1ITQA

Human renal dipeptidase
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
369
structure length
369
Chain Sequence
DFFRDEAERIMRDSPVIDGHNDLPWQLLDMFNNRLQDERANLTTLAGTHTNIPKLRAGFVGGQFWSVYTPCDTQNKDAVRRTLEQMDVVHRMCRMYPETFLYVTSSAGIRQAFREGKVASLIGVEGGHSIDSSLGVLRALYQLGMRYLTLTHSCNTPWADNWLVDTGDSEPQSQGLSPFGQRVVKELNRLGVLIDLAHVSVATMKATLQLSRAPVIFSHSSAYSVCASRRNVPDDVLRLVKQTDSLVMVNFYNNYISCTNKANLSQVADHLDHIKEVAGARAVGFGGDFDGVPRVPEGLEDVSKYPDLIAELLRRNWTEAEVKGALADNLLRVFEAVEQASNLTQAPEEEPIPLDQLGGSCRTHYGYSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Human Renal Dipeptidase Involved in beta-Lactam Hydrolysis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords RENAL DIPEPTIDASE
total genus 149
structure length 369
sequence length 369
chains with identical sequence B
ec nomenclature ec 3.4.13.19: Membrane dipeptidase.
pdb deposition date 2002-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01244 Peptidase_M19 Membrane dipeptidase (Peptidase family M19)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1itqA00
1K6WA 3F2BA 3MSRA 1UIPA 4DYKA 4ICMA 3LNPA 3A3XA 3PBMA 3FDGA 3GU1A 1A5OC 4C6FA 3AUOA 4QS6A 4XD5A 1RA0A 4C6KA 3RN6A 3E2VA 2I5GA 2Z2BA 4EPKA 2XIOA 2HBVA 2VC5A 3OQEA 1KRAC 1M65A 1K70A 2ZC1A 4H9VA 1PB0A 4KEVA 2QT3A 3JZEA 4H9UA 1WXZA 2HNHA 4F0RA 3DUGA 4RDWA 4QTGA 5E5CA 4L9XA 1NDYA 4CNTA 4PBFA 3TN5A 4KERA 2WJDA 4CQBA 4EPEC 3O7UA 3NEHA 2ICSA 1KCXA 4BJHA 2WJEA 3IARA 2AMXA 3S2JA 4INFA 1EZ2A 3E74A 2D2HA 3RHGA 3ICJA 3T8LA 1A5NC 4IGNA 4LCQA 4CNSA 4DZIA 1FKWA 4OFCA 1ADDA 3QGKC 2R1LA 4LFYA 4H9ZA 3IJ6A 3MDUA 4QS5A 4LCSA 3URAA 1EF2A 3TN6A 1FWHC 4C60A 3PAOA 1QW7A 4C6OA 1M7JA 2VM8A 4LEFA 1XGEA 2HBXA 1A5MC 2RAGA 3LA4A 4IGMA 1J6PA 1PO9A 2ANUA 4H00A 4GYFA 4HK7A 1KRBC 1R9ZA 2OODA 4C6PA 4IF2A 4B3ZA 3URBA 1V7AA 4J35A 1I0BA 3LGDA 3GUWA 1HZYA 3C86A 4YIWA 4C6JA 1RA5A 4WVXA 1ITQA 4XAGA 4CEXC 4DLFA 4G7EA 2GZXA 1FWFC 4LANA 3NURA 4C6BA 3GTFA 3B0XA 4G2DA 1EJVC 4AQLA 2UZ9A 3MPGA 2O4QA 4J5NA 2OOFA 4HK6A 1EJUC 2DVTA 4GX9A 4DIAA 4DNMA 4IQJA 3T1GA 4GOAA 3MVIA 4IFKA 3EWCA 4L6DA 1XWYA 3CS2A 3LSBA 2Z27A 3AU6A 3F2DA 1YNYA 4ERGA 2P50A 4B91A 4H01A 4KEZA 3OJGA 2PLMA 2E1WA 2Z28A 1V77A 3OOQA 2KAUC 1V79A 4H9MA 4GC3A 1M68A 2UBPC 3PANA 3HPAA 4D8LA 2Z26A 2A3LA 3CJPA 3E38A 3R0DA 1PTAA 1P1MA 2R1MA 2WJFA 4BY3A 1J79A 1J6OA 2DVXA 2PGRA 3UR5A 4IFKB 3K4WA 3GTXA 2YB1A 3WYZA 3K5XA 1A5LC 3G77A 3HM7A 3ORWA 4CQCA 4QSFA 3GU9A 3N2CA 3BE7A 2Z2AA 4JOMA 5FSDC 1V51A 3PNUA 5G4HC 4RDVA 1K1DA 4KQNA 1GKRA 1FWGC 4WHBA 3URNA 1YBQB 4XAFA 3ISIX 1RJQA 4PCNA 4LAKA 2PGFA 1POJA 2BGNE 3F2CA 3QY6A 4IFRA 3QGAC 3IPWA 3WMLA 4KF1A 4C6DA 3TNBA 2QVNA 2VC7A 4PE8A 1RAKA 1POKA 3GG7A 4RE0A 4TQTA 4J2MA 2FVKA 4PCPA 4HK5A 3GTIA 3IACA 3O0FA 1ONWA 3OODA 1IE7C 1PSCA 4KETA 1FWCC 1S3TC 1FWEC 4DZHA 1YRRA 2EG7A 3URQA 4CQDA 3CAKA 1JGMA 4V1XA 5HMDA 2GSEA 3OVGA 2Q01A 3UF9A 1RK6A 1FKXA 1XRTA 4LAMA 3F4DA 1UMLA 2Y1HA 1NDZA 2DVUA 4GBDA 3E0LA 2WM1A 4P5UA 4ERAA 3UR2A 3FDKA 1V4YA 1KRCC 4QROA 1EJRC 4C6EA 2GOKA 4GY7A 1A4MA 3K2GA 4ZSTA 2Q09A 1EJWC 1EJTC 4EP8C 2OQLA 4EPDC 1NFGA 2GWNA 2Z24A 4PBEA 2Z25A 2OGJA 2PUZA 1YBQA 3E0FA 3MVTA 2FTWA 3OU8A 3B40A 4C6MA 2D2JA 3F4CA 1VFLA 2R1NA 4ZSUA 3RCMA 2I9UA 4C5ZA 1EJSC 4NI8A 2W9MA 4LAOA 2FFIA 3UPMA 3S2NA 2EG8A 2YZ5A 4F0LA 1NDWA 4KESA 3TN3A 3UBPC 2G3FA 4LALA 4XAZA 4LH8A 1R9XA 1FWBC 4DO7A 4DI8A 2EG6A 1E9ZB 3E3HA 3ITCA 2Z29A 4C6IA 2R1PA 1FWDC 2YB4A 3S2LA 3GIQA 4V1YA 1ZZMA 2QS8A 4DLMA 4C6QA 4C6NA 4CNUA 2GWGA 3PNZA 5LXXA 4XD6A 3GIPA 4ERIA 2AQOA 1YMYA 4GZ7A 4RDZA 3SO7A 4GX8A 2QPXA 4GY0A 1W1IE 4XD3A 2Z7GA 1YIXA 3DC8A 1R9YA 3S4TA 4AC7C 1P6CA 3MJMA 4UBPC 1WXYA 3GTHA 4MUPA 2O4MA 1A4LA 5AKQA 4Z42C 3HTWA 4E3TA 1KRMA 3SFWA 3MKVA 2IMRA 3TN4A 4C65A 1ITUA 3LS9A 2VHLA 3IV8A 1P6BA 1FWIC 4G7EB 4XAYA 3D6NA 3MDWA 4R88A 2R1KA 4KIRA 4H9XA 2FVMA 4C5YA 2ADAA 4CEUC 1RK5A 4C6CA 4F0SA 1FWJC 4M51A 4R7WA 2P53A 5FSEC 4NG3A 4H9YA 1I0DA 4DI9A 1EJXC 4RZBA 3LU2A 1RJRA 4IFOA 3IGHX 4KEUA 3QY7A 1DPMA 4IG2B 4R85A 1UIOA 2CZVA 5CH9A 1GKPA 4IG2A 1E9YB 3S2MA 3KM8A 4H9TA 2OB3A 4B90A 1ONXA 4GY1A 2HQAA 3A4JA 2HPMA 4GXWA 4BKNA 4HJWA 3V7PA 1BF6A 1O12A 2PAJA 5HMFA 4UB9A 2Z4GA 4I6VA 3AU2A 3ID7A 1UBPC 3GRIA 1O5RA 3T81A 1J5SA 4C6LA 1FWAC 1RJPA 1NDVA 4NP7A 3FEQA 4WGXA 2YXOA 4QRNA 2BB0A 3B0YA 3MTWA 1EYWA 2HPIA 3A3WA 3QY8A 4I6KA 3LY0A 2VUNA 4GK8A 4EPBC 3RYSA 2VR2A 3GU2A 4LCRA 5HMEA 4RDYA 2D2GA 1A5KC 3LSCA 2AQVA 3WZ0E 3IRSA 1QXLA 3LGGA 4HA0A 4IH3A 1XRFA 2F6KA 3DCPA 4XD4A 3NQBA 4B92A 3EWDA 2FTYA 5A6TC 2E25A 1GKQA 3EGJA 2Z00A
chains in the Genus database with same CATH superfamily
2QUNA 3QN3A 2EXOA 1DJYA 3H54A 2R24A 1LG2A 2QMKA 1JAEA 1Q7QA 4AWTA 1JCLA 1XLHA 5B80A 1AH4A 4JYFA 3TVAA 2ODOA 2FB2A 4NNAA 2BBFA 3GE7A 1T8XA 3E2VA 4J7RA 1FY6A 5D32A 2CBUA 5D30A 3CHCA 1KRAC 2DDXA 3DIPA 2QT3A 3B9OA 4DUOA 1B5TA 4RDWA 3WNOA 1BGAA 4P7RA 3STPA 4CNTA 3SFKA 3WLKX 1OK4A 3RRXA 3NEHA 4L4OA 3O07A 4BJHA 2AMXA 1QNQA 2CKSA 3OBAA 4DEFA 2BVTA 4AZBA 3NSMA 3WKZA 3LM7A 4IGNA 2I5QA 4NAEA 4Q4KA 1V08A 2QCHA 2X42A 3DFNA 2IXVA 1GJUA 1PKMA 3AZSA 4ATLA 3NXLA 3VM7A 4J27A 2J47A 3UWVA 1RLCL 5EFDA 2CEQA 1MQQA 3AS3A 5FJTA 5EL1A 1TPH1 2TYSA 3B04A 2OZTA 1V7AA 2AGTA 3NO5A 2A0NA 1Z44A 3LPPA 3B8TA 1CXFA 4XAGA 2QPUA 3H55A 4Z1DA 4IQLA 1TWIA 1FWFC 4DELA 2CKRA 3OLIA 2Q71A 5CSRA 4DM2A 4QG9A 3GDRA 6ALDA 3FA3A 1TWSA 3V3WA 3W7DA 5AZ1A 2XVGA 1UZ4A 1RP8A 4FLQA 3ARQA 4H7CA 1F73A 4HK6A 4DUWA 1TPB1 2O56A 1DJQA 2C0AA 1UWTA 3AYSA 4WJEA 5EMLA 4K1WA 4GD0A 1KLYA 3TWBA 2DSKA 3DFSA 5AHNA 1PUDA 3AAMA 1JCXA 1LCOA 4TV6A 3OVPA 3GHRA 1MW1A 3RO6A 4QGCA 3QLDA 1H7OA 3SCUA 1MUCA 1W9VA 4LVAA 3DERA 4D8LA 4Q7IA 2I57A 5EA9A 3KOXA 1MDLA 3CJPA 3SI9A 3GO2A 3H2EA 1REQA 4LYQA 1JF6A 1YTDA 1K9FA 1AZ2A 1JDEA 5REQB 1FWSA 2QJHA 3GXMA 4S2CA 4CD7A 3OZMA 3ORWA 2WCSA 4DBDA 4OUEA 4W86A 1GGOA 4F4RA 1E15A 1LL4A 4PR4A 2X1UA 3W24A 4UOQA 3TC6A 1LTDA 1Z32X 3QGAC 2J8TA 4ZQRA 3BC9A 3SR7A 3DFYA 1WA3A 5DQPA 1JZ5A 4LU0A 4RE0A 2WPGA 4YTQA 1GVIA 2J7BA 4HK5A 4RR4A 1YADA 1HTIA 2TRSA 2POZA 4A4AA 3UGRA 3UU0A 2Y7DA 1EPVA 4WSHA 3HV8A 3L5AA 2QUVA 4OBRA 4LGXA 3EX3A 2CLIA 1UMLA 2R14A 2FZBA 4P5UA 2WM1A 5I3FA 1Y5XA 4P7NA 4PMVA 2YFNA 1VBJA 2FGZA 2BV9A 3CEUA 2NQZA 4GY7A 3O6AA 3IIVA 1TJ0A 3ARTA 4ZXOA 2J75A 1L8PA 5HXMA 1P7TA 1UKQA 1KFWA 4Q8UA 3R94A 3ARWA 3RCMA 1HF6A 2Y85A 4C5ZA 4RW5A 1G67A 2EG8A 3UY8A 4O0ZA 4REQA 4AZIA 1GWJA 4F0HA 3AISA 5T91A 2VZOA 1KCKA 4PMZA 2ON3A 1BSIA 3V1PA 1ISWA 1MQPA 3CB8A 1FVPA 1PDZA 2VR5A 3TU9A 3H6OA 4GUFA 1EHNA 1KFCA 1C8QA 3CZJA 2OO6A 2ZZ6A 2AQOA 3BQ5A 1DWFM 4I9JA 4GJJA 4UWMA 4AYSA 1K3UA 3DC8A 4QFUA 3HG3A 4NRRA 3KAOA 1MXGA 2DEPA 1PZ2A 2PCQA 2QDEA 4GHRA 5FJPA 4K7YA 1LYXA 2BVDA 3VNLA 1PZ1A 1UOZA 2YBUA 1UR8A 2GJXA 4Y8FA 1V0NA 2OWCA 5BOEA 4ZB2A 4YVVA 4FOKA 4C5YA 1NH6A 3UY7A 1QTWA 2P76A 3MO7A 4DI9A 3I6EA 5AYZA 3S5NA 1T0OA 1F3WA 3VOJA 3GYEA 5M1TA 2C18A 1EGMA 2WPBA 2HVOA 3B8DA 3KP1A 2HVNA 2HQAA 4J40A 4O19A 4Q8NA 2DV0A 4X2PA 3RU8X 4A2RA 3A5VA 4FALA 2AL2B 2IW0A 1WKFA 2TPSA 2PU0A 1YNQA 5HMFA 2Z4GA 4PMNA 3HPFA 4XKMA 5U4NA 1GPWA 4ZA0A 1EP1A 3G1RA 1XC6A 4CVUA 3BJTA 3W1TA 3W25A 3RR1A 4MWAA 3GU2A 3MYPA 4C1NA 2XN0A 1PTDA 1H50A 3FV9A 3R8GA 3LSCA 3IRSA 4UR8A 1FCQA 3GFXA 3BV7A 4HYWA 4D6CA 1XUUA 1JNEA 1VPYA 3S42A 1WCGA 4TX6A 3AXIA 2CESA 2CXEA 4NHVA 3K30A 3DG7A 1ZTVA 2QCCA 4B5TA 4E8CA 3RG6A 3PWGA 1UBSA 2GK1B 4IP5A 1KFJA 4Q8MA 5CPMA 1TV4A 5LSMA 3NDYA 3GU1A 1R46A 2J24A 2OTDA 3GDLA 4X2RA 2VFEA 3RAOA 4RPQA 1HGWA 2HTMA 2VT0A 3SSZA 2RDTA 1ELSA 3DDMA 4DY1A 3NL3A 1WXZA 3SECA 3P74A 1WUFA 4QITA 5CPLA 3UG8A 3O7UA 3F5LA 1ISVA 4PZVA 1Q6OA 1SM9A 3JS3A 3TSBA 4RXFA 2DT2A 1WUEA 1ADDA 2DUXA 2GVLA 1ITXA 4LFYA 4H9ZA 3FVMA 4B9YA 3SCTA 5KSWA 4QJ3B 3TN6A 1PX4A 1B9BA 3H8AA 4D6JA 5I79A 1SW7A 3P2VA 3AMDA 4X22A 1JD7A 5CSSA 1UA3A 1MQRA 3HQNA 3WLRA 1R9ZA 1W3TA 2WOQA 3TROA 3N9SA 1B4EA 4KCUA 4MB3A 1ZSXA 3WQ5A 4DLFA 3HG2A 4S3JA 3FN9A 3MUAA 1Q65A 1QAPA 4TIMA 4KBXA 5KZ6A 5PTDA 1Y8BA 2WMIB 4X0NA 2PF8A 4I7WA 4Q3MA 1EJUC 1VYRA 4DNMA 2VQTA 3O6CA 1R3QA 1JYNA 3EPMA 3ABSA 1R0MA 3I10A 3NQDA 4J3XA 2FDMA 3NQ6A 4ADUA 3ZR4A 1XLBA 4QISA 1AZ1A 4GA8A 4G1KA 1XICA 1OFEA 5E0KA 4RLIA 4FS9A 2PDUA 1IXNA 3N9RA 3N15A 3E38A 3QR3A 4EXAA 1P1MA 1WX0A 2Y2WA 4BF9A 1RVGA 1FFRA 4YTRA 5LHEA 3BAXA 3HM7A 2PGEA 5CGMA 3HQOA 2CXGA 4QX4A 1JZ4A 5JBFA 1DBTA 3VIJA 3W38A 1W5PA 2WWCA 2OMAA 3VMNA 1K1DA 4KQNA 1YBQB 2Y70A 3DG6A 4CQ8A 3QXBA 1DOSA 4L1XA 1ZJBA 6XIMA 1POJA 5D8ZA 2FVLA 5FEXA 1UD6A 4PA8A 3PSVA 1N82A 4ACZB 2YL5A 5HNRA 2DZBA 1IZCA 3CAVA 4TQTA 4JBRA 2RHGA 2FZNA 5FJRA 1MNZA 2CBJA 4HSHA 1JD9A 1OM0A 1S3TC 3DFHA 4L9YA 4LS2A 3WBAA 4CQDA 2XG9A 1TA3A 3TLQA 3BW3A 3UF9A 3V75A 1XRTA 3KP0A 5HJXA 4JTRA 1X8FA 4Y96A 5REQA 4HNOA 4PUMA 3NFUA 2J7GA 3GXPA 1GUVA 4YPJA 4JIRA 4WY0A 4O12A 4DWSD 3C2RA 4JTKA 3ITGA 4AD5A 4EPDC 8XIAA 3CH0A 2GWNA 1OWQA 2Z25A 3CASA 3NQGA 5AC6A 2FTWA 3L65A 4QLKA 3HGJA 4E5TA 5LIYX 2I9UA 4NY2A 2GJPA 1SSDA 3TN3A 1MUMA 3Q4DA 2WK2A 5EBUA 5HAOA 4AXNA 2P0IA 3N11A 3WBYA 3QHMA 3GR7A 3KEHA 4QXIA 1SO3A 3QOMA 2NX1A 1ZZMA 4YTUA 5DO8A 3PP7A 5B7ZA 2OZ3A 1N8IA 3APTA 1GOMA 3NUKA 1BFNA 3GNNA 4GQBA 1W1IE 4IPIA 5FF2A 1XH0A 1F4AA 2VCAA 2E5DA 3ES7A 4AC7C 3WK0A 2HZGA 1ICSA 1YEYA 2V6AA 4GE8A 4PTWA 4O4WA 4E2OA 3GDKA 1RD5A 3MKVA 2Y7FA 1XCXA 4RL3A 2VEPA 1G4SA 2DZAA 4NJIA 2Q8XA 2YBTA 2O7SA 2Z7KA 1TUFA 3EMQA 1E0XA 1QUMA 4R7WA 1VIZA 3WD2A 1UB3A 5FCZA 3CHFA 4WOZA 3NPWA 3ZM8A 3M47A 3DFTA 1QO2A 2VVNA 1XIMA 2WZMA 4L56A 1DVJA 1PL9A 1L0PA 4MMWA 1UIOA 1IEXA 1IT0A 2XWDA 1UKSA 4IG2A 4IP7A 2WSQA 3MY9A 2J27A 4XAPA 4BI5A 4LAZA 4PSRA 3MMTA 5G5IA 1A3WA 2JGQA 3LM3A 1J0JA 3B4YA 4N0RA 4XO6A 1UWRA 1WP6A 3AHZA 4XUYA 1ZB5A 4I6VA 4HB7A 4Y9MA 2GGGA 1A80A 3OHIA 1T99A 4D6IA 4JX5A 4YTTA 3UZZA 1NDVA 1U1UA 5D37A 5XINA 3FEQA 4MOZA 1TV5A 1E0WA 4WOQA 1W2VA 3K8MA 4KMQA 1H62A 3U48A 4K38A 2XIIA 4M56A 1LRTA 3VKAA 4RV8A 1US2A 1KKRA 2INZA 5ECUA 4B92A 3P14A 3S5OA 3STEA 5A6MA 3PB0A 1A53A 3AHVA 3BZGA 3LCHA 4L5ZA 4M6UA 4MJMA 3L9CA 3CO8A 5LHFA 4QCEA 5FJJA 1P0NA 4JTIA 1RZMA 3HJZA 3EA3A 1W32A 3NTYA 3UWQA 4JKKA 3UG4A 3PZIA 1MSSA 4XG1A 5U7SA 2IKIA 1E4IA 5M17A 5D38A 1QATA 1HQTA 3YPIA 3DUGA 3CQKA 1E43A 4QDWA 2VEFA 3VINA 2WJDA 3KHJA 3S2JA 4EOUA 2X05A 3R13A 2FPYA 1OFPA 3TC7A 4PEEA 3MV11 1JFHA 5SWUA 3NVTA 2EQDA 3KTCA 5FESA 3QSRA 1ECEA 1J96A 2FJKA 3PAOA 2CZEA 1LLZA 5IFPA 1PEZA 2PC4A 3W26A 2VM8A 1GYNA 2PDHA 1XGEA 2HXTA 2CWNA 1DP0A 4JIHA 3FHQA 5CXPA 3UZYA 4DX3A 4F66A 1UQZA 1QJWA 4JFTA 4C6PA 4RK8A 4R9OA 3MWCA 5DN1A 3URBA 4P8UA 2NUXA 5G1MA 2GVYA 2V30A 4N9EA 1HZYA 3OZOA 2VX7A 1XSJA 1U83A 3WDHA 3WLPA 1MW0A 5C9RA 3F5KA 4ZO8A 3W6LA 3EXSA 1YLVA 3AZRA 2WVSA 4K68A 1VAHA 3AS2A 3GTFA 3AS0A 4AWSA 2WVVA 4W7UA 4LBRA 4AQLA 4TUFA 2WVVB 1H7NA 3S9IA 3SB0A 1VH7A 3NYDA 3PZTA 3ZLGA 1UUMA 4LRSA 1FDYA 2OG9A 4OQVA 4FP1A 2V2CA 1KBKA 3RM9A 2Z28A 2OZ0A 3ECQA 2WC4A 1IT7A 4AZ7A 1UASA 5K4XA 1KM6A 2V82A 1X6NA 2ACQA 1EC9A 1RVKA 3KVLA 2VD8A 4PC8A 3PZOA 4MKVA 4KS0A 4XKYA 3NDOA 5AFDA 3WK3A 4CQCA 3OBEA 3UD6A 4HJFA 4WHBA 3FOKA 4KFPA 1TVNA 1XI3A 4NZ4A 4D6HA 2PF0A 4C1NB 1WZMA 2B7NA 2D23A 3DX5A 5IHSA 5HWJA 1ZPTA 1RP9A 5DBTA 3E12A 1QT1A 2V5DA 5LA1A 4PMUA 1MZRA 1V6VA 1H0GA 3M4HA 3C4UA 1IE7C 1UWIA 4GUHA 2XSBA 2OX4A 3KL0A 3U2ZA 2QUMA 1R3YA 2AGKA 3OZPA 3S1GA 2Y24A 1JGMA 4XZBA 4XTIA 5DMYA 3W29A 4W7WA 4MB4A 3KCJA 1BYDA 4PN2A 1L6YA 7ODCA 3A4AA 2BASA 2DVUA 3HFTA 3VGDA 2GVEA 4IX2A 3WQ8A 4LNCA 4JXCA 2H6RA 3SIZA 1UD4A 3F4WA 1P4CA 3LQGA 4PRWA 1JDFA 1EB3A 3S9YA 2RH9A 3TK7A 1A4MA 1RCQA 4C90A 4Z2JA 3BVJA 2UY5A 2VZSA 1RHCA 1GOQA 1LQAA 3IGUA 2AKMA 1P6WA 3W22A 2V5CA 3E0FA 2D2JA 2HV5A 3BARA 3BCFA 2P3ZA 1EJSC 3AYTA 2W9MA 3I3EA 4NI8A 5E93A 3BSHA 4IQDA 3C61A 2G3NA 3WQEA 3TAKA 4ZGYA 4BI6A 1SZNA 3OHMB 4IIGA 3H2FA 1BXCA 2RDXA 2Z29A 2MUCA 2YB4A 3ME3A 3MI6A 3DECA 1EX5A 3WX7A 3W2KA 2HRWA 1Q85A 1JDCA 4ZZ9A 3GIPA 1E6QM 2PWDA 4DAFA 1QU4A 1C93A 1F74A 3VD7A 1O1ZA 4ROQA 3O6DA 1XBZA 4JY9A 4A22A 1HJUA 1IEVA 4AZ6A 2VZUA 4MGGA 4AY8A 1U2YA 2J13A 1RPXA 4WDXA 4JNYA 1WAWA 2X1IA 1R3WA 3KOYA 4PMOA 1IR2A 1FQ0A 1CXIA 1QNOA 4OE7A 3H4GA 2C1IA 1W37A 3FXYA 4G7EB 4XAYA 4LUYA 3KW3A 3KLKA 5D2TA 4R88A 4M0XA 1N55A 4CEUC 2WMHA 3KBSA 4E8DA 3K13A 3AIBA 3VGEA 3E02A 4WDWA 1X7FA 3UA4A 4C1LA 1I0DA 1HX0A 3NQ2A 3WUBA 1MNSA 3RJXA 3E2SA 2NQLA 2J6VA 1Z48A 3QR0A 4JDYA 3W86A 1QDSA 4FF5A 3WF3A 4JS3A 4S1FA 3TQKA 4MNLA 1PWMA 4RJEA 2ZUUA 2XGBA 3OLEA 2ZDSA 3UXKA 4KPLA 4W84A 4FK9A 3GXNA 4NF7A 4CLMA 2Y89A 1OGGA 5CPOA 5DANA 3MSYA 1DQWA 3WFLA 5AHEA 4Z0SA 4TVUA 1ZRQA 3O2LA 5C71A 3SRFA 3WG6A 3W73A 2OLSA 3SSJA 1F4HA 4UTWA 4NU7A 4M24A 1H41A 4JGDA 3LGEA 4KRTA 3QYSA 1OGSA 4GXMA 3CUHA 3S83A 4B5XA 2NQ5A 4LC8A 1IEWA 2A79A 1IZJA 2NQHA 5EU9A 1K6WA 3BH4A 2FGBA 4PB3A 4H6EA 5G4WA 3ES8A 1VPQA 3UJRA 4DN1A 1XDMA 2CLHA 3CAQA 2XVKA 5RUBA 1H7RA 1EUNA 2OSWA 5HR6A 3JU2A 4U3AA 2X0HA 3DFOA 4A8LA 4V27A 1VEMA 1SR0A 3W72A 2OLHA 1W1TA 5E5CA 3MCMA 2DPEA 4ZTYA 3DI0A 1UP3A 3H7RA 1F3TA 3BOLA 1UKOA 3T78A 5EMMA 1FKWA 4L4PA 3QGKC 6CGTA 1JVNA 5JVLA 4HMNA 2Z1WA 2RGMA 2DJXA 2DSWA 5LKYA 4LCSA 3RMEA 4TV5A 1FWHC 1W9UA 4IMGA 1V8EA 3U2EA 4A8NA 2R91A 1QWKA 3VOIA 3CO4A 1E6RA 1VZWA 3JVAA 1PKLA 3PZMA 4RPPA 3N2OA 3EWZA 4I9TA 3OA3A 3FYPA 2OODA 3C52A 4Y9AA 3SGGA 2XHYA 2X1RA 3LGDA 1YW1A 5DCEA 1K8XA 1TZZA 2BZNA 4RE4A 4M6PA 3DGBA 4NZFA 2GL5A 1VF8A 1K6AA 4LANA 3NURA 3A23A 3FGCB 1E6ZA 4K3ZA 3BLPX 1VJZA 1EJVC 4HHMA 1FHLA 1SJDA 3LENA 2P10A 2PTXA 2GVGA 4A2SA 3IRDA 1W1B1 2AKZA 1KA9F 2GOUA 1X96A 4WEVX 3AIRA 3NSNA 4NRSA 3F2DA 3EKLA 2Y8KA 2C79A 1ZHAA 3LCWA 2B4GA 3WQGA 4HNUA 3OOQA 4XWUA 1M68A 2QR6A 2PWUA 2CCRA 4LUJA 2R1MA 5FOOA 3XISA 1H49A 4JHOA 3QQ1A 3UR5A 3TJ4A 1T41A 4FNQA 3STFA 1XP3A 4HOZA 3K5XA 3ITOA 4W5ZA 5LNUA 4JEQA 2GSJA 1OX5A 1K7FA 1E40A 4B3KA 1A3XA 4M6QA 2Z6JA 1KM4A 3M9YA 2D0GA 3LUTA 1UH3A 4LAKA 4HA1A 1UWSA 2BGNE 1WDRA 1BRLB 5LA2A 1KR1A 1R3TA 5C2CA 3E49A 3IEBA 2E9BA 3L5MA 1AG1O 1ZALA 3EBVA 4LV9A 1A5BA 1GZJA 4O1CA 5HMSA 3TXZA 1EC8A 2WC3A 1JZ2A 5JH1A 1E1CA 4ZOCA 3WBWA 2ABAA 3WF1A 2PDGA 1SSGA 1OC6A 3IUIA 4K6AA 4UOJA 3KOFA 3VIHA 2ZRXA 1NDZA 3M0LA 3CH9A 1KXTA 3BICA 3WSUA 5ABHA 4MUZA 1OFDA 5GJPA 1CNVA 2OPJA 4HMCA 1GQJA 1EJTC 1UR3M 3C2FA 3HGOA 4AY7A 1W56A 7CGTA 2CLEA 4IL2A 1KXHA 3TR9A 3P84A 3W7JA 1KTCA 2WZIA 3WNLA 5M3WA 4GINA 4CUCA 2FFIA 2VCCA 4JIEA 2VRJA 3ENLA 2OKOA 3G8EA 3GXIA 3VILA 3IV3A 4W8LA 4DO7A 1LOSA 4GIEA 5AC4A 3S2LA 2VELA 3P67A 1V3LA 1L8NA 2ZICA 1E6PA 4I5RA 1P1XA 4XBKA 3ZQ9A 3QEZA 2PTDA 5BMWA 3CQJA 5CC7A 3AWOA 1OINA 3LV6A 5FL0A 1XC4A 1EUAA 1JQVA 3O16A 3TP4A 4JAWA 1R9YA 3M0MA 3CIWA 1SZFA 5AOUA 1HO1A 3GTHA 1QNRA 4MUPA 2DIKA 5FF3A 3WDQA 1LQ2A 4W93A 5DMMA 1UJQA 3ZOAA 1JF5A 2J7HA 1W3KA 5BXSA 5BWAA 1FWIC 3SJ3A 2A3HA 3WMCA 3WQWA 1QBBA 2W4XA 2QDHA 1KM0A 2DQWA 1X38A 1ZBCA 4C6CA 4CVWA 4RW3A 2PP1A 3ABOA 2W66A 3OO2A 2OT1A 3PPFA 1GW9A 1S5MA 3CT7A 5FF7A 4DQWA 2XM2A 2G96A 5A6JA 2YCJA 4F9JA 2ISWA 1RJRA 3LRMA 2JEQA 2PRHA 1MEHA 4J3WA 3GDBA 5F7UA 2CZVA 1DJWA 1PIIA 3G1FA 5CH9A 1XYMA 2GPTA 3TONA 5FD0A 3VNZA 3PTMA 4IUOA 3NEVA 3RIKA 2W91A 1XKJA 4YYFA 2XVNA 1V3KA 4HTBA 1MFVA 3SM0A 1TJ2A 5BU9A 5K9DA 3KRZA 4F2TA 4OHQA 1O12A 2PAJA 4JIIX 3WLJA 3NZGA 1W1YA 4QJ1A 2JBMA 1O5RA 3Q45A 1FX6A 2ZRUA 1T7LA 3STCA 4GYJA 4JX4A 2WZEA 3DZ1A 3F4NA 1W1VA 3FA4A 2G95A 2DIEA 2IPFA 4RDYA 4AY1A 5KITA 1E0UA 3HF3A 2BNJA 3LGGA 3GVQA 2OCZA 4ZODA 1V6XA 3IK4A 3TFCA 1YTEA 5D2XA 2IPWA 1PYMA 3TCEA 2CFFA 1Z9AA 3MSRA 1P0DA 1VCFA 3L4YA 2V9DA 4IX0A 1AMYA 4CCEA 2QCDB 1IIGA 4XD5A 5BXRA 1BGGA 2ZUWA 1C8YA 3KL3A 4LQ1A 3IGXA 4AVOA 2WHKA 3W1RA 1VEOA 2ZC1A 1K70A 3VC5A 4M29A 2QXWA 3VMPA 3VDCA 4D8ZA 1EHAA 1CENA 2XZ9A 2PA6A 4OOUA 2I16A 2F38A 3OVQA 5DY3A 1RBAA 3FW6A 4UTLA 3CLMA 1JUKA 4IIFA 2MNRA 2ICSA 1CDGA 3A12A 3IAPA 3E74A 3B8WA 4WGHA 3QFEA 3H4XA 2QJMA 3ITXA 1VS1A 3QHNA 2J7DA 5T9BG 1LQ0A 5A6KA 4AEEA 3S5ZA 4D1JA 3CYJA 1O5KA 3DXIA 1CI1A 3NYZA 2YDAA 3MDUA 1WKDA 1LWHA 1M01A 1EF2A 1C8XA 4DBWA 4C6OA 4AWEA 2ZYFA 2RAGA 3ARYA 4UC5A 4Q8WA 3TSDA 2FYMA 3R10A 2ANUA 2NV9A 1OD0A 4AIOA 1OCQA 2VC9A 2YYTA 3V5OA 4FI4A 3R7MA 1HKMA 1VHCA 2FDSA 2VUYA 4HYVA 4P7QA 1XX1A 2YW3A 3EKZA 1ITQA 1Q8JA 3H7VA 4E6MA 2QGHA 2Q02A 3A5FA 1SO6A 3WLTA 2ZA1A 5LGXA 3B8SA 3SBFA 5HQMA 3JW7A 4PRTA 3T1GA 3MVIA 1BAGA 3W02A 3GNRA 4XZHA 3CS2A 2VVSA 4FNRA 3GC5A 1XPYA 2ZX9A 2JGYA 2NXHA 2ZTJA 4OUIA 2WBGA 4HPJA 2BY3A 3PPCA 3BUVA 2XSAA 3CUGA 3SUWA 1V77A 4Q4PA 3GNXA 1J11A 1DORA 1GYLA 4LYPA 4P7OA 1TMHA 3PANA 3T2OA 2PWVA 4FSAA 3AOFA 2NVCA 2NX9A 1UD5A 4O1DA 4EIVA 1QWGA 3A3HA 3UJ2A 4GVFA 5C2XA 1XYCA 4I7VA 4UIOA 2J7FA 1GHRA 2G8ZA 3KVKA 3VABA 3IJQA 3K4WA 5I2UA 5FKYA 5HANA 3B0PA 2QCMA 3MZNA 1MI3A 2QGYA 3KOZA 3NPUA 2GGIA 5FSDC 2CERA 3M7SA 3PJXA 3EX6A 5E6ZA 4DF1A 4GG9A 4ACYA 3G5EA 1KM3A 2XFYA 3R4IA 5A2CA 4DJEA 3CUXA 3P61A 5BROA 9CGTA 2IKHA 3U5UA 2DUAA 3NGFA 3B0VC 1RV8A 3LBCA 3G2GA 1KNWA 3VDGA 5A1AA 4Q22A 3DFQA 3LI0A 4LBUA 4MAZA 2ZX7A 2DU2A 3UQNA 1PCKA 3CGTA 5ABFB 1J8VA 1R3VA 3VPLA 3L5LA 4RZ5A 3M43A 3LCFA 3N9KA 3W37A 4DWDA 4Q6XA 4L64A 2GLKA 5D33A 1HW6A 4MFEA 1Z8AA 3CQIA 1EIXA 1GVEA 5CEWA 4YCOA 4UOZA 4HZ6A 5TBOA 1LG1A 2IS7A 4MPKA 1X6UA 4HNNA 5A6BD 1SFSA 3DHFA 4FPSA 3SUVA 4JZ5A 2VOTA 3TJLA 3CUJA 1NARA 2ZVIA 2BDQA 1BF2A 3BLIA 2G37A 2DQXA 4IMFA 3GG0A 2XM1A 3WL1A 2QAPA 2HSAA 3PUGA 1CTNA 5KINA 1E4NA 3IIZA 4PGLA 1R9XA 5MKGA 1E9ZB 1BYCA 1CGWA 2R1PA 3C3NA 5I24A 3DAQA 4GCAA 1EDQA 3CUZA 4DUXA 1GOWA 1KQZA 3W7NA 5A6BA 1NVMA 1JCMP 2JIEA 2ZFAA 4NZCA 1ZU8A 2X40A 1KFEA 1F5ZA 3HG4A 3PG9A 2VNCA 3TW7A 1L6GA 1J0HA 1OIFA 3NCOA 2PTWA 5CLWA 3LEPA 2XINA 4J3VA 3GUGA 4TX9A 3FGCA 3CV7A 1CB2A 4DJDD 2P3EA 1U1JA 2FPTA 3MS8A 3SGZA 1Q4NX 2QJIA 4UTIA 4DXKA 1RALA 2QJJA 1F61A 3GXFA 4YYCA 4NJGA 4Y6GA 4S3AA 3GAYA 1W8SA 1MFUA 3NZRA 3NL2A 5TIMA 2PURA 2IQDA 2XPKA 3QY7A 2BHUA 5CZKA 1S2UA 1RCOB 1S5NA 3S2MA 3W87A 5I77A 1CB7B 3NVDA 3NQ8A 5I6SA 4FHAA 1VJIA 3BSMA 3FLUA 1EC7A 5L9FA 2HPMA 1TIMA 4MY9A 5G1YA 1QK2A 2IPJA 1C7SA 3FEMA 4IXXA 4DWSA 3THQA 4XZ9A 3WJYA 1Q66A 2FJUB 1UBPC 4N02A 5DY2A 4Q8VA 1VLIA 1R47A 4C6LA 2ACUA 3MW7A 2HISA 3EPOA 4NP7A 3RFAA 3GW0A 3HZ3A 5EMKA 5CSYA 3T6CA 2ISDA 1BYBA 4Y9PA 3S6TA 2QYGA 1DE5A 3FA5A 5E09A 2XWEA 1FCUA 1KXQA 5A8PA 2XIBA 5ABGA 4OTKA 1CGYA 2ZRVA 3AIVA 3GFZA 4HKPA 5K7JA 1AD1A 3IJ9A 1I60A 1YX1A 3ZFHA 3WH8A 4QDPA 4QAIA 4MADA 3HQ1A 3UFYA 1A49A 4CN4A 3H7UA 1ZAIA 2HCVA 4H4IA 3QFWA 3IJ7A 1GT8A 1BVZA 4EPKA 3OIHA 4H9VA 3CMJA 3KCOA 4NVTA 2GUUA 1LBFA 3S5SA 5G1TA 4XUGA 4ZCWA 1QVBA 3HFYA 3AUJA 4WQ6A 4QIUA 3GDMA 4AZ5A 2Y5JA 3T0CA 3ZLHA 3TJXA 5CZJA 3LLXA 3UG5A 5DFAA 2WVTA 4XIAA 4LCQA 2JEPA 4DZIA 2ZX5A 3RR4A 1OBAA 4KCTA 3M5VA 1R3SA 4OVXA 1FA2A 4JL2A 3WLQA 3IJ6A 4HHHA 4QLJA 2H8XA 4AZCA 3WH5A 2PDKA 3NZQA 2HBXA 1HN1A 4BA0A 1QI5A 3IJLA 3BLLA 2DGAA 3HV9A 3KZSA 4P61A 1D8WA 2GJNA 2OSXA 4I8YA 3TA9A 1SW3A 3MMUA 3WUGA 3AMCA 1V5XA 1XIGA 4Q32A 4CEXC 1EPXA 4G7EA 4CNOA 4YLWA 1K7EA 1NOUA 1ISYA 1AQ0A 1HUVA 2VEIA 1WZLA 4N4QA 1YQ2A 1PS9A 1RBLA 4KCVA 5CJNA 4J5NA 5EGRA 5A8MA 4IQEA 1VC4A 1G4PA 4QE4A 2OLAA 2RGLA 4LT9A 2NUYA 1I8JA 2PDMA 4GOAA 1NOWA 1UOKA 2X8RA 2Z0IA 1LORA 1XLGA 1SFJA 1M6JA 1T96A 5T26A 3L68A 3TYEA 3TXVA 1AD4A 5F4WA 3I6TA 1Z6KA 4JTQA 3A21A 3BAWA 2PP3A 4GRSA 5TAOA 4GC3A 3H21A 4DXXA 2CBIA 3HPAA 5HWNA 2VFGA 1XD0A 3ZYZA 2OQHA 2DZWA 4O52A 4BY3A 3IGSA 3VOHA 2GUBA 3FJNA 3NGJA 4UZUA 3VI2A 1I45A 2WBKA 1F8MA 1WXJA 3NL6A 3C2YA 4JTSA 4QLLA 1E56A 4LW7A 3H2OA 3BE7A 2X1SA 4E3VA 4WF7A 2NSXA 1KC7A 2XVPA 2NVDA 4ZO9A 4WLCA 3URNA 1S1PA 2IPGA 3AIWA 3GC4A 5CKSA 2ZIDA 1DHKA 4DJFD 4S3KA 4ASTA 1VFMA 1I1WA 4Q4OA 3TTQA 3UZXA 3S1XA 3TNBA 1CXEA 2HXUA 1VR6A 1IWAA 3MB9A 4J2MA 4D72A 3UPWA 2W63A 4XIMA 3N25A 1PKNA 1G1YA 3W7GA 3EX2A 4HSOA 5HMDA 2C16A 3ABRA 2GSEA 1TQJA 2WHJA 3W00A 1EDGA 2VP8A 1GOXA 3SDOA 3T55A 2C3ZA 3OGVA 4EACA 5FA5A 3M16A 3RMJA 2OEMA 2B0MA 2WCAA 3DYMA 3QKZA 2GVJA 2PC8A 2NT1A 4EAYA 3K2GA 2XJ7A 1XYZA 3APGA 4EWJA 1TX2A 4NYUA 3EX1A 4YJ5A 3TCSA 4UMBA 4MAVA 1YBQA 1XLAA 1RSCA 3DGRA 2YL8A 3SCOA 3V0SA 3WF2A 3TR2A 3TMQA 4Q4RA 3MUIA 4BEQA 1TTIA 4J3TA 4F40A 2B7QA 4GISA 5T8GA 1A0DA 1RPKA 3W28A 1WE5A 1BHGA 3Q94A 4S3FA 3ZR6A 4A35A 4CQAA 4LS0A 4CD8A 4OV9A 4XB3A 1JJKA 4U31A 4HNVA 2IKGA 1YIXA 3OTRA 4KKXA 6PTDA 4PCSA 2WVUA 1WXYA 2QV5A 3BXWA 4NASA 1Y65A 1QK0A 1ICQA 4XSLA 4BWLC 2WMIA 5JUVA 3SFWA 4FA3A 2EPNA 1ITUA 2NVAA 3GH7A 1TV3A 4FIRA 1J0KA 3C2OA 3K8KA 4GH1A 1H0IA 4ATWA 1MYRA 1H1NA 4W4QA 4JYEA 3REQA 1B3VA 1W5MA 1OCBA 4Q8TA 3UZWA 2DORA 3MUXA 3W9ZA 4POCA 4NX0A 3W07A 3CZ8A 4QNWA 1A0EA 2C13A 3QTPA 2AL1A 1TV2A 2WMJA 3IGHX 2ZC8A 1NF0A 4MDPA 2BOEX 2FQIA 1VQTA 2BOGX 1QRQA 4ZR8A 4H9TA 4B15A 4B90A 1A0CA 1RQEA 1Z3NA 2WNNA 1XQLA 1VBRA 4YTSA 1QFEA 3VKJA 4DB7A 4I5UA 4E2BA 4GXPA 3VNMA 5E1QA 1QBAA 2HE5A 4MM1A 4WDTA 1IQ8A 1ZJAA 2DSVA 3MU7A 1UZHA 3N2MA 4Y9OA 3VOFA 3S47A 3SCRA 4UFLA 4QHRA 4QRNA 1UH4A 2VTFA 3QY8A 4I6KA 3PBUA 1AFSA 3BW4A 3M7WA 4KWVA 3S1VA 2XYLA 1VRDA 3M0YA 3ANYA 1QXLA 1M9HA 3WJWA 3BAYA 3EWDA 1KM1A 3N73A 4C1KA 2VURA 3OG2A 2OYLA 2DT1A 3BAJA 2GQ8A 3I4KA 2A3EA 3FDGA 1LROA 5CG7A 4ROPA 3G0SA 3EZ4A 3RN6A 1V93A 1F9CA 4JFUA 3ITYA 1PJ9A 1H7PA 3OA5A 1CZ1A 4GIRA 3EEGA 2PTZA 2AMGA 4X0VA 3CB3A 3L66A 3SGUA 1PB0A 4BQ4A 3TX9A 4C91A 4NZ3A 5HDRA 4F0RA 1XIHA 1LDCA 2PDXA 3VD3A 3PFMA 4PBFA 2PBGA 3QM3A 2YCIX 2XTKA 4P8VA 1FCVA 2VWSA 1ZENA 1UWQA 5LIUX 2J9XA 3W7MA 3TQPA 1GVQA 2EPKX 4U5IA 1ZS2A 3W2LA 2R1LA 3CQHA 3XINA 2CITA 3N17A 1UR2A 3CZEA 1KWKA 4QCFA 3T05A 5FF4A 3H24A 2DH2A 2CLPA 4GYFA 2ZZ3A 5CZSA 4U28A 1ICPA 1FP9A 3ARSA 2VZTA 3BJSA 5XIMA 1NFBA 3S8HA 1W3IA 2ZX8A 3KS5A 2WW5A 3V4BA 4J35A 1NEYA 3C86A 1UUOA 2WQPA 1BSLA 5TD4A 3LNMA 2YJQA 3EB2A 1VFUA 3B9NA 1RY8A 1I2RA 3VD9A 3ABXA 1Y7VA 3N2XA 1OIMA 4K8HA 2O9TA 4O8RA 3VCNA 4M3PA 1OCJA 3FXGA 1TMLA 3AIEA 1XLJA 5H2ZA 3QYQA 4JTEA 3LSBA 2Z27A 3AU6A 4ERGA 4R7OA 2AQWA 3RPDA 5I3GA 1M5WA 2XFRA 3FSUA 3W7QA 3T4WA 1Q7MA 3POHA 5D9OA 2BHYA 2XDFA 4PMXA 2UBPC 1J01A 2V67A 4G56A 3W2UA 1CX9A 2BODX 2E9MA 3N29A 1OK6A 1J93A 3RX3A 1YPIA 1C7TA 5FJIA 1PDYA 1TPDA 4M81A 2G4JA 1XUZA 3TTSA 1E6SM 2J77A 3O6YX 1TJ1A 2X0SA 4O1AA 1GOIA 1UCWA 4WY0F 2BS9A 4JN7A 4O57A 5CPQA 3W88A 1KCLA 1PHQA 3H22A 5A2AA 5CBBA 1K8CA 5EKYA 1B4KA 4BK9A 2WNQA 3QY6A 1LT7A 2ZZ1A 4KF1A 1TTJA 5I3HA 2QVNA 4GYPA 1EGVA 3DBPA 1TYGA 3BWWA 4PUDA 3GG7A 1B0IA 8A3HA 4LBSA 3VIMA 3UERA 1O94A 3RO8A 1D3HA 3NDZA 3A9BA 4DZHA 8TIMA 3P0XA 4H04A 1E71M 2FH8A 4FO4A 4YNGA 4L1WA 7REQA 1TVLA 1FUYA 5HPCA 5A95A 3VZYA 4ACZA 4ERAA 4Y7EA 4IMDA 4G6CA 1DIOA 3AIQA 2GOKA 7PTDA 4V33A 1OZMA 3W2JA 2Z24A 4L65A 4Z1CA 3U9IA 4AD2A 4X3ZA 1RCXB 3F4CA 5G2WA 2R1NA 5LXEA 4NXSA 4IT1A 3UW6A 3UG3A 4ZL1A 1SO4A 1Y5WA 3B9DA 3GC2A 1VENA 3S3GA 1TUXA 3W7EA 2E9LA 1ALDA 2JALA 1ZGDA 3QKEA 1XDJA 3VDHA 2Y7GA 1GQNA 4A3QA 4GIAA 3GIQA 3W1LA 1OG6A 3XIMA 1KR0A 3WFAA 4XD6A 4Q6JA 2DIJA 1XYFA 4RDZA 3KTSA 1NP0A 2QULA 2QPXA 5A8OA 3GBEA 4F3HA 3VGBA 1QI3A 4PRRA 1E0TA 2E7FA 4JTAA 4Y9NA 3W2NA 4CU7A 4NT0A 3VNDA 1W1PA 1KRMA 1O1HA 1J0YA 4MJ4A 3TN4A 4UNIA 4MLRA 4UTHA 3VZXA 1P6BA 2GQ9A 3V16A 4LY8A 3C8FA 3TEVA 3U57A 4WKFA 2WHLA 3UP8A 1XGDA 3QTGA 4HOWA 3MQTA 2V63A 3N14A 4R33A 1KFBA 4UQEA 1JPHA 1Z42A 1LF1A 1QI0A 4DM1A 3SZ8A 4H9YA 1KLZA 3VKDA 4RZBA 5FAJA 1XINA 1SUXA 5BNKA 3HA1A 5GNXA 3RX2A 4H1ZA 1W5QA 1W9BM 5F2IA 3WIJA 3M44A 4UNLA 2C14A 1U5VA 2QVHA 5I3KA 4UQDA 2PEVA 2XSXA 2CU0A 3AHXA 1XKYA 2PDBA 3L4UA 3IVTA 4HJWA 2ZRZA 4EXBA 3GSMA 2P8BA 3H12A 3L7RA 3N4AA 1YNPA 4IZGA 3JUGA 1B3XA 1RJPA 4WIWA 3IS4A 1MXDA 3SY8A 1LBMA 4DYJA 1BWVA 3PS7A 3RRAA 3LV5A 3GH5A 5HMEA 1E3XA 1JUBA 2A3CA 1QPQA 1Z41A 2AQVA 1BXNA 4JIPA 1XLFA 4EF9A 2Y8UA 3AXHA 4GBUA 4XD4A 3NQBA 4O1EA 3TIMA 2PS2A 3N18A 2DSUA 1OADA 1KM5A 2JKPA 4ZQOA 4GQGA 2X1TA 2I5IA 1TPEA 1XCWA 2HK1A 3GKAA 4CU8A 5BRPA 2OFJA 3P0WA 1GYMA 2FB3A 2D3LA 3MSDA 4UNKA 1L6SA 3BLEA 3U5YA 3NJ3A 3QMRA 1KV5A 2XIOA 2HBVA 1EZWA 3T7VA 3CEPA 3KRSA 3VXGA 4H9UA 3RGTA 3KTXA 1OX4B 3PBYA 3BJFA 4MSSA 3CL7A 2VGBA 4CQBA 1K9EA 3RCNA 4INFA 4TMCA 2ZUNA 5E0CA 2PD5A 3T42A 3RHGA 3T8LA 1A5NC 4AG0A 3IJDA 1T5AA 4LUSA 1QHZA 4E2VA 4TXEA 4HOXA 4X9YA 3VA8A 5K9XA 2G0WA 4ICNA 1R6WA 2CETA 3HGSA 4AW7A 1QW7A 3P81A 1O6IA 4AEOA 3WL0A 1HP4A 3FK4A 5ENLA 4DJFA 1QNVA 1A5MC 1XLDA 1PPIA 5A3HA 2V5KA 1GVOA 4LYKA 5CC5A 4PUJA 1V03A 4HA3A 3APYA 1KO0A 1L2QA 2B31A 5CC6A 1S2AA 3HPXA 2V5LA 4OZOA 4GGHA 1B30A 4NX5A 3G1HA 3LDVA 5AECA 3WNMA 1TA3B 3VC6A 5MF5A 3UWEA 3TDFA 1W5NA 1CGUA 2GGEA 1IXOA 3W83A 3GVGA 5F1VA 3MPGA 3C0LA 2JK2A 3U0HA 3MO4A 2PDLA 1ECQA 2W79A 1XWYA 2C1HA 4OJYA 5DXYA 5H8MA 4HTYA 4PMDA 2PLMA 3E0WA 1GJPA 2NLYA 4DJDC 3UNTA 1OYCA 2KAUC 1V79A 1UR1A 4H9MA 4RNJA 4MWAD 1XV8A 1JUEA 4PB4A 3QHOA 2FTPA 2PGRA 5GPRA 3K4AA 1A5UA 4XZIA 3AMGA 1FRBA 1Q6RA 4GI4A 1OGBA 4JOMA 1MRAA 2OWXA 4LTSA 3B8UA 2NZLA 1LLWA 1H63A 3OYZA 2WNWA 4TR9A 1UUQA 2QJGA 4DJEC 3H2CA 2PGFA 3BO9A 5BXTA 4UTTC 5GNZA 4W7VA 4NJJA 3WFZA 1BXBA 1NELA 2ZZ2A 3G1YA 1O5QA 1PBGA 3VNYA 4L7ZA 5IOBA 8RUCA 3WLHA 1ZP3A 4MYXA 4KETA 5MKGB 2YZRA 4IP4A 2OXNA 3F7JA 3R0UA 4HVXA 4YWIA 3QV6A 3CC1A 2Q01A 1FKXA 3WUFA 1B3WA 4XV0A 1EJ7L 3PAJA 4GBDA 1JYXA 4YN5A 1BWLA 3FDKA 3CUFA 1LWJA 3MBDA 3KBMA 3WJSA 3UESA 1EXBA 2Z1KA 4DF2A 1P0EA 1JULA 3LCGA 3RITA 3DN5A 3AFBA 4LF1A 3W84A 2OQLA 3GNPA 4LC6A 1UD8A 3B40A 1HP5A 4TTUA 4XZWA 2BVWA 3SURA 1G7UA 1PCWA 4LAOA 4O28A 2IUZA 1W54A 4F0LA 3UA3A 3BAIA 1UPMB 2HE8A 1EFZA 3R11A 3UGVA 4ES4A 2DZUA 4H7ZA 1UR9A 2A6LA 2DZTA 3E3HA 4WRHA 1IXPA 1CLXA 4C6QA 4RNFA 3G3DA 3WQDA 1XF0A 3R2GA 3N19B 2ISFA 1L6WA 3ARZA 1SPQA 1G5AA 3GY1A 3MP5A 2E3ZA 4LV4A 2GYIA 2DJLA 3WH9A 1TTPA 1GEHA 2EPMX 4RE2A 4A3UA 1P6CA 1B57A 3W7PA 1L6FA 3L4VA 4D8AA 4S3EA 3WCZA 3AZTA 1WAUA 4AF0B 4AVNA 1GG1A 3CQ0A 3ZWSA 2OQYA 2QNEA 1V0MA 3VCRA 4BQ5A 3ITVA 4U3CA 5ECVA 2VL4A 1EH9A 4RV3A 2WLZA 3OLGA 1HT6A 2ZUMA 3FIGA 3O0KA 4A21A 3V0TA 1E6XM 5DXXA 1AH0A 3UXLA 1KTNA 2C8NA 4YXGA 1FWJC 3KZPA 3W82A 4F9DA 1O66A 3W6MA 5D02A 1LT8A 2YCKX 1EOKA 3W1UA 3POCA 4JHZA 2ZX6A 1OF8A 1AODA 1W6TA 3W70A 1WBJA 3M1ZA 4LVGA 4JTCA 4IG2B 4LEQA 3P5YA 2CYGA 7TAAA 1UR4A 1UQYA 4UTUA 3USZA 1EEXA 2V2HA 4PMQA 3KM8A 4UFMA 1FDZA 3FAXA 1DTUA 3KRBA 1ZJIA 4NJKA 4DO4A 1F7BA 1EX1A 1QHPA 1OT2A 1LM1A 4IIEA 2BXVA 2OU4A 2VFDA 2YA0A 1SZGA 4N9BA 1Q7ZA 3GD6A 5I06A 3P93A 2BMBA 4XTDA 3N1AA 1JFXA 2Z1SA 1A3HA 1PX3A 3LTPA 2XH7A 4B5VA 2QF7A 3EXRA 1Q6FA 3GNDA 3L67A 1CYGA 2FH6A 2YDSA 1SFTA 3WZ0E 3MYOA 3LERA 4ILSA 4MKSA 3ZXWA 4OT7A 5JIPA 3U2OA 1DXFA 2E25A 1GKQA 1MEIA 5AC5A 2REQB 1Q6QA 4ORIA 3TLLA 4YCPA 4IMAA 4CNPA 1WDPA 3WQVA 2EAWA 3UR8A 3GXTA 2CLKA 1RA0A 4PTNA 3DENA 1IHIA 2PDCA 4IIDA 3LPGA 4J3UA 4K39A 1YXCA 1KBLA 1AA1B 4I9MA 4XBJA 2I5GA 2VOMA 2D3NA 1PE1A 3BQ6A 3OP2A 3HPZA 1DV7A 2D1ZA 2PDPA 3FCPA 3JZEA 5GJNA 3FY1A 3KVMA 3M41A 1UP0A 4HCDA 2LLEA 4GQ0A 4NZJA 3CZKA 3JRKA 2Z2UA 3F1QA 2G41A 1FBAA 1Q6GA 4RNHA 4AVFA 4WSJA 3RJYA 3EA1A 4GI8A 2PD9A 1HKVA 3W01A 4AC1X 4C7GA 1H4PA 3BLOA 3U3HA 4CNSA 1EA9C 2OYMA 3UCQA 4NI3A 2PDYA 2Z1VA 4MJZA 2ZUSA 4W9TA 1I2PA 1TFVA 1P7TB 1XJBA 1LL6A 1J18A 1ZAHA 3PUOA 1Q8AA 1WDDA 4MHBA 5EFFA 4K2SA 4HK7A 5FF0A 3VX1A 2V68A 4M1BA 3HQPA 5IRPA 1ZFJA 4JQ1A 2OYKA 1FHVA 1ZCCA 4IXHA 1NFPA 1FOBA 3TWAA 1TQXA 2XUCA 4FZIA 2E6DA 3GUWA 5C7VA 3B97A 1GOKA 5I7GA 1X7IA 1MW2A 3PZQA 5K2ZA 1FXQA 5DLCA 4UZSA 3MCOA 4GPNA 1LJYA 2ZA3A 4ZBCA 3PJWA 3VU2A 1UG6A 1TE6A 3ZVHB 1I4NA 3B0XA 1VCVA 4A29A 2ZXAA 4HPGA 3DG3A 1WNOA 4JICA 3U4AA 4KGJA 1I2OA 4IFKA 4JHMA 4L6DA 1XQKA 5CPTA 3HO8A 4GNVA 3EWYA 5BRBA 3GHUA 5I3IA 3VGFA 4H01A 3CV6A 2E6AA 1B2YA 1G4TA 3F5JA 3QV7A 2OOGA 4QSHA 3COTA 3LHYA 4QNEA 2I9EA 4PL1A 5F2MA 2I1OA 5D03A 4JCLA 4BQ2A 3GIYA 2E8YA 4A3YA 3I65A 3WYZA 1W1A1 1UPPA 3G77A 3GU9A 4DJED 3IJIA 3ERPA 2PDIA 1AW2A 2Z2AA 3AI0A 4JKLA 4U5KA 3PNUA 5G4HC 1XIJA 4RDVA 1XBXA 1V02A 3VO0A 4E38A 2XVLA 2WANA 2YXXA 4R3UA 3NM1A 5A6SA 5J5RA 1PIFA 3R79A 1BKSA 4FOUA 4PTVA 5EMUA 3QOKA 1I6NA 4OIFA 5XIAA 4IOTA 3V35A 2VX5A 2YSWA 2VFFA 5C54A 3T0TA 4ZENA 1C9WA 2PBOA 3GR8A 3AHYA 3G24A 1PZ3A 5EY5A 1SMDA 3WNKA 5AC7A 1CW2A 2GGHA 3PUEA 5ABEA 1VGAA 2BSLA 3OODA 1PSCA 2PLKA 4HPXA 1S2WA 1DEDA 2EG7A 1C3FA 3W85A 2PPGA 2QUUA 4WDUA 4KEMA 1C92A 5AHFA 3TQ0A 4GVGA 2EPOA 3CHEA 1RK6A 1ME9A 3PZNA 4KFNA 2O92A 1P5BA 4KWUA 2Y1HA 5F1UA 1B31A 2WV8A 3PJUA 2DP3A 2ALRA 4MZ1A 5FL1A 4QR6A 1MW3A 5CGQA 1KRCC 3G6MA 4QROA 2Q6ZA 2BGSA 3SQSA 4ZSTA 3WO8A 3UCDA 4EP8C 1KXVA 2I17A 3ANVA 4PBEA 4QG8A 3UYIA 2PWGA 2V3GA 1PVNA 1UZ1A 1HKWA 3G6LA 3UZJA 1VFLA 2FLIA 5J5DA 1W9XA 4AD3A 2Q3OA 3GKFA 5KZMA 5C7HA 3LX9A 3LG3A 1VCGA 4GFSA 3L21A 3KCLA 4PBGA 5AHMA 3G1AA 3EDKA 1QW9A 4W8AA 9RUBA 2QPSA 3Q67A 2EG6A 1FWDC 2CHNA 4DWSB 3T08A 1DWIM 2CW6A 3CYVA 5CPNA 4DLMA 3WLSA 4ZQCA 5H8PA 1J10A 2PDFA 1JXJA 3O3RA 1LOQA 3VUPA 2GK1A 1UD3A 1ME8A 3RK8A 1ITCA 3P6LA 1BRLA 1XSIA 4GY0A 4ZB5A 1IWPA 3HMJG 4MY8A 3SIMA 3DOPA 3EWUA 8XIMA 4DJDA 1K4HA 3NO3A 2OEKA 2WLYA 1KQYA 2EPHA 3LS9A 3IV8A 1AL8A 3O9NA 1LZOA 3IIOA 5IBXA 3ONBA 2AAAA 3Q37A 5I5RA 3MDWA 3WF0A 2FHFA 2R1KA 3NQMA 2FVMA 4Q8PA 4ADSA 3ZZ1A 1VFFA 1GEQA 4Q7BA 1WZKA 1HL2A 1SVDA 2AL2A 4WXZA 3R8HA 1U30A 3VOCA 2VMFA 3W76A 3L23A 3LK6A 1NJJA 2V2DA 4AHOA 5CQ1A 2VJXA 2D2OA 1QPOA 1XIIA 1S5VA 1IXQA 3CIXA 2OVLA 1E9YB 3SY1A 2VX4A 4LUSB 3UETA 3CPGA 3MUCA 3TYAA 4BKNA 4B5UA 1DTNA 1E3ZA 4N6EA 2JF7A 2V3EA 4G1NA 4LY4A 3TTYA 3I3BA 3U6WA 2WMKA 5BW6A 3AXKA 2F9RA 3LLDA 3AU2A 4NQ1A 2E1DA 3ID7A 3DC0A 3ZVHA 3M0KA 1PWLA 1Q2SA 4HPNA 1DYSA 3TYBA 5KZEA 2W92A 3B0YA 4D6GA 1EYWA 3A3WA 1TO3A 2W27A 3NQ7A 1B9ZA 1XLEA 2A2IA 3AWNA 3WEMA 1ZBKA 2BY0A 5HINA 3B3DA 4PFMA 4Q4MA 1M03A 4XKYB 1XLKA 5I78A 1QOQA 3EDJA 3VUSA 3LNPA 4JIQA 4S23A 3D3AA 3R12A 4WXYA 4E8GA 1XPGA 3PBMA 1VBHA 3G3MA 1TTQA 5AYYA 1UC5A 2QLYA 1IEQA 5ABFA 2Z2BA 3I6RA 2VC5A 3OQEA 3INPA 4IGSA 3TOPA 4ZQNA 1DHPA 2BY2A 2WC7A 2VC6A 5LIXX 1TWZA 2PWFA 1R30A 4MZ8A 2J9YA 4H2HA 4Z2IA 4HT3A 3FKKA 3IARA 4S38A 1UA7A 1N2VA 3QMSA 3OIXA 3KUMA 1PKYA 1CEOA 4UR7A 1PAMA 1OYAA 1UROA 1JYWA 2BTMA 2XH0A 3FKRA 1SW0A 1NWUA 2CHRA 1VKFA 4OFCA 3PULA 3RU6A 4UFJA 5DCBA 2ZE0A 4J9JA 1JZ7A 3AS1A 3EB3A 2ZXQA 1U22A 3EB4A 5LIKX 3TKFA 4HPHA 1MDRA 2R9RA 1W2PA 3EDEA 3HG5A 4O50A 5BCAA 3S6DA 2FPVA 2ESCA 2Y8VA 2OWWA 4AF0A 1XDLA 2NWSA 2CIPA 3N34A 3TZNA 4Q7NA 4IF2A 3L2LA 2WZTA 4JX6A 4D71A 1IGWA 2J8FA 5E9XA 3R43A 1ONEA 3SUUA 1WOAA 3ZLFA 2Y63A 1RA5A 1XL9A 4XVEA 1HVXA 4QM1A 1R7OA 1ADOA 3GG1A 2QF8A 3J7HA 4DUVA 4JYDA 4IPNB 2OOFA 5KZDA 2QCGA 3MZ2A 1EWDA 3CK5A 5FEWA 3G1XA 4IQJA 3FJ4A 1SZRA 1C91A 5GJMA 3EWCA 3M46A 2HWGA 4HA4A 1E9IA 4AAJA 2BVYA 2C19A 1A47A 1X8CA 3U8GA 4LVBA 1Q45A 3L4WA 1JCNA 3SCQA 1UJPA 4RXGA 2QW5A 2Z26A 3TMLA 2VEGA 2YFOA 1PTAA 3WK2A 4PUWA 4AWUA 1M7OA 1ME7A 3LOTA 5C55A 4IFKB 2QAFA 3GTXA 2YB1A 2P5NA 3ZR5A 3T0DA 1Y0EA 1NWSA 4TX8A 1VIWA 4W8BA 3F03K 3E9AA 3RNDA 1XLCA 3EDDA 1S2TA 1JR1A 2HMCA 2ZBTA 3SN4A 6XIAA 3PHAA 4L6OA 4XAFA 3O05A 5E0FA 1RJQA 1UP2A 4PODA 5IDZA 4PTMA 1TPUA 2BOFX 1UW9A 3T07A 3F2CA 1KTBA 3PBWA 3DHPA 4U2ZA 4CU6A 3C2EA 4R7JA 5AHLA 4W85A 4M7TA 4PE8A 3O1NA 1XFCA 3ABQA 3EYPA 5B7YA 1JCJA 3GTIA 5FACA 3HIJA 1Q63A 1EQPA 2NW0A 1FWEC 4KRUA 3T09A 5A6LA 3WK1A 2ZZ7A 1FTXA 3GG8A 4NNBA 3RUBL 1TVPA 5C9UA 4UTMA 5CZ0A 1ISZA 4WJXA 1S38A 2NXIA 3MP3A 3UJFA 2WJZA 4NAEB 3VGHA 4Z1AA 2GGJA 4P8WA 2YDRA 4XISA 4G8TA 3TYCA 2QIIA 3GHTA 1R5YA 4JR5A 2PUZA 5KEZA 1RXOB 1GHSA 3N4FA 3T44A 4NSBA 2Q3RA 1NDWA 2F8QA 3CMFA 4MNJA 1BG9A 4IHCA 6ENLA 4Z0JA 1T40A 2IQTA 4LH8A 1EOMA 1EBHA 1GPFA 4Q4SA 2PLCA 2TSYA 3WH7A 3WLLA 4DO5A 2YL9A 1LRQA 3R25A 3VIGA 4DBSA 1RUSA 1DE6A 4OBTA 3M0JA 4GX8A 2X7VA 2HS8A 1TJPA 3O06A 2A21A 1OFOA 4NZ5A 1F6PA 4AB4A 3S4TA 3MJMA 4UBPC 2DW6A 4J4KA 1A4LA 1AW1A 3HTWA 3UT0A 1WQ5A 2J78A 3BTNA 4FNPA 3ZSSA 3RPTA 2J79A 3DU0A 2W6RA 5JBEA 4HYRA 2POTA 3EOEA 1LRNA 1OFBA 3HMCA 2OSYA 2BXZA 1XIEA 1GVRA 3MV01 1HVQA 4KH2A 3VX0A 1V0KA 1I2NA 1XH1A 3LTYA 4IPLA 4PH6A 4MLJA 1WDQA 3PPGA 1BPLB 4F0SA 4AUBA 1BVNP 1G9HA 4NG3A 2Y5EA 1OT1A 1RY0A 4D1IA 2RFGA 1GG0A 1NU5A 3KBNA 1GCYA 5C9XA 4HU8A 2I7GA 3AJXA 4AZCB 3SCWA 2X2GA 1Q6CA 3AYVA 1OCNA 1EF3A 2Y5SA 4ML4A 2GJLA 1V3HA 2IKJA 1E4LA 4P7LA 2H3BA 4O8AA 3S0CA 2EJAA 1JG9A 3V7PA 3AMLA 1R2SA 5ABTA 2QZRA 3VMOA 3AO0A 3RDKA 1GVFA 1OG0A 5I02A 3PB2A 1DL3A 4ENLA 1TCMA 4GH3A 2E5BA 5G2IA 3TA6A 1JCTA 4PUNA 3LTSA 4BR1A 4XQ6A 3AXMA 5D09A 3EGJA 2ONEA 3GB6A 4XSMA 1ZBVA 4AD4A 1JAKA 1UIPA 4DYKA 2F6UA 3ALFA 5M03A 5GNYA 4EVZA 1VRXA 7ENLA 3AUOA 1T6MA 5D8WA 1IGSA 3DFPA 4ZXLA 1QOXA 4GZIA 4IPPA 2J7EA 4TO8A 5C5YA 3PG8A 1Q4WA 1XXXA 4IUGA 3LCXA 2KZHA 1M65A 2J74A 1SQ7A 1C29A 4ZOBA 1AJZA 1VPXA 4H7VA 3I68A 1IEIA 3PTDA 3G1VA 1OX4A 3TN5A 1DJHA 4KERA 4HNLA 1M7PA 4EPEC 1C8VA 2RUSA 1EIBA 2BFGA 1BEUA 3IWPA 3AQUA 2ALDA 4K1GA 4UTKA 5DX7A 1AVAA 3GNOA 2UY3A 3TV8A 1VJSA 1TPFA 2XH2A 3FSTA 4GC4A 1R87A 1JRBA 2FZMA 3URAA 4F48A 3L4TA 3LZ5A 1I2QA 1M7JA 3NR0A 3NG3A 3QH2A 1PO9A 4H00A 1ISXA 1HG3A 1E6NA 2ZWYA 5KMYA 2HVMA 4FAMA 4A8RA 4FOJA 2JFEX 1CGVA 2PP0A 4N2YA 1DJIA 1NTHA 4M80A 3NXFA 4C6JA 3UJSA 3PPHA 3A13A 3PC0A 1EQCA 4X60A 2O7QA 1NP2A 3BANA 4I8DA 4DZ5A 3VNKA 3PZVA 2W3ZA 1GZGA 4HP5A 2O4QA 2OZ8A 2BGQA 2QCFA 1Q13A 3DH7A 2UY4A 5AN7A 2CZ5A 4FX6M 3MC5A 2CLFA 3EOOA 1CECA 1JXKA 2QKFA 1V3IA 5C8BB 5BZAA 5D2VA 3EKGA 1H5VA 1RR2A 1KB3A 2GDVA 3UNDA 3ZJ8A 3NPXA 3LQLA 3THUA 3C0QA 4OECA 3E6EA 3HOJA 5I3DA 1HJXA 1GQLA 1J6OA 2NX3A 3BMWA 4U4MA 2A3AA 3CIVA 1WV2A 1JGIA 4JTUA 2WAGA 4B16A 4QSFA 5CAHA 1GKRA 3SY5A 3U7BA 3KWXA 4KGLA 4TMBA 5A5WA 4PCNA 3OW1A 3SCNA 2PMQA 2YOCA 3CZGA 2ATSA 1DIEA 1E9LA 4JL1A 4F8XA 3EWWA 4GO8A 1MMFA 3BGAA 3PBVA 4FLOA 5HWMA 2VC7A 4TVDA 2FVKA 4LRTA 4PCPA 3IACA 2ISSA 4IJRA 1LOLA 2CWXA 1Z7AA 2DZPA 1JPDX 2DH3A 2RJGA 3L0NA 1JQXA 5A6AA 4D2JA 2ACRA 3VIPA 5CJ5A 1LBLA 4UCGA 5F2LA 1TRIA 4K7VA 1K03A 1NIUA 5C0QA 1AMKA 2C6QA 3MJYA 4LB4A 4H2CA 2VFHA 4G5DA 1PIGA 2E77A 4PFHA 1I1XA 4ZO6A 1W31A 3NPVA 2Q09A 1A50A 4WY0B 4EX4A 1E51A 1PXGA 2A3BA 2OT0A 2NUWA 4D6EA 2ZQ0A 4MVAA 2VZVA 1FP8A 4Y90A 1SFLA 4ZMGA 2G3FA 4HQVA 4S3DA 2V38A 2E6FA 4J3SA 3PUDA 4IJBA 1X39A 2J62A 4C6IA 1OABA 3QRHA 4W87A 4HCLA 3CLWA 5D4YA 1J2WA 3N2TA 3KBVA 4C6NA 4IICA 2X0YA 5E6YA 4CNUA 7XIMA 5LXXA 4GO9A 4GFIA 2QCNA 4GZ7A 4NJHA 2A4AA 2W0UA 3SN1A 1EGZA 1AQHA 4LF2A 1GTEA 1ZQ5A 4GKTA 1X97A 3CAWA 2O4MA 1DKWA 5DCDA 2VDGA 4C65A 2J7CA 4YHGA 3VGGA 1O5XA 4BF5A 1S46A 3U2CA 4GIYA 3C0JA 4M1RA 3KL5A 1E0VA 3AROA 4KRZA 3WDIA 3MMWA 4KIRA 3SQLA 5AC8A 3D47A 3WBEA 2ADAA 3W7RA 3QR1A 1RK5A 2ZZ4A 5DRIA 4GQQA 5DMLA 4FLRA 1X1ZA 5HQEA 2VYOA 2J88A 4B4FA 5CG0A 3PTKA 3TAOA 3MI3A 5IM51 4L61A 3D46A 4AX6A 1QPNA 3UWWA 1AJ0A 2EKCA 4R5EA 4UFKA 4V15A 2IXUA 3WEOA 5IDIA 3WQFA 4NXKA 1SZEA 3GBDA 6REQA 1B3OA 1K8ZA 4EKJA 2WSYA 5L6UA 3VE7A 2GFTA 3VD5A 4JDBA 4B5NA 2OO0A 3QVQA 1VP5A 1CGTA 3Q65A 5EPDA 1TMQA 1E5NA 2IQ0A 2CBVA 4GVIA 2H8ZA 2WWDA 5BMXA 2O0TA 4WGXA 3B9EA 4HU0A 2V69A 3UPBA 1AH3A 5A8NA 1R7AA 4MNKA 4RCXA 1F8IA 4GKLA 2ZE3A 3MHUA 2V8ZA 4N7QA 2VD9A 4IIHA 5M2FX 4P2VA 4M19A 1K7XA 1XRFA 3DCPA 3ARXA 3GWQA 1OF6A 1WBHA 3QC0A 3BCDA 1P0BA 3TE9A 4QE1A 3DHDA 3T0AA 5LGZA 4HHPA 4PEKA 4QS6A 3WNPA 1AUSL 5DEZA 3WQOA 1XBYA 4AMCA 3LBOA 1K77A 2WHMA 1S1RA 3N3TA 2FZDA 3N12A 3QPEA 1AQMA 5H8UA 1XLLA 5T9CE 2V3DA 4TOQA 1HGYA 4UQBA 2HNHA 2NLIA 2ZKMX 3P3BA 4AU0A 2VI0A 1N8FA 3VYLA 2UV8G 3E2RA 4ZQPA 5HPOA 3ZT7A 1B3YA 2WSRA 3N6QA 3OLDA 3DYOA 4PL2A 4GABA 3CV1A 1GQIA 1EXPA 1TSIA 3MP4A 4ECLA 1HL9A 3RCYA 3ATYA 3KDOA 4FMVA 6TIMA 5I3JA 2PCEA 4N6FA 4ZVJA 3W1PA 1HKIA 1VFTA 3VIFA 3B4UA 1A5CA 2JKAA 1TX0A 3WMSA 1OFQA 1DIDA 3BOXA 3N04A 2CZDA 2I56A 3FJLA 3BCJA 3E5PA 3GK0A 3BG5A 1UH2A 2XIJA 3PWIA 3RLGA 5HULA 1F07A 3QBUA 1Q6EA 1B1YA 2OR2A 1BLIA 2VFIA 4D6FA 3CXOA 4LPCA 5HUPA 1V3JA 4JCMA 3ZSTA 4G2DA 4GNKB 2EHHA 2QV4A 2EEXA 2OJPA 3TZFA 3EOSA 3MI2A 1Q3NA 3FFSA 5JH2A 5F2GA 3FS2A 3T8QA 4LXFA 4HZ8A 4Z2KA 3W7LA 3OJGA 3TYDA 2X41A 4OWGA 3M07A 4K8GA 2NV1A 1IZKA 5HJLA 1YE6A 4AZGA 3CWHA 5K9CA 4PUKA 5LNRA 1DJZA 1XM3A 2QIWA 2DVXA 3QPYA 1JZ8A 3E2QA 1H60A 1VEPA 4IMCA 2REQA 3B8IA 3BGJA 4JFSA 1HL8A 4YHEA 3BL3A 4HU3A 1JI2A 1TKKA 1FWGC 5HBFA 2JE8A 2J9ZA 1ZLPA 1VLWA 3BDKA 1HJVA 4O0KA 3I7SA 3LXBA 5FEPA 4IFRA 3SUSA 1M04A 3WMLA 2C15A 1KGUA 1TR1A 4ALDA 4LVDA 3L4ZA 1JI1A 1R3RA 1YXYA 3N6HA 4NUWA 4DNHA 4ADTA 2GJRA 3PZGA 3CAKA 3NQVA 3EWBX 3OYXA 4V1XA 4DWSC 3M5ZA 1S3HA 3M0HA 3WEZA 4Y8EA 1US3A 3WENA 3ZIZA 5I09A 4EAMA 1TWDA 3HPSA 4HIBA 5H91A 3UR2A 1QNSA 4Z1BA 4MB5A 1EJRC 3G0XA 4H6QA 3ZO9A 4UTJA 3C3UA 3CU2A 1F05A 3FJ6A 1ZUAX 1NFGA 1JPMA 1XISA 3Q58A 1TV7A 4K8EA 3LRLA 2ZXDA 4JQ2A 3HURA 3K46A 3OU8A 3CM4A 4JKMA 5BYWA 4D6DA 3W53A 2WKGA 1YPXA 2NT0A 1V3MA 2F2HA 4DZAA 2VRQA 4E4PA 4NIRA 4XAZA 3QQ0A 2XIQA 3NZPA 3WDPP 1FH9A 4CN6A 1WDWA 1E72M 1U5HA 3VNIA 4MTVA 4D9PA 5HATA 3WUEA 5I23A 3QW3A 4N9CA 3PZ9A 2PDNA 3NWRA 3GZAA 3FHAA 1CXKA 1WYIA 3G1DA 5D05A 1XGZA 1OVDA 1JDAA 2GUYA 4DRSA 1KBJA 2DZVA 5CPSA 3QZEA 2YKKA 2E40A 2ZUTA 1FWTA 4B2DA 3WDJA 2VXNA 1S39A 4QEHA 2QCDA 2RDWA 2ZZ5A 1XHGA 3V1HA 1JYVA 2ZRWA 1W1ZA 3MWAA 1HJWA 4UMCA 1OX6A 3NQFA 3WJZA 4ZOAA 1VB9A 1S2VA 1GORA 3F4VA 3VM5A 4L4MA 4M51A 2E0PA 2E67A 4IISA 5FSEC 3LD5A 2H9AA 3BPWA 3HU7A 3O63A 2GJXB 3EMZA 3LU2A 4HCHA 2CLMA 4X9SA 4E0CA 1V6WA 2NV2A 1NY1A 5IFTA 1W3JA 5K4ZA 3OG3A 3T2QA 4GJIA 3KS6A 3QSTA 3NOEA 5HR7A 4LB3A 3SJNA 4YL2A 3MKKA 4GJ1A 2G3IA 1AJ2A 2A7RA 1K4GA 4HN8A 1NM9A 2X16A 1R85A 2HS6A 3U4FA 3UXIA 3SCVA 3H53A 4NAFB 4AD0A 2V81A 4G7FA 4OKDA 5JQ9A 4U10A 4BI7A 3TYZA 4DBEA 2WCGA 4B2DD 1RD6A 1JRCA 1QASA 1TPWA 2FKPA 1QW8A 2VWTA 4GZJA 4WK9A 1BQCA 3E0IA 3L12A 5A69A 1AL7A 1XIFA 1W0MA 4ICMA 1QR7A 3ZWTA 2ZA2A 4UFIA 4C7FA 1FDJA 2D0FA 4MPQA 4JNZA 5CBIA 3BLKA 1H3GA 2VCBA 5AYBA 3MANA 1GNXA 3PM6A 1TG7A 2PTYA 4AXKA 4DF0A 2CLOA 2E09A 3KBJA 5JXQA 5FAGA 4PTXA 1EP2A 4FNSA 3GX9A 1TB3A 2XU2A 3MHFA 1C9DA 3P7YA 3M64A 2A85A 4YWSA 2WSPA 5M5DA 2E28A 3TTOA 2D73A 3WN6A 4GCXA 1X1OA 3WMBA 4GYKA 3TFXA 1GVSA 4YU1A 2GDQA 2ZADA 4C60A 5CJMA 5JIWA 4I9AA 4MYAA 3AC0A 1O68A 3IIPA 3ZJ6A 3B03A 1NWTA 1UMYA 4Q8QA 3MUZ1 4F0KA 2GQ3A 3VKBA 3EDFA 1XR2A 1THFD 3ZT5A 2RKXA 3W4RA 1I0BA 2XH4A 4DVOA 1QPKA 3LPOA 1CPUA 3WH6A 3GVRA 3WD4A 4MWAE 3S6OA 4KT2A 1HIZA 2GZXA 4PTDA 3LLFA 1J9YA 3QQWA 3CTTA 2GDUA 3JR2A 3E1F1 4L4LA 1YXDA 3LHTA 3NQAA 3QMTA 1R38A 2YCLB 1F2JA 2P0OA 1OC7A 5FEZA 3IIXA 3VCCA 3V0UA 4H6RA 1EA0A 5D2YA 1W3HA 1YKWA 2FIQA 2VEKA 4H83A 8CGTA 3U7VA 3MBFA 2EJ1A 1E4MM 1EWEA 3P8JA 3WQ4A 3A9IA 4JFWA 4FNUA 1D8CA 1H51A 3R6IA 4TVCA 4GZEA 4I3GA 2A3LA 1WKYA 3R0DA 2PWHA 2YW4A 3PK7A 3CL6A 4QAWA 3SN0A 3TW6A 4FB7A 1XRSA 4U2YA 2Y62A 1YHTA 3ZT6A 5HA7A 1XW8A 2PDQA 1VFSA 1Z69A 3VTRA 3KDNA 4F79A 3NA8A 1TIWA 1I9CB 2ZDRA 1WZAA 4G9PA 3QJAA 4EF8A 3T4CA 5BWFA 4MKNA 4LUTA 4DAIA 3IVUA 3VVGA 2F7FA 1SU5A 5AB3A 2YCLA 1ADSA 1RAKA 4L1GA 1LUCB 1KWGA 4WD0A 6A3HA 2O55A 2XGZA 4WJ8A 1QMLA 1SO5A 1J0ZA 1KV8A 1FH7A 3KRUA 2R6OA 3OVGA 3CMGA 1W3NA 3TW9A 4LOCA 4JN8A 1ZY9A 1CGXA 5C6MA 3V5FA 2WZHA 3RLHA 1K9DA 3EPNA 4EE9A 1UKTA 1V4YA 7A3HA 1YDVA 5TNVA 3GLCA 1B54A 4AX7A 4O16A 3L0GA 5C9WA 1QOPA 4DPQA 2OX1A 1V6YA 4XZMX 1BTCA 1H1YA 2VENA 3QW4B 3MKCA 4ZSUA 2E4TA 2P1FA 2XFFA 3C2VA 5EMJA 4GUGA 1BD0A 4PMRA 3IAQA 2CHOA 2DUZA 4LALA 3UZ5A 4ICCX 3O8AA 3UVIA 2DT3A 1KFLA 5D04C 4BZYA 3L4XA 3B9AA 3ITCA 3CHVA 3W7OA 1D2KA 4AIEA 3BK0A 1XSKA 1SR9A 3P80A 2YPIA 3PNZA 1VYPX 2BXYA 4E2DA 3W23A 3PFRA 2HJPA 3ONCA 3C0SA 3TC3A 5EB8A 3D3FA 4ZOEA 2Z7GA 3HBLA 2X30A 2UWFA 1W9DM 3T40A 5D9PA 3SCSA 3W7IA 4ORMA 2YX0A 4JTLA 3BURA 5AKQA 4MWAC 1QNPA 5IHRA 4H8HA 5I00A 3WLMA 5A8GA 4S39A 5BRQA 5F4XA 3WQCA 3K8LA 3LMZA 3KX6A 1GW1A 1CXLA 1G69A 4GLEA 1JDDA 1XS2A 2W67A 1GTHA 1TREA 2PWEA 4M6VA 1YDNA 2P8CA 1TELA 9XIMA 2TMDA 1S5TA 1Q6LA 1EBGA 2PLJA 2O9OA 1IIHA 2SFPA 4JTFA 2X2YA 3H26A 3G18A 2QHAA 2G97A 4IFOA 1XD1A 3W1MA 3BLDA 2QUTA 1GKPA 2DW7A 4UCFA 1MWOA 2WMFA 3ABZA 2D24A 2V5JA 4J3ZA 3HB9A 3A47A 4A8IA 4HU4A 4LYRA 3JZUA 5LA0A 4FXRA 4UQ9A 1HO4A 1U5JA 2WKJA 2ZVRA 5I03A 4BFAA 4JD4A 4LNYA 4P8XA 4B9ZA 3NL5A 4AFYA 4UB9A 4A3RA 3SQMA 5AYIA 6REQB 4REQB 1F76A 1J2BA 4DYEA 4I5XA 4TTGA 3LY0A 2VUNA 3LHVA 3KXQA 2VR2A 4LCRA 4YMZA 4CQ9A 4S3CA 2XISA 1JZ6A 4US5D 1IV8A 1J0IA 4HA0A 2FMNA 4ZFCA 1CBGA 1U1HA 5TF0A 2EF9A 4RZ4A 3TYUA 3IUHA 3F2BA 2ASHA 3UWUA 5HJYA 3G1SA 2J66A 3UCCA 4NAFA 3C8NA 1J4EA 3W2MA 2Q8ZA 1KFKA 1YDYA 4H3DA 1A5OC 1R2TA 3SCPA 3CPRA 1VBGA 3S46A 1XG4A 1KBIA 1J12A 4I7UA 2C71A 4XBSA 3AJ7A 2PE4A 5JU6A 4IJCA 4Z1YA 3R1ZA 1H7XA 3W75A 3W3OA 3CHDA 4ZO7A 3STGA 3VFCA 4QJ5B 3MHGA 4L9XA 1NDYA 5LIWX 2PI6A 3CWOX 3H70A 4GYPC 3C5QA 1HKKA 2FHCA 3PBGA 1V6TA 7REQB 3LPFA 1KCXA 3D5HA 3VNJA 1JNDA 1SGJA 3I4EA 3PZUA 3ICJA 1N8WA 1P43A 1D3CA 4FEZA 4HNTA 3ARPA 1V02E 5HQLA 4R27A 3W1QA 2PZNA 3EMCA 3T9PA 1O60A 3DYPA 4H8NA 1R2RA 3I3DA 3NQCA 2VGFA 4B3LA 3SRKA 4LJ3A 2E6YA 4PYSA 1MUWA 4BF7A 4O53A 2QJNA 4IGMA 4S2BA 4A3HA 3OGRA 4RE3A 3ARRA 1DQUA 1VBUA 7TIMA 3NSXA 5H1WA 1YYAA 4CGTA 2PDJA 3CZLA 2FHBA 1C90A 3IUDA 1ZL1A 4CCZA 5BXPA 2Z6IA 1EO7A 2F2KA 1TR9A 2CZFA 2C91A 5H6HA 2BG5A 1CWYA 2E5CA 4XX6A 3UVAA 5CCZA 1UWUA 1MZHA 1WKEA 4HNCA 1I75A 2EPLX 4HZ7A 1M3UA 3P60A 5HNTA 2PSNA 4PCFA 5LNWA 3AIUA 1BWKA 3M0ZA 4IGHA 4HBKA 4MZYA 4W88A 4V28A 3W74A 1YNYA 4RUBA 3UEQA 4JTJA 2WB5A 2E1WA 1L9WA 1B3ZA 3GYCA 4DHGA 5A94A 1ML1A 2PRLA 1E70M 1OHLA 3W7KA 4DPPA 1BKHA 1FXPA 3S5YA 4UTFA 5KTLA 4X61A 2WJFA 5FJUA 2VQUA 2CNCA 2QDGA 2YBVA 3KHDA 1GQKA 1YTKA 3OBKA 1A5LC 4JPGA 2ISVA 2NQJA 3KBWA 4ZE4A 3DKLA 1V51A 4KIEA 2ABBA 5A2BA 3ITTA 4FR1A 2JQXA 1UWAA 4KWSA 4X63A 3QV9A 4OV4A 1GK8A 4AYGA 4QDMA 1XYLA 4KWOA 4ML9A 4KWWA 4WSKA 1PX8A 1B90A 4Z17A 2YIHA 3N13A 3GDTA 3LMYA 3QF0A 3D0CA 4M8UA 3NZ1A 4XZNX 1FHUA 3P82A 2PDWA 2YA2A 4K37A 4ZFMA 1FWCC 1ENUA 1BYAA 3WQ6A 3B05A 1KW1A 1LL7A 4JTDA 1TE1A 1JPKA 3V5CA 1VHNA 3GVWA 4LWWA 1N7KA 3W7CA 3PY2A 4A6GA 4F0MA 3UXDA 2YR1A 4GQRA 4HZMA 3EEZA 3GW3A 1WB0A 3C56A 4WR3A 1BTMA 5GQBA 3T0BA 3CNYA 3KOWA 4CCDA 2B7OA 4FXFA 1TV8A 2G4FA 1E73M 3SUTA 1QO5A 4OU1A 1K9TA 2F84A 2X09A 3KVJA 4ONVA 4BWLA 2OGJA 5DT5A 1X6LA 4V2XA 4MB1A 3FVDA 1RLDA 2J4GA 4UUIA 1E1EA 5K3VA 3THDA 1ESWA 3W1XA 3W27A