2PF0A

F258i mutant of exo-b-(1,3)-glucanase from candida albicans at 1.9 a
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
394
structure length
394
Chain Sequence
AWDYDNNVIRGVNLGGWFVLEPYMTPSLFEPFQNGNDQSGVPVDEYHWTQTLGKEAALRILQKHWSTWITEQDFKQISNLGLNFVRIPIGYWAFQLLDNDPYVQGQVQYLEKALGWARKNNIRVWIDLHGAPGSQNGFDNSGLRDSYNFQNGDNTQVTLNVLNTIFKKYGGNEYSDVVIGIELLNEPLGPVLNMDKLKQFFLDGYNSLRQTGSVTPVIIHDAFQVFGYWNNFLTVAEGQWNVVVDHHHYQVISGGELSRNINDHISVACNWGWDAKKESHWNVAGEWSAALTDCAKWLNGVNRGARYEGAYDNAPYIGSCQPLLDISQWSDEHKTDTRRYIEAQLDAFEYTGGWVFWSWKTENAPEWSFQTLTYNGLFPQPVTDRQFPNQCGFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Hypothetical protein XOG1
publication title Carbohydrate binding sites in Candida albicans exo-beta-1,3-glucanase and the role of the Phe-Phe 'clamp' at the active site entrance.
pubmed doi rcsb
source organism Candida albicans
total genus 151
structure length 394
sequence length 394
ec nomenclature ec 3.2.1.58: Glucan 1,3-beta-glucosidase.
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2pf0A00
4FLQA 4CVUA 4CD8A 2XFYA 3WMSA 1GHRA 2BFGA 4ACYA 3WBEA 3GXDA 4J3SA 1EHAA 1DWHM 2IUZA 1K9TA 1J9YA 1VAHA 4MB3A 5CG0A 1W1VA 4TXEA 3AIEA 4U31A 2WB5A 3ZIZA 3IJ7A 2V3FA 4CN1A 4CD7A 4HMCA 5LA2A 1VBUA 1UR2A 4RE3A 1UWIA 4CD5A 2VC9A 1Q6DA 1PIGA 2J78A 2CETA 1NOUA 1V3HA 1WDQA 2VL4A 1E6NA 3BCDA 1GQIA 3AS0A 2E4TA 4AZIA 3SCQA 1PX8A 1X6LA 3VINA 1V02A 1B31A 1F4AA 2VQUA 3POCA 3VDCA 4NI3A 5AY7A 3SUSA 2GDUA 2J74A 2BHUA 2D0GA 5I2UA 3F5LA 3VD3A 1GOKA 5M03A 1C91A 3CUIA 5JIWA 2OLHA 2G3IA 3FNDA 1GQLA 1ODZA 1OM0A 4EKJA 2A3EA 1ZB5A 1E70M 1UD5A 3AMCA 3AIQA 4H41A 1PX3A 1JNDA 4J3TA 3ZJ8A 4MB5A 3O6AA 2F8QA 3W24A 1C3FA 4ACZB 2D23A 4QCEA 4JIEA 1KR0A 1XRVA 4GIAA 1H0IA 2G3JA 2V3EA 2Y4SA 2HVMA 5GNZA 1B3YA 1HT6A 4BF7A 1W3LA 3VIIA 4FK9A 4BZYA 5FCZA 5JIPA 3ZSTA 2ESCA 3PZNA 4JL1A 2F61A 2WHJA 3VTRA 1UD4A 1OWQA 4GI8A 3AXHA 1E9LA 2JALA 1US2A 5HOSA 1MVYA 1ZU8A 2PWDA 2ZXAA 2D22A 4V28A 4IISA 3VIGA 3FN9A 2WCSA 3VNZA 3UERA 3VGHA 1N82A 2ZUNA 1OT1A 1FH9A 3IANA 4H7VA 1I1XA 1XYZA 4PMDA 1E4LA 4X0VA 9CGTA 1OGGA 3AMDA 3HMCA 3ALGA 3T0BA 4P8WA 3S6TA 1UKQA 1BLIA 1EDGA 3U57A 3NSNA 4YHGA 3VIOA 3GH7A 2BS9A 3CGTA 4AIEA 4QLLA 4AEFA 3B8SA 3W28A 2WVSA 2CKSA 1GZJA 1TA3B 1QI3A 2ZE0A 4HPHA 4W89A 1A47A 3MUZ1 4YHEA 2Z1SA 4HA1A 3A4XA 2J77A 4URIA 2OYKA 1UUQA 4E8DA 1BAGA 1G5AA 3WMBA 3L4VA 2GK1B 3DYOA 3WH9A 4TTUA 4KRTA 5ABFA 4H8UA 1J0HA 1CXEA 3DECA 1UR8A 3VGGA 3CUFA 5A69A 3OA5A 4AZGA 4QDMA 2PWFA 1LG1A 3VGDA 3OB8A 2GUYA 4TX6A 1QHPA 5BCAA 3SCVA 1UG6A 4AZHA 3ARPA 2F2HA 3RJYA 2VZSA 1HF6A 2VX7A 1CIUA 2XVGA 2EPMX 2ZXBA 1U33A 1FOBA 4WSJA 1W1YA 2EPKX 3KEHA 3MO4A 5CPTA 6CGTA 1KWGA 1E3XA 5DT5A 2CKRA 1V03A 1LL4A 2CPUA 3MKKA 1E6SM 1WNOA 1V0LA 2J7EA 1B30A 1XSIA 1WZKA 3NDZA 4ZE5A 2ZUMA 5TD4A 3VIMA 4MNMA 4MJ4A 4M24A 3NDYA 1JNEA 2W66A 4MAVA 4F79A 2WWDA 1V3IA 3U7BA 1GOIA 4AY1A 3T0DA 5D9PA 4BA0A 3UEQA 4W88A 3RM4A 1EA9C 4J7RA 2GJRA 2OWXA 1MW0A 2NT0A 2ZUSA 3W81A 2GJPA 3VVGA 4P7RA 1DP0A 2YJQA 1UH3A 2WYSA 1E0XA 2CEQA 3OGSA 1B3XA 5D9NA 1HL8A 2YKKA 4LQ1A 5ECUA 1W3HA 1RD6A 2J62A 3AYSA 3WQ8A 3KL0A 5I79A 4PTVA 4DUVA 4PMYA 4NRRA 4W8LA 5A6KA 3WD3A 5FIPA 3OZPA 1QW9A 4DWSD 4J27A 1VFOA 3BLPX 2Y2WA 4AIOA 3SCSA 1FP9A 2VMFA 3IJ9A 4M8UA 1R87A 1MW1A 3BLKA 4XX6A 1W3KA 1EGZA 2DSZA 3KWXA 1V6WA 5F7UA 3B9DA 2O92A 1K9EA 3LPOA 4XZBA 1JZ4A 4U33A 1NARA 2WVUA 2ZUVA 1SMDA 1OSEA 3ALFA 3AZTA 2XVNA 1C90A 2ZX8A 3MUIA 2YA1A 3ZM8A 1JF6A 1Q6FA 3S2CA 2NT1A 2WKGA 5A8MA 3UESA 1DHKA 1JD7A 2HISA 4UQBA 1E4MM 3RCNA 4CU6A 1DWFM 2Y5EA 2CCRA 1WDRA 4JCLA 4IPNB 3CZ8A 4D71A 1GUVA 5I3DA 3OGRA 1NP2A 5I24A 5A6SA 1JI2A 3DC0A 3UCQA 1M53A 2XSAA 3CTTA 4J3UA 4D6GA 1ISWA 1V0MA 5A95A 2DDXA 2X1IA 2W92A 5I23A 4BCEA 2G8ZA 2VT0A 4V27A 4BS0A 4CN6A 1JYNA 2W62A 3ARXA 1KBBA 3L4TA 3TONA 1W9DM 2WPGA 2WZHA 2W67A 2O9TA 5I77A 4K68A 5A6AA 3AHYA 4TOQA 1JYVA 3LMYA 1LQ0A 2YDRA 4MB1A 1WKYA 3MV11 2YLAA 3TTOA 1HJXA 3W27A 3NSMA 4M82A 1UWRA 1EO7A 1FA2A 2YDSA 4MDOA 4D6EA 4PBGA 3U5UA 1QPKA 4PTXA 2Y8VA 4OIFA 3OLIA 3GXFA 3M46A 3WKZA 1ISZA 4W86A 1Q4NX 3PZUA 1WZMA 4KRUA 2WVVB 1H09A 4AZ5A 4B3KA 1XGZA 4JKMA 1P6WA 2YL9A 1F4HA 3K8MA 3CZJA 4GQRA 3ARRA 3U5YA 3ZO9A 2WMGA 2OWCA 3HJEA 1ZL1A 3K46A 1V6VA 3SIMA 1LJYA 3SCUA 3BCFA 1E6RA 2IXVA 4WJXA 4CCEA 3PZIA 1ZBKA 4B15A 3D3AA 1TUXA 3AJ7A 4XV0A 2VCAA 3MS8A 2CBVA 3THCA 5HXMA 5C71A 1J0KA 1MFVA 5A6BD 5A6MA 1IV8A 3WL0A 4A3YA 4PUEA 1UWSA 4PTWA 1MQRA 3M6DA 4DWSB 5DT7A 4RE4A 3WEMA 3WDJA 5AYBA 4B9ZA 1CGTA 4ZXLA 4LPCA 2DT1A 2VRQA 3SCPA 2WC3A 3WEZA 1HIZA 4LX4A 1W9UA 3VX1A 3LPGA 3PTKA 1CPUA 3QGVA 3WNMA 5I5RA 2GJXB 1B1YA 2WSKA 3VD7A 4F66A 1BGGA 5A6LA 3OLGA 1I1WA 1M7XA 5AC5A 2DSWA 1ESWA 5BXSA 1JZ2A 1HKJA 1CXKA 1TR1A 1V0KA 5HPOA 2EXOA 3GYCA 1VEPA 2JIEA 4PMUA 1UD3A 1W2PA 4IM4A 3VUPA 3GM8A 5I6SA 2E9BA 5E6YA 1J0JA 1B90A 3GH5A 4D6CA 2WC4A 1E5NA 4JL2A 1IZKA 1O7AA 1R7OA 1E6PA 2A3BA 1J01A 4MTVA 4P8XA 4XZWA 4IPLA 4P7LA 2FHFA 3MUAA 1JZ8A 1VIWA 1QI2A 2XPKA 3SUTA 1KB3A 2J7HA 1JIBA 1NP0A 5E0FA 2XFFA 1RP8A 5DF0A 2JFEX 2X0YA 4UOQA 1QBBA 1X6NA 2E3ZA 3ARQA 5I78A 2VR4A 4RL3A 4CVWA 4BQ3A 3TTQA 3FHAA 3N04A 1BYCA 1BVNP 3CZGA 5ABGA 5DMYA 1XCWA 4PN2A 3VDHA 4W7VA 1CXIA 1GOWA 1XH2A 3ZSSA 2ZIDA 4UFKA 4AZ7A 3BAJA 6TAAA 1MQQA 1VF8A 4PMQA 2DIJA 3ECQA 4CUCA 1LWHA 4UQ9A 2AAAA 2ZX9A 3AI0A 3RDKA 1BFNA 1ODUA 3T08A 3WNKA 1KQYA 3WNOA 4AW7A 4HZ8A 1XSJA 4CKQA 2C7FA 3GNRA 2VX5A 4W5UA 3AQUA 3BH4A 5FD0A 2XGBA 3WUGA 4GZEA 3IK2A 4WKAA 2OWWA 1KXVA 3BAIA 5ABHA 4LYRA 2UWFA 1C8YA 2QHAA 3SEPA 1DTUA 4N42A 1DWJM 1Y7VA 4FLSA 3TTSA 3GDBA 2CYGA 2QLYA 1TVPA 2WLYA 1J18A 2XM1A 3W4RA 1QW8A 1E6ZA 2YL8A 1KXQA 3K8KA 2CHOA 5E9AA 5FL1A 1EHNA 1JAEA 2WLZA 3VD4A 5D8ZA 2WZEA 3VIFA 3MSDA 2BHZA 4M1RA 4DWSC 1JXJA 1TFVA 5IDIA 5M5DA 1FH7A 1HVQA 1XYFA 1OGBA 4MJ2A 1OGSA 3A47A 3CMJA 4ATWA 1PX4A 4UQCA 2ZUWA 3BSHA 4QLJA 2DPEA 4JCMA 4HZ6A 2GFTA 1UR0A 2VJXA 3WDPP 4R5EA 2O9RA 4MADA 1XSKA 2RGLA 5A94A 1HP4A 4CCDA 1C92A 1NWSA 5CPQA 2EO7A 2V5CA 1UKSA 3AS1A 4UFIA 4AD4A 4AC1X 2E8YA 1M04A 4D72A 3UETA 1BF2A 1H41A 2D1ZA 1UR9A 1CYGA 4CD4A 5KEZA 1E0VA 3VM7A 3EDDA 1HXJA 5LA0A 1W9XA 1CXLA 1HJWA 4QLKA 3E1F1 3RMEA 3QR3A 5EMYA 3VGBA 1D3CA 3GBEA 3QHMA 4EAMA 3NUKA 4JHZA 4P8VA 1Q6EA 2J8FA 1GPFA 2J7GA 4S3JA 4D1IA 5IFPA 3ARUA 2DH2A 4DUWA 4AZCA 1EIBA 1RH9A 3APGA 2VTFA 1UZ1A 4NRSA 1QI4A 4OBSA 2QPSA 1JZ5A 1JL8A 2MANA 4UOJA 3N18A 2EJ1A 1ZBWA 2WBGA 2OSYA 3WD0A 3SURA 4CU8A 1CBGA 3VM5A 5A8PA 1QNOA 4ZENA 2JIWA 2ZX7A 3UR7A 1GQJA 4Y7EA 3NYDA 1D2KA 2JEQA 3SCTA 1WZAA 4CN4A 3F5KA 2W5FA 2YA2A 3BGAA 3VKKA 1ISYA 4AD5A 3NJ3A 3VDBA 1B9ZA 2DSVA 1FHDA 4U5IA 2PI6A 3WY1A 3A4WA 2BXZA 2XFRA 2WXDM 3T2QA 3VGFA 7A3HA 4MNJA 2ZICA 5LYRA 1A3HA 1MWOA 2QMKA 4NZCA 1AQMA 4LGXA 2PB1A 1G9HA 3ARZA 5CLTA 5A8NA 3CZLA 2AOSA 1HKIA 2PBOA 2VZUA 3OZOA 3AS3A 1OIMA 4WKFA 2BNJA 2E8ZA 3AZRA 5AC4A 1VB9A 2XM2A 2A3CA 2DT3A 5CGTA 5BXTA 4UFJA 2WWCA 4X0NA 1YHTA 7CGTA 5FKYA 3J7HA 3A6OA 1LL7A 2CHNA 3L4UA 2W4XA 3DHPA 1H0GA 1BYDA 2CIPA 2PWHA 3KZSA 1E5JA 1M03A 4HZ7A 4MPKA 2CITA 2VR5A 1QNQA 3ZR5A 6A3HA 1JDDA 5D9MA 1HN1A 3CHFA 2BY1A 3GH4A 1LF1A 3WQ5A 3CBWA 3SCNA 1HX0A 3CLWA 3OBAA 2CERA 3FAWA 3M07A 1SFSA 1J0YA 1NM9A 4HU0A 3MSGA 3N13A 1CDGA 2GDVA 3PZOA 3WD2A 3GNOA 1B3WA 2BVDA 1E4NA 1GVIA 3CUGA 4D6JA 3CUHA 1VFMA 1EOMA 4HMDA 1QOXA 2VX6A 3FHQA 4CCCA 4QP0A 1HL9A 4D6DA 1UWUA 2X05A 4JFSA 1XHGA 2OYMA 3AHVA 5A1AA 1W32A 5DO8A 4CGTA 3WQ6A 4P7OA 3SUWA 4H8HA 3VO0A 1VEOA 4A3HA 5IXEA 1E71M 2FH8A 3EBVA 3WF0A 5LA1A 3T2PA 1FFQA 2WMIA 1GHSA 2EQDA 3B9EA 4TVCA 1CXFA 3OG2A 3ZT6A 3NSXA 4D6HA 1O6IA 1E72M 2CESA 2BY0A 2VURA 1BVZA 5JBDA 2WBKA 5FOOA 1ISXA 1Q6GA 1CWYA 3ZR6A 1SR0A 4HOZA 1ECEA 1UHVA 3WSUA 5EFFA 1MFUA 3RJXA 5GNXA 1X1NA 5GPRA 1MW3A 4PYSA 3BAKA 3U7VA 4AWEA 1NOFA 2XVLA 1EH9A 4YPJA 1W9PA 1MQPA 5A2AA 4EE9A 3I3EA 3FW6A 5CPSA 5CSYA 3WH5A 2VZOA 2XIIA 4PSRA 1R8LA 2YL5A 2UY3A 5FL0A 4AD1A 2J7FA 2VVNA 1GJWA 1LWJA 3ARTA 1US3A 3EYPA 3WN6A 3AHZA 2RGMA 3AROA 1QI0A 4E8CA 5CZKA 2VOTA 3MMDA 3CPUA 1BQCA 1UH2A 3WF1A 4J3WA 2VNCA 4GO9A 1HJVA 2PF0A 2D3LA 3IAPA 2OSWA 4U2YA 4GI6A 1H11A 2J75A 3GTNA 2WC7A 5BROA 1JDAA 2PBGA 1UA3A 4B16A 3WELA 5BYWA 3QOMA 3LPPA 2J7CA 2BHYA 1UKOA 1W9BM 4PEEA 5A2CA 2VVSA 1C7SA 4M56A 1ZJAA 3A4AA 1H2JA 1XD0A 5E70A 1QBAA 3CO4A 1UQYA 5M3WA 3WUEA 2WANA 4PUDA 1CGUA 3AIVA 2D3NA 2WVTA 3FXYA 5BXPA 1WAWA 4R27A 3CHEA 3D5HA 2Q8XA 2BVTA 2QPUA 4ZXOA 2AMGA 3EMZA 1DWGM 2W63A 1UKPA 1PEZA 3THDA 3MMUA 4TVDA 1E73M 1BGAA 1PAMA 4J28A 1CECA 3BAXA 1PZ2A 3KL5A 3WFZA 2WMHA 1U2YA 2CBIA 3ARWA 1QI5A 2DSUA 1H49A 4GINA 4AD2A 4AEEA 4JKLA 1JZ7A 3WDHA 2O9PA 3WUFA 4BQ2A 1QNRA 1ISVA 1RPKA 1PJ9A 3WDIA 1E1FA 5HDRA 4EK7A 4P7QA 2EEXA 1UA7A 4GI9A 5CGMA 4HOXA 1V3KA 1OIFA 2WK2A 4BQ5A 5ABFB 1CGWA 1XCXA 1FHLA 3W0KA 1OB0A 2WHMA 3TTYA 3ZMRA 4OJYA 1JXKA 3MMWA 4GZJA 4L4OA 4NF7A 4D1JA 1L0PA 1DWIM 1V6XA 1WE5A 1OINA 1V6UA 4DM1A 2VRKA 1JYXA 1GORA 3WF4A 1TCMA 2W91A 4KWUA 1FP8A 5JBFA 2XVPA 3ARYA 1W2VA 2EPOA 4KH2A 1MXDA 2DSKA 4ML4A 3AIUA 3GXIA 4Z2HA 2G3MA 4AYSA 1QHZA 3CUJA 5A8OA 3VPLA 4F9JA 2GK1A 1BHGA 3T09A 1WDPA 2ZX6A 5E09A 3W6MA 3SCRA 3W26A 3VMPA 1BG9A 2G41A 4WK9A 4J3XA 4YN5A 2V38A 4J3VA 4JAWA 1DWAM 5IHRA 2C0HA 3WDRA 4W8BA 2XTKA 3PZGA 1FFRA 5DFAA 2YA0A 4C7FA 1J0IA 2WMJA 3UG3A 2E9MA 3VMOA 2CBUA 1B3ZA 2VO5A 3EDEA 4GKLA 1E0WA 2BY2A 3WL1A 1WZLA 1XH0A 3BAWA 3G6LA 3VIJA 3ZT5A 1J10A 1WO2A 4B9YA 3PTQA 1C8QA 1H1NA 2FH6A 1BYBA 1KFWA 2WW5A 2XYLA 2DEPA 5A3HA 1W9VA 2VRJA 4U2ZA 2ZWZA 4UQDA 3OLDA 2VCBA 3ARSA 1IT0A 2WMKA 1AQHA 4P8UA 1M01A 4JFWA 1SMAA 3HU7A 1GOQA 1JDCA 5A2BA 2G3NA 4DUXA 4UCFA 2WMIB 2GVYA 3OGVA 3AXXA 4U5KA 1ZBCA 4ZEPA 3KE0A 4AIUA 2E9LA 3AICA 4PSPA 4E2OA 3IAQA 1W3JA 1AMYA 1VFFA 3MANA 3VD9A 3OIHA 3AYRA 3RM9A 3AIWA 4C7GA 4NSBA 8A3HA 2UY2A 5D4YA 1PBGA 3POHA 1TG7A 2YBTA 4KMQA 1W91A 4AZBA 2WCGA 1R7AA 1E43A 1H5VA 2VUYA 4PMZA 3K1DA 2UY4A 3QHNA 4ATLA 4OOZA 3UR8A 1R85A 1WPCA 4GPNA 4W85A 1NWRA 3GXMA 3VIKA 4PMRA 3PZQA 5JBEA 2QV4A 5A6JA 3WEOA 3WF2A 4LYQA 3SUUA 4AISA 3HN3A 3VD5A 5BRPA 2B31A 1UR1A 2EBNA 3NIYA 2XWEA 1HJSA 4ZE4A 4PRWA 1YQ2A 3W38A 3VMNA 2Z1KA 3WD1A 2PWEA 1HNYA 2J7DA 3PZMA 3CZKA 1CTNA 4Q7NA 1EDQA 2DT2A 1JAKA 3EDFA 2XHYA 4QAWA 3WQ4A 4XUYA 3VIPA 3JUGA 4WSKA 2D0FA 3FY1A 4AD3A 1XV8A 3VGEA 2QMJA 4Z2LA 3BAYA 2IXUA 2WHKA 3MUY1 4AD0A 1VJSA 4GO8A 3II1A 1GOOA 4UZUA 3N9KA 1KGXA 1EO5A 4DM2A 1E55A 2VQTA 4TTGA 8CGTA 4UTFA 1H3GA 1CEOA 1K9DA 3W53A 3WNNA 1GVYA 4JFTA 3GZAA 4UQEA 4PMOA 1V0NA 1JF5A 4LYPA 5CSUA 5C70A 4PCSA 2VZTA 3CIVA 4UFMA 1TMQA 1CLXA 2JF7A 2EPNA 3PN8A 5C8BB 1KWKA 1DEDA 1UOKA 3RO8A 1E1EA 2J7BA 1UD6A 1WDSA 2XG9A 3ZQ9A 4OUEA 3DYPA 5IFTA 3N1AA 3AIRA 2VX4A 5I0DA 1XD1A 1NQ6A 3WFLA 3BSGA 1ZS2A 2WVVA 1GJUA 4MAZA 2Y24A 3L4ZA 2BY3A 4KGLA 1C7TA 4JFUA 3F5JA 5DEZA 3RILA 1HKMA 1TZ7A 1KCKA 1VENA 2C8NA 4D6IA 2QF8A 1XH1A 3AMKA 2VCCA 2PC8A 3AISA 3ZJ7A 2XIBA 4CD6A 1NWUA 4AZ6A 1BYAA 1JD9A 3AIBA 3W37A 3AS2A 4Z2IA 4S3KA 2J47A 1QVBA 2WCAA 2WKLA 2D0HA 3PZ9A 4JZ5A 1U30A 1Q6CA 1OD8A 3WNPA 1V3JA 2WNWA 1AQ0A 4DWSA 1W1PA 1Z32X 1G01A 3AZSA 1B3VA 3QOKA 4OOUA 3UG5A 3GBDA 3VU2A 2D24A 5BWFA 2WHLA 2BVYA 1GCYA 3N15A 4UFHA 3QHOA 3WD4A 4HU8A 2GJXA 1J0ZA 4MNLA 3BXWA 1E56A 4PCTA 2JF6A 3PTMA 1LL6A 4F8XA 4FLOA 1UR4A 1L8NA 4C7DA 5BRQA 2EPLX 3CMGA 3L4WA 4ZFMA 5EBAA 1R86A 2FHBA 2WMFA 1VJZA 4X9YA 1EOKA 1SYTA 1FH8A 1OCQA 3AMGA 1K6AA 5E0CA 4A4AA 1GOMA 3CHDA 3ZJ6A 3W25A 3OLEA 1VFUA 1CENA 2E0PA 2YBUA 2OSXA 3BMVA 2CXGA 3BMWA 1UWQA 3WNLA 4ATDA 1ITCA 3RPMA 1H4PA 2BV9A 3AHXA 4UOZA 1J12A 4HPGA 2V3DA 3T2OA 4EANA 2ZWYA 2ZX5A 3MU7A 4P7NA 4PMVA 4Q22A 3CHCA 5D9OA 2Y8KA 1PZ3A 3CH9A 4U3AA 2J25A 1EQCA 3BC9A 4JFVA 4QCFA 4UZSA 4N0RA 4MDPA 2YOCA 4UR9A 4H2CA 3W29A 2XSBA 7TAAA 4HMEA 1GQKA 5HBFA 3DHUA 4HA4A 5ABEA 3N17A 3VDAA 1HJQA 1HKKA 3FAXA 3T0AA 1AVAA 1D7FA 5IHSA 1V02E 4W7UA 1MXGA 1UWTA 3ZJKA 3WQVA 1B0IA 2NSXA 3VILA 4H04A 3WMCA 1JGIA 1G1YA 4PMNA 1KXTA 2XUCA 1WCGA 2D20A 4W87A 2CNCA 5M17A 2ZUTA 3NCOA 1V6YA 3WH7A 3EMQA 2WSPA 2G4FA 1QHOA 1E6XM 1S46A 1E40A 5GQBA 2FHCA 4QFUA 4FLRA 1UD2A 4TVUA 5A6BA 4KGJA 3TA9A 3K4DA 1C93A 3AOFA 4B3LA 3ZOAA 2BXYA 1JZ3A 1V08A 1OBAA 1OD0A 1JG9A 2DH3A 4E4PA 4OBRA 1CZ1A 1E4IA 3WUBA 4W84A 3VNYA 2NW0A 2YLLA 3GNPA 3TOPA 2ZOXA 1UH4A 4OZOA 3N12A 1VBRA 1W1TA 1WB0A 4PMXA 3AHTA 1JYWA 1HVXA 1BSIA 2O9OA 3ZT7A 4L4PA 4JHOA 5E6ZA 2ZXQA 3RM8A 5HPCA 4AZCB 2XGIA 1RP9A 2VI0A 4W93A 1CGYA 3EDKA 3SUVA 3SCWA 3O2LA 5CQ1A 3WF3A 4CU7A 4U3CA 1ITXA 1G0CA 1VRXA 4ACZA 2X2YA 4GZIA 2WAGA 3L4XA 4HA3A 2D2OA 2X0HA 3F4VA 3WENA 1JI1A 3MV01 5GNYA 2YDQA 5KZ6A 4MNKA 4M29A 3WBAA 3PHAA 1MYRA 2V3GA 1B2YA 2J4GA 2GSJA 2YIHA 3AXIA 2JE8A 1CNVA 3WQWA 2XJ7A 1VEMA 2DGAA 3L2MA 2X09A 3M7SA 5CXPA 4LXFA 4HTYA 4FMVA 1KQZA 1KBKA 3PBGA 3VX0A 2ZUUA 4UQAA 2E40A 3PZTA 1CGXA 3I3BA 2J8GA 1ZBVA 4Z2KA 1HP5A 3WH8A 1UKTA 3L4YA 3A3HA 4W5ZA 4BQ4A 5HNNA 3AMLA 2A3HA 1OT2A 2DT0A 1QNPA 4TUFA 3G6MA 3VIHA 1JFHA 1GNXA 3WIJA 1HJUA 1LG2A 2J79A 4GXPA 4WLCA 2V5DA 1E6QM 3CZEA 4AMCA 3I3DA 4WKHA 3B9AA 4MB4A 1MW2A 3KL3A 1I75A 3TP4A 1C8XA 1CXHA 1UD8A 4H8VA 4V2XA 1TA3A 3K4AA 1TVNA 1KXHA 3N11A 1K9FA 5BXRA 1J11A 1CLVA 2FGLA 3VOCA 4WIWA 1EDTA 1KGWA 5CJ5A 1WP6A 4UFLA 2TAAA 3WH6A 4XB3A 4Z2GA 4WF7A 1TE1A 4OKDA 1JZ6A 3L2LA 1UQZA 1PIFA 2DIEA 2XWDA 1KCLA 2XVKA 1BG4A 2W61A 1BTCA 3IJ8A 1G94A 1GW1A 1XC6A 4Z2JA 4M81A 4RE2A 3SCOA 1LLOA 4F9DA 4HP5A 1CGVA 1IZJA 1KR1A 2ZXDA 1JFXA 1ZJBA 3LPFA 3PZVA 1BPLB 4D6FA 3EDJA 1E3ZA 4HOWA 4GQQA 3DYMA 2FGZA 1V3MA 1EQPA 3EMCA 2WZIA 3WDQA 2A3AA 4W7WA 4W8AA 2UY5A 3W6LA 4FF5A 4IUGA 2OYLA 1PPIA 5EB8A 3K8LA 2YL6A 5D8WA 4M80A 1V3LA 4UNIA 3W82A 4TX8A 3UG4A 3AFBA 2WM0A 5EFDA 2PWGA 2X8RA 2CBJA 3RIKA 3ARVA 3O9NA 1NWTA 4JKKA 5JUVA 5AYIA 1QNSA 1EXPA 1NH6A 2VZVA 1UYQA 2DQXA 1UZ4A 4PTMA 5A8QA 1NOWA 1GONA 5CLWA 4AXNA 1E15A 2JEPA 2FDMA 1KGUA
chains in the Genus database with same CATH superfamily
4FLQA 3O63A 3WMSA 2BFGA 1AK5A 5U7SA 5LNSA 2ABBA 3NQ2A 3GR8A 3GXDA 1XS2A 1EHAA 4HNOA 1S5MA 4HT3A 1TTJA 4TXEA 2HK0A 2DUAA 2I14A 2V69A 5LA2A 3DGRA 2OZTA 1UR2A 4KEMA 3LHWA 2QJNA 4CD5A 3IWPA 1F73A 1NJJA 1EC7A 3NO1A 1OHLA 2E4TA 2F2KA 4QRNA 3NGFA 1VLWA 3POCA 4NI3A 3SUSA 5IBXC 2BHUA 3I4EA 2D0GA 3ZXWA 3GS6A 4MSSA 5M03A 3RCYA 5JIWA 2OLHA 2G3IA 1TZZA 3PUGA 1J2WA 3DFQA 3W73A 5HWJA 4H41A 3DENA 1AZ1A 1JNDA 1O5XA 3GVQA 1H7XA 6TIMA 3I6TA 3C0JA 3HG3A 3BVJA 3PPFA 1KR0A 2R6OA 4MM1A 4NT0A 3M0IA 4M6UA 2QULA 2QJHA 4IPIA 4BF7A 1W3LA 4BZYA 5FCZA 5JIPA 3UVAA 3LXAA 3MDUA 4GC3A 3BDKA 1C9WA 2A3LA 1J4EA 1OWQA 3GQYA 5DELA 1SUXA 3PBVA 2JALA 4BF9A 5G4WA 1XLMA 1FWCC 2PWDA 3RF9A 2H6RA 4V28A 1QMLA 3VIGA 2YCKX 1P0KA 1N82A 2PDFA 1OT1A 2EG8A 4X60A 1XYZA 1T5AA 2W6RA 4GFSA 3GY1A 3DAQA 1OGGA 3DU0A 1F3TA 3VUSA 3HMCA 3XISA 3S6TA 1KV8A 3NQBA 5FF2A 4Q33A 1AMKA 1DJGA 1RD5A 3U57A 1RLCL 3NSNA 3NQGA 3GH7A 2BS9A 2C79A 4F0SA 4QLLA 4LUIA 2NX9A 2C1HA 3G1DA 4UTUA 3PUDA 1QI3A 1A47A 2ASHA 3MUZ1 4EIVA 3GX9A 2Z1SA 4HA1A 1XLIA 3A4XA 2J77A 4URIA 4MJMA 1UUQA 4E8DA 1UWAA 1G5AA 2OJPA 3L4VA 3N3TA 3WH9A 3KVKA 5ABFA 1J0HA 2ZZ1A 3CB3A 1X38A 2JKPA 4QDMA 3UFYA 2FZNA 3FYYA 2X1SA 2CLMA 3VGDA 3OB8A 1YMYA 1I2NA 2GUYA 4ZB0A 4QDWA 2LLEA 1UG6A 1ALDA 1HF6A 1CIUA 3DGBA 1PWLA 2XVGA 1UB3A 3LEPA 1U33A 5LNWA 1N7KA 3MO4A 5CPTA 1XJBA 1KWGA 4Y8EA 4PODA 4MWAC 5H91A 1RA0A 2E09A 1PHQA 3MKKA 4XAGA 4ZE5A 3NDZA 4I9TA 4O14A 3UNTA 1LP6A 4I6KA 4MJ4A 3ICJA 4MAVA 4F79A 1K03A 2FZ8A 1IF2A 4IPPA 3TFXA 2QDHA 4BA0A 3LS9A 2GJRA 2OWXA 1MW0A 2ZUSA 3GHRA 3WFAA 3MQTA 2E6DA 1POKA 1UH3A 3VKAA 3CB8A 3BW4A 3QY6A 4JTQA 3B4UA 4PH6A 1V7YA 2E5CA 1RD6A 2J62A 3S6DA 3W1TA 1VD6A 4PTVA 1YE6A 3K4WA 3REQA 4Y9PA 3R4IA 5DMNA 2NQZA 1YW1A 4UBPC 3BLPX 2A4AA 4ZO9A 3SCSA 4F0KA 3B3DA 3QVQA 2INEA 2VMFA 3IJ9A 3EXSA 2YXXA 1XL9A 3KWXA 5AHIA 2FLIA 3M0JA 4B5UA 2O92A 4GE8A 1H1ZA 5FEPA 5LIYX 1VLIA 1TWSA 4DLMA 3ZR4A 3UD6A 5EPDA 5A8MA 3F4NA 5GJNA 1U5JA 1GUVA 1XLEA 4DNMA 2H90A 3L0KA 4YTSA 5A6SA 5I24A 1JI2A 3L67A 1M53A 2XSAA 1XYMA 3KTCA 4KWWA 4HHMA 1V0MA 5A95A 2R1KA 2X1IA 2W92A 2G8ZA 4IIDA 2W62A 3PBMA 1SO3A 2OEMA 4GD0A 4POCA 4FNQA 3AHYA 4TOQA 3T05A 5CC5A 5I00A 1A5MC 1XICA 2X42A 1IXNA 2QIIA 4E0CA 1WKYA 3UY8A 4M82A 1DQWA 3LI0A 1S1RA 1A5OC 4ERAA 2VEPA 2YDSA 4D6EA 3QMTA 3FVMA 3UR2A 1PCWA 5F2LA 3B8IA 3QGKC 2EKCA 3QQ0A 3GXFA 1H50A 3M46A 1OZQA 5FJJA 3E0IA 1Z41A 1MEWA 4KRUA 4DJEA 3PWIA 1XGZA 4HPJA 2OWCA 4L6OA 3KUMA 5FSDC 1QK0A 3UPBA 4ZOEA 1V6VA 3N19B 1JVNA 4K3ZA 4NYUA 3NQ8A 1E6RA 2IXVA 4JXCA 3O0FA 4AWSA 4FZIA 5HMDA 5J8LA 4IMGA 5C9ZA 2FPYA 5HXMA 5C71A 5HUPA 5HQLA 4RX0A 7ODCA 4L7ZA 3M64A 2QF7A 3HIJA 4A3YA 1UWSA 3ZWTA 3GC5A 3MUXA 4WDWA 2ZA1A 3IUDA 5DT7A 3MZ2A 4RE4A 5AYBA 4ZXLA 1NIUA 1VKFA 1EF2A 4OBTA 4LX4A 1Q85A 4GCAA 4LEQA 3VX1A 2TSYA 3G2GA 3WNMA 1DIKA 4FIRA 2GJXB 1OX4B 1YPXA 2PDNA 3ZS4A 4LFYA 2WSKA 2X40A 2AQWA 3GRIA 3R6IA 5HWNA 4F66A 2F38A 4RE0A 3EOLA 4GGBA 3OLGA 1I1WA 5AC5A 5BXSA 1JZ2A 1W3IA 1W5QA 1FWGC 4ZOCA 4KKXA 3GYCA 4A29A 4PMUA 1XX1A 1W2PA 2CHRA 3S3GA 5I6SA 2BWGA 4C6IA 4D6CA 5EY5A 1TELA 1E5NA 1R2SA 1A0EA 1J01A 4MTVA 3CUZA 3BUVA 3MW7A 1Z69A 3MUAA 5FEXA 1N8FA 5HUOA 2A5HA 2Y5SA 2Z0IA 5E0FA 3TN6A 5KITA 1FQ0A 2X7WA 1RP8A 4UOQA 1X6NA 2BOFX 4BQ3A 3TTQA 4KEUA 3UXLA 3CZGA 4O0QA 8RUCA 1R3RA 1XCWA 3VDHA 4W7VA 3UYIA 1P6CA 1BSLA 1MSSA 2ZIDA 5TQLA 4YCPA 1IYXA 4KFNA 2PDKA 5CZTA 3CAKA 4JTKA 2J6XA 3RDKA 2X30A 1BFNA 3KHDA 3ZVHA 3WNKA 3TAKA 3UWUA 4LANA 5CBBA 4HZ8A 4TQTA 3CUXA 4HSNA 1XSJA 4Z0SA 4W5UA 3ITGA 3AQUA 4RR4A 5BW6A 3GVVA 4MFDA 3UR5A 5CPNA 4GZEA 4WKAA 2OWWA 3EKLA 2B7QA 1AJ0A 4LYRA 1JEZA 3W74A 4B5SA 3LX9A 3ATYA 1Y7VA 1EPVA 1X97A 5G2IA 2XM1A 1TPB1 3LQGA 3HM7A 1BTMA 4I9MA 4M3PA 1EHNA 3H2OA 2XIQA 2WZEA 2B7NA 3E96A 5HJYA 1SO5A 3GTIA 3AAMA 1OF8A 4CQAA 1HVQA 4MJ2A 1OGSA 2QXWA 2CLLA 4GJIA 4UQCA 4O1DA 3RLUA 2ZDRA 2A7RA 4LNYA 4HZ6A 5DXYA 1UZHA 4BEQA 3WDPP 4DBSA 3GG7A 4MWAE 4MADA 1WXYA 3MHUA 1SSGA 3QC3A 1HP4A 5K4XA 3S1WA 1XPGA 4GISA 1SVDA 5LXEA 3N29A 4D72A 3NFUA 3LTSA 1A49A 2XIJA 3UETA 3DFTA 2HBXA 3NL6A 4TR9A 3ES7A 3R0UA 4US5D 5LA0A 1W9XA 1J5TA 3E1F1 3V0UA 1RPXA 4EAMA 4JHZA 4K8GA 3IVUA 1Q6EA 3DHFA 4S3JA 1GKPA 4O1FA 1IGSA 4D1IA 5IFPA 4Q4OA 3ARUA 1ME8A 4F0MA 3BLIA 2ON3A 4ZCWA 4ORIA 2IKHA 1TVLA 3DG3A 3B0XA 1TB3A 3BQ5A 4EOUA 2RFGA 4FA3A 3WD0A 1YXYA 2RJHA 3VM5A 5A8PA 2VP8A 2QZRA 3CTLA 2ZX7A 1GQJA 4Y7EA 4DX3A 3F5KA 2W5FA 2YA2A 5G1MA 4KQNA 3VDBA 4NP7A 1FHDA 5MKGB 3N34A 2V63A 1VZWA 1GZGA 2OX4A 2XN1A 3VGFA 1K02A 1W56A 3W07A 3VFLA 3DG7A 4GCXA 1MWOA 3O6CA 3CK5A 2PB1A 1G9HA 3PG8A 5K4ZA 3F7JA 4N6EA 2VZUA 3GIQA 4IUOA 3AYVA 2DQWA 2HRWA 4JTCA 2XDFA 4FNRA 3DBPA 2H9AA 3O6YX 1VB9A 2A3CA 4JTAA 4X0NA 3INPA 3WMLA 4O12A 3J7HA 3KBJA 3H2EA 3W70A 1SZEA 5MHBA 1LL7A 4G7FA 4GA8A 1L2QA 4WDXA 3FJLA 2H3DA 4IJRA 3KZSA 1M03A 4B2DA 3JR2A 4JTEA 1UROA 2YB1A 5XINA 4A8RA 1K8YA 1PIIA 1QPRA 4LAMA 1LF1A 4V1YA 3FVDA 1CCWB 3PUOA 4XBSA 3OBAA 4AMAA 2FVLA 2GUUA 2PU0A 1A80A 4HU0A 3MSGA 3IRSA 4Q8PA 5LZLA 4DYKA 5I7GA 4KS0A 5BZAA 3HGJA 4C6FA 2BVDA 2Y7GA 1A0CA 1PHWA 4RV3A 4CCCA 4YU1A 1NDZA 5D2WA 1HKVA 5DO8A 4CGTA 3SO7A 2VXNA 3WQ6A 4C1NA 2V2HA 2SFPA 3VO0A 1ZUAX 4A3HA 2IMRA 2ZQ0A 3EBVA 3VKJA 4HPXA 3T2PA 4JYEA 1OADA 2WMIA 2AGTA 4TVCA 1R38A 1MUWA 3Q45A 1E72M 2QPXA 2BY0A 1BVZA 1O5QA 2Z25A 4NX0A 1AH4A 4XO7A 3N9RA 3TJXA 4HOZA 1SO4A 1ECEA 1F6YA 3C2EA 1EJWC 3WSUA 1HQTA 5MF5A 3MP5A 2CFFA 4EF8A 5GNXA 3R89A 3W88A 4GRSA 3BAKA 1NOFA 2XVLA 3SFWA 3W2UA 4I8YA 3JZUA 4EE9A 1H61A 3WH5A 1KO0A 1R8LA 3BV4A 3DBNA 3AHZA 3E0VA 2BMBA 3DN5A 1H60A 1NFGA 1BQCA 2ZZ3A 1UH2A 4RDWA 2OSWA 1MUCA 1H11A 2ADAA 2VDIA 4KESA 4ICMA 2WC7A 4OFCA 5BROA 1JDAA 3TXZA 7REQB 3LU2A 4CQDA 3CC1A 1U5VA 4G6CA 1IZCA 1FDYA 2J7CA 2NSOA 3BOLA 4LUYA 1UKOA 4PEEA 3U6WA 4DZHA 2DUZA 1ZJAA 3MHFA 3L0NA 3CM4A 3CO4A 2NUYA 3O06A 1VQTA 5M3WA 3KX6A 1DIEA 1KNWA 4L6DA 3AIVA 4LS1A 1S1PA 3FXYA 4XK2A 3S2JA 4GYPC 1JUKA 3EOUA 3FYPA 3GAKA 4LCSA 3B8UA 3SJNA 5J5DA 2Q8XA 2BVTA 2E28A 2JGYA 3Q4DA 3EMZA 3MJYA 1TWDA 2W63A 4IQEA 1PEZA 4QEHA 3CWOX 1BGAA 2R24A 3KL5A 1HKWA 2WMHA 3NURA 1U2YA 3VCCA 1MDRA 3NM3A 1QI5A 3RMJA 4GINA 2OLAA 4JKLA 2MNRA 2ISDA 2DIKA 4MVAA 2GQ8A 3EWWA 2O9PA 4ASTA 3WUFA 4BQ2A 3FJ6A 4DXXA 3B4YA 3NO5A 4MMWA 1P0DA 4K1WA 2A85A 1GZ1A 3FOKA 1M5WA 5CGMA 1V3KA 4WY0B 3NNTA 3LERA 5AHNA 2VR2A 1OB0A 3BICA 3CQ0A 1UUOA 2PDBA 2FPVA 3MMWA 4GZJA 1V8EA 5CPMA 1XLJA 1V6XA 1DWIM 1X6UA 4IJCA 3BG3A 2VRKA 5JBFA 2XVPA 5D33A 1W2VA 3TR9A 3AIUA 3KLLA 2G3MA 4AYSA 1F61A 4F9JA 4GVFA 1BHGA 2OZ3A 1WDPA 3DG6A 2ZX6A 3OW1A 4PZVA 4LAKA 4NHVA 1WBJA 4WK9A 2QNEA 4YN5A 4JAWA 2WPBA 5IHRA 1FFRA 3C2FA 2C18A 4C7FA 5FAGA 1ZCCA 3H7VA 1FRBA 4GKLA 1E0WA 3EWXA 4UTLA 4CQ9A 2VFDA 3W7RA 2NZLA 4N4PA 5E0KA 3VIJA 1J10A 1WAUA 3M16A 4B9YA 3MI6A 2I56A 3CV2A 3UXDA 1YPIA 1KFWA 4OU1A 2XYLA 5A3HA 1W9VA 3OVRA 3OLDA 3PWAA 2VCBA 1AQHA 1OC7A 1GOQA 1ML1A 3TYAA 1JDCA 2G3NA 2NUWA 1W37A 1J6OA 4M5PA 3DUGA 3BPWA 4U5KA 5TIMA 4B5XA 1LCOA 5BNKA 2PD5A 3KW3A 3L5MA 4GVHA 3KE0A 4AIUA 5I06A 2IKIA 4REQA 2Q3RA 3FXGA 4R9XA 1KFBA 1W3JA 1AMYA 3C86A 1VFFA 3PPHA 3AYRA 3RM9A 8A3HA 4KPLA 4UUIA 2Z24A 4FXRA 4QNWA 2F9RA 1D7KA 3POHA 1VPXA 1R7AA 2NXHA 3GTXA 5T9CE 3K1DA 1R85A 2P0OA 2VC6A 1SZGA 3PM6A 3VIKA 2B4GA 4ZO6A 2Y7FA 4OGZA 1Q63A 5G4HC 1GPWA 3P5ZA 3WEOA 4E6MA 4AISA 4DAFA 4A3RA 3DEQA 3S47A 4DZ5A 2GGGA 2XWEA 3H55A 3W7PA 4PRWA 3IIOA 1DJYA 1XC4A 4BY3A 1AODA 3CPGA 1ZRQA 2PWEA 4MPQA 3VIPA 3JUGA 2PMQA 4AD3A 5ECVA 2QMJA 4Z2LA 3O3RA 2ACQA 4C6CA 2NQ5A 1VJSA 1A4LA 2MUCA 2VGBA 2ACSA 1MXSA 4MLRA 4UZUA 4IHCA 1P0BA 4YVPA 4DM2A 1YRRA 1E55A 2G0WA 4TTGA 2O0TA 3QRHA 3QKZA 1IIGA 3KCLA 4GUJA 1CEOA 3G18A 2TYSA 3WNNA 1ZAIA 3GZAA 1DXIA 3TE9A 4LU0A 1YE4A 1PTGA 4A2SA 5C8BB 2Y0FA 1VP5A 4X63A 4ICCX 3TW6A 5AECA 1DEDA 2XG9A 3ZQ9A 2Z2AA 3A5FA 2DVXA 4CQBA 4NKCA 2WVVA 2YYTA 4MAZA 1B5TA 2QV5A 1TQJA 4TV6A 4KGLA 5KZDA 4CNOA 4QIUA 3RILA 2PDWA 3KRZA 3P6LA 1N8WA 3RRAA 2XIBA 2PCQA 2P3EA 5CEWA 3SDOA 4LEFA 5AYYA 4Z2IA 1FKWA 2OCZA 3CQIA 4Q4SA 3PZ9A 2P8CA 1OD8A 4ZQCA 1XRTA 1V3JA 3L9CA 2WNWA 3B04A 4DWSA 1W1PA 3DXIA 3QOKA 4OOUA 3UG5A 3GBDA 4H9UA 4NZJA 4FSAA 5BWFA 2WHLA 1YPFA 1GCYA 5K2ZA 3USZA 3L5AA 3QHOA 1TV2A 1RY0A 1QXLA 1M3UA 2OQYA 4ILSA 1J0ZA 1VPYA 1E56A 3C2YA 2JF6A 4FLOA 2CWNA 2BASA 3CMGA 3DFPA 3L4WA 4R7OA 1D3GA 5SWUA 2FVKA 1RCXB 1K6AA 4MLJA 4B5WA 5HK4A 3IJIA 1SZRA 3E38A 4LF1A 3ZJ6A 4QE5A 1VFUA 3WK1A 4ZQNA 1ZALA 2OSXA 3BMVA 1Q6RA 1UWQA 3WNLA 3RPMA 1H4PA 2BV9A 5EL1A 5CAKA 4UOZA 3QLLA 2ZZ5A 1GG0A 3T2OA 2ZX5A 1IWPA 3HOJA 2ATMA 3TSDA 3QZEA 3TFCA 3CHCA 4QBXA 3MCNA 3TYCA 3BCJA 4JYFA 3CH9A 1L6YA 4UZSA 5B7ZA 3MT1A 1A5UA 4UR9A 3ZWSA 5CZSA 3W29A 2IPGA 1ZY9A 2XSBA 1GQKA 5HBFA 3DHUA 1RALA 1IHIA 1G4SA 1FHVA 3N17A 3EWZA 1PVNA 1OF6A 4KF1A 4DPPA 1HKKA 2QCEA 4UTHA 5IHSA 4ZFCA 1WUFA 1GKRA 3WQVA 1B0IA 3VILA 1MRQA 5EGRA 4X22A 4RJEA 4NL1A 2XUCA 3NOYA 2BGQA 4W87A 2CNCA 2CZVA 5M17A 4ROPA 1R2RA 3GC2A 3EMQA 3O6DA 3TQ0A 4FLRA 1WKFA 3EX6A 2OB3A 3C5QA 1DTNA 1ZCOA 3PSWA 4KGJA 4PRTA 1PKMA 3TA9A 2W79A 3GVRA 1C93A 2V5JA 3AOFA 4B90A 1PDYA 2Y8UA 3ZOAA 1V08A 1OD0A 4E4PA 2RDXA 2WOQA 2BVWA 2NXGA 2NW0A 3WLOA 2QDDA 1RVGA 3TOPA 4MOZA 3G1SA 4JOMA 1HVXA 3TC6A 2O9OA 4AY8A 4JHOA 4KRZA 1RP9A 2VI0A 1A5SA 1GG1A 3FJ4A 4Z1CA 4W93A 1LZOA 1TV4A 1FWBC 1CGYA 3QZAA 3XIMA 1X98A 4CU7A 1ITXA 1VRXA 4HMNA 1XKYA 4QJ3B 5HNTA 3F4VA 3WENA 2HS6A 1KBJA 3IRDA 4IF2A 3BE7A 2VEIA 1B2YA 4H8NA 3UWQA 4C6DA 3GIPA 3AXIA 4FOKA 4JIHA 1S3HA 4C6BA 2JE8A 1CNVA 1E1CA 3S9ZA 3TVAA 2DGAA 2X09A 3N6HA 4QQUA 3TV8A 2IPFA 2PDLA 4FMVA 1KQZA 1WQ5A 1PYFA 4PA8A 4HPNA 3GW3A 5DBUA 3GDTA 3QPZA 4IJBA 2E40A 4UR8A 1S2UA 3IPWA 3BG5A 4GH3A 4WUIA 2GPTA 2HJPA 4CEXC 2AQVA 4W5ZA 1PKYA 3OVGA 2WM1A 4S39A 1GNXA 1W1A1 4HCDA 2DZSA 2DZPA 1EWDA 6XIMA 3CZEA 1R2TA 1H7OA 1MW2A 2HPMA 3N3MA 4N9EA 1WXZA 1N8IA 5HNRA 1ITQA 1NFPA 3N11A 1J11A 3VOCA 4WIWA 4Q4RA 2Z1WA 4ECLA 1WP6A 3CT7A 3W7GA 3WH6A 4XB3A 4LAZA 5D02A 3M5VA 1W54A 2C91A 4DJED 4EXAA 1JZ6A 2BZNA 4D8AA 1UQZA 3HPFA 5HJXA 2XVKA 3OEXA 1BG4A 1BTCA 4HCHA 3IJ8A 4TX9A 4FIQA 4L9XA 3IGHX 3W7CA 5FESA 3RU8X 3SCOA 1LLOA 4F9DA 1CGVA 4HN4A 5L9FA 3FJNA 1KR1A 3E12A 2CLHA 4NZFA 1ZJBA 3LPFA 4UCGA 1SO6A 4HOWA 2FGZA 1EKOA 1V3MA 3CEUA 4K7YA 3PBYA 3E3HA 1W3NA 3KDOA 1EL3A 2PTDA 2WZIA 1X96A 2A3AA 4W7WA 4IH3A 4O15A 3W6LA 4S2CA 2QCDB 2OYLA 4AC7C 4Q4MA 3VNJA 2YL6A 1G67A 3ITLA 2X1TA 4M80A 3W01A 4UNIA 1AA1B 4TX8A 3AFBA 5EFDA 2PWGA 2PWUA 4RKAA 4LBUA 5JUVA 2VEFA 1LDCA 3S1GA 1DQXA 3IJQA 1E15A 2VD9A 1ZP4A 2W9MA 4O54A 2Y61A 3BJFA 4CVUA 5HMFA 1KFKA 4RZ4A 1P43A 4YTUA 1E0TA 1DWHM 2IUZA 4LVFA 2INFA 3IGSA 3CLMA 4MB3A 4RZBA 5CG0A 3AIEA 2WB5A 3ZIZA 2V3FA 3WLPA 3FEQA 4O0KA 4YJ5A 1VBUA 3WLHA 2J78A 3KCJA 1NOUA 3UZWA 1V3HA 1WDQA 5FJRA 3BCDA 1GQIA 4O18A 4PB5A 2X0SA 4S3EA 3U2EA 3R8GA 3EX4A 2ALDA 1B31A 3VDCA 5AY7A 2REQB 1G7UA 3C8FA 4C6LA 5I2UA 2O56A 3N25A 1KLZA 3W1XA 3F5LA 3VD3A 3KVLA 1GOKA 3CASA 3CUIA 4FPSA 3FNDA 2GWNA 3T6CA 1EFZA 3NYZA 4J5NA 2NWRA 1OCJA 3AMCA 1UD5A 1M7PA 1PX3A 4TMCA 2HNHA 1SJBA 4J3TA 5C2GA 4MB5A 3O6AA 4IFOA 3S2LA 2F8QA 3W24A 1C3FA 5JH1A 2D23A 2UV8G 5C6MA 3VDGA 4JIEA 1WBHA 4GIAA 4RXFA 3M0HA 4A8LA 1Q13A 5REQB 3VIIA 2Z27A 4FK9A 5DCEA 5AC7A 4HK6A 4DELA 4JL1A 3NZGA 3VTRA 1UD4A 3HMJG 1DQUA 3AXHA 2DY3A 3BZGA 5C7VA 1QW7A 1US2A 5HOSA 4MZYA 1ZU8A 1DKWA 4DEFA 1LUCB 4LV9A 3QV8A 3VNZA 2NLYA 4G1NA 3O05A 2I17A 3VGHA 2PFHA 4GUHA 3IANA 4H7VA 4I3GA 1E4LA 3WQFA 2YW4A 4N9CA 4O4WA 3W7LA 3AMDA 2QCCA 3KP0A 4K8HA 4P8WA 3NOEA 3WBYA 3FA3A 1J79A 5JXQA 1BXBA 4AVNA 4NXSA 4AEFA 3HQOA 1Q6LA 2PRLA 2BODX 3W28A 2WVSA 4MKSA 3OO2A 1TA3B 3M0LA 4A6GA 4HPHA 4XZNX 4W89A 2PDPA 3AUJA 4YHEA 4LCRA 2Z7GA 1P4CA 4DO4A 4ZR8A 1LT7A 2GK1B 3Q67A 4KRTA 5KETA 3EWBX 2Z28A 1UR8A 3NGJA 4E8GA 3IIVA 3P0WA 5A69A 3OVQA 3OA5A 3KBSA 4JEJA 1BVWA 2BB0A 4TX6A 4PTDA 4NAFA 1QHPA 3IIXA 3LHYA 3SCVA 1HGWA 1NY1A 1L2UA 3LBCA 4MY8A 3ARPA 2PP3A 3MSRA 4EWND 2CLEA 4QNEA 5CJNA 2HV5A 2Y70A 3LUTA 3O7UA 1TJRA 4WSJA 1W1YA 5AVNA 1SQ7A 3P62A 3TQVA 6CGTA 4IIFA 4L5ZA 4GLEA 1H1YA 1E3XA 1G69A 3IIPA 5AOUA 1LL4A 4NG3A 4HNLA 1WNOA 3FCPA 2J7EA 1XSIA 3VIMA 1A3XA 2ZUMA 1V3IA 3U7BA 1GOIA 3P74A 3M7WA 4IX2A 3STFA 4W88A 3W7MA 2WQDA 2NT0A 6XIAA 4QXIA 1RVKA 4NIRA 3B8WA 3W2JA 2D2JA 4WEVX 5GJMA 4E5TA 2YKKA 4LQ1A 2J13A 3B06A 4OT7A 3E49A 2BTMA 3COTA 5I79A 4DUVA 2X16A 4JTSA 4IOTA 1Y8BA 4NRRA 4W8LA 1ME7A 5FIPA 1QW9A 4J27A 1C9DA 1QFEA 4PULA 2Y2WA 4AIOA 1JUBA 2VFFA 4M8UA 4JBRA 3QLDA 1RQBA 4CEUC 4XX6A 2WQPA 1SW0A 1V6WA 1IWAA 1K9EA 4XSLA 2BG5A 5K3VA 1JZ4A 3T0TA 3RU6A 2XISA 5DBTA 4DQWA 2XVNA 5RUBA 3KBVA 2YA1A 1IT7A 1JF6A 1LYXA 4O1EA 3TJ4A 3SBFA 3SJ3A 3UESA 1JPKA 2HISA 4UQBA 2Y5EA 2CCRA 4JCLA 4E4UA 1ZPTA 1L6WA 3R2GA 3T1GA 2AKZA 1NP2A 1X8FA 3NL5A 3BZJA 4KIRA 3R8RA 3CTTA 4J3UA 4D6GA 4DO7A 4O53A 1ISWA 3N73A 4IP4A 5EA9A 5D37A 3UJFA 3CEPA 1NDYA 3W1MA 1YBQB 4FR1A 4AAJA 4CN6A 3S46A 4IGHA 1M7JA 3L4TA 3TONA 3HG4A 4BWLC 2I5GA 4LB4A 2W67A 2C19A 5I77A 4K68A 1VFLA 3GU9A 1XYAA 2DW6A 4MB1A 1KBIA 5DY3A 5AN7A 3TTOA 1EO7A 2R1LA 2X7VA 3CAVA 4UTWC 4MDOA 4XD6A 1VBGA 4PBGA 1QPKA 5BWAA 5CZ0A 2Y8VA 1XLLA 1Q6QA 1K70A 3UPMA 2IPJA 1PCKA 3U3HA 3W1UA 3WG6A 2DV0A 4AZ5A 4B3KA 1LRTA 5A5WA 3LY0A 3H4WA 3PVFA 3VNLA 9XIAA 3K8MA 3CZJA 3ZO9A 2WKJA 3IJ6A 1ZL1A 4B4FA 3URQA 2VM8A 3N4EA 1LJYA 3SCUA 3BCFA 3VAVA 3K5XA 2CLPA 3PZIA 4PFMA 1TUXA 2VCAA 2CBVA 1UIPA 1R3YA 2PDXA 4JDBA 2IKJA 3BURA 3LXCA 5JH2A 1H7NA 3P82A 1GVFA 5H6HA 1A5AA 5F1UA 3IUIA 1PTDA 3VCRA 4HCLA 3M6DA 4NUWA 1SU5A 1MEHA 3BOXA 2VDGA 4B9ZA 2O4QA 1CGTA 4GMEA 5MKGA 3SCPA 4AF0B 2VEKA 3LV5A 3QY7A 1HL2A 1BGGA 2V9DA 3H12A 2G4JA 2VUNA 4YTRA 3KHJA 3LZ5A 5CJMA 4O8AA 3DDMA 1V0KA 4Q6XA 5LGZA 4YMZA 2X1UA 4Z1AA 4IM4A 1ICSA 3GM8A 1A4MA 4J2PA 4L1GA 3MVTA 1J0JA 4KETA 4IXHA 3HURA 3BO9A 1O7AA 3LLXA 4KFOA 1U1HA 4XZWA 4P7LA 1GJPA 2XPKA 1AUSL 3CIWA 3OIXA 3IGUA 1J93A 1ME9A 3EPNA 1TMHA 3QV9A 4I8DA 1NP0A 3P0XA 2GWGA 5DF0A 3ZLFA 3ARQA 5I78A 1UC4A 3IJDA 4ZO7A 4FX7A 1BYCA 1BVNP 1E9YB 2BOEX 1O4UA 3LSBA 4PN2A 4KCTA 3V1PA 1CXIA 4AZ7A 1Q45A 3BAJA 6TAAA 4WXYA 1FCQA 1RY8A 4PC8A 3H2FA 4YXGA 1HO1A 1PTAA 1LWHA 4JQ2A 2AAAA 2ZX9A 4JQ1A 1EGVA 1ODUA 3T08A 4Y9OA 5LIXX 5DXXA 4JR5A 1EP3A 4CKQA 2C7FA 3IV8A 4QS5A 1V4YA 3WJXA 2XGBA 3TNBA 3TYEA 4BK9A 3QSRA 5ABHA 3OG3A 3SEPA 4L9ZA 5LSMA 2D2GA 1DWJM 3N6JA 3PJUA 2CYGA 3SN1A 3SW6A 3W4RA 2PLCA 2ISSA 1KXQA 5LIWX 2CHOA 5E9AA 1JAEA 1PS9A 3DZ1A 3LHTA 4XKYB 5D8ZA 3VIFA 3MSDA 1UMLA 3ABXA 1GT8A 4X3ZA 2Q01A 1X7FA 3MYOA 1EJSC 1OGBA 3A47A 4ATWA 2R9RA 1LBFA 1ADOA 3BSHA 3UZJA 2L5HA 2WJDA 1T41A 3TDFA 3GLCA 1IXOA 2O9RA 3QZ6A 4DBWA 5ENLA 4DAIA 1TX0A 3T0CA 1NWSA 1R5YA 3S5NA 1OQFA 1OEPA 1RR2A 3A23A 1QPOA 4G1KA 2IW0A 4F48A 4MFEA 2V5CA 1VYRA 4UFIA 4AD4A 4GX9A 3QMRA 1L6GA 2E8YA 1XISA 1RZMA 1YIXA 3H2CA 4IL2A 3MC5A 3SY1A 2E67A 1Z8AA 3GKAA 1CYGA 4CD4A 1E0VA 3EKZA 3EDDA 4UMAA 3RYSA 1CXLA 1T7LA 4QLKA 1VCVA 3RMEA 2WSQA 1D3CA 3GBEA 2ZRZA 3APTA 3N6QA 3NDOA 4MKVA 1XIJA 2QIWA 3OU8A 3RFAA 5JVLA 2PLKA 2J8FA 1XLHA 3AC0A 3TXVA 2J7GA 1M1BA 5HMSA 2DH2A 4AZCA 1FXPA 3APGA 4XD5A 1FWSA 1HFBA 1UZ1A 5C7HA 1BF6A 1PDZA 3IEBA 3H24A 4WR3A 2MANA 4QROA 2WBGA 4WGHA 3RUBL 4GNVA 4ZENA 1FWDC 3UR7A 3NYDA 1K7FA 4E2VA 3NJ3A 4H3DA 1TPFA 2E1WA 4U5IA 2YBVA 2JKAA 3T2QA 5F2IA 2Z6JA 3HG5A 3B9NA 3DOPA 5XIAA 3AUOA 2QMKA 1AQMA 2D73A 2XH0A 3ARZA 2AOSA 2WNNA 1R30A 3OZOA 2H3BA 1T99A 4O19A 1UMYA 3AS3A 4WKFA 5GJPA 4H6KA 4R88A 3QMSA 5AC4A 2Q09A 2OU4A 4LB3A 4C1KA 4JYDA 4GIYA 2EPHA 1XRFA 4O8RA 4QR6A 4X9SA 3MWCA 5IBXA 4F0HA 4QG6A 1FKXA 5LIKX 3UW6A 3WBXA 1BYDA 2PWHA 4LNCA 3H22A 2CITA 1S2VA 1QNQA 5D9MA 3DESA 1Y65A 2A7NA 3CHFA 4HHHA 3P7YA 1EJUC 4J1OA 5BOFA 1RQHA 3WQ5A 4ADUA 3QXBA 1IXQA 4O1BA 3M07A 3BWWA 4NI8A 4NYYA 1Y5WA 3C52A 1F74A 1H51A 4ADTA 3TYDA 3TWAA 3PZOA 4M7SA 3GNOA 3PS7A 3BG9A 1B3WA 3CUGA 5EMJA 3CUHA 4UTTC 3FHQA 1UP3A 3M43A 4D6DA 1UWUA 2X05A 2OYMA 3AHVA 5A1AA 1JPMA 3SUWA 3VNIA 2PWVA 1OABA 4YWSA 1MO0A 2NX1A 1AW2A 4ZVJA 1S5VA 2FH8A 3WF0A 2HVOA 3UY7A 3UCCA 2EQDA 3HJZA 2XIMA 3HPSA 4DJDD 3OG2A 4D6HA 1EIXA 2VURA 4N4QA 3TTEA 4MG4A 3CQHA 4DZAA 4GNKB 1ISXA 1LOQA 2A6LA 4JX4A 1MNZA 3ZR6A 4M6QA 3HFTA 2E77A 1RSCA 3SY5A 1XFBA 2QJMA 1TMLA 1QR7A 5EFFA 3D47A 4NILA 1MFUA 4KEVA 1X1NA 5GPRA 2Q6ZA 1XIGA 4AWEA 3G24A 4YPJA 1W9PA 1MQPA 3I3EA 3FW6A 1T0OA 3QJAA 5CSYA 3WQPA 2VZOA 2UY3A 3B0YA 2VVNA 1YNPA 1GJWA 1LWJA 4YYFA 1US3A 4E2BA 4LWWA 3MVIA 1QOPA 2YDAA 3GC4A 2AKMA 3N14A 3MMDA 5TBOA 3W1AA 3WF1A 3EB2A 4GO9A 4ROQA 3VKDA 5IRPA 4GI6A 4S3FA 3GTNA 2PBGA 1QOQA 1IEQA 2P1FA 2PPGA 4MKNA 3SFKA 3VOFA 3W7JA 4RLIA 4QSHA 3QOMA 1SM9A 3OOQA 3LPPA 4C1LA 5A2CA 2VVSA 4G8TA 3DH7A 2D69A 3A4AA 2DZUA 4MWAA 1XD0A 2D2HA 2OO0A 1QBAA 1WXJA 1F2JA 2FDSA 2NUXA 1AW5A 1O94A 2C71A 2D3NA 1V51A 5BXPA 1WAWA 4H9VA 3CHEA 1Q3NA 3UZYA 4Y9MA 3D5HA 3LDVA 4ZXOA 4AU0A 3HV9A 4S3AA 1UKPA 3AXKA 3WK0A 2AMXA 4TVDA 1A5NC 1CECA 1PZ2A 4HHLA 3W85A 1X39A 2CBIA 3KTSA 5LXXA 3WLTA 2P53A 2DSUA 3TSBA 1UIOA 3GXNA 4AD2A 4AEEA 4K37A 2VDHA 3MO7A 2FJUB 3WDHA 1UUMA 2O7SA 3EWUA 4HNCA 3VC5A 1ISVA 4IIGA 5HQMA 1XYCA 1PJ9A 1E1FA 1QWGA 4P7QA 4C5ZA 2EEXA 5G2HA 2WK2A 1OIFA 3VOIA 3LTPA 5ABFB 1CGWA 4Z1YA 2DZVA 4AXKA 1FHLA 4NJJA 4S1FA 3UJ2A 3W0KA 1JXKA 2WSRA 1I6NA 4G9PA 2WO5A 4D1JA 1WE5A 5E5CA 3F1QA 4WJEA 1JYXA 1GORA 1DJWA 4XKMA 3TEVA 3WF4A 3ITXA 4GUGA 1UPMB 4DN1A 1FP8A 3ARYA 3SQMA 1G4EA 3LV6A 4QX4A 3M5XA 1MXDA 3F2CA 1L6SA 3RR4A 2ZYFA 3P2VA 4XZIA 1QHZA 5D2XA 3CUJA 5AHLA 3VPLA 4EX4A 3T09A 3MYPA 5E09A 2ZCGA 4RDZA 3SCRA 1BG9A 2PGRA 1OFEA 3TAOA 3RGTA 4YIWA 3WDRA 3PZGA 5DFAA 5M2FX 2CXEA 1J0IA 3A22A 3UG3A 4GHRA 3EDEA 3EXRA 3WL1A 1XH0A 1GVEA 3EXTA 3NXFA 1XIDA 3UZ5A 1N55A 1H1NA 4XG1A 2DEPA 3TQPA 1TQXA 2VRJA 2I9EA 1DJZA 2ZWZA 4UQDA 3ARSA 1IT0A 3REQB 3H2NA 4IFRA 3C2RA 3R0DA 4P8UA 3EKGA 5ABTA 4UXDA 5DCDA 4HIBA 1F5ZA 4UCFA 2QKFA 2GVYA 3OGVA 3SECA 1OFOA 5AB3A 4PUJA 4UWMA 4I9JA 3QQ1A 2E9LA 2Z6IA 4F2BA 3AICA 4XZHA 2G3FA 2WSYA 1VBHA 2PURA 2ZRXA 4NSBA 4XTIA 2UY2A 2JGQA 4FXSA 1PBGA 3FK4A 1VYPX 4RNFA 4M6PA 2I9UA 4CNPA 1ZNNA 4E4FA 1E43A 1EP2A 3VFCA 2UY4A 4OOZA 1YYAA 1WPCA 1NTHA 4FNUA 4HQVA 4DZIA 3W22A 1F76A 4GPNA 3UJRA 3QY8A 4PMRA 4HD5A 5JBEA 4AX6A 7TIMA 1XLAA 1FDJA 3Q37A 1MEIA 1W5NA 3S5OA 4DJDC 1ECQA 1XBVA 2B31A 2V2DA 2EBNA 2EG7A 1DXFA 1YQ2A 3W38A 2Z1KA 3RLHA 1R9XA 3IV3A 3PZMA 2BP1A 1JAKA 3EDFA 4QAWA 3TC3A 3WQ4A 4XUYA 3CPRA 3W72A 3R58A 3VGEA 5I3KA 2WHKA 3MUY1 4S38A 3FA4A 4NZ1A 1P7TB 1FDZA 5HAOA 5T26A 3II1A 2ZA2A 4FAMA 3GO2A 1KGXA 1G4PA 2VQTA 8CGTA 2GGEA 3W2NA 1BRLB 1KV5A 1IEIA 1H3GA 3W53A 1GVYA 4IIHA 4PUWA 5CGQA 4IWWA 4NVTA 4UQEA 1XUZA 3G22A 1JF5A 4LYPA 1F8IA 2NQLA 5C70A 3RX3A 1I4NA 2OO6A 2XGZA 1TJ1A 3CIVA 4UFMA 4R85A 1PYMA 2BDQA 1GWJA 4JTFA 3DYPA 3MSYA 4IMFA 3AIRA 3BARA 4QTGA 1XD1A 1NQ6A 3HFYA 4MHBA 3BSGA 1ZS2A 3AJXA 1R9YA 4Q4QA 3L4ZA 1NAL1 3SSZA 1OFPA 4JFUA 3HPZA 1R6WA 2BOGX 5DEZA 4PL2A 2C8NA 1U5HA 4D6IA 2QF8A 1XH1A 4UMCA 2VCCA 5IOBA 3GG1A 1S2TA 2FB3A 2FPTA 4RW5A 4K2SA 3AIBA 4XBJA 3AS2A 4HU3A 1AQFA 2J47A 1QVBA 4N9DA 2WCAA 2NVDA 2WKLA 2D0HA 1XDMA 3HG2A 1Q6CA 3R11A 1QAPA 1I2PA 1AQ0A 2YZRA 5G2WA 1G01A 1Q6OA 3AZSA 3NPVA 2B81A 4JHMA 4ORMA 3M41A 2BVYA 3LHUA 1P5BA 3B05A 3N15A 3E2RA 1FXQA 3WD4A 2GQ9A 3ONCA 3M1ZA 4HU8A 1VGAA 4PGLA 4CCZA 1BQGA 3WYZA 3BXWA 1W17A 2POZA 3PNZA 2Z29A 3PY2A 2Y62A 1UR4A 4C7DA 4F4RA 2C16A 1BEUA 1SJDA 3SGZA 4ZFMA 1R86A 1D8CA 2PDMA 1S2CA 2WMFA 4X9YA 1EOKA 1IQ8A 3GDKA 3TJLA 4FX8A 5CG7A 1U1JA 4PCPA 4A4AA 1WV2A 1GOMA 3CHDA 3OLEA 3ZVHB 1Z44A 1JCYA 2CXGA 2VGFA 3LG3A 4QE1A 2IPWA 4ATDA 3WCZA 4Y2WA 2QAFA 3AHXA 1TR9A 1XWYA 4M1BA 1I9CB 1VHNA 4EAYA 3QTGA 4EANA 2ZWYA 4Q8UA 3UT0A 2VOMA 3F2DA 3M0YA 4P7NA 3MKVA 1YLVA 2Y7EA 2QAPA 2F6XA 3T4WA 4PUNA 5D9OA 1JCLA 2J25A 1EQCA 4J9JA 4JFVA 4QCFA 5CPOA 2VC7A 1P0NA 2QCFA 5T8GA 4DXKA 3Q94A 4IFKA 4O28A 2VEGA 7TAAA 2QCLA 3C4UA 4FB7A 3R43A 4PL1A 5HANA 1AVAA 1V02E 1MXGA 1UWTA 3HBLA 4S3DA 3KOXA 1QO2A 2CZFA 3NPUA 3FIGA 3ZLGA 2VFEA 3H54A 4HK7A 3NCOA 1R3TA 2WSPA 2G4FA 2WV8A 4C6MA 1MZHA 1ONWA 5H1WA 3AXMA 1GTHA 1E40A 4HN8A 2TRSA 4L4LA 2A7PA 4GYKA 4TVUA 3FSUA 4NQ1A 5H8MA 3K4DA 3ZYZA 3QV6A 3QH2A 3KRSA 5JQ9A 1JR1A 4FXFA 2BXYA 2RAGA 4I6VA 4HBKA 1OBAA 3KWSA 1JG9A 1RJQA 4OBRA 3WUBA 3NEVA 3VNYA 4CQCA 1EGMA 2REQA 2ZOXA 4M51A 2PDUA 3N12A 4S3BA 2ZVRA 5D32A 4PMXA 3LBOA 3RHGA 3AHTA 3ZT7A 4L4PA 1DIOA 5E6ZA 3MP3A 4FOUA 5EBUA 3OODA 3T44A 3SUVA 3WLQA 3O2LA 5CQ1A 4QJ4B 1EXBA 4E3TA 3V0TA 3TZFA 1JJKA 3TCSA 2RH9A 6REQA 2D2OA 1B57A 3QQWA 2FZMA 2VGIA 3MV01 1TJ0A 4HSHA 4LS2A 5KZ6A 2DVUA 3E0FA 4NZ4A 5REQA 3C56A 3T55A 4DJFD 2PU1A 3P81A 2XJ7A 2PTZA 2O55A 3L2MA 3M7SA 3NL2A 4A2RA 4HTYA 1TPVA 5DN1A 2QUUA 2IQDA 4IIEA 2F6UA 2DFAA 3NQEA 3O15A 2ZUUA 1RCQA 1FWRA 4UQAA 1QPQA 1R3VA 1PSCA 4GUIA 3SN0A 1A5KC 1CGXA 2G95A 4GGHA 4Z2KA 1ZTVA 4HJWA 4FP1A 5HNUA 3WH8A 1UKTA 1FVPA 4D8ZA 2H9AB 2DT0A 1QNPA 4TUFA 5LHEA 1RCOB 3EB4A 4DXVA 5FEWA 4JN7A 4KCVA 1JULA 3TSMA 3TP4A 4DHGA 1UD8A 1TA3A 3GTFA 3K4AA 3MCOA 1XLBA 4JDYA 3GZ3A 1K9FA 1X7IA 4L9YA 1CLVA 1GW9A 1S38A 4XAYA 5CJ5A 2V0TA 4UFLA 1A3WA 3NQCA 4ZOBA 4WF7A 4IX0A 2CZDA 5FA5A 3W7NA 4UR7A 2YXOA 2DIEA 1KCLA 2W61A 1I2QA 4ONVA 2I5IA 4FO4A 2OT1A 4M81A 1F6KA 4HP5A 2ZXDA 1JFXA 2PF8A 2Y89A 5LKYA 1BPLB 3MA8A 4D6FA 3EDJA 1E3ZA 3MBDA 1PZ0A 2C6QA 3LZ3A 2W27A 4LVGA 1KCZA 4C1NB 2DJLA 2W0UA 3CWHA 1EQPA 1O1HA 3STGA 1UASA 1TV8A 4WD0A 4GYPA 3PAOA 4IPJA 4N2YA 5M1TA 1I2OA 2B7PA 4FF5A 2ABAA 4RNHA 4AFYA 1LBMA 1TUFA 5CH9A 2CBJA 3H7RA 3TW7A 3ARVA 1NWTA 1O68A 1EXPA 1NH6A 3CXOA 1LRQA 2DQXA 5KINA 4PTMA 1NOWA 5CLWA 4AXNA 4PUKA 4US5A 2JEPA 2FDMA 3TC7A 1KGUA 1A0DA 1NELA 3ZZ1A 2GJNA 4AX7A 2BLEA 3UWWA 4UNLA 2VFHA 2R82A 4J3SA 3VA8A 1O12A 3H23A 1K9TA 4ZQPA 1U1UA 2A1YA 1VAHA 1YADA 1W1VA 1VR6A 4A22A 3UWYA 3M0ZA 4U31A 3GNXA 2OXNA 4CN1A 4BEUA 1TYGA 1ZAJA 2WNQA 4WRHA 1NDVA 3W3OA 4JQ4A 2FJKA 4RE3A 3NQDA 2QR6A 3W7QA 4EPEC 1Q6DA 2PP1A 3C2VA 3LRKA 1E6NA 1A50A 1W5PA 4R3UA 3LSCA 4AZIA 3BK0A 3E74A 5C55A 1GVRA 1X6LA 1JQVA 5FJOA 3TMLA 4Z42C 4GQBA 1DJXA 3I4KA 2J74A 3DX5A 1KM6A 4ALDA 4YTTA 1XLGA 1C91A 2A79A 4ZSUA 2YSWA 1WYIA 1EF3A 3V18A 4H1ZA 1ODZA 1YBQA 1OM0A 3OTRA 2A3EA 2OOFA 3R79A 3AIQA 3KS5A 4ACZB 3VE9A 4QCEA 4HYVA 3A9BA 2FFCA 2G3JA 5FJIA 2V3EA 2PZNA 5GNZA 1QU4A 1B3YA 4B92A 4RUBA 3DKJA 3E6EA 1HT6A 1LT8A 3ZVIA 2QEZA 3BLEA 3PB2A 1PO9A 4MUPA 3PZNA 2F61A 4GH1A 1QJWA 2J6VA 1V77A 1BKHA 4JTTA 1PKNA 1E9LA 1MVYA 3GSMA 5G1TA 2ZXAA 2D22A 3KM8A 1GQNA 3S9IA 2WCSA 4A35A 1QPNA 4L1WA 2ZUNA 5E1QA 3UZZA 4PMDA 1O66A 9CGTA 3VOHA 5K7JA 4C60A 3ALGA 3T0BA 3OZMA 1BLIA 1EDGA 4O13A 3H4GA 3V5CA 4YHGA 4AIEA 1KFLA 3B8SA 3OQEA 4J4KA 4DJFC 2CKSA 1GZJA 4PBEA 3IS4A 2ZE0A 1JUEA 4O11A 4H4IA 2XIOA 1SFTA 5DMLA 4DNHA 4IT1A 2OYKA 5KTLA 1LQAA 3U4FA 4JTGA 3WMBA 1DYSA 2F84A 2OQLA 4TTUA 4H8UA 3QF0A 3DECA 3PNUA 4Y9AA 2RDTA 5T91A 2V5BA 4AZGA 3LCXA 2PWFA 3T8LA 3T9PA 1GYMA 3N9SA 1JDFA 3NA8A 3MZNA 2YCJA 3B0UX 3RJYA 2R14A 4NAEB 2VZSA 5EYWA 3IVTA 4P5UA 5U4NA 5I3FA 3JS3A 2ZXBA 4PUUA 3PTDA 1FOBA 2NXIA 3CQKA 5CC3A 2EPKX 1HG3A 3KEHA 4IP7A 3CQJA 1H7RA 5DT5A 2CKRA 3NR0A 1V03A 2OZ8A 5AVHA 2CPUA 3GWQA 4B4HA 5I09A 1V0LA 3B8VA 1B30A 3SY8A 5GVJA 4GNJA 1JNEA 2W66A 3VZXA 5D9PA 1XF0A 1KKOA 2YFOA 2Q8LA 3GUWA 4KCWA 1ELSA 3UYCA 2YCEA 4J7RA 4REQB 3UXKA 2GJPA 1Q8AA 3W6YA 4P7RA 1DP0A 2YJQA 2WYSA 2YCLA 1P1XA 1E0XA 2CLKA 1B3XA 3HF3A 3EOEA 5D9NA 2EKGA 2ACUA 4GY7A 5ECUA 4IL0A 4ML9A 1W3HA 3AYSA 3KL0A 1CI1A 1FWFC 1MZRA 2QGYA 4PMYA 4R7JA 4CQ8A 3WD3A 3OZPA 1O5RA 1VFOA 1OX6A 1M65A 4QM1A 2P10A 3RX2A 3SIZA 1MW1A 3BLKA 4ZQMA 2KZHA 1XIEA 3STEA 3NZRA 1KM2A 3GFZA 4XZBA 4U33A 5FJUA 1E9IA 2WVUA 2ZUVA 4UMBA 4IMEA 4O50A 1OSEA 3ALFA 1TRIA 3MUIA 3MJMA 3ZM8A 4H19A 1Q6FA 1XCFA 1H62A 2AL2B 2WKGA 4ZZ9A 1DHKA 1JD7A 4A8NA 4B5TA 4CU6A 1A5CA 1DWFM 5D09A 2OKOA 5CBJA 3UCQA 3DC0A 4TV5A 3CNYA 4K8EA 3SQLA 3OJGA 4JIQA 1LLZA 1TWIA 1VBJA 2DDXA 4JY8A 4BCEA 2VT0A 2PP0A 2Z1VA 1JYNA 1P6BA 3VI2A 1QWKA 3LNMA 1W9DM 5HULA 2WZHA 4LJ3A 3MI3A 3KZPA 1OFDA 1E51A 3LMYA 1XRSA 1K6WA 1LQ0A 2YDRA 3MV11 4UC5A 5F2MA 2YLAA 4BF5A 3NSMA 1UWRA 3GKFA 4U28A 1YXCA 3LLFA 1LTDA 3FSTA 4PTXA 4OIFA 3OLIA 4IZGA 1ISZA 3SGUA 4W86A 3PZUA 2J24A 3P93A 2HS8A 4LVBA 2WVVB 1H09A 3EB3A 2PE4A 4JKMA 1OG0A 1P6WA 1ZQ5A 1F4HA 4GQRA 1SSDA 3ARRA 2WMGA 2XINA 1SGJA 3E5BA 4PMJA 4IMAA 3HJEA 4FR6A 4UTIA 3SIMA 1XI3A 4IG2A 1VC4A 3NVDA 1THFD 4PFHA 5HJLA 1FX6A 4WJXA 2PEVA 2FGBA 3H7UA 4LUTA 4CCEA 4B15A 1ITUA 1LQ2A 4PB4A 3MS8A 3THCA 1NVMA 1J0KA 1REQA 4YTQA 4JTRA 5A6BD 3W7EA 1IV8A 1MDLA 3HO8A 4LUSA 4PUEA 3T7VA 4PTWA 1VYSX 4XUGA 3C6CA 5J04A 1BD0A 2IQ0A 2BX7A 3SADA 4DWSB 1IWBA 3WEMA 5DX7A 1SZNA 3WDJA 2FTWA 3QYQA 3W84A 2VENA 2YXGA 3TYUA 1EC8A 2DT1A 2VRQA 4B5VA 2WC3A 1EUNA 3QW3A 1HIZA 1W9UA 2CLFA 1B1YA 4MWAD 3TQKA 3VD7A 2C3ZA 3P67A 2W3ZA 1RXOB 1XBZA 1U22A 3CL8A 2A21A 2DSWA 2ZVIA 1ESWA 1JCJA 1TR1A 5B7YA 3FGCA 2HPIA 5HPOA 2EXOA 4IQJA 2E7FA 1UD3A 1F7BA 3UPWA 1B90A 3GH5A 3ERPA 2WC4A 3TN5A 4NNCA 1SJCA 1R7OA 1E6PA 4JD4A 3UP8A 1QTWA 4H9TA 4IPLA 1JZ8A 1VIWA 1QI2A 1KB3A 1XBYA 3GUGA 3FEMA 4XZ9A 3TZNA 2J7HA 2V68A 1MNSA 2XFFA 2JFEX 3TK7A 2X0YA 3FLUA 3P61A 1NF7A 4UTJA 3HZ3A 3N04A 5AC8A 4EP8C 4AWTA 1GOWA 1XH2A 2BGNE 1VS1A 7XIMA 3C3NA 3WQOA 1MQQA 3H70A 4QG8A 5D30A 3ECQA 3N2XA 3QN3A 5J5RA 4CUCA 1FWAC 1Q5MA 3AI0A 4G5DA 1PB0A 4GBUA 1H5YA 3BLLA 1NDWA 4N9BA 1DIDA 2P5NA 3GNRA 1QUMA 2VX5A 2FQIA 5A8GA 4DIAA 1NSJA 2ZRVA 3RRXA 3UWVA 4WQ6A 4XD3A 3U2OA 1KXVA 3BAIA 2UWFA 1C8YA 3A9IA 4ICNA 1W0MA 3L66A 1DTUA 4WHBA 4N42A 3DFNA 3UCDA 4FLSA 3TTSA 4DBUA 1TIMA 2QLYA 1TVPA 2WLYA 1J18A 2TPSA 1QW8A 1E6ZA 3LCHA 4OV9A 4Q32A 1KD0A 1YX1A 1KW1A 1LOLA 2R1MA 1I45A 4B5NA 4M1RA 1TJ2A 4QJ5B 1JXJA 1TFVA 4LY8A 5IDIA 5M5DA 1FH7A 4YVVA 4DO6A 3CMJA 2ZUWA 2OOGA 1W1B1 2F7FA 2DPEA 3U9IA 4JCMA 2GFTA 1UR0A 2DZBA 4OWGA 2NV9A 3F03K 5KZMA 5LNUA 1FWJC 2NQHA 3KCOA 1H7WA 2HCVA 5EMMA 1GYLA 1OG6A 2RGLA 4CCDA 5K9XA 3HPAA 5KZEA 2EO7A 3AS1A 4BI7A 4AC1X 3CMFA 1M04A 2GZXA 4IQDA 1AG1O 1H41A 4GY0A 5C9RA 3OP2A 1GTEA 3VM7A 4H9XA 4Y6GA 2HVNA 4Z1BA 3B8DA 1TREA 4XAZA 3MMTA 2HZGA 1TPC1 4YLWA 1KFJA 1E1CB 3KVMA 1EB3A 4P8VA 4J35A 3SZ8A 1VIZA 4DUWA 1EIBA 3E0WA 1ENUA 4HNUA 5AKQA 3PANA 3QFEA 3KP1A 4NRSA 3MBFA 3SAZA 3TKFA 4UOJA 1ZGDA 3A24A 4Q8WA 3PJWA 1ZBWA 4XAFA 2OSYA 3SURA 3AYTA 3IGXA 3WLSA 2WJFA 2OT0A 1D2KA 2JEQA 1B54A 3SCTA 1WZAA 5BU9A 1ISYA 4AD5A 1B9ZA 2DSVA 3WLIA 2PI6A 3A4WA 4HKPA 1VCGA 2XFRA 2WXDM 7A3HA 4AIBA 2ZDSA 3W7KA 1A3HA 1I0BA 4XVDA 5CPLA 4Y9NA 4NZCA 4LGXA 5CLTA 3QM3A 4Y96A 5A8NA 3CZLA 1F8MA 2HWGA 1HKIA 1RK6A 3IJLA 1XYBA 2QCHA 2PUZA 4F0RA 4ADSA 1Q2RA 3AWOA 2BNJA 2E8ZA 3AZRA 1OYBA 2BXVA 3ES8A 3QEZA 1S5WA 4XISA 3W83A 1PXGA 2DT3A 2OZ0A 5CGTA 5BXTA 2WWCA 1U83A 1YHTA 5FKYA 4JN8A 3A6OA 1Z3NA 5LGXA 3DFSA 2CHNA 2FZBA 3URNA 3L4UA 3MPGA 2J9XA 2W4XA 1EUAA 3U2ZA 3DHPA 1UCWA 1KRAC 1Y0EA 4MPKA 4HZ7A 1DE6A 5C0QA 1NU5A 5C9UA 3TU9A 6A3HA 4JTDA 3O1NA 1HN1A 3VOGA 3GH4A 2GGHA 3CBWA 2E1DA 1HX0A 3TUUA 2CERA 3O0KA 1SFSA 1J0YA 3E5PA 1NM9A 3MCMA 5CZJA 9RUBA 3N13A 4UTMA 1CDGA 3PULA 7PTDA 1XP3A 1HO4A 4DRSA 3WD2A 1R9ZA 4WOQA 1KLYA 3W2LA 4XTDA 4TU1A 4D6JA 1Q8JA 3C61A 3LGDA 1VFMA 1AL8A 4HMDA 4HB7A 2CLOA 3UXIA 2VX6A 4QSFA 4A3QA 3ITYA 2FB2A 3EEZA 3AU2A 1D3HA 1R3SA 4FF7A 4P7OA 2J27A 3FKKA 3SSJA 3XINA 3EOOA 3H6OA 1XIIA 2ICSA 3LRLA 2OKTA 3UA3A 3I7QA 1Q4WA 1ZP3A 2ZBTA 3EGJA 1GHSA 3B9EA 1JGMA 1Z42A 5D05A 2V8ZA 3P8JA 1CXFA 1O6IA 1IR2A 5JBDA 5HINA 4QGCA 4S3CA 2PAJA 2WBKA 2AL1A 2GGJA 5FOOA 5BMWA 3GAYA 1WDWA 1SR0A 4KFPA 3TLQA 1DE5A 1UHVA 4L6HA 1OJXA 2P0IA 3RJXA 2NX3A 1MW3A 4PYSA 4EPDC 3U7VA 1EH9A 3ANUA 3V7PA 3UGVA 5A2AA 2A6NA 2XIIA 1YTDA 1LBLA 5FL0A 4AD1A 1CB2A 3VCNA 3EYPA 3WN6A 3AROA 4I9AA 3OBEA 3VABA 1QI0A 4E8CA 1E0UA 2VOTA 3CPUA 2PTYA 3DFOA 4J3WA 3EPOA 3GD6A 2D3LA 4U2YA 2J75A 2OGJA 1UW9A 4PCNA 3M0KA 3PPCA 3THUA 2QDEA 4B16A 5IDZA 5BYWA 4H00A 3RXZA 3EPMA 5DRIA 6ENLA 5CCZA 2PGEA 4OTKA 4S3GA 3P60A 1CW2A 2V82A 3BV7A 3QTPA 1C7SA 4LALA 4DF2A 4IMDA 3NM1A 4ZSTA 2GSHA 3V16A 3AWNA 3KBNA 3I6EA 3GR4A 1UQYA 4D8LA 1P7TA 1CGUA 4BI5A 2PDGA 4L64A 3STCA