4W7UA

Crystal structure of xaccel5a in the native form
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
313
structure length
313
Chain Sequence
HMLKYVGVNLSGAEFNSRKKPGTLFKDYTYPAASDFSYFAGKGMNTIRLPFLWERVQPELNGPLDQAQLGLIKKSLEAAKANKQYLILDLHNYATYSGKRIGTSDVPAGALADLWRRLALEFKDDKAVIFGLMNEPNGISAPDWANAAQGTITAIRKTGAKNLILVPGTAYTGAHSWRSTSYGVSNAKALEILKDPGNNLAFEAHQYLDKDYSGTKPVCTSDSVGQEKLQGFTSWLRENKQKGFLGEFATANNPVCDKALEGMLTYMEKNSDVWLGWTWWAAGAWWKPDYPFTVQPGKDGSDKPQMAILSKYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of XacCel5A in the native form
rcsb
source organism Xanthomonas axonopodis pv. citri
molecule tags Hydrolase
molecule keywords Cellulase
total genus 122
structure length 313
sequence length 313
ec nomenclature
pdb deposition date 2014-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4w7uA00
1HP5A 5D9NA 5A94A 3D3AA 4J3XA 3OB8A 1HJXA 1K9EA 3ARUA 5GPRA 1ZBWA 4UQDA 2Z1KA 4JCLA 4JAWA 4ML4A 3WD1A 3AHZA 2GVYA 1C8XA 4D6HA 3UR7A 3NIYA 3N1AA 1J11A 3WD2A 5CLWA 4KGJA 4DM1A 4H8HA 1VAHA 1CNVA 4BQ3A 3ZT5A 2J8GA 2B31A 2DSVA 3HU7A 1BGGA 2G41A 4CGTA 1V3KA 3W6LA 4UFHA 2OSWA 3UG4A 1VEMA 1EDGA 3WD0A 2WK2A 1X6LA 3B9DA 1XCXA 4AYSA 2AOSA 4HMEA 3SEPA 4LPCA 4D1JA 4H04A 4FK9A 2VZTA 2OWXA 3CMJA 5E70A 1EXPA 3MUIA 2VO5A 3CHFA 2FGZA 2ZXAA 3WDIA 2YL9A 2ZOXA 2W66A 1KWKA 1A3HA 2GJXB 1NWUA 4U5IA 1KXQA 1GHSA 3UERA 3TTYA 2JFEX 4IISA 2UY3A 2EPKX 2XVKA 1B9ZA 5I0DA 3CZJA 5IHRA 1CXFA 3ZMRA 1XSJA 1DTUA 4CVWA 4YPJA 4HU0A 3T2OA 1AQHA 4GZJA 1UOKA 1H09A 4OKDA 1UWIA 3FW6A 1ECEA 2WB5A 1LG1A 1GORA 1MQPA 3SUVA 5JIPA 2WKLA 4AD5A 4JFUA 2VC9A 3CUHA 4MAVA 5A69A 3VDHA 1NARA 1RD6A 1XD1A 3OIHA 2YDQA 3FNDA 5CQ1A 4QP0A 4GQRA 1KGWA 1M53A 3OGSA 4UFIA 3OLGA 2J78A 3A4WA 1E1FA 2JIWA 4MNLA 5GNYA 1GQLA 3WMCA 1V02A 4ZXOA 3WDPP 2DDXA 3AXXA 4L4OA 5LA1A 4JFWA 3GXDA 1UWTA 1GPFA 1W2VA 1X1NA 5IHSA 4JFTA 4X0VA 1UZ1A 5KZ6A 1GJWA 3FHQA 3GBDA 2VX5A 1GOWA 1UKSA 1TG7A 2PWHA 3RILA 1DWHM 2E8ZA 3WD3A 4BZYA 4OOZA 1E6SM 1BSIA 3UG3A 2ZUTA 1YHTA 2CEQA 4AZ5A 1GQJA 2X1IA 4H41A 3MMDA 1LWHA 5FCZA 5LA0A 4WJXA 1B30A 3PTKA 3WF4A 4B15A 2WCSA 4XB3A 2X8RA 3RO8A 2PWEA 1PZ2A 1EO7A 4HA4A 4PN2A 4S3KA 4F9JA 1FP8A 3CTTA 2PF0A 3SCWA 3DYOA 3ZIZA 3WNNA 4CVUA 2OLHA 4PTMA 2C7FA 3WQ6A 3AOFA 2ZWZA 1E15A 1WP6A 1Q6DA 2J25A 2D3NA 2OWWA 1MW0A 1MXDA 3L2LA 1VB9A 4MB5A 4JFVA 4AD1A 1GUVA 3W26A 4ATDA 2DQXA 1QI4A 4XX6A 3ARRA 1NP0A 1K9TA 4B3KA 4MPKA 1HJUA 2Y2WA 4XV0A 3AHVA 1E6PA 4J3WA 5A6JA 1W32A 3ZT7A 3VDBA 3LMYA 1NM9A 3BAIA 1JF6A 4P8UA 3L4UA 3WQVA 3W37A 5I6SA 5FIPA 2VRQA 4OZOA 4Z2HA 3K4DA 4UQCA 2DIJA 3FAWA 3B8SA 3PTMA 3PZMA 4MB4A 1X6NA 2NW0A 3BAWA 3VM7A 3W38A 1H11A 4NI3A 4EANA 2VX4A 1JYXA 3IK2A 3WMBA 2WC4A 5FKYA 2XVNA 2EPMX 3FY1A 1UKTA 4A4AA 5ABGA 4H8VA 1BYCA 3TOPA 1LL6A 4PUEA 4QCEA 2VVNA 2W91A 4PCTA 3RCNA 2BXZA 2OYMA 2W67A 3FHAA 4JIEA 5E6YA 3VTRA 3VD7A 2YL6A 2BY1A 3MUY1 1V6UA 2E9LA 4UQ9A 3CGTA 4PMOA 3PZIA 4TVUA 4TX8A 1UG6A 2E9BA 3F5JA 3WH6A 1OCQA 4M81A 1MQRA 2ZWYA 4HOWA 1AQ0A 1H0IA 2XGBA 1UH3A 3BH4A 5HPCA 3T2PA 1E4IA 3W6MA 2BY2A 2GDUA 1MFUA 3WF1A 3VD9A 4Q22A 1D7FA 2WCAA 3ZO9A 2MANA 4D6GA 1BVNP 2J62A 5M03A 3PZVA 2IXUA 1GHRA 2RGLA 4D6FA 3K46A 3VGHA 1CIUA 3CO4A 3AMGA 2WM0A 1QHPA 1W3JA 4IPNB 1Q6EA 3SUSA 1E56A 1E6RA 1ZBKA 2YL5A 3L4WA 3AXHA 1R7AA 1BG4A 4Z2GA 1C8QA 4HZ6A 3WY1A 4PMVA 2X09A 5FL0A 1ZU8A 4W8AA 1BGAA 1NOUA 1FH7A 4DWSD 3ZJ7A 4HOXA 4HZ7A 3VGFA 2RGMA 4D6EA 1OM0A 1AQMA 4F9DA 2ZX9A 1HVXA 1WDRA 2JALA 1CXHA 1EHNA 1E0WA 3I3DA 3AHXA 3WDHA 5HPOA 2VX6A 2CETA 3TONA 1BHGA 1UR1A 3IANA 2XWDA 4UQAA 2WC7A 3N12A 5HBFA 5CGTA 1F4HA 1JDCA 3SCSA 1UA7A 1TVPA 3U5YA 5IFPA 3FN9A 4W89A 5HNNA 4MDOA 3WSUA 1W91A 1JDDA 2EPOA 2JE8A 1F4AA 3W82A 1QW9A 3FAXA 4AZGA 4F79A 1FA2A 1HNYA 1JZ2A 2WLYA 1U33A 2C8NA 5CJ5A 3AJ7A 1ITCA 1R8LA 1GVIA 1KGXA 2BVYA 3RDKA 3AIQA 4MNKA 1US2A 2CYGA 2ZUNA 4JKLA 4ZEPA 5A6AA 5M5DA 4AZIA 1KXHA 3WNPA 1CWYA 3PZNA 4PTWA 5E9AA 3CUFA 2CHNA 4J28A 4JHOA 1VJZA 5FL1A 3JUGA 3AICA 3BCDA 2VOTA 4S3JA 2WMIA 5CPTA 1RPKA 1KR1A 2D0HA 5A6BD 3THDA 3EDEA 1CTNA 3MKKA 2WNWA 1H3GA 4YHEA 4A3HA 3GTNA 1EQCA 3A4XA 3A3HA 3DECA 2W4XA 3GH4A 3KE0A 1CGWA 1Q6CA 4AZHA 1PIFA 3KL3A 5IXEA 1VFMA 2GK1A 4FLRA 1CGTA 3GDBA 2WZIA 3NSNA 4HMCA 2PBGA 1R85A 4ACYA 2BY3A 4Z2IA 3GYCA 1QNSA 4QFUA 3CZLA 1E6NA 1GJUA 1LLOA 3POHA 2PWFA 3VD5A 4UNIA 2WSPA 3WMSA 2DPEA 2XWEA 1ZJAA 1QI0A 3K8KA 3W4RA 4GZIA 1EA9C 1BVZA 2F2HA 5E0FA 2JF6A 1JZ8A 2BHYA 2YBUA 3AYSA 4B9YA 5A6SA 2CPUA 1ISVA 4PMDA 1W9UA 1V0NA 4AZCB 5JBDA 3TTSA 3VUPA 2J47A 3UR8A 3CHEA 1R87A 4JFSA 4R27A 4TTUA 4KMQA 3RJXA 2X0HA 1NQ6A 3ALGA 1ISYA 1K6AA 2DH2A 4XUYA 4UFMA 1H49A 4MB3A 3WL0A 1BFNA 3AXIA 3U7BA 3W27A 1J0HA 3ZSTA 3NSXA 1TZ7A 1CGVA 4TTGA 4HU8A 2D24A 4DWSA 2O9PA 3BMVA 3SCRA 3VMNA 3BC9A 5D4YA 1CGYA 5BXSA 3VGEA 4RE2A 2VZVA 3KL0A 4W8LA 3RM4A 4V28A 1WZLA 1G1YA 4N42A 2YJQA 4JL1A 1BLIA 4U2ZA 3ARVA 4JKMA 4NF7A 2NSXA 3II1A 2EBNA 1HL8A 3AS0A 1EDTA 3L2MA 4XZBA 4WSJA 5D9OA 3VGBA 2XFYA 1M04A 3G6LA 2WSKA 1LJYA 2YA1A 1W1VA 5I79A 4D1IA 2W63A 1UQYA 1W3LA 4JL2A 2GUYA 1JF5A 3M46A 1Z32X 1H2JA 5GNZA 3ZJ6A 1BPLB 1VFUA 3MUZ1 2WKGA 5BXRA 2XIIA 1B3XA 1HKIA 4DWSB 5A2CA 2XTKA 4J3SA 3PZTA 5FOOA 3CZ8A 3K8MA 1W1PA 2ZX5A 3WD4A 4U31A 1M03A 1NOWA 4W5UA 4GIAA 3NUKA 1FHDA 1VFOA 3CHDA 1C91A 3KZSA 2DT1A 5DT5A 4D6DA 8CGTA 4M82A 1E72M 2VURA 1VBUA 2VZOA 4DUWA 1JG9A 4NSBA 3RPMA 1UD6A 3BXWA 1V3LA 3VDCA 2W62A 4M56A 1H5VA 4GI6A 1PX3A 5C8BB 1S46A 1BYAA 4D71A 3WKZA 4C7DA 1RP9A 4HTYA 5ECUA 4RE4A 1KR0A 3PHAA 4L4PA 1P6WA 3AI0A 1OBAA 1WZAA 4UOQA 3AMKA 5BRQA 5I23A 1UZ4A 3TP4A 3UEQA 3O9NA 1UKOA 1JAKA 3U57A 1QNRA 2DIEA 1KBKA 2QMKA 1KFWA 5HDRA 3T0AA 4CD8A 2XM2A 4P8XA 2BFGA 4AW7A 2CBVA 3IJ7A 3K4AA 1LL7A 3OZOA 2E40A 1OD0A 3CBWA 2E3ZA 3N15A 5EFFA 1V6VA 2V3FA 2WMKA 4B3LA 2QHAA 4Z2KA 4H7VA 1K9DA 1PIGA 1XH2A 3J7HA 4DM2A 3IJ9A 1CXLA 1QNPA 1XV8A 1JL8A 9CGTA 5AC4A 4U3CA 2V5DA 3GXFA 3W24A 4AZCA 5I24A 1JXJA 3SCPA 3AS1A 2HISA 3T09A 3QGVA 1GOOA 3OZPA 3WUEA 2JF7A 3CZKA 1C92A 1JAEA 4WLCA 4M8UA 2PBOA 2FH6A 2FHFA 1JNDA 3WEOA 1B3VA 5D9MA 4PTXA 2D22A 2EPNA 4HOZA 1E3XA 4UR9A 1TFVA 3O6AA 1U2YA 4CD5A 4K68A 3T2QA 3D5HA 4P8VA 3DC0A 3ARTA 1U30A 2VR5A 3EMQA 2ZUWA 3DHUA 2XSBA 3G6MA 2XG9A 1G0CA 2OSYA 3CUJA 1IZJA 1JDAA 2DSWA 2XPKA 4KGLA 2YLLA 1XH0A 1J12A 4P7LA 2O92A 3WQ5A 3S6TA 1BTCA 1JD7A 1HT6A 5A1AA 1C7TA 1HJVA 2CHOA 3VU2A 4A3YA 3SCTA 1GOKA 1OB0A 1V02E 3EYPA 5LA2A 1GVYA 3WDJA 1TE1A 1W1YA 3WNOA 3GM8A 4GZEA 2WCGA 2YBTA 5CPQA 3VGGA 3GNPA 4J3TA 2Q8XA 4E8CA 4RL3A 3WFLA 3EMZA 3AIBA 4WIWA 3PZ9A 2YIHA 1HVQA 3K8LA 4P8WA 1QI3A 3SUWA 5CSUA 2QPSA 2WHKA 4NRRA 1YQ2A 1W9VA 1J0JA 2CESA 2XJ7A 5I3DA 4CN6A 2G3NA 2EPLX 1D3CA 3MV11 4GO9A 2XVPA 4WF7A 3DYMA 2VZSA 2ZX7A 5ABFA 4CD4A 6A3HA 1ODZA 1G9HA 2BHZA 4KRUA 2V3EA 4HA3A 1UWQA 2OSXA 3W81A 1D2KA 3T08A 3I3BA 1TA3B 3L4VA 2D2OA 3AQUA 3GBEA 1H1NA 1TR1A 4AZ7A 3WL1A 3OBAA 2D20A 2QF8A 1V6YA 1VJSA 4ZE4A 5AC5A 3WF2A 3WNKA 1AVAA 2VX7A 3ARWA 1DWFM 3VIKA 3ZQ9A 1J10A 1SMDA 3AYRA 3NDYA 2EXOA 1OSEA 1OIFA 1WPCA 4M29A 1Q6FA 1ITXA 4PBGA 1C8YA 2FHCA 3POCA 1HJSA 2DEPA 4CCEA 1J0YA 4CKQA 3CHCA 1UQZA 4PSRA 1E73M 1WZMA 1VEOA 2ZXBA 3L4ZA 4JHZA 4TVCA 3VIMA 1GQIA 1V0KA 1V08A 2E4TA 3S2CA 1JYVA 1WKYA 3TTOA 3VIIA 3U5UA 3W0KA 2E0PA 3VILA 1MW2A 5BYWA 3F5KA 3AROA 1WDQA 5I5RA 3N17A 5I77A 4QLKA 1VRXA 3GXMA 1FFQA 3AIWA 3UG5A 4WKAA 3BCFA 4LYRA 1E6XM 3F5LA 2D23A 2F61A 3ARXA 3PN8A 4C7GA 1H4PA 1ZBVA 5CXPA 3ALFA 3AHYA 4GXPA 3LPFA 4UOJA 1E55A 2WVUA 8A3HA 4PSPA 4MNJA 5EFDA 1VF8A 3CUGA 1UD8A 2FH8A 1BAGA 3AZTA 5I78A 2WMHA 1XYZA 1UR4A 3VO0A 3VIOA 3MMWA 2F8QA 4DWSC 1GOMA 2GK1B 3AIRA 4AD0A 5TD4A 4PMZA 2CKRA 5A6BA 2ZXDA 1GOQA 5CPSA 3VIPA 1BF2A 1EQPA 4LXFA 1B2YA 3AIVA 1UD2A 4D72A 3WBAA 4ATWA 5HOSA 6TAAA 1HL9A 4QAWA 5CG0A 4B9ZA 2BHUA 4AEEA 3M7SA 5CZKA 3ARZA 1E4LA 4H8UA 4UFJA 4QDMA 4AXNA 1Y7VA 2EO7A 3RJYA 1HKMA 1CLXA 3VNZA 3ZR6A 1WDSA 1VEPA 1W9XA 1GONA 2EQDA 3RMEA 2DT0A 3ZJKA 4J3VA 4HZ8A 4JCMA 1XSIA 4QLJA 1I1WA 6CGTA 4URIA 1OGSA 2W61A 4W7VA 4IPLA 2J74A 4TUFA 1FP9A 3VIJA 1KWGA 2UY5A 2Y8VA 4CUCA 1ISZA 3VD4A 1OINA 4CD7A 1XC6A 3BGAA 3WUBA 4GINA 4W93A 3VIFA 4YHGA 2AMGA 2ZUVA 4KH2A 5EMYA 3E1F1 4PMNA 3WENA 5C70A 1HKKA 3CLWA 1UR2A 2G3MA 4PMQA 4QCFA 1OIMA 1SR0A 1QOXA 3CH9A 4W7UA 1NWTA 4AY1A 4J7RA 5JBEA 3NSMA 1ZS2A 1DWJM 4PMRA 5A2AA 1FH8A 5D8WA 3BSGA 2VUYA 3MU7A 1UA3A 2WHJA 4PMUA 3WELA 2DSKA 7TAAA 4OUEA 2Y4SA 1GW1A 2WW5A 2ZX6A 1CYGA 2IXVA 1PAMA 2J79A 1PZ3A 2XVGA 1FOBA 4UQEA 1GQKA 2WMGA 1B3YA 3VDAA 1BG9A 1JI1A 1H0GA 4CN1A 1WCGA 3ZJ8A 2X0YA 4OJYA 4CU7A 5BXTA 2V38A 1UR9A 1CDGA 5DO8A 2FGLA 3N13A 4PMYA 2CBIA 5A8PA 2A3EA 3PTQA 1WB0A 4M24A 1E5NA 2X05A 4CCDA 5DFAA 1ODUA 3MS8A 3VM5A 1DHKA 1LF1A 2YOCA 5I2UA 2CKSA 1C93A 1UR0A 4BQ4A 1ISXA 2VCBA 2X2YA 3HMCA 1B1YA 5JBFA 3CZGA 1RH9A 1I1XA 1FFRA 2J7DA 4YN5A 2DT2A 3AMDA 2ZE0A 2CBUA 2G3JA 3WF3A 1JNEA 1J01A 2Z1SA 3RM8A 5A8NA 1B3ZA 2XIBA 2ZIDA 2V3GA 1WAWA 2WMIB 2GJPA 3U7VA 4HPGA 5LYRA 5C71A 2VQUA 3QOMA 3N04A 1HKJA 2GDVA 3KEHA 2XUCA 3WF0A 2BV9A 4PEEA 5M3WA 2WWDA 1E3ZA 4BQ5A 1W3KA 5HXMA 3UCQA 3THCA 3WDRA 2PB1A 1ISWA 3IJ8A 5EB8A 5GQBA 3BAXA 2WXDM 3TA9A 4W86A 5JIWA 2VQTA 1E4NA 1XHGA 4LYPA 3WNMA 1LG2A 1CGXA 1O7AA 3WH9A 5ABHA 2XM1A 2J7FA 4AD3A 5M17A 2PWDA 1HJQA 2GJRA 2J8FA 4HPHA 3AIUA 1A47A 4GKLA 1NH6A 1LQ0A 3WFZA 2O9OA 4U3AA 4FLSA 3W28A 4MB1A 3CUIA 2WHMA 2J7GA 1E0VA 1KCKA 2J75A 2QMJA 4CU6A 4W87A 2ZUMA 5FD0A 1JZ5A 3AZSA 1DP0A 4PMXA 1KGUA 1G94A 4J3UA 2VRKA 3SCNA 2IUZA 3GXIA 4FMVA 1UUQA 2WVSA 1W2PA 1XRVA 1JZ4A 1JFXA 1W9BM 1IZKA 4HP5A 1BYBA 3MO4A 2VR4A 4UCFA 1E70M 1E4MM 2QLYA 3NYDA 1J9YA 3GH7A 3SUUA 3VMOA 4GQQA 2QPUA 3VX1A 1EOKA 1RP8A 4Y7EA 4QLLA 3BMWA 2CIPA 3WUGA 4ACZA 4AISA 4D6JA 3WH5A 1JGIA 4TOQA 3IAPA 2J4GA 1IV8A 2FHBA 4MNMA 2WYSA 3CMGA 1GZJA 3EDFA 1B31A 5EBAA 1NOFA 3OG2A 2XGIA 3SURA 5ABFB 3BLKA 1OGGA 2O9RA 1I75A 1JZ6A 3WIJA 4U5KA 5BWFA 2ZICA 2WZHA 3EDKA 1Q6GA 5IFTA 4X0NA 3DHPA 3ZOAA 1JYNA 3QHMA 4HMDA 2ZUUA 4CU8A 1ZJBA 1CEOA 2VCCA 4BA0A 2XVLA 1O6IA 3NJ3A 3RIKA 1V3MA 3IAQA 3CZEA 3L4YA 1XSKA 2NT0A 3AS3A 3EBVA 2VJXA 2DH3A 2YKKA 3RM9A 1HF6A 1UHVA 1EIBA 1M01A 1MVYA 1TVNA 1UWSA 4X9YA 4GO8A 2D1ZA 2G8ZA 2CERA 1C7SA 1J0KA 4Q7NA 1ZBCA 4W88A 3KWXA 1XCWA 2WANA 1UH4A 2WWCA 3K1DA 1PBGA 2XFRA 5A6KA 4EK7A 1BQCA 4W85A 1LWJA 1BYDA 1V3HA 1V3IA 3L4XA 1NWRA 1W3HA 5A8OA 4JZ5A 3VX0A 3AMCA 3EDDA 1WDPA 2ESCA 2WPGA 3OLEA 1KBBA 3MSDA 3EMCA 1ZB5A 4UQBA 3PZOA 2CNCA 3ZR5A 4MJ4A 3NCOA 2Y8KA 2E9MA 3WQ8A 2JIEA 3A47A 7CGTA 3ARSA 1EDQA 4AIEA 1W1TA 2WLZA 2V3DA 3ARPA 1SMAA 2AAAA 2PC8A 3N9KA 4HA1A 1CECA 2YDRA 3SCOA 3VOCA 1WO2A 5D8ZA 2XFFA 1SYTA 1JI2A 3APGA 4GPNA 2CCRA 1GOIA 1OT2A 2J7HA 3UETA 1E43A 2A3HA 5DEZA 2FDMA 3EDJA 1CXIA 4DUVA 4V2XA 4E2OA 4CCCA 4RE3A 1AMYA 1E71M 3TTQA 2DT3A 1UD5A 5GNXA 4UFLA 1J18A 4MDPA 4ATLA 5A3HA 1VBRA 1MW1A 2O9TA 3A6OA 5DT7A 1XYFA 3AS2A 1E1EA 1WNOA 4P7RA 2VI0A 1QW8A 2XYLA 4WKHA 5IDIA 1HXJA 2YA0A 1L8NA 5A6MA 2BNJA 3ZT6A 3MV01 2OYKA 2VZUA 3FXYA 1JYWA 1G5AA 1CXEA 1MYRA 1KXTA 1KQYA 2JEPA 1CZ1A 1WZKA 5CGMA 4WKFA 4P7OA 1TCMA 2HVMA 1NP2A 2GJXA 1JXKA 1LL4A 1PX4A 1HN1A 2D0FA 4Z2LA 1DWIM 1JD9A 1PJ9A 4E8DA 3GNOA 1CENA 4D6IA 1PEZA 1TA3A 3WQ4A 4FLQA 4LQ1A 4MAZA 1QVBA 2WBKA 3SCQA 3WEZA 1DWGM 2YDSA 1KXVA 2WC3A 1C3FA 4PCSA 1TMQA 2Y5EA 4F66A 3ZM8A 3LPGA 4WK9A 3VD3A 4CD6A 4OBSA 2E8YA 2D0GA 3T0DA 2A3CA 2VCAA 4P7QA 3MSGA 1N82A 2BVTA 3ARYA 3QOKA 3MUAA 3GZAA 1OWQA 5E0CA 2WHLA 1Q4NX 1OGBA 3SUTA 1W9DM 1MWOA 4ZXLA 4E4PA 1V0LA 2PWGA 4U2YA 2WMJA 2CXGA 3WBEA 3QR3A 1H41A 3HN3A 4UFKA 1EH9A 3WDQA 1UD3A 4OBRA 4OOUA 2CITA 3W25A 4W8BA 2A3AA 1VFFA 2VNCA 3SIMA 1E0XA 3W29A 1PX8A 3T0BA 3VIGA 4F8XA 1QHOA 1V3JA 1XD0A 2ZXQA 5BXPA 1E40A 2PI6A 4UOZA 1MQQA 1V03A 3VGDA 1E6ZA 2VRJA 2GFTA 3AZRA 1GCYA 1CBGA 2EEXA 4TX6A 2G3IA 4JKKA 1J0ZA 4ZENA 4GI8A 4WSKA 4EKJA 1QI2A 4ACZB 1QI5A 1UD4A 4J27A 3F4VA 5A8MA 2XHYA 4GI9A 2YLAA 2VVSA 3M07A 1HP4A 3QHOA 4AZBA 3VVGA 4W84A 3VINA 1R86A 1E9LA 4BS0A 5A8QA 3BLPX 3WUFA 2ZX8A 2DSZA 4BF7A 1G01A 1FHLA 4BQ2A 2BVDA 3WH8A 4UZSA 1IT0A 4H2CA 2JEQA 2BS9A 3PZQA 1DEDA 3B9EA 2DGAA 3GNRA 1JIBA 5A6LA 2NT1A 4ZFMA 4AEFA 5DF0A 1ZL1A 3VNYA 4TVDA 1HIZA 5A2BA 3QHNA 5ABEA 1QBAA 3MANA 4IUGA 1CLVA 2A3BA 1CGUA 1OT1A 3W53A 1WE5A 3ZSSA 3VPLA 4FF5A 3GH5A 4TXEA 1QNQA 3CIVA 5KEZA 1B3WA 2OWCA 5AYIA 3HJEA 3SCUA 4AMCA 2UY4A 1MFVA 3BAJA 4P7NA 1PPIA 2BXYA 2WZEA 5BCAA 2D3LA 4CN4A 1XH1A 1B0IA 1R7OA 1TUXA 5CSYA 4BCEA 3OGVA 4AD2A 1UH2A 1EGZA 4N0RA 1SFSA 1QPKA 1UWRA 3AISA 3PZGA 3SCVA 5F7UA 2W5FA 2ZUSA 3MMUA 3N18A 4W7WA 3WH7A 2V5CA 1CXKA 4XZWA 1MXGA 3BAYA 2Y24A 2VTFA 2QV4A 2J77A 2WVVB 5AYBA 5E6ZA 1B90A 1VENA 3BAKA 1CPUA 2UWFA 4PYSA 3WNLA 1E5JA 1V6WA 3KL5A 3AFBA 4EAMA 2UY2A 2BY0A 4V27A 4AC1X 1KB3A 4AIOA 3A4AA 2TAAA 3LPPA 2DSUA 4B16A 3VKKA 2CBJA 4IM4A 3M6DA 4MADA 5DMYA 5E09A 2WAGA 2WBGA 4D6CA 4FLOA 4NZCA 3ECQA 4KRTA 4PRWA 3DYPA 3O2LA 5D9PA 4AZ6A 1JZ7A 1HX0A 1M7XA 4W5ZA 3PZUA 1C90A 4PTVA 2J7BA 2J7CA 5CLTA 2VMFA 4UZUA 1UKQA 4M1RA 4LGXA 3OA5A 1K9FA 1QHZA 1UKPA 2GSJA 1V0MA 1UWUA 1QBBA 2W92A 3I3EA 4AIUA 3B9AA 4ZE5A 2WVTA 4C7FA 3VIHA 3WQWA 1E6QM 1VIWA 1QNOA 1DWAM 1KQZA 1NWSA 3NDZA 1J0IA 4EE9A 1XGZA 4AWEA 1EHAA 2G4FA 4PUDA 1KCLA 3CPUA 1US3A 3OLIA 4DUXA 1UYQA 4OIFA 3N11A 4R5EA 1V6XA 1ESWA 5A95A 4Z2JA 3BSHA 2VT0A 4MJ2A 4LYQA 1JFHA 2YA2A 2VL4A 2XSAA 2EJ1A 3AIEA 3WN6A 2WMFA 5JUVA 3UESA 3AMLA 3AHTA 3OGRA 1EO5A 1W9PA 2OYLA 4AD4A 1OD8A 4U33A 4M80A 3OLDA 4MTVA 4NRSA 3WEMA 3VMPA 1GNXA 1UR8A 5BROA 1MW3A 4KWUA 1HJWA 5BRPA 1EOMA 3LPOA 2WVVA 2YL8A 4UTFA 3ARQA 3PBGA 2J7EA 3L4TA 1FH9A 2C0HA 1JZ3A 1L0PA 5AY7A 4LX4A 7A3HA
chains in the Genus database with same CATH superfamily
2PU1A 4HVXA 1K8CA 4UMBA 1HJXA 1K9EA 3N19B 1ZZMA 2Z1KA 3PBVA 4JAWA 1NF7A 3W73A 1C8XA 5KITA 4LCQA 4NZ5A 3N1AA 3NQVA 1CNVA 4BQ3A 3ZT5A 2J8GA 5D2WA 4I5XA 2YCLB 1TPWA 2Y70A 3SQSA 4FOKA 1X8CA 1V3KA 3S5YA 1P1XA 1EDGA 4DX3A 3WD0A 3PANA 4XK2A 1DHPA 4FXRA 2CLMA 2OVLA 3SEPA 4D1JA 3KCOA 1EA0A 3CMJA 1W5OA 3CHFA 2QF7A 4DN1A 1TREA 1H7XA 1NWUA 2QCFA 1EJXC 4R3UA 2DUXA 1KXQA 4XAYA 7REQB 2ZRUA 1DE6A 1F73A 2NX3A 4DEFA 1LBLA 3UYIA 4IISA 2UY3A 3W02A 2ABBA 3ZMRA 1XSJA 3TLQA 2Y6ZA 2PLMA 4C6DA 1H09A 4GC3A 1S2WA 3ITGA 1WOAA 4DZIA 4L65A 5JIPA 4AD5A 2XH7A 1DXEA 1FWAC 3GXPA 4IMEA 2BTMA 3NQ2A 1HW6A 2P8BA 3QQ0A 1RD6A 1XD1A 2YSWA 3HURA 3KLKA 4JTCA 3NQGA 1V7YA 3IJIA 5CQ1A 4QRNA 1J93A 1ZHAA 3NXLA 3OLGA 5G1MA 3A4WA 4JX4A 4MNLA 1TPUA 1GQLA 5GNYA 3MB9A 2Y5JA 3GE7A 3LX9A 1ZNNA 2VFIA 4ILSA 4WD0A 5DXXA 4H9MA 2J88A 3TC3A 1DPMA 4UTJA 3UNDA 1DQXA 1ECQA 4HHPA 1GPFA 1X1NA 5IHSA 4X0VA 2QCNA 4Q4PA 5C55A 1UZ1A 2VX5A 1GOWA 3LCXA 4IG2B 3WD3A 1E6SM 5AC7A 4FR6A 3PBWA 4AZ5A 4H41A 3MMDA 4ERIA 5AHFA 3W1LA 1Z6KA 4QQUA 1B30A 3BDKA 3SY8A 5J5DA 3IJLA 2KZHA 2F6KA 1EO7A 1CX9A 1WXJA 4PN2A 4S3KA 3SN1A 4CEXC 3EB4A 1RR2A 4DXKA 4LUTA 4IQDA 3R89A 1VP5A 3HA1A 4JYFA 3Q65A 4LAUA 3SSZA 1MXDA 3LYEA 1M3UA 1D3GA 4Y9MA 2XH4A 3TFCA 1GUVA 4A3RA 3KBJA 1G69A 5CZJA 2XIOA 5FF3A 3KXQA 1SVDA 1NP0A 1K9TA 2QEZA 1DXIA 3AHVA 1E6PA 3RCMA 3MJMA 3ANYA 3ZVHB 3ANVA 4FIRA 3L4UA 3WQVA 2W27A 3OEXA 4S3EA 5JH2A 3RN6A 4JYEA 1AW2A 1HL2A 3K13A 2NW0A 1TJ1A 1M7OA 4TR9A 3W38A 4EANA 2VX4A 3QM3A 3L21A 5HR6A 3WCZA 3WQOA 5C9UA 1O66A 4O10A 4RUBA 1YNQA 3ITTA 2P0OA 2QYGA 3TOPA 4BEQA 2ZZ1A 4PCTA 3VNKA 3TYCA 3NPWA 3UR5A 4RNFA 4JIEA 5E6YA 1BTMA 4FXFA 2NXIA 3VTRA 3TYDA 3PBUA 4BEUA 3HQPA 1JR1A 3H7UA 3CNYA 3U2CA 1X96A 4I9MA 5TAOA 3KCJA 3PZIA 1YXDA 4TX8A 1I9CB 3TC7A 3WH6A 3FYOA 4KEZA 1PXGA 2IKJA 3BH4A 4ASTA 3W6MA 4IPJA 2BP1A 3AWOA 1DJHA 3TDFA 3W7LA 4HU4A 1GGOA 2WCAA 3ZO9A 4ZOEA 3CEPA 3K46A 2ZKMX 3CO4A 2WM0A 4IPNB 3LLXA 3SUSA 2PGFA 2Y88A 3AXHA 3NG3A 2R14A 2NQ9A 3ZWTA 1BVWA 3USBA 5FL0A 3NL5A 1Q66A 4W8AA 1BGAA 4DWSD 3RRAA 3SFKA 3P93A 1HVXA 3H8AA 3HQNA 2JALA 2QKFA 3ENLA 3G2GA 4A8IA 1GVOA 1E0WA 3I3DA 3UZWA 1ALDA 4GIRA 1RQEA 5LIUX 3TONA 1SFLA 3U3HA 5CBIA 2C0AA 1HGYA 2PDFA 4UQAA 3V5CA 3KRSA 4IJCA 1DJNA 2CLEA 4E0CA 5D37A 1JDCA 5FF4A 3SCSA 4DY1A 3M0YA 3U5YA 4QE1A 1R46A 4MDOA 3S8HA 1H7RA 1R9ZA 3GWQA 4AZGA 2FQIA 1EBHA 4GABA 1NQKA 3OIXA 4YTSA 1Q63A 3GG7A 4Z08A 1ZJHA 4MNKA 4JKLA 1XIBA 5DELA 3MKCA 4V1YA 2Q6ZA 1B4EA 4ML9A 3E5BA 1A49A 4S3JA 3CPGA 2D0HA 2C14A 3FJ4A 2Q8LA 4MG4A 3THDA 4CCZA 1TV7A 2OLSA 1A0DA 3SAZA 1UR3M 1H7OA 1JQVA 3KRZA 3GTNA 3AXKA 3OQ8A 3A3HA 3DECA 2PF8A 2W4XA 3HV9A 3O8AA 3QQWA 1CGWA 1PIFA 5IXEA 1LBMA 2J6VA 3O6YX 1CGTA 2XZ9A 3LCGA 3RU6A 4HMCA 2GOUA 2BY3A 1E9IA 3LHVA 4MM1A 3FSTA 1XG4A 4O4WA 2Z00A 5I03A 2AKZA 3OOQA 2HVOA 1XGDA 2PRHA 1GJUA 2PODA 1H60A 1LLOA 1WA3A 1QNVA 4O0ZA 2PWFA 3UJRA 5E0KA 4UNIA 1ZJAA 1KFBA 2AQWA 4Q6XA 3CL6A 1BVZA 1S38A 3W86A 1KM3A 2BHYA 3DU0A 1PYMA 5JBDA 3VUPA 2CLFA 2J47A 3CHEA 1YE4A 1R87A 4R27A 4H6RA 2B81A 1R6WA 1M9HA 4XZLX 4O19A 1EEXA 3W00A 1O1HA 4IIDA 3MCMA 4I5UA 3NQBA 1H49A 1TQJA 3F4NA 1RVGA 1VZWA 3PPGA 4YXGA 3W27A 3ZSTA 3MYPA 3DX5A 1TZ7A 4Y9PA 4HU8A 3TU9A 3EWBX 4CQCA 4AWSA 4DWSA 3BLFA 2O9PA 3BMVA 3TW9A 1NDYA 3CB3A 3JR2A 5D4YA 1EKOA 3TQVA 2RJGA 3VGEA 1IT7A 1ZFJA 1L6GA 3PC0A 3KL0A 3DXIA 4N42A 2YJQA 3T7VA 4JL1A 5U7SA 2NX1A 3O7UA 4M7TA 4NF7A 2NSXA 1E1CB 4IQJA 2Y7DA 1WUEA 2P76A 2CLIA 5AHMA 5AB3A 5D9OA 2VGIA 1M04A 2WSKA 5BOFA 3C2YA 4PCNA 1W1VA 1OABA 2PGEA 3PWGA 2GUYA 3BE7A 4GC4A 1H2JA 3ZJ6A 2XIIA 2Z6IA 3I6EA 4DWSB 1SJAA 1W31A 3C3NA 1KV5A 5A2CA 4O15A 2O7QA 4E2BA 4YWSA 3CZ8A 1FWNA 1W1PA 2BGNE 2ZX5A 4G56A 4H9VA 3D6NA 1EZ2A 4EPEC 4W5UA 4LY4A 1FHDA 1U5HA 4PGLA 5DT5A 4D6DA 3H2NA 5I00A 1BXCA 3NZQA 3FA4A 4GH3A 3UWZA 1M41A 4DUWA 3ITVA 3ABXA 4Q8OA 4NSBA 1V3LA 4LRTA 3QC0A 3HGRA 4M56A 1A0EA 4MVAA 5LKYA 3BL3A 1H1YA 2VWTA 4C6BA 4GVIA 1R3YA 1EJSC 2WJDA 4JHMA 5ECUA 3EKZA 4L4PA 3PJUA 1K1DA 4JEJA 1Z8AA 5I23A 5G5IA 3O9NA 1JAKA 3W2KA 1QNRA 3LGDA 2TMDA 1IEVA 3R4IA 2A6LA 5HDRA 1XPYA 2BFGA 4AW7A 1TV5A 1OEPA 1KD0A 4EP8C 4GJIA 1P0EA 4BWLA 1OHLA 3CBWA 3N15A 1GG0A 4XSLA 4GK8A 5EFFA 4X60A 3NWRA 5T9CE 3OHMB 2WMKA 4RDVA 4B3LA 1K9DA 1PIGA 1XH2A 2GVEA 5D2XA 2ZZ7A 1QNPA 3AYTA 5E5CA 1MI3A 9CGTA 1EJUC 5AC4A 4U3CA 5LNSA 3QPEA 3GXFA 4CNTA 1X97A 1JCJA 4Z1CA 4X63A 3N25A 1GOOA 3TAOA 5HK4A 2BGSA 4WLCA 4PTDA 3LK6A 2PBOA 2FH6A 2IKGA 4PTXA 1KRBC 1XYMA 4DBWA 2P88A 2E1WA 3APYA 3PJWA 4UR9A 2CW6A 3NQEA 4LVGA 4UWMA 2HROA 3O6AA 2QNEA 4CD5A 1MUMA 5IBXA 3E9AA 3D5HA 3HV8A 3MW7A 4S38A 2JKAA 3ARTA 2VR5A 3EMQA 3OYXA 1G4SA 2OSYA 3CUJA 1JDAA 1JRCA 5CPNA 2VYOA 5D30A 3TZNA 4H8NA 3HQOA 4Q8NA 1JD7A 4MFDA 1HT6A 5A1AA 4N4QA 4AF0B 4O57A 1KLZA 4F0KA 5HWNA 4A3YA 1V02E 4V1XA 3T8LA 1GVYA 1SFJA 3C0QA 3FJ6A 1TE1A 3KS5A 3OHIA 1OK6A 3IIVA 2WCGA 2GZXA 5CPQA 4J3TA 2PP1A 3PF3A 3H70A 3R8GA 3PZ9A 1A5MC 1HVQA 1LQAA 3WK3A 2QPSA 4S3FA 3W71A 4NRRA 3MMTA 4JN8A 1OC5A 3K4WA 2PSNA 2ZC8A 3PTDA 3KBNA 3MV11 2XVPA 4WQ6A 1YDNA 3DYMA 5M1TA 3IIXA 3VE7A 1P48A 3AXMA 2QXWA 6A3HA 1FWHC 1ODZA 3TYEA 3FDGA 2X1SA 5I3KA 4EVZA 1G4EA 3OTRA 5DY2A 4N2YA 3G3MA 4JQ1A 3DKJA 2OMAA 3KHDA 5HNTA 5HMDA 3VCCA 2Q02A 3AQUA 3GBEA 1T96A 1SQ7A 3WL1A 3OBAA 2PTXA 5LIXX 3OG3A 4PUMA 3TWAA 1UC5A 2VX7A 3SDOA 4AH7A 2IQDA 1QPOA 4M29A 4ENLA 4PBGA 1TPEA 2DEPA 4PSRA 2ZXBA 4AHOA 1GQIA 3N14A 3CB8A 1IIGA 3N2CA 1TVLA 1JYVA 3TTOA 1YTEA 2HTMA 3U5UA 1LCOA 2QUUA 1WDQA 3N17A 5D03A 1O5KA 1XIIA 2BG5A 2Y7GA 3AIWA 2AL2B 2WZMA 3UG5A 5FJTA 4HQVA 3I10A 2PFHA 3WLSA 2FPTA 4PTNA 2G96A 2FMNA 3F5LA 1RPXA 3PN8A 1H4PA 3ALFA 1LOQA 4DPPA 5FJIA 2A7NA 5LHFA 3MI2A 4H00A 4HIBA 1MEIA 1M68A 8A3HA 4HK7A 5EMKA 5EFDA 3C2FA 1DBTA 1BAGA 5I78A 4C1NB 4JEQA 1OYCA 2VHLA 5AECA 4H2HA 2CKRA 4FA3A 3IJDA 4MY9A 1XRFA 2C1HA 1XLEA 1TMLA 3SQLA 1GOQA 3LN3A 3VIPA 1BF2A 1EQPA 2H90A 3PUOA 3AIVA 3DHDA 4DZ5A 1EP3A 4ZQNA 5MF5A 1L2QA 1A50A 4QAWA 5JQ9A 2PURA 4Y90A 3EX4A 1E4LA 3O6DA 4QDMA 4AXNA 3CUXA 4O54A 3T9PA 1CLXA 3A24A 1UP3A 3QMSA 1W9XA 2A3LA 3THQA 2XIJA 2FZNA 3F1QA 4DELA 4J3VA 3UZJA 3PSVA 1H1ZA 4C90A 3GHRA 1I1WA 3QR1A 4KETA 2Z4GA 2QCHA 4KWWA 4GXWA 1FP9A 5C9ZA 1KWGA 4ERAA 4F0RA 3VD4A 2QUVA 4B5NA 3SJNA 1PVNA 2Q01A 3DOPA 4QBXA 3WUBA 4GINA 4W93A 3EX1A 3VIFA 4CQ9A 4IOTA 3G3DA 4KH2A 3ZLFA 3KVMA 4QNEA 3IJQA 1UR2A 2G3MA 4NJGA 5F1VA 4QCFA 2E7FA 3CV6A 4JTIA 2ZVIA 1NWTA 4H4IA 4WCJA 1EWDA 3Q45A 2EG6A 2VM8A 4AY1A 1ZS2A 1DWJM 4PMRA 5A2AA 3DZ1A 2VUYA 1UA3A 5LGZA 3AU6A 4UMAA 1GG1A 4XISA 1Z3NA 2CWNA 3MA8A 4AIBA 4XD6A 2DSKA 5ENLA 3M6YA 4IJBA 5JMUA 1CYGA 2IXVA 3N4EA 1H63A 1JEZA 1GQKA 2WMGA 1B3YA 3VDAA 1BG9A 9RUBA 3DH7A 4GKTA 1WCGA 3ZJ8A 4AHPA 2VENA 4OJYA 2ZZ2A 5BXTA 1FX6A 3P14A 3DBPA 4C1KA 5ABTA 5C5YA 3BICA 5A8PA 4F0HA 4E5TA 4XBSA 1EYWA 3MJYA 1UPPA 1V6TA 3LTPA 3GS6A 1ISXA 2HRWA 4N4PA 3HMCA 1A53A 1RCOB 2CZFA 2BB0A 4EPBC 1O4UA 2OB3A 1R38A 8RUCA 4FAMA 1GWJA 1DIEA 2A0NA 3SBFA 1TYGA 2G3JA 1AFSA 3GU2A 1J01A 5A8NA 2XIBA 1K02A 3OW1A 3MKVA 1Q7ZA 4ADTA 5LNRA 2WQPA 1ZAJA 3CJPA 3GW0A 3U7VA 2MUCA 4YTTA 5LYRA 4JTFA 2EJAA 2VQUA 4A3QA 4GX8A 4QROA 3WF0A 3RUBL 3BWWA 4BQ5A 3UY8A 1FWSA 1W3KA 3MY9A 2ISDA 3THCA 3LLFA 2PB1A 4DJDA 4IIGA 1ISWA 3IJ8A 3W2MA 3TA9A 5JIWA 1E4NA 1O12A 3CV2A 3M41A 1XHGA 3WH9A 4MWAA 1JULA 1QPNA 3KVLA 4C60A 1PWLA 2J7FA 4PR4A 4AD3A 1IYXA 1XDMA 1HJQA 2PRMA 3NQMA 3AIUA 1A47A 1NH6A 3QY8A 1LQ0A 2C13A 3BV7A 1GPWA 3RLHA 4MB1A 2DZVA 1Q65A 3P0XA 3B0PA 3QGKC 2QMJA 3LHWA 4CU6A 4W87A 2ZUMA 3MSRA 3IIPA 2Z7KA 3VC6A 3HM7A 3UU0A 4S1FA 1XLLA 1KGUA 1EL3A 3CHVA 5REQB 1G94A 2VRKA 1QFEA 2BX7A 1UUQA 3COTA 4TO8A 1XRVA 1JZ4A 3W1MA 2NQLA 4HP5A 4HN8A 4MYAA 1SPQA 2WNQA 3P81A 4WDWA 1RBOB 2PPGA 3W85A 1A3WA 2NUXA 4L5ZA 1R3QA 4H3DA 3VX1A 4GCXA 4LCRA 3W88A 1MZRA 3HB9A 4GGBA 1IV8A 3NPUA 3UVAA 1QTWA 2OKTA 1SZEA 2PDWA 2XIMA 3UZZA 3EDFA 1AD1A 5BRBA 4DJFC 3FJNA 4S2CA 4DI8A 1R30A 4FXSA 1TTPA 5ABFB 4DXXA 1I75A 2PMQA 3SY1A 4ONVA 4C6EA 3HG5A 5BWFA 1HQTA 2WZHA 5IFTA 3RG6A 1BKSA 2C71A 2ZUUA 4CU8A 1ZJBA 3R94A 5D32A 3TSMA 2QUTA 4BA0A 4PRRA 1XSKA 1IEQA 3RM9A 3VOHA 4OE7A 4F3HA 4RNIA 3GIPA 1SZNA 4NXKA 4LBRA 4IPPA 3KWXA 1XCWA 2WANA 3G8EA 5DMNA 1BQCA 5CZTA 2RAGA 3BW4A 3THUA 3VCRA 3VX0A 3AMCA 3XISA 2ESCA 2WPGA 1KBBA 2F2KA 2WQDA 3ES7A 2DV0A 4HNVA 3MSDA 1Q4WA 2CZVA 3BGJA 6REQA 3PZOA 2CNCA 3ZR5A 2E9MA 3GDLA 3WQ8A 2JIEA 1FWIC 5L6UA 1W1TA 2V67A 5KZMA 1EJ7L 1KCZA 5C9XA 3ARPA 2AAAA 4KF1A 2WNNA 3UT0A 4HA1A 2FLIA 3GDMA 3SCOA 3GKAA 3QC3A 5AYXA 2E28A 1RALA 1VLWA 1DTNA 3APGA 4GPNA 4ZOBA 3BOFA 1OT2A 2A3HA 1LTDA 4DUVA 1E9ZB 3PBMA 1JUKA 4E2OA 4CCCA 2DVTA 4HPJA 3CWOX 4RE3A 3UPBA 1AMYA 3FV9A 2DT3A 5GNXA 3EWCA 1J18A 1EEPA 2VGFA 3UWWA 1W17A 2OJPA 3A6OA 2PDQA 3GW3A 1H5YA 3RHGA 1XYFA 4BJHA 4PC8A 4DZHA 2V2CA 1E1EA 1WNOA 3G0UA 2VI0A 1VCGA 1QW8A 2XYLA 5EMLA 3LM7A 1HXJA 3QKZA 5A6MA 3LG3A 3ZT6A 3MV01 3HG3A 2VZUA 3QMTA 3GFYA 1ZUAX 1MYRA 2YCJA 1KM5A 2ZE3A 3M0JA 3N2TA 1NY1A 4JIQA 5D02A 3PK7A 3W7KA 2CWXA 2PRLA 1TCMA 2HVMA 2B7NA 1JXKA 2QJGA 1X38A 3R1ZA 2D0FA 2NUYA 2HWGA 2PDJA 3DFYA 3W7NA 3UW6A 7REQA 1JD9A 1PJ9A 4OECA 2AQVA 3VCNA 4D6IA 4JQ3A 1ME9A 3V4BA 3S1WA 3F2DA 4FLQA 2WBKA 3DEQA 3T4WA 3SGGA 3THAA 3WLPA 3KLLA 2YDSA 4JBRA 4L6OA 4K1WA 1TJ2A 4F66A 4XIAA 5L9FA 3TNBA 4CD6A 4OBSA 2D0GA 2A3CA 1CB2A 2VCAA 3M0XA 3MSGA 4B5XA 3ITXA 4DJDD 3C0LA 3W1NA 4GUGA 1YW1A 4LBSA 4HSNA 3VNJA 3UA4A 1I45A 2XIQA 1MWOA 1V0LA 2OQHA 2WMJA 3WBEA 6PTDA 1H41A 3CYJA 2ZRVA 4H19A 4GNKB 4X9SA 1X1OA 3VIGA 4F8XA 1RJPA 1V3JA 4B5UA 2ZXQA 1TZ9A 1E40A 3HQ1A 3NM3A 2PI6A 3LCLA 2OQLA 1R47A 1VFLA 1QDSA 1IF2A 1XLGA 2GFTA 4M7SA 1NDWA 2F7FA 2EEXA 2G3IA 3PS7A 2ZRWA 5DQPA 4EKJA 3GDKA 4LH8A 1QI5A 1UD4A 2YXOA 4J27A 2XHYA 3OBEA 3QHOA 5MKGA 4MPQA 1R86A 4REQA 3AUOA 3VYLA 3B8WA 2FYMA 3BLPX 2P0IA 1UUOA 1XLHA 4AG0A 2CLPA 2YW3A 2NWSA 1IT0A 2PUZA 3PZQA 2Y1HA 3GR4A 2DGAA 3BZGA 2NZLA 3L5LA 5DF0A 3FEMA 2GQAA 7ENLA 1GK8A 1QBAA 3MANA 1CGUA 1OT1A 1RJRA 4ECLA 4FF5A 1QNQA 2FB2A 1DE5A 4CQ8A 4CNSA 1QOPA 3WBXA 1HFBA 6ENLA 2V0TA 1CT5A 4P61A 3M43A 1Q13A 3QF0A 1TWWA 4UXDA 1DJGA 4C6KA 3OGVA 2ZFAA 1UH2A 1SFSA 1LWIA 4ICCX 3AISA 3PPHA 3SCVA 4HK6A 3LNMA 5G2HA 5F7UA 2ZUSA 3P7YA 1CXKA 4L1WA 4XD3A 3BAYA 3TR2A 3EX3A 2VTFA 2QV4A 5E6ZA 3BAKA 3PM6A 3VDGA 2UWFA 4J35A 4PA8A 3KL5A 1L6SA 4MHBA 3GR7A 5C2XA 3GXTA 4V27A 1RLDA 2PTWA 3UCDA 3VOGA 5C7VA 2DSUA 4B16A 3VKKA 2CBJA 1BQGA 4GQ0A 3GG0A 2YPIA 2EPHA 1HTIA 1UBSA 1JZ7A 3FVDA 3LHUA 3G0XA 1U5VA 4Z1YA 3L68A 2OX1A 2I56A 4LGXA 2GSJA 1V0MA 4EWND 3PVFA 2QVHA 1MNZA 4JN7A 2QCDA 4HK5A 5CC5A 3W1XA 1RHCA 3B9AA 4ZL1A 2ZDSA 1LROA 3VIHA 2PTZA 3W7JA 1VIWA 4ALDA 4GCAA 3B8TA 2ZA2A 1EHAA 4PUDA 1US3A 3OLIA 3LSCA 1UYQA 4OIFA 2HDJA 1A5AA 3I68A 1VQTA 2D2JA 3O63A 3T44A 4WHBA 4B92A 2G37A 2YA2A 1T7LA 3GU1A 1Q45A 2XSAA 4IWWA 3E0IA 2YCKX 2VC6A 3WN6A 4S39A 3R12A 3IVSA 4IGHA 3AHTA 5D33A 2BOFX 4GJJA 4MZ8A 4M80A 4NRSA 4MTVA 3URQA 2CZ5A 3C2VA 4KWUA 1GKRA 5BRPA 1EOMA 2PTYA 4Y96A 3IV8A 4PUWA 5AY7A 4LX4A 3RR1A 7A3HA 3D3AA 4J3XA 4O53A 3BUVA 3NFUA 1GYLA 4QE5A 1PO9A 3QKEA 3WD1A 1YNPA 3S42A 2INEA 3NIYA 3R0KA 1F5ZA 1J11A 1I0BA 2ISWA 5CLWA 3VOFA 1VAHA 3W9ZA 3HU7A 2HVNA 3W6LA 2J24A 2OSWA 3V1PA 2WK2A 2AOSA 3W1QA 1YXYA 4WY0F 4FK9A 1OCJA 2VZTA 2OWXA 2OT1A 5E70A 4MY1A 2Z6JA 3HGOA 5EMMA 2ZXAA 3GY1A 3WDIA 3MVTA 5FF7A 2ZOXA 2W66A 2NVCA 4ZO8A 4Z1DA 1A3HA 3LDVA 2GJXB 3LTYA 4JGDA 1JDFA 3LBOA 5BMWA 4U5IA 4BY3A 3GC5A 3TTYA 4B90A 5D04C 3NZPA 4FX6M 2XVKA 1B9ZA 2PU0A 3NPVA 5IHRA 1CXFA 1LZOA 1DTUA 4YPJA 3UJEA 2PDNA 1AQHA 4M51A 4OKDA 4K1GA 1K77A 2WB5A 3EWDA 3UG8A 1RQBA 3KW3A 4CQDA 4K6AA 1M7PA 4H01A 2Y7EA 4B4FA 1NARA 5HJLA 4FPSA 1PDYA 1OF8A 1Q6LA 1P4CA 1SSDA 4OBTA 4NYUA 3IWPA 1M53A 4R7JA 1E1FA 3C0JA 1V02A 2XN1A 1BXBA 2DDXA 2GYIA 4L4OA 1DXFA 2GVLA 4JFWA 3GXDA 4UC5A 2ZBTA 3M0VA 2Y0FA 3U9IA 1XCFA 2Q8ZA 1ZENA 2J9ZA 2E8ZA 4BZYA 1YE6A 1P5BA 3GR8A 4DB7A 3GD6A 2O56A 1GQJA 3KUMA 2I9UA 4ZVJA 1LWHA 5F2IA 5LA0A 4B15A 2X8RA 1PZ2A 4I9AA 2Z2BA 3CWHA 1RA0A 4F9JA 4RCXA 1I2NA 2PF0A 3CH0A 3SCWA 3VOJA 1XYBA 3WQ6A 4LS0A 2ZWZA 1WP6A 1Q6DA 2A21A 1AQFA 1HG3A 1TJ0A 4C5YA 3ELFA 4J2MA 4ZA0A 4DAFA 3TJ4A 3UJFA 3SM0A 4JFVA 4HHHA 3HGSA 2DVUA 4C6QA 4C6JA 2EG8A 3W26A 1OF6A 3KRBA 1KKOA 1LOSA 3INPA 3TCSA 2QJHA 4MPKA 4XV0A 1GZ1A 3IUIA 1W32A 4Z1BA 3VDBA 1Q85A 4J1OA 4Y8EA 1NM9A 1OADA 2GL5A 3PJXA 4WDTA 5I07A 1XLBA 3IJ6A 4YIWA 5FIPA 5H6HA 4Z2HA 4UQCA 3FAWA 3B8SA 3NEHA 4O1EA 1X6NA 3T0CA 4MIMA 4EPDC 1VYPX 3FOKA 5M2FX 3JW7A 2FVKA 1JYXA 4B5TA 3NQ7A 4NZ4A 2NXGA 2PC4A 4EXQA 1EFZA 2P5NA 4A4AA 1P1MA 5ABGA 4GZ7A 1M1BA 3HFTA 4QCEA 1W1A1 4GXMA 2VVNA 2W67A 3L5MA 3GG1A 4HN4A 3VD7A 3KVKA 1SSGA 2BY1A 1EP1A 5HWJA 2E9LA 4UQ9A 1VH7A 3CGTA 4PMOA 5CAKA 3TYUA 3U8GA 1UG6A 2VC7A 2PZNA 1K8ZA 3TN5A 1AZ1A 1TTIA 4M81A 3S1GA 4HSHA 1MQRA 3W7HA 4HNTA 1UH3A 5HPCA 1EWEA 2BY2A 2BDQA 4C6CA 3GVRA 1JCTA 1MFUA 3DG3A 3WF1A 1D7FA 4D6GA 2MANA 1F6PA 2IXUA 1GHRA 2RGLA 4D6FA 1TPVA 4XD4A 3QYSA 2G3FA 2Q09A 1QHPA 1Q7QA 3VUSA 1Q6EA 4LF1A 5LHEA 1E6RA 3DIPA 2QJNA 2E6FA 2YL5A 3L4WA 3BVJA 2DZXA 3GU9A 2ZCGA 1LBFA 3V5FA 5LGXA 1C8QA 2X09A 2C79A 1I2QA 2OELA 3KBMA 3QYQA 5HULA 4NX0A 4LCSA 4D6EA 3BW3A 5I06A 2IQ0A 3KDNA 4F9DA 1WDRA 2NQJA 1CXHA 3C6CA 3T05A 2QULA 2R91A 4JR5A 3AHXA 3WDHA 5HPOA 2QQ6A 3GIYA 1FDYA 4KS0A 3N12A 1WYIA 1Q6QA 3AWNA 5CGTA 1R3RA 4A2RA 3I65A 2X1UA 4NJJA 4NIRA 4KESA 3C4UA 1GYMA 5HNNA 3BANA 3W2LA 3WSUA 1W91A 1JDDA 4JNYA 3O3RA 3FAXA 1HNYA 4MLJA 2WLYA 2C8NA 4F2UA 2ZC1A 2ANUA 4GYJA 4EPKA 1SJCA 3S6DA 5PTDA 2FTYA 3NXFA 4UIOA 1OC7A 2HK1A 3LM3A 1QMLA 2DZSA 2CYGA 4R7WA 5M5DA 4AZIA 3BGGA 2YXGA 1W3IA 1FXPA 3JUGA 5T26A 3AICA 3FEQA 3OJGA 1WUFA 1O68A 3NQ6A 2X16A 4Q8TA 1ONEA 1OX5A 2FJKA 1KR1A 3T1GA 1MUWA 4AQLA 2REQA 3NQ8A 1TIMA 4DLFA 1Z9AA 1ADDA 1ADSA 1CTNA 1JPHA 3MKKA 1H3GA 3A4XA 3NEVA 2V30A 1L6YA 4AZHA 3BJFA 3KL3A 1RV8A 3IACA 3GDBA 4QSHA 4HNLA 2X41A 2DY3A 2BXVA 2Y7FA 1R85A 3M0IA 3PPFA 3UXIA 2OX4A 2NX9A 2VC5A 1QNSA 4QFUA 3CZLA 4XUGA 2QPXA 1FDJA 3V0UA 5REQA 5F2MA 4G7EA 2DZUA 1EF2A 3ERPA 2WSPA 1VRDA 3K8KA 2JKPA 1GW9A 1F76A 2IPWA 4LF2A 1YIXA 5D2YA 3U2EA 1ISVA 3CV7A 3LNPA 3LCWA 2RH9A 4KMQA 3MP3A 1ZTVA 5AOUA 2X0HA 4MWAE 4IX2A 1FWDC 3TXVA 2DH2A 1VIZA 4XUYA 2PDMA 4ICNA 4LAOA 3ITYA 1BFNA 1NFBA 1J0HA 2C1GA 3BTNA 4UBPC 3P5YA 3RPDA 3AU2A 2D24A 5TIMA 4UTKA 4BF9A 1XWYA 3URAA 3HG4A 3SCRA 3VMNA 1F3WA 2PDLA 3UXKA 4K37A 2ZRYA 2OGYA 3MI3A 2PLKA 4XTDA 4ZO6A 3PPCA 3SSJA 4G8TA 1ZCCA 3ARVA 4JKMA 4U28A 3II1A 5FI8A 3AS0A 3GZ3A 3OQEA 3L2MA 1OVDA 4XZBA 3TCEA 3G6LA 3GAKA 3GTFA 1LJYA 2GQ9A 5C9WA 1B57A 1UQYA 2IPJA 4H9TA 4NKCA 1S3TC 5GJNA 1BPLB 3RCYA 2C18A 1B3XA 4KFPA 1FRBA 3PZTA 3WLTA 1FWFC 1REQB 3GNXA 5HMSA 3G1DA 3PSWA 1NVMA 4QDWA 1KKRA 3UQNA 1ZRQA 2QIWA 4K7VA 3TWBA 1NOWA 2NLIA 3CHDA 3EEGA 3KZSA 8CGTA 2DT1A 4Q7BA 4JIHA 2VEPA 4IMGA 2VURA 4GG9A 3EAUA 3TJXA 2VWSA 3UZ5A 2HS6A 3HJZA 5HANA 1JG9A 3S2MA 3TQ0A 3IV3A 4N9DA 1GVQA 3MSYA 2QDHA 1H5VA 4GI6A 4TX9A 1PX3A 4Z1AA 4I8DA 3S5SA 1SUXA 4GJ1A 3WKZA 4C7DA 2A6NA 5EU9A 4RE4A 1KR0A 2C19A 3PHAA 1WZAA 3E12A 1P6CA 3OBKA 1VHCA 4L4LA 3DKLA 1QOQA 1Z44A 1UZ4A 1PKYA 3HOJA 3TP4A 3UEQA 3N6QA 4QISA 2QDGA 1KFWA 3KM8A 4CD8A 2YBVA 4QDPA 4GA8A 4L6HA 2CBVA 1V7AA 1DOSA 2HSAA 2HQAA 3K4AA 3OZOA 1VBHA 4JICA 3NO3A 3TNOA 3B8DA 5BW6A 1ITUA 3G24A 1TRIA 4HA0A 2QHAA 4H7VA 1NEYA 1QPRA 3STEA 1XV8A 4PFHA 3W24A 4OV9A 3EWXA 2HISA 4Y9NA 4J9JA 1C92A 5U4NA 3RX2A 3SRKA 3AAMA 4LVBA 1HUVA 2FHFA 3AO0A 1B3VA 3WEOA 5D9MA 1R9XA 2EPNA 1WQ5A 3I7SA 4HOZA 1E3XA 1ZP4A 1K03A 2HE8A 5LZLA 1QU4A 3V3WA 4K68A 4P8VA 2VELA 3UPMA 4GYPC 2ZUWA 3DHUA 2XSBA 4L56A 2QR6A 3A13A 4NZ1A 1IZJA 2DSWA 1GKQA 1XH0A 2PP3A 4F0MA 2IMRA 4JNMA 5I3GA 4ERGA 3WLQA 2PTDA 2HNHA 5LIYX 1M5WA 3H2EA 1GOKA 1OB0A 2NV2A 1CCWB 3EOLA 1L6WA 3WNOA 4GZEA 3DCPA 5CPLA 5AHLA 4H9ZA 3MZ2A 3AIBA 4HHMA 3K8LA 4FI4A 2E5BA 1FCVA 4LYKA 2OU4A 4UR7A 3TN4A 4FO4A 3LGEA 1J0JA 4RK8A 5I3DA 2G3NA 4WUIA 2EPLX 4WEVX 1AL7A 5BU9A 4GO9A 4E38A 2ZTJA 3HPXA 2VZSA 4N9BA 4XZ9A 2E25A 5CZSA 4CD4A 3C5QA 4LC6A 4NNBA 4KRUA 3RYSA 3IK4A 1CW2A 4QG8A 2OSXA 1OCBA 4H9YA 3A3WA 3W81A 1D2KA 3U6WA 1WDWA 2E5DA 3L4VA 3CASA 2O0TA 2D2OA 4HJFA 3KOXA 1AL8A 2OEKA 1BF6A 2D20A 3WK1A 4TIMA 5FJJA 3DGBA 2FGBA 4GQBA 3ARWA 5LNUA 1J10A 1R3VA 1R3TA 1OSEA 1XIDA 3I4KA 4GVHA 4EF8A 1KFCA 4QGCA 3W75A 4JOMA 4A8LA 1J0YA 1E73M 1NFGA 3GVGA 1VEOA 2E4TA 4ZBCA 3GIQA 1WOBA 1XYLA 3CIWA 3E02A 4HCDA 1MEHA 5BYWA 1JCLA 3EPNA 1VRXA 5HQEA 5FF2A 2BOEX 3KCLA 3BLIA 3H4WA 4INFA 1E6XM 2J9XA 3ARXA 4C7GA 1N7KA 2C6QA 2V5KA 3SN4A 5KZDA 2PDIA 2P1FA 2VP8A 4MNJA 4KCVA 2FH8A 1XG3A 4MWAC 3VIOA 4XVDA 2Z27A 2PDXA 4Q4QA 3KS6A 3ITCA 2J9YA 4DBSA 5A6BA 5K9XA 3GFXA 3DDMA 2ZZ5A 2GDQA 2Y61A 3C56A 5CPSA 3LUTA 3PNZA 3S2JA 1B2YA 5H8UA 3EOOA 1UD2A 2Z25A 4ATWA 2ALDA 2QAFA 4C6IA 1WAUA 3MP5A 4XWUA 3VFLA 1QUMA 3DENA 3ARZA 4H8UA 4UFJA 3H6OA 3V16A 1HKMA 4HYWA 3VNZA 1A5BA 1RA5A 2D69A 1VEPA 3ABZA 1GONA 4C6NA 3DFQA 3VKDA 2WZTA 2HPIA 1T6MA 1ONWA 1OQFA 5DLCA 4QLJA 3REQA 3WBWA 3GNNA 2QAPA 2ASHA 5JU6A 3BLDA 2PLCA 3ANUA 3VIJA 1Z7AA 1HKWA 2Y8VA 3P5ZA 4CUCA 3UZXA 4ZTXA 3TR9A 1XC6A 4JTDA 3AYVA 3DI0A 1EPVA 4YHGA 2Z0IA 3H55A 3CO8A 4H7CA 2AMGA 3MYOA 1A5UA 3QZ6A 5CCZA 3HF3A 4M6PA 3E74A 4L9ZA 2GGGA 4PMQA 1RK5A 3ZR4A 3ZZ1A 1SR0A 1QOXA 3CH9A 1T8QA 4J7RA 3NSMA 3BQ5A 3LV5A 4QIUA 3IVTA 4ZQRA 4IXHA 4NXSA 2ISSA 3L65A 4YNGA 1YTKA 3CK5A 3WELA 7TAAA 3ORWA 2Y4SA 1QO5A 1GW1A 2V63A 2WW5A 2ZX6A 1PAMA 2TSYA 3GC4A 3NYZA 1SGJA 4FIQA 4FXJA 1JI1A 4CN1A 5C7HA 2X0YA 3MHGA 2X1TA 3NGFA 4JS3A 1KM2A 5DO8A 3N13A 3C52A 2A3EA 3S6OA 3B8IA 2PDBA 3M5VA 1E5NA 3MWCA 4CCDA 3PUDA 3EZ4A 4PL1A 2AQOA 1PZ1A 2CKSA 1XW8A 3WLRA 2YYUA 1LRQA 2X2YA 4NZFA 5C2CA 2OZ8A 3CZGA 1RH9A 3BMXA 1I1XA 4ROQA 2J7DA 1KM0A 4US5D 3TQPA 4YJ5A 2CBUA 1W5PA 3WJYA 2Z1SA 1Q8JA 2DZAA 1UIPA 2ZIDA 1MDLA 2GJPA 3I6TA 4HPGA 4R85A 5C71A 4OV4A 4JTLA 4PEEA 4BR1A 1YDOA 4WRHA 5M3WA 5HXMA 3VABA 2OO6A 3UCQA 4I7WA 5GQBA 1BWVA 4EWJA 3EXTA 1LG2A 4H9XA 4LVFA 4E2VA 3FDKA 4ICMA 4NAFA 3H12A 2BWGA 2D73A 5CZ0A 3TAKA 4GVFA 3MCOA 3CQ0A 5M17A 1Z69A 4C91A 2FKPA 2GJRA 4FF7A 2V9DA 3GYEA 4A29A 1D7KA 4HPHA 2JQXA 5I3FA 3EGJA 2EAWA 4MSSA 1E0VA 4ROPA 1SO3A 2J75A 5F2GA 3QVQA 5FD0A 3QSRA 1M65A 3AZSA 3NZGA 3WQPA 1F8MA 4J3UA 3WX7A 4HTBA 4YTQA 1W2PA 1F7BA 1EUNA 2CHRA 1W9BM 2B7OA 1IZKA 2E09A 4FSAA 2QLYA 1QR7A 1K8YA 3NYDA 3GH7A 3UJ2A 4TV5A 2XISA 3S9YA 4GQQA 2C15A 2PDPA 4GNVA 1RP8A 4Y7EA 4D6JA 3BMWA 4ACZA 3HGJA 2NV1A 3HPSA 1N8IA 3NOEA 4TOQA 3IAPA 3WH5A 4B91A 2R94A 4FNTA 2Y8UA 3STFA 4MNMA 3O15A 2OKOA 1GTHA 2I9EA 4QX4A 3F03K 3TTEA 1I6NA 1KBIA 4LOCA 3QEZA 1GZJA 1B31A 5HUPA 3PUEA 3R25A 3E0LA 4A22A 3CAKA 4C1NA 3WLKX 3NL6A 1YPIA 4POCA 5K7JA 3N6HA 3RLGA 4OU1A 5LXXA 4XQ6A 1PE1A 3JRKA 3RIKA 3IAQA 3CZEA 2YR1A 3IUHA 3KTCA 3ITOA 2VJXA 3VE9A 4BF5A 3L2IA 2YKKA 1HF6A 3R43A 1M01A 1RD5A 1TVNA 4X9YA 2ONEA 4GO8A 2CERA 1C7SA 1ZBCA 1K3UA 1UH4A 2WWCA 4YYCA 4EK7A 1BEUA 1LWJA 1BYDA 5A8OA 3L4XA 1W3HA 4EACA 3VNDA 1SW3A 1OG0A 1EB3A 3WK0A 3WO8A 1SM9A 3L12A 3KTSA 5K4ZA 3NZRA 1GVSA 4DF0A 4HSOA 5HJXA 3EMCA 1XLAA 1I0DA 2YCIX 1H61A 3A47A 3S2NA 2GUUA 1EDQA 4GD0A 4DJEA 1UJPA 3W83A 2WLZA 2PC8A 1FWGC 3LQLA 3VNLA 3VOCA 1WO2A 2XFFA 1F3TA 1SYTA 4O11A 1T41A 3TYBA 3W7QA 5TNVA 1YDYA 2CCRA 3UETA 2FDMA 3EDJA 3S46A 2WM1A 4QR6A 4BI7A 1PZ0A 1L9WA 3TTQA 3KFTA 3HMJG 2WPBA 3BG9A 5JH1A 4GNJA 5A3HA 4LTSA 4ATLA 1VBRA 2NLYA 4KQNA 3ABOA 1P0BA 2O9TA 1XINA 4IQEA 2PE4A 1WX0A 5BU6A 5IDIA 3D0CA 3S1VA 1OY0A 3M5ZA 4HBKA 3LXCA 1KXTA 2NWRA 1KQYA 2WJFA 3M0HA 1SZGA 1WZKA 5FAGA 1JCMP 2DQWA 3PWAA 4WKFA 4GQGA 2I7GA 4P7OA 4AX7A 1OFQA 1B9BA 1LL4A 3JZUA 1PTAA 2PP0A 2JKEA 4QE4A 1IEXA 1PEZA 4UCGA 3ATZA 3WQ4A 1ZQ5A 4E6MA 4MYXA 2VFFA 4HZMA 4LQ1A 4MAZA 1QVBA 1V8EA 1DWGM 3SADA 2GGHA 3MT1A 2PWUA 1TMQA 4GISA 2F6UA 3ZM8A 3SRFA 4OQVA 1K7EA 1XKJA 4P7QA 4WDXA 3CQIA 2GGEA 1Q2RA 3MUAA 4O13A 3RGTA 2FJUB 5RUBA 4W9TA 2ON3A 2D2HA 4UB9A 4JTGA 4YVXA 4E4PA 2WJZA 3LBCA 3LS9A 1C9DA 1EH9A 3WDQA 1VFSA 1ENUA 1UROA 1VFFA 2VKZG 3SIMA 4D9PA 3W29A 1TV4A 3B9OA 6REQB 5BXPA 1XUZA 2GVGA 4UOZA 3KVJA 1MQQA 5LIWX 1H50A 1E6ZA 2X2GA 1UW9A 2YZ5A 1GCYA 3WYZA 1CBGA 3D3FA 3EWWA 5TQLA 1UMLA 4QS5A 2X1RA 1QI2A 2PD9A 3MP4A 4KKXA 5G1TA 3U48A 4BFAA 4L6DA 2YLAA 2E5CA 3EWZA 1HP4A 3VVGA 3VINA 3E0VA 1PKMA 1E9LA 4BS0A 5A8QA 5EMUA 4X61A 4NILA 3WUFA 2ZX8A 2DSZA 3WLMA 1G01A 3MUXA 4G9PA 5EBUA 3JU2A 1U1JA 3KX6A 5JVLA 4UZSA 1NELA 1DEDA 1ICSA 4JQ2A 2VOMA 1RY0A 5A6LA 2NT1A 4ZFMA 1ZL1A 2POTA 4HB7A 3VKJA 3QHNA 3A23A 2IS7A 2FZDA 3W53A 2Y5SA 4UTMA 3VPLA 3GH5A 1EGMA 3CIVA 1B3WA 2R82A 3QZEA 1CLKA 4PL2A 3W01A 4P7NA 3BPWA 4MJZA 3QLDA 5AZ0A 2BXYA 2WZEA 3FCPA 4A21A 5BCAA 3PBYA 1XH1A 2HEJA 5A5WA 4BCEA 1WBJA 4N0RA 1TKKA 5F4WA 1QPKA 5TBOA 3T8QA 3E5PA 1GVEA 1F9CA 2I5IA 1MXGA 3G1RA 2C16A 1TX0A 3EXRA 4YLWA 2GVJA 3GQYA 4LJ3A 1JPKA 3DBNA 1MMFA 3GVQA 4PYSA 2HK0A 1E5JA 3H2AA 3AFBA 4DLMA 3KHJA 5DX7A 2BY0A 4AC1X 1B4KA 2OG9A 3N4FA 2ACSA 3N2XA 1PDZA 4AIOA 3A4AA 4GUIA 5AFDA 1RQHA 2TAAA 5KETA 5FJUA 4MADA 3W76A 2RDTA 4E3TA 4FLOA 4KRTA 4PRWA 2DUZA 4NNAA 5D9PA 1GZGA 4H6QA 4ZQOA 4W5ZA 3PZUA 1XDJA 2OTDA 4PTVA 2J7BA 2HMCA 4UZUA 2B4GA 3OA5A 1QHZA 1UKPA 1UWUA 3R8HA 1NU5A 4QJ5B 3I3EA 4DJED 2FZMA 1F05A 4Q4SA 3MO7A 1QNOA 4Q8PA 1DWAM 3TFXA 1KQZA 5XIMA 3NDZA 5AC8A 1XGZA 4K2SA 4HNNA 1KCLA 3CPUA 1W6TA 2V81A 5CJNA 1EZWA 1V6XA 3N6JA 4RZBA 3M0MA 4GFSA 2MNRA 2WJEA 3BSHA 3QN3A 1XF0A 4O4VA 3N2BA 5AKQA 3EWYA 2C91A 2EJ1A 3AIEA 4GUJA 2WOQA 3OGRA 1LT8A 4QAIA 2OYLA 4O12A 2VFEA 4AAJA 1OD8A 4U33A 2GSHA 4AD4A 3VMPA 1UR8A 4XZHA 4CQAA 1VR6A 3LPOA 1XLKA 2WVVA 2YL8A 4UTFA 1BRLB 3ARQA 2J7EA 3L4TA 4YMZA 1KFLA 1U1HA 1JZ3A 1L0PA 1LQ2A 4MKVA 4JXCA 4AYGA 1HP5A 3PULA 5D9NA 3WMLA 4Y9OA 4I5RA 1OCNA 3OB8A 3B9NA 4N9EA 3ARUA 3V75A 5GPRA 1ZBWA 3N2OA 4JCLA 1POKA 4ML4A 4YS1A 4B5SA 4Q6JA 3C61A 4D6HA 3UR7A 3N3TA 3WD2A 4KGJA 4DM1A 4PEKA 1FY6A 3TN3A 1FWJC 2B31A 1OFBA 1ZAIA 2G41A 4UFHA 4FEZA 1VEMA 1NFPA 2RHGA 2FZBA 4WY0A 1XCXA 4AYSA 4K3ZA 3MUIA 2GJLA 4QJ3B 3TUUA 3FFSA 1CI1A 2YL9A 2GLKA 3G18A 5K3VA 4IUOA 1KWKA 3LZ3A 1VBJA 5D09A 3VXGA 3O0KA 3UERA 2JFEX 3B0YA 2EPKX 3RO6A 4MF4A 2CLLA 3LOTA 4S3BA 4C65A 3H53A 3Q67A 4Y6GA 4CVWA 4GZJA 1UOKA 5J8LA 4LAKA 4ZOCA 5IBXC 3FW6A 1ECEA 1XRTA 7XIMA 3SUVA 1K70A 2W3ZA 4M1BA 2WKLA 1DIDA 2VC9A 4JFUA 1M7JA 2FB3A 5A69A 2CZDA 1UCWA 3M7WA 3OIHA 3B0VC 1XRSA 3FNDA 4B3ZA 4GQRA 5DXYA 3BJTA 2W0UA 2Z1BA 3OGSA 1P0NA 3TA6A 3G1YA 2QIIA 2JIWA 3WMCA 3TKFA 3LBMA 2YGYA 3WZ0E 3H4XA 4DF1A 3WDPP 3AXXA 4RW3A 4DZAA 2GWGA 1S39A 1SW0A 1UWTA 3OPSA 4JFTA 5KZ6A 5DMLA 1GJWA 3W2NA 1UKSA 1DJQA 2KX9A 2J27A 3RILA 4RKAA 4A8RA 3JVAA 4OOZA 4UR8A 4J40A 1BSIA 3UG3A 2ZUTA 1YHTA 2A5HA 2CEQA 1SJDA 2NQHA 2X1IA 1TQXA 2HCVA 4O8RA 2DW7A 3G1XA 3FYYA 5DMMA 3T6CA 3WFAA 1GTEA 2BASA 2YYTA 3WF4A 4XB3A 1AJ2A 3RO8A 1LP6A 3B3DA 1IT8A 5GJPA 3B40A 1YYAA 4H1ZA 4HA4A 1FP8A 3CTTA 3RPTA 3ZIZA 2G97A 1N8FA 3M9YA 4LVAA 3WNNA 4CVUA 2OLHA 2C7FA 7TIMA 2J25A 3SZ8A 1C8VA 3PAJA 2OWWA 1L6FA 1MW0A 5J04A 1G4PA 1I4NA 3H2OA 3A21A 3SN0A 3L2LA 1YDVA 5AYYA 4MB5A 3RMJA 1MDRA 2QW5A 1T8XA 4H7ZA 4ATDA 4E8GA 4XX6A 3C2OA 5H2ZA 3ARRA 1YNYA 4WVXA 4LV4A 4IIHA 1HJUA 2Y2WA 2O55A 1OFAA 5A6JA 1PSCA 1IXPA 1Q5MA 1XKYA 3BAIA 4PUKA 4PUJA 4P8UA 1JPMA 5I6SA 1ML1A 3K4DA 3LSBA 1N8WA 4JY8A 1HO4A 1JRBA 3PZMA 2QZRA 2AGTA 4MB4A 4ZO7A 3VM7A 3W2JA 3T55A 1GJPA 4I9JA 3IK2A 1IGSA 4WX2A 2WC4A 3MTWA 3BSMA 3OZMA 4R88A 1V77A 4H8VA 1TWIA 1J6OA 2W91A 5DCBA 3RCNA 2BXZA 2OYMA 3QW3A 1VKFA 2Z1VA 4ZB5A 3QQ1A 2UBPC 4ADSA 4LNCA 2H3DA 5CC3A 1OJXA 1TPDA 4O0KA 1G6CA 1G7VA 1V6UA 1HZYA 1FCQA 4I8YA 4RNJA 4Q8WA 4TVUA 3S47A 1YPFA 4GACA 3F5JA 2E68A 2ZWYA 4HOWA 1AQ0A 1H0IA 4BK9A 1E4IA 1R2TA 2Y85A 2VUNA 1MNSA 2GDUA 2V68A 3NA8A 1BVNP 1WKFA 2UV8G 2B7PA 3VGHA 8XIMA 3GVWA 1XQLA 4AVOA 3UWVA 3V5OA 1XXXA 3N73A 4IMAA 1QO2A 4PMJA 1R7AA 4Z2GA 3OVGA 5I3IA 3NAVA 4IT1A 1S3HA 2HE5A 3IARA 1ZU8A 3G0SA 1DJWA 1NOUA 1FH7A 3ZJ7A 3GLCA 4HZ7A 3VGFA 1AQMA 4IMCA 2IQTA 1PHQA 4IIFA 3ME3A 4LALA 3GHTA 5H91A 1XISA 2BGQA 1VPQA 2VX6A 2CETA 3LGGA 4US6A 5MKGB 1BHGA 3IIOA 3H23A 3IANA 1XICA 1WXYA 3NQAA 2WC7A 5HBFA 4JTAA 4NT0A 4PBEA 1UA7A 1IE7C 1TVPA 3W74A 3FN9A 3B0UX 3NZ1A 1XL9A 4LC8A 1ADOA 2EPOA 1F4AA 2DZWA 1QW9A 2BZNA 3KOFA 1FA2A 1GVRA 1DJIA 3GSMA 1U33A 5CJ5A 1F74A 4MKSA 4XZIA 5HINA 4KERA 1KGXA 1W8SA 4US5A 1JCYA 1GYNA 4NJIA 1QXLA 2Z2AA 1KXHA 1UC4A 4BI6A 1CWYA 5E9AA 5C2GA 1S2UA 3CUFA 4JHOA 3JS3A 1UZHA 3BCDA 1WDDA 4JTSA 5KTLA 3P8JA 2PDUA 1RPKA 2AL2A 4J5NA 5A6BD 3GNDA 3P67A 3EDEA 2WNWA 4YHEA 3EXSA 3LEPA 5K2ZA 3BG3A 3MDWA 3GH4A 3CWNA 3QFEA 3KE0A 4J2PA 2VFGA 4Q8QA 2GK1A 3KAOA 3F4DA 3BARA 5K9CA 4WOQA 3DHFA 4O1AA 5DCEA 3DG6A 4DF2A 4D8ZA 2G4JA 5AN7A 4IP5A 4Z2IA 3GYCA 3WJXA 3WLLA 1EC9A 4LUYA 5I3HA 1SZFA 2J66A 3E6EA 4HT3A 1E6NA 1R2SA 2QCLA 4Q8UA 4O1CA 1DJXA 4XAGA 2QCEA 3B4UA 3VD5A 4PB4A 5FSDC 3TJIA 2DPEA 3F7JA 4RZ5A 1QI0A 3KDOA 3WJWA 1P7TA 4GZIA 1EA9C 1JUEA 3B97A 2F2HA 2JF6A 2YBUA 4B9YA 5A6SA 2IW0A 2PEVA 1TV8A 4PMDA 1W9UA 4Q8MA 1V0NA 2H8ZA 3M5YA 3V36A 2GUBA 2DORA 4IGMA 4JFSA 1KFKA 2FMOA 3PG9A 3BCJA 1K6AA 4P2VA 4HNCA 2L5HA 2I5GA 4MB3A 1YPXA 4GYKA 1B5TA 5CSSA 4AFYA 3AXIA 3LCHA 5FEZA 3Q58A 1CGVA 2OZTA 3EOSA 1KFEA 3QV7A 1XDLA 3I7RA 5H1WA 4B2DD 5FEXA 2WKJA 1CGYA 5BXSA 4C5ZA 3RM4A 1XM3A 4UMCA 1G1YA 5DY3A 1BLIA 4U2ZA 4UTUA 3DFNA 4XBKA 3O6CA 1W37A 1XUUA 3TW7A 2EBNA 1HL8A 3O1NA 2E6YA 3VGBA 4IPIA 1W0MA 3CUZA 4IG2A 3QPZA 4D1IA 4JL2A 2DW6A 1A4MA 3PB2A 1JF5A 1IZCA 3SB0A 1Z32X 2DUAA 3QV9A 1EYEA 3VA8A 4LANA 2WKGA 3W23A 5BXRA 4L4MA 2XTKA 3AJXA 4J3SA 3K8MA 4IIEA 3WD4A 4U31A 4G7FA 2EGZA 4G6CA 1M03A 3PFMA 4GIAA 2ZDRA 1VFOA 1JUBA 3S9IA 1POJA 3L67A 4M82A 1E72M 4FALA 1AD4A 4JYDA 5D05A 5I3JA 4ES4A 1ELSA 3RPMA 3MHUA 4L7ZA 2W62A 3GTHA 5C8BB 3GG8A 4EOUA 4D71A 1ZPTA 3IIZA 4KWOA 1RP9A 1P6BA 3W7GA 3OA3A 4HTYA 3Q94A 5H8PA 2OT0A 3KP0A 1P6WA 1OBAA 2OZ0A 4UOQA 1IEWA 2XDFA 1F6KA 1RLCL 5CKSA 3AMKA 4WZHA 1UKOA 1J5TA 3GXNA 5CBJA 4NJHA 3U57A 1OFEA 2YB4A 3ICJA 4LV9A 1KBKA 4LUTB 3VKBA 2XM2A 3NL2A 4JIIX 1TELA 2GJNA 1A5CA 5FAJA 1H7WA 4ZOAA 5FEWA 1XLMA 5AVHA 1VGAA 4WGHA 1V6VA 2V3FA 4WXZA 1ZJIA 2NSOA 3N2MA 4UTLA 2VXNA 4Z2KA 4DM2A 3IJ9A 3BV4A 1CXLA 1JL8A 3CM4A 3W1PA 1DJYA 4RZ6A 2V5DA 1Y5VA 3MVIA 3SCPA 4M6VA 3AS1A 3T09A 3QGVA 4GBUA 3WUEA 3V0TA 3CZKA 4YCPA 3CQJA 4E2DA 4F40A 1TPB1 3LMZA 4IFOA 4M8UA 1OFDA 2D22A 4WDUA 1YTDA 4AB4A 2ZA3A 3IGSA 3AALA 2W9MA 4XAPA 3T2QA 3DC0A 4XO7A 1U30A 3QW4B 2XG9A 2ZRXA 3F2BA 1G0CA 2J8TA 1XYAA 2ISVA 2YLLA 1J12A 4JTRA 2O92A 2SFPA 3S6TA 1BTCA 1THFD 1IEIA 1C7TA 2Z28A 1KRCC 1FCBA 4IMFA 3WDJA 1W1YA 2F6XA 3R5EA 4NG3A 3GM8A 1OYAA 1AW1A 1XIFA 3MQTA 2YBTA 2I57A 5D38A 4E8CA 3VGGA 3GNPA 2Q8XA 1TPH1 1J4EA 2BOGX 1UASA 4BWLC 3EMZA 4WIWA 2VDIA 4P8WA 2ZZ4A 5HNUA 1S1RA 6XIMA 4B2DA 1O5QA 3RU8X 5CSUA 4AEOA 2EG7A 1D8CA 1W9VA 2CESA 3G5EA 2XJ7A 4CN6A 5AHEA 1D3CA 3S1XA 1LDCA 3QPYA 1LM1A 4WF7A 1BWKA 3FGCB 3UF9A 2FTWA 3TSDA 2BHZA 1QW7A 1G7UA 3GFZA 4HA3A 4A2SA 3RR4A 3T40A 4AVFA 1OX6A 2RFGA 3T08A 3I3BA 3W3OA 2IKIA 1TA3B 4R33A 8TIMA 1W1IE 1IHIA 3OVQA 1QRQA 1H1NA 1TR1A 4AZ7A 3A9BA 3QBUA 2QF8A 4J4KA 3FS2A 1I2PA 5BMXA 1RY8A 4ZE4A 3P62A 5AC5A 3WF2A 3WNKA 1RCXB 1AVAA 2FVLA 1AH3A 4Q4KA 1IWBA 3ZQ9A 1SMDA 3AYRA 2A1YA 1QPQA 3NDYA 4FOUA 1OIFA 1WPCA 1Q6FA 1ITXA 4OFCA 4RE0A 4E4FA 5SWUA 1C8YA 3L0GA 4JTEA 2V5JA 3POCA 4CCEA 1TR9A 2OFJA 4CKQA 2A2IA 3SQMA 1I2RA 5FF0A 1WZMA 4KFOA 3W7MA 4JHZA 4TVCA 1S5VA 4ZQMA 2Y63A 4ZSTA 3NOYA 4TQTA 3OVRA 3B0XA 3TVAA 3W0KA 3PAOA 3W22A 2A85A 1QWGA 4FZIA 4QLKA 4ZO9A 3GXMA 3R8RA 1FFQA 3LRLA 3FGCA 2QCCA 3BCFA 5G2WA 3QY6A 4LYRA 4LBUA 1ZBVA 3H2MA 1KFJA 4PODA 2ACUA 3R6IA 4GXPA 3GK0A 3QGAC 3LPFA 4NJKA 3SFWA 3DFSA 6TIMA 5A8GA 2WSRA 3HPZA 1VF8A 3CUGA 1VHNA 2WMHA 3C0SA 4PCFA 4G1KA 1UR4A 3VO0A 2ZQ0A 2F8QA 1KBJA 3T78A 4DWSC 1AG1O 4HYRA 5TD4A 2FFIA 2ZXDA 5KZEA 4P5UA 1Y5WA 2PDCA 3TX9A 2PZ0A 3L9CA 4LXFA 5T8GA 2JK2A 1LUCB 3VNIA 1J8VA 3LHTA 1A5LC 5HOSA 3LU2A 1E51A 1HL9A 3WLOA 4IFKA 5CG0A 1VFHA 2BHUA 3M7SA 2NQ5A 5LIKX 2QVNA 4YCOA 3UFYA 1AH4A 1JDEA 5KINA 3E2VA 2RKXA 3W70A 1OFOA 5LNVA 3CAVA