1ITQA

Human renal dipeptidase
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
369
structure length
369
Chain Sequence
DFFRDEAERIMRDSPVIDGHNDLPWQLLDMFNNRLQDERANLTTLAGTHTNIPKLRAGFVGGQFWSVYTPCDTQNKDAVRRTLEQMDVVHRMCRMYPETFLYVTSSAGIRQAFREGKVASLIGVEGGHSIDSSLGVLRALYQLGMRYLTLTHSCNTPWADNWLVDTGDSEPQSQGLSPFGQRVVKELNRLGVLIDLAHVSVATMKATLQLSRAPVIFSHSSAYSVCASRRNVPDDVLRLVKQTDSLVMVNFYNNYISCTNKANLSQVADHLDHIKEVAGARAVGFGGDFDGVPRVPEGLEDVSKYPDLIAELLRRNWTEAEVKGALADNLLRVFEAVEQASNLTQAPEEEPIPLDQLGGSCRTHYGYSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RENAL DIPEPTIDASE
publication title Crystal Structure of Human Renal Dipeptidase Involved in beta-Lactam Hydrolysis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 149
structure length 369
sequence length 369
chains with identical sequence B
ec nomenclature ec 3.4.13.19: Membrane dipeptidase.
pdb deposition date 2002-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01244 Peptidase_M19 Membrane dipeptidase (Peptidase family M19)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1itqA00
2OB3A 1E9ZB 4UB9A 3TN4A 2QPXA 3IARA 4DI9A 2AMXA 2G3FA 3AU6A 2Y1HA 4LAMA 2EG6A 4XD4A 1GKPA 4LFYA 4C6MA 1E9YB 1WXYA 3MDWA 1O5RA 3RYSA 2UBPC 2DVUA 1J6PA 3K2GA 3DCPA 4IF2A 1XRTA 2AQOA 3IACA 1UIOA 1V77A 3T1GA 4CNSA 1PB0A 1K1DA 5A6TC 2I5GA 3F4DA 4GX8A 4QS5A 3RCMA 2Z24A 4XD3A 3RN6A 3OJGA 4KEVA 2PUZA 2O4QA 4F0LA 1KRBC 3S2MA 4LANA 2P53A 4RDWA 4QROA 4BY3A 4CNUA 2BGNE 4F0SA 3GIPA 3S2LA 4B3ZA 4HK5A 4WVXA 1FKXA 3A3WA 1V79A 4AC7C 3E38A 2Z2AA 3LY0A 1KRMA 2YB1A 3UR2A 4ERAA 1PSCA 4RDYA 4XD6A 3F2BA 2Z29A 3QY6A 3S2NA 3GTIA 4LCRA 1XRFA 3GTFA 1FWHC 4E3TA 2Z25A 2CZVA 1QXLA 1M68A 3EWDA 3LGGA 1P1MA 4PBFA 2FVKA 4DLMA 2F6KA 3GRIA 1FWAC 2DVTA 1KRCC 4RZBA 1EF2A 3O0FA 3GTHA 3SO7A 1RA0A 1POKA 4J5NA 4PBEA 4WHBA 4DIAA 3A4JA 3AU2A 3LSCA 2Z26A 4RE0A 1HZYA 4B91A 4C6EA 4C6IA 1PO9A 4EPKA 4P5UA 1R9YA 1EJXC 1FWGC 1UBPC 3TN3A 1NDVA 3GU9A 4C6QA 1RK6A 4WGXA 3JZEA 1PTAA 1GKRA 4IGMA 4TQTA 2GWNA 5FSDC 4C6DA 3URQA 3HTWA 4CQCA 3QY8A 3LA4A 4C60A 4YIWA 4DZIA 3ID7A 3TNBA 4ERGA 3ICJA 2OOFA 4C6PA 3DUGA 1RK5A 2VR2A 3PANA 4IGNA 2W9MA 4H00A 2OODA 1EYWA 2Z4GA 3URNA 1I0DA 4IG2A 3OOQA 4BKNA 2XIOA 4XD5A 2HQAA 1J6OA 1I0BA 1UMLA 4HA0A 1A5LC 1QW7A 4HJWA 2VC5A 3LNPA 1EJVC 1POJA 4AQLA 4NG3A 4EPEC 3DC8A 4C5YA 2FTWA 1R9ZA 3LU2A 1FWDC 3B40A 4GY0A 2Z2BA 3G77A 1FWIC 4IFKA 1YBQA 1FWFC 2GWGA 1FWJC 3LS9A 1RA5A 2KAUC 4DI8A 3MVTA 2QT3A 4EP8C 2VM8A 2IMRA 4M51A 4L9XA 2EG8A 4G7EA 4NP7A 2HNHA 4IFOA 1P6BA 4J2MA 1R9XA 1J79A 1UIPA 3E3HA 1KRAC 1V51A 4H9XA 3FEQA 4H9UA 3EWCA 4CEXC 4KERA 4CQDA 3MTWA 4B92A 4EPDC 1JGMA 3S4TA 4H9MA 2HPMA 4JOMA 3IGHX 3WYZA 3F4CA 1KCXA 3GG7A 3IRSA 1V4YA 2A3LA 1GKQA 5LXXA 2Z7GA 4C6OA 4C6LA 1BF6A 1FWEC 4L6DA 4H9YA 2R1LA 4C65A 4KEUA 5E5CA 3WZ0E 2WJDA 3MKVA 4LH8A 4GXWA 3K4WA 4D8LA 1YBQB 3MVIA 1FKWA 4QS6A 1VFLA 3CS2A 4GYFA 3GUWA 4GZ7A 1RJRA 4KF1A 1WXZA 1RJPA 4H9TA 4R7WA 4IQJA 1EJWC 1K70A 3HPAA 3PNZA 4B90A 4KETA 4RDVA 2VC7A 3F2DA 3E0FA 4CQBA 1M65A 3R0DA 4GBDA 3UR5A 3O7UA 1W1IE 4QTGA 1XGEA 3E0LA 3GU1A 4DNMA 4DO7A 5HMFA 1YIXA 3CJPA 1EJTC 4LAKA 2PAJA 2P50A 3V7PA 4LCSA 2D2HA 2WM1A 3E2VA 3T81A 4MUPA 2HBVA 2E25A 4INFA 2GOKA 4PCNA 2UZ9A 2AQVA 3B0YA 2PGFA 5AKQA 3EGJA 1ITQA 1S3TC 4GY7A 3IV8A 1YNYA 4LAOA 4LCQA 3A3XA 1K6WA 3E74A 4GX9A 3GTXA 4H9ZA 3URAA 4BJHA 4EPBC 5HMEA 4IFRA 3NEHA 4C6BA 2PLMA 5G4HC 4KIRA 1RAKA 1NDWA 2VHLA 2YZ5A 4C6JA 2ZC1A 4C6NA 3OODA 4KQNA 4XAYA 3D6NA 4C6FA 3K5XA 4H9VA 4ERIA 1A4MA 3IJ6A 3TN6A 3NQBA 4PCPA 4XAFA 2D2JA 4UBPC 1O12A 1V7AA 2PGRA 4GOAA 4QSFA 4LALA 3LGDA 4R85A 1DPMA 2O4MA 3S2JA 3UBPC 2WJFA 4G2DA 4CNTA 4IH3A 3OVGA 4ZSTA 3OQEA 4GC3A 4OFCA 3HM7A 2ICSA 3MSRA 3PBMA 4Z42C 3T8LA 2Z00A 4R88A 4IG2B 1P6CA 4I6KA 1FWCC 3FDGA 4GK8A 2GZXA 2HPIA 3PNUA 4KESA 4DLFA 4J35A 3MJMA 1YRRA 3QY7A 3OU8A 3GU2A 3N2CA 4CEUC 5CH9A 1XWYA 4HK7A 2E1WA 1M7JA 2R1MA 4C6CA 4I6VA 4XAZA 2R1PA 3CAKA 3URBA 4HK6A 1ONXA 1RJQA 3MDUA 4IFKB 1NDZA 3GIQA 2QS8A 1EJUC 5HMDA 2R1NA 3BE7A 2FFIA 3B0XA 2WJEA 1A5OC 2DVXA 4PE8A 4DYKA 1EZ2A 1YMYA 2VUNA 3UF9A 4C5ZA 3QGKC 5FSEC 3C86A 4V1YA 1J5SA 3ISIX 2OQLA 4G7EB 1ITUA 2FVMA 3WMLA 1A4LA 2Q01A 3LSBA 1A5KC 4NI8A 4F0RA 2OGJA 1EJSC 2QVNA 2Z28A 3KM8A 2I9UA 3SFWA 2GSEA 1FWBC 3IPWA 4V1XA 2HBXA 3QGAC 4DZHA 2YXOA 2ANUA 4ICMA 4C6KA 4QRNA 1EJRC 3NURA 2D2GA 1A5MC 4KEZA 1ADDA 2ADAA 3PAOA 4ZSUA 1NFGA 3ITCA 2RAGA 3FDKA 2YB4A 3UPMA 3MPGA 1IE7C 2R1KA 4XAGA 2EG7A 1ZZMA 2Z27A 1A5NC 4LEFA 4RDZA 1ONWA 1NDYA 2BB0A 3AUOA 3TN5A 3RHGA 4H01A 2FTYA 2Q09A 4GY1A 3F2CA 3ORWA
chains in the Genus database with same CATH superfamily
3W7OA 4UB9A 1JCNA 4MF4A 4FF5A 3AU6A 4D6GA 1JXJA 2XIIA 1WA3A 2HV5A 3AOFA 4D1JA 3T0AA 1O1ZA 3G0SA 4H1ZA 1DE5A 1QU4A 1BSIA 2AQOA 1VFOA 3T1GA 4C7FA 1IEWA 3GXDA 2PS2A 3OJGA 2R94A 4PMZA 2VT0A 4IWWA 4O8RA 3R10A 4W88A 4UTTA 5IBXC 4B5XA 1SO5A 3ZMRA 4M1RA 3VIFA 1AL8A 4RE2A 2PRLA 4DPPA 4NRRA 3E38A 4DN1A 4CNPA 1GYLA 4WDXA 3VC6A 2RHGA 1KBKA 5FJRA 2JALA 3Q65A 2CZEA 4E2DA 3ARSA 4FPSA 4LCRA 1FVPA 3DC0A 2VFHA 2FZ9A 3WMCA 3S47A 1R5YA 2EKGA 4M6PA 1XSKA 2VP8A 5LXEA 2O9PA 1KBLA 4FNSA 1BD0A 5LHFA 5TIMA 1B5TA 3H2EA 3A4JA 2IKIA 3B0VC 4IL2A 1SPQA 3W23A 1VH7A 4MY8A 4NZ5A 2E8YA 3OA3A 2OYMA 3GZAA 5G1MA 4QFUA 2UY2A 4R53A 4PMXA 3ITGA 2WSRA 3DFNA 3EOLA 4KWVA 3UZ5A 1Q85A 3WLMA 3H22A 1GKRA 1Z9AA 4XG1A 1E6ZA 5HPCA 1ODZA 3WBAA 3U5UA 1N55A 3K4DA 5A6BA 5E9XA 4HMNA 4B5NA 1QFEA 2SFPA 1PWMA 1HQTA 3UXLA 2YYUA 3A21A 1TVNA 1TV7A 3DUGA 3PVFA 1G6CA 4AYSA 5A6SA 1TA3A 1PPIA 1EYWA 4H41A 4FA3A 4V2XA 5CPTA 2ZQ0A 3GR8A 1J6OA 4XBKA 1B4EA 1FX6A 4P7LA 1UR9A 3WK1A 1POJA 2PBGA 3CIWA 3DDMA 5K9XA 1XYZA 3T6CA 3GNNA 1GVEA 4AF0B 4Q8WA 2NQLA 1UWSA 1S2UA 2XH2A 3OGSA 4KCWA 2Z2BA 1K8ZA 2XG9A 3S9IA 1UBSA 2X09A 3LZ3A 2V3DA 4JIRA 3HPXA 1F73A 1DTNA 3NPXA 1TVPA 2E6AA 2IMRA 1SW3A 5F4XA 5D9MA 3WK2A 7REQA 3RRXA 2HNHA 3WMBA 1J79A 4JQ3A 4UFJA 4PEEA 3EXRA 3GB6A 3LV6A 3STGA 1JZ4A 4FNRA 3AXHA 4J3WA 3TONA 1E40A 1YXYA 3R0UA 1RVKA 2QZRA 3SRKA 1AW5A 3UPWA 3GK0A 4JTTA 3U2CA 4G1KA 3M07A 2FKPA 4LNYA 4AY8A 4Z08A 5LXXA 3AMCA 5IM51 3DECA 3FOKA 3AWOA 4S3KA 1OX4B 2YYTA 3MMUA 3IGXA 4R27A 3MCNA 4OUEA 1IIGA 3QGVA 3WKZA 3JVAA 4L64A 3SCWA 1ZU8A 2VXNA 2ZE0A 1XLCA 3S8HA 1BWLA 5A6AA 1W5MA 1XSIA 2H8ZA 3GR4A 4GBDA 3O6CA 1VIWA 2RJGA 1HF6A 5HMFA 2F2HA 3E02A 1D3CA 4O15A 4K8EA 4IUOA 1H5YA 2QNEA 3DHFA 4QLJA 3WFAA 2GOKA 1GVQA 1OG6A 3LBCA 4QJ4B 2IQDA 1VYSX 1XBVA 5HNUA 2YW3A 2G41A 3QHNA 5HWNA 2IXVA 3PZVA 3CLWA 1ITQA 1XRVA 3IV8A 2ZRYA 1K6WA 1OZMA 1F3XA 1KV5A 2NV2A 2VC9A 4J4KA 5C9WA 2AL2A 3QYQA 3PUGA 1HTIA 2NXGA 1L6YA 3PZTA 4ATDA 3D3AA 3IJ6A 1DBTA 3T42A 1OZQA 3CAQA 4WSKA 3GNPA 4DJDC 3SEPA 2P0IA 3A3HA 4Q4OA 1DPMA 5GPRA 1E43A 1OGBA 3UBPC 3GE7A 4CNTA 2HTMA 3OVGA 3STEA 4LV4A 2WQPA 1TV5A 3UEQA 3W7LA 3H54A 2DV0A 4UUIA 1J4EA 4Q8NA 2GJLA 3WLPA 4O54A 4XTDA 4F0KA 3MHUA 1MDRA 4MB4A 2FQIA 4GMEA 4EANA 5BOEA 2ODOA 2R1MA 3FJNA 3M6YA 1LORA 4IXHA 3TJXA 3N18A 3NA8A 4M82A 4RK8A 1FHDA 3LYEA 3BE7A 4QHRA 4HPXA 3NOYA 3DX5A 1SJCA 4MLRA 2PLCA 3JU2A 4QE5A 2J79A 4RE3A 4TXEA 3MY9A 2ZWZA 4FLOA 5HJLA 2Z28A 3KRBA 4B4HA 3DIPA 3VNZA 3IUHA 1FTXA 2ANUA 3B05A 1A5MC 3N3TA 4AW7A 2DU2A 2I1OA 1L6GA 4AX7A 1KCLA 1WDSA 1WB0A 3HPSA 3S1GA 3FY1A 3LPGA 1C3FA 1ZZMA 2OYLA 5I06A 1GWJA 3QYSA 4QGCA 1RVGA 4JXCA 4LPCA 3BMXA 5CPLA 3W37A 5B7YA 2NQ9A 4AD4A 1M1BA 2OB3A 3TUUA 1GORA 3NAVA 4DO6A 3IARA 2Y1HA 3BAJA 3HURA 1SYTA 2BX7A 2WO5A 3GC4A 1TUFA 3LPOA 5DELA 4JD4A 4GO9A 3TDFA 1CGUA 1TJPA 5FF7A 1X6LA 1PZ2A 1UIOA 3LMYA 2Z6IA 3DKJA 4R7OA 1RPXA 3CZJA 3WDRA 3AIRA 4RNJA 3WJXA 6CGTA 3H26A 2J88A 4FO4A 3UWUA 2AAMA 2FH8A 4BY3A 2BGNE 1D9EA 1SGJA 4PL2A 2V5DA 1IWPA 1ME7A 2PTDA 3CEPA 4GQQA 2DIEA 2HXTA 5F1VA 4PGLA 2QJMA 5EB8A 1AJ0A 4UOJA 2GYIA 3CV7A 2XM1A 1PX3A 3E0WA 1JL8A 2PC4A 3T0DA 1V02A 3QSTA 1H0GA 3NSXA 3O9NA 3FHQA 1AVAA 4OJYA 5B7ZA 4WKAA 3KHDA 4RZBA 4CU7A 2FMOA 1D2KA 2XIJA 3WD0A 2A3HA 2J77A 3ARYA 1TUXA 2EAWA 5F2IA 3UYCA 1IR2A 3FEMA 2WQDA 4AWSA 1VGAA 4O53A 4GHRA 1J01A 1BGGA 5CEWA 3AZTA 2WHLA 3T8QA 5EGRA 3P62A 3RRAA 2DEPA 3N1AA 1VRDA 3TR2A 2YR1A 3CUHA 3PZ9A 5CAKA 2QCMA 4JCLA 3SQLA 4B9ZA 1CZ1A 3JUGA 4W7WA 3KOWA 4ZB0A 2OJPA 3HPZA 1DKWA 3F03K 1QHPA 3KP1A 3NZQA 1WDDA 4GQRA 3PANA 4LF1A 3LLFA 4LUSA 1QWGA 3VD4A 3CUZA 4QJ3B 3LHTA 4L4MA 5BWAA 1I8JA 2BHUA 5F2MA 3APYA 4HJWA 4X22A 3G1SA 5BNKA 1KM4A 3E9AA 2WC4A 1SO4A 4DJDD 3DC8A 1H2JA 4GJJA 3AS1A 3PTQA 2REQA 5FCZA 1B9ZA 1W9VA 1FDYA 2QGHA 1C8YA 4HNVA 4RNFA 5AYBA 2PDNA 1H4PA 1DWJM 1VF8A 1A3HA 2EG8A 4D72A 3TLQA 4IFOA 1CGYA 3MBDA 3NZ1A 4HYWA 1WKEA 3EX1A 1KRAC 2GGEA 3NQCA 3E2QA 3EEGA 3TWBA 1JYNA 2QUVA 1VBGA 1TX0A 5BOFA 1CEOA 2WVVB 1BVNP 1NSJA 2XM2A 3VD9A 2CKRA 3WUGA 4K8HA 2PC8A 1QOXA 5I02A 5LZLA 3CLMA 4CCZA 1YDNA 4S38A 4DY1A 1UW9A 4OUIA 4BEUA 1SW0A 4YCOA 4LYRA 3BQ5A 1J0IA 3F1QA 2GL5A 2ZX9A 4GI8A 4C6OA 5K4ZA 1XGDA 3SN0A 1DWFM 3NWRA 4JFVA 4NAFA 3WO8A 8XIMA 4LH8A 3W1UA 1DWIM 5HPOA 1H11A 3MVIA 4H6KA 4L80A 3CV1A 4PUKA 4JDBA 2CWNA 1VHNA 1GOXA 2JFEX 1KKRA 1WZKA 3CIVA 1EJWC 3HQPA 1J9YA 3W53A 4LXFA 1FP9A 3O7UA 1KWGA 1E6QM 4I8YA 1E4MM 4ICCX 5I24A 3GIYA 2PWVA 5G4WA 3TROA 4HU3A 3KDNA 1QDSA 4P7RA 1PEZA 2W61A 5L9FA 2PEVA 3CGTA 1XIFA 4Q7NA 3I6RA 2PGFA 4F2UA 2PFHA 3VX0A 2PP1A 3IS4A 3ZT5A 3B9AA 5BMWA 3EA1A 1X38A 4MWAC 3ZJ6A 3S83A 1GW1A 5T9BG 1KBIA 3BARA 3EKZA 3GFZA 2JBMA 5ABFB 2ZYFA 1NDWA 1GYMA 4HU0A 2Z7KA 1XH1A 3U4AA 2ZDRA 1QW8A 5FESA 3DI0A 1KCKA 1Q7QA 4GNKB 2ZUSA 4IM4A 3LGDA 3WEMA 1V6TA 3SURA 1ZTVA 3VTRA 2O4MA 5FD0A 3W72A 2R6OA 2G3IA 1OF6A 3W88A 1JCYA 1MI3A 1PVNA 3HZ3A 3IWPA 2IS7A 1YDOA 5I3FA 2X0HA 2Z00A 4IMAA 1OB0A 3AHXA 3GLCA 3PBUA 5KSWA 2Y7EA 5H6HA 4Z17A 2OEKA 4J35A 3MUAA 1WZLA 1KFKA 2PB1A 3QXBA 5IFPA 1S1RA 3GXTA 3IRDA 3HMCA 4JTEA 5E6YA 4WXZA 4XKYA 3CH0A 2DVXA 3T4WA 4WR3A 4GGBA 3QV8A 1PIFA 2V2HA 4F66A 2X41A 3KCJA 1Q6RA 1V7YA 1WOBA 3CZKA 3RNDA 3BW2A 2GSEA 3QLLA 3IPWA 4MGGA 4UQEA 2YXOA 3LRMA 4C6KA 3HIJA 3RPMA 4J9JA 3R13A 2UY3A 1P48A 1NFGA 3W1PA 1V0LA 4PUJA 1JEZA 5KITA 2HWGA 3WDIA 2PRHA 2VFDA 3B97A 1ZBVA 3OIXA 3KHJA 1BRLA 1JF6A 1I2OA 3WQEA 1HL2A 2Q09A 3GVGA 3RM9A 1WAWA 2QPXA 3NZPA 4TO8A 4Y8FA 2G3FA 4LAMA 1WCGA 4S3GA 4AIEA 3T9PA 1UB3A 1HJQA 4C6MA 1LOQA 2IQ0A 3DFOA 2CNCA 1K9FA 1DVJA 5CZKA 3PZUA 3IACA 1Z42A 1SZEA 2BNJA 4CNSA 1N8WA 1PB0A 1XP3A 4QS5A 5C9ZA 5FF0A 3DI1A 4IX2A 4NJJA 4PMQA 3IIOA 3WD4A 5E0CA 3WDQA 3W70A 5C0QA 3GD6A 4F0SA 2WVSA 5I77A 4W8BA 4WVXA 1Z6KA 2ON3A 4N0RA 3TXVA 4WJEA 4I8DA 3AICA 3THAA 4A29A 4UCFA 2QEZA 5AYZA 4RDYA 2P5NA 1UKSA 4EWJA 3QY6A 4Z2IA 3GYCA 4WOQA 4WKHA 2ACSA 1SO6A 1VYPX 3MHGA 3W07A 4ES4A 1V0MA 4KBXA 1Q7MA 8XIAA 2C18A 4JTRA 2Y62A 4MWAE 2QPSA 4EE9A 1EQPA 1YE6A 1RH9A 3ITLA 4DELA 4EXBA 4JQAA 3A23A 3AUJA 4NYUA 3QPEA 2BY0A 1GVFA 3WNNA 5LIYX 3NFUA 3OTRA 5DEZA 1X96A 4JKMA 1E15A 2GLKA 2QJGA 3DHPA 1BKSA 3W7GA 4JN8A 2Y8UA 1R47A 2DIJA 2WC3A 4XWUA 4CQCA 3H21A 2HXUA 3PWAA 4DM2A 4LB4A 3AXIA 1TRDA 3QHOA 3REQA 3CASA 1G5AA 4REQB 1VLWA 3IIPA 1H3GA 3EWBX 3M0LA 2OLSA 2QCGA 1Q6LA 4J3TA 5AHIA 4MWAD 3XIMA 4IICA 1TQXA 3GXMA 4GKTA 4Y9NA 2A7NA 1RCOB 4IG2A 3OOQA 1HIZA 1RALA 3OP2A 4IUGA 5E70A 1AD4A 4E8DA 2ISVA 3G0XA 4PMVA 3P0WA 4YTUA 1LBLA 1LUCB 4PMRA 3LM7A 1AL7A 3H70A 4TMCA 4DJEC 3VKCA 4ADUA 2J75A 3B40A 1RV8A 2WHMA 4PTWA 1BYBA 4GH3A 3NUKA 2W63A 5CZSA 2KAUC 1MVYA 4XISA 4TX6A 1GJWA 1W9XA 3KLLA 5IHRA 3VUPA 4CD7A 3YPIA 3WL1A 1H7RA 3SCNA 2X1IA 3SCTA 1Q4NX 2XJ7A 1EWDA 3ZIZA 2ZBTA 3E5PA 3TR9A 5IFTA 1H63A 2HROA 3CB8A 1HJSA 4JFWA 3VDHA 4MDOA 1F74A 1FCBA 2ZRZA 4B92A 4NKCA 4PUMA 4PRTA 2DT2A 3GG1A 3AYVA 5KZ6A 5M5DA 3PG9A 2ATMA 1E6NA 5AZ1A 3M43A 3CM4A 3WG6A 4LUTB 3ITTA 3A13A 4UR7A 1HJUA 2Q02A 1R7OA 1ZY9A 1JI2A 1MQPA 1JZ2A 3LOTA 3ONBA 1K9DA 3MKVA 4G6CA 1VFSA 1KFCA 2DZWA 3UG5A 1NQ6A 3KLKA 3HMJG 1BFNA 5I0DA 5LSMA 2OFJA 4IGSA 5JVLA 5H8PA 3EKGA 3GM8A 1RJRA 4CVWA 1RJPA 2B31A 1E6XM 3BC9A 5F2LA 3U9IA 2BXYA 4RDVA 1Y7VA 1GVYA 1E72M 1G4PA 4N7QA 4C1NA 2HK1A 1RBOB 4GGHA 5CCZA 5FEXA 1U30A 2WKJA 1X97A 3QV6A 2J66A 3QKEA 2VWSA 3GAYA 4JTQA 1GTEA 1VFUA 1TO3A 4MMWA 3TCSA 4B5SA 4OECA 2V9DA 1P4CA 3QFWA 4M3PA 3W81A 1UKQA 2FTPA 2IKJA 1EXBA 3VNJA 1RD5A 4Q8OA 4Z2KA 3QZEA 2WM0A 3QQ0A 4LCQA 1SZRA 3VMOA 3EMQA 1NU5A 2BVWA 4GX9A 2BDQA 3CUIA 4O52A 4G1NA 3ES8A 4R5EA 2PLMA 4DZAA 1DWHM 3R8GA 3AALA 4C6FA 1AMYA 3R12A 3DFYA 2PDHA 4OV4A 3ARRA 1LOLA 5DLCA 4D6EA 3W85A 2I16A 3KUMA 4Z2JA 2OKTA 1QI5A 4G2DA 4ZSTA 1MRAA 1K3UA 3L4UA 3CTLA 1VR6A 3AROA 3SR7A 3HG2A 3RAOA 3GKAA 1H7NA 1A0EA 3QQ1A 2GVEA 2GZXA 4XZHA 1QCWA 2WZMA 3WK0A 2D20A 3LM3A 3VIMA 2HZGA 3KBVA 5LIXX 2HDJA 1UASA 1O66A 1OABA 2YOCA 3O63A 2WJEA 3GHUA 2UY4A 3VNDA 1LP6A 1V3MA 5FSEC 1XJBA 4JDYA 1I1WA 3NQ7A 2FGLA 1LRTA 1XHGA 3VKDA 3TJLA 2XGBA 1ZP3A 2CHNA 2QCCA 1O5QA 1QOPA 2JIWA 4HJFA 1TCDA 4JEJA 4GQ0A 2DW6A 2D2GA 3PR2A 4KEZA 4ACZB 3WJZA 2IPGA 1DXEA 3ITCA 2G3NA 1ME9A 3VNKA 2G4FA 1KW1A 2JGYA 4D6DA 3ALFA 4AWUA 4L6HA 2W3ZA 3MPGA 4NZ1A 2ZE3A 4DBSA 4I9TA 2V3FA 5I23A 3AUOA 1CXFA 8CGTA 1W3TA 3O8AA 4IJCA 5C70A 1YXCA 4S3FA 3EDJA 3CBWA 5EFFA 3TQPA 3UW6A 5BW6A 3VKAA 4JHOA 1R6WA 2X05A 1SFLA 4DJED 2EG6A 2ZADA 4AX6A 1R3WA 1Q5MA 4JTHA 5BRPA 2ZX6A 3L0KA 1Y0EA 2E3ZA 2UBPC 5DBTA 3UD6A 3L68A 4GXPA 5DCBA 4PTVA 1LL7A 1EO5A 3B9NA 2VELA 4NAEB 3RX4A 2DP3A 2WVUA 4A3YA 4HNCA 5A6JA 5BYWA 2O56A 3FAXA 1G01A 1YDVA 3GWQA 3NIYA 3PZGA 4CNUA 3MCMA 4HK5A 1FKXA 4AC7C 1NH6A 1O60A 3BJSA 3TIMA 2ALDA 1QO5A 3GTIA 4U3CA 2C16A 1UP2A 4R9OA 3GTFA 1FWHC 5HWMA 3M47A 5LGXA 3P3BA 2HJPA 4J27A 2EGZA 3CWHA 5LIWX 3EDEA 4QJ1A 2PLKA 3GRIA 3CHEA 1AFSA 2RGLA 2DVTA 3A12A 4GUIA 3S6OA 4FZIA 2TRSA 2GGHA 3O0FA 1XS2A 4X63A 4XZLX 2QCNA 3LSCA 4MYAA 3BOFA 3S1VA 4B91A 1OK4A 3HGOA 4FOKA 1XKYA 5CAHA 3MI2A 4DWSD 3R89A 1ZL1A 4F8XA 4H8NA 3DFPA 5E93A 4XSLA 4J3VA 2G96A 4XB3A 5G1TA 2Q71A 3F4NA 3R2GA 1XDMA 3VPLA 1UR4A 3FVMA 1JIBA 3MWCA 3EYPA 3S46A 2HVNA 4XZIA 2FHBA 2D69A 4K7YA 3W7RA 3EX2A 2QVHA 3NQDA 5XIAA 4CGTA 4ZQOA 5AFDA 4QLKA 3SECA 2WHKA 3NNTA 1OC7A 5XIMA 1MWOA 3B8UA 1E70M 2O7SA 4GUJA 3S5OA 4M80A 1D8CA 3TW7A 1WDRA 2BGQA 1OSEA 1GVOA 1Q6GA 2FZ8A 1A3WA 1MXGA 3L23A 1U22A 4DO5A 2Z6JA 2QCDA 4H8VA 5AC6A 1TWWA 3PS7A 1YBQA 4FIQA 1TE6A 5AN7A 4PUUA 4QQUA 3INPA 3W83A 2DUAA 4B3KA 3E2SA 4J3XA 4ZR8A 2V5LA 3W3OA 1U1JA 3G3MA 5I78A 2Q6ZA 3GC2A 2AKMA 4GISA 4UR9A 2VI0A 3S6DA 3VGGA 1V51A 2F6XA 4DXKA 1AW2A 1YTDA 1MW0A 2W66A 3OLIA 2VD9A 2DQWA 3HF3A 4JFTA 1V6VA 3RX3A 3S4TA 7A3HA 2ZRVA 3SQSA 1YPFA 4MPQA 3WQ5A 3T55A 5D33A 1OYCA 2VRJA 4S2CA 5EA9A 4H6QA 4AFYA 3HU7A 1ZAIA 4Q8UA 1AZ1A 1PIGA 3A5FA 1ZCCA 4OGZA 3OZMA 1CXKA 2E6YA 3PULA 3K8KA 2VGBA 3W2LA 1CCWB 2H9AB 3CMFA 1E6RA 1TJ2A 1TCMA 3DKLA 1X8FA 4JY9A 4XZBA 4AIBA 1ZCOA 4NU7A 3ERPA 4MZ1A 4RZ6A 1BYCA 1F8IA 4HP5A 3VILA 1F5ZA 1VJZA 4Q3MA 3CK5A 3GFYA 4Z0JA 5A69A 1R3YA 2WM1A 3TH6A 3B9EA 4YPJA 2DJXA 2E25A 2OXNA 2CLKA 4RNIA 1LDCA 4S3JA 1W54A 2V38A 4DYJA 1JUBA 1PZ0A 4QP0A 1HKWA 2EQDA 1QNRA 4RL3A 5A6LA 2YCLA 2WMIB 5HMEA 5KETA 4RXFA 1RAKA 3OEXA 3KVLA 3W7PA 2YZ5A 2C91A 1SJDA 1UD6A 5JIPA 4HZ8A 1OCQA 3U6WA 2YX0A 1O12A 1T7LA 4LALA 1FFQA 3N9KA 1SFSA 4J3ZA 4JIHA 4B5WA 1JZ3A 1Q6EA 4AIUA 1PV8A 3GKFA 3F5LA 4J7RA 3VGEA 4JTCA 2HISA 4O11A 1EDTA 4GC3A 2VEFA 3V36A 4XBJA 4RNHA 3E96A 2TMDA 1IYXA 1FWCC 4DPQA 1XH0A 1W2VA 3CYJA 2INFA 2DORA 3PNUA 3WQ6A 5CPQA 3OU8A 4OIFA 3ABOA 1OFPA 2ACQA 1Q6OA 4Q4SA 3O2LA 4IPLA 2Q3RA 1PTDA 3L4TA 1T99A 2ABAA 4HCDA 5G4EA 5I2UA 3MDUA 2DDXA 4O1EA 3H53A 1V08A 2R1NA 4ZB2A 3HGJA 1J8VA 3C86A 4JYFA 1HL9A 5GNXA 4JNMA 2ISWA 2Q01A 3BH4A 3PBWA 3G8RA 3TA9A 1RD6A 1YTEA 5EY5A 1J2BA 3NZGA 1UZ1A 3TNOA 1NELA 2J7EA 2VC6A 5AVNA 3ARZA 4LU0A 3THCA 1CLVA 3NQFA 5AZ0A 4RDZA 4KGJA 3CPUA 1LM1A 1NFPA 1Z44A 4LS0A 5J5DA 3CNYA 2FTYA 2CEQA 3VCRA 2RJHA 3N6JA 3F2CA 1LQ2A 1XR2A 5DQPA 3TYBA 5FL1A 3H4WA 3S2CA 5D2XA 3NYDA 2CHOA 1E4NA 4LVFA 5GQBA 3APGA 3ATYA 2Y70A 2E7FA 2WCAA 3NL3A 1A3XA 2H8XA 3IVTA 1CXLA 5HNTA 3GC5A 1UHVA 3BJTA 3T7VA 1VBRA 1BF2A 1RP8A 3D46A 1WUEA 3CHDA 4FX8A 2VGFA 4KEVA 3EPMA 3PZOA 1QATA 3RK8A 3NR0A 3RXZA 1U2YA 3VIOA 1KFWA 3WELA 6ENLA 3WLIA 3VE9A 4KWUA 5EMJA 1ZRQA 4IIEA 2ZUUA 1H1YA 2VEMA 3LY0A 3UP8A 3KBJA 3WDPP 1JRBA 1TV3A 3A22A 4GZEA 4IPIA 3DYMA 3KTCA 1EJ7L 4FX7A 2NZLA 3ECQA 5FJOA 3VM5A 5CJNA 1XKJA 3JR2A 3AZSA 4L4OA 2HEJA 1G67A 4O14A 1H62A 1ESWA 1V6YA 3LMZA 1VAHA 2JIEA 1SMAA 2OKOA 3M7WA 4L4PA 3W4RA 1JPIA 3T2PA 3IVSA 4AZ6A 1KGXA 2VEPA 3DZ1A 1UWQA 3IIZA 5I09A 3NEVA 4RZ4A 2XVPA 4S3BA 3UCCA 4W84A 4JBRA 1UBPC 3PB0A 5F7UA 2GWNA 1UKPA 2X16A 4GIAA 4R33A 1Q4WA 4F48A 1KTNA 3OPSA 5FJJA 5FAGA 2A85A 3IEBA 4ORMA 3RJXA 4DZIA 1EC7A 1IXQA 1XICA 4NILA 3S5YA 3WQPA 3ZR4A 1NFBA 3S5SA 3VNYA 3TJ4A 1QI4A 6A3HA 4HMEA 3DHUA 1ZUAX 1OCJA 4JIIX 4QITA 4W8LA 1RY0A 4JIEA 2I7GA 2ZZ7A 3URNA 1IWBA 3K8LA 4EVZA 4NI3A 1P0BA 1W5PA 1I2NA 4MJMA 1RLCL 3RDKA 1NOUA 4UTMA 2QIIA 4LAUA 1E9IA 4QCFA 1EJVC 4BHYA 3R94A 3S5NA 3STFA 3VMNA 2W67A 5MHBA 6REQB 1EL3A 2P3ZA 4QAIA 1XLAA 2NQZA 4E6MA 1VQTA 2XISA 3UY7A 4D71A 4DI8A 4LVGA 1HKKA 4GCAA 5A8GA 3H2AA 3W75A 3UETA 4ZCWA 1IZJA 4Y9MA 3IJ9A 4G7EA 3SDOA 4CCEA 1FP8A 3L0GA 1JZ8A 3TQVA 5CG7A 2PTXA 3BGAA 4H9XA 3LI0A 3AIUA 4P8WA 1YYAA 3F5JA 3VDAA 4KERA 3NYZA 3P67A 1NWSA 1S3HA 2QCFA 4UTLA 1GEHA 1I2QA 3T2QA 1UOKA 3HGSA 2GDUA 4HHLA 4NZ3A 1OQFA 1S2WA 3NL5A 4JTGA 3USBA 1W3LA 4ZE4A 5I79A 1UH4A 2OU4A 4LC6A 2WZTA 3HV9A 4X2PA 1J0ZA 3PJUA 4U3AA 1LT8A 4V15A 4JTLA 2Q8LA 4LT9A 2VENA 3N15A 4WK9A 3E0FA 3BAWA 4US5D 1SSGA 5G2IA 3TOYA 3T40A 3GDBA 4CN6A 4I7UA 2PWGA 2CBUA 4LAKA 2J7FA 2O92A 1J18A 2P50A 1E71M 1PKMA 1XFBA 1XPGA 4AB4A 3U8GA 3UZZA 2A6NA 2E0PA 6TAAA 1F8MA 4K7VA 2ZZ1A 2A3CA 3MI3A 3G18A 1S5MA 2PDMA 2VQUA 4JR5A 2OLHA 1NOWA 2YW4A 2ZVIA 3BG5A 1K02A 4ADTA 1JDCA 3FHAA 3URAA 3IJLA 2NV9A 2EKCA 5L6UA 3WUBA 2EJAA 3GXPA 2PGEA 1QPNA 4G8TA 4YHEA 2CLPA 2VZOA 3TTEA 4XAYA 2CLEA 1EZWA 3P74A 4PUEA 3BANA 3GVVA 4NUWA 4CVUA 3BZJA 1BWKA 1JNEA 1V8EA 1X1OA 1TA3B 4I5RA 2XIQA 1KB3A 2XN0A 4HMDA 3HM7A 3Q4DA 1GEQA 2YIHA 1TWDA 2C71A 2Y5EA 2YZRA 4PMOA 2CLMA 3DBPA 4FNQA 4M7SA 3DAQA 4JTFA 2XPKA 1EC8A 3G1DA 4WY0A 3BSHA 1C93A 4GVHA 3SSJA 1L2QA 3TSDA 1IT8A 4OBRA 1XIHA 3RU8X 2OVLA 3A4WA 1VJSA 4DVOA 3COTA 1DL3A 4W86A 2DFAA 3DOPA 3O06A 5FF3A 3MP4A 4PE8A 4QEEA 4GC4A 4BFAA 4ZO9A 2CERA 7REQB 1XYAA 1MYRA 1OT1A 2QVNA 3W1NA 5CC3A 4V1XA 4IIDA 2HBXA 1EDQA 3GFXA 2WC7A 3NDOA 3UERA 4QRNA 1DQXA 1R0MA 1TKKA 2TYSA 4NZCA 3ZQ9A 1R3SA 3PPCA 3CMGA 3UPMA 4HSHA 3G6MA 5BRBA 1SW7A 3R43A 5HJXA 5D02A 3FA3A 5AECA 2VUYA 2XFRA 5H1WA 4DHGA 1UP0A 1XC4A 3LBMA 1PIIA 1TPDA 1OFEA 1Q66A 3I6TA 3EDKA 1DE6A 3R0KA 3VDCA 1DJZA 5CPSA 1QR7A 3XISA 4JKKA 1H5VA 1BTCA 3LXBA 5AVHA 3Q2DA 1EP2A 3RYSA 5ECVA 1V77A 4O19A 3EWWA 2A7PA 2WZHA 3VOFA 4QNWA 4IMFA 4WDUA 1OFDA 3BGJA 1O1HA 3QPZA 1MZRA 3MQTA 3QZ6A 1YPIA 1LRQA 5C9UA 1A47A 1FWSA 1C92A 3WN6A 4CD5A 4TU1A 1NQKA 3SIZA 4D1IA 1FUYA 4Y7EA 3TA6A 2X2GA 1KRMA 3F2BA 3VZZA 2YDRA 4URIA 3EDFA 3AYTA 2BS9A 1YADA 4KRUA 4S3DA 2XUCA 4H8UA 2WMJA 3V1PA 1Q65A 3GVWA 1EP3A 3SO7A 5CPNA 2GUYA 4JEQA 4GYPA 3ABZA 3H2OA 4DIAA 5C71A 3N9RA 2R91A 4BQ4A 4JHZA 5I3IA 5K7JA 6ALDA 3RG6A 4W93A 2CFFA 5A6MA 3SRHA 1UP3A 1ADOA 2INEA 4LAZA 1XLJA 4B5VA 3MSYA 3ZVIA 1E6SM 4Y9AA 2OLAA 4BK9A 4LUJA 4E5TA 1CLKA 1TTJA 2VFEA 3MMDA 4NJKA 2E1DA 2YLLA 1O68A 2BOEX 3GYEA 3RPTA 4UNKA 5M2FX 2YBVA 1UWIA 1JF5A 2HK0A 2B81A 4YIWA 2DSVA 2ZUVA 4MKSA 3O6AA 1GOKA 1EA9C 5CC7A 1RK5A 2VR2A 4IT1A 5JH2A 2WBKA 3NDZA 4BI7A 2W0UA 5I3GA 1I0DA 1MDLA 1GJUA 2PWEA 4XD5A 4DBWA 1WXJA 4PB3A 4CQAA 3HN3A 2KZHA 5M1TA 2OYKA 4KFNA 5K9CA 2WLZA 5I3HA 3N2XA 3V5CA 1Q7ZA 3G77A 4HSNA 1DWAM 2EPMX 5HR7A 1RA5A 1MEHA 3KE0A 3NCOA 4JYEA 1OYAA 1IZCA 3WNPA 1HKMA 5FEPA 4MKNA 3TSBA 4LVBA 1E0TA 3S9ZA 1NAL1 4JS3A 5CC5A 3ZZ1A 7TIMA 1UPPA 2YCJA 3CT7A 4RXGA 3LHUA 3MP5A 3NQGA 3B0UX 1FH8A 2VVNA 1FH7A 1TWIA 4MADA 4GBUA 2HPMA 4JOMA 2CLFA 4AHQA 5AHMA 4C6LA 1XISA 1FWEC 3M0IA 3GHSA 2ZA1A 2DZSA 1V3IA 2IQTA 5HANA 2JKEA 4FLRA 3TOPA 1Y5WA 3TMLA 2IPWA 4N2YA 5DMYA 3CS2A 2B7QA 2GQ3A 1TV8A 4H04A 6TIMA 1GQKA 4Y8EA 2QULA 4R7WA 3PF3A 3EBVA 3LQLA 2VNCA 1HNYA 1ECQA 1Z3NA 5CBJA 4F3HA 3FGCA 3E0LA 4LV9A 1YIXA 1L0PA 4U2YA 1UZ4A 3U57A 3R5EA 1CBGA 1QBAA 4LCSA 3ARXA 4YVVA 2D2HA 2V67A 3EEZA 4UIOA 4LW7A 4XVEA 1F3WA 3P80A 1G4SA 2F84A 3QSRA 2GJRA 3LXCA 1EEPA 3BLEA 3E12A 3BICA 2Y88A 1G94A 2HMCA 3UWWA 4PCTA 3SUVA 1JDAA 1FXPA 3N6QA 1SFTA 4AZIA 2G95A 1W2PA 3VZYA 2L5HA 1WPCA 3W2NA 3KAOA 4LYKA 2OZTA 4MB1A 3ZLFA 3U2EA 1P43A 2D0GA 1UZHA 4DF0A 3HGRA 4GFIA 3TFXA 3HQOA 3KWXA 2WJFA 2YPIA 2YXGA 3Q94A 3PK7A 4OFCA 1A53A 4LUSB 5ABGA 4TVCA 1ONEA 3TYCA 4GINA 5FAJA 4NNAA 4XAPA 4QXIA 3WQVA 4DLFA 5EYWA 1OWQA 2E5BA 1T41A 4YWIA 1J0HA 4UTJA 3RMJA 4ZENA 2G0WA 1SM9A 1Y5XA 3TYDA 2E1WA 1A80A 1QNQA 1OFBA 1P7TA 1JZ6A 2DY3A 4I6VA 3SCSA 2ONEA 2WPGA 1RJQA 4LC8A 4RX0A 2QS8A 4HT3A 3W73A 9RUBA 1EGVA 4J2PA 1ITCA 1LQAA 2VUNA 5D09A 2DJLA 4YS1A 4AEOA 4NX5A 1J5SA 2OQLA 4D9PA 1A4LA 1OCBA 3VKBA 4N4PA 4F0RA 4UWMA 4O1FA 1FWBC 4K37A 5J5RA 4L1GA 3ZXWA 5AHLA 4KCUA 4ICMA 1Q6QA 2GJPA 2XFYA 1JCLA 5DT5A 2H3DA 3OO2A 4IP5A 2RAGA 3UG8A 1P6WA 1QK0A 3C2RA 2R1KA 3SSZA 3L2LA 3JW7A 3LZ5A 1VENA 4QDMA 2VCBA 1BVWA 3EX3A 4NAFB 3FA5A 3PG8A 3WD3A 2JF7A 1E9LA 2AMXA 1UUOA 3WLQA 2HS8A 1ZAJA 3EPNA 1XM3A 4ZB5A 4S3CA 1M03A 3UJFA 3U3HA 4DUOA 4AISA 1L9WA 1TR1A 1PYMA 2IXUA 1M5WA 4NF7A 6XIMA 1QNVA 3QN3A 2AL1A 4FNPA 1R85A 1CT5A 2H90A 4CU8A 2PUZA 4TX8A 2X7VA 3U7BA 1QI0A 3LCFA 3DFSA 3HQNA 1HGYA 3KDOA 3OIHA 2EPOA 4PB4A 1VCGA 9CGTA 4N6EA 2C1GA 4NJHA 2CBJA 2OZ0A 1H7WA 3WLRA 4X0NA 1VZWA 1W1B1 2YXXA 4DWSB 1JQVA 3LCIA 4ACYA 1UC5A 2XFFA 1ISYA 3DYOA 3DG7A 3V75A 4M19A 3V0SA 4B3LA 2WB5A 3B8TA 3WBWA 4K2SA 1K7FA 4F2BA 1LOSA 5C9XA 3P81A 4HNUA 3SB0A 4X9SA 3IUDA 2QV4A 4BQ2A 4J40A 1X98A 1OY0A 4JTSA 3AU2A 3LCLA 4QE4A 4HA4A 3WJWA 3NQMA 1S46A 2E68A 2I57A 5LYRA 1KA9F 1D7FA 1GOWA 4LY4A 1R9YA 5C7HA 3KL0A 1GOQA 3UG3A 1NDVA 2VZSA 3ZYZA 1DIDA 4O0ZA 2YLAA 3I7QA 3ZVHA 3CAVA 4Z1CA 1BKHA 1WKDA 2JEPA 5JMUA 1U83A 3QW4B 5AC8A 3N2MA 3WQFA 2ZKMX 1XV8A 5EPDA 4I9MA 1QPKA 1TMLA 6XIAA 1DJHA 1QUMA 5G2HA 4XKYB 3W7DA 2ZVRA 2W9MA 2CW6A 1SJAA 1I4NA 3LLXA 4DJFC 2GGJA 4GIRA 2FDSA 2OR2A 2YBTA 4PODA 1XLHA 1I0BA 1JZ5A 4YJ5A 4TV6A 3LDVA 1LG2A 4WQ6A 4P7QA 4MIMA 2PBOA 4P61A 4M0XA 4OQVA 2GSHA 4OOZA 4RPPA 1H49A 1NWUA 3WUEA 1D3HA 1Q2SA 3TAOA 1W3KA 3SZ8A 3VD7A 1S5TA 3UXKA 1KQZA 3RX2A 4O1AA 1YKWA 2QUUA 1BRLB 1CXHA 4HMCA 1EIBA 1CYGA 3LGEA 3KBNA 3W26A 4K1WA 5F4SA 5A5WA 3PTMA 1SO3A 4A21A 3MTWA 4K39A 2ZXBA 1EIXA 4NY2A 3TEVA 1K77A 1L6WA 4W89A 4GUGA 4AD5A 2WCGA 3KRZA 3AXKA 1R3VA 1KCXA 2VZTA 3ZLHA 3BVJA 3G24A 2BSLA 4IIHA 3PWIA 4JFUA 2MNRA 1FOBA 3ATZA 3WFZA 4AZGA 3U0HA 1S5VA 1B3ZA 3RM8A 2ZX7A 4XBSA 3SY8A 5ABFA 3AMKA 3LCWA 2FGZA 2I5QA 5I7GA 4B90A 2DW7A 1WAUA 3GDRA 2EEXA 5D03A 1S38A 3UR5A 4NASA 5CQ1A 1TWZA 3WUFA 4IOTA 3BLPX 2V63A 3WH8A 4A3QA 5IHSA 4YTSA 3V5OA 1FWNA 2VX6A 2DUZA 3H2NA 4INFA 2QLYA 1NWRA 3DG3A 1KM3A 2YDQA 1EOKA 1R3RA 1OFRA 5FL0A 3RO6A 3OVQA 4PRRA 3HPFA 4MTVA 2EHHA 2GDVA 3E74A 2WAGA 1HT6A 3GTXA 1R30A 3MT1A 1AD1A 5D2VA 5T9CE 4C6BA 4LB3A 4BWLA 4C6JA 3V3WA 3M41A 4ORIA 1OF8A 2V81A 3K5XA 2XGIA 5AHEA 3FXGA 3TN6A 4PCPA 3EOEA 3QM3A 4QAWA 1S2CA 2DZAA 3REQB 1E0XA 1FHUA 1ZAHA 2XFWA 3BPWA 2D1ZA 1R38A 2WOQA 4PYSA 2E9BA 2IPJA 3QBUA 3HJEA 2QR6A 3SN4A 3TYUA 3BGGA 4IG2B 2FVLA 2OSYA 5T26A 3CIXA 4LNCA 3DG6A 3SRFA 1LROA 4I7WA 1T0OA 2Y7DA 5CGQA 3CO4A 1MW2A 5ABTA 3CAWA 2A79A 3LNMA 2CKSA 2GFTA 3HFTA 3W02A 3A64A 1ONXA 1TPUA 4GA8A 5IDZA 2FHCA 4HBKA 4C7DA 3PFRA 3SJNA 1EJUC 4DYKA 3M5ZA 1PX8A 2RDTA 4B2DD 2ZUMA 4JKLA 4L7ZA 2FVMA 2NWRA 4GPNA 2ZTJA 1EA0A 1E4IA 2XIMA 4UTUA 3R8RA 3N19B 4AIOA 4P7NA 1EJSC 1S39A 4DEFA 1IXPA 1OFOA 3QGAC 2VEGA 3EWYA 3VXGA 1W56A 1KXTA 4UQ9A 3VD5A 2CU0A 1DEDA 3G6LA 3UCQA 2BY1A 3G5EA 4ASTA 3V1HA 2G3JA 4ZO7A 3O1NA 1RPKA 4LEFA 4ZOEA 3TFCA 4DZ5A 4DJFD 1OD8A 3CL6A 3EPOA 2YFOA 3CQJA 3ORWA 2YKKA 3AFBA 4JNYA 4WDTA 1TMHA 2BY3A 3TN4A 1R2TA 2BV9A 1SSDA 3UYIA 5XINA 3F7JA 1JPKA 4LYQA 3I7SA 2PTZA 2Z2UA 3KWSA 4OKDA 3P60A 1KM5A 4HZ7A 3UZYA 3G1XA 2A6LA 4IIGA 2JF6A 4C1NB 2PE4A 2VGGA 4IX0A 1X1NA 1WX0A 4QX4A 7XIMA 4FOJA 3PUOA 1GT8A 1I6NA 3FKKA 3RCMA 4KMQA 4H6RA 1LT7A 4A22A 2P88A 3QPYA 1JG9A 3GDMA 1A50A 4QDWA 4UMBA 2V3EA 5D9PA 4CQ9A 2WMGA 3GIPA 4B3ZA 3ZT7A 3SADA 3QOMA 4AY7A 1QRQA 2Z2AA 3FKRA 1HVXA 3L65A 5HOSA 4HQVA 2Z29A 1PBGA 4TUFA 1JCMP 4A3UA 3TYAA 2A0NA 2WLYA 3WLHA 1ZBCA 1AG1O 1S5NA 3L12A 4K38A 4KCTA 1AH0A 1M68A 2OT1A 2WWDA 5AY7A 3TQKA 2VURA 1P1MA 2J27A 3PAJA 3G1VA 4LVAA 4ZQNA 3E1F1 4AMAA 1OX5A 4J5NA 5CGMA 5FF4A 3B3DA 5K9DA 3VKKA 1UWRA 3RPDA 4RE0A 1HZYA 3OZYA 2J7GA 3KZPA 2PDXA 3SAZA 3GNXA 2XVLA 3JZUA 2D2OA 1GVIA 5M03A 3GAKA 3GDKA 1KM0A 1SR0A 2A3AA 4AWEA 3LK6A 3AISA 6PTDA 4JX6A 7ENLA 4XKMA 3NQ6A 5EBAA 3JRKA 4D8ZA 1KCZA 3ID7A 4Y6GA 3N11A 4HTYA 2YL8A 2WNZA 2J4GA 3UWEA 4W87A 1IIHA 4GO8A 1TR9A 1QNPA 5GJMA 3AHVA 1JFHA 3G0UA 1VPQA 4IMDA 1XFCA 1XIMA 1CGWA 4BKNA 3MMWA 2OT0A 1TPH1 1QI2A 2FLIA 2VVSA 2OWWA 3WLNA 2C7FA 1MW3A 1A5LC 1L8PA 1TPFA 2RUSA 4AQLA 3NO3A 5D37A 2JGQA 3ITXA 4KS0A 4NYYA 5HQMA 4AZCA 3UPBA 3LB0A 3BW3A 3P93A 2XN1A 2XWEA 4NNBA 2CZ5A 5DY3A 4MY9A 1MUWA 4CU6A 1B3WA 3PZNA 4S2BA 1IHIA 5DF0A 1WZMA 4D6HA 1EF3A 2YCIX 2J7HA 5DCDA 4ILSA 4I7VA 3EOSA 2BVYA 4Q8VA 3O07A 3MYPA 5DRCA 5I00A 4CN4A 3B8VA 1QPQA 1WNOA 3WYZA 5CSSA 1V4YA 4M5PA 4Q4QA 1GKQA 1E5JA 2AAAA 5JBDA 5FJIA 1K9EA 5LNSA 1F4HA 3PM6A 2R1LA 4LTSA 2VWTA 3M46A 3B03A 3V0TA 1EHNA 1FKWA 3ITOA 1G4EA 1Q6CA 3GUWA 2ISSA 4DQWA 3I4EA 3J7HA 4N42A 4E38A 1E56A 4KETA 1JULA 3F2DA 4YVPA 2BZNA 3SRDA 1CX9A 3VIHA 1C9DA 3KCLA 5BCAA 4DO7A 2PDLA 4Z1DA 5ABHA 1JRCA 4ECLA 3WQOA 4N9CA 3MW7A 4AEFA 3UA4A 2BVTA 3C2EA 1VRXA 2BG5A 1BYAA 1LYXA 4FEZA 4KWSA 2QW5A 3B0YA 4AU0A 1ZALA 5D32A 3M0JA 4GZJA 5MKGA 4PMNA 2YSWA 3MZ2A 3WH6A 4AEEA 1KFEA 1FA2A 3L67A 4PC8A 3SUWA 4DUVA 4BF5A 3O6YX 4K1GA 2WV8A 1V3JA 3T78A 2B4GA 2VR5A 1CIUA 2XIBA 4A2RA 4AZBA 1V3HA 1JPDX 2J78A 4TTGA 3UVIA 3OLGA 2JK2A 3TW9A 3TC3A 3H7RA 2FH6A 3TZNA 2PLJA 2G8ZA 3VM7A 2X1RA 1M04A 1U1UA 1UJQA 3AS0A 4M6QA 1IV8A 2F61A 2J7BA 2NV1A 3MB9A 2C14A 1NARA 5AYXA 2YJQA 2W62A 4KEMA 2OG9A 3TTYA 4GYKA 2A5HA 1W17A 2Z0IA 1EX5A 1ML1A 4IMGA 4FXRA 5AHFA 2ZA3A 1V6WA 2BOGX 2YFNA 3I3BA 4FHAA 4E4FA 3QY7A 4LQ1A 1BYDA 3UFYA 5BU6A 3M9YA 1M7JA 1OEPA 4RV8A 2ZXQA 4JTIA 1TTPA 1UR2A 3O15A 4AZHA 4A2SA 2DZBA 3M6DA 3QC3A 2C13A 4GVGA 4QDPA 4MJ4A 1M3UA 1S2TA 1TYGA 1CXIA 4N6FA 3TJIA 2FFCA 4FAMA 4IQDA 3AQUA 3B8DA 1BEUA 3PPFA 1A5KC 3RJYA 2QPUA 1IR1A 2KX9A 1W31A 1MSSA 4NX0A 5GNZA 3DYPA 4A8LA 3NZRA 2ZRXA 3MKCA 3N9SA 4ZSUA 4XZMX 3JS3A 3ANYA 2DH2A 2YB4A 2ZIDA 4JGDA 4YU1A 1H51A 1TTQA 1DTUA 2EG7A 3N6HA 4UTWA 3W76A 1NDYA 2YL6A 4W85A 5D04C 1UQYA 4MB3A 3W1MA 1PXGA 1W32A 4GI4A 3A5VA 2PZ0A 5LHEA 2NQ5A 3LCXA 3LI1A 3NO5A 1XUZA 4FF7A 4HNNA 2VD8A 1DJWA 2GGIA 4PTXA 3P7YA 2AQWA 4LUIA 2DVUA 2DZTA 4DJFA 3H2CA 2DSWA 4PSRA 1K1DA 3SI9A 4WF7A 5JXQA 2D73A 2QUNA 3KTSA 4XD3A 4YMZA 1YQ2A 1TZ9A 1B3OA 3V0UA 4EACA 1JUKA 4MNKA 3GDTA 3CPRA 2V3GA 3BAKA 1E4LA 1WP6A 1UWUA 3S9YA 1UWTA 3GW0A 1PKLA 1J0KA 3A24A 1ME8A 4ZQCA 4DYEA 4AUBA 3AHTA 4C1KA 1XLEA 2YCLB 3W7QA 4E3TA 3LG3A 3GNDA 3H4GA 3BLOA 5LNVA 2QHAA 3Q37A 3WD1A 2CZVA 1CNVA 4RZ5A 1D3GA 5KINA 3LGGA 4V33A 3CYVA 3NPVA 3N4AA 1FWAC 3WLSA 3BCFA 3OLEA 4OBTA 5MF5A 4U2ZA 3BLKA 4JX5A 4WHBA 3FFSA 3P8JA 4MNMA 3GO2A 5I3JA 4HOZA 1RZMA 1B9BA 3I3DA 3CUFA 1W1PA 3GH5A 1W6TA 4HPHA 2UWFA 3GS6A 4KKXA 3GU9A 1RK6A 2GQAA 2Y6ZA 2W92A 4A3RA 3HTWA 3W84A 1CECA 1P0EA 5U7SA 3VI2A 2ZOXA 1XBZA 4ERGA 4IP4A 3THDA 1ZJIA 1WYIA 4Q7BA 4S3EA 3LTYA 2WVTA 4LBSA 4Y2WA 2NUXA 1OT2A 4IQLA 3VDBA 1MQQA 2MUCA 2YA2A 1WBJA 1Z8AA 4HZ6A 1LCOA 4IGHA 1M01A 4UQDA 4EOUA 1I2RA 2HRWA 1VEMA 2E9MA 1GQIA 5D05A 3FYYA 4C5YA 3UNTA 3LU2A 4K6AA 3U48A 3LBOA 3BWWA 2GWGA 2WW5A 3VOHA 2H9AA 3K1DA 4QSHA 1L6FA 3S0CA 2WPBA 3RUBL 3CB3A 3DXIA 3SGZA 3CWOX 1LTDA 4GVFA 3OA5A 1UIPA 8RUCA 2NWSA 3AI0A 3FEQA 4E2OA 4O1CA 3KZSA 4PSPA 4MZYA 1T40A 3G1HA 3KEHA 2PP3A 1O6IA 4A8RA 2G37A 4FOUA 3CZEA 5IBXA 3OG3A 1FHVA 3K8MA 1UA3A 4M81A 7PTDA 3OB8A 3F4CA 4WJ8A 4Z1BA 3T09A 1UR8A 4X3ZA 5A6BD 2DSKA 3W0KA 2I5IA 1HP5A 4YYCA 5A8NA 5C9RA 4QJ5B 3D0CA 3CPGA 5DXYA 1IWAA 1F9CA 3K4WA 1O5KA 3IAPA 4GIEA 4QS6A 3A6OA 4AC1X 3H2MA 4U31A 2Y5JA 4GZ7A 1IF2A 3NQEA 5BOOA 4EXAA 3N12A 5LA1A 1ECEA 3Q67A 3RCNA 1TIWA 4NXSA 2OZ3A 2EJ1A 1VYRA 1ZJBA 1CGVA 5D9OA 3GU1A 5FOOA 1EX1A 1PX4A 5CPOA 3G3DA 2NX3A 2YDSA 1E1CA 3DGBA 3LLDA 1ZBWA 3KOZA 4S3AA 2ZZ4A 3D3FA 3VNLA 4YCPA 2WSQA 4E8CA 3GVQA 4PMUA 2CZDA 2ZX8A 3UXIA 1JD9A 1XC6A 5AKQA 3BQ6A 3EGJA 4HPJA 1F7BA 2TAAA 4FIRA 4GY7A 1KBJA 1NEYA 1NTHA 3L2MA 3AHYA 4FLSA 4BJHA 4D8AA 2A7RA 3IANA 1XIGA 1W5QA 3F4VA 3P61A 5G4HC 4JQ4A 2Q3OA 2ZZ6A 4NRSA 2CWXA 4ERIA 2YL9A 1FRBA 5HQLA 1V7AA 3NSMA 4QIUA 5TF0A 1FQ0A 4WZHA 3H4XA 3C0JA 2NQJA 1HKJA 4BI6A 1W0MA 3CL7A 3APTA 1DYSA 1QPRA 2ICSA 1L6SA 3TZFA 2BODX 1KTBA 2WSYA 3FA4A 2VX5A 2C19A 1ICSA 4P7OA 3KP0A 4KESA 4B9YA 5DT7A 1G9HA 4B15A 1W3JA 3WH9A 4OV9A 1DHKA 2NW0A 1ICPA 3KOXA 1KNWA 3VUSA 3M44A 3BW4A 3HB9A 4HK6A 4QCEA 1NDZA 1A5OC 4XO6A 1U5VA 2GPTA 4U5IA 1XD0A 3GH7A 4U28A 2VGIA 4C91A 1KLYA 2A2IA 4G7EB 2Y2WA 4EKJA 1NY1A 4O18A 3LSBA 1VEPA 5GVJA 1I60A 4NI8A 3FAWA 4JCMA 3HG4A 4XIMA 2PSNA 4PULA 3WEZA 3TTQA 5BXRA 1HGWA 4XIAA 3BXWA 3LTPA 1EJRC 3NXLA 3SN1A 3NGJA 3VCCA 1DXIA 3GHTA 3FDKA 2E4TA 4X61A 3NXFA 1KR1A 2VR4A 3I65A 4GKLA 4IIBA 3CHVA 3W1AA 1IZKA 1ITXA 1R2SA 4OHQA 2O0TA 3SY1A 1JPMA 4H01A 1DJYA 1ISWA 4FB7A 3B0PA 3POHA 2O7QA 3KBSA 3NQ2A 4Z2LA 5G2WA 1Q8JA 4YLWA 3WBEA 4H7ZA 3AIEA 3LRLA 3V4BA 2DH3A 4UTFA 2VQTA 3DFQA 4FXSA 4LFYA 3QFEA 3B06A 5D2TA 4Q4RA 2EF9A 2PURA 2GJXA 1GUVA 4PB5A 4YHGA 3CL8A 2R14A 2V5BA 4HKPA 1UQZA 1UKOA 1W1YA 4EF8A 4DBUA 1XIIA 3WQ8A 3G22A 1Z48A 1UC4A 4F0LA 1VCFA 3CQHA 1A5UA 5CJ5A 3FJ4A 4UTIA 3LPFA 1JQXA 3E6EA 1TQJA 4ATLA 1NP2A 3HG5A 3EMZA 4DJDA 3RMEA 1FWRA 3AXXA 2H3BA 4V27A 4I9JA 1HO1A 1D8WA 5LNUA 2GJNA 3PPGA 3TAKA 2CHRA 3KBWA 2JE8A 4UTKA 4IMEA 3WEOA 2C0AA 1BLIA 4PBFA 1XDLA 2FVKA 5DMNA 2QF8A 2CZFA 3QR1A 4L4LA 2FZDA 3GTHA 3LRKA 4W7UA 1EHAA 2G4JA 4BR1A 4CCCA 2Z26A 3STCA 2J9ZA 2PGWA 1ZS2A 2D23A 4IIFA 1XLBA 3O16A 4WXYA 1PO9A 2J6XA 3L4VA 3KBMA 2FB2A 4O4WA 4ZO8A 4UZUA 3UA3A 2CC0A 1XYFA 5A8MA 4IQEA 4ZXOA 1CXEA 3IGSA 3ZO9A 3TN3A 2B0MA 4C6QA 4WY0B 1B3XA 2QUMA 1A49A 3HQ1A 1LQ0A 4L61A 1Y5VA 1XYCA 1H0IA 3GG0A 2QKFA 3AIBA 3EWZA 1U5HA 3RU6A 4DWSC 5IXEA 1DJXA 1V02E 2OX4A 4PUDA 2GSJA 1JD7A 3ICJA 1DJNA 2QGYA 5CJMA 4BI5A 4BEQA 2X1TA 2FYMA 4UZSA 3AZRA 2Z4GA 3W2UA 2XIOA 3LHZA 2VMFA 3GR7A 3GNRA 1RR2A 3BCDA 1ISZA 4O1DA 1QJWA 1UG6A 2VC5A 5M3WA 1N8FA 4U10A 1WDQA 3L4WA 4MYXA 2J9XA 1TPWA 1EBGA 2OMAA 3TXZA 1W37A 4LRTA 1EOMA 3S1XA 3QEZA 2RH9A 1E5NA 4JYDA 3TSMA 3LPPA 2C15A 1VC4A 4UMAA 1ELSA 2G97A 1B54A 4ZQRA 3O3RA 1JZ7A 1P6BA 4J2MA 1R9XA 3MU7A 1ZFJA 2DQXA 2J6VA 2Y8KA 1SR9A 3QV7A 4RW5A 2FJKA 4MUZA 1UUQA 2QDHA 1QASA 1AQHA 3ARVA 4EPDC 2X0YA 3BV4A 4MAVA 2DUXA 4FSAA 4N4QA 1RLDA 5CZTA 3WBXA 2WHJA 3H8AA 3WF3A 1TPB1 4WSHA 3R4IA 4LWWA 4MHBA 1IEXA 4L6DA 3LCGA 4C65A 2WJDA 1XW8A 2Z1XA 4ROQA 4E4UA 4Y9OA 3WQGA 4MAZA 1VFLA 1E6PA 2WKGA 4D2JA 2QCLA 3VGDA 3GXIA 2RKXA 4KF1A 2E8ZA 3RO8A 2J25A 4LOCA 3VDGA 4IQJA 5HNRA 5A94A 4GQBA 4DAIA 1GHRA 2CLLA 2OX1A 3GXNA 2XGZA 3HOJA 1XIBA 2PMQA 4I90A 2RFGA 4IPNB 1ZB5A 4CLMA 3GBEA 1W8GA 1GK8A 4O50A 1HKIA 4W5ZA 4AVNA 1RBAA 3CQ0A 4UNIA 1UROA 1V3LA 2VOMA 5BU9A 1BG4A 2CPUA 4UFMA 3SM0A 3L2IA 1S3TC 1F3EA 2POZA 3NVDA 5GNYA 1XLDA 3P5YA 3K1GA 2PDPA 1EGMA 5D9NA 1QNOA 1UWAA 4M6VA 1H1NA 3NQBA 2EBNA 3P0XA 4GH1A 2B7NA 5HQEA 3EB3A 3ZLGA 3T07A 1I1XA 4ZO6A 1EPXA 1KGUA 2BWGA 3S6TA 3IJ8A 4RJEA 1XCFA 4JL1A 5DBUA 2VO5A 3UJRA 1LL4A 3SGUA 5HDRA 4TIMA 1K4HA 4GK8A 3CUJA 5C54A 3UGRA 3AS2A 4YVXA 3VFLA 4I3GA 2WNWA 4CEUC 1C9WA 3EWXA 2QF7A 3DU0A 2ASHA 3MO4A 4C6CA 1MO0A 2CLIA 5CPMA 5FACA 2R1PA 1JNDA 3H55A 3VOIA 1E1EA 1B30A 4XUYA 2J62A 5KMYA 5A2BA 3UNDA 4Z2HA 4C5ZA 1VP5A 2XWDA 4FXJA 5TD4A 2X7WA 2GGGA 2NQHA 3QV9A 1V93A 2XH4A 3MKKA 1DWGM 3KVKA 1I45A 2OGJA 3M0VA 4I5UA 3HA1A 3ARPA 2P8BA 2OQHA 5E9AA 1WBHA 1YDYA 5ABEA 1WQ5A 4JFSA 4QLLA 1C8VA 2ZUNA 5KZDA 1JCTA 1P0KA 4WGHA 5HUPA 4IZGA 4ZXLA 5LNRA 3SCQA 2EPNA 1W5OA 1R2RA 1G69A 3AO0A 1AJ2A 3ME3A 2PWHA 1ZHAA 3W38A 4WOZA 4FMVA 1NF7A 1QVBA 1E9ZB 4GUFA 3UT0A 3LV5A 4JTUA 3W2KA 2ZXDA 2Z1KA 3K4AA 3EA3A 1I2PA 1MZHA 2BTMA 4PRWA 3PBYA 3WLJA 1O5RA 1J6PA 5KEZA 3FGCB 1WDPA 4IF2A 1LBFA 2QAPA 2P0OA 4O28A 4MFDA 3I68A 2VOTA 5EMMA 1ZJHA 2I5GA 1YX1A 3TC6A 4E2BA 1LWIA 3U7VA 3D5HA 4MWAA 4XZWA 2YA0A 1KRBC 4LYPA 5BMXA 2ZRWA 3NPUA 3F5KA 1KFJA 1BSLA 1OGGA 4QROA 2ZCGA 5AC5A 2EPHA 2HSAA 2F2KA 1XLGA 2V8ZA 1GTHA 1C7SA 3C8FA 4XD6A 4DX3A 2VJXA 1XCWA 4UOZA 2YCKX 1GZJA 3UGVA 3WCZA 2WSPA 1JVNA 2XSXA 4DF1A 1W1A1 3M4HA 5HWJA 1B57A 4AD3A 3EWDA 2GUUA 1HJWA 1QTWA 1KRCC 2W91A 5FKYA 2I14A 3AS3A 4ML9A 1KO0A 3RLVA 4C6EA 3PBGA 3L4ZA 2R8WA 3A9BA 2D24A 3W2MA 3W6MA 1EC9A 3PPHA 1IXOA 3W22A 1GYNA 4WGXA 4X2RA 2QDGA 1W3IA 5GJNA 4S1FA 2BHYA 2VDGA 3SGGA 1P7TB 4XV0A 2J9YA 1ONRA 4ZBCA 3GY1A 2PODA 3DFTA 4N9EA 4PCSA 3EB2A 2ACRA 4H00A 4CD8A 2CIPA 1VJIA 4HTBA 3QZAA 3VIJA 1MQRA 4PN2A 4LBRA 5HATA 3PZQA 1T96A 2QJJA 4LRSA 1UMLA 5A2AA 3LNPA 3W71A 1IEVA 3WF4A 2NVAA 1XGZA 4RUBA 2NXIA 3PB2A 4HVXA 1FWDC 4IXXA 5J8LA 3NQ8A 4GY0A 4QM1A 3MV01 3BL3A 4KIEA 1AW1A 3OLDA 4U5KA 2J8FA 3LS9A 1XXXA 5H8MA 5CXPA 3FN9A 1P0DA 3TWAA 3R79A 2R82A 4TVUA 1ISVA 2ZZ2A 1JCXA 1Z7AA 1G7UA 2FMNA 3R58A 2O9RA 4AY1A 3BOLA 3UJEA 2PI6A 4O10A 4W7VA 2A3EA 4H9MA 1TG7A 3LHYA 2CLHA 4KRZA 2E5CA 3GG7A 3LENA 3O6DA 2HNEA 4OVXA 3MUXA 3VU2A 1VEOA 1KV8A 2EPKX 2XTKA 4IJRA 1FH9A 2RDWA 5D8WA 1M7OA 1OD0A 1S2VA 3W9ZA 4GABA 4R34A 2YBUA 3P82A 4GYFA 3KVJA 1Q2RA 2QDDA 4UQBA 3KS5A 2PWUA 3CC1A 4XSMA 4GYJA 2WWCA 3MBFA 4KWOA 4CQBA 2DT0A 3SCRA 3R1ZA 4QQ3A 4F0MA 4UNLA 1FDZA 2VX7A 2QIWA 4GRSA 1LBMA 3CJPA 1EH9A 2XVKA 3EXSA 4P8VA 5CSYA 4UC5A 1SJBA 3W29A 1KXHA 3T81A 1EGZA 2HCVA 4Q6JA 2X0SA 4F9DA 2P1FA 4JHMA 1KFLA 1TSIA 1UH2A 5LA2A 4A4AA 5C5YA 3GH4A 3ZR5A 3FYPA 2ESCA 3PFMA 4H9ZA 3MUZ1 2Y7FA 1YXDA 4GE8A 3ZOAA 3E0IA 3L4XA 4YYFA 3L5AA 4H9VA 2X40A 3MA8A 1TIMA 2IUZA 2GVJA 4XAFA 3ZVHB 4QSFA 4YTTA 2BVDA 4W5UA 4GNJA 1NWTA 3SCOA 3BG3A 4JTDA 2E6FA 4DUXA 4NHVA 3C3UA 4A35A 5AC4A 3PJXA 2QJHA 4DJEA 3OZPA 2IPFA 1R3QA 3C2VA 4LX4A 4FP1A 1EDGA 5JQ9A 5E09A 4PMDA 2W6RA 2WCSA 3SY5A 3OYXA 1MFVA 1CLXA 1UCWA 3OGVA 4G9PA 4RR4A 5E0FA 4B16A 4XAZA 3VIPA 5C6MA 3ABQA 3N73A 3BLDA 1W91A 3ZWSA 3IAQA 4CUCA 1XG3A 4PZVA 4M8UA 1EZ2A 3GDLA 2FZNA 4DB7A 2IW0A 4XQ6A 5A2CA 3TP4A 1K8CA 1ZLPA 1CB2A 2ALRA 2FB3A 3W87A 3VO0A 3RLHA 3IJDA 2PDUA 2QV5A 1PDZA 1B3YA 4LS2A 1UA7A 3LN3A 3AC0A 4EAYA 1PCKA 3TTSA 5HNNA 1FHLA 3ARWA 1XYBA 2ZXAA 3EX6A 3MS8A 4EF9A 1Q3NA 2ADAA 3LEPA 4GWEA 2PU1A 3I3EA 2XSAA 2GQ8A 2VYOA 2ZX5A 3T0CA 3RGTA 4XAGA 1XYMA 1E55A 2Z27A 1OM0A 1ONWA 3WDJA 3TN5A 3RHGA 1XLIA 2CCRA 4WX2A 3NL6A 3QHMA 3PN8A 4F79A 3W7CA 4DWSA 3TC7A 1SZFA 1NIUA 1H7OA 2XN2A 3IGUA 2TODA 1GKPA 3GXFA 2V0TA 1E51A 3N34A 1EBHA 3LX9A 3I7RA 4G56A 5DX7A 4IPJA 1P0NA 1GG0A 2W5FA 3BMVA 3OHIA 4HGXA 4ZL1A 2Z1VA 4MG4A 2ZRUA 4JX4A 3FX4A 1H7PA 3BAYA 1Z41A 3N04A 4HD5A 2PDKA 5LGZA 1B3VA 3S2LA 4HIBA 4MSSA 4LF2A 3PJTA 2ZDSA 1SFJA 1JAEA 1H09A 5REQA 1LF1A 1V0KA 2E40A 2OPJA 1CWYA 1PDYA 3UWQA 3W82A 3ABSA 4JNZA 2QMJA 1BG9A 3SCUA 2Z25A 3EOUA 4AD1A 1JAKA 4RV3A 4MOZA 4YN5A 1F6KA 3NTYA 2F6KA 1REQA 3RLUA 4GFSA 1JYWA 4FK9A 4JTKA 4W4QA 5J04A 3UVAA 3EOOA 5CLTA 1W3NA 3MSGA 4O12A 4P5UA 1ZGDA 3W27A 4AD2A 4GJ1A 1H61A 1NM9A 1SU5A 1YLVA 7ODCA 1KWKA 1O7AA 3JZEA 2J47A 3URQA 5C55A 1HKVA 1EFZA 1OC5A 2E77A 1UUMA 4YTRA 4NJIA 2OWCA 3BZGA 3VIIA 2OZ8A 1MMFA 4Z2GA 2PU0A 3PWGA 3C2FA 1XBYA 4L9ZA 1IGWA 3KL5A 3O0KA 2WK2A 5CBBA 2Y7GA 1FCVA 1GPFA 2OTDA 2XSBA 1WZAA 4I9AA 4QEHA 1KBBA 2D0FA 2DT1A 1VPYA 3T0TA 3N17A 4FALA 1SZGA 2V5CA 1CI1A 3FV9A 4ZEPA 3W7NA 4B5TA 4H6EA 3R7MA 1UD8A 4IFKA 3W1QA 3EX4A 3FJLA 1QPOA 3GNOA 1M9HA 5FIPA 1V03A 4PUNA 1KQYA 3RCYA 3QLDA 3N4FA 3UR7A 2CITA 3M0ZA 1JI1A 3R6IA 4CEXC 5D2YA 3W7MA 3PY2A 1W9BM 4XZ9A 4FXFA 2BASA 3ABRA 1XG4A 2XYLA 2GK1A 1HN1A 2WNNA 3UZXA 1X8CA 3TTOA 1QAPA 1XCXA 3MI6A 3IRSA 1C7TA 1XBXA 3EZ4A 2E5DA 1DIEA 1J12A 5FJUA 3OBAA 3UZJA 4MY1A 1AQMA 3H12A 1EO7A 3NSNA 1GG1A 4XVDA 5DCEA 3UJSA 1NJJA 2VCAA 4PH6A 3DFHA 4FR6A 1K70A 1BHGA 4AVFA 2Y61A 2VC7A 4WDWA 1Z69A 1M65A 3R0DA 1PYFA 2PWDA 1FWTA 4GNVA 3EDDA 4DNMA 1NVMA 1V6XA 2VDHA 4MB5A 3VINA 5I6SA 1N7KA 3C52A 3HO8A 4XK2A 1BQGA 3N2BA 1G7VA 3MMTA 4XO7A 3WH5A 3BMWA 3L0NA 2F8QA 2JEQA 3D47A 4ENLA 2HBVA 2FPVA 1T5AA 5SWUA 3C6CA 4JQ1A 2POTA 3NVTA 2UZ9A 2VFGA 3CV6A 2EXOA 4YTQA 1IGSA 5I5RA 2DT3A 3O05A 3SFKA 4ICNA 3T44A 1XINA 3UXAA 1RSCA 1JDEA 3UCDA 1UR1A 3ITVA 1YEYA 4Y90A 5CC6A 1PCWA 4Z1YA 3RM4A 2PD9A 1A0DA 1B1YA 3NEHA 1CTNA 5FJTA 3WSUA 1FBAA 4C6NA 5A95A 3BLFA 3BUVA 1A4MA 2PA6A 3E5BA 4QBXA 4EWND 2D2JA 5EFDA 2DGAA 4GOAA 3MCOA 4F40A 4BS0A 4R85A 2DZVA 3S2JA 3EKLA 1KTCA 2C1HA 1FWWA 1G0CA 3PC0A 4P8UA 1UD5A 1A5SA 3T8LA 2D0HA 1TE1A 2C0HA 4I6KA 4IISA 3P8IA 4KCVA 5HINA 3VFCA 1KM1A 1CW2A 2V2CA 3DEQA 5CH9A 1ZBKA 3GUGA 1WOAA 4WRHA 3KRUA 2AL2B 4AZCB 1AQ0A 2ZUTA 1JJKA 3VOCA 1PUDA 5PTDA 4F4RA 1UR0A 2GDQA 1UD3A 2FFIA 4NNCA 1MFUA 2XU2A 1GVSA 5CZJA 5TBOA 2PCQA 4ZZ9A 5M17A 5C8BB 4KT2A 4N9BA 2I9UA 4GACA 2BP1A 1DQUA 3K13A 4HOXA 2BY2A 1R87A 4PMYA 3U2OA 4AF0A 1UKTA 5CGTA 4OT7A 1E0UA 2DIKA 1W9UA 1M7XA 3N25A 2V6AA 2F7FA 2PTWA 2VDIA 1H60A 1US0A 4RKAA 4LSBA 2WBGA 2I56A 1KFBA 3C4UA 3L5LA 2WMKA 3TK7A 4DO4A 4F2TA 1HG3A 1KM6A 2PF8A 2MANA 5AOUA 3RR4A 4TR9A 3B8WA 1XLMA 4GZIA 3AIQA 3H6OA 4PA8A 3ONCA 1DOSA 3QTPA 4DI9A 3VOGA 4U33A 2ZZ3A 4WJXA 4WIWA 4QISA 3KCOA 2W27A 4IHCA 3W1TA 3VNMA 3CTTA 3AMDA 1DORA 2DSZA 3L21A 2QMKA 3KW3A 3K30A 3SIMA 5AHNA 2VEIA 2LLEA 3KX6A 1WE5A 3PSWA 1BVZA 5A6TC 2Z24A 1OX4A 3ZFHA 1V6UA 1RQHA 4IMCA 4ZODA 1W9DM 5JH1A 3HBLA 3OGRA 1RCXB 1B2YA 9XIAA 1K9TA 3U4FA 3RFAA 1X7FA 4GIYA 4UR8A 1AUSL 3GHRA 2C8NA 1VS1A 4IL0A 2TPSA 4Y9PA 4NSBA 5MKGB 3C0LA 3UZWA 1GHSA 1TJ1A 4IJBA 4FLQA 1ZP4A 2IKGA 5I07A 4OTKA 3HV8A 1HP4A 2CESA 4Q33A 5D8ZA 1BWVA 1JFXA 3V5FA 3WLLA 4ONVA 3BOXA 2ISDA 2I17A 1BQCA 1DXFA 1SQ7A 1OGSA 4A8NA 2DSUA 3NL2A 4DLMA 3B9DA 4BF7A 3VYLA 3AMGA 1K6AA 1LL6A 3BSGA 5B80A 3A4AA 4R7JA 3PUEA 1HW6A 4W9TA 4TX9A 2QJNA 1VHCA 3BO9A 1LG1A 3OVPA 5DMMA 4QNEA 3AMLA 3IJQA 3UXDA 1HX0A 4R3UA 3WNOA 2GUBA 4PTDA 3II1A 4TQTA 4A05A 4JTJA 3GBDA 5TAOA 3W1RA 1QHZA 4HPNA 3MO7A 1JUEA 1H50A 2Y5SA 1N82A 4HZMA 1AODA 3A4XA 4ZOCA 3TNBA 2OOFA 1EEXA 1ZJAA 3NQVA 2O9TA 4C6PA 1OJXA 4PBGA 5H2ZA 2CBIA 1F6YA 2Y85A 3EXTA 3ZSTA 2OWXA 2FZBA 1EWEA 1N8IA 2HQAA 2HVOA 3WIJA 4US5A 3ENLA 1A5BA 4HN8A 1OINA 3UY8A 5CLWA 4NG3A 1OC6A 1P5BA 3K46A 3KL3A 1VPXA 4P2VA 3H7UA 4G5DA 5C7VA 3VC5A 1KLZA 4L65A 5BRQA 1QI3A 4WKFA 1PWLA 3WY1A 2PDCA 3N4EA 3W2JA 3CZ8A 2WKLA 1M6JA 5JU6A 5TNVA 2PDYA 3WNMA 2EO7A 3TKFA 3POCA 4N02A 3M7SA 5LIUX 1S5WA 1TELA 1VBUA 3FYOA 4O0KA 1RCQA 3BAIA 2Q8ZA 1HO4A 3VGHA 2B7PA 1XYLA 2Y8VA 4FNUA 2Y63A 1HL8A 1E0WA 1XQLA 3UG4A 4HSOA 4X0VA 1TPC1 2REQB 4Q22A 3GQYA 1X39A 4JIQA 3E0VA 3T2OA 3VCNA 1PE1A 4TOQA 3QJAA 3IIVA 1VFMA 4K8GA 1EPVA 5EL1A 7TAAA 2FZMA 2V5JA 1RQBA 1GQLA 3IV3A 4QTGA 3NDYA 5HULA 5AB3A 4DXVA 3RR1A 1Q13A 1WDWA 2CLOA 1MEIA 3V7PA 1T6MA 4AHPA 4OOUA 4X60A 1YNPA 4Z0SA 5JBFA 4FS9A 3NQAA 2WZEA 4HPGA 4AVOA 3EA2A 1ENUA 5LIKX 1OIFA 4HHHA 1RQEA 3VABA 1GCYA 3KVMA 2RGMA 3A3XA 4HNLA 5ENLA 1Q8AA 4DRSA 4EX4A 5G5IA 2PP0A 4EPBC 2V2DA 2JKPA 3DENA 4DWDA 4KWWA 4MZ8A 4KIRA 1LLOA 1NOFA 1W5NA 2WANA 4HA3A 2ZC1A 1R86A 4PFMA 3WX7A 2CYGA 2WZIA 4JY8A 2ZA2A 3LHWA 3RITA 1V5XA 3ZJKA 3QOKA 3OBKA 4UBPC 3KTXA 8TIMA 4RPQA 1ADSA 5D2WA 3C56A 3AIWA 1Q63A 4UQCA 1US2A 1JR1A 1EB3A 4H2HA 2OEMA 3CEUA 1R46A 3DH7A 1FY6A 4OU1A 3VIKA 3MSRA 1PZ1A 1OYBA 1DP0A 1Y65A 3AIVA 2HPIA 4GYPC 3OYZA 3MV11 1VIZA 3N2CA 1DJGA 3W6LA 4ADSA 3I6EA 1E73M 1XWYA 1UOZA 3GG8A 3M0KA 4UMCA 2XH0A 1J96A 4CNNA 2TSYA 1XUUA 4UTHA 4JTAA 3W24A 1B31A 4PL1A 3N14A 3U2ZA 1RXOB 3ISIX 4QG8A 1DHPA 1KD0A 3T4CA 3M0HA 4H83A 5K2ZA 4DZHA 1TB3A 1TMQA 4S23A 4UCGA 2VEKA 3C0QA 2R9RA 1TZ7A 4CCDA 2BXVA 3L4YA 5E1QA 1OHLA 3W86A 1IT7A 1HUVA 3AXMA 4AZ7A 1IE7C 2QXWA 1H1ZA 1A5NC 2BB0A 3M64A 4Q8QA 1UPMB 3ARQA 3VIGA 4FX6M 4A3HA 2J24A 1X1ZA 3G2GA 5IRPA 1OBAA 2UV8G 4FI4A 3TYZA 1BGAA 2G5WA 3WMSA 3SCPA 3BK0A 3M5YA 1EXPA 5FF2A 5A6KA 1MXSA 3MSDA 2WVVA 2J7CA 1OX6A 1PS9A 2NX9A 3WQCA 2ZFAA 3MDWA 5FJPA 3Q45A 4HHPA 3K2GA 3ARUA 4ZOAA 2J8GA 4LJ3A 1K4GA 4CKQA 5DO8A 4LVDA 3B04A 2WSKA 4ATWA 3W74A 1OVDA 2Y4SA 3CU2A 1E1CB 2BLEA 2ZZ5A 1OIMA 2DZPA 1EUNA 2O4QA 4D6CA 3SBFA 3M0XA 2BMBA 1JCJA 3TX9A 1J0JA 4L5ZA 4KW2A 1ZNNA 3KS6A 4AH7A 1C91A 2VZUA 3A3WA 4MJZA 5BZAA 1RBLA 2YL5A 3VD3A 2YB1A 5E0KA 2Z1SA 1XLFA 1C90A 3WNLA 2Z1WA 5HBFA 3S2NA 1OFQA 2PDFA 3CUXA 3P84A 3SUUA 1G1YA 1BTMA 2E28A 3GTNA 3ZM8A 4ZTXA 3DN5A 3VGBA 4NVTA 1EF2A 1LLWA 1YE4A 4PBEA 5C2XA 2OELA 2C3ZA 4QG6A 2CETA 1F3TA 3SUTA 2RDXA 3C3NA 4OZOA 3IVUA 2WMFA 3QQWA 4L9YA 1GQJA 1PTGA 4ML4A 1FWGC 3RIKA 2PDQA 2GVLA 3ZJ8A 1P1XA 3M16A 3PHAA 4QG9A 4HYVA 2J13A 3IK4A 3TLLA 4AXNA 3QVQA 1A0CA 3FCPA 1N2VA 1JPHA 3KXQA 3PZMA 3CUGA 1KC7A 3BDKA 5CSUA 2F9RA 3I4KA 3GX9A 3H24A 4KRTA 1AJZA 4O57A 3OQ8A 3VKJA 1SUXA 1XIDA 4IGNA 5TQLA 4J28A 1VB9A 4Q4PA 2OOGA 2WXDM 1A5AA 1W3HA 2VFIA 3WNKA 1PHWA 3PJWA 3R11A 3AJ7A 2NVDA 1H41A 1MNZA 1FFRA 4HN4A 3M5VA 3ARTA 5BROA 1J93A 2IKHA 4EPEC 1C8XA 2PCEA 2FTWA 1R9ZA 4GUHA 1Z32X 1SZNA 4F0HA 4BZYA 1FXQA 1AQFA 3MJYA 1I75A 4AAJA 4RW3A 3E49A 3VK5A 1FWJC 2J74A 1IEIA 1PL9A 3QKZA 3ELFA 4M51A 3IUIA 4KFPA 2C1IA 4ZFMA 2V68A 3EWUA 5DN1A 3SCVA 3WJSA 3E3HA 4ZFCA 3EWCA 3MC5A 4YL2A 3KOYA 4G7FA 1M41A 1VFTA 2NSXA 3QW3A 1KGWA 1YNQA 2GJXB 5LA0A 5F2GA 1DV7A 1RUSA 3MUCA 1QHOA 4NQ1A 3QH2A 3QR3A 4UOQA 1BF6A 2G50A 1Q45A 4AWTA 3T05A 3W7KA 4ZA0A 2FPYA 3CO8A 4KEUA 3WZ0E 4GXWA 4YXGA 1CB7B 2JQXA 3H2FA 1JXKA 2XVGA 1Y8BA 4YNGA 3G1RA 2V5KA 2YCEA 3F4WA 1R7AA 3PNZA 3EB4A 2PD5A 1K8YA 3B9OA 3QMRA 3VAVA 1ODUA 2WNQA 2XVNA 1LZOA 4XX6A