2PF0A

F258i mutant of exo-b-(1,3)-glucanase from candida albicans at 1.9 a
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
394
structure length
394
Chain Sequence
AWDYDNNVIRGVNLGGWFVLEPYMTPSLFEPFQNGNDQSGVPVDEYHWTQTLGKEAALRILQKHWSTWITEQDFKQISNLGLNFVRIPIGYWAFQLLDNDPYVQGQVQYLEKALGWARKNNIRVWIDLHGAPGSQNGFDNSGLRDSYNFQNGDNTQVTLNVLNTIFKKYGGNEYSDVVIGIELLNEPLGPVLNMDKLKQFFLDGYNSLRQTGSVTPVIIHDAFQVFGYWNNFLTVAEGQWNVVVDHHHYQVISGGELSRNINDHISVACNWGWDAKKESHWNVAGEWSAALTDCAKWLNGVNRGARYEGAYDNAPYIGSCQPLLDISQWSDEHKTDTRRYIEAQLDAFEYTGGWVFWSWKTENAPEWSFQTLTYNGLFPQPVTDRQFPNQCGFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Carbohydrate binding sites in Candida albicans exo-beta-1,3-glucanase and the role of the Phe-Phe 'clamp' at the active site entrance.
pubmed doi rcsb
source organism Candida albicans
molecule tags Hydrolase
molecule keywords Hypothetical protein XOG1
total genus 151
structure length 394
sequence length 394
ec nomenclature ec 3.2.1.58: Glucan 1,3-beta-glucosidase.
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2pf0A00
2FHBA 3MV11 2YL5A 1AMYA 5BXTA 1IV8A 1LG1A 2FH6A 3CUHA 1QW9A 1HVQA 2YDRA 1E4LA 2WANA 1KBKA 5E6YA 2ESCA 3ARZA 1LL6A 2YA1A 4J28A 2WWCA 1WZLA 4UOZA 3CIVA 1HF6A 1KCKA 3F5LA 1WKYA 4M24A 4S3KA 1PEZA 3GBDA 1UR8A 1E6NA 1GVYA 2YLLA 4W8BA 1C92A 4MDPA 1QBAA 3ZJ6A 4QLKA 4M56A 2BV9A 2CYGA 4AWEA 3PZOA 4WK9A 5A6MA 1S46A 3WQWA 1R87A 2WNWA 3VGFA 3AS2A 3B8SA 6TAAA 2CCRA 3WH7A 3AOFA 1MWOA 1UYQA 3A3HA 3A4AA 3U7VA 3DC0A 7CGTA 5ECUA 4CN4A 2FHCA 1BAGA 2FHFA 4GI9A 3L2LA 5E70A 1FHLA 1KGUA 1K9FA 3GXIA 1EH9A 1JFHA 1V3HA 3WEOA 4WLCA 3SCQA 2J25A 4U2YA 1D3CA 3AS3A 1V02A 4CVWA 3UETA 1LQ0A 5KEZA 2DQXA 3GXMA 4P8VA 3OG2A 1NWRA 2VC9A 1K6AA 2GUYA 1JZ2A 1Q6GA 2VVNA 1CXKA 4OBRA 2BFGA 1QNOA 4CD5A 1GHSA 5DFAA 2DIEA 5M5DA 4P7QA 4AIEA 2XG9A 4J3VA 2ZICA 2DSUA 4B16A 4V28A 2EEXA 2GVYA 3WF4A 5ABFA 5D4YA 1E0VA 2OSXA 1VFFA 1DTUA 3WDQA 2GDVA 1FH8A 1UD4A 3VD5A 4MB3A 5ABFB 4KH2A 1L0PA 4X9YA 3WN6A 1NOUA 3UG4A 1ISYA 1CGYA 2ZUSA 3N9KA 4V2XA 1UOKA 4Z2KA 5BXPA 1H41A 4CD4A 1SFSA 3DECA 3ARWA 1V6XA 1W2VA 3BGAA 1B90A 1J18A 1TZ7A 2PWFA 4WF7A 2F8QA 3IK2A 4MTVA 1O6IA 1R7OA 1WE5A 2VZUA 5LA0A 2BNJA 2W91A 1OGGA 1G1YA 3UG5A 2WBGA 7TAAA 1EDTA 3T09A 3WIJA 1XCXA 1UWTA 3N11A 1KGWA 1G01A 1W3LA 2BY0A 3WQ8A 1W3JA 3VD7A 3VMPA 2XUCA 5A6SA 5CQ1A 2B31A 3CZGA 5I24A 3AFBA 1WDSA 1OB0A 3AJ7A 2OLHA 4AY1A 3W6LA 5JIPA 2V3EA 1KQZA 4URIA 4XX6A 3ZO9A 3AMDA 5A6LA 4LYPA 1CDGA 3GBEA 3K4AA 2VCCA 1JAKA 1UR4A 2RGLA 4XZWA 3K1DA 1ZBWA 5A6AA 1AQHA 3O6AA 2J7EA 1KGXA 1UHVA 4B3KA 2ZWZA 1C93A 2BY3A 1EOMA 2ZXBA 2UY5A 2NT1A 5A2AA 2X09A 3RPMA 3W6MA 2BHZA 4PMNA 4M81A 1ITCA 1G94A 4C7GA 3BLKA 1OIMA 2DH2A 4LX4A 3PHAA 5E6ZA 2YBTA 2X8RA 4D6GA 3CHFA 2VTFA 3W82A 4TX8A 1EXPA 4D6CA 1J0IA 3KE0A 3BAJA 3WF3A 4CUCA 1C3FA 2Y2WA 4DUWA 1W9DM 1CGXA 3WNPA 1UD3A 2YA2A 1PPIA 3TTYA 3VDAA 2DT3A 4UNIA 4MB5A 2BHUA 2D22A 2OSYA 4TTGA 3WDRA 4M80A 1JZ3A 1LL7A 1E15A 2J7GA 3K46A 1EQPA 5AC4A 1ZJAA 4UFIA 2XHYA 1JD7A 2JFEX 2PWGA 5I0DA 1RP8A 1JXJA 1QVBA 3N1AA 4PMXA 3AXHA 3WDIA 3HJEA 4AC1X 1WB0A 1E9LA 5JBFA 3N04A 3G6LA 3VD9A 4PMUA 1UWRA 2XFRA 3S6TA 2WC3A 1QNPA 2Y8VA 4H41A 5E09A 2JE8A 4KMQA 3CZLA 2WMJA 3RJXA 5I23A 1J01A 4MDOA 3BMVA 3TTSA 1LF1A 4PSPA 5HNNA 2XVKA 2BXYA 1E1EA 3WD1A 5DEZA 3T0AA 3UERA 4MJ4A 4HZ6A 1VRXA 5FCZA 2PBGA 4N42A 3NDYA 4AIUA 1UD2A 4AZGA 3AIUA 4JKKA 4A3YA 2GJXA 3SCWA 3DHPA 1BTCA 2WLYA 2XWDA 4GQQA 4CGTA 1UWIA 3ARVA 3AYRA 4UQDA 2PF0A 3CHDA 3WFZA 2CHNA 3CZEA 1ISWA 3O2LA 1JNEA 2D24A 1MW0A 4RL3A 2BVYA 4EANA 4KRTA 3FW6A 3APGA 2J7HA 3GYCA 4DUXA 1EOKA 4J3UA 1KR0A 3VGHA 1JXKA 4GZEA 1XD0A 4WSKA 1W3KA 1DWHM 5CLWA 5DF0A 3WEZA 1GONA 1WNOA 1ESWA 2XIIA 3TTOA 3MUY1 1EO7A 2CERA 3DYOA 2G4FA 1B0IA 3ZR6A 2NW0A 4TVUA 2Y8KA 3W25A 1C91A 5GNZA 5ABGA 4PTMA 2E4TA 1J11A 1DWFM 3ALFA 5IXEA 1CGWA 3WUEA 3AROA 4GI6A 2CKRA 3CLWA 1E6SM 1OT2A 3M6DA 3MUAA 1ITXA 1UD5A 3POHA 3PZGA 2EPKX 1XSIA 3OLEA 4U31A 3CZ8A 2GJRA 5IHRA 3AHYA 1UWSA 4JFVA 3WENA 4OOUA 4HP5A 5FOOA 3ZJKA 1DWAM 3AZTA 3MMUA 4TUFA 3QHNA 4QLLA 2WVSA 3GH7A 2YDQA 1W9PA 3VIPA 5BRQA 1WO2A 1HJUA 2WVTA 1E3ZA 5CZKA 3SEPA 4Q7NA 4PMVA 2WZIA 5TD4A 1MFVA 5E9AA 2ZE0A 1VEMA 4CVUA 5D9MA 1E56A 1YHTA 3GM8A 3WNKA 4B9ZA 4ZXOA 2UY3A 1E55A 2CIPA 3ZMRA 5M03A 1TFVA 1MYRA 3U57A 1B3XA 1JF6A 1W9UA 4AD1A 1MVYA 1UH3A 2RGMA 4OUEA 4AW7A 3WL0A 2ZUWA 2OYMA 4D71A 4UQEA 1J9YA 1CZ1A 2DIJA 3VOCA 1UKOA 1WAWA 3AHVA 4U5IA 4MNMA 2D0GA 5D8ZA 3WUFA 1TE1A 5A2CA 4YN5A 1X6NA 3F4VA 3RCNA 3VM5A 1HT6A 1H09A 2A3CA 1UKQA 1W2PA 5HPCA 1CECA 4MB1A 4WJXA 4EE9A 3KL0A 3BAKA 1UKTA 1HXJA 1UA3A 1K9EA 1BSIA 3UEQA 1GQJA 4L4PA 2WSPA 1FHDA 1TVPA 4B3LA 4P8UA 4BA0A 4F8XA 1WCGA 3WY1A 7A3HA 4LQ1A 1GQLA 2C7FA 3BAIA 3WD4A 3ZIZA 1VFMA 1OM0A 4FLSA 3VIFA 1UD8A 4JFSA 2CBJA 3RIKA 1Q6DA 4GQRA 1GHRA 5I78A 2VQUA 4W88A 2VQTA 2BY1A 3VINA 3HMCA 1VEOA 3PZ9A 1H2JA 2AOSA 5I3DA 2JIEA 1GOMA 1OINA 5BYWA 3BSHA 5IHSA 3WH8A 4H8UA 2JEQA 1QNSA 3AHXA 1HL9A 2DT0A 1BQCA 1XH2A 4DM1A 3CGTA 4XZBA 2WC7A 4DWSA 1E70M 4JL1A 1H0IA 2WZHA 4PRWA 4TXEA 2ZUVA 1NWTA 2VZOA 2D3NA 2WMIA 1J0KA 2J47A 1CEOA 3UR8A 4M82A 1XCWA 5HPOA 2WMKA 2VZTA 4H04A 4ATDA 2GJXB 2VRKA 1JDDA 2VUYA 3VNZA 5FIPA 4MB4A 4W85A 4UFHA 1QHZA 4PYSA 1XC6A 4P7LA 1JIBA 1FH9A 1EDGA 3OZOA 3VD3A 3L4XA 2Q8XA 3SCSA 1Q4NX 3MMWA 3O9NA 2WVUA 4PTWA 3VDCA 2HISA 2E9BA 4AEEA 1G5AA 3CUFA 3W29A 1NWSA 1V3JA 1B1YA 5HDRA 4PMYA 4F9JA 5IDIA 1V0KA 4J3TA 4AZ7A 1E73M 4JCMA 3PZUA 2BXZA 1MW2A 4JZ5A 4CD7A 5JBDA 1DHKA 2QV4A 5DT7A 3W53A 2C0HA 3KL5A 1SMAA 2WAGA 1CLVA 5CLTA 1AVAA 3GNRA 3VX0A 3E1F1 4IISA 1HP4A 1VEPA 2W5FA 4R5EA 2G8ZA 3W4RA 4ZE4A 2WK2A 3WUBA 5IFTA 2ZX5A 4JHOA 1HJQA 5EBAA 4Y7EA 2V3FA 2V5DA 3WNLA 5JBEA 2A3AA 4OOZA 4PEEA 1ZJBA 3VILA 1R86A 4D6IA 3ZOAA 1VB9A 3OGVA 4H7VA 4Q22A 2O9OA 4N0RA 2EXOA 3TTQA 4J27A 3KWXA 3WUGA 2VNCA 4P8WA 3L4UA 1HX0A 4AMCA 5EFDA 4S3JA 4RE3A 1QOXA 3SUWA 1MQQA 2ZXAA 1UQZA 2X2YA 1PIFA 3RM8A 1V3LA 3PZNA 2QMKA 2QPUA 3I3DA 5D9OA 5A8MA 2W4XA 3LPPA 1V3KA 3B9DA 4DWSD 1U33A 3ARUA 1IT0A 3VDHA 2CBVA 2XFYA 4UTFA 2Y24A 3RDKA 1TA3B 1PX4A 4CD8A 1CYGA 2NT0A 4NSBA 3UG3A 4UZSA 2ZXDA 3RM4A 3WQ4A 1OCQA 4AZHA 3IAQA 3SCVA 1NP2A 4MADA 3WDPP 5AC5A 1TMQA 5BRPA 3PTQA 1KXHA 3SUUA 4A4AA 3VDBA 3M7SA 2XGBA 3WDJA 3EMQA 2X0YA 2XSAA 1JG9A 2OWWA 1E0WA 3B9EA 4MNKA 1V6VA 4ZFMA 1H1NA 5A3HA 1CXEA 3IJ8A 3CUIA 2A3BA 3IANA 5DT5A 1K9TA 4LYQA 3GXFA 2ZX8A 3BCFA 5CSUA 3AYSA 1GJUA 4PSRA 1B3WA 3ZSTA 3PTMA 1B9ZA 1FFQA 2DSKA 2PBOA 1W1TA 3ALGA 2W63A 4P7OA 1OBAA 1CENA 1N82A 3WMSA 1CXFA 1KQYA 4GI8A 2J75A 4QAWA 4HTYA 5BCAA 3MU7A 1PJ9A 1TUXA 2DT1A 1QI0A 3FNDA 3SCTA 1FP8A 3SCNA 4PUDA 4CCDA 4WKHA 4Z2IA 5LA1A 1UWQA 5A1AA 2D23A 1WDPA 3NSMA 3ZSSA 3MKKA 2PWDA 4AZBA 2W66A 1V3MA 1E72M 1B30A 1CGTA 2O9TA 3T0DA 5KZ6A 3AMCA 3A47A 1ISXA 2ZUUA 3EDKA 4HMCA 1BVNP 3VM7A 4GKLA 2FGZA 2F2HA 4HMEA 3WSUA 3TP4A 4R27A 1KXQA 4FF5A 3GTNA 2JF7A 3DYPA 4Z2HA 1R7AA 2V5CA 2VR4A 4Z2JA 2ZIDA 1EQCA 3UCQA 5CPQA 4HOXA 5I77A 2WHMA 3CZJA 2J79A 3OLDA 4W86A 4D1JA 4C7DA 2EPOA 2TAAA 1QI2A 3IJ9A 4QDMA 3RM9A 3EMCA 1WZKA 4CN6A 4JKMA 3VO0A 4W84A 2BVDA 1FP9A 3VVGA 1BG4A 3AIQA 3K8LA 1J0JA 1OGSA 1M01A 3U5UA 8CGTA 1JZ6A 4ACZB 3DHUA 3VMOA 2ZXQA 1BVZA 2CHOA 2JIWA 1E40A 3VGGA 1KXVA 1M53A 4CCEA 3W27A 2VT0A 2X1IA 1CNVA 4TTUA 1NP0A 1V6YA 5DO8A 1GUVA 5EMYA 8A3HA 2XSBA 3ZQ9A 1QI5A 1M04A 2D2OA 1GCYA 1GOIA 3LMYA 1UH2A 1FOBA 4PUEA 1GQIA 2CESA 4U3AA 3L2MA 2W92A 1XHGA 2QMJA 1PAMA 5A95A 3RMEA 2A3EA 4W7VA 3SCRA 5CXPA 4E2OA 2Z1SA 2VX7A 3L4TA 1EDQA 4HPHA 3VGDA 4BZYA 3SIMA 1C90A 5ABEA 4M29A 4JCLA 1EO5A 1EIBA 1ZBCA 3VTRA 4AD2A 1C7TA 1GW1A 1VJSA 1W9VA 2DSVA 4BF7A 1H5VA 2VCAA 4PMZA 1LWJA 2X05A 2BVTA 3PZVA 4JFWA 5D9PA 1CWYA 4W5UA 2J78A 2GK1A 3TA9A 4CCCA 1MQPA 1OSEA 4MPKA 4RE4A 3THDA 3I3EA 2CBUA 4M1RA 6A3HA 2IXUA 1UQYA 3WNNA 3MSGA 3N15A 1W9XA 2VI0A 3ARPA 4FK9A 1I1WA 4HA1A 2J74A 5BWFA 5HOSA 1GOQA 1EA9C 4EAMA 2QHAA 1GZJA 1E4IA 3EBVA 1DP0A 3PN8A 3WFLA 3FHQA 3N17A 4ZXLA 3CMGA 3VIJA 3AXXA 5CJ5A 2YJQA 3K8MA 4FLOA 1UG6A 3S2CA 3SUVA 4CKQA 4OJYA 3ECQA 2OYLA 5A69A 1XH0A 1KWKA 1RPKA 1Q6CA 1MFUA 3WH6A 1B3YA 4AZCB 3FN9A 1V6UA 3MUIA 3W81A 1V6WA 2CKSA 3EMZA 1FH7A 5BROA 1MW1A 2XVNA 2DPEA 3CUJA 4AZCA 1CGVA 2DSZA 2O9PA 3W38A 1H11A 5FKYA 2GDUA 4V27A 3J7HA 3BAYA 5IFPA 2EQDA 3OGRA 1KXTA 1J0HA 5AYIA 1P6WA 3RJYA 1ZBKA 5E0CA 1BHGA 1QW8A 2ZUTA 3WF2A 5A6JA 5D9NA 5C8BB 3OA5A 3VGBA 4HMDA 2VL4A 2WPGA 3T2QA 2VRJA 2QPSA 3W37A 2WYSA 4UFMA 3IJ7A 1I1XA 2UWFA 4UQAA 1F4AA 5CPSA 1JL8A 2QF8A 4H8HA 4AZ5A 4Z2LA 1XV8A 2WMHA 2E8ZA 1TR1A 2VJXA 2XPKA 3WF0A 4IM4A 2DGAA 2E9LA 1JI2A 2Z1KA 1BF2A 1C8QA 1OT1A 1V03A 4P8XA 4D72A 2VX5A 1E6RA 3MSDA 5LYRA 2YL6A 3ZR5A 2E3ZA 3EYPA 3BC9A 5LA2A 3VIOA 4DWSC 1C8YA 1GOWA 3ZJ8A 4HU8A 1C7SA 3MS8A 5BXSA 3MUZ1 1CBGA 1JGIA 4LGXA 1DWJM 5A2BA 2BHYA 2W62A 1XSKA 3AMKA 1EHNA 3CBWA 4TX6A 5I5RA 1KB3A 4LPCA 1NM9A 1VIWA 2YIHA 2J8FA 4W7UA 3BLPX 5FD0A 4HOWA 3NSNA 3W26A 5I2UA 1W9BM 1I75A 1W32A 4TOQA 2ZX9A 4D1IA 2VCBA 4J3WA 1SYTA 4CN1A 3BAWA 4JFUA 5CG0A 2YDSA 3GH5A 1BG9A 4AD4A 4EKJA 4BS0A 3AI0A 2OWCA 4E8CA 4PCTA 2FGLA 1BGAA 3QHMA 4D6HA 4PMOA 1LLOA 4CD6A 1HL8A 4GIAA 4AD5A 3LPOA 1PIGA 1QHOA 3W28A 2IXVA 3QOMA 3WELA 5AY7A 1NQ6A 1GORA 3VIHA 3SCOA 2CNCA 4GPNA 3VNYA 3AS0A 2VZSA 3NUKA 3ARTA 2G3MA 5BXRA 3WNMA 1WPCA 1HJVA 1E4NA 1W1PA 4J7RA 3AIEA 5GNXA 4PMQA 4DM2A 2JF6A 2EPLX 1QI3A 1ZL1A 2W67A 4TVDA 2E0PA 2OSWA 1Q6FA 2J4GA 2FH8A 2BS9A 5HXMA 2WC4A 1OIFA 4XV0A 2A3HA 2OWXA 2GK1B 4JKLA 3ZM8A 1UR9A 1IZJA 3OBAA 4W93A 1X6LA 2YOCA 4F66A 3AZSA 3NDZA 3A4XA 2MANA 3ZT6A 1PX8A 3L4YA 2VMFA 3QGVA 2FDMA 2F61A 4HPGA 4BQ2A 3K8KA 1CXIA 2CETA 3CPUA 3WMCA 3VU2A 2G3NA 2WMFA 3MANA 1W91A 1U30A 4WKAA 1TCMA 2CITA 2V3GA 5I79A 2DT2A 4UFLA 1DEDA 1BGGA 1E1FA 5E0FA 2PB1A 3CH9A 3L4ZA 1EGZA 1MXDA 4HZ8A 5M3WA 1V0LA 4M8UA 5GPRA 2E8YA 1B31A 3DYMA 2WMIB 3WD2A 1JZ7A 4U5KA 4AISA 2BY2A 3I3BA 3AXIA 1AQMA 1B2YA 1BPLB 2PWHA 3U7BA 3AIBA 4QCFA 2WHLA 4RE2A 5A6KA 4H8VA 1HNYA 3FY1A 1QI4A 4HA3A 4J3XA 4U3CA 2WLZA 1ODUA 2ZUNA 1WDRA 1HVXA 3T0BA 1KWGA 1WZMA 1JYNA 3TOPA 4OZOA 1IZKA 3OIHA 1GJWA 4OKDA 1H4PA 1E0XA 2YA0A 1MXGA 5DMYA 4OIFA 2O92A 3TONA 4GO8A 5C70A 4X0NA 4D6JA 4PMRA 1DWGM 2WM0A 4D6DA 2WKGA 1X1NA 3AICA 3WD3A 1V02E 4KRUA 4YHGA 4PTVA 1K9DA 2WHJA 2PI6A 1RP9A 3NSXA 1LL4A 5A6BD 1E3XA 4MNJA 3AZRA 2YLAA 1KCLA 4JIEA 1VFOA 3BAXA 3B9AA 5A8OA 2YBUA 2ZOXA 2EPMX 3OZPA 1JF5A 3WMBA 1DWIM 4W8LA 1HKIA 3M07A 1A3HA 4NRSA 1JZ8A 4W89A 1KR1A 1HKMA 2G3IA 2VZVA 4GINA 3WQ6A 3GXDA 4YPJA 3MO4A 4W5ZA 3SCUA 2J62A 2WW5A 3F5JA 1W1VA 2WCAA 5I6SA 3ARYA 3CHEA 2G3JA 1HIZA 1E43A 1E5NA 1ZU8A 2DEPA 2EJ1A 4XUYA 3AHTA 1D2KA 1G0CA 1UUQA 1UR0A 3CMJA 3ZJ7A 1JD9A 3WEMA 3GNPA 2O9RA 1VAHA 3L4VA 3T08A 1XSJA 2CEQA 3THCA 1J10A 2WXDM 4W87A 1VF8A 1UR1A 1BYDA 4HOZA 1KFWA 5AYBA 4MAVA 4U2ZA 3LPGA 5JIWA 4FLRA 5A8NA 3VIMA 9CGTA 1XD1A 3EDJA 2UY4A 1QNQA 1TVNA 4CU7A 4NRRA 1XRVA 5A8PA 1JDCA 1US2A 4B9YA 1BLIA 2G41A 2GJPA 4AD3A 3G6MA 4NZCA 4X0VA 2NSXA 2PWEA 2V38A 3A4WA 1JYWA 3PZIA 3GNOA 4AXNA 4ATWA 3AQUA 3T2PA 4ML4A 3GH4A 4UFKA 4AYSA 3RO8A 1HKJA 5D8WA 1SR0A 3CZKA 3SUTA 1J12A 3T2OA 2XWEA 3K4DA 5CGMA 1JYVA 4K68A 2J7CA 3WH9A 4IUGA 5GQBA 3L4WA 2E9MA 1O7AA 4BCEA 4PCSA 1UR2A 3N12A 2VOTA 5M17A 4U33A 4HU0A 4ZENA 1OD8A 4QLJA 5C71A 2HVMA 4CU6A 4ZEPA 2D20A 3FHAA 4C7FA 1V3IA 2XVPA 4NI3A 4WKFA 4W7WA 4AZ6A 2VR5A 3ZT5A 4PN2A 3KEHA 1BYBA 4CU8A 1J0YA 1UKSA 3WNOA 1TG7A 3WBEA 2XYLA 4UOJA 2AMGA 1GOOA 1WDQA 2XTKA 4DUVA 1Q6EA 5EB8A 1VJZA 4MJ2A 1GQKA 2Y4SA 3VIGA 4NF7A 4MAZA 2UY2A 2JALA 3WF1A 4IPNB 1NH6A 4B15A 1PBGA 4P7NA 1QNRA 2VURA 3VGEA 3OB8A 3MMDA 2YKKA 2D0FA 4AEFA 1FA2A 3ARXA 1VFUA 4KGJA 2EO7A 4ATLA 3EDDA 3OLGA 5EFFA 5CSYA 4E8DA 3II1A 3POCA 1G9HA 1SMDA 1E5JA 5FL0A 1H0GA 3KL3A 2VRQA 1JYXA 4GZIA 1KBBA 3ZT7A 1JZ4A 1XYFA 2J7BA 1E6QM 3SCPA 1CTNA 4JFTA 3WD0A 1OD0A 4HZ7A 3CTTA 3BMWA 2YL8A 4BQ3A 3F5KA 1JDAA 1HP5A 4J3SA 2J7DA 1UZ1A 3VIIA 3VKKA 3BCDA 1QBBA 1CPUA 3U5YA 5ABHA 4UQ9A 3KZSA 3ARSA 2XIBA 3SURA 3QR3A 1CXLA 1HJWA 2J8GA 4AD0A 1VBRA 2CBIA 3RILA 1HJXA 4D6FA 4MNLA 2Y5EA 1ZS2A 3UESA 4E4PA 2WSKA 4LXFA 3PZMA 4OBSA 4UQBA 1US3A 2EBNA 2WZEA 3WBAA 4JL2A 4PTXA 1CIUA 3WL1A 2ZX7A 4D6EA 1UWUA 5A6BA 1UA7A 3GDBA 1A47A 2VX4A 3BH4A 3JUGA 1JAEA 3PBGA 5F7UA 1OGBA 1BYAA 4LYRA 1UH4A 2OYKA 1QHPA 3PZQA 3WQVA 2D3LA 3VUPA 2WMGA 1WP6A 2V3DA 2XGIA 3D5HA 3W24A 1E6XM 1CXHA 2WKLA 4KGLA 3WH5A 2EPNA 4GO9A 4JHZA 3AS1A 3HU7A 3EDEA 3GZAA 1V0NA 3WKZA 3AIRA 5CGTA 4AZIA 1V0MA 2D1ZA 1QPKA 2E40A 4Z2GA 3VMNA 3VPLA 3QOKA 1PZ3A 3D3AA 1ISVA 3AMLA 2WWDA 1W3HA 2ZWYA 2IUZA 2VVSA 1MW3A 4AIOA 1RH9A 1UD6A 4TVCA 3AMGA 4UQCA 2CXGA 2WB5A 1E6PA 4F79A 3WQ5A 2WCGA 4PBGA 2VX6A 4GXPA 4WIWA 4FLQA 1MQRA 4QFUA 1XGZA 2W61A 4ZE5A 3VX1A 1M03A 4DWSB 3VIKA 3ARRA 2ZUMA 3N18A 1TA3A 1GOKA 1B3VA 1BFNA 4WSJA 2DH3A 1Z32X 3NCOA 3EDFA 2C8NA 3AIVA 4PMDA 3WDHA 1F4HA 5GNYA 1YQ2A 1NWUA 4QCEA 4L4OA 1ECEA 2WVVB 1V08A 2PC8A 1EHAA 2J7FA 3HN3A 5CPTA 5FL1A 2JEPA 1ISZA 3BSGA 1H49A 1GPFA 3FAXA 2WVVA 5JUVA 3PTKA 2XFFA 3AIWA 4UCFA 3OLIA 3NJ3A 1GNXA 1ODZA 1R85A 2WHKA 3A6OA 1R8LA 1ZBVA 2CPUA 1GVIA 1VBUA 1HJSA 4P7RA 6CGTA 1HKKA 2QLYA 1RD6A 1ZB5A 2D0HA 2X0HA 2XVLA 4A3HA 2WBKA 2DSWA 2XJ7A 3VD4A 1E4MM 2GFTA 2XM1A 4YHEA 2AAAA 2YL9A 4UFJA 1B3ZA 3W0KA 1LJYA 2J77A 1H3GA 3SUSA 1E6ZA 1W1YA 1HN1A 1C8XA 2XVGA 1J0ZA 3CO4A 1OWQA 4F9DA 3N13A 3CHCA 3LPFA 1E71M 1CGUA 1JI1A 4QP0A 1M7XA 4FMVA 4UOQA 1XH1A 5HBFA 4XB3A 1BYCA 4UZUA 1CLXA 3NYDA 4JAWA 3OGSA 3IAPA 4BQ5A 4UR9A 4EK7A 3NIYA 4KWUA 5A8QA 1UKPA 1FFRA 2ZX6A 4H2CA 2WCSA 3PZTA 1LWHA 1VENA 3FXYA 3FAWA 1NOWA 4BQ4A 1PZ2A 1JFXA 2GSJA 1LG2A 1JNDA 3M46A 1WZAA 2DDXA 2XM2A 3BXWA 1D7FA 3AISA 1AQ0A 3QHOA 4HA4A 1NOFA 2VO5A 3UR7A 1NARA 3MV01 1L8NA 1UZ4A 4GZJA 1JZ5A 3CUGA 1U2YA 1Y7VA 4ACYA 3ARQA 1XYZA 3AHZA 4W8AA 1PX3A 4ACZA 5A94A 4IPLA
chains in the Genus database with same CATH superfamily
3MV11 2TMDA 4PFHA 3ZLFA 3UPBA 1HVQA 2ACSA 3QY6A 5E1QA 1IEWA 1OYBA 3EPNA 4PZVA 1YX1A 4K37A 4Q4RA 5CSSA 3UYIA 3N2BA 3H54A 1HF6A 4S3KA 4HHMA 5EA9A 1E6NA 1JPMA 2YLLA 4W8BA 3ZJ6A 2BV9A 2CYGA 4H9YA 1S46A 1VGAA 1A49A 4E3VA 3T07A 1DIEA 4F0HA 4RX0A 1OHLA 3AOFA 2WSQA 3A3HA 2FHFA 3SRFA 3L2LA 5E70A 1FHLA 5XIAA 4L9ZA 4LVFA 3UGRA 4S3DA 3V5FA 3PBVA 3WEOA 4YTQA 4WX2A 3SCQA 1RJRA 2J25A 4RXGA 3AS3A 4CVWA 3AWOA 1J2WA 5T8GA 3DGRA 4NJKA 4DXXA 4IGNA 2PODA 3OG2A 4L64A 3PSWA 2VC9A 3HBLA 2VVNA 4UMAA 4O11A 5F2IA 5LZLA 1CLKA 2XG9A 3GG8A 1F2JA 1X98A 2OVLA 2WJDA 4V28A 2GVYA 5ABFA 5D4YA 1ZGDA 3HJZA 1O1ZA 3W1UA 3UA3A 1AW5A 1R3SA 2CZVA 1FWCC 1UD4A 4RV8A 2PDWA 3QPZA 2D73A 3AWNA 3FVDA 4H4IA 1YBQA 1Q2RA 3UG4A 2FTPA 2NUYA 4Z2KA 1H41A 3M16A 4CD4A 1SFSA 4G8TA 2DZSA 2B7OA 3O16A 4WF7A 2F8QA 1O6IA 1R7OA 1JDFA 2W91A 3D0CA 3TLQA 3UG5A 4K3ZA 2WBGA 1I0DA 1EDTA 3W7RA 3HPFA 3LBMA 2RDUA 1UWTA 2A7PA 4QBXA 4D8LA 3B9OA 5FEXA 1FWWA 4TV6A 5A6SA 5CQ1A 2B4GA 3CZGA 3ITCA 3N2MA 4JTGA 4CQ8A 3W6LA 3D46A 1L6SA 2CZDA 1U5HA 4XX6A 3AMDA 4LYPA 3K4AA 2VWSA 1UR4A 1IXNA 1XLEA 1ZBWA 3I68A 5F4WA 3QLLA 3TYBA 2VUNA 2PZNA 2X1SA 4B3KA 3W1RA 1C93A 1W1ZA 2UY5A 3RPMA 3R2GA 4M81A 5D04C 4C7GA 4L9YA 3BLKA 2YBTA 3QC3A 3GNDA 3W82A 4TX8A 3HO8A 3GDTA 3NPVA 5FESA 2Y2WA 4K39A 1W9DM 2NX3A 4B90A 2YA2A 1PPIA 1FDJA 2RJHA 4S3CA 4IIBA 2BHUA 3MPGA 3GTXA 4GISA 3WDRA 3NR0A 3FFSA 4XTIA 1E15A 3TMQA 3K46A 3L21A 3GYEA 2WQPA 5LXEA 2QCDA 5D2VA 4QHRA 2VFFA 1ZJAA 3WJSA 1PZ1A 5IDZA 2BOFX 3BK0A 4Z0SA 1RP8A 3RPDA 5I3FA 2B7PA 4PMXA 3P14A 4NG3A 3FA4A 1LUCB 5FSDC 2X41A 2ZTKA 2QS8A 3NQEA 4BWLC 4WSHA 2XFRA 2PEVA 4OGZA 4LVAA 3LGDA 2QW5A 2Y8VA 4AHPA 2ZA2A 1WQ5A 5LKYA 4AEOA 1AZ2A 2BWGA 3I7QA 3NO5A 4PBEA 5HNNA 4D9PA 2XVKA 2BXYA 4GJIA 1P0EA 1V7AA 5GJMA 4CQCA 4MJ4A 1VRXA 3E38A 4S1FA 2QUUA 4AIUA 1UD2A 3F2BA 1K77A 1XPYA 1O5RA 3VOGA 4ROPA 1DJWA 3EWZA 4GQQA 4CGTA 1UWIA 3AYRA 4UQDA 4AHQA 3N34A 1TPB1 4NIRA 3SO7A 1DORA 2D24A 1MW0A 3TR9A 4KRTA 1K3UA 3W73A 5C9XA 2ZZ6A 2IQDA 3GYCA 7REQB 3C0JA 4QG9A 1AH4A 3NGFA 4BY3A 1FX6A 4HMNA 1KLYA 3IUDA 3M47A 3F1QA 3KAOA 2BG5A 2GQ9A 3S2MA 5BRBA 3DYOA 2G4FA 5AN7A 1XUUA 4CQAA 4DELA 1J11A 4S23A 1XLJA 4H19A 3AROA 2ISSA 2CKRA 3IPWA 4ILSA 4H9TA 1E6SM 1UD5A 3POHA 3OLEA 3DZ1A 4EX4A 2I14A 1UZHA 4NUWA 3GR4A 1DWAM 3AZTA 3E96A 3MMUA 2RAGA 2A2IA 4QLLA 1FWEC 2YDQA 2C13A 4LALA 3W6YA 3VIPA 5BRQA 3HA1A 3XISA 2QCMA 4GC4A 5HNRA 1MNZA 4S2BA 4PMVA 2HS8A 4QRNA 5JH2A 2ZE0A 4XAFA 4GY0A 4JQ4A 4JD4A 3GM8A 2HK0A 4ZXOA 3VYLA 3CJPA 4DZIA 2FIQA 1EP1A 1M7OA 3JZUA 3ZMRA 1QJWA 1TFVA 1TWSA 3E0WA 3FSTA 4ZR8A 5HQLA 2PDLA 3M0XA 2HNHA 3B8UA 4PR4A 3DBPA 4LNCA 3WQPA 2OT0A 3HB9A 1BXBA 1Q66A 5BOFA 4Y6GA 3F2DA 3VZZA 1WAWA 3CPRA 1RLDA 2D0GA 4Y8EA 5A2CA 1LT7A 3MCOA 3M4HA 4HZMA 3T0TA 3QYSA 3OG3A 1UKQA 1NJJA 3W22A 2E6AA 4WJXA 5FJRA 4EE9A 1U83A 3ITVA 2OGYA 3PJWA 4QQUA 1IEVA 4FX8A 2WJZA 1K9EA 2ZC8A 4MWAE 3N25A 1X8FA 1GQJA 1DXFA 3DDMA 1GVOA 3MYPA 2ZQ0A 4F8XA 4AG0A 3DAQA 3TZFA 3VIFA 1BWVA 1VFHA 3AO0A 1IR1A 4WVXA 3HFYA 4L1GA 1F3XA 4AIBA 4C6CA 4XO6A 4W88A 3URNA 5BMXA 3HMCA 4LVDA 4C6PA 3EWXA 1H2JA 4O1EA 1XUZA 3WK0A 1FWIC 3TJXA 4LUSA 4LV4A 4Z1CA 4H8UA 3W1XA 1EJRC 1W1A1 1BQCA 4XZ9A 2OZTA 4QGCA 2WC7A 1FY6A 5CPOA 1TWDA 3H8AA 1XIHA 4B5XA 1H0IA 5D05A 4JIHA 3LCIA 4TXEA 4O4WA 2WMIA 2D2HA 3TQPA 1CEOA 2E25A 5D02A 4JBRA 5KITA 1XCWA 2WMKA 4H04A 3UZ5A 3I6RA 3TJIA 2VRKA 3M0IA 1JDDA 4J1OA 3VNZA 4ZODA 2OKOA 4DJFD 3FYOA 4UFHA 3R0UA 3FJ4A 1XC6A 5I07A 4RW5A 1FH9A 1H1ZA 1A5MC 4A05A 3GAYA 3W7QA 4LS0A 3OJGA 4PB5A 3M7WA 4Q33A 4JY8A 1R30A 3Q4DA 3DKLA 3N2CA 2WVUA 3VDCA 5CBBA 4AEEA 2IMRA 1V51A 3G24A 3FCPA 4QEEA 2BGQA 4HCLA 4PE8A 3NL6A 5HDRA 5IDIA 1V0KA 3OODA 4J3TA 4ICMA 3QVQA 3UR5A 2BXZA 4CD7A 3TZNA 2C3ZA 5JBDA 2QV4A 3LHYA 3GHSA 1SMAA 1Q8AA 3EWYA 1W0MA 4WJEA 1AVAA 3VX0A 3E1F1 4CNNA 1HP4A 5DBTA 2W5FA 4YCOA 4ZE4A 3WUBA 5IFTA 4L4LA 2ZX5A 4JHOA 4QG6A 1HJQA 3MDUA 5EBAA 1YNPA 2VGIA 1EFZA 2A3AA 1SJAA 4OOZA 4PEEA 1L2QA 1ZJBA 3ZOAA 2AGTA 2O9OA 4I6VA 2YZ5A 1MZRA 3TTQA 1R9ZA 4HNLA 4S3JA 1QOXA 2PPGA 4AVNA 2CLOA 3SZ8A 3EAUA 1B5TA 1D8CA 2QPUA 2QCHA 2HV5A 1TPDA 2W4XA 5JQ9A 2XZ7A 3W7HA 1R2RA 3ARUA 3NQVA 4ZO6A 1MRQA 1TA3B 1PX4A 3E2SA 3NQDA 3WQ4A 1JVNA 4AZHA 1W5PA 1NP2A 4HBKA 5BRPA 3PTQA 3NYZA 3SUUA 3VDBA 4LUJA 1S2CA 1RUSA 3VDGA 3LA4A 4KBXA 3ICJA 2X0YA 1JG9A 4MNKA 3KVKA 1TIWA 3IJ8A 3CUIA 2A3BA 3KRZA 4IMGA 4N9BA 4LYQA 3GXFA 5CBJA 1XDMA 3U2OA 1KM4A 3EZ4A 3RUBL 2QQ6A 3ZSTA 3PTMA 1MI3A 1W37A 3KBJA 4P7OA 3BARA 1CENA 1KRMA 1RR2A 2PP0A 5DCBA 4DHGA 4GI8A 3OQ8A 2BOGX 2DY3A 5BCAA 3ABOA 1K6WA 1XIDA 1TTQA 3SCTA 1R3VA 4Z2IA 1NTHA 4HQVA 3ZSSA 4IH3A 1B30A 3E0LA 1TRIA 5KZ6A 4R9OA 1M7PA 3AMCA 3IK4A 3ES8A 3L67A 2QPXA 4XSMA 4ZQMA 3QBUA 1J96A 3TP4A 3MUXA 3OBKA 1YBQB 4C6NA 3DYPA 2OO6A 4QJ5B 3H7UA 3AU6A 1X7FA 3TW7A 3AXMA 4W86A 3PY2A 4C7DA 2TAAA 4QDMA 4LBUA 2Z29A 4PUJA 4CN6A 2HCVA 4FPSA 3R11A 4S3BA 5DY3A 3BOFA 5H1WA 3K8LA 3DFNA 1THFD 5AHEA 4IMCA 1PWMA 5CEWA 1M9HA 2YCEA 3VMOA 1QXLA 1BVZA 1Y8BA 4XUGA 3TAOA 2V68A 2WOQA 4O50A 3LBOA 4IIHA 2X1IA 1CNVA 5AYZA 4MWAA 2E5BA 1NP0A 4GI4A 1OCJA 3F7JA 3W1AA 2XSBA 3ZQ9A 2CHRA 2H6RA 1M04A 3ERPA 2VC5A 3B0UX 3CLMA 2DJLA 5AKQA 2ONEA 4Q4KA 3DN5A 2DZPA 3HG2A 3LHVA 2ALDA 3WBYA 4E8GA 4W7VA 3N2TA 4E2OA 4WRHA 1ICPA 4M6UA 2Z1SA 3M5ZA 3GVQA 1K4GA 5FF7A 1EO5A 1EIBA 1ZBCA 3CQJA 3VTRA 4C1NA 1GW1A 1OFBA 3WLTA 5FAJA 1H5VA 4NJGA 3W70A 4JICA 1YPIA 1HZYA 4M7SA 1Q8JA 1WX0A 1P1XA 3RCYA 2G96A 1TPWA 1DJXA 2CBUA 2I16A 3A5VA 3TYAA 6A3HA 2IXUA 2FMNA 1TB3A 3WNNA 1JJKA 3ARPA 3NQ2A 4HA1A 1SSDA 5BWFA 3GHUA 1GOQA 1KO0A 1UPPA 1X97A 4OFCA 1OX4B 3PN8A 1XDLA 5RUBA 4GH1A 4KIEA 4MYXA 1VR6A 5KZEA 3O63A 3AXXA 2YJQA 3CM4A 1MMFA 2OYLA 1KWKA 4PH6A 1RPKA 1MFUA 3WH6A 4FP1A 4AZCB 3PANA 1V6WA 2Z25A 1LORA 3EMZA 4JIRA 3FYYA 3TQ0A 3UA4A 4K1GA 4AWSA 3Q2DA 3CUJA 2OQLA 6TIMA 1CGVA 1TQXA 5FJPA 2O9PA 3PJTA 3W38A 4JIIX 1D8WA 5FKYA 4WQ6A 2Z6JA 3J7HA 3BAYA 4Q7IA 1R46A 4MUZA 3OGRA 2ZVIA 1CX9A 4M7TA 3M0VA 1ZBKA 3T8LA 3GU1A 5HR7A 4UTWC 2I5GA 1QW8A 1KBJA 2XIQA 5A6JA 2OZ8A 3VKCA 5C8BB 3OA5A 1YTDA 2FB3A 3VGBA 4HMDA 3CV7A 3YPIA 2QPSA 4NHVA 2WYSA 3MB9A 3O07A 3WLKX 1W1B1 2NQLA 2UWFA 3IJ7A 5EMUA 1ZUAX 1JL8A 5JVLA 2XPKA 5C6MA 4IM4A 4IFOA 4O4VA 2Z1KA 1EJXC 1N7KA 4CNOA 2NQ9A 3B8WA 3PB0A 5LYRA 4WXZA 4FA3A 5A8GA 3WO8A 1PHWA 5CJNA 1H61A 2Q3RA 4Q8VA 4HU8A 3MS8A 1Q6QA 1PB0A 3KTSA 2A7NA 4Y8FA 2HE5A 2V0TA 4O1CA 3CBWA 4RUBA 3C5QA 4TX6A 1AJZA 4REQA 5FD0A 3BLPX 1TPFA 5I2UA 1W9BM 2C1IA 2ZX9A 3W2JA 1IIHA 4GNVA 3G1YA 1SYTA 1F6YA 4TMCA 3B8VA 2PDYA 4IMAA 3C86A 4S3AA 2QZRA 4D6HA 1LLOA 1R3TA 2VEIA 3MTWA 1PWLA 4JGDA 2WJFA 1PIGA 3QKZA 1LDCA 2IXVA 1NQ6A 3UXAA 3BURA 4LEQA 5I00A 4MY1A 2VZSA 3DC8A 3WNMA 3L9CA 3AIEA 4J4KA 5GNXA 5A5WA 1IR2A 1ME7A 2BASA 2P3ZA 1S38A 3E2QA 2EPLX 2ZYFA 2W67A 4TVDA 2J4GA 3CYJA 2BS9A 5HXMA 1OIFA 4XV0A 1QFEA 2OWXA 2NXHA 1KM2A 3GU2A 4LCQA 4JKLA 4UTHA 5C0QA 4E6MA 3QV6A 2DZWA 1E9IA 4XTDA 3QH2A 4JTHA 4W93A 4MJZA 1X6LA 2PWUA 3A4XA 2MANA 4IJBA 3ZT6A 1G6CA 4FNPA 3QW4B 1J6OA 1NVMA 4HPGA 4GGBA 2ACUA 3PUGA 1UWAA 1W91A 5AC7A 2BODX 1UJQA 2V3GA 3BG3A 1DEDA 1BGGA 4GUFA 2AQWA 2KAUC 4EPBC 3BMXA 1SGJA 1EGZA 5M3WA 4UC5A 3EEZA 5GPRA 5CAKA 1UBSA 2Y62A 3W1PA 1F74A 2WMIB 4FAMA 2BY2A 1WUEA 1BD0A 1AQMA 2V82A 1BPLB 5HR6A 3F4NA 2W27A 3AIBA 5DRIA 3A3WA 4HA3A 2ZRUA 1LOLA 3A9BA 3CEUA 1FWBC 2WLZA 2F6XA 3UXIA 3T0BA 4NP7A 1KWGA 2FJUB 2RHGA 1EPVA 1YXCA 3NXLA 3TOPA 4Q6XA 1GJWA 4PRRA 4OKDA 2HDJA 2VC6A 4DJDA 1R3RA 1V8EA 4FOUA 1R9YA 4D6JA 4PMRA 3BOLA 2PLCA 4D6DA 3L12A 3CMFA 4I5XA 2WHJA 3QMSA 4HNVA 1RP9A 1ZTVA 2H8ZA 3NSXA 1VFLA 4YXGA 4AUBA 1UPMB 2XZ9A 4H3DA 3G3MA 4EXBA 4JIEA 1VFOA 3MSRA 1N8WA 2QDGA 3B9AA 5A8OA 1T0OA 1HQTA 2NXGA 3E0IA 1JF5A 2FFCA 1DWIM 1XQLA 4NRSA 1R38A 1F3EA 4Q32A 1KR1A 3EX3A 1R2SA 4DN1A 3U0HA 4DI9A 1MUCA 1G67A 1SPQA 1Z41A 4W5ZA 3DBNA 4JXCA 3QQWA 3ARYA 2G3JA 1CB7B 1G0CA 5D09A 3GNPA 1J6PA 4FALA 2CEQA 3THCA 2I1OA 4EXAA 2WXDM 1D9EA 4W87A 1VF8A 3TN6A 1UR1A 1BYDA 1DVJA 3JS3A 3LPGA 2QJJA 4AWUA 1UIOA 1Q45A 3NL2A 2EJAA 5BNKA 3SY1A 4NRRA 3OVRA 5KINA 3GTIA 1KLZA 5LNSA 4GYKA 2FZBA 3IUIA 2Q02A 1QPNA 2G41A 3VCRA 4X0VA 2PWEA 3A4WA 1XGDA 3UBPC 3LDVA 4AXNA 1M68A 4ATWA 3RO8A 3H7RA 5D8WA 1YTEA 1WKFA 3LRKA 5F2MA 4QE4A 3T2OA 3K4DA 2QCLA 4NNCA 1BTMA 3WH9A 4G7EB 2OX4A 3QR1A 2FPVA 4JTTA 4EF8A 3QYQA 4BCEA 1IE7C 4ZB2A 3JW7A 4U33A 5C71A 4X3ZA 3STPA 3TN4A 1VCFA 2XVPA 1LYXA 2CW6A 4AZ6A 3W7PA 3NA8A 4ZSUA 5HWMA 3KOYA 1FWTA 5HULA 1KM3A 4PMJA 3WBEA 2XFWA 2E67A 4UOJA 2AMGA 4RNFA 3RLUA 1Q6EA 3BGGA 3APYA 3IV8A 2Y4SA 3T81A 1I2PA 3LBCA 4B15A 3TH6A 1R5YA 2R6OA 1FA2A 3NZGA 4H6QA 4LB4A 3KUMA 5CSYA 2YCLA 2OXNA 1YDOA 2H9AB 3GX9A 4E8DA 4IGMA 3MCNA 2NVCA 1SMDA 1GK8A 3KL3A 1CB2A 3N3TA 3DKJA 2QDDA 1CTNA 3LI1A 3GUWA 2HK1A 4KIRA 3CTTA 3ZVHA 4BR1A 2YL8A 1GYLA 3T0CA 4H83A 6ENLA 5DANA 4B5SA 2CLIA 4QJ4B 2ACQA 1CPUA 1XFBA 4BWLA 3E2VA 4O19A 5FEPA 1GVFA 3SURA 1JUKA 1EEXA 1PO9A 2D2JA 1CXLA 2YYTA 2J8GA 3WG6A 4D6FA 4IJRA 3MI3A 2BLEA 2YW4A 3PZMA 1Q6LA 3IIVA 4WUIA 2PC4A 2WZEA 3O6DA 2GJNA 1WKDA 3DI1A 3T8QA 2ZX7A 1FWNA 1UWUA 4UTKA 1RBOB 1UA7A 3R13A 1JDEA 1XRSA 3BH4A 3HIJA 4TQTA 2DZTA 1QHPA 3UPMA 3PZQA 4Q8TA 1WP6A 1YDYA 4NJHA 4IP7A 1RVKA 5FEWA 1GVSA 4I8YA 3CWOX 5G2HA 4C5ZA 2G5WA 3GZAA 3FJLA 3AIRA 4TR9A 4AZIA 3TNOA 1XPGA 2YB1A 1R47A 4CNPA 1QPKA 4IP4A 1SJDA 2E40A 1A5AA 4ZQRA 1KBIA 1PZ3A 3GO2A 1ZFJA 3S6DA 1JCYA 4KF1A 1A5NC 1RXOB 5JH1A 1T8XA 5EYWA 3O3RA 3B4UA 5BOEA 1LLWA 3M0YA 3ABQA 4PBGA 4WIWA 3MJYA 2NVAA 3VX1A 3IGHX 4DWSB 2A85A 3SADA 1PCWA 2VGFA 4C65A 3VIKA 4IIDA 5TQLA 1BFNA 3LEPA 2QCNA 4WSJA 3EX2A 3QM3A 5GVJA 3TCSA 3QKEA 1XIEA 1XYLA 1U5VA 3LQGA 2WVVB 2QUNA 1PDZA 3AC0A 4HNNA 3PG8A 3WK2A 2QJHA 2BMBA 3NM1A 1OCBA 3BSGA 1S39A 4ASTA 1ENUA 2OGJA 3ZVIA 4UCFA 4K7VA 1ODZA 2WHKA 5I7GA 1HJSA 3LNMA 6CGTA 2QLYA 2YXOA 1RD6A 3VKAA 3V75A 4A3HA 3AYTA 3N14A 2DSWA 2BTMA 2GFTA 2PGWA 3BANA 3LN3A 4YHEA 2AAAA 4UFJA 3LXAA 1LJYA 1H3GA 1NIUA 1KM0A 4NAEB 4OT7A 2PCQA 1SW7A 2CZFA 1EP2A 5AYYA 3W88A 3LPFA 4DNHA 1E71M 3VNDA 4XAGA 1ELSA 1QDSA 2C1HA 1BYCA 1A5KC 4UZUA 1W17A 4G5DA 3IAPA 2JK2A 4NX0A 4UR9A 4H1ZA 2A5HA 5A8QA 3PG9A 3A21A 2WCSA 5E0KA 7REQA 1QW7A 3E0VA 3NEHA 4MZYA 3FXYA 1PZ2A 1JFXA 1LG2A 2DDXA 3UXDA 4O53A 3WLPA 3AISA 2XINA 3QHOA 4S2CA 4B5UA 1IXOA 1L8NA 3MV01 5LHFA 4REQB 3B06A 3AHZA 3NPXA 5T26A 3ES7A 4WD0A 4MGGA 2FVLA 2QGHA 4I9AA 5CJMA 4JYEA 1JCNA 1E4LA 3PS7A 3B0VC 4HSNA 1KBKA 3GE7A 3NZ1A 3TVAA 1ME8A 1REQA 1Z7AA 2WWCA 1WZLA 3M9YA 4UMCA 3U2CA 1TVLA 2XIOA 2Z1BA 3LGGA 4PTNA 1IQ8A 1EB3A 3CS2A 3MDWA 3MP3A 3LHZA 4S3FA 4DJFC 1WA3A 3ORWA 1QBAA 1XBXA 4QLKA 4M56A 1VYRA 4HNUA 5A6MA 1TTIA 3CB8A 2CLHA 3W9ZA 5T91A 4H01A 3KBNA 2FDSA 5SWUA 1FQ0A 3DERA 3LHWA 2PCEA 2R94A 1BAGA 1K9FA 2ABAA 3W01A 1JFHA 3KP1A 1XIGA 2EG7A 4H6KA 1U22A 4IZGA 3CAWA 1V02A 4WXYA 3NNTA 3OZMA 1QOPA 4QJ1A 3OOQA 7PTDA 4P61A 3HMJG 4QE1A 1HKVA 1K6AA 1FWRA 1JZ2A 3CAVA 1CXKA 4XKMA 2BFGA 4CD5A 1GHSA 3WLIA 4P7QA 4FSAA 3TROA 3VC6A 2O4QA 5HQMA 3EWBX 4B16A 4QDPA 2EEXA 2HVOA 3RXZA 1E0VA 1RQEA 4JTDA 1VFFA 2GWNA 3WDQA 3BW4A 4A3UA 1W6TA 3VD5A 2VDGA 2PDHA 1XQKA 4WZHA 1MEHA 4GFIA 4DIAA 3CK5A 4AY7A 2FJKA 3QZEA 5HJXA 2ZUSA 3O0FA 3H2AA 4UTUA 4KKXA 1W3IA 4TIMA 1P0KA 3B8IA 1V6XA 1OX5A 4OUIA 2PDMA 3SN0A 1XIFA 3IK2A 4JTIA 4MTVA 3CL6A 5LA0A 2BNJA 1TV8A 2XN2A 2V5BA 1OGGA 1G1YA 1QPQA 3KTCA 3RRAA 1LOSA 3GR7A 3SQSA 5EMMA 4IQJA 4XWUA 1W3LA 4MFDA 3PP7A 1W3JA 3W1LA 5K3VA 2B31A 1A3XA 2OU4A 2PGRA 1Z42A 5I24A 2C79A 1OB0A 4IUOA 3AJ7A 4LF1A 4WOQA 4EPEC 4OE7A 5JIPA 3TAKA 1EL3A 4M3PA 1JQXA 3RLVA 3TLLA 1EIXA 3GKFA 2NQZA 4O1DA 1JAKA 1OEPA 3XIMA 3LSBA 3VZYA 2RGLA 3UJRA 1EA0A 5A6AA 9XIAA 4NQ1A 3P0XA 3AJXA 1KKRA 3E3HA 4AY8A 4YTUA 5EL1A 1V93A 2BY3A 2ZXBA 1YLVA 3RHGA 3W6MA 2BHZA 3W2UA 2OB3A 1G94A 4OWGA 1OIMA 4LX4A 1P5BA 5E6ZA 1TTPA 4GY7A 3H12A 3O8AA 1J0IA 4DUWA 1BXCA 3L5MA 1UD3A 1BRLB 1AH0A 3FA3A 2DT3A 1HKWA 2QCDB 3AU2A 1TZZA 2OSYA 2D22A 3GS6A 6ALDA 1QO5A 1XLIA 3LZ5A 2B7NA 1EC9A 4M80A 5E5CA 1EQPA 1H63A 5AC4A 4RDWA 3THAA 1JD7A 4GNKB 1DJYA 3EOEA 4INFA 1P6BA 3AXHA 3WDIA 3HJEA 1DHPA 2ATSA 2CLMA 4H2HA 5DCDA 1YPFA 1F8IA 3CASA 4RNJA 3RO6A 5AC8A 1QNPA 4H41A 5E09A 2JE8A 4X61A 3LLFA 4A2RA 3CZLA 1Q65A 2WMJA 1C29A 4J3ZA 9XIMA 1J01A 1OFRA 6XIAA 4AF0A 4HNOA 1LF1A 4PSPA 3BL3A 1UBPC 2QCEA 1H7OA 3ZWSA 1T40A 4DYJA 2PBGA 1RLCL 1OG6A 3KBWA 3ZZ1A 2DW7A 2O7QA 1Q7ZA 2WLYA 3ARVA 3UXKA 3IUHA 3CHDA 4LFYA 3KFTA 1IXQA 2CHNA 2AQVA 4F0LA 3RLGA 4FHAA 2BVYA 3GDKA 3KRBA 4PCFA 4JN6A 1M3UA 4J3UA 2ZE3A 3IIZA 1JXKA 2NV9A 4C5YA 4WSKA 3HQPA 5DF0A 2WJEA 3WEZA 1ESWA 4PBFA 3TTOA 1H62A 4C6BA 2NW0A 2Y8KA 3W25A 4DLFA 5GNZA 4PTMA 3ALFA 3C0SA 1TPEA 1TPVA 1XG4A 1FRBA 1EUAA 3QTPA 3GAKA 3CLWA 1EPXA 3MBFA 3M6DA 3AXKA 3BG5A 3P82A 2EPKX 4MY8A 3RCMA 4U31A 1VBJA 2B7QA 1YMYA 4IWWA 5E9XA 5IHRA 4JFVA 1UWSA 1P0NA 2B81A 3W72A 4HK6A 3ZJKA 1FHUA 3QHNA 1RY0A 4HN8A 2YB4A 1ZENA 1HJUA 3BJTA 3WZ0E 3NQ8A 1DQUA 1KTNA 3HGSA 2R91A 3S8HA 1Y5WA 5E9AA 4B5VA 4C1LA 2QCCA 1XR2A 1ADOA 5EBUA 5D9MA 1E56A 3GTFA 3WNKA 4B9ZA 4FR6A 1QASA 4Y9PA 4NZ4A 1E55A 3PJXA 4QS5A 3AUOA 4Q4OA 4JIPA 3Q58A 3U57A 1B3XA 1JF6A 4XKYA 2NV2A 7ODCA 3NO3A 1UH3A 1X6UA 4AW7A 2ZUWA 3ABRA 1E1CB 2TODA 4UQEA 1YDNA 4QSHA 3PBYA 3V5OA 5C55A 1J9YA 1DXEA 4QISA 2DIJA 3VOCA 1A0EA 4MNMA 1OJXA 3WUFA 1TE1A 4NZ1A 1X6NA 1K8YA 1H09A 1GVQA 1DE5A 3MKCA 4U4MA 1Q6RA 1XI3A 1UKTA 5D2XA 1DQXA 1UA3A 3WLMA 1BSIA 4L4PA 3NOEA 4BA0A 3S2JA 3NL3A 1WCGA 4M6PA 3WY1A 2HJPA 4RPPA 3EOUA 1GQLA 2X1RA 2C7FA 3WD4A 1OM0A 1Z89A 2QAFA 4FLSA 2Y89A 2VDHA 3PWGA 3RIKA 4MKNA 3P5YA 1RJQA 1XIJA 4H7ZA 2VQUA 1EGVA 1VYPX 3RMJA 1FTXA 4QX4A 4QS6A 2IS7A 3W86A 4MMWA 3PZ9A 2JIEA 1GOMA 3RGTA 4YJ5A 5BYWA 1S2VA 4LH8A 1FHVA 4AFYA 5I3JA 4NNBA 4F40A 3AHXA 1QUMA 2DT0A 4DM1A 3DU0A 2PLKA 3MUCA 5HMDA 2X7WA 3RNDA 3VKJA 1E70M 4J2PA 2WZHA 4PRWA 2ZUVA 2VZOA 2D3NA 1AMKA 1DYSA 1BKSA 2J47A 4NT0A 3MHGA 5HWNA 3PWIA 2RKXA 4ATDA 4J40A 2ZA3A 3OO2A 2HTMA 1WBJA 2ZRVA 4W85A 3QSRA 4RZ4A 1QHZA 4PYSA 3Q65A 4M1BA 2HNEA 4ZB0A 3AUJA 2NZLA 1F9CA 3OU8A 2WKJA 1SO5A 2A6LA 5A6TC 3UWUA 3P2VA 3ATYA 2VEKA 2PU0A 2Q8XA 3LLXA 3SCSA 3IGSA 4HCHA 1Q4NX 3MMWA 1P4CA 3O9NA 4PTWA 5MHBA 3E74A 2E9BA 4US6A 2PLJA 3W29A 4EVZA 3QPYA 1V3JA 4I3GA 1JUEA 4F9JA 5CSRA 3IRSA 1E73M 4JCMA 1DHKA 2PLMA 2JGYA 3KL5A 3BW3A 4K6AA 4RR4A 1WOAA 3W7CA 3GQYA 4DYKA 3PC0A 3N19B 4B2DD 1ZNNA 4R5EA 3W4RA 2G8ZA 2VC7A 2YCKX 3HGRA 4KT2A 1PDYA 3UWEA 2Z1XA 4Y7EA 1OG0A 3DCPA 3G0XA 4K36A 1R3YA 1E0UA 4DBWA 4N02A 4C60A 3VILA 2F6KA 4D6IA 1FDZA 4H7VA 2E5DA 4N0RA 4ZSTA 1DQWA 2EXOA 5AZ1A 4JYFA 4NZJA 3KWXA 3WUGA 2VNCA 1G7UA 5AFDA 4OBTA 4RE3A 1PKLA 5F1UA 1UQZA 1XX1A 1V3LA 3PZNA 3USBA 1QAPA 3I3DA 3CV1A 5FJUA 5H8UA 1XLGA 2PD9A 3O6CA 3B9DA 1IT0A 3VDHA 4MFEA 3M0LA 3V1HA 1XKYA 3HQNA 3RM4A 2PURA 1OCQA 3SCVA 2FGBA 5AC5A 1JGMA 4C6LA 3RAOA 1YADA 2DFAA 5ENLA 1E0WA 1V6VA 1CXEA 4JX5A 5DT5A 1I2QA 5CSUA 1F8MA 5GJNA 4RKAA 1FWDC 1B3WA 1BF6A 2DSKA 1MEIA 2PBOA 1W1TA 3M64A 4WGHA 1JCJA 4GWEA 3SFWA 3GKAA 1N82A 2VHLA 5M2FX 1K1DA 4Z1AA 4HTYA 1BSLA 2QVNA 2DT1A 3ZYZA 5DQPA 1QI0A 4IMEA 4CCDA 4M0XA 1YDVA 4WKHA 5LA1A 5A1AA 2D23A 2OO0A 1NFBA 3QMRA 3R10A 3H4XA 1V3MA 3G77A 1IEIA 3T0DA 1ALDA 3CH0A 4LCRA 4EACA 3EWUA 3A47A 1ISXA 1DPMA 3PSVA 1BKHA 1BVNP 4GKLA 4HMEA 3HQ1A 1KKOA 1KXQA 4FF5A 2PP1A 4GUIA 3GTNA 2JF7A 4Z2HA 1XS2A 1UMLA 2PP3A 2V5CA 2VR4A 3EA3A 3TC3A 4Z2JA 3UCQA 4ZTXA 3LB0A 3WJWA 5I77A 1HUVA 2WHMA 3W2NA 3OLDA 2GQAA 4FXSA 2EPOA 1QI2A 2F9RA 3T4CA 3PNUA 3RM9A 3W23A 2HPIA 3AYVA 4W84A 1FP9A 4KW2A 1BG4A 1D3HA 1J0JA 1OGSA 3URAA 3U5UA 4S3GA 1GZGA 4NYYA 1T41A 3NDOA 1WKEA 2ZXQA 3K2GA 3ITTA 4GUJA 1FKXA 3M5YA 4MY9A 3VGGA 1M53A 3K5XA 1NDVA 3RF9A 2FTWA 4AHOA 4DJED 2PFHA 3G1RA 1GUVA 4UCGA 1NY1A 8A3HA 4DX3A 1I8JA 4TO8A 5B80A 1LRTA 5C9ZA 4FO4A 5HK4A 1GEQA 3V5CA 5LIXX 4DBDA 1GQIA 1XWYA 4XIMA 1OADA 2ISVA 4V15A 1XHGA 2QMJA 3A24A 4HJWA 3T9PA 4ZQPA 3RMEA 3TQKA 5KTLA 3VE7A 2ZDRA 1KFEA 4ZZ9A 1EDQA 3VGDA 4BZYA 1H7RA 4JCLA 4AD2A 2NLIA 4GUHA 2Y70A 1VJSA 1W9VA 1KTCA 5ECVA 4US5D 4PMZA 1LWJA 2X05A 1EWEA 2FPTA 3R8RA 3WBWA 1CWYA 1EEPA 2GK1A 4IX0A 4HJFA 3JU2A 1XG3A 4GH3A 4O12A 1MQPA 4HIBA 4Q3MA 4BEUA 2NQHA 1VHCA 5EMJA 4C6IA 3MSGA 4KERA 4AVFA 1BVWA 3TYDA 4LNYA 3CQ0A 3IARA 1R3QA 1K02A 4XBJA 1EA9C 3RX2A 3CHVA 3UYCA 4GLEA 1E4IA 3RRXA 3MVIA 4BJHA 2NQ5A 3N17A 4ZXLA 4UNKA 3VIJA 1AK5A 2INEA 3N2XA 4YTRA 4Y9NA 5CJ5A 3VC5A 4FLOA 3H7VA 1UG6A 4C6JA 4B2DA 1OK4A 5A69A 1Q6CA 5EY5A 4L7ZA 7XIMA 3D6NA 2AQOA 4QR6A 5B7ZA 1IZCA 1YTKA 3MWAA 2W79A 5DELA 3EOSA 4XG1A 3A5FA 3NQCA 1VP5A 3KCLA 5IFPA 3AALA 2PGFA 2OTDA 5LGXA 2DVTA 4NVTA 4XAZA 5E0CA 3GDRA 2ZUTA 3KS6A 5D9NA 4B4HA 4OQVA 1A5BA 3BSMA 1PTDA 4DO6A 2WPGA 5K7JA 2ZZ2A 4JPGA 3T2QA 3A64A 4S39A 1JUBA 3NGJA 1ICQA 3S9ZA 1HO1A 4UFMA 1I1XA 3QGKC 2Z7KA 3SRDA 1F4AA 4HSOA 2F38A 1AW1A 4H8HA 2C91A 1RA0A 3JR2A 2NUWA 2YBVA 1Q85A 1DXIA 3KS5A 2GPTA 1AZ1A 1JI2A 1LQ2A 1BF2A 2PF8A 2WZMA 1V03A 1E6RA 1T6MA 3R5EA 3CT2A 1GVEA 1TJPA 3EA2A 4DB7A 3N4EA 1I4NA 5LA2A 2CZEA 1ZZMA 3ZJ8A 1C7SA 5IM51 3LY0A 4W4QA 3BPWA 1JGIA 3MSYA 5TIMA 1DWJM 1WXYA 1XIBA 2W62A 1LWIA 2EAWA 1EHNA 1TPC1 4XD4A 2GGHA 4W7UA 1NM9A 2WNNA 2YIHA 2J8FA 2NX1A 3UWYA 1Q2SA 4MZ8A 3SSZA 4XIAA 3T78A 5CAHA 1I75A 4IL2A 4TOQA 2YCLB 4IF2A 4D1IA 6PTDA 4FOJA 1HTIA 1SZEA 2VCBA 1ONRA 5I09A 2OPJA 3KVJA 3W7EA 3BAWA 3G1SA 4MPQA 2YDSA 2GL5A 2INFA 4O1AA 4BS0A 3AI0A 2OWCA 1W31A 3FX4A 1JCXA 1XL9A 2E6DA 2VEPA 3O05A 1XYAA 3BUVA 3W28A 2QIWA 5KZMA 3WQGA 4RCXA 5EPDA 1N55A 3VIHA 3PPFA 4GPNA 4NZFA 4F4RA 1XYBA 4LUTB 5BXRA 5J5RA 4BK9A 1HJVA 1E4NA 3R43A 4J7RA 4XQ6A 4A8IA 4DM2A 4NI8A 3V7PA 2JF6A 3REQA 1QI3A 2OSWA 3U48A 3N73A 4LJ3A 3PFRA 1YW1A 3H4GA 3S6OA 4LAUA 1A4MA 3U9IA 4JQ2A 4DJEA 4EF9A 3W83A 2ZRXA 4UTLA 5IBXA 3OBAA 2GDQA 2D69A 4F66A 2FZ8A 3AZSA 1Z48A 1OK6A 2EGZA 2VMFA 3QGVA 1VJIA 4Z08A 3CV6A 4O1BA 4GCAA 2NVDA 1B3OA 4JTCA 3GU9A 3VU2A 4IMFA 4IQDA 4DPPA 4H9VA 4N4QA 3LCGA 4WKAA 1TCMA 3KP0A 3EB3A 3P6LA 5I79A 3DFOA 4UFLA 4KEVA 9RUBA 3VKDA 3FIGA 3L4ZA 3LUTA 1DOSA 3VXGA 3FGCB 2I9UA 3MZ2A 1KV8A 1GKQA 3P60A 4ERAA 4AISA 4I5UA 2PWHA 3U7BA 4QCFA 2XU2A 3GD6A 4RE2A 5DMLA 5A6KA 5T9CE 1HNYA 3FY1A 4JTAA 1K4HA 2X40A 1ODUA 2FZDA 2HS6A 2NV1A 1U1UA 3HM7A 2F6UA 1MUMA 4CEXC 1WZMA 2Z2AA 5L9FA 2A0NA 3MZNA 4BF9A 2ANUA 4PGLA 2VELA 5G2WA 4G7FA 1JQVA 2DJXA 4WY0A 1E0XA 3TSBA 3VCCA 4LAZA 4Z17A 3IJLA 1TWWA 1YE6A 3UJEA 3TONA 5C70A 2Q6ZA 1OFPA 2WM0A 3AICA 3W76A 1V02E 2QDEA 1GKRA 4KRUA 3TMLA 1ZY9A 5C7VA 4C90A 4GD0A 3TW6A 3LXBA 4IMDA 2FB2A 3MJMA 2YLAA 1KCLA 2YPIA 1VLWA 3R4IA 1A80A 4HYWA 2EPMX 1TWIA 4EWJA 3OZPA 1FCQA 1ONXA 2FVKA 4W8LA 2FZMA 3M07A 1JZ8A 3GR8A 3H2OA 2GQ8A 3R7MA 2G3IA 2VZVA 3WQ6A 1TR9A 2E68A 4A3QA 5C9RA 2J62A 1OFEA 3EWCA 2VEGA 1W1VA 5I6SA 1ZQ5A 3PJUA 5C2XA 1HIZA 1E5NA 1ZU8A 4O18A 2EJ1A 4XUYA 4QQ3A 1P7TB 1PKYA 1QO2A 2ZRZA 1D2KA 2GYIA 4IG2B 1UR0A 4JY9A 3WEMA 2V5LA 2O9RA 3VABA 3T08A 1XSJA 1J10A 1SJCA 3NEVA 3H6OA 3CYVA 3S2LA 2E09A 2I57A 4KEZA 4U2ZA 3UCDA 1XD1A 3EDJA 4RZBA 1QNQA 4CNTA 3BCJA 1ZHAA 4Y9AA 4LUSB 5A8PA 2J9XA 2Z1VA 1BLIA 4AD3A 2OMAA 3NQ7A 4AXKA 2OEMA 3DESA 1OC5A 1F3TA 5H91A 4GUGA 1HKJA 4H9UA 1AD1A 3SUTA 3Q45A 3NTYA 3S1GA 1KFKA 4Z1DA 5LXXA 4MF4A 2XWEA 3C0LA 5CGMA 4LCSA 3EB4A 5HMSA 1S5WA 4KWVA 4I8DA 3WCZA 2J7CA 5LIWX 4PCSA 1TJRA 1UR2A 3SECA 4P5UA 4HU0A 1XLCA 4QLJA 1NFGA 2DORA 4HPJA 4C7FA 1V3IA 4CQDA 2JKPA 4PC8A 1LBLA 2VENA 1M41A 2VR5A 4EPKA 3GUGA 3T6CA 1PYFA 1VS1A 1FXPA 1NF0A 5EGRA 4E2DA 1J0YA 4XSLA 1CW2A 4ZB5A 2WNQA 1WDQA 2P8CA 4DUVA 1T99A 3GSMA 4IQEA 1VJZA 1GQKA 3VIGA 5BWAA 1AL7A 4POCA 3WQOA 4TV5A 1K7EA 2UY2A 4ERGA 1W5NA 2CLKA 2VD9A 4IPNB 5CZTA 4P7NA 3VGEA 2VURA 4MWAC 3MMDA 4Q8UA 5D32A 3ARXA 4AEFA 3PTDA 1VFUA 2EO7A 2OEKA 5EFFA 4GGHA 3ZWTA 4M6VA 1G4EA 3K4WA 4R7OA 3II1A 3T40A 6REQA 2IKGA 1A3WA 2Z2BA 2PMQA 3K13A 3H2NA 3ZT7A 1KBBA 1DJQA 1XYFA 1YYAA 1E6QM 2J7BA 3SM0A 4JFTA 3WD0A 1S5TA 2OR2A 4V1XA 3QEZA 2X2GA 3F5KA 3NQFA 2NUXA 1HP5A 4HK7A 4J3SA 3CAKA 2QV5A 1A0CA 4QNEA 3ANUA 1UZ1A 3TYEA 1W5MA 5FJOA 1REQB 3U5YA 3I7RA 4E38A 4LC6A 3UD6A 5PTDA 1GKPA 1OABA 2PDNA 3KZSA 3ARSA 3RILA 1HJXA 4MNLA 5IRPA 4GBDA 1EYWA 1L6WA 4GFSA 4LXFA 4IQLA 4UQBA 2EBNA 4IFKA 5KSWA 4JL2A 4PTXA 3PB2A 1FCUA 1NDWA 1Z9AA 1MZHA 1SO4A 3WK1A 4DJDC 3EXRA 3NPWA 1H60A 3GDBA 3TK7A 4XD6A 1W3TA 3WJXA 3JUGA 4L65A 2DZUA 3IVSA 4LRTA 4WDXA 5T9BG 1Q3NA 5D33A 4CEUC 4ZO8A 3DFPA 2A4AA 5I06A 4DBSA 3INPA 3W07A 3SJNA 3H2CA 2XGIA 4BFAA 3LU2A 3W24A 2WKLA 5U4NA 4GO9A 3L65A 4JX6A 1UUMA 4HNTA 3AS1A 4IJCA 2HEJA 1V0NA 4UBPC 4M5PA 4EWND 5CGTA 2OLSA 4PA8A 2D1ZA 4DJFA 1DV7A 3VMNA 3VPLA 1KW1A 3A4JA 3D3AA 4HN4A 3AMLA 2VR2A 2VVSA 1MW3A 4AIOA 4TVCA 3FDGA 4UQCA 4N4PA 2OELA 4V1YA 4KEUA 2WB5A 4O1FA 1E6PA 4F79A 2L5HA 2FQIA 2VX6A 3KRSA 4GXPA 2WO5A 1MQRA 3S2NA 1XGZA 3GNXA 4ZE5A 1M03A 3M0ZA 1J8VA 1TA3A 1XF0A 3GDMA 1YPXA 2YXXA 1F4HA 4QJ3B 1VLIA 1W1IE 5CH9A 1ML1A 1LP6A 2F7FA 1TO3A 3TW9A 3ID7A 4YWSA 3HN3A 3W74A 1ISZA 3DHFA 3W2MA 1H49A 2FFIA 1GPFA 1EZ2A 3TJ4A 2OFJA 2G37A 3PTKA 2XFFA 3MVTA 3H26A 3NJ3A 1GNXA 2NX9A 4KS0A 4IL0A 1FWSA 1R8LA 3A6OA 1LRQA 4XD5A 3SSJA 1SO6A 1HKKA 3CAQA 4NAEA 3S42A 2X0HA 1KCZA 1UIPA 3VA8A 1NQKA 2XM1A 3VFLA 2J77A 1FXQA 2ZC1A 4G1KA 4L56A 3PR2A 3SUSA 3VAVA 3BWWA 2BGSA 3CO4A 4FIQA 1OWQA 3UP8A 2GVEA 4DVOA 4F9DA 4GACA 2V63A 5AHFA 1KRBC 5J5DA 1F07A 1H7NA 4LVGA 1M7XA 3CNYA 1AW2A 3I6EA 1I9CB 4XK2A 1CLXA 1S1RA 4JAWA 4MLJA 3QY7A 3I10A 1OZMA 3IV3A 4K7YA 3NIYA 1FFRA 1NAL1 3FAWA 4BQ4A 3VOIA 2X42A 1RPXA 3BXWA 4Q8NA 3G1VA 5LSMA 4HA4A 1HL2A 3ITGA 3UR7A 1NARA 3DXIA 4J35A 5H8PA 1UZ4A 2EF9A 4R88A 4GZJA 3FA5A 1JZ5A 3CUGA 4RDZA 1Y7VA 3ARQA 1XYZA 3EOLA 4ACZA 1ME9A 4L61A 2PS2A 2FHBA 4JYDA 3G1FA 1AMYA 4L5ZA 5BXTA 1IV8A 1LG1A 4UNLA 3CUHA 5J04A 1QW9A 2YDRA 5LNWA 3M5XA 2EG8A 1OX4A 3N6QA 3P0WA 2ESCA 2EPHA 1H7XA 4J28A 2W3ZA 4UOZA 3CIVA 3CWHA 1M65A 4HHLA 4XVEA 3F5LA 2EG6A 4M24A 4O57A 3TUUA 4JTUA 1SZGA 2DV0A 1C92A 4MDPA 5I03A 1U5JA 5CC6A 1S2WA 2PTZA 4AWEA 1AODA 3E5BA 4GC3A 2WNWA 4NXSA 4R53A 5TNVA 4D2JA 1JRCA 4M51A 1HW6A 1DTNA 3FKKA 3IJDA 6TAAA 1R3WA 8TIMA 4OECA 1DIDA 2CCRA 3WH7A 3G0SA 3GHTA 3EPMA 1UYQA 3U7VA 5BW6A 3DC0A 3AAMA 5ECUA 4YVPA 2FHCA 4CCZA 4GI9A 4FB7A 1KGUA 3SBFA 1IYXA 4XVDA 4H9MA 4IP5A 1EH9A 3QV8A 2R1KA 1V3HA 3OQEA 1AL8A 3C2VA 4U2YA 4RPQA 3UETA 5LIYX 1LQ0A 5KEZA 1BQGA 4RDYA 2DQXA 3GXMA 1S1PA 4YWIA 4P8VA 5D2YA 3N6HA 4JIQA 2NWRA 4FX7A 1Q6GA 1W8SA 2GUBA 5FF4A 1YEYA 1QNOA 2J88A 5M5DA 1PIIA 3STCA 4AIEA 5CPLA 3L0NA 4J3VA 1U1JA 1Y0EA 3HPSA 1K70A 2DSUA 3BTNA 1I6NA 3LERA 3NVDA 4RV3A 4I7WA 4YCPA 3DG7A 1DTUA 3CTLA 3I4EA 2IKHA 3CL8A 2GDVA 4WEVX 3OHMB 1FH8A 1OFDA 2C1GA 4MB3A 2OKTA 3K1GA 4Q7BA 5ABFB 4KH2A 1L0PA 4X9YA 3GC5A 3KM8A 3UNTA 1NOUA 1CGYA 3SIZA 1RALA 1C8VA 5CZJA 4V2XA 1UOKA 5BXPA 3ARWA 3ITOA 1W2VA 1B90A 1IF2A 1TZ7A 1QRQA 2VZUA 1N2VA 4ECLA 4KESA 1MUWA 4ENLA 7TAAA 4LF2A 3T09A 1TPH1 2GQ3A 1G01A 3GVRA 2BY0A 3WQ8A 2WSRA 4R34A 4IIFA 4OHQA 4OV9A 1TUFA 3VD7A 2DVUA 2Z26A 5AB3A 3AFBA 1OZQA 3P61A 2OLHA 1PTGA 4URIA 1U1HA 4ORMA 3SGZA 4KFOA 1CDGA 3PM6A 1IWBA 4XAYA 3P84A 2Z2UA 3CXOA 3H2MA 5HJLA 1AQHA 1I2RA 4BI7A 3CU2A 1MSSA 5DXYA 3IEBA 2NT1A 5CCZA 3W2LA 1A5OC 1UW9A 4KWOA 4TX9A 4I9JA 4UTTA 2X8RA 3HPAA 4D6GA 3CHFA 2VTFA 4D6CA 1UUOA 5K2ZA 3BAJA 4CUCA 1Q5MA 5DMNA 3UNDA 1CGXA 3H21A 3DI0A 4GA8A 5C54A 3W1TA 3TTYA 3VDAA 4ADTA 4MB5A 4TTGA 3GTHA 2GVJA 4WDTA 1LL7A 4C6FA 4UXDA 3ZFHA 4I7UA 3STEA 5LNRA 1EZWA 4C91A 1DIOA 3QRHA 2C18A 4UFIA 2CU0A 1EJVC 4H6RA 2XHYA 2JFEX 3EWDA 4N2YA 2AKZA 4ORIA 3CQIA 5I0DA 3IVUA 1JXJA 3TSMA 1QVBA 3G18A 3N1AA 2QXWA 3PPHA 4AC1X 1E9LA 4K8HA 3N04A 1RQBA 3VD9A 4PMUA 3PPGA 1O95A 1UWRA 3GY1A 3S6TA 1LUCA 4HNCA 3R8GA 4EIVA 1RJPA 5I23A 3T1GA 1ZPTA 4MDOA 3QV9A 3MHFA 2RJGA 5DEZA 3WD1A 3B04A 1RD5A 1IHIA 1RZMA 4N42A 3NDYA 4AZGA 4JKKA 4LB3A 1PZ0A 4PB3A 2XWDA 2P50A 3N4AA 2PDCA 1ISWA 5DLCA 3O2LA 5AZ0A 1JNEA 2C0AA 4DJDD 4EANA 3SJ3A 2ZVRA 3FW6A 2J7HA 4Q8MA 1QWKA 4GHRA 4DUXA 2RDWA 2Y88A 4JEJA 4DWDA 1KR0A 3GK0A 1DJNA 1F6KA 4GZEA 3QFWA 4K38A 5DMMA 1PKMA 1MXSA 8XIMA 3Q67A 1WNOA 2GOUA 3L66A 3MUY1 1Z69A 1XLDA 3KZPA 4TVUA 1C91A 5ABGA 3OVQA 1FWGC 1DWFM 3DENA 4ZQOA 5BOOA 1CGWA 3WUEA 2O55A 2ICSA 3PZGA 5H6HA 1XICA 3M0JA 3CWNA 3G3DA 1PXGA 4PUUA 2GJRA 3AHYA 4XD3A 3ZR4A 2AL1A 5FOOA 4TUFA 3BGJA 1RA5A 3GH7A 3R58A 4H00A 1I60A 5EU9A 1OFOA 1W9PA 1LCOA 2IPFA 1IGSA 3OYXA 3TDFA 1WO2A 4B5TA 4O0QA 2J27A 2DZXA 3SEPA 4Q8WA 2Z28A 2WZIA 2GSHA 1GGOA 1VEMA 4CVUA 4M19A 2UY3A 3H2EA 2CIPA 5AVHA 1LT8A 1PV8A 4GVIA 1MYRA 4LAKA 4AMAA 3LYEA 3LTSA 2RGMA 8RUCA 3WL0A 3GFYA 5CC5A 2OYMA 2YFOA 4AC7C 1RBLA 1IXPA 1SUXA 2C15A 1DJIA 3IIXA 2Y7DA 3AHVA 3LS9A 3HTWA 5DBUA 4YN5A 3VM5A 3KXQA 4PL1A 4XO7A 2FKPA 4XISA 4HGXA 5HPCA 1CECA 4MB1A 3KL0A 3BAKA 3P93A 2QUTA 3TC7A 2XN1A 4UTJA 3G8RA 3L2IA 3TN5A 1T5AA 5TBOA 4R85A 1L2UA 2WSPA 4O15A 4B3LA 5F4SA 4N6FA 1QCWA 4KQNA 4GIRA 3ZIZA 1EX1A 1S5NA 1VFMA 1UD8A 4FNUA 4JFSA 1TV5A 2CBJA 1UZDA 1OCNA 3UZZA 4K1WA 1VC4A 3KW3A 2VQTA 3G1XA 2YDAA 4J9JA 4HKPA 3VINA 1WAUA 1ZCOA 2ZZ1A 1VPQA 2ZZ7A 3PFMA 3SN1A 2AOSA 4E5TA 1OINA 3I7SA 5MKGB 5IHSA 1MO0A 3MI2A 4Y90A 4KRZA 1QNSA 4UR8A 1XH2A 3CGTA 3BLFA 2PWVA 1AJ2A 4JL1A 2BB0A 3C2FA 3OIXA 1X1OA 1M1BA 2I17A 1J0KA 2X30A 1OYAA 3HFTA 1YKWA 5HPOA 4J2MA 2GJXB 2VUYA 4N9CA 1OC6A 3L0GA 2ZZ3A 4A8RA 4MB4A 1QTWA 1VYSX 1EC7A 3TTEA 3BVJA 3O15A 4P7LA 1JIBA 3KOFA 2Y61A 4QNWA 4H8NA 2CXEA 3L4XA 3BLIA 3OTRA 2R8WA 1G4PA 4KWWA 3W7GA 2HISA 4GY1A 1G5AA 1VCVA 1R6WA 2Y7FA 3CUFA 1Z8AA 3VKBA 1AA1B 4AZ7A 4BI5A 2GGEA 3PZUA 3UXLA 4JZ5A 2C0HA 2WAGA 2A79A 5CLTA 4RXFA 3GNRA 1LBFA 3M5VA 3TFXA 5XINA 1PS9A 1UOZA 4C1NB 1S2AA 4ZO7A 2FVMA 2V5DA 3WNLA 5JBEA 2Q8ZA 1XGEA 2X1TA 3G2GA 3HQOA 3QV7A 2VWTA 1R86A 3OGVA 1KFCA 1P43A 3BJSA 2V2DA 2WM1A 3SQLA 3UJFA 1VCGA 2FMOA 1HX0A 4AMCA 4A22A 3SUWA 3W3OA 2OT1A 1MQQA 1XBYA 4FXJA 2ZXAA 2X2YA 3B8DA 1PIFA 2E77A 2HE8A 3RM8A 2H8XA 5KMYA 5D9OA 5A8MA 3WMLA 5LIKX 5HJYA 4Z0JA 1GG0A 4FNTA 3LPPA 5J8LA 4IIGA 4F2BA 2CBVA 3KHDA 2XFYA 3A22A 2IPWA 5BU9A 3C8FA 5DX7A 2NT0A 3S46A 3UG3A 3E02A 1HO4A 4MADA 2GZXA 3MHUA 3UJSA 1KXHA 1A5CA 4A4AA 1QMLA 4G7EA 2XGBA 3WDJA 1SZRA 4WGXA 2XIMA 3GNNA 3LHTA 2EKGA 4ZFMA 1S3TC 3UW6A 1YE4A 2CWNA 3IANA 1K9TA 1EC8A 1WOBA 2IW0A 2G97A 2ZX8A 3U4FA 1GYMA 1GJUA 4C1KA 4PSRA 1B9ZA 4LS2A 3UFYA 1AD4A 2H90A 3ALGA 1K7XA 1OBAA 3TWBA 3L5LA 4PFMA 1CXFA 4FNSA 3HF3A 3FOKA 2Z27A 3MU7A 1TUXA 3FNDA 1FP8A 4H9ZA 3VI2A 1JRBA 1P1MA 1UWQA 2ZCGA 3W85A 3NFUA 1WDPA 3P8IA 3PUEA 1S5MA 4ADSA 1RHCA 4AZBA 3UY8A 2W66A 3KTXA 1E72M 3GC2A 3NG3A 5CGQA 3UF9A 3PVFA 2ZUUA 3EDKA 4HMCA 2FGZA 2F2HA 3WSUA 3W00A 3I6TA 2HXTA 2Z1WA 2R1LA 3RG6A 1OQFA 1OFAA 1R7AA 1JEZA 2ZDSA 2ZIDA 3H23A 4Q4PA 1SQ7A 5U7SA 3F4DA 2E1WA 3FDKA 3LLDA 2J79A 4DO4A 3W7IA 4D1JA 5IBXC 4ZOCA 3IJ9A 4DJEC 1FWAC 3EMCA 1WZKA 3UWVA 4H7CA 4JKMA 2RH9A 4YTSA 4LSBA 4Z1YA 3VVGA 2HWGA 3AIQA 5G5IA 4HPXA 1M01A 1SFTA 8CGTA 3VCNA 4WHBA 3H4WA 1GTEA 1LRNA 1VFTA 2CHOA 2I7GA 3R25A 1E40A 1XC4A 6REQB 3LX9A 1XINA 4CCEA 3W27A 3VOJA 1OF8A 4KCWA 4TTUA 1V6YA 5DO8A 4QAIA 5EMYA 2Q3OA 5I3GA 1ZALA 4ADUA 1QI5A 2C14A 3BQ6A 2OLAA 1KM5A 2P88A 1GCYA 1GOIA 1UJPA 3L0KA 1XLHA 3W1QA 1FOBA 4KPLA 3C2OA 3UZYA 1GT8A 4U3AA 3L2MA 5BMWA 2W92A 3UQNA 4N7QA 5F2GA 1RCOB 3NQMA 4F48A 4WJ8A 4Q4MA 5I3IA 3EX6A 3L4TA 4HCDA 2QJMA 2VKZG 4HPHA 1JCLA 3TIMA 4LUTA 1C90A 5ABEA 2HBXA 4OVXA 4O0ZA 1I45A 2C19A 4EOUA 4BF7A 2DSVA 4XZLX 3O7UA 2IQ0A 2VCAA 5FEZA 1ICSA 2BVTA 3PZVA 4JFWA 4X2RA 4JR5A 5D9PA 3TXVA 2Z4GA 4W5UA 1MRAA 4RW3A 3TA9A 1XYCA 3A23A 4K8GA 4RE4A 3TN3A 3I3EA 2QIIA 1G7VA 3VNKA 1H7PA 4A6GA 1EKOA 3SI9A 4BKNA 1NFPA 1UQYA 2O56A 1UC5A 3W2KA 3N15A 2INZA 2VI0A 4ZTYA 4FZIA 4O28A 4BI6A 1EGMA 4EAMA 2XH2A 1OC7A 1XKJA 2QHAA 1GZJA 1P0BA 3EBVA 4AB4A 3HPXA 3LCLA 5D30A 2QCFA 3FHQA 2DIKA 2Y7GA 3HGOA 3LRMA 2VDIA 1UP0A 4CKQA 2A21A 4IPIA 1XH0A 3THUA 2V81A 3D3FA 4B4FA 1B3YA 5I3HA 1V6UA 5CPNA 3MUIA 3SFKA 1VKFA 2CKSA 5C5YA 2VD8A 1P0DA 2XH4A 4IT1A 3P74A 2XVNA 2P0OA 1RCXB 2DSZA 4PODA 1QATA 1Y5XA 1H11A 3NZPA 2GDUA 1GQNA 4A35A 2NSOA 2YZRA 2EQDA