4DF1A

Crystal structure of orotidine 5'-monophosphate decarboxylase from thermoproteus neutrophilus complexed with inhibitor bmp
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
199
structure length
199
Chain Sequence
NLPLVVALDTEVLKAIDVAKRLKGAVAGFKVGWDLIFEGGISIVGEIARYGNVIVDLKIADVPHVASRVVEKLVNRGACCVIVHGFLHPSLPRGQHVYVLVKMTAPTIYDEMWEKLLNSVQDVRGFVLPGNQPEVVAQARKRIGCSYRIISPGIGPQGGRPGAAIEAGADFEIVGRYVLEDPARISQWAQYRPTCFETP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Crystal structure of orotidine 5'-monophosphate decarboxylase from Thermoproteus neutrophilus complexed with inhibitor BMP
rcsb
source organism Thermoproteus neutrophilus
molecule tags Lyase/lyase inhibitor
total genus 70
structure length 199
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4df1A00
4UTMA 2X1UA 3U2OA 3W1AA 2WNNA 4OWGA 1B3OA 4O19A 5AHLA 2J9YA 4UTJA 1UUMA 4K6AA 2ZQ0A 3TSMA 3T78A 3G1YA 3UPWA 5LNRA 4O11A 1TSIA 4DXVA 4CCCA 2ZZ5A 4LUJA 3UPBA 4AF0B 3GDMA 4JTUA 3FKRA 4FNQA 1PCKA 1UBSA 1SSDA 1F05A 2WV8A 1W8SA 2Y7FA 4QISA 2YDAA 1KM3A 1JQVA 2CWNA 4GNJA 3G24A 4JTJA 3C2VA 3IIVA 4ORMA 2Y7DA 3NM1A 1VRDA 1LM1A 1G4TA 3RU6A 2ALDA 1D9EA 1C29A 3PWAA 4M7SA 1VYSX 3N2XA 3I7QA 3C4UA 4BK9A 3GVGA 1SZEA 4UNKA 3BG3A 1R2TA 2D73A 1UB3A 1KLZA 1GG1A 3ABRA 4HPXA 1SFLA 3UNDA 1H61A 1Z41A 3NQ6A 1OFPA 4X22A 2ZZ6A 3LTPA 4XBSA 5KMYA 2X2GA 3ABQA 3P74A 5CKSA 3CT7A 3W2KA 5G2IA 3ZR4A 2OT0A 4AWUA 2CLEA 2DP3A 5D2VA 4LV4A 3QPZA 3WJXA 1K3UA 4MFEA 3W1XA 3UWQA 4WY0B 3UZ5A 5C6MA 4UFJA 1O5XA 4CQ9A 3NA8A 1XDMA 1H1ZA 3G3MA 3B8DA 3TFCA 2F7FA 2Y7GA 3DXIA 5D30A 3HPSA 1ICQA 5TBOA 2OMAA 4MJZA 3R13A 3DBPA 2ZRXA 3CWNA 2QUVA 2VFHA 5AC8A 4G1KA 2V2CA 4YWIA 2CLFA 1W3TA 4UCGA 1SW3A 1IXOA 3JR2A 3W6YA 1OFEA 3H53A 2C19A 3O05A 2CLOA 4JTGA 4AHOA 2A0NA 3V1PA 3S5NA 1GVOA 3IVUA 1QOPA 1LZOA 3PUEA 5D33A 2FQIA 2QCCA 1QPRA 3W2NA 2NXIA 3GXTA 3MP5A 2ABBA 3P80A 1TCDA 3W7MA 3QF0A 4FHAA 1KBJA 5LSMA 1QNVA 5D09A 1H60A 1QOQA 2FPYA 1F5ZA 2C1HA 1L6YA 1AL8A 1GG0A 5AOUA 3TSBA 3EWBX 4JIQA 2QAFA 5HUPA 1AG1O 5K3VA 5CPLA 4JYEA 3IIPA 3W7IA 4YCPA 3TA6A 2VELA 3UY7A 3W1PA 2H3DA 3FEMA 4QNEA 1PVNA 3VE7A 2Q3RA 3P8IA 2A6LA 4AH7A 2RKXA 3KVMA 2ZYFA 4MIMA 1I45A 5DLCA 1P4CA 3C2FA 4H6KA 4RXGA 1W3IA 2QF7A 5LGZA 4Q33A 5D2XA 1EWEA 4OBTA 3WJZA 3W9ZA 3G22A 4J9JA 4R33A 4AAJA 3A5VA 4DPPA 3NGJA 3RLVA 4MY1A 3L5MA 1H7RA 1EPXA 4JNMA 4M19A 5FEXA 1H7WA 3W70A 1FQ0A 4ZMGA 3N3MA 3WJYA 3CB8A 4PFMA 2CZDA 4LNYA 3W71A 3LCFA 1YDOA 3MYOA 2VFFA 3W7OA 5LGXA 5D04C 4TX9A 4O4VA 3SGZA 4E38A 3A24A 4GRSA 3T7VA 3TIMA 3M47A 2ABAA 1R2RA 1Z44A 2JK2A 3E96A 3C2EA 2FPTA 2XFWA 1G6CA 3NR0A 1OFAA 3LI0A 3TSDA 3SIZA 2VFIA 1LRNA 2NV1A 4UMAA 1OG0A 2I1OA 2V8ZA 3CTLA 3G8RA 3CLMA 1UUOA 4HSNA 5FEPA 4NU7A 4UC5A 2EKCA 1AW5A 3EX4A 4YCOA 5I3KA 2WO5A 3EXTA 1GYLA 2GJLA 2NZLA 2Y62A 3DI0A 1QO5A 3W72A 1EA0A 1J4EA 4HKPA 1KM2A 4I7UA 3PBUA 1SW7A 3TR2A 2GJNA 2E6DA 5KSWA 4GUGA 2CLMA 1X6UA 3MI2A 1GVFA 4JY8A 4WOQA 3Q58A 1W5OA 4LY8A 3GYEA 4ML9A 3DH7A 3EKZA 2YZRA 2A1YA 1FUYA 3EWXA 1HFBA 4XQ6A 1TPB1 1S5WA 3BW2A 5CG7A 2HS6A 1O94A 4RZ5A 4IJBA 4AVFA 5AC6A 4KFPA 5EA9A 4MYAA 2TSYA 2QCDA 5F2GA 2BX7A 1JJKA 3E02A 2R91A 1KM4A 3W7RA 1NF0A 3UWZA 2TYSA 1B57A 1OFRA 1C9DA 1TQJA 4JX6A 3NXFA 3CU2A 1XFBA 3O63A 3W1LA 4EOUA 3IEBA 1JCMP 2X16A 1BEUA 1NVMA 1YYAA 4BF9A 5BMXA 2VENA 4NX0A 1KFJA 4Q32A 5AN7A 3SR7A 3TNOA 4IX2A 1IGSA 2P0OA 3EB2A 3LHVA 4Z1DA 2NLIA 2OJPA 3IIXA 3PF3A 2ZRWA 3TMQA 4XWUA 1X1ZA 3NQGA 2YSWA 1ME7A 4RK8A 1SW0A 2AQWA 4O14A 4B5NA 3WK0A 3NPVA 4ZQCA 5G2WA 4Z1CA 1KFLA 3P67A 4X3ZA 5I3JA 5K7JA 4ALDA 1PE1A 1J2WA 4UFHA 2C15A 1AL7A 5TQLA 3UWYA 5IM51 5A8GA 3W7NA 3LCIA 1FCQA 2QCNA 1DHPA 1OX6A 3W1QA 1MSSA 5AYYA 1YLVA 3M0ZA 3CHVA 2QJHA 3HGJA 2RDWA 3NQ2A 1JULA 1DQWA 3TXVA 2DJLA 1PHWA 2YFNA 4NJIA 2V5LA 2QUUA 5CGQA 1KTCA 1YXDA 3OVRA 1E51A 3HPXA 3MYPA 4U4MA 3N9RA 4JR5A 3LXCA 4HNUA 3TW6A 2A21A 2NUWA 3THQA 2WSRA 4XUGA 4UFLA 1BKSA 1DJQA 1ZAIA 4UFMA 3S5OA 4IMDA 3A9IA 1ZY9A 3ATZA 4FNPA 4NQ1A 3HGOA 4LTSA 3W1MA 4K37A 1Q3NA 1IIGA 1M6JA 4PTNA 2ISWA 1QAPA 4OE7A 2QDGA 2CZFA 5BNKA 1LP6A 3GR8A 4FX8A 3DHDA 1I2PA 3B05A 3KVJA 4RXFA 1LOLA 1VCGA 1VLIA 2NUXA 4Z0SA 3OG3A 2VXNA 1FDJA 1W5MA 1FWNA 4N9EA 3S5YA 3M5XA 5H91A 4MPQA 5LNSA 5DELA 3BG9A 3BPWA 3O06A 2H8XA 4JTSA 2H90A 2X1RA 4NXSA 3LLFA 4ADTA 3LHYA 2NUYA 3U8GA 1RR2A 1UASA 1EWDA 1JUKA 1HL2A 4BR1A 4HT3A 1D3GA 3P81A 3UQNA 3ZWTA 4GFSA 1U5JA 2YXGA 1X8FA 1H63A 1YDNA 4N4QA 1F7BA 2R14A 4UMBA 3W7DA 4M6VA 4TU1A 1DKWA 1ICSA 1DQXA 1KM6A 2ZZ7A 3P62A 2EF9A 1ALDA 4BI5A 4FNTA 1A53A 1W31A 3I68A 5DBTA 1JRBA 4RLIA 1KM0A 3L65A 4C1KA 4JTFA 2YGYA 5I3FA 1L6SA 3MJYA 3QH2A 1FWTA 2YPIA 1GQNA 1L9WA 4XTDA 1K03A 3W07A 4A3UA 3D0CA 1KA9F 1TV5A 1VZWA 1WBJA 3IGUA 3M41A 1TJRA 4NX5A 5AHIA 1G7UA 4LC6A 1BWLA 2V81A 2YW3A 2AAMA 3GDKA 5K2ZA 2QDHA 2E77A 4GUIA 3KOFA 1EX5A 2YW4A 3ABOA 5F2LA 3NDOA 3C0JA 3B4UA 3TE9A 3FLUA 5U4NA 1FCBA 3LCWA 1O4UA 4O0KA 4WUIA 1EP3A 1I8JA 2J24A 5F4XA 3RK8A 3CM4A 2B7OA 2TPSA 2QCMA 3W86A 2JGQA 1G7VA 2JKPA 4L4MA 4ONVA 4A22A 1QMLA 5LNWA 1GT8A 1MZHA 1LCOA 4N2YA 5FEWA 1LBLA 1A5CA 1DVJA 1MEHA 2C0AA 4UFIA 3KVLA 1LLWA 4Y96A 3B0UX 1H7XA 1LBFA 3LXBA 4ADSA 3EEGA 4R7JA 1ZCOA 3BV4A 3LRMA 4FX6M 4WD0A 5F2MA 2QCDB 4JTHA 4O1BA 1FWRA 1WDWA 3G8EA 3N2MA 1H50A 4O1AA 4ZQRA 4S1FA 2XN2A 4HIBA 5HMSA 1ADOA 4I9AA 1I2OA 3TKFA 5FEZA 3BK0A 3GKFA 3P82A 1OFBA 3L0KA 3GDLA 1N7KA 3NQDA 4AXKA 4GJ1A 4LRTA 1F73A 1GJPA 2CW6A 3OBKA 4PL2A 4Z1BA 4NJGA 1CI1A 4X9SA 1TPEA 3DI1A 5HWNA 4QNWA 1I2NA 5BMWA 3W1RA 1L6WA 3LTYA 4EF8A 1DOSA 2H6RA 3DZ1A 4OV4A 5E93A 4E2BA 2Y85A 3SY5A 3TQ0A 3HQ1A 4MOZA 2GQ8A 3N34A 4FB7A 1TPFA 2C14A 3PBWA 4PA8A 2DZPA 4O54A 4EWND 1H5YA 3BLFA 1RQEA 3GLCA 3VNDA 2CZEA 3BW3A 2W79A 3HG5A 3BW4A 5LHEA 4UTUA 4CCEA 2NX1A 4R53A 4IMCA 4A29A 3ATYA 5F4SA 2WQPA 3VKJA 3MW7A 1ME9A 3G0SA 3Q94A 4U28A 3CQ0A 5D2YA 3T55A 2P10A 1EP1A 1YDVA 2AGKA 1TYGA 3INPA 2UV8G 3DAQA 2NWSA 2GVJA 4DF2A 3O15A 3R89A 1XM3A 3S8HA 1IXQA 2Z1BA 4P61A 2DZSA 4NJJA 5AFDA 1KV8A 3W7PA 1XUZA 5EMUA 1K02A 3W7KA 1XI3A 2PE4A 4QSHA 4NNBA 2A7PA 1W56A 3FKKA 3TX9A 3T4CA 1W0MA 2B0MA 1OHLA 4UTKA 5I3IA 4LVGA 1QFEA 4JTLA 1W1ZA 2Y6ZA 5DY3A 5F4WA 3RNDA 4JS3A 4O4WA 2B7PA 4UMCA 4RZ6A 3VCRA 5DXYA 1JCJA 1AK5A 4ADUA 4M7TA 2GVGA 3L5AA 1WAUA 4TMBA 1FDZA 4NNCA 3HMJG 4AWSA 1MEWA 2VEKA 4O10A 3N9SA 3PG9A 2V5BA 1GVQA 3NNTA 4QM1A 4WQ6A 3O6YX 4H3DA 4JX5A 3FYPA 4UTWC 2G96A 3OVPA 2C13A 3L66A 3NPXA 2I14A 3QJAA 5KTLA 1TV7A 4N02A 2FJKA 5D38A 7TIMA 4DQWA 1VS1A 1TRIA 3JRKA 4O53A 3M5YA 4UUIA 2QR6A 3TJXA 4MLJA 2BZNA 4OHQA 3R8RA 4E0CA 3ZWSA 5HINA 2ATSA 3CIWA 4QQ3A 1W5NA 2BWGA 2A6NA 4XKYA 3W87A 1R30A 1HTIA 3F1QA 3M5VA 3G0UA 3DFNA 3MP4A 2W6RA 4RV8A 1A5BA 1LTDA 1O60A 2ZZ4A 4LUIA 5U7SA 4LS0A 4LVDA 1HO4A 3LV6A 3USBA 3W1UA 3T40A 3G1SA 1XBZA 4OGZA 1KBIA 3MBFA 5FF7A 3FJLA 5HJLA 2X30A 4LC8A 1JCNA 2FB2A 3NVTA 3QC3A 1KLYA 1K7EA 1JUBA 3I7RA 3I7SA 3JS3A 3M9YA 1SZGA 2Z0IA 5BRBA 1OF8A 1FBAA 1EUNA 4O17A 3S1UA 2X1TA 5K9XA 4PEKA 3SECA 4IX0A 2PRHA 5ABTA 2NV2A 1T99A 4IMEA 3BG5A 3UWVA 4GWEA 2EAWA 1OFDA 4FO4A 4JDYA 5CZ0A 1TV8A 3UWWA 2FTPA 4O15A 5J5RA 1T96A 2GQ9A 2R94A 3W7JA 1WQ5A 4DO6A 2B7NA 1FX6A 3CC1A 3C8FA 3QQ0A 1GPWA 4MY8A 4QIUA 1RQBA 4N4PA 1F6PA 4UFKA 1VQTA 1MXSA 4FIQA 4UTWA 3HG4A 2G95A 2A4AA 3THAA 1H51A 8TIMA 1PL9A 2O7QA 1RD5A 3TXZA 4D2JA 4AHPA 3MI6A 3TAKA 1WA3A 3M5ZA 1HO1A 1GZGA 3I6RA 1OVDA 1SPQA 5LZLA 1C8VA 3L5LA 3H54A 5G2HA 1YADA 2BTMA 1SUXA 3BO9A 1QPQA 2Y88A 3NZRA 2YFOA 2QCGA 3P84A 2Y7EA 4I7WA 4BI7A 1P5BA 4NZFA 5DCBA 3G0XA 2OT1A 2WNQA 3NM3A 4K7VA 3MO7A 1RVGA 4IXHA 3N73A 5FF2A 2YX0A 3FIGA 4LWWA 2GOUA 4XBKA 3N14A 3TFXA 4CNOA 3L9CA 4UTHA 1PCWA 3PSVA 3STFA 3A5FA 2FB3A 3SW6A 1KTBA 2KZHA 2ATMA 3R2GA 3SJ3A 2VEMA 1OFQA 3O1NA 2YYTA 1XDLA 4KWVA 1QO2A 3BVJA 4AHQA 3LCLA 4Y90A 1QPOA 4PCFA 3M44A 1XL9A 1EP2A 3MUXA 3B03A 4DF1A 2O7SA 3CWOX 4M6QA 3NQEA 4UXDA 1WOAA 2YCEA 3HG2A 1F76A 4WZHA 4NXKA 3QEZA 1TTPA 3IIZA 2ZRZA 4OT7A 1FXPA 1ICPA 1DORA 3M16A 3Q2DA 3ELFA 3W7QA 3GNNA 3LTSA 4NJKA 3UD6A 5HUOA 5G4EA 3W7LA 3NQ8A 2B7QA 2X1SA 1TRDA 5FF4A 2Y63A 5K4XA 3S0CA 3QM3A 4MZ8A 4DO4A 3QRHA 2VFEA 3HIJA 3E9AA 2JKAA 1Q6OA 4FEZA 3IRDA 3W83A 1XC4A 1JUEA 2E5DA 3BARA 4YLWA 2E1DA 5C55A 4EVZA 3W3OA 4NJHA 3GB6A 2J27A 2EGZA 3E0IA 3MHFA 2J9XA 1VHCA 5I3HA 3B06A 3NQAA 4HNTA 3AJXA 4E2DA 2BSLA 4RJEA 1CX9A 4O57A 4LRSA 1VCFA 2ZA1A 3PVFA 1P0KA 2VEPA 4YMZA 4KWWA 3W23A 3L0GA 1IF2A 1ZHAA 2ZFAA 1AW2A 3NQ7A 3KVKA 5KZMA 3MBDA 6TIMA 3C3NA 2DZXA 1M7PA 1JR1A 5EKYA 2IQTA 2BLEA 3G1DA 4IGHA 3PB2A 3B0VC 4O8RA 3NL3A 4PODA 3MMTA 4MY9A 1TPC1 1WX0A 3IVSA 3L21A 3L0NA 3QMTA 3SZ8A 4N6FA 3LRLA 4JD4A 4JEQA 1Q45A 4JXCA 3G18A 1I4NA 5G1YA 3W84A 4Y6GA 2ZA3A 1OX5A 3LB0A 1FDYA 3FA5A 3S1XA 4FIRA 5CZSA 1N8FA 4M6PA 5G5IA 3NOEA 4XKYB 1NEYA 1MEIA 5HR7A 1KV5A 4HPJA 4LVFA 5I3GA 3UZJA 3PB0A 1X7FA 3RMJA 1OX4A 3C52A 1NAL1 4FX7A 1DV7A 1PHQA 3TJLA 1IIHA 1LROA 3GXNA 5FF3A 1MO0A 4LVBA 4O0ZA 5GVJA 2PCQA 1D3HA 2RH9A 5T26A 3NQVA 4O1CA 2ZRVA 1EIXA 3A23A 3GDTA 3NL5A 5DCDA 1LORA 4AB4A 3W7GA 3O6DA 4TO8A 3LXAA 1R2SA 1WYIA 4JTEA 4LW7A 3EWWA 4O1DA 3LHTA 3W2UA 2W0UA 3HGRA 5AB3A 4IXXA 2TRSA 4N6EA 1KFKA 5J5DA 2R8WA 3R12A 1B4KA 2JBMA 4CQ8A 1F74A 5L9FA 3GDRA 2CLHA 3LI1A 3EWUA 1EB3A 2Q3OA 3HJZA 5EBUA 4TR9A 4HSOA 5D37A 3TCEA 4GC4A 3NEVA 3OA3A 4JGDA 1ME8A 4DELA 1KM1A 1Q6QA 2E68A 4KFOA 2C6QA 1G4SA 4O16A 1TTQA 4WXYA 3TDFA 5CSSA 4GXMA 2PRMA 5CPOA 5DCEA 3OIXA 1VLWA 3G1FA 4MKNA 3PUDA 5A5WA 1K8YA 4DBDA 1XKYA 5KITA 1W37A 1LRTA 4IPJA 4K8EA 1A50A 2E09A 1IXPA 1LOSA 2ZRYA 3F4WA 4IWWA 4MJMA 5HQEA 4HHPA 3GR7A 3FS2A 2DU2A 4IMFA 5G4WA 1ZALA 1VH7A 3SGUA 4RZ4A 1VHNA 2P1FA 2QEZA 4O28A 3CPRA 3AO0A 3B0PA 3M43A 2QUTA 3P61A 2DZTA 1M5WA 1ONRA 3IV3A 3QPYA 1GTEA 3EWYA 3NYZA 1WV2A 2DZUA 2QCEA 3LDVA 5DN1A 4JTIA 2G5WA 4PH6A 1JQXA 1J5TA 4CCDA 1SO5A 4O18A 2Z6IA 3F4NA 1ZAJA 2GUUA 1XUUA 2OZ0A 3LBCA 3STCA 3TW7A 5K9CA 4ZQMA 4CNPA 3EX3A 4IMGA 1OF6A 5C54A 3W76A 2QAPA 3YPIA 1WOBA 4ZL1A 2ZTKA 5K4ZA 1FWWA 1M7OA 2E5CA 1W5QA 1SO4A 1Q6LA 3IGXA 1XBYA 3GX9A 3QW4B 4DPQA 4Y9AA 4KFNA 3W88A 5SWUA 2WOQA 3RLUA 3DFSA 3S6DA 5CPNA 4A21A 2VFDA 1SZNA 4MUZA 4A2SA 1F6KA 3DFOA 1YTDA 1SQ7A 2NX9A 1H62A 3HG3A 2VOMA 2WPBA 5AHFA 1KTNA 3S5ZA 1ZENA 2HS8A 4P2VA 1HG3A 5FI8A 3QZEA 1QR7A 1VCVA 4LVAA 2EHHA 4POCA 1I2QA 1W3NA 4W9TA 3LHUA 1SFJA 5D03A 3TAOA 1AW1A 1K7FA 2DZWA 2OX1A 4AMAA 3EXRA 5LHFA 4TMCA 1RZMA 2C3ZA 3TU9A 3MWAA 3O07A 4LV9A 1PS9A 4JN6A 1KM5A 3W7HA 1TMHA 2PRLA 4NNAA 1OK6A 4DO5A 4UTLA 4RCXA 2RHGA 4IQLA 4MZ1A 3FYOA 4CQAA 3RF9A 1I2RA 4LS2A 3RFAA 1W5PA 2C16A 4N9DA 2DZVA 2QCHA 3BLEA 5DBUA 2WJZA 2VKZG 3OEXA 3H55A 2GPTA 4UTIA 3PY2A 3NQFA 4PC8A 1HUVA 1YTEA 5EL1A 1SZFA 2A85A 1PV8A 2H8ZA 1WBHA 2XN0A 3BLIA 4O12A 2CLKA 3LHWA 4YXGA 1OX4B 1VJIA 1JRCA 2Y61A 4ICNA 5CZTA 1FCUA 2Y89A 3GAYA 2J9ZA 5K9DA 3G1AA 4BWLC 3GXPA 5FESA 2YR1A 5CZJA 4A2RA 1NF7A 2WSQA 1ML1A 1JCYA 2ZCGA 1S5VA 3CIXA 3PR2A 4LT9A 2HTMA 2ZZ1A 3NQCA 2ZTJA 2Y70A 1R46A 3KRUA 3TMLA 1SU5A 2A7NA 3S42A 4WX2A 1XCFA 5HNRA 3QMSA 1WXJA 3S1VA 1A5AA 5L6UA 3LV5A 4UR7A 4FNUA 4HN4A 4UTTC 3SFKA 3PULA 4NUWA 2LLEA 5D2TA 1L2UA 1LRQA 2ISSA 4R34A 1ZAHA 1VPXA 4JIPA 4L4LA 1QWGA 2B4GA 3EKLA 1FCVA 1S5TA 4K7YA 3VI2A 1OK4A 3GIYA 1IXNA 3DFTA 3LCHA 3B04A 1VR6A 3STGA 2PC4A 2QCLA 1G67A 2ZA2A 3QW3A 4WY0F 4K39A 5CPMA 1JCXA 2A7RA 5D02A 3WJSA 3GAKA 2ZZ2A 2A5HA 1UJPA 3EWZA 3TV8A 2RFGA 1OYCA 2V2HA 2DJXA 2DORA 1H7OA 2WSYA 2VC6A 4FXSA 4N9CA 5D05A 3QSRA 4UNLA 1QPNA 4Z08A 5KZDA 3W1NA 1XBVA 4FF7A 2C18A 3W7EA 3W74A 4NZJA 1LOQA 3W7CA 3P8JA 4AEOA 3UYCA 4GE8A 5F1UA 4QJ1A 1H7PA 3TC7A 3C2OA 1YTKA 4JX4A 4N9BA 3LLDA 3TK7A 4UIOA 5F1VA 1KFCA 3IIOA 2Q8LA 3I65A 5E1QA 3NPUA 1KW1A 3QQ1A 3KRZA 2E6FA 5AYZA 1OYAA 3DGRA 3SI9A 3NQMA 2FFCA 3DU0A 3HO8A 4QITA 1TB3A 1TQXA 4BWLA 4OU1A 1G4PA 5IBXC 4MZYA 4C1LA 5CSRA 3CEPA 1H1YA 3KHJA 3NZ1A 1GVSA 3W85A 5DXXA 1OABA 2V0TA 3TQVA 3NO5A 3G1VA 1T8XA 3DFPA 3TUUA 3DFQA 3ZS4A 4ORIA 1DL3A 3UWUA 4UR8A 5AHMA 3PBVA 3QFEA 3K30A 3GK0A 4PL1A 1GEQA 4LOCA 3DKJA 3LHZA 4UTTA 1YPIA 1S3HA 4K36A 3BGJA 2V2DA 4I7VA 3UY8A 3TC6A 4EIVA 1OYBA 1KFEA 5BOOA 3KRSA 3TROA 2FLIA 5D2WA 1GVRA 1TPH1 3PSWA 3QMRA 4O13A 5KINA 4K8HA 4ZQOA 4MYXA 1U83A 2ZZ3A 4RX0A 3HGSA 1NSJA 1NFBA 3W73A 3PG8A 3M7WA 3TH6A 3BGGA 2YYUA 5EPDA 2JKEA 3LERA 3P5YA 3LRKA 3N19B 4FNRA 2CU0A 2QJGA 5KZEA 1PIIA 5AC7A 4AF0A 1KFBA 5AHNA 3MHGA 4XZ9A 1VGAA 1B9BA 4RKAA 5BW6A 2FIQA 4OV9A 2FPVA 4JTKA 2RDTA 1F2JA 3PC0A 3W1TA 1T0OA 3OVQA 5EY5A 1YXCA 3HPZA 2CLIA 5MHBA 3P7YA 1G69A 3EXSA 3W2MA 2QJIA 1FWSA 1P1XA 3S1WA 2JGYA 3LOTA 3HOJA 3KFTA 3C6CA 1FXQA 2BXVA 4IUOA 1GYNA 1O5KA 1RPXA 1TREA 5LNVA 3S9YA 2E6AA 1K8ZA 3P5ZA 4BFAA 5E0KA 2V82A 3FJ6A 1V7YA 3MI3A 5HR6A 2Z2UA 1QDSA 1YXYA 4ZQPA 5C2XA 3HBLA 1BTMA 1R47A 1SR9A 4K38A 3V75A 2NXGA 2A2IA 4X2RA 1JCLA 1OFOA 1LLZA 5AHEA 2V9DA 3G1XA 5H2ZA 1TPVA 3G1HA 3W2JA 3IVTA 2F84A 4ZQNA 4LU0A 5C5YA 3O6CA 4WY0A 3KAOA 4MFDA 4WOZA 1JVNA 1RV8A 3W2LA 4IOTA 5D32A 4JICA 5IBXA 3TQKA 3WK1A 1X1OA 4AWTA 2WNZA 1TPDA 1GTHA 1K7XA 2ZRUA 2PURA 5FF0A 1XBXA 3KX6A 4CNNA 2ISVA 3O16A 3QYQA 3A22A 2NXHA 4S2CA 4Y8FA 3PS7A 3DHFA 3LGEA 3IGSA 1GOXA 4TIMA 3F03K 4DEFA 1TO3A 1LBMA 1GWJA 1N55A 3W22A 1Z48A 3MP3A 4MLRA 4MVAA 4DF0A 4HNNA 3LX9A 1LYXA 3NPWA 3E12A 4Z0JA 4DBEA 3QSTA 3ZFHA 1G4EA 1OJXA 3OHIA 3C2RA 3M1ZA 1DJNA 2E6YA 2J6XA 3GNDA 3HB9A 3WJWA 6ALDA 2WKJA 3EX1A 2GVLA 3SSJA 3PUOA 5HWJA 3W75A 2CFFA 3ANYA 5G1TA 2H3BA 1FY6A 2E5BA 4NVTA 4Q4KA 1B4EA 3DKLA 3NL2A 1RQHA 3Q37A 4GUJA 3C56A 1ZJIA 4JDBA 4EF9A 2HMCA 4GUHA 3T44A 5DY2A 3A21A 3LCGA 4ZZ9A 4NT0A 1XXXA 3VE9A 2CZ5A 1TTIA 2ZDRA 2RDUA 3FOKA 2J88A 1UCWA 1TTJA 1P0NA 3GZ3A 3L68A 1CW2A 4GBUA 1YPFA 1SO3A 2QCFA 4IPIA 4O52A 4ZVJA 4BI6A 3U6WA 3FFSA 1W54A 4O50A 3E49A 4S2BA 4XTIA 2HSAA 3EX2A 2XN1A 3LM7A 3WK2A 1LDCA 1VC4A 1O95A 4H4IA 4JYFA 4LS1A 1V5XA 2VEIA 1DBTA 3UXAA 4QAIA 1Z42A 4GUFA 4JY9A 1Y0EA 3CEUA 4WXZA 3NL6A 3PM6A 1VYRA 4HNVA 1H7NA 5LNUA 4CLMA 1BWKA 1ZFJA 5EYWA 3ABSA 3C61A 3R5EA 3HF3A 1TPWA 2CLLA 3G3DA 1SO6A 3WK3A 4OQVA 2I9EA 3LCXA 1THFD 2Q8ZA 3L67A 3KXQA 4JTTA 1TIMA 1QCWA 2V30A 4M5PA 2QKFA 3L2IA 3WFAA 5HULA 2TMDA 3EX6A 3UXDA 3O8AA 3DENA 4YL2A 4WJEA 2GQAA 5LKYA 2EPHA 3NAVA 2NWRA 2NX3A 4Z1AA 3M6YA 3MHUA 4FXRA 1TJPA 4FNSA 5F2IA 3PBYA 3VFLA 1TPUA 2G97A 3P60A 1Q6RA 1EUAA 4JYDA 2ZBTA 4KKXA 5HWMA 3NG3A 1VYPX 3PAJA 3LBMA 5TIMA 1SSGA 2OCZA 3STEA 1AMKA 1K8XA 2Z6JA 1A5SA 3GKAA 2VFGA 1ZNNA 2FDSA 4RR4A 1EEPA 5AYXA
chains in the Genus database with same CATH superfamily
3WF0A 3U2OA 3SRKA 1HGWA 1B3OA 2J9YA 4K6AA 4F8XA 1ELSA 2ZQ0A 3TSMA 1IQ8A 3BUVA 3ABZA 2W5FA 3UPWA 1XW8A 3TN6A 4LUJA 3GDMA 1QK0A 4EPDC 3CMJA 4FNQA 4F0RA 1F4HA 1R3TA 3UJRA 1M65A 2WV8A 3O9NA 1CT5A 1JQVA 1KM3A 2YCJA 1EO7A 3IIVA 3NM1A 1VRDA 2XUCA 2AMXA 4DLMA 1JPDX 2ZADA 4GYJA 3PWAA 4LUSA 2P0IA 2QIIA 3WH7A 3I7QA 4GCAA 3C4UA 3B0YA 3WLHA 4JQ2A 3GVGA 1SZEA 4HK7A 3BG3A 1R2TA 4NI3A 1UB3A 4AU0A 1GG1A 1SFLA 3NQ6A 1BXCA 5KMYA 1T5AA 3P74A 3ZR4A 3CMFA 2CLEA 3QPZA 1MMFA 1K3UA 4JN7A 1KGUA 2FZDA 5C9XA 1XYLA 4H6QA 5J8LA 1H1ZA 1M03A 3G3MA 1KGXA 4PCNA 2G3JA 3TFCA 2Y7GA 3E2QA 3IJ8A 1L2QA 1DJIA 2UY4A 1J6OA 1GK8A 4MJZA 2HXUA 2QUVA 5AC8A 1J93A 3LM3A 1W3TA 3LZ3A 5D9PA 1EQPA 2MUCA 3FCPA 3ICJA 5CZKA 3VVGA 2C19A 2A0NA 2D23A 3R8GA 1XIEA 1QOPA 1LZOA 2FZ9A 1QPRA 4U5IA 2WPGA 4B3LA 4V15A 3P80A 1TCDA 1VPQA 3GO2A 2DT1A 1H0IA 5D09A 2C1HA 2XM1A 5AOUA 3TSBA 2FTWA 4JIQA 4HYWA 1AG1O 4RDYA 3U2EA 4JYEA 1BHGA 1VFTA 3UY7A 2DSKA 1IEQA 3KZSA 3VE7A 2VRKA 2A6LA 4AH7A 3ARUA 3HU7A 2DT0A 1XPYA 3N15A 4ATLA 1RJPA 4U2ZA 5LGZA 3CGTA 4BKNA 2DZBA 2P53A 2EPMX 4DPPA 3NGJA 4DWDA 1TUFA 5A6SA 3WG6A 2EEXA 3CB8A 4PFMA 4LNYA 3TYZA 1FP8A 3NTYA 2VFFA 5LGXA 1CGUA 4JTAA 4DAIA 2IQ0A 3NCOA 5REQA 2IQDA 3A24A 2YCLB 2WKLA 5LIYX 1X96A 2ABAA 1R2RA 4AY7A 2I9UA 2GJPA 1KRAC 3C2EA 4Y2WA 3LI0A 2VFIA 2HPIA 3TTYA 2V8ZA 3IAPA 4UC5A 1AW5A 3MVTA 5I3KA 3BOLA 2WO5A 1GYLA 1I1XA 3L12A 2GJLA 2JF7A 2Y62A 1N2VA 1UR2A 1EA0A 4FOKA 1KM2A 1OC7A 1K4HA 1SW7A 3LPFA 2E6DA 3HPAA 4LGXA 2PDNA 3VIPA 3N9KA 4WOQA 3H8AA 4UZSA 1OZMA 3U7VA 3DH7A 2A1YA 1FUYA 1R7OA 3EWXA 4B5SA 4BQ2A 2JE8A 4MM1A 2HS6A 3TN4A 1S2AA 4KFPA 3SY1A 4MYAA 2QCDA 2WVTA 4XK2A 3E1F1 1JJKA 4YTRA 3E02A 3W7RA 1NF0A 1B57A 2R1MA 3W1LA 4EOUA 4HA1A 2WW5A 4BF9A 2FHFA 4NX0A 3TNOA 3W6LA 3SR7A 2BV9A 3AZRA 3SUTA 3TR9A 2DZAA 5A8OA 4S3EA 3XINA 2P0OA 2QJMA 5CPTA 3BANA 1QUMA 4Z1DA 4ZE4A 5I77A 4QSFA 2OJPA 5A6BA 4EWJA 3QKZA 2ZRWA 3SGGA 3RLGA 4LCSA 4YTUA 1ME7A 1W1A1 4GGHA 4O14A 4ES4A 2RUSA 3NPVA 2XWDA 1KFLA 5K7JA 1FOBA 4BJHA 4B9ZA 2C15A 4QLJA 3UWYA 2V3FA 5I00A 3M4HA 2FVKA 3MMDA 3S83A 4KWSA 3BZJA 3W1QA 3ECQA 3T0DA 4OKDA 3FW6A 4CN4A 1YLVA 3WNOA 3TXVA 3M0XA 3VZXA 1OGBA 3P2VA 4NJIA 4YWSA 1RJRA 3HPXA 3MYPA 3N9RA 4F2TA 3LXCA 3TW6A 2YA2A 1BKSA 1XG3A 1DJQA 3GR4A 1ZAIA 3MKCA 3RM4A 5HQLA 4UFMA 3SEPA 3LD5A 1AQMA 3ATZA 1IE7C 3O2LA 4Q4MA 3REQB 3W1MA 4K37A 4E3TA 4C1NA 3ORWA 3KP1A 4IICA 2CZFA 4CU7A 3BMWA 3ARPA 3VU2A 1R9XA 4XD3A 4FX8A 1I2PA 2W9MA 4RXFA 1VLIA 2ZOXA 4DBWA 4IFRA 3IK2A 3COTA 1GZ1A 1R38A 1W5MA 4WKFA 1FWNA 3LMZA 4Q4RA 4MPQA 3GM8A 3L4WA 2XVGA 5DELA 3IGHX 4TVCA 3SQSA 3BPWA 2DVUA 2H8XA 5CGTA 4IQEA 5ENLA 2PMQA 2DT2A 3L4ZA 1K9FA 4ADTA 1RR2A 4NY2A 1FHUA 1UASA 1J5SA 1EWDA 1HL2A 1JUKA 4BR1A 1XD1A 4L6OA 1XYMA 1S5MA 4Q8WA 3ZWTA 2GGHA 4C6JA 3SUUA 1F7BA 5A95A 4GH3A 4MB4A 5HXMA 1ICSA 4MADA 2OWCA 3MV11 3SCPA 1W31A 2OWXA 1T41A 3MSRA 3DYPA 1FWTA 1GQNA 1L9WA 2XVNA 4XTDA 4AC7C 2CXGA 1TWDA 3W27A 1JI2A 1L0PA 1VBUA 3OYXA 3OLIA 5AHIA 2AAMA 3GDKA 5K2ZA 5T91A 2QDHA 4GUIA 4PSPA 5CLTA 5EMLA 4S3BA 2PAJA 2D0GA 4HVXA 3FLUA 5U4NA 3ITXA 4O0KA 5AC4A 4WUIA 4AD0A 3CM4A 3QR0A 2CHRA 4FK9A 2B7OA 2TPSA 4ZOBA 3W86A 1S46A 2JGQA 1G7VA 2JKPA 2EPOA 4L4MA 3NGFA 2BVWA 2V3DA 1HJXA 5FEWA 4A3RA 4AZ6A 1LBLA 2F6XA 1EGVA 2C0AA 3V18A 5CLWA 4Y96A 3HMCA 1ZSXA 2EPNA 4KEUA 2XH2A 4QTGA 4YHEA 1PIGA 5G1MA 3WD1A 1B31A 3N2MA 5A1AA 4O1AA 1JZ2A 2XN2A 4I9AA 1EJSC 4AZ7A 1I2OA 3TKFA 3GKFA 1N7KA 3NQDA 4AXKA 4GJ1A 2CW6A 1KCLA 4PL2A 1KWKA 4NJGA 3UF9A 1CI1A 2FZ8A 2GDUA 2OQLA 2WJDA 5FJTA 1TPEA 4B91A 5HWNA 4QNWA 3AXHA 4EF8A 3BMXA 5E93A 4E2BA 3OQEA 4MOZA 1KR1A 1TPFA 3K13A 2C14A 4OBSA 1QI5A 1DWGM 4O54A 4PTWA 3L7RA 5HATA 4DYEA 3OA5A 5FJOA 2W79A 3LPOA 3I6TA 4CVWA 3BW4A 2OG9A 3VNMA 3H7RA 3OOQA 2NX1A 4R53A 4A29A 2J7BA 4DB7A 2NQ5A 2WQPA 3VKJA 1ME9A 3T55A 3S2LA 3GFZA 2V67A 3CL8A 4NYYA 3INPA 2WVUA 2UV8G 3DAQA 1W91A 3WN6A 2NWSA 4HOXA 3AIUA 2DUAA 4DI8A 4DF2A 3GTIA 3QLDA 2P3EA 3H70A 1RD6A 1IXQA 3GU9A 4P61A 1ZGDA 4NJJA 5AFDA 1KV8A 2YB1A 3B9OA 3KBMA 2Y0FA 4QSHA 4NNBA 2A7PA 1W56A 1NP0A 4LUYA 3TX9A 1W0MA 3MC5A 1I6NA 2B0MA 2GWGA 3QVQA 1QFEA 4ZODA 1T40A 2Z26A 3RNDA 3AMGA 4JS3A 4L1GA 4O4WA 4WKHA 4A4AA 2B7PA 4RZ6A 3VCRA 1UOZA 1JCJA 2GVGA 2VP8A 3QHOA 1WAUA 4NNCA 3VKCA 2VEKA 3LZ5A 4KCVA 3N9SA 4DJED 3IARA 3AZTA 4WEVX 4I6VA 3O6YX 3OLGA 4W7WA 3CTTA 3GU2A 2NVDA 3LQLA 2C79A 1SFSA 3OU8A 2WC7A 1IEVA 2BGNE 4G8TA 1LT8A 3WSUA 1MW1A 4DYKA 3QJAA 1BGGA 5C2GA 3D47A 4N02A 1HL8A 4AY8A 1W17A 4PCPA 7TIMA 1CLKA 1PKLA 1TRIA 4O53A 3M5YA 4UUIA 3UJEA 3URQA 2WHMA 3R8RA 4E0CA 3ZWSA 2WJEA 3G1RA 1OIMA 4PMQA 4AUBA 5HINA 4TV5A 2HVOA 2ATSA 4QEHA 3G0UA 3MP4A 3S2CA 5D8ZA 3WNLA 1LTDA 1M9HA 1O60A 2F61A 2ZZ4A 4LUIA 1B3XA 2GOKA 3LV6A 3PZUA 1KBIA 3MBFA 4ZEPA 5DO8A 4DJFC 2B31A 1E0UA 4QAWA 1PXGA 3U9IA 3NVTA 4LYQA 3VAVA 4HCDA 3NXLA 3I7RA 2EXOA 3VIOA 3JS3A 3KCLA 3CB3A 3S5SA 3S1UA 4YTTA 5CPSA 3N4FA 3SECA 2PWDA 4MJ4A 4IMEA 4QDPA 3GXFA 3S6TA 3UWVA 4EXAA 2W91A 3KTCA 4FO4A 3QYSA 3UWWA 4HMNA 1T96A 2WMHA 4O1FA 1WQ5A 2W92A 1UZHA 3VCNA 2PU0A 1D3CA 3W53A 3CQIA 2B7NA 4ROPA 1UC5A 3TTSA 4N4PA 4MWAE 1MRQA 1PL9A 2O7QA 3CUIA 4PUDA 4UNIA 2EPKX 8A3HA 4DNMA 1GZGA 1F8IA 2Z1SA 3FA4A 4C7GA 3FGCB 4GIRA 3RX2A 3NZRA 3TYBA 1RLDA 3KOYA 1WUFA 3WD3A 3G0XA 3UCQA 2WVVA 4LAZA 3FIGA 2OLHA 3N14A 4CNOA 2C71A 1W9DM 4UTHA 1PCWA 3KLLA 4S3AA 1D7FA 2KZHA 4AIEA 4J3XA 2VEMA 3O1NA 3QGVA 2YYTA 4KWVA 3KUMA 4K68A 3WQEA 3M44A 1C92A 3QHNA 4V28A 4CGTA 3T2PA 3LLXA 1WOAA 3NUKA 3QEZA 4LNCA 2ZRZA 4OT7A 6CGTA 1EJXC 3BJSA 4GYKA 4I5XA 2O55A 2XISA 1K8CA 2BASA 2XZ7A 1NDVA 5XIAA 4WJXA 2B7QA 1ZB5A 3M0LA 2VI0A 5FF4A 1UZ1A 2Y63A 4AEFA 1JDAA 3QM3A 4MZ8A 4DO4A 2PDLA 3U7BA 5LA2A 2V69A 4JTQA 1X98A 2JKAA 1Q6OA 4FEZA 3IRDA 1R3YA 4HU8A 1XC4A 1OCQA 1TE1A 1I0DA 3MA8A 3W3OA 1UR3M 4GFIA 1KCZA 4NJHA 2EGZA 3MHFA 3NDZA 4OZOA 3B06A 3E5BA 2BSLA 4GI4A 1JF6A 2VR4A 1B90A 3WH8A 4O57A 2ZA1A 1P0KA 3BQ5A 3W23A 3L0GA 4FP1A 5JUVA 4AFYA 2ZFAA 1AW2A 3RR1A 6TIMA 2DZXA 5LIUX 3TA9A 3UZZA 1E9YB 2E25A 3E74A 4E3VA 4Q8MA 3CUHA 1AVAA 4PODA 5T9CE 2WWDA 1TPC1 3IVSA 3M0HA 3L21A 3SURA 3SZ8A 2BB0A 1EDTA 7TAAA 4JD4A 1E0TA 4JEQA 3W0KA 5DMYA 2PI6A 3W84A 1EEXA 1Q65A 1OX5A 2J13A 3FA5A 3F2DA 5G5IA 3DG7A 1VB9A 2IW0A 1FWIC 2ZX6A 1MEIA 2XDFA 1RLCL 5I3GA 3KWXA 4F9JA 3PB0A 1X7FA 2VYOA 4FX7A 1CGVA 4QEEA 1CBGA 3TJLA 2HXTA 1LROA 1RBAA 3GXNA 5GVJA 4LVBA 3AISA 1EF3A 5T26A 7CGTA 4O1CA 2BY1A 4ZO9A 3A23A 3H4WA 3IUIA 2W63A 1LORA 4RW3A 4TO8A 5CCZA 1R2SA 2BGQA 4FXJA 1XRTA 1Z7AA 3IJDA 4AD3A 3HGRA 1P43A 2TRSA 1BGAA 5A6KA 2I57A 2WK2A 3R12A 1AODA 1KRBC 1F9CA 3BJTA 3HA1A 4ZOAA 3GDRA 2Y5JA 3LI1A 5CGMA 2DEPA 3EWUA 1EB3A 3U5YA 4HSOA 5D37A 4GC4A 3KBWA 3VK5A 1UKTA 4LUTA 3CBWA 5D9NA 2JIWA 4Q4SA 1ME8A 2J47A 1B3ZA 4KFOA 1G4SA 3LQGA 4HNOA 1YHTA 3TDFA 1EJ7L 4GXMA 2PRMA 4GG9A 2PDUA 1RP9A 3U4FA 3W24A 3LPPA 4OBRA 3EGJA 1K8YA 4Z2JA 1XKYA 3ES7A 4PMXA 5CSUA 3EPOA 1RBOB 2ZX7A 5A6JA 3GY1A 3VMPA 2E09A 3V4BA 1LOSA 4MJMA 3B4YA 4HHPA 4S3GA 4RDZA 2DU2A 5G4WA 4F48A 4PE8A 3RPDA 1JZ8A 1VHNA 2QEZA 4O28A 3VNKA 3CPRA 3WIJA 4F0HA 3AO0A 2O9TA 4DRSA 2DZTA 3OG2A 2ZWYA 1ITXA 1Q6GA 1ONRA 3T08A 3QPYA 3RLHA 3FDKA 2IXVA 1QJWA 3T4WA 4IPLA 7A3HA 3AYVA 2VOTA 3GZAA 2ZUMA 4JTIA 4PH6A 3DESA 3JU2A 2X8RA 1V0MA 4PBEA 5AECA 2UY5A 2H9AB 2QS8A 3LBCA 2ZIDA 4J3WA 1QVBA 4U3CA 3THCA 1W3JA 4IMGA 3W76A 3YPIA 1WOBA 1QNOA 1QNQA 2XYLA 2QV5A 2Z1XA 4GNKB 3AOFA 1ZTVA 3R1ZA 4RW5A 4AD2A 3QW4B 1XHGA 1XX1A 4M56A 5SWUA 1XH1A 1X6LA 3WQPA 2FHBA 5CPNA 4A21A 1LJYA 4FR6A 3AMCA 3ZJ6A 1W1VA 3EWCA 5I6SA 1H62A 3HG3A 4MB3A 4PYSA 4J35A 5AHFA 2PWHA 1S2CA 1A80A 1U1JA 1HG3A 3QZEA 2WNWA 2PZNA 3B8TA 1VIWA 3QN3A 2NT0A 2EHHA 1XRSA 4W9TA 5D03A 3RIKA 5C9UA 3TAOA 1AW1A 2IPGA 3EXRA 2D3NA 4B2DD 3TN3A 3SCRA 4DZAA 2C3ZA 4IFKB 3GTXA 1WDQA 5M2FX 3O07A 4LV9A 3PZIA 1WDPA 5E09A 1NU5A 3HFTA 1TMHA 2PRLA 3OVGA 1OINA 2RHGA 4L65A 5BYWA 4LS2A 1CYGA 1W5PA 4BS0A 4GI6A 2ACSA 3BLEA 2WJZA 1I0BA 3J7HA 4URIA 3NQFA 4PC8A 1SZFA 2OZ3A 2O56A 3QGKC 2XN0A 4O12A 2CLKA 2ZX9A 4YXGA 1OX4B 4U2YA 5K9DA 3G1AA 5FESA 1E73M 4J40A 1NDWA 2OU4A 1DHKA 4A2RA 2ZCGA 4HPNA 1VBJA 1QHZA 2BBFA 4MKVA 2Y70A 1BFNA 1R46A 2WSPA 4DJEC 2A7NA 4ZA0A 2QW5A 3LA4A 4K3ZA 1EXBA 1XCFA 1UHVA 3QMSA 3HN3A 5L6UA 4UR7A 3IJ7A 4FNUA 1UPMB 3SFKA 3H24A 2LLEA 4G6CA 1RALA 1P0BA 2ISSA 4R34A 4HU0A 2X0SA 1HVQA 1S5TA 3VOCA 1XH2A 3PTKA 1UQYA 3R0DA 1IXNA 3ERPA 5I79A 1YEYA 2RAGA 1VR6A 3A3XA 2PC4A 2KX9A 3VABA 2D69A 2BP1A 5D02A 3HJEA 2ZZ2A 3UBPC 7REQB 3EWZA 4QS5A 3PPCA 2BOEX 4WIWA 2DORA 3GBEA 4HJFA 3EZ4A 4F3HA 4Z08A 5KZDA 1VBRA 4IM4A 4GYPA 1JNDA 5H8MA 5BXPA 1JPMA 4NZJA 1U30A 4AZIA 3W7CA 4JTCA 2VL4A 4HU3A 3KTXA 1AQHA 4Q7BA 4PRRA 4N9BA 3LLDA 2UZ9A 3ITGA 3UFYA 1XLJA 1VIZA 5F1VA 4Q6XA 1S2UA 1JEZA 1JPHA 3I65A 3NPUA 1EOKA 2XG9A 2E6FA 3UESA 3DGRA 4I9MA 2P76A 4AD1A 1KRMA 1W3KA 3W26A 1UZDA 4ZBCA 1GKPA 2FFCA 3HO8A 1TQXA 3VNIA 2NT1A 4PRTA 4N7QA 4OU1A 4C1LA 1H1YA 3NZ1A 1GVSA 4X2PA 5H8PA 2GL5A 3NO5A 4QRNA 1T8XA 1DL3A 3UWUA 3OIHA 5E5CA 3S2JA 3BAYA 1RAKA 3AU2A 3PBVA 2VZSA 1TZ7A 4TTGA 4UTTA 4XZHA 1S3HA 4DJFA 4K36A 3BGJA 5EB8A 4EIVA 2WANA 3CO4A 3B8WA 3KRSA 2FLIA 3B8VA 1OT2A 4JL1A 4O13A 3VO0A 4UWMA 2CYGA 3H4GA 3LERA 3BLLA 1SR0A 1POJA 3LRKA 1F8MA 1J0YA 5KZEA 4IGMA 3THDA 1JCTA 2VJXA 1XQKA 4K8GA 3OGVA 4HPGA 1UA3A 4XZ9A 1E6NA 1B9BA 4PUKA 2FIQA 2FPVA 4H9TA 1T0OA 5MHBA 3W2MA 3RCYA 2OXNA 3N6QA 4F0MA 4OFCA 1TMQA 3LOTA 3HOJA 3KFTA 3C6CA 3OZPA 3UJ2A 2V38A 2X0YA 4BFAA 1K4GA 3M0YA 1ZLPA 2V82A 3FJ6A 2NVCA 3GBDA 2JF6A 4ACZB 5HR6A 1NFPA 1QDSA 4TUFA 1EC9A 1BTMA 1R47A 4DXKA 3CO8A 1JCLA 1OFOA 4X2RA 5AHEA 4H6RA 1SJBA 2RJHA 5I7GA 1TPVA 3B9NA 4IL2A 1C7TA 1HJQA 3ZO9A 2OWWA 1K1DA 1BVWA 1JVNA 5D32A 1K9DA 2G8ZA 2W62A 1Y5VA 8CGTA 2VX4A 1R5YA 3O16A 3QYQA 3A22A 1OC5A 1AMYA 4Y8FA 5BWFA 3LGEA 3ZSTA 4KGLA 1W1YA 2X41A 3CH0A 1GWJA 4GI8A 2OB3A 1R9ZA 3IPWA 4DF0A 4ZFCA 4L4PA 4P7QA 1LYXA 4GQGA 4D6GA 3CUFA 2CBJA 3AIVA 4A3YA 3QSTA 3SM0A 3DC0A 3MWCA 3L4UA 1L8NA 3FNDA 4JHZA 2E6YA 1X39A 1H09A 3EX1A 1Q7QA 3W75A 1GONA 5G1TA 4D1IA 1FY6A 2REQB 4C6LA 4NVTA 3CXOA 1TVPA 4Q4KA 2PS2A 3S1GA 3BC9A 4GUJA 4GUHA 5DY2A 5DRIA 3C86A 3A21A 4QX4A 3LCGA 1XXXA 3WMCA 3H7VA 3IJ9A 2XIOA 3TTOA 2J88A 3JUGA 3SRFA 1TTJA 3BLKA 2VEFA 5HNUA 3LBOA 3MUCA 4IPIA 4O52A 2RJGA 4XTIA 3KDNA 1E3ZA 4YTQA 4H4IA 4LS1A 2VEIA 4QLLA 3CEUA 3NL6A 4HNVA 2XIMA 1H7NA 1AD1A 1UIPA 4CLMA 3EPMA 4MAVA 3ABSA 3C61A 3CHEA 4KMQA 2OOFA 1AA1B 2YCLA 1OCNA 4JTTA 4RZBA 2V30A 3FAWA 1KXQA 3ID7A 2QKFA 3L2IA 1GVYA 1TIWA 4HZMA 2D24A 1S2WA 2OGYA 3PTDA 4WJEA 2QXWA 3O0KA 2G4JA 4ACYA 2EPHA 2NX3A 4FXRA 5ECUA 1H0GA 2XFRA 5F2IA 4MDPA 2XFFA 3B8SA 1V3JA 4KKXA 1BG9A 2GVEA 3RG6A 3GNRA 5TIMA 1SSGA 3PPGA 2D0HA 4GQRA 1K8XA 2GK1B 3AYRA 5IHRA 2FDSA 1SFTA 4E8CA 5JVLA 4UTMA 2X1UA 4A8NA 4I5RA 1GORA 3ARTA 4NYUA 3W1AA 2OYLA 2WNNA 4P8XA 3MJMA 3R94A 1UUMA 1IWPA 1SVDA 4F0KA 5LNRA 4NRSA 4IIGA 4KBXA 2OELA 4IP5A 3MV01 2ZZ5A 2PCEA 4AF0B 1FH8A 3FKRA 3SCWA 2D1ZA 4LH8A 1VBHA 3G24A 1XINA 3C2VA 3S3GA 5I09A 2Y7DA 1V7AA 5HMFA 3PZNA 1NIUA 4DZHA 3BWWA 1G4TA 3NZPA 1YE6A 4A8LA 3DERA 2PFHA 1EL3A 4H9XA 2FVMA 2L5HA 3EDEA 1IR1A 4Q6JA 1XLBA 1H61A 4PBFA 1Z41A 1OFPA 1UH2A 1YMYA 3ABQA 3W2KA 5A6MA 3GDBA 2BVTA 2PLKA 3RMEA 2DP3A 3SJNA 4UR9A 1V6VA 4NZ1A 1PUDA 2QF8A 4U31A 5C6MA 3A4JA 4JFUA 3GW3A 4CQ9A 1XDMA 1W2VA 3GHUA 1E55A 3B8DA 4FOJA 1A5UA 2F7FA 1ODUA 1JFXA 5D30A 1ICQA 4KEMA 4D6JA 5TBOA 4A8IA 1PDYA 1PO9A 3DBPA 4F2UA 2ZRXA 4MWAB 1PZ1A 3SQMA 4RE2A 2FFIA 2CLFA 1KCKA 1OFEA 1FH9A 4X63A 2CLOA 3UA3A 2CBVA 1CXIA 2VZOA 1GVOA 2Z1KA 3EDKA 4DWSB 2FQIA 2QCCA 5FJPA 2NXIA 1B5TA 3GXTA 1EXPA 3MP5A 4NF7A 4AMCA 1EZ2A 4IJCA 4PBGA 3QF0A 4FHAA 1QOQA 3A3HA 1L6YA 3REQA 1PIFA 1GG0A 3EWBX 3QOMA 4AZBA 1ZPTA 2INFA 1Q13A 5CPLA 3ES8A 4R88A 5A8QA 4LCQA 3TA6A 1V3MA 4GXPA 3W1PA 3SCNA 3FEMA 4CD6A 5CC5A 1UH4A 2WZIA 3MCMA 2ZYFA 4AISA 1P4CA 4HA0A 3WBYA 1LL4A 2QJJA 3EOEA 1EWEA 5AYBA 4OBTA 3RCMA 1W1B1 4J9JA 3VZYA 3A5VA 4ENLA 5KEZA 3NO3A 4UBPC 4Q8PA 2PTDA 4M0XA 3N04A 2Q02A 3N3MA 1B3VA 1QRQA 4FLSA 1YDOA 4TX9A 3KCJA 1UR1A 3N2CA 3SGZA 3T7VA 1PBGA 3GNOA 1C90A 4XISA 3MUY1 3QKEA 2P88A 1OBAA 1AQ0A 1Z44A 4NG3A 1ZP3A 2JFEX 3E96A 4QE4A 2FPTA 3NYDA 2XFWA 1G6CA 1OFAA 3NSMA 2GGGA 1OG0A 4X9YA 1RH9A 2I1OA 2HJPA 3WD0A 4HSNA 5FEPA 4OVXA 4H04A 2EKCA 3EX4A 4KF1A 1DTNA 2OYMA 4QG8A 4IIDA 1AUSL 3TYDA 3AS0A 3N29A 3M07A 3W72A 1XPGA 2YOCA 3KTSA 1EQCA 1J4EA 1A0EA 4HKPA 4NIRA 4QJ3B 3PBUA 2C8NA 2GJNA 4GUGA 4L1WA 3UZWA 1EFZA 1X6UA 3MU7A 4H2CA 1VRXA 3Q58A 4H9UA 3GVRA 2C1IA 1EOMA 4ML9A 3TNBA 3ISIX 3ZXWA 2YZRA 1Y5XA 1S5WA 1U1UA 3BW2A 1UKSA 3BOFA 5F2GA 4MNLA 2WBKA 2R91A 3SUVA 1WXZA 1OFRA 1XC6A 2I56A 4JFVA 3CU2A 4I3GA 1XFBA 2WM0A 4MPKA 3IEBA 2DSWA 2DPEA 1HNYA 5HA7A 4DO7A 1NVMA 2VENA 1KFJA 4Q32A 1UJQA 4LJ3A 3VM7A 1CB2A 4MUPA 1ISWA 5HBFA 2BOGX 2NLIA 1H11A 2AL2B 1ZCCA 1AQFA 3M6DA 5EFFA 4B90A 4RK8A 4F66A 5G2WA 1HVXA 2CPUA 1C8QA 3ARRA 4ALDA 3BAXA 4IUGA 3EAUA 1YKWA 1WDSA 5CBJA 5IM51 5A8GA 1FCQA 3FV9A 3STPA 1DHPA 1MSSA 4GHRA 5AYYA 3WDIA 1H1NA 2YDSA 4HA4A 1VFOA 1KB3A 4NAFB 1SM9A 3NQ2A 4NHVA 1HP4A 4MGGA 2QUUA 3AMKA 3BICA 3W02A 1IHIA 2BDQA 3RCNA 1E51A 4ZXLA 2J8TA 3B8UA 2IKJA 3BCJA 4HNUA 4PMRA 2X1IA 4F0SA 3A9BA 4PTVA 4UQEA 4IMDA 4ZFMA 4FNPA 4LTSA 3QY6A 1A5MC 4Z42C 4RE4A 4Z2LA 1B30A 3WLSA 2ISWA 2XGZA 2XGIA 1A4LA 3LYEA 5BNKA 1LP6A 4LAMA 1JDFA 3B05A 1NQ6A 3VGDA 4PMUA 1LOLA 1VCGA 4GO8A 4Z0SA 2PC8A 2BG5A 2VXNA 3VDCA 3S5YA 1MW0A 3OBAA 5H91A 1EHAA 2W27A 1E6PA 3PK7A 1DXFA 4KRUA 5CAHA 5BXTA 4M81A 3O06A 3VA8A 2H90A 4NXSA 2ZX5A 5H8UA 3LHYA 3G5EA 3U8GA 4HT3A 3GC2A 1EGZA 1X8FA 3VNZA 2R14A 1J79A 4TU1A 4HNLA 2ZZ7A 5GJPA 2EF9A 1OT1A 2GVYA 4BI5A 4HOWA 4QE1A 3CNYA 3L65A 1AJ2A 4AWEA 4JTFA 3OP2A 1TFVA 3L2MA 2YPIA 1K03A 4RNHA 1VZWA 3IGUA 1TJRA 4NX5A 2PEVA 1G7UA 4LC6A 4JTRA 1T7LA 4PMVA 4V33A 1E6XM 3VDHA 1PX8A 1DYSA 1EF2A 2WCSA 2YW4A 2X05A 2D2GA 3U2ZA 4GA8A 4LALA 4B15A 4WCJA 3H21A 3N18A 1A5KC 1D7KA 1P0EA 1I8JA 4RUBA 5HPOA 4MSSA 3KCOA 4R85A 3DG6A 4P5UA 1UMLA 3CUJA 4DJDC 3CL6A 1PAMA 4N2YA 1PX3A 2BNJA 4UFIA 3KVLA 1LLWA 8XIAA 3UVAA 4PMOA 1R0MA 3EEGA 1NWRA 4IGSA 4FX6M 1GOKA 1V6TA 2XIQA 2V68A 2DQXA 1H50A 3WNPA 5HMSA 1ADOA 5E9AA 3LGDA 3GDLA 1E4IA 3FGCA 4K2SA 1F73A 1GJPA 1GPFA 1JL8A 4LXFA 4Z1BA 1BF2A 6PTDA 1OCJA 1US0A 3W1RA 1L6WA 3LTYA 1Z9AA 4AYGA 2Y85A 3TQ0A 3HQ1A 3FVDA 3K1DA 2O4MA 2GQ8A 2HNHA 4FB7A 4QJ4B 4IQJA 1TR1A 3AUJA 1ZJHA 3GLCA 4JHOA 3ZYZA 3BW3A 4A6GA 1FA2A 2CC0A 5LHEA 4UTUA 4CCEA 1VD6A 1XV8A 1DIOA 4IMCA 1BSLA 3MW7A 3HQNA 1WZMA 3V35A 1EP1A 1YDVA 3GG8A 4DHGA 4LFYA 3WLMA 5FL0A 2YLAA 7ODCA 1C3FA 3S9ZA 3I3BA 4JBRA 3UU0A 4QDWA 3ARSA 1IT0A 2DZSA 1TVLA 1XUZA 2J75A 3WKZA 2GJRA 1XI3A 2Y5SA 4YU1A 3BH4A 3FKKA 5JXQA 3U4AA 1E9ZB 3PFMA 1OHLA 5I3IA 4JTLA 4CNTA 3UXLA 4F0LA 3EYPA 1ZUAX 1YPXA 5DXYA 3SCQA 4ADUA 1GCYA 2XWEA 1ZZMA 4EAYA 3FXGA 3AMDA 3KRBA 3HMJG 4AWSA 3WDRA 2ESCA 1XLHA 1A5OC 2CEQA 2VQTA 3NNTA 4QM1A 4H3DA 4JX5A 2VM8A 4W89A 3FYPA 4G7EB 1WNOA 3A47A 4ZXOA 5BRPA 3PBMA 3L66A 3KBSA 1Q6FA 3NPXA 2CCRA 1SJDA 4Z2GA 5ABFB 5KTLA 1TV7A 4FOUA 2FJKA 5D38A 3FN9A 3JRKA 1O1ZA 1CZ1A 3ZVHB 4HYVA 3EMCA 1E4NA 3MCOA 1J0HA 2G3NA 3EOLA 3OZMA 1XDJA 1W5NA 2A6NA 1HTIA 1L8PA 4HGXA 1B54A 2W6RA 2Y8KA 2BHYA 1PWLA 2YL9A 5A2BA 4LS0A 1HO4A 4IPNB 4UZUA 3WBWA 4ZSTA 1XBZA 4OGZA 4LYRA 3G2GA 3A4XA 2R1LA 5HJLA 2X30A 3A6OA 3RDKA 1HJUA 4HMEA 3WBEA 1P6BA 4MDOA 1K7EA 3APTA 1RVKA 3I7SA 3M9YA 4YIWA 5H6HA 1SZGA 5C9WA 1AJ0A 1FBAA 1REQB 1V0NA 5IFPA 2FGBA 1T99A 4MAZA 2IKIA 1JZ7A 4GWEA 2EAWA 3EOUA 2FTPA 2V5DA 1ZBKA 1XLEA 2R94A 4QQUA 4DY1A 1ZJAA 4P7NA 4YJ5A 2ZXAA 3R0UA 5BOEA 2E0PA 1FX6A 1GJUA 2OR2A 3QQ0A 1GPWA 1F6PA 2G0WA 4JPGA 4DBUA 4UTWA 5T8GA 3TCSA 2J7EA 1OSEA 3THAA 5CC6A 3CWHA 1RD5A 1A5NC 3TXZA 3MI6A 3DHUA 1EDQA 3L5LA 3H54A 1YADA 2BTMA 2VX5A 4TX8A 2Y88A 1MI3A 3SCUA 2QCGA 4GKLA 2WAGA 2OT1A 2WNQA 4K7VA 3Q65A 1RVGA 3AC0A 3H7UA 2YX0A 5FF2A 3C0SA 4XBKA 3TFXA 3WLLA 3L9CA 3PSVA 1N82A 3LNPA 4MWAC 4H1ZA 1KTBA 1PJ9A 2ATMA 3W4RA 1OFQA 1QO2A 3BVJA 4LUSB 1HJVA 3LCLA 4Y90A 1XS2A 2H9AA 1XFCA 4B4HA 2WHJA 1UWTA 1XL9A 1JZ5A 4DWSC 3VKDA 3MUXA 4L64A 3CWOX 5FSEC 1F76A 4NXKA 3G77A 3IIZA 1Z89A 4WGXA 4RDVA 3VX1A 2YL5A 2CZVA 1DORA 3Q2DA 2POTA 3VDBA 3GIQA 4NJKA 2G50A 1FFRA 1L6FA 5BU9A 3W7LA 3NQ8A 3GG0A 4XX6A 2X1SA 5ABEA 3S0CA 4XAPA 2HDJA 4B5TA 1M53A 3E9AA 3WMLA 5D9OA 1GQKA 3SUWA 2E40A 3W83A 4S3KA 1NELA 4YLWA 3SCTA 3AIEA 1WO2A 3GB6A 4M29A 2J27A 4C6QA 3GFYA 1X97A 2VGIA 3PWGA 4KH2A 4ROQA 2C7FA 3UR8A 3ZM8A 4CEXC 3NQAA 1JFHA 4HNTA 1O5QA 2MNRA 2AAAA 3FSUA 5DMLA 3UJSA 3U3HA 4LRSA 3TONA 3WQFA 1XSJA 3MBDA 1J0ZA 1GHSA 1GGOA 4IFKA 4AC1X 4YVXA 3WDPP 2INZA 3G1DA 3RHGA 4DM1A 4LANA 2E8YA 3QY8A 4GNVA 5FKYA 3L0NA 1FP9A 4GGBA 3QMTA 2WHLA 3LRLA 4Q8UA 2PWVA 3G18A 1HKWA 5ECVA 3VYLA 2F2HA 3SBFA 2DV0A 4JIEA 3S1XA 3G6MA 5IXEA 1CGXA 1LWIA 4UQBA 1Q6CA 4XKYB 1NEYA 4HOZA 4XIAA 1DE5A 4HPJA 1EJVC 3GWQA 3RMJA 1OX4A 4HYRA 4HN8A 1MFVA 3WD2A 3CIVA 1IIHA 2FTYA 1J11A 1GUVA 2RH9A 1SZRA 2BHUA 2I17A 2ZRVA 1EIXA 3GDTA 5DCDA 1S2TA 3O6DA 5DEZA 4LW7A 1DWIM 1TR9A 4Q8NA 2GUYA 3CZKA 5AB3A 2YDQA 4N6EA 4W84A 4QGCA 3DEQA 5HPCA 1KFKA 3GD6A 3GH4A 3AZSA 4Y9PA 1EJUC 5J5DA 2QVHA 1B4KA 3H12A 3IWPA 1MUCA 5L9FA 2V5CA 4FI4A 2VX7A 5DX7A 2VGGA 1XD0A 2Q3OA 5EBUA 4HU4A 4GQ0A 3OA3A 4JGDA 4ERAA 4US6A 2D20A 2VMFA 2E68A 1XWYA 2C6QA 3URAA 4KPLA 1P6CA 1SGJA 4L56A 1JG9A 3AYSA 4A05A 5DCEA 3OIXA 1VLWA 3L4YA 4MKNA 2XIIA 3PUDA 4M82A 1ITQA 3KZPA 1X8CA 3BXWA 1LRTA 4LSBA 1F61A 4K8EA 3AXXA 4IWWA 2EBNA 4D1JA 2QT3A 3CV2A 3U48A 1VH7A 1I60A 4RZ4A 4LYPA 2PF8A 1TELA 1XIMA 2QUTA 4Z2HA 1DQUA 3WYZA 4GQQA 3IV3A 3OPSA 5CEWA 1EZWA 4LYKA 3E2VA 1RBLA 4ICCX 1IEXA 1WKYA 5DN1A 1V77A 2G5WA 2IMRA 5E70A 2ZC1A 1U5HA 2OEKA 3KS6A 1HP5A 2DH2A 2Z6IA 4LB4A 3F4NA 3TZNA 1A3WA 1XUUA 2X09A 3BL3A 5BXSA 5DF0A 3TW7A 3EX3A 3NFUA 3VD3A 3NZQA 5C54A 4ZL1A 2ZTKA 3VMNA 1SMAA 1JZ4A 1E6RA 1W5QA 1PWMA 3IGXA 2ADAA 1AH0A 2IXUA 4Y9AA 4C6EA 4KFNA 4X0NA 2J7HA 2WOQA 1VFFA 4M8UA 3MQTA 4GACA 1TZ9A 1YIXA 4FXFA 4F4RA 2YKKA 3VD5A 3D5HA 4MUZA 4A35A 3ALFA 2NX9A 1BVNP 5A8MA 2DIKA 2HRWA 4RNIA 1BXBA 1G01A 4GCXA 3TWBA 4NRRA 2Y4SA 4P2VA 5EMMA 4WKAA 1QR7A 4D9PA 3B0XA 3DYMA 3FJNA 3KOZA 4AYSA 4PUWA 2FZNA 2R6OA 3E2SA 3LHUA 3VOGA 1PZ2A 1B1YA 2HV5A 2CKRA 4AMAA 2DZWA 4KIEA 2Z00A 5LXXA 3CPGA 3UT0A 5LHFA 4TMCA 3W00A 3W29A 4DJDA 1RZMA 4XB3A 1R7AA 3HZ3A 3TU9A 1VENA 4WGHA 3MWAA 3Q67A 1MW3A 3GC4A 4UOJA 3QV9A 4ACZA 2EG7A 1MFUA 1OK6A 2QUMA 5JMUA 2YBUA 4IQLA 5AZ1A 5I07A 2YA0A 2C16A 1EH9A 2QCHA 3UZYA 4DAFA 3H55A 2ZVRA 5FAJA 1HUVA 1YTEA 5EL1A 1XICA 2YBVA 3ARVA 4J3UA 2E1WA 1CENA 1WBHA 3BLIA 1VEPA 2QGHA 5CZTA 3NURA 2J9ZA 3GAYA 3DGBA 2PP0A 1CEOA 3GXPA 2YR1A 1WAWA 2OEMA 1NF7A 3HPFA 1JCYA 3GNXA 3GXIA 4H01A 2QPXA 2ZZ1A 5A6BD 1MDLA 1U33A 2ZC8A 3VDAA 3TMLA 1V03A 3AAMA 1JXJA 5HNRA 1EHNA 1IZCA 4NUWA 3TEVA 5XINA 1ENUA 3WO8A 2JEQA 5CC7A 2Y8VA 1LRQA 2REQA 2PDYA 4L4LA 1JPKA 1N8IA 1FCVA 3UWEA 4H7CA 2WMFA 1CXLA 4LAUA 4AZ5A 3STGA 2QCLA 2VT0A 2IPJA 2VUNA 5CPMA 1JZ3A 2CESA 1OADA 3WJSA 3CUXA 2J4GA 3TV8A 2VC6A 3GVVA 3CLWA 1JIBA 4MF4A 3PZVA 3AU6A 1QPNA 1FH7A 1QHPA 2YJQA 2VWTA 3QOKA 2GDQA 4L9XA 3W7EA 1V0LA 3W74A 5MKGB 1LOQA 3AIQA 3ANVA 3P8JA 4TQTA 3IAQA 4OECA 5F1UA 3R8HA 1I1WA 2VEGA 4QJ1A 3TC7A 3EOSA 3TK7A 2VR5A 1TKKA 1IZJA 5AVHA 2Q8LA 4Y9NA 1KW1A 3KRZA 4R5EA 1U5VA 3AXMA 4KCWA 1W1PA 3S47A 1XIFA 2HISA 3LY0A 1FWGC 2VQUA 3DU0A 4BWLA 5IBXC 3D46A 3CEPA 5CSRA 2WJFA 5DXXA 3H4XA 4DZIA 4LBSA 1ECQA 3DFPA 3OTRA 1CGWA 4ORIA 4TVUA 4UR8A 4KRTA 3QFEA 1UD6A 3WDQA 2X7VA 3K30A 4PUJA 3TYCA 3FVMA 3GK0A 2WSKA 5T9BG 1GEQA 3GIPA 3IANA 3RRAA 2GK1A 3DKJA 3LHZA 5FOOA 3UP8A 1JAEA 3T0TA 2Z28A 4I7VA 4GI9A 3V0TA 3TROA 1W8GA 4BEQA 3F4CA 1UWIA 4K8HA 4UCFA 5A8PA 4MYXA 2ZDSA 3HGSA 3W73A 5B80A 1FVPA 3TH6A 1C8XA 2YYUA 4TVDA 2JKEA 5EPDA 2WZEA 4FLOA 4FNRA 2DVTA 2CU0A 1Q8JA 1QW7A 3BSGA 4AF0A 4PUMA 1PTDA 1IV8A 1KFBA 3R79A 3EMZA 1VGAA 2W3ZA 4RKAA 4Q8VA 1OC6A 3WF4A 4JTKA 3PC0A 3W1TA 1YXCA 3HPZA 5FD0A 2F6KA 4CD7A 1OM0A 2QJIA 3K46A 3PFRA 3TYAA 1K6AA 3BAIA 3ITYA 3S1WA 2JGYA 5DMNA 1GYNA 1RPXA 4AQLA 1TREA 2FKPA 4D6EA 5JQ9A 2E6AA 1CDGA 3PZGA 1V7YA 3GG1A 3VIJA 1P7TB 1QI2A 3ITOA 5M5DA 3GNPA 2F38A 1SR9A 2ACUA 5D4YA 4W5UA 1LLZA 3G1XA 4H9MA 5DT5A 3VGBA 1E6SM 4Q4PA 1JGIA 4LU0A 4Q8TA 3O7UA 3C2YA 4F40A 3KAOA 3W2LA 4JICA 3D3FA 3TQKA 1GTHA 1K7XA 2PURA 1W9BM 1XBXA 1K77A 2NXHA 4S2CA 1BLIA 3DHFA 3IGSA 1UPPA 3N2TA 4TIMA 3F03K 4JCMA 4HCLA 5A69A 2W66A 4ZENA 1KNWA 4MWAA 4OTKA 3NOYA 3LX9A 5KZ6A 3L23A 3NPWA 4QG9A 2GFTA 3LUTA 3AROA 1VPYA 4DWSA 1MNZA 3C2RA 4GIYA 3M1ZA 4TTUA 3VD7A 5A2CA 3T0CA 2J6XA 4G1NA 3HB9A 2PWUA 3WJWA 3EA1A 5HOSA 2GVLA 4HHHA 3E0VA 5IDZA 2CFFA 1HX0A 3VNLA 1AFSA 1DJGA 2H3BA 3XIMA 1VFUA 3TZFA 1RQHA 3Q37A 3BAWA 3C56A 1BQGA 1ZJIA 1UP3A 2OLAA 3T44A 2Z27A 1UOKA 5FJRA 3BCDA 4PTXA 2F9RA 4P8WA 2ZDRA 3PZOA 2AMGA 2HWGA 1OQFA 4KWUA 3GFXA 4WHBA 2G3MA 2PDIA 4E2DA 3FFSA 1J0IA 1DIKA 2HSAA 2XN1A 3VOJA 3LM7A 1OY0A 2R1NA 2VNCA 4GJIA 3W37A 3UXAA 4QE5A 1E40A 3QV6A 1Y0EA 3OGRA 2WC4A 1M7XA 4IHCA 3EDFA 1BWKA 1G1YA 3LG3A 2FHCA 4E2OA 2OSXA 2ZXDA 4AG0A 3BZGA 4YN5A 1Q2SA 3HF3A 3EPNA 4L9ZA 1SO6A 1X1NA 4IGNA 1NM9A 5JBEA 4OQVA 4CQCA 3KXQA 1TIMA 2QV4A 3WFAA 5HULA 2R1KA 3DENA 2Q8XA 4R7WA 3A4WA 4YL2A 3LSBA 5LKYA 2OO6A 1QBBA 3AS2A 4MB5A 3NAVA 2ZE0A 2NWRA 2BMBA 2GSEA 3MHUA 4FSAA 3PBYA 3VFLA 3PJXA 5LIKX 2G97A 1OGSA 3SIMA 1EUAA 4IQDA 4QS6A 2F2KA 3NG3A 4Z2KA 4XAFA 3MANA 1NWTA 3PAJA 1R6WA 3LBMA 2OCZA 4WSKA 1P0DA 5LIXX 1AMKA 1V3IA 1Z69A 3GKAA 2VFGA 5C9ZA 4RR4A 3FXYA 1UP2A 1VBGA 2FGZA 1MZRA 3N1AA 1BF6A 3ITLA 1FWJC 4ML4A 4O19A 3QTGA 2BXZA 1M3UA 2IS7A 4O1EA 4OIFA 3T78A 3G1YA 1YDYA 4O11A 1TSIA 2VRQA 4GLEA 1Z8AA 4L80A 3UPBA 4CVUA 4C6OA 4JTUA 1PCKA 1UBSA 1SSDA 1KXVA 1AZ2A 1XIIA 3VOFA 2Y7FA 3EA2A 3GXMA 2CWNA 4JTJA 3WDHA 1LM1A 2D0FA 3ARQA 4WVXA 3RU6A 3N17A 2EPLX 4M7SA 1B9ZA 1VYSX 3FX4A 2PWGA 3HV9A 3TTQA 4UNKA 4PFHA 5TNVA 4B16A 3UNDA 3WLQA 2AL2A 4X22A 3AHZA 3LTPA 4XBSA 3EDDA 3KOXA 4KETA 2UY3A 2X2GA 5CKSA 5G2IA 4ZOEA 2OT0A 3T2OA 4AWUA 3DC8A 4LV4A 3WJXA 3UG5A 1XSKA 1Q4NX 4MFEA 4NZ3A 4QDMA 3W1XA 3UWQA 4WY0B 3VKBA 2DH3A 3DCPA 1QI3A 3NA8A 1ISZA 1I9CB 1U22A 3SDOA 1E6QM 2Q01A 4IF2A 5C8BB 4LY4A 3RPTA 6REQA 1LQ0A 3R13A 3MB9A 4NAFA 3CWNA 1GQIA 1UZ4A 4G1KA 4YWIA 3WLTA 1DWFM 1RCXB 2XSAA 4FS9A 5FJJA 4G9PA 3W6YA 3O05A 4JTGA 1YBQB 3V1PA 3S5NA 4S38A 3JZEA 2PP3A 2BOFX 3BSMA 4HCHA 1O66A 1TJ2A 3UETA 1RCOB 3FJ4A 3N2BA 2ABBA 3W7MA 1XR2A 3CS2A 1H60A 2FPYA 1F5ZA 3T42A 4YPJA 2P3ZA 3N4EA 1AL8A 4XD5A 1A4MA 4Y7EA 2OYKA 3NJ3A 4S3JA 3ZLGA 3OBEA 1CLXA 1VEOA 3IIPA 4YCPA 1Z3NA 3WLNA 4F2BA 2VELA 1QPKA 2H3DA 1ADSA 4JQ1A 1ITUA 1KQZA 1CPUA 4INFA 4QNEA 4MB1A 1HF6A 3P8IA 4C6FA 2RKXA 3KVMA 1I45A 2E8ZA 3C2FA 3N11A 2QF7A 6TAAA 2TODA 3WJZA 3W9ZA 3G22A 4R33A 1P1MA 3RLVA 1IWBA 4HA3A 3L5MA 2FH8A 1H7RA 1RY8A 4TXEA 4B5WA 4LAOA 1EPXA 1HN1A 1SMDA 4M19A 5HQMA 3L4TA 1UKOA 2XZ9A 4ZMGA 1M7JA 1O7AA 3QZ6A 5FJUA 2CZDA 3LCFA 2VGBA 5EMKA 5D04C 5JH2A 1Q2RA 4O4VA 5CPQA 4E38A 3KDOA 4GRSA 3M47A 1V6YA 2OO0A 5BWAA 4NZCA 4YVPA 2JK2A 1X6NA 1NJJA 3PP7A 3QC0A 4CU8A 3NR0A 3TSDA 3ZLFA 3LU2A 3SIZA 5E0CA 5AYIA 1LRNA 2NV1A 4KERA 3G8RA 3GW0A 4NU7A 3H2EA 2INEA 4D72A 2IKGA 2PDWA 3M0MA 4ZB0A 3DI0A 1QO5A 4C6IA 1VJZA 3BLDA 5FCZA 3E5PA 4I7UA 1JAKA 3ARYA 1ZQ5A 3WELA 1NWUA 3TR2A 4AIUA 2RDXA 4GIAA 1GVFA 3OW1A 4JY8A 4LY8A 1PSCA 3GYEA 5CJMA 4J1OA 1UKQA 3EKZA 1K6WA 4IJRA 2YCIX 4PMDA 3ZT6A 1E5NA 5CG7A 1O94A 3VUSA 4RZ5A 4IJBA 4AVFA 5AC6A 4RDWA 2PTYA 2TSYA 2BX7A 1KM4A 1BQCA 3TVAA 1C9DA 1TQJA 2TAAA 4Z1YA 4WRHA 4JX6A 3B3DA 3NXFA 5B7YA 3RN6A 3O63A 4LBRA 5C2CA 1E6ZA 1BEUA 1YYAA 5BMXA 4H9ZA 3RJYA 5AN7A 4N0RA 4IX2A 1LQAA 3MT1A 1A0CA 4REQB 2E3ZA 3EB2A 3LHVA 1R3QA 3I10A 2PGFA 3VNJA 3TMQA 3TYUA 2YSWA 4B5NA 3KL0A 1KRCC 4ZQCA 4Z1CA 4X3ZA 3P67A 3SCVA 3WLRA 4UFHA 3ENLA 5TQLA 3WF3A 4NSBA 1HJSA 4GVIA 4E8GA 4C60A 4LQ1A 2V6AA 5LA0A 1OX6A 4S39A 4CQDA 2QMKA 3ONBA 3CHVA 2QJHA 3HGJA 2RDWA 4AY1A 1JULA 1DQWA 2DJLA 1PHWA 1GKQA 2V5LA 3M0KA 4BF7A 1BSIA 3OVRA 1WPCA 4U4MA 5J04A 2G3FA 4JR5A 3QZAA 3THQA 4UFLA 1CLVA 1ZL1A 1NOFA 2HROA 3VNYA 4H8VA 4US5A 1IEIA 4E6MA 1EJWC 4U5KA 1Q3NA 5EU9A 1IIGA 2PDQA 4PTNA 4LBUA 4OE7A 2QDGA 3T1GA 5GJMA 3GR8A 4JKKA 1GHRA 5KETA 1R3WA 3CZJA 3BAJA 3DHDA 2ASHA 1WP6A 5LA1A 3MUIA 1V3HA 1H41A 1Y5WA 1BRLB 4G7EA 4KEZA 2VCBA 1FDJA 1TX2A 2IUZA 4N9EA 3AHVA 3FDGA 2J8GA 1PZ3A 4XO7A 3PUGA 5ABFA 5JIPA 3BG9A 1DJHA 3W81A 2X1RA 1MVYA 4U33A 3IRSA 3ZVHA 4CQBA 2PU1A 4BHYA 1XCWA 3K8KA 3DG3A 3UERA 1VJSA 1D3GA 3CJPA 3CL7A 3UQNA 4GFSA 1U5JA 2YXGA 1L6GA 1TJ0A 1DTUA 2I5IA 2VVSA 4HZ6A 3BOXA 4M6VA 4NILA 1DQXA 4DUOA 3BJFA 3P62A 1A53A 3MVIA 2WMGA 2EKGA 1XG4A 2PDJA 4J4KA 5DBTA 1JRBA 4C1KA 2C1GA 5M3WA 4W4QA 4XD6A 3BLOA 4A3UA 1BYBA 3UCCA 3D0CA 1KA9F 1TV5A 3TQPA 1WBJA 3M41A 4H2HA 2Z2BA 2V81A 2YW3A 2D3LA 4KCTA 4I9TA 3UGVA 2E77A 3SY8A 1POKA 4C65A 4L4OA 1HIZA 3ABOA 2Z25A 5F2LA 3NDOA 3C0JA 3B4UA 3TE9A 1REQA 4CU6A 4O0QA 2J7FA 4J2PA 1FCBA 4XD4A 1O4UA 2CBUA 4LF1A 5FAGA 5A3HA 2NLYA 4PEEA 5IDIA 4BQ4A 3MS8A 4A22A 1MZHA 3BLPX 1LCOA 5JBFA 2I5QA 4PB4A 4EX4A 1A5CA 3L4VA 1MUMA 1LBFA 1LF1A 4M51A 1ZCOA 3LRMA 2PD9A 1LT7A 5F2MA 4V1XA 5CBBA 3U5UA 1FWRA 1W9PA 3SCSA 3G8EA 2C0HA 2OZTA 4ZQRA 2QULA 4HIBA 4UQ9A 4H9VA 4CD4A 3AIRA 4PMYA 1E9IA 3BK0A 1OFBA 4LRTA 1RA0A 4FALA 3R7MA 2EO7A 1LG1A 4AIBA 3RUBL 2DUZA 3DI1A 3K8LA 1I2NA 5BMWA 3SRDA 1K9TA 5XIMA 1TA3B 2H6RA 3QPEA 3ZR5A 3SY5A 3N34A 1Q4WA 3DHPA 1FTXA 2GSHA 3PBWA 4PA8A 5CH9A 4QROA 1H5YA 3BLFA 1RQEA 3UXIA 3VNDA 4JFTA 3HG5A 1H5VA 3KL5A 1OZQA 4Q8QA 3WQ8A 1P48A 5F4SA 4J2MA 3Q94A 3G0SA 2SFPA 4U28A 5D2YA 2P10A 4ECLA 2AQOA 2P8BA 3XISA 2NSXA 4YYFA 5I03A 1E43A 1FHVA 3SN0A 3WY1A 4V2XA 3QBUA 2I5GA 3JW7A 3O15A 3R89A 2VZVA 4XZBA 3DECA 2Q6ZA 2Z1BA 1US3A 4L61A 4EK7A 5EMUA 3AIBA 1K02A 3ABXA 2PE4A 4D6CA 2VD9A 3CQJA 2DY3A 4H41A 3VGEA 5C71A 4C6CA 3M7SA 1Q7MA 1W1ZA 2Y6ZA 5F4WA 3V0UA 3DX5A 4UMCA 4YHGA 4M24A 5JIWA 1AK5A 5HJXA 1XQLA 4QBXA 3L5AA 1J6PA 4TMBA 1FDZA 1VFMA 3IK4A 4O10A 3PG9A 1US2A 2V5BA 1QBAA 1GW9A 4X61A 3IJQA 4HSHA 3FSTA 2G96A 4FR1A 3OVPA 1LLOA 1CGYA 4DJFD 3MCNA 5CC3A 3D6NA 2I14A 4JL2A 3BCFA 2CBIA 1UD4A 4PMJA 2OQYA 3OODA 1VS1A 3TLLA 3A4AA 2QZRA 1DIDA 2W67A 4J7RA 5C7HA 1SJAA 1TWIA 2BWGA 4XKYA 3W87A 1R30A 3M5VA 4EE9A 3DFNA 3APGA 1YNQA 4XVDA 3AHYA 3C0LA 4RV8A 2E67A 2P50A 1UROA 5I78A 5U7SA 3VDGA 3W1UA 3A12A 2Y1HA 3T40A 3W6MA 1TUXA 1NY1A 4Z2IA 1IT8A 2ZICA 1TV2A 4QG6A 1M1BA 2OOGA 1JCNA 2VWSA 4YYCA 2FB2A 3QC3A 2ZVIA 3TOYA 2HE8A 3RX4A 3UR5A 4IL0A 4EPKA 1QW9A 3AICA 1IR2A 1OEPA 1OF8A 3N6JA 4KEVA 4O17A 3OZYA 5K9XA 5ABTA 2NV2A 3DOPA 1FWCC 1V02E 1EJRC 4C6PA 1OFDA 5CZ0A 4O15A 1X7IA 2HE5A 5J5RA 2WM1A 2VRJA 3W7JA 2ANUA 4CN6A 1XLAA 3W38A 3SFWA 1AJZA 4MY8A 4L6DA 5IRPA 4HHMA 3T0BA 3AHTA 4HTBA 4FIQA 2BVDA 1DWAM 4GABA 3MMWA 1IYXA 2BODX 3R25A 2HCVA 3I3DA 8TIMA 4P8UA 3FK4A 1S1RA 4AHPA 5A94A 2EJAA 3VIHA 1HO1A 5AY7A 3I6RA 1OVDA 3AQUA 3ZOAA 3BO9A 4FMVA 4YNGA 1KQYA 4I7WA 1P5BA 1V0KA 1DWJM 4NZFA 1UIOA 3IJIA 2ZXQA 2AOSA 3OZOA 3MO7A 3N73A 3WCZA 1V79A 4LWWA 2GOUA 2O9PA 2DSZA 2DUXA 3LPGA 3STFA 1LL6A 2PGEA 4FA3A 3SW6A 4YVVA 1HKVA 4GZIA 2PDHA 1AD4A