3DAQA

Crystal structure of dihydrodipicolinate synthase from methicillin-resistant staphylococcus aureus
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
292
structure length
292
Chain Sequence
THLFEGVGVALTTPFTNNKVNLEALKAHVNFLLENNAQAIIVNGTTAESPTLTTDEKELILKTVIDLVDKRVPVIAGTGTNDTEKSIQASIQAKALGADAIMLITPYYNKTNQRGLVKHFEAIADAVKLPVVLYNVPSRTNMTIEPETVEILSQHPYIVALKDATNDFEYLEEVKKRIDTNSFALYSGNDDNVVEYYQRGGQGVISVIANVIPKEFQALYDAQQSGLDIQDQFKPIGTLLSALSVDINPIPIKALTSYLGFGNYELRLPLVSLEDTDTKVLREAYDTFKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Dihydrodipicolinate synthase
publication title Structure and evolution of a novel dimeric enzyme from a clinically-important bacterial pathogen.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 114
structure length 292
sequence length 292
chains with identical sequence B, C, D
ec nomenclature ec 4.3.3.7: 4-hydroxy-tetrahydrodipicolinate synthase.
pdb deposition date 2008-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3daqA00
1P5BA 1JUKA 3S5ZA 3IVUA 1FQ0A 3NM3A 1FX6A 1W5NA 3UWQA 4RJEA 3TQKA 3QPYA 2E5DA 3BPWA 4OE7A 1KM0A 4UFLA 3TQ0A 4EIVA 1KM5A 4Q32A 5EPDA 3EX1A 4IXHA 3W1TA 1I4NA 5HUOA 3PAJA 1RQBA 2VOMA 4LU0A 4DEFA 2VXNA 1K8ZA 2E5CA 5K9XA 3QMRA 3GK0A 1QOPA 4RR4A 1JJKA 2R8WA 3NQVA 2ZRXA 3LXBA 3E02A 2HS6A 1AL7A 3CT7A 3W7PA 3KOFA 4RK8A 4IX0A 4BI7A 3LCLA 2XN1A 1TRDA 1IIHA 2GVJA 4P61A 3P81A 1L6YA 4L4MA 5J5RA 2ALDA 3LRLA 4ADTA 3RU6A 1QCWA 1F6KA 4GC4A 3N2MA 3NA8A 1EUAA 5AYZA 3PBYA 2RDTA 4UTMA 3EWYA 2ZZ7A 1QR7A 2ZZ3A 4ONVA 1VGAA 5FF0A 1QPNA 2R14A 4C1KA 3L2IA 3BG3A 4HNTA 2EAWA 3W73A 2Y62A 3B8DA 4FNPA 3TSMA 4TU1A 3OVRA 1SO3A 3G1YA 1SW7A 3HG5A 3PVFA 4JTJA 4AHQA 2E6FA 1B9BA 2BWGA 4GUIA 1ZAJA 2WJZA 4P2VA 2V8ZA 2VFFA 1UUMA 1XDMA 3C2FA 3ELFA 4WOZA 1OYCA 4UTLA 3LV6A 4MJZA 4OU1A 2WSRA 3VI2A 5LSMA 1SZGA 4UNKA 1B57A 3SSJA 1YTDA 4UTUA 3JR2A 3PBVA 5D05A 1OF6A 3MP3A 4UXDA 1WDWA 1DHPA 2GPTA 5AHEA 4QAIA 2ZRWA 1YDOA 5BOOA 1YTEA 4UTWA 4WUIA 1N55A 1BKSA 3BG9A 3MBFA 1N7KA 4QQ3A 3N9SA 4JX6A 2VEIA 5LHEA 2B4GA 4ADUA 3C0JA 1SSDA 3C6CA 2G96A 4UUIA 5LHFA 3S5NA 3VCRA 5I3FA 4MZ1A 3C61A 4O16A 4BWLC 4FEZA 4QSHA 4NU7A 2FFCA 2ZRYA 4MOZA 3NQMA 4FX6M 2CW6A 3S8HA 2W6RA 2X16A 1ZCOA 2E1DA 4Y8FA 5AFDA 1XUUA 4ZQMA 3OIXA 1SFLA 4FIQA 3MW7A 3KHJA 4U28A 4NVTA 1NFBA 2BTMA 4IXXA 1Z42A 2ZTKA 1TPB1 3L68A 2GVLA 1LTDA 2QF7A 3TROA 2V9DA 3OVPA 4LS2A 4UMBA 1JUBA 1F05A 1TQXA 2BSLA 2C3ZA 4MY8A 1Q6RA 1WAUA 3HGJA 3MYPA 1T96A 3L9CA 1SPQA 3QM3A 3NQ8A 3RFAA 3NXFA 4FHAA 3HGOA 3C52A 1ZFJA 1FDZA 1XFBA 5TBOA 3UPBA 1ZY9A 2NX1A 4JTLA 2Z1BA 2ZDRA 3RK8A 3SGUA 3TJXA 5FEPA 3HGRA 3DBPA 4XKYA 2Q8LA 4KFPA 5U4NA 1X1OA 3E0IA 1JCXA 3TUUA 2I1OA 5IBXA 4JNMA 3W87A 5AYXA 1ML1A 2NX3A 3IGUA 2QUUA 5K4XA 1UJPA 1WOBA 4MYAA 3WJZA 5K4ZA 1TMHA 3W75A 2X1RA 5C2XA 4IMCA 2FPVA 2CZDA 1O5XA 3TR2A 3PSVA 1AW5A 1TYGA 2J9YA 5DCEA 2Q8ZA 3GAKA 3CHVA 3OA3A 3EXSA 2YFOA 4N9DA 2DZVA 2XN0A 4Y96A 2DZSA 5CZJA 3FYPA 1TO3A 5AC8A 1K8YA 1H1YA 3KRSA 3GR7A 1GPWA 2V2HA 4WOQA 4JYEA 3O06A 2ZFAA 3NQDA 2CZFA 5LNUA 3MHUA 3SJ3A 3IIOA 1EPXA 2C0AA 2JKAA 4MY1A 2H8ZA 1KV8A 2DZWA 1GYLA 4GUGA 3P60A 3L67A 4ICNA 2R94A 3MI2A 4X2RA 4N4PA 4R33A 5I3JA 3U2OA 4XZ9A 5G1TA 1I2RA 2B7OA 1X8FA 1YLVA 4JX5A 1LZOA 1OF8A 2A0NA 1O5KA 4PL1A 4AMAA 1PE1A 1VHNA 4AWSA 2A2IA 1SZNA 1TQJA 4M7SA 3LTPA 1MEIA 5AHMA 3HG3A 3WJXA 1WX0A 1GG1A 5DBTA 4FB7A 3W88A 3MI3A 3W7GA 3S1WA 4PA8A 1KFCA 4I7VA 3MP5A 1FUYA 4TMBA 4KKXA 3B0PA 3TA6A 5LGXA 2Y85A 5G1YA 3W7MA 1ZAIA 5DXXA 3LHVA 4LUJA 4YMZA 2P0OA 3TAKA 1VLWA 1OX4B 2CLLA 3BK0A 1IXNA 5L6UA 3PSWA 2BLEA 3NL5A 5D32A 5TQLA 1VRDA 2ZTJA 2VEKA 1O60A 1P4CA 2Z6JA 5F4XA 4LC6A 1QPOA 3BGGA 3GKAA 2FPYA 3PY2A 4WX2A 4O11A 3KVMA 5HINA 2NXHA 3WJYA 4IUOA 4UCGA 3MI6A 3UXDA 3WK1A 1AW2A 3W2LA 5G2WA 3PB0A 1W31A 5CPMA 1WBJA 3G1FA 5AYYA 5CSRA 3P67A 4NJKA 1GYNA 4O0ZA 2ZRVA 4MJMA 3LM7A 5CPOA 3BLFA 1GT8A 2QCNA 3W07A 3VFLA 1LRTA 1PCKA 1RVGA 2FIQA 3LI1A 5FF2A 4UTWC 1A5CA 4Y6GA 1VCVA 3YPIA 1ZNNA 3W74A 3LCFA 4GBUA 3UQNA 4AHPA 4QNWA 3DFSA 3KRUA 3LCGA 1H7WA 4LNYA 1GTEA 1VCFA 5LNWA 4NJHA 3TV8A 1UASA 3W9ZA 5CGQA 3EWZA 3TKFA 3LCHA 2ISVA 4N02A 4X9SA 3UNDA 1W5OA 3HPZA 4UTTC 1F76A 5LKYA 1TV5A 1Y0EA 1KM6A 2G97A 3CU2A 3QQ0A 4JTSA 3TW6A 3W22A 1OFDA 2FLIA 1FWSA 2NV2A 2QR6A 4NQ1A 4IJBA 4WY0F 3B0VC 2ZRUA 1YXDA 1OFRA 4NJIA 3CQ0A 3TC6A 3M43A 1YDNA 4QISA 2BX7A 3PB2A 3V75A 2Z0IA 4RX0A 4WY0B 3M0ZA 1MEHA 2Y88A 4O54A 3THQA 2Q3OA 2NLIA 2V5LA 4K6AA 1QAPA 5F2MA 1YTKA 3TXZA 4A21A 1JCJA 1JQXA 2ZA1A 3DHFA 4XWUA 2EGZA 4ADSA 2DU2A 3T78A 3ATYA 1F5ZA 1J4EA 3W2KA 2I14A 1SZEA 1OK6A 5G4WA 4UR7A 3TFXA 1HFBA 5IBXC 3WJSA 3CEPA 1S5TA 3F4WA 1DJQA 1TB3A 2A7RA 3DFQA 3G8EA 1ADOA 2WNZA 4JEQA 4IWWA 4LT9A 4O18A 2QCMA 4X22A 3H55A 4K8EA 3W83A 1KFBA 5DLCA 3UYCA 4O17A 4GWEA 2G5WA 3DI1A 1LOQA 3MP4A 3S1UA 1H60A 2NUYA 4BF9A 1PV8A 3L5MA 3FKKA 2ZA2A 1FDYA 3TMLA 2AQWA 5KMYA 4UFKA 5G2IA 2C18A 3E49A 3NPWA 2A1YA 3TXVA 1UUOA 4M6QA 1XCFA 1KLYA 2OX1A 4H4IA 1Q6OA 3E9AA 4XBKA 1OHLA 3C4UA 3SR7A 3DI0A 1THFD 3TX9A 2IQTA 3PBUA 3NQFA 3GLCA 3DU0A 1M6JA 1Q6LA 2YW3A 3Q2DA 4JTIA 4LVFA 1LLWA 3DKJA 4HNVA 1OX4A 5HWMA 3VE7A 3BW2A 1E51A 1EP3A 3W70A 4KFNA 3LRKA 3W86A 2QCCA 3WK3A 3EWUA 3BW4A 4PC8A 4O19A 3V1PA 3RMJA 1W5MA 1HO4A 5DY3A 2WNQA 2CLKA 3LV5A 1XXXA 3F03K 2W0UA 3JRKA 4CQ8A 3HBLA 2QCDB 1XC4A 1SR9A 3PULA 1DORA 2V81A 3QQ1A 4MPQA 1R2TA 2YSWA 1TSIA 2A7NA 2UV8G 1HO1A 1WBHA 2PCQA 3O1NA 3LLFA 4JTUA 1IGSA 5CZ0A 3DFNA 2X1TA 4JGDA 2J88A 1TPC1 2OT1A 4O1BA 4S2CA 3S0CA 1TV7A 2GVGA 3G1AA 4NJGA 1EWEA 3H53A 2Q3RA 4NJJA 3S5OA 1W37A 2QCFA 2X1SA 1MEWA 1I8JA 4GFSA 4IPJA 4JY8A 2EKCA 4QM1A 2GQ9A 5D30A 4IQLA 3W7DA 2GJNA 5I3IA 2H3BA 2FJKA 2TSYA 1TPH1 5DCBA 3R2GA 1F73A 2OJPA 2VEMA 2B7QA 2OZ0A 2RKXA 1LDCA 4CNPA 2DJXA 3HMJG 5F2IA 3BARA 2H3DA 2QDGA 3Q37A 1OK4A 1ICSA 1TJRA 3A22A 3KVKA 4L4LA 5D03A 2R91A 1D3HA 2LLEA 3B4UA 3CLMA 2CLMA 1TPWA 5HUPA 1GVOA 1RPXA 1XL9A 2GUUA 2NV1A 2J9ZA 1JVNA 1TPFA 4DO5A 1VYSX 2H8XA 1TIMA 1R46A 3FOKA 1MZHA 2CLIA 1XBZA 2CLEA 5LNVA 1KV5A 5F2LA 1EA0A 3CTLA 5D33A 4WY0A 2CLFA 2Z2UA 3P62A 1HUVA 3LBMA 1JULA 1P0NA 3CWNA 3ABQA 1NEYA 2CU0A 3INPA 1XM3A 4JTEA 3S42A 3ANYA 1B3OA 1W3IA 3MMTA 2NXGA 1UCWA 3VE9A 3W6YA 3DFPA 4HHPA 1I2NA 3PC0A 3S5YA 3UWZA 2QCEA 4HNNA 4DF0A 4LRSA 1FCUA 5KITA 2YXGA 3QFEA 1O94A 5DCDA 4DO4A 2BZNA 4O28A 1B4EA 4DF2A 3QW3A 1W54A 2E6DA 1S3HA 5D02A 1JQVA 3QPZA 4O0KA 3HQ1A 4IMGA 4M5PA 3I65A 3TW7A 2YFNA 3CEUA 1LBFA 2Y7EA 4AB4A 1TPUA 2GOUA 3R89A 3P5ZA 1GVSA 3G18A 4JY9A 1K7XA 4PTNA 3CM4A 4AWTA 3NAVA 3EX6A 1NSJA 2E77A 3M41A 3W7KA 1TPVA 3TU9A 1FCBA 4GUJA 3TE9A 3KVLA 3C2OA 3GDRA 3STGA 2QKFA 4HN4A 3W1MA 3SECA 4LC8A 2PRMA 3M1ZA 3QEZA 1IIGA 4O8RA 2DORA 2WOQA 2Z6IA 1GVRA 3W1QA 4IPIA 1DQWA 1G4PA 1AG1O 2YW4A 2ZQ0A 2PRHA 5HMSA 1TV8A 4Z1DA 3A21A 3O6CA 1YDVA 1YADA 5EBUA 3W85A 5CZSA 3CB8A 1CW2A 4MZYA 4RCXA 4DBDA 4BR1A 1FY6A 3EKZA 5CPLA 1ALDA 3W1LA 4YXGA 2Y89A 3PUDA 3BG5A 4NXKA 4JYDA 4FNUA 3R12A 3O15A 3NO5A 3I68A 4HPJA 4ZMGA 3W1RA 4IMFA 2QUVA 4WXZA 2A6NA 2QCDA 2GQ8A 3FEMA 3R5EA 4PFMA 2J9XA 3OG3A 3O6YX 3DHDA 1VH7A 4DPQA 1FWRA 3T55A 1C29A 4NNBA 2VFIA 2ATMA 4JDBA 4FX8A 3HF3A 4LS0A 1TTPA 3LI0A 6ALDA 3IV3A 3W2JA 1TTQA 3P7YA 4ZQOA 5DY2A 2WO5A 4AF0B 4UR8A 1O95A 1G7VA 4JXCA 3LOTA 3LHWA 4ML9A 1LRQA 3TQVA 1EP1A 4PCFA 1R2RA 4QJ1A 2FB3A 2QJGA 4FF7A 2A4AA 3NPVA 1QO2A 1OJXA 3N14A 1M7OA 5BRBA 2NXIA 2E6YA 3STCA 1WOAA 4Z1BA 3NQEA 3ZWTA 1KA9F 3M44A 1RD5A 1IXPA 3DAQA 5DXYA 1EB3A 1Z41A 1ZJIA 4K8HA 4Z0SA 2VC6A 1I45A 4CNNA 1OFOA 5HWNA 5EMUA 5KSWA 3DXIA 3T4CA 5FESA 1KLZA 4FNSA 3EX2A 4IX2A 1YPFA 1KW1A 4I9AA 3C2VA 4IGHA 1HG3A 3G0UA 3DH7A 4HSNA 4CCDA 3IVSA 4N9BA 2Y7FA 1Q45A 1XBXA 2YYTA 3U8GA 2V30A 4OHQA 3K30A 2WSYA 4QNEA 2A6LA 1WXJA 4B5NA 4MVAA 3QW4B 6TIMA 4DBEA 1KFKA 3NDOA 3DZ1A 1KTNA 3SI9A 3HOJA 3NL3A 4MKNA 3ZR4A 4H3DA 4ZL1A 2F84A 3LTYA 3LHYA 3R13A 4E38A 4AWUA 2TYSA 5D2YA 3A5VA 3T7VA 5E93A 1RZMA 1KTCA 4GUHA 4O1CA 2EF9A 4O52A 4UMAA 4DXVA 4N6FA 4TIMA 5L9FA 2A5HA 3KXQA 5D04C 2PC4A 2C6QA 5FF7A 3TK7A 5BMXA 3G1SA 3G1VA 1OYBA 4EOUA 4N9EA 1H5YA 1ZHAA 4I7WA 1S5WA 3GYEA 3JS3A 1T8XA 3NGJA 4IMEA 4NNCA 4BFAA 1LOLA 1XKYA 4LV9A 1OFBA 4K38A 1H62A 3U6WA 3EKLA 3W7JA 3SW6A 1VQTA 4JTFA 3W7EA 2E68A 2X30A 3CWOX 1EWDA 3HGSA 3NVTA 3W1PA 1QPQA 3VNDA 3P74A 1DOSA 5A8GA 3NNTA 4OBTA 4RKAA 3GXTA 3QZEA 3VKJA 2YGYA 4EF8A 5CZTA 1W5PA 5AC7A 1D9EA 1L6WA 3N73A 2WQPA 5BW6A 1F74A 4E2BA 1GEQA 3RF9A 5EY5A 3O6DA 5ABTA 1QDSA 3QMSA 3PG8A 4CLMA 1LP6A 3M16A 1SU5A 3C56A 1RQHA 1OABA 1YXCA 4RZ4A 4U4MA 3IIPA 2WNNA 3GDKA 3ZFHA 5EL1A 2DZPA 3T40A 3QMTA 2ZZ4A 3FLUA 3Q58A 3S1VA 3A9IA 4TO8A 3D0CA 3W7NA 1MO0A 3GDLA 5HWJA 4RXFA 1GZGA 1QMLA 3L21A 2RDUA 1FWWA 4FNQA 3M47A 4UTHA 1R2SA 1VPXA 2I9EA 2NWRA 1DVJA 3W2MA 4DELA 1A5AA 1DJNA 1VYPX 3BLIA 4AF0A 1IF2A 4K7YA 1O4UA 4ZQPA 1FCQA 4MIMA 3W2NA 2FB2A 4ORIA 4OT7A 1NAL1 1GTHA 3MBDA 4XUGA 3NZRA 2J6XA 5D2VA 3W7LA 3W7RA 2JGYA 4KWWA 4BI6A 3IEBA 4JR5A 3WK2A 5F1VA 1H1ZA 2YDAA 1PS9A 2QAFA 3A23A 3MJYA 3H54A 1NVMA 1Z44A 3B05A 1LBMA 4HSOA 4O13A 5F4WA 4LWWA 4AAJA 4OV9A 4MFDA 5F4SA 3I7QA 5FF3A 4UC5A 1B4KA 4WD0A 4LW7A 2FTPA 4O12A 3FKRA 4GUFA 4BWLA 2YYUA 3HPXA 3PWAA 5HJLA 4BK9A 4MUZA 5HULA 3QH2A 4CNOA 3C8FA 4R53A 4UIOA 1IXQA 4DPPA 4N4QA 3SGZA 2HTMA 1J2WA 1AK5A 2VFEA 3WFAA 1MXSA 5K9CA 3GXPA 2EPHA 4AHOA 1X1ZA 4MY9A 3P84A 3NEVA 4CCCA 4JTTA 4D2JA 1OFPA 1RR2A 5C55A 4X3ZA 4H6KA 1OVDA 1ME7A 4ORMA 3LLDA 1V7YA 4A2SA 3S9YA 2CZ5A 2NZLA 4TX9A 3O16A 1TPDA 3RLVA 1EX5A 1M7PA 3HJZA 4YWIA 3G1HA 1IXOA 2ZZ5A 5A5WA 2FQIA 4GNJA 4YCPA 5SWUA 5AHLA 1W3NA 4IOTA 5C5YA 5K2ZA 3NQGA 3M5XA 4RZ5A 1QFEA 4K7VA 3GIYA 3TCEA 1EEPA 2RH9A 4NXSA 3IIVA 1SUXA 4NNAA 2AAMA 2E09A 1XI3A 2H90A 2A7PA 1A5BA 3IIXA 4JX4A 1R47A 3LBCA 3FA5A 4QITA 2QAPA 1OG0A 1QOQA 2FPTA 2VFHA 2YCEA 2X2GA 5AN7A 4RZ6A 4TR9A 1KFLA 3NQAA 2CLOA 3PG9A 4K39A 2V82A 4FNRA 3GZ3A 1XDLA 2QDHA 4MLJA 2OT0A 3O63A 1SSGA 3E96A 3B03A 4W9TA 3GDMA 3I6RA 3N19B 4GRSA 3A24A 5F2GA 4S2BA 2RDWA 2Y6ZA 3W1NA 2ZZ6A 3STFA 3ZS4A 1PCWA 1KM2A 1U83A 1A50A 3T44A 5IM51 5GVJA 2YPIA 5KTLA 5D2TA 3O8AA 2B0MA 1OFEA 3LXCA 2NX9A 4Y90A 1A53A 1FDJA 1VCGA 3IGXA 1JRCA 3ABRA 3PS7A 1I2QA 5KZEA 3O05A 4FX7A 1WV2A 1LORA 3FJLA 2VFGA 4O14A 2FDSA 2CWNA 3DGRA 3CIWA 3P5YA 3TJLA 5K9DA 1FWNA 3EX4A 1K7EA 3LDVA 4N9CA 3QYQA 1TTIA 1KM1A 4A22A 3LHTA 5FEXA 5D09A 1M5WA 3G3DA 1OYAA 4AXKA 5BNKA 1JCYA 4Q33A 4AVFA 2ABBA 2C19A 3QSTA 3UXAA 2XN2A 1KM3A 1T0OA 1PHWA 3DFOA 3NOEA 5DELA 1LRNA 3TAOA 1KM4A 1GVFA 1YPIA 4O15A 5AHNA 1JCMP 2Y7GA 5H2ZA 2B7PA 1I2OA 3HG2A 3IGSA 5AHFA 2JGQA 4NUWA 2X1UA 1OX5A 3GVGA 3NQ2A 3L65A 3NM1A 3UWVA 3L5LA 1I2PA 2O7SA 1K02A 4PL2A 4JTKA 3KFTA 1GJPA 3LTSA 3EWBX 3W3OA 4LRTA 1W0MA 1AL8A 2XFWA 5I3HA 5T26A 2A85A 2WSQA 3AJXA 5D38A 3NG3A 1C9DA 2NUXA 3W72A 5KINA 2VENA 3UWYA 4Z1AA 4LUIA 3W76A 3SIZA 4YCOA 4G1KA 2TMDA 1G6CA 1VR6A 1XUZA 1H7RA 4LY8A 5D2XA 1GG0A 3P80A 1HTIA 1RV8A 4UFMA 1VS1A 4POCA 3PF3A 4DO6A 3HO8A 3BO9A 4J9JA 3G1DA 1ONRA 1NF0A 3DENA 1L9WA 1KTBA 4MZ8A 5KZMA 1KFJA 1ZENA 3PR2A 3RNDA 1LLZA 5FF4A 1VHCA 3LCIA 4M6PA 5LGZA 3C3NA 3UZJA 3MWAA 5D2WA 2Y61A 1F6PA 5J5DA 1FWTA 3L0NA 3CC1A 2VKZG 1G4EA 4O53A 3S1XA 3A5FA 4K37A 5FEWA 4OQVA 1L2UA 3NQCA 2QEZA 4CQ9A 5LZLA 1FXQA 2YR1A 5AB3A 3I7SA 1LM1A 1JCLA 3UZ5A 1YYAA 3GR8A 1GOXA 4RLIA 4UTTA 1ICPA 4HPXA 4WQ6A 4UMCA 2HS8A 3CPRA 2J24A 1PIIA 3FYOA 3DFTA 3N9RA 2WPBA 5AC6A 3TSBA 3GAYA 2DZUA 4WJEA 3BW3A 1DQXA 3C2EA 2V5BA 3QJAA 4ZQRA 2G95A 2Y7DA 1KBJA 4DF1A 5K7JA 2V0TA 1HL2A 3P82A 2P1FA 4ZQCA 3UD6A 4HKPA 1LBLA 3MYOA 3WK0A 1OX6A 4GXMA 4JD4A 2DZTA 1QO5A 5CG7A 3PUEA 4JYFA 3W7OA 4XBSA 1ME9A 1FBAA 1DL3A 2OMAA 3ZWSA 3MO7A 5AOUA 2A21A 1JRBA 3GNNA 4HNUA 3GDTA 2J27A 3HB9A 2AGKA 4O57A 3TSDA 1G7UA 1V5XA 4M7TA 4LVAA 5HR7A 1A5SA 4PEKA 3QF0A 4FIRA 1GVQA 3UPWA 3W71A 7TIMA 1ZAHA 1VZWA 3NPXA 4YL2A 3G0SA 2PRLA 3NL2A 4TMCA 4Y9AA 3N34A 2ATSA 4KFOA 1XBVA 1NF7A 1H63A 2C1HA 3USBA 1BEUA 2DJLA 4XTIA 3W7HA 1G69A 1SO4A 1WA3A 2ZCGA 3W23A 4UNLA 2VEPA 3TFCA 4A2RA 3L0KA 3BLEA 1ICQA 4JTGA 2TRSA 4M6VA 4JICA 4MYXA 1FXPA 1W8SA 1GQNA 4ZVJA 1SO6A 5I3GA 3EXTA 3G3MA 2HMCA 4JN6A 3P61A 3GNDA 4DQWA 1L6SA 5AHIA 1DBTA 4M19A 1QNVA 3F1QA 4OV4A 5LNSA 4O1AA 3W1XA 3RLUA 3UWWA 2GJLA 1U5JA 2P10A 3NR0A 1EP2A 3HIJA 4C1LA 4JS3A 1D3GA 4UTIA 1W56A 1KFEA 2E6AA 3NZ1A 1GWJA 4Z0JA 4JIQA 2ISSA 1K7FA 1YXYA 3I7RA 1W5QA 3CIXA 3QSRA 1TREA 1QWGA 2ZZ1A 3LX9A 1WYIA 4K36A 2DP3A 3B06A 3ABOA 3AO0A 5EKYA 1OFQA 4LOCA 5HR6A 1OFAA 4AEOA 3EEGA 5C54A 1QPRA 1XBYA 2OCZA 3G8RA 5E0KA 2DZXA 5HNRA 2QJIA 1T99A 1K3UA 1H50A 2ZZ2A 3OBKA 4R34A 3GX9A 3TNOA 4EWND 3QRHA 5H91A 3KX6A 3L0GA 1H7OA 3F4NA 2Y63A 4ZQNA 3OEXA 1J5TA 1DV7A 1PHQA 2BXVA 1G4SA 5E1QA 3G24A 1CI1A 1SW3A 3M5VA 3B0UX 1SO5A 4Z1CA 4WZHA 1ZALA 1VLIA 3KVJA 3ATZA 3KRZA 4PODA 1SZFA 4EVZA 3LHUA 2CZEA 4HIBA 2WKJA 2QUTA 2ZYFA 3W84A 1WQ5A 3NQ7A 1AW1A 5EA9A 5MHBA 4BI5A 3M6YA 4JTHA 3FFSA 4AH7A 3EX3A 5CSSA 1SQ7A 4XTDA 3G0XA 2Y70A 3W7CA 2ISWA 1K8XA 3EWXA 4LVGA 3MHGA 3IRDA 1N8FA 3LXAA 3HPSA 3IIZA 2NUWA 2QCHA 3DKLA 5G2HA 3L5AA 2TPSA 1X7FA 3KAOA 4OGZA 4LVDA 1EIXA 1F7BA 3SFKA 3UWUA 3P8JA 1PVNA 3NQ6A 1KBIA 3GKFA 3OHIA 4UTKA 3W1AA 2QJHA 5KZDA 1ME8A 4KWVA 3TH6A 3Q94A 4YLWA 1W1ZA 4NX0A 1MSSA 2JK2A 2C13A 3BV4A 5C6MA 1R30A 3UY7A 3LCWA 3QC3A 4E2DA 1TCDA 1EUNA 1UB3A 1TRIA 2RHGA 1PL9A 2PURA 1TPEA 4GE8A 4JIPA 5F1UA 4Q4KA 3W1UA 1JR1A 1H7NA 3EXRA 4JDYA 5CPNA 2VELA 4CCEA 3ABSA 2JKPA 3B04A 1VJIA 3STEA 4N6EA 4NX5A 1Q6QA 2B7NA 2CLHA 4FO4A 3TC7A 1JUEA 4ALDA 4I7UA 1BTMA 3E12A 1TJPA 1X6UA 5TIMA 3BGJA 3FIGA 8TIMA 4O4VA 2KZHA 4LVBA 5FEZA 2V2DA 4NT0A 4CQAA 2H6RA 2HSAA 5G4EA 4UFIA 2C15A 1CX9A 5K3VA 3THAA 3LHZA 4WXYA 4E0CA 1SW0A 3BVJA 4PH6A 4MLRA 3UY8A 3FJ6A 3NPUA 3LGEA 2ZRZA 4R7JA 5U7SA 4O10A 3W7QA 3LRMA 1TTJA 3WJWA 3HG4A 2JBMA 4RV8A 2YX0A 3G1XA 2PE4A 3NYZA 5LNRA 3LCXA 1G67A 3MHFA 2GQAA 1DKWA 1S5VA 4EF9A 4NZJA 4O4WA 5DBUA 5CKSA 4UTJA 2QCLA 3S6DA 3M7WA 1G4TA 4Z08A 4RXGA 4O1DA 5G5IA 3MUXA 5BMWA 4LS1A 3SZ8A 3M5ZA 2D73A 3L66A 1LOSA 1Z48A 2QCGA 1LYXA 3M5YA 1P1XA 3NL6A 3W2UA 3PUOA 4UFHA 3GB6A 2WV8A 1H61A 4MFEA 1AMKA 2ZA3A 3LERA 4A3UA 3O07A 2RFGA 5EYWA 4A29A 4O50A 1P0KA 3M9YA 3G22A 2EHHA 3PBWA 4LTSA 2JKEA 2VFDA 4FXSA 2CFFA 4N2YA 3P8IA 2ZBTA 3R8RA 4IMDA 2C14A 2E5BA 3TMQA 1H7XA 4ZZ9A 3IVTA 4GJ1A 5HQEA 3W7IA 1JCNA 3FS2A 3TDFA 1BWLA 3N3MA 1H51A 1W3TA 3PM6A 4XQ6A 1RQEA 2W79A 3C2RA 3EWWA 1H7PA 3SY5A 1C8VA 2O7QA 1VC4A 3LB0A 1Q3NA 4S1FA 5FI8A 5I3KA 1K03A 2C16A 1LROA 3OVQA 4FNTA 1BWKA 1FCVA 3N2XA 1F2JA 2F7FA 3EB2A 1LCOA 2NWSA 2ABAA 4QIUA 4FXRA 4OWGA 4LV4A 3TIMA 2YZRA 4HT3A 4XKYB 1VYRA 4UFJA 3GXNA 5DN1A 1SFJA 5D37A 2V2CA 1UBSA 4NZFA
chains in the Genus database with same CATH superfamily
3GS6A 3S5ZA 1EJXC 1FX6A 2OWCA 1H2JA 3HN3A 1PX8A 1BTCA 4UFLA 3TQ0A 4EIVA 1KM5A 2QNEA 4Q32A 3SUWA 1I4NA 2DT3A 1P1MA 4LU0A 4V1YA 1K8ZA 1UBPC 3GK0A 4NIRA 1P48A 1XV8A 1GVYA 3VU2A 3UFYA 4C6CA 1UMLA 4LUTA 3E02A 1BGGA 3MMDA 2YDRA 5B7YA 3IJ9A 7ODCA 3LCLA 4G7EB 2XN1A 1TRDA 1CLXA 4QLKA 2ZUVA 3P81A 4W7VA 2Y5JA 2VX7A 1VB9A 3N2MA 2P8CA 3WLQA 3LPPA 2ZXDA 2ZZ7A 4I9MA 3TW9A 1JZ7A 2ZZ3A 4ONVA 5CAKA 1VGAA 4FLRA 2R14A 1BQCA 4C1KA 3BG3A 4B5SA 1V6UA 3SUSA 5DT5A 3TSMA 3JU2A 2PWFA 3S4TA 4JTQA 3OVRA 3PVFA 3AIQA 1XLAA 3UJRA 1B9BA 2BWGA 4IQEA 4GUIA 5TD4A 1UUMA 1XDMA 3ELFA 3L4ZA 4GACA 1OYCA 3LV6A 3U7BA 2WSRA 1MUCA 5LSMA 3EWDA 4UTUA 3JR2A 3PBVA 1FP8A 3SCWA 4UXDA 1DHPA 3JUGA 5AHEA 1EJWC 3EDDA 4WUIA 3BWWA 1BKSA 3GE7A 4LQ1A 3KOYA 3DG3A 3N9SA 4JX6A 1TA3B 1QWKA 4ADUA 3C0JA 1SSDA 3WDIA 3C6CA 4F0HA 2NQ9A 2HCVA 3RPMA 2Z25A 2WCSA 3EWCA 2VD8A 4NU7A 2WSPA 4MOZA 5JH1A 1LQAA 2WMIB 1R6WA 5H8MA 3C86A 4LXFA 1EDGA 1XUUA 1K9EA 3VGGA 3PANA 1HJXA 1NFBA 3UETA 1Z32X 1GQKA 1TPB1 1GVEA 4LS2A 2BSLA 1TQXA 4IG2B 4Y9OA 4DXXA 2CITA 4PMRA 2C3ZA 4J7RA 2X1IA 3MYPA 1J01A 3L9CA 5I78A 1SPQA 3NXFA 1F8IA 2PWDA 3C52A 2VR2A 2XH0A 3UPBA 1ZY9A 2PMQA 1JD9A 2ZDRA 5DANA 5FEPA 4C6EA 2CBJA 1W3HA 5H8PA 4XKYA 5DMNA 1X1OA 3E0IA 2I1OA 4IGSA 4JNMA 5DT7A 2PDXA 2QUUA 3NZPA 3UP8A 3LY0A 5K4XA 3B97A 1UJPA 5K4ZA 3GIPA 1LUCB 1ZQ5A 4H41A 2FPVA 4DYJA 2VCBA 1AW5A 1DIOA 1TYGA 4S3GA 2C1IA 2J9YA 4MWAC 3LZ3A 2HROA 3WEOA 3FYPA 1TO3A 5AC8A 1H1YA 3S1GA 3SCPA 3KRSA 3GR7A 4M29A 3DCPA 2V2HA 4WOQA 2PLMA 1CZ1A 3O06A 3NEHA 5LNUA 4MY1A 1GYLA 3DHUA 4IGMA 2BHUA 2YJQA 3WDQA 4N4PA 4WSJA 5I3JA 3GFXA 2INEA 4HK7A 3WDJA 1MFVA 1DJXA 1E0WA 1YLVA 4JX5A 1LZOA 1OF8A 3A9BA 3WLLA 3VC6A 4AMAA 4ZEPA 2A2IA 1E9LA 3AHZA 2O9PA 4M7SA 3LTPA 1SJCA 3ZT7A 2DVXA 3H4XA 2J62A 5DBTA 4FB7A 3S1WA 2YIHA 1J12A 4JQ4A 4GHRA 4QFUA 4TMBA 5EMKA 1I0DA 5LGXA 2PDJA 1ZAIA 3UZXA 1EYWA 5DXXA 2VRQA 3ARZA 4LUJA 3N6HA 3TAKA 1LWIA 5D32A 2ZTJA 2OYKA 1GVIA 1O60A 2Z6JA 5F4XA 2NSXA 1CGVA 3GKAA 2FPYA 4QCEA 3R8HA 3PZTA 1XIFA 4O11A 5AYIA 5HINA 2OSXA 1C8YA 4GG9A 1QNRA 2E7FA 1EL3A 3KCLA 1J0IA 1AW2A 4DX3A 1CXHA 3EDJA 3W2LA 2F9RA 5CSRA 1E1FA 1V6WA 5C9UA 4NJKA 1XLDA 4O1FA 5BOEA 4Z42C 3BLFA 1GT8A 2C71A 1H09A 1LRTA 4B5VA 1RVGA 3LI1A 4HPHA 1M03A 1MUWA 1RY8A 4MUPA 1PZ0A 3IAPA 4Y6GA 4W85A 1GNXA 5JBFA 3UQNA 4AHPA 3LCGA 2WHLA 5HK4A 1XSKA 3H7RA 2OFJA 1UOZA 4LNYA 5A94A 1IEQA 3CXOA 6ENLA 3EWZA 2ISVA 4X9SA 4D9PA 3URQA 3HPZA 3P14A 6XIMA 4UTTC 4C6DA 4ZTYA 4GI9A 4Z2JA 3BLPX 1V0NA 1ADDA 4JTSA 2PF8A 3MT1A 4KCUA 2NV2A 2XJ7A 2ZRUA 4XAZA 4IHCA 2QZRA 3BXWA 1YDNA 2Z0IA 4WY0B 3THQA 2Y88A 4O54A 3WCZA 4AQLA 4HPNA 4HGXA 1DE6A 3TXZA 3QXBA 1B3YA 4PMXA 2QUNA 4ADSA 3T78A 2WW5A 3LU2A 1J0ZA 3B40A 4NAFB 3IUHA 3MSGA 1BVZA 1E6XM 3GBEA 3KP0A 3SUTA 2B31A 2BXZA 2NV9A 2ZE3A 3DFQA 4C6NA 2WNZA 1DXFA 4LEFA 3THUA 1E0XA 4JEQA 4O18A 1TUFA 4D8AA 2QCMA 4X22A 3H55A 4K8EA 1CB2A 5DLCA 4AWEA 3F5KA 4PCPA 2G5WA 3DI1A 1LOQA 2UBPC 3K4AA 3WUGA 3BAKA 3MP4A 1E3XA 1H60A 4ZO9A 2Y24A 3EZ4A 2VZTA 4UFKA 2PGRA 3WH7A 3TXVA 3OLGA 3PZUA 2FGZA 5JMUA 5A6AA 5M03A 2OQHA 3E9AA 3DI0A 3TX9A 2IQTA 3NQFA 2G3FA 1EOMA 3GLCA 3DU0A 3L4WA 1Q6LA 1NFGA 4LVFA 1LLWA 3DKJA 4HNVA 1OX4A 1NY1A 3OODA 5HWMA 1ITQA 1EP3A 3EB3A 3MMWA 3W86A 3EWUA 2NQJA 1WO2A 3KCOA 5FKYA 3H7UA 3RR1A 2WNQA 3DDMA 2PTWA 2Z4GA 1OC5A 3JRKA 4CQ8A 3HBLA 2VD9A 3TA9A 1SR9A 1CCWB 3QQ1A 1XKJA 1W6TA 3AUOA 1XIEA 1TSIA 3ABZA 4HBKA 1Q85A 4JTUA 1E3ZA 3DX5A 3II1A 4JGDA 3REQB 4QJ5B 1Y5VA 1KWGA 4L7ZA 1UOKA 4DUVA 1TPC1 3CUIA 2E8YA 1EX1A 4NJGA 2WZTA 2Q3RA 4NJJA 3WQVA 1W37A 2PSNA 4GFSA 2EKCA 4NRRA 1EGMA 2GQ9A 4IQLA 3W7DA 5I3IA 2H3BA 3KHDA 2TSYA 1JYWA 1TPH1 4TV5A 4E3VA 3UJFA 2OJPA 4KS0A 2GSHA 1F61A 2B7QA 2G4FA 2OZ0A 1QNPA 3HMJG 5F2IA 1E4IA 1W1IE 3BARA 1JXKA 1ICSA 3A4WA 3L2MA 2GSJA 1UKTA 1GVOA 4I6KA 2HNHA 5MKGA 3V7PA 2J9ZA 3GBDA 3IGHX 2J7HA 1A49A 1TPFA 1F3TA 1TIMA 1R46A 3BANA 3KLLA 2Y8UA 4WKAA 3VKDA 2NVAA 3GW3A 4DYEA 3WUBA 2XM2A 1EA0A 1JFHA 2CLFA 2OQYA 4CQCA 1JULA 1P0NA 3L4YA 5GNXA 3WIJA 3WY1A 1J93A 3PZ9A 3CT2A 2NXGA 1UCWA 3VE9A 3DFPA 3PC0A 3VZYA 4HNNA 3AU2A 3ITOA 3SQSA 1BYDA 4L61A 3QFEA 1O94A 1JNEA 5DCDA 3LSCA 2BZNA 4A3QA 4DF2A 1XLKA 1JQVA 2R6OA 4GCAA 4UWMA 1NOUA 1UR8A 4L4OA 1BF6A 2Y7EA 3C8NA 1U1JA 3UNTA 3G18A 4JY9A 3W53A 3PTMA 1ZPTA 3EX6A 1NSJA 5CJNA 1PKLA 4KT2A 3W7KA 5FOOA 2ZICA 3TE9A 4R7OA 3C2OA 3GDRA 2VQUA 4HN4A 2FYMA 4O8RA 3EDKA 3W1QA 4LAMA 3BZGA 3DC8A 1G4PA 3SIMA 3WNNA 2PRHA 3CQJA 2Z2AA 2BXYA 1IWPA 3GW0A 5EBUA 4JQ3A 3ZOAA 3N11A 2GLKA 4IP7A 1C3FA 1FY6A 3HPAA 2IW0A 3W1LA 4YXGA 3R12A 2PD5A 3I68A 3W1RA 1BLIA 4GZIA 4QG9A 3R5EA 2J9XA 2D24A 4AD3A 1FWRA 3SCSA 3RX4A 1A5OC 3WF0A 1C29A 4NNBA 4GZJA 2WVTA 1CBGA 3CZGA 3URBA 1FFQA 1QI2A 1ZJBA 3IV3A 5REQA 4GY7A 3NVDA 4IIGA 2VC9A 4YYCA 2YB4A 4ML9A 1RJPA 1LRQA 1EP1A 2QJGA 4JTRA 1A5UA 2A4AA 1FHDA 3THCA 3ARTA 1M7OA 4ES4A 4CQDA 5BRBA 2NXIA 4PULA 2E6YA 1WOAA 1EFZA 4Z1BA 3H2FA 3AS2A 3ZWTA 1W9UA 1RD5A 3SCTA 1IXPA 1Z41A 4K8HA 2VC6A 5KZ6A 1OFOA 3GNXA 3FEQA 2WK2A 4P5UA 4GI8A 5EMUA 2DVTA 4XIAA 2YA2A 2QMKA 4N9BA 3WLOA 3VNMA 1D7FA 4OHQA 1SVDA 2OGJA 4G9PA 4QNEA 1POJA 3PBGA 1S2CA 1UR0A 3AZSA 4DBEA 1S2WA 3SI9A 3TYZA 3EPMA 5A8PA 4ZL1A 1P43A 1MDRA 2F84A 3LHYA 5BXRA 2Q01A 4PE8A 3VGDA 2IUZA 4AWUA 1MRAA 4LX4A 1QW9A 4UR9A 4PSPA 4DXVA 4TIMA 2A5HA 2VR4A 3USZA 4DWSA 3GR4A 5FF7A 2UY4A 4M24A 1P6WA 4PMOA 4EOUA 1EH9A 3ZSSA 1AJZA 1ZHAA 2ZC8A 1OY0A 1S5WA 4QSFA 3SB0A 1T8XA 3FK4A 4ZSUA 2DSZA 3T05A 1XKYA 2D3NA 4LV9A 3T08A 1R7AA 3W7EA 2E68A 4DUOA 1VPYA 3P74A 4MWAE 4WIWA 1FHVA 1HJSA 3NNTA 1UP3A 3QZEA 2QVNA 3CMFA 2YGYA 5HAOA 4LB4A 1R7OA 4JFUA 2PP0A 3OZMA 2VM8A 5CQ1A 3H7VA 3RF9A 4LAKA 5ABTA 4B9ZA 1BRLA 1DE5A 1LP6A 3U3HA 1C7TA 3PZNA 2CETA 5IFTA 4OECA 1HT6A 3PP7A 4J27A 3BL3A 2OYMA 3NDYA 1TZ7A 3HV9A 3AZTA 5IHSA 3MUZ1 1QNQA 3T40A 1OCNA 1F6YA 2ZIDA 2ZZ4A 3DERA 2YL9A 4OKDA 3D0CA 3W7NA 1OWQA 1MO0A 4BEUA 4MB3A 5I03A 1WZLA 1GZGA 1NH6A 1W1TA 5HNUA 1QMLA 3W37A 2RDUA 1TZ9A 2ONEA 3M47A 3PN8A 3CAWA 4EACA 2J25A 4XUYA 3UXIA 2R24A 4QJ4B 3W2MA 5BROA 1A5AA 1DJNA 3B8VA 3T42A 3T1GA 4LPCA 1IT0A 4K7YA 1MXGA 5M17A 1WKYA 4RE0A 4ZQPA 1YNYA 3WH6A 3HZ3A 4XUGA 3CK5A 3NZRA 5D2VA 3W7LA 2VHLA 2JGYA 4KWWA 4JR5A 4TX6A 1H1ZA 1XFCA 2G3MA 5GJMA 5FL1A 1J10A 1KRBC 1SJAA 2I5QA 1LBMA 1UMYA 3F2DA 1OSEA 4LWWA 1XRSA 4MFDA 1ECQA 5F4SA 5FF3A 1NDYA 4A8IA 1NQ6A 2ON3A 4GUFA 4AZ7A 4BWLA 1KXQA 2YDSA 5HULA 1E6RA 3KTSA 3QH2A 3C8FA 8CGTA 4HMDA 4DPPA 2EPOA 3KL3A 2DGAA 4LYPA 4X0NA 3LPGA 4HK6A 2QF8A 1X1ZA 5A8NA 1JZ6A 3H26A 1ME7A 3NYDA 4ORMA 3RHGA 3WLKX 1LLOA 3RMEA 3R7MA 2CZ5A 2NZLA 4BHYA 3O16A 1OGGA 1M7PA 5I2UA 2ZUSA 4UQ9A 3ITYA 4B4HA 1R3QA 3PTQA 3QR0A 3U5UA 3G6MA 1S2TA 2PWGA 4LUSA 5IFPA 2ADAA 3NQGA 1XIGA 3TCEA 2VX5A 2RH9A 4NXSA 5A6LA 3GH4A 4B91A 3A4XA 1Y8BA 2E09A 4ZGYA 3IIXA 4XAFA 3B4YA 4JX4A 2EJAA 3QBUA 2DUAA 4QITA 2QAPA 2OZ3A 3ZVIA 2X2GA 3NQAA 2CLOA 1OBAA 1QI5A 3KBJA 2QDHA 1O12A 4DWSC 1HVQA 1UD5A 1O7AA 1Q6EA 1GEHA 3N19B 4X9YA 2QJMA 2Y6ZA 1PYFA 1US3A 4HMEA 4OOUA 5IM51 3R4IA 2YPIA 3G2GA 1OFEA 4F0MA 2NX9A 4Y90A 1VCGA 1VAHA 2Z27A 3O05A 3MSYA 2OYLA 4ACYA 1EQPA 4O14A 4GKLA 4HVXA 3P5YA 3TJLA 2QJNA 1FWNA 1RP9A 3AS3A 3M0HA 1XRVA 1KM1A 4A22A 1GJUA 4AXKA 1HQTA 1JCYA 4Q33A 2ABBA 4CU7A 5CPTA 5DELA 1KM4A 4DJDD 1GVFA 1YPIA 2KAUC 1JCMP 2Y7GA 3OA5A 1PXGA 1G9HA 3HG2A 3IGSA 4XZMX 5AHFA 2JGQA 3VMNA 1O1ZA 1Q8JA 4C60A 3GVGA 2HBVA 3L65A 1TMQA 3L5LA 2PLCA 2HVNA 4AYGA 2GK1A 3GM8A 1BVNP 7PTDA 3K5XA 3KFTA 2XGZA 3NSXA 3RO6A 2WXDM 4H8HA 2XZ7A 4PUWA 4LRTA 3WO8A 2XFWA 5T26A 1EC7A 4IQJA 3N2OA 4LAZA 1Q7ZA 2PS2A 1REQA 3TYCA 3BQ6A 3D47A 1G5AA 1E6NA 3NG3A 2GJXA 3IANA 4Z1AA 2E1WA 2P50A 2O9TA 4G1KA 4LYRA 8XIMA 2DVUA 3PWIA 3UW6A 1V3KA 1XUZA 3L4UA 4JKKA 4Q4QA 1GG0A 1VS1A 2XVPA 4POCA 3PF3A 4IISA 1V3IA 3BO9A 4J9JA 2FGLA 3G1DA 1ONRA 1NF0A 3DENA 1A0DA 1ONEA 4FOKA 1KFJA 3NURA 2CYGA 2D3LA 2CCRA 3LCIA 4G6CA 4M6PA 1LF1A 3TN4A 1X98A 4NAEA 3VTRA 1RA0A 1E43A 2XVLA 3MWAA 5TAOA 4DIAA 4AZHA 2D2GA 3L0NA 4KETA 1VBUA 2VKZG 3ZSTA 1DTNA 4O53A 3S1XA 4US6A 4FOUA 3NQCA 2QEZA 3UR5A 1FXQA 3GXIA 3V0UA 3V0TA 4M56A 4B3KA 1TIWA 1ZSXA 3DC0A 4R7WA 1GOXA 4M1BA 2FGBA 4GCXA 5B7ZA 2J8GA 4UMCA 2HS8A 3CPRA 2E8ZA 2J24A 2DH2A 3L2LA 2DUXA 3VDAA 4WSKA 4MNMA 4ICCX 4CD6A 3GAYA 1MQPA 2DZUA 3UWEA 1DQXA 2CKRA 3CGTA 4IPPA 2Y7DA 3GTXA 3WK0A 2VNCA 2CPUA 1OIFA 2DDXA 2I16A 2QS8A 2G3NA 4JYFA 2G41A 4F66A 4AFYA 3BDKA 3E1F1 3WF4A 1DL3A 2OMAA 2A21A 3WD4A 3MKCA 4AVOA 1AMYA 3V18A 1G7UA 4LVAA 5HR7A 4DXKA 2BOFX 4XD4A 4EX4A 4FIRA 3N4FA 4OOZA 3NL2A 2QLYA 4WVXA 2FZ9A 3K2GA 3P0WA 4WR3A 3T8LA 1X38A 4RL3A 1H63A 1EO7A 3UYIA 4HU3A 1CPUA 1IE7C 4IQDA 4UNLA 3AXHA 2VEPA 4A2RA 4JTGA 2J77A 4MYXA 1QUMA 1W8SA 1IHIA 3EXTA 4CD4A 4JN6A 1A0EA 3GTNA 2EPMX 5AHIA 3F2BA 1DBTA 1K8CA 5LNSA 3ITVA 1F3WA 4J5NA 3M07A 3BLKA 4O1AA 3RLUA 4J3ZA 5IDZA 4REQA 2PDCA 4WDWA 1PTAA 3AROA 5JUVA 4JS3A 4ZOCA 1DWFM 3I3DA 4AMCA 5D4YA 1KFEA 1IV8A 4NP7A 3IK4A 4JIQA 1K9FA 1K7FA 1W5QA 2ZZ1A 3LX9A 2HNEA 1ZUAX 2X7WA 2BBFA 3N4EA 3WNLA 1OFQA 4FA3A 4GIEA 3EEGA 2EO7A 5C54A 1QPRA 2OCZA 1HL9A 2QJIA 2VGIA 3WQFA 4FXJA 4R34A 1K3UA 1MMFA 3AI0A 3GX9A 5FJIA 1OC6A 2Y63A 3QOMA 4XZHA 4ZQNA 1J5TA 5LA0A 1PHQA 2BXVA 1G4SA 1ZBVA 1U2YA 3M5VA 3VOHA 3B0UX 1UKPA 1ZALA 1PJ9A 1VLIA 3VA8A 1E55A 5I77A 2HQAA 2EEXA 4H9VA 3W84A 3NIYA 3FSUA 4W4QA 3NQ7A 1AW1A 3PUGA 4BI5A 1ITXA 3M6YA 4Q8UA 1Q2SA 4I9TA 3EOLA 3IARA 3WSUA 3FY1A 4AH7A 1S2UA 3WBXA 1XF0A 1UUQA 1WZMA 3G0XA 2Y70A 3MHGA 4IIBA 1N8FA 2INFA 3HPSA 2NW0A 4WSHA 6A3HA 2BY1A 4EANA 4WJ8A 2VOTA 4OFCA 1ME8A 4XISA 2W92A 3Q94A 5C9WA 1W1ZA 3TJIA 2JK2A 3BV4A 3RCMA 3LCWA 3P2VA 1RD6A 1TCDA 3AU6A 2YZ5A 3AISA 3E0WA 2C79A 3CH0A 2G50A 2RHGA 1AA1B 4Q4MA 4A3RA 4XVDA 1JD7A 4JIPA 2BDQA 1YRRA 4B90A 3FA3A 3STEA 4N6EA 4FO4A 3TC7A 3E12A 1TJPA 1V4YA 1X6UA 4KGJA 3FGCA 1UD6A 4O4VA 5HJYA 4LVBA 4E4FA 2D2HA 4CQAA 5E9AA 2WZHA 3WN6A 3E2VA 4GVIA 3WH5A 5IRPA 9XIAA 3K1GA 1SW0A 3BVJA 4MPKA 3WF3A 2JFEX 4MLRA 4CNUA 3M0VA 4AD0A 3W00A 3G6LA 3NPUA 3LGEA 5U7SA 2XH7A 3MUCA 4H8VA 1NDZA 4Q8MA 1UC5A 3I4EA 1HP5A 2WVSA 4CU8A 2OZ8A 1B3VA 5PTDA 3OJGA 3NYZA 5LNRA 1G67A 3MHFA 1FWJC 1CGXA 1DKWA 4GA8A 5G4HC 4L9YA 3RG6A 2J47A 1BF2A 4RXGA 4O1DA 3MUXA 5BMWA 3T0AA 2YB1A 3KL0A 1NJJA 4XV0A 1TJ2A 2WKGA 1VJZA 3K13A 4C65A 4QP0A 2QCGA 1XDJA 1P1XA 4Q4OA 3WQCA 4UFHA 1JPDX 4IIFA 3KBNA 3WL0A 2JE8A 2WV8A 1JI2A 2ACUA 2YL8A 2RFGA 4AG0A 2CXEA 4XG1A 1P0KA 4EK7A 4LTSA 4U2ZA 1SJDA 4FXSA 5I3DA 2CFFA 5HNNA 4MNLA 1GOMA 4IMDA 1H7XA 4S3DA 4ZZ9A 3MVTA 3FS2A 4J3XA 1AFSA 2D23A 5I06A 3O7UA 1EXBA 1RQEA 3HM7A 3AIWA 2CKSA 2IMRA 1C8VA 2VVNA 4QBXA 3T8QA 3EDEA 3F4VA 4TVCA 1JPIA 1LROA 4KF1A 4YTQA 6REQB 3N2XA 4J35A 2XGIA 1LCOA 4QIUA 3EAUA 2RJGA 4OWGA 4LV4A 2V3DA 2HBXA 4ZFMA 3GXNA 1SFJA 4AZIA 2V2CA 2IKHA 4NZFA 2W3ZA 3B3DA 3D3AA 4JTDA 5CAHA 1XGEA 3WD2A 2OLAA 3H4WA 1WUEA 1KXHA 1V6TA 4Q7IA 2E5DA 4E4UA 3T0TA 3EX1A 3WLHA 1Q4NX 4QG6A 4IXHA 1YNQA 3M64A 2BFGA 3XIMA 3GQYA 1X6LA 1KR1A 2V67A 3S2NA 1JJKA 3NQVA 2J7BA 1J0JA 1AL7A 3CT7A 1NOWA 4TXEA 3W7PA 2EG8A 1YEYA 3KOFA 4RK8A 4FP1A 3CJPA 2RJHA 1EGZA 4BA0A 3QGAC 3N25A 2PDPA 1L6YA 1UZHA 5J5RA 4GI6A 4GXPA 2ALDA 3LRLA 3RU6A 1V0MA 4GC4A 1XLBA 4AC1X 1UP2A 3VINA 4UTMA 2OZTA 1QPNA 4L56A 3TN6A 3LS9A 3OU8A 5AVNA 5A6BD 3CL8A 3KOWA 3KTXA 4FNPA 4B4FA 4JIRA 1WZAA 3G1YA 1CGYA 1SW7A 1PWMA 1RP8A 4HPGA 4DO7A 2CEQA 1PZ3A 3S83A 2VC7A 3QR1A 1R3SA 3TTSA 3VVGA 1HNYA 1XH2A 4P2VA 1MNZA 3GC2A 5AYBA 4OU1A 1E72M 2WVVA 2FVLA 2XTKA 1B57A 2X7VA 2WHKA 5D05A 3MP3A 2YL6A 1WDWA 4QAIA 5BOOA 4CKQA 3SCQA 4GYPA 3GWQA 4P7NA 4DVOA 5AC5A 3MBFA 4KPLA 3WDRA 2X0YA 4AD1A 4MB1A 1GOQA 3LMYA 4G56A 2PPGA 2G96A 4DAFA 5LHFA 3VCRA 2YCJA 4J40A 4O16A 4QSHA 1UC4A 2XIIA 2ZRYA 3NQMA 2CW6A 3S8HA 3OG2A 2W6RA 1UIOA 2I17A 2YDQA 3OIXA 1KCXA 3MW7A 3KHJA 2BTMA 2ZTKA 3UERA 4PMVA 5GQBA 9RUBA 3OVPA 2WHMA 4UTFA 3THDA 4U3CA 4MY8A 1M1BA 3HGJA 1MW3A 3QM3A 3HGOA 2PWHA 1W9BM 3B9EA 4QEEA 1XFBA 2J7GA 5TBOA 4JTLA 5C8BB 2Z1BA 4FSAA 4DBSA 3GNRA 3DBPA 4KIRA 4GINA 3W6LA 3DG7A 3W87A 1ML1A 2NX3A 2J7FA 3HFTA 3VIKA 4RPPA 2QGHA 4MYAA 1TMHA 4JKMA 1JZ4A 2VQTA 4HU0A 5C2XA 2CZDA 3SCVA 2Q8ZA 3CHVA 5EMMA 1QHPA 1R85A 4N9DA 2DZVA 4AD2A 2XN0A 2IQDA 3WEZA 1W9PA 4DJDA 3PFRA 3ZVHA 2OQLA 3HQPA 4UQAA 1HJWA 2W63A 3IIOA 2JKAA 4FLQA 2DZWA 3IV8A 1S2VA 2YBTA 4AEFA 3PPFA 1A3WA 4AU0A 3MI2A 1CIUA 4R33A 2WLZA 4LAUA 4XZ9A 5G1TA 5BRQA 1M68A 2F6KA 2B7OA 4A3HA 1V02E 3RYSA 4DM1A 1R86A 1WPCA 1E71M 1LL4A 4PL1A 1XH1A 2BHZA 2NSOA 2E25A 3Q65A 4JIEA 2F38A 2FJUB 1U1HA 1B3WA 1B9ZA 3QY7A 3WDPP 2CWXA 1VEOA 3W7GA 4I7VA 3MP5A 2WLYA 2DSUA 3ZO9A 3W7MA 4H83A 3R79A 4A05A 4JN8A 4RNIA 1JZ2A 1M65A 2P0OA 3N04A 2HWGA 5L6UA 4QRNA 2PUZA 3I6EA 4D6CA 3NL5A 3IJ6A 4EXQA 4DN1A 1VRDA 4DI8A 2VEKA 1VFTA 5ABEA 4DZHA 4HOZA 3GFZA 5FA5A 3H23A 3C0LA 5E6ZA 5BRPA 3AYTA 1KFWA 2NXHA 3WJYA 3VM7A 1B3ZA 4MWAD 3QQWA 3P0XA 2PA6A 4PTXA 3UR7A 3GO2A 1GYNA 1FH8A 2C0HA 3LM7A 2IPWA 4GX9A 3VFLA 1PCKA 5FF2A 3OTRA 5JQ9A 3UR8A 5HNTA 3O2LA 5A8QA 4E8DA 3EPOA 4PUNA 1VCVA 4L1GA 1ZNNA 3W74A 2JEQA 4GBUA 2GOKA 2YA0A 3GXFA 2EPNA 1K4HA 3E0FA 3TN5A 3KBMA 4CN6A 4NJHA 3FVMA 4Y8EA 1DJHA 1SYTA 5CGQA 5H6HA 3N13A 1S1RA 2VDIA 1POKA 2OX4A 2VL4A 1YX1A 1TWIA 1HN1A 2XHYA 4KBXA 3EMQA 3BC9A 3MC5A 3BAXA 7REQB 4QHRA 1FWSA 4H19A 4IJBA 3N2CA 1YXDA 4NJIA 3CQ0A 2F6UA 2W4XA 3URNA 1XLLA 4QISA 2BX7A 3V75A 3EGJA 3G77A 4OBSA 1MEHA 3TYDA 4JKLA 2IKGA 2Q3OA 1CWYA 1QAPA 1Q6FA 2Z29A 1YTKA 1Q7QA 2ZA1A 3R0DA 1UR2A 4H6EA 3BAWA 3KBSA 1DWGM 3ATYA 1F5ZA 1PKMA 1QBBA 3FDKA 1OK6A 1I6NA 4ASTA 1B31A 2WB5A 1TB3A 3G8EA 4H01A 1ADOA 4F0KA 4LT9A 1N8IA 5EBAA 3EDFA 1V6XA 3KUMA 3R11A 4F8XA 4O17A 3SRKA 1TR9A 2NUYA 3FKKA 2ZA2A 3MSRA 1W2VA 2DQWA 1FDYA 1GOOA 1HF6A 4HJWA 4U31A 2AQWA 1KB3A 3C2YA 1EZWA 2VWSA 6TAAA 5CGMA 5LIKX 4Q8OA 1Q6CA 2C18A 3E49A 3NPWA 2A1YA 1P0EA 4M6QA 3RU8X 3IJ7A 4GZEA 3PPHA 4JHZA 1V8EA 4XBKA 3C4UA 4S3BA 3SR7A 1M6JA 2YW3A 5EMLA 3WQ4A 3QZ6A 4B16A 3G1RA 3N2TA 4KFNA 2WYSA 1EC8A 3BW4A 1JF6A 2WM0A 3VDCA 3LV5A 5AY7A 2Z1WA 1FWHC 1QATA 1TV2A 4MMWA 3F4DA 8XIAA 2QCDB 4GIRA 1XC4A 3TJ4A 3A4JA 1R38A 2B81A 2A7NA 1WBHA 3O1NA 4J3UA 3LLFA 3Q4DA 4GBDA 5KETA 3MTWA 1IGSA 3ENLA 3KRBA 1FWDC 3DFNA 1OADA 1GYMA 3OBAA 3QZAA 4WDXA 1E1CB 2DIJA 3GUGA 3NXLA 2OT1A 2H9AA 2NT0A 2GVGA 3QTGA 3GHTA 2VCAA 2X1SA 2ZVRA 5DO8A 4G8TA 5D30A 3VGFA 4R27A 4KGLA 2FJKA 1O5QA 3FVDA 2ZDSA 2VGGA 4GVFA 1F73A 1XC6A 2VEMA 1HKWA 3RCNA 3TVAA 3B8IA 4UOQA 1UH3A 1ZGDA 4DZAA 5BWFA 1A0CA 3KE0A 2ZX6A 3Q37A 4Q8NA 2PEVA 5ECUA 1XYFA 1KGWA 1OK4A 1TJRA 5JU6A 3KVKA 4RZBA 5D03A 2LLEA 3CLMA 3EB4A 5HUPA 2PGWA 1S46A 4AYSA 2NV1A 2XFYA 1JVNA 2J8FA 3ZR6A 5ABFA 4DO5A 4TX8A 2WSKA 3H22A 1MZHA 1R3RA 3QGKC 1XBZA 1FWIC 2CLEA 3SRDA 4F2BA 1C8XA 3CTLA 4L6HA 3LBMA 3AXXA 1XQLA 1GK8A 1JIBA 4JTEA 3S42A 3ANYA 1B3OA 1W3IA 4PEEA 3W6YA 4MKSA 1I2NA 2FKPA 2EQDA 4DF0A 1K9DA 4PB4A 1JYNA 2WMKA 1ISZA 4YTRA 2YXGA 4INFA 2A3EA 2BY0A 4IFKB 4O28A 2BS9A 3QW3A 1XG4A 1S3HA 1EIBA 3QPZA 3HQ1A 3PTDA 4IMGA 3H2AA 3I65A 2AQOA 3U48A 4V1XA 1LBFA 1B54A 2NQHA 3P5ZA 1GVSA 1X1NA 3SBFA 1FP9A 4LF1A 2OO0A 2E77A 2EKGA 1JAKA 3VYLA 1FWAC 1Y5WA 2QKFA 3STGA 1DXEA 3APYA 3N3TA 3VOIA 3W1MA 4LC8A 2PRMA 4QROA 4DI9A 3VIFA 3QEZA 3WLNA 1QI3A 3UXLA 3TOYA 1GVRA 3GU9A 4LCQA 1DQWA 5C71A 1PTDA 4C6QA 4H7ZA 1AG1O 2YW4A 2ZQ0A 5HMSA 1TV8A 1BWVA 1YADA 4J4KA 3W85A 5CZSA 4RCXA 4MZYA 4BR1A 5CCZA 4QXIA 2FTWA 2A79A 4ZB2A 1ALDA 4I9JA 4C6PA 3PUDA 1D7KA 4JYDA 3QV8A 4KEVA 2J7CA 4QX4A 1HIZA 4AIBA 2EBNA 3PWGA 4HA0A 3FHAA 4ZMGA 4IMFA 2QUVA 2A6NA 1MW2A 3FEMA 4ENLA 3K8KA 3GD6A 3SN4A 4CD5A 1E70M 4HYVA 1LWJA 3CZLA 4ZB5A 6PTDA 4KEUA 3KOZA 4L80A 1O66A 2PU1A 3VIOA 4JDBA 4W8AA 4FX8A 3HF3A 4LS0A 1E1EA 2VT0A 1ZBWA 3TQPA 4DBUA 2ACSA 5A6MA 2AKMA 2J75A 1TTQA 5CGTA 5IHRA 2WO5A 4TVDA 5FAJA 3N4AA 4MNKA 1G7VA 4JXCA 3ITTA 3LHWA 4ECLA 4PCFA 4QJ1A 4BJHA 2FB3A 1UWQA 4JTAA 4YIWA 1OJXA 3EPNA 1Q4WA 3ZJKA 3M44A 1NM9A 1EB3A 3H6OA 4CNNA 1PIFA 1TG7A 5AC4A 3T4CA 1DTUA 5FESA 1KLZA 1F4HA 3D46A 2I5IA 3DH7A 4HSNA 4CCDA 4MHBA 3IVSA 5A3HA 2FZMA 3EYPA 2VJXA 2Y7FA 3IWPA 4XBJA 2DUZA 1XINA 2ZXAA 5FCZA 2ZX5A 4AVNA 1UWAA 2REQB 3QW4B 6TIMA 1KFKA 3NDOA 1BXBA 3DZ1A 3VGEA 3AS1A 2WKLA 1UD2A 1KCZA 3NL3A 2P0IA 3ZR4A 5D9PA 3V36A 1GUVA 2V5DA 1RALA 3RLHA 2WWCA 1MXDA 1QNSA 3L4XA 3WMBA 4ACZB 1KTCA 4GUHA 4PMYA 3WF1A 4O52A 4Q8PA 4N6FA 1ELSA 3KXQA 3POCA 5D04C 2C6QA 5A6JA 1UR9A 3G1SA 5HBFA 1OYBA 3WLMA 1CXLA 4N9EA 4DRSA 1HKKA 4I7WA 2WMFA 3JS3A 4C1NB 4EAYA 2ACQA 3A3HA 1OFBA 2IQ0A 2GWGA 4CD7A 2VGBA 1AD4A 1U5VA 1VQTA 4XSMA 4Z17A 2X30A 1EWDA 3HGSA 1AQFA 1FH7A 3VNDA 4RKAA 3VKJA 4EF8A 2AL2B 3FA4A 1W5PA 5AC7A 3TZFA 1L6WA 2UWFA 4GNKB 5J04A 2WQPA 3MSDA 3R43A 1Z8AA 1F74A 1ZTVA 1GEQA 5EY5A 1QDSA 3E2SA 4GO8A 5ABGA 4C90A 1SU5A 3C56A 4HU4A 3IIPA 3CH9A 3MCMA 4QS6A 1X97A 1K4GA 2DZPA 3ZXWA 3RILA 1JZ8A 2OLSA 3LNMA 2ZWYA 1GW1A 3Q58A 4TO8A 4LALA 3ZLHA 4FLOA 4ZB0A 4AZCB 1FWWA 4CQBA 1IEVA 3VCNA 1PKYA 2VZSA 4D1IA 2ZKMX 2I9EA 2NWRA 3RRXA 1DVJA 3TLLA 4DELA 2O9OA 1VYPX 3BLIA 3B9OA 4AF0A 1IF2A 4XAPA 3WLSA 4B92A 2XG9A 4C6OA 3W2NA 2FB2A 4OT7A 1NAL1 1GTHA 3JZEA 3MBDA 3WYZA 5CC5A 2V38A 2DFAA 1XLMA 1XLIA 4BI6A 4CUCA 3P6LA 2YDAA 3A23A 1ONXA 3H54A 3MDUA 3APTA 5C9ZA 4OV9A 4ZA0A 5AZ1A 1D3CA 3CPUA 4LW7A 2FTPA 4O12A 4S3KA 4HHHA 4GQQA 4D71A 4GQBA 3M0IA 4JPGA 2J7EA 5HJLA 4DJFC 1VP5A 1BYBA 3S2CA 4CNTA 4GIAA 5BXSA 2VFEA 1MXSA 2YA1A 4ATWA 4AHOA 1H0GA 3BQ5A 2XWEA 3CIVA 3NEVA 3H24A 4CCCA 4JTTA 4IL0A 1RR2A 5C55A 4X3ZA 1W1A1 3BAJA 2QGYA 1K6AA 4FOJA 2ZC1A 3CHFA 3CS2A 4TX9A 1PPIA 3RLVA 4YWIA 5DMLA 2PDIA 1WAWA 4KESA 3OGVA 4K1GA 2ZZ5A 5LA1A 2FQIA 4GNJA 4GY0A 3VGHA 1TWZA 2RDXA 5C5YA 1PDYA 3PK7A 1QFEA 3OZOA 4WCJA 3RPTA 2AAMA 1VBRA 1XI3A 1IYXA 4K68A 4ATLA 2BHYA 3FA5A 3AXKA 4ZXOA 1OG0A 2VFHA 3RPDA 4MWAA 1RCOB 3ARYA 4RZ6A 3M7SA 3OPSA 3PG9A 4K39A 2V82A 4IMAA 4FNRA 3GZ3A 3JVAA 4Y2WA 4MLJA 3AJ7A 1AJ0A 1SSGA 3E96A 3B03A 1CLVA 3WDHA 2QIIA 3ARPA 3GDMA 3I3EA 3I6RA 4RV3A 4S2BA 1XIDA 2RDWA 2QHAA 4X63A 3DIPA 3DEQA 3HPFA 3STFA 4JFVA 1A50A 3ZIZA 3PJUA 5ABHA 3T44A 3GHRA 4C6FA 4PBGA 3NOYA 2JEPA 3LXCA 2C7FA 3IGXA 3OBEA 2D0HA 3C3UA 1I2QA 5KZEA 1EDTA 4FX7A 1WV2A 1LORA 1FWEC 3QLDA 4KQNA 3FJLA 2VFGA 3BGAA 4HQVA 2CWNA 5K9DA 1OQFA 3EX4A 1DJYA 1TTIA 4Q3MA 2Z24A 4GXWA 2VX6A 2Z7GA 5BYWA 3ES7A 4AVFA 1XS2A 1DWHM 3DBNA 1KM3A 3TAOA 1PHWA 1K70A 5RUBA 3NDZA 4A3YA 5AHNA 5H2ZA 3TYAA 1KR0A 3TCSA 3LSBA 3NQ2A 1XPGA 1E6PA 3DG6A 2PDGA 3RGTA 5HANA 2DH3A 4W89A 3QKEA 4HYWA 4PL2A 2QPUA 4JTKA 1N2VA 1LQ0A 3LTSA 3W3OA 2W61A 1E5NA 5XIAA 3BLOA 2ZUUA 4GGHA 5I3HA 3AJXA 4Q8VA 1GQIA 2E28A 3KWSA 2XSBA 1A47A 4H9TA 4W8BA 3W72A 5KINA 4TVUA 3DYPA 3N18A 3UWYA 3QYSA 1DIEA 4LUIA 1LG2A 4F2UA 1G6CA 3VNJA 1AVAA 4M81A 4LY8A 4L64A 1HTIA 2PAJA 2OEMA 3S2JA 4DWSD 1YBQB 1L9WA 1KTBA 3NCOA 4O1EA 3QLLA 1ZENA 3B9NA 4S3JA 2FH6A 4PGLA 5ENLA 5FF4A 1VHCA 1A5LC 2XFFA 4AC7C 1HXJA 5LGZA 3T4WA 4KRUA 2NVDA 3V16A 4LYQA 3CZ8A 5J5DA 1FWTA 1V6VA 2BVYA 4D8ZA 4HHLA 4RDWA 4JFWA 3I7SA 1LM1A 4DY1A 3CUZA 1U22A 4TOQA 4RLIA 4UTTA 1ICPA 1UWTA 4S23A 2IXVA 2XIOA 3AALA 4PUMA 4RNHA 1XICA 1BXCA 3FYOA 3DFTA 1V6YA 1I9CB 2WPBA 1S38A 1XLFA 1WCGA 2BY3A 3GU1A 3IJ8A 4WJEA 3RM9A 3C2EA 3QJAA 3BLLA 1BKHA 2G95A 3ARWA 4DF1A 2V0TA 2P1FA 3UD6A 1OM0A 1LBLA 4HKPA 4EAMA 3S3GA 1PBGA 3IJIA 4TTGA 2NLYA 2DZTA 1QO5A 1YE6A 5CG7A 1VD6A 3PUEA 4WKHA 1GPFA 1EJSC 4HA4A 3CHEA 3GDBA 3PBMA 2ISFA 5BXTA 1YHTA 5AOUA 1R8LA 4C6BA 1M53A 4O57A 3IJLA 1A5SA 2CBVA 3UPWA 7TIMA 1ZAHA 3VAVA 1KBLA 2GGEA 1MRQA 5TF0A 4F0RA 4Y9AA 2D20A 3WQ5A 2C1HA 4IFRA 1WDDA 4F9JA 1SO4A 3W23A 2R1LA 3WQ8A 3TFCA 3BLEA 4JICA 1OG6A 4AD4A 4S38A 5CXPA 4ZENA 4AD5A 3G3MA 1V3MA 2BGSA 2FH8A 4UOJA 2YCLA 4M19A 1IZKA 1L8PA 4OV4A 3M0JA 3TTYA 3UWWA 5CJMA 2P10A 3VDBA 4N7QA 3NR0A 4ATDA 2QIWA 5H8UA 4C1LA 5D8ZA 2OEKA 4FI4A 2CHRA 2EPLX 4OTKA 4D6EA 1KQYA 4AZGA 3D6NA 5HDRA 3NZ1A 1RBAA 3AXIA 1KCLA 3WD3A 1UKSA 2ISSA 3ITCA 4LEQA 3R8GA 4ZOBA 3QSRA 1OGSA 1TE1A 4ZFCA 2WBGA 2BG5A 4ILSA 1H5VA 5EKYA 4LOCA 4E8CA 3GVQA 1LJYA 2PDNA 3KDNA 3G8RA 5HNRA 4YN5A 4K8GA 1KO0A 2WC7A 4EE9A 3WQGA 2PF0A 3A64A 4GGBA 1C9WA 3KX6A 3GTHA 5B80A 1H7OA 4LCRA 4F3HA 2JF7A 1DV7A 1VIWA 4NI3A 1X96A 1CI1A 2VX4A 1YDYA 5HATA 3V1HA 4YJ5A 3RM4A 3SRHA 4S3AA 1XQKA 1M01A 3VD9A 3KVJA 1AQMA 1DQUA 2CZEA 4HIBA 2I5GA 4LB3A 1UZ4A 2BNJA 4GQ0A 1WQ5A 3AMDA 2QDDA 1J2BA 1OB0A 2V63A 1K77A 2VRJA 3H8AA 1Q7MA 3EX3A 2X2YA 3N29A 2PWVA 4US5A 1P7TB 1YQ2A 4L6OA 1BGAA 1FHUA 3IIZA 1RH9A 1WKFA 1X7FA 2Y5EA 3UESA 2YBVA 3N17A 4OGZA 1EIXA 1TELA 3UWUA 4RDYA 2BV9A 3NUKA 3PHAA 3VKCA 1TWSA 4KWVA 1FTXA 4YLWA 1J6PA 1MSSA 3TTQA 3UY7A 1WXZA 4PTVA 3OGSA 4E2DA 3MVIA 1TRIA 3ITGA 2PURA 4GE8A 5HA7A 4LUTB 3DECA 4M6UA 4Q4KA 3BCJA 3RUBL 4JDYA 3VZZA 2PBOA 2PDWA 3MMUA 1SFSA 2JKPA 1VJIA 4RUBA 5AZ0A 3FCPA 5HQLA 2BMBA 2B7NA 1V03A 2CLHA 4ALDA 3CL7A 5E0FA 1T41A 1NQKA 4CCZA 2IKJA 5FEZA 2DEPA 5G4EA 4J3WA 1CX9A 3LHZA 1XGZA 4WXYA 4J2PA 3F2CA 2PD9A 3H2OA 4R7JA 3IPWA 2DIEA 1ODZA 4LNCA 4F48A 2OG9A 4RV8A 2YX0A 1JXJA 2PE4A 4H9UA 5I7GA 1VFHA 3LCXA 1W3KA 1XLEA 3QC0A 1MZRA 4EF9A 5DBUA 4JZ5A 3S6DA 5LXEA 1EJUC 1I0BA 1FWBC 5G5IA 1RY0A 1MFUA 3E2RA 5E09A 1VRXA 4LS1A 2DW7A 2D73A 1LOSA 1LYXA 3RITA 5FJPA 1RVKA 1US0A 3T2OA 3PUOA 4PMZA 3UGRA 3UCDA 1LQ2A 2ZA3A 3SCRA 2VMFA 2IPGA 1E4LA 3KM8A 4A29A 4O50A 7A3HA 4TUFA 2FHBA 4W8LA 4MB4A 2VFDA 1UWUA 4N2YA 3P8IA 3WG6A 3R8RA 3AYSA 2C14A 2E5BA 3CPGA 3IVTA 4GJ1A 3W7IA 1XYCA 3AMKA 1T40A 3N3MA 1TV3A 1P0DA 1UH4A 3PM6A 2ZADA 3ANVA 2W79A 3IACA 4OIFA 4LGXA 4RDVA 1VPQA 1Q3NA 1JEZA 4U5KA 1XSIA 3E2QA 5I3KA 3TYEA 3RLGA 2WZEA 4URIA 1F2JA 1XCXA 1F3EA 2ABAA 2D2OA 4NZ4A 4ERGA 3T81A 3RDKA 1B1YA 2YZRA 4HT3A 5HPOA 4XKYB 4UFJA 3AWOA 2NVCA 3S46A 5XIMA 1UBSA 4BY3A 1P5BA 1XIJA 1JUKA 1QOXA 4HZMA 4RJEA 1OEPA 3A47A 1DEDA 2V68A 3QPYA 3BPWA 4OE7A 1KM0A 3A12A 5EPDA 2WMHA 1N82A 3AIRA 1OD0A 2J13A 1FFRA 5MF5A 4DEFA 2ACRA 4JFTA 2E5CA 5K9XA 1QOPA 1VBGA 4QTGA 3ALGA 1QVBA 2R8WA 4H9YA 3LXBA 2HS6A 2VDHA 1UP0A 1XH0A 2SFPA 1WXYA 4KWSA 4BI7A 4UQCA 1PX4A 3F5LA 5EMJA 4R3UA 1IIHA 2GVJA 4P61A 1Q6GA 3DESA 3W25A 3VOJA 4L4MA 4IH3A 4ADTA 4B3LA 4HMNA 3WQ6A 3NA8A 1EUAA 5AYZA 4CEXC 3C0QA 4LF2A 1QR7A 3VFCA 3O0FA 3ZZ1A 4HNTA 3W73A 1CLKA 1JL8A 1BD0A 4PCNA 3F4CA 3HG5A 5FJRA 4JTJA 2P76A 3LPFA 2Z7KA 1ZAJA 2WJZA 1KRCC 1DJZA 2V8ZA 3VUPA 4L9XA 4WOZA 2PGFA 4MJZA 4I90A 5C7HA 3VI2A 1P0BA 1SZGA 4UNKA 1GQJA 3VABA 1OF6A 2GPTA 1BHGA 3S47A 3TTOA 1N55A 1HW6A 4LAOA 2JIEA 4QQ3A 1D8CA 2B4GA 3TTEA 5BOFA 4ZXLA 1K6WA 4UUIA 3VK5A 4C6LA 3S5NA 5I3FA 4MZ1A 5C0QA 4HZ7A 4Z2HA 3DOPA 1JGMA 3RX3A 3W24A 1UZ1A 1XLHA 3WNPA 3QR3A 3E0VA 3WQEA 5JBEA 3SUUA 4FX6M 5BXPA 2X16A 2E1DA 1GZ1A 4ZQMA 1V3JA 4U28A 4IXXA 1Z42A 4YHGA 3J7HA 1R3WA 1J11A 2GVLA 1LTDA 3L68A 3RJYA 4G7FA 1H3GA 4PMUA 1NFPA 3TROA 2V9DA 1JUBA 1S2AA 3HQNA 2GJPA 2G3IA 9XIMA 3MUY1 3AWNA 1Q6RA 4BEQA 4OBRA 1ZFJA 1FDZA 3H4GA 2YCIX 1EGVA 3ANUA 2NX1A 4XB3A 1W1PA 4PTDA 3RK8A 5FSEC 4J1OA 3CAKA 4HB7A 2XPKA 4V33A 4KFPA 3HJEA 5U4NA 1JCXA 3BMWA 5CSYA 3VNKA 4JBRA 1E15A 1QU4A 1F3XA 2WQDA 4GJJA 2WANA 1WOBA 2X09A 4XSLA 3WJZA 3FV9A 4ZOEA 3TR2A 3SRFA 4PCSA 5A8MA 4JCMA 3CHDA 1EKOA 3GAKA 4O8AA 1C8QA 1B90A 4LH8A 3S9ZA 3AZRA 2DZSA 3QN3A 5CZJA 3WBEA 5CBIA 1K8YA 2F61A 4OJYA 4H6RA 4PMDA 2Z26A 4A6GA 4NYYA 4JAWA 3K46A 4BQ4A 1GPWA 2VWTA 4JYEA 3NQDA 4G7EA 2ISDA 3SJ3A 1EPXA 2C0AA 1CECA 4W84A 2I57A 3CUFA 1DWAM 2GSEA 4GUGA 1WDRA 2D0GA 3L67A 1OD8A 3WQPA 4GVGA 1Q65A 2R94A 3FX4A 3IK2A 4X2RA 4HZ6A 1I2RA 1UR4A 4L1XA 2A0NA 1O5KA 2HRWA 1PE1A 1VHNA 4AWSA 2Y1HA 1EZ2A 1TQJA 4WDUA 4C6JA 1JDDA 1MEIA 4HHMA 3HG3A 4P8WA 4C5ZA 3WJXA 3MWCA 3SM0A 1U5HA 3MI3A 4K3ZA 1KFCA 1K9TA 1GZJA 4KKXA 2YXOA 3B0PA 2Y85A 3GG1A 4J3VA 4GK8A 3SN0A 4YMZA 1VLWA 1OX4B 3BK0A 1IXNA 4PUUA 2PODA 2BLEA 3ID7A 2E67A 3T6CA 5TQLA 1CT5A 2OSYA 2GVYA 1TA3A 1TKKA 4GO9A 4B5WA 1P4CA 4LC6A 5HMEA 4KH2A 1FWFC 1IT8A 4EPEC 1PWLA 4IUOA 2WMIA 3CZKA 3MI6A 2PDHA 3UXDA 3G5EA 3WK1A 3MV01 1CGWA 5G2WA 3R58A 3PB0A 5CPMA 4PUEA 1WBJA 3OLDA 1MW1A 3P67A 1V3LA 5M5DA 4OZOA 3LENA 4O0ZA 4QDPA 2INZA 5GPRA 5CPOA 4FZIA 4IG2A 2FIQA 4OUIA 1B30A 3I3BA 4MF4A 4Z2GA 1A5CA 1BQGA 4QCFA 3YPIA 1OCBA 3AYRA 1GKQA 4QNWA 1QT1A 2E40A 4YTUA 3ARRA 3VUSA 1SJBA 1VCFA 5LNWA 3TV8A 2CXGA 1UASA 3W26A 1ITCA 4J2MA 3W9ZA 2VR5A 4LBRA 1ZRQA 1NOFA 1MWOA 3TKFA 1NELA 2E3ZA 3UNDA 3OVGA 1W5OA 1F76A 5LKYA 2PP1A 3EBVA 2VI0A 1Y0EA 1KM6A 2CNCA 2UY3A 1NDWA 1PO9A 4CNSA 1LUCA 2XISA 3OLIA 5MKGB 3TW6A 1OFDA 4P8UA 1VFFA 4NQ1A 4EPKA 3B0VC 3D5HA 3TOPA 4YTTA 3M43A 1EOKA 4GMEA 4AZBA 3VIIA 3PB2A 3COTA 2UY5A 1BAGA 4U10A 3M0ZA 1CXFA 1TX2A 2NLIA 4K6AA 2XZ9A 3O9NA 3L4VA 1JCJA 3V3WA 1BXNA 3LLXA 1V0KA 2UZ9A 3UT0A 3ZYZA 1J4EA 4YHEA 3W2KA 1TR1A 1ZL1A 1SZEA 2R9RA 1EJTC 5G4WA 1HFBA 3CEPA 4E4PA 1S5TA 1DJQA 4TV6A 2A7RA 4UQBA 4QLJA 1FOBA 3BMXA 1C90A 2W62A 4Q4RA 2WWDA 1R9XA 3GZAA 3UA3A 3W83A 1AH4A 1I75A 5E0CA 3LN3A 1JI1A 1EF2A 2PGEA 4DNMA 1FA2A 1EJ7L 2XWDA 3CZJA 3VD3A 2G0WA 3L5MA 4H6QA 4UOZA 3TMLA 5KMYA 4GKTA 3BCDA 1E4MM 4QGCA 4C7GA 1W32A 2F6XA 3IS4A 3QY8A 1XCFA 1QJWA 2OX1A 3WL1A 3UG8A 2HZGA 2WC3A 3CUGA 2QJJA 3PBUA 4KRZA 2W91A 3ZT6A 3Q2DA 3UEQA 1XLJA 4JTIA 1UROA 2VRKA 3BW2A 3W70A 3LRKA 3BJFA 2QCCA 2MUCA 2AKZA 3WBWA 1UKQA 1A3XA 3MPGA 3V1PA 1VJSA 3P93A 1I1XA 1GJWA 1Q13A 5DY3A 2CLKA 4CD8A 1XXXA 4WHBA 2W0UA 5I5RA 2D2JA 2OODA 2PDLA 5A95A 3SY8A 1DORA 2V81A 2D1ZA 1R2TA 2JIWA 2YSWA 2UV8G 1B3XA 1X7IA 3WH8A 5CZ0A 3M6DA 1Q66A 2X1TA 2J88A 1H0IA 1FKWA 1ONWA 2J78A 3PZGA 1RHCA 4O1BA 2GGJA 3GY1A 3MDWA 5REQB 1TV7A 1EBHA 4V28A 4DZIA 4Z1YA 3S0CA 4JNYA 3G1AA 3PZQA 3CTTA 1EWEA 4RPQA 3U0HA 2W67A 3S5OA 3R0KA 3DUGA 1MEWA 1I8JA 4JY8A 4QDWA 1TFVA 3RRAA 3U2EA 3NQBA 5DCBA 3R2GA 3T0BA 2FZNA 3NJ3A 2POTA 3H12A 3L7RA 2RKXA 1LDCA 4ZO6A 5AKQA 1VKFA 2ESCA 3AFBA 2QDGA 2WM1A 2XIJA 2TODA 4GPNA 2XGBA 3T2QA 2X40A 2OWXA 3A22A 2R91A 2CLMA 1TPWA 1ENUA 4ROPA 3ZR5A 2HV5A 3DYMA 1VFLA 1XL9A 3WUFA 2I7GA 4BS0A 1VYSX 3KBWA 3FOKA 2CHNA 3M0KA 5LNVA 1KV5A 2P8BA 4AY8A 5F2LA 3PNUA 4DWDA 4WY0A 2Z2UA 3P62A 1HUVA 3SJNA 3CWNA 5HPCA 3INPA 1NEYA 3ITLA 4ZCWA 4S3FA 3A4AA 3FAWA 4NI8A 1XM3A 1N8WA 2HXUA 1IZCA 3MANA 3MMTA 4I8YA 2ZUNA 1FKXA 3QPEA 3ARUA 3CLWA 2AMXA 4M1RA 4HHPA 3S5YA 1V77A 5CPSA 3UA4A 4NAFA 4DWSB 3E74A 4LRSA 4XD5A 1L6FA 5T8GA 2WJFA 4D6DA 1BG9A 2PB1A 1UR3M 4IPLA 4IIEA 4UNIA 2Z1VA 2WHJA 3MKVA 1W54A 2PTZA 1GHSA 1PX3A 1TWDA 3TW7A 2YFNA 1A80A 4RE3A 3MCOA 1TPUA 1H49A 4PTNA 1K7XA 2DSKA 3CM4A 1HKIA 4JCLA 4AWTA 3MV11 1WB0A 1HGYA 1JAEA 3M41A 1TPVA 3TU9A 1C92A 3EKGA 4L6DA 1FCBA 2IKIA 4GUJA 2W66A 3BSHA 3KVLA 1R0MA 4C6MA 3VM5A 4ZR8A 1GCYA 2DORA 4IPIA 3BCFA 1MQRA 4R5EA 1JPMA 1BRLB 1UJQA 5FJJA 1CW2A 1EF3A 4DBDA 3IAQA 2E4TA 2AOSA 5CPLA 3SAZA 1NDVA 2Y89A 4NXKA 4FNUA 1UQYA 3K4WA 1NWUA 3SQMA 3NO5A 2XH4A 3FJNA 3WD0A 4J28A 4BQ5A 4DJEA 2GQ8A 3GTIA 4PFMA 5A6KA 1H41A 3O6YX 1VH7A 4ZO8A 3T55A 6XIAA 1RUSA 2FVMA 3BE7A 5IDIA 2VCCA 4KWOA 4EP8C 2FTYA 1VBJA 3REQA 2VFIA 2D69A 2Z1XA 1AD1A 2WCGA 4HK5A 1NWSA 3A6OA 3N6JA 4ZQOA 5DY2A 5FD0A 1O95A 1M7JA 1EPVA 5C2GA 2OR2A 3KBVA 1TCMA 1R2RA 4WDTA 3E5BA 3H2MA 4IGNA 4FF7A 1EJRC 3WENA 3O3RA 3T0DA 3N14A 4MJ2A 4KEZA 5T9CE 2PWUA 4GQRA 1AODA 1OGBA 4HU8A