2PF0A

F258i mutant of exo-b-(1,3)-glucanase from candida albicans at 1.9 a
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
394
structure length
394
Chain Sequence
AWDYDNNVIRGVNLGGWFVLEPYMTPSLFEPFQNGNDQSGVPVDEYHWTQTLGKEAALRILQKHWSTWITEQDFKQISNLGLNFVRIPIGYWAFQLLDNDPYVQGQVQYLEKALGWARKNNIRVWIDLHGAPGSQNGFDNSGLRDSYNFQNGDNTQVTLNVLNTIFKKYGGNEYSDVVIGIELLNEPLGPVLNMDKLKQFFLDGYNSLRQTGSVTPVIIHDAFQVFGYWNNFLTVAEGQWNVVVDHHHYQVISGGELSRNINDHISVACNWGWDAKKESHWNVAGEWSAALTDCAKWLNGVNRGARYEGAYDNAPYIGSCQPLLDISQWSDEHKTDTRRYIEAQLDAFEYTGGWVFWSWKTENAPEWSFQTLTYNGLFPQPVTDRQFPNQCGFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein XOG1
publication title Carbohydrate binding sites in Candida albicans exo-beta-1,3-glucanase and the role of the Phe-Phe 'clamp' at the active site entrance.
pubmed doi rcsb
source organism Candida albicans
molecule tags Hydrolase
total genus 151
structure length 394
sequence length 394
ec nomenclature ec 3.2.1.58: Glucan 1,3-beta-glucosidase.
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2pf0A00
4KGJA 3VIJA 1KR1A 5AC4A 1CGWA 3VGBA 5FL1A 1JF6A 3PZGA 4AEFA 4D6HA 4MB1A 3LPPA 3ALGA 1HJQA 3VIHA 1J0JA 2PWGA 1JYXA 2WM0A 1F4AA 3UG3A 4QLKA 5M17A 2NT1A 2D2OA 4JHZA 1UA3A 4U5KA 2CCRA 4ZENA 1V3KA 2EPMX 4LQ1A 4X0NA 3AIEA 4QAWA 3VPLA 2XIIA 3J7HA 1E0WA 3O9NA 4JKLA 2J7DA 4PMOA 4F9DA 1SMAA 3PZMA 5BXTA 3L4XA 3WMCA 5BWFA 2WKLA 3WQWA 4PUEA 1EIBA 1HVQA 1FH7A 1NOWA 3MMDA 2Y8VA 5A1AA 2QV4A 2ZWZA 1UR1A 3U5UA 4URIA 2W66A 4W8BA 4UFHA 3AXXA 4M24A 3UETA 4UQEA 2D22A 3FHQA 3W28A 4AISA 2PB1A 4XUYA 6A3HA 2W91A 1FA2A 1GOKA 3WH7A 1FH8A 1WDRA 2QMJA 3WDIA 2WYSA 2J74A 3OLDA 3CGTA 4UOQA 1NWRA 2J8GA 3ZMRA 4CU6A 7TAAA 3OIHA 1JXKA 3AMDA 3D3AA 4GI6A 5CLTA 4PMYA 1E71M 2F2HA 2FHFA 3K46A 1UWUA 4P8UA 1PX3A 4HTYA 1DHKA 1J12A 3S6TA 3VMNA 2XGIA 4UOJA 4CCEA 4C7FA 1OB0A 2ZUNA 3MUY1 3BMWA 1KBBA 3AIRA 1VRXA 1HKKA 4KGLA 1JYWA 1KFWA 2BXYA 4OIFA 2QLYA 1E0XA 2EO7A 1CWYA 1XC6A 4XB3A 7A3HA 3GDBA 3WDRA 2CBIA 2VRQA 2XGBA 2OWCA 1BPLB 3AZRA 1KXQA 2Q8XA 1PZ3A 2VUYA 1UD8A 3AMLA 1H09A 1VEPA 3M6DA 2VQTA 2WMJA 5A8NA 3CHEA 1HT6A 2EPNA 5FCZA 5LA2A 1B2YA 3WUGA 2XJ7A 3RJXA 3WNMA 3NDYA 4PCTA 2B31A 2F8QA 2YA0A 3PZNA 2W92A 4L4OA 4M80A 1VF8A 3WD3A 1B3YA 5E0CA 2F61A 3AFBA 1MXDA 1RP8A 5EB8A 1GQIA 2VMFA 2JIWA 3AIQA 1BYBA 1BSIA 1OINA 4E8CA 1LJYA 1TR1A 5C8BB 2VZTA 1H3GA 1BG4A 4CVUA 1FH9A 3PTMA 3UERA 3WH8A 5EFFA 4CN1A 1MW3A 2WMHA 2PWEA 3BAKA 2PWFA 1UKOA 4AZ5A 3AJ7A 5EBAA 3MV01 2J77A 3AMGA 4S3KA 4W5ZA 2WMFA 4HA4A 1JF5A 3N11A 2V3FA 4ATWA 4LXFA 4Z2HA 1UOKA 1JZ8A 1WO2A 3ARVA 3BAXA 2OSWA 4MNLA 1HKMA 2Z1SA 4IPLA 3U57A 3VUPA 3RO8A 4UQBA 1XD1A 2FDMA 4P7RA 5CQ1A 3WENA 3PZQA 1LLOA 4AIEA 4W7VA 1UWSA 4PYSA 1K9EA 3W53A 2PBGA 4L4PA 4MADA 1VAHA 4LYQA 4LX4A 3T0AA 2X8RA 3N12A 3SCUA 1R87A 1UR9A 3VNZA 4ZE5A 3MSGA 3UG5A 2CERA 3G6LA 1UWIA 3AZSA 2RGMA 5AC5A 2DT1A 1OD0A 2JIEA 1LWHA 1GOQA 3PTQA 4BQ3A 4JFUA 1SMDA 2C7FA 3W26A 1TZ7A 2EPOA 3ARPA 4AZGA 1VJSA 1B9ZA 4BQ4A 3CZGA 5D9OA 1UYQA 5FL0A 1I1WA 1JL8A 4RE4A 4F66A 4W84A 1KGUA 2JFEX 4Z2IA 5AYIA 1E15A 2YDRA 4YN5A 1TVPA 3F5JA 2WVVA 3CZJA 4MDOA 4AZ6A 2X0HA 3TTQA 2ZUTA 1JYVA 2DIEA 2VZUA 2G41A 2PI6A 4AD2A 4F79A 3NYDA 4B3LA 1BYDA 4D6EA 5I5RA 3EDKA 1QNRA 4H04A 1KWKA 4BZYA 2WMIA 2CIPA 3VGFA 4KRTA 1K9DA 1V6UA 4W88A 2C0HA 4B9ZA 1EQPA 5A2BA 5A8OA 4NZCA 4PTMA 1MVYA 1E6NA 4J3TA 3VX0A 1JI1A 3ZJ7A 4AZ7A 3WD1A 3O6AA 1B3VA 1KB3A 3AMCA 2J25A 2BY2A 4R5EA 2JF6A 4AY1A 1B3XA 4PTXA 3S2CA 2XG9A 2XVGA 1D7FA 3GH4A 1ZJAA 1EH9A 3DYPA 5GNYA 1W9DM 2ZX8A 1E6XM 3K1DA 5GPRA 1B3WA 1MXGA 4PMVA 1C7SA 3QR3A 3I3EA 1N82A 1W3LA 4B3KA 1CBGA 3OBAA 1HNYA 2WB5A 2WW5A 4JAWA 1MQRA 1GNXA 2DSZA 2J7EA 4UQ9A 4UTFA 3NSNA 3BAYA 4H8HA 1E72M 3F5KA 3L4WA 1E4IA 1GUVA 4HZ6A 2J78A 3WQ8A 5GNZA 2XFYA 3AXHA 2J7HA 1AMYA 2XHYA 4HA3A 4HOXA 2O9RA 5DMYA 1UR8A 3OG2A 3MUZ1 3CUIA 1JNDA 4FMVA 1UKPA 1ZBVA 3WL0A 3VIMA 3EDJA 2O9PA 3WH6A 2GK1A 3MV11 2A3EA 1E9LA 7CGTA 4HPGA 1LG1A 2J47A 2YL8A 1KBKA 4WSKA 2V3EA 4AWEA 3BLPX 1H0GA 3WQVA 5IFPA 3AIBA 3RM8A 4GIAA 2VI0A 3W29A 3OGVA 2YLAA 1PJ9A 2PBOA 3AIUA 4TVCA 1M53A 1EXPA 2ZWYA 3BGAA 4JFSA 2CITA 4J27A 4DWSA 1W9BM 5CPSA 4GZEA 4Z2JA 1W91A 1LL6A 1W3HA 1CZ1A 2ZUWA 2VNCA 1KQYA 1OGSA 4M82A 5CGTA 1XHGA 2XYLA 3T0BA 4AD1A 1VFMA 4W86A 1HL9A 2BY0A 1G9HA 3M7SA 1UD6A 2DSUA 4MNMA 4QCEA 1E0VA 4QLLA 1WE5A 2YBTA 4DWSC 3IAQA 1QOXA 4TOQA 4AZCB 4AEEA 1GJWA 2XVKA 3EDDA 1E73M 3WEOA 1SR0A 4HOZA 4MPKA 1JYNA 1CGTA 2ZUVA 4M1RA 2BS9A 1OIFA 2YDQA 4PMDA 5EMYA 4AD3A 2VURA 1DWFM 5E09A 4AD4A 2W5FA 3EBVA 1EDQA 1JDCA 1OT2A 4U3CA 2V5DA 3B9DA 4D6GA 1QNSA 4GO9A 3VD7A 2E3ZA 1OCQA 2V5CA 2VZOA 4UNIA 1TVNA 5TD4A 1CPUA 1MFUA 4P7OA 1V02E 2ZX6A 3CPUA 2YL5A 4CU8A 3RM9A 4AMCA 4Z2KA 3MU7A 1W9VA 4B15A 1D3CA 4BQ5A 2YIHA 1EGZA 1CGVA 3CIVA 1K6AA 2IXVA 1X6NA 3NCOA 1E5NA 3VIFA 2XIBA 1GZJA 1XSJA 1EDTA 3W6LA 3CZEA 6CGTA 5D9MA 3D5HA 4J3WA 1V02A 4HZ8A 2DH2A 2UWFA 4JFWA 4BS0A 2E9LA 1BLIA 3WBEA 3PZTA 3W81A 5DF0A 2YBUA 2XWDA 4U33A 4P8VA 4P7NA 4DWSD 1MW1A 4BF7A 3AHYA 4XV0A 1H2JA 3ARUA 1ISXA 4PRWA 1IT0A 1G94A 2WC4A 3IK2A 1O6IA 1OIMA 3O2LA 1BVZA 4DM2A 3WDPP 4WJXA 3VU2A 2WANA 1LL7A 1FHDA 4CVWA 4CN4A 3KL3A 1ZB5A 4QFUA 1V3IA 5KEZA 1ECEA 4AW7A 2DT3A 2AMGA 3N13A 3T09A 3APGA 4FLRA 3B8SA 3W0KA 1JD9A 1DWAM 1HKJA 3SCPA 2VL4A 5ABHA 1UUQA 4WKFA 2WZIA 2V3DA 3ARYA 1CGUA 4Z2LA 2BHZA 1QHPA 5A6MA 3WELA 4UR9A 1EHNA 4OOUA 1V6WA 5A8MA 3WDQA 1BFNA 3WSUA 3CZKA 4E8DA 2QPUA 4QCFA 3GM8A 1US3A 2YL9A 3WF4A 3AS0A 5I79A 3WD4A 1B90A 4MJ4A 1HF6A 5CJ5A 3RDKA 1E40A 1UD4A 2YA1A 1C8XA 2RGLA 1E6ZA 3K8MA 1C7TA 1WZAA 1XRVA 4FLQA 3WQ6A 3SUTA 2DGAA 3N18A 3W37A 4JZ5A 4EAMA 4AZCA 2WC3A 5D8WA 3UCQA 3ZIZA 1GVIA 2XVNA 3N17A 4N0RA 2VTFA 1NP2A 3GXIA 1QI4A 3K8LA 1IV8A 3AHZA 1V03A 2ZIDA 1VFFA 2ZXBA 1W1VA 1PIFA 4ZE4A 1PIGA 1HVXA 1M7XA 2G4FA 3FHAA 2ZX7A 2WVVB 1TCMA 2PC8A 4OOZA 1KXTA 3ARXA 1V0MA 3NUKA 1UWQA 2CETA 4W85A 3A3HA 1V6YA 1DWJM 2WMIB 3MUAA 5D8ZA 3OLGA 4D6JA 2VCAA 2J7GA 4UFKA 1QW9A 2WWCA 1KCKA 1HN1A 4YHEA 1GOWA 3GYCA 4HA1A 4H2CA 3WEMA 3ARQA 3VILA 2YA2A 4OUEA 1DEDA 1GJUA 1NP0A 4HMEA 4HMCA 1BHGA 2AOSA 3GBDA 5A8QA 2JE8A 2AAAA 2V38A 4W8AA 4PCSA 2D0FA 1TUXA 2D24A 4RE2A 2X09A 3WD2A 2WBGA 1VEOA 2BVYA 1U33A 4EK7A 4S3JA 3EMQA 3CBWA 2XSAA 4J7RA 3DECA 3GH5A 1XSKA 4PTVA 1GONA 4A3HA 1XD0A 3ZJ8A 1W1PA 1UD2A 1DWIM 1B1YA 2DSWA 3SCOA 3W27A 4CD8A 4DUVA 1QI0A 1BTCA 3T0DA 1HJVA 2WC7A 5GNXA 3WFLA 1K9TA 1DTUA 1V0LA 4QP0A 1Z32X 4FLSA 5I2UA 4KWUA 3ARZA 5FD0A 5I78A 4QDMA 2GDUA 4M29A 1JFHA 3U7VA 1QPKA 3ZR6A 1B3ZA 2E9BA 5KZ6A 2J7CA 2J8FA 1VJZA 1W32A 1EO7A 2GK1B 2DPEA 4CN6A 3UR7A 1R7AA 1TA3A 2VOTA 1R8LA 3DYMA 1Q6GA 1WDPA 1J0ZA 3WQ4A 3ZT6A 3ZO9A 5A6JA 1EOMA 1VBRA 4UFLA 4AXNA 1JDDA 4MNKA 3WFZA 5A6AA 3VD9A 1FOBA 5M03A 1KGWA 1V08A 3VNYA 1E3ZA 2A3HA 5A2CA 5A6LA 2D3NA 4DWSB 1WP6A 1E4LA 4PTWA 4ZFMA 3WF2A 3ZSTA 5I23A 4WLCA 1E3XA 4WF7A 2BVTA 3GTNA 3LPOA 3AS2A 2E8ZA 1V3LA 1CEOA 3BSHA 1FP9A 4PMQA 1WDQA 1WZLA 1WAWA 1UH4A 3OB8A 5JIPA 1E4NA 3WNOA 3I3DA 5BXPA 3E1F1 4UQDA 3WF1A 1ESWA 3SURA 5JIWA 4J28A 3UESA 1C92A 1EQCA 1VBUA 1BYCA 4TUFA 2FHCA 2W63A 3AZTA 1GQLA 4KRUA 1W3KA 5BROA 1QW8A 1SYTA 3CZLA 5A95A 5JBDA 1PEZA 1PPIA 3AS1A 1E1EA 2G3IA 2VX6A 4PMXA 4JFTA 1DP0A 3CMGA 4Q22A 5IHSA 1E56A 1ISZA 5I0DA 2CHOA 1FHLA 1OM0A 4C7GA 1X6LA 3VGGA 2VT0A 3T2PA 2Y2WA 5JUVA 3OGSA 2DSVA 2DSKA 1UD3A 4Y7EA 3WN6A 3VINA 1B0IA 1UKQA 9CGTA 3VX1A 3SCQA 5M5DA 2WCGA 4U31A 2WCAA 1L8NA 1EA9C 3VMPA 2CKRA 1P6WA 4AIOA 3SUSA 3EYPA 3MMUA 5A6SA 4LPCA 1W9XA 1KR0A 1G1YA 2YOCA 3ZM8A 2GDVA 1H41A 4W89A 1SFSA 3GH7A 2NW0A 1NWUA 2DIJA 2NT0A 3KL5A 3AYRA 3K8KA 4ACYA 2OLHA 4GQQA 3WDHA 3T08A 1GOIA 1ZL1A 5C70A 2J7BA 1VENA 1IZKA 3RJYA 1OGBA 4UZSA 2X2YA 3AISA 2ZE0A 1V6XA 4IM4A 2CNCA 1MQQA 2CEQA 5HNNA 4AC1X 3PN8A 2GUYA 3TONA 4UQAA 1XV8A 3AQUA 4V27A 3TTSA 3TOPA 3FNDA 5FIPA 4CUCA 3UG4A 3JUGA 5A94A 3N04A 1PZ2A 2BY3A 5E0FA 3M46A 1H4PA 4GINA 1MQPA 2OWWA 4HU0A 3T2QA 1HX0A 3FAWA 3PTKA 4PN2A 4Q7NA 4MB4A 1FFRA 4JKMA 4CD5A 1D2KA 2XPKA 3VVGA 1V3JA 4V28A 3IJ9A 3ZJ6A 3WF3A 3BMVA 4D1IA 1RD6A 4AD5A 1LF1A 3HMCA 1I1XA 2GSJA 4ZEPA 1PX4A 1HKIA 2G8ZA 4D6DA 2GJPA 1JNEA 2VO5A 2YJQA 4CD4A 4P8WA 1E5JA 2W62A 5D4YA 4PUDA 4F9JA 1E4MM 1MW2A 3AMKA 2GJXB 1UHVA 5F7UA 3WMSA 4ML4A 1MW0A 4CCDA 4NSBA 4GZIA 1W9PA 3DC0A 1EHAA 3GNRA 1EDGA 1CXFA 4OKDA 3PHAA 1W2PA 1V0KA 2J62A 4XZBA 1WPCA 1NWTA 4D72A 3ARTA 5AYBA 1J10A 5E70A 1DWHM 2UY5A 2GJRA 3CH9A 5JBEA 1ITXA 5I24A 2X1IA 2CHNA 2ZUUA 4PSRA 4HU8A 5DT7A 2E9MA 4W7UA 1RPKA 3FW6A 1LQ0A 2WZEA 1GORA 4XZWA 5M3WA 5DO8A 2WHLA 2ZOXA 4JFVA 3VDAA 2XSBA 3HN3A 1GOOA 1HJUA 1C90A 3CUJA 2D3LA 2ZICA 1UA7A 1WNOA 2W67A 3EDFA 3MSDA 1TMQA 4TX8A 3VD5A 3DHUA 3VDHA 2OSXA 1HP5A 2WVTA 3THDA 4YPJA 1NWSA 4EKJA 2IXUA 3EDEA 5CZKA 5CSUA 2WWDA 2VVSA 3GXDA 5LYRA 2GFTA 2W4XA 1XYZA 2XTKA 4NRRA 3WH9A 2VCCA 4NI3A 3IJ7A 1G01A 3OZOA 1HJXA 4N42A 2A3BA 1G0CA 4WSJA 3SUWA 4BQ2A 1V0NA 3OGRA 1OGGA 3AOFA 3W24A 1V6VA 4ZXLA 3IAPA 3ZQ9A 1C93A 2VR5A 3LPFA 4MNJA 5A3HA 1NH6A 3VDCA 4J3UA 2EBNA 4LGXA 2WPGA 2Y24A 4U2ZA 1J0KA 1E43A 2TAAA 3QOMA 3GNPA 5BYWA 4FF5A 1W9UA 2E8YA 1CGYA 4GI8A 1J9YA 4MAVA 5DFAA 1V3HA 3WH5A 1QVBA 3MUIA 3AHTA 4MDPA 4W93A 4GZJA 4W87A 1JD7A 4CD6A 1QBAA 2PWDA 4FK9A 3T2OA 3WD0A 2WMKA 3WMBA 3CUGA 2WVSA 5CPQA 3HU7A 1QI3A 5HPCA 1H5VA 3OLIA 5HOSA 4JCMA 3WDJA 2EXOA 2XM1A 3AHVA 4AD0A 1M01A 2BV9A 4UZUA 2PF0A 2WAGA 5HBFA 3KWXA 4WKHA 4X9YA 3A4XA 5CLWA 3A4AA 1OSEA 4B9YA 2Y4SA 4X0VA 2EPLX 4HPHA 1C8YA 1TA3B 2W61A 1QHZA 3EMZA 5BXRA 1GOMA 1UQYA 3WUFA 2JEQA 1QBBA 3BH4A 4BA0A 1J0IA 2J4GA 4MJ2A 1NM9A 1QI2A 2GVYA 2MANA 3WNKA 3SCRA 1BGAA 1GPFA 5BRPA 2GJXA 1Q6EA 1CENA 3CUFA 2HVMA 2VR4A 5AY7A 3WEZA 1LG2A 2WZHA 2CESA 4MTVA 4ZXOA 5I6SA 3POCA 1HJWA 3POHA 2XFRA 3VTRA 2ZX9A 1VEMA 1MWOA 1G5AA 4EE9A 8CGTA 5BXSA 1I75A 1JZ3A 1PX8A 4D6IA 4OBSA 1B31A 3L4TA 4GPNA 5ECUA 4CU7A 1QNQA 2X0YA 1BYAA 4R27A 1GCYA 2XUCA 2EJ1A 3VKKA 4KH2A 3GXFA 3PZUA 3CUHA 1A47A 2D20A 2CBVA 1BAGA 3WNLA 3DYOA 1CXIA 2A3AA 2YDSA 3SUUA 1UD5A 1BF2A 1CXKA 2FGZA 3TTOA 3AROA 3ZOAA 5C71A 3W82A 1UKSA 3II1A 2WKGA 2OSYA 3FAXA 3W4RA 2EEXA 1HIZA 4U2YA 4ATDA 4RE3A 4GXPA 5ABFA 3SUVA 3ZT7A 1GQKA 4DM1A 3HJEA 4AYSA 1UWTA 1HP4A 1B30A 3MO4A 1GQJA 4M56A 3RMEA 5I77A 4K68A 1JGIA 3ECQA 3WNNA 2QF8A 5IDIA 3B9EA 2YLLA 2OWXA 5IXEA 4RL3A 1NQ6A 4XX6A 2ZX5A 1X1NA 2DQXA 4ACZB 1JAKA 1M03A 1ITCA 1J18A 2XWEA 1C8QA 3OZPA 2E4TA 3L2LA 1H49A 1WZMA 3VM5A 2UY2A 1GHRA 3AXIA 3OLEA 2Y5EA 2J7FA 3TP4A 4TX6A 3QHMA 2VRKA 3L4VA 4E2OA 4IPNB 1WB0A 3L2MA 4TVUA 5A6BA 3L4UA 2BNJA 3CMJA 1ISWA 2JEPA 1M04A 1UH2A 2XVLA 3BAIA 1ZBCA 4MAZA 3PZOA 1QHOA 1JDAA 1R86A 3A4WA 4M8UA 1YHTA 3ARSA 4ATLA 1WKYA 4U3AA 1XSIA 1CXLA 4H41A 5CPTA 4CGTA 2FGLA 2WLYA 3VOCA 2G3JA 4J3VA 3NIYA 4FLOA 2O92A 3MKKA 2WHMA 3VMOA 1JZ4A 5A69A 2G3NA 1CTNA 2C8NA 3SCVA 4IUGA 4UQCA 4W8LA 3UEQA 3N9KA 3WUEA 1CNVA 1BG9A 5EFDA 3ZT5A 1CGXA 2FH6A 3QHNA 2EQDA 4NRSA 4QLJA 5HPOA 4D1JA 1BVNP 3L4YA 5A6KA 4W5UA 1U30A 3TTYA 6TAAA 5GQBA 2VC9A 3RIKA 4WKAA 1E6QM 4UOZA 4D6CA 1TE1A 4A4AA 3FY1A 3OA5A 3ARWA 3VIPA 1NOFA 1ZU8A 3NSMA 3L4ZA 2BY1A 1V3MA 3VO0A 2WHJA 1W1YA 1RP9A 1IZJA 3SIMA 4EANA 1A3HA 5BRQA 1W2VA 1VIWA 1E6PA 4GI9A 4MB3A 4AZHA 1S46A 5CG0A 1PBGA 4V2XA 3CLWA 3VDBA 2NSXA 3UR8A 1UQZA 4J3SA 3PZ9A 3CO4A 5ABGA 1PAMA 2BHYA 1Q4NX 1JIBA 2ZXAA 1VFOA 1AQ0A 5I3DA 5HDRA 4WK9A 2BVDA 4JL1A 4PMNA 1OBAA 3IJ8A 2CKSA 1CLVA 2DT2A 2WLZA 1EOKA 1EO5A 3BCFA 1J01A 3AIVA 2D1ZA 2XFFA 2DEPA 4GKLA 3ZSSA 3RILA 2QHAA 4PMZA 1HL8A 4GQRA 3THCA 1RH9A 3BAWA 3RPMA 4B16A 2WK2A 3VIKA 4UCFA 5A6BD 3KZSA 2JALA 3WNPA 4W7WA 3VM7A 3F5LA 1XH2A 3W25A 1UKTA 4TXEA 3WY1A 2VZVA 1JI2A 2D0HA 3CHCA 4KMQA 1Y7VA 4PSPA 2D0GA 3WQ5A 1U2YA 1NOUA 1H11A 4HMDA 1MYRA 2VCBA 4F8XA 5BCAA 4NF7A 1UG6A 1E6RA 3FXYA 1WZKA 5A8PA 2E0PA 2ZUMA 3DHPA 1KXVA 3AYSA 4CCCA 4Z2GA 4JCLA 1JXJA 5E9AA 2CBJA 1TG7A 4HP5A 2ZUSA 3AHXA 4TTUA 5E6ZA 1UR0A 3QHOA 4UFMA 3VGHA 1QNOA 3CTTA 1JFXA 5IHRA 3ZJKA 4ACZA 1C91A 2HISA 4H7VA 3WIJA 3A47A 3SCTA 1WCGA 5D9PA 1KXHA 2J79A 3ALFA 3LMYA 4PBGA 4JKKA 2VRJA 5A2AA 3ARRA 2WMGA 1CECA 1CIUA 3G6MA 5FOOA 1TFVA 2BFGA 2Y8KA 2XVPA 4DUXA 1JAEA 3BSGA 4LYPA 3NDZA 1K9FA 5D9NA 4UFJA 2DDXA 3K4AA 1NARA 2BHUA 3FN9A 3AI0A 2VX4A 1ZJBA 3VIIA 1AQHA 3AIWA 3GNOA 3RCNA 8A3HA 1XH0A 2YL6A 3MMWA 1AVAA 1CLXA 2X05A 1E55A 1UWRA 2CPUA 4PEEA 4P8XA 5DT5A 1CXEA 1KCLA 2UY3A 1GVYA 4H8VA 1KWGA 5CGMA 3KEHA 2BXZA 2ZXQA 3U5YA 1XYFA 1UZ1A 2PWHA 4YHGA 5LA0A 3W6MA 2CYGA 5JBFA 3A6OA 2WVUA 4AZIA 1CDGA 3VGEA 1JZ6A 3MS8A 2ZXDA 1LL4A 3BC9A 4P7QA 3I3BA 1ISYA 1UH3A 2VX5A 4TVDA 1ODUA 2FH8A 1H0IA 1YQ2A 1ISVA 3WL1A 2EPKX 1C3FA 2WNWA 1ZBWA 1XH1A 1OWQA 4D6FA 4CD7A 3WKZA 1KQZA 1JG9A 2VX7A 1QI5A 1HJSA 1HXJA 4PMRA 4AZBA 1Q6DA 3B9AA 1DWGM 3AICA 5CXPA 3U7BA 3VIGA 1W3JA 2VJXA 3TA9A 1Q6CA 1MFVA 3QOKA 4DUWA 1KGXA 1UR2A 2QMKA 5CSYA 3N1AA 4D71A 1CYGA 3VD4A 4JL2A 3IANA 3N15A 1ZBKA 1FFQA 1Q6FA 3SEPA 1L0PA 4CKQA 3AS3A 3GBEA 3CHDA 2OYMA 4C7DA 3CZ8A 2DT0A 4H8UA 1F4HA 3NJ3A 1XCXA 1LWJA 5ABFB 3WBAA 5E6YA 2WSKA 4P7LA 1AQMA 2VQUA 4AIUA 2WXDM 2E40A 2D23A 1JZ7A 1W1TA 3F4VA 2CXGA 5FKYA 2OYLA 3VGDA 1OD8A 5IFTA 3QGVA 4BCEA 1J0YA 1XCWA 3GXMA 2FHBA 4E4PA 3BXWA 2WCSA 2G3MA 1QNPA 3WUBA 1US2A 2J75A 2WHKA 5HXMA 1ODZA 3MANA 4JHOA 2O9TA 3GZAA 3NSXA 4M81A 3BAJA 2UY4A 1E6SM 1VB9A 1UZ4A 2IUZA 1E70M 3KL0A 4A3YA 4HOWA 3SCNA 4TTGA 2VZSA 1R7OA 2JF7A 1H1NA 3EMCA 1WDSA 4LYRA 2Z1KA 4OZOA 2ESCA 2V3GA 1ZS2A 5DEZA 2WSPA 1GW1A 3K4DA 1GHSA 1UR4A 3PBGA 3PZIA 4HZ7A 3VIOA 1FP8A 2XM2A 4PMUA 2O9OA 4IISA 1E1FA 1VFUA 3BCDA 3SCSA 1JZ2A 2YKKA 2QPSA 1O7AA 3PZVA 1J11A 4J3XA 4GO8A 3KE0A 5ABEA 3LPGA 3ZR5A 3BLKA 1BGGA 2WBKA 3RM4A 5LA1A 3CHFA 4UFIA 4OBRA 2A3CA 2OYKA 2CBUA 3M07A 1JZ5A 3SCWA 3VD3A 1CXHA 1BQCA 4MB5A 1XGZA 2DH3A 3WF0A 4WIWA 4OJYA 2VVNA 4U5IA 1R85A 3W38A 1J0HA 1OT1A 4JIEA
chains in the Genus database with same CATH superfamily
2V30A 3OTRA 1WX0A 3QLLA 1T41A 4AEFA 1XIMA 3NQCA 4IQEA 4S3CA 1FBAA 4FX8A 2PWGA 3QV7A 4GA8A 4KESA 3UY8A 4C5ZA 2F7FA 4EPDC 1C29A 3UG3A 4QLKA 5M17A 3MO7A 4QHRA 1QFEA 4U5KA 3N34A 4NY2A 4ZENA 2DVTA 4X0NA 4X9SA 3BMXA 2XIIA 3LUTA 2PRMA 1OFOA 4LEFA 3L4XA 2Y7FA 3WMCA 3FOKA 5HJYA 4GIYA 1HVQA 2I5GA 3Q94A 3MMDA 4LOCA 1I2PA 4UFHA 3AXXA 1XYMA 3R5EA 4NAEB 1EUAA 5DBTA 1GKQA 2PB1A 1REQA 2OZ0A 4YMZA 5BNKA 1GOKA 3TR9A 4KFNA 4DBWA 3CGTA 4C60A 2J8GA 3IGSA 1YXCA 4GQGA 7TAAA 1WXJA 1PO9A 1JGMA 1JXKA 3AMDA 5TQLA 2Z1XA 3KBSA 1PKMA 3K46A 1MO0A 3HV8A 3UNTA 1KKOA 1J12A 4FXSA 4GX9A 4C7FA 3MUY1 2YCKX 2AL2B 1KBBA 3E5PA 3W1XA 4MF4A 1FWNA 4TQTA 3T55A 1LDCA 1KFWA 2BXYA 2Z6IA 1Q7MA 1M68A 1CWYA 1XC6A 3T9PA 2QUVA 4EXQA 4HNCA 1FWCC 1HO1A 1JRCA 1JULA 2CBIA 4WXZA 1VHCA 3IVSA 2OWCA 2NX3A 3EEZA 3RCYA 1SZNA 4FOJA 1PZ3A 4XIMA 1UD8A 4L9XA 2BZNA 2VQTA 1VYSX 3CNYA 2ZTKA 4FNSA 2ISVA 5LA2A 1DIDA 3WUGA 5GVJA 2PDUA 3RJXA 3UBPC 2BXVA 1MMFA 4M80A 4CNUA 1UP0A 3WD3A 3QSTA 3S3GA 3DH7A 3NM3A 1QTWA 4B5UA 3AIQA 4PUNA 2FFCA 1BSIA 3WLNA 4YTRA 4E8CA 3L5LA 1TR1A 4C6NA 1LRTA 2B7OA 2Y85A 3UERA 1YDVA 3WH8A 3I6RA 5HULA 1MW3A 2PWEA 2VFEA 1GVOA 4GUIA 3FGCA 1A5UA 1B54A 3AJ7A 3MV01 4W5ZA 3SBFA 1HKVA 3UF9A 1S2CA 5XIMA 3P93A 2ZDSA 4HA4A 1PYMA 4LALA 4Z2HA 1JZ8A 1JUKA 3U3HA 4O1DA 2Y1HA 3QV8A 2ON3A 3KTCA 1MI3A 4IPLA 3R79A 3GVVA 3G0XA 1X1OA 3RO8A 4UQBA 3TWBA 2Z00A 3V5OA 1LT7A 1TSIA 4JTCA 3WENA 1GZGA 1W1IE 2LLEA 5HJLA 4AIEA 1V4YA 1UWSA 2ZZ7A 3L0NA 4PYSA 3C2FA 4NNAA 1R87A 2ACRA 1SQ7A 4G1KA 3WJXA 4YTTA 3TU9A 1XS2A 4GUFA 2UZ9A 5F2GA 1J6OA 2CERA 3AZSA 2RGMA 1M9HA 1LWHA 5AHFA 3ANVA 3D0CA 4E4FA 3JW7A 4N4PA 3QR1A 1Q2RA 4RPQA 1BSLA 3V7PA 3ZWSA 3N2BA 3LI1A 2DP3A 3WLIA 2EPOA 1FXQA 3UWZA 4ZOBA 1IGWA 3G0SA 3LLXA 4FAMA 1B9ZA 3QKZA 4IT1A 3EWUA 1BWLA 5H6HA 3HPFA 3CB8A 4ORMA 4UTUA 1MUCA 6ALDA 2VDHA 4RPPA 4FO4A 7TIMA 3UZXA 3CZJA 4AZ6A 3TTQA 2V9DA 1JYVA 2DIEA 3NYDA 3HPZA 4HJWA 4H04A 5CZ0A 1V6UA 2QQ6A 3O6YX 3S2LA 2H8XA 4JTHA 5A8OA 2F6KA 3DUGA 4PTMA 3SAZA 5REQA 1RALA 3T44A 2IMRA 4ZQCA 1T6MA 4AIBA 3M0KA 3WD1A 4BI6A 3AMCA 2BY2A 3VE9A 1ZAIA 1BVWA 4R5EA 3VUSA 4LU0A 2RDUA 5A6TC 1B3XA 4KEUA 5C5YA 4YVXA 3LZ3A 2XVGA 2CLLA 1ZJAA 5GNYA 4GUGA 1OG0A 3ABOA 1E6XM 3K1DA 4X63A 1PVNA 2JQXA 4UTMA 3UYCA 4PMVA 3QR3A 1CW2A 3B06A 5G2HA 3H2CA 1W3LA 4JQ4A 3U0HA 2J27A 3DBPA 4JAWA 1GNXA 3FFSA 2FZMA 3B0UX 3JS3A 2PDNA 5XINA 1MSSA 5JQ9A 3L4WA 1E4IA 4Y9NA 2XGZA 2J78A 1GKRA 1LYXA 3CK5A 4JY8A 1HG3A 3KBWA 4WY0A 2PCEA 2O9RA 2E5DA 1ME9A 3W6YA 1UR8A 3WBXA 3VC6A 1D8CA 4V15A 1QK2A 3WL0A 1R5YA 1XFCA 2J47A 2DZSA 2YL8A 4L65A 1VBJA 1GOXA 4QBXA 4NJIA 3WQVA 2WJFA 3G22A 4AB4A 3KLKA 3W29A 4EOUA 5FJUA 1MNSA 3IIZA 4WOQA 2NLYA 2ZWYA 4TMCA 1K7XA 2X40A 1W9BM 2QULA 2ZUWA 3VE7A 3CUXA 3EA2A 4M82A 3PSVA 4AD1A 3TYDA 2YR1A 3R0UA 2BY0A 3QM3A 3GTFA 2PE4A 4UMAA 2GVEA 4QLLA 2WKJA 2YBTA 3UZ5A 4ZO7A 3I7QA 1GJWA 5T91A 3S1XA 1V7AA 3E0FA 2OG9A 4QJ5B 1VPYA 1JYNA 4AFYA 1DL3A 1KO0A 4HU3A 2Y63A 5T26A 1DWFM 2CU0A 4CEXC 2P8CA 2PLCA 3NNTA 3ZR4A 1JDCA 3MI2A 1IR1A 4P2VA 5D2TA 1RA5A 4XZMX 3VNMA 4A2SA 1QNSA 4M6UA 3KUMA 1OCQA 4HD5A 2I9UA 4MZYA 3W71A 1K6WA 4K37A 4H9ZA 1KTBA 3LGGA 3SN1A 3MWAA 2YL5A 4UNKA 7REQA 4YIWA 2GVLA 3MU7A 3O8AA 1W9VA 2E1WA 1XP3A 3ZXWA 1TPEA 5B7ZA 3I65A 2PDMA 4EACA 1KTNA 2WJZA 4FS9A 4KBXA 2XIBA 1GZJA 4MUPA 4E2VA 1EDTA 4UTTC 3W6LA 3PULA 3CZEA 3RNDA 5D9MA 1V02A 1ZNNA 4QSFA 3T1GA 2DH2A 3IS4A 3UZWA 4CLMA 3QBUA 2YZ5A 3M6YA 1Y8BA 3WQEA 4YWSA 3CEPA 4DWSD 3ZVIA 4AH7A 3PAOA 4MJZA 2JKPA 1ISXA 4PRWA 1G94A 3PNZA 3D3FA 3IK2A 3QZAA 4MLJA 4FHAA 3BW4A 2VFHA 3R10A 1BVZA 4DJFC 1LL7A 3GU2A 4CVWA 4F2UA 4E6MA 1V3IA 4NKCA 3LERA 2NXHA 1ITQA 4QM1A 3EB2A 3N13A 1UOZA 1YIXA 4JTUA 3W0KA 5CBBA 2XN1A 5I06A 4C1NB 5LXEA 4PBEA 4WKFA 1CGUA 1AFSA 2DZVA 4X2RA 4L56A 1Z48A 4I5XA 4OOUA 4JQAA 5HNTA 4QITA 4ES4A 1BFNA 3TYZA 3JZUA 4E8DA 4ADSA 5FI8A 1TX0A 3MVIA 4V33A 5D03A 5I3GA 5GJNA 1ZY9A 1B90A 4MJ4A 1N8IA 3S2NA 1VCVA 3P61A 1E40A 1UD4A 3KVJA 4PB4A 1C7TA 1WZAA 3G3DA 1RR2A 1S2AA 4ZB5A 3WQ6A 2PTZA 1TV4A 3W37A 4DYEA 5LHFA 4RNFA 1D8WA 4AZCA 1K77A 2YGYA 3LHWA 4MUZA 1V8EA 1XDJA 2ZC8A 4MGGA 3NGFA 2XVNA 4DQWA 1XRTA 4CQ9A 1P0KA 2J9ZA 1M7JA 1LTDA 1DJIA 4JTJA 5TAOA 3N4FA 3O05A 1UZHA 1S1PA 2HBVA 1M7XA 1Q2SA 3B0VC 4A3RA 1TCMA 3MP4A 3W85A 1KXTA 2TMDA 3ARXA 1XBXA 4YTSA 3NYZA 3A3HA 2VWTA 2Q3RA 3TYUA 2E09A 4YVPA 1MRQA 1W6TA 2VCAA 4HPXA 1HN1A 4PUKA 3H2EA 4LAOA 4HA1A 2VDGA 3ABQA 4H2CA 4WRHA 3HG3A 2PDCA 2V69A 1TJ2A 1GJUA 3D6NA 1DBTA 1G4PA 3BVJA 3U6WA 3LRKA 2V38A 2D0FA 5CZJA 2D24A 2X09A 2Y88A 3BDKA 3F7JA 1O1HA 1U33A 1TR9A 4EK7A 3EMQA 4XAGA 3S9YA 5F1UA 2DUZA 1XSKA 1GONA 1POKA 1XD0A 3GFXA 1V93A 3OBKA 1IT7A 3APYA 3W7QA 3RPTA 3CPRA 2DSWA 1TV3A 3KLLA 3W27A 1DE6A 1QI0A 1LBMA 1AUSL 1BTCA 5EBUA 1HJVA 3BTNA 3HPAA 5GNXA 4N9EA 3TYEA 5HR7A 1Z32X 3GHUA 2B7NA 4KWUA 5FD0A 2O56A 3HQNA 2GDUA 4M29A 1JFHA 4RZBA 3PPHA 4ZQOA 2VD8A 4ERAA 1M5WA 2NVDA 2J7CA 2ZVRA 4O1CA 1WUFA 5D37A 1IXNA 1R7AA 3FLUA 8RUCA 1YKWA 1WDPA 1PTGA 4DO6A 1IIGA 3ZT6A 3M47A 3ZO9A 4AXNA 3DG6A 4ALDA 1JDDA 3WFZA 1OX4A 4Q8TA 5M03A 1EXBA 3PUEA 3UVAA 3RU6A 4DWSB 3WF2A 3FVMA 3VC5A 3ICJA 2D73A 4ZMGA 3GTNA 1DIEA 1MEIA 2I5IA 4GVGA 1VPQA 1H50A 5HQMA 2GDQA 5HQEA 5AZ0A 1HKWA 1QR7A 3K30A 1Y65A 1ZCCA 3WNOA 3I3DA 4HTBA 3SURA 2HNEA 4J28A 3AXKA 4J9JA 3TJLA 3UESA 2G97A 1BYCA 4TUFA 4KRUA 3W23A 3IGXA 4PCFA 2G95A 1S3TC 2IKGA 1OVDA 4PFMA 3LHVA 3HTWA 3TSDA 5A95A 4M19A 3ABXA 1T40A 4DPPA 2G3IA 4PMXA 3MCMA 2FZBA 1XLIA 4JFTA 2Y7DA 4Q22A 5DRCA 4LF2A 1H61A 1A5NC 2VM8A 2XIJA 1X6LA 3VGGA 1T8QA 3A5FA 1H5YA 1BRLA 2Y2WA 3NL5A 3C2OA 2NZLA 1IWPA 2GJNA 3GKFA 3LCLA 3W2NA 2C6QA 1XC4A 3IPWA 4J4KA 1NFGA 4UB9A 3G1XA 5M5DA 4IF2A 2CKRA 4AIOA 2WOQA 3MMUA 4LPCA 1M7OA 2OPJA 3G3MA 1G1YA 3NQ7A 3C6CA 2GDVA 1H41A 2YFOA 4W89A 4Q8NA 2NW0A 2DIJA 2NT0A 3K8KA 2OLHA 4K38A 4FR1A 1NFPA 4OTKA 3WDHA 4LVAA 3T08A 3BLOA 1IZKA 1P6CA 2FB2A 3QV9A 3KS5A 3UWUA 4HSNA 1V6XA 1YX1A 2CNCA 1RBOB 3QZ6A 3GR4A 3DFQA 3PN8A 2GUYA 2QCFA 3BJTA 3BW3A 5CPOA 4UQAA 4TIMA 1F2JA 2GGEA 3R1ZA 3TTSA 3PB2A 3TOPA 3FA4A 4IPIA 1UIPA 7PTDA 3OYZA 3W86A 2BY3A 2PDWA 1G67A 3BPWA 4Z0JA 4GINA 2OWWA 2PTYA 1Y0EA 3T2QA 1A53A 3FYOA 2P88A 2X30A 2Z27A 4MB4A 3C0JA 1QAPA 1XW8A 2XPKA 3W7RA 3KFTA 4H8NA 4V28A 2VC7A 5BU6A 3TE9A 3HG5A 4ADTA 5FEZA 2GSJA 3NO1A 2FMOA 3THAA 1DXIA 1JNEA 2VO5A 2ZRWA 4P8WA 5LNRA 2VD9A 3GFYA 3AWOA 4F9JA 1MW2A 1KBLA 2PWUA 2GJXB 3LTPA 1R3VA 2AAMA 3WMSA 1MW0A 4CCDA 4NSBA 4DJEC 1W9PA 3UP8A 4NHVA 1EDGA 4I9TA 4DWDA 3T05A 3CL8A 3TNBA 1WPCA 4IH3A 1JCYA 5AYBA 1DWHM 5CZTA 3CMFA 4WJEA 5I24A 4PSRA 4WOZA 4HU8A 4A2RA 4ZOEA 1OYBA 3E2QA 1ZJHA 2E9MA 1R9XA 2H9AA 3AJXA 5CG7A 4XZWA 4OV9A 4YLWA 5M3WA 1A49A 2WHLA 4EXBA 2XINA 3SGUA 4MY9A 2D3LA 2C1HA 4GJJA 4K7VA 2O7QA 5EL1A 3WJWA 2OFJA 1TMQA 4UTWA 3S9ZA 1A80A 1J5SA 3RCMA 5IBXC 4YPJA 1NWSA 4EKJA 2IXUA 5CZKA 5CSUA 4QNEA 2YXGA 5F1VA 2VENA 4NRRA 1OZQA 2OKOA 2IPFA 1UASA 1SSDA 3IGHX 1FXPA 3PWIA 1G0CA 2V82A 3CWOX 2Y5JA 3P84A 3V75A 3M5YA 4BQ2A 1V0NA 4M0XA 1QW7A 1V6VA 3LXBA 5A3HA 3VDCA 4J3UA 4ZCWA 2WPGA 1I2RA 2ATMA 3QRHA 4U2ZA 3QOMA 1R3SA 2J88A 3BWWA 2NQLA 5BYWA 5DANA 4N6FA 4FF5A 1JCLA 1Q45A 2X42A 2OOGA 5DN1A 1XL9A 1SR9A 1FHVA 4DO4A 4MAVA 1YDOA 3BSMA 4XKMA 4MDPA 1XFBA 4O12A 3EPMA 1QBAA 1V6TA 2PWDA 1MEWA 4FK9A 4M6VA 2PDBA 1QWKA 3HU7A 3NOEA 4H4IA 4Q4RA 3M0XA 3WDJA 1E0UA 2EXOA 2QPXA 2I7GA 4RUBA 3OO2A 1M01A 3DFPA 3N19B 2BV9A 4UZUA 2PRLA 2PF0A 1H62A 4WKHA 1AQFA 3G8EA 1A5LC 2EPLX 3UFYA 3CASA 3ENLA 4DZ5A 3R12A 1QXLA 1J96A 5G1MA 1FUYA 1FDJA 1QO2A 1KM2A 1TPVA 1Z42A 3AWNA 5FSDC 2Z26A 3SSJA 2J4GA 1GWJA 3SQLA 3WNKA 3OG3A 1SVDA 1GPFA 1OQFA 1OYCA 1AD1A 1Q6EA 1NU5A 3CUFA 2VR4A 3A3XA 3WEZA 3TC3A 3P0WA 3C56A 2X16A 2Q6ZA 2C13A 3UG8A 3KRUA 4N6EA 4ZXOA 1XGDA 4GG9A 2PP1A 3RX3A 4GCXA 3L9CA 6PTDA 4EE9A 1I75A 1LWIA 4MWAA 4PMJA 2X0SA 2R14A 3GWQA 4MIMA 2Y8UA 1BYAA 3VKKA 3TJXA 5DCDA 3CUHA 1UPPA 2D20A 3Q37A 4EIVA 3MBDA 9XIMA 2PAJA 2A3AA 4PFHA 2YDSA 3SUUA 1UD5A 1BF2A 3H7VA 4DJFD 3AROA 1W3IA 5C71A 3V4BA 3II1A 1UJPA 2EEXA 3PUDA 5G2WA 5C55A 3IV3A 4GXPA 1XINA 3SUVA 4DM1A 3HJEA 1RCQA 3R94A 4OGZA 1UWTA 4JN7A 2REQB 3U8GA 5FJJA 1JGIA 4S3BA 2QF8A 1K3UA 2OEKA 1AL8A 2YLLA 2E77A 4RL3A 4J1OA 5AECA 1FWSA 1X1NA 1JAKA 3G1DA 5I09A 4TX9A 1ITCA 5CAHA 3OZPA 2E4TA 4IGSA 3OLEA 3S5ZA 3U4AA 2J7FA 4Q4PA 3DXIA 4XQ6A 3L4UA 3IJDA 3B8DA 3GO2A 3LBOA 4MAZA 4I9JA 1JDAA 1Y5VA 4M8UA 4PBFA 3H6OA 1XSIA 4H41A 3V36A 3F4WA 5C2XA 2WLYA 3TK7A 3VOCA 2YX0A 3VMOA 2CZFA 3PP7A 2B81A 3LHUA 4H6KA 4W8LA 3WUEA 1BG9A 4C90A 3QHNA 4D1JA 5AYYA 3TTYA 5CEWA 1OFPA 2F2KA 2VC9A 5AVHA 3QF0A 3W75A 4FEZA 4RV8A 1J5TA 1ZU8A 3NSMA 3TW9A 4DAFA 4DZAA 1UC5A 1KM3A 2WHJA 1DJNA 3NL2A 4K36A 1IZJA 1ZFJA 2OELA 3QYSA 1PIIA 5BRQA 1E6PA 1GK8A 4GI9A 1S46A 4KKXA 1SW0A 2VEPA 4O0ZA 2PDFA 1XR2A 1KNWA 3SN0A 3G1VA 1EJRC 3GKAA 3WLPA 2BHYA 1JIBA 3OODA 2RH9A 2ZXAA 4NQ1A 5I3JA 1JCTA 1AQ0A 4ZGYA 3KM8A 3OQ8A 4OECA 5HMDA 3PPGA 1I2NA 1TV2A 1CLVA 3PUOA 4L9ZA 4KWOA 1HQTA 2OMAA 2ZZ4A 3AIVA 4FXRA 1XLGA 3WFAA 3FJLA 5FF0A 3RILA 1B4EA 4PMZA 1VLIA 3THCA 4B16A 4O4VA 3C61A 3F5LA 2GPTA 1G4EA 4WJ8A 1XH2A 3XIMA 1VLWA 1AZ1A 4TXEA 4M7TA 1F5ZA 2DORA 1XLMA 2JKEA 4GUJA 2HZGA 4PSPA 1JR1A 2D0GA 5BW6A 1VQTA 4HMDA 3U2OA 4IIEA 1S1RA 4BI7A 4IIBA 2UBPC 1PWLA 4NF7A 3W2LA 3G24A 4INFA 3FXYA 5A8PA 1TRDA 2E0PA 4NZJA 3G1YA 4HCDA 4M6QA 1ICPA 4HP5A 4JN8A 4TTUA 4UFMA 4JBRA 4HN4A 4GD0A 1JFXA 4Y8EA 4LCSA 2O55A 5IHRA 3HFTA 3N73A 3USZA 1PDZA 3HO8A 3TSMA 4DI9A 3LY0A 2J8TA 2J79A 1JDFA 2NV1A 1GZ1A 4YJ5A 2VRJA 5A2AA 3ARRA 4DYKA 1RQHA 2YXXA 4IL0A 4RZ6A 1GG0A 3SM0A 1TFVA 2PURA 3B03A 4XZHA 4DUXA 4RXFA 3G1SA 3NDZA 5F4WA 3LM7A 1ZPTA 2BHUA 4UR8A 2XIQA 3AI0A 1ZJBA 5FJOA 1I60A 1XH0A 3QSRA 3M4HA 4O15A 1AVAA 2Q8ZA 3NQ8A 3KW3A 1UWRA 4PEEA 2IQ0A 3LEPA 5DT5A 2W0UA 2ZZ5A 1CXEA 1NVMA 3P82A 2QIIA 1GVYA 4H8VA 1V79A 2OGJA 4LV4A 3H7RA 4NAFB 4B4FA 4FNTA 5CC5A 1PZ1A 1TQXA 4YHGA 5LA0A 5JH1A 5B7YA 2CYGA 5JBFA 2WVUA 1JPKA 1A50A 1LL4A 4P7QA 1ISYA 1UH3A 2QUUA 1ODUA 4XD5A 1RSCA 4OHQA 2WNWA 2PLKA 3OHIA 3W22A 1G4SA 2QF7A 3GW0A 1J93A 1JG9A 3P3BA 4F48A 1HXJA 3NFUA 4PMRA 4DXXA 2AQVA 4PCPA 3STGA 2XH0A 4H83A 3W7IA 1Q6DA 4EVZA 3B9AA 1LCOA 1S3HA 3EOEA 4LRSA 4Q8PA 3AICA 3VIGA 3H21A 1W3JA 2VJXA 4NG3A 2V6AA 3ME3A 5CSYA 1FRBA 1M6JA 1CYGA 1UBPC 2CLEA 3PBUA 3UA4A 2HEJA 1WV2A 3UY7A 4CKQA 3AS3A 1ALDA 1PDYA 2INFA 1D3GA 2X1RA 4IFKB 3TTEA 3L7RA 3FYYA 4O52A 4DYJA 1F4HA 4D2JA 3WYZA 1LWJA 1IEQA 5ABFB 4OVXA 4P7LA 2VQUA 4RX0A 2E40A 3W76A 1TB3A 2OYLA 1SJBA 3WJSA 1J0YA 4E4PA 4ZQMA 1F6KA 2WCSA 1QNPA 1XBYA 2ZQ0A 3S9IA 1ODZA 3MANA 2O9TA 2FVMA 1UZ4A 4LNYA 4A3YA 4HOWA 3V18A 1IXPA 3LI0A 2VZSA 5G4HC 2ADAA 2HE5A 3EMCA 3FJ6A 2Z1KA 3YPIA 1YNYA 3NQAA 4RDYA 5LSMA 1THFD 4HZ7A 3W02A 3VNKA 2O9OA 3UU0A 3SADA 4LBRA 4JHMA 1YE4A 3DERA 4GO8A 2XH4A 3QLDA 3LPGA 2OODA 1F6PA 3ZR5A 5FEWA 1BGGA 4W9TA 5LA1A 1JPMA 4OBRA 3SCWA 1CXHA 4MB5A 2ZKMX 5C9RA 1VYRA 4U5IA 3MYOA 1J0HA 1OT1A 3VK5A 3MZNA 3BW2A 3VGBA 3T42A 6TIMA 3LPPA 1ADDA 1HJQA 3GR8A 4S3AA 1IEVA 4I3GA 3HV9A 1JYXA 3L65A 1WKEA 2DZAA 2WM0A 1F4AA 1JQXA 1Z44A 1KKRA 2NT1A 4JHZA 1V3KA 1QATA 3J7HA 1K8CA 3KOYA 1UZDA 4HYWA 3W9ZA 5BWFA 1H51A 3GSMA 3MJYA 1XLJA 2IS7A 4US5A 3MPGA 1EIBA 2VEIA 1KTCA 1FH7A 1CLKA 4URIA 3OZYA 3UETA 1KM5A 1MRAA 2H3BA 4S1FA 2D22A 3FHQA 3NR0A 3CV7A 4AISA 4XD6A 1XPYA 4XUYA 2BOGX 1FA2A 3WH7A 3WDIA 3ANUA 3OLDA 1NWRA 4F0KA 3ZMRA 3GC4A 4GRSA 3NQDA 3OIHA 4GY0A 3COTA 1GVRA 3V1PA 4GI6A 4PMYA 2FHFA 4HTYA 1DHKA 3VMNA 3DGRA 6ENLA 3C2VA 4UOJA 4DO7A 4Y96A 2RJHA 3B4UA 4GABA 1Q6OA 3W7CA 3AIRA 3MWCA 2PODA 4GVHA 2QLYA 1E0XA 3KHDA 2EO7A 4AF0A 2NQHA 4HT3A 1GQNA 1JDEA 1Q7ZA 7A3HA 3WDRA 4GX8A 1SSGA 1R9ZA 3S83A 4M3PA 2JBMA 2DW6A 5C6MA 3AZRA 1KXQA 1KFEA 3AMLA 3IUIA 3N4EA 4I6KA 5A8NA 1ICQA 2WMJA 3GY1A 5D33A 5FCZA 3NEVA 2Y61A 2YCLA 3T0CA 4GHRA 2OB3A 6XIMA 4QE1A 1JCNA 2W92A 4L4OA 5BU9A 1VF8A 3W01A 1B3YA 5E0CA 3AFBA 4R9XA 1XG3A 3UXAA 1BYBA 4S2CA 3W87A 1XGEA 1ZHAA 1A4LA 3U2EA 1OINA 3CLMA 3NXFA 3W1RA 2WZMA 4HIBA 4WCJA 3PG9A 1OABA 2B7PA 4WX2A 4KW2A 4CVUA 1JCMP 5CKSA 3MKCA 1SJAA 3BAKA 2JGYA 3F4NA 3P8JA 1EF2A 4IWWA 2QCMA 3VKJA 3MI3A 3MHGA 3RLHA 1O94A 3HPXA 1UUMA 2J77A 3AMGA 4S3KA 4XD3A 2ZE3A 1QMLA 4H01A 4RNIA 1S5VA 3I4KA 4FALA 6XIAA 1JF5A 5IDZA 4AXKA 4EX4A 1HGWA 5BWAA 4XVEA 1HKMA 2Z1SA 3NVDA 3L5AA 1ONEA 4L1GA 4GYJA 1Q5MA 1S2VA 4XZ9A 5A5WA 4L4PA 4MADA 1VAHA 4CNNA 3T0AA 2X8RA 3SCUA 2WV8A 4HGXA 3VNZA 3PK7A 4YWIA 1HGYA 4ZE5A 3UG5A 2HV5A 2XDFA 4JTKA 3TNOA 3RG6A 3LHZA 1OD0A 2JIEA 3M16A 1GOQA 4K3ZA 3PTQA 4DRSA 4NAEA 4RJEA 1U1UA 4Q7IA 2YW4A 3KP0A 3ARPA 2A5HA 4BF5A 3FVDA 1Z41A 4RZ5A 1Z9AA 3W7DA 3F2CA 4AHQA 3T7VA 3E12A 5FL0A 2PU0A 2FYMA 1JL8A 4F66A 3O6DA 4RK8A 5G4EA 5H8PA 1E15A 3LM3A 5CPMA 4YN5A 5SWUA 5U7SA 4JTEA 1X97A 1TVPA 2A7RA 2WVVA 4Q8MA 2ZUTA 4F3HA 2OQYA 1BYDA 4D6EA 4CQAA 5I5RA 3EDKA 4GY7A 1SFLA 3RR1A 4BZYA 2WMIA 3VGFA 4JS3A 4X22A 3LCGA 3ISIX 1EQPA 1KA9F 3EWCA 5FACA 2DUAA 3MDUA 4J3TA 4ADUA 2HTMA 1JI1A 3ZJ7A 4AZ7A 2DZPA 1B3VA 4E4UA 1K8XA 1AJZA 2J25A 3B9NA 1L6SA 3TWAA 3W7KA 1EEPA 5PTDA 1QK0A 2BLEA 2JF6A 3KOXA 3QMRA 1HO4A 1VJIA 3S2CA 5DMMA 2PLMA 1G7VA 2P50A 5FJRA 3FDGA 1D7FA 4U4MA 4AMAA 4GLEA 3C3UA 5K7JA 2VFFA 1B3WA 1RLCL 1W5MA 1YNPA 3REQA 1C7SA 4RNHA 4O0KA 3FEQA 4S23A 1W1B1 2VDIA 3OHMB 3LV6A 3S5NA 3SY8A 4XSMA 2DSZA 2J7EA 3B8IA 3P8IA 3QTGA 2R9RA 3DENA 2FTPA 3L21A 2ABAA 1GUVA 2EJAA 4HZ6A 1TWZA 2XFYA 3EX3A 2ISSA 4HOXA 5GJPA 4C1KA 2I56A 4EPEC 3OG2A 5AYZA 3DESA 4LW7A 3CUIA 1JNDA 1UKPA 1FWTA 3WH6A 1HTIA 2GK1A 5CPLA 1XICA 3MV11 4R9OA 1KM0A 1KBKA 2BOEX 4WSKA 4H9VA 1VCFA 2V3EA 3AIBA 3RM8A 1L6FA 4GIAA 1N8WA 4Q32A 1PJ9A 1LLWA 4WVXA 3AIUA 4TVCA 4LS0A 4GI4A 5BMXA 1E1CA 2CITA 2A7PA 5J5DA 2WSYA 4Z2JA 5C7HA 1W91A 4XTIA 3VKAA 1KQYA 3CIWA 1XHGA 1DV7A 2XYLA 4QDWA 3H8AA 4IMGA 4W86A 5DMNA 5ENLA 3LN3A 1UD6A 4Q8UA 3N9RA 1E0VA 1REQB 3KOZA 3W1QA 1R6WA 4AEEA 3OZMA 4H9UA 5FA5A 3AALA 4O8RA 3MHUA 3WEOA 1SR0A 4MPKA 1T0OA 4QNWA 3BOLA 2V5BA 4ASTA 1AD4A 3N6JA 4GFIA 4AD3A 2VURA 5E09A 2FJUB 5IOBA 4AD4A 3CYJA 3EBVA 4NX0A 4F0LA 2CXEA 4LUTB 2C19A 1KCZA 4D6GA 2E3ZA 2VZOA 5TD4A 1CPUA 1OFAA 3LLDA 4QE5A 1V02E 4PTDA 4KCUA 3IIOA 3NZ1A 4DXKA 1EYWA 2NVAA 3LMZA 4O54A 4ZQPA 1Z3NA 3RM9A 4UTTA 3WLOA 1EJXC 4B15A 3H4XA 1D3CA 1B4KA 1EGZA 1CGVA 2HCVA 3VIFA 3NPUA 1ML1A 2P53A 4US6A 3VXGA 4UCGA 1MDLA 1I0DA 3NPWA 4WDTA 2HK1A 4OQVA 4JFWA 4LTSA 1JVNA 1BLIA 3EOLA 3OYXA 2YBUA 1RD5A 4PULA 4GMEA 5EPDA 4U33A 4P8VA 4XBKA 1MW1A 3B0XA 5CBJA 1IT0A 1OIMA 2C91A 4PZVA 3O2LA 4JOMA 2FDSA 3FGCB 1WKFA 3WDPP 1FHDA 1IT8A 1UCWA 2ISDA 1YDNA 4XBSA 2WZTA 3KL3A 2ZA3A 2Y5SA 3C5QA 4QFUA 4XAFA 2ZRYA 1AG1O 4LBUA 4AW7A 3BK0A 5CH9A 4E8GA 2AMGA 1A5SA 3KRSA 2QT3A 1O68A 3EPNA 3B8SA 1J2WA 1DWAM 3VKDA 1VP5A 5JH2A 1QOQA 1KRBC 1MEHA 4IMDA 3MJMA 4P61A 5A6MA 4UR9A 3BICA 1QNVA 3HF3A 2OJPA 3GIQA 1DORA 5U4NA 3WSUA 1EC8A 3GU9A 4QCFA 3ZFHA 3IVUA 3WF4A 3AS0A 3QQWA 5I79A 2FZ8A 3WD4A 5CCZA 3TC6A 5MHBA 3L5MA 3STPA 1HF6A 3LHYA 1IEXA 3K8MA 3ORWA 1XLAA 2WPBA 2A2IA 4LCQA 2C79A 1IZCA 1ME8A 3I6EA 3MQTA 5XIAA 4DZHA 1WYIA 4MY8A 1NP2A 1DJZA 2QEZA 1Z8AA 3AHZA 3W7NA 4FA3A 3OVGA 1VFFA 2OCZA 2ZXBA 4NJKA 4MWAC 1PIGA 1HVXA 3R0DA 3UZJA 1EA0A 2ZX7A 3FSTA 2PC8A 4OOZA 3NUKA 2NQ9A 2FVKA 3BZGA 1ZLPA 1DJXA 3E9AA 2CETA 1V6YA 5LNUA 2H8ZA 3EWDA 5CJMA 3H23A 5DLCA 1QW9A 2WWCA 2QV5A 3H2OA 4HVXA 5REQB 1Q66A 2EG8A 1LROA 1NP0A 4HMEA 4LY8A 3WLHA 2JE8A 2AAAA 4KFOA 4W8AA 2WNZA 4PCSA 1HL2A 1YADA 1VEOA 3UPWA 3N2OA 4NP7A 4XZLX 4Z42C 5E9XA 3CBWA 1XISA 1GT8A 2GOKA 4J7RA 3GH5A 3H7UA 2ZC1A 4PTVA 3GUWA 1W1PA 1EUNA 1DTNA 2A3LA 4ZOAA 3UGVA 4G7EB 2WSQA 1UB3A 1VPXA 4Q6JA 2QJGA 2RFGA 3TX9A 3GLCA 4CD8A 4DUVA 3E0VA 3CC1A 3EWXA 4D8ZA 3F2DA 2WC7A 3WFLA 3LGEA 3HG2A 1ZSXA 3RFAA 4JIHA 3ES7A 1QO5A 2Z7KA 4FLSA 3M1ZA 4H6RA 4N7QA 4QDMA 5DY3A 1QPKA 3ZR6A 3M0JA 5BZAA 2P10A 4FX7A 5T8GA 3IK4A 1GVEA 1F61A 1GVFA 1XLDA 1EO7A 4HHLA 2DPEA 3DYMA 4C1NA 1J0ZA 3WQ4A 3R7MA 4UFLA 3BGJA 1KFCA 3C0SA 5H2ZA 1KGWA 3HJZA 5A2CA 4WZHA 4TV5A 1GVSA 1WP6A 4PTWA 3ZSTA 2FGBA 4WLCA 5I23A 1E3XA 1RAKA 4WF7A 1LOQA 2GSEA 3LPOA 2OEJA 2F6UA 3TXVA 4MKSA 2P1FA 1FCUA 3EZ4A 1K4GA 3GC2A 4PMQA 4FI4A 1MNZA 1VCGA 1WAWA 3OB8A 1TWIA 7XIMA 2W27A 1E4NA 1ESWA 4BWLA 1TPWA 1EQCA 1VBUA 3EA1A 1UR3M 1W3KA 5BROA 1SYTA 1Q3NA 1P0NA 3M5VA 3UJ2A 4AWUA 3KZPA 1PPIA 3AS1A 1E1EA 1WDWA 3CQHA 3H2MA 1DP0A 3S5SA 1PYFA 4RW5A 3HGJA 1E56A 5I0DA 2CHOA 2JK2A 1FHLA 1AA1B 4C7GA 3KOFA 3JR2A 4CNTA 3FA3A 1O5QA 3NAVA 1B0IA 4D9PA 1UKQA 4GGBA 3V5FA 7REQB 3HMJG 3RLUA 3V0TA 1TJ0A 3VX1A 1EIXA 2WCAA 2BVWA 4OWGA 1SM9A 1P6WA 1ZZMA 3E0WA 2GGHA 3EYPA 3A5VA 1LUCB 4JIRA 5H91A 4H9YA 2R6OA 1SFSA 1NWUA 3KL5A 3CTLA 5FAGA 2QAPA 1BXCA 4ACYA 1Z7AA 1H7WA 3BOXA 1YTEA 4GQQA 3B9OA 1EP2A 1OGBA 1RJRA 1CCWB 1P1XA 5D38A 5HNNA 2BGNE 3W1LA 4CNOA 3SECA 1LZOA 3TONA 4CNPA 3WG6A 4V27A 2IKHA 4GC4A 3VNDA 3FNDA 1FWGC 3UQNA 2G4JA 4Q4MA 3M46A 4M1BA 1XRSA 1TZ9A 4AAJA 3FS2A 4L1XA 1ELSA 4PN2A 2NX1A 4O1EA 2R94A 2I57A 1FFRA 4ZR8A 4CD5A 3GVRA 1D2KA 4MYAA 4KWVA 1W5NA 3MCNA 1I6NA 2POTA 3IJ9A 3SSZA 4C6CA 3TUUA 5D2VA 4D1IA 3R43A 3GAYA 4AD5A 2DZBA 2V5JA 1LF1A 3EX2A 2EPHA 4D6DA 2GJPA 2Z2UA 3T4WA 5BRBA 2NLIA 2CZVA 1E4MM 3NQBA 4MZ1A 3M44A 5C9XA 2DZWA 3ABSA 3W72A 5EMJA 1T5AA 1GTHA 2TPSA 3PNUA 4GZIA 1EHAA 4A8NA 4DPQA 1CXFA 3S2MA 2BB0A 3N4AA 1V0KA 4XZBA 3R2GA 1MDRA 1NWTA 4AVFA 5E70A 5JBEA 3CH9A 1W31A 2ZUUA 4DN1A 1GPWA 5EMLA 3VKCA 3BV4A 5DT7A 3RN6A 1RPKA 3FW6A 3IARA 3QFWA 3TQKA 4B92A 1LQ0A 2WZEA 4JIPA 3VDAA 3W73A 4JFVA 4UTIA 2R8WA 2WO5A 2XSBA 1HJUA 2PP3A 4ZTYA 4FF7A 4IHCA 3M0IA 1UA7A 5J5RA 5B80A 2WQDA 2ACQA 3MW7A 4O1FA 3EGJA 1K8YA 3VDHA 2HE8A 2WVTA 1FWFC 1KRMA 3EDEA 2WWDA 2YCIX 3BO9A 3HGOA 2GFTA 4RE0A 5JMUA 2NV2A 2VCCA 1E9IA 3TDFA 2AQWA 3OZOA 4H3DA 4N42A 1S2UA 2A3BA 4WSJA 3NQGA 4EP8C 2OKTA 3AYVA 3GZ3A 3EEGA 4C6FA 3LYEA 1WXYA 4OT7A 3C8NA 3I6TA 1ZENA 3VKBA 2SFPA 4ZXLA 2QGYA 1JQVA 4GK8A 5AC8A 2GUUA 2Y24A 4GIRA 2TAAA 1DPMA 1NDYA 1BEUA 4J3ZA 5FF3A 5DFAA 1XLEA 9XIAA 3WH5A 1SO4A 1QVBA 1KC7A 3MUIA 3NZGA 4IX0A 3IEBA 4W93A 3ZLFA 1LRNA 2AMXA 4A3UA 1KFKA 3S5OA 3GS6A 4JPGA 4KWSA 1OY0A 2Y6ZA 3RR4A 3T2OA 4WQ6A 3WD0A 3WMBA 1XIIA 3CUGA 2WVSA 2BGQA 5CPQA 2DVUA 1XG4A 3N14A 5G2IA 2PZNA 5DBUA 1H5VA 4WR3A 4JCMA 3BQ6A 2KX9A 3LOTA 3T8LA 3DFNA 2XM1A 3FEMA 4AD0A 3QFEA 1L6GA 2WAGA 3KWXA 3M0YA 4X9YA 2GVJA 3A4XA 2E68A 4JIIX 2QUTA 3A4AA 2Y7GA 2YCEA 3KX6A 1QPNA 3IIXA 4RXGA 4HPHA 1X8CA 1RK6A 3ITOA 1RJPA 4XISA 3A12A 4K8HA 3M9YA 2XIMA 4Q8WA 4BK9A 4EPKA 5FJPA 1UQYA 3W7PA 4GOAA 4UXDA 1OX4B 1NM9A 2GVYA 3OVPA 3SCRA 1S5NA 4MWAE 3GDRA 5BRPA 2GJXA 1KM6A 1UROA 4N2YA 3ABZA 1C9WA 5AY7A 3B8VA 5EA9A 5HJXA 2WJDA 4B5TA 4MTVA 2D2JA 3BOFA 4NX5A 1XLLA 5AN7A 3WK3A 2WNNA 4R3UA 3POCA 3H2NA 3ZLGA 3SFWA 4B5VA 3GG1A 3TZNA 4NZFA 1G5AA 8CGTA 3FA5A 1JZ3A 1XQKA 1SJDA 1W1ZA 1ZJIA 3PF3A 5ECUA 4CU7A 2Z29A 3QV6A 1GCYA 1H7PA 2QYGA 3PZUA 3AU2A 1A47A 4WGHA 2CBVA 1IGSA 1LP6A 3WNLA 3G1HA 1OFBA 1XF0A 2VFDA 2NX9A 3UVIA 3C2RA 1PXGA 1U1JA 2ATSA 2ZYFA 3UCCA 4U2YA 3ZT7A 1GQKA 1E9YB 2YW3A 1DJWA 2B0MA 1TMHA 1HP4A 3B8UA 3RMEA 4HU4A 1SPQA 5I77A 3ECQA 3WNNA 3UR5A 4PCNA 2OWXA 4KF1A 5IXEA 4RCXA 4XX6A 1OX6A 5FAJA 3DBNA 5G1YA 1C8QA 5HAOA 3L2LA 2BG5A 3OOQA 1PKYA 1WZMA 4LB4A 1ONRA 2UY2A 3AXIA 1S2WA 8TIMA 3EXSA 3TP4A 3QHMA 3L4VA 4E2OA 3OVRA 1WB0A 3GYEA 4TVUA 1BWVA 2C16A 1ISWA 3CMJA 2XVLA 3W2UA 1ZAJA 1ZBCA 1L8PA 1QUMA 1YHTA 2Z2BA 1CXLA 2Z0IA 2PGEA 3THUA 1ZAHA 2OQHA 2O92A 3PJTA 1XQLA 1CTNA 1F3EA 2C8NA 4RDZA 1OFEA 3SCVA 2V67A 1VIZA 1LQAA 1CNVA 4L6OA 5EFDA 3ZT5A 2FH6A 2EQDA 1B57A 1BVNP 2IQTA 2FMNA 5GQBA 3RIKA 3TJIA 4WKAA 3RHGA 4JX4A 3NQFA 3S2JA 3L4ZA 3A23A 1BQGA 1QOPA 1MZHA 4EXAA 1RP9A 3I7SA 3WLLA 3U2CA 3RITA 2Z24A 2Z4GA 1O1ZA 4HYRA 4EANA 1A3HA 3RUBL 1VIWA 1VHNA 4MB3A 3GVWA 2QDDA 5G5IA 3UR8A 1UQZA 4HSOA 4J3SA 3CO4A 3HGSA 4ZSTA 1M3UA 1Q4WA 5ABGA 3W1NA 1PAMA 3BLDA 4GC3A 3UR2A 2NUYA 2CLOA 4Q4OA 2H9AB 5HDRA 3RO6A 4WK9A 2BVDA 4PMNA 1OBAA 1DJYA 2DT2A 2WLZA 1J01A 2D1ZA 2XFFA 4LRTA 3A64A 2DEPA 2QHAA 1XDLA 2C1GA 3D47A 5RUBA 3KCJA 3KZSA 3WNPA 4W7WA 1SFTA 3DEQA 1A5OC 3BLEA 5I3IA 4NT0A 1F7BA 3CH0A 1TPH1 1LQ2A 2G37A 1PHWA 3CHCA 3CV2A 3GB6A 3S1GA 1H11A 4UUIA 4JYEA 1MYRA 1OZMA 3LTSA 2VCBA 4RDWA 3TR2A 5FJTA 1FWHC 2GGJA 5BCAA 1UG6A 1L2UA 5CZSA 1WZKA 3LENA 2ZUMA 1KXVA 3AYSA 4LY4A 3QMSA 2X41A 4GNVA 1TTIA 2OT0A 3VGHA 1QNOA 1RPXA 2X1SA 2QIWA 1XWYA 3N9SA 1VRDA 3MVTA 2ISFA 3PVFA 4IMAA 3IJLA 1S5WA 3P5ZA 1QPQA 3ALFA 4JTSA 3L0GA 4JKKA 1NF7A 2BP1A 4A8IA 3R6IA 4B5SA 2WMGA 4LUSA 1S5TA 5FOOA 3DC8A 5LZLA 4ML9A 3M7WA 3T78A 3BSGA 1K9FA 3M5ZA 4PUWA 4C65A 3N25A 2AGTA 3VIIA 1AQHA 1X1ZA 3AIWA 3LA4A 3RCNA 1A0DA 4O4WA 1P48A 3GVGA 4QDPA 2CW6A 1CLXA 3IRDA 2EGZA 2CPUA 3AU6A 4IGMA 3MUXA 1RV8A 3LDVA 2UY3A 3QQ1A 1ZP3A 1PKNA 1H1ZA 3KAOA 5E5CA 3IUDA 3N3TA 4Z1AA 3KEHA 1WUEA 3B97A 4AY7A 3LCFA 1DHPA 5JU6A 2VC6A 2HRWA 1XYFA 2ZZ2A 3NL6A 5CGQA 5DY2A 1UZ1A 1YXDA 1DQWA 4AVNA 4B5NA 3RMJA 3A6OA 3DX5A 1CDGA 3VGEA 2VGIA 1JZ6A 3MS8A 1UMYA 2ZXDA 2ZADA 1ZP4A 2ONEA 3BC9A 5M2FX 1NELA 4JYDA 3FIGA 1UC4A 3LSBA 1ISVA 1K8ZA 1XH1A 1EJSC 4GE8A 1OWQA 4D6FA 5BMWA 3WLKX 1KQZA 2VX7A 1QI5A 4HMNA 1RJQA 2J66A 2QVNA 4YCPA 1RZMA 1T7LA 4H6QA 5EGRA 2IPWA 2QCDA 1OK4A 5CXPA 1X6UA 3N29A 3TA9A 3UYIA 1Q6CA 4RKAA 1W8GA 4O11A 4O53A 4DUWA 1KGXA 3UCDA 2PTWA 2QMKA 2QCNA 3GRIA 4D71A 1NDVA 1PKLA 1TYGA 3IANA 3W84A 4QJ3B 4DBEA 3N2XA 1Q6FA 4HA0A 1L0PA 3OIXA 3VFCA 1YNQA 3CHDA 1XDMA 3HGRA 3GTIA 4B2DA 2HMCA 3NJ3A 3WBAA 7ODCA 2WXDM 2D23A 2PDJA 1JJKA 1OD8A 3HURA 3KWSA 4Z0SA 3W1PA 1XCWA 3HB9A 3BXWA 1Q7QA 1UIOA 2PD5A 1B5TA 1US2A 1EGVA 2J75A 3P6LA 3GZAA 5F2IA 3NSXA 1E6SM 2IUZA 3V3WA 1VC4A 1E70M 3MB9A 3GK0A 2BODX 2HNHA 5HA7A 1WDSA 2WQPA 1XBVA 4ZZ9A 2WSPA 1GW1A 4IL2A 2R1KA 3K4DA 4DLMA 1EPXA 4LAKA 4C1LA 4M7SA 3JRKA 3VIOA 1FP8A 2DU2A 4C6EA 1EKOA 4IISA 1EC9A 1VFUA 1US0A 2YKKA 3A21A 4JEJA 5ABEA 3EA3A 4JTGA 4NJJA 4DJDD 2WBKA 3RM4A 4Y2WA 4AX7A 3DKJA 4UFIA 4AG0A 1JPHA 2QUMA 1JZ5A 4GACA 3LRMA 4IMCA 4C5YA 3Q58A 4NUWA 3VD3A 4GXMA 4DF0A 1EJVC 4JNYA 4QROA 1XGZA 1R38A 2DH3A 3WF0A 1TV7A 4WIWA 2NXGA 2OOFA 3WCZA 4GY1A 4NAFA 1DVJA 1XIDA 4JIEA 4KGJA 2FIQA 3XISA 3UD6A 3G0UA 5FL1A 4D6HA 4MB1A 4O18A 1FKWA 1AW5A 1YE6A 3GD6A 4F40A 1Q6QA 3NQ6A 3IV8A 2PTDA 1J6PA 3H24A 4WGXA 3ITGA 4REQA 4QR6A 4A35A 1UA3A 4Q6XA 2CCRA 2EPMX 1HW6A 3OA3A 5TBOA 3RF9A 1GGOA 2RDXA 4QAWA 2ZDRA 3VPLA 1EX5A 3O9NA 2FPYA 4AU0A 1XKYA 3KCOA 3GDLA 3URQA 4PMOA 5BXTA 1SMAA 3PZMA 3CQKA 2WKLA 2Z2AA 3WQWA 1EX1A 1IF2A 3WJYA 1WAUA 1Q6RA 2Y8VA 5A1AA 4GJ1A 2ZWZA 1UR1A 3TAOA 2W66A 1IIHA 2GZXA 3R11A 3A9IA 3EXRA 3VNLA 3USBA 4Y9PA 2X7WA 6A3HA 5C54A 2EKCA 1FH8A 1WDRA 2WYSA 3AC0A 2FKPA 4UOQA 4G9PA 4CU6A 4IFKA 4E5TA 1UWUA 4P8UA 3WLJA 1PX3A 1UP3A 1IEIA 4R7JA 2XGIA 3UW6A 1QPRA 3WX7A 2QJHA 1ICSA 2ZUNA 4KT2A 3BMWA 1QJWA 1EL3A 3HM7A 4FNUA 5AZ1A 1VRXA 4NNBA 1T8XA 2PDQA 1LBFA 4KGLA 2PEVA 1PWMA 1YPFA 3QY6A 1XLCA 4OIFA 3W70A 3PWGA 4XB3A 3TKFA 2NWRA 3GDBA 2XFWA 4FXFA 2VGFA 2MNRA 3C3NA 2QCHA 1ZUAX 5CC7A 1X7FA 4QQUA 1H09A 1VEPA 2CZEA 1A5MC 2EPNA 4ZODA 3W1MA 4PUJA 3GXNA 3QKEA 4GH1A 3CYVA 3WNMA 1MZRA 3Q65A 2OO6A 3P7YA 1RVKA 4MFEA 5CBIA 2PF8A 3EX1A 1MXDA 1RP8A 2VR2A 1FTXA 5EB8A 4NYUA 2JIWA 3PS7A 6REQA 1F8IA 2A85A 4US5D 1F3WA 4QXIA 1LJYA 3TCSA 5C8BB 4NILA 1BG4A 2Z6JA 3CB3A 1A3WA 5C9WA 2WMHA 2PWFA 4DNHA 4I8DA 4AUBA 4RLIA 3R0KA 3QJAA 4S38A 4LJ3A 1ENUA 3GC5A 3N11A 2V3FA 4ATWA 1V77A 3UNDA 2OSWA 1EP1A 3VABA 3U57A 1XD1A 4CEUC 5L9FA 2FDMA 5CQ1A 2TSYA 1GEHA 2R1NA 3PZQA 3O0KA 4W7VA 1QT1A 4K1GA 5D04C 2BBFA 1K9EA 3W53A 4LYQA 3N12A 4UNLA 4L6HA 3UJSA 1UR9A 1EBGA 1S38A 5LNSA 3MSGA 2PP0A 4PTNA 2NUWA 3G6LA 5AC5A 2Z1WA 4MVAA 2HDJA 2QVHA 2IPJA 3C8FA 4ORIA 4JFUA 1SMDA 2GWGA 4AZGA 3WLRA 1IR2A 3G1FA 3CZGA 4LB3A 1UWAA 1TPUA 5D9OA 1I1WA 4JTQA 4W84A 4BWLC 1PL9A 2J13A 1KGUA 3HPSA 2GQ9A 3F4DA 3RU8X 5E93A 1PCWA 3UXLA 1YYAA 4GQBA 3MI6A 2PDHA 3GG0A 3F5JA 1T99A 2VZUA 4G5DA 4RW3A 4JYFA 1G7UA 4E3TA 3G1AA 2ACSA 4KRTA 3LQGA 3VOIA 4W88A 4ERIA 5A2BA 3CQIA 2E6DA 3G1RA 1EFZA 4GBDA 3CL7A 3TA6A 3TN4A 3LCIA 4K1WA 3A22A 3EB3A 3WK1A 4HK5A 2E28A 1KB3A 3P0XA 3EXTA 2I1OA 2GWNA 1W17A 5HNUA 4AY1A 1YBQA 1FWJC 3STCA 1W5PA 3W7MA 3GH4A 1O60A 3DYPA 3LRLA 2C71A 2DZTA 5E0KA 3E5BA 5GPRA 5T9BG 1X96A 2ZRZA 3WLMA 3RX4A 1MXGA 2O7SA 4JTAA 1N82A 3OEXA 4X61A 4NU7A 2BOFX 3P5YA 3PSWA 2FZ9A 2WB5A 1OC6A 3SGZA 2R1PA 3BAYA 4H8HA 1E72M 5HMFA 1UJQA 4JQ1A 4K6AA 1X8FA 1JPDX 2J7HA 1XKJA 2XHYA 4HA3A 1C9DA 5CC6A 5DMYA 2IW0A 1DQUA 4KETA 4NIRA 2ZA1A 4O1AA 3MUZ1 4FMVA 1ZBVA 3ES8A 2O9PA 3EDJA 4IFRA 5D05A 1TWDA 5TF0A 3QW3A 5HK4A 1P0BA 2A3EA 4HPGA 1LG1A 4N02A 2QDEA 3WLTA 3CWNA 3BLPX 1H0GA 3BANA 5IFPA 4O10A 4AC7C 1W56A 1YRRA 1RVGA 3NZQA 3LNMA 3UZYA 2YLAA 3CU2A 2PBOA 4G7FA 4GXWA 1IWAA 3BGAA 3NXLA 4XD4A 3PTDA 5CPSA 4GZEA 2Q71A 1LL6A 4PGLA 2VNCA 5CGTA 1TQJA 2QJNA 3PBWA 3T0BA 1EZWA 1LORA 1VFMA 3TXZA 3SY1A 1G9HA 3M7SA 4MNMA 3EWBX 4JNMA 3KP1A 3E49A 5HQLA 1WE5A 4DWSC 3O7UA 3IAQA 1QOXA 5LIYX 2XVKA 1XYCA 3EDDA 1EJ7L 1E73M 4HJFA 4C6JA 3TIMA 2OX1A 2J6XA 2VHLA 4CQ8A 3HG4A 2O0TA 1XLKA 4WD0A 2ZUVA 2BS9A 1OIFA 2YDQA 4PMDA 3BUVA 5H8UA 3VNJA 2W5FA 1EDQA 1ZTVA 5KETA 4U3CA 4O16A 5TIMA 3FKKA 4HYVA 4LT9A 4UNIA 1FVPA 3BLFA 1ITUA 1GYNA 2QUNA 3T6CA 4AF0B 4HSHA 2W6RA 3K4WA 5LIUX 4MSSA 4F4RA 5MKGB 4Z2KA 1OCNA 3PPCA 2QJJA 4K8GA 2YDAA 5BOFA 1GTEA 2XN2A 1HUVA 4BHYA 3GX9A 1UBSA 4IIHA 2YIHA 2QJIA 1J79A 1X6NA 3NCOA 1E5NA 4NNCA 1TJPA 1XSJA 2YCLB 3NQMA 5ECVA 5DRIA 1O95A 4J3WA 4HZ8A 1BKHA 3UXKA 2UWFA 4Q4SA 3PM6A 4JGDA 4BS0A 5LIKX 2QJMA 3EOOA 4B91A 3ITLA 2FVLA 3W81A 1SFJA 2X1TA 1W5OA 2AL1A 4O28A 4XV0A 5AOUA 3ARUA 3R8HA 2WC4A 1O6IA 1F05A 4QAIA 4LCRA 1EWEA 4MFDA 1O12A 2DIKA 3NTYA 5AHMA 2Q8LA 1W8SA 3E0IA 5AC7A 3PR2A 3TFXA 5KEZA 3BV7A 4GKTA 4K39A 1ECEA 1IEWA 2RKXA 3T09A 2DZXA 4FLRA 3V35A 1JD9A 1R3TA 2Y62A 3SCPA 4L6DA 3VYLA 3W3OA 1XLBA 4Z2LA 2CZ5A 1QU4A 1F3XA 2R24A 4YNGA 3LBCA 1EHNA 5EMUA 3VCNA 1V6WA 4LVBA 3EWWA 5A8MA 1GG1A 1P0DA 4ZVJA 3P60A 3WDQA 1BTMA 3UJRA 2QPUA 1US3A 2YL9A 4KCWA 1VZWA 1P4CA 1KRCC 3ABRA 5LIXX 3AUJA 5CJ5A 4JEQA 3WJZA 3CV1A 3UXIA 5FF7A 4XZNX 2DGAA 4JICA 3N18A 4JZ5A 2PDPA 4DI8A 2WC3A 5D8WA 3DGBA 3UCQA 3ZIZA 3LX9A 3EKZA 3N17A 4JDYA 4KIEA 4N0RA 4IX2A 2QNEA 1XIFA 2VTFA 4H6EA 5K3VA 2E6YA 3W2KA 1QI4A 3K8LA 5C9ZA 3IIPA 3WQFA 2E5BA 1WOBA 1V03A 2ZIDA 3DDMA 2YZRA 1Z69A 1W1VA 1PIFA 2CZDA 2FPTA 3Q2DA 3FHAA 2WVVB 4LUTA 1V0MA 5HATA 2CHRA 1SZRA 1UWQA 1DWJM 1X98A 2WMIB 3CAQA 4UWMA 4YTQA 1EWDA 3OLGA 4D6JA 4RV3A 3TMLA 3WBWA 1GOWA 4DY1A 3H22A 2DZUA 4IUOA 3UWEA 5E1QA 2PC4A 3PBMA 3WEMA 3ARQA 3N6QA 2YA2A 4OUEA 4X60A 3PB0A 4HMCA 2AOSA 3GBDA 2ZRUA 3L2IA 5A8QA 4O17A 1TUXA 2AKMA 2VP8A 4F2TA 4RE2A 4LNCA 3WD2A 2GQ3A 2WBGA 5DXYA 2BVYA 4S3JA 4PB5A 2VGBA 2XSAA 3CIXA 3UXDA 3REQB 3S1WA 4A3HA 4MLRA 1P6BA 3ZJ8A 3H55A 3PBVA 2INEA 4GYFA 4Q33A 3W83A 1DWIM 1XCFA 4H19A 3SCOA 2YBVA 3T0DA 5LHEA 2Y70A 4ICNA 3KS6A 3HA1A 2JGQA 5I2UA 1Q13A 3ARZA 2P3ZA 5I78A 3H12A 4BF9A 1BWKA 3U7VA 4WSHA 1PHQA 5H1WA 1ONXA 2E9BA 5KZ6A 1FWEC 1Q85A 4G8TA 1VJZA 2GK1B 1Q6LA 3HOJA 1TA3A 1R8LA 4I6VA 1R2TA 4CCZA 1WOAA 5A6JA 3FJNA 1EOMA 2Z1VA 3ZS4A 2BWGA 4MNKA 3C2EA 1H60A 3VD9A 1Q65A 1E1CB 1V08A 3VNYA 3LQLA 4QQ3A 1E3ZA 2A3HA 2QDGA 5A6LA 2D3NA 2ZFAA 2FTYA 4R7WA 3PPFA 4ZFMA 2BVTA 1RQEA 3M0LA 2E8ZA 3BSHA 3NDOA 1FP9A 2W79A 1RQBA 4J35A 1NFBA 3SN4A 1WDQA 1UH4A 4L80A 5JIPA 5BXPA 3E1F1 4UQDA 2YXOA 3WF1A 5JIWA 2EG7A 4O0QA 2FHCA 1GQLA 3WO8A 1R0MA 2XH7A 1QW8A 3AXMA 3QH2A 4JTIA 3CZLA 3KBMA 3GU1A 5JBDA 3SJNA 1PEZA 3CM4A 1U1HA 5K4ZA 1G69A 3GG8A 4FPSA 2ICSA 5IHSA 1ISZA 4DHGA 4FZIA 1QDSA 1OM0A 4AX6A 1H1YA 1KBIA 3AUOA 3LK6A 1A5BA 1FKXA 1Q8JA 3LTYA 5JUVA 3CAVA 4Y7EA 3WN6A 3IRSA 4IG2A 3PANA 4R7OA 3SCQA 4U31A 1L8NA 1IYXA 1EA9C 3VMPA 3TQVA 3HBLA 3LS9A 1IHIA 5A6SA 2MUCA 1W9XA 3QGKC 4KEZA 1YLVA 2DJLA 2QDHA 4F0MA 4LUIA 3AYRA 1KM1A 1WBJA 2P76A 3NEHA 3B0YA 4GZ7A 2ZRXA 4C6MA 3PJUA 5AHNA 1K1DA 4IM4A 4IXHA 1MQQA 1G6CA 5I00A 1YPXA 1XV8A 4OFCA 4O14A 1NEYA 4ICCX 2VYOA 4G7EA 5FIPA 3UG4A 5A94A 4UTKA 4S3E