1ITQA

Human renal dipeptidase
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
369
structure length
369
Chain Sequence
DFFRDEAERIMRDSPVIDGHNDLPWQLLDMFNNRLQDERANLTTLAGTHTNIPKLRAGFVGGQFWSVYTPCDTQNKDAVRRTLEQMDVVHRMCRMYPETFLYVTSSAGIRQAFREGKVASLIGVEGGHSIDSSLGVLRALYQLGMRYLTLTHSCNTPWADNWLVDTGDSEPQSQGLSPFGQRVVKELNRLGVLIDLAHVSVATMKATLQLSRAPVIFSHSSAYSVCASRRNVPDDVLRLVKQTDSLVMVNFYNNYISCTNKANLSQVADHLDHIKEVAGARAVGFGGDFDGVPRVPEGLEDVSKYPDLIAELLRRNWTEAEVKGALADNLLRVFEAVEQASNLTQAPEEEPIPLDQLGGSCRTHYGYSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RENAL DIPEPTIDASE
publication title Crystal Structure of Human Renal Dipeptidase Involved in beta-Lactam Hydrolysis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 149
structure length 369
sequence length 369
chains with identical sequence B
ec nomenclature ec 3.4.13.19: Membrane dipeptidase.
pdb deposition date 2002-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01244 Peptidase_M19 Membrane dipeptidase (Peptidase family M19)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1itqA00
3LA4A 2AQOA 3NEHA 4YIWA 1KRAC 3R0DA 3B0YA 3OVGA 1ONWA 3T1GA 2UBPC 1EJUC 4EP8C 4IFKB 2GZXA 2OQLA 3OJGA 3IV8A 4H01A 4H9TA 1V77A 4ZSUA 4C6JA 4GY0A 3UR2A 4LANA 1YIXA 2Z00A 2R1MA 1FWDC 4IGNA 4AQLA 4WGXA 4RDZA 3LU2A 1J6OA 2IMRA 3HPAA 2Z24A 4QSFA 3UBPC 2DVUA 3GIQA 3NQBA 2PUZA 4LFYA 1RK5A 2ICSA 3URNA 3LNPA 3LSBA 3IACA 1ITUA 4DNMA 1RJPA 2D2GA 4F0SA 1K6WA 4C6LA 2VC5A 4DI8A 2GOKA 4ZSTA 2Q09A 4C6IA 5CH9A 1I0BA 5HMFA 4OFCA 3SO7A 1ZZMA 3MDUA 1K70A 1RA5A 4CNSA 1PTAA 3HTWA 2DVTA 1EZ2A 1EJRC 4INFA 3RYSA 4XAZA 3S2JA 3PBMA 4LAMA 4KEUA 4UB9A 3ID7A 3URBA 3EWDA 1NDZA 3GTIA 2OGJA 5HMEA 2D2HA 2FVMA 4RE0A 2Z29A 2HBXA 2Z26A 1EJXC 4KERA 4RDYA 3TN4A 4XAFA 4EPKA 3CJPA 4J5NA 1W1IE 4IF2A 1FWCC 2WJFA 1RK6A 2ZC1A 1EJSC 5FSEC 3MJMA 2QPXA 2A3LA 1RJRA 1FWGC 1I0DA 2GSEA 3O0FA 2HBVA 5FSDC 3GG7A 1ITQA 3K4WA 3FDGA 3F4DA 3A3XA 1EJTC 3NURA 4IFRA 1FWHC 2R1LA 5AKQA 3LGDA 4H9MA 3D6NA 3E74A 3QGAC 3AU6A 4LEFA 3G77A 4LALA 4TQTA 1GKQA 4M51A 4BKNA 3OOQA 4C6EA 4XD6A 4B90A 2O4QA 3OU8A 2KAUC 2HPIA 3BE7A 4L9XA 1ONXA 4B91A 4BJHA 1O5RA 4E3TA 1YBQB 3S2MA 3PNZA 2W9MA 3F2DA 1NDWA 3C86A 2FVKA 3DCPA 3T81A 3UR5A 4RDWA 4C6MA 4IFKA 1P6CA 4KESA 4H9ZA 2OODA 2PGRA 2Z2AA 1UMLA 1QW7A 3GTFA 3F4CA 1P1MA 1XGEA 3E38A 1FKWA 2EG8A 4NP7A 3LGGA 5A6TC 3E0FA 3HM7A 4GBDA 3OODA 2CZVA 2VHLA 3TN5A 4IFOA 1PSCA 2PLMA 1WXYA 3GU1A 3IARA 3FDKA 2ADAA 4C6BA 1E9YB 3AU2A 4LAOA 1K1DA 1YNYA 4MUPA 4GX8A 2WJEA 3GIPA 4DZHA 1KRMA 5HMDA 3WYZA 3QGKC 4GYFA 3TN3A 2Z27A 3MVTA 1R9ZA 1XWYA 1V79A 2EG7A 1WXZA 3SFWA 3IPWA 4DI9A 4DLFA 3DC8A 1E9ZB 4QS6A 1XRFA 4EPEC 3QY7A 4DYKA 3WMLA 2YZ5A 4J35A 1FKXA 1FWFC 4I6VA 3GTHA 2Z25A 2Y1HA 3ORWA 5LXXA 2G3FA 4F0LA 1J79A 3A4JA 5G4HC 2YXOA 4IGMA 2R1KA 3IGHX 2HPMA 4UBPC 3ISIX 4B92A 1NFGA 1P6BA 4PCPA 3MVIA 1UIPA 4GY1A 1R9YA 2Z28A 3PNUA 1M65A 3A3WA 4DZIA 2BB0A 1J5SA 3IRSA 4XAGA 2ANUA 2AMXA 3IJ6A 2D2JA 1YMYA 4CQBA 4WVXA 4C6PA 4RDVA 1EF2A 1YRRA 3ITCA 2PGFA 4HJWA 1KCXA 4H9UA 2E1WA 4GK8A 3ICJA 4QTGA 3K5XA 1POKA 2GWNA 1YBQA 4C6FA 3UF9A 1EYWA 4IG2B 3DUGA 1RAKA 1GKRA 4I6KA 4C65A 3QY6A 4G7EB 3F2CA 1QXLA 4KF1A 2DVXA 3RN6A 1A4LA 3EGJA 1NDYA 4R7WA 4XD3A 1J6PA 3E2VA 1XRTA 3UPMA 4H9YA 1JGMA 5E5CA 4GXWA 3B0XA 4LAKA 2VUNA 4PBFA 4Z42C 4H9VA 2WJDA 4HK6A 4WHBA 3S2LA 4KETA 3GRIA 2P53A 3OQEA 4XAYA 1V4YA 4D8LA 3MDWA 1FWEC 4LH8A 1BF6A 3E3HA 4V1YA 2BGNE 4L6DA 4IQJA 1R9XA 3K2GA 4NI8A 4PBEA 3CS2A 3PANA 2Z4GA 3E0LA 4GC3A 3S2NA 3GU2A 3RCMA 4KEZA 1GKPA 4ERAA 3MSRA 4PE8A 2GWGA 3PAOA 4CNTA 4BY3A 1FWBC 4GY7A 4C5ZA 1DPMA 1UIOA 4DO7A 1V51A 4C6NA 2WM1A 4CQDA 1EJWC 1M7JA 2UZ9A 4J2MA 4JOMA 4NG3A 2Q01A 2Z7GA 3MKVA 2QT3A 2F6KA 4C6QA 1A5MC 2QS8A 3URQA 3MTWA 1FWAC 4R85A 4H9XA 4C60A 2HQAA 4QROA 4DLMA 1UBPC 4RZBA 4EPDC 4XD5A 4C5YA 1V7AA 1A5LC 1M68A 2R1PA 4C6CA 3WZ0E 3QY8A 4G2DA 2P50A 1RJQA 3LSCA 2FTYA 3TN6A 4AC7C 4ERGA 3RHGA 3TNBA 3V7PA 4V1XA 1A5NC 2FFIA 4HK7A 2FTWA 4B3ZA 3GTXA 3F2BA 4DIAA 3CAKA 4F0RA 1A5KC 3LY0A 4C6KA 4HA0A 2O4MA 4IG2A 3GU9A 2EG6A 2QVNA 4G7EA 3JZEA 4GZ7A 4R88A 2VM8A 4EPBC 2HNHA 2OOFA 1RA0A 1IE7C 1A4MA 1KRCC 3MPGA 1POJA 1ADDA 3LS9A 4ERIA 4C6DA 4KQNA 4CEUC 2VC7A 4LCSA 1PB0A 4C6OA 3URAA 1NDVA 4CQCA 3O7UA 4XD4A 2XIOA 4HK5A 3T8LA 1S3TC 2PAJA 3N2CA 4KEVA 4KIRA 2I5GA 4GOAA 4GX9A 4CEXC 3AUOA 1KRBC 1EJVC 2I9UA 2VR2A 1FWJC 3EWCA 4LCQA 2Z2BA 2AQVA 3GUWA 2OB3A 4QS5A 4P5UA 1A5OC 4CNUA 4QRNA 3KM8A 2RAGA 4ICMA 2R1NA 4LCRA 1FWIC 4H00A 1HZYA 4IH3A 1VFLA 3FEQA 2YB1A 4PCNA 2E25A 2YB4A 1PO9A 3B40A 3S4TA 1O12A
chains in the Genus database with same CATH superfamily
2ZZ2A 3VXGA 4IFKB 3IVSA 2FGLA 3W29A 4D72A 1YADA 2OX1A 1DJHA 4HNOA 3LEPA 1AG1O 4L1WA 2GGIA 3DDMA 1Y5VA 3BMXA 4PUDA 4LS0A 4JAWA 3ABQA 2DT0A 2F2KA 5MF5A 5IFPA 2AGTA 1DQUA 1VBGA 1JVNA 4OTKA 3QXBA 5BXTA 1DXIA 2X1TA 3PPCA 4ZO9A 3W9ZA 4E2DA 3VI2A 1IHIA 3HTWA 1Q6EA 1HKJA 3MY9A 4OVXA 4Z0SA 2A5HA 5EA9A 4L4PA 3M7SA 1H1YA 4JBRA 3POCA 1UA7A 2YYUA 3GTIA 4XZIA 5LKYA 2QGYA 4D1IA 2I5IA 3W76A 2O0TA 3TN4A 1CZ1A 1LL6A 1XLCA 1HL2A 1W8GA 3NIYA 4AHOA 3GFXA 2A3LA 4F0MA 1I0DA 2ZOXA 1ITQA 2Q8LA 3IUHA 3A3XA 1ISVA 3JUGA 2QUUA 2FVLA 1FWHC 7ODCA 3Q37A 2QCFA 5FCZA 1TMLA 3HGOA 4JTJA 3K8KA 4HZMA 2O4QA 1VIZA 3ZOAA 2DP3A 5C9UA 4GPNA 1BYAA 1OX4B 1T96A 4E3TA 4YHEA 1ZJIA 1DOSA 2QYGA 1QW9A 4GUHA 1B57A 3KVMA 4W5UA 2PRLA 2GGHA 5LIUX 1CBGA 3GTFA 1CXKA 4K3ZA 5A6TC 4GBDA 1GVQA 5DRIA 1DXEA 2HV5A 4N9CA 2J9YA 3CL7A 3SY8A 1SO3A 1E9YB 1YPFA 2DZBA 2EPMX 3P61A 4ZCWA 1ME7A 3ES7A 3VDCA 1QI0A 1WOBA 4UWMA 1KRMA 5EFDA 3WYZA 1PKYA 3WO8A 2YW4A 4Z1BA 1H5YA 3A13A 5F2IA 3MCOA 4HA3A 3N3MA 3DGRA 3CB8A 1E9ZB 2XFFA 5AYXA 2PI6A 5JBEA 3T05A 3WQWA 4JR5A 3W7MA 4HZ8A 4Y8EA 3VX0A 4RPPA 4E8GA 2Z25A 2G3NA 1DWHM 5M3WA 3W73A 5I3KA 4UBPC 5FAGA 3MB9A 4GY1A 1T8XA 4RE3A 1E15A 3JS3A 3XISA 1JZ4A 3ABRA 1TA3B 4ROQA 4LUJA 1W3TA 3WUEA 1Z8AA 5CLWA 3GDLA 2BS9A 3NO3A 1JXKA 3IJ6A 5ABTA 3NQAA 2JIEA 4TV5A 4EK7A 2W79A 3LYEA 1MEWA 3ITCA 5DMLA 5TAOA 2A7NA 3ITOA 1L2QA 3S1XA 3GFYA 3VOFA 1CLVA 2OTDA 1OFDA 1MDRA 1A80A 1TPEA 4FF7A 1TRIA 1TWIA 2W4XA 3NOYA 3P2VA 4REQB 3RF9A 1I45A 3F4VA 3N4FA 5HJYA 1Y0EA 5I79A 3E2VA 4EWJA 3OIXA 1US2A 1E0WA 5E9AA 4FLRA 3ITLA 3TR9A 3NFUA 1YDYA 5M2FX 3GIYA 3FEMA 4QAIA 1PEZA 4Q4RA 3AS3A 3UCDA 5IBXC 3KCOA 1WKFA 4MPQA 4RPQA 1WV2A 3SQMA 8XIAA 1EXPA 1ALDA 3EWXA 1JD9A 3UZJA 1JGIA 2QAFA 1E0VA 3H22A 4W86A 1ZBCA 4WLCA 4DJFD 4V2XA 2XN2A 3PANA 3CPRA 3D47A 4PCFA 3O16A 3THUA 1YEYA 1FDYA 5DY3A 2AMGA 1TCMA 4BY3A 1KBLA 4FX6M 5FF3A 1Q8AA 2ABBA 1Q7QA 4O15A 4AWTA 5A94A 4JX4A 3WQPA 1GOKA 4J2MA 5CAHA 1B3WA 5E9XA 2WW5A 3W02A 4LYQA 4UMCA 3NZGA 1QT1A 1FWAC 4PFHA 4AD5A 4MSSA 3AMKA 5BCAA 4C60A 1TTQA 3ZQ9A 1V7AA 2WSPA 1UKOA 2FZBA 1XG4A 5D2TA 4PUJA 3SGZA 2EGZA 1W56A 1HG3A 4GBUA 5K9CA 4GUFA 3R4IA 2ZVIA 3NXLA 3CUGA 2YA1A 4PUEA 2WZEA 4GLEA 4O57A 4F0RA 3AZRA 3RU8X 1MFUA 3T0CA 2PTZA 1IE7C 4JNMA 2WHLA 3MWAA 3WBEA 1LL7A 2OQYA 1WUEA 4C6OA 1QPQA 4C1KA 1XIGA 2GQ3A 1XH0A 3IUIA 5LXEA 2NV9A 1F61A 3K46A 4KEVA 5G4WA 1GQLA 4CEXC 4MY8A 2H6RA 3N4AA 2VWTA 2E9BA 3ZS4A 2OJPA 4I5RA 3GXNA 3BANA 4NASA 4LV9A 3IK4A 4S38A 1O5XA 5I3IA 4Y8FA 3MO4A 1EIBA 2WSYA 3PJUA 4GACA 1HKKA 2DZUA 3DYOA 5K7JA 5FACA 3PJTA 4GINA 1P48A 3GBEA 4FNUA 1CXHA 2UWFA 3BW2A 2Y4SA 3QOMA 2W63A 2XINA 1QPNA 1QOQA 2GGJA 3QGVA 2GZXA 4MFDA 3N17A 2DIKA 2Y70A 3SUTA 1UWAA 2PP1A 1K9DA 3ANYA 2GYIA 3W28A 3GNPA 1FWDC 4AQLA 1P1XA 4UFJA 2LLEA 2IMRA 3A6OA 1OYAA 2VFDA 4IPNB 3URNA 4MWAD 3ZLFA 3HN3A 1ITUA 1WBHA 3FOKA 2GOKA 2G97A 5DCBA 4ZSTA 3RNDA 1RUSA 5BWAA 4MDPA 2H8ZA 5CPSA 4JNYA 4UTFA 3W07A 4QQ3A 3WEMA 3F5KA 4HN8A 5RUBA 5J04A 3W7KA 4HB7A 2D0FA 5IFTA 2G3IA 3EMZA 3P80A 4LYKA 4F2UA 4AWUA 1OIMA 3WDIA 4AD1A 5JH2A 1M03A 4IICA 3T08A 4IPPA 5G2WA 3M0IA 2YA0A 3G1DA 2QDDA 1TYGA 3WQVA 1EJXC 1RH9A 2ISDA 3ECQA 4H8HA 2WHMA 4M5PA 2QPXA 1SR0A 4KWSA 4OECA 3K4WA 3UZYA 3FDGA 1YXDA 3LPGA 5CZJA 3FSUA 4D6CA 3L5MA 2HNEA 3H2NA 2OLHA 4FAMA 4KFOA 1TIMA 2ZRVA 1DTUA 2V5CA 3W00A 3WQ8A 4DBSA 1O68A 1HIZA 3F1QA 4AISA 4WKAA 3S2MA 2W9MA 2ZRZA 3C86A 4JHOA 1JCJA 2OODA 2Z2AA 4LSBA 2PA6A 3EYPA 5EMYA 5D9OA 3AMLA 4B5NA 1SO6A 2EG8A 3HG2A 3GAYA 1QOXA 4TV6A 3CUJA 1MZRA 4RV8A 1WKDA 3GU1A 1TMHA 3YPIA 3I68A 4WJEA 1GOIA 1YNYA 3CH0A 3KVKA 1NF7A 3UWEA 2HVNA 4JKMA 3LV6A 4AF0A 4MNLA 4NZ1A 3AICA 3D3FA 4E4UA 3D0CA 3NVTA 1RXOB 2FPYA 4EPEC 3QY7A 5D2XA 1JPHA 1S1PA 3HPXA 5K9DA 3ZVIA 4XKMA 4BA0A 1FWFC 1HTIA 1KW1A 2IKGA 3T55A 1TJ0A 4O18A 3U4FA 3ORWA 2G3FA 3ONCA 1J79A 3QPEA 1UD6A 3UXLA 4ZB0A 3E1F1 4IGMA 4YYFA 2E09A 2AL1A 4JQ4A 4B92A 3O6DA 3WQ6A 1Z44A 2JGQA 2QMKA 3AIEA 3CC1A 3T44A 1XH2A 2VOMA 2OSYA 1Y8BA 3SRHA 3DHDA 5ABFB 4H83A 3T7VA 4F3HA 3IGSA 2A3CA 1OK6A 2GJXA 1PKLA 1IR1A 2FTPA 4EIVA 1DIDA 4K8HA 2RHGA 2PU0A 5C9WA 1CX9A 4Y6GA 4GYPA 3SCSA 1UUOA 2C0AA 3UW6A 1OZMA 3K5XA 3WUGA 2GWNA 3RIKA 4IX2A 1W3LA 3QY6A 5JBFA 5HANA 3OG2A 3SRDA 1DIKA 4H9YA 3NM3A 4AIBA 3C61A 3FNDA 4Q6JA 5IM51 1ISYA 4AXKA 4MYAA 1FOBA 1TUFA 4U28A 1UH2A 2QJJA 4Q8WA 1HGWA 4S23A 2HTMA 2V30A 1BTMA 3MDWA 4IX0A 2XFRA 5C70A 3SGUA 1BF6A 4EF8A 4MY9A 2PDHA 4S2BA 3P0XA 5HA7A 4ACYA 3MP4A 1R9XA 4MKVA 2Z1VA 4POCA 4NI8A 3QPYA 3HA1A 1CNVA 4S3KA 4L6OA 2OCZA 3BH4A 3AWNA 1T6MA 2X40A 4CCZA 2OWCA 5LIWX 4OBTA 1YNQA 3MHGA 4QBXA 2J88A 4C6NA 1XLDA 4M3PA 5CC3A 2PLCA 3W74A 2WVUA 5GJPA 1V03A 3KX6A 4AIOA 2VEGA 3LCFA 4XBJA 1OFPA 3AALA 3MKVA 2REQA 2NUWA 5BRPA 3DFPA 4R5EA 3SR7A 1JYVA 1A5SA 2ZX5A 4WX2A 4ADUA 3ZZ1A 1JZ8A 1DJYA 1DJQA 1ADOA 1OF6A 3HGRA 3VOJA 4Q4KA 3SJ3A 1PE1A 3TQKA 1M68A 3SY5A 4B3LA 1UR9A 2P0OA 3NCOA 1P4CA 3H24A 2XVLA 1DE6A 4G2DA 2B0MA 1BVZA 1G1YA 1ZU8A 3RUBL 2DSVA 3WJXA 1J4EA 1MUCA 2GSHA 3GAKA 4O11A 2HEJA 3NO1A 1JFHA 3VIKA 5E6ZA 2QVNA 2E6YA 3EWUA 4EPBC 3ABOA 2JBMA 1ZY9A 4RE2A 5A2AA 3RO8A 4GNVA 3E6EA 3S5YA 3WQDA 1SSDA 5LNVA 3A4AA 3QKEA 1HJXA 4S3DA 3EA1A 1K6AA 3S3GA 4TMBA 3KBSA 5FJJA 3T09A 3JR2A 3HFYA 2Y7EA 3AZTA 3BW3A 2I14A 1QWKA 7REQA 4GHRA 1TVLA 3DFHA 2VRJA 1MW0A 1GZJA 3PTQA 3II1A 5T8GA 5C9RA 1QHOA 4LCRA 5DRCA 4Q3MA 5IXEA 4V33A 1XLIA 4H00A 4IGSA 3LRKA 1XLEA 4AD4A 1W2PA 3PP7A 1U1HA 5ENLA 2V2HA 3NQVA 1YNPA 2E7FA 1X98A 1L8NA 1TV5A 4O50A 3TJXA 1FHLA 3KBVA 2VGBA 5BU9A 3IV8A 2QCCA 2BV9A 3L2LA 3W7HA 1E70M 1RBLA 3VNJA 1KV5A 4IJBA 5AHIA 5BXSA 4AU0A 1PYFA 3N9RA 3NQBA 3LNPA 3V5CA 2FFCA 1OCBA 1SZRA 2XH0A 3CQKA 3H2AA 5AVHA 3W71A 3WNNA 1JZ3A 2CC0A 3K4DA 2WZHA 3N19B 2HDJA 2GDVA 4KT2A 3STGA 3CPUA 1OABA 1BQGA 2QDGA 3LZ3A 1AL7A 3W1QA 3IK2A 1XDJA 3EWDA 4E4PA 1CGUA 1VH7A 4AX7A 4RNHA 4C7FA 1I75A 1BFNA 2NUXA 1OGGA 1H62A 3RJYA 1W1IE 3MBFA 2RDTA 2XG9A 2J77A 4BFAA 1SGJA 3VABA 4WDTA 3TW7A 5K2ZA 1GUVA 1CW2A 3T78A 4WGHA 4A8IA 4LALA 3GC5A 3RR4A 1MW3A 1C3FA 2WM0A 4L9XA 5LA0A 3RGTA 1K9EA 3VTRA 3W7PA 1VFSA 1XPYA 5FF4A 3W7LA 1KGWA 1UCWA 4KWUA 1LUCA 1QMLA 2F8QA 3QZ6A 2FVKA 1UP3A 4L80A 1ELSA 3TLLA 1I9CB 1UMLA 1QW7A 1VRXA 2ACSA 4D6GA 4QP0A 4LUIA 4J3TA 1GYLA 3VD4A 4NILA 1WXYA 3WQGA 4H6KA 3IARA 3PZNA 3VM7A 1XHGA 2Y8KA 3I6RA 1RD6A 3GZ3A 4UOQA 4IT1A 1XYLA 3LQLA 3SEPA 4PSRA 4GYFA 3WENA 1VCFA 3OTRA 1KFEA 2BMBA 3ABSA 3NZQA 3A21A 4DI9A 3EOUA 4WDUA 1J96A 1BGGA 4O54A 4X9SA 1HJSA 2QCDA 5A6LA 1FCQA 5JU6A 3ARVA 3F4NA 1CENA 1PCKA 5KMYA 2A6NA 3UJEA 2WBKA 3WMBA 3VIJA 3PFRA 3WNLA 5C2GA 1H61A 3QJAA 4WY0F 4DZIA 3CO4A 4GIAA 4S3JA 2R9RA 1E71M 3NPVA 3T4WA 3SI9A 1QI5A 3TTSA 3FA4A 3UXAA 3ONBA 1J0YA 3P6LA 2V5KA 4HJWA 2ZRUA 1POKA 3WD1A 4P8WA 3NZ1A 2ACRA 4KH2A 3REQA 1W3IA 2W92A 1JCNA 4GQQA 5BXPA 4KFNA 2ZWZA 2ZWYA 5A6JA 1Z6KA 2VZOA 1V6WA 4DJDC 4HU8A 3WF3A 1H49A 4XO6A 3KBNA 3WBXA 4A8LA 3W87A 3VDAA 3G0UA 1NP0A 3W72A 1QW8A 2FH6A 1EEPA 2O9RA 4GA8A 1EO5A 1VKFA 4HPNA 4YNGA 3FHAA 1JR1A 2QV5A 1O95A 3VNMA 4IM4A 2ZE3A 2W66A 3L4TA 5FL1A 1NELA 3BMVA 3STEA 2GUBA 4O19A 3W26A 3R89A 3SIZA 2J74A 1EGVA 5HAOA 3C0SA 3WX7A 3UP8A 3MZ2A 1RPXA 3W7IA 3GH7A 2XN0A 1KC7A 2NQHA 2VEKA 3EDDA 1FCUA 3ME3A 4NF7A 4Q8QA 3AHZA 4HPHA 1ZBVA 1M7JA 2PC8A 3TIMA 2CZEA 3TXVA 2Z7GA 1MYRA 5E93A 2PDLA 3JRKA 2X7WA 4H9XA 4NIRA 2X09A 4US6A 1EPXA 3HFTA 2HRWA 1XFBA 1PHWA 1HJUA 2Z6IA 4PMJA 3QV6A 2FB2A 1EXBA 4FNTA 3WJWA 2FTYA 3NEVA 3ZJ7A 6TAAA 4B9YA 1HP5A 1B30A 1XC6A 1A5NC 2ZX7A 4OU1A 1GK8A 1XP3A 2QUNA 3NOEA 4AZGA 4G7EA 3MYPA 3JZEA 3T0BA 4Z2HA 4PZVA 2NXIA 3OHIA 3BMWA 1OHLA 3S83A 2XU2A 2JF7A 4KQNA 1D7KA 2OU4A 2XPKA 1D9EA 3P7YA 3PJWA 3VMOA 2HVMA 4W7WA 4MB1A 1G4PA 3KCLA 5D9PA 3W7GA 4JS3A 4O0ZA 5FESA 1OB0A 4B5VA 3AZSA 2GUYA 4J4KA 1FA2A 4MJ2A 2OR2A 2PAJA 3L0GA 3MUXA 1EC8A 4UTIA 2PDNA 3UWUA 2I9UA 2VZUA 2RDWA 4XKYA 2QUVA 5AN7A 3QR1A 1QUMA 5C71A 1SZFA 4U10A 1H11A 3N25A 1YYAA 4WQ6A 3FKRA 2Y7DA 2VFHA 3OYXA 2FDSA 1YW1A 1HZYA 1VBRA 2NX1A 2FZMA 3SCVA 2W3ZA 3C2EA 2IQ0A 5AZ1A 3S6OA 4M7SA 3ZWTA 2PDYA 4Q7NA 3L65A 3IV3A 5KZEA 1ONWA 1K03A 4MIMA 1ZCOA 3EBVA 2E6AA 2BGSA 3KRSA 1R7OA 2Y89A 3MI2A 1CPUA 1FWNA 4HN4A 2Z00A 4WOZA 1SW3A 2G96A 3OLIA 3QW3A 1DIEA 3HPAA 3KHDA 4UTLA 9CGTA 2E5BA 1LTDA 4KPLA 1W1B1 3WLTA 4A2SA 4BF5A 2XSXA 5LZLA 3SIMA 3GNRA 4DVOA 5CKSA 3RILA 1AUSL 4MDOA 4AF0B 3AHYA 2GDQA 1EPVA 4CNSA 3W7OA 4ORIA 3QHOA 1AD4A 2W6RA 3M46A 3B9NA 1OCJA 3WF4A 2QEZA 4Q8OA 4JY9A 3PWGA 1KBIA 1QI3A 3OVPA 2QF7A 1J9YA 2ZVRA 3WCZA 1I2OA 1EP3A 1TWSA 1IIGA 5LA2A 2X30A 3M9YA 3WNMA 3EX2A 3RG6A 4LYRA 2OQHA 3QPZA 4HU4A 4OWGA 3BLEA 2EKGA 1BWLA 5FSDC 1TCDA 4LC6A 2J8TA 1B5TA 3FAXA 4TIMA 4UFMA 1EJTC 5FKYA 3G1HA 4NX0A 3QGAC 4IXHA 2GJXB 4HNUA 4AVOA 1REQA 1JULA 3OZOA 3UWYA 1JPIA 1PZ3A 2BY2A 3BOXA 3N6JA 1R0MA 1GZGA 3CHEA 5HXMA 2V69A 4AXNA 4CGTA 1F8MA 2R6OA 3ZSTA 1F8IA 4PUKA 3DCPA 1QNQA 1ZL1A 4RDWA 4DXVA 1KFCA 4JPGA 3E38A 2ZZ3A 1R3VA 4NP7A 3U6WA 4H04A 1SSGA 2QPSA 3KL3A 3CT7A 2V5LA 1R3SA 4O13A 3FYPA 3CZ8A 4XBSA 4CNNA 2GJPA 2WC7A 4QDWA 3DHUA 3C56A 2NVDA 1Q6GA 2DPEA 4S2CA 1J18A 1FUYA 3WMLA 1SQ7A 3WMSA 3ZR4A 2ISSA 3ANVA 3VDHA 2DUZA 3L23A 4I6VA 3S6DA 4ZENA 1RY8A 1VFOA 4F0LA 2PLKA 1AMKA 3IANA 1GGOA 3PUGA 1KTCA 1AW2A 3K1GA 1NFGA 3W27A 1UIPA 2REQB 1VFFA 2GVEA 3I4KA 1RLCL 4KCVA 4LJ3A 3UERA 1YE4A 4XAPA 5FD0A 3DBNA 3EWBX 3WLQA 1S2CA 6XIMA 1XYAA 3IRSA 4DUOA 2XFYA 3CYVA 1E0TA 1CECA 5C2CA 1Y5WA 6TIMA 5CSSA 4R7JA 1KNWA 4JXCA 3BURA 2H3DA 1V8EA 5KETA 5AC4A 4I9TA 2O9TA 2DSUA 2CLKA 1NOUA 3F03K 4IMCA 1F74A 3TK7A 2WCAA 1WZMA 3IJLA 4RCXA 5GJMA 1NDYA 3AJ7A 3P8IA 4C1NA 4D71A 1WDRA 2WMGA 1W9PA 1R2SA 1UWUA 1VLIA 2F38A 1IV8A 1E3XA 2Z0IA 4J3XA 2WJDA 1VGAA 4E6MA 1HL8A 5CPQA 4Y9PA 4S3BA 2RJHA 3NQ6A 1WZKA 1Q65A 2MUCA 1RLDA 2YBTA 3CV1A 1VCVA 2J6XA 1QPOA 1X97A 4CCDA 2HK1A 1IXPA 1KB3A 4O4VA 3LHUA 4XVEA 7REQB 3CAWA 4GC3A 3OB8A 1V6UA 2B31A 1YDVA 1B54A 3LXAA 1TZ9A 2XSAA 1C92A 2AKZA 4GY7A 4MZ1A 3L2MA 4L56A 1CI1A 3LUTA 4C1LA 5AFDA 1XLGA 1UR2A 2FGZA 4MB4A 1XYCA 4R33A 1EX5A 1B3XA 3MANA 2FZ9A 1L8PA 4UCGA 3AROA 3CEPA 4AW7A 3W7JA 1W37A 3M0KA 2BNJA 4N4QA 4UFHA 2W67A 3N34A 4S3EA 2XTKA 3CIWA 4WZHA 1MDLA 3R0KA 3GVGA 4LB4A 2Q8ZA 4FHAA 2WNZA 4B2DA 4M7TA 3LCWA 1VPYA 5F4SA 4ERGA 3W1LA 5CBIA 3NDYA 3C3UA 1AA1B 2NW0A 3PZOA 4AVFA 4IG2A 3G1RA 4R53A 2O9PA 3GB6A 5JH1A 4IISA 4R88A 4XZ9A 3VKCA 1JXJA 2EPKX 3FFSA 1XM3A 4MWAA 1O6IA 2Q02A 2G4FA 1ZLPA 2YXGA 3S1UA 2JGYA 4ERIA 3VIHA 3H2OA 1DXFA 2E9LA 3AXHA 4WDWA 1E72M 1R2RA 4JIHA 4MZ8A 3O7UA 1TJRA 3LHZA 6PTDA 2YDRA 1S3TC 1B3ZA 1KWKA 3E96A 4JD4A 2Z7KA 2INFA 1SMAA 1ZSXA 2E6FA 1IEQA 1IGWA 1KM5A 3N29A 4K37A 4LCQA 3LHYA 3ERPA 1MZHA 1HL9A 4X3ZA 4CN1A 3RM8A 3H7RA 3CUHA 1XSJA 5CLTA 3W1TA 3L4YA 3FJNA 3GFZA 3M4HA 4NUWA 1TX2A 4HCLA 3CM4A 4PL1A 4WJXA 2OO6A 4LNYA 2BZNA 1M53A 3ARTA 1DL3A 1V3MA 3VOHA 1O1HA 2CBUA 5I3DA 3Q45A 4DNHA 3NEHA 1LUCB 5A8NA 1AMYA 1XSIA 4I9JA 2QF8A 1O4UA 1YE6A 2EPOA 3K4AA 3VGBA 4HBKA 3MI3A 2F61A 4FP1A 5D05A 2OQLA 4EF9A 3W37A 4RZ5A 4NU7A 3FJLA 4H01A 3VYLA 1RY0A 5D03A 4DM2A 2IXVA 4PMYA 5E0CA 3AIUA 3SN0A 1IZCA 3W6YA 1KFWA 1GOMA 4RDZA 2Y5SA 4Y96A 3E0IA 4HKPA 4FEZA 1T8QA 2BHYA 5TBOA 2P0IA 4GQGA 1RQBA 4C6LA 1VD6A 2QCMA 4OFCA 3R43A 1G5AA 1WYIA 4K7VA 2IW0A 1PDYA 3LMZA 1PTAA 1XXXA 1U5HA 2CHNA 2OPJA 8XIMA 1W91A 4Q32A 3WMCA 3WUBA 1VIWA 3RR1A 4Z08A 2QCDB 3OEXA 1AQ0A 3OW1A 4HNTA 2PDPA 4HZ7A 1Z9AA 3UXDA 5C6MA 3CJPA 4QJ3B 3N11A 2J7CA 1CLXA 1H60A 4XIAA 2DH2A 4JTHA 1B9ZA 5DEZA 5G1TA 1FXQA 5BOEA 3KFTA 3QTGA 1G7VA 3KOWA 4TQTA 3C6CA 5A8OA 2XIIA 3L7RA 4C6EA 3UG3A 4B90A 3NGFA 2ZXAA 3MV01 1XPGA 2WMKA 1EFZA 3IJDA 2WSKA 1KXHA 3CIXA 3B8SA 3F2DA 3REQB 3L2IA 4EXQA 4AX6A 5A6BD 2VMFA 1P1MA 4MJ4A 2UY5A 3EOLA 3KWXA 2RUSA 2FB3A 4PMZA 5HNNA 3U9IA 1WKYA 3GY1A 4QCEA 4B5TA 2EQDA 3W2MA 3AO0A 4Z2IA 1OK4A 4YVVA 4AZIA 2E5DA 3W2KA 1H7NA 2F6UA 2FMOA 2ZE0A 2BBFA 1JDAA 2FGBA 1F05A 1AW1A 3M0JA 4W7UA 1Y5XA 3ATZA 4ILSA 3OLEA 5XIMA 1OSEA 1XLAA 1Q6FA 4DYKA 4CLMA 4L4LA 2QJGA 3NGJA 1Q3NA 4NSBA 3NL5A 3MMWA 2WCGA 4GZEA 3CLWA 4IPLA 3A4JA 3UA3A 5HNTA 1B90A 3MVIA 3P74A 2VXNA 1SM9A 4E2VA 4QIUA 4BWLA 4GYKA 4ASTA 2D0HA 4OKDA 1D7FA 1NU5A 2OT0A 1WDDA 4AZHA 3L0KA 4YYCA 1WUFA 2ANUA 4Z2KA 3ENLA 4HMCA 4YN5A 2PDXA 3P84A 3TTEA 4AD3A 2PGWA 3TSMA 1S5WA 3H8AA 3UNTA 1TR1A 4H9UA 2YCEA 4WXYA 1B3VA 5I78A 4QTGA 4Q8TA 1P43A 4RZ6A 1V0KA 3GUGA 3DZ1A 4O1FA 4FR6A 4G7EB 2J6VA 1H4PA 4AY8A 1Q6LA 1JGMA 1Y65A 2PE4A 4DF0A 2PD5A 2G4JA 3KOXA 2RDUA 3QR3A 1IQ8A 1ITXA 4LAKA 3NWRA 3P3BA 4Q8UA 3ZJ8A 5KTLA 1RSCA 1EWDA 3IAQA 2V2DA 2DDXA 3GNOA 4DQWA 4JQAA 5F2LA 1FWEC 1LT8A 3FIGA 1PL9A 1OZQA 4PUWA 3U2OA 1GONA 4XKYB 5C5YA 1GJWA 4N9BA 4GO9A 1MI3A 4NJIA 4AVNA 3WH6A 3E2QA 5DFAA 1QPRA 1TQJA 2OWWA 1QJWA 4HMEA 4JIEA 3VC5A 4OBRA 1G9HA 5EYWA 2XGZA 3EA2A 5F4WA 4DYEA 2DSWA 4TX9A 3KUMA 3QSRA 3ZO9A 3GW0A 5LIYX 5G4EA 1FH8A 1MQPA 4R85A 3WFLA 4DPQA 3BLDA 2R1PA 4HOXA 3TJLA 2VD8A 4PUMA 2FJKA 4H2HA 3PPGA 1X39A 4O0QA 2XDFA 4TX6A 5LIKX 3GHTA 3VNKA 2VWSA 3FA3A 2WZMA 3FA5A 5DXXA 1EC7A 4M8UA 2XVNA 3P60A 6A3HA 3WDQA 3ZIZA 3UZXA 3WQCA 1N8IA 3HG4A 1PVNA 2ZZ4A 1QFEA 3CH9A 1F4AA 5BOFA 3IGUA 2I7GA 2V67A 4RL3A 4QSHA 4JCMA 2VZSA 4CEUC 2QQ6A 1WNOA 1E51A 1RHCA 1QI2A 3H2EA 5LGXA 5D38A 1BPLB 3LK6A 4JDYA 4YVPA 3WQOA 2YJQA 4O1DA 2I5GA 1AZ1A 3I7SA 1KBKA 4PTDA 2V6AA 4BZYA 3G2GA 2Z2BA 1OCNA 1H2JA 1TIWA 4BCEA 1KA9F 2VC9A 1DWIM 1TWWA 4IQLA 4P5UA 2V3FA 3H4WA 4K8EA 3RX2A 4YTRA 2P8CA 2RAGA 3ABXA 1WAUA 1I2RA 5HPOA 3TA6A 4JTDA 1X1OA 3NQ7A 1REQB 4QR6A 2XN1A 4PCNA 1OFBA 4TVCA 3ZMRA 2ALDA 4YLWA 1EHAA 1FFQA 3B9EA 1KRAC 3R0DA 3T40A 5E0KA 4W8LA 3GH4A 2EXOA 5AYBA 1QPKA 3TV8A 4YCOA 1EWEA 3ZSSA 2XISA 3O6CA 3SRFA 2D1ZA 4M81A 4D6FA 2WNQA 3UY8A 3UR2A 3AMGA 9XIAA 5I5RA 2R1MA 3FAWA 3L12A 4O28A 1Z7AA 4GJIA 1JCMP 4J9JA 1JIBA 3O07A 3GVVA 4XX6A 4LVDA 2PUZA 3BG9A 1S5VA 2QZRA 4GVHA 3TR2A 1RJPA 4AAJA 2NX9A 3RPTA 3O15A 5C7HA 1KBJA 3EXSA 3MDUA 2FMNA 3TH6A 2DVTA 3U48A 1EZ2A 3BCFA 4IIBA 1QWGA 3SCPA 4D6DA 3P81A 4LYPA 3WBWA 2H3BA 1TX0A 2V0TA 2XUCA 4QHRA 9RUBA 3WNPA 4URIA 1SVDA 1S2UA 3FYYA 1BLIA 3A5FA 3LZ5A 4YTTA 3V0UA 2DZSA 2E0PA 4GFIA 4RNIA 2Z26A 1R86A 3W2LA 1F4HA 3GH5A 4L6HA 5KSWA 1EJSC 3OYZA 2INEA 2PDFA 3IEBA 4Z1YA 2VVNA 3G0XA 3L68A 1CTNA 4F9DA 3OGSA 3LGDA 5M17A 1YQ2A 5EGRA 1AK5A 2Y63A 1VPXA 3GW3A 4LAZA 3M43A 1XW8A 2YYTA 5T9BG 1TKKA 4CVUA 2WPGA 2PGRA 2TAAA 4C1NB 2ZTJA 3CZLA 1FHUA 4H2CA 3IJIA 4JFSA 3NG3A 7XIMA 2ZUVA 3IIVA 1Q85A 4PMQA 2ADAA 1PX4A 3PR2A 5CC5A 5C9XA 3NPXA 1I2NA 1F5ZA 2BOFX 3NM1A 4C7DA 4XZMX 1UR3M 3IIPA 4ZGYA 3TN3A 2YIHA 3BPWA 1R9ZA 1Q63A 2WNWA 3VOCA 4JTTA 2O55A 2E77A 3HJZA 2DEPA 3GXMA 3QYQA 4AZCA 4ZODA 1R8LA 3GTHA 3MC5A 3BLIA 4DZAA 2A85A 3LN3A 3PZQA 1BYCA 2R1KA 1XSKA 4HVXA 1DE5A 1JRCA 2NLYA 2WV8A 3QEZA 4XZNX 5D9MA 1UASA 1MWOA 2VENA 1GWJA 4FZIA 4K36A 1A0DA 3VINA 3TJIA 2J7HA 3VGEA 1JJKA 3DC0A 2D2JA 3FYOA 1UMYA 4WDXA 1CLKA 4HHHA 4WVXA 1HVQA 4GE8A 2X0SA 1W9XA 1PV8A 4CD5A 2C16A 3ICJA 5EBAA 2J24A 3KTXA 2BDQA 4BWLC 3TW6A 1YLVA 3UF9A 4IG2B 1O5QA 4IMAA 3VKJA 3UXIA 2WWCA 2ZX8A 1GYNA 1EQPA 1XRTA 2WOQA 4MWAB 1ZRQA 5T9CE 4B3KA 1T5AA 5BWFA 3W0KA 1ESWA 2VUNA 3TYBA 3LGEA 5FJTA 3NTYA 3TCSA 3VOIA 1VJZA 2J78A 4V27A 1N8FA 3STPA 3DG7A 3PZ9A 4AEEA 3LV5A 3BICA 4UR9A 1UWSA 1VF8A 1SFLA 3CUIA 2HROA 4M56A 2C71A 1E4LA 1V3HA 1W1A1 4B5SA 1LL4A 4O12A 1NF0A 2VDGA 4CQAA 2WB5A 3GU2A 3HJEA 3HB9A 3M0YA 4PRTA 1EH9A 3APTA 4MVAA 4ZFCA 1YTEA 4O1EA 3QV8A 2CHRA 1V51A 3AIQA 2ZTKA 1HX0A 5A3HA 4TXEA 3AMDA 3EOSA 3G24A 4NG3A 4FSAA 2I56A 3MMDA 3LBMA 2F6KA 4MADA 1XIMA 3URQA 4ZMGA 4FB7A 4DWSA 2V82A 1RV8A 4UTHA 5CZKA 4QROA 1DJGA 2ZZ1A 3HQ1A 4EE9A 4RZBA 1R3YA 5DCDA 1UZ1A 3TOPA 3UT0A 1AJ0A 1AODA 4GRSA 2DY3A 2OYLA 4JTCA 1EA0A 3P14A 4V1XA 1VHNA 2NZLA 4KGJA 3N1AA 3WEOA 2VD9A 4QM1A 1Z89A 4GZ7A 1PPIA 2RFGA 2X1SA 3WDPP 1MO0A 1ITCA 1JI1A 2R14A 5U7SA 1A53A 4J1OA 1Q45A 2HXTA 3EWWA 5AHEA 3EMQA 3VZYA 1JAKA 4CQCA 3S6TA 1KBBA 3AIRA 4NNAA 3UNDA 2W61A 3OVQA 1DP0A 3ABZA 1B3YA 4KIRA 4HMDA 1R47A 3E9AA 1UWIA 5LHFA 4PL2A 1NEYA 2YL8A 3VKDA 4MJZA 2E9MA 1P7TA 1W9DM 2XVGA 1RP9A 3EB2A 2PC4A 3W84A 3WD3A 4CKQA 1I1WA 1P0BA 4FNSA 4TVUA 3SAZA 2YX0A 5CGQA 2X2YA 2E25A 3BLLA 1JUBA 4RXFA 4JTRA 1O60A 3TX9A 1U22A 4ZTXA 4P7LA 4F4RA 2AQOA 3B0YA 4I8YA 4S3AA 4Q7IA 2EPNA 4DUXA 3NO5A 4GCAA 3GVRA 4ZO8A 4AD2A 3OJGA 4UQDA 4G56A 3ZT5A 3T9PA 1WZLA 1V93A 4BQ2A 3ITTA 2NWSA 1TPDA 1ZHAA 1MNZA 5GJNA 3THQA 1S5MA 2GK1A 3V75A 2WWDA 3VD7A 3VU2A 3UBPC 1D3HA 2P10A 2J75A 1Q6RA 3A47A 3DI0A 4FLOA 3W38A 1XLKA 3WF0A 3KOZA 5KZ6A 5HMFA 3NQCA 2Q6ZA 3N2BA 3BAIA 3EKZA 3CQHA 2I1OA 4DUWA 3S2JA 2VJXA 2EAWA 2ZIDA 3E5PA 4ORMA 3N18A 3R94A 5ABEA 2Y2WA 1AL8A 4LXFA 3AISA 4JFVA 3GWQA 5F4XA 3TXZA 4JTUA 2ZZ5A 4W9TA 3C8NA 4AZBA 3FK4A 1A5CA 1V6YA 1FVPA 3THDA 4UQBA 1G6CA 1HKWA 1E6RA 5G1MA 4EPKA 1DQXA 4J5NA 1TVNA 2PDGA 3CQJA 1IF2A 2ZC1A 1IR2A 3N9KA 1GVIA 1H7WA 4UOJA 1SYTA 3QHMA 5FJOA 4FMVA 4JL2A 3WH9A 5DN1A 3CV7A 1X1NA 2XGBA 3DXIA 5BNKA 1XKYA 3BO9A 4U3CA 2WKLA 1C93A 4LEFA 4HPJA 5JXQA 1YDOA 2BVTA 3M5XA 4BI6A 4XD6A 3KXQA 1Q7ZA 5GNXA 4JIIX 4QX4A 1OVDA 3GDMA 2QPUA 1XGDA 1LORA 3KRUA 3BAJA 1W3KA 1ZB5A 3VDBA 2PTXA 4FK9A 3PPHA 3W3OA 1KWGA 1XGEA 1GVYA 1OADA 2XH4A 4H3DA 2D20A 5I24A 1I2QA 1O1ZA 3VE7A 1FFRA 1JCTA 3MJYA 1F6KA 3BLOA 2JQXA 4NYYA 2GQ8A 1F3XA 3AC0A 3MSGA 2AAAA 5JUVA 2D22A 3BZJA 4MGGA 1HP4A 2E68A 4N9DA 1JRBA 4M1RA 1XH1A 1F73A 5G5IA 4OGZA 4CVWA 3MVTA 2X2GA 5IRPA 4DLFA 4Z2LA 3SURA 1C91A 3WLIA 3NQ2A 3N73A 1L0PA 4A3HA 2OGYA 3MS8A 4U5KA 3CASA 4O1BA 2OLSA 1BWVA 1FX6A 3BJSA 5CG0A 4B9ZA 2C1HA 3H7UA 1J2BA 2UV8G 2DQWA 2BXZA 2C79A 4ZL1A 3PWIA 1FDJA 2UY4A 4A22A 2ZICA 4IMFA 1F2JA 4DBEA 2Q8XA 3S42A 4ZXOA 1TSIA 1R9YA 1W5OA 2BASA 4F0KA 3V4BA 4PRWA 3L5LA 7CGTA 3QTPA 1MFVA 4HYRA 3W2NA 3TLQA 4DO6A 5DQPA 1US0A 5KINA 1V6VA 3KBMA 4Q8MA 3UA4A 3KOFA 2BXVA 3NPUA 1F6YA 3DERA 3KRBA 4ZOBA 1U2YA 3MQTA 4LY4A 1OFQA 3TCEA 2RJGA 1H63A 2DVXA 2DZXA 3EGJA 3GHUA 3ES8A 2B4GA 2IS7A 2FH8A 3RCNA 4J3WA 3B03A 2X1IA 4PUNA 2PZNA 3MMTA 4BF9A 2PP0A 3TONA 1IXQA 3LPOA 1KR1A 1Z32X 1V4YA 3IIXA 4ROPA 1PXGA 1FP8A 2WMFA 4CD8A 1ISZA 3O2LA 2WZTA 2R91A 4UCFA 4ADTA 2DIEA 3W25A 1X6UA 4YJ5A 1ME8A 4CD6A 3WFAA 3VAVA 1TWDA 2PS2A 3UWWA 1PBGA 2QCEA 1GKPA 3SCRA 3CL6A 2G0WA 2FZNA 3L4VA 3OVRA 3PTDA 3UY7A 1GEQA 1KM0A 3PZIA 4I7VA 5FJIA 3R25A 2E8YA 4H6QA 1WO2A 4CCEA 1EJWC 1HF6A 1MSSA 1Q6CA 1JZ2A 5C9ZA 1XF0A 3DOPA 3HPZA 3FW6A 3M47A 1KM3A 2VR5A 3WH5A 1H7XA 1RZMA 2V9DA 1LWHA 3UEQA 3LCGA 1UQZA 3LLFA 3W7RA 3CUFA 2CCRA 1OX6A 4LBSA 2HQAA 1FH7A 5EL1A 4KRZA 1VFTA 3M1ZA 3VKBA 3G1XA 3NSXA 5JMUA 1EBGA 4HSHA 4JIRA 5DT7A 4D6HA 4PRRA 5H8PA 3M0ZA 4X9YA 2XIJA 2QUMA 3ALGA 1FBAA 2FKPA 2YL6A 3E02A 3VCRA 4DWSC 4UQCA 1LLOA 2PF0A 1CGVA 3B8TA 2CLMA 5C54A 1HJQA 1HO4A 1RA0A 2ONEA 5CBJA 1ICQA 2C13A 2J47A 4FOJA 4K1WA 3T0AA 3UJRA 1U1JA 4X2PA 2ZDSA 1DQWA 3TTOA 5A8MA 5CPMA 4C91A 2DT3A 3VGFA 1W54A 3H55A 1DORA 4GOAA 1EJ7L 3U5YA 1GZ1A 3IWPA 1A0CA 4L4OA 4NZJA 1LCOA 2CLOA 1ECEA 5C55A 3HIJA 3TMQA 2AQVA 4Q4PA 1DV7A 1NP2A 2CWNA 3WF2A 2PPGA 2XIMA 3UZZA 4DO4A 1WKEA 4OOZA 4Q4OA 1D3GA 1E43A 4U2ZA 1GT8A 5JQ9A 2XH2A 3RX4A 2CXGA 4D6IA 4MAVA 2GJLA 2QHAA 1AQMA 1OINA 4DZ5A 2YL9A 4J3VA 1DJZA 3B9OA 4PMRA 1VEOA 4ZR8A 3O0KA 4UFLA 2G8ZA 4UTTA 4OQVA 1J0KA 1VYPX 4P2VA 3M6DA 5HNUA 4C6JA 2R24A 1GJUA 4FF5A 1X7FA 2DZTA 3VMNA 5A6BA 1MVYA 3KTSA 1NIUA 4PTXA 1SJAA 3NZPA 3R2GA 3PM6A 3HV8A 3LSBA 2CLIA 3CGTA 4DNMA 3VZZA 4NJKA 2YR1A 1LQAA 3ZR6A 3FXYA 3KVJA 1BGAA 1CGTA 3ELFA 3TROA 5FOOA 4PMVA 5CC7A 1JCXA 4G8TA 1XIHA 4ZO7A 3B9AA 2VGGA 2UY2A 1VB9A 5FF0A 5HQLA 3GC2A 3G18A 3DIPA 1OT1A 2X16A 4NT0A 4AZCB 3LM7A 3NXFA 1IEVA 1EHNA 2V8ZA 5M03A 2I16A 2RDXA 4TUFA 3R5EA 2Y61A 5A2CA 4K8GA 1V6TA 2JKPA 4RDYA 1V5XA 1IT8A 3MT1A 4XAFA 1OM0A 2RKXA 2WJFA 2BHZA 3RDKA 1A47A 1CXFA 2DH3A 1FWGC 2HBVA 3W85A 2ZA3A 2A4AA 2CHOA 4NXSA 1QI4A 1BWKA 2CPUA 3D6NA 1F9CA 3WD4A 4M51A 1H7OA 4BKNA 4G7FA 3LBCA 1DJNA 5G2HA 2KAUC 1TFVA 1F6PA 1ONXA 4EKJA 3LTYA 3GBDA 1FWSA 2ODOA 3OBAA 1BG4A 2CLEA 3HPSA 1A5UA 2QULA 4ZFMA 1WQ5A 4H9ZA 3UVAA 4AY7A 3BUVA 3ZR5A 1K8CA 3VCCA 4XO7A 2WMJA 1VBJA 2X0HA 4JN7A 1UROA 1EBHA 2CU0A 3BLFA 2NX3A 2MANA 4H19A 3PC0A 2PLMA 5HJLA 5D2YA 3RFAA 1H3GA 2PLJA 3TEVA 3GXIA 3VIMA 4UUIA 4E0CA 1ZQ5A 4MUPA 4OOUA 2Y62A 4N7QA 1K4HA 3GKAA 3W1XA 2PWDA 3DESA 5A69A 4O53A 2ZA2A 3PTKA 2OWXA 5DXYA 3H53A 3GE7A 1FKXA 5DMMA 3W75A 2JFEX 3QC3A 3UESA 5E6YA 5BRQA 3MUCA 3T0DA 1C7SA 3V3WA 3W24A 2JE8A 3UFYA 3WLLA 3VNLA 1YXYA 4PCPA 3QC0A 2G3JA 1XIDA 4A4AA 4W7VA 2CEQA 4DWSB 1JL8A 3L5AA 4H1ZA 3UYCA 1AFSA 2JKEA 3CTTA 1J5SA 1ZNNA 2DT2A 3P8JA 3EPOA 3VX1A 4RX0A 4TR9A 1SFTA 1SO4A 1UUMA 4ONVA 1YRRA 6XIAA 2EEXA 3AWOA 4TU1A 3QHNA 1XYZA 1G94A 4GK8A 4AY1A 3UG8A 2YPIA 1YBQA 1WOAA 4JZ5A 1T99A 3BAXA 3SCTA 1P0EA 3INPA 4ZQOA 3DFOA 3LMYA 2NUYA 2GL5A 5IDZA 2J8FA 3DYMA 2Y8VA 4LUSA 4DJEC 3S2LA 1M9HA 1O66A 3OLGA 4F40A 3EA3A 4GMEA 2QNEA 3W1PA 3PB2A 1PKNA 3BL3A 1BVWA 3CIVA 4V1YA 4JTIA 2Z1BA 3DG3A 1XISA 2VX6A 1NSJA 2ZXDA 1T0OA 4NAFA 2GQ9A 4UC5A 2JEQA 4WKHA 2ON3A 1KFBA 3BG3A 1ZP4A 4HTBA 1FWBC 5D9NA 3OG3A 4IPJA 2VO5A 4J27A 4DB7A 1F3EA 4JOMA 2YBVA 4IUGA 7A3HA 1NOFA 4O16A 1A5MC 5GNYA 3KBJA 5REQA 2NQZA 3W6LA 4NAEA 4P7QA 3SN1A 1RBAA 3HV9A 2ZUSA 3WD2A 3THAA 4AEOA 2F84A 3A4WA 4JN6A 1R87A 5F7UA 4LW7A 3WDJA 3STCA 5D02A 4R9OA 2GK1B 4A6GA 5EMKA 3NUKA 2IPFA 2FFIA 2OG9A 3O3RA 2V63A 3GTXA 3F2BA 2Y24A 4HA0A 2I57A 4RE4A 3LXCA 3VCNA 2I17A 2XIBA 1Q13A 3VK5A 2PWGA 1E6NA 1GYMA 3FXGA 4JN8A 3RK8A 3OBKA 1XLBA 1BXCA 1TV2A 5T26A 2B7PA 1LBMA 4PTNA 1NJJA 3WELA 1HNYA 4HK5A 5DMNA 4FR1A 2ZXQA 2XFWA 2BVWA 3GC4A 1EJVC 4MWAE 3PS7A 3W2UA 1CWYA 4FALA 5ABGA 4KRUA 4XVDA 3CZGA 1GCYA 3VUPA 3G5EA 3HG5A 3AFBA 5HULA 3WNKA 3S1GA 3GR7A 1T40A 4QRNA 4OV9A 1EP1A 7TAAA 1SFJA 1S46A 4H4IA 5AY7A 2G50A 1JD7A 4B4HA 4XTDA 1WP6A 5A6KA 3RU6A 2X7VA 3M7WA 1TJ1A 1S2WA 4B15A 1PO9A 3ARQA 1FCBA 4MB5A 4QLLA 5IHRA 2CLLA 2VFIA 4AHQA 3OIHA 3LA4A 5H6HA 1KFLA 4HPXA 1VFUA 2QDHA 1OG0A 3E12A 1EJUC 3NDOA 3NQMA 1JPDX 3CHFA 4Y9MA 2Y8UA 8RUCA 4H8UA 1KLZA 2CWXA 1YDNA 3RLVA 2YA2A 3QQ1A 4I5XA 4DJDD 3RMEA 1YTDA 2Z24A 3L4UA 4ZZ9A 4FIQA 4MZYA 3OGRA 3QQ0A 3G8EA 1XX1A 2O56A 2ICSA 3SBFA 3IACA 3HQOA 2WVSA 5C7VA 1VPQA 1JEZA 4MOZA 1PTDA 3WK3A 2ZUUA 2VX7A 2J79A 4UTTC 3BJTA 1UUQA 5AHNA 1P0DA 2CKRA 3LRMA 4UB9A 1TV7A 3MP5A 2W91A 4L64A 1XIJA 4QJ1A 4YPJA 1GVFA 3GXPA 1FWWA 4S1FA 4A3UA 1W9BM 3LG3A 3O1NA 2YFOA 1IGSA 1Q7MA 5PTDA 1V3KA 2OMAA 3DENA 1TELA 3C2VA 4C90A 3IIOA 3W4RA 1PZ1A 4MAZA 4E3VA 1SJDA 4IIHA 4PTVA 3G6LA 2ZDRA 1PKMA 3NURA 4GCXA 1TZ7A 4LS1A 2BP1A 5FJUA 2FHCA 3TQPA 2V81A 1R3RA 3O9NA 1OYCA 4QLJA 3ZFHA 1M5WA 1UZDA 3I7QA 5ECUA 3AXKA 4H8NA 1KXQA 2A3AA 1TO3A 1PZ2A 2OZ8A 5CXPA 4KESA 1T7LA 9XIMA 1G01A 3NL6A 1SPQA 1TE6A 3G0SA 3DECA 3Q4DA 5I02A 3TN5A 1B4KA 1NOWA 3TC7A 5D8ZA 1E9LA 1X6LA 1HQTA 4JTGA 2A0NA 1DTNA 1AD1A 1QK2A 2BY0A 3WY1A 1EDGA 2P3EA 3G1SA 3QGKC 1KR0A 4L9YA 1VR6A 2RGLA 2W0UA 2WNNA 1XLJA 3BLKA 4DN1A 2HE5A 5LYRA 2OELA 1A3WA 1V02A 3Q2DA 3ARZA 2PBGA 3B0UX 2QJIA 1TVPA 1RP8A 1JDDA 3ITXA 2B7NA 2CITA 3V0SA 1J8VA 1TG7A 2DT1A 1BF2A 5D2WA 4CQ9A 1KGUA 3LLXA 1VCGA 4ZOEA 1XFCA 2QUTA 1UWTA 4E8CA 3PF3A 4GQBA 1M41A 2BOGX 3G8RA 3CWNA 5CG7A 4CU7A 2AMXA 5J5DA 3COTA 2PDCA 4NJJA 5CZTA 4XIMA 3EB3A 1JQVA 1LLZA 3NJ3A 3GR8A 1DEDA 4YU1A 1A3XA 4U5IA 1ISWA 3N9SA 1LOQA 2FZDA 1CT5A 2R82A 1RAKA 2DUXA 1QXLA 3PSVA 1A4LA 2IPJA 3PBVA 3R79A 4GGBA 4B4FA 1J6PA 2PP3A 5AC5A 3CMGA 4GJJA 2A7RA 1Q6OA 1V3IA 3SECA 2G95A 4IMEA 4HK6A 4OIFA 1GTEA 2P53A 4PH6A 3SADA 3NPWA 5TQLA 2P76A 3SSZA 2ZADA 1E6PA 1EYEA 2QKFA 3PG8A 3MSYA 3AUJA 1W17A 4PCSA 3LX9A 3T2OA 3HO8A 2GPTA 1B9BA 1OYBA 5D4YA 3S5ZA 3AS0A 3AIWA 1JUKA 3KAOA 4UNIA 3VIIA 4HNLA 2D2OA 3H2FA 3WJYA 4M6PA 2JIWA 4JX5A 1L2UA 2HMCA 3E2SA 2J9XA 4US5D 1EGZA 1GOOA 1DPMA 4QE5A 3C4UA 1M01A 3MKKA 2J4GA 1RQEA 4MMWA 3TQ0A 1CGWA 2Q01A 3APGA 1J12A 1KKRA 1J11A 3WSUA 5A6AA 2Y7GA 3KDOA 3NYDA 1JYWA 1OT2A 5KZMA 4RNJA 4DLMA 1UBPC 2WAGA 4LNCA 3RJXA 1FY6A 4TO8A 3BW4A 3QMSA 4GWEA 4FXRA 5HWMA 1PWLA 2OEJA 3BAYA 1L6GA 4DIAA 3CXOA 4S3GA 4CQ8A 3GU9A 4AYSA 1OC7A 4Z1DA 4JTFA 1ZAIA 3UWVA 2GVLA 1KQZA 3DFSA 1QNSA 4LUYA 1C8QA 3MPGA 1POJA 3CBWA 3R12A 4C6DA 3A4XA 3ATYA 3HZ3A 1U5VA 3Q65A 1V08A 4LCSA 1PB0A 1AVAA 1NDVA 1A0EA 1ZALA 1Z42A 4MUZA 4D9PA 5SWUA 1FWTA 2PBOA 3T8LA 4QLKA 4HHPA 3APYA 3EX6A 4NZFA 3H23A 2TSYA 3T8QA 1XRSA 1H41A 4ML9A 3WNOA 1XBYA 4OJYA 5AHLA 4PMNA 3JZUA 2WPBA 4HZ6A 1A5AA 1TPVA 3K1DA 4NYUA 4ZQPA 3NQ8A 1KCZA 1TZZA 2XYLA 4LRSA 8CGTA 5BU6A 3UCQA 1UQYA 2GQAA 1FWIC 2O7QA 3VOGA 1VFLA 4HNVA 1FP9A 1NTHA 2YB4A 4P7OA 4HT3A 2OFJA 4IHCA 3S4TA 1R85A 3HQNA 4EAYA 5CJ5A 1G4SA 1WCGA 4BK9A 4FPSA 3DGBA 4AH7A 3OVGA 3KBWA 5BROA 3WLKX 1LRQA 3ALFA 1NFPA 4JIQA 1JDFA 4GY0A 3ZM8A 2WZIA 4PEKA 3POHA 3LPFA 3CO8A 4PMDA 5C8BB 2DVUA 5AZ0A 1UR1A 2PDMA 3KCJA 4Y90A 3MU7A 2YBUA 2D2GA 2ZUWA 3DI1A 2VC5A 2Z6JA 5EY5A 1J0ZA 2Q09A 2Y6ZA 1HUVA 4IIGA 1QVBA 1ZZMA 1ONEA 3S47A 3SUSA 1MW1A 5I3GA 1LBFA 1R30A 2TRSA 4DHGA 1X6NA 3LCHA 3MCMA 3V36A 1ODZA 3PBMA 4LAMA 1UR8A 3BTNA 5LNUA 1XIEA 3B8WA 2YCKX 4NY2A 2EO7A 4RLIA 1VS1A 3OZPA 3NL3A 2QW5A 3XINA 4LAUA 2P1FA 3IRDA 1QNOA 2ZZ7A 2ISWA 2OOGA 3BAKA 4KMQA 1PHQA 5FJRA 5GNZA 3IJ7A 1TB3A 3T42A 1K8YA 1DKWA 3LI0A 2ZFAA 1UBSA 3MJMA 3AYTA 1CCWB 4UMBA 3IS4A 3M0MA 1VYSX 1B3OA 3EAUA 4AHPA 1EQCA 3UJ2A 5CGMA 1CIUA 4ATWA 2R1LA 5AKQA 4H9MA 1Q66A 5I3JA 4TTGA 4JQ3A 4GVIA 1E6SM 2HJPA 2IQDA 1OQFA 4Y2WA 3I3DA 1YBQB 5BRBA 5FEXA 4G5DA 1LJYA 4MLRA 2DSZA 3KL0A 3FLUA 1QBAA 4GYPC 5I07A 2DZAA 3NQDA 2NT1A 4FXFA 4KBXA 3F4CA 3HURA 3PG9A 2PF8A 3LGGA 2ESCA 4R34A 4PYSA 4LUSB 1AH0A 3PHAA 4PCTA 3BOFA 1SW0A 3AU2A 3N2XA 1R5YA 1YKWA 1RCXB 1ZBWA 3DEQA 6CGTA 2E5CA 3LENA 4M29A 1UH4A 2V5BA 3TTYA 5FA5A 2PCEA 1W6TA 4ZQCA 4NAFB 4IOTA 1E1EA 5IHSA 4DO5A 4ZBCA 1JDEA 1K9TA 4ML4A 5A6SA 3KZSA 4E38A 4N02A 4JCLA 2YZ5A 4J35A 2IKJA 2VI0A 4A21A 3WLPA 4X22A 5AC8A 5HOSA 1UH3A 4M19A 3LTPA 4P7NA 3VGGA 5XIAA 1PJ9A 3IGHX 4LV4A 1M1BA 2HE8A 3EEZA 3VGHA 3MUY1 3PNUA 4HSOA 5REQB 2ISVA 4EAMA 4NAEB 3HMCA 4H6EA 2QIIA 2XZ7A 4QE4A 4XAGA 1AZ2A 2QVHA 1XD1A 3UJSA 5BMWA 4OT7A 1TV3A 4E2OA 4CQBA 2YCJA 5TNVA 4C6PA 3H70A 4X0VA 3IVTA 5XINA 3QN3A 3PAJA 4QEHA 2R94A 2J25A 2SFPA 2FIQA 4BS0A 1PAMA 1EYWA 3WEZA 1GKRA 3CEUA 1I60A 4KF1A 2XJ7A 4KCUA 1J93A 5LA1A 4JKLA 4MNKA 5AOUA 2PFHA 1ICSA 4PBFA 2YFNA 4H9VA 3W7QA 3T2PA 4EACA 4XAYA 2ZXBA 1U30A 2AL2A 2X0YA 4LH8A 3UG4A 3M16A 1ZBKA 1TPC1 2YCLA 2YOCA 5HDRA 4L6DA 4IQJA 4HHMA 3K2GA 2YDQA 3M6YA 3TWAA 3Q67A 3AOFA 3AYSA 3G3DA 4KGLA 3P67A 4W88A 3ZYZA 2BVYA 4LEQA 1TTJA 4I5UA 1S5NA 1OGSA 2GOUA 5CPNA 3U2ZA 2JKAA 4DO7A 1XINA 2Q3RA 4TTUA 3JW7A 3AAMA 4H7ZA 4RW5A 3VFCA 3B04A 3CK5A 4NL1A 2I9EA 5T91A 4LVFA 1BVNP 3HMJG 7TIMA 1HKVA 1EIXA 3S5NA 4QJ5B 2X42A 2BLEA 5LNSA 5F2MA 5DF0A 3VVGA 1K7EA 2DZVA 2PDUA 3GHRA 2C18A 1E4NA 3I6TA 3WBYA 3H7VA 2ZX9A 5D09A 2NSOA 1X1ZA 2VQUA 2DORA 3GX9A 3CPGA 1R3WA 2CLFA 3V7PA 1XLLA 4GISA 2FTWA 2RGMA 1ONRA 3QVQA 5ECVA 1NM9A 3EXRA 2C91A 2EG6A 1WDPA 3N3TA 3KZPA 4Y9AA 3SQLA 1Q8JA 2C1IA 3GYCA 4N42A 3TFCA 4WSJA 4ZQMA 1W5PA 1H1ZA 3RLHA 4W87A 3URAA 2FPTA 4IZGA 4FO4A 1F3TA 1Q2SA 4UFIA 1UD2A 5DY2A 5BW6A 2XIOA 4ZQRA 2F2HA 3AIBA 4GX9A 1HJVA 2PTWA 4QQUA 4AB4A 2VP8A 5E09A 4GJ1A 4BQ4A 2QJMA 3C52A 4QAWA 4L1XA 2FDMA 3MV11 1NAL1 3LDVA 4ICMA 1JAEA 4IP5A 4F8XA 2VTFA 4IH3A 1SZNA 3CZJA 1BKSA 1FCVA 2Y7FA 2XM2A 4MYXA 3CV2A 4QG9A 4Q22A 4XZHA 4B16A 4C7GA 3GKFA 1NQKA 4JYDA 3MHFA 1RBOB 1UKPA 5AYIA 3TW9A 3SSJA 1H7RA 2VEIA 2NQLA 3SUVA 3NDZA 2IXUA 3AQUA 1PWMA 1TTIA 3EPNA 2VQTA 3TYUA 5M1TA 2BG5A 4RNFA 4PR4A 4MFEA 4WF7A 3LU2A 4WSHA 4ZOCA 1GG0A 3W01A 1RK5A 1KTNA 4OBSA 2ZBTA 1WDWA 1K6WA 4IP4A 1PUDA 4PULA 2CERA 4I9MA 4DJFA 3C0LA 4C6IA 1I6NA 4G9PA 3SO7A 1RR2A 5DMYA 1XIFA 2WQDA 3W22A 5HINA 3F4WA 3RYSA 3SN4A 5HMSA 2H9AA 1TUXA 5D2VA 3H12A 1EL3A 1XQLA 2PWHA 3URBA 2YL5A 4JNZA 2GJNA 3TUUA 1G4EA 3SB0A 1THFD 1S38A 5HMEA 4GNKB 2QMJA 3GNNA 2C19A 3OPSA 3DX5A 4LY8A 2Z1XA 2QCGA 4E2BA 4UR8A 1NQ6A 2J9ZA 2GSEA 1K9FA 3KRZA 3ANUA 4XSMA 3E0VA 1XJBA 4X2RA 4NZ5A 3VIOA 4IFRA 2J7GA 4QFUA 4I7UA 1IWBA 4EVZA 1U83A 3OOQA 2G3MA 4Q4MA 2HPIA 1LP6A 5IOBA 3QMTA 2NQJA 4BJHA 3WBAA 1W1PA 3OBEA 3PNZA 2A79A 4HOWA 4O14A 5L9FA 4C6MA 1C90A 1HKIA 1L6SA 4QGCA 2VYOA 2CZ5A 1YPIA 1UPPA 3CWOX 3E0FA 1GVSA 2NV2A 1VYRA 4NRRA 1N82A 1PSCA 4E5TA 1D8WA 1PX8A 4B2DD 2WKGA 1DJXA 2VCBA 3PBWA 2I5QA 2PODA 2D3NA 4K7YA 3DN5A 4N9EA 4J3ZA 5K3VA 4PB5A 2PTYA 2BWGA 1CGYA 2QIWA 3EWYA 3CNYA 3DC8A 3FV9A 1XRFA 2CLPA 1PIIA 2PCQA 4FX7A 4OE7A 3CZEA 1LLWA 3UGRA 3CMJA 3CWHA 4GXPA 3WLOA 1EO7A 1WDSA 1XBZA 1PTGA 3MCNA 3VUSA 2DFAA 4FS9A 4HTYA 3CMFA 4D8AA 2L5HA 2FZ8A 4XSLA 3UZ5A 4B5WA 3AYRA 2VFEA 4R27A 3EX3A 2NLIA 3CLMA 1UOKA 3UPBA 3L9CA 3V0TA 3TWBA 1RVKA 1QR7A 3KL5A 2Z2UA 3K30A 2PGFA 1ZGDA 3TYAA 1GVOA 3AMCA 3G1VA 3VIPA 1E6ZA 3IJQA 1JDCA 3WLJA 3PBUA 4LTSA 5F1UA 4C65A 3BJFA 4GFSA 1MUMA 2GLKA 4GZIA 4QDPA 3WL0A 3TYEA 4W5ZA 5HBFA 1XYMA 3W7EA 4GXWA 3B97A 3B0XA 1I4NA 1MRAA 2Y5JA 1ZTVA 3LHVA 1K8XA 4JKKA 4KETA 4M82A 2OEMA 2PDJA 2VR4A 1GTHA 2W27A 4GGHA 3CHVA 2BY1A 2NWRA 1LWJA 4WIWA 1E55A 3SUWA 1C9WA 4W84A 5HATA 2XHYA 1JUEA 2ATMA 1W32A 4BI5A 4UFKA 2OSXA 4WRHA 2DZPA 3C2YA 3B0VC 4UOZA 3CS2A 4R7OA 1IZKA 2ZC8A 1GJPA 1NWTA 2VCCA 2JF6A 4E8DA 1YX1A 3H26A 4IL2A 4FNRA 3CZKA 1E9IA 1H51A 2WM1A 6ALDA 1SZGA 3MI6A 2WSQA 4GC4A 1C8VA 2YGYA 4UQEA 4IMGA 1AQHA 4FXSA 2BXYA 4JICA 4C6QA 2QS8A 4Q33A 1UKQA 1VEMA 3OGVA 4GIYA 1DBTA 3MUAA 5E0FA 2J13A 2VFGA 3GDTA 2EPHA 1YPXA 1XYFA 5GVJA 3DKLA 3WZ0E 3KHJA 4GI8A 2P50A 3LSCA 5JIWA 1XG3A 1ENUA 4IL0A 5DANA 3TYCA 3WQFA 3RHGA 3QZEA 4PTWA 4ZE4A 5HUPA 3AXXA 5CPOA 1UZHA 4C6KA 4LC8A 4DJDA 5J8LA 3DHPA 4RZ4A 4XQ6A 3W81A 4X61A 2CXEA 1VFMA 5CAKA 3TU9A 3SGGA 1A4MA 1XDLA 4K2SA 4DWDA 2VC7A 1C8XA 1P0KA 1W1ZA 1QHPA 3OZMA 1UD4A 3NVDA 3M0XA 4PSPA 3I10A 2IKIA 3QLLA 4LQ1A 2INZA 1BTCA 2EJ1A 4UTWA 3ARWA 3BAWA 3RM4A 3TKFA 3LCXA 5DX7A 1G4TA 3TE9A 4WKFA 3GUWA 1XBVA 3QM3A 3LLDA 3ITYA 1XLFA 3SM0A 3V35A 2E3ZA 2HS8A 3QFEA 2DJXA 3A5VA 4M0XA 1H7PA 2WKJA 3GXFA 3QBUA 4LB3A 4BEUA 3WG6A 1E1CA 4DM1A 3SCQA 2VRQA 4MKNA 3F5JA 1SMDA 4GI6A 2CKSA 3RXZA 2AKMA 5ABHA 1H09A 1K02A 4P8VA 1JCLA 2XWDA 3KEHA 4JTLA 5FEZA 3H2CA 1XDMA 1O12A 3N2OA 1HFBA 1X96A 3AIVA 1OGBA 3LHTA 1JPMA 2BOEX 4MG4A 1WX0A 4PTMA 2PWFA 1WAWA 3KOYA 1F3WA 2YLAA 5HR7A 1F7BA 3VIGA 4Z1AA 2E67A 4G6CA 4M6UA 2PRHA 1AH3A 3NSNA 4MM1A 1KFJA 4NZ4A 4QSFA 3N13A 5I77A 1JPKA 1HW6A 3B0PA 1M3UA 4I7WA 4O8RA 4JFUA 3FX4A 4P7RA 1SU5A 3SDOA 5JIPA 1JG9A 2QCLA 5CH9A 4RKAA 5I7GA 1BYBA 4O4WA 2X41A 4GI4A 1DWJM 1NARA 3IJ8A 1K70A 4UTMA 2VDIA 1EJRC 4FOUA 4O8AA 4KEUA 3A23A 4GYJA 2WO5A 4LF2A 4QE1A 3RLGA 3GDBA 1TREA 1R3TA 3MWCA 2ZUTA 2QLYA 4FLSA 1G0CA 5AC6A 2YDAA 5H8MA 3UQNA 3RAOA 1IIHA 4N4PA 4I9AA 2P3ZA 4DJFC 4F2TA 1ODUA 3UG5A 2GVJA 1LQ2A 4D2JA 5BZAA 3PVFA 1GVEA 2O9OA 3PWAA 4LBRA 3GG7A 3RRXA 1QNPA 2OZ3A 1UWRA 4W4QA 3ZT6A 1J0IA 2C1GA 1BYDA 3C2FA 1WE5A 3WK1A 2QCNA 3A24A 4AEFA 2E8ZA 4LU0A 3EDEA 1JCYA 1PIFA 4P61A 3B8VA 1UA3A 2A2IA 4WJ8A 1L6WA 1BSLA 1DJIA 1PYMA 3OZYA 3G1FA 1NDWA 2POZA 3DKJA 5IDIA 1HKMA 5G2IA 1TR9A 4DPPA 4IUOA 1OFAA 1O5KA 4OUIA 4ZB5A 3MZNA 1FKWA 3WJZA 4NHVA 1IEIA 3AHTA 2CZVA 3W86A 1BXNA 1G7UA 1PS9A 1AQFA 1E40A 2AL2B 3PSWA 4JIPA 1ZP3A 4TX8A 2YCLB 3PTMA 4GX8A 1BD0A 3GIPA 4YWSA 1EUAA 1LT7A 2PTDA 3ZJ6A 1YTKA 1BKHA 5MHBA 1RQHA 1WB0A 3DH7A 1Q5MA 2OX4A 1WXZA 4YVXA 1J10A 3LCLA 4QS6A 3QRHA 3WLHA 1CDGA 2H90A 2X1RA 3WL1A 1U1UA 1VP5A 4O17A 3IUDA 4AUBA 2J7BA 4Q8VA 1OF8A 3L4ZA 3DHFA 4GQRA 4IIFA 2WHJA 4DBUA 5MKGA 3A9BA 5F2GA 2HSAA 1V6XA 3CT2A 4US5A 2IQTA 4OUEA 2Y5EA 4WUIA 3FN9A 4RV3A 5GPRA 1BSIA 2QJNA 3W1MA 1VRDA 3QV7A 4JEJA 1H50A 4AD0A 2HS6A 3GK0A 3ZLHA 1DWFM 1OFRA 2WXDM 4XZBA 3MUIA 4OV4A 3O06A 4G1KA 4ENLA 2Z1SA 1S5TA 1H0GA 4NXKA 1OCQA 1S2TA 1FDZA 2WQPA 3IIZA 4K6AA 3DUGA 1LG2A 4I6KA 4Q6XA 1I2PA 4GZJA 3S1WA 3FSTA 5A8GA 4R7WA 4NKCA 1XQKA 3BV4A 3FVMA 3UPMA 1LOSA 1B2YA 1H5VA 1ZPTA 3P82A 1OY0A 1LG1A 3D46A 4Z42C 2A3HA 5FIPA 1G67A 4K38A 1JNEA 3OQEA 4MWAC 4AC1X 4F0HA 3WN6A 3TA9A 3CL8A 4DBDA 3CAQA 3U8GA 4IPIA 4UNKA 1J5TA 4ZA0A 3A12A 3LCIA 4N6FA 2GFTA 3OQ8A 3TSDA 2Z4GA 1XCFA 1E4IA 3OHMB 3PZVA 3I3BA 1QDSA 3PUDA 1ZAJA 1R7AA 3MP3A 4KEZA 4XISA 1UP2A 4ERAA 2OLAA 3PAOA 3VKAA 3V1HA 1UC4A 3BWWA 2VRKA 3L67A 4DX3A 2PDBA 4KCWA 1XC4A 3LOTA 3TVAA 5LIXX 2Y0FA 2UZ9A 4LWWA 3BQ5A 1XUZA 3R7MA 2IPWA 2NT0A 3LB0A 4GO8A 5E1QA 8TIMA 3BCJA 3KS6A 3BSGA 3ITGA 4Z2GA 2ACUA 3EWZA 1XYBA 3P0WA 4EPDC 3BLPX 4UTKA 1GVRA 1TJPA 1D2KA 1O7AA 3QOKA 3S46A 4CU6A 2WHKA 2BODX 4X0NA 3QY8A 2VUYA 3WLRA 1US3A 4FI4A 3RRAA 3AHVA 3TNBA 2DGAA 1XLHA 1W5MA 3LPPA 1NWUA 2YDSA 2PU1A 3E49A 1FXPA 1SR9A 4UNLA 3B4YA 3EDJA 6ENLA 2HNHA 2OOFA 3AXIA 4MTVA 2CBIA 2IKHA 2DUAA 1KTBA 5BYWA 1ADDA 4X63A 2PDWA 2H9AB 1C7TA 1JI2A 1V3JA 4BF7A 2J62A 4PB4A 3R1ZA 2NXHA 3AUOA 4UIOA 4U33A 7PTDA 1SFSA 1TRDA 3NQGA 5LSMA 1GHRA 3AXMA 4AZ7A 1IEXA 3BOLA 4DF1A 2Y85A 3CV6A 1R2TA 2EJAA 1U5JA 3EOOA 4EXBA 2YKKA 4W89A 1QNVA 2A7PA 3R8RA 3WK2A 2R1NA 3B05A 2GDUA 4GUGA 2NVAA 2VVSA 4UTWC 4HU3A 4Q8PA 2VGIA 2DIJA 5DT5A 3N2TA 3B40A 1B4EA 5EFFA 5CPTA 5BXRA 1Z69A 2VCAA 3QSTA 3TC6A 3E0WA 3VZXA 3T1GA 3U7BA 4H41A 2KZHA 3QQWA 5L6UA 4TOQA 4H9TA 4WD0A 2PEVA 4ZSUA 1E4MM 1Q4NX 1LM1A 4IGNA 3SRKA 3GHSA 2ASHA 3GIQA 5AVNA 3K13A 2RH9A 4F0SA 4DI8A 5I03A 2QDEA 1XD0A 5H1WA 1UKSA 2ACQA 3TYDA 3EZ4A 1HN1A 4O1AA 4YS1A 4YTSA 2BY3A 1N8WA 1P0NA 1JZ6A 4XAZA 3R13A 1GPFA 1M7PA 5KITA 1XICA 3VILA 1M7XA 4JTQA 4MNMA 3M0LA 1M7OA 2HBXA 3UXKA 3B4UA 5CGTA 3S1VA 1EGMA 1FWCC 5FSEC 1RK6A 1QAPA 4IJCA 3QYSA 3O0FA 4WXZA 3TAOA 2ZRYA 4RJEA 3F4DA 3HOJA 4ATLA 1RALA 3WLMA 4LOCA 2TMDA 2AOSA 1GOQA 3P5ZA 2F6XA 3G77A 2VEPA 2PGEA 1GKQA 4GIEA 4KCTA 2GGGA 3KVLA 4FOKA 2CYGA 2EHHA 4KS0A 3LRLA 1RVGA 3R6IA 3R10A 4PC8A 3EX1A 1CGXA 1KXVA 4DWSD 5A5WA 1JF5A 2ZA1A 1YXCA 1JNDA 3BGJA 1OC5A 5CEWA 1IT0A 3C0JA 1NFBA 3FHQA 4IQEA 2ISFA 2BHUA 2CZDA 4CD7A 4BI7A 3N6HA 2TPSA 5HPCA 1MQRA 4LAOA 4L61A 4I90A 4QEEA 2J27A 5FI8A 1VBUA 1ZENA 4F2BA 1UC5A 1KFKA 4NQ1A 1UR4A 5HMDA 3K8LA 4GABA 2Z27A 3BSHA 1V79A 2DSKA 3HF3A 3PBGA 4MF4A 1XKJA 3VD3A 1LDCA 3CUXA 3H21A 5FL0A 1UG6A 5I6SA 3BC9A 3CHDA 3IVUA 4PBGA 3VGDA 1RCQA 4KWVA 2Z1KA 4MJMA 4PB3A 2ZKMX 3GVQA 2Y1HA 4LX4A 1GW9A 2EPLX 5G4HC 1W9UA 3O6AA 3AHXA 2Z28A 3LHWA 1OD0A 1DWAM 1V02E 3HPFA 5KZDA 1TE1A 3MHUA 4NRSA 1CYGA 3THCA 2F7FA 4L7ZA 1XV8A 3PB0A 4KEMA 3BDKA 2EKCA 1N7KA 1EF3A 2D69A 3T0TA 1D3CA 1I8JA 4JTKA 3C3NA 1TPWA 2G5WA 1ZJHA 3ZT7A 3W83A 2J8GA 3WIJA 5D37A 5EB8A 4XBKA 1GOWA 3MKCA 5B7ZA 4H6RA 1D8CA 1TPUA 4NNCA 3VMPA 4Q8NA 3V5OA 3HU7A 1SO5A 1B1YA 3UR7A 4NJGA 5I0DA 1MEIA 1TV8A 5AC7A 4EXAA 3SCOA 2ZX6A 3MSDA 2J7FA 4CN6A 2FHBA 5M5DA 5K9XA 4EWND 4XTIA 3UYIA 3GD6A 3J7HA 3UZWA 1DVJA 3W1UA 3S9ZA 5D04C 5H8UA 1LZOA 1VAHA 3O63A 4PBEA 3I3EA 4I3GA 2P8BA 3ITVA 4JFTA 3QF0A 3MSRA 2GWGA 3O6YX 3SY1A 4CNTA 1E1CB 3BSMA 4LVGA 2J66A 2VZTA 4GUIA 3W1RA 2W62A 2XVKA 3TYZA 3BV7A 2NSXA 1L6FA 1H0IA 1LWIA 3I7RA 2TODA 4JTEA 4AYGA 3RITA 5EMUA 1UD8A 2PWUA 4W8BA 1PX3A 3LQGA 1W5NA 1FTXA 3FCPA 5LNRA 1NWRA 4J2PA 1V3LA 2PRMA 4LRTA 2DW7A 1A5LC 4QG6A 2OT1A 4MLJA 4P8UA 4QJ4B 4GH1A 1BEUA 4NI3A 3U57A 4AC7C 2XIQA 4H7CA 3ARYA 5I3HA 4FNQA 3D3AA 4HK7A 4B3ZA 4WY0A 3VM5A 1EP2A 3RLUA 3CAKA 1M6JA 2FJUB 2WC3A 3TZNA 3R8GA 3GTNA 4XB3A 1HJWA 4QITA 3N4EA 5A1AA 1KM6A 3C0QA 1XBXA 4H8VA 3KWSA 1ZJAA 2XVPA 1JZ5A 1KD0A 1QCWA 1Z41A 3ARXA 2ZYFA 3GLCA 1GHSA 4V15A 3TAKA 3C5QA 4NJHA 2KX9A 5D33A 3H4XA 3W70A 5DBTA 1FWJC 1MNSA 2ATSA 4GVFA 4EOUA 2OB3A 1MUWA 3AS2A 1UOZA 4CNUA 1EUNA 4ZXLA 4AWSA 5HNRA 1O94A 3W23A 4IXXA 5LGZA 2PDKA 5C2XA 3VIFA 1ZS2A 3FEQA 2YB1A 3PBYA 1WXJA 3T07A 5DELA 3STFA 3W7NA 3RM9A 3I65A 3WD0A 4YIWA 2JK2A 3QH2A 4GVGA 1FH9A 4HA1A 3ZXWA 4LUTA 2HCVA 1KLYA 4Z0JA 1V77A 1BQCA 3NQEA 4Z2JA 1YIXA 3M41A 4Q4SA 3OO2A 3TOYA 4PUUA 1TPFA 5EMLA 1J6OA 4YXGA 2BX7A 2OO0A 4GD0A 4AMAA 4MNJA 4W93A 3MMUA 4DJED 3WQEA 2WVVA 1GQJA 1ZJBA 3NL2A 2PZ0A 3BK0A 2PURA 3BG5A 5I23A 1I0BA 5HWJA 2PDIA 2ZUMA 5H91A 3KE0A 1RA5A 5CZ0A 4ZVJA 4D6JA 3N15A 4FA3A 4QDMA 2GUUA 3GDRA 1IXNA 3RO6A 5AB3A 2FPVA 4HPGA 3JVAA 2OGJA 4PA8A 2D3LA 4JHZA 2D2HA 2YCIX 5HQMA 2PD9A 5MKGB 4AIUA 3QR0A 4IIDA 2P5NA 4EX4A 1RJRA 3BQ6A 2POTA 4AG0A 4Z17A 4R9XA 4HQVA 4DYJA 1GQIA 4J40A 4A3QA 1J0HA 1FHVA 2WLZA 1W3NA 3M0HA 5AHFA 1XGZA 3OU8A 1EB3A 3BE7A 4B91A 4HYWA 4GI9A 1EDQA 4JYEA 1NH6A 5K4ZA 2C0HA 3CQ0A 2CIPA 5DCEA 4FX8A 1U33A 4S3FA 1OWQA 4S39A 1AJZA 3QZAA 5D30A 1B31A 1VZWA 1ZAHA 4OZOA 4M1BA 1UD5A 2CBJA 4KWOA 2VT0A 3SZ8A 1WZAA 4DAIA 1EA9C 1F76A 2GSJA 3CYJA 3HM7A 3IGXA 1JYNA 4UQ9A 3MA8A 5AYYA 1QHZA 3NR0A 4B5XA 1XI3A 4PEEA 3CTLA 4ACZA 3H2MA 4QXIA 2X8RA 2OZTA 2TYSA 3MW7A 3SCWA 3CU2A 3USZA 4D6EA 4DZHA 5EBUA 3BGAA 4YL2A 1HGYA 3DFTA 4EANA 2EG7A 3QW4B 3VPLA 3SFWA 3IPWA 2V2CA 3GNXA 3TQVA 4DAFA 3MYOA 1MXGA 2E28A 2PDQA 1OX5A 3UR8A 2HK0A 2WMIA 5D8WA 4AMCA 4J3SA 4ZEPA 5EPDA 2V3DA 2VEFA 1F07A 3W1NA 2PMQA 3USBA 4GG9A 5TF0A 1NWSA 1R38A 1X8FA 3FGCA 1A50A 1EZWA 3UJFA 3H6OA 2XGIA 3ZLGA 5I06A 3TDFA 3QKZA 1S2AA 2QV4A 4XG1A 2FHFA 4W8AA 3R0UA 1EF2A 2QGHA 3UVIA 4XWUA 5FF2A 1VJSA 2E1WA 4BQ5A 2QR6A 1IEWA 4M80A 1QRQA 1FWRA 3L4XA 1TWZA 1QASA 4G1NA 2WBGA 3RN6A 1J0JA 1OD8A 2B7QA 1KQYA 4U4MA 1HT6A 1MXSA 5EU9A 1K7XA 4NNBA