1ITQA

Human renal dipeptidase
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
369
structure length
369
Chain Sequence
DFFRDEAERIMRDSPVIDGHNDLPWQLLDMFNNRLQDERANLTTLAGTHTNIPKLRAGFVGGQFWSVYTPCDTQNKDAVRRTLEQMDVVHRMCRMYPETFLYVTSSAGIRQAFREGKVASLIGVEGGHSIDSSLGVLRALYQLGMRYLTLTHSCNTPWADNWLVDTGDSEPQSQGLSPFGQRVVKELNRLGVLIDLAHVSVATMKATLQLSRAPVIFSHSSAYSVCASRRNVPDDVLRLVKQTDSLVMVNFYNNYISCTNKANLSQVADHLDHIKEVAGARAVGFGGDFDGVPRVPEGLEDVSKYPDLIAELLRRNWTEAEVKGALADNLLRVFEAVEQASNLTQAPEEEPIPLDQLGGSCRTHYGYSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords RENAL DIPEPTIDASE
publication title Crystal Structure of Human Renal Dipeptidase Involved in beta-Lactam Hydrolysis
pubmed doi rcsb
source organism Homo sapiens
total genus 149
structure length 369
sequence length 369
chains with identical sequence B
ec nomenclature ec 3.4.13.19: Membrane dipeptidase.
pdb deposition date 2002-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01244 Peptidase_M19 Membrane dipeptidase (Peptidase family M19)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1itqA00
4NG3A 4EPDC 4PBEA 3GTHA 4GZ7A 4C60A 3NQBA 4QROA 2OODA 4IG2A 5FSEC 1PSCA 3N2CA 3OVGA 4RDYA 3LSBA 1NDWA 1RJPA 2PGRA 1VFLA 3MTWA 3QY7A 2DVXA 1KRMA 1RK6A 4BKNA 5AKQA 3RN6A 4C6PA 1K6WA 3IACA 4IG2B 4HJWA 4J5NA 2EG8A 4QS6A 4I6VA 3FDGA 3K5XA 3OOQA 2PAJA 3MVIA 2OB3A 4GY7A 4B3ZA 4DI9A 4OFCA 3MSRA 4XAZA 3WYZA 1RAKA 1FWIC 3RCMA 3F2CA 3LU2A 4AQLA 3TN5A 3GG7A 2FFIA 3LS9A 3QY8A 2YB1A 3ISIX 4HK7A 2AMXA 4P5UA 4BY3A 1A5LC 2P53A 3URNA 4H9MA 2WJFA 3AUOA 3UF9A 2Z2BA 4R7WA 2HBXA 4H9ZA 4KEUA 3EGJA 1FKXA 4D8LA 4MUPA 3S2NA 2QVNA 4C6QA 2IMRA 3IGHX 1P1MA 2R1NA 1W1IE 1ITQA 2EG7A 1NDYA 3E0FA 3S2MA 4RZBA 1ONWA 3ID7A 3QGAC 2YXOA 3AU6A 1P6CA 1S3TC 1R9YA 5HMFA 2I9UA 1WXZA 2FTWA 4CEXC 4H00A 2KAUC 1YBQA 4NI8A 1KRAC 2ANUA 2G3FA 2A3LA 1NFGA 3GU2A 4H9TA 1POKA 4CQDA 3GIQA 4ZSTA 3JZEA 4Z42C 1M68A 1YRRA 2Z26A 1YBQB 2XIOA 4QSFA 3BE7A 3T81A 4RDZA 4UBPC 3E38A 2R1KA 3O7UA 3ORWA 4ICMA 4YIWA 3LA4A 4DZIA 4DIAA 3O0FA 1EJVC 1NDZA 4AC7C 1J6OA 2Z25A 2WM1A 1GKRA 4LCRA 1O12A 4B91A 3LGGA 3KM8A 4B92A 4EPEC 3S2LA 3IV8A 4C6MA 2FVKA 4DZHA 1HZYA 4RE0A 1NDVA 4WGXA 1UIOA 3ICJA 4LH8A 4C5ZA 2HPIA 3GUWA 3UPMA 4C6NA 1K70A 1FWGC 4C6BA 4ERAA 2FVMA 3LSCA 5A6TC 2Z2AA 1V7AA 4RDVA 2GSEA 4WVXA 4H01A 3PANA 1I0DA 4LFYA 3EWCA 1FKWA 2VHLA 4GYFA 4HK5A 3G77A 2Z24A 3K4WA 3NEHA 4GY0A 2HPMA 2UZ9A 3V7PA 3DUGA 2UBPC 4IGMA 2Z27A 1EZ2A 3MKVA 3CS2A 2BGNE 3PBMA 2R1MA 1A4MA 4XD3A 1FWAC 4QRNA 3GU9A 4KEVA 3DCPA 3EWDA 2P50A 4C6LA 4GK8A 1RA0A 2VC5A 1UIPA 1RJRA 2QT3A 3WZ0E 2W9MA 3OODA 3S4TA 3TNBA 2GOKA 3E3HA 3MPGA 3A3WA 1EJXC 3ITCA 1I0BA 3IPWA 1RK5A 4C6EA 4F0RA 3GTXA 4L9XA 3RHGA 3HTWA 4RDWA 4C65A 1V79A 3GTFA 4XAFA 4JOMA 3GTIA 4B90A 2FTYA 4DYKA 4H9UA 2BB0A 4KESA 4KERA 4ERIA 2ADAA 1POJA 3UBPC 4C6CA 3F4DA 4LANA 1O5RA 4GXWA 4ERGA 4LCQA 2YZ5A 2E1WA 4CNSA 4QTGA 3MVTA 4IF2A 3GIPA 3D6NA 1PB0A 1M65A 3UR2A 4XD4A 4NP7A 1KCXA 3LGDA 4L6DA 4IFOA 1EJUC 4EP8C 3HPAA 4R88A 1EJTC 5LXXA 1IE7C 5HMDA 4C6FA 3T8LA 2CZVA 2PLMA 2PUZA 1WXYA 3NURA 2GZXA 3E74A 4KETA 3QY6A 1DPMA 4LCSA 4DI8A 3A4JA 4EPBC 2F6KA 3TN3A 3FDKA 3RYSA 3F2BA 4IFRA 2Q01A 1XGEA 1A5MC 1FWJC 4J35A 3S2JA 3SFWA 2QPXA 4I6KA 4V1YA 1XRFA 1UMLA 3QGKC 1XRTA 2AQVA 1J5SA 1A5NC 4IH3A 1A5OC 4KEZA 1EYWA 2HQAA 2OQLA 4PBFA 2VR2A 1M7JA 2Z00A 4XD5A 1FWFC 5HMEA 2EG6A 4PCNA 3B40A 4C6IA 4WHBA 2DVUA 2WJDA 4DLFA 4F0SA 1YMYA 1J6PA 3URAA 4F0LA 1FWHC 2YB4A 3MDWA 3B0XA 4GX9A 4XAGA 2O4MA 1ONXA 3GU1A 1UBPC 1E9YB 5CH9A 4HK6A 1RA5A 2HBVA 4LAKA 4UB9A 3C86A 3IARA 3LNPA 1J79A 3LY0A 4V1XA 1K1DA 1KRCC 4GX8A 4GBDA 1V77A 4KIRA 4C6OA 4CQBA 4C6JA 2D2HA 2Z29A 3DC8A 4PCPA 2E25A 1EJSC 4C5YA 1R9XA 1GKPA 3URBA 4LAOA 1JGMA 4IFKA 4CEUC 3CJPA 2Z4GA 2D2JA 4LALA 4H9XA 3IJ6A 3CAKA 3K2GA 2DVTA 4IGNA 2GWGA 2VM8A 2RAGA 1P6BA 4KF1A 4LAMA 4IFKB 4ZSUA 2Y1HA 1A4LA 4GY1A 1PTAA 1A5KC 4TQTA 4GC3A 2AQOA 4M51A 3T1GA 1RJQA 1R9ZA 4CNTA 3F2DA 2ZC1A 4QS5A 4H9YA 3MDUA 2QS8A 3GRIA 2Z7GA 1ZZMA 3OJGA 3OQEA 2VUNA 3F4CA 1ITUA 1V51A 4BJHA 4DNMA 1EJWC 5G4HC 1FWDC 3HM7A 1ADDA 4PE8A 2VC7A 4EPKA 3MJMA 2Z28A 2HNHA 1FWCC 4G2DA 5FSDC 2PGFA 1V4YA 3E0LA 4XAYA 3E2VA 1GKQA 1QW7A 3FEQA 4CNUA 3B0YA 1KRBC 2OOFA 2Q09A 4IQJA 3AU2A 1QXLA 4J2MA 2D2GA 1BF6A 1YNYA 3TN4A 3SO7A 3TN6A 5E5CA 3PAOA 4XD6A 4H9VA 4GOAA 2GWNA 3IRSA 4LEFA 4HA0A 1EF2A 3WMLA 4G7EA 1XWYA 1YIXA 4CQCA 3R0DA 4E3TA 4R85A 1PO9A 2I5GA 4KQNA 4DLMA 2R1LA 4C6KA 2R1PA 4INFA 3URQA 4G7EB 3OU8A 3PNUA 1EJRC 3A3XA 4C6DA 2OGJA 2WJEA 3PNZA 2O4QA 3UR5A 1FWEC 1E9ZB 2ICSA 1FWBC 4DO7A
chains in the Genus database with same CATH superfamily
1B54A 3W6MA 4GZ7A 5F2IA 3W88A 3H23A 1PSCA 1UR1A 2PWGA 3GH5A 3MZ2A 4RDYA 1NDWA 2E9BA 4US5A 4Y9MA 4GKLA 1MEWA 4PCSA 1W1PA 4BKNA 4CD8A 2G41A 1B90A 1MW2A 3SN1A 5CZJA 1C29A 2BASA 3RU8X 3RAOA 4I6VA 2YA2A 3W2UA 3BLIA 3OOQA 4FF7A 4GISA 5HULA 2O92A 2HSAA 3VC6A 3TSMA 1FXQA 3TONA 3VGGA 4Z2GA 3QY8A 4RE2A 2E1DA 3T78A 4G9PA 1L8NA 4AYGA 1EBHA 2FGBA 5C70A 2WJFA 4GCAA 3V0SA 3OLGA 2VQUA 2XIQA 3N2XA 3EGJA 5DY2A 1GK8A 3AI0A 1GYLA 4MMWA 4AIBA 4Q6XA 2V63A 2AQWA 1P1MA 3ARRA 4ZCWA 4NF7A 3FJNA 4RZBA 4X2RA 1OX5A 2EAWA 4MJMA 2CZFA 2Z2UA 3FA5A 1HF6A 1GOOA 3RX4A 2YCEA 1A47A 2I9UA 5E0CA 1PTGA 3I6TA 2CHOA 3LTPA 4H9TA 1WO2A 1WP6A 1F3EA 3C2RA 4AD0A 4ZSTA 2A3AA 4CCEA 3TXVA 3WNMA 2PDWA 2C6QA 1LP6A 1BF2A 1AMKA 4Y6GA 3VOJA 4O1FA 2CITA 4EX4A 4PBGA 3UJSA 1EJVC 4FIQA 1IF2A 1K8XA 2WCSA 3AWNA 1JEZA 1UR2A 2PWFA 3CUZA 3NVTA 4LBSA 3W7KA 4U28A 3TQ0A 1HXJA 4FS9A 4UTHA 4LUJA 4C91A 4LB3A 4RKAA 3AWOA 3LSCA 3UJRA 4I90A 1DQXA 3RPMA 2RUSA 1B2YA 2Y0FA 4H2HA 4QG8A 2Z2AA 2WHLA 3CTTA 4RDVA 2GSEA 2Y7EA 1VD6A 1I0DA 4LFYA 3LCHA 2FZ8A 4H8UA 3PPCA 1BWKA 2Q02A 1UC5A 1S38A 3DUGA 4HPNA 3HJZA 1XR2A 2WHKA 2P0IA 1A4MA 4FZIA 3KVLA 3UFYA 3WLIA 3GU9A 2YPIA 1SO6A 1KV5A 4GK8A 3UJFA 1EP3A 3E02A 1RV8A 4A29A 3AISA 1E6PA 1RY0A 5LXEA 3Q67A 3KEHA 1TX2A 4PGLA 1QCWA 2VT0A 3EXSA 1OB0A 2CHRA 2VFHA 2YA1A 5BOOA 1YXDA 2C91A 1H7WA 2OX1A 4CQAA 3GXPA 4ML9A 2INEA 2QIWA 1LORA 3W1PA 3W87A 1PL9A 5CBIA 4KESA 4LSBA 4MWAB 3GVGA 4L9YA 4ZVJA 2V6AA 3IRDA 1EUAA 2DQWA 1C7TA 3R8RA 1JI2A 3GIPA 1MI3A 1XLGA 2CU0A 1PB0A 3PTMA 4I9JA 3P5ZA 4NP7A 3PF3A 1EJUC 1Q5MA 1U1UA 4IPPA 4JL1A 4LVBA 1PS9A 4KEMA 1VC4A 1FBAA 4NZ1A 1ZTVA 1ENUA 4LVDA 3WD3A 4RV3A 2FPVA 4EPBC 4ORIA 1VIZA 2Z1XA 1WAUA 1R47A 2XINA 3O6AA 4M7SA 1S2AA 3RYSA 2QDHA 3H2EA 1TPWA 4JXCA 2POZA 3R58A 3O6CA 5PTDA 4HP5A 4Q8VA 1E0UA 2OMAA 1TVLA 1A50A 4Q4KA 1KFLA 4CGTA 3VKAA 3WH7A 3ZR6A 1NWSA 5LHEA 2DSKA 3AS2A 3MUAA 2DVUA 2WJDA 2BY0A 3H24A 1US3A 3T42A 1G7VA 1DJZA 1TJ2A 1CBGA 3LHTA 1LT7A 4JN8A 1BPLB 4RNJA 1ZLPA 3W7IA 1QATA 4UB9A 1H3GA 3LHZA 1QW8A 4QEHA 1KBLA 2AOSA 2A3BA 1A0CA 1RXOB 1R3RA 3W7MA 4Z2KA 4B5XA 4C5YA 3NCOA 1FDYA 5AC7A 3QC0A 1O5KA 2CEQA 3CAKA 1GNXA 1DQUA 1FHDA 1KLZA 4JD4A 3R43A 3MT1A 3VMOA 3LI1A 3MMDA 4P7NA 4K2SA 4YL2A 2I17A 1SUXA 2H9AA 4HNLA 5EB8A 3CUJA 3OW1A 3ARVA 4M51A 3CMFA 3R5EA 2WM0A 4AZCB 3L0GA 4ICNA 3TLLA 1IR1A 5EU9A 5HJYA 4EAMA 1P43A 2E68A 4R53A 2QV4A 4YXGA 2ZE3A 4ECLA 3ZM8A 2C71A 4IUOA 1F73A 5FJIA 3GXDA 1TREA 1FWCC 4HD5A 4QE5A 4KW2A 2CXEA 2P88A 3ZR4A 2QJGA 3AIEA 1QXLA 3BMVA 2EJ1A 2E9MA 3EYPA 4YHEA 4B15A 3C0SA 5ABTA 5JXQA 1ZPTA 3UYIA 4FK9A 3BOLA 1XWYA 3ZS4A 3GC2A 4R85A 4F2BA 4IOTA 3T0DA 3MSDA 1J12A 3WUEA 2VX5A 1PE1A 1V93A 4S3AA 2Q3RA 3PZGA 5GJMA 3NDOA 3E6EA 4K7VA 1JCXA 4WKFA 5E1QA 1V0MA 4QQUA 1XUZA 2J6XA 1B30A 3BK0A 4QHRA 1JCJA 1REQA 2CLFA 3LHVA 1WKFA 1E9ZB 5I3HA 3N4EA 1SZGA 2VGIA 2FPYA 3RFAA 2XVGA 1UWSA 5A8NA 4N42A 3PFRA 3I3BA 4PMDA 5LNVA 1F6PA 4G56A 3EOEA 4R3UA 1IV8A 4W93A 1V3MA 4N9BA 1TJ0A 1QK0A 2QHAA 3WNLA 4DUWA 1S2TA 3TYDA 5EBUA 3LRKA 5BRQA 3MA8A 5FL1A 2ODOA 1C3FA 3B9EA 4TX6A 2ZZ7A 4H41A 2A3CA 2F6UA 3GVQA 3WLHA 1H7OA 2V9DA 4DM1A 3CQIA 1RAKA 1W9UA 3WBXA 3LU2A 2BXVA 1ZJHA 3C0QA 3G6LA 4KBXA 2VRJA 3EWYA 2XH7A 2AMXA 2PTXA 4P5UA 1W31A 1KLYA 3ARYA 1W3NA 2C7FA 1XDMA 1J0KA 4UFHA 4P8VA 1H50A 5BZAA 5HXMA 3UF9A 5FI8A 3M0HA 3NO1A 1DIDA 5AHEA 1BVNP 4L6HA 3I3DA 2WVTA 4FNRA 3QV9A 5FF2A 4OV4A 5GJNA 1O4UA 2OKOA 2HWGA 3NPVA 2XH2A 6CGTA 1CTNA 3J7HA 1XCFA 2VDGA 3LB0A 1UG6A 2INFA 1V5XA 3CUFA 4XIMA 1PKLA 5D9MA 2WLZA 3SRFA 1FY6A 2ANUA 1TTQA 1SPQA 4IMFA 1E6SM 2JE8A 3NPXA 3C0JA 5HATA 3MS8A 1GPWA 1XCWA 5CJ5A 1TCDA 3A21A 3PN8A 3W2JA 2QVHA 1UKPA 3L5AA 4HNNA 1CXIA 4FX6M 1PYMA 2XGIA 1WZKA 4PFHA 2DQXA 4AC7C 1J6OA 3O06A 1JZ4A 1A3WA 2FHFA 1O12A 1UKQA 3C52A 5TD4A 4J3UA 3L12A 3W26A 3S2LA 2FVKA 4WGXA 1UIOA 3NQGA 1UWUA 2XN1A 1TWWA 4Q22A 2PMQA 1BSIA 2QUNA 1TIWA 3TC7A 3WNNA 1XDLA 2Y62A 4DWDA 1UUOA 5D30A 2D3NA 4Y2WA 1HVXA 5AZ1A 3SSJA 2W6RA 4HK5A 4GY0A 4JY8A 3BH4A 1MYRA 3E1F1 3BMXA 3UWEA 4U3CA 1KM2A 1EHNA 2PWHA 4Q4OA 4YN5A 1SSDA 4WKAA 2BGNE 4GIAA 3FNDA 3UZYA 4X3ZA 1H11A 4EXQA 3WO8A 3P2VA 1QBAA 4AVNA 1IHIA 4LUYA 3S47A 3VX1A 2JEPA 7TAAA 1UH2A 2Z1VA 2CBJA 3MPGA 4MHBA 2XSXA 4QSHA 4C1LA 3WQGA 1JYXA 1ZBVA 1Q4WA 3MUXA 1I0BA 1RD6A 1S2CA 4P8WA 1K9TA 3MV01 2CERA 4IP4A 3GFZA 3S5NA 4UOZA 4TUFA 1JVNA 2UY2A 4XAFA 4GBUA 1FHLA 2CKSA 5EL1A 4DYKA 1PUDA 3PJWA 5FOOA 3GW0A 1SR9A 3BURA 4Z2HA 1S5VA 4DY1A 3UBPC 3W72A 1ICSA 1DIEA 1S39A 3MVTA 4IF2A 4CD4A 5IRPA 3D6NA 2W63A 2QULA 1ADOA 3T09A 1BXBA 3PZTA 3CYVA 4IP5A 2GQAA 3BICA 3UCDA 1VENA 3VOHA 2DUAA 4LVGA 1AL7A 2MUCA 3G0XA 4KETA 5REQA 3NEVA 2V82A 4ZL1A 3U2EA 2D0HA 3JS3A 1RBAA 3F2BA 3A5FA 4J35A 1AJZA 3JRKA 4FF5A 3VFLA 3BLKA 2F8QA 5IFTA 2G95A 1XIEA 3DENA 5JQ9A 1GW1A 4E4UA 2JK2A 3ZYZA 1FWFC 1XLFA 2YW4A 1K9EA 1Y5VA 2EG6A 2GOUA 4RNFA 1EIBA 4H1ZA 3PP7A 1OIMA 3CIXA 1GQJA 4DJFC 3DAQA 4LY4A 3OEXA 1UJPA 3MKCA 4LJ3A 2G0WA 1H7RA 3UD6A 3T2QA 1E6ZA 3WMBA 4UQDA 3DH7A 1QPNA 2PF0A 3VVGA 2OZTA 4KIRA 1LG1A 3PC0A 3LCFA 4FX8A 4MG4A 2FB3A 5T91A 2RFGA 1XIFA 5CCZA 2PB1A 4JDYA 3TSDA 2CLOA 2D1ZA 1I2RA 4WR3A 4XV0A 3VGDA 1G5AA 5FJRA 1WDDA 3RIKA 2G4FA 3SUSA 4GNKB 4LAMA 4B9YA 3PBWA 3H70A 2I16A 4MAVA 2ALRA 5A6BA 5FJUA 1SR0A 3KP1A 2PDYA 1YTKA 3ZIZA 9CGTA 2H9AB 4KGJA 2ZFAA 4GINA 2XWDA 1ZS2A 5JIPA 3LNMA 2Q8ZA 1TV7A 3AHXA 3CMGA 3CAQA 4KH2A 4OOZA 4LW7A 4XQ6A 1E40A 1R3SA 3AFBA 3RPDA 2R91A 4G2DA 1AZ2A 1V4YA 5KZ6A 5EMJA 1G7UA 4QE4A 4S38A 4DBUA 4IJBA 2PDMA 3WQFA 1LOQA 1JGIA 3GVRA 1ICPA 4LBRA 5CSSA 2C8NA 1PZ2A 3BV4A 3SRKA 5HNUA 1M1BA 4HT3A 1UD5A 3ZVHA 5DFAA 3AIUA 5CPSA 1E73M 4V33A 1VZWA 9XIMA 4ACZA 4KQNA 1D9EA 4Q8WA 5D4YA 1W2VA 2C15A 4UTLA 1EBGA 1H7PA 2WSPA 5I02A 4CKQA 3BG5A 2PRHA 2WMFA 3OTRA 4OUIA 1UJQA 4EPDC 1BYDA 1REQB 3TP4A 3M5XA 3AMKA 1RJPA 1VFLA 4PRWA 1RVKA 1RK6A 2NT1A 4H19A 1A0EA 2VD9A 3DFYA 3R8HA 1UWQA 3EMCA 2DZVA 3IVTA 3BGGA 3QR3A 2Y85A 5D03A 3W7OA 4XAZA 1KBJA 1HJWA 1YKWA 5TF0A 4E8DA 4DZ5A 1JDAA 3SGZA 1OFOA 3GG0A 2A6NA 3OA3A 1KM3A 3EEGA 1UP2A 3TK7A 3W2LA 3G1HA 3WQCA 3QRHA 4X22A 4AW7A 3U2OA 1TTJA 1EA9C 4NUWA 4UTKA 3HZ3A 3BPWA 2QCNA 4I7UA 1RQBA 1GT8A 3W6LA 4Q8PA 4NZ4A 3FYYA 1TVPA 1H49A 4Q7NA 3U0HA 1I2NA 3VU2A 3WK0A 2AL2A 5I7GA 3ALGA 3KFTA 2IPFA 1GHSA 2WZHA 1KRAC 3L68A 2DZBA 2YFNA 1DXEA 2IPGA 3W01A 3RO6A 1POKA 3SUWA 4TTGA 4Z42C 1X38A 1YRRA 4IMEA 4O1BA 5BWAA 1L6GA 4KCVA 4PTNA 3W82A 2YDQA 3ATZA 4KCUA 3V5FA 1Q63A 4IIGA 2ZICA 3EB2A 3JU2A 1NDZA 2WBKA 3DU0A 3JUGA 3O05A 3LGGA 3M5YA 4DJDA 3CZKA 2DSUA 1DJQA 3GR7A 4C6MA 5GNYA 3AC0A 5I03A 4LRTA 3WLPA 4E2VA 2A7PA 4PSRA 2NV1A 2WK2A 5I3JA 5EGRA 3GG1A 2P10A 1QO5A 3O8AA 4NXSA 1WKEA 4P61A 3VD3A 3BJTA 3WL1A 4H01A 1QPQA 1B9ZA 4N6FA 1VJIA 3MC5A 4JNYA 3VOFA 3KVJA 3OZYA 4LUTA 2Z27A 4RW5A 3TYBA 3QTGA 3AMGA 2H8ZA 1PHWA 3LN3A 1TJRA 1VFSA 5AYYA 1PWMA 2HROA 4Q8UA 3EDKA 4MWAE 1RBOB 1EXBA 3S9ZA 1LQ2A 3GXTA 3HGSA 3KCJA 2QJIA 1R2SA 1PZ1A 4L1WA 4TTUA 3L2MA 3EKGA 2GVLA 4O57A 2WSYA 2DZUA 2ISWA 2GQ3A 2ZCGA 3V1PA 1M53A 1ISWA 3BMWA 3AAMA 3KZSA 1N82A 2Z6JA 3A13A 2BVDA 3EWBX 2YXXA 3RF9A 1XQLA 3P0WA 4I5RA 5M17A 1GQKA 3S1GA 1XIMA 4B2DD 4PN2A 1J2BA 3GTIA 1KFWA 2WKLA 4JIIX 2DUZA 4UTWC 4GXWA 5DY3A 3WH6A 2GL5A 4V2XA 1FCUA 1R6WA 1VIWA 1B3ZA 2CLLA 5AOUA 4CCDA 5IHSA 4RX0A 1ZAHA 2GJPA 1PIFA 2H6RA 2GUUA 1QPOA 1RD5A 3LGEA 2ZADA 2CZVA 2FTPA 4BR1A 1KWKA 1Q85A 1XISA 2QEZA 2B7OA 3ELFA 2WKGA 4X63A 1DPMA 3CAVA 2YYUA 1O5QA 3KZPA 5HUPA 5REQB 3DXIA 1E6RA 2GPTA 4O8AA 2BV9A 1SSGA 2D22A 1MFVA 4QCEA 3LBOA 4QBXA 1OZMA 3CH0A 2QCGA 3H7VA 1UB3A 1V0LA 1VF8A 4CD5A 3AJXA 1WNOA 1HL9A 4LX4A 1GG1A 1IWAA 3MDWA 5I06A 3PFMA 4US5D 1X1NA 3AIBA 1XXXA 3QPEA 1U5HA 3HG5A 3SJNA 3G6MA 3R8GA 2GQ9A 3VOCA 1LRNA 2OOGA 4D6CA 3KOZA 3BSGA 3SQSA 4AVOA 4UMAA 3O6DA 2ZUTA 3DI0A 4UNKA 1YNPA 3VYLA 1ZJBA 5E93A 4JTLA 1GVIA 1V02A 1KCLA 2LLEA 3BGAA 4MKNA 4MY1A 3PBUA 5T9CE 1KD0A 5DBUA 3KP0A 1TPEA 5DCBA 3WK2A 2J13A 1PTAA 3IIZA 4ZTYA 4NZJA 4A22A 2RGMA 2C14A 1HN1A 1VRDA 3WH5A 1XD1A 4FLOA 2BOEX 2VUNA 4A8LA 1V51A 3HM7A 4JTKA 1SJDA 2PLKA 3BW3A 1EGVA 3NFUA 3GYEA 3NR0A 2F9RA 3C6CA 1MXGA 1DE5A 3N34A 3BUVA 3WUBA 1XYLA 5FJOA 2ZIDA 1QW7A 1RPXA 2TODA 4H6RA 1Z48A 4KGLA 4A3QA 2OOFA 4IQJA 3LXAA 4J2MA 4AZ7A 2HISA 2CIPA 3MW7A 1DL3A 4XD6A 4AEOA 4NJGA 3W6YA 4OQVA 3MWCA 2OO0A 4DXKA 3KE0A 3MI2A 1MEIA 2AAMA 1PO9A 2I5GA 2RJHA 4Z2JA 2EQDA 5L6UA 3ZVHB 3PNZA 4ACZB 4L1XA 1FWEC 2WC4A 2E5CA 4QNEA 3MHGA 3ZJ6A 3BAIA 4YTSA 3DECA 3FVDA 2NUWA 2Z1WA 4GLEA 3STCA 1QHPA 3WBEA 4IJRA 1X1ZA 1DV7A 3N15A 2PDCA 4HHHA 1TKKA 3UXDA 3WD4A 1MZHA 5CLWA 3MB9A 3UWUA 1PKNA 4WSKA 3W85A 4QS6A 3MVIA 4GY7A 3KLKA 1XP3A 3ZT7A 2PDBA 2NUXA 3GBDA 3GG7A 3EDEA 3H2NA 3QLDA 2C0AA 2H3BA 4AX7A 1AG1O 3WDIA 2ZZ3A 1HL2A 4N9DA 4GH1A 4GUGA 3UETA 3AYSA 2ZDSA 1DIOA 1HVQA 1MDRA 3IEBA 3NYDA 4NVTA 3IUDA 3KOYA 3PJUA 3I6RA 1OY0A 1J11A 1IEQA 2AKMA 2E9LA 3W81A 4AIEA 3DEQA 1VYPX 4W85A 5A6LA 1OZQA 3ABSA 4E38A 3EOSA 4DJEA 2G3FA 1RY8A 2A4AA 2VR4A 5JBEA 4O52A 2AL2B 1NU5A 4IGSA 3SCNA 3WLKX 1SM9A 3AXXA 3QZAA 4UBPC 1H2JA 2X41A 1J18A 3ORWA 1HNYA 5C55A 1NWTA 3NAVA 1IXQA 1OCQA 1IEIA 1I1WA 1E3ZA 2PDQA 4RE0A 2QKFA 3FIGA 4WLCA 4GI4A 1ZBCA 3GUWA 4BK9A 1PEZA 2VFIA 3VDCA 1P0BA 2FVMA 2O9RA 3QMSA 1MWOA 3TKFA 2CXGA 5DBTA 2YL8A 1JDDA 3F4NA 3M0YA 2PDKA 2VHLA 1VLIA 4MPKA 4L1GA 1Q6OA 2UZ9A 3TCEA 4LT9A 4IGMA 3NXFA 4JX4A 3VX0A 1RR2A 1H60A 5RUBA 3MBDA 5JU6A 2XISA 2CCRA 1UD8A 2GGJA 1P5BA 4HHPA 4R7OA 4LUTB 1H62A 2D0GA 1SFJA 3LHUA 2WVSA 2VC5A 1QI3A 4LTSA 2ZUVA 1QOPA 1OJXA 1EJXC 3BLOA 2OEMA 1W0MA 2C18A 4Z1AA 1GQNA 1XIIA 3NZQA 4WOZA 1SJCA 1R5YA 2WZTA 1XLJA 4C65A 2PTDA 1XIJA 1V6XA 1UWTA 4B90A 1K4HA 1RHCA 4GNJA 3A24A 3BGJA 3THCA 1VLWA 3VI2A 1OFEA 2E0PA 2YR1A 3VNMA 4LCQA 3TFCA 4CU6A 4MLRA 4WX2A 2XZ9A 1V3JA 3L67A 3W07A 2F6XA 2XIMA 3K8LA 2MANA 1EQCA 4FSAA 1AUSL 3ZT6A 3TTEA 3WNPA 3BO9A 3ATYA 1E3XA 2Y70A 3PWAA 1YPFA 2PC4A 4BQ3A 1DJWA 3WD1A 3GS6A 4ADSA 3BAKA 4XVDA 5FL0A 1N55A 3M0MA 2XH0A 4EK7A 4F9JA 3QV7A 3QYQA 4WKHA 3SFWA 5GJPA 2E6AA 3BSHA 3QPYA 1XIBA 3VOIA 1QMLA 4AY8A 1RALA 4CCZA 3STPA 3NQ2A 3KVMA 1DE6A 5DT5A 2CWNA 2VCBA 1V3IA 3M7SA 5LA2A 3B40A 1QHZA 4Q33A 1J0ZA 1KV8A 1KTNA 2EHHA 2YB4A 1UBPC 2XWEA 3V0TA 4A8RA 5CH9A 2VGBA 3BZJA 3K1DA 4ZZ9A 3PZUA 3FHAA 4BZYA 3WLTA 4J28A 4NJHA 3SJ3A 3LUTA 3L5MA 4UFKA 4YVXA 2E25A 4GO9A 1ISYA 2DZAA 3JW7A 4HZMA 2F2KA 4O18A 2Z4GA 4RJEA 3ANUA 1M7PA 2C79A 9RUBA 3ZZ1A 2VR5A 2DH2A 1WX0A 1U30A 1W5OA 1OCJA 5AZ0A 2XFWA 4ZO7A 1QNRA 1A4LA 3VDHA 5AHNA 2VELA 1HQTA 3RU6A 4JYFA 3S6OA 3THUA 4H9YA 3OBAA 3MUIA 4O17A 3OQEA 4MKVA 2HTMA 3B05A 1RUSA 2BZNA 3CWOX 3F5KA 3YPIA 3PK7A 1ECQA 4WIWA 5AVHA 3WJYA 1DTNA 1C91A 4GA8A 3W28A 4H8VA 3AZSA 2QNEA 2DZWA 2F2HA 4CNUA 3B0YA 2Q09A 3GC4A 4HMEA 2DZSA 3OVRA 3CNYA 3WF1A 4A8NA 4Q7BA 4W8BA 3B9NA 3CZGA 4IPJA 4EANA 1W17A 3BAJA 3PAOA 3NSNA 3DHUA 1DVJA 1FRBA 2Y2WA 1X7IA 1OC6A 2ZTKA 1M6JA 1C8YA 5KETA 4PEKA 3SCRA 3U6WA 1NOFA 3PWGA 2CZ5A 4D6JA 3OZOA 3IVUA 3DHDA 4LC6A 2ICSA 3S3GA 1OGGA 4QG6A 3G0UA 3F5LA 4ORMA 2BNJA 1SJAA 5DN1A 1ME7A 4QROA 2OODA 3WH8A 4UTTA 3ALFA 1US2A 4FR6A 4E4PA 1CB2A 5BXPA 4IXHA 1HTIA 3W1XA 3N29A 1CENA 4XBSA 5IDZA 1LM1A 2JQXA 3FGCA 1K8CA 2QMJA 1ONEA 4E2BA 4GQGA 1TR1A 1MW3A 1G94A 4U2ZA 3HFTA 4AISA 5JBFA 2PD5A 3ITTA 1G4TA 2I5IA 2OVLA 3NL6A 1YEYA 3KL5A 1EUNA 1WZMA 5FD0A 1GOXA 3V5CA 3BCFA 4QCFA 1EX5A 2J74A 2VOMA 4AEFA 5A2CA 1CI1A 5L9FA 1PDYA 1TWSA 2UY3A 5IFPA 1ITQA 4ASTA 2EPMX 2YZRA 3LZ5A 4ONVA 4ZTXA 4OT7A 3SECA 3MV11 1B9BA 5J5DA 4DO5A 4OE7A 4HU0A 4JDBA 5F2LA 3FXYA 2DH3A 4A05A 1OG6A 5CSUA 3DKJA 4F2TA 2OT1A 2TAAA 1BWVA 4FMVA 2Z26A 4UR7A 3LZ3A 4PB4A 4XISA 1BFNA 4RCXA 2HE5A 3H22A 3TJ4A 3V18A 4AD3A 2DT3A 3E2SA 1KTCA 4KCWA 2PWVA 4M3PA 1YDVA 1S1PA 2QUMA 3NO3A 3L4UA 3POHA 4JHOA 1E4NA 2ATMA 3VIJA 2A1YA 1CXHA 1US0A 3M1ZA 4ZOAA 5FACA 3IV8A 2NW0A 3NQVA 1PVNA 1ISZA 3ECQA 5BWFA 3CLWA 2C13A 3U2CA 4PMNA 3ZQ9A 6XIAA 5M3WA 2RH9A 3WF3A 2MNRA 4UUIA 4M24A 2NXGA 4N6EA 3S9IA 3LQLA 1LLOA 2ONEA 3EX6A 3MY9A 3W1LA 1SFTA 3NOEA 3ITOA 3V7PA 2ZA1A 4DAIA 1FWNA 1R3QA 3PBMA 3DG7A 3SCTA 2NXHA 2DFAA 3TZNA 1F9CA 2EPKX 4IIBA 3SN4A 5EFDA 1OFQA 3T0CA 1RJRA 1GVOA 4G6CA 4NX0A 1QPKA 2J78A 1EQPA 1YE4A 5CBBA 5H6HA 4IQLA 3M44A 3HU7A 3QQ0A 3KOXA 3JZUA 4OIFA 1CCWB 4KWUA 4RUBA 1JDEA 2YCLA 1DWGM 5A6BD 3AS3A 1W5NA 4I5XA 3DG6A 2P3ZA 7ODCA 3M0VA 2J9YA 3L66A 2V0TA 4ZMGA 3P67A 1WBHA 3F4DA 1NOWA 3AJ7A 2OWXA 5HPOA 4CVWA 1QHOA 4CNSA 5CBJA 1OBAA 3RX2A 1O94A 1GONA 2G50A 4JFSA 1A5CA 4F66A 1B3XA 1V3HA 3PPGA 3HPAA 1OADA 3M16A 4PMQA 1OINA 3IVSA 4LS0A 1BYAA 3C5QA 3C2EA 1MO0A 2XU2A 2XHYA 2NZLA 3A4JA 3W29A 1P4CA 4AIOA 1MQPA 1ALDA 2NVCA 1VEMA 3WG6A 5I3DA 3P7YA 1RH9A 4RL3A 4LYRA 5D2XA 4JQ3A 3W1TA 1TE6A 2QJNA 2PBGA 3H4XA 3BTNA 3HIJA 1B5TA 3ONCA 5AY7A 5H8PA 4POCA 3DBNA 4D1IA 4F0LA 4ZQMA 3RMJA 2XFFA 1VBJA 1ONXA 2WMJA 3AHZA 3QC3A 1LLWA 1GJWA 1T96A 4AMCA 4MNKA 1FXPA 4HK6A 1RZMA 4FLRA 2PC8A 3LNPA 1GJPA 4J4KA 2P3EA 4CQBA 3B3DA 5DO8A 2Z29A 1XUUA 3SURA 3TA9A 3CEUA 4PUWA 3E2RA 4YTQA 3URBA 7TIMA 2AMGA 4HNOA 1X8FA 3IAPA 3SCWA 3ZJ7A 2DVTA 3B4YA 1Y8BA 4XTDA 2PDNA 1ZHAA 4J9JA 1ISVA 5LIYX 1UZHA 4Z1CA 2X0SA 1KXVA 2E09A 1A5KC 3PPFA 3NL5A 2PA6A 5AC4A 2INZA 1L0PA 3F2DA 5TBOA 1TPVA 2ZC1A 4GVHA 3N9KA 1UKSA 2Y8KA 3S5SA 3TAKA 4MVAA 4N4PA 1BGAA 3XISA 3CQ0A 1JCLA 1K03A 2WW5A 2XSAA 1DWHM 3THQA 2G97A 1A5SA 1SZFA 2TRSA 1ZBKA 1ZCCA 3NZRA 3S6TA 5BXSA 3P74A 2PGFA 4DAFA 4O4VA 5C9ZA 1DBTA 4YJ5A 1LQAA 1WV2A 5LHFA 4AZBA 1RCQA 1SMDA 1MSSA 3M9YA 5E5CA 1F74A 2J77A 2ZDRA 4MZ8A 3A22A 2JALA 4UIOA 1GCYA 3IRSA 5LIKX 4B5SA 3F1QA 1TV4A 4ZB0A 4Y9PA 3CPUA 2V5DA 2G8ZA 1KFJA 3ONBA 3R1ZA 2QXWA 4GUFA 1R3YA 3CIVA 3TOYA 3UWVA 4XUYA 4JTCA 3CHVA 3O3RA 3STFA 5CPNA 5D37A 2V68A 1ONRA 5CPLA 1EWDA 2FZBA 4UFIA 3TW9A 2PDIA 4KWVA 2V69A 3NQBA 1YHTA 2OO6A 3P93A 1Q7QA 2R14A 3N2CA 6TIMA 5CPQA 3R12A 4HMDA 3ERPA 1CXEA 6PTDA 2WNQA 1K6WA 3B06A 3K1GA 1TMHA 2EG8A 2ZXBA 4GH3A 1SFSA 3VNJA 2CNCA 4LVAA 2Y4SA 3VIMA 3RMEA 4R34A 3TQVA 3LQGA 4I7WA 1Y0EA 2DU2A 3QOMA 3FGCB 4FXFA 4MY8A 5HWNA 4B9ZA 3DESA 3T44A 2GVEA 1CGYA 2BY3A 5F2GA 3QV8A 3EAUA 1KNWA 1S1RA 7XIMA 1FKXA 2V5KA 4PMRA 1QI5A 4PMUA 2YDSA 3N17A 3QKZA 4QDMA 5I0DA 1P6CA 1XKYA 2A7NA 4EF8A 4OBRA 5DMYA 3T6CA 2WCAA 3IAQA 3TJXA 4BQ5A 1SMAA 4NI8A 1UD6A 4JTRA 4J40A 4FX7A 5HQMA 1NFGA 2PBOA 2ZTJA 1MUMA 1E5NA 2ZXDA 3K13A 1TQJA 2V3FA 1WBJA 4ACYA 3W7JA 4YS1A 4L4PA 4M29A 4LPCA 4MAZA 3VZZA 4M6PA 4Z2LA 1QPRA 3FY1A 1KM4A 4H7VA 2E5DA 2I7GA 1XIGA 1WB0A 1BTMA 4B91A 4GUHA 2BBFA 3CV1A 2ZUWA 4L4OA 1PKMA 4RZ4A 1ML1A 4L6OA 4V28A 4C6BA 2XTKA 2V8ZA 3II1A 3TJIA 2HS6A 3TLQA 1TE1A 4WDXA 2HVMA 3U9IA 5CGMA 4WVXA 1P7TA 1FKWA 2ABBA 2A6LA 2VC6A 3KDNA 2UY4A 3A6OA 3PUEA 5CQ1A 2B7PA 3HGJA 1XI3A 4LC8A 1JAEA 1XPGA 3EB3A 2Q3OA 2VMFA 3MANA 3AMCA 5FEZA 4JN6A 4GFIA 1FUYA 4FOKA 1ZSXA 3BDKA 2YLLA 4Y7EA 2WC7A 5HNRA 3DDMA 3WQ6A 1W3KA 2PI6A 1UPMB 3OVQA 1J0HA 5KZDA 5DMNA 2W9MA 3TQKA 1S2WA 3TNBA 4DVOA 3ITCA 3M46A 8XIMA 4YCOA 1ICQA 4HZ8A 4QG9A 4UWMA 2ZVIA 3B8SA 1BSLA 1TFVA 5HJXA 4LOCA 3PG9A 1UWIA 4O1EA 3G5EA 2WXDM 2YCLB 2Y24A 3O63A 4CQ8A 3FLUA 4A3RA 1F76A 2V2DA 3TC6A 3T55A 1QTWA 3WJWA 1W1ZA 2OKTA 5CC3A 3UGRA 3M41A 4IFOA 1JZ2A 3VNYA 2F61A 1SZEA 3L0KA 4FNUA 1BRLA 3NURA 3PUOA 1J0JA 3H2FA 3PTDA 3LEPA 2E7FA 3DG3A 1W1YA 1KQYA 1I4NA 3KW3A 3CAWA 4H7ZA 3FDKA 3R4IA 4PRTA 3A12A 3FJLA 4XZIA 1VPXA 3FOKA 2CWXA 1W37A 3VKCA 1I1XA 2AQVA 3K46A 3LCWA 1YPXA 5LIUX 2Z00A 5A8GA 2OSWA 2F84A 4Q32A 3U8GA 3S1WA 3TWBA 2H3DA 1F2JA 4MM1A 1FWHC 2J24A 3G1SA 3WSUA 3FXGA 1NJJA 3MI3A 2QIIA 2VCCA 2OYMA 4LAKA 2Z6IA 5D33A 1V02E 4Y90A 3SADA 1PDZA 3UWYA 2ACSA 4V1XA 4OBSA 5CZ0A 1W56A 3Q58A 1V77A 4C6OA 3GWQA 1KGWA 4HIBA 4K36A 4P7OA 5CSYA 1BG9A 1H1ZA 4IHCA 3T0BA 4QLKA 3DKLA 2D2JA 2IQDA 2PWUA 4Q8TA 4H9XA 4JYEA 2PSNA 2GLKA 1AH3A 4S3DA 1H61A 2NLYA 4PZVA 1TPB1 4Q4MA 3G1AA 3ANVA 3CLMA 1D7KA 5LNWA 1E15A 4TMCA 5HNNA 5DEZA 3T1GA 2P0OA 1ZRQA 2VFGA 4UQCA 3ZSTA 2Y8VA 2W67A 5A3HA 2NQ9A 1QK2A 4ROPA 2Z7GA 5DMLA 2PF8A 3IWPA 2J62A 4W5ZA 4HPGA 1FVPA 1R7OA 3W3OA 2CBVA 3VNKA 3TUUA 3D3AA 1G4EA 4O15A 3BVJA 4UXDA 1QNQA 3GK0A 3WLRA 3T8QA 3APYA 3AOFA 1UYQA 3VNLA 1UR4A 3TE9A 2V3DA 2XFYA 4XZLX 2WYSA 4YMZA 1H09A 3GVVA 1E71M 1X98A 5CZTA 3KVKA 4RZ5A 4LEFA 2PURA 4U3AA 3CO4A 4CCCA 1JFHA 4XKYA 4AHOA 3WEZA 1LWIA 1GVQA 2PCQA 4QM1A 1E4IA 1DXFA 5A6KA 3U5UA 1ZL1A 5AYIA 3CWNA 1X96A 8XIAA 1NF0A 4HSHA 2CYGA 3VIPA 4XO6A 2PFHA 4HQVA 3QSRA 3W1QA 5FSEC 5H8MA 2XVLA 2X1UA 2YCKX 5G5IA 4Q8NA 3TAOA 1EB3A 4O16A 2BLEA 2D23A 4GZEA 2DSZA 2OLAA 4WY0A 4BI5A 3M43A 4HJWA 4P7RA 3N6JA 3KL0A 1I45A 2DGAA 3HA1A 4O53A 3T4WA 4S3BA 1QJWA 1UASA 1KFBA 3E5BA 1DQWA 1G6CA 5DLCA 3BC9A 1YE6A 4JS3A 1PAMA 3KTSA 3ISIX 4HK7A 2ZE0A 4FAMA 3QF0A 1JPDX 5BROA 4V27A 4BEUA 1WDWA 4R7WA 1EP1A 1E4MM 4MWAA 3ZMRA 1UH3A 4LXFA 1KXQA 2ZRVA 4S3GA 4UCFA 3B8VA 3BL3A 4JY9A 4DNHA 2QVNA 1FFRA 3SBFA 4G7FA 1ONWA 2YXOA 1O66A 4DJFA 4BFAA 3F7JA 1G9HA 3VDGA 3RUBL 4QEEA 3WLNA 3NNTA 3SCVA 2WMKA 4UMBA 1K7FA 4JX5A 4JTFA 4XZ9A 4CQDA 1Z42A 2HE8A 2GK1A 1FWWA 1PKYA 3EDDA 1W9XA 2IS7A 1W8GA 4E2OA 2ZZ5A 4JAWA 3ENLA 1UR0A 4E5TA 3QFWA 4ICMA 4RNHA 1CLKA 3KX6A 3B8DA 1T7LA 3FV9A 3RLUA 2EBNA 3C4UA 2R9RA 1V6TA 1PX3A 3KL3A 4DHGA 3M0XA 5KITA 3HMCA 3C0LA 3TEVA 3L4YA 4DQWA 4D71A 1JNEA 1XBZA 2XVPA 1AD4A 3L5LA 5K4ZA 4EXBA 1FWSA 4E2DA 1PIIA 4GI9A 3MU7A 1I2QA 1EZWA 3W73A 1Q13A 3WJXA 4HNTA 2RKXA 5LNSA 2QW5A 1UZ1A 1TA3A 2NX3A 4GFSA 1EZ2A 1R2RA 3B04A 1P7TB 1VEOA 2YA0A 3NZPA 1FWAC 4MGGA 5CGTA 4XIAA 2ZQ0A 1V7YA 6TAAA 1JRCA 2A7RA 3W86A 1QW9A 4Z1BA 3BQ5A 5TIMA 2VFEA 5K9XA 4FXSA 4MKSA 2FHBA 4IPIA 1CXFA 3PAJA 3UG8A 5H1WA 2PU1A 1JJKA 3CHFA 2GGEA 4MUZA 2E77A 1LDCA 3VXGA 1OF6A 1ME8A 3THDA 3PUGA 5LA1A 1V79A 1XLKA 4GABA 2XGBA 1HJVA 4NHVA 4DYEA 4XZWA 1OFAA 1FP9A 4UTUA 3B9OA 3KCOA 3EZ4A 5HDRA 1LRQA 3QTPA 3VIKA 4HN8A 5CC7A 2V2HA 1FH9A 4PMXA 3USZA 3MYOA 4E0CA 3TC3A 4PL1A 5EY5A 2P1FA 1IE7C 5HMDA 2GYIA 1VPYA 3QZEA 3SSZA 1OFPA 5BW6A 1IGSA 2CESA 3GDKA 1EC7A 1JFXA 3LHYA 2ZC8A 5DELA 3RJYA 4IIEA 1RPKA 3P82A 3LCGA 1A3HA 4YYCA 3H21A 3VD5A 1F3XA 4XAPA 1G1YA 1GZ1A 4DM2A 3VMPA 3EOOA 1NWRA 1BRLB 5CPTA 3IUHA 2C19A 3G1FA 4GWEA 3RCNA 2AAAA 1XGEA 1A5MC 3S2JA 3AICA 1O6IA 1TR9A 3WJSA 3LX9A 3IGSA 1TWIA 2VR2A 2W5FA 4F2UA 1M03A 2OCZA 1N8IA 3W7CA 4ZQRA 5CZKA 3H2MA 3VK5A 4O12A 1YMYA 3GZ3A 3UQNA 1JYVA 2CKRA 3P14A 4KRTA 2HBVA 3TTOA 3FX4A 3UEQA 4D6GA 1VH7A 2D2HA 3UY7A 4PCPA 4AWTA 2J9XA 1R9XA 4XZNX 3FW6A 3T0TA 3WLOA 1SU5A 2B81A 2VP8A 1LG2A 5BRPA 1OEPA 4LAZA 1PWLA 3GUGA 2YBTA 1JD9A 3AHVA 3AYVA 1IXNA 4AEEA 3UNTA 1OSEA 2PEVA 5FF7A 2OYKA 1VAHA 1BVWA 4XZBA 1DP0A 3H6OA 2DP3A 1MW0A 1WCGA 4GVGA 1E6NA 3OQ8A 2PP3A 3W2MA 5A8PA 3KBJA 3CQJA 2DZPA 2DW7A 1YNQA 3ANYA 1GEQA 1JCMP 2VGFA 2BXYA 4HNCA 3OGRA 3IIVA 4EE9A 2O9OA 2Q71A 1RCOB 2RDTA 1VFTA 4J27A 4GO8A 1I8JA 2GDVA 1DJYA 3ARQA 2E28A 3GNXA 1W9BM 3PB0A 1C9WA 3OIHA 1EF2A 3FN9A 1GUVA 2VZUA 4AD2A 5HINA 2VRKA 1B57A 3PPHA 5FJPA 2BY1A 2WNWA 1WPCA 4DWSC 4PMZA 1JCTA 4R9OA 4ZFMA 2VX4A 3ZLGA 4GCXA 2E6DA 4CLMA 3PNUA 1EJRC 1I6NA 4XKYB 4HBKA 3NJ3A 1LL4A 4FEZA 1JR1A 3R25A 4NILA 4M6QA 4HVXA 1Q7ZA 3UR5A 3W38A 4G1KA 2OX4A 3U3HA 1P0NA 3HF3A 4GD0A 3SUUA 1NOUA 2IW0A 4X9SA 1SGJA 3H55A 4DN1A 3OVGA 3PULA 1TV8A 4D6HA 3QY7A 5DXXA 1TWZA 5T26A 1E6QM 4HNVA 2GJRA 3UVIA 4MB1A 1JI1A 4JFUA 4MYXA 4PYSA 4M0XA 2ISSA 1E0TA 2PRMA 2JFEX 2OU4A 2PLCA 2V67A 4JPGA 4B3ZA 4DI9A 3MSRA 1ZAJA 1VBRA 3WYZA 3GSMA 4WY0B 3ABOA 3HPSA 4A2SA 3TTYA 2J7FA 3SDOA 2BDQA 5D2VA 4NZCA 5F4XA 2X0YA 2WZEA 3LPPA 3WBWA 4GGHA 1MRAA 3URNA 5FAGA 3MHFA 2QGHA 3I4EA 3NQ7A 3CV2A 4J7RA 2BY2A 2GVGA 3CUIA 5D9PA 4JTTA 2H90A 3AUJA 1H4PA 1IZKA 3P8JA 3SCQA 4GHRA 4O1DA 3EOLA 3QHMA 1BQGA 3U7VA 4JCMA 1NDYA 4KFOA 4KKXA 3S2MA 4BEQA 2QCDA 4KWSA 3RRXA 1X8CA 1OD8A 1ZP4A 5C71A 5LIWX 1YBQA 4GYPC 1JL8A 2HZGA 2PWEA 4AWSA 1CW2A 1K7EA 1SW3A 3VO0A 4LF1A 2QDDA 2X30A 3L4ZA 1UR3M 5A8MA 5HQEA 1XIHA 1BYCA 1VYSX 2XIOA 3P6LA 3CQKA 4BQ4A 3VA8A 1XS2A 4XX6A 3CGTA 3UCQA 5D09A 1RLDA 5F2MA 5B80A 2GK1B 2ZZ4A 2J7DA 2WM1A 3GG8A 4F48A 4LCRA 5D2TA 2J27A 3H4GA 2JEQA 3QW4B 4BWLC 1JUEA 3IK2A 3TYAA 5KZMA 1XPYA 1WZLA 1GHRA 1Z9AA 3MO4A 3RG6A 1KKRA 3N2TA 2YKKA 4AU0A 3UYCA 5I07A 5A6TC 4MJ4A 1V7AA 1W9VA 1M41A 3NQEA 6REQB 4IZGA 3UXIA 3KRSA 3QMRA 1VB9A 4AWEA 3T7VA 4NNCA 3B0VC 2HPMA 3R94A 4U31A 3Q94A 4UQBA 4KWWA 3ZVIA 3NG3A 1THFD 5G2WA 1PCKA 4FR1A 4KEVA 3GDRA 4DBDA 1T8XA 2P50A 1A49A 1TA3B 1OCNA 4W84A 3VIOA 3WZ0E 4NXKA 2C1IA 3M7WA 5A8QA 2G3NA 1KQZA 4X0NA 1UP0A 3BAWA 1Z41A 5HJLA 3GD6A 1PX8A 3IPWA 3AIQA 4IXXA 3S8HA 3F03K 4D8AA 3NIYA 3GTFA 2RJGA 1EKOA 3MMWA 3VNDA 2YLAA 2TMDA 1AJ0A 2P8CA 3B4UA 1IQ8A 1VFMA 1M01A 2JIEA 3TIMA 2YZ5A 2E1WA 4EACA 4AHPA 3UW6A 1M65A 4QE1A 1PYFA 1MRQA 1EPVA 3VGFA 3WD0A 1V0NA 1E56A 4EP8C 2A0NA 4WOQA 1HX0A 4O0ZA 1LF1A 3DYPA 4LUIA 2Y5EA 1WUEA 3OBKA 4PODA 1FHUA 4PTXA 2G37A 1XC6A 2I9EA 3SAZA 4BF5A 5EMLA 1D3HA 3C8FA 2QCCA 3UA3A 2CETA 1F8IA 1NM9A 1TMQA 4CQ9A 3BOFA 2WAGA 3FK4A 1ZJAA 1EF3A 1ODUA 3QQWA 5K9DA 3O9NA 1XL9A 4G8TA 2W79A 4CN4A 1F3WA 8RUCA 1JZ5A 1VP5A 4W86A 3VAVA 3M0JA 5DF0A 3E0IA 1CZ1A 1ELSA 1TO3A 4NAFA 2HS8A 3OYZA 5LSMA 4JEJA 5KSWA 4IMAA 5TQLA 4RPQA 4WJ8A 3EWZA 4CD6A 4IIDA 3C86A 2EPHA 2WJZA 3GXMA 1H1NA 4NU7A 3VUPA 5A6AA 3VD4A 2BHUA 4WY0F 3GH4A 1EJSC 1AMYA 3EMQA 3H54A 1QUMA 2WC3A 2FMOA 5BMXA 4O13A 2WQDA 2ZZ1A 3STEA 1GW9A 3COTA 1MUCA 4KPLA 3SI9A 3V0UA 1B0IA 1ZP3A 4UFJA 2ZUSA 3V4BA 3O0KA 1SVDA 3NDZA 3SW6A 1G01A 4GY1A 3G1DA 4I9TA 4LS2A 3VDAA 4GC3A 3A64A 1Q7MA 3N2MA 3L4WA 3PJTA 3TA6A 3KOWA 4ZXLA 1Q6FA 1GOWA 2ZX6A 1L9WA 5DANA 2VVSA 5D04C 4IUGA 3CUXA 4PR4A 3LDVA 3ITVA 4E8CA 1AVAA 1XLIA 3GM8A 1XW8A 2AL1A 5MF5A 3IGXA 2E8YA 4JGDA 4HU8A 4H9VA 2GWNA 1TELA 4LU0A 5TNVA 3CTLA 3CL6A 4EIVA 4DLMA 1M7XA 1BVZA 1MW1A 1JZ8A 3C2FA 4F79A 1KCZA 3DFOA 2J8GA 3DI1A 3CM4A 1XYAA 1F6KA 5C6MA 4UNLA 5IHRA 1YXCA 2J7BA 5FESA 4B4HA 1Q2RA 4NNBA 1E43A 4GXMA 3IJLA 3Q37A 4MIMA 1NY1A 5H2ZA 3MTWA 3VPLA 2I1OA 2XIIA 5A1AA 4AAJA 3VABA 1O1HA 1G0CA 2QJJA 1W1B1 1IZCA 1R3WA 2QUVA 2YX0A 1R86A 1K8YA 4ZE4A 3K5XA 3CZ8A 2PAJA 3BJSA 1JD7A 4W7WA 1QNSA 1VGAA 2XH4A 1Y7VA 4PUMA 1I75A 4XBKA 1H41A 3TN5A 4PUJA 3V36A 1TTIA 3LTYA 4CNNA 5JH1A 4Q8QA 1UZDA 1CXKA 1ZGDA 1B3VA 1J8VA 3KHJA 1GPFA 1DOSA 4TV5A 1XM3A 1VHNA 1SFLA 4FB7A 3NL3A 1C7SA 2W4XA 3DC0A 4DXXA 5HR6A 3CT7A 2OTDA 4OVXA 4GYJA 1Z8AA 3FSUA 1VCVA 2IUZA 3RM4A 3E0FA 4R9XA 2ZZ2A 4X2PA 2J7HA 1O1ZA 3T2PA 3ZO9A 4M1BA 1A53A 3CK5A 2A85A 1HGYA 4W89A 2A3LA 3REQA 2QCDB 4TO8A 2OQHA 2J4GA 1B3YA 4JCLA 1YBQB 4MOZA 5FF3A 4QSFA 3GNRA 3T81A 5HBFA 3GXNA 3BLPX 3O0FA 1A0DA 2WMIA 5A5WA 1AA1B 1OFDA 4A35A 3E96A 4N7QA 3OG2A 1H0IA 3JVAA 4UR9A 2PDFA 3IK4A 4LH8A 4N02A 3LG3A 4D6EA 4K38A 1EDTA 1K70A 1FWGC 3Q65A 3P61A 1UOKA 3MP4A 1SO5A 3RCYA 3GVWA 4W8AA 5AB3A 1JCNA 3QSTA 3G77A 1F61A 3P84A 3AXKA 5GNXA 3AHTA 5FF4A 1VEPA 4RR4A 5MKGA 4MLJA 1EGZA 4OZOA 3VTRA 4CD7A 4QRNA 1GG0A 1LBFA 1Y5WA 3BLDA 3LPGA 1GVSA 5C54A 1R38A 3GR8A 1XYZA 3S4TA 3CPRA 3GNDA 1P0DA 4TMBA 2NX9A 4KFPA 7PTDA 3GQYA 1UW9A 3QFEA 2QF7A 3QH2A 1NELA 4L9XA 1XLCA 1QU4A 1VCGA 1MDLA 1XG3A 1QDSA 3LLFA 1MQRA 2F38A 3CL7A 3NL2A 1AW5A 2BB0A 1X1OA 3W7GA 4MFEA 4HZ7A 2WPBA 2WHMA 1K9FA 2WBGA 1FDJA 1Q6QA 3WELA 2V3EA 5CKSA 2ACQA 4JIEA 2GSJA 1B31A 4D2JA 3EA3A 2BODX 2GUBA 2PDUA 5LKYA 4WEVX 3TYEA 3RLVA 1R7AA 3T8LA 1V3KA 1VYRA 1WXYA 2DW6A 4L5ZA 1ISXA 1Z44A 1PX4A 4US6A 3O2LA 2NV9A 3QY6A 2TSYA 2VVNA 3GHUA 2X2YA 4HJFA 2QLYA 3EX4A 3PS7A 3EMZA 4IFRA 3KCLA 2Q01A 2FYMA 4NI3A 1NF7A 5AC6A 3KBMA 1XRTA 5JBDA 3BOXA 4RXFA 2XPKA 4CNPA 4XD5A 1UR8A 4FALA 2ISDA 4WHBA 4F0SA 4BQ2A 3BV7A 2DT2A 4PEEA 4WSHA 4J3SA 1VPQA 3D3FA 1RA5A 1W3HA 1PTDA 3WLLA 4P8XA 3TOPA 4NAFB 2ALDA 4GBDA 1NH6A 2IKGA 2EPLX 1BXNA 4QJ4B 3TW6A 3DC8A 2VEKA 2QCMA 1BHGA 1JGMA 4TOQA 5BMWA 4XK2A 3LMYA 3FKRA 7REQA 1LUCA 1DWAM 2HVNA 1EFZA 3LD5A 2PTWA 3DERA 3LENA 1AH4A 3S5OA 2X16A 1P6BA 3ARZA 3P0XA 1UBSA 4XKMA 1GVEA 2YJQA 4MJ2A 3QHNA 4P7LA 1QO2A 2BGQA 4MWAD 1S5MA 4WRHA 4O11A 3TNOA 3KOFA 1GWJA 1QRQA 4ROQA 4MNMA 4TVDA 1KB3A 3BW2A 4W88A 4NX5A 1U22A 3H8AA 1E72M 2FLIA 3IJQA 4K68A 2YL6A 3S1XA 3RO8A 2ZRZA 4PE8A 3VD9A 3MBFA 5I5RA 2C0HA 5D9NA 1O68A 4O10A 1WKDA 1DHKA 1HKWA 5HAOA 3FEQA 1KRBC 4B3LA 3GAYA 3LBMA 1JZ7A 1NP2A 4D9PA 4QDPA 2BHZA 1T41A 3HQPA 2DZTA 3WUFA 1WA3A 3VKKA 2I14A 3RILA 4GOAA 4I8DA 2J9ZA 3RGTA 5DXYA 2X09A 2DY3A 3I6EA 3DFTA 2D0FA 1IXPA 2POTA 3PZIA 3GIYA 3EWUA 4YWIA 4JIRA 2EKGA 4GACA 4WXYA 2JBMA 4D6IA 2VEGA 4HCDA 3WK3A 1KFCA 3W7HA 2SFPA 5EMKA 1TCMA 4GPNA 2DSWA 1QBBA 5AYXA 1J96A 2AGTA 1HP5A 4W7UA 1XICA 3QW3A 1E4LA 3CT2A 4DO7A 4NG3A 4XVEA 2PDGA 4NIRA 2YGYA 2GJXA 1WDQA 1H7XA 2VDIA 3OVPA 1VR6A 3MUCA 1KRMA 4UTJA 4WSJA 1H5YA 3ARSA 1QAPA 4QIUA 3NGFA 2X1RA 3U4AA 2W92A 2VEIA 3W2NA 1LLZA 1HO1A 1GVFA 2NWRA 4PTVA 3A3HA 1AL8A 5EBAA 1P1XA 2WWDA 4MJZA 4W87A 4MDPA 2FFIA 3NM1A 3H2OA 3TVAA 3WQDA 3B0UX 1KXTA 5T9BG 1RVGA 4QLJA 1Q65A 2A21A 4B2DA 3W9ZA 4H8HA 1XLDA 1GOIA 1U83A 2CW6A 3L23A 2GVYA 1EOKA 1S2UA 1VKFA 4C6QA 4GKTA 2EEXA 3TW7A 3ZFHA 3E49A 3AU6A 1BXCA 1R3TA 5HMFA 4CEXC 4H00A 3KWSA 1QNPA 1K7XA 2PDLA 5I3KA 3QKEA 5XIMA 1HP4A 1MUWA 4LAUA 3HPXA 3W1MA 2WMHA 4FPSA 4ZR8A 1HFBA 2NQJA 3M47A 5AHIA 2F7FA 3REQB 1QOXA 3WF4A 5HWMA 3UZWA 3IANA 4NL1A 4KCTA 1FDZA 1WYIA 1FTXA 3KM8A 2DORA 4H3DA 3VOGA 4WXZA 1UD3A 5C7VA 4LS1A 5BOFA 3I65A 1TX0A 2WMIB 2NQZA 2PE4A 3LHWA 5ABFA 1WZAA 4O4WA 4JYDA 4Q8OA 4C6NA 3WL0A 3VIHA 4J2PA 2QYGA 3L2IA 3TFXA 1EA0A 3VGEA 3A9BA 5JVLA 3B9DA 4NZ3A 1TPUA 3NQAA 3K4WA 1J0YA 1HO4A 3BW4A 3LOTA 3BAXA 3QR0A 1DWFM 2OGYA 2DZXA 3CHCA 3W1RA 4J3WA 4M8UA 2FQIA 3UGVA 3O07A 3M4HA 1JXKA 3UZZA 1ZJIA 3QMTA 4P2VA 4UOJA 3PTKA 5K3VA 3I7RA 5MKGB 5I00A 5HR7A 3EB4A 3TX9A 3IIPA 4AZ6A 1PZ3A 3SIMA 2YBUA 4JZ5A 3ZJ8A 4DUOA 2XGZA 1W8SA 4BCEA 1NVMA 4HU4A 3S6DA 2J88A 1ECEA 3I3EA 4O1CA 3UXKA 1DIKA 3DIPA 4D6DA 3INPA 1DWJM 4M7TA 3SUTA 2DJLA 4LY8A 4JOMA 4DUVA 2VCAA 3NQDA 2C1GA 3IJ8A 4NKCA 4FLQA 4PUKA 3D5HA 3L65A 4WD0A 2V38A 1OIFA 4JTQA 1QFEA 3UXAA 3GDMA 3WX7A 3W7QA 4IL0A 1N8FA 1K6AA 1UPPA 3IJ9A 4HOXA 3WDJA 3TWAA 4IQEA 3ZOAA 4PULA 4GJIA 3E0VA 5BOEA 3LBCA 3P62A 5A94A 5IBXC 7CGTA 1L8PA 2EGZA 1K4GA 4V1YA 3VFCA 1JF6A 3K8KA 1B3OA 3RM9A 4HKPA 4N9CA 4WJEA 1W1VA 3D0CA 3B9AA 4Q7IA 2J6VA 2G4JA 4W4QA 3N14A 8CGTA 4HA1A 5EPDA 1J6PA 4I9MA 3VC5A 2Y63A 5LZLA 3L4VA 3MP5A 2WKJA 4GMEA 2Z7KA 1M04A 3IARA 1JUKA 1X6NA 3EX1A 3LRLA 2ISVA 3H12A 4LAOA 1U5VA 4QP0A 3CWHA 4UMCA 3GYCA 4Q3MA 4A8IA 4X60A 4IGNA 2ZA2A 3OGVA 3FKKA 1EP2A 1LYXA 1VBHA 4AX6A 3OB8A 7REQB 1LUCB 1XH0A 2AQOA 1U2YA 2FHCA 2D3LA 4CNTA 2I56A 4GVIA 1IT8A 4GZIA 1NSJA 3WBAA 1U33A 2OELA 2X8RA 4AZIA 1EO5A 4X61A 3OJGA 5AHMA 1XCXA 5AVNA 2VZOA 3GBEA 4DNMA 2YBVA 5G4HC 1CPUA 1OX6A 3UZ5A 2E67A 4QNWA 1EHAA 3ITXA 4XSLA 1OT2A 3TN4A 3WLJA 1XHGA 1VRXA 4JQ2A 4G1NA 1PJ9A 3R0DA 1JAKA 1MMFA 5HWJA 3K8MA 4GNVA 4BI6A 1Q6LA 3W2KA 1PZ0A 1J10A 5CEWA 1I60A 3KBNA 5BU9A 3BARA 3JR2A 3A3XA 2VRQA 4LNCA 4GZJA 2J7GA 3RLHA 1HW6A 2CZEA 2WJEA 2YYTA 2JGQA 3WMCA 3L2LA 4FHAA 4EWND 1OWQA 1XSKA 3S1VA 2E8ZA 2ABAA 3ZWTA 3GTHA 3TZFA 3VE7A 4C1KA 1F7BA 3WFAA 4ZENA 1B3WA 4DXVA 3NSXA 1ZQ5A 1Z69A 1JPKA 4GQQA 4FNQA 3KRBA 4DF2A 4AD1A 4QAWA 2GJXB 1UMYA 1OT1A 1OGSA 3IACA 1F05A 1Q4NX 2OB3A 3B8UA 3ES7A 4UFLA 4O19A 2VEPA 1EC9A 4QLLA 2Z1BA 1GZJA 2PZNA 2O55A 3F2CA 3KLLA 2QZRA 3PM6A 3A5VA 4AQLA 3IGUA 1RQEA 3DHFA 3MQTA 4AVFA 1KTBA 1IR2A 2D20A 2WO5A 4E6MA 3TDFA 5CAKA 2D2OA 4AMAA 1O95A 3G3MA 4Q8MA 4GIEA 4S3KA 4WZHA 2FZNA 2XFRA 1C8QA 3O1NA 4NRSA 4JHZA 1F4HA 3LLXA 4H9ZA 3O15A 3S2NA 5CZSA 5HPCA 4LVFA 1E0VA 1KM5A 2EG7A 1Z3NA 4PTDA 3RR4A 3PBVA 4BI7A 3PZMA 3QGAC 3NGJA 3LM7A 4F0KA 2QV5A 5FJJA 3WK1A 4FXRA 2IQTA 3LMZA 3I7QA 4DB7A 2OJPA 2CFFA 4AXKA 3BXWA 1Q6EA 2TYSA 3GIQA 4I5UA 3JZEA 2RHGA 2P8BA 1M68A 2GDQA 2VWTA 4AY1A 3PSWA 3WDQA 4ADUA 4AD4A 4O0QA 4WDWA 4MB3A 4B16A 2OWCA 1D2KA 2ZZ6A 2Z0IA 3G22A 4JTAA 4QR6A 1M9HA 4B92A 4YPJA 3GDTA 2YXGA 3MCOA 1JZ3A 1E70M 2WV8A 3NQCA 1DTUA 3G24A 3I7SA 1EL3A 1XKJA 7ENLA 4PL2A 1E5JA 2HV5A 3MUZ1 1E1EA 5ECUA 5ABFB 4MB5A 3ITLA 4GE8A 4A21A 5GQBA 3QVQA 1BD0A 1F8MA 1JG9A 1KCKA 1WOAA 3DOPA 2QCLA 2UBPC 5F4WA 3C2OA 3CS2A 4L65A 3AYTA 1RP8A 1HJQA 4GI6A 4XB3A 2XM1A 3AS0A 2QUTA 4UTFA 4KS0A 1TV2A 1DORA 3OODA 2Y8UA 2HNEA 4M81A 3T2OA 4OOUA 5HUOA 3WDRA 4DPPA 2VEFA 4B3KA 2EPNA 4NRRA 5GPRA 3GKAA 3PZQA 1DJIA 3UZXA 1E1FA 4HYRA 4NZ5A 4JFTA 4MSSA 4GVFA 3HGRA 4D72A 2VX7A 4K37A 3PBGA 1KBBA 2E40A 3WNOA 3GY1A 1TPDA 4HOZA 4ZA0A 3LRMA 4RLIA 2FTYA 4ZE5A 2FGZA 3WBYA 4B5NA 3GZAA 2BHYA 1POJA 1A5UA 2HK0A 2FFCA 1PCWA 2V30A 4ERGA 1EPXA 1X7FA 4BA0A 1CGWA 3GW3A 1UR9A 3FEMA 4F0MA 1V08A 1CXLA 3UR2A 3VNZA 1W1A1 1Q6GA 1A5BA 3LGDA 3V35A 3RJXA 2NLIA 4XWUA 1OG0A 2WQPA 4WJXA 3AIRA 3E12A 2FH8A 4PMYA 1T40A 1UWRA 4H6EA 4IQDA 5AECA 4FNSA 2PLMA 1TQXA 2PUZA 1LT8A 2Y7FA 1TUXA 4U5IA 3A4WA 4MDOA 2CHNA 5HK4A 3CO8A 1A5AA 3UG3A 3EKLA 3AMDA 5JUVA 3NDYA 3B97A 1NQ6A 3PBYA 3XIMA 2FIQA 1AODA 4Z17A 1ZALA 4YVPA 1Z6KA 2CZDA 3GNNA 3BG3A 3BZGA 4PB5A 2VNCA 5TAOA 2L5HA 3M0ZA 3C56A 1J5SA 2GDUA 2XDFA 3UXLA 2VDHA 1YYAA 3UWWA 1QI2A 4GIYA 3EEZA 2E6FA 2FDSA 4C6IA 3W02A 2PWDA 3H4WA 2J8FA 1IWPA 1TV3A 5FCZA 3UERA 1I9CB 1VHCA 1G4SA 4JTHA 3N6QA 3N18A 4JR5A 1WOBA 3HPFA 3N2OA 3VIGA 3IJDA 3LY0A 1WQ5A 3SQMA 2GGGA 5FEXA 2AGKA 5E6YA 5E9XA 1GKPA 1MFUA 4IFKA 3VCNA 4QITA 3BWWA 4OWGA 1TYGA 3LCXA 4JBRA 1AH0A 5E0KA 2Y88A 3K2GA 4R27A 2BOGX 3P5YA 3UPBA 2CBIA 5G2IA 2NSXA 1LL6A 5CC5A 4HHLA 4RXGA 3WFZA 3C8NA 3MO7A 4NYYA 3R11A 4KIEA 2UY5A 2YCJA 3ZSSA 5I78A 1OF8A 3SGUA 3WDPP 2JF6A 1X97A 3MMTA 2ATSA 1XLLA 1LZOA 1XFBA 2V5BA 4ML4A 3M0LA 2J7EA 3CQHA 3MJMA 2PU0A 2IKIA 3LV6A 1QOQA 2EF9A 4S2BA 3E2VA 4LBUA 3G8EA 3EX2A 4S39A 3W7LA 3OLDA 3AU2A 4HPJA 1F6YA 1BF6A 1YNYA 3S42A 4U4MA 2QR6A 4HTBA 2UWFA 1P0KA 3TN6A 4PTMA 3TMLA 5I24A 1XH1A 4LYPA 4S3EA 3CU2A 3T40A 2HXTA 3W00A 2R6OA 4ZO8A 3GHTA 4MZYA 4MWAC 3VZYA 2R1PA 3URQA 3BCDA 2EJAA 4HMCA 4PUUA 1EOMA 3UJEA 1JULA 2O4QA 1NFBA 1E6XM 4UC5A 2VFDA 1T6MA 1XGZA 1XQKA 3VM7A 3KTCA 1F5ZA 4HB7A 1B4KA 2B4GA 1PIGA 2B0MA 3WLSA 4LV9A 5FEWA 2QAPA 3C2YA 5AKQA 2PGWA 4O0KA 4QXIA 4DF0A 1E0WA 2QPUA 1ITCA 5K4XA 4J3ZA 3C2VA 5E6ZA 1P48A 3I10A 3VINA 1BGGA 3WD2A 3WIJA 3OG3A 5KTLA 2YB1A 4RW3A 2VO5A 4BY3A 4HSNA 1W5PA 1D7FA 1L6FA 3HQ1A 4TXEA 4ATWA 1NFPA 5GNZA 4QX4A 2VX6A 3VUSA 3GE7A 1DJNA 1MXSA 4MB4A 1T0OA 4MUPA 3FHQA 4L80A 1XLEA 2C16A 3GHSA 1ZENA 5M2FX 1TZ7A 1XYMA 3QZ6A 1S3TC 1W32A 3N6HA 2W61A 4DBWA 1LWJA 4F9DA 1OHLA 1WXZA 3UWZA 1XRSA 4UOQA 2ZX7A 3VKDA 2WMGA 1TIMA 2D24A 1BKSA 2QJHA 3QHOA 3CC1A 1JPMA 4GIRA 1ZU8A 3M0IA 2CPUA 3QPZA 4IIHA 5HA7A 3EWWA 1J0IA 3DZ1A 1OABA 5AC8A 4A6GA 4YIWA 3KRUA 1OFRA 2YSWA 1TUFA 1DXIA 4YLWA 1NIUA 4H6KA 4OBTA 4KMQA 3W74A 1CGVA 4EPEC 1M7OA 3IIOA 4PA8A 4PTWA 2ZX8A 3CZJA 2HPIA 3SB0A 4HYVA 1FWTA 1UWAA 5FKYA 1AQ0A 4AC1X 3QR1A 2JKEA 3K30A 4NJIA 1KR1A 3CB3A 1YTDA 2A79A 3R13A 4AUBA 1XJBA 1W91A 3ARTA 3QJAA 3HV9A 3BLEA 5G4EA 2WZMA 2VZTA 1P6WA 1TMLA 1DJGA 3PZVA 5BYWA 2WVUA 3UJ2A 4LGXA 5I3GA 1XF0A 3IUIA 3RDKA 2XM2A 4QQ3A 1ESWA 4CUCA 2WWCA 4HCHA 1T99A 2V5CA 3W7RA 1R3VA 3G3DA 1OC7A 5ABGA 3W84A 3LCLA 4Z0JA 1M3UA 4OUEA 5F7UA 1UD2A 3ZJKA 3RR1A 1GOQA 2PP0A 1CGUA 4RK8A 2V2CA 5HOSA 4C6EA 4DWSA 1F07A 1QWKA 4PSPA 5J5RA 5B7ZA 2HJPA 1UUQA 2PTZA 3QQ1A 4GJJA 3ZLFA 3S83A 1IYXA 1GYMA 2OQYA 2GGHA 1W3TA 4JTSA 2G3IA 4ZQCA 1ZFJA 5KEZA 1SQ7A 3NOYA 4C7GA 6XIMA 4RE4A 4C6CA 4K7YA 3PY2A 1TSIA 4IL2A 1XYCA 3Q4DA 1EIXA 3M6YA 4M6VA 4PH6A 2YCIX 2WZIA 3H2AA 2EO7A 2VURA 1UQYA 4UQEA 2PODA 3THAA 5LXXA 1KA9F 5FA5A 1V6WA 1CNVA 3W83A 5CC6A 1D3GA 4ZFCA 1XD0A 3TR2A 4TU1A 3DFHA 2XSBA 2GZXA 2PGEA 2DPEA 5ABEA 4H4IA 4LCSA 3NA8A 1SO3A 1U1HA 4CNOA 3SCPA 5G1MA 4J3VA 1Q45A 1UMLA 4DJDD 3WFLA 2QUUA 3R6IA 3UZJA 1H1YA 4O14A 1AJ2A 1C8VA 4PBFA 4W5UA 3SY8A 1JUBA 4B5TA 1BTCA 5C5YA 2WOQA 1QNOA 4A3HA 1JDFA 4RE3A 3B0XA 4EWJA 2O4MA 1EJ7L 1PV8A 3N3MA 1HJUA 4X9YA 4MTVA 3SEPA 2A2IA 3QEZA 3V1HA 5EMMA 1XBYA 4JQ1A 4GYPA 3BG9A 3H53A 3BCJA 3PZ9A 4LWWA 4JTIA 1FP8A 1IEXA 1XSJA 3FYPA 3LERA 4C7FA 2WCGA 2W0UA 1Y5XA 4KWOA 5KMYA 3ITGA 1AW1A 4HZ6A 4ZB5A 3SFKA 2FMNA 3CJPA 4K1GA 3UR8A 5I2UA 5E70A 4A2RA 1XG4A 3CXOA 3IJ6A 3U57A 1S46A 4N9EA 2IKHA 3KWXA 4N0RA 1UKTA 3N9RA 2GWGA 1HKKA 3GR4A 2VM8A 4IFKB 4MYAA 4OGZA 3RRAA 1LBMA 4ZSUA 1RQHA 3T4CA 4C1NA 2Y5SA 4BWLA 4TVUA 1Q6RA 2WNZA 1V6YA 3R10A 1H7NA 1KGUA 2GGIA 4D6FA 1DHPA 5LIXX 4F4RA 1BEUA 2NXIA 5G1YA 3SUVA 5CPOA 1ZZMA 1QASA 4BJHA 4Y9NA 2QPSA 2ZKMX 2WLYA 1T5AA 3MHUA 1KFEA 3TROA 3PZNA 1LOLA 1XRVA 3SIZA 1QR7A 1A3XA 1AQMA 4ZODA 3W23A 5BNKA 4GGBA 3RPTA 7A3HA 3PG8A 4DPQA 1YXYA 3SO7A 1OC5A 4WGHA 4L64A 4IX2A 3WQ8A 1AZ1A 5ENLA 3WMLA 3S9YA 4PRRA 2Z1SA 3SGGA 2QDEA 5G4WA 4CQCA 1K8ZA 1EC8A 3K4AA 2OZ0A 4AF0A 4HSOA 1SJBA 3KRZA 5C2CA 1L6YA 2PS2A 3WN6A 5A6MA 2ISFA 1CYGA 4GXPA 2QAFA 3TH6A 3N25A 4JQ4A 2KZHA 2FZMA 3L4TA 2REQA 4JEQA 3BSMA 4PBEA 1R85A 2O7SA 4C60A 1VCFA 2YL5A 3W7PA 3K4DA 1RBLA 3W70A 4IWWA 3LLDA 3PJXA 3AALA 1K02A 4IP7A 1K3UA 3VMNA 1CWYA 2KX9A 3QGVA 4J5NA 3GTNA 4XSMA 2XUCA 5DX7A 2G3MA 2W27A 1R30A 5FEPA 3HG2A 4X0VA 1FWIC 3NZ1A 3RCMA 3E9AA 5HANA 4PUEA 4HCLA 2GJLA 4Z08A 1K9DA 2R24A 1RLCL 2OXNA 3TXZA 2P53A 4FNPA 1NP0A 1OX4A 4BF9A 1H51A 2R82A 3M5ZA 1EGMA 3G0SA 4LB4A 5EYWA 1KBKA 3RM8A 4ZQNA 1M5WA 2NWSA 4KEUA 4UQ9A 1FCBA 1UP3A 2ZUNA 4ALDA 4UZUA 3IGHX 1SW0A 2R1NA 1W1IE 4CU7A 3ID7A 3OO2A 1EO7A 1NTHA 3N1AA 3L4XA 1V03A 4GQRA 3F5JA 1B4EA 3RXZA 2ZYFA 1BLIA 4ZO9A 1KR0A 1D3CA 2G3JA 3HJEA 5C9XA 4U2YA 2XJ7A 1VFOA 3TYCA 2R8WA 5F1UA 2FJKA 2XG9A 4K39A 4YTTA 1CDGA 3E38A 2OZ3A 2EKCA 2R1KA 1LWHA 1KBIA 1Q66A 5ABHA 4ES4A 1GJUA 4IMCA 3UG5A 5M1TA 4JKLA 5IDIA 3QXBA 2XZ7A 4DF1A 3LK6A 3SM0A 3LXCA 3G1YA 4O28A 4JTDA 5XIAA 4PC8A 1EXPA 4GQBA 4BHYA 2DSVA 3HBLA 1Z89A 1JPIA 1CLXA 1TVNA 4BF7A 3KBWA 2CLEA 2X05A 4NT0A 3EWCA 5B7YA 4OECA 4S3CA 2CC0A 3B8IA 4DO6A 3CV6A 3G8RA 3S5ZA 1UZ4A 1GTHA 1QNVA 4M82A 4AFYA 1CECA 2BVYA 4UQAA 3MP3A 4DELA 4ATDA 1JPHA 5FIPA 2DIJA 1Q3NA 1V6UA 2GFTA 1DWIM 1AQHA 2CLPA 3FA4A 3G18A 1L6SA 3H7RA 4JKMA 3ME3A 2GOKA 1YADA 3MUY1 3A3WA 1WDRA 2ZUUA 2G5WA 3CASA 1AQFA 4NYUA 2NQLA 1CB7B 2VFFA 5KINA 1ITXA 2Y7DA 3W75A 3H7UA 3HG3A 3ES8A 2FB2A 3N9SA 5C7HA 4F0HA 2ACUA 3GTXA 4Z2IA 3QBUA 3OHMB 3WEOA 6ALDA 1CEOA 2HMCA 2YOCA 1AD1A 2D73A 4DBEA 1ZAIA 4H9UA 4DWSB 5C8BB 3MCMA 4QJ1A 3RITA 1XYFA 4LANA 4UTIA 4K8EA 2X2GA 4QISA 3ZXWA 4NAEA 4R7JA 3C61A 1FCVA 1OM0A 1RSCA 2OG9A 5JH2A 4D8ZA 3PSVA 4I3GA 4DJED 4PMOA 1E9LA 4Y9AA 5CXPA 1OCBA 2VWSA 4Q4SA 2QJMA 3OYXA 3D46A 3W76A 1R46A 1WE5A 2ZBTA 3A4AA 4YTRA 4AH7A 5H91A 2CBUA 3R0KA 4K3ZA 5U7SA 4UR8A 2WPGA 1OVDA 1XRFA 3ITYA 1KW1A 3T08A 4LEQA 4S3FA 3U4FA 3WQVA 2X1TA 3EXTA 5HMSA 4Y8EA 4P8UA 4NASA 2PDHA 2V5JA 2FJUB 4ZEPA 4TIMA 5C2GA 1QI4A 4L4LA 1LRTA 3T05A 4XAGA 3M0KA 4IMDA 2DT1A 1Q8AA 4NY2A 5M03A 3WF2A 1OFBA 5I79A 5C9WA 1JF5A 4QJ5B 3M5VA 4EXAA 3GHRA 5M5DA 4MADA 4GRSA 3WJZA 2RDXA 4HN4A 2YDAA 5BRBA 1DEDA 4AZ5A 3KBVA 3HQOA 3N19B 5CJNA 2RAGA 4F8XA 3UWQA 4O8RA 3CV7A 4HNUA 2ACRA 3KS6A 1GORA 4FOUA 4TQTA 4MPQA 1HIZA 3EDJA 2NQ5A 1KC7A 1RJQA 1IXOA 1R9ZA 3MDUA 4C1NB 3UA4A 3GDBA 3L0NA 4HGXA 3GRIA 4DEFA 3TQPA 5LYRA 3GXIA 4WDUA 3N11A 3N3TA 3WQ5A 1ZBWA 3NQMA 3PR2A 4FI4A 5CGQA 3NQFA 9XIAA 5K2ZA 5T8GA 4Z1YA 2VC7A 2XYLA 4L56A 3SY5A 2ZRXA 4AIUA 3LPOA 1LTDA 3DYOA 1GKQA 3NTYA 1NQKA 1Z32X 4OKDA 4M1RA 5FAJA 3GX9A 4LUSA 3ABQA 3TTSA 1JYNA 2VZSA 4IICA 1OK6A 2JIWA 2QQ6A 3GB6A 1Z7AA 1PHQA 3L21A 1YIXA 3HFYA 1CGXA 4FO4A 2EXOA 4IM4A 2PLJA 1YLVA 2RDWA 2R1LA 3W37A 4C6KA 1WXJA 4R33A 3QYSA 4GJ1A 3OU8A 2NVDA 3FFSA 1CIUA 3V5OA 3KBSA 4AF0B 6REQA 3EDFA 1QVBA 4LRSA 3CHEA 3LXBA 4D1JA 3CZLA 1EEXA 2J7CA 3MMUA 3GXFA 4U10A 3TSBA 1OYCA 2GUYA 3Q45A 3LYEA 4RV8A 3AQUA 2DVXA 2X1SA 3EPOA 4AD5A 2REQB 3HGOA 2O9PA 4S23A 3GFXA 4S2CA 3RN6A 4C6PA 1WDSA 3NYZA 2HXUA 2FKPA 3FDGA 3PVFA 1JDCA 1XLMA 4OFCA 4HOWA 1BKHA 3HO8A 1PBGA 5HNTA 4Q4RA 5D2WA 4B5VA 5I23A 3KS5A 1EDGA 5EMUA 2ZWYA 5CLTA 1A5LC 3G1XA 3AXHA 1VFFA 4PMJA 3KTXA 1O60A 2OEJA 2Z1KA 3AUOA 2HBXA 3ARXA 2O7QA 4QDWA 1TPH1 1OX4B 4H7CA 2OPJA 4DYJA 2IMRA 3ZT5A 1R2TA 1R8LA 4KRZA 4I9AA 2ZRWA 1R9YA 1IT0A 1XBXA 4K8GA 4HYWA 2FTWA 3FA3A 3W0KA 1NEYA 4XZHA 1W3JA 3APTA 4DBSA 3HOJA 3W1UA 3DBPA 3OZMA 4AHQA 4H2CA 2BWGA 5D8WA 1YDOA 3NSMA 4GC4A 4G5DA 3AIVA 3BE7A 1V6VA 2V81A 4RDZA 2FDMA 2QCHA 4DZIA 4WQ6A 4YCPA 3CZEA 5CSRA 3VDBA 2IKJA 2Z25A 2AKZA 1GKRA 1VBUA 1UOZA 3GDLA 3VKJA 1MQQA 1XX1A 4DZHA 1NDVA 3RNDA 1CX9A 3DX5A 1A80A 3EA1A 3WQ4A 5GVJA 1CT5A 3NQ6A 2DIEA 2WNNA 4ERAA 2PRLA 4UCGA 3C3NA 2YL9A 3R2GA 2DIKA 3R0UA 4YTUA 1JZ6A 2IPJA 2P76A 2HDJA 2W3ZA 3AZTA 2WSRA 4W8LA 1FWRA 2BMBA 2IQ0A 4PFMA 3PWIA 1D8CA 2OLHA 4B5UA 3ABZA 1QWGA 2VENA 4XD3A 3AHYA 4RNIA 1U1JA 4JKKA 1WUFA 5EA9A 4IX0A 4QFUA 3EWDA 3GO2A 4V15A 3LV5A 1RA0A 3TU9A 1XV8A 5CG7A 5ECVA 1E55A 1UIPA 1TTPA 2QT3A 2DUXA 5I77A 2ZUMA 1ZUAX 4FOJA 3FS2A 1UUMA 3VILA 1IEVA 3XINA 1RK5A 3ARWA 1MEHA 4F0RA 1TWDA 1HUVA 3DHPA 3MSYA 3MI6A 4YWSA 1RP9A 2EPOA 2PPGA 3RHGA 1W6TA 2ZRUA 5D38A 5LNUA 1IZJA 2A3HA 3WH9A 3SY1A 3S2CA 2ZXAA 4IPNB 4ERIA 2BFGA 5JMUA 1IIHA 5LGXA 2WSKA 1GOMA 2OSYA 2VYOA 4N2YA 4EOUA 3O16A 3PHAA 1O5RA 4YHGA 4QTGA 2X7VA 5SWUA 1GQLA 2B7NA 4MFDA 4L7ZA 1UCWA 3MYPA 3CIWA 4AZGA 5IOBA 3U5YA 3U7BA 6ENLA 4NAEB 2WB5A 1UHVA 2XN0A 1WDPA 1NWUA 4ZB2A 3GLCA 4JNZA