3DAQA

Crystal structure of dihydrodipicolinate synthase from methicillin-resistant staphylococcus aureus
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
292
structure length
292
Chain Sequence
b'THLFEGVGVALTTPFTNNKVNLEALKAHVNFLLENNAQAIIVNGTTAESPTLTTDEKELILKTVIDLVDKRVPVIAGTGTNDTEKSIQASIQAKALGADAIMLITPYYNKTNQRGLVKHFEAIADAVKLPVVLYNVPSRTNMTIEPETVEILSQHPYIVALKDATNDFEYLEEVKKRIDTNSFALYSGNDDNVVEYYQRGGQGVISVIANVIPKEFQALYDAQQSGLDIQDQFKPIGTLLSALSVDINPIPIKALTSYLGFGNYELRLPLVSLEDTDTKVLREAYDTFKAGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydrodipicolinate synthase
publication title Structure and evolution of a novel dimeric enzyme from a clinically-important bacterial pathogen.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Lyase
total genus 114
structure length 292
sequence length 292
chains with identical sequence B, C, D
ec nomenclature ec 4.3.3.7: 4-hydroxy-tetrahydrodipicolinate synthase.
pdb deposition date 2008-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3daqA00
2CLFA 5FEZA 5AHMA 1WXJA 3UY7A 2Y63A 5D04C 2OCZA 2WNQA 3QMRA 4AHOA 3W7GA 1ICPA 4NX5A 3NDOA 2VEPA 3GAYA 3O8AA 4NXSA 4GBUA 3BPWA 1V5XA 3NVTA 2J88A 3OG3A 1DL3A 4TMBA 1S3HA 2E5BA 1EWEA 4N4PA 1E51A 3JS3A 3DFSA 3M7WA 3W76A 3WK0A 5FEXA 4UFIA 3M5YA 3PULA 3O05A 3RK8A 5CGQA 2WSQA 5CG7A 4YMZA 3CC1A 5L6UA 2JGYA 4AF0A 1F05A 3TH6A 1DJNA 1P1XA 3TE9A 1AW2A 4FX8A 1SW0A 4NNBA 1OX6A 1XKYA 3R5EA 1KFLA 2ZRYA 2WPBA 4OWGA 1LRNA 4IMCA 4N02A 1QFEA 2E5DA 4AH7A 4FNRA 1RVGA 1W8SA 3EWYA 4O50A 3OVQA 3R8RA 2NWSA 1X1OA 5I3HA 3VI2A 4Z0SA 2V30A 2QCMA 1I2PA 4O12A 4IPIA 1ICQA 5D38A 5LNUA 3EEGA 3M16A 1JQXA 3W87A 3IGUA 2DU2A 3ZFHA 3EX4A 2VOMA 3E0IA 3GB6A 3PC0A 4BI5A 1PS9A 5AHNA 3W83A 4NJHA 2QCLA 4AEOA 3V1PA 5I3GA 3N34A 3QYQA 3UY8A 2A0NA 5D2YA 4UMBA 4EVZA 4FB7A 1SPQA 5F2GA 3M5ZA 4I7WA 1GG1A 1OF8A 1PCWA 4ONVA 1G6CA 1KLZA 1OJXA 1C8VA 3NQ7A 4QSHA 3LX9A 3R12A 1D3GA 5BMXA 2GJNA 3E96A 2C19A 2NXIA 3S0CA 4JTTA 3SECA 1K8XA 3CU2A 3HPXA 3LHVA 1XBZA 3G1XA 3A9IA 1H7XA 3SJ3A 4HNVA 1TV7A 5K4ZA 3S1UA 4MZYA 3W1NA 3KVLA 2J6XA 4AAJA 5DBTA 3S9YA 3N3MA 3W6YA 4LS1A 3EWXA 4IOTA 4OBTA 2W0UA 4OT7A 5HULA 1GYNA 5CZJA 1SFLA 1T8XA 2ZRWA 1OFQA 2VEIA 3CWOX 3INPA 3ZS4A 1YDOA 3LOTA 3PBYA 4XTDA 2TMDA 4QISA 5HMSA 2DZWA 3LCHA 4WOQA 1DKWA 4JTEA 4H4IA 5TBOA 3A23A 1EA0A 2ZA2A 4NJIA 1LLWA 2W6RA 4Q33A 1B3OA 4O1DA 2GVJA 3SR7A 1KM0A 2ATSA 1A5CA 1K3UA 3P74A 4UC5A 1SW7A 1LBFA 3NZRA 1SO3A 4LOCA 3T40A 4O4WA 2TPSA 4M5PA 1QCWA 3KRZA 3GYEA 5LNVA 3CT7A 5D33A 3S42A 3HG3A 2G96A 2A5HA 3PB0A 4JDYA 3G1YA 4JTHA 1SO6A 3MHGA 3QFEA 5A5WA 3MHUA 3CB8A 3KVJA 3W1TA 5KITA 7TIMA 1A5AA 4O4VA 4D2JA 2C16A 2QDGA 5DELA 2C0AA 3GKFA 3G1HA 3N73A 5DLCA 3UXAA 3IIXA 2R91A 2PE4A 1A53A 4MY8A 2P1FA 1ME7A 3NL2A 4ALDA 4LV9A 3NM1A 4NZJA 3H53A 4GWEA 3EKZA 4MJZA 1VLWA 2ZRVA 5H2ZA 3CHVA 4MPQA 3W74A 2NX1A 3BLIA 1Q6RA 4LW7A 3S1VA 3GDKA 3W75A 3NO5A 1KM3A 1TSIA 1AL8A 3NL6A 4JN6A 1G4SA 1O5XA 5KZDA 5KZEA 3VE7A 4UUIA 1X8FA 3Q37A 1Z48A 1JCMP 2ZTJA 3BW3A 3VKJA 5HUPA 4W9TA 5AYXA 3A5VA 1EP1A 2J9YA 3IEBA 3UWZA 2RDTA 2AGKA 4O1CA 3DENA 2A7NA 1EP3A 2BTMA 3BLFA 3QF0A 4JS3A 4PA8A 1GTEA 4P61A 6TIMA 2A21A 4LUIA 3O6CA 1CX9A 3ANYA 3B0UX 3QQ0A 2DZSA 3FYOA 3LXBA 1OYBA 3NQEA 4L4LA 1MXSA 1FBAA 5I3IA 3LRKA 2I9EA 4AWUA 2GQAA 1LOQA 3NPUA 2F7FA 1F76A 1TJRA 1GVRA 1MSSA 1X6UA 2Z6IA 1GOXA 3LGEA 1XDLA 5LGZA 4RLIA 3I65A 3CEUA 3W86A 3E02A 3AJXA 3HGJA 4DO4A 2QCNA 4LU0A 1KW1A 3PSVA 5BMWA 1OFDA 1NF0A 4DELA 2B7PA 1LROA 4GFSA 2Y7GA 3M47A 4MY9A 4Z1AA 3NPXA 3NAVA 3H55A 4EOUA 3IIZA 1T0OA 4GC4A 2J24A 3OVPA 4UTTA 1TPC1 3Q58A 4KFPA 4OQVA 2OJPA 1OK4A 3MBFA 4M19A 1J4EA 1JCYA 3S1XA 3UWWA 1SW3A 2YCEA 3TFCA 4R33A 4JICA 3G1SA 3O63A 2E09A 3UWQA 1FWRA 3LLFA 1F6KA 4BR1A 2BXVA 3GNNA 2ZZ5A 3W1MA 4OU1A 1FWNA 3Q94A 1AL7A 3GZ3A 4RX0A 3M6YA 4JR5A 4N4QA 1FUYA 1LBLA 3HOJA 3W88A 4DO5A 3O07A 1DBTA 2I14A 3LB0A 5AYZA 4K6AA 1F74A 2XN0A 5FF2A 1N7KA 1SZEA 4O16A 3BGJA 3W1QA 1P5BA 1OYAA 3LLDA 3PAJA 4CCCA 2DZPA 1YTKA 4WY0A 4ADTA 5C55A 4IXHA 2C14A 5EPDA 1TQXA 3K30A 1W0MA 1F2JA 4JTGA 4RZ4A 3PBVA 3PVFA 1M5WA 3DGRA 3RMJA 1K7FA 3TR2A 1W1ZA 4JTJA 2YYTA 4GNJA 3P5ZA 3WFAA 1KBJA 1VHCA 1YXCA 1NVMA 3EB2A 1M6JA 5CPMA 4O1BA 4QM1A 5AHIA 3L66A 3ABQA 4PTNA 1W54A 1H7NA 3L5AA 4H6KA 4K36A 4NU7A 4LUJA 3MP4A 3S5OA 1TPWA 3I68A 1R2RA 2R8WA 3LRLA 4UNKA 3OVRA 1DQWA 3DH7A 1QOPA 1KTCA 4N9EA 5F2LA 1SO4A 3W2NA 2A7PA 4IGHA 3N2XA 1OFRA 4CNNA 3IVTA 1ZJIA 4X22A 2NUXA 3PUDA 1BKSA 3LTSA 3KXQA 1HO1A 2YW3A 2QCHA 4UFKA 1DOSA 4O18A 2TSYA 1ALDA 1HFBA 1UASA 3CQ0A 4ADSA 4O15A 4MFDA 4O10A 2YX0A 4RK8A 1I45A 3UWUA 4ADUA 4C1KA 3O16A 2EGZA 4K39A 3HO8A 3ZWSA 3IVUA 2CLLA 3MHFA 1FDJA 1JR1A 4X2RA 4UMCA 2EHHA 1X1ZA 3W84A 1H50A 4MKNA 3R13A 1VYRA 3WK3A 1OFBA 4QITA 3G8RA 1H1ZA 3C2EA 3MW7A 3HGRA 5CZTA 4BI6A 4RXGA 4XUGA 4O28A 1FCUA 4JTLA 1QO2A 4RKAA 1OX4B 4EIVA 1Z44A 3BK0A 3P67A 3T44A 1C29A 3L68A 2B7NA 3QPYA 1K03A 1JUBA 1ZALA 5G2IA 3TQKA 4AHPA 4AHQA 3P60A 3DKJA 3IRDA 3MO7A 1J2WA 2JBMA 4JTIA 1ADOA 2X16A 4TIMA 5AC6A 3LCIA 3B0PA 2FTPA 3T4CA 1MEHA 1JULA 4O1AA 4AWTA 2VEMA 2IQTA 2CZFA 3PBUA 4BI7A 4ZQOA 1KTNA 1LM1A 3P8IA 1MO0A 4J9JA 4WXYA 3PR2A 5G1YA 3DFTA 3LHWA 3AO0A 3C4UA 3P8JA 1VC4A 1S5VA 3LERA 2XN1A 3U6WA 1TPDA 1PCKA 4UFHA 4M6QA 5EY5A 3LCFA 1ZFJA 5GVJA 1XXXA 2DZXA 3TAKA 4YXGA 4OV9A 5HINA 1WBJA 4O53A 3UXDA 1TIMA 2E5CA 3W1LA 4NNAA 5F1VA 2ZZ6A 1OX4A 3W7IA 4GUGA 3G0UA 1WAUA 1SO5A 2YFOA 3E12A 3G0SA 1JVNA 1FWTA 4N2YA 3B0VC 3N2MA 3BV4A 4OGZA 5DCEA 2H3BA 1F73A 3G22A 4WUIA 1KM2A 2FPVA 2RKXA 1NSJA 5DXXA 5F2IA 1YPFA 4HN4A 4Q32A 5A8GA 4AB4A 2RHGA 1OFAA 4QQ3A 1IIGA 5DN1A 1OK6A 4M6PA 3RNDA 1M7PA 4TMCA 1D9EA 3KAOA 3TAOA 3FLUA 2GVGA 3W2MA 1VCVA 1SZNA 4IMEA 3ZR4A 3EWWA 3U2OA 1A5BA 4EF9A 1SU5A 5F2MA 5HWJA 3G24A 4OV4A 3FJLA 1JRBA 5HQEA 4BK9A 3M5XA 3DI1A 3ATYA 3P81A 2V2CA 4DPQA 4MLRA 4ORIA 2PRLA 4R7JA 4CNOA 4X9SA 1I4NA 3W7LA 1G69A 3MJYA 4FIRA 4UIOA 1R30A 1JQVA 1Q6QA 1OF6A 4JTUA 3TW6A 2ZZ4A 3BARA 2X2GA 2FB2A 4ZQCA 3BLEA 5LNWA 4GUHA 4UFMA 3GXPA 4E2DA 3H54A 4CLMA 3IVSA 4KFOA 5DY2A 3HPSA 4N9CA 4ZL1A 1BWKA 1LRTA 3QM3A 1FWWA 3NQ2A 4IUOA 4AWSA 3W3OA 5CPLA 1RV8A 3DHDA 3I7RA 1TPH1 3UWYA 1OYCA 4HT3A 2V82A 2VC6A 1BEUA 3LBMA 3NA8A 3HQ1A 4H3DA 3FS2A 1GWJA 3SW6A 3O06A 2P10A 3Q2DA 4N6EA 3PUOA 1K7XA 3KFTA 3S1WA 5C2XA 1LLZA 3R89A 1EWDA 1KM6A 5LSMA 2QDHA 2WSYA 2H8XA 3LHYA 4OHQA 4LTSA 2C6QA 4Q4KA 1I2OA 3OHIA 1ME9A 4DF2A 2E68A 3U8GA 5K3VA 1R46A 4GE8A 3C2RA 3G1DA 4N9DA 5U7SA 3LDVA 3M41A 2J9ZA 2QCEA 1YADA 4NX0A 2H6RA 3M0ZA 4A29A 3ABRA 3MI3A 1F6PA 3BW2A 3FKRA 1WX0A 5F1UA 3RLVA 5K2ZA 2WNNA 2PRMA 1NF7A 1XL9A 4OE7A 3ZWTA 2RDUA 3OEXA 4LVFA 1OFPA 1QO5A 2H3DA 1G7VA 2FPTA 4E2BA 1YLVA 5CPNA 1YTDA 2KZHA 1TTQA 4MLJA 4MVAA 3W7EA 1O60A 4TX9A 3LHUA 5KZMA 3EXRA 2YFNA 2H90A 2CZEA 3B05A 3P62A 3W72A 3HJZA 2QUTA 3P80A 1KFJA 3HB9A 2WV8A 2Y70A 3CLMA 3NEVA 5AC8A 3LXCA 5D09A 3NQCA 2YXGA 4O0ZA 4NJJA 1WYIA 1FDZA 4M7TA 3PSWA 4MIMA 1TO3A 4MZ1A 4Z1BA 3G3MA 1K8YA 1TV8A 4BWLC 4LT9A 4UFJA 1F5ZA 3M9YA 3ELFA 1G4EA 4IMFA 1H62A 2ZA3A 1LCOA 1P4CA 2C1HA 4YL2A 2VEKA 1PHQA 4YWIA 1VHNA 3NQGA 4JY8A 3VFLA 4IQLA 3TSBA 4JEQA 4E38A 3S5YA 3C3NA 3NXFA 4KFNA 1TTPA 4IX0A 4PL2A 5FEWA 1QMLA 4XBSA 1KBIA 4AXKA 5SWUA 3W1AA 1UB3A 3RFAA 2Y7EA 3HG4A 3PF3A 2YSWA 4UTJA 4P2VA 3A5FA 2B4GA 1EP2A 3N9SA 1ZCOA 4UTLA 3TA6A 1JUKA 4CQ9A 4YCOA 5DCDA 3B04A 4LS2A 4LVAA 2NZLA 3BW4A 4FO4A 4S2CA 1IXNA 1TQJA 3STFA 3MYOA 4O57A 2XFWA 2Y6ZA 2Q3RA 1I2QA 2QKFA 3I6RA 1R2TA 1H7OA 3TW7A 2EF9A 3W7QA 3LRMA 5G4EA 3SI9A 4XTIA 1RPXA 3DI0A 4I7UA 2HSAA 1SSGA 1GPWA 5H91A 3GDTA 2ZZ2A 3G18A 3KOFA 4WJEA 3W7PA 2R94A 5BOOA 4U4MA 4ZQMA 3PY2A 5ABTA 4ZQPA 2OT0A 2GVLA 5EYWA 2EAWA 5E93A 5T26A 1A50A 4TU1A 4O19A 5AHEA 3G1VA 1I2NA 3L65A 5AFDA 4JYEA 4PFMA 4BFAA 1U5JA 4JTKA 3T7VA 3HGOA 3VCRA 5FF4A 5D2XA 2Y61A 3KHJA 1W5NA 1WV2A 1DQXA 3QEZA 3THAA 2OX1A 4CCDA 1AW5A 1EX5A 3MYPA 1TJPA 1IF2A 1GVQA 4DQWA 2QUUA 3EX3A 4S1FA 5D2TA 2FPYA 2G97A 4JY9A 1JCJA 2CZ5A 4NVTA 3HIJA 2QAFA 1LRQA 3TX9A 1R2SA 1DHPA 2NX3A 4JNMA 1H1YA 3VNDA 4MYAA 3F03K 2X1RA 1W5MA 2JGQA 3NL3A 3NR0A 2ALDA 4FX7A 2GUUA 4PH6A 2JKEA 3GIYA 1SSDA 2TRSA 2AQWA 1QDSA 1AG1O 4CQAA 1RD5A 2Z6JA 3VE9A 3PG9A 4JX5A 5KSWA 3WJYA 2NUYA 4O8RA 2AAMA 2WJZA 2Z2UA 3DU0A 4LS0A 3W7RA 2C15A 3BO9A 3UYCA 4AMAA 4PCFA 5BNKA 4GRSA 1KFCA 1PL9A 2CW6A 1T99A 4N9BA 3IGXA 1LOLA 4KWWA 2HS6A 4LRTA 4Z0JA 2CLMA 1WDWA 3C56A 1KLYA 5EMUA 3IIVA 4NXKA 3M44A 4JX4A 3DAQA 3A22A 3C6CA 4ORMA 3TV8A 2YR1A 4FNTA 4DBEA 4MUZA 3NQ6A 2A6LA 2JKPA 4Y9AA 1NEYA 1HTIA 3SGUA 4UTHA 1CW2A 3DHFA 3D0CA 3EXTA 2PCQA 2ZA1A 1ZAJA 5LZLA 3EX2A 4O0KA 1Q6LA 1EEPA 1XBYA 2G5WA 3PBWA 2V5BA 3B4UA 4QIUA 2VFIA 3C2FA 2I1OA 4XQ6A 1F7BA 3MMTA 2W79A 5CZ0A 2CZDA 3A21A 4A2SA 2QCDB 1W5PA 2V2HA 1UCWA 3YPIA 3GDMA 4YCPA 4UTMA 2DJLA 1GQNA 1QAPA 1YPIA 3L2IA 5FF0A 4A21A 3THQA 2NUWA 4UXDA 4DPPA 4FF7A 4UTKA 3SZ8A 2FJKA 2V81A 2DORA 4UNLA 2YZRA 3OIXA 2GOUA 3QW4B 2GQ9A 2FQIA 3BVJA 4QNWA 5AN7A 1R47A 5D2VA 4XBKA 3EX1A 3P61A 4TO8A 3QQ1A 4CNPA 3PG8A 2BWGA 4BWLA 2ISVA 2WQPA 3DBPA 2ZTKA 3GDLA 5FF7A 4ZMGA 4RV8A 3N9RA 4UMAA 3UZ5A 3FA5A 1ICSA 1XM3A 3P84A 4I7VA 5EKYA 4RZ6A 5KMYA 2RFGA 3TCEA 3JR2A 3TXZA 1ZENA 5K4XA 1XC4A 2X30A 3G1AA 5AOUA 4UR8A 4UTUA 3F4WA 1ZNNA 2XN2A 4AVFA 1HO4A 3GNDA 4E0CA 1VS1A 3TC6A 4WZHA 1QOQA 3KVKA 5CKSA 1ZAHA 1LYXA 5G2WA 3S8HA 3TKFA 4HHPA 3QH2A 4WY0F 4ZQNA 2Y89A 5HR6A 1J5TA 3V75A 1YDVA 2JK2A 1I2RA 1H61A 2ZZ3A 3LTYA 1L6WA 1LORA 1RQHA 4LC6A 3CEPA 1KM5A 1YYAA 1PHWA 5D37A 4WY0B 1GT8A 5DXYA 3E49A 5D32A 3SSJA 1TPVA 3PWAA 3S5ZA 2HS8A 1JJKA 2V9DA 3GK0A 3GVGA 4IMGA 1YXYA 2LLEA 2ZZ1A 4HNNA 1SUXA 4PL1A 1GVFA 4JYFA 1IIHA 1EB3A 3TFXA 4A2RA 5I3KA 5TIMA 3GXNA 3C52A 1LOSA 1A5SA 2QCCA 4WX2A 1OG0A 2EPHA 2V8ZA 2YW4A 2FDSA 3E9AA 2QR6A 1H7PA 4K8EA 2QUVA 3NQAA 1H60A 4POCA 2R14A 3W7JA 4UTIA 4AF0B 1DVJA 2HTMA 3P82A 4GUIA 3C8FA 3BG5A 3B03A 1XUZA 1OFEA 4IMDA 3HF3A 3G8EA 2FIQA 4LY8A 3LXAA 1VYPX 4NZFA 1B4KA 1KTBA 4JTSA 3TIMA 2B7QA 4GUFA 3NQ8A 1TREA 3USBA 2E6FA 3L0KA 4U28A 5K9XA 4RR4A 4JYDA 4CCEA 4YLWA 3QSRA 1UUOA 4FXSA 4UR7A 1MEWA 1UUMA 2BX7A 2Y62A 5LNRA 5EA9A 3L0GA 4DXVA 2Q8LA 1OFOA 5F4XA 3ATZA 2WKJA 3OA3A 3I7SA 3GAKA 3IGSA 1PVNA 5L9FA 3HMJG 3W9ZA 2QCFA 3LCXA 4HPXA 3ABSA 1FCQA 4JGDA 4MFEA 1K7EA 3LI1A 3M1ZA 2DZVA 4L4MA 3NQMA 3QMTA 5BW6A 2VFDA 4Y8FA 5LGXA 3S6DA 4UTWC 1LTDA 3C61A 4HNTA 2QJIA 3GR7A 1H63A 1AK5A 4LRSA 2X1UA 3WJSA 4LNYA 3WJZA 4FNSA 4RZ5A 4M7SA 1T96A 5TQLA 1IGSA 3M43A 3O6DA 1BWLA 2WOQA 2NX9A 5BRBA 5IBXC 1SR9A 3W73A 3W7OA 1FX6A 1W5QA 1W3IA 4NUWA 1GJPA 2NV2A 1TTJA 1H7WA 4HKPA 3CIWA 3P5YA 2ZRZA 1L9WA 3LBCA 4O11A 4M6VA 3PUEA 4R34A 5E0KA 2QF7A 2H8ZA 4UTTC 3LHTA 3DFNA 5G2HA 4C1LA 3GKAA 1HG3A 4LV4A 3KX6A 4KWVA 2PRHA 2D73A 3MWAA 1G4TA 1VCGA 5AHFA 1TV5A 1VPXA 4RXFA 1RR2A 4Z1DA 3DFPA 2OT1A 5HUOA 2QAPA 4O54A 3W85A 5D2WA 4JIQA 1QPRA 4BF9A 3HPZA 3RF9A 2ISWA 2CLIA 1KV5A 1G67A 2GQ8A 3W2KA 3SY5A 4DEFA 5CSSA 3W7KA 2QJHA 3LV5A 3JRKA 1W56A 4QNEA 3NM3A 4XKYB 4XZ9A 1VQTA 3CM4A 4JTFA 2QEZA 1TCDA 1TRIA 3QZEA 1GZGA 3NYZA 1H5YA 2VFHA 4QJ1A 1LZOA 1WA3A 2DJXA 5AHLA 3CTLA 3EKLA 3TQVA 1O95A 3W7CA 2ZCGA 2DZTA 3L9CA 4UCGA 4RJEA 2EKCA 4HIBA 3TROA 3WK2A 2OMAA 5FESA 1PE1A 2CU0A 3STEA 2PC4A 1RQEA 2V5LA 3NQDA 4IPJA 1SZGA 2V2DA 5D05A 1X7FA 2TYSA 3A24A 1RQBA 2QJGA 4DF0A 3LCLA 2Y7FA 2FB3A 3PS7A 5EL1A 1XUUA 5EBUA 1FWSA 1JCLA 2Z1BA 1TMHA 4FEZA 3FIGA 3LTPA 4Z08A 1O5KA 2WNZA 1EIXA 3CIXA 1KFBA 3M5VA 3MP5A 4I9AA 1KFKA 3BG3A 3TSMA 5F4SA 3FEMA 2C18A 3EWZA 3GLCA 2A7RA 4K38A 2B7OA 1IXQA 1OVDA 2ISSA 4XKYA 1ZAIA 5FI8A 4NJKA 2C13A 1XBVA 3FKKA 3GX9A 1SZFA 3W7DA 5D03A 1FCBA 3IV3A 3KRUA 1VGAA 3LCWA 3N14A 2Q8ZA 1U83A 3FJ6A 3HG5A 3NL5A 4FNPA 1YXDA 3W1UA 2VFEA 3SFKA 1KA9F 1N55A 2Q3OA 4TR9A 2J27A 3DFQA 1VH7A 3PB2A 2VELA 2ZYFA 2ATMA 1H51A 2VFFA 5HWNA 1D3HA 1HL2A 2A85A 3W1XA 1ONRA 3W7NA 4NT0A 5F4WA 2CLKA 4FXRA 1EPXA 2HMCA 4LWWA 3FOKA 5MHBA 4IWWA 3MBDA 1QWGA 5J5RA 5IM51 1FDYA 2UV8G 4X3ZA 5AYYA 5U4NA 1WOBA 2CLOA 4Y96A 5D30A 2CFFA 1MZHA 1S5TA 1HUVA 3T55A 1RZMA 3LHZA 3LCGA 1DV7A 2X1SA 1P0KA 3MI2A 4FIQA 1GG0A 3RLUA 4RCXA 3W1PA 2E6DA 4DF1A 3LM7A 4A3UA 3EX6A 1W31A 5E1QA 2DP3A 1G4PA 2GJLA 1M7OA 2F84A 2NXHA 4QAIA 1K02A 3O15A 2VENA 4N6FA 2ZDRA 3G3DA 2Y85A 1VR6A 3L5MA 1NFBA 1TRDA 3QMSA 4GJ1A 4K8HA 3STCA 1G7UA 5G4WA 3SIZA 5CPOA 4DO6A 3UPWA 1BTMA 2YGYA 1FXQA 4ICNA 3QW3A 1JUEA 1O94A 2A4AA 4O13A 1KM4A 1UJPA 1Z41A 1TB3A 1S5WA 2E6YA 2V0TA 2ZQ0A 1QR7A 4DBDA 2E77A 3C2OA 2NWRA 3TDFA 3IIPA 3O6YX 4O14A 2A1YA 4IJBA 3WK1A 3I7QA 1VRDA 5LHFA 1ZHAA 4K37A 4UTWA 2GPTA 1L6SA 1QPOA 3LV6A 4WD0A 3W23A 5C5YA 3MI6A 2DZUA 4K7YA 1OHLA 3EXSA 3L0NA 1KV8A 2O7QA 4UFLA 3UQNA 1Q6OA 3TC7A 2ABBA 5AC7A 1NAL1 4R53A 5IBXA 4MY1A 3QPZA 1GVSA 3G0XA 1Z42A 1KFEA 2BZNA 4LC8A 2ZRXA 4FNUA 2O7SA 4NNCA 3CPRA 4JXCA 2YDAA 1GEQA 1XBXA 2NLIA 3W7MA 4HNUA 6ALDA 1L6YA 3TJXA 3TU9A 5I3FA 1C9DA 1LP6A 3W2JA 3WJXA 1OX5A 3EWUA 5K9DA 4FX6M 4WXZA 5CZSA 3C2VA 3C0JA 2B0MA 4ML9A 3NPVA 3NQVA 3DXIA 1GYLA 1UBSA 3MUXA 3CWNA 3W2LA 1VZWA 1P0NA 3EWBX 2VXNA 3T78A 3TMQA 1TPB1 1Y0EA 3DKLA 4IXXA 2JKAA 4FNQA 4IX2A 2NXGA 1W3TA 4CQ8A 1TPFA 1VLIA 5K9CA 2Y88A 2ABAA 1WQ5A 1TYGA 4PC8A 2ZFAA 2PURA 3NOEA 2VFGA 4MJMA 3W1RA 4S2BA 1DORA 3DZ1A 2QCGA 3HGSA 1L2UA 4K7VA 1FXPA 1JRCA 1TPUA 2P0OA 3KVMA 5HJLA 1QPQA 4ZVJA 3QJAA 3RU6A 1PV8A 3NNTA 4ZZ9A 1THFD 3L67A 3O1NA 2E6AA 5FEPA 1SQ7A 1ML1A 2ZBTA 4A22A 1FY6A 1SFJA 1AMKA 4B5NA 1DJQA 3HBLA 4EWND 3TSDA 3QSTA 1GTHA 2Y7DA 3W22A 4KKXA 2C3ZA 2CLEA 3R2GA 1XI3A 2G95A 4EF8A 1YDNA 1YTEA 5LKYA 3TMLA 3F4NA 5LNSA 3OBKA 3UNDA 2VKZG 1AW1A 2E1DA 4MOZA 5CSRA 3L21A 2YYUA 1XDMA 4Z1CA 2BLEA 3B8DA 3KRSA 1QNVA 4ZQRA 1K8ZA 3NZ1A 1XFBA 2WSRA 1LBMA 1IXPA 1MEIA 4G1KA 3W2UA 3STGA 3W7HA 5AB3A 1Q3NA 1W3NA 4HPJA 5HWMA 3NGJA 3UPBA 1OABA 3G1FA 3TUUA 3TXVA 2QCDA 2WO5A 3B06A 4LVGA 3P7YA 4JD4A 1W5OA 2RDWA 3S5NA 5DY3A 2CLHA 3N19B 3HG2A 1KM1A 5G1TA 1N8FA 5DBUA 3FFSA 3GR8A 3TNOA 2YPIA 4PEKA 3NQFA 3GXTA 1FCVA 5I3JA 1H7RA 1LDCA 5HR7A 1CI1A 1JCXA 4WOZA 1QPNA 4O17A 5LHEA 1TPEA 4FHAA 4HSOA 3NPWA 4LVDA 3ABOA 1EUAA 2A6NA 4JX6A 2Z0IA 5J5DA 5C54A 5D02A 4Y6GA 1XCFA 1FQ0A 2CWNA 3F1QA 3FYPA 2J9XA 2ZRUA 3UZJA 3TJLA 1VCFA 1WOAA 3SGZA 3UWVA 8TIMA 4HSNA 3BGGA 1IXOA 3QRHA 4NJGA 4GUJA 4PODA 1B9BA 2OZ0A 5HNRA 3TQ0A 2ZZ7A 1PIIA 4LVBA 5C6MA 1ZY9A 3L5LA 3WJWA 3PM6A 2RH9A 1B57A 4WQ6A 2A2IA 2BSLA 4GXMA 1V7YA 1Q45A 3IIOA 4MZ8A 2FLIA 3UD6A 3W71A 3TK7A 1I8JA 1ME8A 2FFCA 1EUNA 5DCBA 5FF3A 5KINA 4MYXA 4NQ1A 3W70A 1B4EA 4JIPA 3BG9A 3NG3A 1WBHA 4XWUA 1JCNA 5K7JA 5KTLA 3W07A 3MP3A 1W37A 4O52A 1O4UA 1VYSX 2NV1A 1VJIA 5G5IA 3DFOA 2X1TA 3GDRA 1TTIA 3LI0A 3QC3A 4Y90A 1GVOA 4JDBA
chains in the Genus database with same CATH superfamily
2HJPA 3TLLA 5D04C 3GXFA 1NJJA 3QMRA 4AHOA 2AMXA 1RK5A 1ICPA 1JI1A 4NX5A 4Z1YA 1XIBA 1D7KA 3NDOA 3NVTA 3EKGA 3OG3A 1DL3A 3K4WA 3KOZA 2E5BA 1E0WA 4EKJA 3LNMA 1RCQA 4GLEA 3JS3A 3W76A 2GJPA 3CK5A 3M5YA 4FALA 3O05A 1OCBA 1EBHA 5CGQA 1DQUA 2JGYA 2WB5A 1DJNA 1ELSA 1XICA 1AW2A 5GJPA 1JZ2A 2YL9A 1PSCA 4NNBA 1KFLA 4KWUA 2ZRYA 4C6NA 3ZJ7A 1FHUA 2P3ZA 2E5DA 4PTWA 3KBMA 4MWAD 4O50A 3VI2A 4XD4A 4IPIA 3EEGA 3W87A 4D6IA 2DU2A 1YE4A 4YPJA 4H9UA 5H8UA 4HU4A 1EHAA 3GB6A 1W1PA 4MJ4A 8XIAA 4H41A 3OGRA 4RE2A 3N34A 2X0HA 2DT1A 3QYQA 1E6RA 1HVQA 4C6LA 4A4AA 3TWBA 5KZ6A 3SCVA 3DESA 3R0UA 1QJWA 1OF8A 5XIAA 3S2NA 1G6CA 3IJLA 2ZUNA 3LX9A 2CITA 3AMKA 3W38A 1C8YA 1XLIA 5DANA 3SECA 3CU2A 3F4VA 1XBZA 2WPGA 3UR2A 2XPKA 4HNVA 2WVSA 4QXIA 1B3VA 3N2BA 8CGTA 1EJXC 3W1NA 3KVLA 2C0HA 4AD1A 4MTVA 4AZ5A 1TA3B 1W9BM 2ZRWA 1OFQA 4QSFA 3CWOX 4EAYA 4V1XA 1J18A 1LJYA 2ZOXA 3PBYA 4W86A 4XTDA 5A6AA 2HDJA 3RX2A 1GW9A 3WNPA 2FZ8A 1Y5VA 4NJIA 5T9CE 3CS2A 4XAZA 3GNRA 1JZ3A 3L4UA 4J1OA 4GQBA 1KM0A 2W5FA 4F79A 4PTVA 4NZ5A 4F0RA 1SO3A 2GGJA 1A3HA 4LOCA 3WN6A 3DIPA 4LCRA 1QCWA 4G7EB 3GYEA 4ICMA 2G96A 2A5HA 1VFLA 4CEUC 3G1YA 1UWSA 2I5QA 4V33A 1F4AA 1SO6A 3CPUA 2DIEA 2AKMA 4PB3A 3QTPA 3A4JA 3W1TA 5C9XA 5HJXA 2C0AA 3N73A 4W93A 4HMNA 5DLCA 1US0A 5JH2A 4HA4A 3GTXA 7REQA 2ZC1A 4OECA 2C8NA 3W6LA 3MT1A 4NZJA 4FS9A 4H01A 4MJZA 4IG2A 5H2ZA 3W74A 2V3DA 1OZMA 3WD0A 3GDKA 3NGFA 1KM3A 1V0MA 2PD5A 1E73M 4ERAA 5KZEA 4F40A 1EQPA 4M51A 1EJVC 1C3FA 2ZTJA 3BW3A 3VKJA 3WUBA 3WD3A 1G0CA 3A5VA 2X1IA 4L4PA 3P2VA 3UWZA 2AGKA 1REQA 4PMJA 1RH9A 3KZSA 2W9MA 1UD6A 1EP3A 3QF0A 4PA8A 6TIMA 4MB4A 4LUIA 3PN8A 5REQB 5I79A 1NM9A 3B0UX 1EXBA 2CHOA 3II1A 4TXEA 3PZQA 3BLDA 1DWJM 4CU8A 1MXSA 4OOZA 4CD8A 2ADAA 2J75A 1YMYA 2GQAA 4QDMA 3NPUA 2V3FA 2Z7GA 2W67A 3A4AA 4JBRA 2V5CA 2Z6IA 3LGEA 5CJMA 4RLIA 2A3CA 2D20A 4KRZA 1P48A 3HGJA 1E1EA 3BV7A 4EPBC 3OGVA 1US2A 3PSVA 4U31A 1R85A 3VVGA 2QULA 1LROA 4GA8A 1KXQA 3U2ZA 3S2JA 3NAVA 4JAWA 2J24A 3OVPA 4UTTA 1TPC1 4ZXLA 2VEFA 3N4EA 1SGJA 1G5AA 1J4EA 2YCEA 3TFCA 1VKFA 1H2JA 3UWQA 2EO7A 4XO7A 5A6MA 3WH9A 1LUCA 6ENLA 4OU1A 3Q94A 3T81A 1AL7A 5CLTA 1NH6A 1Q6GA 3M6YA 4CVUA 1H0IA 2GGHA 2PDKA 1LBLA 3VILA 2I14A 3LB0A 1JDDA 1SZEA 1AFSA 4NP7A 4CCCA 1X8CA 4QROA 4ADTA 5A6SA 4CEXC 1H3GA 2VOTA 5D9MA 5C55A 3BSMA 1CZ1A 4GCXA 1M5WA 3RMJA 1DHKA 1W1ZA 4DN1A 1ZB5A 1KBJA 1EC8A 3PZTA 1A0CA 2AQVA 2WMKA 4QS6A 4QM1A 1H7NA 4Z2IA 3MSYA 4CCZA 2RGLA 4NU7A 4JQAA 2NLYA 3QY7A 3HQNA 3KBWA 2P0IA 1FH7A 3W25A 1UR0A 2HROA 2QDDA 1TZ9A 1SO4A 4ERIA 4B5SA 3WELA 1ZJIA 1JF5A 3LUTA 2WM0A 1K8CA 3KXQA 1HO1A 2YW3A 2QCHA 4O18A 3SCUA 2E25A 1S2TA 4ADSA 4DI9A 1XLJA 1GOMA 2QT3A 3EPNA 7PTDA 2YBVA 3C86A 3N2TA 4ZODA 2W4XA 1H09A 2EGZA 4GVIA 3IVUA 2CLLA 2OZTA 1ITQA 1C92A 3G8RA 3C2EA 3CAQA 3MW7A 4BI6A 3DERA 5A8QA 3CBWA 1MRAA 1EJRC 3KDOA 1QO2A 3WZ0E 3WNKA 3B8UA 3B9DA 4LF1A 1Z44A 3BK0A 1J0YA 1C29A 1BGGA 1QNQA 3B40A 3ZIZA 1K03A 1ZALA 3QZ6A 4QQUA 4AHPA 3P60A 2W27A 3DKJA 1ADSA 3LS9A 3W02A 4IJCA 1J2WA 4JTIA 1NU5A 4TIMA 2XTKA 3LCIA 1XLBA 2IW0A 1MEHA 1JULA 4MWAC 4O1AA 3KOYA 4Z2JA 2IQTA 3E74A 3WSUA 3O0KA 1OC5A 3NIYA 1EF3A 4ZQOA 3TN4A 3E2RA 3P8IA 2OO0A 3SO7A 1DWHM 2XH2A 4J9JA 5FAGA 2D22A 7CGTA 1VC4A 3SCTA 1PTDA 3KBSA 3QTGA 3U6WA 1ZFJA 4RV3A 4WKHA 2DZXA 3TAKA 5IDIA 4OV9A 2Q6ZA 3WQCA 3T8LA 1GUVA 2E5CA 3VZZA 5F1VA 1J0ZA 3WL1A 3BXWA 4L1GA 1UP0A 5EBAA 2YFOA 3E12A 3HV9A 4DHGA 1XGEA 4AX6A 3B0VC 1R6WA 1MVYA 2OR2A 4HU8A 3THUA 4AUBA 2RJHA 4Q32A 4Q8TA 4AB4A 3AUOA 2J7CA 3GXIA 2RHGA 1E4NA 2EJ1A 1SM9A 2JE8A 4TMCA 1D9EA 3GXMA 4GC3A 3TAOA 2GVGA 3W2MA 1SZNA 3FA4A 2ZVRA 4JEJA 3CAVA 4LB3A 3MDUA 5FOOA 3DGBA 1Z3NA 3LN3A 4OV4A 4W4QA 4F9JA 1UWAA 3M5XA 5GPRA 5IDZA 2Z28A 3V18A 1VB9A 4R7JA 2O56A 4XAPA 4G5DA 2ISFA 3VIJA 3V7PA 1SZRA 3W7LA 1MMFA 1XV8A 1OF6A 3UG8A 1DWGM 1CB2A 2FB2A 1JGMA 3WBEA 1KWKA 4I6VA 3H54A 3ZOAA 3KOWA 2W62A 4CLMA 2WWDA 5DY2A 3AIQA 4JL1A 3UWYA 2IKHA 2VC6A 1BEUA 4R9XA 4RNFA 3O06A 2P10A 5HMDA 4S3EA 3VMPA 4IGNA 1RY0A 4GYFA 4B15A 1F61A 1EWDA 1KM6A 3S2LA 1HT6A 5BWAA 2WHKA 3UBPC 5C71A 1HIZA 1ME9A 3HFTA 3XIMA 4DF2A 3C2RA 1L6GA 4H8UA 4QG9A 4N9DA 2EPMX 5A8OA 3M41A 1YADA 1HW6A 4S23A 1KNWA 1VEPA 4HZ7A 4HP5A 2OSXA 1V3HA 1DIOA 3EPMA 3ABRA 4ACYA 5A6BD 3BW2A 4E4UA 3FKRA 5F1UA 1HZYA 2RDUA 4UQDA 1MI3A 3OEXA 1UH2A 1QO5A 2H3DA 1G7VA 3IAQA 2FPTA 3DOPA 3RRAA 1R0MA 3W6MA 5KZMA 4AD3A 3VC6A 3P62A 3W72A 2Z1SA 7TAAA 2BODX 2QUTA 3N17A 3WDIA 3CLMA 2V5JA 3CUGA 5JBEA 2YXGA 1TUXA 1BPLB 1TWIA 2FTWA 3TC3A 2BY3A 4R85A 2AMGA 3Q67A 2ZKMX 3PJUA 2ZC8A 3WQ6A 4LT9A 3ITGA 1F5ZA 3M9YA 4B3KA 3U7BA 2YB4A 2WM1A 1H62A 2X7VA 1P4CA 2JIEA 4QE1A 1EBGA 3NQGA 4JY8A 5DRCA 2V63A 1M7JA 2MANA 4E38A 3S5YA 1R3YA 3WLOA 3FW6A 1AJZA 3GS6A 5KETA 4S3BA 1F6YA 1QMLA 4XBSA 3DUGA 5SWUA 4R3UA 1UB3A 3PF3A 3AZSA 1ZCOA 4UTLA 1X38A 1PTGA 5DCDA 2PDUA 3BW4A 1R3WA 5GQBA 1IXNA 1WDDA 1CGWA 3STFA 4PMNA 1CGYA 3VA8A 4H7CA 2QKFA 2VRKA 2EF9A 3W7QA 5G4EA 3SI9A 1M01A 3DI0A 2QV5A 3GDTA 4JKLA 1E55A 2ZZ2A 2XVGA 1E6PA 2DZBA 4A8RA 3KOFA 3M0XA 3W7PA 3G6LA 3UP8A 3GUWA 2GVLA 2XVPA 1A50A 4TU1A 5AHEA 1UD5A 4F0MA 5FCZA 1U5JA 3WDHA 1C8XA 1WV2A 5E9AA 3MB9A 1JPKA 3BAJA 4DNHA 3RLHA 1AW5A 1EX5A 3KCJA 4QCFA 4DI8A 4OBRA 1GVQA 4BF5A 4Z17A 2XVNA 2QUUA 2J7BA 5D2TA 2G97A 4U5IA 3GU2A 1JCJA 4NVTA 1XF0A 3TX9A 1R2SA 4IIHA 2NX3A 2XIMA 3F03K 4R9OA 2WK2A 2PDQA 3NL3A 1DWIM 1RLCL 2GUUA 3ICJA 3VOIA 2AQWA 3IANA 1QDSA 3PG9A 1J01A 2J79A 5CJNA 2DUXA 4AZCA 5EFFA 2YCLA 2WJZA 2BVDA 1EO5A 3OB8A 5RUBA 2C15A 1EKOA 3BO9A 4KESA 4N7QA 2NV9A 2ACRA 4AYGA 1VBGA 1RJRA 2POZA 2Z25A 1KBKA 3RJXA 4S38A 4LRTA 1CCWB 7A3HA 2CLMA 3IIVA 1PWLA 1M41A 4E4PA 3A22A 3TV8A 4QS5A 4FNTA 3ZLGA 1YE6A 2VUNA 1ZL1A 2Z26A 5MKGA 1ISVA 3SRKA 1K9FA 3JUGA 1B3ZA 1HTIA 1XWYA 4QJ4B 1CW2A 1LL6A 3DHFA 3WMBA 3GE7A 4V27A 1DE6A 2X05A 5LZLA 3EX2A 1JI2A 4HSHA 1Q6LA 5ABFA 4KGJA 4FLOA 2ZUWA 4C7GA 3H23A 3MMTA 1UZHA 1VF8A 2W79A 2CHRA 3A21A 1W5PA 2HK0A 1XS2A 1U1HA 5EMMA 3URAA 3SSZA 2J47A 4DPPA 4FF7A 4TUFA 4U2YA 2BOEX 3CO8A 2YZRA 5I0DA 4ILSA 2GQ9A 4A35A 3WF1A 1KCZA 5D2VA 4XBKA 4NAFB 3BLPX 3LZ3A 6REQB 4CNPA 3PG8A 4DO7A 1B0IA 4BWLA 2ISVA 2I17A 4GO9A 2IQ0A 4FLSA 5FF7A 1ONWA 5BCAA 4LAUA 4UMAA 3UZ5A 3FA5A 3TR9A 3AICA 1ICSA 2E67A 3P84A 1OGSA 5CCZA 1W1A1 2RFGA 4REQB 5AY7A 1OM0A 1LL4A 1F3TA 3DYPA 4H04A 1J0HA 4UR8A 2BNJA 2OQHA 1ZNNA 3LGGA 4QFUA 4N42A 4E0CA 1R3SA 3RCMA 4I9JA 1ZAHA 3S8HA 3UZXA 4HHPA 4GIRA 2Y89A 4J3TA 1V6YA 1XH2A 1H1NA 1WZAA 1GGOA 1RQHA 3BAYA 3QPEA 1E1FA 2WC3A 4GK8A 4GNVA 1KM5A 1FWHC 1K6AA 4Y2WA 5DXYA 5D32A 3PWAA 1JJKA 1PKMA 3MCNA 3GVGA 1AH0A 4IMGA 1YXYA 4HNNA 4PL1A 1GVFA 4Q8PA 3N4FA 4CNSA 4A2RA 1UKOA 5TIMA 3C52A 1LOSA 2FGZA 2QCCA 4XB3A 4IQDA 1OG0A 4XX6A 2YW4A 4M56A 4B92A 1W6TA 2REQB 4K8EA 3NQAA 4QBXA 1IWAA 3BTNA 1DVJA 3PZ9A 4Q6JA 3BG5A 1XUZA 4GIEA 3AWNA 1OFEA 4IMDA 4YJ5A 1KRMA 3TIMA 3UZYA 4GUFA 2YXOA 1TREA 5LIYX 5K9XA 4RR4A 3QSRA 4CD5A 2J7DA 4GYJA 1UP2A 1KRAC 4FXSA 1MEWA 4F48A 3EDDA 4Q22A 4DXVA 1VEMA 5F4XA 1F8MA 1YNPA 3GAKA 3RLGA 1X7IA 1HKMA 5FL0A 2QCFA 1S38A 1FCQA 4JGDA 4O1EA 1GK8A 3H4XA 3WH7A 1VRXA 1AODA 5BW6A 5LGXA 2J66A 4UTWC 1RUSA 4LYQA 3LBOA 4PFHA 4MNLA 3GHRA 3GR7A 3GBDA 1R7AA 1OZQA 4BQ5A 4C6FA 4CKQA 3S2CA 3RIKA 1XSIA 3T2QA 2OO6A 4A8IA 3M43A 3O6DA 1Q63A 1QI3A 2NX9A 1SR9A 3ONBA 4Q3MA 1FX6A 1M04A 4NUWA 4YTUA 3CIWA 1L9WA 4Q7IA 2ZX9A 5I78A 4PMQA 3AIRA 4LAOA 4R34A 2QF7A 2H8ZA 4UTTC 1FFQA 1UWUA 1DJZA 4PN2A 3E0VA 1M65A 1G4TA 2BY2A 1VPXA 4R27A 5LYRA 1RR2A 2O9TA 2OT1A 5FA5A 1LG1A 4JIQA 4BF9A 3VIPA 3T6CA 4IPPA 5DMMA 3MKKA 4W85A 3WQPA 5I7GA 3BC9A 1ADDA 1VAHA 4DEFA 1J6PA 4NZ3A 2YCKX 4XKYB 4HZMA 3CM4A 1TRIA 3QZEA 1QATA 3D3AA 3IK2A 4KCWA 1WA3A 4UWMA 3CTLA 3AS1A 3EKLA 1VBJA 1VPQA 4F66A 4A3HA 2DZTA 1YBQB 4UCGA 3TROA 3WK2A 1EQCA 2FHCA 3EDEA 3N25A 4U3CA 3FXYA 3ZT7A 2V5LA 2TYSA 3A24A 4LAZA 3K4AA 4BHYA 4DF0A 3LPFA 2J8TA 1RA5A 3U5UA 3GHTA 5FJJA 3FIGA 1VFSA 2NQJA 3L4YA 1DYSA 4PUNA 2WNZA 3C3UA 1QI2A 3CIXA 3LNPA 3M5VA 3BG3A 5F4SA 2HK1A 2C18A 2A7RA 3QZAA 4K38A 3GWQA 2BY1A 1IXQA 4C6BA 1OVDA 1OSEA 3M0IA 1MDLA 2ACUA 3WEOA 3NEHA 1FCBA 1I0DA 1AUSL 1H49A 3GG0A 3LCWA 6PTDA 1U83A 3FJ6A 3NL5A 3W1UA 3WFLA 3R11A 2P76A 2Q3OA 3WNNA 3DFQA 1MYRA 1VH7A 3QGKC 5HANA 2PGEA 3VMNA 1U1JA 4F0KA 3W37A 1HL2A 4IZGA 5EMKA 2D3LA 1QI0A 4LQ1A 1TR9A 2VUYA 4D6CA 2UV8G 3L2MA 5AYYA 2HPMA 2F9RA 5D30A 1DXIA 3I6TA 3NSMA 3LCGA 2Q8XA 4DYKA 1P0KA 1QI5A 4RCXA 3W1PA 4YTRA 4JOMA 4A3UA 4NZCA 3EX6A 3ECQA 5E1QA 2DP3A 1PDYA 1GOKA 3DG7A 3WX7A 1WCGA 2V3GA 1KD0A 3O15A 2Y5JA 2Y85A 5C8BB 2V38A 3AHYA 1VR6A 3L5MA 3STCA 8XIMA 3SIZA 1T5AA 3WF2A 2D0HA 1CBGA 3AROA 4CN4A 1FXQA 1LT7A 5BOEA 1ZBWA 1JUEA 4AD2A 2UY5A 1S39A 3FHQA 4A6GA 2OVLA 1UJPA 1UBPC 2NSXA 2ZQ0A 2E6YA 2V0TA 2VDIA 4M6UA 3TDFA 3HQOA 2A1YA 4IJBA 1VD6A 2NQLA 3TYBA 4B91A 4XZBA 4HCDA 4IFKB 1ZHAA 4K37A 1WUFA 1L6SA 5C5YA 1CTNA 3LV6A 2JF6A 3ZVHA 3UCCA 4CVWA 4GVFA 2EG8A 1CNVA 3HM7A 3EXSA 4GY1A 4UFLA 1BLIA 1Q6OA 1NDVA 3RCNA 4ZO9A 5ABGA 4RZBA 3VGEA 4MMWA 4WHBA 4OJYA 3A12A 2Y24A 1E15A 1OQFA 2ZRXA 4FNUA 1WDRA 4I5XA 2DDXA 3MVIA 4HHLA 3CQJA 1GEQA 1XBXA 3LSCA 6ALDA 3TJXA 4M80A 4DJDA 1L8PA 2I5GA 3V0SA 4WXZA 4JCLA 5CZSA 5AVHA 3ID7A 4L1XA 2B0MA 3NPVA 3VIKA 2D2GA 5HATA 1XG4A 1UBSA 5M1TA 2DSUA 4WGXA 1J6OA 5BROA 2JIWA 1VZWA 5BXTA 3VNKA 4IXXA 1XH0A 4LCQA 3SY1A 1TPFA 3OU8A 4HBKA 3RITA 5H8PA 1FFRA 3GTNA 4X0NA 2ABAA 4LAKA 5LA2A 2VCBA 2PURA 2VFGA 3W1RA 1R87A 1UUQA 3WF3A 4B5UA 2RUSA 3DZ1A 2NVCA 3IRSA 4K7VA 2WSKA 4B16A 1IEWA 3RCYA 2BGNE 2RJGA 1MFVA 1JDEA 1GOQA 4OIFA 5C7VA 3FHAA 4EACA 1BVWA 5FKYA 3L67A 3R25A 1KQYA 4NHVA 2E6AA 3MMUA 3R8GA 2HVNA 3GD6A 5FEPA 1FY6A 1SFJA 3H70A 1BTCA 1AMKA 3HBLA 1CGXA 1DTUA 3PPCA 4IIEA 1HL8A 2F6XA 4KKXA 4DRSA 1FWAC 2G95A 1NOFA 3UESA 1OB0A 1YTEA 4JIHA 3TMLA 3UA3A 1AW1A 2E1DA 4MOZA 1ITCA 4MADA 2WVVB 4UQ9A 4Z1CA 4CD6A 3H2NA 1IT0A 2WCSA 3KRSA 4LYKA 1Q8AA 3W7HA 1IXPA 3W2UA 1JYVA 1DJXA 2OB3A 3BUVA 3FNDA 4IL0A 1OABA 4UB9A 3UPBA 4GJJA 1TJ1A 1W9DM 3UXKA 1EGMA 3B06A 4LVGA 1ZJAA 3ZR5A 2QMJA 2WW5A 2VZTA 1YRRA 1XIDA 4HVXA 1X6LA 3IS4A 3CUIA 2YPIA 4HZ6A 5I3JA 5HR7A 3USZA 5D4YA 3L4ZA 1TPEA 2PWEA 3RJYA 4FHAA 4HSOA 3ABOA 3HA1A 2A6NA 4JX6A 3TJIA 5J5DA 1XIHA 4JL2A 4EANA 1BYAA 4Y6GA 1Q66A 2Z7KA 1E1CB 3FYPA 3WBYA 2ZRUA 3M07A 1PO9A 5H6HA 2WNWA 2ICSA 3TTEA 4U2ZA 3TJLA 4C1NA 3SGZA 3SY8A 3UWVA 8TIMA 1J96A 3BGGA 4J3XA 3APGA 3V4BA 1FTXA 1EGVA 4HGXA 1BAGA 4NJGA 3KTSA 3BL3A 1B9BA 7ENLA 4DIAA 3ARUA 5HNRA 1FWEC 1QHOA 5E9XA 2PDJA 1J5SA 4WQ6A 3ZSSA 3OZMA 4GXMA 3NVDA 3ITVA 4J5NA 4MZ8A 2PDHA 4QX4A 3BAIA 3FVMA 2WCGA 2FFCA 4Q4MA 1E3ZA 4J7RA 4L9ZA 4NQ1A 3EA3A 3VKAA 5A94A 1JCNA 5BZAA 4PMUA 1VYSX 2NV1A 3OO2A 4JNZA 2R24A 3GDRA 4AY1A 3QC3A 2FZDA 1ZPTA 3AXMA 4HTYA 4P8XA 5FEZA 4YTSA 1RY8A 2WNQA 4A05A 3QKEA 3EB3A 4J2PA 3O8AA 4NXSA 4GBUA 1XLFA 3V36A 3WNLA 3K46A 3GIQA 1XRFA 4F2BA 4GIYA 1E51A 3V3WA 4FK9A 3ARYA 3CXOA 3M7WA 3WK0A 4UFIA 1JDCA 3VOHA 3UT0A 3MMDA 2ZICA 5L6UA 4AF0A 1QW9A 1WB0A 2E3ZA 3TH6A 2DPEA 3H7RA 1XDJA 1XKYA 2WPBA 4R7WA 4UCFA 3B8WA 3PPGA 1QFEA 3ITLA 1RVGA 2NWSA 5I3HA 3DHPA 2GWGA 4E4FA 2QCMA 1I2PA 4O12A 1ICQA 3RUBL 3M16A 3HQPA 4XG1A 3CUHA 2QCLA 1QHZA 3M0HA 2DQXA 4PULA 5HDRA 5D2YA 4JFTA 5A95A 4EVZA 4FB7A 2CZVA 2OWWA 3M5ZA 4I7WA 4RNIA 1GG1A 1PCWA 1K1DA 3LGDA 3VIIA 3UU0A 3NQ7A 4QSHA 3FX4A 3MV01 4NKCA 1A5KC 5BMXA 4ACZA 3CQHA 4FF5A 2C19A 3DYOA 3BSGA 2NXIA 3NZGA 3S0CA 1M3UA 1OT1A 2EEXA 4MAZA 4H6RA 1T41A 2VCCA 3BOFA 3OZPA 4PUMA 2XDFA 1SR0A 1JPIA 4ZTXA 3GG7A 1V0KA 1H7XA 3SJ3A 5A2BA 5K4ZA 3AS3A 2FGBA 4FI4A 2J6XA 4AAJA 4KCTA 5DBTA 3S9YA 3G5EA 4LPCA 2VGFA 3EWXA 3SN1A 4OBTA 2VZUA 1SFLA 4HOZA 2VEIA 2PDPA 2G3FA 3CUJA 3ZS4A 1YDOA 2TMDA 4QISA 5HMSA 1PKYA 4D9PA 1GOWA 3CQKA 3S9IA 4JTEA 3WLRA 2ZVIA 1ITUA 4DBWA 3A23A 2ZA2A 4K2SA 1RLDA 2PDGA 1NWRA 4PBEA 1O68A 3HN3A 4EXBA 4O1DA 2I7GA 1I75A 2WZTA 4FA3A 1POKA 1C91A 1A0EA 3IJQA 3T40A 4WJ8A 4O4WA 4M5PA 2O9OA 3KRZA 5D33A 3K5XA 4DXXA 3TYAA 2P8BA 4JDYA 3RM9A 5GNZA 3EOOA 1K9EA 4G6CA 1GKRA 1RHCA 1R86A 1Z6KA 2BGSA 3MHGA 1MUWA 3CB8A 3KVJA 5KITA 1A5AA 4O4VA 4D2JA 4DJDD 2GSHA 1UYQA 1GNXA 3IIXA 4CUCA 3EOUA 1A80A 2ZUUA 5C9RA 3VAVA 3EKZA 5FJPA 1VLWA 1ONEA 3CHVA 3HU7A 3BLIA 5ABHA 1QBAA 3E1F1 2PAJA 4MM1A 1EDQA 2DH3A 1GOIA 3VE7A 3T4WA 1X8FA 4DLFA 4I9MA 1Z48A 3RR4A 1JCMP 3QYSA 2XH0A 4D8AA 1EP1A 2J9YA 1TIWA 3PANA 3GTIA 3M0KA 2RDTA 1UG6A 4MPKA 3DENA 1YNQA 2A7NA 4LXFA 2BTMA 5M3WA 1GTEA 2A21A 4J27A 3SBFA 1CX9A 4ZB5A 4W87A 3QQ0A 4XIAA 4O0QA 2VCAA 1LUCB 2XSAA 2CIPA 2PU1A 3LXBA 4AZHA 1OYBA 2PZNA 4L4LA 3H22A 1MQRA 1FBAA 4AEEA 5I3IA 4AWUA 1LOQA 3NJ3A 4J3ZA 1JGIA 4QJ5B 2GK1B 4JHOA 1X6UA 1EXPA 5LGZA 2CESA 1FP9A 2WMIA 3I65A 4Z2KA 4INFA 3SRHA 1K9TA 2FZBA 3ZYZA 2CBUA 3VC5A 3E5PA 2HE5A 4AIUA 1NF0A 4NF7A 1E9ZB 4WEVX 2B7PA 4YU1A 5FAJA 1ECQA 3M47A 4MY9A 4Z1AA 3NPXA 4M29A 4X9YA 3SUSA 3E2QA 4OQVA 1E9LA 2IMRA 4YTTA 3UWWA 5A69A 2P88A 3PAOA 4GKTA 1AD4A 3UPMA 1PZ3A 2ZX8A 3LLFA 2X09A 4P7OA 4MDPA 3GW0A 3RR1A 3GNNA 2ZZ5A 4BZYA 2GUBA 2QW5A 4JR5A 3PTDA 4L6HA 4L61A 3N13A 4LBSA 1S3TC 3L4TA 1F74A 4CNTA 1BHGA 4O16A 3FSUA 3W1QA 3LLDA 3PAJA 1ISZA 2DZPA 5CC6A 1D3CA 1BSIA 4G2DA 4PR4A 4B5TA 4AD0A 2ZUVA 2XGZA 2PDYA 4DAFA 2C14A 4XD6A 4TTGA 5EPDA 4Q4OA 1TQXA 1W0MA 1F2JA 3PVFA 3DGRA 4IQEA 4JTJA 2UWFA 4YN5A 2FZMA 3WFAA 3CHEA 5JVLA 1NVMA 3WQOA 1M6JA 1DIKA 1W54A 3L5AA 3S5OA 1PB0A 4P8WA 1R2RA 3LRLA 2HBXA 3OVRA 3N18A 3DH7A 4FMVA 3M4HA 1KTCA 5F2LA 4PB4A 1X1NA 3QKZA 1RP9A 3HURA 1OY0A 1AH4A 2BASA 1OFRA 3N2XA 2V5KA 2XHYA 3MZNA 3PUDA 2NSOA 1BKSA 5E5CA 4W5UA 6XIAA 4UFKA 1DOSA 1XLHA 1LWHA 2X41A 1UZDA 1JIBA 4MFDA 3SGGA 4O10A 2DSVA 3LD5A 5DRIA 2TODA 4ADUA 3V35A 1W9VA 3O16A 1E5NA 2UZ9A 3CV2A 3E0LA 3ZWSA 3MHFA 1CXIA 1JR1A 2EHHA 2BG5A 3S9ZA 3WK3A 2NVDA 1H1ZA 4C91A 4EPEC 4A8NA 5CZTA 3GSMA 4ZOEA 4O28A 1FCUA 4BEUA 3L68A 5HPOA 3ZM8A 4MKSA 1DTNA 2D2OA 3QPYA 1DE5A 1W2VA 5G2IA 2OWCA 4AHQA 3RYSA 1TUFA 3MO7A 3M64A 3TVAA 2X16A 1FWJC 4URIA 3T4CA 5DFAA 4PSRA 1S1RA 2AL2A 4QAWA 2CZFA 3M6DA 5CAHA 5IHRA 4RNJA 1KTNA 3KBVA 4P8VA 1DJHA 3A3HA 1J8VA 1MO0A 1KC7A 1JG9A 5G1YA 1SFSA 1W8GA 4C6IA 3P8JA 3VCCA 2XN1A 1PCKA 4UFHA 4M6QA 1TX2A 4ZO7A 3N6JA 4LGXA 2YDSA 1DJWA 1L6FA 4YXGA 2X7WA 1WBJA 2H9AA 3H2EA 3W1LA 4NNAA 2ZZ6A 3TP4A 3W01A 3W7IA 3VABA 4PUWA 4D6FA 1SO5A 4GD0A 5A3HA 3R10A 1RCXB 4OGZA 2GJXA 3VD9A 4UQBA 3EDJA 4WUIA 1NSJA 1SMAA 4C90A 5DXXA 1YPFA 1KR1A 4XVDA 1OFAA 5LIWX 1OK6A 7XIMA 3RNDA 3AJ7A 3FLUA 1ZBKA 3EWWA 1D7FA 3U2OA 2XIQA 1A5BA 4EF9A 1VJZA 2KAUC 5JMUA 5HWJA 3G24A 3KHDA 2GSEA 4XZIA 1JRBA 4BK9A 3WLKX 3QR0A 1PX8A 2J8FA 1QTWA 4FLRA 2VZOA 1I4NA 3MCOA 3BZJA 1G69A 1XH1A 4PMXA 3P0WA 3BARA 2X2GA 2VURA 5LNWA 3AUJA 3S6TA 4E2DA 2X40A 3OZYA 2Z24A 4NILA 3IVSA 5JU6A 4KFOA 4N9CA 1O6IA 4ZL1A 1U33A 1LRTA 4HOWA 3SEPA 2E28A 3I7RA 1O5RA 1OYCA 1PJ9A 2V82A 4XUYA 1EYEA 3MKCA 1NFGA 3LBMA 3VMOA 3NA8A 3HQ1A 1HL9A 2R1NA 3S6OA 3OYZA 3SW6A 1FH9A 3GTFA 1CT5A 1N8WA 3ARXA 3KFTA 3NDZA 3SURA 4NY2A 3KRBA 3R89A 5LSMA 4PUUA 4LYPA 4LTSA 3S46A 2C6QA 4S3AA 4Q4KA 1JNEA 4CQCA 1QW8A 3R43A 3OHIA 3OHMB 3U8GA 4GE8A 3MY9A 3G1DA 1XX1A 2DQWA 5U7SA 1IZCA 3LDVA 2ISDA 2YL6A 6A3HA 1F9CA 1EJ7L 2H6RA 1ZS2A 3MI3A 4CD7A 5EFDA 2VWSA 2ZUTA 4K1GA 3RLVA 5K2ZA 2PRMA 1GQKA 3WKZA 1XL9A 4OE7A 3ZWTA 3LY0A 1OFPA 4KIEA 2QDEA 4E2BA 1R9XA 2KZHA 2Y4SA 9XIMA 3PJTA 1TMQA 3VXGA 2H90A 2CZEA 3ABZA 2XWEA 2WV8A 3NEVA 5AC8A 3NQCA 3DDMA 3VNZA 4NJJA 1KGWA 1BVNP 1BXNA 4D6DA 4MIMA 4MDOA 1UMLA 3G3MA 4NZ4A 2XGIA 1XIGA 3U2EA 4WDUA 2W61A 4UFJA 1G4EA 1WO2A 4EX4A 2ZA3A 4JTRA 1LCOA 4AZGA 5JQ9A 2VEKA 1PHQA 1Y65A 2OEKA 4YWIA 3VFLA 3TSBA 5HPCA 4Q4QA 3NWRA 2FHBA 2VGGA 3CAWA 3AMDA 4KFNA 1TTPA 2WC4A 4DZHA 1RXOB 3UW6A 3W1AA 4X61A 3I10A 1UR3M 2BVYA 3HG4A 1O7AA 3A5FA 1I0BA 2QJNA 3PUGA 3CL8A 2PDLA 1UH3A 4CQ9A 4LS2A 4LVAA 4PTXA 4TQTA 4S2CA 2PDBA 1ONXA 3FY1A 2VGIA 2XFWA 3ANVA 1KGXA 3I6RA 4LSBA 3PZUA 1H7OA 3TW7A 2DUAA 2ZIDA 4XZNX 3AXIA 2XIIA 3EB4A 4I7UA 4NL1A 2HSAA 4G7EA 3V0UA 4LUTB 2QMKA 2WMHA 3KZPA 3RMEA 3TTQA 2XVKA 2R94A 2OOFA 3PY2A 4AZCB 4ZQPA 3BCJA 4NAEB 5E93A 5T26A 3MVTA 3SAZA 4O19A 3U5YA 2EPKX 4GG9A 1QUMA 3L65A 4PFMA 3RM4A 4PGLA 3T7VA 5FF4A 3GG8A 3N3TA 3WLHA 1QK0A 3KHJA 1W5NA 1NWTA 1DQXA 3MTWA 5E0FA 3THAA 2OX1A 2F38A 1IF2A 4DQWA 2YDQA 3AYSA 2RAGA 1HKVA 4M3PA 4FR6A 3K4DA 3VNDA 4MYAA 2X1RA 4NG3A 1DIEA 3VGBA 3NR0A 4IQJA 1HGWA 4H00A 4TVCA 2JKEA 3CWHA 4HNLA 1QRQA 3GIYA 2TRSA 3EDKA 4IJRA 3EOLA 2J8GA 1TELA 4JCMA 2QUNA 3IUIA 4JZ5A 5KSWA 1WAWA 2IXUA 3WJYA 3ITYA 4O8RA 3AWOA 3ZJ8A 3DU0A 4LS0A 3W7RA 2A79A 4UR9A 4AMAA 2JFEX 5REQA 2YJQA 3FDKA 5BNKA 2CW6A 5HOSA 1OCJA 5CJ5A 3QC0A 4KWWA 4WDTA 2J7HA 4Z0JA 1E6ZA 1WDWA 5EMUA 3M44A 4JX4A 3CQIA 4C7FA 4XK2A 3F5LA 3C6CA 4ORMA 2QPXA 4MUZA 1T8QA 3KL0A 2QV4A 2W91A 4S3CA 2OKOA 2JKPA 4Y8EA 2OZ8A 3SGUA 3TYZA 3AYVA 3NSXA 4GVHA 3CV1A 1ZAJA 1EJWC 4O0KA 1XBYA 2G5WA 3OVGA 3UZWA 3WLIA 2I1OA 4BA0A 3VPLA 1I1XA 2QCDB 2V2HA 1UCWA 3UG4A 4AVNA 3N6HA 1PEZA 1GQNA 3W26A 5E6YA 3H6OA 4A21A 4LANA 3QV8A 1YW1A 1QOXA 3U48A 3SZ8A 4GKLA 3MA8A 4UNLA 3L2LA 1W3HA 1EHNA 4QEEA 2GL5A 3EX1A 4AYSA 3QQ1A 2OYMA 5E09A 3P6LA 1ZCCA 3DHUA 4IIBA 5HNNA 2QYGA 2YOCA 1KQZA 3GDLA 1Q6CA 4ZMGA 4RV8A 3WBAA 1YNYA 1UD2A 1HP5A 3WUGA 1QBBA 1CLXA 1Q5MA 1QNRA 2DVTA 2OEJA 5EKYA 4RZ6A 3UEQA 5KMYA 1JCTA 3TCEA 3ES8A 3SQMA 3TXZA 2IKIA 2VTFA 1J2BA 1ZENA 4MB1A 2X30A 3AIWA 3H7VA 4WDWA 5AOUA 1UR8A 4W8LA 2XN2A 5EMLA 4HK6A 4LEFA 3GNDA 1PWMA 1VS1A 4LBRA 3Q45A 3TONA 3KVKA 1LYXA 4DZAA 4I5RA 4WY0F 5HR6A 3H4WA 1E40A 3GVRA 3LPOA 4IP4A 1E6XM 1YDVA 3U3HA 2J7EA 1XW8A 2ZZ3A 3LTYA 4KGLA 1LORA 1UQYA 2ZWYA 1PHWA 3WBXA 4WY0B 3VNJA 3NO1A 1TPVA 1WE5A 2V9DA 3GK0A 2LLEA 4IUGA 1KCKA 1SUXA 2O0TA 1IIHA 4C5ZA 3UG3A 3GXNA 2OWXA 1A5SA 4WX2A 2V8ZA 1UPPA 2FDSA 2QR6A 4PUJA 3T0DA 3WLJA 3W7JA 1Q7ZA 2HTMA 4FZIA 3B03A 5JBFA 2OLHA 3VZYA 1IV8A 4LY8A 3LXAA 1VYPX 4NZFA 4JTSA 4ZGYA 2B7QA 3PPHA 4KRUA 2Z2BA 2EJAA 4JYDA 4PCTA 3SFWA 4CCEA 3ZJ6A 4LX4A 3KBNA 4UR7A 2CERA 1HXJA 1KKRA 4GY7A 2BX7A 5LNRA 4L1WA 3L0GA 2Q8LA 3ATZA 1V6TA 3IGSA 1PVNA 4XV0A 3VOFA 2V67A 5L9FA 3PBMA 5ENLA 3HMJG 3BJFA 1YX1A 4I3GA 4KCUA 1S5NA 2OZ3A 2DT0A 1FWFC 1H11A 4IP7A 1FHDA 4L4MA 1MW2A 4QP0A 3QMTA 4HN8A 4WF7A 1DJIA 4Y8FA 3EZ4A 4M82A 4I8YA 1MDRA 5BXPA 3GU9A 3B8TA 4DZ5A 1AK5A 3F2CA 2O9PA 2X1UA 1KO0A 3WJZA 4WSJA 4DVOA 2W66A 4M7SA 2JEPA 1TJ2A 3ALFA 1PYMA 1IGSA 4J35A 1UR4A 1BWLA 2WOQA 3W7OA 2PP0A 1P7TB 1W3IA 2GWNA 2IPGA 2CBJA 3VM7A 4IM4A 2CXEA 4A3YA 2NV2A 3HJEA 2F6KA 5D8ZA 2ZRZA 2QIWA 3O2LA 1GZJA 4GYPA 4L56A 4KWVA 2D73A 4QDWA 4GI9A 2GVYA 4I9TA 3DCPA 5AHFA 2A3LA 2WZEA 1ZBVA 2XH4A 4UOJA 1XYCA 4Z1DA 1EDGA 4JN8A 5D2WA 1QPRA 3HPZA 2JALA 3IJ8A 5I03A 4E2VA 1G67A 1AZ2A 2GQ8A 3W24A 5CSSA 4C6CA 3LV5A 1W56A 1CENA 1YKWA 4QNEA 1UD4A 4XZ9A 3QY6A 1VQTA 2QEZA 3SQSA 2J25A 1H5YA 1BF6A 4QJ1A 2DJXA 1KRBC 1XRSA 4DUOA 1ZBCA 4W8BA 3B8SA 3GC5A 3TQVA 3W7CA 4D1JA 4M24A 4UQAA 5LA1A 5FESA 1ZJBA 1PE1A 1PDZA 3STEA 4IPJA 1SZGA 5D05A 5AZ1A 1X7FA 1RQBA 1KR0A 1KBBA 1LG2A 3AALA 3PS7A 5EL1A 3WQWA 1TZZA 1XJBA 1GHRA 1FWSA 1JCLA 3CYJA 1V3MA 4FEZA 3QV6A 1O5KA 2QIIA 1EIXA 1KFBA 2PB1A 3MP5A 4I9AA 1NOWA 2PA6A 3GFYA 4ICCX 3H2OA 3BDKA 2B7OA 2BY0A 3IPWA 4S39A 4NJKA 2C13A 1XBVA 3FKKA 3GFZA 1Q4WA 3SCQA 5TD4A 3B9OA 3W7DA 3IACA 5D03A 3VD4A 3IV3A 3RAOA 3N14A 3SN4A 3GQYA 4CNUA 1YXDA 5GNXA 4JQ3A 3V5CA 3URQA 4TR9A 2J27A 4C6MA 3PB2A 2ZYFA 2ATMA 4RE0A 1H51A 2VFFA 1YEYA 7ODCA 3S5SA 1JYNA 2XFFA 5M03A 1ONRA 1TVNA 1OCNA 1LT8A 1O1HA 3D3FA 2BOGX 5MHBA 3QFWA 1QWGA 2WVTA 1FDYA 3E0FA 5FJIA 5CPTA 5C9UA 1K4HA 3W82A 3UVIA 1RZMA 2BHUA 5M17A 1XD1A 2WZIA 4J2MA 3W4RA 3RLUA 2NQ5A 3LM7A 2CBIA 1UD8A 2ON3A 3QR1A 2GJLA 4JKKA 2F84A 4ZENA 3THDA 1K02A 3KDNA 4N6FA 1DWFM 5CH9A 5HMEA 3G3DA 2VC5A 3QMSA 4GJ1A 5GJMA 1G7UA 5G4WA 4WJXA 4JNYA 2WMGA 4OFCA 4YWSA 3UPWA 1BTMA 2WLYA 2WSPA 3WBWA 1P0BA 5A6BA 1O94A 2A4AA 3GZAA 2NQZA 4PRWA 1PZ0A 3ZR6A 3BCFA 3WMCA 4H8NA 4IICA 3O6YX 2BBFA 3IV8A 3I7QA 4NYUA 2WWCA 4HA1A 4UTWA 4NIRA 4WD0A 4XIMA 2DZUA 1KV8A 5I24A 3N29A 1UC4A 3M0VA 1OD0A 1XLCA 3TC7A 2JQXA 1BSLA 2RDXA 3RO8A 3EMZA 3Q4DA 2DV0A 2BV9A 2UY2A 5HXMA 1ISYA 3AIVA 1DJGA 1LWIA 1GVSA 3G0XA 3QLLA 4NNCA 3VIMA 3EAUA 3FN9A 3ITOA 4J40A 5MF5A 2R1LA 1L6YA 3TU9A 1C9DA 1LP6A 3WJXA 3B8VA 1SMDA 4IIGA 2IPWA 5K9DA 4H9YA 1C8QA 3C0JA 1DXEA 1XPYA 4P7LA 3N2CA 4GXPA 2DY3A 2WHMA 1MNZA 1WZKA 3W2LA 4Q6XA 4IF2A 3EWBX 3CPGA 3GNPA 3BOLA 1Q2SA 1B2YA 2VZVA 3SCWA 3O0FA 4CQ8A 3BQ5A 2Y88A 1A49A 1UIPA 3MMWA 3L4WA 1TYGA 4GXWA 2ZFAA 3NOEA 3JVAA 2YDRA 4MG4A 3GM8A 1L2UA 1FXPA 2QS8A 3KE0A 4QR6A 3KVMA 2BDQA 3AISA 3RU6A 5DO8A 3VDHA 3NNTA 3ZO9A 1UW9A 1F8IA 3ORWA 3CZLA 2VMFA 4B9YA 1JNDA 2WVUA 4HCHA 1E0UA 4B5NA 4FPSA 1DJQA 4EWND 3TSDA 1C9WA 1GTHA 4H9VA 1CB7B 4B5VA 1WKYA 4AVOA 1TKKA 5LNSA 3UNDA 2VKZG 1F3XA 4IH3A 1MRQA 3WF4A 2MNRA 2Z1VA 4E3TA 2BLEA 1KXHA 3NZ1A 1XFBA 1LBMA 4F3HA 4IP5A 4OZOA 4HPJA 5HWMA 8A3HA 4GPNA 1UJQA 3QGAC 3TUUA 3TXVA 3G77A 2DIJA 2C1GA 1NQKA 1W5OA 4M8UA 2GDVA 3S5NA 2J7FA 4Q8MA 2V3EA 3HG2A 4JQ4A 1ZJHA 3KL3A 3KTXA 1DWAM 1UR1A 4YNGA 1W17A 3TNOA 1HGYA 3DG6A 4PYSA 3VNLA 3GXTA 1FCVA 3COTA 1B31A 1H7RA 1LDCA 4LH8A 4NASA 1JCXA 3TWAA 5LHEA 3OZOA 1EYWA 4NAFA 6REQA 3FSTA 3QGVA 1EUAA 2FZ9A 3AQUA 5C54A 5CC7A 3QXBA 2HISA 3R79A 2G3JA 4HU3A 1FQ0A 1MQQA 1XD0A 3CUFA 3WQFA 1E6QM 3OW1A 1ZU8A 1JZ4A 3VKBA 1Q6FA 2FJUB 3SM0A 3UZJA 1BRLA 4WSHA 1VCFA 1US3A 1WOAA 3CZGA 5EU9A 2GQ3A 4LNCA 4LUYA 4REQA 4PTDA 4HNOA 4PBFA 4LVBA 2Z29A 1ZY9A 2RH9A 4ZEPA 3UNTA 2BSLA 3IIOA 2O55A 2PP3A 4EXAA 2FDMA 4FSAA 3KCOA 1XKJA 1ZSXA 3HFYA 3TK7A 1I8JA 5KINA 1EUNA 3J7HA 3NG3A 2PGWA 4XWUA 3MP3A 3HMCA 2OTDA 2YLLA 2PZ0A 1WDPA 1E9IA 3RPTA 4W7UA 4JDBA 2CLFA 3UY7A 5AHMA 2Y63A 1V0LA 3VDBA 4B2DD 3H26A 3GAYA 2EBNA 1V5XA 4LY4A 2GDQA 3JW7A 3TEVA 4S3KA 4AISA 3RPDA 5FEXA 2REQA 1X6NA 2WMFA 2WSQA 5CG7A 3VIHA 3CC1A 2OODA 4GIAA 2XM2A 1F05A 2G3IA 4ACZB 3TE9A 1PIGA 1Y7VA 1SW0A 1BXCA 4XD3A 3SDOA 4N02A 1NIUA 1Z8AA 3REQB 4FNRA 4P7QA 1KFWA 3EWYA 1X1OA 4LB4A 4Z0SA 3FDGA 2QVNA 3AMGA 3RRXA 1JQXA 2ANUA 3K2GA 4WR3A 3ZFHA 3EOSA 3EPOA 3TTOA 1LL7A 3UR7A 3ZJKA 3PC0A 1PS9A 3TA9A 5AHNA 2PFHA 3W83A 1XG3A 4DWSB 1MW0A 3V1PA 4AEOA 2O9RA 3LQLA 1V4YA 1GEHA 3UY8A 4UMBA 1LLOA 1SPQA 1IYXA 1Q6DA 2QLYA 4ONVA 1OJXA 4D71A 4G8TA 3R12A 1D3GA 2HXTA 1IR1A 2XIJA 1J0IA 1Q8JA 3HPXA 2I9UA 1BKHA 3PJWA 4JFWA 1TV7A 2GGIA 3S1UA 1V6XA 4MZYA 4NRRA 3GHSA 2A3EA 2HWGA 3N3MA 3VCNA 5DT5A 2ZXDA 4ZO6A 4LS1A 4IOTA 3CZEA 4DJFC 3WH6A 3K8LA 1GYNA 5CZJA 1CGTA 1T8XA 1EGZA 1OGBA 1JL8A 3UG5A 3CL6A 4XZMX 3INPA 5FJUA 2DZWA 4WOQA 4J4KA 1DKWA 2AOSA 1TMLA 2OXNA 3K8KA 3BOXA 1EA0A 4QCEA 2JF7A 4XKMA 2XSXA 1OCQA 4LFYA 3IARA 4W89A 1FH8A 1RD6A 3WL0A 3P74A 4UC5A 5CSUA 1SW7A 3XINA 1LBFA 5HA7A 4BJHA 4GX9A 3VDGA 2TPSA 5DMNA 1JZ8A 5LNVA 2PLMA 3CT7A 4AZBA 4B4FA 4OVXA 3PB0A 4BQ2A 1XIIA 2J62A 4JTHA 1L0PA 2EPLX 4Q8NA 3LU2A 5I2UA 5A5WA 3MHUA 4PUDA 3WYZA 2ONEA 1YBQA 2C16A 4I5UA 4ZA0A 2YCJA 4UTFA 2R91A 3WEMA 1A53A 1E56A 2IKGA 2P1FA 4KRTA 3NL2A 3VX1A 4LV9A 3NM1A 1CIUA 3H53A 1C93A 3S2MA 2J4GA 4KWSA 4RDZA 4GNKB 2NX1A 1W1TA 3P0XA 3NO5A 1AQHA 1NP0A 1AL8A 1W2PA 3NL6A 4CU7A 1O5XA 4RL3A 5KZDA 3WY1A 3SUTA 3N15A 3JZEA 1DIDA 5HQLA 3Q37A 3KCLA 4V15A 3MCMA 2PTXA 4GQGA 5HUPA 2CNCA 2Y8VA 5AYXA 3I4EA 1Q7MA 5C9ZA 4Z2LA 2GZXA 2XVLA 1UA3A 2O4QA 3BLFA 4JS3A 3QOMA 4P61A 3NZQA 3LMZA 2VYOA 5EMJA 3WCZA 1TV4A 1HVXA 3FYOA 2YIHA 1QNSA 3H2AA 3MV11 3NQEA 2E9MA 4NI8A 3TYCA 1PTAA 4JPGA 3KW3A 3PZMA 1A3XA 3G2GA 1F76A 1UKQA 3BLKA 4PRRA 1MSSA 3POHA 2NQHA 4HCLA 3QQWA 3ITCA 3E02A 3AJXA 3ERPA 4DO4A 1I6NA 3XISA 2VDGA 2VR5A 4LU0A 1KW1A 5B7YA 5BMWA 3WD1A 1EZWA 1LWJA 1OFDA 2Y2WA 5I23A 4MAVA 1E72M 2VVSA 2QZRA 2Y7GA 2AKZA 4MNKA 1JXJA 3FK4A 3H55A 3IIZA 1T0OA 4GC4A 4AIOA 1FRBA 5C70A 3BICA 1XQLA 3LENA 1JCYA 4Z2HA 3G1SA 3GFXA 2OLSA 1FWRA 3W53A 5D9OA 3TZNA 2BXVA 4LF2A 4QHRA 1HJUA 3PZVA 4Q8VA 3W1MA 3BSHA 2NQ9A 4IFKA 1FUYA 3DBNA 2PDNA 3W88A 2FVLA 3ZLHA 4DO5A 3O07A 4QLJA 1XLEA 1DBTA 5AYZA 4K6AA 1YPXA 2XN0A 5FF2A 5J04A 2QF8A 3WD4A 1P5BA 1JD9A 1YTKA 2J74A 4ZO8A 3HPAA 1P43A 1RPKA 1GHSA 4DUXA 1OGGA 1GW1A 4YVPA 1AJ2A 4RZ4A 4GYPC 4NZ1A 3TR2A 4KPLA 4GNJA 4MSSA 1VHCA 1YXCA 3PZGA 3L66A 4PTNA 2VDHA 4WK9A 2X0SA 1IT8A 4LUJA 4H9ZA 4ZSUA 5A6LA 2Y5EA 2R8WA 4M1RA 4UNKA 3LPPA 2OG9A 5CBJA 1RJQA 1R9YA 4N9EA 3URNA 3VINA 3W2NA 4IGHA 3WQ8A 1QWKA 4CNNA 3IVTA 3WUEA 4AY8A 2NUXA 3LTSA 1V08A 2ZUMA 3WD2A 2TSYA 1ALDA 1HFBA 3CHFA 4AU0A 2X0YA 3MU7A 4O15A 1S2UA 5A8MA 4DJEA 4PTMA 3NZPA 4DUWA 4RK8A 3UWUA 1I45A 1VJSA 4C1KA 3OTRA 3TTYA 4P7RA 3T05A 1PZ2A 1NTHA 1TX0A 2ZUSA 3HO8A 1Z9AA 3AIBA 2BXYA 1R38A 1EOMA 1FDJA 2INZA 1X1ZA 2J78A 3W84A 2X42A 4QITA 5XIMA 3UZZA 3LMYA 4XUGA 3HTWA 4YHGA 3UJRA 3WLLA 4Q7NA 2V69A 4G7FA 3P67A 3T44A 1WUEA 1JPDX 4Z2GA 2B7NA 5FL1A 2ZX6A 1G94A 2YLAA 2FGLA 4Q4RA 3GVVA 3ES7A 2OFJA 3MPGA 1ADOA 1TWWA 9CGTA 1G9HA 5JBDA 2WVVA 3B0PA 1SVDA 3BMWA 2Y0FA 3S3GA 3PBUA 3C0LA 4BI7A 2OSWA 1LM1A 3R8HA 4DZIA 2OX4A 3IAPA 1EDTA 3AHXA 4WXYA 2DVXA 4IT1A 4BCEA 1BXBA 3DFTA 2D2JA 5JUVA 3LHWA 3C4UA 1S5VA 3L4VA 2WBGA 1TPDA 3ARWA 5GVJA 1OG6A 3WLMA 5BXRA 1EJUC 5HINA 2F61A 3UXDA 4YVXA 1OX4A 1PYFA 4ZBCA 4FLQA 3G0UA 3D47A 3ZSTA 3OOQA 3VK5A 2XYLA 2J13A 3G0SA 5BWFA 3IJDA 1E1CA 1FWTA 4C65A 3VD7A 4N2YA 3N2MA 4HPGA 5DCEA 2H3BA 4PBGA 1F73A 1AQFA 3G22A 1KM2A 2RKXA 3OP2A 3N4AA 5A8GA 3N04A 4JQ1A 2WJFA 4QQ3A 5DN1A 3T9PA 1QASA 1UZ4A 3RGTA 2POTA 4GI4A 3KAOA 2D0FA 3GC4A 5CSYA 1VCVA 3E5BA 4IMEA 3ZR4A 3B9NA 4ZR8A 4Y9MA 2GOKA 1QK2A 5F2MA 5ECUA 1VPYA 2VR4A 5HQEA 3DI1A 1UWTA 4MLRA 4ORIA 3IK4A 4X9SA 1XCXA 1R3QA 1R30A 1Q6QA 2DZAA 3UA4A 5J8LA 3MSGA 2J7GA 3TW6A 1E71M 3SN0A 4GUHA 3GNOA 2QNEA 3GXPA 2CXGA 3RX4A 1U30A 4XVEA 2Y8KA 4B5XA 1FWWA 4IUOA 4AWSA 2P3EA 1TPH1 1EJSC 5AECA 4HPHA 4HT3A 3GNXA 5D8WA 4FAMA 4H3DA 2EQDA 4AZIA 1IE7C 1W91A 1T7LA 4HHMA 3WUFA 3S1WA 1LLZA 2XG9A 4US6A 2QDHA 2G3NA 5CC5A 1IZJA 4OHQA 1H5VA 4ZOCA 2VGBA 3AFBA 1I2OA 4QE5A 5DX7A 5IOBA 2E68A 5K3VA 1E9YB 4YS1A 5IRPA 2QCEA 3I3EA 3ALGA 1B30A 3UGVA 1JPMA 3RHGA 3VGDA 3C5QA 1KRCC 2YA0A 4W7WA 1PAMA 1F6PA 1W9XA 3WDRA 4MWAB 3TZFA 4YTQA 2WNNA 1NF7A 3AXXA 2EXOA 3GH4A 5AYIA 3K1DA 4LVFA 1EX1A 1YLVA 2VJXA 3OA5A 5CPNA 1YTDA 1TTQA 4MLJA 3W7EA 2PWHA 3LHUA 3TJ4A 3EXRA 4GHRA 3KL5A 3HJZA 3P80A 2EG7A 2F8QA 5IFPA 3LXCA 2VO5A 1TFVA 1FDZA 4I6KA 3THCA 4M7TA 3A64A 4MNJA 4GOAA 4RPQA 5ECVA 3WMSA 4S3JA 1TE1A 4Z1BA 3AOFA 6TAAA 1VBRA 2UY3A 4GBDA 1DEDA 3T0CA 2ACQA 4IGMA 1VHNA 4JEQA 1EA9C 3C3NA 3NXFA 4RNHA 2G0WA 2XGBA 4US5A 4IX0A 4PL2A 3V0TA 1UC5A 4TOQA 5FEWA 4XAYA 4AXKA 4L9XA 2A3HA 4LUSB 2Y7EA 4UTJA 4B5WA 8RUCA 2INFA 1EP2A 1GQLA 3N9SA 4XSLA 5A6KA 1FHLA 3TA6A 4PZVA 1JUKA 1XYMA 4YCOA 4DM2A 1TQJA 3MYOA 4O57A 1YDYA 2Y6ZA 2Q3RA 1GCYA 4WRHA 2FMNA 2CBVA 3LRMA 3EOEA 1FKXA 4XTIA 1RPXA 2OSYA 1HJXA 5FSDC 3CZKA 3ARZA 4B4HA 3G18A 3TLQA 4E2OA 2GFTA 3B97A 4WJEA 5AYBA 3U0HA 1UQZA 5BOOA 4U4MA 5ABTA 5EYWA 1QI4A 1TVPA 4H6QA 4DUVA 1M53A 2D24A 3WIJA 3GXDA 3UXIA 1G01A 2B81A 2VT0A 2XFRA 3D46A 3G1VA 5AFDA 4JYEA 1JDAA 1XLGA 5BXSA 2D2HA 4JTKA 1ITXA 3BE7A 3VCRA 4EP8C 3P93A 4DNMA 1IEVA 3ARTA 2NVAA 5LXEA 2QJJA 3QEZA 1PX3A 3FGCB 3GY1A 4B9ZA 3I3DA 4CCDA 4GABA