4DF1A

Crystal structure of orotidine 5'-monophosphate decarboxylase from thermoproteus neutrophilus complexed with inhibitor bmp
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
199
structure length
199
Chain Sequence
NLPLVVALDTEVLKAIDVAKRLKGAVAGFKVGWDLIFEGGISIVGEIARYGNVIVDLKIADVPHVASRVVEKLVNRGACCVIVHGFLHPSLPRGQHVYVLVKMTAPTIYDEMWEKLLNSVQDVRGFVLPGNQPEVVAQARKRIGCSYRIISPGIGPQGGRPGAAIEAGADFEIVGRYVLEDPARISQWAQYRPTCFETP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Crystal structure of orotidine 5'-monophosphate decarboxylase from Thermoproteus neutrophilus complexed with inhibitor BMP
rcsb
source organism Thermoproteus neutrophilus
molecule tags Lyase/lyase inhibitor
total genus 70
structure length 199
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4df1A00
1TTJA 5LNUA 1S5VA 3W2JA 1F5ZA 1O5XA 4O13A 1YXCA 3M9YA 2G95A 1W54A 2TMDA 2OMAA 1DQWA 3GDLA 2CLFA 3QMSA 2OX1A 1KTBA 4MLJA 3IVSA 1OFRA 1IIGA 2XN1A 1W0MA 4NJGA 1UJPA 5LZLA 4AF0A 4PL1A 1FWNA 5DBTA 3HO8A 3VE7A 2ZZ3A 3BPWA 3HGJA 3G1FA 1EA0A 4L4MA 3NQCA 4JXCA 1VH7A 4R33A 1Q45A 3BGGA 3W1QA 1L9WA 2FIQA 3L68A 3HMJG 1JQVA 2ZBTA 5TQLA 3CWNA 2UV8G 3QPYA 1BEUA 3LM7A 4JN6A 5F4WA 3W1NA 1VQTA 4FIQA 4OT7A 3DU0A 3GXTA 3QJAA 1KBIA 1FXQA 3DH7A 1RZMA 2PC4A 3CU2A 2DZUA 2VEKA 2YGYA 5G5IA 4HT3A 2QF7A 4LRSA 2NXGA 1XCFA 3P8JA 3W86A 2EKCA 3KAOA 3G0SA 5K3VA 4OV9A 1SPQA 5I3HA 1LDCA 4O57A 5T26A 1SFLA 3ATYA 4KWWA 2ZRWA 3R2GA 1N7KA 2G96A 4A29A 3U2OA 3V1PA 1H5YA 2GPTA 1QPOA 1DORA 1V7YA 3W22A 3B4UA 4N9DA 3H54A 5D37A 2Z0IA 5KZEA 4ZQCA 1W5QA 1X1ZA 5F4SA 1KTNA 3NL3A 2V9DA 1KM3A 1VLIA 1SUXA 2VFDA 3VKJA 5C6MA 3YPIA 1WQ5A 4MY8A 3NEVA 3C8FA 3HGOA 1O95A 1RVGA 1LTDA 1W1ZA 3WJSA 1LYXA 1JCXA 1W31A 2QDGA 4N9BA 1N8FA 3MHUA 3FOKA 2NX9A 5FEXA 1XL9A 3LI0A 4JS3A 1F73A 1PL9A 5CGQA 4ZQRA 2E09A 1OFOA 4XWUA 4QISA 2WSQA 2VFGA 3HBLA 4DEFA 2A4AA 1IXPA 2DZWA 1TPH1 3BW2A 1KM6A 4BWLC 1G69A 4FEZA 5DLCA 3TQ0A 1KBJA 1KFJA 2H6RA 4NQ1A 3FYPA 1ME8A 4JTKA 2ZA1A 4AXKA 3O16A 4AHOA 4LVAA 4A21A 3LOTA 4TO8A 4QSHA 4RLIA 1Q6LA 3PBYA 4N9EA 2J6XA 3IEBA 1ZY9A 2QCMA 4ZZ9A 3M16A 1VLWA 4HPXA 1PCWA 1MEWA 1UCWA 2W0UA 1J5TA 1XFBA 5AHIA 2X30A 3JR2A 4BI6A 2PRMA 2TPSA 2QCLA 2GQ9A 2JKPA 4YMZA 2ZRXA 3UNDA 1K7FA 5E0KA 2PE4A 1ADOA 2ZRVA 4WY0A 2C0AA 1TREA 5K7JA 1TPVA 3Q37A 3F03K 5AHEA 2B0MA 1JUBA 3N14A 2FLIA 3GR8A 1N55A 1EPXA 1LROA 2C1HA 5D2YA 3L5AA 1VHNA 1OF6A 2DZTA 3EX1A 4J9JA 4RV8A 4O16A 3TX9A 4O28A 1LRNA 3TA6A 2C19A 4CCEA 5LHFA 5A8GA 1IXQA 1YPIA 2ZFAA 4UR7A 1GEQA 2Q8LA 4BF9A 2W79A 4CNPA 2J9XA 3UWUA 4BFAA 5IM51 1Z48A 2BXVA 2LLEA 5K9DA 1DV7A 3NL5A 3GDKA 3ABOA 1A50A 2GQAA 1GVFA 5FF0A 1TYGA 3HPSA 1CW2A 3HGSA 4AWTA 3TSBA 4E2DA 3N3MA 1FX6A 2QCNA 4WX2A 4Z1DA 4FX8A 2Y70A 3DFSA 2ISSA 3ELFA 3ZS4A 1FDZA 5G1YA 3LI1A 5HR6A 4X2RA 4O4VA 3E02A 3TUUA 3C52A 3A23A 1U5JA 4K37A 2QJIA 5FF4A 1HFBA 2H3DA 4E38A 1GVOA 3O06A 2QCEA 1A5CA 4MYAA 2IQTA 3W3OA 1P5BA 3BGJA 5C55A 3NDOA 3ABSA 3MI6A 4N4QA 2RFGA 4O54A 1KLZA 1YYAA 2YR1A 4UFIA 3C61A 1IGSA 4NUWA 3FEMA 5CSRA 3QPZA 5F2LA 1L6YA 3W1UA 4N02A 2DZVA 4QQ3A 4X9SA 3SY5A 4A3UA 4QITA 1L6WA 1KFEA 3LCHA 4UTTC 1OFBA 1SW7A 4OQVA 3S8HA 1F6KA 4GBUA 2E77A 3O05A 4A2RA 4YWIA 5HWJA 3LHTA 3UQNA 3IGSA 3BW4A 4MYXA 5HJLA 4ML9A 4O1BA 4ALDA 1WYIA 3GXNA 3FIGA 2HS6A 3FJ6A 3G1XA 4LV9A 4DO6A 5DN1A 4UMAA 3QMRA 2Y63A 4M6PA 3G1DA 1J4EA 4GRSA 4JY8A 3S5NA 3KHJA 3M5VA 2WNQA 3W71A 5K4ZA 1VYSX 4MZ8A 4JDBA 1SSGA 2NUYA 5AC8A 2QDHA 3HQ1A 4PODA 3E96A 1A5BA 2VXNA 4RZ5A 1SFJA 3W76A 2RKXA 3MJYA 4M6VA 2PCQA 1NSJA 3Q94A 1OFPA 3LRLA 1JCJA 1H7PA 1LP6A 1I2PA 4Z08A 3TSDA 1L6SA 2QAFA 1LOLA 4U4MA 1BWLA 4PCFA 1DKWA 1Q6RA 3EX2A 5FF7A 2FJKA 2WV8A 2CU0A 1F74A 3UWYA 1J2WA 3LHYA 3ZWSA 1TJPA 1AK5A 3SR7A 1OX4B 3U8GA 1F6PA 3VNDA 3OA3A 3B05A 4FNSA 3TC7A 1DVJA 4JIQA 3W23A 3OVPA 1FWTA 2HSAA 3P61A 4K6AA 4ORIA 5HWMA 1P0KA 4O0ZA 4IMFA 4UFJA 3M5YA 3W1MA 3PUEA 3KVKA 5LSMA 4MVAA 1KV8A 4JY9A 4ICNA 4LVDA 3UWVA 3DFPA 1OFDA 2XFWA 1GVSA 1OABA 3HJZA 4Y90A 5LNVA 1KV5A 1VCFA 3TFXA 3UY8A 4JIPA 5FF3A 1HL2A 1G4PA 1P0NA 2NUXA 1W5PA 1H51A 4LS0A 5F2IA 3NO5A 3NQAA 3STCA 4IPJA 3CEPA 2QJHA 3RLUA 5DCDA 4DO5A 4JICA 1JUEA 3DI0A 2FB2A 4IX2A 1JCMP 3O07A 3L0NA 3SZ8A 2C15A 2FPTA 4MJMA 1OK4A 4JX5A 4HNTA 1WAUA 2E5BA 3E0IA 3GDMA 2CLHA 3SGUA 1ALDA 4GFSA 1YTDA 3W7KA 5BMXA 3W7MA 5FEWA 1SW0A 3FLUA 4NJIA 1YXDA 3PG8A 2DZSA 1EEPA 3C2OA 2WSRA 2A7PA 3C2VA 2B7PA 3LCXA 1H61A 2DJLA 3HB9A 3A5VA 1R2TA 1FWRA 4NXKA 3T4CA 3W1PA 2VKZG 1XKYA 3LBCA 1KM0A 2VFHA 5KMYA 1AW2A 2A7NA 2JGYA 3S1UA 3L5MA 4O11A 4K8EA 5D33A 3ABRA 1TO3A 1TPFA 1UB3A 4XKYB 2ZZ2A 4IWWA 1G7VA 2OCZA 2QAPA 3T40A 4P61A 3H55A 4DPQA 3OVQA 1DQXA 4IGHA 3GKAA 4BK9A 4MZYA 1B4KA 3TQKA 4O14A 4UTIA 3FKKA 3P5YA 1HG3A 3KOFA 3UWZA 4UMBA 3ATZA 4K8HA 5D04C 1I2RA 4HKPA 2X1TA 3FJLA 4GNJA 1EB3A 4ADTA 4O18A 3TR2A 4YCOA 2WO5A 3IIXA 2ZTJA 1OFEA 3O6DA 4UTLA 1RQEA 4DELA 3W7CA 3G3DA 3I7RA 2X16A 1L2UA 1G4EA 3G0UA 2WNZA 3JRKA 3U6WA 4GC4A 3UYCA 3WK3A 4MOZA 3THQA 3GIYA 4QAIA 3O6CA 2DJXA 2OZ0A 4D2JA 4BR1A 1TJRA 3R13A 4L4LA 2AAMA 1LLZA 1UUOA 4ADSA 1SZNA 1P4CA 3HG5A 1LBMA 2Y88A 3DFQA 2FTPA 4H6KA 3PC0A 4U28A 4YLWA 3VI2A 2V2CA 3IGXA 3THAA 2VEMA 1SZEA 2DU2A 3P80A 4PL2A 3A21A 3INPA 4N2YA 4NZFA 4YL2A 5EYWA 2FQIA 3UXAA 1GWJA 3W84A 2Z2UA 4LWWA 4OBTA 1LRTA 4UR8A 3G1YA 4S1FA 1ML1A 3IIOA 1TTPA 3HPZA 1VPXA 1JRBA 3VCRA 1JCLA 1FQ0A 3QSTA 3AO0A 1JCYA 2GJLA 4O0KA 1MEHA 1OFQA 5DXXA 2V0TA 4GJ1A 2RDWA 4JX6A 6TIMA 1EWEA 1H7RA 1VJIA 3WJXA 2NLIA 2Y89A 4KKXA 2CLOA 5FEPA 5AYZA 1LZOA 3B0UX 2HTMA 4RZ6A 4DQWA 3CTLA 3IIVA 5AHNA 3NNTA 4JTLA 4JTSA 4LC8A 1CI1A 1LBFA 1Y0EA 3DFNA 3TC6A 3KVLA 3HOJA 4OHQA 5G1TA 4K7VA 2YYUA 4FNQA 5FEZA 3LTPA 3LBMA 4WOZA 2JGQA 3M7WA 5AOUA 3T78A 2WQPA 4XTIA 1VCGA 5I3FA 4UTWC 2CLEA 2NXIA 4UUIA 5HQEA 1VR6A 3Q58A 3G8RA 2A2IA 4FNRA 1M6JA 2YSWA 4AB4A 3P81A 5DY3A 4LRTA 4UMCA 3B04A 3P7YA 4HNVA 4S2BA 5CSSA 3S5ZA 3LLFA 3ZFHA 4UFMA 4ONVA 5KITA 1W5OA 1H1YA 1A5AA 2OJPA 3G1AA 1XBXA 4AH7A 3TE9A 1I2OA 1TPDA 1V5XA 2ZQ0A 5D32A 3L2IA 3TJXA 5C54A 3T7VA 1VS1A 3LCLA 2DZPA 5D30A 1TPB1 3AJXA 2ATSA 3L9CA 2VFIA 3TMQA 4FXSA 1ZNNA 2OT1A 3USBA 4DF1A 2V2HA 1BKSA 1ZALA 1K02A 3FA5A 4JYFA 3UD6A 2ZZ7A 1RQBA 1SZFA 2BX7A 2Y61A 3QEZA 3QFEA 2R8WA 3GAYA 3SSJA 1ZAIA 1H7OA 1OX4A 3S1WA 3PM6A 3T55A 2XN2A 4N9CA 4UIOA 4FNPA 1XDLA 1K8YA 5BMWA 2CZEA 1B4EA 3RLVA 4C1LA 4G1KA 3TAKA 3W6YA 2Y7DA 1SO3A 3EWYA 3QW3A 5EBUA 3L67A 1AMKA 5KTLA 4Z1AA 4IXHA 4LV4A 1S5WA 2E6YA 3W2KA 4JTGA 1B9BA 2XN0A 3OVRA 1TB3A 3B0PA 3GZ3A 3RK8A 4WOQA 1W5MA 6ALDA 3EWWA 4UTMA 1Z41A 1YXYA 4UFHA 3W74A 2Z6JA 3LXAA 2C14A 4NVTA 1NF0A 1IIHA 3EXRA 1XUZA 2WPBA 1T8XA 3BK0A 2GVJA 3W2MA 3W9ZA 4H3DA 3P82A 1SSDA 2AGKA 4TU1A 4OU1A 1EP3A 1O4UA 1IF2A 3PVFA 3W83A 5D2TA 3BLFA 1SQ7A 3C2FA 4R34A 2QCHA 1TV7A 1RQHA 4EF8A 1KFBA 5MHBA 2WNNA 3W7DA 2R91A 5CG7A 1PVNA 2YW3A 4HSOA 3DKJA 1PCKA 2CLIA 5LNSA 1Z42A 3QQ1A 2YZRA 2VC6A 1W8SA 3JS3A 4GWEA 1VYRA 4LUIA 4X22A 5LGZA 3P8IA 4EVZA 1MSSA 3B0VC 4OWGA 3UPBA 4TMBA 5DBUA 5TBOA 4TR9A 4GUJA 4CQ8A 5FESA 2Z1BA 1OYCA 3OHIA 3W7IA 5EPDA 4BWLA 5AB3A 1VYPX 1QPQA 1PHQA 3TROA 3M5ZA 3SIZA 4N6EA 4O53A 1ONRA 3TSMA 3EWZA 1MXSA 4S2CA 1KFKA 1X1OA 1SO5A 2ZCGA 1I2NA 1QWGA 2C18A 2NX1A 1WA3A 2CLKA 3NQ8A 2VENA 1JCNA 1LOQA 2P0OA 4X3ZA 4TMCA 5BNKA 1GYLA 2E5DA 1I8JA 5HUPA 3KXQA 5D2XA 3TXVA 3PWAA 4IXXA 4BI7A 2ZZ6A 3EWXA 3BG3A 3MMTA 5HR7A 1LCOA 3MHFA 3H53A 1K7XA 4FXRA 1A53A 3WK0A 3LX9A 1YDNA 1WOAA 1G6CA 1W56A 3OIXA 1NAL1 5AHMA 2BSLA 3DHDA 3LGEA 3SECA 1EP1A 3PAJA 3PF3A 1G4SA 3TCEA 2VELA 5IBXC 1C8VA 3C2EA 4UCGA 3CPRA 4ZL1A 4FX7A 4I7UA 3WJYA 3ANYA 3L0KA 5D2VA 1ICSA 4LVBA 2B7NA 3CEUA 4LT9A 4IMCA 4RXFA 2FPVA 1F7BA 4RK8A 1QOPA 1H7WA 2E6FA 3GYEA 1G4TA 3LTYA 1G7UA 2Y6ZA 2E68A 5AFDA 5AYYA 3W72A 1PIIA 3IIPA 2V5LA 2W6RA 3BW3A 1DJQA 3C2RA 3TJLA 3LERA 1W3TA 5D05A 4QIUA 4UNKA 1TSIA 2RH9A 3NL6A 4EF9A 4O1DA 5ABTA 3KRZA 3OBKA 1SO4A 3QW4B 3QMTA 5LKYA 4NJKA 1H7XA 3LCFA 5G2IA 4RZ4A 2JKAA 4GUGA 3TXZA 1YTKA 4QJ1A 3W73A 1NVMA 1ZHAA 2I14A 3TK7A 4IJBA 3G0XA 1FCVA 3P62A 2A1YA 3P5ZA 4GXMA 1CX9A 1FXPA 3CIWA 3WFAA 3C4UA 4JTEA 4AWUA 1UUMA 4WXYA 1DOSA 1T99A 1TV5A 5G2WA 1AW5A 3NQMA 3PBWA 1QO5A 2C3ZA 2GQ8A 4ZQPA 5F1VA 1T0OA 4O19A 1OX5A 4UTTA 4RKAA 1O94A 3KFTA 3SW6A 1KM5A 4NU7A 3PUDA 2ZTKA 3NM3A 4AWSA 3NQEA 2H3BA 4IX0A 3EXTA 1XC4A 3GKFA 5AHLA 2ISWA 3IVUA 5LNRA 1H50A 3NAVA 5KZMA 3UY7A 1ZFJA 3DKLA 1X7FA 3SI9A 3S42A 1M5WA 1T96A 3O8AA 3N9SA 3B8DA 4LU0A 3VFLA 4HHPA 1X8FA 1B3OA 3LRMA 3NXFA 1FY6A 3QQ0A 3PULA 3G8EA 3HF3A 4IMGA 5CZJA 1PHWA 4HNNA 2WSYA 4FNTA 2PURA 4HPJA 1VCVA 1WBHA 2CWNA 2X2GA 5TIMA 3NPWA 3V75A 4WJEA 3NVTA 3M0ZA 4XTDA 5EKYA 1EX5A 2E5CA 4FX6M 3IIZA 4TX9A 3RF9A 3W2UA 2NWRA 3IRDA 2ABBA 3W7JA 3CT7A 2Y7EA 4WY0B 3NM1A 3W7LA 1JR1A 4JNMA 2Q3RA 3GDTA 3MBDA 5C2XA 3WJZA 2QUTA 1XDMA 4MFDA 1IXNA 4AAJA 3MI3A 3NA8A 1QO2A 5K9CA 1P1XA 4NNBA 3W85A 1B57A 5I3KA 3L5LA 3STFA 3GB6A 1XBZA 4IQLA 2VFEA 3B06A 1KLYA 4JTIA 3NG3A 3LV5A 3NQFA 3PSVA 4HN4A 3O63A 2C13A 4JEQA 7TIMA 2CLLA 2YXGA 4M7TA 3TFCA 4UNLA 2X1UA 5E1QA 2A6LA 3W70A 4N4PA 3BO9A 5L9FA 5F2GA 3F4NA 3G1SA 3C3NA 4LS2A 2FDSA 3A5FA 4RX0A 3FKRA 1FWWA 2ATMA 5H2ZA 3KVJA 4NX0A 2GVLA 2FFCA 2DORA 3KRSA 3OEXA 5DCEA 3A22A 3C6CA 3HPXA 1FCBA 4JGDA 1JJKA 1QCWA 2CZDA 3UXDA 1LBLA 1F05A 4DO4A 2QUVA 3QM3A 2OT0A 2ZRZA 2YX0A 2ZZ4A 2PRHA 4ZMGA 2ZDRA 2Y7FA 4WQ6A 3FYOA 1QR7A 3A9IA 5D2WA 1HO1A 2FB3A 1EIXA 1KW1A 1F76A 2WOQA 1WOBA 1FDJA 1WXJA 4WZHA 5LGXA 3TAOA 4O1AA 2QUUA 3QF0A 2GJNA 5D09A 1JRCA 1HO4A 5BRBA 2DZXA 1WBJA 1RPXA 3SJ3A 4TIMA 2NZLA 3GVGA 3LTSA 1K7EA 5HUOA 2JKEA 5CPNA 1ICPA 4Z1BA 1FBAA 3EX3A 3STEA 4GUIA 3LDVA 2Y62A 4XBSA 3E12A 5H91A 3BLEA 2B7QA 3UWQA 3M47A 4IPIA 4K7YA 4AHPA 3LRKA 3RU6A 2E1DA 2QKFA 2V30A 2ZRUA 1YDOA 3O1NA 3TKFA 4ZQNA 3MP4A 1JULA 4LOCA 4FIRA 4JD4A 2Q8ZA 3PB0A 4EIVA 4R53A 5DXYA 3DBPA 4KFNA 2YPIA 3NQGA 4O12A 1IXOA 1QAPA 3N2XA 4MY1A 4YXGA 1PS9A 5E93A 1QNVA 1ZJIA 2O7SA 5U4NA 3EEGA 2YW4A 1TPEA 2RDUA 4EWND 3EX4A 3QYQA 4LTSA 3BLIA 4DBDA 1YLVA 3WK2A 4LY8A 2WKJA 2V82A 3DAQA 1D9EA 3KVMA 3F1QA 3GDRA 3I68A 5CZSA 1JUKA 4NNAA 4W9TA 4CQAA 2GUUA 3BVJA 3P67A 3L0GA 2Y7GA 1XI3A 1D3GA 3NQVA 3CIXA 1KM4A 4Q32A 5HMSA 1YDVA 4KWVA 5FI8A 4NJHA 3QSRA 1ICQA 3LCGA 3ZR4A 3MI2A 4NJJA 3PSWA 1QOQA 5G2HA 3W2NA 3MBFA 3O6YX 1DL3A 3G24A 4DF0A 3E49A 1KM1A 4FHAA 1QPNA 3WK1A 1WX0A 4M7SA 1R2SA 1M7PA 1TPC1 1K8ZA 4UXDA 3NPXA 3P60A 3EX6A 2ZYFA 3RMJA 3SFKA 2V81A 2HS8A 2E6DA 3LHZA 4XZ9A 3S9YA 2X1SA 1JQXA 1R47A 3PB2A 4NNCA 2J9ZA 5D02A 3BG5A 4GUFA 2QCDB 1OVDA 2ISVA 1K8XA 2P10A 1H60A 4Q33A 3NOEA 5AN7A 1OG0A 1XUUA 4RJEA 1E51A 3CC1A 4RR4A 5KSWA 3HG2A 3TH6A 3S1VA 3GLCA 3TQVA 2J88A 2EPHA 5EA9A 2YDAA 1DBTA 1EUNA 4MJZA 1I2QA 3HIJA 4XQ6A 2QJGA 3S6DA 4CQ9A 5EY5A 3TIMA 2HMCA 5DELA 3LXBA 1NEYA 4RCXA 1MEIA 1XXXA 4UFLA 1OYAA 3ABQA 4Y96A 2NX3A 4NT0A 3I65A 2NWSA 4WXZA 1GQNA 4Q4KA 5KZDA 4LS1A 3LCIA 2O7QA 2J27A 2P1FA 1TPWA 4PA8A 3W7EA 4CCDA 5BW6A 3W1TA 3G3MA 1BTMA 4CNNA 4MUZA 2VEPA 1R30A 3HG4A 3EWBX 3NQ6A 4UTWA 2PRLA 3TW6A 1AL7A 1XM3A 3IVTA 2CLMA 1GZGA 4JYEA 1SR9A 4POCA 5CZTA 2GVGA 5AC6A 3TDFA 1FCUA 1S3HA 4UTUA 4ZQOA 4BI5A 2ZZ1A 4Y9AA 2FPYA 4WY0F 3W1LA 3QH2A 3PBUA 3W7PA 2QCGA 1R2RA 1TMHA 1PE1A 3G1VA 3DENA 1LLWA 4QM1A 1Q6QA 3WJWA 2BZNA 5F4XA 3G22A 4P2VA 1VZWA 2ABAA 2V5BA 3KX6A 3GR7A 2J24A 3C0JA 2BLEA 5SWUA 8TIMA 2A5HA 3UZ5A 1QDSA 2H8XA 3R89A 3CLMA 1EP2A 4E2BA 4UTKA 5J5DA 4LVGA 4O17A 5EL1A 3Q2DA 4NXSA 5L6UA 2ALDA 3EXSA 3L66A 4LUJA 3MP3A 3TV8A 3M1ZA 3W7GA 2E6AA 3M6YA 3CQ0A 3RNDA 3BV4A 4IMDA 1TRIA 2J9YA 3KRUA 3FFSA 4CCCA 2H8ZA 3I6RA 4NZJA 4O50A 5CPOA 5DCBA 3CB8A 3R5EA 4CLMA 4RXGA 5I3JA 4KFOA 4EOUA 1KFCA 3DGRA 1TPUA 4NX5A 3GXPA 5CKSA 4XKYA 2ZZ5A 4DPPA 3QRHA 2ZA2A 4E0CA 1TRDA 3MHGA 3NQ7A 4DF2A 5CPLA 2EGZA 4Z1CA 1MO0A 1H63A 3D0CA 1ZAJA 1A5SA 3UPWA 1GVQA 3TU9A 4JTHA 3TNOA 1TQJA 2GOUA 4JYDA 1Z44A 3HG3A 4FNUA 3W2LA 3NZ1A 2X1RA 3MP5A 3GNDA 5KINA 1TQXA 1FUYA 4PC8A 4IOTA 5D03A 3TMLA 4K36A 5HULA 4AF0B 1GOXA 5LNWA 1RR2A 1LORA 4JTJA 4MPQA 2A0NA 3M43A 4MY9A 3W7NA 1SU5A 4QNWA 3W7HA 5K2ZA 2YFNA 1KM2A 3M44A 4FF7A 3PUOA 3R12A 4MIMA 4JTFA 3TW7A 2G5WA 1W37A 3LV6A 1EUAA 1GG0A 3W7OA 3MO7A 1OX6A 2EF9A 2QEZA 1EWDA 1I4NA 2B7OA 2F84A 4Z0JA 3W75A 3B03A 4M5PA 4AMAA 1MZHA 1OK6A 4JDYA 2A6NA 5AYXA 1LOSA 4H4IA 1ZENA 3QC3A 1S5TA 2YYTA 3FS2A 5J5RA 1GTEA 4ORMA 5G4WA 2CZFA 1GYNA 1VGAA 3LHWA 3PG9A 2VOMA 2I9EA 2QCCA 1C9DA 1FWSA 5EMUA 1W5NA 5U7SA 5HNRA 3NYZA 3W88A 1TTIA 1DJNA 4IUOA 1VHCA 2A85A 3HGRA 4PEKA 4WUIA 4PTNA 3PR2A 1RV8A 4M19A 2D73A 2KZHA 2V8ZA 2TYSA 4O8RA 4I9AA 5IBXA 1OHLA 2VEIA 1YTEA 1H7NA 3MW7A 1QFEA 3LB0A 1SW3A 3CWOX 3QZEA 4AVFA 3CHVA 3C56A 4O1CA 3LCWA 1K3UA 3G18A 3P84A 2Z6IA 3M5XA 1Q6OA 3NGJA 4JX4A 3MUXA 4UFKA 1GJPA 3OG3A 3IV3A 4IMEA 3S5OA 1H62A 4CNOA 3G1HA 1DHPA 4LW7A 3W7RA 1WDWA 1Q3NA 1KA9F 4GUHA 2C6QA 1KFLA 4I7VA 4ZQMA 5CZ0A 1GG1A 3DFOA 2V2DA 1OFAA 3S0CA 3K30A 3EKLA 1ZAHA 3GX9A 5K4XA 3MWAA 1SZGA 1O5KA 5C5YA 4DBEA 3NZRA 5GVJA 2BWGA 3ZWTA 5G4EA 1UBSA 4JR5A 3O15A 4WD0A 3CM4A 3LLDA 1PV8A 4R7JA 4I7WA 3PY2A 2H90A 2QCDA 3LHUA 4O15A 1UASA 2NV1A 4JTUA 1OYBA 2R94A 4MFEA 3R8RA 2ZA3A 1G67A 1W3NA 2NUWA 4DXVA 1FDYA 3N19B 5AC7A 3P74A 4MZ1A 5CPMA 1K03A 3IGUA 5DY2A 2DP3A 3GNNA 4Y6GA 1HTIA 4N6FA 1NFBA 4Z0SA 3NL2A 3LHVA 4UC5A 2RHGA 2C16A 4O52A 1YADA 2Y85A 4MLRA 5D38A 1RD5A 2JK2A 1XBYA 2TRSA 3DI1A 4ZVJA 2NV2A 1M7OA 4O10A 2AQWA 1TIMA 2CW6A 2YCEA 3L21A 3RFAA 2R14A 5I3GA 3N2MA 4PH6A 3NPUA 4XUGA 1JVNA 3S1XA 4HSNA 4OGZA 5K9XA 4XBKA 5F1UA 1ZCOA 1GVRA 4UTJA 3STGA 5FF2A 5I3IA 4ADUA 3NPVA 1BWKA 5BOOA 2A21A 1AW1A 1KTCA 3UWWA 4B5NA 1GPWA 2VFFA 5LHEA 3F4WA 1VRDA 3NQDA 1R46A 1C29A 5AHFA 2Q3OA 2B4GA 3GAKA 2JBMA 1QPRA 1F2JA 5F2MA 1XBVA 3BARA 3N9RA 1ME7A 3DZ1A 4FB7A 1LM1A 4LC6A 1TTQA 2G97A 1GTHA 3NQ2A 3T44A 1I45A 4C1KA 4JTTA 1WV2A 4AEOA 2EHHA 2A7RA 3I7QA 4MKNA 2WJZA 1THFD 4AHQA 3MYOA 1U83A 5A5WA 5HWNA 1ME9A 3PS7A 4LVFA 2CZ5A 3DHFA 3E9AA 1D3HA 4PFMA 5HINA 4OE7A 4O4WA 3UZJA 1QMLA 3W07A 4FO4A 3GK0A 3N34A 3A24A 3S5YA 4LNYA 1TCDA 2I1OA 4K38A 1HUVA 3W1AA 4HIBA 3MYPA 2ZRYA 1FCQA 1VC4A 2BTMA 3W1RA 4HNUA 3I7SA 4Y8FA 3EWUA 3L65A 3N73A 2QR6A 3W87A 1SO6A 4A22A 3SGZA 1AG1O 1GT8A 1OJXA 1LRQA 3VE9A 1AL8A 4YCPA 2EAWA 2NXHA 4GE8A 4K39A 3LXCA 1W3IA 1YPFA 2F7FA 1H1ZA 4M6QA 1X6UA 2CFFA 2YFOA 2QCFA 3DXIA 2TSYA 3EB2A 3M41A 3NR0A 4KFPA 3BG9A 4A2SA 4UTHA 4QNEA 3EKZA 3W1XA 3DFTA 3W7QA 1O60A 1OF8A 1TV8A 1NF7A 4OV4A 2RDTA 3PBVA
chains in the Genus database with same CATH superfamily
3NFUA 1PB0A 5LNUA 3AYTA 5HXMA 1FFRA 2G95A 3GDLA 3QMSA 4J1OA 3ITXA 4HTYA 1MRAA 1OFRA 2BOFX 4AF0A 2E3ZA 4TTGA 3VE7A 3HGJA 3G1FA 3HFTA 3WYZA 4R33A 2E28A 3BGGA 1L9WA 3TTEA 5HMDA 4C91A 1DEDA 4BS0A 2ZBTA 5TQLA 3TLLA 3CV2A 3W82A 1DJIA 3USZA 1BEUA 3LM7A 4JN6A 3W1NA 2V5JA 3SBFA 3K8MA 3GXTA 4UBPC 1KBIA 3DHPA 4M6UA 1FXQA 3DDMA 2PC4A 4L7ZA 2YGYA 1V0KA 3AALA 4QXIA 4LRSA 1XCFA 5A69A 1B3ZA 4G9PA 1UQYA 1SPQA 1A4MA 2FMNA 1WZKA 4O57A 3WNNA 4GFIA 4ML4A 3NZPA 4A29A 3KLKA 3V1PA 2GPTA 3W22A 2BS9A 1B5TA 4LAZA 4DJEA 3GTFA 5D37A 4C1NA 1W5QA 2Y5SA 3NL3A 3W81A 1VFUA 1KM3A 3H23A 1VLIA 1WZAA 2BVTA 2Z7KA 3NEVA 3VK5A 2ZUSA 3W25A 5IXEA 3GU2A 1RVGA 1LYXA 4PRWA 1UW9A 3VZYA 1N8FA 3MHUA 4Y9PA 4QEEA 3TTQA 2WSPA 3NSNA 2HVOA 1FWBC 1ISWA 3SN0A 1PL9A 5CGQA 3AZTA 1OFOA 4XWUA 2QIIA 4IL2A 4UR9A 3HBLA 1EJTC 4DEFA 4IFKA 2A4AA 1J10A 3ARVA 3EDDA 1G69A 4FEZA 5A8PA 1B3XA 4NQ1A 3FYPA 1ME8A 1E9LA 3O16A 3LOTA 1RCXB 1XSIA 2PI6A 1SGJA 2YIHA 3PBYA 3EPNA 1CLKA 1ZY9A 2QCMA 1MQRA 4HPXA 3TYBA 3BQ5A 3DX5A 3VC6A 3JR2A 4D8AA 4BI6A 4C6MA 2IS7A 1IT7A 5FL1A 2BFGA 4WLCA 2OQHA 2JKPA 3MB9A 3UNDA 4GQRA 2PE4A 4KPLA 4A8IA 5AHEA 2B0MA 2O0TA 1JUBA 4B91A 1EPXA 1RK6A 3L5AA 1VHNA 4J2PA 3ZXWA 4WDXA 2OG9A 2PWHA 3MZNA 3EX1A 4J9JA 3TA6A 5FACA 4CCEA 2DIKA 4KGLA 4UR7A 1GEQA 4BF9A 4TX8A 2D2JA 2W79A 4CNPA 2J9XA 4YYFA 2W62A 4BQ5A 2CXEA 3GD6A 3OW1A 3SCTA 3ABOA 1A50A 3CASA 4F48A 3U4AA 1GVFA 5FF0A 1QRQA 5T9BG 4E2DA 4ZOBA 3FGCA 4J3SA 3DFSA 4PRRA 1CIUA 1VJZA 3VNIA 2WQDA 3ELFA 3ZS4A 4D8LA 1NP0A 4X2RA 4IICA 2QJJA 3A23A 3CYVA 3U4FA 3D3FA 1U5JA 5FF4A 3O06A 3UT0A 3KEHA 1V3MA 4GMEA 3T07A 1P5BA 4ICMA 5EFDA 3KOYA 4PGLA 3IRSA 3MI6A 1JZ7A 4LB4A 3OOQA 1KLZA 2YR1A 4UFIA 4YPJA 2FZ9A 3C61A 1IGSA 1UROA 4NUWA 1LG1A 1LL6A 3XINA 4BHYA 5CSRA 5CG0A 3SCWA 3QPZA 5F2LA 2V38A 4C7GA 4QQ3A 4RDWA 3UFYA 4OQVA 1SW7A 3CMJA 4GBUA 6XIAA 4A2RA 4MTVA 4YWIA 4REQA 3UQNA 4LFYA 1PKYA 3ARSA 3IGSA 1J0ZA 4MYXA 1AH3A 3O0FA 3E2QA 4O1BA 4DJFA 4HU0A 1RAKA 3SRFA 3EOUA 2HS6A 3FIGA 4B3LA 3MU7A 3VDBA 3WLTA 2DSVA 3D47A 4M6PA 4DXKA 4E4FA 2G50A 2XFRA 3W71A 5K4ZA 4MZ8A 2R1MA 1SSGA 1OWQA 2NUYA 2QDHA 2WYSA 2PDYA 3ITOA 2D2GA 2GJXA 4RZ5A 1EHAA 1SFJA 3W76A 2PCQA 3SM0A 1XRSA 3WD1A 1H7PA 2DFAA 2OEJA 1L6SA 1PXGA 2QAFA 4QLLA 1RPKA 4J27A 2DPEA 3IV8A 5I24A 3CNYA 4GO8A 4QX4A 1F74A 4WJ8A 1J2WA 3ZWSA 4D72A 3PZNA 1OX4B 3VNJA 1FWJC 3VNDA 4MB5A 1DVJA 1TA3A 3IJ8A 3W23A 3OVPA 2HSAA 1JDDA 1UPPA 3KVKA 2F6XA 1EC8A 4IP7A 3KS5A 1KV8A 4ICNA 3HJEA 3DFPA 1NP2A 1M7JA 2XFWA 4LQ1A 1UOKA 4GHRA 3TFXA 1UH3A 3LPFA 3WELA 3KRBA 3UGRA 4HU4A 3BE7A 3KCOA 1AQHA 4DO5A 3GQYA 3DI0A 1PZ1A 4HVXA 4YTSA 3O07A 2QVNA 2ODOA 3SZ8A 2DUXA 3TR9A 3CTTA 4RDZA 4JX5A 2GYIA 2MNRA 4GFSA 1YTDA 3RPTA 4C6FA 4V27A 1ECEA 2IKHA 7REQB 5FEWA 1SW0A 5JUVA 1PTDA 4NJIA 2DZSA 3TN5A 3S4TA 2GFTA 2GGIA 2ZX6A 2XUCA 5C71A 2GVEA 2DJLA 3SCOA 3L4VA 4PB5A 3S6OA 4NXKA 3T4CA 1UWSA 4F40A 2CPUA 2VFHA 1WKYA 1HKJA 4JL1A 2PF0A 2RGLA 4GZ7A 1TO3A 4HB7A 3CZGA 4GKLA 2OCZA 3OYZA 4R9XA 3H55A 3CH0A 4J40A 4Q4RA 4IIDA 2Y4SA 4MZYA 3CV6A 3TQKA 5E70A 5D04C 4KEUA 1TJ2A 2X1TA 3B4YA 1FFQA 3WQEA 3ZJ7A 4ADTA 4O18A 1AJ2A 3TR2A 2HV5A 2WO5A 3IIXA 1XX1A 2O9PA 3KL5A 3I7RA 2X16A 1G4EA 1K6WA 5REQA 1DWFM 4EX4A 3THQA 3GIYA 2FHCA 3MSDA 3O6CA 4EPKA 2DJXA 3VDGA 3II1A 1IZCA 1ZLPA 3RJYA 4DVOA 2VR5A 1JZ4A 3R13A 1XR2A 4L4LA 2AAMA 5AECA 1J0KA 1RP9A 4YN5A 3I3BA 5FKYA 1P4CA 3HG5A 5CPSA 3EAUA 2NV9A 1PAMA 3B8TA 1US3A 4GQGA 3R0DA 3PC0A 1CWYA 1E9YB 2FKPA 3VI2A 2CXGA 2P88A 4JZ5A 2DU2A 3L4YA 1FWEC 4YL2A 3UXAA 3BCJA 2ZUWA 3W84A 4OBTA 3B97A 4NASA 3GR4A 3G1YA 1ML1A 3IIOA 1E6QM 3HPZA 1YRRA 4YTQA 1JCLA 4MADA 4LUTA 5JMUA 1JCYA 2PBOA 1MEHA 1OFQA 1UH4A 2YCLA 5DXXA 3AMCA 2EPLX 4B5XA 1R3WA 1UBPC 3VABA 6TIMA 1EWEA 2VMFA 4Q4SA 1Y5VA 2Y89A 4BF5A 4HZ6A 4KKXA 3N4FA 3BMWA 5I06A 3BMVA 3CZ8A 1LZOA 5HPCA 1MNSA 4DQWA 3IIVA 2ASHA 3ES8A 3NNTA 2MANA 4JTLA 3PPFA 4ERGA 3V0UA 3C0SA 5AKQA 3GXDA 1PUDA 3WF1A 1JEZA 3APGA 3KVLA 3HOJA 4OHQA 2SFPA 3VIKA 2YYUA 1QWKA 3LQLA 1KXTA 2VC9A 4DWSB 3M7WA 1E6NA 2WQPA 3JW7A 4XTIA 5I3FA 1BRLB 3LPGA 1QBBA 5BU6A 3Q58A 4B5UA 2BP1A 1ZB5A 3AISA 4AB4A 1MUCA 4CGTA 3P81A 4MF4A 4UMCA 3FXGA 1T5AA 3FY1A 1UD8A 4AD5A 3T0TA 3S5ZA 3ZFHA 3G1AA 3TA9A 4AH7A 3TE9A 2R1LA 3GNPA 4IPLA 3NSXA 2E9BA 1V5XA 4HOZA 3L2IA 4IJRA 3TJXA 5C54A 3LCLA 5A8MA 2DZPA 8RUCA 2ATSA 3TMQA 4O8AA 3K4AA 1ZALA 2XINA 4H6QA 3GU9A 1XIDA 3QFEA 4W5UA 3ZVIA 2R8WA 4M3PA 4MMWA 4R7OA 1ZAIA 2DT2A 2DDXA 3PM6A 3T55A 2XN2A 4N9CA 4UIOA 3EDFA 1VP5A 3WLSA 2WCSA 3MTWA 2Y7DA 2BGSA 1SO3A 5KTLA 1JDFA 4D6HA 4Z1AA 4IXHA 1S5WA 3W2KA 2PDWA 3ALFA 3L4TA 3AXMA 4GX9A 3WD3A 3OVRA 1VFFA 1KCLA 1GGOA 4JQ4A 4WOQA 1W5MA 6ALDA 3EWWA 1YXYA 4PUNA 4UFHA 3F4CA 3LXAA 4NVTA 2A3BA 6REQA 3WLMA 2X41A 3W2MA 3BSMA 3P82A 4H3DA 1SSDA 4OU1A 2J7HA 1IF2A 1J12A 5D2TA 2XISA 3MY9A 1ELSA 1TV7A 1EXBA 3GG7A 3COTA 8XIMA 5MHBA 3W7DA 1XDJA 5CG7A 2VNCA 2YW3A 3CB3A 3DKJA 1LUCB 1QK2A 5LNSA 2CBVA 4QGCA 1W8SA 2E67A 4R85A 2I9UA 4C90A 3WL1A 3UA3A 3UCCA 4L64A 1Q66A 3V7PA 2DW6A 3LN3A 4BY3A 3WUFA 5AB3A 1S5NA 3N15A 1PHQA 2AAAA 1DJYA 1VPQA 3SIZA 1JDAA 1UPMB 4UWMA 4XD6A 4F2BA 1CEOA 3EWZA 1MXSA 3R58A 3N2BA 1OCNA 2VDGA 1MW0A 1YE4A 5AVHA 3V1HA 1WA3A 1T6MA 2CLKA 3KW3A 1GYLA 1X6LA 2E5DA 5HUPA 1V3KA 3WUGA 1LCOA 1E5NA 1E6XM 3MHFA 4GYPA 3UG8A 5BRQA 3LX9A 4WKHA 4F66A 1VBGA 1SJDA 5JH2A 2QPXA 4WCJA 5AHMA 2ZDSA 3GG8A 3SECA 2ZX8A 4UQEA 3PAJA 2OR2A 2RDXA 2XM1A 2WHKA 1W1PA 1BPLB 3WJYA 1AQFA 3ANYA 1M03A 2B7NA 4J3VA 9XIMA 2YOCA 4RK8A 1HP4A 4DUWA 4TV5A 1YNPA 3OLEA 5HA7A 4ZO9A 2NQ5A 1NARA 2QLYA 1XH0A 5AYYA 4XAFA 1H5VA 5A2BA 4AY7A 4KCUA 3AZRA 3GSMA 3WDQA 3C2RA 3TJLA 4F0LA 4LAMA 4US6A 5D05A 3L2LA 1R3SA 4OOUA 5ABTA 4S39A 5I07A 1XS2A 4ZODA 1SO4A 5LKYA 2A3HA 1JXKA 4NJKA 1H7XA 4IIEA 1ZL1A 5IFTA 1RCOB 1PTAA 2XVKA 1NVMA 1BQGA 4U2ZA 4IJBA 2CYGA 3M6DA 1SFSA 2J4GA 3P5ZA 4GXMA 1FXPA 1ZBWA 2PC8A 3MKVA 3WFAA 4JTEA 1UUMA 3EBVA 3SCUA 1DOSA 1GYMA 4IF2A 5B80A 1TV5A 3WEMA 1AW5A 2WCGA 4QFUA 4K8GA 1AH0A 3V0TA 1O94A 1TWWA 1E43A 2CERA 2XH7A 4NU7A 1HN1A 2WC7A 3NM3A 1RY8A 3VCNA 4GZJA 5FAJA 1EQCA 3EXTA 2ISWA 3NAVA 1NOWA 3DKLA 3NXLA 3GHSA 1M5WA 3O8AA 4ACYA 3N9SA 4LU0A 3VFLA 1GOWA 1FH9A 4QE4A 1B3OA 1W9XA 2VHLA 3QQ0A 4W8LA 5ABEA 3HF3A 3UW6A 1GQKA 3BSHA 1Y8BA 2D2OA 2E9MA 3QGVA 4FNTA 4DAIA 2EQDA 1WBHA 4H6RA 3GS6A 4WJEA 1UA3A 4XTDA 4WSKA 1NWUA 4FX6M 3IIZA 4TX9A 1KO0A 3W2UA 1FWHC 4ZSUA 2NWRA 2PF8A 4FSAA 3IRDA 4RE2A 3W7JA 7PTDA 3CT7A 3NM1A 2A79A 4JNMA 2Q3RA 5D9NA 3ZM8A 5C2XA 3WJZA 4MFDA 4RNFA 4YVXA 3MI3A 3LA4A 1L0PA 2YCJA 1VBUA 5JBEA 1D7FA 1B57A 4IIFA 1FTXA 1KD0A 3OGRA 3STFA 3GB6A 4IQLA 1OT2A 1EH9A 4J3XA 3NQFA 3K13A 3O63A 4MNLA 2CLLA 2YXGA 1JYVA 3TFCA 2WJEA 5E1QA 2A6LA 4N4PA 4WGXA 5I79A 3F4NA 3F5LA 1DIOA 4RX0A 2AGTA 3DBNA 1TV3A 4NX0A 3ZQ9A 1XRFA 5DCEA 3A22A 4I5UA 1FCBA 1QCWA 3E5BA 4DO4A 3VOJA 2YX0A 1EBGA 2PRHA 5EMJA 3BAKA 4ZE4A 3A9IA 3ZSTA 5D2WA 2FB3A 1R5YA 2PDGA 4CQDA 1J93A 1WOBA 1XIMA 5LGXA 2ZADA 3TAOA 4O1AA 4CVUA 1XCWA 3QF0A 3ZYZA 3LU2A 4RPQA 5BRBA 1WBJA 2RUSA 3LTSA 3WCZA 2WNWA 1K7EA 4ZXLA 5HUOA 4X61A 3TQPA 3BANA 1FBAA 4JBRA 3VDAA 4L6HA 4AZCB 3LDVA 5C9XA 3E12A 3BLEA 1O68A 3CUZA 1ZBVA 2NVAA 4IT1A 3LRKA 2X7VA 1BVZA 2E1DA 2V30A 3ARWA 4H9UA 4ZQNA 4OOZA 1JULA 4JIRA 1ZJHA 4FIRA 1PZ2A 4GI8A 1R7AA 4EXQA 2J8FA 3DBPA 3MZ2A 4MJ4A 2YKKA 1IXOA 4MY1A 4YXGA 1Z32X 2O7SA 5U4NA 1KBBA 3EEGA 2YW4A 1XSKA 1J8VA 3PANA 4C6OA 3A47A 3BLIA 1NDVA 4DBDA 5BU9A 1YLVA 1OEPA 2ZUMA 1EJRC 3WK2A 4LY8A 3NO1A 2WKJA 1XIEA 2V82A 2Q09A 2POZA 1D9EA 5CZSA 5MKGA 1TE6A 1K77A 3S6TA 4DNHA 1CGVA 2Y7GA 1XI3A 1D3GA 3CIXA 3RIKA 3K8LA 3PPHA 4YU1A 1KM4A 1M41A 3QSRA 4G56A 4NJJA 3PSWA 5G2HA 3W2NA 4TOQA 4GG9A 1DL3A 3G24A 2ZX5A 1F8IA 1KM1A 4FHAA 1QPNA 1FRBA 3HFYA 1WX0A 3G5EA 3AOFA 1TPC1 1E0VA 5ABFB 3RR4A 1CXIA 3RMJA 3SFKA 2V81A 2HS8A 3SRHA 2E6DA 3LHZA 4QJ4B 3S9YA 1R47A 3BG5A 2ISVA 1TVLA 1K8XA 1H60A 1OG0A 1XUUA 5KSWA 3F4VA 4A4AA 2YZ5A 3GFXA 5H6HA 3TH6A 4PTVA 1V6YA 1EX1A 1I2QA 3P0XA 2ZUNA 4GVGA 3TIMA 3LXBA 1MEIA 3VD4A 3ABQA 4Y96A 1Q7QA 4NT0A 4WXZA 2J77A 4LEFA 3RRAA 3IJLA 5DRCA 2OVLA 3LCIA 1MFUA 1M01A 3THDA 3W7EA 4PA8A 4E2VA 3C8NA 1BTMA 1ODZA 5BROA 1UR9A 1Q6EA 4JQAA 2ZWZA 4U3AA 1AL7A 3LNPA 1JF5A 5AC6A 4FOUA 4FK9A 1XRTA 1P0BA 2EJ1A 4ZO6A 2ZZ1A 3FNDA 1X38A 5JU6A 2YL9A 3N4AA 3QH2A 3IACA 3W7PA 1R2RA 4UB9A 4M51A 3WQFA 1ZP4A 3BOLA 1LLWA 2EKGA 2ISFA 1JI2A 4P2VA 1KBLA 4A8RA 3C0JA 1AZ2A 3IAPA 3UZ5A 4LUYA 5A2AA 5LIWX 4EAMA 7REQA 1EP2A 4E2BA 3DG3A 2OWXA 2IMRA 4QG9A 1NIUA 3WBXA 3ZSSA 4D6EA 5FCZA 4A35A 2GL5A 4PBEA 5L6UA 1CXLA 3EXSA 3TP4A 3M6YA 5DQPA 3CQ0A 4AEFA 3BV4A 3PBGA 4IMDA 2IW0A 2J9YA 5I3DA 4E8DA 2H8ZA 4PUMA 4C65A 2C79A 4JQ3A 1B31A 4FP1A 2BGQA 4YHEA 5CPOA 3CB8A 2D24A 4CLMA 1MW3A 5CJMA 2PLMA 3RDKA 1KFCA 1F3WA 3DGRA 3S2MA 3VD9A 1VFSA 5CKSA 4HSHA 2RJHA 3XIMA 3GYCA 1U33A 2JEQA 2WCAA 1VAHA 1GOMA 2V63A 2WLZA 3NQ7A 1ZPTA 4AISA 5CPLA 1MO0A 3KCLA 1H63A 1US0A 1J96A 3TU9A 3H22A 4JTHA 1TQJA 4JYDA 1W3LA 3BDKA 3MP5A 3QR1A 3GHUA 1TQXA 3L12A 1EC9A 3TMLA 1MMFA 2PD5A 3TYUA 3OLDA 1TKKA 4KETA 1TG7A 4MY9A 1SU5A 2IKIA 2YFNA 1PKNA 2HZGA 1CXFA 3R12A 1A3WA 4JTFA 4A3YA 2G5WA 1XYMA 2PWVA 4DBSA 1QATA 1XYLA 2EF9A 4KCWA 4UOJA 4HZ8A 2B7OA 4Z0JA 3W75A 1MZHA 1OK6A 3QN3A 4JDYA 1R86A 1LOSA 1QT1A 4H4IA 2DZBA 1R3RA 4P7RA 4B5SA 4AYSA 1C7TA 1SM9A 5G4WA 1GYNA 3PG9A 3LHWA 2HJPA 1UP3A 2DQWA 1WKFA 1FWSA 2BY3A 3W38A 3RX2A 1W5NA 3FEQA 1DHKA 5HNRA 1HKIA 4D6JA 2JE8A 3W88A 1EYEA 4S3DA 4X2PA 2BNJA 4PEKA 2RGMA 1FHVA 2C91A 1KCKA 3RU8X 1G1YA 1YTEA 3MW7A 4W8BA 2VL4A 5BYWA 3QZEA 1L2QA 1K3UA 4C6IA 4BCEA 1TJ1A 1MNZA 4PMNA 4JX4A 3MUXA 1GJPA 3OG3A 3IV3A 2WVVA 4IMEA 3NUKA 2IUZA 1O12A 4LW7A 1Q3NA 4DWSA 2C6QA 2G37A 3ITYA 1UZ1A 4Q4MA 3OTRA 4I7VA 1YE6A 5CZ0A 3EZ4A 2V2DA 3E2VA 1CT5A 2QF8A 3S0CA 3GX9A 3KTSA 3MWAA 1AJ0A 3IWPA 2X1IA 4P8WA 5G4HC 2BWGA 5C9ZA 3O15A 4W89A 3LLDA 3SUWA 1PV8A 4DYKA 2XVGA 3PY2A 1VD6A 2PDQA 2H90A 5CPQA 1BTCA 2NV1A 1Q63A 4BJHA 4FS9A 1OYBA 2R94A 2REQB 4MFEA 3R8RA 2ZA3A 3V35A 2Z29A 5CSUA 5CBIA 2X2YA 3U7BA 1CNVA 1B1YA 4DXVA 5CPMA 5DY2A 1J0JA 3GNNA 4Y6GA 4N6FA 2BVYA 2VD9A 2HRWA 3NL2A 2YB1A 2C16A 2Y85A 3R79A 2XFFA 1XQLA 4JNYA 2XIBA 3VGHA 2AQWA 5GJPA 1TIMA 3L21A 3L4ZA 1XIJA 5I3GA 3TTOA 3CIVA 3S1XA 4HSNA 2WANA 1EBHA 1KQYA 5K9XA 3W00A 5F1UA 1GVRA 3L23A 3STGA 3AICA 1QNOA 3NPVA 1AW1A 4QLKA 1Z8AA 5I6SA 5LHEA 1DJWA 1VRDA 2GGGA 3NQDA 1R46A 5D9MA 2PU0A 2Q3OA 2JBMA 1F2JA 5F2MA 4Q8PA 3ICJA 1LM1A 4LC6A 1AQMA 3ZVHA 3T44A 4S3EA 2XIOA 2HWGA 4D6IA 2A7RA 4H9ZA 1THFD 1VFMA 4XZIA 2OKOA 2FVMA 4DBUA 4NZCA 1W32A 4PMZA 3PS7A 1DTNA 3WY1A 3DHFA 1BSLA 1A5LC 1E73M 4O4WA 1N8IA 1F61A 3CAQA 3TYAA 4C6CA 1HUVA 4M1RA 3VOCA 1VF8A 4HIBA 3ARQA 1VC4A 3GC5A 4KWUA 3EWUA 3N73A 3H2MA 1XYAA 3PTMA 3S2JA 3UYIA 3LBOA 1YPFA 3CUIA 3QOKA 4B9ZA 3QHOA 1IT8A 1X6UA 4HK6A 4WGHA 2DVUA 3M41A 5CQ1A 3BG9A 4UTHA 1M7XA 3IJ7A 1DJGA 2XYLA 4I8YA 5HOSA 1NF7A 1V0MA 4HD5A 2V68A 4Y9OA 1O5XA 4O13A 1YXCA 1OSEA 3S3GA 1XKJA 3M9YA 1W54A 2VP8A 2TMDA 3ECQA 4ZA0A 3QLLA 5XIAA 2JALA 2V5CA 1EJUC 1RA0A 1L6FA 1C3FA 4MLJA 3VIMA 3IVSA 4WSJA 4LAOA 4LCRA 4R7WA 3EOOA 5J8LA 3OZMA 1ZCCA 2X05A 1FKXA 3BPWA 1EA0A 3NQCA 4JXCA 1Q45A 4H7ZA 4QE1A 3RM8A 3QPYA 1XIBA 1GORA 1VQTA 1C8QA 3NZQA 3MANA 1RZMA 3ZLFA 1MI3A 2Q6ZA 5G5IA 2CITA 1MYRA 2BVWA 3DESA 3P8JA 5E9XA 3T0CA 4F9DA 2GDQA 3KAOA 3G0SA 5BXSA 1E56A 1GNXA 5T26A 4TVDA 5JVLA 1D8WA 2PMQA 1N7KA 3KOWA 3KL0A 1E4LA 1H5YA 1QPOA 1V7YA 2W27A 3C86A 2VZTA 4DRSA 5KZEA 1AODA 1WCGA 4A8NA 4P8UA 5T9CE 5HATA 3BOFA 3CQKA 1XFCA 3DUGA 3R0KA 4DZ5A 2TAAA 3YPIA 1A5NC 4YTRA 1O95A 2WWDA 1EJWC 1W31A 1BXNA 2BBFA 3R43A 1OY0A 1GZJA 1JCTA 1U2YA 2NX9A 1XL9A 3VNKA 1VEMA 4LEQA 3UVIA 2OLHA 3V0SA 2WHLA 4JS3A 4MB3A 4C60A 4I9JA 1N2VA 3CL7A 4ENLA 2XZ9A 2WSQA 1RALA 4GO9A 4H9YA 3GTXA 1IXPA 2J74A 3H70A 3BW2A 4BWLC 3VMOA 1KBJA 3AIWA 3LY0A 2ZA1A 4AHOA 4A21A 1UWAA 4TO8A 1FWFC 3CL8A 4RLIA 1GOQA 2Z2AA 3KWSA 2PSNA 4EAYA 2F38A 2BXYA 2J6XA 4RE0A 4FXJA 4FR1A 2OLSA 4L65A 3C0LA 1R0MA 1W1A1 1J5TA 2PDCA 5IDIA 2AL2B 5LA2A 4Q7BA 2GQ9A 4HGXA 4QAWA 4JFWA 4YMZA 3QR3A 2C0AA 2Y8VA 1TPVA 2PDKA 3F03K 1BAGA 3W4RA 1PWMA 2FLIA 3GHRA 1GEHA 3TOYA 3GR8A 2C1HA 5D2YA 2YL8A 3OU8A 4LAKA 1YNQA 4PCTA 3ENLA 4RV8A 4S3KA 1P6CA 3N6HA 1XLEA 5LHFA 3UZXA 1YPIA 2FGZA 3J7HA 2Q8LA 4W85A 5CZKA 2D0GA 5M3WA 1W9UA 2OELA 4BFAA 4ERIA 3VXGA 4U5KA 3H7VA 3NL5A 4W5ZA 3LM3A 1TYGA 2V67A 3N17A 3RJXA 3KZPA 2ZXDA 2VM8A 3HGSA 4NY2A 1EOKA 4AWTA 1YW1A 3N3MA 2ADAA 2X8RA 2Y70A 3WIJA 2F9RA 3MO4A 2F2KA 3WLIA 2ISSA 3V36A 3WBYA 5HR6A 2YBVA 4B5TA 3TUUA 1B3VA 1FVPA 1ONEA 3TCSA 1HFBA 2V69A 1GVOA 2QCEA 4PCPA 1C8XA 4LBRA 4V1XA 3W3OA 4RL3A 5C55A 3ABSA 4M82A 2RFGA 2I16A 3RO6A 1YYAA 1TR1A 1TR9A 4HYVA 3W6LA 1L6YA 2DH2A 3CV7A 3W1UA 3B8UA 3PWGA 4X9SA 3SY5A 4A3UA 3MJMA 4QITA 3WD0A 3S9IA 1L6WA 1OD0A 3F2BA 4UTTC 4PMYA 1SVDA 2E77A 2J66A 3A4AA 3O05A 4C5YA 1KWKA 5HWJA 4LF2A 3U57A 2FVLA 3H8AA 2D2HA 3BW4A 1S38A 2DIJA 1WYIA 1ENUA 3RPDA 5CBJA 4WF7A 3GE7A 5DN1A 1OZQA 2VGBA 1U5VA 2Y63A 4GRSA 5DANA 1CLXA 3QHNA 1FWAC 1QI2A 2WNQA 6XIMA 3GH4A 1VYSX 2ZUTA 2PTDA 2XTKA 4PODA 1YNYA 1CGWA 2DUZA 4M6VA 1V03A 1A5UA 2E7FA 3LRLA 2W67A 3PJWA 3UCQA 3VKKA 2PGFA 4Q8NA 1DKWA 2WZHA 2Y5EA 5FF7A 4XKMA 2FJKA 5ENLA 1HXJA 3PJTA 1IEVA 2E8YA 1WO2A 3UWYA 3LHYA 3GUWA 3WBEA 1F6PA 1ZS2A 2OEMA 3OA3A 3TC7A 4NSBA 1FWTA 4K6AA 3GY1A 4IMFA 1FH7A 1XIGA 3QY7A 5GJMA 3EWCA 1MVYA 3TONA 2VTFA 4JY9A 2O4QA 2ICSA 1Q7MA 1TWZA 1GKRA 3WO8A 2XVNA 1R38A 5ABFA 1KV5A 2VQTA 3UY8A 2GUYA 4JIEA 1JL8A 5FF3A 1HL2A 1G4PA 2DGAA 3MV11 3NO5A 2OB3A 4S3JA 3RLUA 5DCDA 4H83A 3I6TA 3WDIA 1JUEA 1ITCA 2P0IA 4ZE5A 2P3EA 3L0NA 2JF7A 3IUDA 1X97A 4MJMA 3PZOA 1OK4A 4HNTA 1CXEA 4PUEA 2O9RA 3SGUA 3BAXA 4ACZB 1G01A 1FWCC 2QULA 2VZUA 6CGTA 3HPFA 1U30A 2O55A 3PZGA 4JIHA 4WDWA 4BQ4A 2BY2A 2WSRA 4U2YA 2GUBA 1BVNP 2B7PA 1BYCA 1MUWA 1BYBA 1K9EA 4RZBA 4AD1A 2IXUA 4IG2A 2GQ3A 1UWRA 3CH9A 4KWOA 1KM0A 3ZJ8A 5KMYA 3ZR6A 2FTYA 3R10A 3S1UA 4DJDD 5D33A 3ABRA 1KC7A 4JFVA 3CMFA 1UB3A 3IAQA 4XKYB 1B90A 2ZZ2A 1DWAM 4FALA 4IWWA 1QOXA 3T40A 4D6FA 3OJGA 2PZ0A 2QT3A 1VBHA 4HN8A 1DQXA 4C7DA 4IGHA 1B4KA 4O14A 3WUEA 4UTIA 1H3GA 3CHEA 3ATZA 4K8HA 4GOAA 1TZ9A 2VQUA 4B92A 3FK4A 3P6LA 5C7VA 1EB3A 3S46A 4LBSA 3TN6A 4YCOA 1BYDA 1OFEA 4JHOA 1B54A 2PU1A 4DELA 1SJAA 6ENLA 3AYVA 2VX7A 1Z9AA 5H8MA 4XAZA 5JBFA 4ATWA 3G0UA 5A3HA 5FJOA 3U6WA 2YBTA 3GG0A 3BLKA 4JTRA 2OSWA 4BR1A 3OBEA 1TJRA 4OBSA 4XZWA 1UKPA 2PDIA 3EMQA 4LSBA 2Y88A 3DFQA 2FTPA 4U28A 5EMMA 1RY0A 3THAA 4PZVA 4V28A 2VEMA 1SZEA 3P80A 3R25A 1MQQA 1P43A 2B81A 1ONWA 3A4JA 3HV8A 1O1ZA 2X0HA 4UR8A 4S1FA 4Q8MA 1EGVA 3FXYA 2HVMA 3TYCA 2EPKX 2XFYA 2QIWA 4BA0A 4F4RA 4Q4PA 4A05A 3I3EA 1H7RA 1VJIA 2NLIA 3E2RA 3KBSA 4JAWA 3FCPA 5FEPA 1H2JA 1NU5A 1A5OC 1GJUA 2W63A 4JTSA 5CC6A 1CI1A 2QJNA 1S39A 2GK1B 1Y0EA 3DFNA 3QKEA 3TC6A 3WL0A 1GUVA 5FEZA 1WNOA 4WOZA 1IR2A 4MWAC 3T78A 1VCGA 2CLEA 4J3UA 2VD8A 1OG6A 1XISA 1I1XA 3HURA 1VKFA 1HX0A 3MKCA 1XYBA 3G8RA 4G2DA 4HTBA 5DY3A 4LRTA 5FL0A 1ZBCA 3P7YA 8XIAA 3AROA 4S2BA 5HMEA 1DWIM 4NRRA 1RA5A 3LLFA 4UFMA 4ONVA 1SMDA 1JZ3A 3OBAA 1A5AA 2OJPA 1XBXA 1X8CA 2DT0A 3F2DA 1E6PA 3G77A 3WH9A 3ZLGA 1RD6A 2ZQ0A 3QTPA 3QHMA 3MUZ1 1VS1A 4OUEA 3OGSA 1JYNA 4IJCA 3N3TA 4FXSA 3OQEA 3USBA 4ZTYA 4DF1A 3ARTA 1BKSA 2DSKA 1K02A 3FA5A 4OKDA 3UD6A 4YTTA 3SY1A 2Z2BA 1EHNA 4TVCA 4AIOA 1J01A 3EOLA 3S2CA 5BOFA 4FNPA 2DV0A 1U1UA 4AC1X 5BMWA 2CZEA 3MVIA 3CXOA 3UG5A 3RLVA 4QJ5B 1RUSA 4YWSA 1LWHA 4CQCA 4U33A 3L67A 1AMKA 2XIMA 3EEZA 4LV4A 3RPMA 3DYPA 4HK7A 1TB3A 2RAGA 3B0PA 3GZ3A 3UEQA 4V15A 3MUCA 3BH4A 4UTMA 1YQ2A 3W74A 3TVAA 3V18A 1XLHA 1TWDA 2GJRA 1QU4A 3WNPA 1T8XA 3SN1A 3BK0A 3W9ZA 1MDRA 2AGKA 4IP4A 1E6ZA 4TU1A 1EP3A 1O4UA 5D9OA 9XIAA 3KOZA 3AUJA 1SQ7A 4OIFA 1XSJA 2I7GA 2XSXA 3FX4A 4EF8A 2WNNA 2R91A 2HROA 1W9BM 4H2HA 4NAFA 1PVNA 3E0FA 3L4XA 1NWSA 1UKQA 1E6SM 2CLIA 2XGIA 1Z42A 2VC6A 3JS3A 5B7ZA 4LUIA 3WDHA 4X22A 1CB7B 5LGZA 3KOXA 1UD5A 3I3DA 2FYMA 1YEYA 5JQ9A 1W3HA 5HAOA 5FSDC 2DW7A 3MA8A 5TBOA 3CZLA 1UUQA 3CO4A 4TR9A 4CQ8A 5FESA 1OYCA 4WKFA 3W7IA 1VYPX 4DI9A 2R9RA 2VVNA 4PN2A 1Q6GA 4S38A 1Z89A 1XLDA 3M0YA 1ONRA 3AJ7A 4AD2A 3MUY1 5AZ0A 3QY6A 2G3MA 4Q3MA 3URNA 1OT1A 5HNTA 1I2NA 1P7TB 1R9XA 3NQ8A 2VENA 3ZT6A 1LOQA 3POCA 4NZ4A 2P0OA 4X3ZA 4TMCA 3KS6A 5D2XA 1B0IA 3TXVA 1E5JA 1RHCA 3PWAA 4BI7A 2ZZ6A 3T4WA 1YKWA 3WK0A 1YDNA 1NJJA 1W56A 1JGMA 1NAL1 2HNEA 3CHCA 3VA8A 3N2CA 2XWEA 1JFHA 5AY7A 4XAPA 3GFYA 2DIEA 3TCEA 2WLYA 2VELA 4XZBA 3WQGA 5IBXC 1C8VA 3C2EA 2HPIA 1XLIA 4MPKA 1R87A 4I7UA 2INEA 3BV7A 3L0KA 1NTHA 4KWSA 1SJCA 4GCXA 1Z69A 3CEUA 4PUJA 3QV7A 1V79A 4W84A 2FPVA 2AL1A 3FYYA 2PODA 3GXFA 5E6YA 1UH2A 5HPOA 4FLOA 4M8UA 1XYZA 4QS5A 4NKCA 2VOTA 1IR1A 3W72A 1XG3A 1PIIA 1WDDA 2QDEA 3IIPA 1JF6A 3AHZA 3WMBA 2NQHA 1ZQ5A 4MWAE 1W3TA 1HKVA 2RH9A 2WZTA 4EF9A 3KRZA 3OBKA 4K3ZA 3OP2A 4GZEA 1RJPA 1XH1A 3LCFA 2JKAA 3TXZA 3MDUA 3GBEA 1HL8A 1ZHAA 2WMHA 4IL0A 2I14A 3TK7A 2PWGA 2DVTA 3E0VA 4ZO7A 3CIWA 3OA5A 4GYKA 4AWUA 4TX6A 4WXYA 3R8HA 5BCAA 5G2WA 2OLAA 3HN3A 3R1ZA 3NQMA 3DFYA 1M53A 5F1VA 3N4EA 4GPNA 3T0AA 2BDQA 2QMJA 4K68A 3VKCA 4XZLX 2CLPA 4TUFA 1DWJM 4MWAB 3KFTA 3VOGA 1PIGA 1YBQB 2PUZA 4U10A 1KM5A 4ILSA 2ZTKA 4ERAA 4PTDA 4C5ZA 2H3BA 3GKFA 5AHLA 5LNRA 1T7LA 1REQB 4Q8OA 4JQ1A 3CQJA 5KZMA 3UY7A 1AZ1A 1X7FA 3GVVA 3PZUA 1T96A 3VIJA 1NWTA 1X8FA 1GVIA 3VGGA 3NXFA 3TZNA 2NSOA 4L6OA 4IMGA 4WDTA 1ONXA 4GQBA 1IT0A 3UBPC 4A3RA 3MV01 2PURA 4P7OA 4HPJA 1VCVA 3RM9A 1Q6CA 2PDMA 3NPWA 2QGYA 3NVTA 3M0ZA 1EX5A 3S2NA 1AJZA 2ZWYA 4LUSA 3F7JA 2ABBA 4OJYA 4RE4A 2ZE3A 4WY0B 3W7LA 4BQ3A 1LT8A 3GDTA 1IEIA 3MBDA 3WQOA 1XDMA 1IXNA 4AAJA 5LIKX 1F6YA 1QO2A 4NZ5A 5K9CA 3JZUA 3W85A 1XBZA 3B06A 3E0WA 4Y8EA 1E40A 5M17A 4AZBA 3H4WA 5FJIA 4HN4A 3H26A 2C13A 4L4PA 2X40A 4PTMA 2IQDA 3NTYA 4AIUA 5L9FA 2VGFA 1CYGA 3K2GA 5CJNA 5C2GA 3AMGA 1C9WA 3C3NA 2VZOA 3RCNA 5TAOA 3A5FA 3FKRA 2ATMA 3KVJA 2GVLA 3WG6A 2Y0FA 3PBMA 1UP0A 2XPKA 3AQUA 1V7AA 1I9CB 2XM2A 3D3AA 5I00A 3LG3A 1B3WA 3PAOA 1LBLA 2IPWA 2QUVA 3NYDA 5CJ5A 1H0IA 4ZMGA 3N18A 4GBDA 4WQ6A 1EIXA 2YA1A 4LH8A 1F76A 1WXJA 1AUSL 4GY0A 2FVKA 1HO4A 4LYRA 2DZXA 3FDGA 1RPXA 1X7IA 3GVGA 2UZ9A 4W88A 1NFPA 3T6CA 2C0HA 2FH6A 1ICPA 3B8VA 3N9KA 1JZ2A 3EX3A 1CZ1A 1G0CA 2B7QA 3K4WA 3UWQA 3GXMA 1KKOA 1QASA 3RU6A 1YDOA 3K8KA 3KL3A 4W86A 1R9ZA 2A3AA 2YCKX 4JD4A 3QFWA 2Q8ZA 3PB0A 4GI6A 3AHYA 1XLFA 4R53A 4KFNA 2YPIA 2F61A 3NQGA 3VVGA 1PS9A 4KRUA 1ZJIA 2OZ8A 4FF5A 4XK2A 4DJEC 2J7DA 5CGMA 1Q2SA 3DOPA 2IKGA 2PWDA 1BHGA 3PFMA 1PEZA 3EX4A 1WPCA 4QSFA 4IM4A 3H2CA 4LTSA 1WAWA 3AS2A 3R4IA 2Z27A 4Y7EA 4PMUA 4AMCA 1TWIA 1PJ9A 3KVMA 3F1QA 3WD2A 1EDGA 2GSJA 3VU2A 4PUUA 3VMPA 2GUUA 3BVJA 3P67A 3T0BA 3L0GA 3GNRA 5DMNA 1E4NA 7CGTA 3TC3A 3IJ6A 3RILA 3TZFA 5FI8A 2YL6A 3LCGA 3ZR4A 3S47A 2FTWA 1B30A 3MBFA 2P76A 4U3CA 1VENA 2OGYA 4YYCA 3VX1A 4NZ1A 3EX6A 3CQIA 4XBJA 1TVNA 4XZ9A 3PB2A 4H2CA 3LGGA 2L5HA 4Q33A 5AN7A 4MGGA 1E51A 3CC1A 2Y5JA 1DIDA 3GLCA 3MPGA 2J88A 1DBTA 1EUNA 4XIMA 3ES7A 4E2OA 1YDYA 5A1AA 4CQ9A 2BY0A 5EY5A 2HMCA 5DELA 4L80A 2PZNA 1OYAA 4HBKA 5CH9A 1GQNA 2GJPA 2V5DA 3U2CA 4JEJA 1MW2A 2HNHA 1P0EA 3IUIA 3FHAA 1TPWA 4CCDA 2Y8UA 4V33A 3WQWA 3WQ5A 3G3MA 1UR8A 1R30A 2VZVA 5J04A 4UTWA 3EWBX 2UY5A 4PTXA 3TW6A 3MWCA 2CLMA 1GZGA 2D69A 2J7EA 2WZIA 1LF1A 1HJXA 5AVNA 3TDFA 2VC5A 3WLKX 2CEQA 4ZQOA 1W9VA 3W1LA 1US2A 2W4XA 1EKOA 3PBUA 1PE1A 1QNSA 3DENA 2OWCA 2BZNA 5F4XA 4IQEA 3G22A 1F3XA 4A3HA 2ABAA 2V5BA 4K2SA 2QMKA 2J24A 2BLEA 4G7EA 3KM8A 3FJNA 2A5HA 1JYXA 1POKA 4ACZA 2C8NA 4UTKA 4Y2WA 5J5DA 2Y2WA 3EPOA 4P7QA 4O17A 1K4GA 1DE5A 4PUKA 4I9TA 3M1ZA 2BXZA 3RHGA 2OEKA 3RNDA 5FIPA 4CQBA 3FFSA 4Z2JA 4CCCA 1SYTA 3KHDA 2CBJA 3M4HA 1DPMA 4JQ2A 3AS1A 2PLKA 3R5EA 1C91A 2OU4A 1CPUA 2YBUA 3REQA 4KFOA 5FJTA 2BMBA 2PDHA 1E1EA 4I9MA 1GQIA 1TPUA 4LY4A 4US5A 1Q6DA 4PMXA 4XKYA 2ZZ5A 4DPPA 1W1VA 4E0CA 1TRDA 3MHGA 4ZCWA 2WMIA 4Q8VA 2H9AB 4DJFC 4Z2IA 1V77A 1A5SA 1M65A 1AA1B 5A6KA 2G8ZA 1Z44A 1Q7ZA 3HG3A 2X1RA 1HKMA 1KRAC 3WMSA 5A6AA 1FUYA 1H1NA 2J25A 4JKKA 3MVTA 3OO2A 1UZDA 1GOXA 4AF0B 3DGBA 5LNWA 4JTJA 5LYRA 1BSIA 3SCSA 1Z7AA 3W7HA 3DYMA 2VUYA 2W5FA 4FF7A 4KEMA 1S2CA 2OKTA 1W37A 4I6KA 1GG0A 1FP9A 3MO7A 4D6GA 1S2VA 1G94A 1I4NA 2F84A 4M24A 1CB2A 1F4AA 4AMAA 4F0MA 5I7GA 4MHBA 4XZHA 3QC3A 3URAA 3WNLA 3FS2A 3BMXA 5J5RA 1GTEA 1QUMA 3MKKA 1M9HA 4QBXA 1K9FA 3MCMA 1TX2A 2CKRA 3NYZA 2VGIA 5FJRA 3U3HA 4C1NB 3T09A 1VHCA 1RV8A 4GINA 4IH3A 2V8ZA 4RPPA 2TYSA 2PDXA 2WMGA 3GIPA 1WZMA 3BTNA 1LL7A 3CQHA 3BLDA 3CWOX 3RN6A 3WLQA 3C56A 1FP8A 1F8MA 3P84A 1E55A 3M5XA 3UJSA 1Q6OA 2F8QA 3NGJA 1C93A 5A6BD 2W61A 5CAKA 2GK1A 3EB4A 3S5OA 1H62A 4CNOA 3AU2A 3W7RA 4P7NA 1WDWA 1KA9F 2OOGA 1XCXA 4Y9NA 3QQWA 1JDEA 1R9YA 4O0QA 5CEWA 3LNMA 2E8ZA 4G6CA 2GGEA 1EZWA 3GTIA 1EDQA 4H8UA 2GGJA 3VCCA 1SZGA 2Z00A 5C5YA 3KBWA 1IWAA 3ZWTA 1VJSA 5G4EA 1UBSA 2P3ZA 3ABZA 4JR5A 1W17A 5T91A 2GDVA 4I7WA 4GI4A 4X0NA 2QCDA 4O15A 2PWEA 3KE0A 1G67A 3B3DA 3KBMA 4MZ1A 1K03A 1TE1A 3PPGA 4HMDA 4Z0SA 4Z42C 3LHVA 4UC5A 1VRXA 2WHJA 1E0XA 4HJFA 3H21A 3VKBA 3HQNA 4ZVJA 3SUUA 2DEPA 1GQLA 2CW6A 2ZX9A 2ZIDA 1XG4A 1H4PA 3MSGA 1JZ8A 4CCZA 3TTSA 4PH6A 5CLWA 3NPUA 4XUGA 4J28A 1JAKA 4OGZA 3AC0A 4KEVA 5MF5A 1QBAA 5I3IA 5HANA 4I5RA 4ADUA 1XLCA 4LJ3A 2A21A 4KMQA 4B5NA 3DCPA 1DXEA 2VFFA 4JKMA 3FGCB 2PDPA 3AZSA 1UQZA 1EJXC 5AHFA 3AFBA 3CPUA 3EA3A 3OODA 1LT7A 4UZUA 3N9RA 1ME7A 2VCAA 2G97A 4IGNA 3DC8A 4HNOA 5ABHA 1K70A 4W87A 2OOFA 3GVWA 4AHQA 3MYOA 1U83A 5A5WA 4UOZA 1ME9A 3E1F1 1PPIA 2VC7A 2PTYA 4PFMA 2C1IA 3O9NA 3UWEA 1QMLA 3W07A 2JF6A 3GK0A 1L8PA 3A24A 2V6AA 3F5JA 3MQTA 4LNYA 1TCDA 2I1OA 2QJMA 4D6CA 4DHGA 4KERA 2YLLA 2ACRA 3VUPA 3E6EA 2J8TA 3ZO9A 1FCQA 1V4YA 2OZ3A 3PK7A 3W1RA 4HNUA 4Y8FA 2QR6A 3L65A 2PDNA 4REQB 1GT8A 1OJXA 3SGZA 1LRQA 1AL8A 3DIPA 2P53A 4K39A 3E5PA 3LXCA 3PWIA 4JNZA 2IPJA 3S9ZA 3E0LA 3WQ4A 1F3EA 2ZC1A 2PP0A 2YFOA 3BL3A 3EB2A 1EJ7L 4UCFA 3W7QA 1S5MA 1JIBA 1TV8A 3W6MA 3CV1A 2NQJA 3PBVA 2BHYA 3T1GA 1TV2A 1F5ZA 4LF1A 5BXRA 1DJHA 1DQWA 2CLFA 2OX1A 5CSYA 3ARUA 2WJFA 3Q45A 3B8WA 1IIGA 2XN1A 2WZMA 1HT6A 4NJGA 4XISA 2V3DA 5LZLA 1PX3A 4MDPA 5D8ZA 2ZZ3A 1Q13A 3STPA 5IDZA 4L4MA 5LIXX 3T2PA 5FA5A 3W1QA 2EXOA 1TA3B 1ISVA 4X9YA 1JQVA 4TQTA 3CWNA 2QYGA 4GY7A 5IRPA 2XVLA 3PZQA 2VWTA 1ZTVA 3DU0A 3QJAA 4WK9A 4QJ3B 4C6NA 4HA3A 4N7QA 1EGMA 3AIVA 3RM4A 5DF0A 4HHHA 4HT3A 3GO2A 2NXGA 3BJSA 3W86A 3V5CA 1BGGA 3LZ5A 5K3VA 3AS0A 5I3HA 4JL2A 3TLQA 1SFLA 1QNRA 3ATYA 3SEPA 2ZRWA 2Q8XA 3R2GA 5I03A 4NP7A 5KZ6A 1LWJA 2G3IA 4L61A 4JFSA 4B3ZA 4AVOA 2Z0IA 1HQTA 3UP8A 1X6NA 1X1ZA 4DAFA 3BSGA 5A8QA 2NT0A 4BEUA 5F4SA 3HZ3A 3LLXA 1E4MM 1OGGA 1SUXA 3NO3A 4CD7A 3VKJA 5C6MA 4RW5A 4FLQA 2FFIA 3MCNA 3HGOA 4GISA 1W1ZA 1LTDA 3WJSA 3M0KA 4ES4A 1JCXA 2QDGA 4N9BA 1AMYA 2E0PA 3ARXA 2D20A 1W6TA 4DYJA 2YDSA 1FWGC 2Q71A 1MXGA 3BAYA 2G3NA 1PDYA 1RBOB 2VFGA 3VZXA 1REQA 3CWHA 3VYLA 2DZWA 4DLFA 2FGBA 1KM6A 2H6RA 3U0HA 4JTKA 4AXKA 2I5GA 1O5RA 4F2TA 2BOEX 2FGLA 3FW6A 4AU0A 5A8OA 1Q6LA 3FDKA 3H2EA 1BF2A 4KEZA 3BJFA 2WPGA 4ZZ9A 1IHIA 4HMNA 1VLWA 1HKWA 1PCWA 2AMGA 3NCOA 1UCWA 3WDRA 4GZIA 1IWBA 5AHIA 4ICCX 1PO9A 1W2PA 2OQYA 3BUVA 5JH1A 2PRMA 3A6OA 3ITGA 1NY1A 4ZB5A 4GYPC 5AC4A 1XINA 4CN4A 2ZRXA 1W1TA 5E0KA 2DSZA 1UR2A 3SQSA 3PZIA 4WY0A 2DT3A 5K7JA 4MKSA 5REQB 3N14A 2R1NA 3Q67A 1OF6A 2ZX7A 4TXEA 4UZSA 4O16A 3TX9A 3IK4A 1LRNA 1JXJA 2C19A 1CXKA 2CBIA 4XIAA 5A8GA 2D23A 2ALRA 2ZFAA 2VT0A 3C5QA 3VFCA 1XRVA 5IM51 1Z48A 2BXVA 4Q8TA 2LLEA 1YIXA 2FZDA 1DV7A 3VNYA 3GDKA 3NVDA 5IFPA 2OTDA 2PA6A 4Q4OA 4P8XA 4Z1DA 4H7VA 2NT1A 3WZ0E 3M64A 1FDZA 3RYSA 3H2OA 3LI1A 3G1RA 4Z2HA 4O4VA 5BRPA 4LUTB 3V5FA 2YCLB 2ACUA 1JZ6A 4K37A 4E38A 3ZT5A 4MYAA 1BLIA 2IQTA 4JFTA 1KRBC 1HJWA 3ID7A 4JFUA 4N4QA 1EEXA 4GVFA 4O54A 3SRDA 2QGHA 1JPHA 3FEMA 2BV9A 5KETA 4RV3A 2DZVA 3LYEA 4RDYA 3WD4A 1EJSC 4KF1A 3SFWA 4DJDA 3IJIA 4QLJA 2HBVA 4HYRA 4QDMA 5DO8A 1XYCA 4UTFA 1LJYA 4ML9A 4ALDA 2OFJA 3W53A 3GXNA 5PTDA 3FJ6A 3G1XA 4DO6A 4NYUA 4GIRA 4EKJA 3QMRA 4QQUA 3S5NA 3KHJA 5JIWA 3M5VA 1E1CA 3UJ2A 3TTYA 4JDBA 1A47A 5AC8A 1UWIA 4NL1A 5AC5A 1W9DM 4HHLA 2WZEA 4K1GA 1E3XA 2RKXA 3Q94A 3N6JA 1JCJA 3R0UA 1LP6A 4QDWA 1I2PA 1SZRA 5I77A 3WLPA 4PCFA 4IPNB 3EX2A 3WLRA 2WV8A 1JFXA 2YDQA 4NAEB 2CU0A 2PPGA 1UKTA 3SN4A 4H8NA 4PBFA 3SR7A 1V6TA 3VIFA 4FNSA 1E72M 4Z2LA 4JIQA 3PTDA 4GY1A 1P0KA 4O0ZA 2HE5A 3CUXA 3W02A 5LSMA 1TIWA 3TYZA 3BICA 5C8BB 4JIIX 4LVDA 3UWVA 1OFDA 3ZJ6A 3T81A 1OABA 1J6PA 1LL4A 4HZ7A 1VCFA 1ECQA 5E09A 4UQ9A 4E3TA 1OCQA 2V3FA 1E9IA 1P0NA 3C2YA 4W7UA 1H51A 4NILA 6REQB 2J13A 3DECA 2YA0A 1SFTA 4IPJA 3M0LA 3B40A 4JICA 4LPCA 2VEGA 1Q6FA 4IX2A 1ITQA 2C15A 3HA1A 3A13A 3GG1A 2WSKA 3GHTA 1WP6A 5I09A 2CLHA 4S3FA 1DXFA 3M0JA 3W7MA 3M0HA 2XIJA 1A80A 5D4YA 4QTGA 3CS2A 1W3JA 1WDPA 2E25A 1K4HA 4W7WA 4GGBA 3C2VA 3BC9A 1SR0A 1FHLA 1H61A 1EO7A 3HB9A 4XZNX 3BZGA 2YXXA 3A5VA 2HXTA 1FWRA 2EG7A 3W1PA 4H8VA 3QVQA 2VKZG 3S5SA 5A6LA 3QKZA 4CUCA 3L5MA 4K8EA 3WF2A 3QOMA 4IFRA 5ECVA 4H9XA 3LENA 5EMYA 2QAPA 1H09A 2GVYA 4H01A 4AY1A 4P61A 2HVNA 4DPQA 1BG9A 4JPGA 3FKKA 3P5YA 5FJJA 4AZHA 4BEQA 3KOFA 5BOEA 4UMBA 3MC5A 1X1NA 4ZTXA 3OIHA 1ISZA 2CKSA 1I2RA 4HKPA 4GNJA 3HU7A 1W1IE 1XD1A 3KWXA 2ZTJA 1E1FA 4Q22A 1RQEA 4ZSTA 4GIAA 3CBWA 2PLCA 4M81A 4WIWA 3W7CA 3G3DA 1BGAA 3A4WA 2ISDA 2WNZA 4B9YA 4Q8WA 4GC4A 1X98A 3UYCA 3WK3A 4QAIA 2ZICA 5BWAA 3IJDA 1LLZA 3MUIA 4C7FA 3CUHA 4ADSA 1SZNA 4L5ZA 4ZXOA 1G9HA 3AHXA 1UHVA 1V3HA 1EOMA 3EA1A 4N2YA 2IQ0A 4NZFA 3Q4DA 2Z2UA 3RUBL 3N1AA 3BXWA 2R1PA 3JZEA 5A8NA 1DE6A 1TTPA 2VX4A 4IMAA 4O1EA 2HXUA 3CGTA 1JRBA 5BZAA 1J79A 2XJ7A 1FQ0A 3VCRA 3QSTA 3AO0A 4HA1A 4O0KA 1H0GA 4MKVA 2FZBA 3UXIA 4GJ1A 1GZ1A 2RDWA 3H2AA 1XICA 1IEWA 5E0FA 4WJXA 3SIMA 5AYZA 3VOFA 4LANA 3MCOA 3B0UX 4RZ6A 3CTLA 5AHNA 1E4IA 4WHBA 4CD6A 1Q4NX 1LBFA 4XO6A 1VEOA 5GQBA 1MQPA 1Y7VA 1VFLA 5G1TA 5DX7A 4PMDA 4FNQA 3LBMA 1PIFA 2JGQA 4CN1A 3UA4A 1QHPA 2NXIA 2GWGA 1XHGA 4GXPA 4DB7A 1OIMA 1R85A 3R6IA 1V3IA 1VR6A 1XLGA 4MB1A 1M6JA 1KXVA 1CDGA 1KQZA 1XLLA 4B5VA 4KCTA 2Q01A 2HCVA 1CGTA 5KITA 1W5OA 5DFAA 2Z25A 1PX8A 4FI4A 4GK8A 1K6AA 1TPDA 1GONA 4EPDC 5D32A 2HPMA 5D30A 1V8EA 3AJXA 2CNCA 3L9CA 2VFIA 3RRXA 1NOFA 1ZNNA 4AZIA 2OT1A 3WF3A 1JDCA 4MUPA 4JYFA 2VX6A 2ZZ7A 4JCLA 4ROQA 1MW1A 1SZFA 2BASA 2Y61A 4ATDA 3QEZA 5CBBA 3SSJA 2P5NA 4JTAA 3GDBA 1OX4A 4DIAA 2DSWA 4H04A 1K8YA 3FV9A 3QBUA 4R3UA 1B4EA 2KAUC 3IPWA 3W6YA 3QW3A 5EBUA 3VNLA 4JTGA 1B9BA 5DMLA 3GVQA 2J47A 1KWGA 1Z41A 3HQPA 4MNMA 1ZBKA 2Z6JA 2C14A 4EK7A 4H9VA 3EXRA 3ZIZA 3CUGA 1RH9A 2OSXA 3W83A 1UKOA 3BZJA 1U22A 4CNTA 2O56A 3C2FA 3PNZA 4R34A 2PTZA 1V6UA 1RQHA 4D9PA 3U5UA 1XW8A 1OC6A 3N2OA 2G4JA 2VVSA 1PCKA 3VDCA 2YZRA 1GVYA 1HP5A 4GWEA 1VYRA 5I5RA 3WSUA 1V6VA 3GXIA 3P8IA 1ZSXA 1UMYA 3BLLA 4EVZA 1MSSA 2EPOA 3AYRA 1HJUA 4TMBA 4Q7NA 3CUJA 4WVXA 3NSMA 4GUJA 3TWAA 5EPDA 1QPQA 3TNBA 1J2BA 4N6EA 3KBJA 4QS6A 3TJ4A 3TSMA 4M1BA 4S2CA 5RUBA 2VYOA 3EMCA 1SO5A 2ZCGA 5DRIA 1QWGA 3FVMA 3I6EA 3LGDA 3EA2A 1JCNA 2QPSA 5DMMA 5BNKA 4HHMA 3A9BA 2GSHA 3EWXA 3BG3A 3MMTA 1TMLA 5HR7A 1WXZA 1K7XA 1A53A 5E5CA 3ME3A 1WOAA 1G6CA 4KBXA 3OIXA