4W7UA

Crystal structure of xaccel5a in the native form
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
313
structure length
313
Chain Sequence
b'HMLKYVGVNLSGAEFNSRKKPGTLFKDYTYPAASDFSYFAGKGMNTIRLPFLWERVQPELNGPLDQAQLGLIKKSLEAAKANKQYLILDLHNYATYSGKRIGTSDVPAGALADLWRRLALEFKDDKAVIFGLMNEPNGISAPDWANAAQGTITAIRKTGAKNLILVPGTAYTGAHSWRSTSYGVSNAKALEILKDPGNNLAFEAHQYLDKDYSGTKPVCTSDSVGQEKLQGFTSWLRENKQKGFLGEFATANNPVCDKALEGMLTYMEKNSDVWLGWTWWAAGAWWKPDYPFTVQPGKDGSDKPQMAILSKYA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellulase
publication title Crystal structure of XacCel5A in the native form
rcsb
source organism Xanthomonas axonopodis pv. citri
molecule tags Hydrolase
total genus 122
structure length 313
sequence length 313
ec nomenclature
pdb deposition date 2014-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4w7uA00
3WEMA 1KWKA 1E4LA 4MB5A 3KWXA 2ZXBA 1F4HA 2J7FA 1H2JA 4J3VA 1NWUA 4AIOA 3FNDA 5IDIA 3ZJ6A 4TTGA 1HF6A 2OSYA 5HPCA 4GPNA 1W9UA 1MFUA 4J3SA 3PTKA 3CUJA 3VDHA 4DUXA 1KGWA 3W25A 3WEZA 1TFVA 5IHSA 2J7GA 3FHAA 3TP4A 3WDRA 2ZUTA 4CCEA 4MNMA 1BYDA 7TAAA 4B3KA 3WNLA 4AW7A 5IFTA 2Q8XA 2XVGA 2WHMA 3CZJA 2E8YA 1AQ0A 5EB8A 3VNZA 2CBVA 3MKKA 2VX7A 4ZFMA 1UWUA 4M1RA 1LL4A 2WM0A 1UD3A 5D9MA 5KZ6A 1CXFA 2Y8VA 1GCYA 4P8UA 1AMYA 4Z2IA 1W9DM 3GNRA 1WZKA 3BAXA 4ML4A 5LA2A 2ZUMA 3L4YA 2OSXA 1SMAA 5JIWA 3AMDA 2Z1SA 1B3WA 3ARPA 2XJ7A 3K1DA 3WNPA 1K9DA 3IJ8A 2WSPA 2QV4A 2XGIA 4U5KA 3W6MA 3AZSA 3CO4A 1CTNA 1KQYA 2ZOXA 3N9KA 1BSIA 2CIPA 3UETA 5A6BD 2DDXA 3QOKA 2WVUA 4IPLA 4JKLA 2VRQA 2VZSA 1G94A 5HBFA 3DYOA 5EFFA 4K68A 3OLIA 1UWTA 1UD8A 3GNOA 3TTYA 3WMBA 1VBUA 1SMDA 2NSXA 1EO7A 4AZIA 2VCAA 2BHYA 2G3IA 3IJ7A 1HJUA 3MV11 2WLZA 4HMCA 4P7LA 3DHUA 3IAQA 2E8ZA 1W3KA 1GJWA 5ABFA 1OBAA 1JZ7A 1MYRA 4N42A 4U33A 4JFSA 3ZM8A 1J10A 1W9BM 4C7FA 2VCBA 3NSNA 4UFJA 1ZB5A 3AJ7A 1CGVA 1ODUA 1XSJA 3CLWA 4QLLA 4D6DA 1E56A 3II1A 1M01A 2VI0A 3WH7A 1HL9A 1B3YA 1PX4A 1FOBA 1WAWA 3MUZ1 4OUEA 4B3LA 2CBUA 4AZBA 1TVNA 3ZMRA 3WD4A 3WBAA 3EMZA 4F8XA 2W62A 1V6UA 1CDGA 3APGA 4UFMA 1UUQA 1OM0A 5LYRA 1V0NA 1KR1A 2RGMA 3BCDA 5D9NA 1UD6A 3PBGA 3PZTA 5AY7A 4A3YA 2WMHA 2EPKX 1BGAA 2ZXQA 5DFAA 3WDQA 1U33A 5A2CA 1HT6A 2WANA 1UR1A 3ZJ8A 1NOUA 5JBDA 4QCFA 1X1NA 2J4GA 1MXGA 1JNEA 5ABFB 4AY1A 2QF8A 2XM2A 4UOJA 4JHOA 1ZBKA 3WQ4A 3F5JA 4S3KA 3SUSA 2CXGA 4PMRA 5A6KA 3UESA 1U2YA 5GQBA 4MNJA 3AS3A 2XFRA 5D4YA 1BGGA 4AZGA 4M29A 1C8YA 1UKOA 4E2OA 1JZ2A 3W29A 3WSUA 5BXSA 3OA5A 4PMZA 1WDRA 3GDBA 1CPUA 1FHDA 4GI9A 5CG0A 1V0KA 2O9TA 1TA3A 3MU7A 2QPUA 4PUEA 3ZJKA 1R86A 4BQ2A 2WYSA 2DIEA 2WXDM 3HJEA 3W81A 1UZ4A 1BFNA 3TONA 3WDHA 5I6SA 1UKTA 2EPLX 3LPPA 3VIPA 4KGLA 4EANA 2D23A 3O9NA 2FHCA 4UQCA 1M03A 4Z2JA 3AI0A 1H0GA 1JD7A 3BSGA 3U5YA 1TUXA 2FHBA 3QHNA 4JL2A 4KRTA 2GJPA 4D1IA 2JIEA 1CGUA 4OIFA 2V5CA 3TOPA 1B90A 4H8UA 1V3KA 3O2LA 2WBGA 1H3GA 3EDEA 4J7RA 3ZT5A 2WCSA 4MPKA 1H41A 1V3MA 2XVPA 4B15A 1PIFA 4DWSC 2V38A 4CD8A 1V6YA 1EO5A 1PZ3A 1VFOA 1BYCA 2OYMA 2WKLA 2ZX5A 3ARZA 1E1EA 4HZ7A 4CD4A 2PBGA 5A8PA 1UOKA 2CETA 1NOWA 4EKJA 2YL8A 2WMIA 2JALA 2VX4A 1WDPA 4M24A 5CXPA 4PSPA 2G41A 1CYGA 3WNMA 1KXHA 2ZX9A 3GZAA 1TA3B 3PZVA 5FKYA 3VO0A 3AMKA 3LMYA 3RM9A 3EBVA 1XD0A 3CIVA 3GH7A 1Y7VA 4AISA 1CXIA 3I3EA 3L4TA 1ZJAA 5JIPA 1DWGM 1IV8A 4WK9A 1V3HA 4HTYA 5JUVA 3ZOAA 2WB5A 2X2YA 3N17A 4Z2GA 2BXZA 2WVSA 2YLLA 3GTNA 1HP4A 1NP2A 2UY2A 1C93A 4W8AA 1CZ1A 3F4VA 2NT0A 5I77A 1ZL1A 2VL4A 2GJXA 3LPFA 1PX3A 4UQBA 5I78A 1US3A 1CWYA 5EBAA 4W8BA 1Q6EA 2OWCA 2DSKA 1WKYA 1H4PA 1AQMA 5FL1A 1GOIA 2Y4SA 1C3FA 1PEZA 3IJ9A 2OLHA 3EYPA 4MDOA 5DO8A 5A6LA 3ZR5A 2WMIB 3WN6A 1A3HA 3ECQA 3SIMA 2HVMA 2ZE0A 4KWUA 2DEPA 2YLAA 3AHTA 1B2YA 3EMQA 1E6XM 4BQ3A 1VBRA 2VMFA 1WZAA 1W3LA 5HXMA 4CD6A 2XWEA 3FY1A 1WDSA 2JF7A 1S46A 5CLWA 1H5VA 1JFXA 5A3HA 4PRWA 4D6HA 3PZIA 4DWSD 2BY1A 1Q6GA 1GPFA 3GBEA 2VVNA 3ZO9A 1CXHA 1KBBA 5A8OA 1KGXA 4PN2A 1UR8A 2WMJA 3JUGA 1GUVA 1H49A 4GQQA 3WBEA 1HVQA 1VEPA 2WC4A 2W92A 1YQ2A 1V6XA 1GNXA 3L4WA 2XM1A 3A4AA 4KGJA 3N1AA 2E0PA 2YL5A 3AXXA 3POHA 4KRUA 5CGMA 1E6RA 1UD4A 1XYZA 3OLDA 4PMYA 1X6NA 3EDFA 1L0PA 4IM4A 4TVCA 3WDIA 1KQZA 2VQTA 4ATDA 3VINA 1E15A 1WZLA 4L4PA 1ESWA 4AD1A 1BG4A 1FH8A 2Y24A 1KR0A 1YHTA 2EBNA 1N82A 1VJSA 4R27A 3UG5A 2D1ZA 3PZMA 5D8WA 1JI1A 3UEQA 3VDCA 1VENA 3PN8A 3W37A 1GONA 4JFWA 4OBSA 2W61A 4WJXA 3B9EA 1K9EA 1DWAM 5GNYA 1R7OA 2DQXA 3OZPA 5JBEA 3N18A 1MQPA 3VTRA 4ZENA 2QMJA 1HJXA 2DSZA 4GIAA 5ABGA 3AXIA 4PYSA 2W5FA 2PB1A 2ZWZA 4CGTA 1B3VA 2F61A 1QI2A 2BVYA 3N15A 4V28A 4Q7NA 3CZLA 3ARYA 4YHEA 1GOOA 2VCCA 4M56A 4QLKA 1NM9A 1E3XA 3CUGA 1Q6DA 4CU6A 2PWGA 2VRKA 2G8ZA 5E6ZA 5M5DA 1V3LA 4BCEA 1UG6A 2J47A 3SCNA 1RP9A 2VZVA 1Q6FA 3AIQA 4ZE5A 1HJSA 4FF5A 2J7HA 3WF4A 4JFVA 4BF7A 1UH3A 4GZEA 3RDKA 3WUGA 1JZ4A 1EDQA 1DP0A 3WD1A 4RL3A 4JAWA 3AROA 5A6BA 1IZJA 2QLYA 4PCSA 2XSAA 1HKKA 1O6IA 2EPOA 4W85A 1W3JA 4HA3A 1HN1A 4EK7A 4HOZA 3VKKA 3D3AA 5BROA 3BSHA 9CGTA 3VMNA 3M6DA 4ACYA 4UQ9A 1M7XA 1GQKA 5D8ZA 1HXJA 1LF1A 1BVZA 1H09A 1OT1A 4GO9A 4HPHA 2XTKA 2W91A 3EDJA 5FCZA 1JYXA 3AHZA 3WQ5A 1GOKA 1UKQA 1UR4A 3L2LA 3ZJ7A 4XUYA 2DT0A 4DM1A 5FD0A 4JFTA 1XGZA 3CZGA 1J0ZA 3AZTA 3K8KA 1EIBA 1JZ3A 3I3DA 1J11A 1B3XA 2J8GA 5I2UA 4H2CA 5CPTA 1W9PA 3VIOA 2W67A 1OINA 2XGBA 5A2BA 1NWRA 2WCGA 1QBAA 2XWDA 3VVGA 1D3CA 2WWCA 3A6OA 3VGFA 5BWFA 4CCCA 2XVKA 4OKDA 3CZEA 3SCOA 3KEHA 4FK9A 3GBDA 2ZUUA 2D3LA 4DUWA 2EPMX 5BYWA 5FOOA 5FIPA 4PSRA 2EJ1A 1C7SA 1KXTA 4PMVA 5CPSA 5M17A 3ZT6A 6TAAA 3OLGA 3CHEA 1E73M 3QR3A 3VX0A 3W0KA 3RO8A 1UH4A 3VGDA 4J28A 1E72M 3EDDA 1JL8A 4S3JA 1RPKA 3AMLA 4NRSA 1HP5A 3W26A 4M80A 2XVNA 1ITCA 4W86A 4AD2A 3A4XA 5AC4A 2JF6A 4X9YA 1CGXA 2XIBA 1E40A 4OOUA 2J62A 4P7NA 1VFMA 3B9DA 4JHZA 1H1NA 1BF2A 1K9TA 4MJ2A 2WKGA 3VD7A 4WSJA 1RH9A 3PZQA 1OIMA 1V3JA 4PCTA 5HPOA 2A3EA 4J3WA 4NF7A 5BRPA 4AIEA 1LWHA 1ISYA 1OGGA 2CNCA 1TCMA 3RMEA 3L2MA 5DF0A 5E9AA 2WHKA 3ARQA 2XG9A 4GO8A 3NUKA 3WMCA 1EOKA 5A6MA 1QNQA 4U3CA 1G01A 4WSKA 1EQPA 1UH2A 3NYDA 4NRRA 2WC3A 1QI4A 5C70A 3BLKA 3K46A 4ACZA 1KB3A 1WP6A 3G6LA 1EA9C 4F9DA 3BAJA 2VQUA 3RIKA 3BMWA 3MSGA 2UY3A 3FAWA 3ALFA 1NP0A 1E3ZA 4CN1A 1GOQA 1J0YA 3VM5A 5CPQA 2WAGA 5CQ1A 5FL0A 1B9ZA 2X05A 4A4AA 2JEPA 3AIUA 3ARVA 2BNJA 4UOQA 1CBGA 4MB3A 1OGSA 5BCAA 2A3CA 2PC8A 1LG1A 1E6SM 1W1TA 5AC5A 1E71M 4MJ4A 4WKAA 5A8MA 4LYPA 4AC1X 3DYMA 3UCQA 3RM4A 1UWQA 3U57A 2AMGA 2DSVA 3SUWA 3OB8A 3M46A 3SURA 1LQ0A 4ACZB 3MMDA 1NH6A 3WF3A 4JCMA 2WHJA 1CLVA 3VIFA 3K4AA 1V03A 1ISWA 2IXUA 3ALGA 3CHFA 4UFLA 1IZKA 2CBIA 2PWEA 2PBOA 4PMXA 5A6AA 2VZUA 5ECUA 4BS0A 1BG9A 1JZ8A 1JNDA 1E4MM 4Y7EA 4UQDA 4CUCA 2VR4A 3W28A 3FHQA 2VZOA 3G6MA 3T0DA 3OGSA 1NARA 4WKFA 2WCAA 2J79A 5GNXA 2J25A 4PMDA 2CKSA 3EMCA 3N12A 3NCOA 3VDAA 4H04A 1MWOA 2WZEA 3T0AA 4EAMA 2EO7A 2GSJA 2ZIDA 1J0JA 5E09A 3BGAA 2D24A 4U2YA 3THDA 2J77A 2XVLA 3WH9A 4D6FA 2WSKA 3AYSA 1B3ZA 4DWSA 4EE9A 4B9YA 4PEEA 2NT1A 3W24A 1EHNA 1GQIA 3WIJA 5E0FA 3T2OA 3DECA 1MQQA 3WELA 1KFWA 3OLEA 2A3HA 2J8FA 5C71A 1BYBA 5A8NA 1XRVA 3BAIA 1KCKA 1MFVA 3PZ9A 2WBKA 1JG9A 4W7UA 4TXEA 3SCQA 3NDZA 3AS2A 3DC0A 2BHUA 4TTUA 1RD6A 1EDGA 5IHRA 5GPRA 6A3HA 1GOMA 1CECA 2VJXA 4AZHA 2YL6A 1OD0A 1QHPA 3SUUA 3SEPA 3AYRA 3LPOA 2BY3A 5DEZA 3AISA 4W5UA 2GK1A 1E4IA 4H8VA 4Q22A 5A8QA 1V0LA 1FP9A 2WVTA 1R87A 2VUYA 3WL0A 3VM7A 1XCWA 2VX5A 2ESCA 4QP0A 1HVXA 4QFUA 4PBGA 2W4XA 5I24A 4DWSB 2JEQA 3VILA 3WD2A 3VD3A 2CHOA 4AD4A 3W27A 1E6QM 4P8VA 5F7UA 1HIZA 1KCLA 4HMEA 4P7QA 3VD5A 3WF2A 5EMYA 5I23A 2F2HA 2VZTA 4FMVA 1PPIA 3A47A 2OSWA 1EGZA 4E8DA 3TTOA 3VGGA 3WKZA 3GXDA 4P8XA 1X6LA 3SCWA 1E0XA 4AYSA 3TA9A 2WMGA 5LA1A 1D7FA 1UR2A 4U5IA 2OYLA 3WEOA 3UG3A 1WCGA 4E4PA 4FLOA 1QW8A 4TX8A 1EHAA 3BCFA 4UFIA 3MUAA 4UZSA 3WD0A 1J01A 4HOXA 3W38A 3T09A 1OT2A 1UD2A 3K8MA 1BVNP 3GYCA 1K6AA 1WPCA 1WB0A 2G3JA 3KL5A 4UQEA 3OGRA 1BTCA 4HU8A 1V02A 4AZCA 4HOWA 1V6WA 3PTQA 4CVUA 2XIIA 4CKQA 2E9BA 1LWJA 3WMSA 1VF8A 4HZ8A 5A6SA 4TOQA 4RE4A 2DIJA 4D6GA 2XPKA 1H11A 2WK2A 1E55A 1JDAA 2UWFA 2YIHA 4J3XA 4B16A 1MW2A 1QPKA 2PWFA 4YPJA 2D22A 1TG7A 1DHKA 3VIJA 4CD5A 2WZHA 4H41A 4PMNA 3PZGA 5A69A 3NJ3A 1BAGA 1J9YA 1JGIA 1VRXA 2HISA 5BXRA 4J3TA 1EH9A 1BYAA 1PAMA 4QLJA 4LGXA 1H0IA 3CTTA 1IT0A 3BXWA 3I3BA 1E0WA 4V27A 2VTFA 2GJXB 1E1FA 2DSUA 4JL1A 2WZIA 1NWTA 4Z2KA 1O7AA 1QNOA 1FH7A 3AHXA 4X0NA 1WE5A 4MDPA 1E5JA 1ISXA 1LJYA 2PI6A 3VGHA 1UQZA 4GI8A 5D9OA 3IANA 3VDBA 1KXVA 3OIHA 4GZIA 3F5LA 3POCA 1ZS2A 2ZWYA 4HZ6A 1CEOA 3D5HA 4TUFA 4E8CA 1MVYA 3VIHA 3AQUA 1LG2A 2VURA 1MXDA 1JAKA 3CBWA 4JIEA 3UR8A 1C91A 3ZR6A 2FDMA 2WHLA 1UWSA 4ZEPA 3WNKA 1JI2A 5A94A 2EXOA 2JE8A 2YOCA 4MADA 1OB0A 1OSEA 2WPGA 4M82A 3WF1A 1XV8A 4MTVA 1W1YA 1B0IA 4W93A 1UQYA 3MS8A 3AMCA 2BV9A 3O6AA 1WDQA 1HJQA 3FN9A 1NWSA 3WDPP 2J7CA 4CN6A 1I75A 1SR0A 4JCLA 1D2KA 1ZBCA 2WLYA 3AFBA 3OZOA 4BQ5A 4PMUA 1P6WA 3BAKA 4H8HA 1FP8A 1DWJM 4AZ5A 1I1XA 3CMGA 2ZICA 2PF0A 1PBGA 4MB4A 2B31A 3U7VA 4OJYA 3ZSTA 3K8LA 1QI5A 3VIMA 2G4FA 3KE0A 4UFHA 5CSUA 2Y8KA 3W4RA 3AZRA 1V08A 3T2QA 4A3HA 1JDDA 4GI6A 4NSBA 3WQWA 3AXHA 1CXLA 3WUEA 4HA4A 2FGLA 4AIUA 1JFHA 1VAHA 1B1YA 1FFRA 1SFSA 3VIIA 4TX6A 4F66A 1C8XA 2D2OA 2VNCA 3N04A 1CXKA 3RILA 3VIKA 4UQAA 1ECEA 3GXIA 1OD8A 3MV01 3SUTA 4LX4A 1QVBA 3WF0A 1L8NA 1Q6CA 2BY0A 4AD0A 5I79A 4Z2HA 6CGTA 2X0YA 5M03A 3GXMA 2G3MA 2DSWA 4CU8A 4LQ1A 3NSXA 4ATLA 1I1WA 4LPCA 2YA0A 4KMQA 1XSKA 3SCSA 3GNPA 2UY5A 1UKSA 1DWIM 2XUCA 2YJQA 4D6EA 1VEMA 1JIBA 4C7GA 1W9XA 2AOSA 1GJUA 3N11A 3ZT7A 1MW0A 3BC9A 5IXEA 3GXFA 1G5AA 1KGUA 3ARUA 2ZUNA 1JAEA 2JIWA 5JBFA 3HN3A 1E4NA 4F9JA 2VC9A 4OZOA 1VJZA 2VRJA 1PX8A 2AAAA 3HU7A 2V3DA 1XH1A 2VOTA 3MSDA 3UR7A 3RJYA 5LA0A 1TMQA 3BMVA 3DHPA 4BZYA 3ZQ9A 2XFFA 2V3EA 1US2A 4UTFA 2BHZA 4CN4A 4LYRA 5CJ5A 2NW0A 1GVIA 2IUZA 1WO2A 1EQCA 1J18A 3DYPA 4M8UA 3L4VA 1C92A 2YDQA 1WZMA 4IISA 3S2CA 4YHGA 4UCFA 4LXFA 4D72A 1HL8A 1ITXA 2V5DA 1CGTA 3VMPA 1W1VA 4U3AA 2C0HA 5ABHA 2OWWA 1UWIA 2V3FA 3VU2A 1B30A 3BAYA 5EFDA 1DTUA 3CGTA 3KL3A 3MANA 4XZBA 1E0VA 3SUVA 1JYWA 4ZXOA 3EDKA 4TVUA 3ARSA 2J7BA 4GQRA 3T08A 5IFPA 4XB3A 3L4UA 2DGAA 4URIA 4AWEA 3PZOA 2MANA 3J7HA 2O9OA 3RJXA 4P7OA 4GZJA 3PTMA 4IUGA 3AHYA 3CZKA 2WWDA 5A95A 1QNPA 4W7VA 3ZIZA 3MMUA 1EDTA 1LLOA 2CBJA 1HKIA 1E9LA 1W3HA 4QDMA 3CZ8A 1ODZA 2X8RA 3RCNA 3WH6A 3RM8A 2D0FA 4DM2A 3SCRA 4W5ZA 2X1IA 3PHAA 1M53A 3SCTA 1XCXA 3VX1A 2BS9A 4M81A 4D1JA 2BVTA 4HU0A 1HJVA 4AMCA 4UZUA 2RGLA 4CD7A 1J12A 1HKJA 4PMOA 4AD5A 1AQHA 4HPGA 4PMQA 4D6JA 3FXYA 4CVWA 4GINA 1ZJBA 2ZXDA 1QI3A 3AICA 2F8QA 2EPNA 1VFFA 3AIWA 3FAXA 1UKPA 5E0CA 4AZ6A 2ZX8A 4AZ7A 1JDCA 1DWHM 4W7WA 4BQ4A 4MNKA 1CGYA 2GJRA 1LL6A 1JYNA 2PWHA 3VIGA 4D71A 2PWDA 5AYBA 1V0MA 4UNIA 3THCA 4HA1A 1AVAA 8CGTA 3PZNA 2CPUA 4P8WA 7CGTA 5I5RA 1WNOA 3CPUA 1J0KA 2BVDA 1ZBVA 4UOZA 3W6LA 2Y5EA 2GDVA 1GHSA 1GHRA 5BXTA 4JZ5A 1XH0A 4D6CA 3K4DA 1OIFA 4UR9A 3AS1A 2FH8A 3WH8A 1G9HA 4OBRA 2YKKA 1QI0A 1ZU8A 1BHGA 3T2PA 4F79A 3LPGA 4GKLA 1JXJA 1TR1A 1E6PA 1VIWA 3B8SA 3VMOA 2YA2A 3RPMA 1J0IA 1TZ7A 2W63A 2CESA 3MMWA 3L4XA 1UD5A 1QW9A 1GORA 3WFZA 1ISZA 2WW5A 1QHZA 1HJWA 5CLTA 1C8QA 2DT3A 2E9LA 4DUVA 1HNYA 1CENA 2DH3A 3CUHA 1CLXA 3PZUA 3WUFA 2YDSA 4WIWA 5CGTA 1GZJA 3KZSA 1BQCA 3U7BA 2QPSA 1OCQA 2VT0A 4XX6A 1FHLA 4BA0A 1TE1A 3IK2A 2DT1A 3T0BA 2JFEX 1JZ6A 2XSBA 2X0HA 7A3HA 2D20A 5DMYA 1W32A 3UERA 1GOWA 1W1PA 1CNVA 2O9RA 4Z2LA 2O92A 1KXQA 1V3IA 4R5EA 4PTXA 1JD9A 1E70M 1GW1A 3QHMA 1BLIA 1NQ6A 2GUYA 3OGVA 3ARWA 1SYTA 2ZXAA 4WLCA 1PZ2A 4AXNA 1W91A 2DH2A 4H7VA 2X09A 1MQRA 2E3ZA 2XHYA 1JF6A 3AMGA 2VVSA 4FLQA 2UY4A 1DEDA 2CEQA 1QOXA 2CCRA 1ISVA 1G0CA 2V3GA 3ARXA 4WKHA 1XSIA 4AD3A 5M3WA 4MAVA 3BLPX 3AIBA 1J0HA 2TAAA 4HP5A 4OOZA 4QAWA 3ARRA 1V02E 1KWGA 2YA1A 4WF7A 2Y2WA 3QGVA 3VOCA 2FGZA 4RE3A 4RE2A 1VB9A 1CIUA 1UZ1A 2VO5A 5BRQA 3IAPA 1TVPA 3GH4A 3WY1A 3W53A 4PUDA 3AHVA 3VUPA 2GK1B 2CYGA 4CU7A 5DT7A 4JFUA 2J74A 3FW6A 5CZKA 1R7AA 2YBUA 2J78A 2OWXA 4LYQA 1UR9A 2O9PA 5HOSA 3WNNA 2BFGA 2ZUVA 1FA2A 2XFYA 1UR0A 3NDYA 1K9FA 3VPLA 2E40A 4P7RA 1OWQA 1QBBA 1KBKA 2ZX6A 3AOFA 1JF5A 2G3NA 4W88A 2E4TA 4AEEA 4W89A 3VGEA 4U2ZA 1EXPA 5I3DA 5TD4A 1EOMA 1XC6A 1XHGA 3U5UA 3ZSSA 3WQ8A 2QMKA 1C90A 1GVYA 5A6JA 2WVVA 2IXVA 3VD4A 3M07A 3TTQA 4NI3A 1MW3A 5HDRA 2A3AA 1E6NA 3AIVA 5BXPA 3WL1A 4FLSA 4MNLA 4MB1A 1A47A 1R85A 2YBTA 4PTVA 1UWRA 5ABEA 5D9PA 5A2AA 1ZBWA 5A1AA 3W82A 2YL9A 3A4WA 3CMJA 4QCEA 4AZCB 3B9AA 3WNOA 1F4AA 3M7SA 3CUFA 5HNNA 2GDUA 1JXKA 1OGBA 1W2VA 4JKKA 3WQ6A 8A3HA 3HMCA 4XZWA 1HX0A 5E6YA 1LL7A 1Z32X 3VD9A 5GNZA 2Z1KA 1MW1A 2EQDA 1W9VA 3WENA 1G1YA 3TTSA 5AYIA 4L4OA 4B9ZA 3S6TA 3NIYA 4HMDA 3AS0A 4J3UA 1FFQA 2WMFA 1E6ZA 5KEZA 2GVYA 1BPLB 4IPNB 2EEXA 2WVVB 5C8BB 3A3HA 2CHNA 2FHFA 5CSYA 1DWFM 2WC7A 1CGWA 3SCUA 3AIEA 3WH5A 1Q4NX 2E9MA 3WQVA 2CKRA 3N13A 4ATWA 1XH2A 1JYVA 3E1F1 4NZCA 4C7DA 2CERA 1W2PA 2WMKA 1HKMA 2FH6A 3CHDA 3QOMA 4CCDA 4KH2A 1E43A 4JKMA 4W84A 4U31A 2D0HA 1UHVA 3CUIA 2GFTA 4TVDA 4YN5A 3CH9A 5DT5A 4PTWA 1QNRA 1QNSA 1VEOA 4XV0A 3NSMA 2YDRA 3F5KA 3BH4A 4N0RA 1GQLA 1QHOA 1V6VA 1XYFA 2DPEA 1UA3A 4X0VA 2D3NA 2XYLA 1C7TA 1B31A 5I0DA 2DT2A 2J7EA 2C7FA 3SCPA 1JZ5A 4W8LA 1FH9A 4V2XA 3OG2A 2BY2A 3L4ZA 4ZXLA 1M04A 2QHAA 2J7DA 1UYQA 4MAZA 1GQJA 2A3BA 1U30A 3MUY1 3UG4A 2OYKA 1PJ9A 3BAWA 3VNYA 2BXYA 3GH5A 2VR5A 1UA7A 4W87A 4ZE4A 2J75A 4J27A 3OBAA 1XD1A 3ARTA 3GM8A 1CXEA 2ZX7A 3MO4A 2D0GA 3KL0A 1NOFA 1R8LA 3WFLA 2CITA 3MUIA 3VGBA 3WD3A 2ZUWA 2WNWA 1E5NA 3AIRA 4FLRA 3SCVA 2VX6A 3WUBA 3WDJA 4AEFA 3QHOA 4GXPA 3CHCA 4PTMA 1RP8A 2C8NA 2W66A 4D6IA 4UFKA 5E70A 1VFUA 1PIGA 2ZUSA
chains in the Genus database with same CATH superfamily
3ERPA 4PUJA 4GBUA 1EBGA 1H2JA 1NWUA 1TQJA 5IDIA 3VNIA 3VI2A 4HPJA 4GPNA 1F5ZA 1RBAA 3RITA 3VDHA 3WEZA 2I9UA 4XUGA 3D0CA 2E28A 1YADA 2ZUTA 4CCEA 3RCMA 1HKVA 2P88A 4H9UA 4NZ5A 4B3KA 1TRIA 1KFBA 1HGYA 2BGNE 1FXPA 2OTDA 3E5PA 3H24A 2Q8XA 4RCXA 4ZOEA 2FTPA 2DZPA 2ZZ2A 1UWUA 2WM0A 4ICCX 4IIFA 3TWAA 4HNOA 2OODA 3C0LA 1SJBA 1T0OA 1GCYA 1SFTA 2Q01A 1K7EA 5AECA 4WGHA 4Z2IA 2V5KA 3WJZA 5IM51 1WZKA 3BAXA 3WLNA 2ZUMA 3L4YA 1SMAA 3AMDA 1TTJA 3K1DA 3LI1A 3IJ8A 5LIKX 2BGQA 3MCMA 3W6MA 3GR8A 3MHGA 1CTNA 1K4GA 5HAOA 4MVAA 1KQYA 2ZOXA 4YMZA 4EACA 1BSIA 4UXDA 4LS1A 5A6BD 1ML1A 3QOKA 3G1RA 2VZSA 2ZBTA 1OYAA 1DJGA 1HO1A 1O66A 1X8CA 1LQAA 2QUNA 4K68A 2ZZ5A 1LRQA 1UWTA 1UD8A 1XYMA 3C2YA 1VBUA 1SMDA 4B5NA 4WY0B 4NHVA 1R2TA 3OEXA 2BZNA 3GUWA 1DQUA 3VFLA 4G7EA 3KVMA 5A8GA 5D03A 2WLZA 4ORMA 3IAQA 3G22A 1W3KA 5ABFA 1XCFA 1MYRA 1F73A 4N42A 3OHMB 1OEPA 2P53A 3BG3A 2VCBA 4UFJA 2ZZ3A 5F1UA 7REQB 1VYPX 2FMNA 1ODUA 2MUCA 2ICSA 1M01A 2ODOA 4US5A 3WQPA 1FOBA 3GE7A 4B3LA 3KOWA 3CL6A 1XYBA 2CW6A 1M1BA 3UXIA 2W62A 4ZB5A 5GJMA 2XIMA 3DKLA 1RQHA 3WMLA 3BCDA 5D9NA 4H6EA 4PUKA 5AY7A 3W74A 3NQ6A 1XR2A 2C1HA 3NQ7A 3UF9A 3QRHA 1QMLA 5DFAA 1NF0A 2C1IA 3WDQA 2WJDA 5A2CA 1UR1A 3H12A 3GTFA 4K8EA 2J4GA 3IUIA 3B9OA 4LT9A 4BR1A 1KFKA 4AY1A 4ZQPA 3W7LA 2XM2A 4UOJA 3E2QA 1A80A 1QU4A 2CXGA 1ICQA 4I9MA 1K1DA 3F4WA 1H7PA 2F2KA 3SBFA 4R3UA 4UMAA 1U5JA 2EJAA 1UKOA 4YVVA 1JZ2A 1XGEA 1SJDA 4HPXA 4CNUA 5F2IA 4PMZA 4DY1A 2RJGA 2NUYA 3EOOA 5D38A 1CPUA 4GI9A 4QJ3B 5CG0A 1V0KA 3B0VC 1X98A 3R89A 2PRLA 4EXBA 3EB4A 1JCYA 3ZJKA 1R86A 1FRBA 3HJEA 2DIEA 5KITA 2ACUA 3EPNA 1UKTA 2EPLX 3LPPA 3VIPA 4IOTA 4UQCA 1NAL1 1JD7A 1AD4A 3U5YA 4GQBA 4JL2A 4KRTA 4GACA 5B7ZA 2CU0A 1CGUA 4OIFA 4IIHA 3TOPA 3KW3A 4H8UA 1Y65A 4MY8A 3BOXA 1TPDA 4MPKA 3F2CA 1FHVA 1H41A 1V3MA 4WD0A 3MT1A 4DWSC 4WY0F 4Q4MA 3N2CA 1EO5A 1PZ3A 1VFOA 1E1EA 4FNRA 2QCDB 4H6KA 2I5QA 4DRSA 1EP3A 1UOKA 4FOUA 1WDDA 4M24A 1C8VA 3LCLA 1DVJA 4O8AA 5I3FA 1KXHA 2FFCA 2ZX9A 3GZAA 5FKYA 1XLMA 3ZWTA 4HU3A 5D33A 4NJHA 4I8YA 1DJYA 4UR7A 1NY1A 1Y7VA 5FA5A 3WLRA 2OQLA 1IIGA 1ZJAA 1W6TA 3KTXA 1W56A 1KBLA 1XICA 2CLMA 2WOQA 1U83A 2FPYA 1WUFA 3GZ3A 3N17A 3U8GA 4LBUA 2H6RA 1IQ8A 4Z2GA 1JCMP 2BXZA 3E0IA 4A8RA 4LVBA 2G50A 3ZR4A 3UYCA 1C93A 1J6PA 1SZGA 1CZ1A 3RLUA 2VL4A 3W7RA 2OWCA 4ZQCA 1PEZA 3IJ9A 3EYPA 5A6LA 3E0LA 1A3HA 4C1NB 4XAFA 3SIMA 3AHTA 1B2YA 5LGZA 4BQ3A 2VMFA 2RDXA 4DJEC 3FDKA 4HTBA 3ANUA 3TZFA 3CH0A 4IF2A 1VYRA 3LHYA 1R9YA 3H55A 2XN1A 3KOXA 1Q2SA 5DRIA 1NDZA 3R13A 1Q7MA 1TB3A 4PUMA 5SWUA 4I7VA 3KWSA 2VVNA 4LUSA 1GG1A 3SW6A 3E2SA 1KBBA 2IPFA 1GUVA 3C56A 3WBEA 3PJTA 5AC6A 1YQ2A 3L4WA 1NJJA 3B3DA 4IZGA 4KGJA 1IR2A 4MWAD 3TN6A 1K6WA 2E0PA 1UD4A 4NQ1A 4ZOAA 1Z44A 2YDAA 1RLDA 4QROA 4QJ4B 2J88A 4TVCA 2FZ8A 2FZMA 2VEIA 4DAIA 4K3ZA 5DN1A 1YMYA 5FEZA 3E12A 4L4PA 1BWVA 4NI8A 1FH8A 2Y24A 1KR0A 5HK4A 3GU9A 2Y62A 1YHTA 2DZSA 2DFAA 2H9AA 3DERA 4NT0A 2J13A 4R27A 1VJSA 3C8FA 3SGZA 4BWLC 1OHLA 2A7RA 3HG4A 3PZMA 3N4AA 3UEQA 3PN8A 4GG9A 4ORIA 5AFDA 1K9EA 3URNA 1DWAM 3USBA 5JH1A 1QOPA 1AA1B 3M0LA 3VTRA 3P82A 4GIAA 1ZUAX 2ZWZA 2F61A 2DORA 4MUPA 2CLHA 1QI2A 1YNPA 3R10A 1PKMA 1YDYA 3ARYA 3BLIA 4YHEA 5G4WA 1XIEA 2VCCA 4HHMA 1CCWB 3CUGA 2ABAA 3OVPA 4GA8A 1O60A 4HYWA 3GD6A 3SCNA 2NV9A 1HJSA 2DJXA 3WF4A 4HNTA 3ZLHA 4AEOA 4JFVA 3SN0A 4PCPA 4BF7A 3RDKA 3TWBA 4H6RA 1DP0A 3R8HA 1U1UA 4XAZA 3AROA 1ME7A 3NQFA 4O0QA 2AKZA 4HQVA 4PCSA 4KWSA 3P3BA 4K38A 4UTWA 1O6IA 4W85A 1W3JA 1I60A 4LEQA 1W1A1 4B3ZA 3VMNA 4LANA 4ENLA 4I7WA 4B5WA 2HRWA 1EJWC 1A53A 3GG1A 5C9UA 4GO9A 3DFOA 3QKEA 1DORA 2W91A 4S2CA 3WQ5A 1GOKA 2Y7DA 1UKQA 3KVKA 1XKJA 1OZMA 1MUCA 3K8KA 3V5OA 5KETA 2GJLA 1B3XA 5I2UA 2GVGA 4H2CA 3CQKA 2W67A 4IUOA 2XGBA 1QBAA 5CAKA 4V1YA 4DJFA 3P5ZA 5BWFA 4UTKA 1PS9A 2XVKA 4UTIA 3ZVHA 2INFA 4OKDA 3CZEA 3U2OA 1EZ2A 5LIUX 4ILSA 1EKOA 3T0CA 1YE4A 5BYWA 2REQB 3UXLA 2YZ5A 1TIMA 1XF0A 4O19A 2PZNA 4PMVA 5M17A 1XIHA 1DHPA 3SSJA 2VWTA 4Q8MA 1YTEA 2O0TA 3CIWA 4ADSA 3DGBA 3QR3A 4BHYA 3B8WA 5F2GA 3FYOA 3RO8A 3TYZA 3VGDA 3NXLA 1JL8A 1RPKA 2NX1A 3CT2A 4NRSA 1HP5A 1GYMA 1RXOB 1DOSA 1ITCA 3MTWA 4W86A 4X9YA 1E40A 4OOUA 4AB4A 1VFMA 5G4EA 1Z42A 3B9DA 1BF2A 2C18A 2IQTA 2WKGA 1S2CA 3CQIA 1GVSA 4PCTA 4IP7A 5HPOA 4PH6A 4NF7A 1ISYA 1OGGA 5I06A 3RMEA 2FJKA 5E9AA 2XG9A 4YWSA 2P0IA 1EOKA 3KRZA 1QNQA 4U3CA 3P7YA 1G01A 4WSKA 3MKCA 3NO5A 1FHUA 2QCGA 3E3HA 3KCOA 3BLKA 4E4UA 3RFAA 1WP6A 4HK5A 2VC5A 3EGJA 3KXQA 2PLCA 3G6LA 2OVLA 3PUDA 4K6AA 1AZ2A 3U4AA 2UY3A 1VIZA 4MYAA 2GQ3A 3LGDA 1Z8AA 5CH9A 6XIAA 3VM5A 4C90A 2C16A 2WAGA 5FL0A 4QG6A 5MKGA 4G56A 3T8QA 2R1NA 3C2VA 3R5EA 3DFPA 3ES7A 1CBGA 3UJEA 5C2XA 3TJXA 2P76A 2A3CA 5BCAA 1XJBA 1C9WA 4MFEA 4IQDA 4BI6A 2PZ0A 3M47A 3QTPA 5AC5A 2B0MA 3UCQA 3CAWA 4DO6A 4ZGYA 5HNRA 2TODA 4PBEA 3QFWA 1OC6A 1Q2RA 4Y90A 3S1XA 4ACZB 1YPFA 3QY8A 1CLVA 3VIFA 2HDJA 4WZHA 3CHFA 3LQLA 3M16A 3V36A 5A6AA 1A5KC 4BS0A 5ENLA 4GK8A 1BG9A 1JNDA 1E4MM 3N2XA 1X7IA 5FSEC 2HPMA 4IMFA 2VR4A 4OECA 1P0EA 4HHLA 2YCLA 3G6MA 1YRRA 2VGIA 3QMRA 3SB0A 2WCAA 5PTDA 2A85A 3NCOA 3U3HA 1MWOA 3PG8A 3W1PA 2EO7A 3W9ZA 1TPH1 2GSJA 2ZIDA 1JPKA 1J0JA 1SR9A 3BGAA 1R47A 3TSMA 4XVDA 4D6FA 3AYSA 1BWKA 3CPRA 2V9DA 2HWGA 4HD5A 3ENLA 4DLFA 4R9XA 4EIVA 1JQVA 3WIJA 1DE6A 4YTRA 1MQQA 2W9MA 3OLEA 1JCNA 4IICA 4K7VA 1YNYA 2A3HA 1QO5A 2J8FA 3M0XA 1XRVA 1KCKA 1YKWA 3R25A 2IQ0A 1KM0A 1R9ZA 4LCSA 1RBOB 3AS2A 3DC0A 2BHUA 1NDWA 3MZ2A 1RD6A 1FKWA 2ZC8A 5GPRA 3DFNA 1QHPA 5FF0A 3H2CA 4JQAA 1F9CA 2XIQA 1LOQA 4W5UA 3ATZA 1QWGA 2GK1A 2BBFA 4H8VA 4Q22A 1Q13A 4YJ5A 5A8QA 1V0LA 2PA6A 2PDJA 2VUYA 4B5XA 3WL0A 3VM7A 2ESCA 2PC4A 1AJZA 1HVXA 3HV8A 3H26A 4L1WA 1GOXA 3BGGA 1OCNA 2ZRUA 3CXOA 1Y0EA 1JPDX 1MUWA 1XRSA 5HMSA 3VILA 2CHOA 4XWUA 1JPIA 4FXSA 3DHDA 4HBKA 4P8VA 4AYGA 3FJ6A 4CEUC 2BODX 3VD5A 5AVNA 3WF2A 3RX2A 1PPIA 3A47A 4IFOA 4E8DA 3KCLA 4P5UA 2PDWA 5G1TA 3TR2A 1M3UA 1ITUA 1IGSA 3M5ZA 5LA1A 1D7FA 1Q65A 1TR9A 4EAYA 3UG3A 2GGIA 1MNSA 3BCFA 3MUAA 1T5AA 1JDFA 1F05A 2HJPA 4HOXA 3OVQA 3T09A 4LFYA 4JQ1A 3KL5A 4UQEA 4GI4A 3WQFA 1A5AA 1V02A 5F4XA 1R9XA 3TKFA 3LQGA 3PTQA 4H1ZA 4DI8A 2CFFA 3CM4A 1FWAC 3BVJA 5A6SA 4TOQA 4NL1A 2GWNA 2XPKA 2D2JA 2WK2A 1E55A 7ENLA 4V15A 3BQ5A 3QY7A 4J3XA 5LIWX 3WBXA 1OY0A 3W3OA 3GS6A 3THQA 1ZFJA 3OBKA 4ROPA 1VJIA 2PDQA 4CD5A 4V33A 3NJ3A 1J9YA 4Q8QA 3FA4A 3HV9A 4FOJA 3ABXA 4EPDC 3CTTA 2AKMA 1GTHA 2DSUA 1B4EA 3IEBA 1NWTA 1QNOA 3AHXA 3VE9A 4X0NA 1F76A 4OGZA 5FF3A 1KKOA 2OJPA 4YTSA 1G4TA 5HANA 2PI6A 3INPA 1UQZA 3VGHA 4GI8A 1SFLA 2F6UA 1OFOA 1ZS2A 4HZ6A 5H91A 4GIYA 3D5HA 4TUFA 3VIHA 4QJ1A 1GG0A 2VURA 4WSHA 3HMJG 2PEVA 2RAGA 4PTDA 2WHLA 2PP1A 1J93A 4MJMA 1JI2A 3DBNA 2BMBA 5A94A 2JE8A 1SQ7A 2Z1XA 4MADA 1OB0A 3ITVA 4L5ZA 1XV8A 4LAOA 4MTVA 1XFCA 5CZTA 4OV4A 1PKYA 5IBXA 4LUSB 3CQHA 1WDQA 1HJQA 4S3DA 1JUEA 1O5XA 1I75A 1SR0A 4LF1A 1D2KA 4PMUA 1PDYA 3DI1A 2YYUA 1WOBA 4JR5A 5F2MA 3EOLA 3CMGA 2OXNA 3E2RA 4UTTC 1MEWA 3U7VA 4DJED 4D8ZA 3ITOA 2G4FA 5FJRA 4PC8A 2Y8KA 4GYJA 3AZRA 4YXGA 4NSBA 3M0YA 3V0UA 4JYFA 4JY8A 3SZ8A 4FX6M 2PLMA 4RNIA 1S39A 2J9ZA 1VFHA 1JFHA 2XSXA 2H9AB 1SFSA 3VIIA 4TX6A 4F66A 2D2OA 1GZ1A 1VPXA 3H54A 2ZCGA 1FWIC 4O8RA 3P8JA 3R12A 3GXIA 3I68A 1PVNA 2PFHA 3LGGA 4DJDA 4LX4A 1T6MA 4ZMGA 3RHGA 5DELA 1OFBA 3MW7A 2FZDA 1Y5VA 2G4JA 3TJLA 3O6YX 3DH7A 1XIFA 2X0YA 4NUWA 5M03A 3B4UA 2G3MA 3NL5A 1SJAA 3VNLA 1OX6A 1W8GA 2OEMA 1YTKA 4DF1A 4ATLA 3GXPA 5MHBA 1I1WA 4DBWA 3EOUA 2O56A 1IYXA 5FJJA 1DYSA 4ML9A 5H6HA 3W70A 3GNPA 4GUGA 2V82A 1UKSA 2QCMA 4LTSA 4XAGA 2GLKA 3BC9A 5IXEA 5CAHA 3GXFA 3L67A 3BZJA 4AUBA 4AXKA 2JIWA 4R53A 4O14A 4IJBA 2VC9A 4OZOA 2VRJA 4GGHA 2V3DA 5LA0A 4MMWA 2ISVA 2QCCA 2PD9A 1BXBA 4BZYA 3H2AA 4UTFA 2BHZA 4DZIA 1RK5A 4LYRA 4WX2A 3UQNA 2Z6JA 1KBJA 1WO2A 1EQCA 3DBPA 3DYPA 1V77A 5K9XA 4IISA 4EF9A 4YHGA 4UCFA 3SGUA 1FX6A 3MHFA 4ASTA 1L8PA 1Q3NA 5D04C 1W1VA 4GY0A 3CGTA 1UP0A 3KL3A 3MANA 2TRSA 3LXAA 1Z6KA 2XDFA 2ZRVA 4XZBA 1VCVA 1XIIA 4ZXOA 4A8LA 3CQ0A 1G4SA 5J5RA 4Q6JA 4NAFA 1MMFA 2J6VA 2WPBA 2Z24A 4QIUA 1GYLA 3CZKA 4DQWA 3TYBA 1VLWA 3B0YA 1U5VA 2GSHA 1XQKA 1D3HA 3NQ8A 1FKXA 4NNAA 4QDMA 1V79A 3RCNA 1B4KA 3W7IA 4DM2A 3SCRA 1UZDA 4L6HA 1ONRA 1XCXA 2BS9A 4NASA 4JIQA 4D1JA 2V5BA 4HU0A 1HJVA 5C55A 3H2NA 2RGLA 4A6GA 4PMOA 4JOMA 1XUZA 3FXYA 1E1CA 3O0FA 5H8MA 2OR2A 2RDTA 1QT1A 4LY8A 2ZX8A 1DIOA 2V2HA 4EF8A 3UP8A 3WK1A 2RHGA 1DWHM 2WNQA 2ZC1A 1JPHA 4MNKA 3W76A 3HGRA 1IEIA 1LL6A 3STFA 3VIGA 4UNIA 3NEVA 2PDBA 8CGTA 4O50A 3Q4DA 1PYFA 3DG3A 3UG8A 2VEMA 4N6EA 1F3TA 3C0JA 4L65A 4K2SA 4GFIA 4J2PA 1WNOA 1ZBVA 4UTJA 3ABQA 4UOZA 4GNKB 1LYXA 1WXZA 3G0XA 4O1DA 1XH0A 3ANVA 3QC3A 4UMCA 2VR2A 4RDYA 1OIFA 6XIMA 3WH8A 1G9HA 1QI0A 3LPGA 1RQEA 1JXJA 2AMXA 4RDWA 3B8SA 3HPXA 4OV9A 1TZ7A 2BVWA 2W63A 1SVDA 1W1B1 3KAOA 3VOGA 1ZRQA 3E74A 1XLFA 2H3DA 3NPXA 1F6YA 2UZ9A 1EC9A 4DUVA 4IJRA 1CLXA 1OFDA 3PZUA 1Y8BA 1QPNA 4GNJA 5K2ZA 3KZSA 2IPWA 2VELA 5LNSA 2ZZ1A 4HGXA 4KERA 2YFOA 2VT0A 1TE1A 3BARA 2JFEX 3FJLA 1JZ6A 1O5RA 2X0HA 1KO0A 4KCWA 2Z26A 7A3HA 1W32A 3RU8X 3PUGA 2YCLB 2Z2BA 1RQBA 2O9RA 2PD5A 3W23A 2A6NA 3EKLA 3VNMA 3QTGA 3TH6A 1KXQA 3YPIA 1V3IA 4R5EA 2YR1A 3S6OA 3CEPA 1VHCA 4IGHA 3NTYA 3IVSA 1BLIA 2I5IA 2YX0A 3GVQA 2PWVA 1GK8A 5C0QA 2ZXAA 3LK6A 4WLCA 3S9ZA 4AXNA 1XIBA 1A50A 1A0CA 1REQB 2E3ZA 1JF6A 3WYZA 5EYWA 4IFKB 1A5BA 3G18A 3PSWA 2CEQA 1QOXA 2F38A 3KRBA 3RMJA 2OKTA 4US5D 4WKHA 3N73A 4BKNA 3L0KA 4HK7A 4QAWA 4RJEA 1KWGA 1W3TA 2E5BA 2Y2WA 4XSLA 1S2TA 5C54A 1UB3A 5H1WA 4Q8WA 2BGSA 3V5FA 1PSCA 3V16A 4RE2A 3KOZA 1UZ1A 2VO5A 3KBNA 3W07A 5BRQA 4F40A 3GH4A 4GYFA 4L6OA 4G1NA 4OQVA 2GK1B 2CYGA 2FVLA 5EKYA 1QAPA 3C86A 1PV8A 2J74A 3SQLA 1W54A 3FW6A 2J78A 4LV9A 1E9ZB 4JNYA 4JTFA 2YXXA 3TN4A 4JX4A 4LYQA 5HOSA 5F1VA 3VCCA 1ADOA 4AY7A 2WM1A 4DXXA 1K9FA 3VPLA 4F0MA 2QEZA 4P7RA 1OWQA 3VZZA 5ECVA 1JF5A 1EL3A 2V8ZA 4GZ7A 4U2ZA 4F0RA 3MI3A 5TD4A 1AODA 3WQ8A 3QR1A 4LAMA 4LVDA 1K8ZA 3TTQA 1Q5MA 4JTUA 5HDRA 3NPWA 4LBRA 1RD5A 5BXPA 3V0TA 1NIUA 3WL1A 4KWOA 4O11A 1A47A 5C7HA 3CV1A 4MZ8A 1HUVA 4QISA 5A2AA 1QOQA 5L6UA 2VD8A 2YL9A 1F4AA 1W5MA 5HNNA 1P0DA 2P3ZA 3QQWA 1OGBA 4J35A 4Q4KA 4JTJA 1W2VA 3R0DA 8A3HA 4M7SA 3HMCA 2QDEA 1GWJA 5IOBA 1JGMA 3PFMA 3Q94A 4M1BA 3I7QA 4A21A 3NOEA 1Z32X 2X1TA 3S6TA 2XH0A 4JBRA 1P1MA 3AS0A 1CLKA 2OEKA 1FFQA 2WMFA 3NQCA 3H22A 2PUZA 3GKFA 3EX2A 3TA6A 4RKAA 3A23A 4IPNB 3UWWA 2EEXA 3MVIA 2WVVB 2C71A 2CHNA 4J1OA 3RPTA 2CXEA 2WC7A 2E9MA 2TYSA 4ATWA 1XH2A 3W1NA 3W73A 1W2PA 5K7JA 2FB2A 2V2DA 4H6QA 1E9YB 2VDIA 3CHDA 4UMBA 3PM6A 2EAWA 5E1QA 3CUIA 2GFTA 1OJXA 1MEHA 2PTWA 2YDRA 4RZ5A 1PTAA 3F5KA 4N9CA 1QHOA 1V6VA 1XYFA 1S2VA 4INFA 3LGEA 2OZ0A 2DVUA 2XYLA 5DMLA 2QDGA 3R0UA 2QF7A 3MZNA 2C7FA 3WJYA 3CK5A 3WK0A 2BY2A 2NUWA 4G8TA 4J9JA 4ZXLA 1M04A 2X1UA 1RZMA 4MAZA 1PZ0A 2A3BA 2OOGA 1F7BA 4IMEA 1J5SA 3T9PA 5JXQA 3VNYA 3GH5A 2RH9A 3PB0A 5CPOA 4IQJA 1KM3A 1SSDA 1CI1A 3UA4A 4DB7A 1AL8A 4J27A 4QM1A 4DXKA 1EWEA 3T8LA 3T78A 3GM8A 3WCZA 3GK0A 1NOFA 5KZEA 1ZJIA 3ES8A 4LNCA 3WFLA 3MUIA 4HU4A 3IJ6A 1TCDA 3KDNA 1G7VA 3W71A 2VX6A 1Q85A 4GXPA 1RP8A 4BEQA 4IL0A 2H8ZA 2GYIA 5CJNA 2VDGA 1VFUA 1XG4A 1KWKA 4RPQA 3P60A 4MB5A 4FNTA 3CB3A 3RLVA 1F4HA 2GJNA 2Z27A 2PCQA 3S42A 2J7FA 4J3VA 4ADTA 3MP5A 5GJNA 1RA5A 1ZPTA 1HF6A 1TVLA 1XQLA 5XINA 1W9UA 4J3SA 1JR1A 4DUXA 3OHIA 1RA0A 1SSGA 2Y7EA 3W25A 3G1AA 1TFVA 3TQPA 3FHAA 1NDVA 4MNMA 1HGWA 5J04A 1BXNA 5D2TA 4Q4OA 1S2WA 3NZGA 1F2JA 4JGDA 5EMJA 3WLPA 3UYIA 3WJSA 3VNDA 3W1AA 1YNQA 3FV9A 1AD1A 5IFTA 3GG8A 1UUMA 2WHMA 2E8YA 2CBVA 2VX7A 1UD3A 3EX1A 4GUIA 2Y8VA 4WOZA 2GOUA 1AMYA 3OOQA 5TBOA 1W9DM 3AWNA 5LA2A 1P1XA 3N9RA 1KRBC 2BB0A 1ECQA 3WLSA 1B3WA 1LUCA 2GPTA 3QV8A 1K9DA 2NV1A 4GISA 2QV4A 4E6MA 2XGIA 3R11A 4U5KA 3IIVA 2POZA 1FY6A 7ODCA 2GWGA 3ME3A 4J5NA 2WVUA 4IPLA 2G95A 3LCHA 1TWSA 5HBFA 4GOAA 5EFFA 1BXCA 3SIZA 3TTYA 5CEWA 2OLSA 2CC0A 2NSXA 1XYCA 5KINA 3GW0A 4AZIA 3VC5A 2G3IA 3IJ7A 1T8XA 3UPMA 1OK6A 1BSLA 5I09A 4HMCA 3FS2A 1TV2A 2E8ZA 4GFSA 1GJWA 1OBAA 1EA0A 3ZM8A 1W9BM 1V7YA 2JBMA 3NSNA 5LIYX 1ZB5A 3MI6A 1FWDC 3AJ7A 3CLWA 3C3UA 3T07A 1E56A 3NZQA 4GQ0A 3AXKA 1B3YA 1I4NA 3KLLA 4JQ2A 1AH3A 2G5WA 1WAWA 4DJFD 3H4GA 3E02A 3BLFA 3TLQA 3ZMRA 2BWGA 3WBAA 4GC4A 5HULA 4F8XA 3QV9A 2DVTA 3W2KA 3U4FA 4UFMA 5LYRA 4PB4A 2RGMA 3CV2A 4X2PA 4Z0SA 2FMOA 4WJEA 3KBSA 2WMHA 5DBTA 1E1CB 4B2DA 1PKLA 1U33A 5FI8A 3CT7A 3ZJ8A 1X1NA 3A13A 3P6LA 3GHSA 3TROA 1ZBKA 3VZXA 1U2YA 1AK5A 3KVJA 4S39A 4MNJA 1BGGA 4OBTA 4W4QA 3VCNA 2ALRA 1JCLA 3W29A 2HNEA 3OA5A 4LAUA 4QG9A 1V6TA 5T91A 2O9TA 1TA3A 2HBXA 3MU7A 3IGXA 4ZSTA 5LXEA 3S5YA 2YCIX 1UZHA 3JZEA 2WYSA 3W81A 3P5YA 5KZMA 4ZFCA 4KGLA 4EANA 3O9NA 4F0KA 3OYZA 3W6YA 1DPMA 4Z2JA 3QM3A 1H0GA 4L9ZA 3QHNA 2EHHA 4D1IA 3D6NA 1TUFA 4YLWA 4IP5A 2V5CA 1TO3A 5EU9A 1N8IA 4XG1A 1KM2A 5C9WA 2WCSA 3V3WA 3DHFA 3A24A 4JN6A 2XVPA 2V38A 4CD8A 1FTXA 3DFQA 1BYCA 3GRIA 3RRXA 6TIMA 4O1BA 2WKLA 3ARZA 2V67A 4HZ7A 4CD4A 2R1KA 4Q7BA 2CETA 4EKJA 2YL8A 4ZA0A 2HS8A 5IRPA 4HCHA 3WZ0E 2DZUA 4YTTA 5CGQA 4KIRA 4XD5A 4QR6A 2ZZ7A 2DUAA 1SW7A 3LMYA 3WLTA 3HURA 3RM9A 1FDYA 4JEJA 5DQPA 1VZWA 2NX9A 3BE7A 1YLVA 1CXIA 3HG5A 5JIPA 1UBSA 3GU2A 3I7SA 3VFCA 2YXGA 3LBMA 4JNMA 2J66A 3LNPA 3LERA 2WVSA 3GTNA 1HP4A 3V5CA 5J5DA 4EWND 3UCDA 3F4VA 2DZBA 4M5PA 3GHUA 3UU0A 5I77A 3LPFA 5I78A 1GKQA 4GY7A 4W8BA 3TZNA 1Q6EA 1G67A 2DSKA 3QPYA 1WKYA 3FOKA 2DQWA 1C3FA 4MDOA 3VCRA 3ZR5A 2WMIB 3WN6A 3ECQA 1TX0A 1M7PA 4KWUA 2Q09A 3CL8A 2DEPA 1DJWA 3RG6A 5BWAA 2C0AA 1L2UA 3AUJA 2XWEA 4HN4A 2YBVA 4S3EA 3UD6A 5A3HA 4ZCWA 4MUZA 2OOFA 3MDUA 4PRWA 3PWIA 3PZIA 1FWFC 1JPMA 2BY1A 2ZA1A 3GR4A 2PP3A 3T6CA 3ZO9A 3HQ1A 1CXHA 5A8OA 2YB4A 4PN2A 1UR8A 3STEA 3JUGA 4LUJA 2OZTA 4GQQA 2X16A 1VEPA 2WC4A 1K03A 2W92A 1OADA 3A4AA 1JRCA 2Z7KA 3POHA 4KRUA 5CGMA 4H9ZA 3L12A 1WKFA 3OLDA 1FWHC 2VFIA 3O15A 4ERGA 5TF0A 3GG0A 2PTYA 3B0PA 3CQJA 2VWSA 1H61A 3R8RA 1E15A 1TWIA 1P6BA 4FF7A 1BG4A 4AD1A 3CIXA 3G1YA 3WLJA 3L65A 2YCJA 2BOGX 4C91A 3I4EA 3ATYA 3GXTA 3AUOA 1JI1A 3CAKA 3IGSA 4NP7A 1O4UA 1VENA 4JFWA 3EWUA 4OBSA 4WJXA 4V1XA 3ID7A 2NQ9A 2CWXA 4Y2WA 1MQPA 2A0NA 2Y8UA 3I10A 3VKDA 5ABGA 2HQAA 3QC0A 4KESA 3DENA 1K02A 5I3HA 1LQ2A 3THUA 4B92A 1XUUA 4O17A 4H83A 4PL1A 4Q8NA 3R58A 2V5JA 1M68A 4XIAA 4DNHA 4M56A 2QXWA 4QLKA 2WJEA 3DOPA 1E3XA 1Q6DA 4CU6A 2PWGA 1LBFA 3N9SA 1V3LA 2VZVA 4AX7A 4FF5A 5REQA 5FAJA 1UH3A 1ZCCA 1EDQA 1LZOA 2VOMA 3OQ8A 4RL3A 4JAWA 4MLRA 1FUYA 3W85A 2Y1HA 1A0EA 1IZJA 2QLYA 3LHUA 2X30A 4M19A 4ZVJA 3BJTA 4ONVA 4GMEA 4HOZA 2P8BA 1BWLA 5BROA 4UQ9A 7PTDA 3LUTA 4L9YA 1XIMA 1RCXB 5H8PA 3A3WA 1P5BA 1OT1A 3PBUA 1WYIA 4W9TA 5IDZA 2B7QA 1JYXA 2C6QA 3M5XA 3TR9A 2Y6ZA 1UR4A 4H9XA 1EP2A 3ZJ7A 4BF9A 4DN1A 5C9ZA 4LUTA 4DZ5A 3RRAA 3TEVA 1J0ZA 1J2WA 3AZTA 3I3DA 4XO7A 3O0KA 4O54A 4XD4A 3CLMA 3LD5A 1OINA 4NXSA 3A6OA 3VGFA 4CCCA 4Z1AA 1YXYA 3JR2A 3UWUA 4Y8EA 5CBJA 4FK9A 3ITGA 3GBDA 2ZUUA 4CNPA 4DUWA 2EPMX 2NQLA 3O07A 4PSRA 2YYTA 1C7SA 4BF5A 4JQ3A 4FNQA 3ZT6A 1W1ZA 3OLGA 3CHEA 1E73M 1TMLA 1N8FA 3W0KA 1TMHA 1UH4A 5BMWA 4GVHA 1OVDA 4J28A 5TIMA 5JMUA 3AMLA 1TREA 1YDVA 3W26A 4TV6A 5I07A 2GVEA 3A4XA 5AC4A 1EC7A 2J62A 4JHZA 3P14A 3VD7A 2JKAA 1RH9A 1V3JA 2A3EA 5BRPA 1LWHA 1LROA 2ZDRA 2CNCA 1TWWA 2PDKA 2WHKA 3ARQA 3E49A 4Y9PA 1EWDA 4NAEA 1VPYA 4MKSA 1EEPA 1UH2A 3B8DA 3E6EA 4E2VA 4DBUA 2WC3A 1PL9A 2PU0A 2R9RA 3K46A 1KB3A 3QW4B 4DJDD 3BAJA 3RPDA 1R3QA 3XIMA 3MSGA 3EA1A 3LCGA 3HBLA 1UP3A 4B4HA 1GOQA 4NYYA 3HZ3A 4QDPA 5G1YA 3VKCA 4NXKA 1MRQA 3AIUA 3ARVA 1W5OA 1W31A 2BNJA 1ICSA 3DKJA 4MB3A 2G97A 1OGSA 5CPLA 2ISFA 4LCQA 4O1CA 3WBYA 1LUCB 4DO5A 2ISDA 5AN7A 4PCFA 4WKAA 2JKEA 3DG6A 3PNUA 4US6A 2IKHA 2XGZA 3RM4A 3MVTA 1UWQA 1GEHA 1XLHA 2DSVA 4KFOA 3WX7A 1GJPA 8XIAA 4TV5A 1UC5A 5C2CA 4HHPA 3MMDA 3S4TA 4M6UA 4N9BA 4JCMA 2E5DA 2FLIA 4DO4A 1KFLA 1V03A 1ISWA 3ALGA 1OFQA 5TNVA 3OJGA 2PBOA 3VYLA 3VNKA 3C6CA 5ECUA 2PLJA 3NVTA 3OTRA 4Y7EA 4UQDA 4UTUA 1AW1A 2I17A 4QS6A 2PDIA 3TXVA 1RALA 3FHQA 4JYDA 4FEZA 3V1HA 3UNTA 3OGSA 5HATA 3T4CA 3WLMA 1MNZA 2J79A 5GNXA 2J25A 1XIGA 4Z08A 2XN0A 3N12A 1Q6OA 2E6FA 2WZEA 4C6FA 4S3GA 1F07A 3S83A 1R3SA 3AXMA 3DCPA 5E09A 1PB0A 2D24A 3GNDA 3RU6A 3QZEA 2Y89A 3UXDA 2XVLA 4IIEA 2WSKA 1R38A 1FWWA 3HJZA 4KEMA 4DWSA 4EE9A 3P74A 4E2BA 4M6VA 3BURA 1Z3NA 5C5YA 4B9YA 2DV0A 4HIBA 1RHCA 4FNPA 4LAZA 5E0FA 3UJRA 3WELA 1KFWA 4JQ4A 4I5XA 1BYBA 5A8NA 4ZQOA 3KP0A 2JGYA 4TXEA 2ADAA 4IG2A 3NDZA 3H2MA 3R2GA 4MZ1A 3G24A 3F2BA 4TTUA 3TFXA 2R24A 5FSDC 4HHHA 1GOMA 4AZHA 2VJXA 2JKPA 1OFPA 1ZY9A 2Z28A 3SUUA 1EX1A 3GLCA 4FXFA 1PO9A 2PGFA 3N3MA 1LOSA 3UNDA 2DY3A 2WVTA 3PULA 1KRMA 3OO2A 1YBQA 1XCWA 3EKZA 4NNCA 1UCWA 1TJ0A 4RUBA 4LOCA 3MP4A 3Q58A 4O0ZA 4AD4A 3W27A 4CQBA 1E6QM 3H6OA 4ZODA 4LB4A 4P7QA 5I23A 2BX7A 1EGZA 1Z7AA 3GXDA 1X6LA 3SCWA 3M0HA 3TUUA 4MWAB 1OCBA 3BW3A 2WMGA 4DJEA 2E25A 1VYSX 1UR2A 4F2BA 5BOOA 4ZZ9A 1EHAA 3BSMA 4UFIA 3B97A 5FACA 1J01A 4LCRA 3K8MA 1A4LA 5FEPA 3DXIA 2WSYA 2R94A 4HU8A 1UIPA 4N7QA 1KM1A 1V6WA 2XIIA 4CKQA 3CPGA 4RE4A 1KV8A 3NWRA 3GO2A 3LHVA 1H11A 1JDAA 2R82A 1H5YA 2YIHA 3PPFA 2PWFA 1ELSA 1KFJA 1TG7A 3AALA 3PC0A 1GTEA 4IMDA 4UIOA 4CEXC 1P6CA 1BYAA 5T26A 1PAMA 1TV7A 4NNBA 3L0NA 1DJHA 3FXGA 3GW3A 4V27A 1EX5A 1Q6QA 1HTIA 2WZIA 4Z2KA 1O7AA 1FH7A 4ZBCA 3UZ5A 4PFMA 1AH4A 4C6EA 2X0SA 4BWLA 1ISXA 1UMLA 1Q4WA 3LLDA 1LJYA 1D8CA 1S5NA 3IANA 1KXVA 4C6MA 3OIHA 4C5ZA 3POCA 2X1RA 1CEOA 2HVOA 4JY9A 4E8CA 1MVYA 1I0BA 2E67A 1TWDA 1MXDA 3SY5A 4C6JA 3ZR6A 2FDMA 3Q67A 4ZEPA 4FX7A 3GHTA 2EXOA 1FDJA 4R7OA 3KBWA 2WPGA 1SZNA 1PZ1A 2XN2A 4X60A 5I7GA 2WSRA 3PAOA 2B4GA 3TQKA 1KTBA 3FN9A 1ADSA 3EOEA 3L23A 2Y7FA 2J7CA 2AAMA 4JCLA 2WLYA 1P6WA 1TELA 4H8HA 4GUFA 1DWJM 2G96A 1I1XA 2PF0A 3IV3A 1QI5A 3LM7A 1YPIA 2IW0A 4O12A 4ZOCA 4DXVA 3VAVA 5G2WA 3UXKA 2GSEA 3KHJA 3WQWA 4HYVA 3DGRA 4FA3A 5AHLA 4HA4A 3TAOA 4NY2A 3W7PA 2FGLA 1FFRA 3HTWA 3DUGA 1OFAA 4XKMA 3GY1A 1F61A 1X39A 3RILA 4WEVX 3C8NA 1WOAA 1ECEA 3GR7A 1OD8A 3GDKA 1SW3A 3MWAA 1XKYA 1FDZA 2V2CA 2Z1BA 1DJXA 4UR8A 5I79A 6CGTA 1EJVC 5M1TA 2AL2B 1J96A 4LQ1A 3SN4A 1ZAJA 3GYEA 1VBJA 4KMQA 4O15A 1XSKA 1YEYA 3ABRA 4MG4A 2UY5A 3D3FA 1DWIM 2XUCA 2PTDA 1GYNA 3TDFA 2XZ9A 1XWYA 4DBSA 2AOSA 2VM8A 5REQB 1DIKA 3N11A 3ZT7A 1B54A 4Q4SA 3N4EA 1G5AA 3ARUA 2E1DA 5DX7A 3HN3A 1E4NA 4F9JA 1PX8A 1R3RA 1XH1A 2VOTA 3FVMA 3MSDA 1TMQA 5FEWA 1Q7ZA 2V3EA 1US2A 2Q3OA 3FJ4A 2NW0A 2VEFA 2C19A 1C92A 4D2JA 4ADUA 2C13A 3G1SA 3G0SA 4D72A 4IPIA 4X61A 3UBPC 2E7FA 3VMPA 4XBKA 2GGJA 4Q33A 2OWWA 2V3FA 1B30A 2Z0IA 3BAYA 4P61A 4Q7IA 3VKBA 2OELA 5AHIA 1E0VA 5F2LA 4GVFA 4RE0A 5HUPA 3NQVA 3SJ3A 4TVUA 4UBPC 3T08A 4NU7A 4PGLA 3SY8A 3F1QA 5IFPA 4XB3A 3W1QA 3AYVA 2PURA 1VFTA 1CB2A 5FJPA 4GZJA 3PTMA 4IUGA 3AHYA 9XIMA 1F3EA 1J5TA 2RJHA 3ZIZA 3MMUA 4YTUA 3LXBA 4IX2A 1EDTA 3SGGA 2QCHA 2A5HA 1HKIA 1E9LA 3N25A 1W3HA 3M5VA 1YX1A 3PR2A 5BOFA 2ZA3A 1D9EA 2X1IA 1M53A 3P0XA 1WKDA 2BVTA 3IACA 4CD7A 3QLLA 4PUNA 1M65A 2VKZG 4HPGA 4PMQA 4MPQA 1FWGC 1QI3A 4LU0A 1D8WA 1PE1A 1LCOA 4GHRA 3WLLA 4AZ7A 4LYKA 3DU0A 3DIPA 4NAEB 3VZYA 5LNRA 4REQB 1QTWA 5HJYA 4CLMA 2JQXA 2QJJA 2GJRA 5DMNA 2PWHA 4UTLA 4D71A 2PWDA 5AYBA 1V0MA 1P43A 2C79A 5D2XA 5D02A 1RBLA 4KBXA 1TYGA 2R1LA 3S5OA 2C91A 4P8WA 4KFPA 7CGTA 2NV2A 1KM5A 5DXYA 5I5RA 3CPUA 1XG3A 4DX3A 3KM8A 3WLQA 2KAUC 1YTDA 4YCOA 1GHSA 4XBSA 4O4WA 3OU8A 1I45A 3LHWA 4D6CA 1EGVA 1XBVA 4C6OA 4AHPA 3AS1A 4IFRA 1X8FA 4NJIA 2FH8A 3G1FA 4FR6A 3EOSA 2AQOA 3V4BA 3B0UX 1K8CA 1ZU8A 4MY9A 1BHGA 5CBBA 3T2PA 5I3GA 4GKLA 1VBGA 2H90A 4Y96A 5DCDA 3IJIA 4C6BA 1J0IA 2OB3A 2CESA 3MKVA 1BKSA 1UD5A 1GORA 2WNNA 3RX3A 3BANA 1B3OA 1VFSA 1HJWA 2QJNA 4QDWA 1CENA 3GTXA 4KETA 2DH3A 4MWAE 4KCTA 4E8GA 5H2ZA 3WUFA 1EUNA 4DPQA 1UOZA 3W86A 2Y63A 2PPGA 4XISA 3U7BA 2OEJA 4XX6A 1FHLA 2DT1A 2XSBA 3UERA 1LM1A 1SO5A 3AWOA 3E0FA 4LEFA 4Z2LA 3LTSA 2O92A 3FYPA 1ZP4A 4PTXA 1F8IA 3MWCA 3QHMA 1GW1A 1F74A 3MJMA 5HWMA 1SYTA 4BFAA 4QEEA 4Z42C 1XI3A 4A2SA 4EXAA 3KFTA 2X09A 1XDJA 2ZADA 3C3NA 3AMGA 4FLQA 4AWTA 2UY4A 3O1NA 1ZHAA 3PWGA 2CCRA 5HR6A 1ISVA 1G0CA 1S1RA 2VEPA 1S5VA 3GDRA 3KBVA 2Z7GA 3AIBA 1J0HA 2ISSA 2VUNA 1X96A 2YA1A 4WF7A 1KM6A 3E0VA 5TQLA 3F4NA 1LLWA 3IAPA 1TVPA 1X1OA 4R7JA 3ZS4A 3DFTA 4JTTA 3WY1A 3W53A 2XH4A 4PUDA 4RLIA 3AHVA 3VUPA 4B2DD 4E3VA 4NZJA 2PDNA 2DUZA 3UPWA 2YBUA 4R85A 2X7WA 2OWXA 1YBQB 4POCA 1UR9A 1MRAA 1FA2A 2XFYA 2E40A 1HL2A 2WV8A 3WQOA 3IUHA 2HROA 3PG9A 3TYCA 4KQNA 3OYXA 4JIIX 4GXMA 2G3NA 3GX9A 1Y5XA 3RN6A 3VGEA 3W1RA 1E0TA 1SZFA 1EOMA 2IKIA 4GY1A 3U5UA 4KEUA 2QMKA 1I8JA 4QS5A 1H7WA 4YU1A 4NI3A 1M6JA 1MW3A 3LRMA 4GJJA 1BVWA 2A3AA 1E6NA 4MNLA 5D05A 2Q8LA 2R1MA 1DTNA 1R85A 3BWWA 4PTVA 2PGWA 3KOYA 5ABEA 3W75A 1Z89A 2OCZA 5D9PA 1ZBWA 2QAPA 4WOQA 3W82A 4QCEA 3OIXA 3B9AA 5C7VA 1VLIA 2PRHA 1A4MA 1FWBC 4C6CA 5CC3A 3WQ6A 3PUOA 3PF3A 4XZWA 5DY2A 4UTTA 3I65A 4TR9A 1BRLB 3VOHA 3VD9A 2Z1KA 2HE5A 1XPGA 3UVAA 3TTSA 4QHRA 1TTIA 3NIYA 3LSCA 2KX9A 3TLLA 1QWKA 5KEZA 1PKNA 4BJHA 3F4CA 1BPLB 3VABA 4RDVA 1RAKA 3PBYA 1VP5A 3CWHA 4GC3A 1V4YA 4WDWA 3A3HA 4AX6A 2FHFA 5D32A 1CGWA 4LWWA 3WH5A 2ZZ4A 5CPMA 4A29A 3G1HA 3LN3A 3ANYA 3WQVA 3N13A 1JYVA 3E1F1 2G37A 2CERA 4C6IA 2WMKA 4H4IA 1LOLA 5EMKA 4CCDA 4KH2A 3S3GA 4JKMA 4W84A 3AYTA 4JIRA 1QNVA 4A3RA 4U31A 4PRRA 5HR7A 3MI2A 3IIXA 3SO7A 3CH9A 1B5TA 3BGJA 4XZMX 5DT5A 4Q8VA 1QNRA 1QNSA 1VEOA 1A5NC 1TSIA 3FIGA 1FBAA 1JEZA 1C7TA 3GFYA 4E5TA 4BI5A 1FWTA 1XC4A 2J7EA 3A5VA 3SCPA 1FH9A 1ZTVA 4QE1A 1J2BA 2EKGA 4B91A 1IT7A 5HJXA 2J7DA 2GUUA 4XKYB 1U30A 4S2BA 3MUY1 2OYKA 3HIJA 3LOTA 1V5XA 3HG2A 2BXYA 4IIGA 2BP1A 4FHAA 4W87A 3UT0A 4ZE4A 2QVHA 3FKRA 1J8VA 1XD1A 1TPEA 3LTYA 4KKXA 3GIQA 2ZX7A 3MO4A 3UWEA 3ABZA 4H2HA 4N6FA 5E9XA 4RZ6A 2FVKA 4KF1A 6PTDA 2WNWA 1E5NA 3T0TA 3TN3A 1I2QA 3WUBA 4DPPA 4AEFA 1HKWA 3QHOA 5CSSA 2DIKA 4PTMA 3QF0A 2NXGA 2CLLA 3M0ZA 4PODA 3LENA 4D6IA 1K77A 4UFKA 3RXZA 1PIGA 3WEMA 3W2MA 1E4LA 1OF6A 1W5PA 1U22A 2Z2UA 1VCFA 2ZXBA 2Q02A 3GVGA 3KBJA 1V7AA 4AIOA 3GVWA 3FNDA 3ZJ6A 3L9CA 4TTGA 2OSYA 3ABOA 4FB7A 1MFUA 3PTKA 1S3TC 3CUJA 2ZVRA 2VFFA 1KGWA 3GVVA 1OFRA 4PBFA 5IHSA 2J7GA 5AHMA 4ZB0A 5LNVA 1JJKA 3A5FA 1TPFA 7TAAA 3S5ZA 1HG3A 2XIJA 4HA0A 4DHGA 2ASHA 3WNLA 2E6YA 2PP0A 1BD0A 3IV8A 3QBUA 3MCNA 1EJRC 1UJPA 2OKOA 1PTDA 4WY0A 4L7ZA 1AQ0A 3TE9A 5EB8A 3TOYA 3VNZA 3MKKA 3NO3A 3B8VA 3B9NA 3RNDA 2OO0A 2WQPA 4AWSA 5D9MA 2WJZA 5KZ6A 1I2RA 5U7SA 1H60A 5G2HA 3A4JA 2ISWA 3W2UA 5JU6A 1J79A 2QJIA 1UASA 3OW1A 3LBCA 3A12A 5JIWA 2Z1SA 1FWNA 3TCSA 3WNPA 3C2EA 3KP1A 1PWMA 1Q66A 3AZSA 3CO4A 2PS2A 3N9KA 4DAFA 3UETA 1QPQA 1OCJA 3JVAA 4GABA 4DVOA 3OQEA 3Q2DA 3OLIA 3R0KA 3GNOA 4GYPC 1WXJA 4QQ3A 1H7NA 2J27A 2VDHA 2Z25A 2Y70A 3TX9A 2B7OA 1GZGA 5K9DA 1P7TA 3HM7A 3MV11 4P7LA 4KEZA 4DYJA 1JZ7A 3LCFA 4U33A 4JFSA 3WQCA 2ACSA 1GW9A 5LKYA 1J10A 3W7CA 4C1KA 4TMBA 4F2TA 1GPWA 4C7FA 1CGVA 1XSJA 1TWZA 4D6DA 3FDGA 1A3XA 4DBDA 3M5YA 1HL9A 3KX6A 2VEKA 2HEJA 1PX4A 3UPBA 2CBUA 7TIMA 4AZBA 4FR1A 1TVNA 1XGDA 3F7JA 1NU5A 4RV8A 3OVRA 2HE8A 3BK0A 1EPVA 1OM0A 1V0NA 2GVJA 1UD6A 4GVGA 4M6PA 1Q63A 1R3YA 3HPSA 2FZBA 3IK4A 2EPKX 3T05A 3CASA 5HNUA 3LRLA 2ACQA 1KBIA 4G7EB 1HT6A 2WANA 3L0GA 3UFYA 3E0WA 5JBDA 4QCFA 1MXGA 1JNEA 5ABFB 3S0CA 5DRCA 3REQA 1DJIA 3WQ4A 2INZA 3KRSA 3SN1A 1G6CA 3SRKA 2QDHA 5A6KA 1XPYA 4H9YA 3UESA 3NR0A 1R3VA 1WV2A 3AS3A 2QCDA 4AZGA 3TU9A 3BV4A 3BLLA 4ERIA 4Q3MA 3HG3A 2X2GA 4E2OA 3MMTA 1G7UA 3WSUA 1WDRA 3O16A 4Q4PA 1IIHA 3GDBA 4EPEC 1MSSA 4Z1DA 3M43A 2I9EA 2V81A 4K1GA 1XYAA 5JVLA 4PUEA 1QFEA 1RJPA 3CYJA 4XTIA 1H62A 1UZ4A 2HS6A 3TONA 3WDHA 4RPPA 2D23A 1QK2A 4AAJA 2ATSA 4IL2A 1AL7A 1M03A 3AI0A 1TUXA 2GJPA 3B0XA 2JIEA 3RK8A 1H7RA 4J7RA 4L61A 4B15A 1PIFA 4WJ8A 3HPFA 1V6YA 5EBUA 3WQEA 5HMDA 2ZX5A 4JTRA 2PBGA 5A8PA 1X1ZA 3F03K 1XDLA 5U4NA 1HO4A 2JALA 2VX4A 3HPAA 4QNEA 3G8EA 2PAJA 3MBDA 5H8UA 1CYGA 3WNMA 4JPGA 3PZVA 5FJOA 3VO0A 4MWAC 1ZQ5A 2GL5A 4GYKA 1XD0A 3CIVA 3RR4A 4XO6A 5DCEA 1WQ5A 3IJLA 1O1ZA 3I3EA 3KBMA 3L4TA 9RUBA 5C9RA 1DWGM 3UJFA 1PDZA 1IV8A 2YCKX 4WK9A 5JUVA 3UZXA 3O6CA 3S2JA 3U0HA 1ZNNA 2UY2A 1VC4A 1RJRA 4AHOA 1XLKA 4W8AA 2VC6A 2NT0A 1U5HA 1ZL1A 4UQBA 1CWYA 1H4PA 2OQHA 3G8RA 3QVQA 4G9PA 1QASA 3R7MA 3DN5A 1G69A 1MDRA 2HVMA 1BKHA 4GX8A 1Q6LA 2ZE0A 3TC6A 4RNJA 2YLAA 4E2DA 1CW2A 3EMQA 3GC4A 4F48A 4H8NA 3MA8A 1B57A 1IEWA 3SFKA 4ALDA 4F4RA 2JF7A 5CLWA 1S46A 2G0WA 1H5VA 2AQWA 1JFXA 3GFZA 5RUBA 4EX4A 5LNWA 2OG9A 4NZ1A 4DWSD 4L4LA 1Q6GA 1GPFA 1OC5A 3ZYZA 4K1WA 4X2RA 4C6DA 1T41A 3NA8A 2FYMA 3BOFA 5FEXA 3G2GA 4AU0A 5BZAA 1H49A 3GIPA 1IWPA 3ITTA 4FP1A 3OA3A 4K8GA 4M51A 4HCLA 1V6XA 1ZENA 3QV6A 2XM1A 3H4XA 1S38A 3N1AA 4GJIA 3C52A 2YL5A 4A8NA 3AXXA 2YB1A 3EZ4A 2Y88A 4AY8A 4PMYA 1EBHA 1X6NA 3EDFA 3SI9A 3H2FA 2PGEA 4FZIA 1AZ1A 1D3GA 3A9BA 2J9YA 4TQTA 3VINA 2P50A 1ESWA 1FWJC 3L21A 2ON3A 3ZXWA 1RSCA 4HNLA 5C9XA 3UG5A 1H63A 4QSHA 3I7RA 4OFCA 1Q6RA 4FPSA 1WAUA 1GONA 4EWJA 3BLEA 3B9EA 3RF9A 5GNYA 3SQSA 5JBEA 3BG5A 3N18A 4I3GA 1XLIA 2PLKA 1AUSL 3FSUA 1HJXA 1RCOB 2DSZA 3AXIA 2W5FA 2PB1A 2HNHA 2TSYA 4RX0A 4V28A 4RV3A 1EYEA 4WDXA 3OPSA 3TC7A 1KKRA 1FWSA 3CJPA 4BI7A 2V30A 1R30A 2G8ZA 4NJGA 5E6ZA 5AVHA 5M5DA 1MZHA 3BG9A 4BCEA 2A1YA 3CUXA 4N2YA 3AIQA 4XZHA 4AG0A 4A3UA 4GZEA 3WUGA 4IQEA 3M0IA 3ITCA 4S3AA 2DZAA 3L5MA 1VD6A 3RUBL 3N29A 4L9XA 3EWCA 2VFEA 4X63A 5LGXA 3EB2A 1P0NA 5D2VA 1YXCA 3TJ4A 4IIBA 1HN1A 4EK7A 3VKKA 4PFHA 3BSHA 2REQA 3M6DA 4ACYA 1TPC1 3PSVA 8RUCA 5D8ZA 3P8IA 1HXJA 3VA8A 2GDQA 4RW5A 3KZPA 4HPHA 2XTKA 5C2GA 2BTMA 3AHZA 3CWOX 2NWRA 3HF3A 1YXDA 3PWAA 3L5AA 2IMRA 1ADDA 2I14A 2RUSA 3NZ1A 2NWSA 3KHDA 3A22A 2DT0A 5HWJA 3LCIA 2Y85A 2QJHA 1ZAIA 1XGZA 3CZGA 1FCQA 1JZ3A 1EIBA 1J11A 2DZXA 1TZ9A 3BPWA 2J8GA 3AJXA 3B03A 1CT5A 1O95A 4FXJA 1W9PA 1XLJA 2QCEA 4KWVA 2WCGA 4DLMA 1D3CA 2ZTKA 3TMLA 1QPOA 1QDSA 1UP2A 3PNZA 1SZRA 4E0CA 1UMYA 3DG7A 1TIWA 1I2OA 1W1IE 3GAKA 3EXSA 2EJ1A 1KXTA 4LC6A 3STCA 3W00A 6TAAA 2PDFA 2V0TA 1NTHA 4GWEA 3VX0A 4PEKA 3EX3A 1E72M 3EDDA 4M80A 2XVNA 1PTGA 1LRTA 4AD2A 5G4HC 2JF6A 1CGXA 3H8AA 4Y9NA 4P7NA 4I90A 1H1NA 1K9TA 3TVAA 2CHRA 4MJ2A 1OZQA 3QY6A 1TTPA 4KCVA 4WQ6A 3PZQA 1W17A 4J3WA 4AIEA 3S1GA 1J6OA 1TCMA 2QNEA 3I6RA 3ZVHB 1OC7A 5DF0A 4GUHA 3NUKA 5BOEA 2P5NA 4AFYA 5AHNA 4NRRA 3C5QA 3TV8A 4ACZA 4XAYA 3N19B 3TK7A 1EA9C 4F9DA 1UUOA 1GVFA 3EPOA 2EF9A 4AIBA 4DF0A 3BMWA 4X9SA 1FCBA 4UNLA 3FAWA 3H70A 1NP0A 1E3ZA 1EJUC 1GEQA 1TZZA 4IXHA 1NFBA 3RLHA 1LDCA 4CN1A 3S6DA 3IPWA 4PRTA 5AKQA 1B9ZA 3PJXA 1JULA 3EX4A 4EVZA 2JEPA 1YPXA 2FZ9A 4GJ1A 3M64A 3MC5A 1L6FA 1I6NA 1W3IA 4I9AA 3JW7A 1E6SM 3DEQA 4IXXA 4MJ4A 5A8MA 4LYPA 2VP8A 3DYMA 4R33A 3RYSA 1M7JA 2AMGA 3K4WA 3M46A 1LQ0A 3THAA 4ECLA 4OWGA 3WF3A 4E4FA 2Y61A 1XXXA 1PYMA 2IXUA 5DCBA 2TPSA 4UFLA 1IZKA 1DKWA 1GQNA 1OX4A 1KC7A 4PMXA 4MLJA 3TYUA 3WQGA 2VZUA 1P7TB 1KCXA 2F7FA 3LS9A 1JZ8A 1WXYA 1DQWA 2A7PA 3BZGA 3RGTA 4CUCA 3GU1A 1MDLA 3P93A 5MKGB 3S8HA 2X41A 1POJA 2VZOA 3UA3A 4WKFA 2PCEA 2UBPC 4DWDA 3UY8A 4P2VA 4GCAA 3W72A 2DP3A 3U2ZA 2O4QA 4MYXA 4EAMA 1M9HA 2O55A 1O5QA 4U2YA 4JTQA 5BRBA 2F6KA 3WH9A 3P0WA 3NG3A 3CAVA 4IQLA 4D9PA 3BW2A 2ATMA 2HZGA 4C6PA 1IEXA 2PDYA 4PEEA 2NLYA 4KRZA 1DL3A 5AC8A 1V51A 1PHQA 1NVMA 7XIMA 2PE4A 2A7NA 4OU1A 4F3HA 4LRSA 5C71A 2OZ3A 3BAIA 3TW7A 4GNVA 2CZVA 2WBKA 1JG9A 3SCQA 3TAKA 3REQB 1NEYA 2QUMA 2PU1A 1W37A 4LJ3A 4C65A 6A3HA 3EXRA 2YL6A 2YW3A 1OD0A 4GE8A 3AYRA 3D46A 2BY3A 3MYOA 1E4IA 3M1ZA 3APTA 3NM3A 3ZZ1A 2NSOA 1FP9A 4LRTA 4TIMA 3DX5A 1RCQA 4QFUA 2W4XA 5I24A 3VD3A 4ROQA 1YDNA 4S1FA 5F7UA 3F2DA 2HXUA 3MQTA 3EWZA 2PDXA 2F2HA 2OSWA 3P62A 4PE8A 3WKZA 4PUUA 1E0XA 4AYSA 3TA9A 2QR6A 1CX9A 4O1FA 4U5IA 2B81A 2OYLA 3WEOA 1ZSXA 2QUVA 4CQAA 4E4PA 1A5OC 2ZRWA 4UTMA 4TX8A 4UZSA 1DJZA 3WD0A 4JYEA 4UC5A 5J8LA 4NJKA 1OT2A 1UD2A 3KOFA 4XVEA 3OGRA 1BTCA 4C6QA 4H7ZA 4I7UA 3QGKC 3IARA 2QUUA 4J2MA 3E9AA 1IE7C 3WMSA 1LWJA 2ZDSA 4F0LA 2DIJA 1LBMA 4O18A 3UZWA 3IIOA 4MIMA 1K70A 2D22A 1FCUA 1L6YA 3VIJA 4LSBA 2PDCA 3QZAA 4JIHA 1QCWA 4H41A 3PZGA 4J3TA 1EH9A 4G1KA 4NX5A 2IS7A 4QLJA