4DF1A

Crystal structure of orotidine 5'-monophosphate decarboxylase from thermoproteus neutrophilus complexed with inhibitor bmp
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
199
structure length
199
Chain Sequence
NLPLVVALDTEVLKAIDVAKRLKGAVAGFKVGWDLIFEGGISIVGEIARYGNVIVDLKIADVPHVASRVVEKLVNRGACCVIVHGFLHPSLPRGQHVYVLVKMTAPTIYDEMWEKLLNSVQDVRGFVLPGNQPEVVAQARKRIGCSYRIISPGIGPQGGRPGAAIEAGADFEIVGRYVLEDPARISQWAQYRPTCFETP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase/lyase inhibitor
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Crystal structure of orotidine 5'-monophosphate decarboxylase from Thermoproteus neutrophilus complexed with inhibitor BMP
rcsb
source organism Thermoproteus neutrophilus
total genus 70
structure length 199
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4df1A00
1JQXA 2BX7A 3JR2A 3NM3A 4PC8A 3BV4A 4UFIA 4OV4A 1MEWA 1WBHA 4R33A 4OV9A 2FPVA 2NX1A 5CSRA 4R34A 3MI2A 4HN4A 5CZSA 1EP2A 1Q6OA 1SPQA 3MHFA 1FWNA 1VH7A 5CGQA 2Q8ZA 3L68A 1W5NA 1P1XA 5CPNA 4C1KA 2QUUA 4NNAA 4NQ1A 5LZLA 2Z6IA 6TIMA 4BF9A 2OZ0A 5DCDA 2DORA 2QJGA 3FEMA 4HPXA 1YYAA 3EWXA 3M44A 3TROA 1DL3A 4K8EA 3NOEA 4HT3A 3LI1A 3W7CA 5D03A 1EWDA 2J27A 1LP6A 5KITA 1F74A 3FS2A 1GJPA 4PH6A 5IM51 4YCPA 5D2TA 3ATZA 5DN1A 4LS2A 1X6UA 4BI7A 1JCNA 3OVRA 3P7YA 2QCMA 2C15A 3DU0A 4UTMA 4JX5A 1KFKA 3TDFA 3QEZA 4O54A 2TYSA 1LDCA 1WX0A 4WY0A 4O15A 3TCEA 1HG3A 2JKPA 2I9EA 4FNTA 4WZHA 3STEA 4A2SA 2C13A 3IVSA 1YADA 4AHQA 3P5YA 1FWSA 1TB3A 1GVQA 2G95A 1D9EA 2WV8A 4N9BA 5HULA 2WKJA 4OT7A 3W7MA 4O57A 2B7NA 3N73A 3MBFA 3NGJA 1L9WA 4MFEA 5F1VA 2PE4A 3L0GA 5U4NA 1KBIA 4IWWA 4N9CA 2F84A 5A8GA 4JYDA 1Q6QA 3GR7A 2ZZ5A 3PM6A 4LVDA 4KWWA 5KMYA 4JTSA 1J2WA 4IX0A 3BARA 4Z08A 5FEPA 3TMLA 4H4IA 1FWWA 2VFFA 1TO3A 1K7FA 4M5PA 5D04C 2Y88A 3SR7A 3WK1A 1OFRA 4HNUA 5C5YA 3TJLA 3EXRA 5F1UA 3RLVA 4MJMA 4FXSA 4H3DA 1XUUA 2F7FA 2QCCA 4ICNA 3V1PA 4JX4A 1A50A 4UTHA 5I3KA 4XKYA 2QCHA 2VFEA 3FKRA 1SR9A 2ABAA 3E96A 2QUTA 3HGSA 5G2WA 1YTKA 5BW6A 3UWVA 3PUDA 4UTLA 1S5TA 1H51A 4WY0B 3I7RA 3GX9A 1VYRA 2R8WA 1WQ5A 3NG3A 4XTIA 1Q6RA 1DQXA 4GUIA 4Y90A 2TMDA 2H6RA 2CZDA 2R91A 1M7PA 3LCFA 2FFCA 1VCGA 1GYLA 3O05A 1VLIA 4NJKA 4LC8A 4MZ1A 1KV5A 2RDWA 5DCBA 1KTCA 3L2IA 5AOUA 5L9FA 5AHLA 2E6FA 2DZVA 1GOXA 1QOPA 2QR6A 3QH2A 4H6KA 3W2UA 1QPQA 1VZWA 3MW7A 3PVFA 4LUIA 1JUKA 3THQA 2ZA3A 3W2KA 1IXNA 3M16A 4BWLA 3W9ZA 3QPYA 4AHPA 4RXGA 3KRSA 4MZYA 3W1TA 3DFOA 4AF0A 2CZ5A 3O6YX 3VNDA 3TXVA 1WOBA 1FBAA 4WJEA 5LNWA 2CLLA 1W56A 3IEBA 5K2ZA 3QFEA 1HL2A 3OA3A 1SU5A 4JIQA 4Y6GA 3NXFA 2ALDA 2GVLA 3FIGA 1I2QA 1QWGA 4UNLA 1HO1A 1F5ZA 3DI1A 3PWAA 1KV8A 1FWTA 4CCEA 1OYAA 1TRIA 3EKLA 3EX6A 5FF3A 3C2VA 3SZ8A 4LU0A 3CT7A 2VFIA 1G7VA 3ZS4A 3GDRA 2JBMA 2UV8G 3R5EA 1J5TA 1QPRA 1KLZA 4JEQA 1O5KA 3L0KA 1LROA 3SGUA 4RX0A 2R94A 4MFDA 1VCVA 5D33A 2C19A 1W3TA 3CU2A 4N2YA 4JTFA 3W7HA 1O4UA 3UD6A 1H50A 4X9SA 3TQKA 1TPH1 4IMCA 3QYQA 3MO7A 1N8FA 4DBEA 1GEQA 3B0UX 4DBDA 2ZTJA 4YLWA 1TCDA 3I68A 4NJIA 4HNVA 1WYIA 4FIRA 1LLZA 4TMBA 3U6WA 5CPOA 4L4LA 4A22A 1JJKA 3GDKA 3LM7A 3W70A 4UXDA 5K4XA 5CZTA 5KSWA 3N2MA 1FUYA 4AF0B 4O1CA 4DQWA 3B06A 1OYCA 4NXKA 3IGXA 3G3MA 5FEWA 4UFLA 3FYPA 5AHFA 6ALDA 2YSWA 2V9DA 1UUOA 1X1OA 3NQFA 3QSTA 4ZL1A 1TJPA 1KA9F 1NSJA 2A7RA 4PL2A 2A21A 3QW3A 3H53A 1OFBA 1Q6LA 5J5DA 1OYBA 3LHWA 2X1SA 3W72A 1Q45A 1EPXA 3WJXA 3W87A 2B0MA 2ZRVA 3GIYA 4IXXA 1OFOA 5EKYA 3A23A 3EXTA 2V82A 4ORMA 3TFXA 3W73A 2H8ZA 2WOQA 4MY1A 2VXNA 4FNPA 4E0CA 3GB6A 1XM3A 5LSMA 3IV3A 1W1ZA 4M7TA 2CFFA 3TUUA 5D32A 5EA9A 3B05A 3I7QA 5SWUA 2ATSA 4DF2A 3O16A 4XWUA 2DJXA 4MLRA 1W0MA 1IIHA 2PURA 3NQAA 1MXSA 2QCDA 4PFMA 3IIXA 1R47A 3PG8A 1XBXA 2H3DA 2Y85A 3IIVA 2OJPA 4YXGA 4JTTA 3MBDA 3LHVA 4GRSA 1P5BA 3ABSA 1TQXA 2EKCA 1JCYA 1V7YA 5E0KA 1FQ0A 1LBFA 1OX4B 4HPJA 5HUPA 3BG5A 1ML1A 1FCQA 2ZRUA 2A2IA 5FEXA 1TJRA 3BGGA 1B57A 4X2RA 1OFEA 5BOOA 4MKNA 1OABA 2OX1A 3B0PA 3GDTA 2J6XA 5K9DA 4O0ZA 3NQGA 3TR2A 2QCLA 3KXQA 4TR9A 2C16A 4JTJA 2CLHA 4IPJA 4NX0A 4I7UA 2B4GA 4R7JA 3M0ZA 4DPQA 3TQ0A 3E02A 4O16A 1JUEA 2P1FA 2E5DA 1H63A 5HUOA 1VGAA 3W23A 3EX1A 3W1UA 4GWEA 3HG4A 2VOMA 3LRKA 5K7JA 3QSRA 3W1LA 3NQMA 1VQTA 2V2HA 1JUBA 3EXSA 1TPB1 1QMLA 1U83A 2IQTA 3TIMA 5D30A 1TPFA 4I9AA 2OT1A 3PB2A 4U28A 1MEIA 1X7FA 3S5OA 1T96A 4QAIA 5HNRA 2LLEA 3Q37A 1LRTA 2A0NA 3IVUA 3R89A 1CW2A 4M7SA 4DXVA 4Z1DA 4O0KA 1RPXA 4HHPA 2QDGA 3S5NA 3MYOA 1K3UA 4ZMGA 5IBXC 5KTLA 3O1NA 1SZNA 3C8FA 4RV8A 4O8RA 4U4MA 1RQEA 2WSYA 3C4UA 2NZLA 4FNUA 3O06A 3CHVA 3WK0A 2QJIA 2W0UA 4Z0JA 3NNTA 3PUOA 1Z48A 4GJ1A 4R53A 3S1VA 3P8IA 1NFBA 5HMSA 4O11A 2CLEA 3G0SA 1I2NA 1ICSA 1XBZA 4CNNA 1QNVA 2Q3RA 3QRHA 5G2HA 1ZENA 3L5AA 4Q32A 1CX9A 1DORA 4S2BA 4N4QA 3TSBA 4WOQA 4N6FA 3VCRA 4K8HA 5D37A 3GZ3A 4KFOA 3IIPA 2FPYA 1P0NA 2ZRWA 4OHQA 4DO6A 4TIMA 2FJKA 2B7QA 4P2VA 4CQ9A 2QCNA 4O19A 1H7XA 4RJEA 3WJWA 1XC4A 3DBPA 3SW6A 1EP1A 1FDJA 1ZHAA 3DHDA 2YZRA 4DPPA 4K6AA 3A5VA 2DJLA 1FY6A 1YTDA 2GQ9A 3S0CA 2NV1A 5LHEA 4NX5A 3W7LA 1BKSA 4GUFA 5AHNA 5DXYA 3T55A 1IIGA 2YPIA 1ME9A 3A21A 1T8XA 3NZRA 2JK2A 1W3IA 4OBTA 4GXMA 4RKAA 4Z1BA 3GNNA 4JXCA 1LBLA 3B04A 4XBKA 1ZAIA 3MP5A 1W54A 3CQ0A 1KFBA 1FXPA 1L2UA 3UNDA 4AAJA 3NQ7A 3L5LA 1DBTA 3LBMA 1C29A 3UPBA 5FF2A 1TREA 4DF1A 4ZQCA 1W3NA 1XUZA 3PB0A 5F4SA 4A29A 1W5PA 5F4WA 4FX8A 4O17A 2BSLA 3M41A 3W2JA 1DJQA 2AGKA 3LCIA 2J9YA 3C2FA 2GVGA 4UMCA 4UR7A 4Y96A 4UTWC 3S6DA 2FIQA 3NPUA 3IIOA 3S8HA 2R14A 2E6DA 4OQVA 3VFLA 4Y8FA 3O07A 4RK8A 1OFDA 1KBJA 3P84A 3UZJA 1RVGA 4UFMA 4YCOA 1H7RA 3C61A 1JR1A 1CI1A 1YXYA 2VENA 2CLOA 3MHUA 1FCVA 2ZFAA 1KM2A 3NPXA 4EVZA 4AEOA 5DBUA 3SI9A 5LNRA 5KINA 2TRSA 3NZ1A 2A1YA 3YPIA 4E2DA 3R8RA 1LM1A 5TBOA 1VYSX 5HINA 3L67A 4WXZA 2DZPA 1Z44A 4IPIA 3WJZA 3OG3A 2J9ZA 1I2RA 1ICPA 1P0KA 3LCGA 4AXKA 5D2XA 5CKSA 2EPHA 2C1HA 3OVQA 2FTPA 3QW4B 1RZMA 3TX9A 4GUHA 3S1UA 1F73A 2ZRXA 1QFEA 3GR8A 3W2NA 2G97A 5IBXA 2ZZ2A 4JY9A 2A7NA 3CM4A 5FF7A 2DZSA 3G3DA 4NJHA 3L65A 2NUXA 4M6QA 4NXSA 4NZFA 1K8YA 1TPVA 3Q94A 1TYGA 2Y7EA 1UB3A 1AW1A 3DHFA 1OG0A 2RH9A 3W22A 4JX6A 3W7NA 1X8FA 5DLCA 5E1QA 1GQNA 4PODA 3EX4A 4FF7A 3NL5A 4UR8A 2CU0A 2DZUA 5CPLA 1T99A 1X1ZA 2QCGA 1QAPA 3GDLA 4UUIA 2CZFA 3HG3A 2CW6A 1W8SA 2ZRZA 1W5QA 1TPWA 1SQ7A 4NUWA 2NUWA 1QPNA 3W1QA 1H1ZA 4FXRA 2P0OA 3LTYA 1NF7A 1H60A 3NO5A 1QPOA 4JTUA 3M5XA 4OGZA 4EF9A 2Y7GA 1GVSA 4IOTA 3W7IA 2HS8A 1RR2A 3F03K 4WXYA 1GVOA 1AW2A 3P5ZA 1L6SA 4UFJA 5H2ZA 3KRUA 1ZAJA 4JS3A 3TSDA 3FA5A 4IJBA 1VHCA 3STGA 1PHWA 1BWLA 2WJZA 1JCXA 1KM5A 4ONVA 3TV8A 3L66A 4UFHA 4XZ9A 1EUNA 5EL1A 1NAL1 1GZGA 1R30A 1OFAA 2YFNA 1O95A 5F2LA 5CZ0A 4MY8A 3KX6A 5D2YA 4D2JA 1I45A 3LV5A 4KFNA 4UC5A 3G1DA 3LOTA 4XUGA 3W1XA 2Y62A 1C9DA 1HUVA 2ZZ7A 3B0VC 3IRDA 5AN7A 2YCEA 3GXPA 4FNSA 5D38A 1IXPA 3P60A 5HJLA 1S5VA 2Q8LA 3W7EA 4FNQA 3PULA 1LRQA 3SSJA 5K9CA 1RQBA 2NUYA 4RXFA 4AVFA 3DXIA 5LNVA 1TTJA 1XI3A 1TV8A 5FF0A 3P82A 2GPTA 4GUGA 4O50A 1TTPA 4FNRA 3PS7A 3CIXA 3DGRA 3TMQA 3W7OA 3LB0A 2X30A 5C2XA 1VCFA 2FLIA 4MVAA 4O1DA 2DZXA 1YDVA 1VYPX 4JYEA 3TC7A 5EY5A 2CLKA 3ZR4A 1EIXA 4NNBA 1DQWA 4BI5A 5DY2A 3BW4A 2FQIA 2WNNA 4JDYA 5K3VA 2E09A 1TPUA 4NVTA 3NEVA 2RHGA 1DVJA 1SW0A 5I3JA 4I7VA 4TX9A 2I14A 4JDBA 5BRBA 4UFKA 1DV7A 2ZA2A 2J24A 3SGZA 3NQDA 3W1MA 2XN0A 4AWSA 2GJNA 2HTMA 1KTBA 3TAKA 3G24A 1FDYA 3EWZA 5I3HA 2XFWA 1FCUA 2YGYA 3QM3A 4LVAA 4POCA 2EGZA 3GXTA 5EPDA 3W7GA 5LGXA 4LS1A 4GE8A 4GBUA 2Y7DA 5AYZA 1OX4A 3NQ6A 1Z42A 1KM1A 2YW4A 3NL3A 3O8AA 4QIUA 4PL1A 5A5WA 2QF7A 1UASA 3D0CA 1B3OA 1SZEA 3LXBA 5D02A 2WNQA 3HO8A 4GUJA 4KWVA 2VC6A 3HB9A 4BK9A 3NQ2A 2D73A 3T44A 4ADUA 1KM0A 1TV5A 3W74A 3PAJA 3PUEA 5EMUA 3T40A 1JCMP 1S5WA 1XKYA 3NDOA 2ZDRA 3U8GA 5C55A 3BG9A 1GVFA 3E12A 2DZWA 3AO0A 3M1ZA 3SJ3A 3UQNA 3UWUA 1RQHA 3L5MA 4RZ4A 3M43A 4TO8A 2JKAA 3QF0A 5K9XA 1R2SA 2PCQA 3NL2A 4FO4A 2YFOA 4M6VA 4CQAA 4KFPA 3S5ZA 1G67A 4LWWA 3PBVA 4FHAA 5F2GA 2GQAA 3HGRA 1ME7A 1KM3A 1YPIA 1S3HA 3G8EA 1K03A 1L6YA 1XCFA 1JCLA 2E5BA 3HF3A 1KM6A 3HG5A 3W2MA 2ZZ1A 4HNNA 4IMDA 3T4CA 2V2DA 3M9YA 3MMTA 3DFNA 1I8JA 1FXQA 3LCHA 1QDSA 1RV8A 1KFLA 2A85A 2Y70A 3QQ1A 1K8XA 4FIQA 2I1OA 4IMFA 4K36A 3LERA 4UCGA 5AYXA 3GKFA 3LTSA 1LOQA 3NPVA 3UWYA 4A21A 2ISWA 1QR7A 5LHFA 5CPMA 3FFSA 2W79A 3N34A 3LCXA 1M6JA 1KFEA 4LVBA 3RU6A 3Q2DA 3HIJA 3B4UA 2V5BA 3G1AA 1DHPA 2ZTKA 1C8VA 2V81A 1EWEA 4BFAA 1SFLA 2CWNA 5C6MA 1ZFJA 3N14A 3TA6A 1YDNA 2BLEA 3WFAA 2G5WA 1HTIA 1H1YA 1TPC1 1EA0A 2JGQA 4RCXA 1ONRA 4ZVJA 1D3HA 4IX2A 1WAUA 1TTQA 2WSRA 1VJIA 4K39A 3MP4A 1QCWA 5CZJA 4XQ6A 3W1RA 4LTSA 3W88A 3E9AA 1Q3NA 4RLIA 2TSYA 4EF8A 2C3ZA 3HPZA 1ZY9A 1GYNA 1YTEA 3L9CA 3NQCA 5K4ZA 3ABQA 3W1PA 1PCWA 3VKJA 3DFTA 1H61A 2Z0IA 3QPZA 3ZFHA 1BWKA 5MHBA 2AQWA 1OJXA 1BTMA 2QCEA 1G69A 1VC4A 1HFBA 4QITA 3ZWTA 5G4EA 3TQVA 3RNDA 3IGSA 4UTJA 4X22A 5CSSA 3W7QA 1ADOA 2A5HA 3W2LA 2ZZ6A 4UTIA 3M5YA 2XN2A 3GAKA 1XL9A 3NYZA 1YDOA 2ZZ3A 1QO5A 2J9XA 1W5MA 4HSNA 4O1BA 2NWSA 4NU7A 4CQ8A 1SW3A 4JN6A 1RD5A 3C3NA 2E1DA 3P61A 1D3GA 3QZEA 3EEGA 3TK7A 2Y61A 3SFKA 4HNTA 5F2MA 2YDAA 1LCOA 1WOAA 4UTUA 1SO3A 2BWGA 1LRNA 5LNUA 1VPXA 4N4PA 3KRZA 3G1SA 1I2OA 2QEZA 4K38A 4IMGA 4DEFA 2O7QA 4OU1A 3M5VA 4CLMA 3HGJA 3BG3A 1PCKA 1IF2A 4I7WA 4MYXA 4DO5A 1GG1A 3W7KA 3BVJA 1TPDA 2ZBTA 3CC1A 3MWAA 1KM4A 2C18A 1GG0A 3P81A 5L6UA 1MSSA 3LCLA 3P8JA 3QQ0A 2ZCGA 2FB2A 3LLFA 3BLFA 3NPWA 4O28A 4W9TA 2A6LA 2Y7FA 1R46A 1KLYA 7TIMA 2G96A 1XXXA 1E51A 1R2TA 1MZHA 4CNOA 4ZQRA 5EBUA 2GUUA 4JNMA 3U2OA 3P74A 4ADSA 1LOLA 1YLVA 1JRBA 5G2IA 3HOJA 5AC8A 4JTGA 2Q3OA 1I2PA 4MLJA 2Y63A 1OK4A 3LX9A 4CCCA 1JCJA 3CEPA 1G4SA 4DF0A 1LLWA 3RLUA 4N9DA 3C2OA 1F05A 3GYEA 4M19A 3KOFA 3STCA 4K7YA 4ZQPA 4A3UA 4BR1A 3IGUA 2A4AA 4JY8A 1XDLA 3CTLA 1AL8A 1YXCA 4PA8A 3OHIA 1F7BA 4M6PA 1SFJA 1H7OA 4MY9A 2VEMA 3EX3A 3FLUA 1O60A 4ZQNA 3IVTA 3G18A 1ALDA 1B9BA 3W75A 1WXJA 2NWRA 3H54A 2NXIA 3LDVA 4QSHA 3BK0A 4GFSA 2Y89A 1G4TA 4MYAA 3DH7A 2WQPA 3BPWA 3HBLA 3JRKA 4IMEA 5I3FA 1OHLA 4K37A 3FJ6A 2ZQ0A 5FESA 1XBVA 3NAVA 3W1NA 3HMJG 1W37A 3DKLA 4FB7A 2DU2A 4LV4A 1G4PA 1ZCOA 3RK8A 5C54A 1IXQA 4O10A 4ORIA 1GT8A 2TPSA 3R2GA 3BGJA 3CLMA 1YPFA 3W71A 3KFTA 1AMKA 2QKFA 4AH7A 1I4NA 4IGHA 2ATMA 1GTEA 3LHYA 1TIMA 1IXOA 1M5WA 1VS1A 4O52A 1EEPA 1KW1A 1FCBA 1H62A 4C1LA 4PEKA 3MI6A 5D2WA 2YYTA 3HG2A 1A5CA 1YXDA 5AB3A 3ANYA 2WSQA 3VE9A 1TTIA 3EWBX 1F2JA 8TIMA 3AJXA 4MOZA 3I6RA 5I3IA 3LLDA 5AHEA 2X2GA 4JTEA 2FDSA 3S1WA 3OBKA 2RDTA 3ATYA 3F4NA 3R12A 5HR6A 1EB3A 4WUIA 1QO2A 3S5YA 3C2RA 3G8RA 4WY0F 3S1XA 3DFSA 4Z1AA 1U5JA 3UY7A 4O53A 5F2IA 4BI6A 3EWYA 2CLFA 3LRMA 4HKPA 2QDHA 4UTKA 1EX5A 5ABTA 2V8ZA 3LCWA 1LZOA 3STFA 4JR5A 3G1FA 4N02A 2V5LA 1A5SA 3KVMA 3PY2A 1IGSA 1VLWA 4O4VA 4JIPA 2NXGA 4QNWA 3UY8A 2EF9A 4RZ6A 1AK5A 4UIOA 4O4WA 4Q4KA 5G1TA 1XBYA 3O6DA 2PC4A 5FF4A 4Y9AA 3QMRA 1SSDA 3B03A 4EIVA 1UUMA 1GVRA 3Q58A 4FX7A 4Q33A 3W83A 1XFBA 3L0NA 3GVGA 1G6CA 3FJLA 3HJZA 3UXDA 2QJHA 3BLEA 1UCWA 1NF0A 3TW7A 2HSAA 2ZZ4A 3LTPA 3W85A 5HWNA 3E0IA 3GKAA 2VEIA 4JTKA 2A7PA 3OIXA 2Z2UA 4GNJA 1NEYA 4JTIA 5TIMA 3SECA 1ME8A 4ADTA 2FPTA 4LRSA 4QM1A 4O12A 1GPWA 3KVKA 1LBMA 3VI2A 1PHQA 3FKKA 2VELA 4TU1A 2EHHA 4LVGA 1NVMA 3I7SA 4WOZA 2C14A 3SY5A 5D2VA 1ZAHA 4L4MA 3NL6A 5H91A 5HQEA 1N7KA 2QAFA 2GVJA 4LS0A 3C52A 3ELFA 3M6YA 1AG1O 2J88A 4HSOA 4LRTA 3G1XA 1O94A 3LHUA 1PE1A 3PSVA 2BXVA 2JGYA 1JQVA 1TQJA 3CIWA 4UTTC 5T26A 3NQVA 5HR7A 2B7OA 1H5YA 3MJYA 1L6WA 1LOSA 1OF8A 4MUZA 1ZALA 3GK0A 3RF9A 2E5CA 3PBUA 3W84A 1MEHA 3MYPA 2NX3A 2PRHA 4CCDA 1KTNA 1K02A 3W7RA 4ML9A 1UJPA 1BEUA 2JKEA 3GAYA 1PIIA 4ZZ9A 3NM1A 3G22A 3OVPA 3TE9A 4LUJA 3C56A 4UTWA 3EX2A 1WBJA 2H8XA 3TXZA 1QOQA 4YMZA 3ABOA 4XKYB 2ISSA 3DFQA 2GOUA 3M47A 4GC4A 1K7XA 3W7DA 4LC6A 1DJNA 1KFCA 2YYUA 4O13A 4LV9A 3CWOX 1OFQA 1PS9A 2GJLA 1DKWA 3UZ5A 4RR4A 1SZGA 5GVJA 4LNYA 5AC7A 2X16A 1SO4A 3C2EA 2O7SA 3MHGA 4OE7A 3MP3A 4X3ZA 3USBA 3EWWA 1WDWA 3P80A 3KAOA 3WK2A 4YWIA 1K7EA 5KZDA 1VR6A 1SW7A 2H3BA 3WJYA 1ICQA 2HMCA 3PSWA 4TMCA 1W31A 3S9YA 4JICA 1VHNA 2B7PA 2ABBA 5D05A 1PVNA 3PF3A 2E6YA 4XTDA 3DKJA 4A2RA 2OCZA 4AHOA 1TMHA 3V75A 3TKFA 3NVTA 2ISVA 4MIMA 5DELA 5E93A 4IUOA 1ZJIA 3NQ8A 1H7NA 3A24A 1F6KA 3RFAA 4WX2A 1PV8A 4O1AA 3P67A 3W7JA 1GTHA 1O5XA 2YX0A 4LVFA 3BW3A 3LI0A 4JTHA 3UYCA 3CB8A 3HQ1A 3UWWA 3W1AA 2W6RA 3DAQA 2V30A 4O14A 3TAOA 3CEUA 1J4EA 3QJAA 3BO9A 2P10A 3N9SA 3NQEA 4E2BA 5G1YA 1LORA 3W6YA 4PCFA 3B8DA 1B4KA 2OMAA 3R13A 5CG7A 3UXAA 3W07A 4LT9A 2H90A 1SZFA 3ZWSA 3F4WA 2BTMA 3G1YA 3W86A 4B5NA 3INPA 3SIZA 4AWUA 1A5AA 2QAPA 4UNKA 4HIBA 5BMXA 3TNOA 4ALDA 2YW3A 3TH6A 1F6PA 3O63A 3EKZA 3KVJA 4EWND 2X1UA 5DY3A 5TQLA 2GQ8A 2OT0A 4FEZA 4QQ3A 4NJGA 5FI8A 1ZNNA 1SO5A 3N9RA 3C0JA 1DOSA 1PL9A 5I3GA 3HPSA 2RFGA 1N55A 1MO0A 3N2XA 3QMTA 3TU9A 5AHIA 3DFPA 1SSGA 3PBWA 4E38A 4NZJA 3N3MA 2FB3A 5EYWA 2NLIA 5FEZA 4UMAA 2CZEA 5HWMA 1OF6A 5U7SA 1A5BA 3H55A 3VE7A 2ZYFA 1M7OA 2C6QA 1W5OA 3HGOA 4RZ5A 3IIZA 1VRDA 1P4CA 1V5XA 2NXHA 4UTTA 1LYXA 4QNEA 1Y0EA 3W3OA 3L21A 3A5FA 4S1FA 3GNDA 3WJSA 3I65A 2VKZG 1UBSA 1OX5A 5AHMA 4AMAA 1A53A 3LRLA 5DXXA 2X1RA 3G0UA 4QISA 3NR0A 4N6EA 1KFJA 5LNSA 3TFCA 1OFPA 3PR2A 2E68A 2HS6A 4P61A 3T7VA 5DCEA 5G5IA 4OWGA 3O15A 3P62A 2Y6ZA 4MZ8A 3TC6A 1OVDA 2WO5A 3UWZA 5KZEA 3TW6A 2E77A 3DENA 1JRCA 2V2CA 4YL2A 4IQLA 4UMBA 3G1VA 1OX6A 1SUXA 2Z1BA 5LGZA 1F76A 2QCFA 3GXNA 3TJXA 2QCDB 1THFD 4IXHA 3EWUA 5AC6A 3K30A 1TPEA 3LXCA 4N9EA 1AW5A 4LOCA 3UWQA 2WPBA 4PTNA 4Z0SA 3N19B 5HWJA 2VFHA 2NX9A 5J5RA 2RDUA 4QJ1A 1G4EA 5F4XA 2CLIA 2YXGA 5AFDA 4XBSA 2V0TA 2VFDA 4JGDA 3UPWA 3BLIA 3LV6A 3NA8A 3M7WA 1JVNA 2WNZA 2X1TA 1H7WA 3QMSA 1WA3A 3MI3A 1H7PA 2XN1A 4WD0A 5D09A 3A22A 3GDMA 4DELA 4LW7A 2E6AA 3M5ZA 2C0AA 4DO4A 2AAMA 1HO4A 4NNCA 3LXAA 3KVLA 2KZHA 1GWJA 2VEKA 3W76A 3ABRA 1K8ZA 1B4EA 4O18A 5DBTA 1TV7A 4CNPA 4MPQA 5G4WA 3PBYA 3JS3A 1LTDA 3MUXA 3C6CA 3F1QA 5AYYA 3TSMA 4S2CA 5BNKA 2Z6JA 4Z1CA 2VFGA 1G7UA 2CLMA 4KKXA 4JD4A 3S42A 2NV2A 3PG9A 3EB2A 1TRDA 5KZMA 3GLCA 3LHTA 3O6CA 4LY8A 1OK6A 3FOKA 2VEPA 1SO6A 1EUAA 3E49A 2BZNA 3G0XA 4MJZA 1XDMA 3BW2A 1T0OA 2DZTA 4WQ6A 2PRLA 2YR1A 4ZQMA 3LHZA 3CPRA 3RMJA 2ZRYA 3T78A 5LKYA 1FX6A 3A9IA 3WK3A 3HPXA 1WV2A 4FX6M 1TSIA 3LBCA 3OEXA 3PC0A 1R2RA 2A6NA 3QC3A 3KHJA 4J9JA 1Z41A 4ZQOA 2QUVA 2EAWA 2PRMA 4JYFA 4K7VA 4AB4A 3DZ1A 3CWNA 3G1HA 4NJJA 4NT0A 1AL7A 3THAA 2ZA1A 5BMWA 2DP3A 4JTLA 3W7PA 4EOUA 1FDZA 3DI0A 1EP3A 3LGEA 4AWTA 4G1KA 4BWLC 3FYOA 1JULA 2RKXA 1FWRA
chains in the Genus database with same CATH superfamily
2BX7A 2VOTA 3NM3A 2POTA 3BV4A 4PUWA 1M01A 1MEWA 1WBHA 5ABEA 2GJRA 4DJEA 1TZ7A 3GTNA 1V6VA 3MI2A 1EP2A 1SPQA 4F66A 2XWEA 5CGQA 2Q8ZA 2VZUA 2ZX7A 5I79A 5T91A 1NY1A 1V3KA 5DMYA 2W4XA 4N7QA 2OZ0A 2DORA 3FEMA 2OOGA 3N13A 3M44A 3TROA 1DL3A 3PBMA 4NZ4A 3NOEA 4URIA 3W29A 3W7CA 1EWDA 4L9XA 2EXOA 2J27A 1F07A 4D6JA 5KITA 1FWCC 3W6LA 5FOOA 1E0UA 3WQ6A 2HXTA 3MU7A 2WMJA 1X6UA 3FSTA 2C15A 3DU0A 4JX5A 4C6FA 4HK6A 5ECUA 4QTGA 1LDCA 2PWHA 3C8NA 1HG3A 2JKPA 3MCNA 4A2SA 5A6JA 2VC5A 3IVSA 1VPYA 4AHQA 4G9PA 3GRIA 1TB3A 3VA8A 4D6HA 4JPGA 3UZZA 2WV8A 5HULA 1EYEA 2WKJA 2QV4A 3LQLA 5CBIA 3L4ZA 4OT7A 1UC5A 1DIOA 3FSUA 4JIRA 3ITOA 5F1VA 5C7VA 4U10A 2PZ0A 3HM7A 1H4PA 4IWWA 3TYCA 1A5UA 1K8CA 3UESA 3UJFA 2NSXA 3VIGA 3CH0A 3HN3A 3TLQA 3R43A 5LIXX 2ZUVA 3WDRA 4Z08A 3T6CA 5FEPA 5AC4A 1FWWA 3G77A 4M8UA 5D04C 3WK1A 1Q6CA 4U33A 3TJLA 4FXSA 4W4QA 1XUUA 3V1PA 1DPMA 4XKYA 2QCHA 2VFEA 3MWCA 1FVPA 1SR9A 2CBUA 4WGXA 3GXFA 3ARYA 4LAOA 3E0VA 4CNSA 1VYRA 2R8WA 3UR5A 4NY2A 2BASA 3NG3A 1Q6RA 2PUZA 4BJHA 1DQXA 4NYYA 4GUIA 1AD1A 5HMDA 2V68A 3DFHA 5H8UA 2FFCA 3OZYA 1GYLA 1VLIA 2RJGA 3ZSTA 4MZ1A 4PFHA 2RDWA 3VOHA 3USZA 1V3IA 5CAKA 3U3HA 3QH2A 2XIJA 4IIFA 5CAHA 5I2UA 4E3TA 2PBOA 2G3FA 3MCOA 1IXNA 3ARUA 3II1A 5FSEC 1UWIA 2CZVA 3O3RA 2O9PA 1CCWB 2EJAA 4MZYA 1AD4A 3A64A 4OBSA 3O6YX 4FLRA 4WJEA 5LNWA 3G6MA 5K2ZA 1HL2A 4AIEA 3OA3A 1KQZA 4JIQA 4Y6GA 3PNZA 2GVLA 2QJMA 1NELA 4UNLA 4O0QA 4HN8A 3DI1A 4Q4MA 3V0SA 4IIHA 1ISYA 1DIEA 3WQCA 1VJSA 4HMCA 3QGAC 3SZ8A 5JU6A 3VK5A 1OCQA 3CT7A 4QDPA 4L4OA 2JBMA 2XH2A 1NARA 1OT2A 1J5TA 3L0KA 1LROA 4X0NA 2ZXAA 3TOYA 1VCVA 3GNPA 4XIAA 5LYRA 3IJ6A 3CU2A 2BXZA 4N2YA 1EDTA 1O4UA 1QTWA 4CU6A 1XICA 3OP2A 4HOWA 1OINA 1G9HA 4HCHA 2BOEX 1GOMA 2WCSA 4Q8UA 3WFLA 4DBDA 2PGRA 1PX3A 1KR0A 3WKZA 1CNVA 5EFDA 4TMBA 1IR1A 4QS6A 4A22A 5XIAA 3GDKA 4UXDA 3HQPA 4B3LA 3M64A 4IFOA 3N2MA 3FA4A 4R27A 5LA0A 4H01A 1CZ1A 4UQEA 2HISA 1NDYA 1UR8A 1FHDA 5C8BB 1FWAC 1JD9A 6ALDA 2V9DA 1R8LA 1FHVA 2ZOXA 1CLKA 3QSTA 2WJFA 2A7RA 4PL2A 1OFBA 4KRZA 3PZVA 2Z2BA 1OYBA 4US6A 1SMAA 4BF7A 4CD7A 3FN9A 3KLKA 1UWAA 3EXTA 2V82A 4ORMA 3LS9A 1IEWA 2WKGA 2VXNA 7XIMA 4HGXA 5LSMA 1W1ZA 1LF1A 2CFFA 4RPQA 3VGGA 2RDXA 3I7QA 1UG6A 1IT8A 3AHTA 3ZZ1A 1IIHA 1PEZA 4MNLA 3WDPP 3NOYA 3E74A 4K8GA 1W9BM 2QCDA 4G56A 2GSHA 1EYWA 3PG8A 1SJBA 3SCNA 4KH2A 1AMYA 2H3DA 3CTTA 3R8GA 3GC2A 3SCUA 3NZGA 4BA0A 2BY3A 1V7YA 3APYA 1FQ0A 1XCWA 2BVDA 4HPJA 2QYGA 3Q45A 1X97A 1IEVA 3FJNA 4WKAA 2FMNA 1H0IA 4TX6A 2PI6A 2YCKX 4HQVA 1CXIA 1TJRA 1FHUA 1B57A 3NGFA 1OFEA 3S2LA 4D1IA 3ITVA 5BOOA 1TG7A 3LPFA 1SGJA 2DIKA 5K9DA 1OB0A 2R1PA 4B9ZA 3F2BA 1BG4A 4IPJA 3M0ZA 4PYSA 4DPQA 3TQ0A 3H4GA 1W1B1 5ABFB 5JIWA 4LCSA 3UFYA 3VM5A 2E5DA 4JIIX 1H63A 3W23A 2ZUUA 3MVTA 3OLGA 3NQMA 4WDWA 4DM1A 2V2HA 4H8VA 2GUBA 2X7VA 2HCVA 1TPB1 6REQB 1FFRA 2PLKA 4DBSA 4ENLA 4EAMA 5CGMA 4Y9NA 7ENLA 3PB2A 4JIEA 1MEIA 3AZSA 1T96A 3TTOA 2LLEA 3Q37A 1TX2A 3R89A 4FK9A 4O0KA 1XHGA 1XWYA 2DV0A 1E55A 1ZP3A 1NJJA 5KTLA 1X96A 2W3ZA 3VX0A 6XIAA 1SZNA 5LIWX 4U4MA 3C4UA 2NZLA 1B9ZA 1T6MA 3EDJA 4RW3A 3VMOA 2QJIA 3QPEA 2W0UA 4Z0JA 3NNTA 1Z48A 1Y5VA 1HZYA 3S1VA 3TTEA 5HBFA 5HMSA 4H19A 4O11A 5HANA 1B3VA 1O12A 4ACYA 4A8RA 2FZDA 1CX9A 4S2BA 4R85A 3TSBA 3SJNA 5M3WA 2VO5A 3SM0A 3IK2A 4C6KA 4K1GA 4XD6A 2FPYA 2WJEA 1P0NA 2Z25A 3M7SA 3V0TA 3WLMA 2ZRWA 1WZAA 2GGGA 4TIMA 2FJKA 3BLLA 4O19A 4RJEA 4KMQA 3DBPA 3SW6A 1FDJA 3WYZA 2F2KA 3VINA 1EBGA 4QJ3B 3RRAA 2QVHA 1FH7A 3H2OA 1FY6A 1YTDA 2GQ9A 4TV6A 2B81A 1XLAA 3VIHA 2NQZA 1ZGDA 3CB3A 2FDMA 3KOZA 5LXEA 3TYUA 3CAWA 2YBTA 1KXVA 4US5A 3OLDA 4Z2KA 1KXHA 1B90A 4CGTA 3B04A 3VC5A 2WLZA 4JL1A 4Z2HA 4AAJA 1XYAA 4DI9A 4L1GA 1C29A 1ADDA 3URAA 4WKFA 1IQ8A 1V6WA 4PTDA 1W3NA 3WF4A 1XUZA 3PB0A 1R3QA 1S3TC 1A5LC 3GU2A 5FL0A 1DJQA 5GJPA 3WH5A 4GNKB 3C2FA 2GVGA 4Y96A 1PKNA 2FIQA 3T9PA 2E1WA 2HBXA 1SVDA 4LUYA 5LIKX 2ZUWA 3O07A 2IW0A 1DIDA 2NT1A 4H8UA 1IT7A 4GLEA 5CJ5A 5C0QA 4C6EA 1H7RA 4MWAE 3O7UA 2PC8A 2ZXBA 1W17A 2ZFAA 1XLMA 4EVZA 3IJQA 3CQJA 2TRSA 1J6OA 2A1YA 3UJSA 4E2DA 3R8RA 1BYBA 2QJJA 1LM1A 3RM9A 3LD5A 2VEFA 2VNCA 3L67A 5HINA 4IPIA 5D2XA 5CKSA 1CLVA 1LL7A 3NO1A 1RUSA 2I7GA 4W89A 1S5MA 3KL0A 4WVXA 3QW4B 1RZMA 3WF0A 5J8LA 3S1UA 1F73A 1M41A 5BRPA 2INEA 4GIRA 1A3HA 1FWDC 5JBDA 1UQZA 2ZZ2A 1H49A 5FF7A 4AIOA 4GIEA 4M6QA 1K8YA 1BF2A 3Q94A 1TYGA 1VBRA 1UB3A 1AW1A 4S3BA 3UERA 4CEUC 3IGHX 1E6NA 3W22A 4MHBA 3NL5A 1H5VA 4UR8A 1A3XA 1W6TA 2FHFA 4EANA 3BLKA 2ZXDA 3TJIA 3RPDA 4HYVA 4ZGYA 1J5SA 5JQ9A 3OU8A 1GQLA 2O9OA 3LGGA 5I78A 1JCTA 2G4FA 1QPNA 2EPMX 2P0OA 1QI2A 4EF9A 2Y7GA 2V69A 2VR2A 2O9RA 3W7IA 1RR2A 5B80A 4WXYA 1RVKA 3KTSA 3OQEA 3K8LA 1L6SA 2CERA 1D7KA 1EF2A 3KRUA 1O7AA 2GL5A 3TSDA 1I6NA 1AODA 4IJBA 4R88A 3VIPA 4YTRA 2Q09A 3MUIA 1KM5A 3GUGA 3R79A 1EUNA 1PTDA 1NAL1 1T7LA 1GZGA 1OFAA 2YFNA 3HJEA 5CZ0A 4CD6A 1XLCA 3R25A 1F3EA 3GS6A 4V1XA 2PU1A 2Y62A 2VCBA 2ZZ7A 4I5UA 4I8DA 3SCOA 5AN7A 3UG3A 2Y8KA 2JF6A 2OPJA 1CGXA 3EOUA 4PN2A 2CBJA 3JU2A 3WH7A 3VGHA 1WKEA 1LRQA 5K9CA 4QS5A 2YBUA 4IP4A 3KCJA 1XRFA 5LNVA 1TTJA 1XI3A 1AA1B 3OGSA 3UJRA 5FF0A 1WDRA 4O50A 2HVMA 3PS7A 2J4GA 3GM8A 3DGRA 4PRWA 3W7OA 1UD5A 2VRQA 2X30A 3AMGA 3UVIA 2FLIA 4MVAA 2DT0A 3RO6A 3WG6A 2G50A 5EY5A 3ZR4A 3AHZA 3ZJKA 4BI5A 3M0HA 4DAFA 3IV8A 3BW4A 3UZXA 1U5VA 4LUTB 1TWWA 1TPUA 3NEVA 2A3EA 4L6OA 1SW0A 4TX9A 1X1NA 1TIWA 4Z2GA 2NQHA 2PPGA 3S47A 5BRBA 3GFYA 4H6EA 2GGIA 3E2SA 2Z4GA 3B9AA 1K1DA 3IACA 4W93A 2W67A 3TYAA 1V08A 2XN0A 2L5HA 4AIBA 2O92A 3EB4A 4L4PA 2D2JA 2EGZA 4B5VA 1IEIA 4KBXA 1GVYA 3ENLA 1XD1A 4LS1A 1I0DA 4GBUA 1DWIM 3NQ6A 1VEMA 1KM1A 3W53A 3O8AA 3SSZA 3N25A 1XCXA 4AD3A 1P48A 4UOQA 5G1MA 3VKBA 1SZEA 4K1WA 1QU4A 4LQ1A 2VZVA 4LX4A 4JTQA 2D73A 3BAJA 2UZ9A 3PAJA 5EMUA 4WKHA 3IARA 3KL5A 3NDOA 4EP8C 3U8GA 3BAIA 3E12A 3A4JA 5IOBA 3S1GA 1EQPA 5I03A 5ABFA 3B9EA 4PUJA 3GVRA 5HAOA 3L5MA 4RZ4A 3CK5A 4GPNA 3IS4A 3AMDA 3AHXA 2JKAA 4F9DA 2FGBA 5JBEA 3NL2A 2YFOA 3AIWA 3SO7A 4M6VA 4CQAA 1X6LA 2GUYA 3PBVA 3A9BA 3QBUA 4FHAA 7ODCA 4G7EB 3U7VA 1S3HA 3RCYA 3OOQA 4W5ZA 1XCFA 1AJ0A 1QBAA 4HNNA 4IMDA 2EQDA 1RA5A 3DFNA 3PAOA 1I8JA 3BSMA 3QQ1A 4Q6XA 3NUKA 2HVNA 2C8NA 3H2EA 2GDVA 1PWMA 3GKFA 5B7YA 5C71A 2ISWA 2R9RA 1QR7A 5HXMA 1XG4A 1XSIA 3N34A 4LVBA 3RU6A 3G1AA 4MGGA 4M0XA 3BOFA 1WDSA 1SFLA 1C7TA 2D3LA 5C6MA 2INFA 3TA6A 2HE5A 1VFFA 1HTIA 3TTSA 1TPC1 1EA0A 2JGQA 1FFQA 4ZVJA 4D6IA 1VFSA 1WAUA 1AH3A 1Z3NA 1XH0A 1DHKA 3QYSA 2OB3A 1MW3A 1EHAA 4K39A 1J01A 4LTSA 3W88A 2F6XA 5D8WA 4RLIA 3GC4A 3ZLHA 2ON3A 3HPZA 1ZY9A 1GYNA 4ZE4A 3NQCA 2VD9A 4PR4A 1B3WA 4LEFA 3DFTA 5F7UA 4LYPA 3WZ0E 4UOZA 3QPZA 1BWKA 2DSUA 1VIWA 2DH2A 1HP4A 3KS5A 4FALA 1XLDA 3GIPA 1T40A 3EOSA 1UMLA 2FMOA 3TQVA 3RNDA 1DXEA 2DEPA 3W7QA 2A5HA 3IUHA 2ZZ6A 3HQNA 3GAKA 1YDOA 1XIBA 1W5MA 4O1BA 1DWJM 2WSPA 2J7EA 4ACZB 3P61A 1D3GA 1V6UA 4YTSA 1P7TB 2OSYA 2F6UA 5F2MA 2YDAA 2WANA 4EXQA 4HJWA 2BWGA 1LRNA 3KRZA 3KWXA 3G1SA 4DXXA 1E1CB 3WN6A 2C71A 4S3KA 4CLMA 3HGJA 5I00A 4I7WA 4DO5A 3WD0A 1V6TA 3CC1A 4U3CA 1W1YA 3MWAA 2J8TA 5CH9A 3HFYA 3LMZA 3P8JA 2XVNA 1VB9A 3BQ5A 3NPWA 4O28A 2OOFA 4P7LA 1BSLA 2A6LA 1MQRA 1VIZA 1KLYA 1XXXA 1MZHA 3LM3A 2VUYA 4ZQRA 5EBUA 2QIWA 2QGHA 3GY1A 1Q65A 3P74A 1BVNP 2WMIB 1JRBA 3SADA 3RLHA 1FWJC 4E4PA 3RG6A 1OK4A 4B90A 4S3CA 4CCCA 2J62A 1E9LA 1KBLA 3CEPA 2XDFA 1E9ZB 1YNYA 1C91A 3TYEA 4BS0A 3STCA 4GCXA 4EPDC 1L2QA 3ZVHA 4BR1A 3D6NA 3PJWA 3KW3A 5XIMA 4BQ5A 1MWOA 4M6PA 2WC7A 1SFJA 2GQ3A 1H7OA 2JALA 1O66A 1PZ1A 4DYJA 4DUVA 3ZM8A 4LYQA 2P53A 4JFTA 2I56A 1Q85A 1ZTVA 3BK0A 4GFSA 3OB8A 2D1ZA 3BPWA 4KEUA 3U7BA 1R87A 5A8OA 2IKGA 1E71M 3FJ6A 3AYRA 2FZ9A 5FIPA 3LEPA 3NAVA 3NZQA 3R1ZA 4GQGA 1E3XA 4FB7A 4MKSA 3VGDA 1G4PA 3WUBA 1MFUA 4KRUA 2PDKA 1I4NA 3GG1A 4IGHA 2ATMA 5DEZA 1TIMA 4GISA 1IXOA 1EEPA 1DP0A 3G2GA 3EMZA 3EOLA 4PEKA 2YYTA 1YXDA 1JI1A 2INZA 4U2ZA 1R7OA 5CEWA 4JTEA 4XVEA 3S1WA 2P76A 2RDTA 3T2PA 3R12A 1I60A 4WUIA 3S5YA 1JXKA 3C2RA 3ZJ6A 3DFSA 1U5JA 3EB3A 3PJXA 3OPSA 4DJFD 2CLFA 3ZSSA 4UTKA 5ABTA 2AL1A 3PZQA 1XYCA 2WMHA 1CXLA 2YDSA 2VL4A 1KGXA 1A5SA 1KRBC 3KVMA 3W24A 1VLWA 3VNIA 1C92A 4NILA 2WSKA 4QJ5B 4C6NA 3O6DA 2PC4A 3BC9A 3SUSA 4C6CA 2TODA 1Z89A 4J1OA 3B03A 4DJED 3WQ8A 4HNOA 1UUMA 2R1NA 1RCOB 4WDUA 1G6CA 3VIJA 4INFA 4XB3A 1EOMA 1KXQA 1NOWA 3TW7A 1RK6A 4YN5A 2Z1VA 1CXKA 1PBGA 3ZO9A 1LQ0A 4GNJA 3OIXA 4JTKA 4ZOCA 4DUOA 4LUTA 2FPTA 4QM1A 4GI6A 1XFCA 1H3GA 2ZDSA 3VI2A 1QJWA 4C60A 1XGDA 3DG3A 3SY5A 5D2VA 3QQWA 2IXUA 3NL6A 1W3JA 2GVJA 4LS0A 4ZEPA 2X42A 4XVDA 2YA0A 1LT8A 3LHUA 1EEXA 2XZ7A 1U33A 2BXVA 1JQVA 1TQJA 3L4VA 2XINA 3F7JA 1BQGA 2PDUA 1L6WA 1R6WA 3GK0A 2E5CA 1MEHA 1MRAA 2NX3A 4CCDA 3KCOA 1K02A 3BMXA 3W7RA 1UJPA 2QV5A 3DGBA 1RD6A 2QIIA 3G22A 5REQB 1UC4A 3TE9A 4LUJA 2XIOA 1KGWA 4RNIA 3BAXA 3A4WA 4DJDA 1ISXA 1L8PA 3KUMA 2GOUA 1V02A 1K7XA 5C9ZA 3WNPA 1XPYA 2YYUA 3AIBA 3B4YA 4JNZA 1OFQA 2E9BA 1BHGA 5GVJA 1CIUA 4LNYA 3AXXA 4E3VA 3H21A 3PPFA 4X3ZA 3USBA 3EWWA 3FDKA 4NAEB 1WDWA 5KZDA 1SW7A 3VAVA 2HMCA 2YL5A 3BICA 5A6AA 3EYPA 2E6YA 1Q4WA 4XTDA 1DEDA 1U5HA 2PGWA 2QPUA 3SCPA 3H8AA 3M0YA 3V75A 1H11A 3O0FA 3TKFA 1V3LA 1XLKA 1RBOB 1YMYA 3M6DA 2PDIA 1PV8A 1XJBA 4O1AA 3P67A 1GTHA 1BF6A 4LVFA 3ITLA 3CB8A 2W6RA 1YBQB 2V30A 3MZNA 2FKPA 2QGYA 1J4EA 1TVLA 3T0AA 2V3GA 3QY7A 1AZ1A 1LORA 4PCFA 3WQVA 3R13A 1V3JA 5CG7A 4X2PA 3HURA 4OUIA 3NWRA 4IGNA 3F4WA 2BTMA 3LQGA 4DJFC 3QOMA 2QAPA 3UCCA 1KKRA 3TNOA 4ALDA 3AU6A 3VKDA 1JZ7A 2YW3A 4DNHA 3EKZA 1JPHA 2OXNA 7TAAA 1SO5A 3H22A 3N9RA 1T5AA 1TKKA 1DOSA 1Q6FA 3PTQA 3HPSA 1MO0A 3CUXA 5JH2A 3GR4A 3UG4A 5CBBA 4GI4A 3N2XA 3QMTA 4ACZA 1W1VA 1P7TA 1Q7ZA 1SSGA 1PX4A 1XLJA 4DJEC 2FB3A 3E2VA 2GFTA 4PB4A 3TN6A 4XZBA 5DFAA 2NQLA 2QS8A 2IS7A 3VE7A 4E5TA 5D9MA 5BZAA 3MC5A 5EFFA 4NIRA 2QW5A 1Z69A 3UG5A 4UTTA 1XLFA 2VDGA 1Y0EA 1QOXA 2CHRA 3L21A 1UWQA 4EE9A 3B9NA 2VKZG 5AHMA 1HL9A 4U5KA 2DW7A 5DXXA 1JD7A 1NDWA 4XD4A 3F2CA 4OKDA 1KQYA 4AD5A 2I17A 3PR2A 1DWFM 2D24A 5G5IA 4HTBA 5AECA 4E2VA 3TC6A 1OVDA 3UWZA 1RBAA 2XZ9A 2WYSA 4DX3A 3S3GA 5KZEA 3TW6A 3A12A 4JQ3A 4YPJA 4DAIA 2V2CA 4IQLA 3G1VA 1OX6A 4GK8A 3DCPA 1F76A 3GXNA 3NJ3A 3T42A 1PKLA 5AC6A 4QEHA 3K30A 7CGTA 1NFPA 4LOCA 4PTNA 2D0GA 2VRKA 4XD3A 4QJ1A 5HDRA 5F4XA 1V3MA 2YXGA 3ES7A 3E0LA 2HVOA 3NDYA 3AJ7A 4M80A 5LA2A 4AW7A 3NA8A 1R7AA 4HU0A 3QMSA 3MI3A 2QULA 5D09A 3A22A 2IKIA 4DELA 5CCZA 4DXKA 4DO4A 4XAZA 2XJ7A 3G6LA 3KOXA 2VEKA 3ABRA 1K8ZA 4N0RA 5DBTA 1EKOA 4CNPA 2VCAA 3AZTA 2JEPA 3LPOA 2ZUMA 3MUXA 3F1QA 4ML4A 1N8WA 2DVUA 1KB3A 4Z1CA 4J2MA 4JD4A 3S42A 1OG6A 1TRDA 4L7ZA 3EMCA 3T8LA 1EUAA 2VRJA 1I0BA 3OZMA 2BZNA 3G0XA 3RJXA 1US0A 1LL4A 1XDMA 3AS1A 1IV8A 4ZQMA 2YZ5A 4S39A 1MW0A 1FX6A 2J7BA 4E8DA 3TWBA 1TSIA 3MV01 2E9MA 3VFCA 1NP0A 4H83A 3PC0A 1R2RA 5BXSA 1RLDA 3BTNA 1Z41A 3ARTA 2E3ZA 2QUVA 5HATA 2EAWA 4K7VA 3DZ1A 1AL7A 3W7PA 4PTWA 4R9XA 5E5CA 1UD6A 4NZCA 4OIFA 1QNSA 4UZSA 1PIFA 3J7HA 1EBHA 1GKRA 4NYUA 2PLMA 3E2QA 1FWRA 4EPBC 1JQXA 4ERIA 4PC8A 2FHBA 1R9YA 1V0KA 1W9UA 2FPVA 5HQMA 3ARXA 1DWHM 3CZKA 1EJVC 2ASHA 3N18A 4GABA 3GWQA 1WE5A 1Q6OA 4W88A 4D8LA 1VH7A 5BXPA 1A80A 2XH0A 2QUUA 4DHGA 1RH9A 4NQ1A 3RGTA 4BF5A 4MSSA 4LB3A 1ZRQA 5EB8A 6TIMA 4JL2A 3H24A 3K8MA 2QJGA 4HPXA 1RY0A 1YYAA 3AXIA 4PUUA 4FAMA 2XSBA 4L64A 4I8YA 5H8PA 4C7FA 3FS2A 1GJPA 4PH6A 2OR2A 1D7FA 1EJXC 3U2ZA 4XO7A 5E0FA 3CWHA 5DN1A 3D47A 2AGTA 4LS2A 5LA1A 4CNTA 3OVRA 4UTMA 1GW1A 3DESA 4O54A 2TYSA 1EDQA 2VX6A 4GY1A 4E8GA 3RR4A 1UQYA 4WZHA 3STEA 1A5KC 1W1A1 3U5YA 3R10A 1R3YA 1H41A 1QK2A 3WUEA 1FWSA 2PDCA 1C8QA 1GVQA 1YRRA 4OBRA 4AZHA 3S6TA 3W7MA 4O57A 5BROA 3WD2A 4MFEA 4PB5A 5U4NA 1KBIA 2YA1A 4GQ0A 4JYDA 2XM1A 4US5D 5CLWA 5BCAA 2PA6A 1J2WA 1TWDA 1Z9AA 1Q8JA 1U30A 2FTWA 4OZOA 2P8CA 4JKKA 2AQOA 1L6FA 1K7FA 2YB4A 3WIJA 3SR7A 5REQA 4F0SA 1OGBA 3WDJA 3H2CA 3VD5A 4XAPA 1VBUA 2QCCA 1VRXA 3KBJA 5FKYA 4UTHA 5I3KA 2PD5A 3H2MA 2ABAA 4QBXA 3FAWA 3HGSA 5CC7A 4PUMA 1YTKA 2JFEX 2PP0A 3WLPA 5BW6A 3PUDA 4MM1A 4ATDA 1H51A 4WY0B 5FA5A 3ZLFA 3MTWA 1XRTA 2VZSA 2MUCA 4XTIA 4DLFA 2VP8A 3UGVA 3F4CA 2CZDA 2R91A 1XISA 1D8WA 1M53A 1XYLA 1U1HA 3DC0A 4B2DD 2JQXA 4M1BA 3MQTA 4NAEA 1W91A 5DCBA 3L2IA 3BAWA 1OC5A 3PJTA 3T4WA 1JYWA 2DZVA 2I57A 2VC7A 4H6KA 1QPQA 3VOGA 4WSJA 7A3HA 2ZA3A 1BVZA 3QKEA 1ENUA 1H09A 3KRSA 1EJUC 1LUCB 2ZADA 4WDXA 4AF0A 3OIHA 1AZ2A 4GGBA 3VNDA 4GYPA 1FBAA 2XGBA 2HE8A 3W82A 3APGA 3S9ZA 3NXFA 2ALDA 2XPKA 3KDNA 2QQ6A 1I2QA 4TX8A 1QWGA 1DJWA 3UBPC 2EJ1A 4B5SA 1KV8A 4DB7A 1EHNA 4QRNA 5AYIA 1TRIA 3ZS4A 3MMDA 3XIMA 3R5EA 4P7QA 1QW9A 3DBNA 2J66A 4AC7C 2YA2A 3CQHA 4RX0A 2PD9A 1WAWA 2V6AA 3ITCA 2V67A 1E6QM 3GIQA 5E70A 1H50A 5FACA 3TQKA 4F40A 3H26A 3ALFA 4IMCA 2ZC8A 3SY1A 3WLQA 4PMNA 3QYQA 2Y2WA 1N8FA 3OYZA 4DBEA 3KOYA 1XRVA 5C2GA 1GEQA 3B0UX 1VJZA 2WC3A 4BEUA 2GLKA 2QHAA 3W02A 1RY8A 4HNVA 4FIRA 1LLZA 3U6WA 2YXXA 5CPOA 4L4LA 4GKLA 1BKHA 1JJKA 3VOJA 4JHMA 1Y65A 5KSWA 4GYFA 4Y2WA 4IT1A 4DQWA 5EMMA 1OYCA 3G3MA 3CH9A 3QR3A 3BJSA 3FYPA 3CL6A 2XG9A 3TJ4A 2DPEA 4GVHA 1X1OA 4F2TA 3NQFA 4ZL1A 3D46A 4ZO6A 1ODUA 5J5DA 1NFGA 2ONEA 3CV2A 3W72A 4AQLA 3WJXA 4MAVA 2B0MA 1GOQA 2ZRVA 2GJXB 5AVNA 3TFXA 3N4FA 3R7MA 1S2CA 1OBAA 4MY1A 4E0CA 1GPFA 3IV3A 3G5EA 1B5TA 3PTKA 4JHZA 3TUUA 4IFKB 1S39A 4HK5A 5SWUA 3O16A 2DJXA 5FSDC 1W0MA 1JYVA 1TR1A 1MXSA 3OGRA 3V0UA 5IXEA 1XBXA 5C2CA 4V27A 4C6QA 4XSLA 3W00A 2WWDA 2BHZA 2OJPA 3PZUA 1P5BA 2XM2A 1TQXA 5AYBA 2EKCA 4YNGA 2VDIA 1LBFA 3K8KA 2V38A 1HVXA 1J11A 5IFPA 2ZRUA 4ILSA 1QI5A 2OODA 1GK8A 2MANA 4X2RA 2GGEA 1REQB 3FNDA 1PJ9A 4MKNA 1C8XA 4H00A 3WBEA 3SDOA 3NQGA 8XIAA 2C16A 3KTXA 3UR7A 3ZT5A 1K77A 4NX0A 4R7JA 1R9XA 1IE7C 2PWGA 3E02A 2DFAA 4MB5A 2P1FA 6A3HA 1LLOA 3QOKA 2PDXA 5HUOA 1VGAA 3EX1A 2TAAA 3FA3A 2VOMA 2PP3A 3IWPA 2OELA 2Q71A 2VGFA 2VGIA 2DVXA 4G1NA 2FYMA 4LF2A 1QMLA 4PUNA 4MAZA 2OT1A 4U28A 2D0FA 1X7FA 4QAIA 5HNRA 1LRTA 4KRTA 4E2OA 1CW2A 1HQTA 2QDGA 3MYOA 2XWDA 4MNMA 1ONXA 1KKOA 3EDKA 5I7GA 3O1NA 3C8FA 4RV8A 1US2A 4O8RA 2YCLA 3O06A 4Q3MA 2HNHA 3PUOA 5EMJA 4GJ1A 4R53A 3P8IA 5ABHA 5A1AA 1ICSA 1XIGA 1QWKA 3E0WA 1XBZA 3ARRA 4PTXA 4YHEA 4DZIA 3QRHA 1JAKA 3L5AA 1CBGA 2GSJA 4RPPA 4AD1A 1K6WA 4WRHA 4WOQA 2E67A 4N6FA 4K8HA 4AIUA 4KFOA 2XH4A 3BDKA 4MB4A 1EJ7L 3UA4A 3GC5A 4P2VA 4UCFA 3SQSA 1H7XA 3WJWA 1Q4NX 4LJ3A 4ZB2A 2YZRA 4CEXC 4L6HA 4ZR8A 3THUA 3CNYA 1ZSXA 5M03A 4NI3A 3S0CA 4HNLA 5LHEA 1V79A 2GJPA 5J04A 4NX5A 1BKSA 2F9RA 4KEMA 5DXYA 5KETA 3WD1A 4P7NA 5CQ1A 2WW5A 1T8XA 3NZRA 4IP5A 4AC1X 1W3IA 4FLQA 4FPSA 2V63A 4XBKA 1ZAIA 1MI3A 1IYXA 1KFBA 1FXPA 3UNDA 1PYMA 2VZTA 3ZVIA 4KWSA 1DBTA 3O9NA 1E0XA 1TREA 1UZDA 3QLLA 2XSAA 4HU4A 4ZQCA 1UJQA 4GH3A 4DF1A 3GU1A 4A29A 5F4WA 3WBWA 2BSLA 2A3CA 1TV4A 1GCYA 2AGKA 2WHJA 2J9YA 2J7HA 4NP7A 1S46A 4UR7A 1E1EA 3RN6A 3WDIA 3MZ2A 1BAGA 3S8HA 2R14A 2X41A 1A3WA 2Z27A 2R24A 4Y8FA 4Q4PA 3CAVA 4RK8A 3CAKA 3JVAA 1KBJA 3B8SA 3P84A 3UZJA 1XC6A 1VFHA 4I5RA 1YXYA 2VENA 1K9FA 1J96A 1CEOA 4GO9A 1FCVA 1KM2A 3NPXA 4AEOA 3SI9A 5LNRA 4FOJA 3EDDA 3WMBA 3GTXA 4PRRA 2DZPA 3WJZA 3VDHA 3HMCA 3WNLA 4LNCA 8CGTA 2ANUA 5I77A 2C1HA 4WIWA 3XINA 3TX9A 4AYGA 3KLLA 1GEHA 3GR8A 2G97A 3K4AA 5IBXA 2GK1B 4NJHA 2ZX6A 1F4HA 4NXSA 1TPVA 1WZKA 3GNRA 4EKJA 1QK0A 3LY0A 1VF8A 1JDEA 3B40A 5DLCA 5E1QA 1GQNA 4R9OA 4PODA 3MO4A 4FF7A 5T9BG 2CU0A 2DZUA 4NRSA 1ZL1A 5CPLA 1T99A 2QCGA 3GDLA 3K2GA 2CZFA 1XSKA 2CW6A 3WQPA 3WLNA 1W5QA 4Q8PA 2DUZA 1K70A 1SQ7A 3GU9A 3GBEA 2PDYA 3MY9A 2NUWA 1E9YB 3EPOA 1GW9A 4FXRA 4TV5A 4NL1A 1QPOA 4OGZA 4C6BA 1GVSA 4YVVA 4HD5A 3SN1A 4PSPA 1OGGA 4J28A 2GGJA 3BMWA 1QHZA 4GD0A 1AW2A 2QPSA 3P5ZA 5H2ZA 3HA1A 1UPPA 1KBBA 1BWLA 2WJZA 3GTHA 4GVIA 3L66A 4XZ9A 1SJAA 5EL1A 4ZENA 3GH7A 1LL6A 3QTPA 2PS2A 2EPLX 4RUBA 3DIPA 4PMQA 1I45A 3DYPA 4UTFA 3LV5A 4KFNA 4UC5A 2V3DA 2D2HA 4A8NA 1YE6A 3WBAA 3VVGA 4H7CA 4S3DA 5DRCA 5MKGB 1HUVA 4PMJA 3B0VC 3VOIA 3GXPA 1DYSA 1LQ2A 1IXPA 3RO8A 5RUBA 3CV6A 5HJLA 2I5GA 1OD8A 3LNMA 3SSJA 1RQBA 1HF6A 2NUYA 4N42A 4CVUA 1TV8A 3KZPA 1TTPA 2PDWA 3CIXA 4D8ZA 3TMQA 4H1ZA 5LIUX 1EFZA 4GI8A 1XYBA 3PZ9A 4O1DA 1MYRA 1EJWC 3B9OA 3RILA 1IWAA 4H04A 4JYEA 3CMGA 3OBAA 1GOIA 3T05A 2CNCA 2FQIA 2WNNA 2E09A 1E70M 4IFKA 4NVTA 3VABA 1IEQA 1NH6A 4ZOBA 2I14A 2PWVA 3Q67A 4YS1A 4L6DA 1GUVA 1KWKA 1S38A 3RPTA 3W1MA 1V93A 4BCEA 4L9ZA 3SUVA 2ACRA 3EWZA 4PMXA 2XFWA 3DX5A 4POCA 1WKYA 2F61A 4MJ2A 2QPXA 4GE8A 3TW9A 1SFTA 1Z42A 4FR1A 2CITA 2HJPA 3NL3A 3P93A 4W8LA 5A5WA 1LJYA 1KCXA 1QHOA 5C7HA 3V4BA 4UBPC 3BGAA 3HV9A 3NXLA 3LXBA 2AOSA 2VMFA 1J0ZA 3SRDA 4KGJA 4P8WA 1KFWA 4KWVA 2ISDA 2VC6A 1JPKA 3NQ2A 1H1NA 5H8MA 5A6SA 3PUEA 2ZDRA 3UEQA 3BG9A 5GPRA 4KW2A 1VBGA 1NWRA 2XVLA 1A0DA 3SJ3A 3UQNA 3IJ9A 3IJ7A 3M43A 4TO8A 4BQ3A 1JNEA 3S5SA 3T81A 2F2HA 3L2MA 3WY1A 4KFPA 4P7OA 4UQ9A 1HX0A 3LSBA 1E1FA 4GIAA 3HGRA 2FVMA 1ME7A 2O0TA 4DJDD 3OW1A 4YTQA 3AFBA 2E5BA 3MSRA 2DGAA 3MT1A 3N4AA 2V2DA 1G94A 4XAGA 3M9YA 3TNBA 1RV8A 2WKLA 2VT0A 1MW2A 4FIQA 2X09A 2GWNA 3LERA 3BJTA 3LTSA 4F2BA 3NPVA 1IEXA 1XH1A 3H7RA 3S2JA 1V7AA 3FFSA 1CGYA 3RMEA 4YYCA 3ICJA 1QPKA 1NDVA 4ZXOA 3BAKA 3EWCA 3THDA 2ZTKA 3AICA 2V81A 3WDHA 1EWEA 5JVLA 1ODZA 2D23A 3N14A 4DLMA 2G5WA 1BRLA 2VUNA 1F3TA 2WZEA 1J0YA 1ONRA 4B5XA 1D3HA 3MSDA 1DTUA 1TTQA 2WSRA 1P43A 1VJIA 2CESA 3MP4A 3E6EA 2WQDA 4R7OA 3QVQA 2TSYA 3PP7A 2XU2A 2C3ZA 3RITA 1E43A 1NQ6A 1YTEA 3WH9A 3W1PA 2YOCA 1QBBA 1PCWA 1J0KA 1H61A 1FP8A 3VD4A 3ARWA 3W38A 1BTMA 3NCOA 3ZWTA 2OU4A 5G4EA 3IGSA 4UTJA 4F3HA 3ECQA 5CSSA 2IKJA 1ADOA 3W2LA 3AIUA 4UTIA 3M5YA 5AZ0A 3CV7A 4RNJA 4ZOAA 3V36A 2O55A 2ZZ3A 3U57A 4HSNA 2NWSA 4NU7A 4CQ8A 3GH4A 4FOKA 1SW3A 3C3NA 4DIAA 3PNUA 4Q8TA 4KS0A 4FXFA 1LCOA 1WOAA 3FVDA 5LNUA 4LCQA 3QFWA 4K38A 4DI8A 4DEFA 1YDYA 2BB0A 2BGSA 3F5JA 4QSFA 5LXXA 4B9YA 3W7KA 4KT2A 4J3XA 2ZBTA 1DWAM 1BXBA 3K1GA 2PCEA 3MANA 1W9XA 5L6UA 2BXYA 1MSSA 2FB2A 2R1MA 2BOFX 3CV1A 3C3UA 1OIMA 2NV9A 1PIGA 2Y7FA 4TVUA 1Q7MA 4B16A 2G96A 1E51A 1WNOA 5T8GA 2GUUA 4JNMA 1JDCA 3PZOA 3B0XA 1LOLA 2DUAA 1QNRA 5G2IA 4H9XA 1W1IE 2Q3OA 4X61A 4PMRA 4CU7A 2VGBA 1US3A 1TMLA 4NZ1A 1JCJA 2HV5A 4DF0A 4N9DA 3WLSA 1F05A 4B3ZA 4XIMA 3GYEA 2YLLA 2UY3A 1AJ2A 2EBNA 4K7YA 3WMSA 4MMWA 1OC6A 1AL8A 1YXCA 1ITCA 3OHIA 4PMZA 1F7BA 3EGJA 2IKHA 4QXIA 3AQUA 3B8TA 4ZQNA 1VFTA 3U5UA 1KBKA 2GK1A 1WXJA 1Y5WA 7REQB 3VDCA 3LLXA 2ICSA 4F0KA 2Y89A 5BXRA 3MV11 3DH7A 1CLXA 2WQPA 2QVNA 5LIYX 3CPGA 2YLAA 2ZQ0A 4QCFA 4YWSA 2PWUA 3DKLA 1NTHA 2DU2A 3FV9A 1QW7A 3RK8A 4GXWA 4DJDC 1P6WA 4O10A 4ORIA 1GT8A 1DJZA 1RBLA 2RUSA 2REQB 3R2GA 3CLMA 4GQQA 2Z7GA 3SQMA 1E4LA 5FAJA 1XH2A 3KFTA 4FR6A 1AMKA 2QKFA 3NDZA 2ZWYA 2IQDA 1KNWA 4J5NA 1R85A 1E4MM 3LENA 1VS1A 1FCBA 1HT6A 3F4DA 3PK7A 1SYTA 3HG2A 3ANYA 2WSQA 3VE9A 2XUCA 3AJXA 4ROPA 3I6RA 5I3IA 1EGVA 4J3UA 2FDSA 3TR9A 4GA8A 2J13A 3F4NA 3AHVA 1EB3A 4P8XA 1QO2A 4LPCA 3G8RA 5CJMA 2PAJA 3Q65A 1BGGA 3UY7A 1RP9A 3EWYA 5E9XA 2DY3A 1JI2A 3TONA 1XKJA 4CKQA 2QDHA 1AQMA 1EX5A 4ECLA 5AVHA 3LCWA 3WUFA 2XYLA 3G1FA 3PY2A 1MRQA 4EACA 4JIPA 2NXGA 3UY8A 4RZ6A 4P5UA 2WVVB 1XBYA 1UYQA 5FF4A 4Y9AA 4Q4QA 1XGEA 1KR1A 3W83A 2XIIA 2ISFA 3AXHA 3W85A 2VX7A 3GKAA 4LALA 2A3HA 1OSEA 1J93A 2A7PA 1HGYA 2Z2UA 4XZWA 1CGUA 5I3DA 2BV9A 4ADTA 3T2QA 4P8UA 3GHRA 3CYVA 4JKLA 5A94A 4KIEA 3LBOA 1PHQA 2VELA 2EHHA 4LVGA 1W1PA 2VZOA 1X98A 2IPWA 3I3EA 4QG6A 1GKQA 3VNZA 3GH5A 4E8CA 1J18A 3R58A 1N7KA 2QAFA 5C9UA 5A2AA 1UR0A 3FGCB 3DFYA 1OZQA 3C5QA 3CIWA 4UTTC 3BV7A 3GVVA 1Z8AA 4C90A 3NQVA 5HR7A 1DJIA 4C1NB 3MJYA 4MUZA 3TN3A 1KRMA 2GYIA 3RF9A 5I0DA 1E40A 3WBXA 2PDQA 3C0LA 1CDGA 2VX4A 2PTDA 5HNNA 3GAYA 1XYMA 3V1HA 3TP4A 2EG7A 1XINA 3EX2A 1WBJA 4C6MA 4A3YA 2CHOA 2QDEA 3ABOA 2ISSA 4HA1A 4ZODA 3M47A 3ZT6A 1DJNA 1UWTA 3SCVA 4LV9A 3EEZA 4FI4A 3AYSA 1WZMA 3WSUA 1PS9A 1DKWA 2Z1KA 3T09A 3ZYZA 3GO2A 1JZ8A 3BCFA 5AC7A 1JGMA 2WPGA 3C2EA 2O7SA 4OE7A 3WH8A 4GYJA 3MP3A 5KZ6A 2C1GA 2G3IA 5AY7A 2J6VA 3KAOA 3FEQA 3P6LA 1AJZA 5DT7A 2H3BA 3WJYA 1ICQA 4NAFB 1MXDA 3PSWA 2V3EA 4I6KA 2XFRA 3S9YA 4JICA 1VHNA 2ABBA 5D05A 3ITYA 1RA0A 4D72A 3DKJA 3UXLA 3B8IA 4A2RA 2OCZA 4ROQA 3CLWA 2W9MA 3NVTA 1UH4A 4AX7A 4MIMA 2J75A 4IUOA 3D3AA 3GXIA 3ZJ7A 1UD2A 3LU2A 3W7JA 4AXNA 4F0RA 4XX6A 2OSXA 3XISA 4B91A 1V03A 3UYCA 3VD9A 3VDBA 1QNQA 2O4MA 2VQTA 5H6HA 3R6IA 1EGZA 3ARPA 4AG0A 3BO9A 3N9SA 3NQEA 4TTGA 1JZ5A 1YQ2A 2QNEA 3W07A 2WCAA 2H90A 1SZFA 2XIQA 2PWFA 3W86A 4B5NA 3INPA 1MUCA 1HJWA 4AWUA 4UNKA 4HIBA 4A3HA 3CIVA 3RCMA 3AYTA 1E72M 3TH6A 4ZA0A 4EWND 4UZUA 2GQ8A 2OT0A 4FEZA 4QQ3A 4NJGA 1ZNNA 1IZCA 3C0JA 1PL9A 1DJYA 8A3HA 2RFGA 2WWCA 2NT0A 5EU9A 1J0IA 3AMLA 4IJCA 4RDWA 3TU9A 4TVDA 3AS2A 3URBA 3PBWA 4E38A 2QJNA 2VX5A 4NZJA 3N3MA 2NLIA 2G37A 5HWMA 5U7SA 3VUPA 3H55A 2OX4A 1HKIA 2ZYFA 1W5OA 3REQB 2VVSA 1AQ0A 3QV8A 1W2VA 3A5FA 2OTDA 3WJSA 4LFYA 2BS9A 4HHLA 1YW1A 3M0XA 3IPWA 4QISA 5CG0A 2B31A 1ITXA 4M81A 3SCSA 1UOZA 4IQJA 1V77A 4P61A 3SCQA 3T7VA 5DCEA 3GW0A 5CC5A 3QGVA 4B5WA 4MZ8A 3FK4A 4HPGA 1JF5A 4M51A 1JAEA 2WO5A 4BQ2A 3I6TA 1OT1A 3WQ5A 2E77A 3DENA 3W28A 3FDGA 2Z1BA 5LGZA 2QCFA 1V0NA 1THFD 4W86A 2PF8A 3LXCA 4QGCA 4N9EA 4LGXA 3TCSA 4Z0SA 3HPFA 2V5JA 3N19B 2VFHA 2NX9A 3UZYA 1G4EA 5AFDA 1G1YA 3ONCA 1W3LA 3UPWA 3LV6A 1JVNA 2X1TA 2Z29A 2G3NA 1H7WA 1RALA 3QN3A 4FLOA 7REQA 3DERA 2Z1SA 4YHGA 2AAMA 5DANA 1HO4A 1C8YA 2KZHA 3TTYA 5HJYA 5EMYA 1P0DA 5G4WA 1UWRA 3AU2A 3SB0A 4REQB 1ZJAA 1WCGA 3GVQA 3JS3A 4GVGA 5BNKA 2VFGA 2NV2A 3PG9A 3LHTA 3B8UA 3O6CA 1OK6A 2VEPA 3SRFA 4UWMA 3WNOA 1QRQA 1J10A 1UA7A 3TYDA 1QNOA 1T0OA 4WQ6A 3ARVA 2G3MA 3SFWA 1DE5A 1F61A 3PPHA 2ZRYA 3HPXA 4KWUA 1WV2A 3A3WA 3LBCA 1ZU8A 3GG0A 3KL3A 3QC3A 1ZQ5A 3IK4A 5GNZA 1UKPA 4ZQOA 4HZ7A 2PRMA 2OSWA 3CWNA 1U1UA 1XLGA 3VKKA 2X2YA 1FH8A 3I4EA 3P14A 4WSHA 2DP3A 5XINA 1VP5A 3DI0A 3LGEA 1TJ1A 1DJHA 2D3NA 2PDPA 4JTDA 3FYOA 1JDAA 1JULA 4IQEA 3M0MA 4PBEA 4GYPC 1Z32X 4AY1A 4J3WA 4HN4A 3SRKA 2CETA 1PZ0A 1FWNA 3MHFA 4PUEA 3L68A 4IIDA 4WGHA 1P1XA 3H12A 4C1KA 1HN1A 4NNAA 1K9DA 5LZLA 3SUUA 2Z6IA 5E9AA 4BF9A 5JH1A 3EWXA 1Y5XA 4C6JA 4HT3A 3N11A 4AFYA 2YDRA 3CPUA 1LP6A 1F74A 3CT2A 4OOZA 5IM51 1PDZA 4IH3A 6XIMA 3V5OA 4YCPA 4PULA 2CC0A 4BI7A 3VIFA 4ASTA 1C93A 1NWSA 4IIGA 3TDFA 3QEZA 4MWAD 5IDIA 1PX8A 5FD0A 4FNTA 1A4LA 2V3FA 2ZX8A 9RUBA 3P5YA 3W37A 1FH9A 4XK2A 4JHOA 3I3BA 4JNYA 2X40A 4JBRA 2B7NA 2YCJA 3EA3A 1XX1A 1L9WA 3FGCA 3VO0A 1RHCA 3HV8A 1ZJBA 4ZFCA 5DMNA 1TUFA 4FLSA 1EJRC 4HTYA 3O6AA 1Q6QA 1CWYA 4ZO9A 1HJSA 4KWWA 1ZBVA 4S3AA 1FWGC 4JTSA 1ZBCA 3NIYA 3BARA 3EOEA 1IWBA 9XIAA 3QY8A 1U1JA 3VIKA 4CD5A 4JQ1A 3KTCA 4HNUA 5C5YA 3RLVA 4MJMA 3SGGA 2ACSA 1HKJA 4ZBCA 3CZEA 5HOSA 3E5BA 4W7WA 1F6YA 4ICNA 1A50A 1BSIA 5A2CA 3FKRA 3K1DA 4CQBA 3UP8A 2AKMA 2BY1A 1ITUA 1JDDA 1ESWA 4UTLA 3S2MA 1ZCCA 3GX9A 4YJ5A 1WQ5A 1S1RA 4HA0A 4Y90A 1EC9A 1M7PA 4IP7A 5I24A 1E3ZA 1VCGA 3O05A 3RCNA 4NZ5A 4LC8A 1O1HA 4C5YA 5IHSA 1KTCA 5L9FA 5AHLA 2AAAA 2P3ZA 2W5FA 4NAFA 1GOXA 1QOPA 5D9PA 3CUZA 1HJUA 1UP2A 4JFWA 2SFPA 4LUIA 5A6TC 3THQA 2C7FA 3PHAA 3M07A 2VYOA 3W9ZA 3QPYA 4AHPA 3V5FA 4PTMA 4AD4A 2OZ3A 3WLJA 1QHPA 1WDPA 3TXVA 1WOBA 3P3BA 1ISVA 1E0VA 2CLLA 1FKXA 4CQCA 3IEBA 2BVYA 1SU5A 3AAMA 1KXTA 2E8ZA 1JFHA 4J27A 3LNPA 4RE2A 4WEVX 2DUXA 3KBSA 1FWTA 1PZ3A 2E28A 3PPGA 4FS9A 3AWOA 1OYAA 1IZJA 1XIIA 4LU0A 2VFIA 3TA9A 4XO6A 4C6DA 4DWSD 1QPRA 1KLZA 2IPFA 3BZGA 4JEQA 3SGUA 3LYEA 4DRSA 1XP3A 2C19A 4PEEA 1M3UA 3W7HA 1A5MC 4H6RA 4X9SA 1TPH1 2JEQA 4E4UA 1SMDA 3CHFA 3VMNA 2ZTJA 2PDBA 4YLWA 4AWEA 4L80A 3AROA 1TCDA 2FGZA 4NJIA 1HJVA 3WH6A 3FVMA 3SN4A 3LM7A 1IHIA 1NWTA 3V35A 4L1WA 3KCLA 3SY8A 3GFZA 1FUYA 1TE6A 7PTDA 2FHCA 4NKCA 4NXKA 5JBFA 4JKMA 3GYCA 3VGFA 5FEWA 4UFLA 2O4QA 1OCJA 2AQVA 3QR1A 2YSWA 1UUOA 1E5JA 3SURA 1NSJA 2A21A 3QW3A 3H53A 3TOPA 1Q6LA 3LZ3A 2X1SA 1EPXA 4MWAC 3GIYA 4IXXA 4GINA 3WQFA 2POZA 5EKYA 2ACQA 3T2OA 3W73A 2H8ZA 2WOQA 5HPCA 2HDJA 4OECA 3GB6A 1XM3A 2RGLA 4EXBA 4IUGA 5EA9A 3B05A 1XIJA 4QAWA 3KE0A 1O6IA 4MLRA 1DTNA 3BE7A 2PURA 3NQAA 3RR1A 3EKGA 6REQA 3VU2A 4DZ5A 4PE8A 4PFMA 3IIXA 1VKFA 3VX1A 4D71A 3N4EA 4JTRA 1U22A 3AIEA 2Y85A 3CAQA 4YXGA 2ZC1A 4GRSA 5EGRA 2IPGA 2KX9A 3ABSA 1JCYA 5E0KA 2J8GA 1OX4B 3WQEA 4HYRA 4YVPA 3WFZA 1UKTA 1Z6KA 3N12A 3VD7A 3BG5A 3IJ8A 1VEOA 4Z42C 3PZMA 3QHOA 4GBDA 4UOJA 4QLLA 3TLLA 1OABA 5HMEA 2W63A 3DECA 3GDTA 3KOWA 4OFCA 4JTJA 3B9DA 4REQA 2CLHA 4DVOA 1UPMB 4I7UA 2B4GA 1J0JA 1O5RA 3RXZA 2HQAA 3I3DA 3DOPA 1JUEA 1M03A 4Z2LA 4AZBA 4QEEA 4LUSB 3W1UA 5E09A 3KP0A 3LRKA 5K7JA 3QSRA 4I9TA 1E6XM 3W1LA 1F4AA 3EXSA 1AQHA 1MUWA 2DT2A 1U83A 3BLOA 4I9AA 4PMYA 2ZWZA 3S5OA 2A0NA 3IVUA 2J78A 4DXVA 4Z1DA 3SAZA 4HHPA 4FA3A 1NIUA 3MPGA 3CUIA 3S5NA 1K3UA 5IBXC 3BWWA 3S2NA 1I9CB 4TTUA 4IQDA 2YJQA 1C3FA 4IGMA 1RQEA 4D6CA 3CHVA 1R3VA 3GTIA 3HTWA 4C6PA 3AC0A 1BD0A 2BOGX 3G0SA 4QROA 1C90A 1OADA 4DWSC 3VILA 1QNVA 2BGQA 5G2HA 1W3KA 1ZENA 3VC6A 2DW6A 4PCSA 1XIEA 2YBVA 4N4QA 1Y8BA 4UQAA 3KDOA 1MDRA 3R0KA 2VM8A 1V6XA 3GZ3A 3IIPA 1UBPC 5A2BA 1JZ6A 3WL0A 3VOCA 2FZ8A 3N6JA 1HXJA 4OHQA 4DZHA 4DO6A 4XZMX 4CQ9A 2QCNA 5C9WA 4PRTA 3C0SA 2OQYA 1XC4A 3N17A 1EP1A 1ZHAA 3DHDA 4GKTA 3IJDA 4LYKA 4DPPA 1D8CA 3A5VA 1DIKA 1W9PA 1UKSA 4QFUA 4NHVA 3W7LA 4GUFA 5AHNA 3FHQA 3T55A 3COTA 1IIGA 1JL8A 1QT1A 1EO7A 2NVDA 1EC8A 2YPIA 2JK2A 3BCJA 4H8NA 1IWPA 4I9JA 2BFGA 3GNNA 4JXCA 2EO7A 4FOUA 1LBLA 1U2YA 2QDDA 3A4XA 3UA3A 3MP5A 1W54A 1Q13A 3NQ7A 4IGSA 5CZKA 3L5LA 4D9PA 3THCA 3LBMA 1GOKA 3UPBA 5FF2A 5I09A 3N9KA 2OYKA 4KQNA 3ALGA 1Q6EA 4O17A 4MDOA 1TR9A 1XV8A 3W2JA 4L61A 2Y0FA 3LCIA 3QV7A 2GVEA 4UTWC 3S6DA 1Q66A 4H2HA 3NPUA 3IIOA 3AHYA 4P7RA 2E6DA 4B4HA 4IICA 3VFLA 4GZIA 3W0KA 5M5DA 3AXKA 4UFMA 5IHRA 3B0YA 2JF7A 3NVDA 3U4AA 3FW6A 1JR1A 4Z1YA 1CI1A 1GHSA 3RRXA 4E4FA 3CL8A 5DBUA 5MF5A 3WMLA 4D6FA 3NZ1A 3YPIA 1MW1A 2ZVRA 2DQWA 1VYSX 1Z44A 1I2RA 3SQLA 3LCGA 1EJSC 2EPHA 4U3AA 3OVQA 2P0IA 3EA1A 3PBGA 2ZRXA 1XGZA 1XQKA 1QFEA 3OGVA 3W2NA 3F5LA 4M24A 1EGMA 4JY9A 2A7NA 3CM4A 1QI3A 3GDBA 2DZSA 3G3DA 1CT5A 2NUXA 4QE5A 4NZFA 1HGWA 1ONEA 3NFUA 1Q2SA 4LBRA 2Y7EA 3UR8A 3AMCA 4MNJA 3W7NA 1X8FA 2FGLA 4A8LA 4UB9A 3N2TA 2CYGA 1GJWA 1X1ZA 4UUIA 3RX3A 3HG3A 1W8SA 2ZRZA 3QZAA 1TPWA 1ELSA 3UVAA 5FAGA 2XFFA 4GCAA 2UWFA 1ZS2A 1H1ZA 3M5XA 3H7UA 2A79A 4FXJA 1KRCC 1QUMA 3WEZA 3R8HA 1WUFA 4DO7A 4MB3A 1ZAJA 2HWGA 4Z2JA 4JS3A 3OHMB 3V3WA 2ACUA 1VHCA 1XSJA 1PHWA 4ONVA 4EPEC 3D5HA 3WO8A 1RJPA 1R30A 4L9YA 4A05A 1O95A 1XLLA 3PN8A 2FVKA 4W8AA 5D2YA 4DBWA 1FWIC 1ONWA 1ZUAX 2W61A 9XIMA 3WQGA 1PUDA 1C9DA 3AYVA 2WB5A 4V2XA 3IRDA 4KETA 1R3TA 3E0FA 3OLEA 4JFVA 3JW7A 1BPLB 4FNSA 4Q8QA 1E9IA 5EMLA 4KIRA 3BAYA 3A13A 3BOXA 1S5VA 2Q8LA 1LQAA 3PULA 4RXFA 1JNDA 1XG3A 3RIKA 5I6SA 3DXIA 4C5ZA 4OTKA 1FWBC 4GUGA 1XIHA 4FNRA 2WBGA 3ABZA 1DE6A 3LB0A 3S2CA 4GI9A 5C2XA 3W25A 1VCFA 4CN1A 2XGZA 3CQIA 4CD8A 3IAQA 4MADA 4Q8WA 2ZUNA 1YDVA 4H8HA 1VYPX 2JIEA 3DC8A 3N29A 1DQWA 5DY2A 1FRBA 1HIZA 5BWFA 3H4XA 1W8GA 2VVNA 3G1RA 5K3VA 3CUGA 5FJJA 1UD8A 2RHGA 3PTMA 3DG6A 4Q8MA 4HHHA 2A3LA 1YIXA 1DQUA 4JDBA 4G7EA 4UFKA 1NU5A 1DV7A 3SGZA 3V5CA 2HTMA 4J3SA 3ORWA 1KTBA 3GG7A 4IL2A 1FDYA 5I3HA 1FCUA 3W7GA 3B8VA 5EPDA 4XD5A 5LGXA 2EKGA 1GORA 4V15A 3H2FA 5AYZA 1OX4A 2PWEA