4DF1A

Crystal structure of orotidine 5'-monophosphate decarboxylase from thermoproteus neutrophilus complexed with inhibitor bmp
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
199
structure length
199
Chain Sequence
NLPLVVALDTEVLKAIDVAKRLKGAVAGFKVGWDLIFEGGISIVGEIARYGNVIVDLKIADVPHVASRVVEKLVNRGACCVIVHGFLHPSLPRGQHVYVLVKMTAPTIYDEMWEKLLNSVQDVRGFVLPGNQPEVVAQARKRIGCSYRIISPGIGPQGGRPGAAIEAGADFEIVGRYVLEDPARISQWAQYRPTCFETP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of orotidine 5'-monophosphate decarboxylase from Thermoproteus neutrophilus complexed with inhibitor BMP
rcsb
source organism Thermoproteus neutrophilus
molecule tags Lyase/lyase inhibitor
molecule keywords Orotidine 5'-phosphate decarboxylase
total genus 70
structure length 199
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4df1A00
2OT0A 3IEBA 1WQ5A 4RV8A 4UTTA 1LORA 4RZ6A 5D04C 4BF9A 3IVTA 4ADSA 2DZTA 1EUAA 5HWNA 3B0VC 5K4ZA 4HHPA 2BX7A 5CZTA 2RKXA 4WD0A 3GAKA 2VFGA 3F1QA 1XCFA 3W85A 2VKZG 4LC8A 2QCDA 2ZDRA 5A5WA 1W56A 1GVFA 1TQXA 2Y7DA 3KRZA 2G95A 2JKEA 4UMAA 3GX9A 2YCEA 3PUDA 5MHBA 4MY1A 4IQLA 4PODA 3LB0A 3SFKA 3A5VA 1J2WA 3TC7A 1O5XA 3DGRA 1QPRA 1KTNA 1O4UA 1W5NA 2B7QA 3A23A 1EB3A 5IBXA 3DAQA 5KSWA 3UY7A 4P61A 3O63A 3L65A 4UIOA 4A3UA 3OG3A 3KVKA 5HMSA 2YDAA 5CZSA 2QDGA 4MFDA 3BARA 4O17A 3R13A 3W1LA 4GFSA 1FWRA 3B05A 3MYOA 5F2GA 2BZNA 1I4NA 3UNDA 5AYXA 5LGZA 3BLIA 2Y63A 1XKYA 2W79A 3KOFA 5BMWA 2ZYFA 1Z48A 1MEHA 3P67A 2TYSA 4XQ6A 3HG2A 3T55A 5KITA 1BEUA 3G0UA 2Y61A 1RVGA 1ZFJA 1AW1A 3LLFA 1PE1A 1N55A 2IQTA 2QUVA 3W7GA 2Q3OA 4NJJA 3UD6A 5I3FA 1KV8A 3LM7A 3BW2A 2WNNA 2NX3A 3UYCA 1P5BA 3PWAA 1PV8A 1SO5A 1NF0A 1JUKA 3MWAA 1GG1A 3QMRA 1EPXA 4MIMA 8TIMA 4UTWC 4HPXA 3CIWA 3R12A 3TROA 1TTIA 5I3IA 3IGUA 3G1VA 4W9TA 3P74A 3N2MA 2NWSA 4GNJA 3UZ5A 4Y90A 4P2VA 4TU1A 5FI8A 5BRBA 2FPVA 3DFPA 1QPOA 3BK0A 3QFEA 3LRLA 1AW5A 5D33A 3DFTA 2RDTA 3P7YA 1ME9A 4FX7A 2GVGA 1X8FA 2RFGA 5G5IA 3EX4A 3NM1A 4O0ZA 3HMJG 4O57A 4GBUA 5D2YA 2Z1BA 1I2NA 4O16A 2QR6A 1MO0A 3G24A 3B4UA 4UNKA 5CPNA 1G69A 5HULA 4JICA 2BTMA 3TNOA 4Z1DA 3EWZA 3P81A 1H7XA 1TB3A 1K7FA 1MEWA 3AJXA 2Y7FA 4IGHA 3M16A 5LNWA 3TK7A 2CFFA 4DF2A 4A2RA 3LCGA 1EWEA 3RMJA 5EA9A 1JUEA 2CLMA 4UTJA 5HWJA 1U83A 3KRSA 4NXSA 4RX0A 5U7SA 4HSNA 5BW6A 5K3VA 3O8AA 2FPYA 3TQ0A 1QFEA 3NQ2A 4ZQPA 3W73A 4YCOA 2VFIA 1K03A 2A0NA 3MP3A 5DLCA 4GUGA 3NL3A 4LT9A 5KMYA 3TQVA 4POCA 1YTKA 3LTSA 1S5TA 2ATSA 1QPQA 5TBOA 3V1PA 4A29A 1GPWA 3KVLA 3STFA 2ZQ0A 1NSJA 3W1TA 3C2EA 1CW2A 4HN4A 3S1UA 2I9EA 4XBSA 2UV8G 3I7SA 5KZDA 3PAJA 3QSTA 4XKYA 3C6CA 2A1YA 3S1WA 2PC4A 3HJZA 2C14A 3W7CA 1DJQA 4ZQNA 1IIGA 1TPH1 3TFXA 2V8ZA 3W7NA 5L9FA 1LLWA 3GVGA 3GDKA 1ZAJA 1VQTA 4ADTA 1I2RA 1T0OA 3TIMA 2ZZ7A 1KM6A 5F4XA 4JDBA 3BO9A 5LNSA 2QCNA 4N2YA 1S3HA 5CSRA 5DY2A 4HNNA 5A8GA 3FIGA 1M7OA 1EUNA 1SW3A 3N19B 3U6WA 1SSDA 2F84A 4O1CA 4YLWA 6TIMA 4O8RA 3TX9A 1R2SA 2JKPA 3TSDA 4N02A 4JTTA 3BW4A 5FF0A 2VOMA 4QIUA 3P61A 3U2OA 4MY9A 1VYPX 4NZFA 4AB4A 3L2IA 4LRTA 3S5ZA 4LVDA 5LHFA 1YXDA 5AFDA 3I65A 3W72A 1ML1A 1B9BA 2E6YA 4YWIA 4TIMA 3CWNA 2QKFA 3HGRA 2QAPA 5I3HA 3TW6A 5H2ZA 2WSRA 1OX5A 1J4EA 1K7EA 3GAYA 2QCLA 3FA5A 4BK9A 5EMUA 3QZEA 3W71A 4O53A 1KW1A 1HTIA 3G1HA 5LZLA 1LROA 4CQ8A 2A6LA 3IRDA 2E68A 4O13A 6ALDA 3SJ3A 5EPDA 3PVFA 4Y9AA 4JS3A 1DKWA 1OK4A 4XUGA 3G0XA 3LCLA 4FNTA 2RDUA 2J88A 1O95A 5DXXA 1GQNA 3P82A 2NUWA 3NQMA 3MI2A 3T40A 1V7YA 4CCCA 4K8EA 4GUJA 2E5CA 4RKAA 4N9CA 2V81A 2A85A 1QOQA 1GYNA 1SUXA 1VJIA 1EX5A 5D09A 3QC3A 3GYEA 2E5DA 4JTEA 3NOEA 4JXCA 1FCQA 3EXTA 2NXIA 4LVGA 4CLMA 3ATYA 2VFHA 1TPEA 4UC5A 4S2CA 2E77A 5IM51 3N14A 4N6EA 1K8XA 3IGSA 3UY8A 2GUUA 4FNUA 4MVAA 3DI0A 3WK3A 4HNTA 3PULA 5AB3A 2YXGA 3EX2A 1N8FA 3UWWA 3WJZA 2X1SA 4MPQA 3BVJA 1SQ7A 2R94A 5FF3A 2DZXA 2VXNA 3G0SA 1THFD 2EHHA 1PCWA 3ABQA 3A9IA 3N9SA 3A21A 1IIHA 4WUIA 3P62A 3NQ6A 1XL9A 2JGYA 3G8RA 4LWWA 4WY0F 2GJLA 1WBJA 1YPFA 2JKAA 1ME7A 1PCKA 4NNBA 2P0OA 3QPYA 1QCWA 1Q6LA 3O15A 1F05A 1I2QA 2TRSA 3SY5A 3NO5A 3E9AA 1UJPA 3NQAA 1GVRA 2H90A 1KFCA 2YSWA 4GXMA 3UWYA 3FJ6A 3QF0A 5CSSA 3QW3A 3D0CA 3OVRA 3W2MA 3FLUA 3NYZA 3THAA 3T4CA 1GVSA 2PCQA 1MSSA 1KFKA 4O54A 4PCFA 3HB9A 5DCBA 5FEWA 3BV4A 1K02A 4DF1A 1H62A 2QCGA 4TX9A 2Q8LA 1FQ0A 3QRHA 3W1MA 2QUTA 1RQBA 4NJIA 1KBJA 1Y0EA 1OYCA 5FF7A 5IBXC 1VYRA 1X7FA 2NV1A 1JUBA 3C2RA 1TIMA 3R8RA 3W7HA 1IGSA 4R33A 4JX5A 3GKAA 3G1SA 4M7TA 1AK5A 4RXGA 5G4WA 3C2VA 4IX2A 3NVTA 1W0MA 3G3MA 2V5BA 3KHJA 1JQXA 3NL6A 3IIOA 4ALDA 1DBTA 2QCDB 5DCEA 1OK6A 2FB3A 3MO7A 1VH7A 3W74A 3TAOA 4JTUA 3TMQA 1GG0A 3DENA 1H7OA 4MLJA 3MYPA 1JQVA 2BWGA 3HGOA 1DV7A 4LUIA 5G1YA 3BLFA 1GZGA 4Y96A 3GDRA 4LNYA 1NF7A 4YXGA 4DPPA 1OYBA 1OVDA 1VCGA 4O1AA 4LU0A 4LVFA 1TJRA 3W22A 3GDMA 1B4EA 2J9YA 1QO5A 2A2IA 3O6CA 1MZHA 3QMSA 3TJLA 3P8JA 1LRNA 3TQKA 3Q94A 3W7JA 3L67A 3GKFA 3RK8A 4AAJA 3CHVA 4JTGA 3CB8A 3DFSA 2ZZ1A 1M5WA 3G1YA 2B4GA 3W7QA 3EWWA 5EY5A 3NL5A 2H6RA 3TA6A 1XDMA 4UTMA 2WNZA 1Q6QA 3UWQA 3G1DA 4M5PA 1EP2A 2QJHA 2X1RA 5F2IA 2QAFA 1H60A 3M41A 1ADOA 1KFBA 4NX5A 4C1KA 1UB3A 4JTFA 5SWUA 2FPTA 3FYPA 2H8ZA 3W70A 5J5RA 2V2HA 3TCEA 3R89A 2QCHA 2A7NA 5CPOA 1YTDA 2OZ0A 4XTDA 4LUJA 1AL8A 1AMKA 3L0GA 3W1RA 3NQGA 1VHNA 3TSMA 1VZWA 2B0MA 5AYYA 2ZA1A 4UTHA 1UCWA 4K8HA 3S9YA 2C3ZA 3LBCA 4M6QA 5CZJA 1GOXA 2QDHA 1L6WA 5I3KA 4XZ9A 1W8SA 3NPUA 5AHEA 3DHDA 2ZRUA 7TIMA 3PB0A 4K36A 1G4TA 2Q8ZA 1GVOA 1PS9A 1W37A 1VS1A 3W7OA 1JCMP 3UPBA 4Q4KA 4XTIA 3LHZA 1NFBA 3W7IA 2P1FA 2ZRVA 4DO6A 3C2OA 3K30A 5C6MA 3LXAA 1SFLA 4AHQA 4A21A 5K9XA 1J5TA 1FDJA 1HO1A 2J9ZA 4IMFA 2GOUA 2FLIA 4L4MA 3QH2A 4LS2A 2NZLA 3E0IA 2Z0IA 3NPWA 4CCEA 1QMLA 3MP4A 3E02A 4JYFA 3LRMA 3I6RA 4MKNA 3I7RA 1VR6A 4FIQA 5TQLA 4MJMA 1F5ZA 1XUZA 1FCVA 1TRDA 3TC6A 2RH9A 4FNRA 2GQ9A 2GQAA 3B8DA 3M1ZA 3IIPA 2H3BA 3R2GA 3DBPA 3QQ1A 1WYIA 1JR1A 4B5NA 1FX6A 5DY3A 5LNRA 4E0CA 3TXVA 3M6YA 1OYAA 4KWVA 4LRSA 1LRTA 4S2BA 4QISA 2QUUA 1S5WA 2G97A 4CNNA 3CIXA 1TMHA 3UPWA 2TMDA 2CLHA 4O15A 3LHTA 3EWYA 5EYWA 4U28A 4JR5A 1UUMA 3VKJA 3NL2A 1T96A 5K9CA 2ISSA 2GJNA 4JY9A 2BLEA 4ZQMA 2ALDA 1YDOA 3IIZA 5DELA 2ZTJA 4IWWA 3U8GA 1WXJA 4WXYA 1QWGA 2XN2A 5D2VA 1UASA 2AQWA 3PF3A 1E51A 3G22A 3G1AA 4N6FA 1D9EA 5G2WA 4TMBA 2VELA 1F74A 3G8EA 4IMEA 3GNNA 5F1UA 2YPIA 3GXPA 2WKJA 3A22A 3GK0A 4JD4A 3PSVA 3NQDA 3KFTA 3DU0A 1LBMA 4IMCA 3TJXA 2FQIA 2V2DA 1P1XA 2ZRZA 3ANYA 1AW2A 4RK8A 4DO4A 3W76A 4Z1CA 1L2UA 2ZRWA 2PE4A 1R2TA 4IPIA 3FEMA 5TIMA 3W2NA 2JGQA 3DI1A 2NWRA 1ICQA 1WAUA 4CNPA 4OV4A 3UWUA 5KTLA 2ZRYA 5HUOA 1C29A 2I1OA 3G3DA 2X30A 3ABOA 1JRCA 1SU5A 1LOQA 4MY8A 4N9DA 3JR2A 4N9EA 5LKYA 3EKLA 2VEMA 5G1TA 1KFLA 2ZTKA 1DHPA 4JYDA 3W88A 2RDWA 4K7VA 4UFIA 2O7SA 1KLZA 2DORA 1RZMA 3Q37A 5I3GA 4JX4A 1FCUA 1VC4A 5DCDA 3TUUA 1XUUA 1Z41A 2QEZA 3SIZA 5FEPA 4GC4A 4OGZA 1I45A 2WSQA 4TR9A 5DBUA 2H3DA 1K3UA 2QJIA 4DBEA 2CLIA 4UUIA 1TJPA 2CW6A 1KM4A 4WQ6A 3EXSA 3L68A 3S0CA 3NNTA 4RZ4A 3M5VA 5F1VA 3S8HA 1TPC1 4ZZ9A 4KFNA 3MI3A 1GEQA 2G96A 5FF4A 3WFAA 4D2JA 2A5HA 3TSBA 1OFDA 4X9SA 2PRLA 1LRQA 2E09A 1K7XA 3NDOA 3WJSA 1K8ZA 4OV9A 1L6YA 1MXSA 1PL9A 1H63A 1JCXA 4UMBA 3LI1A 1EP3A 2X2GA 4GE8A 2EF9A 4UTLA 3C2FA 4NVTA 1IXQA 1W1ZA 4MZ1A 3O1NA 1TO3A 2ZRXA 4ADUA 3DKLA 4O1BA 5EKYA 3NA8A 5D32A 2Y7EA 4PL1A 3HPXA 2C16A 3LTYA 3EXRA 3UWVA 4R53A 5G4EA 2YYTA 4AF0A 4EWND 4AF0B 3M5ZA 3PSWA 1QR7A 3AO0A 4N4QA 1HUVA 4M6VA 1JJKA 4ORIA 3NEVA 3LBMA 2PURA 3S1XA 3GR8A 2YFOA 3HF3A 4ZQOA 3R5EA 2YW4A 3OA3A 1R2RA 3MP5A 4PL2A 4GUHA 2NV2A 1ZAHA 4K37A 1U5JA 2X1TA 3PR2A 2CZFA 1LYXA 3L66A 4U4MA 2C19A 3NQEA 4NNAA 3BGJA 2D73A 3SGZA 4O28A 3LXCA 4FF7A 2WJZA 3S6DA 2FIQA 4O4WA 3CEPA 3G18A 2CWNA 4UCGA 3DFNA 2V9DA 3W86A 3TDFA 1XM3A 2Z6JA 2DZUA 5J5DA 3UWZA 3SECA 1KV5A 2YYUA 4IUOA 3P5YA 2B7OA 1A53A 3QEZA 3EX6A 1KFJA 3JRKA 3RU6A 2YGYA 4UFKA 4GUFA 4EOUA 3W1XA 1P0KA 1TPVA 3CC1A 5G2IA 3RNDA 1L9WA 2HSAA 4JY8A 2J24A 4MZ8A 1IXPA 3NAVA 3ATZA 5CPLA 1I2PA 4X2RA 3ZR4A 1NAL1 2YX0A 1XI3A 3UXDA 4R7JA 2GQ8A 4GWEA 1KTCA 5D37A 1S5VA 1JCYA 3IGXA 4O12A 3LCWA 1QAPA 3CM4A 4CNOA 5KZEA 3ZS4A 2B7PA 4DELA 3FJLA 3TKFA 1F6PA 3OHIA 3LV5A 1LDCA 3B04A 3P8IA 1LZOA 3FKKA 1RV8A 2AAMA 1IXOA 2V30A 3EKZA 2CU0A 1GTHA 4IMGA 3HGSA 3QQ0A 3PBUA 1R30A 5FEZA 2EKCA 4FX8A 1F76A 1SW7A 3PC0A 1WOBA 4UXDA 4BFAA 3C56A 1OJXA 1ZAIA 2Y85A 3CTLA 3GXTA 3BW3A 1G7UA 5AHIA 4RR4A 1R46A 1T99A 3VFLA 3W2LA 2FJKA 3TU9A 5CPMA 4QQ3A 3PY2A 1KM3A 3LHUA 3PBVA 3WK1A 5KZMA 4NJKA 1FY6A 5L6UA 2DZPA 3ABRA 4LY8A 3EX1A 1LM1A 3HQ1A 3W7DA 3F4NA 3VI2A 4JDYA 3E12A 4QSHA 3WK0A 3S5NA 3LHWA 4UFHA 4Q33A 4K39A 2YZRA 5AC8A 2VFFA 3LCFA 1OFRA 1ZHAA 1DORA 4HKPA 2NX9A 5AYZA 4MYAA 3GNDA 1TPB1 4LW7A 5H91A 2XN1A 4FO4A 3DXIA 4UTUA 4G1KA 1AL7A 4Z1AA 3SW6A 1SZNA 4BI5A 2A21A 2GPTA 3M44A 4FX6M 4HPJA 3N3MA 1YXYA 1Z44A 4N9BA 1H1ZA 1KM2A 3OVQA 3N34A 4JGDA 4JTIA 3VE9A 1EA0A 1VRDA 4OU1A 5D30A 4J9JA 3WK2A 1D3HA 3M47A 2CZEA 5CZ0A 2HTMA 3LOTA 3W87A 3TR2A 1TREA 5DN1A 1SO3A 1A5SA 3QM3A 3DZ1A 4JX6A 1ME8A 3CPRA 4OT7A 3IIXA 4PTNA 2ATMA 4TO8A 4X22A 3KRUA 4FIRA 5AOUA 3HG4A 4UTKA 2Z6IA 4JIPA 3W83A 4DQWA 4EVZA 4WXZA 1BKSA 1HG3A 2ISWA 3ABSA 3N73A 2QCCA 2Q3RA 3OBKA 1DJNA 2WNQA 3S42A 3PBYA 1H5YA 4UFMA 1K8YA 3B0UX 3FS2A 3NPXA 3TXZA 4X3ZA 1LLZA 2PRHA 4O50A 1OF6A 4EF9A 4UR8A 3GIYA 3KVMA 2FDSA 4O1DA 5HUPA 4AWSA 5AC7A 5EL1A 1OX4B 4IPJA 4IMDA 3PB2A 3IV3A 2E6FA 1SSGA 5HINA 1TV8A 3UXAA 3PG8A 1TPFA 1NVMA 3MHUA 2WOQA 4MOZA 4DF0A 3SZ8A 4UMCA 2V2CA 2QJGA 4O4VA 2E6AA 5F2LA 2DJLA 2Y88A 3Q58A 4XKYB 1RQEA 4OWGA 4E2BA 4HNUA 2VEIA 1WV2A 5C55A 4DO5A 1C9DA 3MUXA 4LS0A 4TMCA 1GJPA 5LNVA 4A22A 3NR0A 5LHEA 1FWSA 4IXHA 1VCFA 3GDTA 3F4WA 3TAKA 1H7WA 4Z0JA 3W1AA 3VE7A 5HQEA 3GB6A 4QAIA 2CLEA 4IOTA 3P5ZA 3ELFA 3LX9A 1B4KA 3EB2A 3H53A 3NZ1A 1H61A 1ALDA 2DJXA 1F6KA 1H50A 1W54A 3OVPA 3M5YA 3LERA 2RHGA 4CQAA 1PVNA 3W75A 5E93A 1DOSA 1LBLA 1ICSA 2EGZA 1Q3NA 4AWTA 2AGKA 4XBKA 3STGA 2LLEA 4O19A 1VPXA 1W5PA 2WQPA 3NQFA 4O18A 3PUOA 3DH7A 3ZFHA 1W31A 3W7EA 4HT3A 1SFJA 2DZWA 1W5QA 2J27A 4KKXA 3N9RA 1YXCA 3H54A 4IX0A 2ABBA 3USBA 4AHPA 1VGAA 4HNVA 4BWLA 1A5CA 4KWWA 4LVBA 2C13A 5K7JA 4OQVA 3C4UA 3E49A 4LTSA 4BR1A 3LHYA 4FXSA 5T26A 4GJ1A 1G4EA 2A4AA 4OE7A 3RLVA 1YLVA 4YL2A 5AN7A 2ZZ5A 1IF2A 1G6CA 1JCJA 3TFCA 4UR7A 1FDZA 2V5LA 4NNCA 4NZJA 4ORMA 3W23A 1CX9A 3CWOX 3HO8A 4HSOA 1O60A 4O10A 3QJAA 2VFEA 2ISVA 3L0NA 3VCRA 1JVNA 3B06A 3FKRA 1F7BA 2FFCA 2VEKA 3LI0A 3QYQA 2JBMA 4AHOA 3EWXA 4ICNA 3W7KA 1HFBA 1OHLA 3BLEA 1EEPA 1XBYA 2ZCGA 3TV8A 4QJ1A 1C8VA 1ICPA 3BG3A 3LDVA 5LSMA 1RPXA 1JRBA 3W7LA 1KA9F 5D02A 1Z42A 1H51A 2TSYA 4IXXA 4JNMA 4JTKA 3MJYA 3W1UA 2EAWA 4O11A 3BG9A 3W7MA 5E0KA 2XFWA 1FCBA 1ZCOA 4Y6GA 4GRSA 3W7RA 1M6JA 3HG5A 4I7WA 1H7RA 4Z08A 2YW3A 4WY0B 1G4SA 3S5OA 2OJPA 4UNLA 5F2MA 1SR9A 1A5BA 2C15A 2VC6A 3NZRA 4JEQA 4MUZA 3LXBA 3SSJA 3W2UA 4AXKA 1KTBA 3CT7A 2NXGA 3HPZA 3BGGA 3HG3A 3LTPA 3T78A 1WOAA 3P84A 4UFJA 4Y8FA 1A5AA 3CU2A 3LHVA 5CGQA 4WJEA 3F03K 1YYAA 1XFBA 2XN0A 4WOZA 1JCLA 3C3NA 4ZL1A 5HR7A 2C0AA 1H7PA 1GTEA 2VEPA 1OF8A 1TYGA 4L4LA 1Q6OA 3O16A 3SI9A 1SW0A 1OFAA 2H8XA 2KZHA 3PUEA 3QPZA 4DXVA 3L0KA 4RLIA 1O5KA 3W3OA 5BOOA 2NXHA 3M5XA 1L6SA 4RZ5A 5HWMA 1X1OA 4MLRA 1KM5A 4Z1BA 4H3DA 4O0KA 1KLYA 2EPHA 4NX0A 1KM1A 1OX6A 1GT8A 1VHCA 1QNVA 3A5FA 3SGUA 4E38A 2OT1A 4NU7A 1SZEA 2BSLA 4PFMA 4UTWA 3DKJA 1TV7A 1XXXA 5DBTA 4H6KA 1ZY9A 2OMAA 4EIVA 1PHWA 1TCDA 1YPIA 2WSYA 5FEXA 5K4XA 2DP3A 3HBLA 5K9DA 1GVQA 1QO2A 1YDVA 1OFQA 3PG9A 4AH7A 4LV4A 4QITA 5D05A 4FNSA 3HIJA 4BI7A 1WX0A 5AC6A 4I7UA 2QCMA 1XBVA 4ZVJA 1XDLA 4N4PA 3THQA 3W1NA 4FB7A 2X16A 1VLWA 2CLKA 4UFLA 5U4NA 1XBZA 4RJEA 4WZHA 5C5YA 1DVJA 1DQWA 1LBFA 3ZWTA 2R14A 3W07A 3I7QA 3L5MA 2FB2A 1VCVA 3N2XA 2NUYA 1D3GA 3PBWA 2A7PA 3WJXA 1EWDA 2Z2UA 4I9AA 1P4CA 3MW7A 1SZFA 4ZMGA 3O06A 3PS7A 3FFSA 5BNKA 1FWWA 2ZZ6A 5F4SA 2GVJA 3RF9A 4O14A 3HPSA 4CQ9A 3W2JA 3KX6A 4FEZA 1OABA 5BMXA 4QNWA 1OX4A 1W3NA 5D2XA 3O6DA 2Y89A 2QCFA 1ONRA 3NQ7A 3NXFA 4Q32A 5CKSA 1A50A 4ZQRA 1VLIA 1XC4A 2NLIA 1P0NA 2E1DA 1TTJA 1W3IA 3M7WA 3I68A 1T8XA 2VFDA 4GUIA 4PC8A 1X1ZA 2ABAA 3IVSA 2CZ5A 5ABTA 1G7VA 1TRIA 3G1XA 3UQNA 3M9YA 1FWTA 3IIVA 5CG7A 3EX3A 3QMTA 1H7NA 3KVJA 4LV9A 1CI1A 4E2DA 3GR7A 1UUOA 2Y7GA 2HS8A 5C2XA 3CLMA 4I7VA 3O05A 4CCDA 4ML9A 1M7PA 2JK2A 1GYLA 4MJZA 3RFAA 3EWBX 5E1QA 5G2HA 2QCEA 3OEXA 2NUXA 2QF7A 1PIIA 1ZJIA 4ZQCA 4AWUA 1B3OA 2CLLA 2F7FA 2CLOA 4AEOA 4WY0A 1EP1A 3V75A 4NT0A 4FXRA 1X6UA 3NPVA 5HJLA 3B03A 1KM0A 3W2KA 1WDWA 4MZYA 1LP6A 3SR7A 5FF2A 2J9XA 2V0TA 3S5YA 4ONVA 4R34A 3M43A 1FDYA 4A2SA 3C8FA 1G4PA 3H55A 5D38A 3T7VA 1WBHA 3HOJA 5HR6A 3Q2DA 1YTEA 1MEIA 1EIXA 4OHQA 3JS3A 2PRMA 2ZA3A 2DU2A 1TPDA 1OFEA 3LLDA 2OCZA 3B0PA 5I3JA 2GVLA 3LCHA 4IJBA 3UZJA 4NXKA 2ZFAA 3TE9A 1TV5A 1FWNA 4LVAA 3VNDA 3W6YA 2A7RA 1QOPA 3T44A 1AG1O 2WPBA 4OBTA 4NQ1A 1LTDA 3P60A 3QW4B 4HIBA 3INPA 4UTTC 3W1PA 1VYSX 4M6PA 4YCPA 4KFOA 3CEUA 4QM1A 5D2TA 4M7SA 4PA8A 1YDNA 4FHAA 4EF8A 3OIXA 2A6NA 2ZA2A 2DZVA 1R47A 5KINA 2TPSA 3IVUA 5AHNA 4K38A 2G5WA 3QSRA 2ZBTA 1I2OA 5LGXA 2R91A 4S1FA 5AHMA 1SPQA 1DQXA 1LOSA 1OG0A 3LRKA 2DZSA 1YADA 3MI6A 3NG3A 1G67A 1W5OA 4JTJA 2O7QA 2ZZ3A 3L9CA 1OFBA 2C1HA 4KFPA 1BWKA 1JCNA 1FUYA 3DHFA 4PH6A 2CLFA 4K7YA 3C0JA 1FBAA 2BXVA 2Y6ZA 1QPNA 4XWUA 5FESA 2J6XA 3G1FA 2WO5A 1H1YA 2ZZ4A 5DXYA 4M19A 3STEA 2C6QA 5K2ZA 1SO4A 1FXQA 3STCA 1TPUA 4FNPA 4Z0SA 2HS6A 3W9ZA 1F73A 1ZENA 1RD5A 1OFOA 2ZZ2A 4JYEA 2YFNA 1W5MA 3TH6A 2Y62A 3BG5A 1OFPA 3EWUA 4BI6A 1LOLA 2I14A 1Q45A 2C18A 1IXNA 2WV8A 3WJYA 3A24A 1V5XA 3C61A 4NUWA 1O94A 5F4WA 3GZ3A 1ZALA 4O52A 2B7NA 3MHFA 2P10A 3TMLA 4NJGA 3MMTA 4K6AA 4DEFA 4AVFA 4WX2A 3NQVA 1KBIA 1N7KA 3LGEA 3S1VA 1HO4A 3GDLA 3L5AA 3LCIA 4BWLC 3W7PA 1W3TA 3O6YX 3CQ0A 3PM6A 3ZWSA 4C1LA 4FNQA 3YPIA 3WJWA 1SO6A 4PEKA 1DL3A 4MFEA 1FXPA 4LS1A 3L21A 3MHGA 5AHLA 3EEGA 1JULA 3GLCA 4JTSA 3O07A 1UBSA 2HMCA 3E96A 4RCXA 3TW7A 1TSIA 3MBDA 1RQHA 1B57A 1NEYA 4UTIA 4AMAA 1WA3A 1HL2A 1F2JA 2W0UA 3DFQA 3P80A 1ZNNA 2OX1A 3KXQA 2CZDA 4NJHA 5GVJA 2W6RA 2FTPA 3DFOA 3GXNA 3LCXA 5LNUA 1TTQA 2NX1A 3W84A 3KAOA 2VENA 3NGJA 4DPQA 4H4IA 4WOQA 1TTPA 1RR2A 1KFEA 2YR1A 3NQCA 3NM3A 1BTMA 4MYXA 2R8WA 4LC6A 4JN6A 4YMZA 2E6DA 4JIQA 4RXFA 4QNEA 1PHQA 3NQ8A 5EBUA 1BWLA 1I8JA 3C52A 1TPWA 1GWJA 3L5LA 3BPWA 3M0ZA 5C54A 1XBXA 3HGJA 3W1QA 5AHFA 1TQJA 3RLUA 4JTHA 3FYOA 3LV6A 4LOCA 1SZGA 1QDSA 2X1UA 1LCOA 2V82A 1Q6RA 2Y70A 5D2WA 5HNRA 5D03A 4JTLA 3FOKA 2E5BA 3MBFA 4DBDA
chains in the Genus database with same CATH superfamily
2CXEA 4RV8A 1LORA 4BF9A 4R3UA 4ADSA 1QXLA 1PKMA 3B0VC 3POCA 5K4ZA 4HHPA 5CZTA 2VFGA 3BJSA 4LBRA 1XCFA 3TTOA 4LC8A 2V67A 3UR8A 2QCDA 4O0QA 4LFYA 2Z29A 3PUDA 1POJA 4C6JA 1E0VA 1NP2A 4PODA 3SB0A 3B8WA 1GVEA 1AJZA 4Q4QA 4KBXA 3TC7A 3DGRA 1QPRA 4ZO8A 2AMXA 4KCUA 3UT0A 3ZJ6A 1EEXA 3UY7A 1NWUA 2XIJA 4UIOA 2OO6A 3KVKA 5HMSA 2YDAA 2QDGA 3WL1A 3OIHA 3BARA 3MWCA 4GGHA 5LYRA 3MYOA 2NT1A 2WSKA 5C9WA 1IWPA 4GK8A 5BMWA 3KOXA 1Z48A 3CH9A 3P67A 1RBOB 4LPCA 4DZ5A 4E4FA 3RMEA 4US5A 1ECQA 3RN6A 1GOMA 2NLYA 3CQJA 3LLFA 1JDCA 2Q3OA 4PMJA 1W8GA 2CITA 2PCEA 4NJJA 3UD6A 3BW2A 1UQZA 2WNNA 1TUXA 3UYCA 3PWAA 3QKZA 3GM8A 4Z2JA 2WMKA 3LBOA 5B7YA 1S1PA 1JUKA 4W85A 2CPUA 1J0YA 1DYSA 3QMRA 4HPXA 1CGWA 4LANA 1OCQA 3TROA 5I3IA 3VKDA 3FX4A 2FTWA 3B4YA 3R7MA 1F8MA 3SCWA 2HK1A 5F7UA 3G1VA 3P74A 3BMXA 4TU1A 5FI8A 1KWKA 2FPVA 4GQGA 1E72M 3LQLA 1Q6EA 3LRLA 5D33A 2Z1VA 3P7YA 1FH9A 4WCJA 2W4XA 5A6KA 4FX7A 1UMLA 3UJSA 4LAMA 3LZ5A 2ZVRA 5DRIA 3EX4A 3VMNA 1C9WA 2PWDA 3EGJA 2WVSA 1I0DA 4GBUA 5D2YA 4DI9A 2Z1BA 3SRFA 1I2NA 4UNKA 1G69A 5MF5A 4WGXA 4JKKA 2HXTA 3P81A 1H7XA 1BYDA 3WDJA 1MEWA 1FWCC 3TQPA 1BFNA 5LNWA 3TK7A 1EX1A 4NRSA 4H7CA 3E2SA 4MNLA 5EA9A 4I90A 4JQ3A 4OOUA 5JU6A 3UCCA 1XW8A 4JPGA 1I75A 3VNYA 3TCSA 5U7SA 1JZ4A 4HSNA 3O8AA 2FPYA 5C70A 4GLEA 1Q6CA 4JIRA 1E6RA 4PMZA 2W67A 4YCOA 1K03A 2AMGA 4ZCWA 1UZ1A 1XX1A 2XIMA 4DXXA 4LT9A 1ELSA 3MZ2A 1YTKA 2IPGA 2VJXA 1FFQA 2ATSA 4XD6A 2Q09A 4ATLA 3W1TA 2V5DA 1GJUA 4C6FA 3S1UA 4XBSA 3SCNA 3I7SA 3ZLGA 2X40A 4Q7NA 3PAJA 3QSTA 2J7DA 1ZBCA 5FL0A 3S1WA 3W7CA 4ZQNA 1IIGA 2WZMA 3LEPA 1UKQA 1ZAJA 3MUIA 1BRLB 1ZU8A 2XUCA 2WVTA 4I5UA 3XINA 1VQTA 3CUZA 4D6JA 2GGIA 1GOWA 2FH8A 3TIMA 2WMGA 3HQPA 2UY5A 4A3HA 2QCNA 4N2YA 2X2YA 1X39A 4HNNA 4IFKB 3QFWA 1M3UA 1M7OA 4DJDC 3QY7A 1WDPA 3CTTA 3N19B 1SSDA 1UZ4A 4C6NA 1JNEA 9XIAA 2DT1A 3VD9A 1R2SA 4RNIA 2ICSA 1IWAA 3TSDA 3I10A 2XFRA 2WMFA 3P61A 1OC6A 4L1WA 1VYPX 4NZFA 3L2IA 4LRTA 3S5ZA 2C7FA 5MKGA 2WMJA 4J2MA 3A4WA 1UR1A 3UZZA 2E6YA 2QKFA 3HMCA 3HGRA 2QAPA 1OM0A 3K13A 1B9ZA 4AWEA 2WSRA 2WJDA 1VF8A 3VA8A 4LAKA 2VVNA 3QZEA 4Q8PA 3VYLA 3W01A 4LEQA 3G1HA 4CQ8A 3WCZA 5EPDA 4AY1A 5FSEC 1E1FA 1OK4A 4LCRA 4FNTA 3S4TA 2YB4A 1O95A 3N25A 3P82A 4FXJA 2NUWA 3NQMA 1V7YA 1EA9C 4AD4A 5CSYA 1E55A 3SCVA 4CU7A 4AD5A 1JCTA 1SUXA 3NURA 4JXCA 4LVGA 1MDRA 3ATYA 4UC5A 3S9ZA 4PR4A 3IJLA 1X38A 1KXQA 2GUUA 6PTDA 3WEZA 2E4TA 3WK3A 1V08A 1BAGA 3WY1A 4DBUA 2YXGA 2MNRA 4V33A 1UR9A 4W93A 4DI8A 1SQ7A 4A3YA 2R94A 5FF3A 2ZX7A 4DJFC 2DZXA 1XIGA 4R9OA 5D9MA 3WBYA 3WQVA 3OGVA 4E8DA 4WUIA 1DTUA 3VDBA 4LWWA 1BSLA 3M0HA 5RUBA 4PBFA 1OB0A 2I57A 4BF5A 2AKMA 2QHAA 1F05A 1I2QA 2TRSA 5I79A 5M17A 2EEXA 1DWJM 1UJPA 2H90A 2YSWA 3BDKA 1H0GA 3CV1A 5CSSA 3H4XA 3FLUA 3THAA 1QHPA 4EAMA 5DCBA 1YEYA 3HB9A 3BV4A 3SSZA 1K02A 3CHCA 5AC4A 1DJHA 1H62A 5FJUA 4QR6A 1E1CB 4TX9A 1F4AA 1XLLA 4W8AA 3VOHA 1TR1A 2QUTA 1RQBA 1KBJA 2EO7A 3EDEA 1CXIA 5IBXC 1X7FA 1V3HA 4R33A 2J7HA 3CZJA 5T9CE 3UZWA 2PGFA 3S9IA 3QPEA 2VZOA 5G4WA 3KL3A 2J7BA 3WDRA 5CPQA 1MW2A 2ASHA 2O9PA 2GWGA 2V5KA 5JBDA 1UWAA 1W2PA 3WNKA 2QCDB 5D9OA 3AYVA 4D9PA 4GVFA 2Y1HA 4US6A 1EDTA 4DUOA 2XH0A 7PTDA 3DENA 1AODA 1H7OA 4MLJA 1JQVA 5FJIA 3HGOA 4G7EA 5G1YA 1GZGA 4Y96A 3GDRA 1Q65A 3H24A 4YXGA 3QOKA 1XSJA 3W22A 3T42A 3R8GA 3KL0A 4IQJA 3ALFA 2A2IA 2R9RA 4GGBA 3QMSA 1J0KA 3TJLA 3KTSA 8XIMA 3TQKA 4QP0A 3L67A 2VOTA 3H2AA 4M56A 2ZZ1A 1M5WA 3O0KA 3G1YA 2B4GA 1FKXA 3URQA 2WNZA 3B9AA 3AIUA 1B1YA 1H60A 4F0KA 3W37A 4GI9A 3L4XA 3IANA 4NX5A 2EQDA 4JTFA 4H01A 2H8ZA 1CZ1A 3UBPC 3W70A 2V2HA 3TCEA 3GFZA 2A7NA 1CNVA 1AMKA 3L0GA 3W1RA 1VHNA 3TSMA 3GNXA 3F2CA 1CXHA 2C3ZA 4M6QA 4YTSA 3GH7A 3NSXA 1L6WA 3NPUA 4KF1A 3UERA 5HANA 2IXVA 2QDDA 1G4TA 1GVOA 5IOBA 1NFGA 5DEZA 4TTGA 4XTIA 5CC7A 3LHZA 1XQLA 2ZRVA 4PMQA 5A2AA 5C6MA 4TVDA 4A21A 1ZGDA 4C90A 2NVCA 5BRQA 3VDGA 4Q8OA 1U2YA 4L4MA 4LS2A 5A95A 1S5MA 3PPCA 3E0IA 3NPWA 5EMYA 1JGIA 3Q45A 4JYFA 5EU9A 1PKYA 4LSBA 3TTYA 1F5ZA 4H1ZA 3NIYA 2V69A 3TC6A 4B3KA 4GH3A 3WLPA 2BGQA 3M1ZA 4IFOA 1EYEA 2VYOA 1WYIA 1M41A 3CNYA 4GA8A 2DFAA 3UPWA 5DT5A 4MWAE 3EWYA 1WP6A 1RA5A 1T96A 1IZKA 1X97A 5K9CA 4ZB2A 2ISSA 3WELA 3URBA 2WLZA 3D46A 3LZ3A 1QRQA 1YDOA 5DELA 2EXOA 2ZTJA 1Q2SA 3E1F1 4LAZA 4NZ3A 1WXJA 4LBUA 3DG6A 4WRHA 1X8CA 1UASA 2PDYA 2XIIA 3G22A 3G1AA 2D0GA 4N6FA 4WR3A 1O1ZA 1A5NC 3MU7A 1EF3A 4HPGA 4IMEA 4CVWA 1SMAA 1DTNA 3GXPA 2KX9A 3WLTA 3MJMA 1XGEA 4I6VA 5DMYA 2NW0A 2R24A 4IMCA 4IZGA 2ZRZA 3ANYA 1AW2A 4F8XA 1GQKA 3W76A 1L2UA 4HK7A 3O9NA 2ZRWA 4IPIA 4RW3A 1ICQA 3AMCA 1EXBA 2ZRYA 2I1OA 2XHYA 1SU5A 2G37A 1KQZA 4QCFA 5CAHA 1HGWA 4N9DA 4M8UA 4WHBA 1W1B1 3EKLA 2VEMA 1F3WA 3NDZA 5G1TA 1KFLA 1ZB5A 2ZTKA 1JPDX 1GVIA 4EP8C 1IYXA 4K7VA 1KLZA 2DORA 1DQUA 1NOUA 5I3GA 4JX4A 1QI3A 2PDBA 2QJJA 3ORWA 3MKCA 3TUUA 4F66A 1OY0A 2PWEA 3WQPA 1IV8A 3ZLHA 2WC7A 3CUIA 1R7OA 2QJIA 4UUIA 1TJPA 2ZIDA 3KTCA 3AU2A 2VUYA 1MRAA 1MFVA 3KS6A 5M1TA 4LNCA 5F1VA 1CXKA 1WXZA 4H2CA 5CLTA 3AMLA 5FF4A 1J93A 1E0XA 4X9SA 1YMYA 2O56A 4PUKA 1XFCA 3OG2A 4J40A 2E09A 4OOZA 4OV9A 1UA3A 1MXSA 1J0HA 1EFZA 8A3HA 3C2FA 4NVTA 3GRIA 3PZVA 4FPSA 1Q13A 4F0SA 1H4PA 5EKYA 4PTWA 4KS0A 1MUMA 3SIMA 3AROA 4FI4A 4H00A 3T0BA 2YYTA 4AF0A 4AF0B 4MJ2A 1E0TA 3P3BA 1QBBA 4JEJA 3ZZ1A 2DVTA 1V77A 1BQGA 3W02A 1XIIA 4WSKA 4GYPC 3UJEA 2PDNA 2PURA 1G94A 2YFOA 3HF3A 5E0FA 3E3HA 3P2VA 3VIMA 5G4HC 4F0HA 4YHEA 4QRNA 4PL2A 3QXBA 1ZAHA 4K37A 1U5JA 4RE3A 3WLKX 3BLDA 4PCPA 3SDOA 4TX6A 1XLHA 1LYXA 1V6WA 2C19A 4D1IA 1UIPA 4E4PA 4NNAA 4B5WA 3BGJA 3TN5A 2D73A 3WUGA 4O28A 3WMLA 3S6DA 4IQDA 3AZTA 3HURA 1TVPA 3DFNA 2V9DA 3E0FA 2CC0A 2YYUA 2X7WA 4IUOA 3TR9A 4D6IA 2ZOXA 2YGYA 3RU6A 3RX2A 4UFKA 1S1RA 3WBEA 1GNXA 1TPVA 5G2IA 1NELA 4JY8A 4MZ8A 1IXPA 1W1VA 3NAVA 3GBDA 2ZX5A 2XU2A 4X2RA 1NAL1 1VFSA 4PMXA 1XH0A 1S46A 4G56A 1S2TA 2GQ8A 4JCLA 5D37A 2GGEA 3IGXA 3LCWA 1QAPA 4LUSB 4CNOA 2B7PA 4PUWA 1MW1A 1F6PA 1W9VA 3H23A 3B04A 1K9EA 4INFA 2WMIA 4QE1A 5BYWA 2AAMA 3EKZA 4HPHA 2FMOA 1L8NA 3UFYA 3PBUA 1V93A 4BHYA 3AWNA 1VFUA 1UP0A 4BFAA 1ZAIA 2Y85A 3L4YA 3CS2A 4IIDA 5ENLA 3BW3A 4L64A 1G7UA 5FOOA 1UIOA 4RR4A 1R46A 5H6HA 1U1UA 5CPMA 2DH3A 3GTXA 3I6TA 4QQ3A 3UVAA 3BQ5A 1KM3A 2NV9A 3KBWA 1SJBA 1JI2A 4MKSA 1XYLA 2GK1B 1WZAA 3JUGA 2HRWA 4C5YA 3W7DA 3F4NA 4DYKA 4QSHA 3LHWA 4Q33A 4K39A 5AC8A 5CEWA 1ZHAA 3DFHA 3VIJA 2X7VA 1PO9A 5AYZA 2FJUB 3IV8A 1TPB1 4MPKA 4A8NA 4G1KA 2DIKA 4WF7A 3SW6A 1SZNA 4GZEA 2Z28A 3B40A 3N3MA 1Z44A 4KGLA 5CSUA 3S5SA 1TV2A 5D30A 3WK2A 3VAVA 4W5UA 7A3HA 3M47A 1A5LC 5CZ0A 4WVXA 4ACYA 3W87A 2QIIA 3TR2A 2H9AB 1S5NA 4ZENA 1TREA 2OR2A 3NZGA 3RX4A 1A5SA 3QM3A 4JX6A 3IUDA 1OQFA 3DYOA 3IIXA 1EGVA 3MMWA 2ATMA 5REQB 1LG1A 4H8HA 5AOUA 4UTKA 4JIPA 3WNMA 4DQWA 1V3LA 2ISWA 1OC7A 4PRRA 3ABSA 5B7ZA 2QCCA 2BDQA 4D6CA 3S42A 1DIEA 1H5YA 5DMNA 3F2DA 3PJWA 5GJPA 2QPXA 2Y5JA 1DJZA 4DLFA 3TXZA 1B90A 4MHBA 3WF0A 2ZUMA 1OF6A 4O1DA 5EL1A 3UPMA 3U5UA 3COTA 4IPJA 5IDZA 2E6FA 5HINA 3GSMA 1ITUA 3CMGA 4HYVA 3XIMA 3UF9A 2PTDA 1NVMA 1C90A 4JNYA 4UMCA 1A0CA 2E6AA 3NDYA 3DDMA 4G9PA 3Q58A 3KL5A 1ISVA 4E2BA 1UP3A 3CZ8A 4L7ZA 4F3HA 4DO5A 1C9DA 3MUXA 4LS0A 2YA2A 4HOWA 4TMCA 1W1YA 2ZWYA 3PZUA 4A22A 1HW6A 3D5HA 4W89A 4F2BA 4QX4A 5BU6A 3EA1A 2BVDA 5D4YA 3W82A 5LHEA 3GDTA 1UYQA 3LPOA 4JBRA 1E9ZB 2I9UA 1JNDA 4XAFA 2XINA 2R1PA 1R3RA 4IQEA 4HBKA 3ELFA 4QBXA 5REQA 1B4KA 4NASA 3V5CA 1PX3A 3EB2A 3IK4A 2SFPA 4QLKA 1ALDA 2DJXA 3QGAC 2YB1A 4LJ3A 4L5ZA 3C2YA 1W54A 2OKTA 1ZBVA 4E3TA 2QDEA 4C65A 3AHTA 4OVXA 1NM9A 4EK7A 1MW0A 1Q3NA 3EB3A 4AWTA 4XVDA 1E1CA 2AGKA 4O19A 1W5PA 2WQPA 4O18A 3PUOA 3LMYA 1KRBC 4KKXA 3W4RA 3N9RA 3ANUA 3GHRA 1FWDC 3USBA 4GQQA 2ZXBA 1VGAA 4AXNA 1BD0A 1A5CA 1NIUA 1EKOA 3LD5A 4OQVA 1W91A 1L6GA 2DPEA 1C8QA 2VO5A 4FXSA 4K1GA 1KCXA 5T26A 2D22A 8XIAA 1G4EA 4PFHA 1TJ2A 1YLVA 4DUVA 4JN7A 1EJTC 4NZJA 2ZX6A 1CLKA 1PYFA 3W23A 4C6EA 3CWOX 1O60A 2ISVA 2FFCA 2YBVA 4ES4A 3EWXA 4ICNA 2ZC8A 1ZBKA 5EMMA 1A3XA 2D23A 1M7JA 4ZGYA 3CUGA 3LDVA 4DUWA 5LSMA 4Q8UA 2QLYA 1H51A 2PDHA 2TSYA 5I09A 1HKWA 3APTA 3UZYA 4IXXA 4XISA 2BB0A 3W1UA 1GKPA 5E0KA 3WLSA 4GRSA 3W7RA 1M6JA 4I7WA 4CQBA 3CO4A 1G4SA 3AXXA 1R8LA 1B3ZA 2C15A 1YNPA 1GW9A 4HYWA 4DO7A 3W2UA 1KTBA 1EJXC 1ITQA 1M1BA 4AZCA 1GQIA 3HM7A 3P84A 4UFJA 4Y8FA 5C2CA 3P14A 4AD0A 5CGQA 2NQ5A 3F03K 4WOZA 3EBVA 1TYGA 3QZAA 3O16A 4F2UA 4BA0A 2PP0A 1NTHA 2VGIA 1QK0A 4RLIA 2OGYA 4E4UA 4QJ4B 2ZDSA 1VBGA 1EHNA 2W66A 3DX5A 1L8PA 1L6SA 4PRWA 2I17A 1YRRA 4OZOA 4HJWA 4KEZA 1KM5A 1R9XA 5A8PA 4HCHA 3A4AA 3WEMA 1KLYA 4HZ6A 1H09A 1OX6A 1GOOA 3K2GA 1T8QA 2BSLA 5C9ZA 2GJXB 1TV7A 3V7PA 3OLDA 4PUDA 1VPYA 3W26A 4FLQA 3TZFA 4P8UA 4EIVA 1PHWA 1TCDA 3LSCA 2WSYA 3GFXA 1PTDA 5K9DA 3ITOA 3WLIA 1LG2A 1QO2A 3PG9A 4XD5A 4AH7A 4LV4A 1FWEC 1GOIA 3EDKA 3E74A 3IPWA 1RJRA 3L23A 1XBVA 3ID7A 3EPNA 1TVNA 4L65A 3KCJA 3H2MA 3THQA 4ZB0A 4FB7A 2X16A 1VLWA 4GQRA 4XZIA 4DNHA 2GQ3A 3PFRA 3ZWTA 1PJ9A 2FB2A 4AVNA 1D3GA 2NQZA 4R9XA 4ZOCA 2XWDA 1SZFA 4IIEA 5HNTA 3O06A 2ADAA 2J7EA 4LXFA 5F4SA 3VINA 4B5UA 3SEPA 4FEZA 3M0VA 1O1HA 5BMXA 1OX4A 1W3NA 3O6DA 1E0UA 4GHRA 2UY3A 2EG8A 1JZ5A 3NQ7A 1ONRA 3F7JA 1CENA 4G2DA 1HVXA 1I1XA 4Y9MA 4KW2A 1T8XA 1XH1A 4U2YA 2VFDA 4DYEA 3PWIA 3ITXA 1X1ZA 1IT7A 3IVSA 1IZJA 2OEMA 1TRIA 1Y5VA 5CG7A 1CI1A 1LUCB 3BH4A 3W24A 1W6TA 5C2XA 2XVPA 3CLMA 1TELA 3RFAA 4MJ4A 4B9YA 2J75A 1DIKA 3N2BA 4JFUA 3FHQA 5LXEA 2Q8XA 3NSMA 1VAHA 2NUXA 2QF7A 3RUBL 4AWUA 1IHIA 3PTMA 2FMNA 4AEOA 2DGAA 3V75A 1F3EA 3RM4A 3SUSA 3V1HA 4U3CA 1Z6KA 1LP6A 3NO1A 5FF2A 3QKEA 4W8LA 1Q6DA 2JEQA 3SQMA 1Q7QA 2V0TA 4ONVA 5EB8A 4DZAA 4WJXA 1LQ2A 3H55A 4XZNX 3W00A 1DWAM 3ALGA 5AKQA 2ZXQA 3KHDA 3N13A 4OHQA 2PRMA 2YXOA 3B0PA 2Z4GA 4CD8A 2QV4A 2POTA 4IJBA 2Z1XA 3C86A 3TE9A 4L6HA 1TX2A 4LVAA 4MB5A 3VNDA 3W6YA 2A7RA 2XWEA 1DE6A 1AG1O 4NQ1A 4DJEC 3AUJA 3INPA 3W1PA 3ARUA 3OQ8A 4KFOA 4ZXOA 3PBGA 1UD4A 4DBSA 3OIXA 1CBGA 1NDVA 4UBPC 3SFWA 1R47A 1H1NA 5AZ1A 3URAA 2TPSA 1B30A 3S2JA 4K38A 2QGHA 3QSRA 1J11A 2ZBTA 4DWSC 3PBMA 4GG9A 4D6FA 1LOSA 1XD1A 1E4NA 1ZL1A 5BU9A 4HNLA 3LYEA 1AD4A 1G67A 2V68A 2O7QA 1OFBA 2Z2BA 6CGTA 1K70A 2O9OA 4Z2HA 3BMVA 4M1RA 1EC8A 1QPNA 3G1FA 2ZZ4A 4M19A 4D8AA 4LEFA 4BEUA 2BY3A 2NVAA 4FNPA 1B54A 3QHOA 4AX6A 1F73A 1ZENA 1RD5A 3N2TA 1OFOA 4JFVA 2OWWA 4GIEA 4GXPA 3ITYA 4DJEA 3LPFA 3R0DA 3A24A 1D8CA 4AZ5A 4J3UA 1TFVA 2Y8VA 1N82A 2B7NA 3PPFA 1EIBA 4DEFA 4AVFA 5I77A 3S1VA 3L5AA 3GDLA 3HPAA 3LCIA 1BF6A 3GG8A 3AS3A 4HA3A 3R1ZA 4C1LA 4FNQA 3WJWA 1DL3A 4MFEA 1XPGA 4XZHA 1EF2A 2BOGX 4LS1A 1QHZA 5AHLA 2VNCA 4REQA 5DF0A 4R88A 3EWCA 3S2MA 4B5SA 4UTIA 2PDIA 5AECA 4LF1A 2ISFA 4D8ZA 4EX4A 4PSRA 1JAEA 1HL2A 1OSEA 3IJDA 2W0UA 3P80A 2DUXA 2CZDA 4DRSA 3V4BA 3VIOA 2FTPA 3GXNA 2VL4A 3CIVA 2NSOA 3W29A 1TTQA 1V3KA 3W84A 3KAOA 3QGVA 4W8BA 4A8RA 2VENA 4DPQA 4WOQA 4ZODA 1A80A 4JZ5A 1XCXA 2I16A 2F6UA 2Q01A 4JN6A 4W7UA 4JIQA 3GXIA 3T0TA 5CAKA 4B4FA 3B8UA 1VFHA 2YA0A 4LH8A 3UGRA 1TPWA 2CHRA 1O6IA 1MXDA 3KZSA 1BKHA 3BPWA 2VX6A 3M0ZA 4DBWA 3GG1A 1JPHA 4JTHA 3FYOA 1WNOA 1SZGA 2X1UA 3DC8A 1LCOA 3Q67A 3NUKA 4U5KA 5D03A 3MV01 3FOKA 4DM2A 2OT0A 3FAXA 1MQPA 1W9PA 3WH9A 4RZ6A 5D04C 2VGFA 3RCNA 2A3BA 1EUAA 2DQXA 4S3KA 2V38A 4WD0A 1EOMA 4AZIA 3GAKA 3F1QA 3E6EA 3W85A 2VKZG 1A4LA 4ZOEA 2PGEA 1GVFA 1TQXA 4L6DA 3KRZA 4KERA 2JKEA 4UMAA 2YCEA 1O7AA 5MHBA 1A3WA 4IQLA 3LB0A 2CBUA 2FHBA 3U2CA 1O5XA 2W63A 4LUYA 1W5NA 4UTFA 4I5XA 1CLVA 6A3HA 2ALRA 3KDNA 3QHMA 3NSNA 1V6XA 3BQ6A 2BMBA 1QASA 3B8SA 3OG3A 1R85A 2XYLA 3TOPA 5DRCA 4MFDA 4O17A 4C6PA 2BZNA 3UNDA 1O66A 3WQ5A 2E40A 4X61A 2ZYFA 3BV7A 3R0KA 3UR5A 4AYSA 3UCQA 3VOIA 1PIFA 3HG2A 3T55A 3KW3A 2HK0A 2OOGA 3LUTA 4U31A 4KMQA 2C91A 5E70A 1V6VA 1UR8A 4LB3A 1PE1A 2IQTA 2PUZA 2QUVA 5LIWX 4MTVA 1KV8A 3LM7A 2HZGA 3ZT7A 3NO3A 5CJ5A 1R3QA 2IPJA 1M65A 4ICMA 3GC2A 1PV8A 2GSHA 2ZX8A 2IS7A 4J3VA 3L4TA 4RPQA 3T4WA 1EPXA 1AVAA 4AEEA 2GGHA 3N2MA 4GNJA 4Y90A 1R7AA 1IE7C 5BRBA 5IHRA 4IGMA 4PMRA 3BK0A 1IEVA 3QFEA 3TYAA 3VNZA 4HK5A 1I9CB 2ZUVA 3WMCA 3EOLA 3FGCB 2JIEA 4U2ZA 1XYMA 3VUPA 4O0ZA 1TIWA 3N4AA 4O57A 3TJ4A 4C91A 2G3JA 1IT8A 4O16A 4JHMA 2DV0A 5HULA 4BS0A 5DX7A 4QDPA 1TB3A 3AJXA 2Y7FA 1EZ2A 3RM8A 2E9BA 1RCXB 1KR1A 3VD4A 2CFFA 3KBMA 2P5NA 2CLMA 4IG2B 1U83A 5H1WA 1S3TC 4NXSA 4RX0A 4FF5A 4QLJA 1T5AA 4C6OA 4TV5A 1QFEA 2J4GA 3FGCA 3W73A 2REQA 2VFIA 2VDIA 1CXLA 3MP3A 3H70A 3AZRA 3LMZA 5DLCA 1GHRA 2Y8KA 4GUGA 3THUA 4F9DA 5KMYA 4POCA 4DJFA 4K3ZA 1W3HA 1QPQA 3HQOA 2I5GA 3B8IA 1GPWA 3STFA 1AZ1A 3VX1A 5I07A 2RUSA 2PODA 1NWTA 1N2VA 3EMQA 1ADDA 3SUTA 5DMLA 5D9PA 3RHGA 3WNOA 1XLMA 3VMPA 4F0LA 1DJQA 3TFXA 1Q4WA 4GKLA 1HKVA 4Q4RA 2V8ZA 4Q4MA 3G1RA 4XZMX 1FWAC 1CPUA 2DUAA 3GH4A 2ZX9A 4ADTA 3CK5A 1EXPA 3AI0A 5F4XA 5LNSA 1S3HA 1KO0A 5DY2A 1TWZA 2YKKA 5A8GA 3FIGA 1PUDA 2PGRA 4H8VA 4WGHA 2PDJA 1CXEA 1C7TA 4YLWA 6TIMA 3AIVA 3ZO9A 1FVPA 1UHVA 4CN1A 1A5OC 2IXUA 3H21A 3BW4A 4UQAA 2NQLA 5FF0A 4QIUA 2HXUA 5LHFA 1V3IA 3KP1A 1SFSA 4K8GA 3OGRA 3W72A 3PZQA 5GNZA 2CHOA 3FK4A 3TW6A 1DXIA 4XO7A 1Z8AA 3E38A 3FW6A 3GAYA 3FA5A 5EMUA 1KW1A 2WVVB 1LROA 2A6LA 2CBIA 4OBSA 2ZXDA 1ISXA 4QE5A 3CJPA 3PVFA 4Y9AA 1DKWA 2VVSA 2CETA 2PU0A 2W5FA 1OBAA 5DXXA 3EOEA 2GJXA 3MI2A 3T40A 4CCCA 2RGLA 4K8EA 4GUJA 2DT3A 1NH6A 2QYGA 4ZFCA 1EPVA 2A85A 4NAEB 3EMZA 1QOQA 1GYNA 2OEJA 3IARA 5D09A 1MI3A 2NXIA 4CLMA 1TPEA 2WCAA 2E77A 3QV8A 3LM3A 3N14A 3SY8A 2RJHA 5BXPA 1PB0A 4Q8MA 3LY0A 3DI0A 4HNTA 5AB3A 3EX2A 5CBIA 1N8FA 3H2NA 3T9PA 3UEQA 4MPQA 3BWWA 3ITLA 3BVJA 1UR3M 4W7WA 1XQKA 3G0SA 1THFD 2HJPA 2EHHA 4L9ZA 2CBVA 5T91A 1PCWA 3ARTA 3M0XA 4HGXA 3P62A 3AMKA 2JGYA 4WY0F 1YPFA 5A1AA 1M68A 1RAKA 2PTZA 2P0OA 3QPYA 3VKCA 3GG7A 1CIUA 4IP5A 1VFTA 1QCWA 1Q6LA 3SY5A 3NO5A 3FCPA 3E9AA 3R0UA 3GTFA 3ARVA 1GVRA 1KFCA 4GXMA 3UWYA 3FA3A 1OGBA 3VILA 3W2MA 1BVZA 3OVRA 4MDOA 1JXKA 3BURA 3T4CA 1GVSA 2BY1A 5LIXX 1BTCA 1LQAA 3K8KA 1DJGA 1R3YA 2FVKA 3MB9A 3ARQA 3FYYA 3VKAA 2PDPA 1CGXA 4ZFMA 5CCZA 3VZXA 3QRHA 1JZ3A 3VIIA 4FR1A 3W1MA 4US5D 3T1GA 2WZTA 5ECVA 1VYRA 2NV1A 1F9CA 1TIMA 3G1SA 1V6UA 3N4EA 1QI0A 2VWTA 4IX2A 3NVTA 3OBEA 2A3LA 2G50A 4LBSA 3KHJA 3SADA 4ROQA 3N29A 3CUXA 3IIOA 4B90A 1DJIA 5DCEA 2VX5A 2FB3A 3MO7A 1VH7A 4I9TA 2D2GA 4CGTA 1CWYA 1GG0A 3R94A 1WKFA 2BWGA 7REQA 1DV7A 4I9MA 4LUIA 1UKSA 2G8ZA 1J10A 3QBUA 5T9BG 4DPPA 1OYBA 1VCGA 4LVFA 1QPKA 5AZ0A 3GDMA 1B4EA 3WL0A 3O6CA 3P8JA 2WKLA 2WZEA 4QTGA 4UQDA 3K8LA 4WKAA 2W91A 2XISA 4LY4A 4AAJA 3CHVA 3UVIA 2WLYA 2PDLA 1CEOA 3TA6A 1XDMA 4PN2A 3UWQA 5EBAA 2GGJA 3G1DA 1F4HA 5F2IA 2X1RA 9CGTA 2QAFA 3M41A 2PDMA 4RL3A 1ADOA 4C1KA 1UB3A 2XGIA 3VDHA 4Z2LA 1FWBC 2QCHA 5I02A 3W27A 2XM1A 3WLQA 4LUJA 4IIFA 3S6TA 4QFUA 3CL6A 1IEQA 1VZWA 3APYA 4IF2A 3KCLA 1UCWA 4K8HA 4GYKA 4Q8NA 5CZJA 3WLLA 3ZLFA 2GSJA 2VT0A 1EL3A 4XZ9A 2VR4A 3DHDA 1EHAA 3UETA 2XTKA 3H6OA 2GGGA 2Q8ZA 1PS9A 2BVYA 1I1WA 4UQ9A 3TN4A 3BOFA 3CHDA 3W7OA 2J62A 4DJDA 1JYVA 1XV8A 5GQBA 3OLEA 2VEFA 1WDDA 1LWIA 1NFBA 3W7IA 1XYFA 3C2OA 4AZBA 3K30A 1V6YA 2GDQA 2BOFX 2E67A 1ZJAA 2F2HA 5K9XA 1W3LA 1J5TA 1FDJA 1EJVC 1HO1A 1NQ6A 3V36A 3GHTA 1UR4A 2FGLA 3MV11 3BOXA 1SJAA 2JIWA 2Z0IA 4NYYA 1E1EA 4CCEA 2I56A 3R10A 3UXLA 3LRMA 4MKNA 3I7RA 4FIQA 5TQLA 1XUZA 4E6MA 4ZOAA 1TRDA 4QSFA 2RH9A 3H12A 1XLJA 2X42A 3NVDA 3GR4A 1RK5A 2XVKA 3GFYA 1YBQA 1YBQB 3IIPA 3P93A 4ACZB 3R2GA 3DBPA 3TLLA 2Z00A 4QQUA 3UJRA 1FX6A 4E0CA 3TXVA 3M6YA 3VOCA 3ME3A 4KWVA 1LRTA 4QISA 1S5WA 4CNNA 1WZMA 1RBLA 3FHAA 1ODZA 4I8YA 1HF6A 3CQKA 2TMDA 2CLHA 4O15A 1BYCA 2GJPA 4B9ZA 4WKFA 3NL2A 2F38A 1E9LA 2VX4A 2GJNA 5XIAA 2ALDA 3IIZA 3REQB 3HV9A 4LX4A 3WDIA 4Z1YA 3PF3A 3IAQA 1ZS2A 3EPMA 3B9DA 1E51A 3A9BA 2Z7KA 1UMYA 1D9EA 5G2WA 4TMBA 1TE6A 1VFMA 2VELA 1F74A 3VGDA 3VO0A 2FZMA 2HQAA 1VRXA 3HQNA 2I5QA 3DU0A 5ABFA 3TJXA 2DZAA 2V2DA 4MM1A 4DO4A 3DBNA 2PE4A 4RPPA 3V5OA 4CD7A 5TIMA 1WAUA 4OV4A 3PZGA 5HUOA 1WDQA 4EXBA 3ABOA 3L4VA 1JRCA 3H2CA 1J6PA 3EEZA 3AJ7A 4N9EA 2TAAA 3GZAA 4H7ZA 2FYMA 1UH4A 3ZYZA 2F6XA 1RBAA 2WAGA 4ZTXA 3CMJA 3W88A 4UFIA 2O7SA 4CQDA 1R3WA 1MUCA 3FJNA 3PHAA 1RZMA 1OEPA 1FCUA 4IIHA 3KEHA 4MG4A 3SIZA 4W88A 4HNOA 4PBEA 2Y2WA 3AALA 2Q71A 4OGZA 1NWRA 4TR9A 4FP1A 5DBUA 2P76A 4RZBA 3RG6A 2J6VA 3KRBA 4WQ6A 2OYKA 1S2UA 4W84A 3K1GA 3L68A 1E9IA 3SQSA 3S8HA 1TPC1 4AZ7A 2PI6A 4O1EA 2G96A 3BAIA 3WFAA 4D2JA 2A5HA 3TSBA 4EANA 2EG6A 3O6AA 1JI1A 3VM5A 1R3SA 3GHUA 3WNPA 3BUVA 3NDOA 3PJXA 1K8ZA 1ONWA 4HMNA 6TAAA 1H63A 1JCXA 3UG4A 5HMFA 2IKGA 2X2GA 4GE8A 3M64A 3VZZA 4RDVA 1OT2A 1TCMA 1W1ZA 4MZ1A 3O1NA 3FV9A 3M4HA 4GI4A 2FVLA 1LL4A 2AL2A 1ZSXA 2Y7EA 4CD6A 2C16A 1XG4A 3WO8A 3EXRA 3AS0A 3RJYA 3PSWA 3AO0A 4N4QA 1HUVA 3NXLA 2G3MA 1UWIA 1GHSA 2FHCA 2F6KA 4B4HA 3S1XA 3SUWA 4ZQOA 2VD8A 4JHZA 3OA3A 1VJZA 1R2RA 3MP5A 1W9XA 1XRSA 2NV2A 3JZUA 2X1TA 5CC6A 3NWRA 2CZFA 2PAJA 3L66A 3ABZA 1AJ0A 3K4AA 3SJNA 4J4KA 2GVEA 3SGZA 4FF7A 4Q6JA 3V16A 2WJZA 4Q7BA 2FIQA 2PEVA 1GCYA 3G18A 2CWNA 1P48A 2BS9A 1H0IA 4C6QA 3TDFA 1W1TA 3UWZA 1IGWA 3SECA 3IRSA 3PNUA 3G6LA 5FJRA 2NSXA 2GJRA 3EX6A 1XIFA 4GUFA 4S3EA 4IMAA 4DWSD 3MS8A 4GCAA 3CC1A 1L9WA 4HU8A 2J24A 1Q63A 3ZR4A 3W28A 4ILSA 5LA1A 3UXDA 4R7JA 1KTCA 5J8LA 3CM4A 1UOKA 3ZS4A 3FJLA 3B9NA 3PZ9A 4KH2A 3OHIA 1V02E 2CESA 1KNWA 3A4JA 3ITGA 3DHPA 1BF2A 3FKKA 1RV8A 2AGTA 4IMGA 1GTHA 3QQ0A 2Y24A 1L2QA 2BGNE 5ECUA 4JQ1A 3R11A 1EZWA 4UXDA 1WOBA 3PC0A 3ERPA 1EO7A 3C56A 1QW8A 1F8IA 1D8WA 2QNEA 3T05A 4Q7IA 4GXWA 1RD6A 4Q3MA 1E4MM 3K4DA 3VFLA 3W2LA 4GOAA 3TU9A 4NI8A 3DEQA 3PY2A 4N42A 4OTKA 2E28A 3LHUA 2VC7A 3UWEA 1NQKA 5L6UA 4NAEA 4AY7A 3ABRA 3I4KA 2VC5A 4IHCA 1B3XA 4YYCA 3N04A 3SN0A 4JDYA 4Q8QA 2VP8A 1HKJA 2VFFA 3LCFA 2HPMA 4DXKA 4MNJA 4PTVA 1KKRA 2IUZA 4MYAA 3OTRA 1B2YA 2XN1A 2A3AA 2GUYA 4UTUA 2JF6A 1AL7A 4RW5A 5LA2A 1B0IA 3M44A 4FX6M 1KM2A 1FWGC 2BXZA 1UR2A 1N8WA 4JTIA 4KEMA 5A69A 3QZ6A 4J9JA 1XRTA 1GORA 2CIPA 2W9MA 3ZXWA 3S3GA 1E4LA 4V1YA 3LOTA 4JN8A 2OO0A 2QF8A 4P8XA 3VPLA 2DQWA 4KCVA 3I3DA 3WMSA 4PTNA 4TO8A 4Y7EA 4AG0A 2D20A 2JQXA 4WXZA 2Z7GA 2Q3RA 3OBKA 1DJNA 1HJXA 1WE5A 4UFMA 4W5ZA 5GNYA 1NU5A 3CAWA 4DUXA 1UD5A 2J79A 4H04A 1XLEA 4X3ZA 5HXMA 5HUPA 4AWSA 2G41A 1UD8A 3OYXA 4IMDA 3CZEA 4V28A 3IV3A 3USZA 2HEJA 2OB3A 3O3RA 1US0A 2YL8A 2WOQA 4DF0A 4H9TA 4ZSUA 2UZ9A 1HJSA 1F6YA 7ODCA 2ACQA 2DJLA 2Y88A 1RQEA 4PMYA 2VEIA 4DN1A 4OIFA 2A79A 1GONA 1L6FA 3VIKA 5M03A 1FWSA 1VCFA 3F4WA 3TAKA 4EACA 1EC7A 1OC5A 5HQEA 2QPUA 3BL3A 4DM1A 4IOTA 3LX9A 1EOKA 1E6XM 1XLCA 1NY1A 1HIZA 2VCAA 2ZE3A 1VFOA 1H50A 1QBAA 5IHSA 3WLRA 3LERA 4NAFB 2RHGA 1XD0A 4CQAA 1Q4NX 1GW1A 1O5QA 1A0EA 3JW7A 3ITTA 4C7GA 4BCEA 3U7VA 5BWAA 4QEHA 2D24A 2OEKA 2WHJA 3NQFA 4LCSA 1W31A 3W7EA 1SFJA 4FS9A 1RCQA 3M0JA 1REQB 3BE7A 1REQA 1RA0A 3ZSSA 4HNVA 3WG6A 4BWLA 4KWWA 4LVBA 1MUWA 3QOMA 5HA7A 3R8HA 2UWFA 1M53A 3E49A 5GJMA 1U5HA 1NARA 3FNDA 4Z17A 4WDXA 4PE8A 2PWFA 4M0XA 2YJQA 4OE7A 1KKOA 1G6CA 4UCFA 3TFCA 3DYPA 2V5LA 1CX9A 3A47A 3WEOA 1TWIA 3L4ZA 3M6DA 4HSOA 5A2CA 3QJAA 2VFEA 3L0NA 4U10A 1F7BA 3FKRA 3LI0A 3EPOA 4AHOA 1LJYA 1HFBA 1EEPA 1XBYA 3RX3A 4M51A 4RNJA 2CXGA 1KA9F 2CEQA 1Z42A 3CO8A 3MVIA 1BYBA 4O11A 3W7MA 3MPGA 1ZCOA 5I06A 4P8VA 3TTEA 4Z08A 3IGHX 5KEZA 3OZPA 4WY0B 3ARWA 3UNTA 1ISWA 1AUSL 2OKOA 3RR4A 3CT7A 1CGUA 2PU1A 3WKZA 4AQLA 3RIKA 1WPCA 2R82A 3CU2A 2CWXA 1YYAA 2OELA 2UY4A 3C3NA 3V35A 5HR7A 2VEPA 1OF8A 2PSNA 1OD0A 2KZHA 3ZT6A 1QOXA 1VFFA 3QPZA 3MDWA 2F8QA 4DXVA 3GU9A 3L0KA 4GYPA 1O5KA 1XICA 5E9AA 1LL7A 5BOOA 4ZSTA 2NXHA 5JMUA 2NVDA 4RZ5A 3GDBA 1X1OA 1LUCA 4J7RA 1ZCCA 4Z1BA 2EPHA 2GDUA 1KM1A 3R58A 1GT8A 3QY8A 1W1A1 1QNVA 2G4JA 5IRPA 1ZBWA 4E38A 4UTWA 5LIUX 1RHCA 3BZGA 1CGVA 1ZY9A 2OMAA 2PLMA 3GW0A 4N0RA 1YPIA 3RM9A 1HJWA 1D3CA 2DP3A 3HBLA 3N6QA 3BSGA 2DW6A 3WUEA 3E5PA 2FTYA 1HVQA 4QITA 3HIJA 4BI7A 5H8MA 4OUIA 4IGNA 1XDLA 1S38A 2J8GA 2WYSA 1T41A 4M29A 4UFLA 5U4NA 1QTWA 2ISDA 1YE4A 4WZHA 2FDMA 1DVJA 1A49A 4H9XA 2R14A 3W07A 2O0TA 1VCVA 2NUYA 4G7FA 3TYUA 3WBWA 3WN6A 3WJXA 1EWDA 2Z2UA 1FHDA 1P4CA 4BQ2A 4ZMGA 5BNKA 3PS7A 1FWWA 1A5KC 3OBAA 2ZZ6A 2P8BA 3REQA 3RF9A 1SGJA 4LYKA 4E8GA 2PDKA 4O14A 1PYMA 3BLPX 3W2JA 4C6BA 4GACA 1AH0A 4QNWA 2Y89A 1V8EA 1AH4A 2OWCA 1XF0A 4Q22A 1VLIA 4GX9A 4R7WA 3LGGA 3GUWA 2NLIA 3WH7A 1P0NA 1TTJA 3ZVHA 3VK5A 4XBJA 3KOZA 3L2LA 2JALA 4OJYA 4PC8A 2ABAA 2CZ5A 2XPKA 2DSUA 1AMYA 1G7VA 3IIVA 4I6KA 1EJ7L 1H7NA 3KVJA 3GR7A 4IT1A 3UESA 4Z2KA 4D6GA 4LUTB 2VWSA 4FOUA 2VGGA 4I7VA 4X0NA 1WKDA 3MSGA 1XINA 2RJGA 3RXZA 5G2HA 1VEOA 3OEXA 5HMDA 4JCMA 2CLOA 5H8UA 3SO7A 2WQDA 4RDWA 5HBFA 2R1LA 4NT0A 4FXRA 3AICA 3ONCA 1P0EA 2DSKA 3NPVA 3VOGA 4U5IA 2D0FA 4MZYA 4LQ1A 3SR7A 3JU2A 5JH2A 3S5YA 4XV0A 4R34A 3DECA 3E2QA 4A2SA 5D38A 3HOJA 3PZOA 2HE8A 3JS3A 1XIMA 1QI4A 1MNZA 2DU2A 1TPDA 1OFEA 2OCZA 2GVLA 2WHLA 3UZJA 4NXKA 3GNPA 3MMUA 4JTDA 4QE4A 3T44A 3WD4A 4OBTA 4WJ8A 1E6ZA 2BBFA 3QW4B 6REQA 4PULA 2VR5A 4XAPA 4QM1A 1ITXA 1WUEA 4EPKA 1YDNA 2XH7A 4NILA 1BPLB 3VIPA 2FZ9A 4GY0A 1RJQA 2PDUA 4IL2A 2PZNA 3VGBA 2DZVA 5KINA 3VFCA 3IVUA 4M82A 5AHNA 3SAZA 2G5WA 5BRPA 3OHMB 2HE5A 4S1FA 3RGTA 5AHMA 3WQCA 1DQXA 3CWHA 1I6NA 1OG0A 2E7FA 3LRKA 2OQHA 3QLDA 1W5OA 4JTJA 1UC5A 4RV3A 3CYVA 2C1HA 1JCNA 4CNSA 4PYSA 1FBAA 5FESA 2AL1A 2WO5A 1G9HA 3CPUA 2C6QA 4KCWA 3TYCA 1FXQA 4GVHA 4MWAB 1Q7ZA 2CERA 3W9ZA 2YFNA 4IIBA 1W5MA 5I78A 3TH6A 1OIMA 1OFPA 3TNBA 2I14A 2VEGA 1IXNA 2WV8A 1FWFC 2D2HA 2W27A 4S3AA 3GZ3A 1RSCA 1UZDA 3MHFA 2P10A 4BQ5A 1RP8A 3TMLA 4K6AA 4WX2A 4REQB 4HHMA 3PNZA 3AC0A 4BWLC 3W7PA 1W3TA 4XB3A 3VDAA 2WWDA 2FFIA 4PEKA 2BHYA 5HMEA 1FXPA 3CUHA 9XIMA 3L21A 3MHGA 5HQMA 4R27A 3U0HA 4JTSA 3VGFA 2PTXA 4C6IA 3WQ8A 4RCXA 5HK4A 3TW7A 1TMLA 1VBUA 1KRAC 4GABA 4RNFA 4HD5A 1IWBA 4KWUA 4JQ2A 4L56A 4YYFA 4MKVA 1S39A 3DFQA 1ZNNA 2OX1A 3I3BA 3KOYA 5DT7A 5I6SA 1NOWA 5I00A 2W6RA 3BANA 4GINA 5A3HA 3OODA 3GC4A 1IEXA 3NGJA 3VIGA 4H4IA 1TTPA 3GTHA 1RR2A 2YR1A 2A3CA 1HP5A 4AMCA 1AJ2A 4ROPA 1UPMB 4YMZA 1TMQA 2D0HA 2E6DA 2GWNA 4J2PA 3JVAA 5HJYA 1RXOB 3DHUA 5EBUA 3C52A 3OLIA 1NFPA 3G5EA 4M3PA 1XBXA 2ODOA 3S83A 3A3WA 4QS6A 1TX0A 3M46A 4LOCA 3AXKA 1QDSA 3PTQA 2Y70A 5D2WA 4DAIA 3LGDA 4D6HA 4JTLA 3IS4A 4XZLX 3MBFA 2WJEA 2VI0A 5A2BA 4NIRA 2CYGA 1WQ5A 4KQNA 2J7GA 3CT2A 4UTTA 1E15A 1H49A 3U3HA 2ZVIA 1KRMA 3BTNA 1FRBA 2BFGA 4YIWA 5MKGB 4GQ0A 1BLIA 4P8WA 2G95A 3C0SA 1U22A 2Z1SA 3A5VA 4XD3A 1H2JA 1O4UA 4OFCA 2B7QA 4LCQA 3CAVA 1N8IA 2PBOA 5IBXA 5KSWA 4P61A 3O63A 3VCCA 4KRTA 3L65A 3TEVA 1HKIA 1OGGA 4IICA 3WQOA 2CCRA 2Z1KA 4GFSA 1FWRA 3B05A 5F2GA 4A3RA 1I4NA 5AYXA 5C7HA 3BXWA 5LGZA 1XKYA 2GK1A 3KOFA 3PPGA 3RPDA 2X41A 1S2AA 3AFBA 1MEHA 3MVTA 2TYSA 4HCDA 3SQLA 5KITA 1BEUA 3G0UA 1H3GA 1RVGA 4AZGA 1ZFJA 1AW1A 5I7GA 3GNOA 1ZZMA 3GIQA 4ACZA 1N55A 2IQDA 5TNVA 3W7GA 1C93A 2WB5A 2PFHA 4QHRA 3EA3A 1RP9A 4A05A 4EXQA 2QQ6A 4I3GA 1P5BA 3C0QA 3CUFA 3LLXA 4IL0A 1UH3A 1SO5A 1NF0A 3QLLA 4DYJA 2QV5A 4JKLA 5BOEA 4MIMA 4PB3A 1XYAA 1TTIA 2FKPA 2WMIB 1JPMA 3R6IA 2NWSA 6ENLA 2YLLA 3UZ5A 3WQDA 1Q2RA 4P2VA 3R43A 1QPOA 2G0WA 1AW5A 3DFTA 1ME9A 1UWQA 3IWPA 4AIUA 2E9MA 2QULA 2GVGA 4LUSA 5G5IA 5D8WA 2OOFA 2UY2A 3TP4A 2AL2B 3NM1A 5B80A 3HMJG 4MDPA 3QTGA 2QR6A 1HKMA 3G24A 4YN5A 3RO6A 2WZIA 1O68A 4HB7A 4JICA 3TNOA 4Z1DA 3EWZA 3W25A 3MMDA 4PUJA 1K7FA 1XLBA 4IGHA 3AIEA 2O92A 3AAMA 5EMJA 4DAFA 4DF2A 3LCGA 2XVNA 4LALA 1JUEA 3AHXA 4UTJA 5HWJA 3HJEA 3KRSA 1PTAA 3F4VA 3R4IA 2GOKA 1XLFA 3C8NA 1M01A 3TQ0A 4B2DA 3NQ2A 4TOQA 4KETA 3NL3A 1BG4A 3ECQA 4KT2A 3NGFA 3TQVA 3V1PA 1ISYA 4A29A 3KVLA 2V5JA 5I23A 2ZQ0A 1NSJA 3WF3A 4PMVA 5LIYX 1U30A 3P0XA 4HN4A 2I9EA 4HTYA 2UV8G 3EYPA 3L2MA 2XIBA 3HJZA 4ERGA 2C14A 3GG0A 4H6QA 3W7NA 4AZ6A 1VD6A 4M6UA 4F0RA 3ZT5A 1I2RA 4E5TA 1XLGA 1T0OA 2ZZ7A 1KM6A 1KXTA 4JDBA 3BO9A 4TTUA 5HNUA 5ABGA 2QMKA 4BJHA 3SURA 3S2NA 1SW3A 3U6WA 3G77A 2C71A 3T2QA 3UG3A 5AY7A 1JPIA 4O8RA 3TX9A 5IFTA 4L61A 4TV6A 3VD3A 4H19A 2GLKA 2VOMA 3CV6A 4C6DA 4MY9A 3ICJA 3WYZA 5CC5A 1YXDA 3QQWA 3P6LA 3I65A 1B9BA 4TIMA 4PMDA 4WIWA 1OT1A 4Q4SA 4RDZA 1IEIA 4N7QA 1OX5A 3VZYA 1J4EA 3CV2A 2POZA 4BK9A 1SMDA 4ZA0A 4O53A 1HTIA 4NAFA 3NCOA 4Y9NA 4LF2A 5CQ1A 4O13A 6ALDA 3SJ3A 1XLAA 4URIA 3NTYA 4GNKB 4JS3A 4AC1X 1WUFA 3LCLA 3N6HA 1R3VA 1DJXA 3SY1A 3M7SA 3H22A 3CGTA 1KQYA 2IMRA 3ITVA 3BMWA 1E73M 2VRKA 2V81A 4N9CA 3VX0A 5A8NA 1FKWA 1VJIA 3VGEA 4GC3A 5J04A 3QC3A 3CHEA 2WANA 3NOEA 5A6BD 1FCQA 2KAUC 2VFHA 4D6EA 5IM51 4N6EA 1V4YA 5CXPA 3IGSA 1CGYA 1VENA 3UY8A 4FNUA 4RNHA 1HX0A 3H2OA 4ERIA 3PULA 3WJZA 3F2BA 2X1SA 4QJ3B 3PPHA 4KWSA 1XLDA 2WJFA 4QROA 3ABQA 3T2PA 1XYZA 3A21A 1IIHA 3N9SA 3G8RA 2GJLA 4KEUA 2JKAA 2OSXA 3TTQA 1PCKA 1UD2A 5HDRA 2J47A 2PZ0A 1JF6A 1UUQA 3O15A 1A3HA 1E71M 3PZNA 3GXFA 1JDEA 4YVXA 3NQAA 2WHKA 3KE0A 1TE1A 3QW3A 3D0CA 1YDYA 1RY0A 2VTFA 2PCQA 1MMFA 4XAZA 4O54A 4PCFA 3UA4A 3WLOA 5C9XA 2GUBA 4DF1A 1VFLA 2QCGA 3QGKC 3UJ2A 4D71A 1UWUA 1UW9A 1Y0EA 5XINA 5FF7A 1Y65A 1W2VA 4LAUA 3W7HA 3H7UA 1IGSA 1DIDA 4JX5A 3GKAA 2W3ZA 3BAWA 2VDGA 4M7TA 4RXGA 3C2VA 3QC0A 3EA2A 1W0MA 4QCEA 4ENLA 2V5BA 1JQXA 2YZ5A 4C7FA 1DBTA 2VZVA 5FJPA 4JOMA 1T7LA 1YX1A 3W74A 5ABEA 2VMFA 3TAOA 3BAYA 3TMQA 3PN8A 3D3FA 3MYPA 1J0JA 1ZJHA 2HDJA 4JKMA 4LNYA 1NF7A 1K8CA 1XYBA 1XCWA 1OVDA 2UBPC 4WKHA 4S39A 1BYAA 3KLLA 4LU0A 3LA4A 3MQTA 1QO5A 1MZHA 1XC6A 2DIEA 1LRNA 3AHZA 3Q94A 3W7JA 3E0WA 3W38A 3ARPA 1IR2A 3RK8A 1UZHA 3EWWA 3F5KA 2YCJA 4UTMA 2X0HA 4ZO7A 2CHNA 4HMDA 3DGBA 2QJHA 5HATA 3T8QA 3QR1A 1QW7A 3B0XA 1KFBA 4FOKA 5SWUA 5JIPA 4F2TA 3R89A 1YNYA 4XTDA 1Q8AA 3UW6A 5D8ZA 1AL8A 1MRQA 3GXDA 5AYYA 5M5DA 4ASTA 2ZA1A 3S6OA 1KCKA 4UTHA 4Y9OA 4D8LA 3LBCA 3BCFA 1GOXA 1SZRA 1BRLA 4PMUA 1W8SA 5AHEA 4BKNA 5ABFB 4K2SA 3WBAA 5JVLA 3Q4DA 4GY1A 2ZUWA 3KS5A 4K36A 3PAOA 2OLHA 5DQPA 1TA3A 1ZJBA 1T40A 2QVNA 2OLAA 1JG9A 1LLOA 2XVLA 3AZSA 3SCSA 1RCOB 2XSXA 2MUCA 4GZJA 4PGLA 4DO6A 3KBVA 4MUPA 2YCLA 2ZICA 1SFLA 4AHQA 5A8QA 2J9ZA 5I03A 4IMFA 2GOUA 2FLIA 3B8TA 3VNIA 3QH2A 3U2ZA 3CZGA 2NZLA 2PWVA 2J74A 1QMLA 1W9DM 1S2WA 1LT8A 3I6RA 3MANA 1JIBA 1ZP4A 4MJMA 2Y5EA 2GQ9A 2GQAA 2O4QA 1U1HA 3N2CA 3B8DA 4NI3A 3QQ1A 1JR1A 4XSLA 3DG3A 4B5NA 3VKKA 2QJNA 2XSBA 2RAGA 1OYAA 4S2BA 2QUUA 2G97A 2WXDM 5CBJA 3CIXA 3MDUA 2QJMA 4Q6XA 4RUBA 1ISZA 3URNA 4MNMA 3VKJA 1JYXA 5LXXA 1US2A 3RRAA 3RU8X 3T0AA 1QNOA 4JY9A 5C9RA 3UJFA 4IWWA 1SVDA 5CPSA 3U8GA 4WXYA 2AQWA 4JIHA 3ES8A 1XPYA 3G8EA 4C7DA 4H9UA 2YPIA 1UJQA 2EKGA 2WKJA 3A22A 3GK0A 4JD4A 4PBGA 3FVMA 1DPMA 1J18A 3NQDA 2Q02A 1LBMA 2OODA 2DT0A 4RK8A 3VCNA 1VB9A 3L12A 4MMWA 2HWGA 1P6BA 1R2TA 3FEMA 3VVGA 5A6SA 2NWRA 1GVYA 5CC3A 5JQ9A 1EBHA 3UWUA 1HGYA 1J8VA 1L0PA 5KTLA 2YA1A 1C29A 1MNSA 2X30A 3CB3A 2B81A 4IUGA 1TJ0A 3TLQA 1AA1B 3JR2A 5LKYA 4XG1A 1DHPA 4JHOA 3FY1A 5BXTA 1XIDA 1JF5A 1Z9AA 3O2LA 3OW1A 3SM0A 5C71A 4G1NA 4LYPA 4JTCA 1VC4A 3RDKA 1XIEA 5DCDA 1HJVA 3N3TA 4E8CA 4MB3A 5AC5A 1Z41A 4UZSA 1P7TB 5FEPA 4G5DA 2WSQA 2WBGA 3N4FA 1K3UA 4DBEA 4HCLA 3EXSA 1CB7B 3RR1A 2INFA 3KCOA 3S0CA 1KFWA 3SRHA 4ZE5A 1V0LA 4ZZ9A 4KFNA 1R0MA 3MI3A 1EQCA 2YBTA 1MQQA 4AC7C 3WDQA 1BXCA 1LRQA 3WD3A 3W53A 1K7XA 3WJSA 3MCNA 1JDDA 2NQJA 1WKYA 5I3DA 3LI1A 1VBJA 1EP3A 4XK2A 1P7TA 2EF9A 2GFTA 4G7EB 3AHYA 1TO3A 4GJJA 4ADUA