N6HA 4A22A 3MCNA 1O5RA 3APTA 1B9BA 1KFJA 4UMAA 3M0HA 3TC3A 1RUSA 2DSWA 1OM0A 4Z1BA 3MT1A 3TNBA 1JPMA 5HAOA 4B3KA 4HGXA 3E02A 3JW7A 4ML9A 3ZR4A 5DMNA 4DNHA 3OIHA 3PFMA 5FF3A 3SFWA 2I5QA 4IICA 4UR8A 3E1F1 1BSIA 1A3WA 2QVNA 3ONBA 4GC3A 1JYVA 3L21A 4YTTA 4X2PA 5I3GA 5AHNA 1UQYA 5CPNA 3QV8A 3ABRA 2XVPA 3OB8A 4GYPA 4AEOA 3S0CA 4O10A 1S2UA 4RW3A 4PUDA 4EIVA 1TCMA 3E3HA 2Q8ZA 5ECVA 3DAQA 1QK2A 2WQPA 4OGZA 4DVOA 3CZGA 2XFYA 3AJXA 1EJTC 2NXGA 2ZRYA 3UU0A 1HO4A 4G5DA 1QI2A 1ICPA 1Y8BA 3S9ZA 5I03A 1FTXA 2V3FA 4IPJA 5FACA 1TMQA 3UETA 3ES8A 1XICA 2WJFA 1R3VA 4AHQA 1JVNA 1E6RA 1EBHA 3BJTA 3ATZA 3FGCB 4IIDA 5I3KA 3TJ4A 3SUUA 4PSPA 4MPQA 4MSSA 2WJEA 3HQNA 2X1TA 4L5ZA 1KR1A 1VZWA 4DBEA 2V5CA 1WB0A 2DZXA 4MJ2A 4LY4A 4CD8A 1QI0A 5FJTA 2YL8A 1HUVA 2OYKA 1FP9A 1RVGA 3A24A 4ATDA 3H22A 5EFDA 4NKCA 2VX5A 4DUWA 1UOKA 2DGAA 1LORA 3S2CA 1QJWA 4UTUA 4I5RA 3BAKA 1QNSA 2ZWZA 1AK5A 3RO6A 2YCEA 4YTSA 3FYYA 5FL1A 4DI9A 4ICMA 2GK1A 3QYQA 3CJPA 1JI1A 3AHZA 4MLRA 5DELA 1KTCA 5I00A 3V35A 1HGYA 3W24A 1XYCA 1OD8A 1KM6A 3EX6A 1BRLA 5FEZA 2L5HA 3E0FA 4GA8A 3UZJA 4R7JA 3DFHA 3IS4A 4KESA 4M0XA 3CH0A 1IIHA 1A5BA 4NJHA 3WJYA 1LZOA 5HR7A 2YA2A 5IM51 2PDBA 1QDSA 4H7VA 3B8WA 2V5KA 1VCFA 4HPNA 2QCHA 2WZHA 4XVDA 5DXYA 1XLFA 3NXFA 1XL9A 4QS6A 3QLLA 1W0MA 4JICA 3CV6A 1W9UA 2A21A 3W7PA 4AUBA 1NWRA 3QGKC 2Y7DA 1TUXA 2DZPA 1I2RA 2JKAA 3LRKA 2HXTA 1BEUA 4QAIA 4DPQA 1IT8A 4X9SA 4AG0A 4JQ2A 1UJQA 4W87A 2PP0A 1H5VA 4O53A 1Q2SA 2PWEA 1OT2A 5BW6A 1JJKA 2E77A 2I9UA 1Q4WA 5TF0A 3VNIA 5DQPA 3KS5A 1DJIA 2BASA 2H8XA 4ZB2A 5AB3A 1XRVA 5DBUA 1AH3A 1S2TA 1KM5A 1GG1A 5LIXX 2Q01A 4BF9A 4LBSA 3VC5A 3B8DA 3AU6A 4GO9A 2VGFA 3MDUA 5C2GA 1UP0A 3EA1A 4NRSA 3UYCA 3LHZA 2R8WA 3FAXA 4U31A 3SECA 4H6KA 3ZWSA 1K8YA 2EG7A 3VOHA 4ZFCA 4EVZA 2AGKA 2HBVA 1GTHA 4BK9A 1RJRA 3DECA 5ENLA 3WUEA 3V0UA 2CESA 1G94A 3R11A 3W01A 4HOXA 1XGEA 1JNDA 3W7IA 3WK3A 3H2NA 1F9CA 4JIQA 3TJXA 1UHVA 4Y7EA 3H53A 3S47A 4NNAA 4GYKA 3UVAA 3ZWTA 3T0CA 4DF2A 3IAQA 3A3XA 4LW7A 2VEFA 4FOJA 3PTQA 5T9CE 1WXYA 2CCRA 3E74A 5BMWA 4C6EA 4H1ZA 2H90A 1PS9A 3MYPA 4AY1A 1RPKA 3WDPP 3LY0A 4A4AA 4IUGA 3N04A 4KFPA 5D37A 4BQ4A 4QRNA 4MB5A 2NSXA 1GK8A 2VXNA 2YJQA 3M0ZA 3ITTA 4GINA 4MHBA 1GUVA 3BO9A 5I2UA 3W25A 1VFTA 2CLOA 1FQ0A 4NJGA 4QEHA 2OCZA 3CQJA 2GUBA 5FAJA 3LV5A 2WQDA 1DOSA 3GH4A 3L65A 2X2YA 5T9BG 3UCQA 2OG9A 4REQA 3HF3A 3L9CA 1HIZA 1ODUA 2JEQA 4HA4A 1J96A 5D32A 5HA7A 2H3DA 2WOQA 3WH9A 1O66A 4FLQA 1IZCA 5I3IA 1JCXA 3WUBA 4PUJA 2F8QA 4DWSD 2AQVA 1SJBA 3KW3A 5KZMA 1XYAA 1FDZA 4MFEA 4NZJA 4D6DA 3B05A 1P5BA 2TPSA 1TV2A 3THQA 3TLQA 2CBVA 3DHDA 3BG5A 1VAHA 3GUGA 2NX1A 3C61A 4K1GA 7XIMA 5EA9A 7ODCA 2YB1A 2P50A 1KNWA 4C6FA 3R5EA 1KCXA 2BY3A 4W5ZA 4DBSA 1KM2A 5A6MA 1UUMA 2ZZ1A 1X7FA 4NI8A 3QFEA 3LQLA 4UFJA 2VO5A 3O07A 4IIEA 4U5IA 4Q4QA 2G3FA 3QR1A 2A3LA 4QX4A 1JDFA 3GTHA 2X05A 2OGYA 5CLWA 3UWZA 5K9XA 3MUIA 3Q4DA 4I7VA 1IWBA 3GR8A 2A4AA 2RH9A 3VVGA 2ON3A 2HBXA 1AZ1A 3W83A 5HUPA 2Z1VA 2YDQA 4J27A 1FXQA 3IUIA 1IXNA 3TH6A 3EOLA 1NF0A 1KWGA 5CC6A 2GDVA 3GVGA 3CAWA 3QW3A 3OVGA 3W7EA 5M5DA 1FWAC 1OFEA 4ERAA 3TFCA 2E9BA 2GGJA 4HYRA 2UY2A 3HPZA 2Y0FA 3LPPA 3BAJA 2ZFAA 3PWGA 1UCWA 5GJPA 1EP3A 3TTOA 1XLDA 2P3ZA 3LRMA 4LAMA 3AMLA 3GNOA 4ZCWA 1KV8A 3BCFA 5BNKA 1V0KA 4ES4A 3CTLA 1L2QA 1B90A 4TX9A 3RFAA 4AZGA 4UZSA 3EX2A 2D0GA 5CPSA 1S5TA 4UTWA 1R87A 3OLIA 1F74A 1LWJA 3VIIA 3LBOA 2ISDA 2HROA 2HK0A 3N4FA 1OX4A 4CNSA 3C8FA 4GQQA 3FJ6A 3E2RA 3SY8A 2E5BA 3EZ4A 4JEJA 1Y7VA 1W3NA 2TYSA 4Q4OA 1OX5A 2OXNA 4S3CA 1A49A 4PMNA 4LB3A 4Q6XA 2CHOA 1EGMA 4HCLA 1J18A 2OO0A 2Z24A 1QPQA 3W2LA 4BFAA 1WZKA 4KW2A 2DZVA 2BX7A 2ADAA 3GWQA 3N9SA 4YHGA 4DWDA 1IEIA 4E0CA 4OWGA 1LUCB 1G67A 2ALDA 2VC5A 3LGGA 3INPA 3Q45A 4CQCA 4YVPA 4NVTA 4R33A 3UY8A 3EKGA 3WJZA 1EYEA 2W91A 1J8VA 2GFTA 2NW0A 2DZAA 3R12A 3CHFA 2PA6A 4IG2B 2Z1KA 4JHZA 4XKYA 1JQVA 1P4CA 5JBFA 3L4YA 3WEMA 2DH3A 4RE4A 2R82A 1L6FA 1E4LA 1R30A 4WKFA 3S2NA 1ZAHA 4ZVJA 4DWSC 3S46A 4AHPA 2O92A 1HO1A 3L5AA 1UASA 1ZP3A 2X0SA 3TSDA 3T81A 1GW9A 2XPKA 5HWJA 3PBGA 4GQ0A 3XISA 3BCDA 4YWIA 4PA8A 3SIZA 5HWMA 5HPCA 3E9AA 1YTEA 2IQ0A 5HQMA 1NU5A 2J78A 4CD6A