4W7UA

Crystal structure of xaccel5a in the native form
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
313
structure length
313
Chain Sequence
HMLKYVGVNLSGAEFNSRKKPGTLFKDYTYPAASDFSYFAGKGMNTIRLPFLWERVQPELNGPLDQAQLGLIKKSLEAAKANKQYLILDLHNYATYSGKRIGTSDVPAGALADLWRRLALEFKDDKAVIFGLMNEPNGISAPDWANAAQGTITAIRKTGAKNLILVPGTAYTGAHSWRSTSYGVSNAKALEILKDPGNNLAFEAHQYLDKDYSGTKPVCTSDSVGQEKLQGFTSWLRENKQKGFLGEFATANNPVCDKALEGMLTYMEKNSDVWLGWTWWAAGAWWKPDYPFTVQPGKDGSDKPQMAILSKYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cellulase
publication title Crystal structure of XacCel5A in the native form
rcsb
source organism Xanthomonas axonopodis pv. citri
total genus 122
structure length 313
sequence length 313
ec nomenclature
pdb deposition date 2014-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4w7uA00
4UOZA 1XSJA 1V02A 2YBTA 3M07A 3N13A 2VC9A 1CNVA 1U33A 3CHEA 2XFFA 1HVXA 2WLYA 4OIFA 2CERA 4FLRA 1MFUA 3AHYA 3APGA 1GJWA 3AHVA 2IUZA 3L4XA 1ISVA 3PZVA 5ABFB 1KXTA 2Y8KA 3WF3A 3ZT5A 1D3CA 4PMVA 1PJ9A 4UR9A 3O9NA 2GK1B 1JYXA 2OSXA 4YPJA 1EO5A 2XWDA 1W2VA 1B3WA 4E4PA 3GZAA 1GVYA 2DT3A 1J18A 4AD2A 3WNOA 4LYQA 3WL0A 5E6YA 4PUDA 1G1YA 2VX6A 3WQ4A 1E0XA 4EK7A 5D9MA 3BMWA 3I3BA 4F8XA 3F5JA 1MW2A 3U7VA 4BQ4A 4CD6A 2V3GA 4ATDA 1QNPA 4AIEA 1N82A 2ZUUA 4M82A 2DSWA 3WFLA 4KMQA 1H0IA 1OM0A 3BAKA 3GXDA 1E6XM 5A8NA 1LL4A 2O9TA 2V38A 2ZUSA 2Z1SA 4P8VA 3GNOA 3N17A 2XFRA 1JDCA 1VEPA 2ZXDA 3DYMA 4AZIA 3GXFA 2D3LA 4MPKA 1TE1A 4MADA 5AYBA 2BNJA 2TAAA 4J3UA 3W0KA 5JBDA 1W9VA 1CIUA 2XYLA 1B3ZA 1GCYA 4MJ2A 4TXEA 5M3WA 1HP5A 2XSAA 3NCOA 5HPOA 1UKTA 3T0BA 5IDIA 3NJ3A 1FHLA 1HJQA 5AC4A 4M81A 4X0NA 3PZMA 2VJXA 3FXYA 4HA3A 3MMUA 1CENA 1XD0A 4W84A 7A3HA 1VIWA 2WMKA 5HPCA 2ZX8A 4Z2IA 4WLCA 4GO9A 3T2OA 2JFEX 3WD3A 2WZHA 2Y4SA 5I2UA 1MYRA 1UH3A 4WF7A 4P8XA 2D22A 2DIJA 1KR0A 3WEZA 2QMJA 4ZE5A 5A95A 1UR0A 1E5NA 4AD0A 3WH9A 2XFYA 4AEFA 3AISA 1R87A 2DEPA 3QHOA 5A94A 3CTTA 2OYKA 3WD4A 2VZOA 4FLQA 2A3CA 5CJ5A 2VX4A 2V5DA 4HMEA 1JAEA 1L8NA 1EIBA 2WW5A 3CZJA 4GZJA 1MXDA 3AZSA 1BYCA 1UR4A 1UD2A 3WUFA 4QFUA 1OIMA 1CWYA 1UR2A 3ZQ9A 1HX0A 3AZRA 3CZEA 4MAZA 1H11A 3N15A 1GVIA 2XGBA 1HT6A 1MXGA 4JAWA 1EDGA 3K4DA 3VKKA 3GNPA 4W87A 4XV0A 3SCUA 1BTCA 1PZ3A 2UY2A 4LYRA 3VIPA 1OCQA 1RD6A 5I77A 1FHDA 1NWUA 3L4VA 3CZKA 3MUIA 4NF7A 4GO8A 1VFMA 1Z32X 3S6TA 1NWSA 4GI9A 1B0IA 1H3GA 3ARVA 3BMVA 1HIZA 4WKHA 1MW1A 3RM9A 4D6HA 1FOBA 3NIYA 1M01A 3F4VA 2EBNA 4FF5A 3A4XA 3VTRA 2VX5A 4PMNA 1VEMA 3IJ7A 3UEQA 2OWWA 4F9DA 1E9LA 4NRRA 4AC1X 2VL4A 1CGYA 2Y8VA 1H4PA 1JXKA 2NW0A 4W8LA 2W91A 3KE0A 4B16A 1X6LA 1CGWA 3WQWA 1JD7A 4J3XA 1BVNP 2V3DA 3DYOA 2XWEA 3ZOAA 2EPKX 1E73M 3MSDA 4UZUA 3VNYA 1E1FA 3PN8A 2E40A 1J0ZA 1BAGA 4GI8A 1BYDA 3AYSA 2VVSA 5A6BD 4HPGA 1UUQA 4CCCA 3ZSSA 1QI3A 5M03A 2G3NA 5GNXA 2CXGA 4TOQA 4BS0A 1C93A 3KL5A 4B3KA 4JIEA 3UR8A 2BXYA 2J8FA 5D9PA 3WDIA 1V3JA 2Y24A 2G41A 1FH9A 3N12A 1WDQA 4EANA 3NYDA 3HU7A 4L4OA 4PCSA 1VFUA 1BSIA 2G4FA 3M46A 1TVPA 1QHPA 3BAWA 5I3DA 3AZTA 3FAWA 1E0VA 2E9LA 2J74A 5HOSA 1J0YA 1I1XA 5C71A 1UR8A 1KWGA 1QNSA 1V0MA 2A3BA 3VD3A 4HU8A 1LG1A 3W37A 1WB0A 2J79A 2W61A 1B3VA 3UG5A 3WH7A 2NSXA 1QVBA 3B8SA 3MO4A 3E1F1 3ZM8A 1UZ4A 4JFUA 4PTVA 1UH2A 5CGMA 4RL3A 1RP8A 1E4NA 1DEDA 2CNCA 1BYBA 1NP2A 3ZJ7A 3VIHA 3AHTA 3SUUA 5HXMA 3L2LA 3VGFA 5D9OA 3KL0A 1E5JA 5JUVA 2OWCA 2VUYA 2X0YA 3QGVA 1R86A 5A8QA 3VIIA 1BF2A 2NT1A 4JFWA 3W27A 1W1YA 2CBJA 1HKIA 1CTNA 5A6KA 2G3MA 2DSZA 1I75A 4W5ZA 1E43A 3VOCA 3J7HA 4DWSB 2GJPA 2ESCA 3AROA 2B31A 2D20A 3CMGA 3MS8A 5A8PA 3FNDA 4TVCA 1ESWA 2CYGA 1MW3A 4PMDA 1CEOA 3CGTA 4P7RA 1B1YA 1UD5A 3A4WA 3UG4A 5D9NA 1WP6A 2J4GA 1CLXA 3AS2A 4CU8A 3IAQA 3W26A 3D3AA 4AIOA 3L4WA 3VD4A 1K9DA 3W4RA 2ZXBA 2C7FA 2VCAA 1ZBKA 2WANA 4JCLA 3WSUA 1Q6GA 3EDJA 5I24A 1JNDA 3OGSA 4FMVA 4PMRA 2J7FA 1CYGA 2VR5A 3VILA 3N11A 1CXHA 1NP0A 3FHAA 1V6UA 1AVAA 3THDA 1E3ZA 1JFHA 2D0GA 3WIJA 2BFGA 2PC8A 3PTMA 3N04A 3MKKA 1OBAA 1KCLA 3L4ZA 3SCRA 1NARA 1XCXA 4D6GA 3EMCA 1EO7A 3ZR6A 3CPUA 3ZSTA 4UOJA 2ZWZA 2VOTA 5JIPA 3WFZA 2CBIA 1GOQA 1V03A 4TVUA 2IXUA 5JBEA 3AXXA 1ZB5A 2EJ1A 2EXOA 4LQ1A 1L0PA 1J0KA 1FP9A 1V3HA 3ARXA 4HMDA 4BZYA 2WZIA 2YL6A 1Q6DA 2ZX6A 4MNJA 3VO0A 2J7CA 2UY5A 3RMEA 2BHUA 2V5CA 3VIMA 3WD0A 5BXSA 1U30A 3LPOA 1NOWA 1H09A 3ZT7A 1F4AA 1UKSA 4D6FA 1WZAA 1KGXA 1UKQA 1X6NA 1ZS2A 2WK2A 4H41A 4WJXA 4UFHA 2X8RA 3NDYA 4H8HA 4UFLA 5F7UA 3VGEA 2O9RA 1QPKA 2XVKA 1EOKA 4Z2KA 1E0WA 2XM1A 3T2PA 3GM8A 2PI6A 1WAWA 3WBAA 4UOQA 3EMZA 3JUGA 4E8DA 4HTYA 3MSGA 3PZTA 3QOMA 4XZBA 5E09A 4IPNB 3S2CA 1NWTA 3POCA 1TMQA 1W1TA 4J3VA 3RM8A 1K6AA 1PX4A 4CN1A 1HL8A 2WMFA 1AMYA 3ALFA 1H5VA 2WXDM 4MNLA 3BLKA 4UCFA 1PZ2A 3CUJA 2JEPA 4KGLA 1DWHM 2O9PA 1NH6A 1JZ7A 1JL8A 1GONA 2PBOA 4A4AA 4AWEA 5A6BA 1JYWA 2QHAA 5ABGA 2VNCA 2DSVA 4DUVA 2PWGA 2YL8A 4V27A 1Q6CA 4TX6A 2W66A 3SCSA 4QLJA 3WF0A 1WDPA 1O6IA 1PEZA 1PX8A 2YDRA 3WMCA 2GJXA 4N42A 3SCNA 2Z1KA 3AIRA 3AHXA 4W86A 3OGVA 2WBKA 4EAMA 2WKLA 4PYSA 3BLPX 2VTFA 3AMGA 3NSNA 1NOFA 3TTSA 4CCDA 4GXPA 1EOMA 2WC3A 1EA9C 3DYPA 4XB3A 4E2OA 1H2JA 5FD0A 4D72A 4ATLA 1UWQA 1ZU8A 4AZCA 4U31A 2VZTA 3SIMA 1HKKA 3WNNA 5I23A 3ZO9A 1LL6A 3L4TA 4D1JA 3AI0A 2WVSA 1W91A 4NI3A 2XVPA 3ARUA 3CBWA 1TUXA 1ZL1A 1OWQA 1YHTA 3WN6A 3T09A 1EHAA 1G94A 1J01A 2ZOXA 4OBSA 2E8ZA 1GNXA 2XPKA 4A3YA 3KL3A 1J12A 3AHZA 3OA5A 2WSKA 1OGSA 3CUFA 2JEQA 1PPIA 3WMSA 1E72M 4PCTA 4PMXA 1V0LA 1LJYA 5CG0A 1KFWA 4CGTA 1HNYA 2WVVA 4TUFA 4AW7A 3VIGA 2XSBA 2FH8A 4W93A 4UQCA 1UKOA 1CGVA 2D3NA 1KB3A 1QI0A 4PMYA 3KZSA 3VINA 1EXPA 4MNMA 3VM5A 4W8BA 3UR7A 1G5AA 1FH8A 2J7GA 3CUIA 2J47A 4CU7A 4EKJA 5AC5A 4YN5A 3WNPA 1E1EA 3K8KA 4PN2A 1R8LA 4BQ5A 1FFQA 5E70A 2CBUA 3CZGA 2XG9A 1HJWA 1QOXA 3ARYA 3EMQA 3AS3A 2WCAA 5EBAA 1UQZA 5CPTA 5LA1A 3VMNA 2QF8A 3WDHA 4XUYA 3WUGA 1GHSA 4H04A 4P7OA 1E4MM 1R7OA 3OZPA 3MU7A 1MWOA 1HXJA 4GIAA 2VQTA 1QHZA 4JKMA 1B30A 1DWIM 1UD4A 4UFMA 5I0DA 1XYZA 3WY1A 5HNNA 1ZBVA 2VRJA 2YLAA 1J0HA 4UQBA 3WH8A 4D71A 3ARTA 5FIPA 3MV01 1HVQA 1V6WA 3ALGA 2D1ZA 4U3CA 1VBRA 4ACYA 1VENA 4PMOA 3BCFA 1J9YA 4PSPA 6TAAA 1Q4NX 3W24A 1ITXA 2VI0A 4BA0A 2QPSA 4S3JA 4JHZA 3CUHA 3IJ8A 5I5RA 3VMPA 2GJXB 3ZT6A 5A8MA 4DWSA 1KGUA 4X0VA 2CHOA 2ZUWA 1UZ1A 4AZ5A 5E9AA 1QW9A 1E71M 1I1WA 2OSWA 1GORA 3VDBA 4W88A 4FK9A 1V3LA 4NSBA 2YL9A 1XCWA 3WH5A 4PTWA 1JAKA 1K9FA 1XHGA 4OUEA 4B3LA 5EFFA 2BHYA 2EPNA 1BYAA 1XRVA 4JKLA 4AZCB 4JKKA 4P7QA 2YKKA 1CXFA 4H7VA 4UFJA 3AMKA 2FGLA 3BH4A 1A47A 1E6NA 1VRXA 3RIKA 2OYMA 3G6LA 1KBKA 1CDGA 2JF7A 2NT0A 4DM1A 1IZKA 1ISZA 1MQRA 3SCVA 2FGZA 1HJVA 3CUGA 1R7AA 1CGTA 1K9TA 1E55A 3TTQA 3FN9A 4HOWA 4AZHA 1QNOA 4ZXLA 3TA9A 1UQYA 1H1NA 4GPNA 4UQAA 2G8ZA 1UWSA 3WMBA 2ZX7A 3SCWA 3NSMA 2JIWA 1M53A 5M5DA 4AEEA 1C90A 2O9OA 1QW8A 2E8YA 4WSJA 3D5HA 1MVYA 2WVVB 2ZUNA 2XUCA 1BG4A 1HP4A 4QAWA 3QHNA 2EO7A 3WQ6A 3PTQA 3RM4A 4KH2A 1Q6FA 2CCRA 2ZICA 5DFAA 5A1AA 2BVDA 1B3XA 4UTFA 3BAYA 3ZJ8A 1JZ8A 2J62A 1U2YA 4UFIA 4AMCA 1US3A 1Y7VA 1LL7A 1WDRA 4P7NA 1JZ5A 1OSEA 3VPLA 3WQ8A 1CXLA 1VJSA 4GQQA 5HDRA 2FH6A 1K9EA 1VEOA 2VCBA 4D1IA 5I6SA 2VCCA 1KWKA 5I79A 1JFXA 3OBAA 3AS0A 5IFPA 3MUZ1 4D6IA 3HN3A 3SCPA 2G3IA 4BQ3A 2J25A 1HN1A 4AZ6A 3ECQA 1PX3A 1GW1A 3WF4A 1BFNA 3BAXA 5I78A 3WUBA 5DO8A 2E4TA 2WMGA 5GPRA 2DDXA 2WLZA 3VDHA 1G0CA 2AAAA 4IISA 3WQVA 1VJZA 2WB5A 3VIFA 2GSJA 3PZGA 1BQCA 4Z2LA 2DPEA 2W67A 4QP0A 2W5FA 1Q6EA 2WHJA 3ZJ6A 5A6SA 2XGIA 4PTXA 1C8YA 1HKMA 2E3ZA 4JFTA 3CHFA 4CU6A 1JD9A 4M24A 1SMAA 2OWXA 3AIUA 1WO2A 1JYVA 4KWUA 2E9MA 1W3JA 1JZ2A 4TVDA 1IV8A 4NZCA 1JI2A 4CUCA 3VIJA 1J0JA 2J75A 4HZ8A 4Q7NA 1LWJA 1FA2A 2BS9A 2J77A 7TAAA 3GH4A 4W5UA 2A3AA 4CD7A 1PBGA 3AIQA 2QMKA 1GZJA 2X2YA 5CPSA 2XIBA 2ZUVA 4JHOA 1OB0A 1KQZA 2DT1A 3AMCA 3WEMA 1OT1A 3TONA 2WC7A 1JI1A 3CMJA 1NQ6A 2FHCA 1VF8A 1WCGA 1W9PA 1XH2A 1IZJA 2YOCA 1CBGA 1WNOA 4ZEPA 1GOKA 1GQLA 3VGBA 5IHSA 1HJSA 2PBGA 1V6VA 5A6MA 3CHDA 4HZ7A 1GQJA 1W3HA 4J7RA 2VRQA 3AOFA 4AD3A 2GFTA 2VR4A 1EDQA 2D24A 4JZ5A 1XGZA 1F4HA 1UA3A 1VAHA 1C7TA 3TTOA 4A3HA 1VB9A 2OLHA 2WAGA 4UFKA 4W7VA 3M6DA 1LF1A 1ISYA 2FHFA 1O7AA 1V6YA 3QOKA 1GJUA 1DWGM 4CKQA 1BGGA 1GOMA 1NWRA 5ABEA 3VX0A 1AQMA 2DSKA 2J78A 3VIKA 1CGXA 3RO8A 3CLWA 2WVUA 5A6AA 2X1IA 1UYQA 1UHVA 1OGBA 4WSKA 1TG7A 4FLOA 4CD4A 5IHRA 3W38A 1DWJM 3W29A 1OD8A 1SR0A 3VX1A 1HJUA 4ZFMA 4U2YA 3MUAA 1E15A 4ZXOA 1WKYA 4WIWA 2WM0A 1DP0A 2J7BA 2XIIA 3K46A 3WBEA 4JFVA 3PZIA 3AS1A 3I3EA 2ZWYA 4ZENA 1ISWA 3O2LA 4ACZB 1TA3A 4OOZA 1MQPA 2PF0A 3GXIA 3VDCA 2WNWA 4CD8A 1QNQA 1V08A 4FLSA 4IPLA 3DHPA 4AD1A 2WMHA 4IUGA 4HP5A 1QI2A 2D23A 2WHMA 4HOXA 4J27A 5D8WA 2YL5A 4AISA 3AIEA 1LWHA 4ML4A 2WKGA 3EDDA 5M17A 3VGGA 1TZ7A 2WYSA 4BQ2A 2WZEA 4UNIA 2F8QA 5C70A 4BF7A 2YA1A 3AXIA 5DEZA 1W3KA 4R5EA 4P8UA 2E9BA 5DT5A 4H8VA 3WUEA 4TTUA 3W28A 1FP8A 4OBRA 2X0HA 1GOIA 3AFBA 5LYRA 5A6JA 1XSIA 4J3SA 2QV4A 4B9ZA 1W9DM 4D6JA 2RGLA 1BPLB 3VGHA 4D6DA 2ZX9A 3NDZA 1MFVA 2BY2A 3T0AA 5D8ZA 1XD1A 2XTKA 2PB1A 5BRPA 4UQDA 3WELA 2YLLA 4GINA 2CKRA 4J3WA 2ZUMA 4U5IA 4Z2HA 3UERA 1JZ3A 1HL9A 5C8BB 1DWAM 3TTYA 3K8MA 3QR3A 1OINA 1C3FA 1KQYA 3RJYA 4U2ZA 2BVTA 1V6XA 4W7WA 1D2KA 4QDMA 2XHYA 1CZ1A 2WVTA 3GH7A 3SUSA 3A4AA 3AIBA 3B9AA 1UD6A 3K8LA 3WL1A 4AXNA 4F66A 2DH2A 1JIBA 1GPFA 3AQUA 2DSUA 1OGGA 1M04A 1D7FA 1EHNA 1GQKA 1B3YA 2ZX5A 2D0FA 1SFSA 2PWHA 1WZKA 3W25A 3BSHA 3A47A 2V3EA 1B2YA 3CH9A 4H2CA 4PEEA 3OLDA 2VZVA 1KR1A 4MDOA 2PWEA 2CESA 4MB3A 1J0IA 4H8UA 4M1RA 5BYWA 4DM2A 3CHCA 4B9YA 2XVLA 1JXJA 1ZBCA 3KEHA 5TD4A 3PBGA 2QPUA 3MV11 3L4YA 4MJ4A 1LG2A 5JBFA 5GNZA 3OLIA 3SUVA 2WC4A 5GNYA 5A2CA 2WSPA 3I3DA 4QCEA 2X09A 5DT7A 1XC6A 3W6MA 1BLIA 3IK2A 5EFDA 2CEQA 4KRTA 4E8CA 3OB8A 3M7SA 3FHQA 1AQ0A 1J11A 2C0HA 2GDVA 2PWDA 4C7DA 1CPUA 4Z2GA 2XJ7A 1HF6A 1PIFA 4Z2JA 2HISA 4GI6A 5A2AA 1VFFA 2EPMX 3WF2A 3VU2A 4UQEA 3CZ8A 2DT0A 2ZE0A 3POHA 1EQCA 2EEXA 4BCEA 2UY4A 4LYPA 2UWFA 1MW0A 3HMCA 3PZUA 2G3JA 3NSXA 2O92A 3DHUA 1WDSA 1TA3B 1W1VA 4PTMA 3BSGA 1UH4A 3MUY1 1XV8A 5DMYA 1E4IA 4CVWA 3UETA 1WE5A 4MTVA 2YDQA 3GNRA 4LXFA 1ZJBA 4HOZA 2DQXA 4N0RA 3ARSA 3K4AA 3L2MA 2DH3A 1KXVA 4W85A 1RP9A 2WBGA 3AXHA 3SEPA 4K68A 4IM4A 3VGDA 5FL1A 4P8WA 4OOUA 4X9YA 4WKAA 3B9EA 5E0CA 1UG6A 2X05A 1C7SA 3ARQA 3TP4A 4W7UA 1QNRA 2OSYA 5JIWA 3SCQA 1OIFA 1UR9A 1ODUA 1UR1A 3ARRA 3U7BA 1LQ0A 3WNKA 4CN4A 1E70M 3OG2A 5EMYA 1ZJAA 2AMGA 3EDKA 4WKFA 4QLKA 1UWIA 2CKSA 4QCFA 3GTNA 4V28A 1BVZA 1UA7A 2VURA 3SCOA 2MANA 4TTGA 2JALA 4J3TA 2CHNA 2D2OA 2HVMA 4M29A 1EDTA 4L4PA 3VNZA 2A3EA 4U3AA 4DWSC 5LA0A 4XX6A 2ZIDA 1XH0A 3GXMA 5A8OA 3RDKA 1W1PA 3A6OA 4Q22A 4PSRA 3PZNA 6CGTA 5BWFA 5BXPA 1ITCA 4MB4A 3ZJKA 3BAJA 1ISXA 1HKJA 3BAIA 1B31A 3L4UA 3T2QA 3ZR5A 2JF6A 2F61A 3F5KA 2VO5A 3VVGA 3B9DA 3GBEA 1JYNA 4B15A 2W92A 3VDAA 4PBGA 2DT2A 3MMDA 1QBAA 4MAVA 1WZMA 4QLLA 1WPCA 4EE9A 5DF0A 3WDRA 4AZ7A 4MB1A 1GOOA 3AIWA 1LLOA 3N9KA 1WZLA 1P6WA 3CO4A 3WQ5A 2WCSA 2BY0A 1A3HA 3EDFA 1KGWA 4F9JA 3VD7A 3GBDA 1V0NA 2WHKA 2FHBA 5D4YA 2W4XA 2JIEA 3IJ9A 2WWCA 2EQDA 2BXZA 2J8GA 5A69A 2WMIA 4JCMA 4CVUA 1UWRA 2PWFA 5GQBA 4LGXA 4ACZA 3CZLA 1CXEA 1RH9A 1CXIA 4AZBA 8CGTA 8A3HA 2XM2A 4Y7EA 5IXEA 3OGRA 1V0KA 1QBBA 4U5KA 5FL0A 3RJXA 4R27A 6A3HA 4PUEA 2ZXAA 3QHMA 1BGAA 1E6ZA 1M7XA 5LA2A 2YIHA 5FKYA 5IFTA 3WDQA 1W2PA 3UCQA 1FFRA 2BY1A 1SYTA 4MDPA 2CIPA 2VT0A 3WH6A 3WD2A 3UG3A 4S3KA 1V3MA 1JGIA 2J7HA 2WWDA 1XYFA 2WHLA 1V3IA 1TR1A 2E0PA 4YHGA 4ATWA 3GDBA 4F79A 3W82A 5AYIA 3SUWA 4UQ9A 1RPKA 1XSKA 4J28A 5E6ZA 3GYCA 2WMJA 4OKDA 3BGAA 3UESA 4AD4A 3ZIZA 1SMDA 1M03A 2BV9A 3RPMA 3U5YA 3G6MA 3PZOA 3WEOA 2J7DA 4PRWA 2GUYA 3VIOA 2VQUA 2Q8XA 4C7GA 1DHKA 2YA2A 4KRUA 3SUTA 3AMDA 3LPGA 1US2A 4UZSA 4GZEA 3BC9A 2J7EA 3CIVA 1KCKA 4TX8A 5EB8A 2VVNA 5BCAA 5BXRA 5BROA 4AZGA 1UD3A 1JZ6A 2VX7A 4DUXA 4AYSA 2C8NA 3EYPA 5CXPA 2ZUTA 1YQ2A 2W63A 1EQPA 1E6SM 1QI5A 2VMFA 3WD1A 4HZ6A 3PTKA 1W9XA 3NUKA 5CSUA 2Y2WA 1JF6A 4RE2A 3N18A 4ZE4A 1C8QA 7CGTA 2CBVA 1E3XA 2CPUA 4AY1A 4D6CA 3EBVA 3T08A 3TOPA 2QLYA 2RGMA 4KGJA 3RILA 5CQ1A 5FOOA 5A6LA 2F2HA 3AYRA 4W89A 3FY1A 4CCEA 1CLVA 3FAXA 2EPLX 2BHZA 4M8UA 3PZQA 1EGZA 1GQIA 4XZWA 3WNMA 1JZ4A 1QHOA 3W6LA 1KBBA 5HBFA 5ABFA 1XH1A 1G9HA 2V3FA 3N1AA 1OT2A 1MQQA 4NRSA 2GK1A 3OLEA 3AIVA 1JNEA 4MNKA 1E6QM 3EDEA 2YJQA 2FDMA 3MANA 4OZOA 5CLWA 3II1A 4AD5A 3O6AA 4MB5A 1C91A 3OIHA 3PZ9A 4M56A 4CD5A 3WF1A 3W53A 4JFSA 2GJRA 3BXWA 4HA1A 4JL1A 4WK9A 2VRKA 1JF5A 1H49A 1ODZA 2BVYA 5CSYA 1OD0A 3AICA 9CGTA 1GHRA 4OJYA 3DC0A 3T0DA 1E6PA 3W81A 1V02E 4AIUA 4CN6A 5FCZA 1V3KA 1NM9A 2CITA 2WMIB 2XVNA 4U33A 1UD8A 3ARZA 5BRQA 3HJEA 3FW6A 1PAMA 3ZMRA 1ZBWA 3WDJA 1E56A 5ABHA 4GKLA 1W9UA 1X1NA 3WENA 2WCGA 2W62A 1BG9A 3MMWA 4PMZA 5CPQA 4GQRA 2VZSA 1GOWA 1H41A 3LPPA 2A3HA 5E0FA 4C7FA 4HPHA 1KXHA 1UKPA 2IXVA 1ECEA 5ECUA 3KWXA 2BY3A 2DGAA 4GZIA 3VMOA 1TCMA 5AY7A 1DWFM 4V2XA 2AOSA 2WPGA 4W8AA 1VBUA 5A2BA 3ARWA 3SURA 1R85A 1JDAA 4RE3A 1NOUA 3THCA 3SCTA 3VD9A 1CGUA 4DWSD 4D6EA 4M80A 3AMLA 3OZOA 1BHGA 1B9ZA 1W9BM 3PHAA 1FH7A 2EPOA 2D0HA 3LPFA 3VUPA 1TVNA 1E4LA 2YBUA 2YDSA 1QI4A 1VFOA 4HMCA 1W3LA 3U57A 4LPCA 3OLGA 1G01A 4DUWA 1W32A 5KEZA 1CXKA 3AJ7A 1UOKA 3VD5A 2DIEA 2Y5EA 2YA0A 1IT0A 2GVYA 3GH5A 1JG9A 1HJXA 1CECA 3A3HA 3DECA 4LX4A 3U5UA 2CETA 2UY3A 4HU0A 1GUVA 4URIA 1E6RA 1J10A 1EH9A 4PMQA 3F5LA 1UWUA 3WKZA 4P7LA 1S46A 1H0GA 2VZUA 5CLTA 3VM7A 3ARPA 4RE4A 4YHEA 5CZKA 4PMUA 4JL2A 2ZXQA 1C92A 3K1DA 1KXQA 3LMYA 3IANA 2OYLA 3BCDA 1JDDA 1DTUA 1E40A 3WDPP 1TFVA 1UWTA 5BXTA 1C8XA 3RCNA 1AQHA 5CGTA 3WNLA 5A3HA 3IAPA 2GDUA 4HA4A 2XVGA 2JE8A 1PIGA 1B90A 5KZ6A
chains in the Genus database with same CATH superfamily
5LGZA 1XSJA 2YBTA 1FWJC 5D02A 3T44A 3C61A 1P1XA 3KCLA 3ITYA 3FIGA 3PUOA 2XFFA 2WLYA 4REQB 3AHYA 1SJBA 3AHVA 1DORA 4GUJA 1ISVA 2F6KA 4N9BA 4FIRA 3R5EA 3S46A 2QDDA 3ABSA 3ZLFA 3O9NA 1VLWA 4HCDA 1XINA 3LCXA 3EA1A 4AC7C 3DBPA 1XLCA 1KRBC 2YDAA 3QV9A 4LYQA 2G4JA 1FWBC 4PUDA 4G1NA 3M4HA 4EK7A 5D2TA 1QPOA 1FWGC 1GPWA 1H7WA 1BF6A 1MW2A 3OBKA 3BSMA 4CD6A 1HW6A 1Q6RA 2HNEA 2ACQA 4N4PA 4H6EA 4O1FA 4RNJA 1WXJA 4KMQA 4PZVA 1OM0A 3GR4A 3WFAA 1E6XM 1E1CB 3L21A 3UFYA 3LEPA 3WJXA 1UJQA 2PFHA 4P8VA 3GNOA 1JDCA 3GWQA 1VEPA 3DYMA 4PCPA 3CPRA 2D73A 5AYBA 2TAAA 1GQNA 4J3UA 3W0KA 1GCYA 1POJA 3OG3A 2PP1A 3OP2A 1TWSA 5AC4A 5G2IA 4X0NA 1V79A 3PZMA 2ZFAA 2QS8A 3FXYA 4LU0A 5E93A 4DXKA 1CENA 4W84A 1FKWA 1VIWA 2WMKA 5HPCA 4MWAE 2CZDA 4QEEA 2Q09A 4IH3A 1R47A 4EP8C 3WZ0E 5T9CE 3UCCA 1VHNA 2FZ9A 1ME7A 2HK0A 2W27A 5DCEA 3FFSA 4ZQRA 4JX4A 4GY0A 4ZO9A 3WD4A 2VZOA 4FLQA 2A3CA 5G4HC 2I9UA 4UMCA 1S3TC 1XIIA 4O0KA 3NQCA 1RZMA 4MY9A 3CT2A 4GZJA 4KBXA 3AZSA 3VNLA 3GW3A 5BW6A 1W1ZA 1UD2A 4QFUA 2J6XA 1UR2A 1I8JA 1AA1B 2VKZG 5EA9A 4J2MA 1DJZA 4RZ4A 4WOQA 3RCMA 5MHBA 4JAWA 4KCWA 1RK6A 1YE6A 3SN0A 2ZTJA 3G5EA 4CQ8A 1F3TA 1O5QA 1BTCA 4AWUA 3VIPA 2Q01A 1RD6A 1FHDA 3L4VA 3MUIA 3GAKA 4RZ6A 1Z32X 3S6TA 3B0UX 4GI9A 4IT1A 1XF0A 3URBA 4CNPA 3QV7A 3BMVA 2V69A 2WPBA 1HIZA 4BI5A 1PHQA 3HPXA 1QOPA 3IACA 3NM1A 3LGGA 3A4XA 4MOZA 2X2GA 5FSEC 3GX9A 1A49A 1R0MA 4Z1CA 1JJKA 3FX4A 3BZJA 2Y8UA 4PMNA 1K02A 3UEQA 4DNMA 2ZRUA 1R3RA 3SRFA 3HFYA 5CG7A 4Q8OA 4O1EA 1XIEA 2W91A 3P7YA 1X6LA 1JD7A 4J3XA 4XSMA 1BVNP 5H91A 3DYOA 1U1JA 2OGYA 1E73M 3MSDA 3T05A 1J0ZA 3C0QA 4GI8A 1YYAA 3LTYA 3NQ7A 1F74A 1UUQA 1EBGA 1QI3A 3B8VA 4M7SA 5M03A 1OADA 1C93A 4GJ1A 2C1IA 4C65A 3WDIA 4OVXA 1G4TA 1GT8A 4M6PA 2DW6A 1IIHA 1V3JA 1X97A 2GVGA 2GPTA 5SWUA 1FH9A 3N12A 3JS3A 3NYDA 5FACA 5LIWX 2YBVA 4L4OA 4MKVA 3S6DA 1NSJA 4EACA 3C2RA 3CT7A 1TVPA 1QHPA 5CPLA 4DELA 3W75A 3BAWA 2FGBA 2CLKA 3UR5A 4L4LA 2E9LA 1UR8A 3GD6A 2E6DA 5KTLA 2A3BA 2ZKMX 4HU8A 3FYPA 4GUHA 1B3VA 1SW7A 4EXAA 4IPIA 2VDIA 4LALA 3LI0A 1TVLA 4I9MA 3LA4A 1JUKA 2I16A 1K8ZA 1ZQ5A 3UYIA 4I5RA 1J2WA 1RP8A 1DQUA 1UJPA 3ZJ7A 3UXDA 3C2YA 4HD5A 3SUUA 1XLKA 3ZS4A 4GLEA 4ZOAA 2VGFA 2OWCA 4GFSA 3E0WA 3V1PA 5D37A 3MP3A 3QGVA 4L65A 2F2KA 1R86A 1LUCB 3DAQA 2ZZ6A 3PG9A 1EB3A 3W27A 3QH2A 1ADOA 1PS9A 2YCIX 4Q33A 1GVSA 3BL3A 2X16A 2HPIA 1JR1A 1I75A 3QY7A 3J7HA 3GIQA 3DKLA 3G24A 4OV4A 3DZ1A 5L6UA 2C6QA 1G4PA 4FR1A 2ZDSA 4HJFA 3NQDA 4HPNA 4QS5A 1F3EA 1ESWA 3HPAA 1OC6A 3RYSA 5E1QA 1B1YA 2PF8A 1ZZMA 4ADSA 3IIVA 4DBUA 3MO7A 5D9NA 2CW6A 4GVIA 3AS2A 4CU8A 3IAQA 4ROQA 3L0NA 3N34A 1P7TB 4L6OA 3WLPA 3D3AA 5KITA 2G0WA 2GL5A 4H7CA 2C7FA 2VCAA 2D2JA 3NZQA 3WSUA 3L5LA 1Q6GA 5I24A 3JZUA 4AVNA 3E0FA 4RZ5A 1WAUA 4S3GA 1CYGA 4GYJA 4LYKA 1PB0A 1YPFA 1M6JA 3P62A 1V6UA 3THDA 1ZHAA 3CIWA 4ORMA 2BFGA 3PTMA 1LQ2A 3WK1A 3MKKA 1KCLA 4D6GA 3VKDA 3ZR6A 3ZSTA 3CPUA 4XD4A 5DMNA 1REQA 2E5CA 2VOTA 2CBIA 1V03A 4TVUA 4LY4A 2WZTA 3ABXA 3TAOA 2EJ1A 2EXOA 2DVXA 1JPIA 5AOUA 3M0MA 2WZIA 3G2GA 4ZGYA 4GIYA 1EJSC 2V5CA 2I5QA 3VZXA 4H00A 5G5IA 1C29A 1H09A 1F4AA 3JU2A 1NDZA 1WZAA 3M43A 4ZQOA 1OFDA 4H41A 2X8RA 3GNNA 4H8HA 1SVDA 2O9RA 3OQ8A 2C1GA 2XVKA 1EOKA 4PUNA 4N9EA 4IJCA 4M51A 1XLFA 2XM1A 1PYMA 3BDKA 3T2PA 1EA0A 2F6XA 2GGHA 3R94A 3M1ZA 4WXYA 4G7FA 3H6OA 4OBTA 3S2CA 1XP3A 1PCKA 2BOEX 2XIJA 2H6RA 3W88A 3LHUA 3QQWA 3N73A 1PX4A 1A5AA 3G3MA 3KVJA 3TSMA 1XCFA 4PH6A 1RAKA 1OFEA 3T55A 4WSHA 3QZEA 2O9PA 5XIAA 1JL8A 2PBOA 4D9PA 1JVNA 5A6BA 2VNCA 2YL8A 3IRSA 4V27A 4TX6A 4NIRA 3W2NA 2IPJA 2EG8A 3EKLA 1PX8A 4AHOA 3COTA 3S2LA 4DXVA 4IP5A 3QY6A 2Z1KA 3AIRA 1HQTA 4W86A 4EAMA 1R3QA 1TWIA 3DC8A 2ZRWA 1TPVA 1XLHA 1NAL1 2VTFA 3S5NA 2B4GA 4LS1A 2GGEA 3S2NA 3NSNA 3TTSA 1DYSA 1WDDA 4XB3A 4JNMA 1ZU8A 2CLMA 4FNRA 4AZCA 4ZVJA 5I23A 4Z42C 4HPXA 3ZO9A 1A5MC 3L4TA 2QCFA 5JU6A 3KP1A 4DO7A 1W91A 1VCGA 2I9EA 2GOKA 2J13A 2XZ7A 4LVBA 3ZVIA 3T09A 4E3TA 3GG7A 1EHAA 1G94A 3H70A 5G2WA 2OCZA 1GNXA 2PDGA 4A3YA 5K9CA 1OY0A 1J12A 3MI3A 2INEA 2JEQA 3PUEA 4PMXA 1V0LA 3TH6A 5HA7A 1LORA 2WVVA 4TUFA 2AGTA 1XGEA 2FH8A 4X3ZA 4W93A 1UKOA 2OZTA 3G0SA 2D3NA 1KB3A 4MF4A 3KZSA 3VINA 1E0UA 1TPUA 4NAEA 3UR7A 1IGSA 2J7GA 1K8XA 1M41A 1FWAC 4BWLC 3CUIA 3ES7A 3BK0A 3EOOA 2GGJA 1MEHA 1D7KA 1QOXA 3ARYA 3OQEA 3EMQA 2WJZA 3HGRA 5JMUA 1DHPA 4E5TA 4NYUA 1S5MA 3QEZA 1ZY9A 3VMNA 2QF8A 3WDHA 2XFWA 4HBKA 1A0DA 1GHSA 4EPEC 1R7OA 1RQHA 2WM1A 1HXJA 4GIAA 2EPHA 3WQEA 1OG0A 4QISA 4Q7IA 5CZ0A 3GB6A 2Y88A 1ZLPA 3C0JA 1KM5A 3UA4A 1ZBVA 2VRJA 2YLAA 4UQBA 3WH8A 4F3HA 1R3TA 3O06A 1LQAA 1EJUC 1W5MA 2O56A 1L8PA 2CLIA 7TIMA 3ALGA 2D1ZA 2QKFA 2QYGA 4FX7A 4IFKA 1OX4B 1Q2SA 4ACYA 1F7BA 4BY3A 3P74A 1M1BA 3BCFA 1K77A 1GK8A 1EF2A 4QE5A 3NXLA 3SRDA 4LAMA 2QNEA 2VI0A 4DIAA 2I14A 3NTYA 4FZIA 3DFSA 5CSRA 5I5RA 2OZ3A 4MUPA 3VMPA 4PGLA 2VFDA 4QIUA 3QKEA 1KGUA 4X0VA 2CHOA 1QATA 1T6MA 4AZ5A 1W5PA 1GVEA 5E9AA 3UF9A 2GQ9A 1VGAA 1XWYA 1E71M 2WZMA 5F1VA 3WK0A 2VEFA 3M0IA 4M19A 4PTWA 1TQJA 1XHGA 3DI1A 9XIMA 2BHYA 1BYAA 1XRVA 2PCEA 4TIMA 2OR2A 3NZ1A 4Q3MA 1CXFA 4UFJA 2FGLA 2J9ZA 3LSBA 3U4FA 3V1HA 1IWAA 1IZKA 1WBJA 1MQRA 3USZA 3EWCA 1HJVA 4QDWA 1E55A 1N8IA 3KOZA 4D2JA 2VFGA 4ZXLA 4JPGA 3KLLA 3EWDA 1D8WA 1XJBA 4LUJA 1ZCCA 3E9AA 1U5JA 3ZVHB 3DX5A 1QW8A 3E38A 4JQAA 2E8YA 2BG5A 1X38A 4BEUA 1X8FA 3GXPA 2E77A 3VE9A 3G1XA 3SQSA 3W1TA 3GHTA 4KH2A 4LOCA 4MZ8A 2Z6JA 1S38A 4MJZA 1B3XA 4UTFA 3ZJ8A 4KRZA 1U2YA 1KKOA 1CLKA 2GVEA 3LD5A 4FALA 1US3A 1Y7VA 5C2CA 2R24A 3VKCA 3UP8A 4IMDA 4IX0A 1VEOA 2QCDA 2VCCA 1JFXA 4N9DA 3NQ6A 3AS0A 4DO6A 5IFPA 4AZ6A 3ECQA 2ISDA 4XAYA 5EMLA 4BHYA 1RV8A 3HGSA 1BFNA 1R5YA 3A9IA 3W23A 2Z00A 4H6QA 2NQ9A 2WLZA 3WQVA 1WA3A 4DUOA 1VJZA 1R2RA 4I5XA 3VIFA 2GSJA 3LN3A 4MJMA 2V5JA 1S2UA 4QP0A 3WQCA 2W5FA 4V33A 3ZJ6A 1C8YA 1HKMA 1IR2A 4WHBA 1UP3A 3PC0A 4FO4A 4G5DA 1Q63A 4LF1A 2R1LA 1SMAA 2IKIA 3A22A 5AC7A 2YZ5A 4KWUA 3LCGA 1AD4A 1IV8A 3KVLA 4MPQA 2J75A 3B0XA 1LWJA 3IVSA 4JGDA 3AIQA 1SM9A 3NQEA 3DHFA 2XIBA 4Y90A 1QNVA 1H51A 1T41A 2HRWA 4MZYA 4ROPA 3L9CA 1GKRA 5M1TA 1NQ6A 1MDRA 1WCGA 1IZJA 3SI9A 1WNOA 5AZ0A 1GOKA 1R2TA 4I7WA 3RHGA 3GUWA 1XBZA 5A6MA 1TIMA 1FWNA 3FK4A 1MRQA 4AD3A 4EVZA 4US5D 1EDQA 2D24A 3DG3A 4JZ5A 3QPYA 3O8AA 1VAHA 1GW9A 3TTOA 5DRIA 4V15A 4UFKA 3THAA 3V5CA 3M6YA 3K4WA 3PUDA 1ISYA 7PTDA 3QOKA 5IM51 1BGGA 2YCLB 3BPWA 1GOMA 3PBMA 3N6HA 1K7XA 1CGXA 2OO0A 2X1IA 1FVPA 4FPSA 1OGBA 3PBVA 4CD4A 4UR7A 1DWJM 1SZFA 1A4LA 1HJUA 3LS9A 3MUAA 1E15A 4M6UA 4WIWA 4AX7A 5DXXA 4GH1A 3N4EA 2WM0A 2A7NA 1W5QA 2XIIA 2QGYA 4C5YA 3I3EA 2ZWYA 1NF7A 3SIZA 3W2JA 1ITQA 2PF0A 2G50A 2WNWA 4CD8A 4P5UA 3W7DA 3UZZA 4IPLA 4DZAA 3DHPA 3GHUA 1FWDC 3NFUA 3IPWA 4IUGA 4QR6A 3VOFA 1OYCA 2Y70A 3VFCA 1UC5A 3TSBA 3W7QA 4HOXA 4J27A 3AIEA 3LZ5A 4JTHA 1KNWA 5D2XA 3SM0A 4A29A 3CWNA 1TZ7A 2WZEA 2F8QA 3QM3A 3AXIA 5DEZA 1KBJA 4BJHA 1J6PA 3W28A 2O4MA 3FGCB 1FP8A 3XINA 2X0HA 2Z6IA 5DN1A 2QV4A 4B9ZA 1J4EA 1AUSL 5AHLA 3C8NA 1QPRA 3W7OA 4ZQCA 3NDZA 3URQA 2BY2A 2TYSA 3PBUA 1Q65A 3SFKA 1KBIA 3WLRA 3HO8A 3WELA 4IQEA 4FB7A 2YLLA 4U5IA 2CKRA 2ZUMA 1EP3A 1RBLA 2Z0IA 3PBWA 1OFQA 1P0NA 2Y62A 3DGBA 1JZ3A 1HL9A 5C8BB 1PSCA 1AH0A 1NJJA 2FPVA 3QR3A 2CLEA 3C2VA 3OA3A 2PLKA 2XSXA 1O94A 4U2ZA 4AQLA 4IF2A 4DXXA 4QDMA 1CZ1A 4MY1A 3C6CA 2QAPA 4AXNA 2NX1A 3UJ2A 3NXFA 1O68A 1M04A 2ZX5A 3TR9A 2D0FA 4YVPA 1SFSA 5FJIA 3HPZA 2PWHA 1HKVA 1ZSXA 1P6BA 1Y5WA 1B2YA 1V93A 4H2CA 2VZVA 1KR1A 4MDOA 5TAOA 3SR7A 1JGMA 1T40A 4UTIA 4H8UA 3KCOA 3Q94A 3GSMA 1YRRA 3KX6A 3OEXA 3MVTA 1JXJA 3PBGA 2QPUA 4V1XA 1LOQA 5JBFA 2EKCA 3L5AA 5GNZA 4ML9A 3IVTA 3SUVA 2WC4A 3G8EA 2WSPA 3MTWA 4L1XA 2AGKA 2GVLA 3K1GA 4E8CA 4GUIA 3FEMA 3FHQA 1CPUA 4QS6A 1Q4WA 5I06A 4L6DA 2A1YA 3HQ1A 3RN6A 2HISA 3WF2A 3VU2A 5HNRA 3CZ8A 3QY8A 1S5VA 1EQCA 4O0QA 1OX5A 3PFRA 2PTXA 3H12A 4RLIA 4LYPA 2UWFA 4FAMA 1MW0A 3O6CA 3TMLA 1WDSA 1A53A 5DBTA 5K4XA 1JRBA 4ZZ9A 2ACRA 5DMYA 1R9ZA 2FZ8A 3NL2A 3KTCA 5K3VA 4GMEA 1OYBA 4TU1A 1FHUA 3GNRA 4QE4A 3ARSA 3K4AA 2J8TA 1KXVA 2PRHA 3A5VA 1KLYA 3KHJA 3VGDA 1XLIA 4OOUA 4WKAA 5E0CA 3TZNA 2Z24A 1QPQA 2Z1WA 1PDYA 2G3FA 1UR1A 3TNOA 3W84A 3RLHA 2XDFA 3DGRA 1E70M 1B54A 3OG2A 2PTDA 1WUFA 4WKFA 3AWOA 1F73A 2CKSA 3GTNA 4EXQA 2ZVRA 3PBYA 3NDOA 4BI6A 5DMLA 2MANA 3A12A 2D2OA 4ADTA 2G5WA 5KSWA 1EDTA 1TCDA 4LSBA 2A3EA 1YIXA 5B80A 1FWSA 4XX6A 3NYZA 3GXMA 1W1PA 3STCA 3TAKA 3MUCA 3MMTA 3Q37A 4PSRA 1I9CB 1W0MA 5BXPA 1ITCA 3AXKA 3BAJA 1VR6A 4ZFCA 3CXOA 3BAIA 1ZJIA 1TSIA 5HWNA 1O66A 1MUWA 1DJHA 3RR4A 1LRNA 3B9DA 5MF5A 3S9ZA 4QLLA 3NO5A 1HKWA 4EE9A 5DF0A 1J96A 2W3ZA 5DY2A 3PS7A 1FRBA 1S1RA 3W83A 1A5BA 4KFOA 3BV7A 4JX5A 1FDZA 1P6WA 3EX4A 2YYTA 7REQB 3WCZA 2DVUA 4F9JA 4HSNA 3SN4A 5K4ZA 2WHKA 3L5MA 5D4YA 5CC6A 2PWUA 3FJNA 1FUYA 4S38A 2BXZA 1K4HA 4HZMA 4XD5A 3HGOA 3KRSA 4ZB5A 1TWDA 1EPXA 1UWRA 4JTQA 4LGXA 5E0KA 5JQ9A 3S0CA 3CZLA 1POKA 1CXIA 5HATA 4IP7A 3RLVA 4AZBA 3GDTA 3EX6A 4Y7EA 5J04A 3LXCA 5FF3A 4U5KA 2BGNE 2HZGA 4PUEA 2ZXAA 5I00A 4NILA 3TWAA 1VC4A 4D8ZA 1IWBA 1US0A 2W6RA 3UCQA 4ERIA 3WH6A 2VT0A 3WD2A 5U4NA 3HQPA 3UG3A 2WQDA 1SO4A 2WWDA 2NXIA 3VZZA 3A9BA 2EGZA 5E6ZA 3CASA 1MNSA 4BF5A 4HK7A 1SMDA 6ENLA 1M03A 2Y0FA 3EKZA 3F7JA 1KTBA 2R94A 3FA4A 5HANA 4HNVA 2Q8XA 4NX5A 3TWBA 2R1PA 2YA2A 4ZQPA 3E96A 3AMDA 3N19B 4GZEA 3M5VA 3V75A 4UC5A 1UR3M 2J7EA 1KCKA 5EB8A 1LDCA 3M0LA 4LRTA 4AZGA 1QUMA 1UD3A 4DUXA 1PZ0A 4GVHA 2W63A 1E6SM 1QI5A 1KTCA 2VMFA 1P1MA 2DIKA 2Y1HA 4H2HA 4C90A 2Z1BA 2Y5JA 1WKFA 2Y2WA 4ZE4A 2CBVA 5HUOA 2FZNA 1E3XA 2H8ZA 4IG2B 3EBVA 3T08A 1H5YA 3TOPA 4B5WA 4PRTA 2RGMA 3DOPA 5CQ1A 3RILA 1F07A 1S5TA 4A8RA 4M3PA 4CCEA 5I7GA 1CLVA 3FAXA 4C6NA 2AQVA 3FVMA 1CI1A 1EGZA 3SO7A 4ERGA 3W76A 4XZWA 2UBPC 3H2OA 1OF8A 1H62A 1QHOA 4NNCA 1JZ4A 3EOUA 3RF9A 1TUFA 1EP2A 1AW1A 2V3FA 4O8RA 1SPQA 1GWJA 1OT2A 4LAUA 3L2IA 4RXGA 1D8CA 4Y2WA 4MNKA 1A5SA 5GJPA 1LLZA 5HJLA 2YJQA 4EIVA 1TJ1A 2FDMA 5CLWA 4AD5A 2IPGA 2Y7FA 3MJMA 1P43A 2ZRYA 1JULA 3TXZA 1WBHA 2BVYA 2WNZA 4M1BA 3T0DA 3TYUA 1V02E 3TW6A 3WLJA 2WMIB 5BRQA 4X9SA 2GJLA 3PWGA 3TUUA 1OCJA 4QJ1A 3WDJA 2V82A 1B5TA 1S1PA 3P0WA 1D3GA 3H2NA 3CQ0A 4MUZA 1UIPA 4KKXA 3LLXA 3WENA 2WCGA 4KEVA 5CPQA 3P2VA 1DIDA 2VZSA 5E0FA 2ZZ7A 3KOXA 4J3ZA 3QYQA 1KXHA 1UOZA 1X39A 3KWXA 1EWEA 3VK5A 3W85A 4WY0A 3GC4A 1FKXA 6TIMA 3VCRA 2QUTA 1ME8A 2E25A 2BVWA 1VBUA 2QT3A 3S42A 4RE3A 2C14A 1SO6A 1NOUA 3SCTA 4XWUA 4DO4A 2V68A 4M80A 1B9ZA 3PHAA 2FVMA 2EPOA 2G95A 2A4AA 1Q2RA 5HNUA 1YW1A 5FJUA 1TVNA 1E4LA 2YDSA 1VFOA 4K1WA 3U57A 3T42A 1CXKA 3AJ7A 1UOKA 2DIEA 2Y5EA 1PWMA 4NJGA 2BWGA 4EAYA 1HJXA 1CECA 3DECA 2A6NA 3B06A 1NDWA 1DKWA 1EH9A 3IARA 1AL7A 2YZRA 1A5KC 3ARPA 4RE4A 4YHEA 1TZ9A 1SO3A 4R85A 4JL2A 2POTA 3OHIA 1KXQA 3EEGA 5I07A 1JDDA 2CZVA 3BLFA 4HU3A 4DJFC 1C8XA 2Y7DA 1YDVA 1TPEA 1AQHA 4DJEC 1PTDA 3LHTA 9RUBA 3OPSA 3UNDA 1PIGA 1EYEA 4O28A 1V02A 3M07A 2WKJA 1XR2A 2NSOA 1HVXA 3R25A 4FLRA 1MFUA 3APGA 3LCIA 1NQKA 5ABFB 1KXTA 3DXIA 4DJDC 4Q4OA 4PMVA 3LSCA 1KM0A 4UR9A 2OSXA 1VBGA 4IIGA 2BSLA 3HPSA 3XIMA 1GVYA 2FB2A 3WNOA 3QMRA 1G1YA 2F38A 4Q8UA 2Q8LA 4F0RA 3WQ4A 1QK0A 4EPBC 2V81A 3G1FA 4W9TA 4XQ6A 1KM1A 4TO8A 3U48A 3N2CA 1UZDA 1DJWA 4L4MA 4PFHA 1N82A 3QFWA 2ZUUA 4M82A 2DSWA 4QJ3B 3BAKA 3CQJA 4JTFA 3G22A 1FBAA 1JRCA 2O9TA 3MYOA 1MO0A 3DDMA 3V7PA 2GQ3A 2MNRA 3GXFA 3NR0A 2HTMA 4MPKA 4MADA 1KKRA 3TYEA 2BNJA 4AY7A 1W9VA 1CIUA 5M3WA 1HP5A 3T6CA 3HF3A 1UKTA 3T0BA 2ACSA 4BWLA 3NJ3A 1FHLA 1X96A 3KS6A 4GHRA 1MZRA 3NZRA 3MMUA 2REQA 1XD0A 1ZCOA 3LZ3A 5M2FX 1YNYA 4WLCA 1GG0A 2NWRA 3MT1A 3H24A 3WD3A 3BW3A 2WZHA 4O17A 1UH3A 4EWND 5DX7A 2Z7KA 2PDLA 4GE8A 2QMJA 4ZE5A 3LHWA 1UR0A 2Y89A 1EKOA 4DNHA 4H01A 2XFYA 3AISA 2DEPA 1CB2A 3CTTA 5D04C 3GKFA 3PF3A 5T8GA 4PBFA 5CJ5A 3H2FA 1UMLA 1ZUAX 1JAEA 1ENUA 3IIXA 2WW5A 3N25A 3W1PA 4DQWA 3CZJA 2QPXA 4JEJA 1M9HA 2VWTA 3CNYA 1J79A 2ALRA 5HMSA 4I90A 1GJPA 1R46A 3EA3A 1XYAA 4Q32A 1FWHC 1OIMA 2NUYA 1QU4A 3R2GA 1HX0A 3WLNA 3AZRA 4H8NA 2X1RA 2OEJA 3CWOX 4FXFA 2XGBA 3CV6A 1JCJA 4KWSA 4X60A 3K4DA 3TQ0A 5DXYA 3GNPA 4W87A 2OGJA 4XTIA 3S2MA 1EJXC 2QQ6A 1TR9A 3KCJA 3WX7A 2B0MA 1EL3A 2CWNA 1W17A 4LYRA 4PTNA 4JNZA 3EX1A 4Y8FA 1K1DA 3CZKA 4NF7A 2BGQA 2A3LA 4WRHA 3ARVA 1M7PA 3SY5A 1S2WA 3WLOA 1ELSA 3BOFA 3F4VA 4QHRA 5LNWA 2ISFA 4FF5A 3TC3A 4N9CA 4I8YA 3VTRA 4JYDA 2PD9A 1VEMA 4DPPA 2OLAA 2FLIA 2VL4A 1SJAA 1FCQA 1CGYA 4IJRA 2CZFA 4MM1A 3LV5A 1TTPA 2NW0A 3E2SA 4L1WA 3GG8A 2ZA3A 1RR2A 3KE0A 5KZEA 1MUMA 2XWEA 3ZOAA 4PUUA 5H8MA 1E1FA 1KRMA 4UTLA 4L56A 4X22A 5REQA 3B3DA 4WVXA 3ZWTA 3ZSSA 3AC0A 3S1WA 3GNDA 1RD5A 4NZ4A 3HFTA 4BKNA 4PRRA 3THQA 3GS6A 3KL5A 2G97A 1O60A 4JIEA 4B3KA 5D9PA 1LRQA 2G41A 1WDQA 3ONBA 3E02A 1BSIA 1DE5A 4GCXA 3W2KA 3W7KA 5I3DA 4DJFD 3AZTA 3I68A 1LZOA 2VC6A 1J0YA 5C71A 3TIMA 3N9SA 4DF2A 3M0KA 2NX3A 3VD3A 4DJED 2W61A 3UG5A 3I7SA 3WH7A 5AHEA 3MI2A 1O95A 2NSXA 5C9ZA 3C0SA 3B8SA 4JIHA 4JFUA 5GJMA 4IIEA 1XIBA 3SY1A 4JN6A 5C2GA 4ASTA 5CGMA 2I57A 3KRUA 1E4NA 1DEDA 1IT7A 1NP2A 3AHTA 4XO6A 5DQPA 2QULA 3VGFA 3KL0A 3ITXA 5EYWA 4AB4A 3H4XA 5JUVA 3GLCA 1U5VA 1VPYA 3TCSA 1MNZA 3BVJA 3W1RA 5A8QA 2YYUA 3A13A 4JFWA 2RHGA 5A6KA 3N2OA 3EB2A 2G3MA 2DSZA 1E43A 2PZNA 2O4QA 4IGNA 2QDHA 3PWIA 3S1VA 4E2DA 3WMLA 2ESCA 3P6LA 5J5DA 1U83A 3S47A 3AROA 3CMGA 3MS8A 5A8PA 3FNDA 4TVCA 1MW3A 1CEOA 1VFSA 3CGTA 4QX4A 3S83A 3A4WA 4PL1A 1WP6A 3LHVA 2J4GA 3DHDA 3N29A 3W26A 3ELFA 4QRNA 3DG7A 3PY2A 1F8MA 4PEKA 4FOJA 4G6CA 2WANA 3E2QA 4JCLA 4AF0A 1JNDA 2Y61A 3MPGA 3T07A 1A5UA 4PMRA 2PTZA 3VILA 2W79A 1NP0A 3QQ1A 1M65A 4CCZA 4K7VA 1BRLA 3WLIA 3TK7A 1OYAA 2DW7A 1OBAA 3L4ZA 1HTIA 1NARA 4P61A 5JIPA 4MWAB 4R9OA 1Y0EA 1Q6OA 1EGVA 1FP9A 5FI8A 3IUDA 3LCFA 4ZB2A 2YL6A 1Q6DA 3RNDA 4MNJA 3RMEA 3H8AA 2BHUA 3QZAA 3N2MA 1FXQA 1NOWA 2A85A 1IEVA 4Y9MA 4D6FA 3KBNA 1IQ8A 2WK2A 4WJXA 4UFHA 3IV8A 4UFLA 2BDQA 4Z2KA 2ZRZA 3NEVA 1D3HA 3GM8A 3BMXA 1W5NA 2OZ8A 3JVAA 3WBAA 3TNBA 3EMZA 4J35A 4H7ZA 3C2EA 4IGSA 4HTYA 3PZTA 5E09A 5C7VA 3W1UA 3CLMA 1NWTA 2Z4GA 3KZPA 1KRCC 2AQWA 2C18A 1KW1A 3AXMA 3LV6A 1OFBA 3MUXA 3RM8A 1HL8A 4PL2A 1AMYA 3TFCA 1H5VA 2WXDM 3BLKA 2JEPA 4KGLA 1DWHM 3A24A 4A4AA 3CMFA 4JTSA 1JYWA 5ABGA 4DUVA 1TX0A 3NQGA 5FJTA 3WF0A 3WLLA 2EJAA 1WDPA 1N55A 1V7AA 4WQ6A 3DIPA 3VKAA 3G1HA 4KCUA 3H4GA 2Q3OA 1IIGA 4N42A 2GGGA 3R7MA 4C6EA 3F2DA 3SCNA 4GYFA 2A5HA 4EXBA 2CZ5A 5FAGA 1YDNA 3ISIX 4CEXC 1G67A 1UWAA 2GLKA 2J88A 3WQFA 5GVJA 1PV8A 2VGBA 2WSRA 1BWLA 3GU9A 1EA9C 1H2JA 3TYAA 4D72A 1T96A 1VCFA 1AH4A 1UWQA 1W1IE 3QC0A 3WNNA 1HKKA 4D1JA 2B7PA 1OQFA 3CYVA 1XFBA 3UWUA 1IR1A 3CBWA 5FSDC 1TUXA 4S3EA 4LAKA 3VOGA 3WN6A 4RDWA 2DZBA 1FDJA 5BMWA 3P93A 2ZOXA 1WKDA 1GKQA 5HR6A 1DTNA 5T9BG 3P67A 2QJHA 3KL3A 3AHZA 1PWLA 1ZP4A 3AAMA 3Q4DA 1OGSA 2ODOA 3R1ZA 2QCGA 3FA3A 4LBUA 1BQGA 1LJYA 5LHEA 1KFWA 1ZFJA 4HNCA 1HNYA 3PR2A 4RNHA 4AW7A 3U0HA 4JTRA 3VIGA 3SY8A 3LCHA 4UQCA 3U2OA 1ZAJA 4Q8VA 3D0CA 2IKHA 4XZLX 1EXPA 4MNMA 1ALDA 1RBAA 4HYWA 2OQHA 2NXGA 4W8BA 1FCVA 1G5AA 2FYMA 4JICA 2DY3A 2V2CA 4IQLA 2GQAA 5AC5A 4TMBA 3T8LA 2WSQA 3NOYA 1A0EA 4YWSA 4CNSA 3T81A 3IWPA 5TNVA 1FFQA 5E70A 3CZGA 2XG9A 1HJWA 1WXYA 5G1YA 5BU6A 5EBAA 4RNFA 3MBDA 3GAYA 1OFRA 4XUYA 3WUGA 4H04A 4P7OA 3OZPA 3MU7A 3AU2A 4O11A 4CLMA 5FESA 4NL1A 2IQDA 1XLEA 4JKMA 1B30A 1DWIM 5I0DA 4K38A 1XYZA 3W7HA 2XIMA 1J0HA 4GJIA 4O1CA 4D71A 2E28A 1O5RA 1ZALA 4C6FA 3BICA 4B5SA 4LF2A 3GTFA 1A5CA 1IZCA 1V6WA 1IXPA 1RCQA 3UWQA 5LIYX 1I0DA 5AC6A 1VBRA 1KRAC 4Z1YA 4GI4A 1VENA 4QM1A 4PMOA 3ENLA 3QR1A 4O50A 1J9YA 6TAAA 3KM8A 1ITXA 3TW9A 1V6TA 4BA0A 1NFPA 3QSRA 4HIBA 4F0HA 4JHZA 1XDLA 5LXXA 3TQKA 2DZXA 3CV7A 4UXDA 4ZOCA 4C6KA 3WK2A 3ZT6A 4FA3A 2E68A 2ZUWA 1UZ1A 2XH2A 5F4SA 1NEYA 1PTAA 1V8EA 4IGMA 8TIMA 3W9ZA 1QW9A 3GZ3A 3CU2A 1KC7A 4WY0F 4AYGA 4MSSA 1I1WA 2OSWA 4Y6GA 1GORA 4W88A 1QWGA 3BCJA 3CO8A 4NJKA 1K9FA 1P7TA 3GDKA 3BTNA 3JRKA 4AZCB 1JCXA 2YKKA 4H7VA 3G0UA 3UJFA 1L6SA 3HG3A 4OT7A 3W7RA 2C0AA 1E6NA 4XD6A 3RIKA 2BTMA 1VZWA 1JDEA 2JF7A 4DF0A 4ALDA 2VEGA 5HQEA 3B8DA 3B0PA 2BX7A 1GVOA 1QNOA 3TA9A 3WLQA 4UQAA 4H3DA 3SCWA 2AAMA 3EAUA 3KW3A 3NQFA 2JIWA 4AEEA 4NZ1A 3D5HA 2WVVB 5CBBA 3CV2A 5HMEA 2XUCA 3CL6A 3TYBA 4CNTA 3ABRA 3BGGA 1RSCA 2EO7A 3LTPA 3PTQA 4O19A 2ZICA 5DFAA 4NJIA 1TWZA 2ACUA 1I60A 1N8FA 3GE7A 3BAYA 4UWMA 2EF9A 4UFIA 4NAEB 4K8GA 4LWWA 3VPLA 3WQ8A 2JKEA 4QJ4B 6ALDA 3KDNA 3SQLA 1RALA 2FH6A 5FF0A 4IL2A 5I6SA 5KZDA 4UBPC 2VEKA 2E1WA 2G3IA 4WD0A 3ES8A 4LNCA 3H54A 3WF4A 3IJDA 5GPRA 3T1GA 4EX4A 4IISA 1XXXA 1E0TA 2Z28A 5C2XA 4YIWA 3PZGA 3KBMA 3VOJA 1Y8BA 2BGSA 2W67A 4MHBA 2WHJA 4GYKA 3PAJA 1T8QA 3B04A 3TA6A 5LZLA 4M24A 3TMQA 3MBFA 1QDSA 3MKCA 2DU2A 4MMWA 4IFKB 3I4EA 4L5ZA 2E9MA 2V63A 4TVDA 3OODA 4CUCA 1JI2A 3WJSA 1J0JA 1OFAA 2OX4A 4Q7NA 3VKJA 4F0MA 2J77A 1FA2A 2IPWA 2PUZA 4IMGA 1BSLA 1XYBA 5LNSA 3EB4A 2ZUVA 2Z1XA 4Q8WA 2DT1A 2PEVA 4DLFA 3TONA 2V0TA 1XS2A 3GVRA 3EWXA 1VF8A 1W9PA 1XH2A 1YXCA 2PU0A 1GZGA 1CBGA 4O52A 1GQLA 4C6DA 3KBVA 1HJSA 3D47A 2PBGA 4NG3A 3W72A 3GG0A 4HZ7A 4R34A 1GQJA 2NLYA 3EWWA 4JXCA 3LERA 3IEBA 3N3TA 4LRSA 4IZGA 4FXJA 4PR4A 1UA3A 1C7TA 2BLEA 3GC2A 5AHMA 3V4BA 3M6DA 1IHIA 3NQAA 3QYSA 4GKTA 3W3OA 1O7AA 1R2SA 1GJUA 3FDGA 3H53A 3MQTA 4Q6JA 2O0TA 5EPDA 5ABEA 1NWRA 1NDYA 3CJPA 2DSKA 4DAFA 3P82A 3VIKA 4IMFA 1UYQA 3G8RA 1DXFA 1TG7A 4ZO6A 3QBUA 5IHRA 1KO0A 3KTSA 3NPXA 3OZMA 4IQJA 3RGTA 3FXGA 2NQ5A 2GZXA 4LH8A 3KS5A 4U2YA 1BXCA 3RCYA 4HCLA 1DP0A 3TC7A 3K46A 3FJ4A 4ZENA 2XIQA 3O2LA 1EEPA 4ACZB 3W2MA 1TA3A 2V5KA 5JH1A 1A5NC 5ABTA 4IMCA 4FLSA 3OHMB 2I17A 4C6CA 1EJRC 4AD1A 1AODA 1TE6A 2WMHA 3TN6A 1AMKA 1UC4A 3V5OA 1QI2A 1H1YA 2WHMA 4Y9OA 5D8WA 2X30A 4WGXA 1LWHA 4JYFA 1P4CA 3B8IA 4ML4A 2QCDB 2A6LA 4POCA 4XZHA 1ICPA 4BQ2A 1W37A 4QG8A 2QGHA 3HBLA 2OU4A 2EG6A 2E9BA 4YWIA 3V35A 2HXTA 4S3AA 1GOIA 2IQ0A 1B3OA 5CAKA 1TV8A 1DJNA 1BPLB 2ZX9A 3T0AA 2WSYA 5D8ZA 2XTKA 1NU5A 4J3WA 4GINA 4M6QA 2DFAA 1CT5A 1D9EA 3UERA 4GVGA 4LNYA 4FIQA 4HK6A 2OZ0A 4WDUA 3ERPA 4IX2A 4DI9A 1OINA 3STGA 3IIPA 1KQYA 1AJ2A 4F0KA 3H21A 3LBMA 2BVTA 3QW4B 1XPYA 1D2KA 2XHYA 1JPMA 4NNBA 3A4AA 4RPQA 3AIBA 4YTQA 1AZ1A 3G3DA 4HA0A 4JIPA 3K8LA 4F66A 5DCDA 3QC3A 1GPFA 2YXXA 3SGZA 2ZC1A 3F4WA 1XISA 1L2UA 2FJUB 1GTEA 4Y96A 3A47A 3V0TA 3CQIA 1BWKA 4DJEA 4Q4QA 5I02A 4US6A 3LU2A 2PWEA 2CESA 4FSAA 3LM3A 3NPVA 2X42A 3CEPA 4M1RA 3C56A 4A2RA 3INPA 3CHCA 2VEIA 1L2QA 5TD4A 3UT0A 3LY0A 1PHWA 3L0KA 1R6WA 4XZ9A 2W9MA 4DJDA 2X09A 1XC6A 3TV8A 1RQEA 1SZNA 2HEJA 1AQ0A 1XDMA 1J11A 3NURA 2TODA 4D8LA 4HHLA 3VUSA 1T7LA 1HF6A 1VPXA 5A2AA 1VFFA 2DT0A 2ZE0A 5AN7A 2QJIA 3PZUA 4R9XA 3CL7A 3DHUA 4GNJA 4E6MA 4C1KA 4O1DA 1W1VA 1WQ5A 1V51A 2J9XA 1A5OC 1P6CA 5I3GA 1Z6KA 2R1NA 1SSDA 1EJVC 1FCBA 2YCEA 1KFCA 4GNVA 1KFJA 1WE5A 6REQA 1W56A 3GFXA 4HPJA 9XIAA 1PCWA 1ZJBA 5EGRA 4HOZA 4N0RA 3TOYA 3L2MA 1C8VA 1RP9A 2WBGA 3AXHA 4C1NA 3UW6A 1I4NA 4B5XA 4B2DA 1TYGA 1VD6A 1C7SA 4NQ1A 1W3NA 1PXGA 1YXDA 2PDQA 2OSYA 7XIMA 3UGVA 1ODUA 1LQ0A 3NNTA 4CN4A 4AG0A 1VCVA 4HVXA 3EDKA 3F2BA 1WOAA 1RCOB 4V28A 2AL2A 1G7UA 2VURA 1W54A 2JALA 2YFOA 2PLMA 3NL5A 2PTYA 5HWMA 4R33A 3URAA 2ZDRA 5LA0A 1XH0A 4LUTA 3A6OA 2L5HA 3PZNA 4GACA 1MRAA 1PYFA 5BWFA 3EOEA 2P3ZA 3WLTA 5G2HA 4L1GA 1ISXA 1HKJA 2CLHA 4JN7A 2DV0A 3NA8A 4S3DA 1VYRA 4FR6A 3L4UA 3TJ4A 3ZR5A 3M0JA 2JF6A 1GVRA 3F5KA 2WO5A 2VO5A 4ZA0A 3RLUA 1JYNA 2W92A 1EX1A 4CNOA 3VDAA 2DT2A 4MIMA 4R7OA 3CYJA 1OFOA 3Q67A 1CB7B 3WDRA 3WLHA 3SADA 1KFLA 1IXOA 4MB1A 1S3HA 1L6WA 4TMCA 4I5UA 3N9KA 3CO4A 1KFEA 5AKQA 2PGRA 4LCSA 4XZNX 1KGWA 3GDLA 1EFZA 3UZ5A 3VD7A 4MWAC 4L7ZA 2FHBA 3A5FA 3C0LA 1AL8A 2I5IA 3BG9A 2JIEA 2Z25A 3IJ9A 2WWCA 2EQDA 1RQBA 1RLDA 1K03A 3DKJA 2YX0A 3LCLA 4DI8A 1CXEA 4H1ZA 1UBSA 1FY6A 4DBSA 3ZFHA 8A3HA 5IXEA 5K7JA 3DBNA 4LVGA 1VS1A 5FL0A 2HROA 1Z41A 3RJXA 6A3HA 3ORWA 4K36A 2GDQA 1BGAA 2VHLA 3T78A 1M7XA 1XLJA 1QPNA 1KM6A 4UTJA 1AW5A 3REQA 3T0TA 4F2BA 2QDGA 4MDPA 1NVMA 4L9XA 1JGIA 3EWUA 3F4DA 2WHLA 3ABQA 4JR5A 1TR1A 3S1XA 4F79A 3SUWA 5BU9A 2DZVA 4IIHA 3EKGA 3GYCA 2OKOA 4FNUA 4TV5A 2RKXA 3O0KA 1DQWA 1XG4A 4J40A 2BV9A 1XIDA 4YL2A 2GUYA 4V1YA 3VIOA 3DFOA 2E5BA 4PB3A 2PWVA 1SFLA 2C3ZA 3NVTA 3BQ6A 3P61A 4MGGA 2XN1A 3LPGA 4UZSA 1UBPC 3BC9A 1G4SA 1K7EA 3GIPA 3LDVA 1MZHA 5BCAA 4B92A 1DJGA 1BVWA 3NQ8A 4HK5A 3EYPA 2PMQA 1YQ2A 1E51A 2NV9A 4A8LA 1EQPA 2VEPA 4DYKA 4OQVA 2PDHA 1W9XA 1JF6A 3N18A 4DHGA 1DJXA 1XG3A 1YBQA 4NYYA 4UR8A 3NGFA 3I6RA 4INFA 1KV5A 3RRAA 2E6YA 2QLYA 2HBVA 4KGJA 8XIMA 3HZ3A 1F6KA 3V16A 1J8VA 2QW5A 5A6LA 3IIOA 4GUFA 2F2HA 3AYRA 4E8GA 5DMMA 3FY1A 4A05A 3H2CA 2QUMA 4KWOA 3M47A 3M5ZA 3UVIA 4M8UA 4Q4RA 3GDMA 4R3UA 4B4FA 3GNXA 1GQIA 1OABA 3UD6A 2OB3A 5FJRA 5HBFA 1G9HA 5AHIA 2NQLA 4NRSA 1Q66A 2GK1A 3OLEA 1AD1A 5BMXA 3EDEA 2ZQ0A 1XBYA 4OZOA 2O55A 4MB5A 3OIHA 3WF1A 3W53A 4JFSA 2GJRA 3BXWA 4HA1A 2R82A 3HMJG 2VRKA 1JF5A 4K6AA 1VYSX 3W7EA 4C6PA 1OD0A 1XQKA 1E6PA 4AIUA 3W00A 1NM9A 2CITA 5CBIA 1ONXA 2HVOA 4U33A 1T0OA 3W01A 1VP5A 4K7YA 1PAMA 1E56A 3IJ6A 4AVFA 3PPGA 2Z26A 4C6MA 4L64A 2OMAA 4Q6XA 4PMZA 2A3HA 1I2OA 2IMRA 4OECA 3UXAA 3M64A 4I9TA 1ECEA 4PMJA 2DGAA 4J2PA 1TCMA 2PDFA 3UY8A 2AOSA 1V7YA 4W8AA 1UP2A 3STFA 5AYZA 3SURA 1JDAA 1AJ0A 2FB3A 4GNKB 2YXOA 1W9BM 3BUVA 1FH7A 4XAZA 5CC3A 3DFNA 3VUPA 1QI4A 4LPCA 3KOFA 2XZ9A 3OLGA 1G01A 1YPIA 1BKSA 1UPMB 3R8RA 3LOTA 2JQXA 4XK2A 3A3HA 4UMAA 1XLMA 2UY3A 3WG6A 2Q02A 4QG9A 4PMQA 3F5LA 1SJDA 1UWUA 4NZ5A 3WKZA 3K13A 4HHPA 3THUA 1SZGA 4K8HA 3QPEA 3VM7A 1NFBA 4ZSUA 1J93A 2HCVA 4GY1A 4PMUA 2DP3A 3RUBL 1C92A 4IL0A 3LMYA 3BCDA 1YTKA 1XW8A 1DTUA 2FVLA 4C6LA 3QW3A 4MWAD 2OXNA 5FJOA 3V18A 4O16A 3ANUA 1F61A 4UB9A 5CGTA 3WNLA 2JKAA 2GUUA 2H3DA 3IAPA 4HA4A 1B90A 1WOBA 5KZ6A 4PUKA 1XLDA 4UOZA 3IGHX 2Y85A 1GOXA 3N13A 3PNZA 1J5SA 4JTAA 1U33A 4YJ5A 4OIFA 2F6UA 1SW3A 4KCVA 1MMFA 1GJWA 1RVKA 3L4XA 5D2VA 1ONWA 3PZVA 3GKAA 4Z0JA 2Y8KA 4Q4PA 4UCGA 4FX6M 3NZPA 1PJ9A 4LVAA 3WQDA 3QMTA 1JYXA 2MUCA 1B3WA 4H9UA 3GZAA 1N8WA 2Y7EA 1J18A 4AD2A 3WL0A 5HQLA 1K4GA 2VX6A 1QAPA 4F2UA 4JIRA 3V0UA 1XYCA 3BMWA 4O13A 5D9MA 4F8XA 3F5JA 3NZGA 1A4MA 2VDGA 2V3GA 4ATDA 1TX2A 3G18A 2H8XA 4CQAA 1E9YB 1H0IA 2VGIA 3GXDA 1GYLA 1RBOB 5A8NA 1LL4A 2ZUSA 2Z1SA 3BLOA 4G56A 2ZXDA 2RDXA 2O7QA 1TE1A 4FOKA 3L65A 4QXIA 1KCZA 4RR4A 2XYLA 4TXEA 2XSAA 5HPOA 3NL3A 3U2ZA 1GTHA 3F03K 1SU5A 1HJQA 2A79A 4WY0B 3DESA 2VJXA 2XN0A 1MEWA 4HA3A 2AQOA 2OT1A 2D2HA 4UTTC 3ITGA 7A3HA 4QJ5B 1IT8A 4Z2IA 4GO9A 3C2FA 4UMBA 3HPFA 4IFRA 4JTDA 1DIOA 4JTCA 2Y4SA 3EZ4A 5I2UA 4JTJA 1OCNA 4P8XA 2D22A 2DIJA 2J24A 2JKPA 2QCMA 3HJZA 1KR0A 3WEZA 3R0DA 1YTDA 4QEHA 4AD0A 3WH9A 1OEPA 5A94A 6XIMA 1TV3A 4I6VA 3CPGA 3WBWA 3HQOA 4HMEA 4KESA 1L8NA 5C54A 4C60A 5LIXX 4DB7A 2Q6ZA 1MXDA 1IEQA 1P0KA 1UR4A 2PP0A 4YCOA 1CWYA 2QJJA 4S1FA 3CZEA 3NQ2A 1F05A 5BZAA 4J5NA 4MAZA 5T91A 4DRSA 3N15A 3OZYA 4LB3A 1Q8AA 3S3GA 3UZWA 2EAWA 4H9VA 5B7ZA 4JN8A 4ICMA 1OVDA 2B7QA 2HMCA 3VKKA 4RXFA 5MKGA 1RHCA 2IS7A 1YDOA 1PZ3A 2UY2A 3GR7A 3NPUA 4PTDA 5EY5A 2ONEA 3M41A 5I77A 1J5TA 1L6GA 4GO8A 3LHZA 3B97A 1Q6LA 1B0IA 1VFHA 1H3GA 1W31A 3YPIA 4LJ3A 4Y9NA 2F9RA 1MW1A 1B57A 2QF7A 3MCNA 3NIYA 3PB2A 4GFIA 4F2TA 4I3GA 3P60A 3WBXA 2VX5A 3ICJA 3IJ7A 2OWWA 4N02A 5ENLA 3O63A 2Y8VA 1CCWB 1H4PA 1DIKA 3BJSA 4JTUA 2NVCA 3OVGA 3CAWA 5LSMA 4IUOA 1CGWA 1DXEA 5C9RA 1XLBA 3W1QA 2EPKX 3HG5A 3VNYA 3TQVA 1XUZA 1BYDA 2IW0A 5IRPA 3AYSA 1FWIC 4JDYA 5A6BD 3HURA 4CCCA 1XC4A 4BI7A 3NGJA 1EZWA 1QJWA 4ICCX 3O05A 1LROA 3CV1A 1W3TA 3P8JA 5FJJA 4TOQA 2P5NA 1Y5VA 4BS0A 1ZPTA 2ZC8A 2VFHA 3UR8A 2PDXA 1I2PA 2BXYA 2J8FA 2QR6A 3S5OA 5XINA 3OIXA 3GFYA 3TLQA 4EANA 3A3XA 4O10A 1VFUA 2E6FA 2REQB 4DZ5A 2G4FA 3M46A 1OFPA 4AHPA 3V5FA 4XKYA 2DJLA 5JVLA 3E5BA 2YB4A 2OO6A 2BOFX 5HOSA 5I3HA 1I1XA 1HL2A 4YNGA 1KWGA 1UCWA 3TSDA 1W6TA 1WB0A 2J79A 3LRKA 3M7WA 1K7FA 3QTGA 2PD5A 3GW0A 3TTEA 3C5QA 2QCHA 1QVBA 3T0CA 1VFTA 5H1WA 3E1F1 3S9IA 4PUJA 3ZM8A 2QXWA 1F76A 1NELA 1WDWA 3EOSA 3PUGA 1UH2A 2DUAA 4ICNA 4RL3A 2CNCA 1BYBA 2X1UA 2ZZ4A 2P1FA 5HXMA 2Z27A 4R7JA 2ZYFA 2PCQA 3EPMA 1KD0A 3DH7A 3QFEA 4JTTA 3UA3A 5C0QA 1EUNA 4ZO8A 4AU0A 1BF2A 1H7OA 4J1OA 4B90A 2B7OA 1XX1A 2CBJA 3SB0A 4NXKA 2PU1A 2H9AA 4O4VA 3W74A 2DJXA 2XIOA 4DWSB 5K9XA 1VJIA 3EPNA 1FWRA 5JH2A 1XBVA 2D20A 4KFPA 3ID7A 3OYZA 4PMDA 3CL8A 4P7RA 3WJWA 1UD5A 2XU2A 4MG4A 3FKKA 1TO3A 1UUMA 1GVQA 4N2YA 4HYRA 4YYFA 1PE1A 3LBCA 1K9DA 3W4RA 2ZXBA 3H23A 4O4WA 1DPMA 3LRMA 3EA2A 2NZLA 4PODA 4U28A 5D32A 3OGSA 1XDJA 2J7FA 3O15A 3PSWA 4ADUA 3N11A 1CXHA 2NXHA 3FHAA 4MYXA 4C6IA 1PTGA 3NOEA 2D0GA 3WIJA 2PC8A 1SR9A 3E74A 5CCZA 4MLJA 3RG6A 3O6DA 3EMCA 5HMFA 4KWWA 3WFZA 3EXSA 1GOQA 4JY9A 4JTIA 3R79A 2AKZA 1ZB5A 3C3NA 3EWZA 3ARXA 1R9XA 3MVIA 3CK5A 2ZX6A 1PO9A 3CH0A 4S2CA 1H50A 5F2LA 3W22A 4TV6A 3LPOA 2POZA 3BJFA 3ZT7A 4KEMA 1UKSA 1EPVA 1FTXA 1UKQA 1X6NA 2ZZ2A 3VGEA 2V6AA 4GWEA 1BXBA 3LB0A 1XLLA 4LUIA 3ZWSA 2PI6A 1XBXA 4PFMA 3GUGA 4UOQA 3WYZA 1UUOA 4K2SA 2FVKA 4E8DA 3MSGA 2KZHA 3QOMA 4XZBA 4U4MA 4GBUA 4ZB0A 4JQ4A 3POCA 4QNEA 1XIGA 1W1TA 1SQ7A 2KAUC 2VFIA 3M0XA 1U22A 1K6AA 5BWAA 3CB3A 2BODX 4W4QA 4MNLA 3GHSA 4B4HA 1PZ2A 1JZ7A 3NO1A 1S5NA 2ZCGA 1ZTVA 2VC5A 1P48A 2QHAA 2CXEA 2HK1A 3SCSA 1FWEC 3ANYA 1O6IA 3V0SA 2YDRA 2OELA 3QRHA 3L67A 3WMCA 2GJXA 2CFFA 4S3BA 1VHCA 2PDBA 3AHXA 3R0KA 3OGVA 2WBKA 3OVPA 2PAJA 4RKAA 1FWCC 3E49A 2WKLA 2DZAA 2QCCA 3BLPX 3NWRA 2JK2A 1R30A 1NOFA 2SFPA 5H2ZA 1Z42A 1EOMA 2WC3A 3RITA 1UP0A 3DYPA 5T26A 3P84A 4E2OA 5FD0A 4ATLA 5D38A 3HV9A 3AU6A 4JTGA 3PWAA 4U31A 3LHYA 3SIMA 2A0NA 3AI0A 1TJRA 2V9DA 3ARUA 1HZYA 1ZL1A 1OWQA 2YCJA 3B03A 4A8NA 4WDTA 3O3RA 4JTKA 2OT0A 1P0BA 1JPKA 2G96A 3W7CA 1S5WA 1R38A 4AF0B 3OA5A 4AWTA 2WSKA 2GWGA 2YCKX 1PPIA 3WMSA 1E72M 1ECQA 4ES4A 1R9YA 5CG0A 3R0UA 3N9RA 3W1XA 5LIUX 1BRLB 4GIEA 2XSBA 4YXGA 4M7TA 3UCDA 1CGVA 4NASA 5CKSA 1QI0A 4PMYA 3MDWA 3UBPC 3HA1A 3VM5A 3R11A 3PVFA 1FH8A 2R91A 1XM3A 1SSGA 4YN5A 1Z9AA 1GGOA 3WNPA 3R43A 1E1EA 3K8KA 4RV3A 1R8LA 3IGSA 1VH7A 2CBUA 1KCXA 3UR2A 4DLMA 2X1SA 3KXQA 1F3WA 3KRZA 1JCYA 3UVAA 5CPTA 3H22A 3ANVA 1E4MM 5HAOA 1QHZA 4HNTA 3SBFA 1UD4A 4UFMA 4HTBA 4Z1DA 3SJ3A 4HNOA 1F6PA 1IF2A 3MZ2A 3ARTA 3KDOA 5FIPA 1Q13A 1HVQA 2QDEA 2XH0A 3UJEA 3C4UA 5XIMA 4CQ9A 2P0OA 1DQXA 1GYNA 1UIOA 2O7SA 2C13A 2E7FA 1Z48A 3TQPA 1J6OA 3GXNA 1U1UA 3SAZA 4MZ1A 4GJJA 5DY3A 4S3JA 5DELA 3CUHA 1A50A 4X2RA 3IJ8A 4C6BA 3LI1A 3ITCA 5C9XA 3EWYA 1TQXA 3JW7A 1ZENA 1YPXA 5A8MA 1AW2A 4JIQA 3QVQA 1TELA 4AIBA 4RJEA 4LEFA 4A3RA 1WYIA 3M0YA 4QSHA 1YX1A 2NVDA 1BWVA 4IICA 2NV2A 4NSBA 4IP4A 1JAKA 4N4QA 5HK4A 3MY9A 5EFFA 4FOUA 2A7RA 1PUDA 3P81A 3U2EA 2FMNA 1XIJA 5TQLA 4OGZA 4KWVA 3IVUA 3BH4A 5KINA 1A47A 1VRXA 3WJZA 2OEKA 2OYMA 3G6LA 4IOTA 3GTXA 4DO5A 4B5UA 3CAVA 2PDCA 4PE8A 4Q8QA 3A64A 4E3VA 3FN9A 4HOWA 4AZHA 1UQYA 4GPNA 2G8ZA 1RJPA 2V5BA 1R3SA 4DZHA 4LV9A 3TR2A 2ZX7A 4HNUA 3LX9A 5M5DA 1I2QA 3U9IA 3KBSA 4MWAA 2PRLA 1MVYA 4XAGA 1O1ZA 4HJWA 4PBEA 1EYWA 2GJNA 3QHNA 1OX6A 3WQ6A 4YTSA 4WR3A 3RM4A 2CCRA 4PCNA 3TLLA 3VNJA 1JZ8A 2J62A 3QGAC 1JCLA 3IV3A 3H2AA 4NX0A 3TDFA 4AMCA 2LLEA 1KFKA 5LGXA 2R14A 1WDRA 1U1HA 1QW7A 1JZ5A 1UMYA 3RU8X 1OSEA 1CXLA 4JQ1A 3FCPA 4GQQA 3UJSA 1K9EA 3DEQA 2P10A 2VCBA 1KWKA 1C9WA 4JHMA 3MUZ1 3HN3A 4QROA 2J25A 1HN1A 3UQNA 4FP1A 1GW1A 1Q7MA 2C15A 3BAXA 2PDWA 3KBJA 1HGYA 3OOQA 3NQMA 2E4TA 3UZYA 1WXZA 4FF7A 2AAAA 3VDHA 2QCNA 2WB5A 4IWWA 3G1VA 2TSYA 1TV5A 2DPEA 5A6SA 3W87A 1BTMA 1EP1A 4GC4A 3DFTA 1W8SA 3CHFA 4CU6A 4JIIX 3B9OA 1JD9A 1WO2A 2PTWA 1JYVA 3PG8A 1AZ2A 3OVRA 2R6OA 1JZ2A 4KETA 4LUSA 5EMJA 2RDWA 4NZCA 1YADA 3VIJA 3S6OA 1ONEA 2BS9A 4W5UA 2A3AA 4CD7A 1PBGA 4NZFA 2GSHA 3O1NA 3M44A 4YVXA 2X2YA 2ZA1A 3EWBX 4M6VA 5FF4A 4X61A 1KQZA 3NQBA 3WEMA 1ONRA 3S8HA 2EG7A 3MW7A 2WC7A 3UXLA 1JI1A 3K2GA 3CMJA 1JCMP 3MB9A 2FHCA 2J66A 4GUGA 1TTIA 2ABAA 4LFYA 4ZEPA 1T99A 4FNQA 3VGBA 2PP3A 1HO1A 4BF9A 1NF0A 1ZNNA 1V6VA 3PJXA 2ZZ5A 3URNA 1W3HA 2VRQA 1HUVA 3GTHA 4I7VA 1XGZA 3ABZA 1F4HA 2OLHA 1MSSA 2WAGA 2HBXA 1LF1A 2FHFA 3L0GA 3OJGA 1V6YA 2VD8A 4HHHA 2CLOA 4K8EA 5FEPA 1DWGM 4LANA 3VX0A 2Z2BA