2PF0A

F258i mutant of exo-b-(1,3)-glucanase from candida albicans at 1.9 a
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
394
structure length
394
Chain Sequence
AWDYDNNVIRGVNLGGWFVLEPYMTPSLFEPFQNGNDQSGVPVDEYHWTQTLGKEAALRILQKHWSTWITEQDFKQISNLGLNFVRIPIGYWAFQLLDNDPYVQGQVQYLEKALGWARKNNIRVWIDLHGAPGSQNGFDNSGLRDSYNFQNGDNTQVTLNVLNTIFKKYGGNEYSDVVIGIELLNEPLGPVLNMDKLKQFFLDGYNSLRQTGSVTPVIIHDAFQVFGYWNNFLTVAEGQWNVVVDHHHYQVISGGELSRNINDHISVACNWGWDAKKESHWNVAGEWSAALTDCAKWLNGVNRGARYEGAYDNAPYIGSCQPLLDISQWSDEHKTDTRRYIEAQLDAFEYTGGWVFWSWKTENAPEWSFQTLTYNGLFPQPVTDRQFPNQCGFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Carbohydrate binding sites in Candida albicans exo-beta-1,3-glucanase and the role of the Phe-Phe 'clamp' at the active site entrance.
pubmed doi rcsb
source organism Candida albicans
molecule tags Hydrolase
molecule keywords Hypothetical protein XOG1
total genus 151
structure length 394
sequence length 394
ec nomenclature ec 3.2.1.58: Glucan 1,3-beta-glucosidase.
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2pf0A00
4CCCA 1BAGA 2CHNA 1O7AA 1VFFA 5A1AA 1UKOA 2JF7A 1GUVA 3ECQA 3VX0A 1B3XA 4HOWA 1KQZA 3E1F1 3CBWA 2WCGA 5CGTA 1VBRA 1B2YA 3GXIA 1VFOA 3ARZA 3VTRA 3M6DA 2W92A 1DWFM 1FP8A 2D0HA 4PUEA 1UD5A 1E6PA 3CZLA 2J4GA 4JL2A 2G3IA 1PPIA 4DWSC 3N17A 3BAJA 1E9LA 1FA2A 5E0FA 2XPKA 1HNYA 4H8HA 4TVDA 1HN1A 2J7HA 4M29A 3OZOA 1GQIA 1W9UA 1H1NA 1VEMA 3ZO9A 3N11A 3W0KA 4QLJA 3VGGA 1FOBA 5ABGA 2CESA 5DF0A 1ZS2A 4Z2HA 2WVTA 3GBDA 2WB5A 1K9EA 5AC5A 3FAWA 2ZX7A 4RE2A 1V02E 3I3EA 4A3HA 2JEPA 1W2PA 1UR1A 4W89A 4RE4A 1G9HA 2V3FA 5I3DA 5A6MA 4UQCA 2WVUA 2J78A 1DEDA 4OZOA 3ZSSA 1UZ4A 4WLCA 3GNRA 3POHA 4JL1A 4ACYA 1A47A 1V3JA 5A94A 1C93A 1QOXA 2XIIA 2YL5A 4AY1A 1C8QA 3WFZA 4P7LA 3WD1A 1TE1A 1BG9A 3RMEA 1YHTA 3HN3A 2WWDA 3GNOA 4GZJA 1JYWA 1UR0A 1B30A 1EDGA 2DPEA 3ALGA 3MUZ1 1C7SA 2NT0A 1UA7A 2ZUVA 3NSXA 3QOKA 4CU8A 2EPLX 1E4LA 4K68A 1FFRA 2WZIA 2VZOA 3TTYA 3WDHA 2ZE0A 4D6DA 4GINA 3WF2A 3LPGA 2BV9A 3T0AA 3PZGA 3LMYA 2WYSA 4IPNB 3MMDA 5A8NA 4KGJA 1US2A 1W3KA 4AD1A 2D0FA 2WHMA 3CUJA 4Z2GA 3L4WA 4U2YA 1VF8A 1B1YA 2CNCA 2YA0A 2XVNA 4UQAA 3A4XA 1CEOA 2J8FA 3AFBA 4MAZA 5E9AA 4HP5A 4ML4A 4PTXA 4X0NA 1E1FA 1C3FA 1NM9A 1AQMA 2ZX6A 3BSHA 5LYRA 1OT2A 5GPRA 5EFFA 3NUKA 1PZ3A 5A6SA 2B31A 2DDXA 1OB0A 2DT1A 1JZ2A 2WMFA 4MNJA 1J0IA 3AIWA 1FFQA 5A6AA 5A6BD 1CYGA 3TONA 2JALA 3VD7A 2D2OA 3SCUA 1W32A 3ZMRA 2VI0A 6CGTA 1KR0A 2HVMA 4HPGA 5CJ5A 4W8LA 1M04A 4FLRA 3WMCA 1C90A 3SCOA 2G3MA 3BCDA 1MW3A 1ISXA 1PAMA 2WC3A 1UWUA 3VDHA 5JBEA 4UZUA 1US3A 5CXPA 5HNNA 1JZ7A 5CG0A 2NW0A 1HX0A 2J7GA 4OOUA 2AAAA 3M46A 5GNXA 3AS3A 2ZWZA 3KE0A 1RP8A 2DGAA 2BVDA 4UR9A 3SUWA 2Y8KA 2EEXA 1HJSA 1JI2A 2OWXA 4LYQA 4J3WA 4GIAA 4CD7A 1CGWA 1QVBA 1GOKA 5I24A 1NWTA 2BHZA 5D8ZA 2WHKA 5ABEA 1JDAA 1OD0A 1E6SM 1ODZA 2PWGA 4N42A 3WIJA 1E56A 1MFVA 2HISA 4D6EA 1PX4A 5CSYA 3S6TA 3U5UA 5BYWA 4U2ZA 3AIEA 1AQ0A 4HMCA 1B90A 4FLQA 1AQHA 2YLAA 3ARWA 4A4AA 1CGXA 4DUWA 3WEMA 2J7DA 3OBAA 1QNQA 2XTKA 1MW2A 3N13A 3RJXA 1Q6CA 5A6BA 3FY1A 2Y24A 4JHOA 1KGXA 2TAAA 1UZ1A 4RE3A 3VKKA 1AVAA 1EIBA 1GOIA 1HIZA 1HP5A 3VD5A 1MXDA 2ZUSA 3JUGA 2V3GA 1E15A 2W61A 2WSPA 3ALFA 1M03A 3D5HA 4BCEA 5M3WA 1WZAA 5GQBA 1UKPA 3ZR5A 2Z1SA 1NARA 4AZBA 4H41A 1E3ZA 5ABFB 1I1WA 3WN6A 2ZUWA 8CGTA 1BYBA 4Q7NA 4QP0A 3WL0A 1V08A 2BHUA 3K46A 2CETA 4MPKA 4D71A 3F5LA 1ZJBA 1WCGA 4GPNA 1J0JA 1GHSA 3BLKA 3W6LA 3DECA 1UD2A 1H4PA 2BY1A 2VOTA 5A3HA 3VNYA 3AMLA 2XG9A 1TG7A 5TD4A 3BH4A 2VMFA 2CBJA 4FK9A 1W9BM 1W1VA 3ZIZA 1CXHA 2VT0A 1AMYA 1G01A 2VVNA 3TOPA 4YPJA 2G4FA 1YQ2A 1GW1A 2WVVA 2J25A 5KZ6A 2O9OA 3OLGA 6A3HA 4HZ7A 1QBAA 2YL9A 1CLVA 1GPFA 1XD1A 4D6HA 5I0DA 3U57A 4JFUA 4MJ4A 1E70M 3AHZA 5A8OA 1ZL1A 3GH7A 3AMKA 3ARRA 3RIKA 2CKRA 3ZJ8A 4H8UA 4AZGA 3O6AA 3DYOA 1ZU8A 4L4PA 2PB1A 3F5KA 4Z2JA 4RL3A 4IPLA 3VGBA 4LQ1A 3OLEA 4AZIA 2VX4A 3EDDA 3EBVA 4URIA 4PSPA 3DC0A 2JEQA 3L4VA 1WE5A 1UOKA 1UA3A 4GZIA 2PWDA 5BRPA 1LJYA 1L8NA 2E8YA 1C8YA 4FLSA 2WC7A 4JZ5A 2F61A 3IJ9A 2VURA 5CQ1A 1TFVA 3ARYA 4W84A 4LYRA 3ZJKA 1ZB5A 1NQ6A 1X6LA 1OD8A 4IUGA 1A3HA 4CU7A 4D6CA 2XSBA 1KQYA 2QPSA 2YL8A 2GSJA 1V3MA 3GBEA 4HA3A 2E4TA 1V6UA 4XV0A 2ZX5A 1JYVA 1CZ1A 3UG3A 1U2YA 3VU2A 2ESCA 1I1XA 5D9PA 3B9AA 2PWHA 4E8DA 4CCDA 1W2VA 2UWFA 3OLDA 1XCWA 4AEEA 4LPCA 5HPCA 1QW8A 2O92A 3QOMA 2YL6A 5CGMA 3WH6A 2VCCA 4CN1A 5A6KA 1UD4A 3L4YA 1GHRA 4H8VA 1VAHA 3GH5A 3MUIA 1JDDA 2G8ZA 2X05A 1XYFA 3AMGA 4WKFA 3B9EA 3CMGA 1KXTA 3ZJ7A 1BVNP 2ZWYA 4QFUA 1J0KA 1E0VA 3M07A 1DTUA 3APGA 4HOXA 4KRUA 4B3LA 4E4PA 1QI0A 3VM5A 3QR3A 3I3DA 3U7VA 1JZ6A 1BQCA 1UUQA 3A3HA 3CZKA 3WBAA 5FL1A 2XWEA 1V0LA 3VPLA 4JKKA 1UR2A 3EMQA 2XM2A 2ZXDA 4TVCA 2DIJA 3PZVA 3T2OA 1V3IA 2ZICA 1JI1A 1JF6A 2XUCA 3NCOA 5A8PA 1EQCA 3W28A 2IUZA 1KCLA 1NWRA 4D6JA 2XGBA 3BMVA 3VIJA 4NSBA 1XSIA 4M80A 5HBFA 4PMXA 3WQ6A 1V3LA 1EHAA 3ZQ9A 4IM4A 1KBKA 1WDRA 3OGRA 4HZ8A 1XCXA 4AD2A 2UY4A 2ZX9A 4W86A 3AS0A 4AXNA 4F9JA 3AHYA 3CHEA 1G0CA 4W7UA 4KWUA 2UY3A 5BXPA 4ZENA 2DEPA 1PIFA 4MTVA 3WNLA 1GJWA 5JBFA 1E6NA 4HOZA 3MSDA 4OUEA 4XB3A 5FOOA 4MNKA 2CXGA 3W27A 4PMUA 4MJ2A 3AYRA 1JD9A 1S46A 1ZJAA 3VMPA 1QPKA 2BY2A 2WANA 3SCTA 1E6QM 3L4XA 4CKQA 4GQRA 4ZEPA 2RGMA 3RM4A 2VX5A 3MS8A 1LWHA 2O9RA 2BVTA 4V27A 1UD3A 1JZ3A 2BY3A 4F8XA 4NRRA 2J75A 2FGLA 2OSYA 4TTUA 1HP4A 3CO4A 2XSAA 3AZTA 4WKAA 4AIOA 3AZSA 1BGAA 1JXKA 3BC9A 1R7AA 2VX6A 2QPUA 1WB0A 2E40A 3WKZA 3WH7A 4B9ZA 4N0RA 3VGFA 1H49A 1XHGA 4UQBA 1KCKA 1DWJM 1E43A 1UH3A 5A69A 3A6OA 3ARXA 3W53A 4ATWA 4L4OA 5M03A 5IHSA 3PTQA 4GI6A 3AS1A 4UZSA 2FH8A 5GNZA 4AIUA 1LG1A 2D3LA 2ZUMA 3ARPA 1OCQA 3WEOA 5LA0A 4M56A 2XVLA 4UFHA 1OWQA 3POCA 2E9MA 2PBGA 1HF6A 3F5JA 1R8LA 1NP0A 4BQ5A 4CVUA 3W26A 2BXZA 2MANA 5IDIA 3UG4A 3PZNA 1UWQA 2IXVA 2A3HA 4LYPA 3ZM8A 1JG9A 2VQTA 1UD6A 4M24A 4AD5A 2JF6A 1E6XM 2ZX8A 2YIHA 3HMCA 2VRJA 4A3YA 5I2UA 3A47A 5C71A 2GK1B 2GJPA 1JYXA 3WNOA 3W4RA 4CD5A 1GNXA 5A6JA 2A3EA 1HT6A 1V3HA 3AMDA 4PMYA 2Y2WA 3VX1A 3QHMA 1JL8A 4R27A 1VIWA 4MDOA 4W7VA 3WUEA 5DO8A 3T2PA 4JCMA 4F66A 2QMKA 5CPQA 2J7BA 3L2LA 5JIPA 2DT2A 4DUVA 3WH8A 5A2BA 4PSRA 4W93A 3VM7A 2VJXA 2D20A 5DMYA 3IAPA 2W63A 2FDMA 1QNSA 1Q6DA 3N04A 2J79A 5FKYA 1GQJA 3GXFA 3WNKA 4JKLA 3ZT5A 3OZPA 2XFFA 1ZBKA 3EMCA 4ACZB 4CCEA 2WWCA 1OT1A 4NZCA 2CHOA 1RPKA 1HJVA 1FHDA 3CGTA 3AIVA 5D9NA 1J01A 3CZGA 2ZXBA 4MAVA 4JHZA 1C8XA 3L2MA 4WJXA 4AD0A 2V5DA 1NOUA 1OINA 3EMZA 3GXMA 1E55A 1CBGA 2GDUA 1E5NA 2CBIA 3NYDA 3WD3A 2VNCA 5BXTA 1LL4A 3BXWA 1W1PA 1KGWA 3W37A 3MUY1 1GOQA 2JFEX 3SCNA 3VINA 3THCA 1TVNA 3N15A 1B3WA 1VFMA 3MV01 1R7OA 4C7FA 2C0HA 4MNLA 2WBKA 1CGYA 1LG2A 1JGIA 2V3DA 1DWIM 1JXJA 1CLXA 2J62A 4PMOA 2VCAA 4J3TA 3WF1A 1JIBA 2DQXA 1WP6A 1NOWA 3IJ7A 1IV8A 2WHJA 1FH9A 3RO8A 3AQUA 2OWWA 1K9DA 1HL8A 4UOJA 4PTWA 1W9DM 4P7QA 3ZJ6A 4W8BA 1CGVA 3MMUA 1KXHA 1PX8A 4AYSA 1BSIA 3EYPA 4Q22A 3W6MA 5AC4A 1VJZA 3WH5A 3WMBA 3WENA 7A3HA 1FP9A 2QF8A 4GO8A 1FH8A 3PHAA 1MQRA 1UKSA 2G41A 3SIMA 2XHYA 1G1YA 2CBUA 2UY5A 1HJXA 4PMQA 5DEZA 2QMJA 3EDJA 3SCVA 3PZTA 8A3HA 1V6XA 1D3CA 3TP4A 3WD4A 4D6FA 4NRSA 3PZ9A 3OLIA 4GKLA 1UG6A 1H11A 1XYZA 1QNPA 4D1IA 1H0IA 3LPOA 4W85A 4X9YA 2OWCA 2CIPA 3BGAA 2BS9A 3AZRA 4HTYA 1OIMA 1H5VA 4BF7A 3KL3A 1K9FA 4H2CA 4JIEA 2YDRA 1EOKA 1BHGA 4V2XA 4TOQA 4ZE5A 3SCRA 4AD4A 4J3SA 4PMZA 3NSMA 5D9OA 4MB1A 5EMYA 2WPGA 3WDIA 4MB3A 3WDQA 1C7TA 3WUFA 5BRQA 2DSUA 3BAWA 4P8XA 4XUYA 5E6YA 4LX4A 4P8WA 3SEPA 4UCFA 4CD8A 3VIIA 3KWXA 2XIBA 1W9XA 1K6AA 4C7GA 1TZ7A 4PCSA 1VB9A 1LL6A 2YA1A 4OBRA 2J47A 2AMGA 3VDCA 4H7VA 5I78A 3N12A 4XZBA 4BS0A 2VVSA 2EO7A 5JIWA 4P8UA 2WNWA 3FAXA 1W1YA 2BY0A 2A3CA 2DSVA 4AWEA 3T08A 5EFDA 3AJ7A 3B9DA 3A4WA 3L4TA 3VDAA 5IXEA 3WQVA 1E6RA 2WSKA 1G5AA 4FMVA 3UESA 3K8MA 1E1EA 4U3AA 1SR0A 1W9PA 4U31A 2VL4A 4KGLA 5E70A 3MV11 3KL0A 2WW5A 3EDEA 1TMQA 3I3BA 1W3HA 1PBGA 5EBAA 1V02A 2EPOA 1V3KA 4WF7A 1NP2A 2ZXQA 1VENA 3WDJA 1QI4A 2FHCA 4KMQA 3W25A 1UQYA 2QLYA 1V6WA 1D7FA 1E73M 2D0GA 3FW6A 5A6LA 1TUXA 1CXLA 4GZEA 3RDKA 4HMDA 4PRWA 1JYNA 1FHLA 1HKJA 1JF5A 3QHOA 2X09A 2PI6A 4J28A 3MUAA 5DT5A 4PMRA 5BXSA 3KL5A 1JNEA 1E0XA 4S3JA 5CLWA 4WKHA 3OIHA 1E4NA 1UHVA 1LL7A 5DT7A 2GK1A 1BYAA 4P8VA 3PTMA 1NH6A 1TA3B 3S2CA 1BPLB 1R87A 5D9MA 3AMCA 5A2CA 4E8CA 1HJUA 1EQPA 2O9PA 3RCNA 3VVGA 5FD0A 3WD0A 4TUFA 1TVPA 3GTNA 2VZSA 4EE9A 1P6WA 6TAAA 4OKDA 1QI5A 1N82A 3ARQA 4UOQA 2CBVA 1U30A 3TTOA 4CUCA 3VIFA 5CLTA 4YHGA 1B31A 3FHAA 1M7XA 5ABHA 3AI0A 1GQKA 1H41A 2G3NA 2DH2A 2X0YA 3L4UA 3A4AA 2D1ZA 1ISVA 3G6LA 2G3JA 1ODUA 4GXPA 3ARTA 4P7NA 5AY7A 3IAQA 4YHEA 4CD6A 4S3KA 2FHBA 3SCQA 3CUHA 4TXEA 3CLWA 1ZBWA 5A2AA 4WSJA 1LWJA 2DSWA 4FLOA 3ZOAA 1RP9A 4WSKA 4D6GA 4JFWA 3GYCA 1JAEA 3OGSA 4CGTA 1HKIA 1JAKA 2Y4SA 4KH2A 4ATDA 1WDSA 3AHVA 2CCRA 3PZOA 2W67A 2DSKA 1DWHM 3K4DA 3LPFA 1ITXA 4FF5A 1OGGA 2W91A 4UOZA 2BVYA 1CXFA 1KFWA 5E09A 1ZBVA 4M81A 4H04A 1XH0A 2OLHA 4X0VA 1J11A 3O2LA 1H3GA 3J7HA 1JZ8A 2Z1KA 2VRQA 1CGTA 3K1DA 3CTTA 2VQUA 4AC1X 1WZMA 3O9NA 1Q6GA 1MVYA 1QBBA 2XYLA 3VOCA 2WVSA 4UFIA 3VIHA 1DHKA 4BZYA 1CWYA 3IJ8A 3PN8A 3BAXA 3OGVA 4UFLA 1UH2A 3L4ZA 4D1JA 3QHNA 1WZLA 1GVYA 1UWSA 1XD0A 3BMWA 3VGEA 4W5ZA 5ABFA 4PN2A 3WBEA 1VRXA 1E4IA 2BHYA 3ZT6A 5BWFA 3SUUA 4ZXOA 4DUXA 4ZFMA 4GI8A 2EBNA 1ITCA 1BFNA 1QI3A 1XRVA 2J7EA 2CERA 2XVPA 2X0HA 3WUGA 2YBUA 4XZWA 2D3NA 2VRKA 4U5IA 1ECEA 5D4YA 2ZUTA 1TCMA 3T0BA 2EPNA 1CIUA 5LA2A 1ZBCA 1DWAM 1CDGA 3SUSA 4GI9A 2E9LA 2F8QA 4J7RA 4MB5A 4CD4A 1IT0A 3SCSA 1UR8A 1GVIA 4EANA 1KBBA 3AHTA 3SURA 3WNPA 4Z2IA 1JNDA 1PJ9A 1OIFA 5I79A 3CUFA 2XVGA 2WZHA 3VGHA 3WQ4A 3RPMA 4QAWA 3NIYA 1PEZA 7CGTA 3CHCA 3W82A 1BYCA 3PZMA 2V38A 4PCTA 4AIEA 1M01A 2ZXAA 4OBSA 1K9TA 3THDA 3CZ8A 1FH7A 4KRTA 5KEZA 3CUIA 3M7SA 3VIMA 1MQPA 5FIPA 2XM1A 2D24A 1MFUA 3BSGA 1H2JA 4HZ6A 1L0PA 4PTMA 2XJ7A 5IFPA 1EH9A 3DYPA 3NDZA 3WL1A 1QNOA 5AYBA 2YA2A 3K8KA 1KXVA 1X6NA 1NWUA 4AZ7A 4DWSD 1BGGA 1KWGA 1OM0A 3ARUA 3WQ8A 1QNRA 4J3XA 4R5EA 3NDYA 1BF2A 4WK9A 3B8SA 2X2YA 3UR7A 2DT3A 5M17A 3BAYA 2C7FA 3OB8A 4Y7EA 4AZ5A 1HKMA 2VUYA 1G94A 2WMJA 1UR9A 2OSXA 3CMJA 2XFYA 1WDQA 5DFAA 1XSJA 4AZCB 1WKYA 3CPUA 4W7WA 7TAAA 5HOSA 3VD9A 4W8AA 5AYIA 1BYDA 2GJRA 2IXUA 3NSNA 1BG4A 2Q8XA 1SFSA 1GOOA 1SMAA 4TTGA 2C8NA 1J10A 4M82A 3WF0A 3KEHA 2J7CA 1KWKA 2F2HA 1HVQA 2PBOA 1SMDA 3UERA 4P7RA 1JFHA 3TA9A 5CPTA 1E6ZA 2QHAA 1UWRA 3VUPA 3CUGA 1MWOA 1W3LA 1B3YA 1C92A 1GORA 1UKTA 1Q6FA 1O6IA 4BQ4A 3SCWA 1QHOA 3VD3A 2A3AA 3CZJA 2E3ZA 4XX6A 1VEPA 1J9YA 1EHNA 1VEOA 3PTKA 2VZTA 3AXXA 2VTFA 3UR8A 5I23A 4ZE4A 3WH9A 1M53A 3RM9A 3FHQA 2W66A 5M5DA 3PBGA 1UWTA 1KR1A 1UWIA 1UQZA 4U33A 3GNPA 4W5UA 1OBAA 2J74A 2BNJA 2WBGA 2DH3A 1RH9A 4QCEA 2VZUA 3FN9A 2ZUUA 4HPHA 1WO2A 5I77A 4MNMA 1F4AA 2AOSA 4J3VA 3K4AA 4B9YA 3AS2A 3VD4A 3MMWA 3PZIA 1JDCA 2JIEA 3AYSA 3IANA 3WQ5A 2J8GA 3GH4A 2BFGA 1MQQA 2A3BA 1D2KA 2VC9A 2WMIA 1XC6A 3T09A 4B15A 2GFTA 3UEQA 3AISA 4CN6A 4JFSA 4QDMA 4Z2LA 5I5RA 4TX6A 4UQEA 3HU7A 1GZJA 2E9BA 2WKLA 3N9KA 1GJUA 5LA1A 2DIEA 2WLZA 1VFUA 3UCQA 3WDPP 1UD8A 2PF0A 2J7FA 1VJSA 3OA5A 1BVZA 1U33A 2O9TA 2EQDA 3KZSA 5A8QA 4MB4A 1LF1A 1Q4NX 4JAWA 4QLKA 2PC8A 3GZAA 3CIVA 1W91A 4EAMA 4DM1A 1PX3A 1E3XA 3WD2A 2WVVB 4OOZA 4M1RA 1R85A 1Q6EA 2VR5A 1E72M 3ZT7A 1CXIA 1UH4A 1UYQA 4MDPA 2EPKX 2Y5EA 2ZOXA 1WZKA 3AOFA 1J12A 3AIBA 1SYTA 1MW0A 1V03A 1CECA 1TA3A 2XGIA 3AIRA 4PMNA 3BAIA 3BCFA 4W88A 3II1A 3ARSA 4YN5A 1CNVA 2GJXA 2X1IA 2OYKA 2OYLA 2CITA 2GVYA 3IK2A 3VIGA 1EDQA 1JZ5A 2W62A 3ARVA 3WF3A 2YDQA 4DWSB 5E0CA 1HL9A 2QV4A 1I75A 1CENA 2YLLA 3WSUA 1EA9C 4B3KA 4GO9A 2W5FA 3MKKA 2CPUA 5CZKA 3WELA 3WNMA 1TR1A 4C7DA 3W24A 2CKSA 3SUVA 4OIFA 2GUYA 3VDBA 3T2QA 4D72A 1W9VA 4PMVA 3GXDA 3BAKA 2BXYA 2JE8A 1CPUA 1MW1A 2E8ZA 3AHXA 1QHZA 1ISYA 1H0GA 3AICA 2NT1A 1XH2A 1W1TA 2YBTA 1Z32X 3OG2A 3CHFA 1GOWA 2V5CA 1DP0A 1WAWA 3MO4A 3AIUA 3WUBA 2YOCA 3RJYA 5IFTA 4CU6A 4CN4A 1JD7A 4AW7A 4JKMA 2YJQA 2EPMX 4AZCA 3MANA 2DT0A 4Z2KA 1GONA 1ESWA 2RGLA 1EO7A 1C91A 1J0ZA 3U5YA 4LGXA 3N1AA 1ISWA 2WLYA 5C70A 4IISA 4PBGA 2FGZA 4U5KA 4UFKA 1LLOA 2WKGA 1E71M 1HJQA 1BLIA 3BLPX 3DHPA 3MU7A 4OJYA 1V0NA 3W29A 1HXJA 1OGBA 4D6IA 2JIWA 2CEQA 3EDKA 1QHPA 4GQQA 3GDBA 4QLLA 2WC4A 3N18A 5GNYA 4ATLA 1E0WA 1RD6A 3U7BA 1EGZA 1QW9A 3AXIA 1HJWA 3F4VA 4AISA 1J0HA 4B16A 1IZKA 1HKKA 5C8BB 1R86A 3DYMA 1OSEA 4JFTA 1XH1A 1EXPA 2FHFA 3CH9A 2Y8VA 2WCAA 1B3ZA 1J0YA 3DHUA 3RILA 3T0DA 4AEFA 3WDRA 5HXMA 2EXOA 1W3JA 5BCAA 3VIKA 3VMNA 3TTQA 1E40A 4MADA 5F7UA 4PTVA 1E4MM 4PUDA 1QI2A 5D8WA 3SUTA 1UR4A 1V6YA 3VO0A 1J18A 4NI3A 1X1NA 3W81A 5JUVA 1IZJA 4P7OA 3PZUA 3AIQA 3VIPA 1JFXA 1HVXA 1B3VA 3FXYA 1NWSA 4PYSA 1CTNA 1KXQA 2VX7A 3K8LA 5A8MA 4HA1A 3HJEA 1F4HA 3VIOA 3VNZA 3RM8A 1JZ4A 2VO5A 4U3CA 2VR4A 1E5JA 1EOMA 1GOMA 4TX8A 2WMHA 4AZ6A 5HDRA 3EDFA 5FL0A 4ZXLA 3WEZA 4UTFA 5IHRA 2YDSA 3D3AA 4EK7A 4UFMA 5CSUA 1GQLA 5A95A 1WNOA 1KB3A 2D23A 4J3UA 2WK2A 3WMSA 2GDVA 1VBUA 1H09A 4HU8A 1V0MA 4AMCA 5BXRA 4BQ3A 3PZQA 5EB8A 1NOFA 1CGUA 3QGVA 4HU0A 1PIGA 1OGSA 4PMDA 4PEEA 1CXEA 3AROA 1MXGA 2E0PA 5JBDA 3MSGA 2ZUNA 1B0IA 2WZEA 2WCSA 2WMKA 2EJ1A 1MYRA 3WF4A 3ZR6A 1BTCA 2WXDM 4DWSA 1Y7VA 3WFLA 1UKQA 4DM2A 3G6MA 4F9DA 5BROA 2J77A 4F79A 4UFJA 2CYGA 2DSZA 2ZIDA 5FCZA 2XFRA 3GM8A 2W4XA 1ISZA 2XVKA 2OSWA 1V0KA 3VMOA 3LPPA 1GCYA 5HPOA 3CZEA 3TTSA 9CGTA 4JFVA 3SCPA 4UQ9A 1CXKA 3UETA 4JCLA 4LXFA 2XWDA 4HMEA 1XV8A 1WDPA 3NJ3A 2NSXA 3WY1A 2YKKA 2FH6A 4UNIA 4WIWA 3FNDA 1KGUA 2V3EA 1V6VA 1WPCA 2VCBA 4TVUA 2WMIB 3WNNA 2X8RA 4W87A 2WMGA 4E2OA 1XGZA 3VGDA 4AD3A 1LQ0A 1PZ2A 1EO5A 3UG5A 3W38A 3CHDA 1B9ZA 3ZSTA 2D22A 2PWFA 3AXHA 4QCFA 4V28A 4ACZA 4CVWA 4EKJA 1EDTA 4BQ2A 2GJXB 4UQDA 4AZHA 4NF7A 4HA4A 2PWEA 2WM0A 2VZVA 2UY2A 5ECUA 3WQWA 5CPSA 1DWGM 2WAGA 4J27A 5I6SA 5E6ZA 3VILA 2WHLA 4M8UA 2OYMA 1XSKA 4BA0A
chains in the Genus database with same CATH superfamily
4CCCA 3FEQA 1BAGA 4QQ3A 1O7AA 4UXDA 2QUMA 3ECQA 3VX0A 4LJ3A 2C18A 1VBRA 1AH4A 1VFOA 3GU2A 3M6DA 1BKHA 1DWFM 3C0LA 1Q2RA 3A21A 4UWMA 4WD0A 2DZTA 4DI8A 5HR7A 2BXVA 3M5YA 3ZVHB 3N17A 1FA2A 1OC6A 1PKNA 3NTYA 4I7VA 5E0FA 2XPKA 3MP3A 3EKGA 5ECVA 4TVDA 4LUTB 4BI7A 1VEMA 2YX0A 4HNVA 3RN6A 3W0KA 3VGGA 3GX9A 1FOBA 3DAQA 4DNHA 3EGJA 1ZS2A 3MBFA 4H4IA 2WVTA 5AC5A 2X1UA 3EEGA 1QOQA 3EB3A 1VLWA 3QF0A 1MUWA 4HNCA 5K2ZA 4O0KA 2BGSA 1AW1A 4RE4A 1HZYA 2QIIA 3ICJA 4OZOA 4WLCA 2MNRA 2ZRUA 3GNRA 3NAVA 4KEVA 2VEMA 2HDJA 1XLIA 3POHA 2FJUB 3QTPA 1A47A 5A94A 2GQ3A 2XIIA 2YL5A 1GYMA 3W7QA 4U10A 3WD1A 4LVGA 1AODA 4XAYA 1JRCA 4OUIA 2OKOA 4L65A 2YR1A 3W83A 1YHTA 3NURA 3S2MA 1Q8AA 1JYWA 3UT0A 3IUIA 3NQAA 3S3GA 4NQ1A 1W0MA 1EDGA 2DPEA 2HWGA 4H1ZA 2PF8A 1C7SA 2NT0A 2QEZA 1EBHA 2GGIA 3NSXA 4MM1A 4CU8A 2EPLX 4MYAA 1FWJC 1XDJA 2WZIA 2VZOA 3WDHA 2ZE0A 3KXQA 3JU2A 4GINA 3DBPA 3T0AA 5HQMA 5A8GA 4IPNB 4A6GA 2FQIA 3IEBA 4KGJA 2I7GA 1QWKA 2D0FA 3R13A 3SRHA 3CUJA 4Z2GA 5T9CE 1TV2A 3HF3A 4UQAA 3SN4A 3A4XA 4O1FA 1FDYA 4LC8A 1CCWB 1NM9A 3FSUA 2V2CA 5LYRA 4LUIA 1K7XA 2AKMA 4I7WA 2NWRA 4CNPA 1OB0A 1LYXA 5H1WA 2D2GA 3STFA 3MO7A 4GQ0A 4MNJA 1QMLA 3PF3A 1J0IA 2R94A 3GE7A 1LUCA 3TONA 4L6DA 2D2OA 3SCUA 3SADA 5LZLA 3GG1A 6CGTA 1VFLA 5CJ5A 2J13A 4O14A 1M04A 3LN3A 2OOGA 3A5VA 1U22A 2C19A 4FLRA 3UCCA 1R3WA 2DJLA 2G3MA 1JDEA 2HTMA 2GOUA 2C16A 3QFEA 5HNNA 1JZ7A 5KMYA 2QPXA 5HMSA 2VEPA 3THAA 3M46A 3AS3A 2QCHA 4PE8A 1FY6A 2DGAA 2OWXA 4DJED 3ZZ1A 4LYQA 4Q4MA 4I5UA 4J3WA 3QV9A 4GIAA 4CD7A 1QVBA 4Z0SA 3L7RA 2A4AA 5HR6A 5D8ZA 1JDAA 1ODZA 3WIJA 4D6EA 3CYVA 3MZ2A 2OOFA 1XR2A 4BR1A 5I3GA 4U2ZA 1AQ0A 4AB4A 2YLAA 4HK6A 4QRNA 4DELA 2E68A 2EKGA 2J7DA 1QNQA 2XTKA 1MW2A 4BEUA 3C8FA 3QKEA 2Y24A 1KGXA 1UZ1A 2R1MA 4IF2A 1GOIA 3TN3A 5IOBA 2VYOA 4YCOA 5BMXA 1ME8A 2YXGA 4E2DA 3VD5A 3VOGA 3KWSA 2FZDA 3TOYA 2V3GA 1R3TA 1RJQA 1E15A 1W3IA 1X8CA 3D5HA 2TRSA 4Q6JA 1R2RA 4MPQA 1WZAA 2ZUWA 1BYBA 4QP0A 3W2UA 3S0CA 3QSRA 2BHUA 4MPKA 1T0OA 3F5LA 4GPNA 3BLKA 3W6LA 1RJPA 1H4PA 4WJEA 2PWVA 3I4KA 2PLJA 1ZQ5A 3MCMA 4E38A 4QDWA 5TD4A 2YZ5A 4LAMA 2PCEA 2VMFA 4C6MA 4FK9A 4EVZA 4AEOA 4KIEA 1V79A 5CZ0A 1JEZA 5I7GA 3EKZA 2VVNA 1GG1A 1EJXC 1B57A 1YQ2A 3NPVA 2DUAA 2J25A 5I02A 2HROA 2E1WA 2YL9A 5LNSA 1GYLA 4MLJA 1E1CB 4QXIA 4MFEA 3CWOX 3AHZA 3ARRA 3OG3A 3MVIA 3W6YA 1IQ8A 3B03A 4L7ZA 4L4PA 2PB1A 3F5KA 3HG2A 1HKVA 4LQ1A 2VX4A 4NJGA 1R9ZA 3L68A 4URIA 1UZHA 3SJ3A 4UTTC 3BW4A 4A3UA 3UBPC 2QCNA 1UA3A 4Q3MA 1J79A 3OODA 2Y0FA 4NXKA 3CAWA 2F61A 5D2TA 3W7GA 4PCFA 3SW6A 2W0UA 3VKJA 2FVKA 2VURA 2B81A 4IICA 1X6LA 1XCFA 2XH4A 2TPSA 2XSBA 3R43A 3GBEA 4HA3A 1JYVA 1CZ1A 1I1XA 5D9PA 2PWHA 2CZ5A 3WBXA 3DERA 1GTEA 3LX9A 4WEVX 4AEEA 4LPCA 1QW8A 3NFUA 4PUWA 3ZLFA 3QOMA 4GBUA 3MYPA 3N9RA 1TV7A 4G56A 1PV8A 4M3PA 3MUIA 1JDDA 5D2WA 1XYFA 4DN1A 3B9EA 1ZNNA 1DQXA 1ZLPA 1SO5A 5G2WA 3M07A 3DGBA 2QQ6A 3APGA 5HNUA 4HOXA 4E4PA 3VM5A 3QR3A 3QGAC 2R1LA 4M7SA 3U7VA 4GY1A 3CZKA 3WBAA 3BLIA 2Z28A 4G7EA 1UR2A 1K1DA 4QNWA 4IFKA 2X42A 2GPTA 1YIXA 1V3IA 1UPPA 5FACA 1JI1A 5LGXA 1R38A 2XUCA 3U0HA 3W7KA 3HGRA 2B0MA 1WUEA 5C9RA 3QQWA 3T1GA 1KCLA 1NWRA 3F1QA 4QE1A 3BMVA 1F2JA 4NHVA 1E0TA 3L5LA 3CV1A 4HHPA 4NSBA 3HPSA 1XSIA 3NGFA 4M80A 1FXQA 5HBFA 1EHAA 3ZQ9A 4N4PA 3CB3A 3UWQA 5CBIA 4HZ8A 4AD2A 3IV3A 1P0DA 3THQA 3AHYA 2C6QA 4ZQRA 3TJXA 2VGFA 3OZYA 5H6HA 1VFTA 4KWUA 2DZXA 5BXPA 4MTVA 5REQB 4HOZA 1EPXA 3MSDA 4OUEA 3TXZA 4C1NB 4XB3A 3W00A 5FOOA 2ISSA 3NR0A 5CCZA 2CXGA 1RPXA 2BDQA 4MWAA 3HOJA 1FWBC 3T6CA 3VMPA 4ZQNA 3CMFA 1QPKA 1SZGA 2BG5A 3ENLA 4O10A 3LYEA 4NAFA 4C6FA 4LC6A 3MC5A 4ORMA 4XWUA 3P2VA 4BEQA 4GQRA 5AYZA 3TN5A 2VX5A 7ODCA 1FCUA 3U2OA 2BVTA 4V27A 5EU9A 1UD3A 3WLSA 2BY3A 4OV9A 4NRRA 2OSYA 3NQVA 1KKOA 4TTUA 4RCXA 2XSAA 1QRQA 4GXWA 1L6GA 3AZSA 4F0RA 1BGAA 2HCVA 1G4SA 1R7AA 2VX6A 5G1TA 1FWRA 2W79A 4XK2A 1EC7A 4CQBA 3VGFA 5CSRA 1KCKA 5LHEA 3O0KA 1UH3A 1A5MC 3CAVA 5EA9A 1PWLA 2Y6ZA 3CV2A 4L4OA 3RLUA 1F61A 5IHSA 2FZBA 2Z26A 5GVJA 3V7PA 1R9XA 1LZOA 3AXKA 2D3LA 3UZYA 4LAZA 1I2PA 2Q6ZA 2RHGA 4UFHA 5EMJA 2FZ8A 8XIAA 1OWQA 1Z9AA 2E9MA 1EGVA 1MNSA 1R0MA 1HF6A 4J2MA 3BURA 2PP3A 3EKLA 2BXZA 1PZ1A 3VA8A 4FR1A 1JG9A 4GNKB 1EP2A 2GVJA 1M68A 1UD6A 2ZCGA 3TCSA 2ZX8A 3QGKC 3W7NA 3B0VC 2YIHA 3HMCA 2VRJA 4LNCA 4J1OA 2YCIX 3SB0A 1ONWA 5C71A 3LG3A 4BI6A 3WQDA 2A3EA 1V3HA 2ZA3A 3MSYA 3QMRA 2WV8A 2Y2WA 3VX1A 3QHMA 1JL8A 4R27A 1QATA 1S38A 4IMAA 4AY8A 5DO8A 2VGIA 3T2PA 4JCMA 3L2LA 1GTHA 1EB3A 3NA8A 3GLCA 3T07A 3MUXA 4PSRA 3AXMA 1JPKA 4L5ZA 4CNUA 2D20A 5F2GA 4O53A 4WX2A 3G24A 4K39A 2GDQA 3DGRA 2FDMA 1H1ZA 3REQA 1LLWA 1I2RA 1IEIA 4DLFA 2XFFA 4QX4A 4NZCA 2CHOA 4IP5A 3AIVA 3NOYA 5D38A 2ZA1A 2YDAA 4AU0A 3M1ZA 3L2MA 2V5DA 1IWBA 3EMZA 1O95A 1CBGA 2OZ0A 5C2XA 1CT5A 1G6CA 3WD3A 3NYDA 3S5YA 2VNCA 1LL4A 3QZEA 2UV8G 3Q67A 3MUY1 4QEEA 2C91A 4Q8OA 3NEVA 3THCA 4IPPA 1J93A 4ENLA 1B3WA 4DI9A 4C7FA 1VBHA 1CGYA 2YZRA 2I56A 3V3WA 2P0OA 2WQPA 1PCWA 1DWIM 3W84A 4PMOA 2VCAA 4WSHA 5I03A 1WP6A 4HYVA 5CZSA 3H2OA 4G1NA 2C3ZA 1KFLA 4Z17A 1HL8A 4GMEA 2GOKA 2Z6IA 4P7QA 3ZJ6A 4H9MA 1EP3A 3IK4A 4W8BA 1PX8A 2Y1HA 4Y9PA 3W6MA 1BD0A 1FH8A 3PHAA 4US5A 1IEXA 2YSWA 4Q6XA 1DHPA 1ICQA 1KM1A 4KKXA 1HJXA 5DEZA 3USBA 2QMJA 3WK2A 1TMLA 8A3HA 2NV1A 3TP4A 2NVDA 4D6FA 4NRSA 1D7KA 3OLIA 3Q37A 1UG6A 4CNTA 3R0UA 4Q4PA 1QNPA 4MSSA 1R3SA 3TA6A 1YEYA 4K1WA 4H7CA 4GIYA 1KW1A 1LUCB 2BS9A 3NM3A 2EJAA 5EMUA 1OIMA 1QXLA 1T41A 4BK9A 1Q63A 2D69A 1H5VA 4K3ZA 1V4YA 2YDRA 1EOKA 3CH0A 4IP7A 2R9RA 1SO6A 1XWYA 4AD4A 2NVCA 1IT8A 4XO7A 1YDVA 1WQ5A 4MB3A 2L5HA 1NF7A 4N4QA 2KZHA 3LGGA 4LX4A 5C54A 4DYEA 4UCFA 1TREA 3KWXA 3VIIA 4TIMA 1W9XA 4LNYA 1K6AA 4C7GA 4PCSA 4K6AA 2YA1A 2P76A 2AMGA 3VDCA 4H7VA 3N12A 1S2VA 4H19A 3BJTA 1M9HA 3LTPA 4ZOAA 1AUSL 3PUEA 3AAMA 3VFLA 3VNJA 1RJRA 1W5QA 2Z25A 2DSVA 2BGNE 3OZMA 4XKYB 1MEHA 1IZCA 2YCJA 3P81A 3E2RA 1YLVA 1XIEA 3WQEA 1W56A 3WQVA 4FXFA 2VR2A 5H8UA 5KINA 4U3AA 1XC4A 3EOOA 1SR0A 1XIFA 3WJWA 1U5VA 4GVFA 1IR1A 3BOFA 4KGLA 3LU2A 4XIMA 1R5YA 1FHUA 3TLQA 3I3BA 1W3HA 4F3HA 5EBAA 1VGAA 2QGHA 4WF7A 1NP2A 3T81A 1QI4A 2FHCA 4RNHA 1NU5A 1D7FA 2D0GA 1F3XA 3FW6A 1A5AA 3VXGA 5A6LA 2ON3A 4GZEA 4AQLA 4FI4A 4F0SA 1TPWA 1FHLA 1QWGA 2TMDA 4GRSA 4O52A 2HXTA 5BZAA 1Z44A 4J28A 2PUZA 3MUAA 4X63A 1Z42A 3KL5A 3KTCA 4NZ3A 1J96A 3N6JA 2YB1A 4WKHA 3OIHA 4DBWA 3TZFA 3LK6A 3KOFA 4HN4A 3VE9A 1OYBA 3BTNA 2AL2A 3DDMA 3EA2A 4NNAA 3NL2A 4S3BA 5FSDC 3UJEA 1NH6A 3GHTA 2DZWA 2BTMA 1CLKA 1TYGA 4CQDA 5A2CA 4E8CA 1GEHA 1HJUA 2ALDA 3SR7A 1O66A 1LCOA 1WDWA 4QE5A 1KTBA 1GZGA 3H2AA 3CQJA 4TV6A 1P6WA 6TAAA 4OKDA 3DH7A 1QI5A 3FKKA 2PE4A 2QCEA 5CPNA 3TTOA 1A5LC 1RBLA 2XINA 4NILA 3TIMA 5CLTA 1V51A 1M7XA 1GQKA 2G3NA 1AQFA 3WBYA 3L4UA 3A4AA 3DENA 1A4LA 2PMQA 2XGZA 3G6LA 1AK5A 4IL2A 5A2AA 3EA3A 2QJHA 1Q7MA 5DCBA 2OT0A 3N34A 3PC0A 6XIAA 1Y5VA 1D9EA 4JFWA 3W7PA 1JAKA 2Y4SA 4KH2A 3WJYA 2O4MA 2WJZA 3KW3A 1ITXA 1XBVA 3LD5A 4UOZA 3TN6A 3RHGA 3TQ0A 3NQ7A 4I8DA 1W37A 1FCQA 4RV8A 2ACSA 3S47A 1MVYA 1QBBA 3B8DA 3KOWA 4LOCA 1B5TA 4BZYA 1QJWA 2PRHA 1NTHA 3BAXA 4DJDA 2HK0A 1UH2A 2NQLA 4R9XA 3QHNA 4JD4A 1GVYA 2VGBA 3TK7A 1SO3A 5ABFA 4PN2A 1OC7A 2DVTA 1OF6A 1EJWC 2X1SA 4I6VA 5BWFA 3BG9A 1HKWA 2O4QA 4IZGA 4C5ZA 2ISDA 2OX4A 3D47A 2XISA 4DF1A 2PA6A 5A6TC 2OU4A 2J7EA 3I7SA 3WUGA 2YBUA 4XZWA 2VRKA 1ECEA 2FB2A 5LA2A 3V35A 1HG3A 1CDGA 4OV4A 3T0CA 3E3HA 3R94A 3E74A 2R82A 3FLUA 2E9LA 2F8QA 3BV4A 4J7RA 4DF0A 4CD4A 4MIMA 2CWNA 1IT0A 4EOUA 1T99A 1UR8A 3AHTA 4LUSA 3SURA 2Y61A 3WNPA 2ZTKA 1FWWA 2G3FA 2HK1A 5I79A 4OECA 3WQ4A 3RPMA 3DFOA 3EOEA 3W82A 3W7EA 2V38A 4PCTA 1TV3A 4OBSA 2FLIA 4D8LA 3CZ8A 4F2BA 1FWGC 3B40A 5HMEA 3DFNA 1TMHA 2X41A 1Z3NA 3VIMA 3RUBL 4HZ6A 1H2JA 4LY4A 3W2JA 3GVVA 4S38A 1NFGA 3WL1A 5AYBA 1KXVA 1NWUA 4ZOEA 1REQB 1KWGA 5E1QA 4S3AA 3ITYA 4J3XA 4DO7A 1RUSA 4HZMA 1BF2A 1XKJA 4ERGA 3B8SA 3OVRA 1F3EA 3UR7A 1M5WA 3TU9A 3BJSA 5M17A 4XSMA 4Y7EA 3N2CA 5FEXA 2PDBA 1O5RA 1HGYA 3RNDA 2OSXA 4IIDA 5CG7A 1KRCC 4W7WA 5HOSA 2I5IA 1ML1A 4EAYA 3TROA 1BYDA 3IVUA 1RQEA 1SMAA 2Z7KA 5C9WA 2WNZA 1FWSA 1VZWA 1DXEA 3N4AA 3NXFA 2F2HA 4IP4A 4M6UA 1HVQA 1NVMA 3UERA 3MY9A 4W4QA 4FNUA 1WBJA 3CASA 5CPTA 1WA3A 1UWRA 4N02A 2QDHA 5K7JA 1MWOA 1FVPA 2JK2A 3BPWA 3INPA 2IPJA 1GORA 2KAUC 4MHBA 4DJDC 5AZ0A 4BQ4A 3RPTA 4GJIA 3SCWA 4V1YA 1I0DA 3FIGA 5LXXA 1VQTA 2PODA 2H9AA 4JNZA 1VEOA 4EIVA 2J9XA 4ZE4A 4ZBCA 3BSMA 1BVWA 4LAUA 4UTWC 3AO0A 1KR1A 4GIRA 1I60A 2ISFA 4ADSA 3C5QA 2BNJA 3S1WA 2CLEA 3ZFHA 3B8TA 3MJMA 1WO2A 1YDOA 1UP2A 4OVXA 1F4AA 4J3VA 1SJDA 1WDDA 1ITQA 3RXZA 4FNRA 1QT1A 8XIMA 3IANA 3AYSA 1AJZA 2J8GA 2BFGA 2REQA 2A3BA 3BGJA 3HTWA 3LI1A 4UMBA 2VC9A 2X40A 2OLAA 3BCJA 4LTSA 3HQNA 1XC6A 2CLFA 6ALDA 3UEQA 4ALDA 4QJ4B 4NAEA 3IIPA 5I5RA 4ICNA 4TX6A 4UQEA 4UTMA 3CYJA 1NY1A 1GZJA 1JPHA 3PNUA 1WKFA 3VUSA 3WDPP 3LHUA 3H7RA 2J7FA 1XLFA 4V33A 1BVZA 4L6HA 3CQHA 3LI0A 1U83A 1U33A 3REQB 5DMNA 5A8QA 3GAYA 3QEZA 2PC8A 2I57A 1NDZA 1SGJA 4KWSA 3GZAA 3CIVA 1PYFA 1F3WA 1N55A 1PX3A 5CJMA 1R3VA 5T26A 3A5FA 3WD2A 3ABZA 5FA5A 2NUXA 4M1RA 5SWUA 2DZAA 2H3BA 3VAVA 2VR5A 2NQ5A 4X2PA 1UH4A 4A8LA 2ATSA 1J6OA 4DO4A 1J12A 3E0FA 3UG8A 4PBFA 1Q8JA 1XXXA 1KBLA 1CECA 1QCWA 5HULA 1AW5A 2P53A 3AIRA 4PMNA 4W88A 4YN5A 1CNVA 2X1IA 2OYKA 2CITA 2GVYA 3E0WA 1Q5MA 1JCLA 4L1WA 4Y2WA 1TIWA 4YWSA 5EGRA 2PU1A 4LBRA 1OVDA 4DWSB 4MWAE 1I75A 1UJQA 2YLLA 3B9OA 4ERAA 3S8HA 1XUZA 1REQA 3BVJA 4NKCA 2XH2A 3KLKA 3ZLHA 1EUAA 2CPUA 1E9YB 3UPWA 3M0JA 4C7DA 2CKSA 4OIFA 3VKBA 2GUYA 1P0KA 2VC7A 1W9VA 2YFNA 4PMVA 2BLEA 1L6WA 2FTYA 4J35A 1YW1A 1LROA 2E8ZA 1QHZA 1TQJA 1QUMA 1P0EA 4TR9A 3U3HA 1ADDA 2EG7A 4ZO8A 3R0KA 4EXQA 3E2QA 3WUBA 2QUUA 3RJYA 2PFHA 3GW3A 3M64A 1IWAA 3B97A 3VI2A 3U2ZA 1GONA 3S1GA 1GZ1A 3LERA 1AZ1A 4CQ8A 3HPFA 1R3QA 4EPDC 3CV7A 2NQZA 4UBPC 1VR6A 3QFWA 4LGXA 1X98A 4PULA 1ISWA 3P0XA 2PRLA 3RFAA 2FGZA 4U5KA 3TNOA 2V5BA 2WKGA 1HJQA 1MNZA 4TX9A 4OE7A 3H55A 2R91A 4I6KA 3P14A 4TO8A 3EDKA 3H54A 4L64A 4GCAA 4QLLA 3E02A 4ATLA 1UOZA 5DN1A 2CWXA 1HJWA 3XISA 1J0HA 3GIYA 1PVNA 1R86A 1OSEA 4JFTA 1LBMA 4FNQA 2FHFA 2GQ9A 3W7DA 2Y8VA 2WCAA 3G1FA 3QTGA 1B3ZA 1VHCA 4XUGA 1J0YA 2HQAA 4Z0JA 3WJSA 3UR5A 4GI4A 4AEFA 3LHVA 3QZ6A 1TPVA 4MMWA 3DKLA 3VIKA 3VMNA 1P6CA 4XD3A 4NI8A 4UTKA 1YNQA 4PTVA 4PUDA 1QI2A 4YWIA 3SUTA 4NI3A 4P7OA 3PZUA 3F4CA 3AIQA 5HA7A 3GNNA 3H21A 1JFXA 1HVXA 4DYKA 4WRHA 4PYSA 1CB7B 1EF2A 1KRBC 4HA1A 1XRSA 1G69A 4QEHA 4JDYA 2DUXA 4GQBA 5HNTA 3GK0A 2CHRA 2ZRYA 5HDRA 3EDFA 1LQAA 4G6CA 3D3AA 4EK7A 2DQWA 5A95A 4HYWA 5F4SA 3STCA 3WMSA 4N6FA 3M9YA 1LRNA 4BQ3A 5EB8A 1CGUA 2E1DA 2WOQA 4X61A 4HU0A 1OGSA 1CXEA 3AROA 5JBDA 1XP3A 2WZEA 4FXSA 2WMKA 1EPVA 4IMFA 3ITGA 1BTCA 2QJIA 3PP7A 3WFLA 3JZEA 3G6MA 3WLRA 3WMLA 2J77A 3DX5A 3S9ZA 4F79A 4UFJA 2CYGA 3C2FA 1UMLA 1LM1A 1XDMA 4LS1A 2ZZ5A 4DQWA 4DEFA 4O8AA 1E0UA 1TJRA 1V0KA 4ZO6A 4GJJA 1AFSA 1OZMA 1GCYA 5HPOA 4AVFA 3USZA 3FJ6A 2A85A 4ZODA 1K3UA 3BLFA 3UETA 3NQ2A 2XN2A 4KCVA 1AJ0A 4YCPA 1QR7A 5K4XA 2V3EA 3BOLA 1XFCA 4TVUA 2WMIB 1XG3A 4JTSA 2WMGA 1YYAA 1LQ0A 1PZ2A 2NX1A 3W38A 3CHDA 4EACA 4B2DD 4TV5A 4QCFA 1ZZMA 1J8VA 4CVWA 4EKJA 1XGEA 2GJXB 4UQDA 2Y7GA 4NF7A 4JY8A 4HA4A 2P3ZA 2PDCA 5CPSA 3PG9A 3CV6A 3W1AA 5E6ZA 1NDVA 2NVAA 3ID7A 2WHLA 2OYMA 4AFYA 4QS6A 4R88A 4BA0A 2GVLA 2CHNA 1L8PA 3S42A 3JZUA 3GY1A 1GUVA 2ZRXA 3QYSA 3UPMA 2PS2A 4C6EA 1B2YA 4PFHA 3GXIA 1XISA 2ACUA 3VTRA 2D0HA 1E6PA 3CZLA 3UXAA 3KVLA 4FP1A 4AUBA 2R8WA 1PPIA 3BAJA 1S3HA 1DE5A 2J7HA 4M29A 1GQIA 1W9UA 3Q4DA 1H1NA 3ZO9A 3N11A 4FF7A 5ABGA 4Z1DA 5DF0A 4L4MA 5EY5A 3P0WA 3TC3A 4Z2HA 3GBDA 3FAWA 2AKZA 3H8AA 1MSSA 3TYUA 3W22A 2Z0IA 4W89A 3UZ5A 4UQCA 1FWHC 3ZSSA 1KTNA 1A5CA 1DJGA 5AZ1A 3CK5A 1G4EA 1SM9A 3LQGA 3TC7A 4DLMA 4IGNA 1V3JA 1C93A 1QOXA 1YDNA 3WFZA 4P7LA 3ZLGA 1SZEA 1TE1A 1A3XA 1BG9A 2QULA 1J5TA 3WQOA 4O17A 5D2XA 3HN3A 3DCPA 1VKFA 1UR0A 1JQVA 5BW6A 2VWSA 1NQKA 3APYA 4PRRA 3ALGA 3MUZ1 4HT3A 1YX1A 3NPXA 3QOKA 3O15A 2CZVA 2O0TA 3TTYA 2PDLA 2R1KA 5K4ZA 3E96A 4IT1A 3WF2A 3LPGA 1XYAA 2BV9A 3FX4A 4R7OA 4DNMA 3TZNA 1Q6RA 4N9BA 1US2A 1W3KA 1PKYA 4C91A 1OY0A 1HTIA 2PDJA 3L4WA 4U2YA 1VF8A 4LU0A 4H7ZA 4REQB 3F03K 4DJFD 1ZAIA 1CEOA 2J8FA 5E9AA 2OX1A 4MAZA 4HP5A 4ML4A 4PTXA 4JIQA 2ZVRA 1GKPA 1XLCA 3KCJA 3BSHA 2ZZ3A 4AHQA 1OT2A 1IR2A 1KRAC 5EFFA 4EPEC 3NUKA 1TO3A 2B31A 2DDXA 2NQJA 3GR7A 3EX1A 1A50A 1YXDA 3MI6A 3N2MA 5FJUA 3QLDA 3AIWA 1FFQA 1AL7A 3UPBA 1EIXA 1FWDC 4FZIA 1X7IA 3VD7A 1W5NA 3QN3A 3ZMRA 2P10A 4YL2A 4W8LA 3TLLA 1PSCA 2P1FA 4HPNA 3T9PA 4Z1AA 4WXZA 3ATYA 1C90A 3C2VA 4XBKA 3KX6A 1PAMA 1FWAC 4F2UA 1UWUA 4UZUA 2Q8LA 5CXPA 4GBDA 5CG0A 1W8SA 4ZVJA 2J7GA 1A5BA 2J24A 3P60A 3DFPA 2OQHA 5JU6A 2BVDA 2FZNA 3SUWA 1U5JA 4HU4A 3L65A 3UWYA 2QVNA 2V63A 5I00A 2A5HA 1NWTA 2Q09A 2WHKA 5ABEA 4S3GA 1OD0A 1E6SM 4N42A 1E56A 3ANVA 1MFVA 4JYEA 5CSYA 3C2RA 3S6TA 4CLMA 3H2MA 4HMCA 1B90A 1M7PA 1AQHA 3RPDA 2RH9A 1LBLA 3ARWA 1A5NC 1CGXA 1H63A 1MDLA 3FS2A 4DUWA 1TPUA 2ACRA 3RJXA 4C5YA 1S2TA 1EWEA 4JHOA 1K8ZA 2TAAA 2V2DA 3N9SA 4HNUA 1RY0A 1HQTA 4QR6A 4GHRA 3N2TA 3UZXA 3E2SA 2WSPA 3DZ1A 4IFRA 1W5OA 3PPGA 3DU0A 3LSCA 3IVSA 5M3WA 5GQBA 1A5UA 4H41A 5ABFB 3WN6A 8CGTA 3U2EA 4Q7NA 2ZZ7A 4PTNA 2CETA 2QW5A 1ZJBA 3DI1A 2PDUA 3QRHA 1XQLA 3CUXA 1U5HA 2BY1A 2VOTA 4JTQA 5A3HA 4M5PA 3AMLA 3QH2A 4E2BA 4F0KA 4IIBA 3QXBA 3WYZA 1EEXA 3OEXA 5DY3A 1W1VA 3ZIZA 1CXHA 2WSRA 2OCZA 2VDIA 3TEVA 2D2JA 1GW1A 2WVVA 5LNVA 3B3DA 3F7JA 4TMBA 3GYEA 1E9ZB 2O9OA 1W3NA 4HZ7A 4KWOA 4RXFA 1ME9A 1XD1A 4NAFB 1ZL1A 1CX9A 3AMKA 5D03A 1J4EA 4Y6GA 4ILSA 3A9BA 3RIKA 1RAKA 3ZJ8A 3O6AA 4NU7A 3LV5A 3FV9A 3R12A 4RL3A 3KHDA 2B4GA 2VFEA 3QZAA 5HMFA 4PSPA 1Q7QA 2JEQA 2ZDSA 1DXFA 1MUMA 2PDFA 2Z1XA 4HHHA 1UOKA 2PWDA 1P0NA 1XLDA 5BRPA 4DBUA 1A49A 4FLSA 4UNLA 3I7RA 3TVAA 3EWZA 3SGUA 5FJIA 4P2VA 3R1ZA 4E3TA 4W84A 3STEA 3FVDA 5F1VA 1OD8A 3FJNA 1TSIA 1JCXA 3O07A 2CC0A 4HNTA 4CU7A 4D6CA 2HEJA 2G0WA 2QPSA 3KBMA 2FB3A 1TV4A 1SW3A 1V3MA 3LGDA 1V6UA 1XIHA 4YYFA 1EJTC 3OOQA 2ESCA 4L6OA 3G1RA 4E5TA 1TVLA 4E8DA 4D9PA 2UWFA 3OLDA 2QCDA 2GZXA 4NZ1A 1HW6A 1QU4A 2ZADA 5CGMA 3A3XA 3GIQA 1ECQA 5KSWA 1UCWA 1R9YA 2DV0A 2I9UA 5FEZA 1GHRA 1WX0A 4INFA 2X05A 3A23A 3CMGA 1VS1A 3ZJ7A 2VWTA 2ZWYA 4O1BA 3CQIA 1J0KA 1PL9A 4LV9A 3EOUA 2Z00A 5AB3A 4E8GA 5XINA 2PWUA 1G7VA 4LVFA 3MSRA 4GVGA 4JX4A 4A2SA 4G7EB 5C9UA 1FKXA 1O94A 1WAUA 5FL1A 4ZZ9A 4JKKA 4C6CA 2ZXDA 4TVCA 3O1NA 3KOXA 3W7RA 1XLKA 2BODX 1D3HA 1LBFA 1EQCA 1XM3A 2ZC8A 4L56A 4PMXA 2FPVA 1I9CB 3WQ6A 1V3LA 4E2VA 4IM4A 3W23A 2OQYA 2SFPA 3HV9A 1N7KA 3OGRA 3AS0A 4F9JA 1ME7A 5LIYX 4MLRA 4DBEA 3V0UA 4W7UA 4ADUA 4JN8A 3UR2A 4JN7A 2ZYFA 4QM1A 3WNLA 1IEWA 1GJWA 4JTRA 3LHZA 4MWAB 3GDTA 3LLDA 3P80A 3W27A 1ZP4A 1G4TA 4PMUA 4NYUA 4MJ2A 4JNYA 1SW0A 3M0LA 3SAZA 1GKRA 1OQFA 2BY2A 3SCTA 2HPIA 1BXBA 2V8ZA 2PLMA 2A79A 3LHTA 2RGMA 2IKIA 3RM4A 1F3TA 3F2DA 1LWHA 2FVLA 2C1GA 1O68A 1PTAA 2A7PA 3VOFA 3PJXA 4WXYA 4F8XA 5JXQA 1HP4A 3APTA 4WKAA 4GGHA 1LWIA 4AIOA 5DBUA 3S9IA 4H9VA 3BC9A 5F4WA 1WB0A 3WH7A 5HWMA 4B9ZA 3FVMA 4N0RA 1H49A 3CT7A 1DWJM 2C71A 1E43A 3LENA 4S1FA 1T7LA 3QY8A 4ATWA 3VNIA 1MZHA 3IIZA 3HFTA 3AS1A 5GNZA 2ZTJA 4AIUA 5I07A 1LG1A 1QO2A 3LZ3A 3G1XA 4OFCA 4M56A 3G22A 2PBGA 3UXKA 2Y5JA 3GZ3A 1N8FA 5LGZA 3OJGA 1R8LA 3QV6A 4AYGA 1TTJA 4BQ5A 5IDIA 3UG4A 4FX8A 1H5YA 1O5XA 5C2GA 2Z2AA 1X8FA 2YB4A 4M24A 3URAA 4ML9A 1LRQA 1E6XM 3GVWA 2PD5A 2E6AA 2GJPA 1JYXA 3WNOA 4CD5A 3KBJA 1HT6A 3PWAA 3LHYA 4FA3A 3EOLA 4A2RA 3L66A 4MDOA 3S1UA 4YTSA 3WUEA 4CNNA 3STGA 2J7BA 1Q66A 3WH8A 4W93A 3VM7A 2VJXA 3QSTA 4DBSA 4A8IA 3RU6A 4FXRA 2W63A 3N04A 1MZRA 4Z1BA 3GW0A 4JKLA 3FYYA 3ZT5A 2HNHA 4WY0A 3OZPA 3LCXA 1ZBKA 3EMCA 2WWCA 1OT1A 3CQKA 1RPKA 1HJVA 4AHPA 3URNA 3K4WA 3CGTA 5D9NA 2W9MA 3B8IA 3KFTA 1J01A 3CZGA 4GH3A 3TW7A 2WM1A 4MOZA 2ZXBA 3GNDA 4WDTA 2OGYA 2PTYA 3M4HA 1E55A 2GDUA 1E5NA 2PDNA 4H8NA 4WCJA 1TRIA 1KGWA 4WR3A 2QJGA 4O57A 3Q45A 4Q4QA 3FA3A 4RDZA 3N15A 3M0YA 2XU2A 3MV01 3P84A 2C0HA 3R0DA 3M47A 4B2DA 4IXHA 3MPGA 2V3DA 3O16A 4LAKA 2J62A 3A24A 5CGQA 4C1NA 2OB3A 4RW3A 1QASA 2OO6A 4O54A 1X7FA 1XIJA 5BOOA 3H70A 4E3VA 4PTWA 1W9DM 1PXGA 3EPMA 2JKAA 4IG2A 4XSLA 3KRBA 4AYSA 4O1EA 4Q22A 1SR9A 3LBCA 1RBAA 2QUVA 3OBKA 3WENA 4GYFA 3D6NA 7A3HA 1MQRA 2WQDA 4TU1A 3AUOA 2XHYA 1VHNA 4LSBA 2CBUA 2ODOA 3C0JA 2UY5A 4PMQA 2PP0A 3SCVA 3EWDA 1D3CA 3WD4A 1TUFA 4WHBA 5DRIA 4OGZA 3PZ9A 3F4NA 1XYZA 4JIHA 3DUGA 2GL5A 3LPOA 1Q6QA 5MKGB 3OW1A 1XRFA 4X9YA 3DHFA 3OPSA 4H01A 2OWCA 3GTIA 2HZGA 4H6KA 2J6XA 1LOSA 4Y8EA 3QC3A 5DANA 4JXCA 2VDGA 4KFPA 4WDXA 1K9FA 3S46A 4ZE5A 4N9DA 4TOQA 5I3FA 4PMZA 1R2SA 3W3OA 4MB1A 3H6OA 5EMYA 2VD9A 2WPGA 3WDQA 3WUFA 1VYPX 3BAWA 3B4YA 4P8XA 4XUYA 1RK5A 3M0ZA 1ZPTA 4YNGA 4CD8A 3RCMA 1X6UA 2VENA 1DL3A 2INFA 3OHIA 4O15A 1LL6A 3MQTA 2YW3A 1ZJIA 3BOXA 3RO6A 4QSHA 4BS0A 4ERIA 4IGSA 2EO7A 4FIRA 1XKYA 1WUFA 5JVLA 4AC7C 2BY0A 4GLEA 2A3CA 4GQGA 4US5D 1VCVA 1DBTA 2XZ7A 2BP1A 3H2FA 3RLHA 3AJ7A 5DRCA 5DMMA 3LRLA 1AJ2A 3H4GA 4X22A 3K8MA 3NQEA 3ORWA 1E1EA 1QPQA 4NG3A 4FOUA 2QDGA 5E70A 2ZVIA 3MV11 3VNKA 3KL0A 1Q65A 1XLAA 4JEJA 1PBGA 3HBLA 2EPOA 3LRMA 1V3KA 3E5PA 3QJAA 1P1XA 4HMNA 3N25A 1POJA 2EF9A 3W75A 3QR0A 1FHVA 4AX7A 5HNRA 3C3UA 4I9JA 1TUXA 4A8NA 3MVTA 1CXLA 2V5KA 1KM0A 3RDKA 4HMDA 3IGHX 1S3TC 4ZCWA 1HKJA 3QHOA 2WZTA 4PR4A 1VP5A 4HCLA 5D32A 2HVOA 3KAOA 5HMDA 2GWGA 4ZSTA 1ZY9A 3C4UA 5BXSA 4WDWA 4NP7A 4B5VA 5AHEA 1M7OA 5HJLA 1UHVA 1K70A 2YW4A 5DELA 1SPQA 5I3KA 1XDLA 4A29A 4P8VA 1I2OA 5AYXA 3UJFA 3SI9A 3QKZA 4IX2A 3AMCA 4NT0A 3EEZA 3V18A 4O8RA 1SO4A 3CJPA 4KPLA 1VYSX 2O9PA 3RCNA 3VVGA 3GTFA 4A35A 1P4CA 2OMAA 5CC5A 1N82A 3DG7A 2PTXA 2VD8A 4UOQA 4LUYA 3ZS4A 4CUCA 3GDRA 5FF7A 3GHRA 4JHMA 3VIFA 2IMRA 3G1VA 3BV7A 4LBUA 3FHAA 3QR1A 2ICSA 3STPA 5ABHA 4Q8TA 2AMXA 1RV8A 1WV2A 2DH2A 3GB6A 6TIMA 3H2EA 1ISVA 2QAPA 1WKDA 1ODUA 4ZOCA 4YHEA 4GX9A 4CD6A 5CBBA 4EF8A 1KM6A 3GO2A 2P8CA 4O16A 3FGCA 2A1YA 2CLHA 4WSJA 3GXPA 1LWJA 4FLOA 4ZQCA 3ZOAA 3R79A 1O5QA 3GYCA 1JAEA 1HKIA 4B3ZA 2ZRVA 1LT8A 4ATDA 3AHVA 4K7VA 3PZOA 4ONVA 2W67A 4ZTYA 4AMAA 3MJYA 4FF5A 3UF9A 2BVYA 1KFWA 5E09A 1ZBVA 2W27A 5EL1A 2VRQA 1OK4A 1TPEA 3CTTA 1UUOA 4JTTA 1Q6GA 3UVAA 4KRZA 3O06A 3VOCA 3VIHA 4NJJA 5JH2A 5FEWA 3IJ8A 3OGVA 4UFLA 3L4ZA 3LGEA 1O60A 3N4FA 4M6PA 1WZLA 4QTGA 3WQCA 4FB7A 5L9FA 1YPXA 1L6YA 4PODA 3NQGA 1E4IA 1BTMA 4X60A 3ZT6A 1V7AA 4XIAA 4DUXA 3I65A 4ZFMA 4GI8A 1BFNA 1OFAA 4K2SA 1EJUC 3LRKA 1XRVA 2QR6A 1OFPA 3ERPA 4ZL1A 2E5CA 3PJUA 2D3NA 3OVPA 5FEPA 4C6KA 4GYKA 3N2OA 1CIUA 2GGGA 4B4FA 3IS4A 1BRLA 2A6LA 1HO1A 4AWTA 2RDXA 1UUMA 4L9ZA 4GH1A 4NYYA 1PWMA 4GVHA 4YTUA 4BKNA 1PB0A 3SCSA 3SZ8A 1GVIA 4EANA 3R8GA 1JNDA 4PUMA 2XVGA 2QZRA 1EJ7L 3LTYA 3VGHA 3G5EA 2FMNA 3CO8A 2Y85A 3B8VA 2AQOA 3PZMA 4AIEA 1M01A 2ZXAA 4GY0A 4KRTA 1IXQA 3N2XA 4JTIA 2BVWA 2V69A 1W5PA 1MQPA 2XM1A 1L0PA 4PTMA 4LANA 3PS7A 1YTDA 3KCLA 3R7MA 3EX4A 3E0LA 4LB4A 1QNOA 2YA2A 3MA8A 1Z6KA 2OEMA 3ARUA 4LRSA 4QG9A 2X2YA 1ALDA 2DT3A 3R58A 3BAYA 3VDGA 3CWNA 1K4HA 4LRTA 1DQWA 5G4WA 2YBVA 3CMJA 4K1GA 1WDQA 3LXBA 4IQEA 1X1OA 3P6LA 4B5WA 4FNSA 1LOLA 3VD9A 1GOOA 4HTBA 1F8IA 2C8NA 2DJXA 3BE7A 3KEHA 1GVOA 2YXOA 2A21A 3PBUA 2PBOA 1TZ9A 4GYPC 4H6QA 3TA9A 3Q2DA 1E6ZA 2FMOA 3P8JA 2QAFA 1U1JA 1KV8A 1B3YA 1C92A 2HE5A 4HQVA 1UKTA 1DJYA 2Y70A 3S5ZA 3QLLA 1CI1A 2E3ZA 2GJNA 4C1LA 1XYCA 4XZMX 3PJWA 3TH6A 1B4KA 1RBOB 2ABBA 2VZTA 3AXXA 3MI3A 2Q8ZA 3WQPA 1FWCC 2QCGA 3AJXA 5I23A 3EPNA 3WH9A 4UTTA 4LF1A 3HGJA 3NEHA 2W66A 1F5ZA 1XG4A 3FXGA 1QPRA 5BU6A 1UQZA 1TWZA 3QQ0A 2Q3RA 4W5UA 2J74A 3E9AA 1OC5A 5HUOA 1PTGA 2DH3A 4QCEA 2VZUA 4QNEA 3FN9A 5I77A 3WX7A 4LCSA 4JICA 2REQB 2CZFA 3VD4A 3MMWA 3PZIA 2JIEA 3GH4A 3IIOA 1D2KA 1P6BA 1VCFA 1F9CA 1V6TA 2PD9A 4Q7IA 1LORA 1EJRC 4JQ3A 4JFSA 4QDMA 3T78A 4CN6A 1EC9A 2BSLA 3C0SA 3PPHA 4AHOA 5KTLA 2E9BA 2WKLA 1VFUA 4HD5A 1IIHA 2FIQA 4B5NA 1VJSA 1XIBA 3GHSA 2DW7A 3TFXA 4IIEA 1S2UA 2EQDA 1GVEA 5FF2A 3KS5A 1Z89A 3UY7A 1S5TA 4UR7A 1R2TA 3UGRA 1KV5A 2WVVB 4C6LA 4OOZA 2R14A 2XIJA 4PH6A 3EXTA 1Q6EA 2EKCA 3JRKA 1E72M 4Q4RA 4GUHA 2ZOXA 2ASHA 4HJFA 5CPMA 3AIBA 3PPCA 4WOQA 2XGIA 1XYLA 4X9SA 5CZTA 1H1YA 1IYXA 5KZDA 3R10A 2OYLA 2ZKMX 1UBSA 3FEMA 3ARVA 3I6TA 5E0CA 3W1LA 3FDKA 2NLIA 2BMBA 2YPIA 3T7VA 1X97A 1OFQA 3RLVA 3L2IA 3DHDA 2G5WA 4ICCX 3MKKA 1RSCA 5CZKA 1EGMA 3WELA 3RR1A 4JTDA 3UGVA 1TR1A 2NQ9A 3W1PA 5G4HC 2CLIA 2IKHA 3SGGA 4D72A 3GD6A 3NG3A 3GXDA 4BJHA 3BAKA 1CPUA 3G77A 1MW1A 1IEQA 3AHXA 4WGHA 1ISYA 4PA8A 3QMSA 3CAQA 4KEZA 4FNTA 4H9UA 5GJPA 4BWLA 2DP3A 3WLKX 4AXKA 1WAWA 4WUIA 3MO4A 2YOCA 4CN4A 1JD7A 4AW7A 1NDYA 3MUCA 3MANA 3OBEA 9XIMA 4Z2KA 3HIJA 2C0AA 1PE1A 4JTAA 4RPPA 4RDVA 1J0ZA 3DOPA 3VCCA 1FDZA 2VUNA 3N1AA 2VELA 5C70A 3E6EA 2NZLA 4PBGA 3OA3A 2AQWA 4V15A 3BQ6A 3BLPX 2VEFA 2EPHA 1TV8A 3R4IA 3W29A 1X38A 5HAOA 4C6QA 1SW7A 3TQVA 4H00A 2WKJA 3LOTA 2H90A 2EAWA 1A3WA 3HA1A 1YXCA 3V36A 5AHIA 3VNDA 3W2MA 5LNRA 1S2WA 4M0XA 1IZKA 1HFBA 5C8BB 2E5BA 3SBFA 3GFZA 3O63A 3DHUA 2BBFA 5AN7A 3LCLA 5HXMA 2EXOA 4X2RA 5BCAA 4Q4KA 4M7TA 3N4EA 3TTQA 1E40A 1NSJA 4MADA 3NZQA 1BRLB 1E4MM 3EA1A 4PUNA 1XFBA 1UR4A 1X1NA 3W81A 5JUVA 5M2FX 1IZJA 1V93A 4FEZA 3VIPA 1QFEA 3IVTA 4O18A 3W2NA 4U28A 3ITCA 1FCVA 1B3VA 3ISIX 4NZ4A 4Y9AA 4IQLA 3CC1A 3CM4A 3WJZA 1FX6A 3IIXA 2GJLA 1F4HA 3ZWTA 2G97A 3GVGA 3VKCA 2VO5A 4JQ1A 2C1IA 8TIMA 1SQ7A 2FKPA 4J40A 4Z1CA 2ZA2A 3WEZA 3K30A 5IHRA 1PHWA 4Q4OA 1RLCL 4UFMA 3R89A 3BG3A 3SFWA 5C7HA 1PKMA 1WNOA 3HPAA 3ABXA 3G1HA 1RCQA 3DBNA 1M41A 2PDPA 1K8XA 3W7MA 3QGVA 1L6SA 4PMDA 5D05A 2E28A 4FR6A 4QAIA 3BWWA 3OTRA 3QPYA 5HK4A 3LHWA 2Y89A 4FNPA 2EJ1A 1F76A 3B0UX 4PUUA 3SFKA 2WXDM 1Y7VA 3SRKA 4JTKA 3FA5A 2NV2A 2PDYA 3AALA 5LHFA 1EJVC 5L6UA 2OELA 3BW3A 1TX0A 3OP2A 3NO3A 2OLSA 4IFKB 5E5CA 1TJPA 2OSWA 5H2ZA 4DB7A 4YJ5A 5I06A 1Y5WA 3BGGA 4IIFA 2I9EA 3VFCA 4NIRA 3SCPA 2QCCA 1CXKA 3NYZA 4JCLA 4I5XA 1Z7AA 3CEPA 4LXFA 2XWDA 3S83A 3FDGA 1CW2A 1MMFA 1S2AA 1BXCA 3B06A 2AGKA 2NSXA 4GWEA 4LB3A 3WY1A 2FH6A 4CNSA 1R46A 4UNIA 4PBEA 2YCLA 3PAOA 3VC5A 1KGUA 1WPCA 3L0KA 2NUYA 3GQYA 1G4PA 3VGDA 4AD3A 1EO5A 3ZSTA 4HJWA 3PSVA 1K77A 5IRPA 2PWEA 2I1OA 4DF2A 3VCNA 2UY2A 5ECUA 1DWGM 1ZAJA 4LFYA 3WLPA 2HE8A 3CUZA 3UFYA 5I6SA 4IGHA 2PEVA 4M8UA 1QNVA 1XSKA 3W85A 1N2VA 2QJJA 3M0MA 3MT1A 2NXGA 2JF7A 1O5KA 1EUNA 3PSWA 4JYFA 4HOWA 1KQZA 2P5NA 3E1F1 1LLZA 3CBWA 5CGTA 3DFTA 4RPQA 5T91A 1EWDA 3CL6A 4L1XA 5F2MA 3P5YA 3PBVA 2XSXA 1FP8A 1JUBA 5CH9A 1EP1A 1ADOA 4JL2A 4E0CA 1E9LA 4RLIA 3UNTA 1TWDA 3WLOA 1YXYA 3U2CA 4OU1A 2E6YA 3PPFA 2WJFA 4QLJA 3L5AA 4O11A 2QF7A 1XLJA 4R7JA 5BOEA 2Z2BA 1ZRQA 3MZNA 2WB5A 3LCHA 2F2KA 1K9EA 4QS5A 3TDFA 1XI3A 2CU0A 2ZX7A 3IACA 4RE2A 3QBUA 1OFEA 1V02E 5I09A 4Y9NA 2JEPA 3LZ5A 3UA3A 3HPXA 3UW6A 1UR1A 1AMKA 2WVUA 1DEDA 1TTQA 1JUKA 1QAPA 4AWUA 1UW9A 4EWND 1QW7A 3M7WA 3P5ZA 3PUDA 2WJDA 4E4UA 3V4BA 4AY1A 5LXEA 1WXYA 2PDXA 3M43A 3S2JA 3R8HA 1QTWA 1MDRA 2WWDA 3GNOA 5U7SA 1B30A 4NZ5A 3V1HA 4I8YA 1FUYA 3PB2A 3AWNA 1UA7A 2ZUVA 3W76A 1MEWA 1O12A 3NNTA 4DZAA 4K68A 4D6DA 2DIKA 3HV8A 4PGLA 3PZGA 3KM8A 2WYSA 3EWCA 5A8NA 4AD1A 3U9IA 4MG4A 2J9YA 2YA0A 4ZGYA 2XVNA 3S1VA 1DVJA 3T40A 1E1FA 4NZJA 3TSDA 2ZX6A 5EKYA 3EXRA 3OU8A 4HSOA 5GPRA 1JCYA 1TTPA 2C79A 1PZ3A 5A6SA 3G3MA 4ASTA 1XUUA 4FOKA 2HPMA 4HSNA 1ICSA 3ITOA 1EEPA 2DZPA 4LF2A 1I0BA 2WMFA 3L0GA 4DXVA 3NDOA 3MCOA 4KCUA 1ONRA 4GUFA 1JUEA 5A6AA 5A6BD 1CYGA 3GC4A 2VM8A 2JALA 1W32A 3QC0A 2VI0A 1KR0A 1QPOA 4HPGA 1GOXA 4GC3A 3W1QA 3H4XA 1KM4A 3BCDA 1V77A 2OEJA 3F2CA 3TJIA 3VDHA 5JBEA 1A0DA 1US3A 1QK2A 1G67A 2NW0A 3DEQA 1HX0A 3TAOA 2AAAA 2ZWZA 2AGTA 2B7QA 1Q3NA 1M65A 4UR9A 2EEXA 4XTDA 1C8VA 5DXXA 1CGWA 4JQ4A 1GOKA 5I24A 3O7UA 2BHZA 1QK0A 4NX0A 3PUGA 3NQDA 3FSTA 4GUGA 2QCLA 2HISA 3V5CA 3U5UA 5BYWA 3VC6A 2ONEA 1GVQA 1TV5A 4TQTA 4A4AA 1GEQA 3FGCB 4GA8A 2POZA 3WEMA 2BASA 4JTEA 4WJ8A 3FY1A 4RE3A 3WLHA 4EXAA 2QCMA 1ZJHA 1HP5A 1OX5A 1MXDA 2ZUSA 3ALFA 3RU8X 3C8NA 4BCEA 4L80A 2HRWA 2VC5A 1U1UA 2Z1SA 4Q8QA 1NARA 1E3ZA 3H2CA 1I1WA 3N29A 2XFWA 2Z24A 4JPGA 1EX5A 3WFAA 3WL0A 3OYXA 2PGEA 4N9EA 4K37A 1TCDA 1WCGA 1J0JA 1GHSA 4UMCA 1UD2A 3R5EA 1LP6A 5CKSA 3VNYA 3L67A 3QM3A 4DRSA 1MEIA 4PB5A 2XG9A 2QXWA 1XLMA 3P62A 1OHLA 4NAEB 4YIWA 2CBJA 4LALA 3JR2A 3EX3A 4MY8A 2VT0A 1AMYA 4M6QA 1G01A 3TOPA 3EWYA 4R34A 1H7PA 3TQKA 1WXZA 1ZFJA 2H9AB 2G4FA 1YRRA 4QDPA 4JR5A 1EFZA 3A9IA 2HVNA 6A3HA 1QBAA 1PDZA 2V82A 3BZGA 1CLVA 1GPFA 4D6HA 1UROA 1E70M 3FKRA 8RUCA 4AZGA 3IRDA 1EKOA 3DYOA 1VH7A 4GACA 4Z2JA 4IPLA 4G8TA 2VFIA 3VGBA 4AZIA 4HCDA 2CLOA 2ATMA 1GG0A 4GNJA 3SDOA 1PO9A 3EBVA 4RX0A 4UTWA 3GHUA 4JBRA 3NL3A 1L8NA 4K8EA 2QDDA 1C8YA 4JZ5A 3DESA 3LNMA 1EC8A 3SN0A 3A22A 5CQ1A 3ARYA 4LYRA 3ZJKA 3G18A 1ZB5A 1NQ6A 2PLKA 1LQ2A 2GSJA 2E4TA 2GSEA 1Z8AA 4XV0A 2ZX5A 1UJPA 3KLLA 5BNKA 2ZZ2A 3UG3A 3VU2A 3NL5A 1PYMA 4CCDA 2P50A 1XL9A 4KEUA 3E38A 3BLDA 2YL6A 3QY7A 4JQAA 3WH6A 4UCGA 1UIPA 2F38A 5FSEC 3L4YA 4H8VA 3GH5A 2X2GA 1AD1A 4WKFA 3S5SA 5GJNA 1KXTA 2BOEX 3BZJA 3PR2A 4QFUA 4XAPA 3L21A 4Q8MA 4ZO7A 1UP3A 1OZQA 3TE9A 4KRUA 2WO5A 4LUSB 1QI0A 4GNVA 4UTJA 1KTCA 1KFCA 2OZ8A 3I3DA 1JZ6A 3TTEA 1BQCA 1UUQA 2BOFX 2CZEA 5FESA 3VPLA 3I7QA 1SFJA 3EMQA 2TSYA 4Q33A 3M0HA 2DIJA 3T2OA 2ZICA 2WSYA 3F4WA 3UQNA 2Y7DA 3W28A 1QO5A 2W3ZA 2HBXA 1PHQA 1RCXB 3ABOA 1R3RA 3UWEA 4JYDA 1GVSA 4C65A 5MKGA 1KBKA 2C13A 1WDRA 2UY4A 4W86A 5LIKX 1G0CA 1VIZA 3QV8A 3VYLA 4GD0A 3R8RA 2UY3A 4EP8C 1GKQA 1PIFA 5JBFA 1E6NA 3WQFA 4A22A 1WKEA 1UP0A 4PFMA 3W70A 3AYRA 3WLQA 1ZJAA 4UIOA 1S5VA 1EA0A 4MWAD 3LS9A 3PNZA 2WANA 1XLBA 4JTJA 5E0KA 5JQ9A 3W07A 4CKQA 5CAKA 1EYEA 2Q71A 3AWOA 3EWWA 3WK0A 3ME3A 2PRMA 3XINA 1JZ3A 4HB7A 2J75A 4GGBA 3RGTA 3CO4A 2A7NA 2NX3A 3AZTA 1EL3A 1DJHA 3WKZA 2E7FA 3KTSA 4PTDA 5ABTA 3B4UA 4J3ZA 4UQBA 1JQXA 1RY8A 5A69A 4ZR8A 2PDMA 4XG1A 3A6OA 1F6PA 2PC4A 3ARXA 5I3JA 2MUCA 2E25A 4DVOA 3N73A 3NM1A 2B7OA 4YTRA 2QGYA 3EX6A 2JKEA 3VNLA 4ZB2A 2VXNA 4UZSA 2XN0A 3C0QA 3W74A 1UC4A 4C90A 3ARPA 5LA0A 3KBSA 4W9TA 3POCA 2P88A 2YXXA 3N3MA 4AIBA 3F5JA 4O19A 1HUVA 1XINA 4CVUA 2FVMA 1E51A 3KS6A 1UWQA 2IXVA 2A3HA 3ZM8A 1RA5A 3CQ0A 3H22A 2X1RA 4AD5A 1BWLA 3COTA 3A47A 1RR2A 5G2HA 3W72A 1TPFA 4AWSA 1ZGDA 1GNXA 4XVEA 1I4NA 4MFDA 2CLPA 4DUOA 1ENUA 1QDSA 4DWDA 3KDNA 4MYXA 3R2GA 3GS6A 3LUTA 1PTDA 3MHUA 4MUPA 4F66A 1F73A 1WXJA 2QMKA 5CPQA 5A2BA 3ES8A 3GNXA 2QT3A 5DMYA 3SRFA 1QNSA 1OF8A 4XAFA 3JW7A 4WZHA 5FKYA 1GQJA 2R1PA 4R85A 3XIMA 3RX2A 3URQA 2QIWA 4CCEA 3HB9A 2GQAA 1FHDA 3SQMA 4KQNA 2VKZG 5AHLA 2FGBA 2HS8A 3W88A 2CLLA 4WJXA 2PLCA 4AH7A 1TE6A 1SJCA 4UTLA 3GRIA 1W1PA 3N6HA 3UJ2A 4E6MA 2XIQA 5LNWA 4PRTA 3SCNA 3VINA 1KD0A 3DN5A 1TJ2A 3GTXA 1VFMA 1R7OA 1BEUA 3G1YA 2WBKA 1OG0A 4KEMA 1JGIA 3G0UA 3K2GA 3LLFA 3E49A 4J3TA 3O6DA 1DKWA 1JIBA 3PAJA 3IJ7A 1I45A 1J2BA 2WHJA 1FH9A 2OWWA 1K9DA 7TIMA 5CC6A 4K8GA 2C14A 3W01A 1CGVA 3MMUA 5TIMA 4M6VA 1KXHA 4F0MA 2RKXA 3EYPA 4GVIA 3FK4A 2ADAA 1JCMP 5AC4A 3C2YA 1JDFA 4RUBA 3WMBA 1FP9A 4DJEC 1ONEA 2Y7EA 4JTHA 4NNBA 4MY1A 2G41A 3SIMA 4HHLA 3LM3A 4IJRA 1H7XA 3EDJA 1KCZA 3ZWSA 4RV3A 1TWSA 4GKLA 1LT7A 5BWAA 1H11A 2ACQA 3WLMA 1XYMA 1H0IA 4PL2A 4W85A 5AOUA 2CLMA 2X16A 3BDKA 3AZRA 1XBZA 2G37A 2OTDA 1Q85A 4Y90A 1MUCA 4H2CA 1P0BA 4JIEA 1I6NA 1BHGA 2V5LA 3SCRA 1OABA 3R11A 3OVQA 3CS2A 3KVKA 2CFFA 3TFCA 3WDIA 5BRQA 2DSUA 2QNEA 5E6YA 1ZALA 2FYMA 1YTKA 4P8WA 3SEPA 4XVDA 3GKFA 4FS9A 4C6PA 1TZ7A 3SRDA 2DU2A 2B7NA 1Q4WA 5RUBA 4XZBA 3TYAA 2VVSA 1SJAA 2DVXA 5JIWA 4P8UA 1KBIA 3CPRA 3G3DA 1TELA 1S5MA 4AWEA 1DORA 1UZDA 1VPQA 3T08A 5EFDA 4QHRA 3L4TA 3VDAA 1E6RA 2WSKA 4BWLC 4FMVA 3UESA 2X7WA 2PDQA 3H26A 3WO8A 1GGOA 3KOYA 5K9DA 4KWVA 4U31A 4QG6A 2WW5A 1KLZA 1ZUAX 5DXYA 4XTIA 1RK6A 4YVVA 3RLGA 4IX0A 1B54A 1WYIA 2ZXQA 3TC6A 4KMQA 4I9AA 2DUZA 1V6WA 4RNJA 4S23A 3UJRA 1FWTA 3WLJA 1FQ0A 3ZYZA 3WK1A 1Q45A 1I2QA 2J9ZA 1YBQA 4PRWA 3OO2A 3JS3A 1JF5A 3GR4A 2X09A 3C52A 2Z1BA 5DT5A 5H8PA 2HV5A 5CJNA 4S3JA 4FSAA 2PZNA 5CLWA 9XIAA 5T8GA 1E4NA 3NQCA 1LL7A 2GK1A