3DAQA

Crystal structure of dihydrodipicolinate synthase from methicillin-resistant staphylococcus aureus
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
292
structure length
292
Chain Sequence
THLFEGVGVALTTPFTNNKVNLEALKAHVNFLLENNAQAIIVNGTTAESPTLTTDEKELILKTVIDLVDKRVPVIAGTGTNDTEKSIQASIQAKALGADAIMLITPYYNKTNQRGLVKHFEAIADAVKLPVVLYNVPSRTNMTIEPETVEILSQHPYIVALKDATNDFEYLEEVKKRIDTNSFALYSGNDDNVVEYYQRGGQGVISVIANVIPKEFQALYDAQQSGLDIQDQFKPIGTLLSALSVDINPIPIKALTSYLGFGNYELRLPLVSLEDTDTKVLREAYDTFKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and evolution of a novel dimeric enzyme from a clinically-important bacterial pathogen.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Lyase
molecule keywords Dihydrodipicolinate synthase
total genus 114
structure length 292
sequence length 292
chains with identical sequence B, C, D
ec nomenclature ec 4.3.3.7: 4-hydroxy-tetrahydrodipicolinate synthase.
pdb deposition date 2008-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3daqA00
3TC6A 5HWMA 3NL6A 5A5WA 2VFGA 4DO6A 4UTLA 3CWOX 2QF7A 1MXSA 2NWRA 2Q8ZA 5HJLA 1A5AA 1JCJA 1YLVA 1H7RA 4RX0A 4E0CA 4XQ6A 3TSBA 2V81A 4RLIA 4LUIA 5G5IA 4ZZ9A 1GVRA 1I2NA 3WJYA 3VI2A 2YFNA 2YSWA 2ZA1A 3TA6A 3JRKA 2RFGA 3IRDA 1F74A 3A5FA 3HPZA 4IMFA 3CWNA 3DFOA 1K7XA 3Q37A 3F4WA 4C1LA 1BEUA 1OYAA 1ADOA 1ZALA 3G1VA 3FLUA 2QCDA 1YPFA 1WDWA 1WA3A 2WKJA 3QW3A 3LBCA 3GNDA 4XBSA 3PR2A 3GDKA 1LP6A 1HG3A 1GT8A 1O5XA 3ELFA 5G2WA 4ORMA 4WY0F 4JY9A 3E0IA 5G4EA 3UPWA 4UMBA 4JS3A 2H90A 4NJKA 2HS6A 1SZNA 3GVGA 2RHGA 3FYPA 2Q8LA 3I7RA 4MY9A 2A7NA 5F2IA 3MWAA 1TJPA 4UC5A 3YPIA 3WJXA 3GX9A 1WQ5A 3DFQA 3W6YA 4LNYA 4X2RA 3IVSA 3UWUA 3R13A 1TPB1 3PBYA 5CSRA 5D38A 2V30A 3IEBA 3PULA 4UTWC 4GNJA 1KM3A 2QKFA 1TPDA 4PC8A 1I2RA 3DGRA 1OX4B 3LDVA 2YYTA 3HG2A 3M1ZA 1TREA 2HMCA 2RKXA 3QYQA 5CZTA 2GJLA 2WJZA 2YZRA 2X30A 1TPH1 6TIMA 1J5TA 3K30A 5D2XA 2ISWA 3W76A 3UY8A 5L9FA 7TIMA 4QSHA 5HUPA 3L0NA 1GVQA 3M7WA 2CLHA 1FDYA 4O15A 5EL1A 5DXYA 3B8DA 5LNRA 1Q6QA 1K3UA 1ICQA 5KMYA 4O57A 4JNMA 3BW3A 4M6VA 5TBOA 3O8AA 4LTSA 2GQ8A 4GRSA 1H7XA 3TMQA 1VS1A 3EWWA 2NXGA 4P2VA 3PUOA 1TQJA 4Y6GA 4ZQPA 2VXNA 2P10A 3RLVA 5LGXA 4JX5A 1EA0A 2X16A 1TPWA 2YGYA 3TR2A 1OFDA 2ZRWA 1SFLA 1TMHA 1YDNA 1BWLA 2DZSA 3TSDA 4CQAA 2DU2A 4UTIA 2ATMA 3LTPA 1IXOA 3W2UA 2Y6ZA 2JBMA 2CLLA 4N9EA 3TCEA 1G67A 5D02A 1LCOA 1Z44A 4FNSA 4O12A 4O53A 1F5ZA 3A9IA 3HPXA 3NZ1A 3MHUA 2P1FA 1OG0A 4G1KA 1VPXA 1OFRA 1VJIA 3UY7A 3OIXA 1VC4A 2JKAA 3VCRA 8TIMA 2XN0A 2WOQA 4GUHA 1TO3A 3SGUA 3S1UA 4OU1A 2ZFAA 5CZJA 3NQVA 3W83A 4M19A 2QCEA 2FTPA 3KXQA 3WK1A 3W7OA 1SO6A 4JIQA 4JICA 3L2IA 3VKJA 3T78A 3CQ0A 1HUVA 3NPWA 1TV7A 1A5CA 3WK0A 3IVUA 1AMKA 4AF0B 3PG9A 3W7PA 5G2IA 2E6DA 1A50A 3TAKA 4WY0A 3I7SA 1CX9A 5CKSA 3N14A 3P8IA 4DXVA 4MZYA 3KRUA 3LTYA 1ZY9A 1H1ZA 1QOPA 1NAL1 2ZQ0A 2C14A 1IXPA 5E93A 2DZUA 3TV8A 3TSMA 3WJZA 4QAIA 2TPSA 2OT0A 1G7UA 3C6CA 3I68A 1X1ZA 3W7RA 2FB3A 5F2GA 5BNKA 3ZWTA 1ICSA 1UBSA 4N2YA 4O17A 4ML9A 1JJKA 1XBYA 3N2MA 3EX6A 4LVFA 1GWJA 4RJEA 2F84A 5BMWA 2ABBA 3MJYA 5AYXA 1CW2A 3LCFA 2ZRUA 2E5DA 4MZ8A 3TXZA 3G0SA 4YCOA 5I3IA 4YLWA 4J9JA 4UTHA 1KW1A 2VEMA 3PG8A 1XL9A 1SU5A 1OABA 2E6FA 3N9SA 2ISVA 3HPSA 4HNNA 3EKZA 2E6YA 5KZMA 2C13A 1KM2A 3DXIA 1GVOA 3KVKA 4M7SA 4MPQA 1TPFA 2C3ZA 2WNNA 1H62A 1HFBA 2QUUA 2V2HA 5D2YA 4NT0A 1SPQA 3L21A 4RR4A 2X1UA 4JTJA 5I3GA 3P74A 3W71A 3MI2A 2ISSA 5KZDA 4AWSA 1KFKA 4Z08A 4HSNA 3W07A 3TXVA 2ATSA 5DCEA 2PRHA 3TK7A 2ZCGA 1H50A 1NFBA 1QNVA 2BTMA 4EIVA 1LBMA 1X6UA 3O6CA 2ZRZA 1L2UA 3RK8A 4EOUA 5G2HA 3BVJA 3P60A 3IIPA 4LW7A 1XBVA 2VEKA 4FNUA 4Y96A 5HR6A 2DZWA 4DF2A 1WYIA 2VC6A 3BW4A 4PH6A 1EX5A 2B4GA 2PC4A 4XKYA 3CM4A 2GPTA 3GYEA 4AF0A 4NNCA 3M47A 2J24A 3C52A 1QAPA 3NVTA 1ZAIA 4ZQMA 3GXNA 3T7VA 4MY8A 3TQVA 5AC6A 3FKKA 1P5BA 1QPRA 1QR7A 2QDGA 4U4MA 4JXCA 2ZZ4A 4O13A 2Y85A 4CNOA 1W37A 4IWWA 4BK9A 5FEXA 4WXZA 4X9SA 1DJNA 2O7QA 1MSSA 2CLKA 4LS1A 2FFCA 2OZ0A 2Q3OA 3FFSA 2WV8A 3MP5A 5FEZA 1G6CA 1XUUA 2B7OA 4AHOA 1DVJA 4JIPA 3IIXA 2X1RA 3SI9A 4HN4A 4ZVJA 3C2RA 4QQ3A 3TNOA 3S9YA 1TQXA 4RXFA 1C8VA 1Z42A 3EWZA 1KFCA 4OT7A 2EKCA 4UTMA 2EF9A 4POCA 1I8JA 3G1AA 1JVNA 5L6UA 2HSAA 3M43A 3SW6A 4IPIA 3LV5A 4LV9A 3MW7A 2F7FA 2RDTA 1X7FA 1A5BA 1VQTA 3TKFA 4UIOA 2Y89A 1AL7A 1C29A 3CIWA 1AW5A 5HULA 4JEQA 5EMUA 5AYZA 3M5ZA 1I4NA 3WJSA 2Y70A 5D30A 3NG3A 4WOZA 3OVPA 2NWSA 1K7EA 4WXYA 1F6PA 1BTMA 4WQ6A 1DBTA 2CFFA 1LTDA 2PRLA 2ZRXA 3MHFA 4O18A 3W86A 4EF8A 4MJZA 5H91A 1FY6A 2VFDA 4ALDA 2NX1A 1VYPX 3R12A 2BWGA 3W1TA 1J4EA 3MHGA 3C56A 4H4IA 4IXHA 4JY8A 4RZ6A 4OQVA 3TJXA 2TRSA 3GB6A 4JYFA 4H3DA 5K2ZA 1EWEA 2OJPA 3ANYA 3ATZA 3NM1A 1OX6A 4HSOA 4O54A 1WBHA 2YR1A 3P62A 1DKWA 4L4MA 3W7QA 3GZ3A 3UZJA 3N34A 3NXFA 1FWRA 4UR8A 1GJPA 3TU9A 1LLWA 2V9DA 3M16A 3T44A 3EX3A 4MZ1A 1DJQA 1S5VA 3DKJA 1GTHA 1RPXA 3VFLA 2NUWA 5F4WA 3OVQA 1ME8A 4K6AA 4LT9A 3LLFA 4AWTA 2RH9A 3W1PA 3DZ1A 1H60A 3O1NA 2J27A 4JX6A 1OFOA 3EWUA 3F1QA 3HB9A 1TTJA 1B9BA 1FUYA 1O94A 1FDZA 4S2BA 3MBDA 3W7IA 4EF9A 3ZWSA 4E2DA 1VR6A 2R14A 1AG1O 3GAYA 3LHZA 3NO5A 3MUXA 3NL2A 3G18A 2V5BA 2BXVA 4O1AA 3B0UX 2Z1BA 2GUUA 4Y8FA 6ALDA 1GYLA 4GXMA 4MLRA 3FA5A 1K7FA 2O7SA 1FWTA 2VELA 3S1VA 3M5VA 2J9XA 1Q45A 2DORA 1YTDA 4TX9A 4FB7A 5U4NA 3Q94A 4E38A 1B4KA 1GZGA 5D09A 4O4VA 3B4UA 1W5MA 4LRSA 2Y7EA 4LS2A 2NV1A 4JTGA 3W2KA 1JCXA 4S2CA 1P1XA 4HHPA 2EHHA 3DFTA 5AHMA 3W85A 3B04A 4JR5A 1ZCOA 2R8WA 1OK6A 4PODA 4L4LA 2GOUA 2JKEA 4FHAA 1R2RA 4FNTA 4CCDA 3QRHA 3O06A 3EXTA 3O6DA 3EWXA 4HKPA 4OE7A 1OF6A 1IIHA 4PCFA 1JCNA 4MOZA 3WFAA 2OCZA 3T55A 1F6KA 3B03A 2ZZ5A 1EWDA 1ZENA 5SWUA 4FX7A 4HPJA 2QAPA 4UXDA 2LLEA 1OHLA 1PL9A 5MHBA 3P82A 4I7UA 4QNEA 1WBJA 1KLZA 4YMZA 4PL2A 2A6LA 4OGZA 4UTUA 3L5AA 1TTIA 3NQAA 4Y90A 3QZEA 1KV5A 3S5ZA 1GEQA 3CHVA 4NZJA 4ICNA 4LUJA 1N55A 3V1PA 3AO0A 4MFDA 3C2FA 4IX0A 3GKFA 4IMCA 4NQ1A 2PURA 3LGEA 2G5WA 1RR2A 4QM1A 1FCVA 1H7PA 3UPBA 1VZWA 5F4XA 3P81A 4CNPA 1W3TA 4JTTA 3RLUA 4GWEA 3HG5A 4O0ZA 1UUMA 5HR7A 2QUTA 4M6PA 5F2MA 3LCGA 3H53A 5AYYA 2ZYFA 4NX0A 2CZDA 1BKSA 2H3BA 2BX7A 2KZHA 1VYSX 3IGUA 4O0KA 3G22A 5I3HA 3PY2A 4O1CA 4K8EA 3I6RA 3HG3A 4M5PA 2TSYA 2V5LA 3EXSA 1G7VA 1GYNA 3HGOA 1YDVA 3W2NA 4GUFA 1H51A 4RKAA 4IGHA 4GFSA 3KRSA 4K38A 4R7JA 3HF3A 5K4ZA 2CW6A 1W8SA 4LY8A 2C15A 4JYEA 3W1RA 3FJ6A 1SR9A 1F76A 3KVJA 4UFKA 3B06A 1TV5A 2YW3A 5D2TA 1AW1A 2I9EA 4RXGA 4AB4A 1XI3A 2Y88A 3GDMA 2J88A 1DQXA 2V2CA 3NQMA 3BG3A 5KINA 3ZS4A 2QCCA 3TJLA 2CLIA 3BLEA 3QC3A 1AL8A 3LHUA 2X2GA 1FXPA 1H7NA 2ZTJA 4YWIA 4LVDA 1SFJA 1LDCA 2V2DA 2VFEA 3QFEA 1XBXA 3G0UA 4ZQNA 3ABRA 2PRMA 1F05A 1THFD 1W5OA 2JKPA 4K8HA 1T0OA 3QPZA 2H8ZA 1YADA 1KFLA 3RMJA 4A21A 2BZNA 1MEHA 4QJ1A 4O11A 3LHVA 2DZVA 2Y7DA 3H54A 3KX6A 3U6WA 3PC0A 3W1AA 1QOQA 3STGA 2UV8G 4RZ4A 1I2QA 1R2SA 2VFIA 4LS0A 1M7OA 3W7LA 2GVJA 4XWUA 2XN2A 3DFSA 1TV8A 3NL5A 3C2VA 3LX9A 2FPTA 1R2TA 5DY2A 1VLWA 4HPXA 3ATYA 3HQ1A 3WJWA 5D05A 2HTMA 2C16A 5AB3A 1ZHAA 2CZ5A 4BI7A 4UTTA 1UJPA 5D32A 2QDHA 3KAOA 1Q3NA 4UUIA 2YW4A 3PSVA 3C2OA 3GK0A 5F4SA 3GR8A 5CPNA 3NR0A 3NQ6A 3TROA 3NPVA 4IMEA 4QNWA 1SZFA 2VEIA 3G3MA 5A8GA 2VENA 2ZZ7A 1HO1A 5IBXC 1H61A 2GQ9A 2A7RA 1MEIA 3E96A 1KM1A 4MFEA 5FF4A 1KFJA 3DU0A 2QR6A 1RV8A 2QCHA 3S5NA 3LHYA 4AWUA 5CG7A 3LB0A 1OF8A 4N6FA 5LZLA 2AQWA 1SO3A 3PBWA 4UMAA 4WJEA 3UZ5A 1LRQA 3I65A 3FYOA 5G1YA 4LVGA 3A23A 3W7JA 3SECA 4JTUA 3C3NA 3GDTA 3HGSA 1NVMA 1EB3A 2AGKA 4IUOA 2RDUA 5BRBA 5K9CA 2OT1A 4JTFA 3W23A 1LOSA 3O63A 2GQAA 1LRNA 3NZRA 1VHCA 2Q3RA 1PCKA 1IIGA 1TTQA 1GVFA 3BLFA 1KM5A 1FBAA 4GC4A 4K39A 3DFNA 3UNDA 1R46A 4BFAA 3W1XA 4JTLA 4IOTA 3UWYA 3LHWA 3GNNA 3W9ZA 1FCUA 2QJIA 2V0TA 4A2RA 4N02A 3T4CA 3PF3A 1A53A 3IIZA 1GVSA 3GR7A 3TH6A 3HOJA 3OEXA 1XDMA 5I3FA 3UQNA 1PS9A 3LV6A 3EX4A 1H63A 5FF3A 3THAA 3NQCA 2QJGA 4MUZA 5CPMA 1EP1A 1KFBA 3NA8A 3USBA 5EBUA 2YYUA 2W6RA 1LZOA 4UFHA 2WSQA 4Z0JA 4A3UA 4DBEA 3N9RA 1B57A 3M9YA 4ZQCA 4U28A 2Z6JA 4S1FA 4O28A 1XFBA 1UUOA 3QM3A 4AXKA 1W54A 3FKRA 2JGYA 3CT7A 1Q6LA 2VEPA 1B3OA 2FQIA 3NM3A 3KHJA 3IVTA 3MBFA 2ABAA 3BK0A 1OFEA 3BGJA 5DBTA 5CPOA 4X3ZA 1FX6A 2NUXA 2Z2UA 2VOMA 2JGQA 3QMSA 1OYCA 2AAMA 3VE9A 1OX4A 2G96A 1SW3A 4M6QA 4ZQRA 1NEYA 5LHEA 1L9WA 3SSJA 1LBFA 2ZA2A 1KLYA 1OX5A 1I2PA 3M44A 3V75A 4MKNA 2V82A 3E12A 3W87A 2ZRYA 4KWWA 4NUWA 3M41A 1RQBA 1UCWA 3OA3A 3ABOA 4N6EA 3EWBX 1ME7A 2E5CA 2VFFA 3OBKA 4O1DA 1YYAA 1LROA 4PEKA 2WSYA 5H2ZA 5FESA 3B05A 4O8RA 5T26A 3KVMA 5J5RA 3NNTA 4W9TA 4UFIA 3P80A 4XBKA 4KKXA 5U7SA 3QSRA 4DQWA 1QO5A 3NGJA 1VYRA 5CZ0A 4NXKA 4MYXA 2NUYA 4DEFA 2YXGA 3BLIA 4JTIA 4RV8A 2QCNA 1U83A 4DBDA 1KTNA 3IV3A 3L66A 4O16A 1RVGA 4GE8A 2C0AA 4ONVA 2X1SA 2W0UA 5HQEA 4NVTA 4CCEA 2A4AA 5BW6A 1KFEA 3A21A 4K36A 3CPRA 3QPYA 4MVAA 3W1MA 2XFWA 3S0CA 1MEWA 1CI1A 4A2SA 3L0KA 2B7QA 2GVLA 3LXCA 4UTKA 3LI1A 1KBIA 3R89A 1HTIA 5D33A 1UASA 4EVZA 3FJLA 1K8ZA 3TUUA 3BGGA 2Y63A 3LBMA 4NJIA 4LU0A 3TAOA 3BARA 3G1FA 3W7GA 3S8HA 3QEZA 3JR2A 1EUAA 1SZGA 3GDLA 2Y7GA 3NQDA 1YTKA 1O95A 1ML1A 5D37A 1ALDA 2JK2A 3SJ3A 3FEMA 3ZR4A 2Z6IA 3PVFA 4HT3A 2QCDB 5DELA 3NDOA 1JQXA 2G97A 3DBPA 2ALDA 2VFHA 3WK3A 1H7OA 4FO4A 1EUNA 5AHEA 3UXAA 3QH2A 1EP2A 5FF0A 2FPVA 5LGZA 3I7QA 4TR9A 3RF9A 3HGJA 4FIRA 1GTEA 4Z0SA 1Q6RA 1OK4A 3OG3A 1OYBA 1WXJA 2B7NA 1Q6OA 4R53A 2E5BA 1M6JA 2YFOA 4JTSA 4DPQA 3W72A 1E51A 4M7TA 3NQ7A 4NJHA 4PFMA 2ZBTA 1O5KA 4UNLA 4WY0B 5HWJA 1QPNA 4TU1A 3A22A 1ZFJA 3F03K 1ZNNA 4DPPA 5I3JA 2X1TA 3W84A 3LHTA 3GXTA 1GQNA 1LM1A 1XDLA 4OWGA 3NQEA 3O07A 1LOLA 3DH7A 2FLIA 5LHFA 4A29A 1G4EA 5C6MA 4HNVA 4FXRA 5HNRA 1TPEA 1W1ZA 3DKLA 2NLIA 1JCYA 2ZZ2A 3W7KA 2A7PA 2YPIA 3P7YA 4N9BA 1OVDA 4IMGA 2ZA3A 5CPLA 3QW4B 3BG5A 3KRZA 3W1QA 4GBUA 2CLFA 2EPHA 3DI1A 4UR7A 2DZTA 3DHDA 1W5QA 2A21A 3BW2A 4KFOA 4LVAA 3PB0A 1OFQA 1LBLA 1SW0A 5C55A 3MP4A 4FNRA 1YXDA 3C2EA 1PE1A 5F2LA 4XTDA 5HWNA 3TFCA 4WUIA 1M5WA 3M5XA 5LNUA 2WQPA 1I45A 2H6RA 3O05A 4YL2A 1FCBA 3TX9A 4EWND 3IGXA 4MJMA 2Y7FA 5TIMA 3HBLA 3A24A 5AHIA 1TTPA 4LV4A 2ZZ1A 4LOCA 4MYAA 4IXXA 1LOQA 3LXBA 1O60A 2RDWA 3KFTA 4I9AA 3TIMA 1Z41A 1FDJA 2QAFA 4UNKA 3UWZA 2FIQA 4IMDA 3G1DA 1OFPA 1DORA 1L6SA 1P4CA 3W2MA 4UCGA 4TMCA 1OJXA 3W74A 1TCDA 1JQVA 3STFA 4UTWA 4JYDA 3SIZA 1XC4A 3DENA 3FIGA 2QUVA 3EX1A 1D9EA 4CCCA 5AFDA 2WNZA 4QIUA 1KTBA 2CU0A 3PUEA 4K37A 4B5NA 1GG1A 2C6QA 1KM0A 3INPA 3L9CA 3BG9A 3HO8A 3G24A 1XXXA 1N8FA 5EY5A 4OHQA 3WK2A 1TJRA 1TSIA 4UMCA 5LKYA 3G1YA 3QF0A 2BSLA 3L5MA 1W0MA 1JRBA 2PE4A 3PB2A 4JD4A 5F1VA 2GJNA 4GUJA 4R33A 2P0OA 3UYCA 4RZ5A 5K7JA 4ZMGA 2DP3A 5IM51 4IPJA 3KOFA 1TRDA 5D03A 4ORIA 4JN6A 2NX3A 4TMBA 4KFPA 1R47A 1V5XA 3LCXA 4XTIA 2W79A 3L0GA 1I2OA 3NQ8A 3TMLA 4HNUA 4P61A 2FPYA 1QO2A 4QISA 2QCFA 2EGZA 4N9CA 2E77A 4JTEA 2J9ZA 3CEUA 3ABSA 1PHQA 3Q2DA 4LC6A 3NOEA 3MP3A 4FEZA 4NX5A 4KFNA 4MLJA 3QQ0A 3B0PA 1P0KA 1T8XA 4KWVA 5AN7A 2QJHA 3SFKA 3CEPA 1S5WA 1K8YA 1IXNA 3GDRA 5TQLA 3UXDA 5DY3A 1PIIA 4O50A 2I14A 1RQEA 3JS3A 3LI0A 4CQ8A 2DZPA 3TFXA 1IGSA 4RK8A 1JRCA 4FNPA 3W7HA 4Y9AA 1DV7A 3MYPA 1ICPA 4MY1A 3HIJA 4R34A 3LCIA 3QJAA 1OFBA 1SUXA 4O1BA 3TQKA 3MMTA 3PWAA 3C8FA 1JCLA 3DHFA 2DJLA 3LTSA 1LORA 3O15A 5ABTA 1VLIA 2NXIA 5EYWA 1JCMP 3MO7A 3W7MA 2QEZA 4DF1A 3S6DA 5DBUA 4JTHA 1HO4A 2A6NA 4FF7A 5E0KA 5E1QA 2BLEA 1TPC1 3CLMA 3L5LA 5IBXA 3STCA 2H3DA 3W88A 3U2OA 3NQ2A 1TPVA 1H7WA 3C0JA 3L65A 3N19B 3LCHA 4Z1AA 3PBVA 1O4UA 2E6AA 3O16A 3G1XA 3G3DA 5LNWA 1VH7A 1WOAA 2ZTKA 3NAVA 5KTLA 3G8RA 4O4WA 4BI6A 4NU7A 4NJJA 3NL3A 3TDFA 4UTJA 3THQA 1JUKA 3HG4A 3L67A 3S1XA 3F4NA 4CQ9A 1FWNA 4XZ9A 4YXGA 1R30A 2DZXA 4O52A 2YX0A 4AH7A 2OMAA 1H5YA 3OHIA 2WNQA 1WX0A 3C4UA 3TE9A 2E1DA 1L6WA 5KITA 2C19A 4CNNA 2QCLA 1EP3A 2J9YA 3QSTA 4A22A 1YDOA 3CU2A 2Y62A 3LLDA 4HIBA 2CZEA 4AHQA 1UB3A 1QWGA 4AAJA 2QCGA 1RZMA 2NZLA 3EWYA 3W7DA 3LRKA 5CZSA 5D2WA 3R8RA 1X1OA 5KSWA 3M5YA 3W73A 5BOOA 1W5PA 4I7WA 3DFPA 4NJGA 4Z1CA 4AVFA 1PCWA 2Z0IA 4PA8A 4Q32A 2PCQA 5F1UA 4N4QA 3E49A 3EEGA 1XCFA 1SSDA 3QMTA 1RD5A 1EIXA 3P61A 1IF2A 4CLMA 3VE7A 2TYSA 3IIVA 1DL3A 2A5HA 2A2IA 4O19A 5DN1A 2H8XA 4FNQA 4ADSA 4UTTC 3N3MA 1DHPA 1JULA 3N73A 4H6KA 3R2GA 4E2BA 3FOKA 3PUDA 3HJZA 1F2JA 1S5TA 4PL1A 4ZQOA 2FJKA 3GXPA 2C18A 5EA9A 4FXSA 2ZDRA 3RFAA 1Y0EA 3SY5A 1FXQA 3C61A 5CGQA 3DI0A 3STEA 1TYGA 1PV8A 1U5JA 4O14A 1RQHA 4DELA 1WOBA 1ZAHA 4Q4KA 4JTKA 1ZJIA 4NNBA 2FDSA 1D3HA 1B4EA 3ZFHA 4GUIA 5HMSA 5HINA 3CIXA 1XUZA 3TW6A 2ZZ3A 4UFLA 2QCMA 3GKAA 3HGRA 4I7VA 3G8EA 2ZRVA 3MYOA 1KM6A 5K9DA 4N4PA 1D3GA 1K8XA 1OFAA 4JDYA 4Q33A 1DOSA 3B0VC 2Y61A 5AHFA 2NV2A 4ZL1A 1TRIA 3P5YA 2ZZ6A 3MI6A 3R5EA 5I3KA 5G1TA 3W7NA 3EKLA 1SSGA 3BO9A 1A5SA 1KM4A 3AJXA 3W7EA 1G4TA 3S1WA 4ADTA 4DO5A 5AC8A 5J5DA 1PVNA 2B0MA 3W7CA 3W2JA 1FWSA 5K3VA 1M7PA 2V8ZA 1VCVA 2R91A 1J2WA 2HS8A 5FEPA 3D0CA 5EPDA 3P84A 3M6YA 3TQ0A 4PTNA 1MZHA 3E9AA 1TPUA 3HMJG 4N9DA 1JUBA 3T40A 2CLMA 1BWKA 4OBTA 4RCXA 3NEVA 5EKYA 1YXCA 1IXQA 3NQFA 3IGSA 5FF7A 4X22A 1MO0A 3FS2A 3QMRA 2WO5A 1V7YA 4LC8A 5DXXA 1W5NA 1GOXA 5C5YA 1SW7A 4IJBA 1F7BA 2IQTA 4NXSA 5FF2A 3KVLA 1VCFA 5AC7A 2DJXA 3EXRA 1JR1A 3PAJA 2A0NA 2B7PA 3NQGA 1H1YA 3PSWA 4WOQA 5DCDA 1NF7A 3P5ZA 3Q58A 4BWLC 1TIMA 3NPXA 1GG0A 3BPWA 1ZAJA 1NF0A 3P67A 3GAKA 4LWWA 1W31A 3M0ZA 3LXAA 1JUEA 2E68A 3IIOA 1FQ0A 1XBZA 5C2XA 1YTEA 5G4WA 4D2JA 3W1NA 3S5OA 4HNTA 1WV2A 1QDSA 1VGAA 2A1YA 4FIQA 4IX2A 4WX2A 3LERA 4NNAA 1FWWA 3VNDA 4C1KA 4OV4A 4OV9A 5BMXA 3S42A 1AK5A 1T96A 1QCWA 3SGZA 1Z48A 4XKYB 1SQ7A 5LNVA 1KBJA 3A5VA 5LSMA 3OVRA 1KA9F 5HUOA 3PS7A 3U8GA 4BI5A 4WZHA 3PM6A 2YCEA 1XKYA 1AW2A 3W75A 4GJ1A 4BWLA 3UD6A 1W56A 4NZFA 2WPBA 1LYXA 3EX2A 1GPWA 4Z1BA 3P8JA 1VHNA 3DAQA 3EB2A 3GIYA 4ADUA 3G1SA 2A85A 3MI3A 1PHWA 5GVJA 3W1LA 2EAWA 1G4PA 5D04C 4UFMA 5DLCA 5AOUA 3SR7A 4AMAA 1YXYA 3CC1A 2VKZG 1K02A 2E09A 1G69A 1N7KA 1X8FA 3O6YX 4GUGA 3LRLA 5DCBA 3LOTA 4LVBA 5LNSA 3LRMA 3SZ8A 3NYZA 1XM3A 1ME9A 2GVGA 3E02A 4IQLA 4UFJA 1QPQA 2NX9A 2CWNA 4O10A 4TIMA 1SZEA 3L68A 1EEPA 2NXHA 5C54A 4BR1A 3W22A 3G1HA 1KTCA 3LCLA 1WAUA 2WSRA 5AHNA 1VCGA 2YDAA 3S5YA 4AEOA 4MIMA 2CLOA 1HL2A 2G95A 4Z1DA 5FEWA 5CSSA 3LCWA 3UWVA 4WD0A 4JX4A 5FI8A 1ONRA 3ABQA 4AHPA 3RNDA 4QITA 2I1OA 3UWWA 1SO4A 1L6YA 5D2VA 4FX8A 2C1HA 2R94A 1G4SA 3CB8A 2XN1A 1K03A 1F73A 2J6XA 2OX1A 3BV4A 1NSJA 1W3NA 3NPUA 1TB3A 3N2XA 3TW7A 3H55A 4XUGA 3CTLA 1C9DA 1T99A 2TMDA 1W3IA 4JGDA 3RU6A 1SO5A 2FB2A 1DQWA 3PBUA 1QFEA 1P0NA 2D73A 1LLZA 4TO8A 3TC7A 4BF9A 1S3HA 4K7VA 4DF0A 2CLEA 4DO4A 4LRTA 5KZEA 1YPIA 4K7YA 1QPOA 4JDBA 3UWQA 3QQ1A 3W2LA 5AHLA 1LRTA 5K4XA 1VRDA 2CZFA 1KV8A 1QMLA 3G0XA 5K9XA 3W70A 4FX6M 3W1UA 3GLCA 1EPXA 3LM7A 1FCQA 3W3OA 4YCPA
chains in the Genus database with same CATH superfamily
3QR1A 3HM7A 4UTFA 1J96A 3VABA 4E5TA 3VD3A 2QF7A 3UPMA 3TN4A 1JCJA 1YLVA 1XCXA 5M3WA 4EAMA 4Q8MA 1TZ9A 3WLIA 3KWSA 3UCCA 4LSBA 1GVRA 1E4IA 2VZSA 1XX1A 3NCOA 3R10A 2YFNA 2PMQA 3CAVA 3CPUA 1F74A 4WSHA 3V1HA 3OZPA 2BOEX 2X0HA 4PUMA 3DFOA 4G7EB 3U7VA 4ZR8A 1TWZA 5LIXX 4AY8A 2R1PA 1OYAA 3FLUA 1YPFA 3QW3A 3LBCA 2YCLA 3GNDA 4XBSA 4H2CA 3GDKA 1Y5WA 1HG3A 5JQ9A 1UHVA 1O5XA 3R1ZA 1L8NA 2BGQA 3ELFA 3VC6A 1A5UA 3SO7A 4WY0F 1K77A 4G56A 3VMPA 1B1YA 3V5OA 1Q2SA 2RHGA 2DQWA 3VIHA 1UWSA 4MY9A 5F2IA 1XICA 4Z17A 3GO2A 2HNEA 4Q6JA 3W6YA 4ERGA 4LNYA 1KGXA 3FDGA 3UWUA 3R13A 1W6TA 1F4HA 1TPB1 3T0TA 4R27A 3CIVA 5CSRA 5C2CA 1K9DA 1KM3A 1D7KA 1TCMA 2QKFA 1TPDA 4HA1A 4Q8UA 1QBAA 3DGRA 4G7FA 3LDVA 4LAUA 1KCLA 1TREA 4C5ZA 2GJLA 2YZRA 4IFRA 5D2XA 2BOFX 5M17A 2GVYA 1GVQA 2ZUTA 3NOYA 4IG2A 4A05A 3GNXA 4KRUA 3B8DA 5DXYA 4C6FA 2ZICA 5TAOA 5LNRA 1K3UA 4IFKB 1Q65A 1OGSA 2CBIA 2WCSA 4JNMA 3U48A 2PB1A 4GRSA 1Q2RA 1IR2A 4GY0A 4AX6A 2NXGA 1TQJA 4Y6GA 4ZQPA 1YNPA 3N3TA 2GGJA 1UG6A 1EA0A 2X16A 4KIEA 5I2UA 2BFGA 3TR2A 3QN3A 2ZRWA 1SFLA 3SJNA 1BWLA 2DZSA 4CQAA 2DU2A 4Z2LA 1YPXA 3EOUA 1ZBKA 2O0TA 4N9EA 3GG1A 1G67A 5D02A 3RPTA 4O53A 2EPNA 3UESA 5AYIA 2YCKX 2Z00A 2BVWA 2V3DA 2Z1SA 5BRQA 1R9ZA 3TC3A 4YVPA 3H8AA 2O9PA 8TIMA 1VC4A 3CUZA 5E0FA 3VCRA 2DZBA 2XN0A 1TO3A 4OU1A 4M19A 2QCEA 3AMGA 2E8YA 3U3HA 3W7OA 5BCAA 4YS1A 6REQB 4JIQA 3H2EA 2GDUA 2ACUA 4PMZA 1A5CA 3H21A 3RUBL 1AMKA 1FWDC 1Q8AA 3FV9A 3CMFA 4XKMA 4XZMX 2QPSA 4WDXA 1CX9A 3WLOA 3N14A 3LTYA 4JQ1A 1H1ZA 1NAL1 1ZP4A 5E93A 2DZUA 4Q8WA 5CSUA 4BKNA 4US5A 4IFKA 4G7EA 4QAIA 2OT0A 1G7UA 1QNQA 3C6CA 3W7RA 5F2GA 1K6AA 4JPGA 1XBYA 3K13A 3N2MA 2F84A 3OGRA 2YLAA 3MJYA 3N12A 1CW2A 2ZRUA 4MZ8A 3TXZA 1CNVA 3UVAA 1KW1A 1XL9A 4L80A 3OYZA 1JF6A 3O3RA 1C90A 4L64A 2C13A 3HZ3A 1GVOA 4GZ7A 4M7SA 1HGYA 3GW3A 4XZIA 4DB7A 4RR4A 1GKQA 4DNMA 1MI3A 2HVMA 1KFKA 2A3BA 1CWYA 1UBPC 2Y0FA 3KBWA 3TK7A 2ZC1A 1R3QA 2XFRA 1H50A 3GU2A 3LY0A 1QNVA 5A6SA 4Q3MA 1B31A 5J04A 1I0DA 1L2UA 1Z7AA 3U2EA 1V79A 1P6CA 3A4XA 3BVJA 3K1GA 1XBVA 4DLMA 3FGCA 3MZNA 4NG3A 1PYMA 1KBLA 2DZWA 3M07A 4DF2A 3AU2A 1JYWA 1WYIA 1XV8A 4M29A 2ZOXA 3G6MA 3WQ4A 2B4GA 4LBUA 4XKYA 2WSPA 3MVIA 3M47A 3IJQA 1DWJM 3F5LA 4ZQMA 4MY8A 3H2OA 4U4MA 1UD5A 1R9XA 1AVAA 1FWFC 1W37A 4IWWA 4BK9A 3FCPA 4WXZA 3AUJA 5GQBA 2INZA 1DJNA 4JQAA 4UOJA 3APYA 2CLKA 4LS1A 1JD9A 2FTYA 2WHMA 5FEZA 4PSPA 4R7WA 2YBVA 5DANA 1VAHA 4ZVJA 1QW7A 3UXIA 1OGGA 5CXPA 4P7LA 1OINA 3D6NA 2EKCA 4XAGA 3G1AA 3BICA 1NDZA 3SW6A 1RK6A 4E2OA 3LV5A 3MW7A 1QK0A 3GSMA 2EPLX 4KETA 3OIHA 2RDTA 2CCRA 1X7FA 1A5BA 4UIOA 3CMGA 4AIOA 5HULA 1H41A 2DZAA 3ITGA 2FDMA 3UZYA 1EQCA 1IZKA 1W1PA 1WKYA 4WOZA 3W37A 1JGIA 1GW1A 2V5CA 1K7EA 4WXYA 3ZLFA 4YYFA 1DBTA 4LF1A 4AW7A 3MHFA 3W86A 4MJZA 1FY6A 2VFDA 3CH0A 4ZTXA 5MKGB 3W1TA 1XSKA 4IXHA 4JY8A 2X05A 4Q8TA 3GB6A 3ATZA 1OX6A 4O54A 4J1OA 2GVEA 2GYIA 3MANA 2PDPA 1DKWA 3W7QA 4DZAA 3BJFA 4LX4A 1LG2A 3W38A 3N34A 2IQ0A 3VK5A 1CZ1A 5FOOA 4PMRA 1LLWA 1XQKA 3GHUA 1S5VA 3BMVA 3VFLA 4A3HA 5F4WA 2V3FA 1ME8A 3ARXA 3DYMA 3W1PA 3QC0A 3P14A 3EWUA 1V6XA 2OQLA 3MWCA 4S2BA 2E8ZA 3MBDA 3W7IA 4JKMA 2CBJA 3CWHA 4EF9A 3ZWSA 1VR6A 4UR9A 4I8YA 3LHZA 2HK1A 2V38A 4WVXA 4EXBA 3B9EA 4O1AA 3B0UX 1VD6A 4EPEC 1BGAA 1CLXA 1GYLA 3B0YA 1BQGA 1K7FA 3DEQA 3HJEA 4DN1A 1QI3A 1UC5A 2DORA 3A3HA 4TX9A 1OCJA 1LUCB 4KT2A 3PWGA 4H8UA 4FB7A 2HXTA 1GZGA 1W5MA 1XP3A 4W7WA 3N9KA 4CUCA 3QGKC 4LS2A 3W2KA 1TV2A 2QMJA 5AHMA 2YLLA 4PODA 2I5GA 2JKEA 3GNRA 4CCDA 1AZ1A 3UXLA 3AU6A 1EFZA 3EXTA 3O6DA 4HZ7A 2G3NA 4ZE5A 4ECLA 4P7OA 3VGHA 1E9LA 4MOZA 1F3WA 3W81A 3AIWA 2ZZ5A 1BRLB 1CBGA 3IJ7A 2CPUA 1ELSA 3KUMA 3EB4A 2YBTA 1NP0A 2WK2A 5MHBA 4GVFA 4I7UA 4GHRA 2CXGA 4HCDA 1J79A 4PL2A 3ZSSA 4Y90A 3EMCA 1KV5A 3QZEA 4FALA 3T4WA 5T91A 3NUKA 1S5MA 3AO0A 4MFDA 1KCZA 3B3DA 4D72A 5JBDA 4IMCA 4NQ1A 2G5WA 4IP5A 1YBQB 2IQDA 2OOFA 4QM1A 1FCVA 3UPBA 3TOYA 1TMLA 3GD6A 3M64A 3LGGA 1NWSA 5IOBA 3GBEA 2NQLA 1PB0A 4M80A 1TV3A 3IGUA 3I3DA 3UZXA 5CG0A 1OCQA 1IGWA 4L9XA 2ODOA 2V5LA 1CXKA 3HGOA 1XD1A 3KRSA 4R7JA 2SFPA 4JQ3A 1DPMA 5K4ZA 4L9YA 1ZPTA 3FJ6A 3TLQA 5IDZA 1ZTVA 3ZVHB 2IPGA 5CLTA 2I9EA 3XIMA 4L4OA 1XI3A 2Y88A 3GDMA 3AS3A 2V2CA 3PFRA 1PPIA 5GNZA 3TJLA 2W91A 1TE6A 1EC8A 2CLIA 3EA1A 1KD0A 3QXBA 4QP0A 4HVXA 1FXPA 1WXYA 1JNDA 1H7NA 4YWIA 1TA3B 1ZP3A 2VFEA 3EDEA 2I7GA 4ZQNA 3ABRA 2PRMA 1THFD 4NYUA 1EC7A 2VZUA 3TYBA 1MUCA 2BZNA 4QJ1A 1DEDA 4HK7A 3LHVA 3H54A 4LH8A 3FHQA 1M68A 2CNCA 3W1AA 3STGA 2UV8G 5FCZA 2V3GA 4RDYA 2DVUA 2ZX9A 4W8BA 5ABHA 3MTWA 1R2SA 3K4DA 1M7OA 1YW1A 4HCLA 4XWUA 5A6BD 3K1DA 3ZIZA 4HPXA 4S38A 5LA2A 1EXBA 4NASA 3GDBA 1D2KA 3RR1A 2CZ5A 3DOPA 3ONCA 3KAOA 3GK0A 2QGHA 4C6MA 1R7OA 5CPNA 3NR0A 3NQ6A 4N0RA 3NPVA 4M0XA 4PR4A 1J0IA 3STPA 4QNWA 1RXOB 4MJ4A 4LY4A 1SZFA 2WZHA 3G3MA 5AVHA 5A8GA 2VENA 4GQ0A 1YX1A 1XIBA 2A7RA 2CHOA 1MEIA 2Y5EA 1IZCA 3E96A 4GXWA 3AHZA 5LIYX 3VMNA 2OPJA 2WB5A 3VUPA 3VGGA 3KLKA 3M7SA 1J12A 1VBUA 4QE1A 4RUBA 3LB0A 4H6EA 1OF8A 4N6FA 5LZLA 3KP0A 2AQWA 3PBWA 4WJEA 2WCAA 1LRQA 4HOXA 3I65A 1XYCA 2PDYA 2YB1A 2BG5A 3WFLA 1NVMA 2AGKA 1X39A 2WAGA 4MB5A 5BRBA 3W23A 3F4CA 4C91A 1LOSA 2V67A 3O63A 1LRNA 4XD6A 2X1IA 4UQCA 4H9XA 2INEA 1IIGA 1XPGA 1TTQA 4LEFA 1BF6A 1KM5A 3OLGA 1JDCA 2WSKA 3N6HA 4UQDA 4XZBA 1J18A 1F07A 4L61A 3WL1A 4JTLA 2NVDA 4IF2A 3QGVA 1FWIC 3AIEA 3L4YA 1OCBA 3RITA 4LPCA 4NI3A 1V3JA 3NFUA 1HX0A 2OSXA 3IIZA 3GR7A 1BXBA 4KBXA 1XDMA 3ONBA 3UQNA 2VX7A 3LV6A 4ZO6A 5FF3A 4MUZA 5I09A 1WUFA 2Z7GA 3NA8A 5EBUA 3E6EA 3KOWA 2YYUA 1EOKA 1FP8A 2QXWA 4B92A 2WSQA 1YQ2A 4QGCA 3H12A 1B57A 1K9TA 1OGBA 4ZQCA 4O28A 4AXKA 4GZJA 3KBNA 1DE5A 3CUXA 1Q6LA 4XSMA 3RCNA 1EL3A 3MBFA 3BK0A 5DF0A 4W85A 5PTDA 4MAZA 3WELA 5DBTA 3KBMA 3SUUA 4M51A 1FX6A 2VOMA 1TWWA 4R85A 3BZJA 4M6QA 1U2YA 1NEYA 3SSJA 1ITXA 3EPOA 3WL0A 4L65A 3IARA 1B3ZA 4ZA0A 1JYXA 3M44A 4MKNA 2CWXA 1J10A 3SCOA 4JCLA 2ZRYA 3T9PA 3UJSA 2WBGA 1ME7A 3V5FA 1IWPA 2XVPA 4PEKA 4YTQA 4JNYA 1J0KA 1OC5A 1ZJBA 1S1RA 4O8RA 5J5RA 3ARYA 4QG6A 3NNTA 1AJZA 4XBKA 4KKXA 5U7SA 4DQWA 4HJFA 3NGJA 5CZ0A 4GO9A 4JKKA 4ML4A 1VEMA 4GINA 2Q09A 4RV8A 4UNIA 1U83A 4GJIA 1NQ6A 3ZQ9A 1E6XM 3CHDA 4Z42C 1MXGA 4GE8A 1CLKA 2PF0A 4IL2A 2W0UA 5C9UA 5FSDC 3GXDA 4WR3A 3DX5A 3FA3A 4RPPA 3CQHA 2WJFA 3S0CA 4A2SA 2B7QA 3LI1A 1W1IE 5D33A 1SYTA 1K8ZA 1N2VA 1UR1A 2BASA 1P1MA 3ITXA 3BARA 3W29A 3E0LA 1J6PA 4LBSA 3QTGA 4A3RA 3JR2A 2REQA 1SZGA 2WQDA 2Y7GA 2QJMA 1KFWA 2PFHA 3PHAA 5D37A 1ALDA 2QCDB 4IL0A 2ALDA 2OO0A 1PWLA 3Q45A 3ZYZA 2EG8A 3OZMA 5AHEA 3VDGA 3ISIX 2O92A 4ZBCA 4PCNA 3QFWA 5LGZA 3RF9A 4Z0SA 5CLWA 3CUJA 1WXJA 3C8NA 3GHSA 3NIYA 3ZSTA 2ZUVA 5CH9A 1M6JA 2YFOA 4JTSA 4AG0A 4NJHA 1E51A 1XLLA 3KBSA 4PFMA 1O5KA 1NOWA 1VBJA 1KRAC 1EA9C 3NO3A 1UOZA 1E6QM 1J2BA 1E56A 1O12A 1FA2A 1LM1A 4TX6A 3O07A 1VBRA 3URAA 3DH7A 2FLIA 5LHFA 2XPKA 3PK7A 4FXRA 5HNRA 4OKDA 2NLIA 2RGMA 3WQ6A 5BOFA 1U33A 2ZA3A 3B9OA 5EMJA 2PDBA 3QLDA 4RV3A 3W1QA 4GBUA 2CLFA 2EPHA 4UR7A 3HFYA 2DZTA 4A8NA 4LVAA 4J3TA 4P7RA 1UD6A 5A3HA 1DJXA 1YXDA 3WLPA 4JN8A 3ZOAA 1V6VA 1GOMA 5FJPA 1E0WA 2H6RA 5C9RA 4EWND 4U2ZA 1JNEA 2EPMX 2NQZA 3A24A 4DJFA 1TTPA 4LV4A 1CENA 2ZZ1A 4GH3A 4LOCA 1W9DM 1QK2A 1V6TA 2PU0A 1XS2A 2E7FA 3MT1A 3M0MA 1DWIM 4I8DA 2FIQA 4BEQA 4IMDA 1R7AA 3CZ8A 2NT1A 4JHOA 1PAMA 2FMNA 4UCGA 1FWCC 1MQQA 1AQFA 1TCDA 4QXIA 3GM8A 2QUVA 5HATA 3EX1A 3G6LA 4LYPA 4CCCA 3CNYA 5ABFA 3VCNA 3PUEA 2C6QA 1XISA 3PZIA 1CIUA 5FJTA 2PA6A 3WENA 5EY5A 2IKGA 4B5WA 3N17A 1TJRA 2F6KA 1DP0A 3G1YA 2VQUA 1JZ8A 3VNJA 1E6NA 3UYCA 1ODZA 1VP5A 3QQWA 3HQNA 3WLRA 2X8RA 1NU5A 3VD7A 1P6WA 5D03A 4D6HA 2NX3A 2WJDA 1KO0A 2W79A 3SY1A 4Q8NA 1H3GA 3PJXA 4HNUA 3OQ8A 4P61A 5C8BB 1QBBA 1QO2A 2WWDA 4ZB0A 2E77A 4NZCA 5DMMA 3SN4A 3KZPA 3CEUA 3U2CA 3ERPA 3Q2DA 3NOEA 1RPKA 2VEGA 4NX5A 3WQ8A 4KFNA 1P0KA 4PTDA 1S5WA 1K8YA 1IXNA 3LG3A 5DY3A 4DJDC 2PLKA 3LI0A 2WM0A 2DZPA 3TFXA 1IGSA 1BD0A 3L12A 3W7HA 4Y9AA 1DV7A 1B3VA 3T8LA 3AXMA 3MYPA 2IKJA 3LCIA 1SUXA 3PWAA 3XISA 4E3VA 2WLZA 3LN3A 1JGMA 3DHFA 5CBJA 2DJLA 4QS6A 3MCOA 5EYWA 1IQ8A 3MO7A 4YN5A 3S6DA 4NHVA 2HCVA 5HA7A 2A6NA 1TKKA 2BLEA 1BF2A 3H70A 4NAFA 3NQ2A 3PAOA 4RNJA 4F9DA 1TPVA 1H7WA 3QKEA 2CBVA 4XUYA 1O4UA 3MUIA 4C6OA 1XGZA 2E6AA 3O7UA 2HJPA 4TTGA 3K4AA 3G1XA 2R1LA 5BXSA 3G8RA 3S6OA 4NU7A 4Q6XA 4UTJA 5BU6A 3UA3A 3THQA 1HVXA 3EKGA 1JUKA 3CL6A 5C7HA 2Q6ZA 1US0A 3B8UA 4H9ZA 4YXGA 2OMAA 1H5YA 4DYKA 4D8AA 3LZ3A 3OP2A 3TE9A 4C6KA 2V5KA 2VCCA 2YXXA 3B8SA 4M1BA 2C19A 2PPGA 4GIEA 2J9YA 3QSTA 1S2UA 3CU2A 2J78A 4HIBA 3EZ4A 2VR4A 3T8QA 1Y65A 4AZ5A 4BF5A 1RZMA 3EWYA 3HMCA 2JF7A 1E9IA 1X1OA 4J2PA 3W73A 4YTUA 1W5PA 4I7WA 4NJGA 4AVFA 2ZUMA 2J79A 2Z0IA 4Q32A 4EANA 3UETA 4E4PA 1WZKA 4N4QA 1XYZA 3E49A 3QV9A 2OKTA 3WEOA 5CJNA 3E3HA 5FIPA 3N2TA 2J7BA 3AHTA 1W8GA 2PD9A 1DHPA 5IXEA 8CGTA 2VGGA 4WRHA 1NARA 3DC8A 3FOKA 3HJZA 3CL8A 4PL1A 2Y8UA 2YZ5A 1A80A 4DJEC 2JEPA 2ZDRA 3RFAA 1Y0EA 4E4UA 1FXQA 3EWDA 4KF1A 3W0KA 4HJWA 1XWYA 1EF2A 4W93A 3DI0A 5HNTA 3STEA 5DO8A 1TYGA 3QR0A 4W7VA 1BSLA 1OT2A 4Q4KA 3OZOA 3KBJA 4IISA 1RCXB 1JPIA 2PC8A 4NNBA 2JIEA 3ZFHA 5HMSA 3CQJA 5HINA 1I1XA 3TW6A 1TV4A 4UFLA 1XYFA 1UR4A 3G8EA 2HROA 2ZRVA 3TJIA 4E8CA 3S9ZA 1NDYA 4L4PA 5K9DA 1EC9A 1F4AA 4ROPA 1OQFA 1B3XA 3VAVA 1TIWA 1OFAA 4JDYA 4Q33A 3B0VC 4XAFA 3NEHA 2VL4A 3WD4A 1A0CA 1DYSA 2W61A 1TRIA 2ZZ6A 2FHBA 3KS6A 1WKFA 4LUTB 3BO9A 4JHZA 2R24A 3WUFA 2QPXA 2UY3A 4Q8OA 3AJXA 1G4TA 4F4RA 4DO5A 5J5DA 1X38A 3TN3A 1PVNA 4PMDA 3J7HA 5XIMA 1O5RA 3MUCA 4LXFA 1UKTA 3WBWA 2QJJA 1TPUA 4N9DA 1JUBA 1VJZA 2CLMA 2PTWA 3WMLA 4LJ3A 3WBAA 3L2MA 2RJGA 5XINA 1TWSA 5FF7A 1MO0A 2GJPA 2WO5A 3P0WA 1W5NA 2VEFA 1EJ7L 5J8LA 3G1RA 1AD4A 2PDFA 3B97A 4CD7A 3EXRA 2DY3A 1JR1A 3PAJA 3NQGA 3ANUA 3PSWA 2W67A 3P5ZA 1RBLA 1ZLPA 4IIFA 3NPXA 3BAJA 3AUOA 3BPWA 3H4GA 4BZYA 3GAKA 4MJ2A 3SCWA 3DFYA 2X41A 2OQHA 4O0QA 3LXAA 2E68A 1XBZA 4HNTA 4YTRA 1QDSA 3TCSA 3CYVA 4FIQA 4XVEA 3F5KA 2D2GA 4Q4RA 4NAFB 3VNDA 5BMXA 1EGMA 3EAUA 3GHRA 3CPGA 3SGZA 1KBJA 5LSMA 3OVRA 5HUOA 2NQJA 1WUEA 3RXZA 4QJ5B 3PS7A 3FJNA 3U8GA 5I6SA 4WZHA 3AHXA 3PM6A 5ABGA 1AW2A 5CBBA 2KAUC 1WB0A 1W56A 2FHCA 4NAEA 4H01A 4QFUA 1B0IA 1JPDX 2QZRA 1VHNA 4ADUA 3G1SA 4GABA 1TFVA 5CQ1A 2F6UA 4I6KA 1WKDA 5LA0A 4D1JA 2VCAA 3RRXA 3SR7A 2E3ZA 4PRWA 3CC1A 1V3MA 1G69A 1X8FA 4Z2HA 5REQA 3TWBA 1P48A 5IHRA 2XGZA 3WUGA 4LVBA 4HNLA 3LRMA 3NYZA 4I5XA 5FKYA 3S1GA 1FWAC 4IQLA 3EPNA 4UFJA 3CAWA 1AH0A 4WHBA 1XYMA 2NX9A 3JW7A 4RPQA 4HPNA 1SZEA 2DIKA 2VC7A 3V36A 3VNLA 3L68A 2NXHA 4BR1A 3P2VA 1CECA 2WSRA 3SUWA 4XVDA 4HZMA 4QAWA 3S6TA 4NZ5A 1A4LA 3CZKA 4U3AA 4H2HA 3BSGA 3EYPA 3ID7A 3VUSA 1D8WA 1OWQA 3GQYA 4Y9MA 3RNDA 2VX4A 5HBFA 2TODA 1DXIA 1EQPA 4FX8A 4PMJA 1QATA 1ITCA 3CB8A 2OX1A 3RLHA 3VO0A 1W3NA 2YDSA 3NPUA 1TB3A 4XK2A 3N2XA 2DDXA 3H55A 2VWSA 3EA3A 2WHJA 3ITTA 4RNHA 1QI5A 3MC5A 2FB2A 2XUCA 3C5QA 3ZT5A 4AC1X 1JZ7A 1PUDA 4DF0A 1H1NA 3VPLA 4DO4A 4GX8A 1U1JA 3TWAA 2CETA 1I9CB 3UWQA 1BSIA 1QMLA 3G0XA 3WEZA 1BYCA 3WNPA 1XYLA 3SRHA 4YCPA 1J11A 1A5KC 2ADAA 3ZMRA 5HWMA 3MCNA 3A47A 1VPQA 4HP5A 1MXSA 1R3RA 4NP7A 2Q8ZA 5HJLA 1SJDA 2YBUA 1A5AA 1V0NA 4RX0A 2UBPC 1V93A 3GVWA 2V81A 3RN6A 5ABFB 4LUIA 5G5IA 4ZZ9A 1KXHA 5I77A 3LU2A 5FAJA 2DIJA 2RFGA 3IRDA 3REQB 3HPZA 4IMFA 4C1LA 4D6JA 1GCYA 3UW6A 4H6QA 1EJRC 3VGBA 1GQIA 3E0IA 3SCQA 1XLCA 3DBNA 1A0EA 3TTOA 2XIMA 4NJKA 1SZNA 3GVGA 1UWQA 2XM1A 4M3PA 5GPRA 3I7RA 4HMEA 3MWAA 4XAZA 4Y7EA 1TJPA 2FZ9A 4R3UA 3VIFA 3FK4A 4CCZA 4NY2A 3WFZA 2JIWA 5D38A 2V30A 5I7GA 3ZLGA 1OX4B 4N42A 1UH4A 3HG2A 3BXWA 2RKXA 2X30A 1EZ2A 1REQA 4MB4A 1TPH1 3VD4A 2ISWA 3UY8A 2EXOA 2P88A 3MY9A 7TIMA 1A3HA 5BU9A 3M7WA 2YOCA 3MKCA 1YEYA 4I9MA 3DCPA 4O57A 1DTUA 4PUWA 3BW3A 3GU9A 1POJA 3HQOA 3POHA 5TBOA 3K5XA 1H7XA 3TMQA 4P2VA 3PUOA 2VXNA 3RLVA 2H9AB 4JQ4A 1S3TC 2O4MA 2YGYA 4C60A 1YDNA 1NJJA 3QY6A 4IJCA 4FLQA 3TCEA 2E67A 4HA0A 4O12A 3UYIA 3A9IA 3CV1A 3HPXA 4S3FA 4YJ5A 1VPXA 2WMKA 4ZTYA 4X63A 3ITOA 5A6KA 3W83A 7TAAA 3ABZA 3DERA 3WK1A 1EBGA 5DEZA 4JICA 3T78A 4WSJA 3CQ0A 1I75A 1ZGDA 1M41A 4AF0B 4HHMA 3S2JA 2QLYA 1GOIA 3TAKA 2J7CA 4WY0A 3I7SA 5FJRA 1H09A 3NXLA 3SUTA 1BXNA 3P8IA 2HVOA 4HU8A 4B3KA 3AYRA 3BTNA 1QOPA 2ZQ0A 3FJ4A 3GTIA 2CC0A 3TV8A 1G0CA 4DRSA 2G3JA 4GK8A 3UZWA 2FB3A 3MDWA 1UBSA 4N2YA 2DQXA 4ACZB 2W4XA 3SCVA 1GWJA 1YIXA 2EPKX 3M0XA 3TW9A 2BP1A 1TVNA 3MUY1 2ABBA 5AYXA 2OOGA 5LA1A 3LCFA 1CPUA 2PGEA 3OBEA 3T0BA 2VEMA 1U5VA 2Y5JA 4MADA 3TYCA 1TG7A 2ISVA 3HPSA 4HNNA 5KZMA 1XQLA 3DXIA 1JIBA 1TPFA 2GJRA 2WNNA 5D4YA 2FHFA 1H62A 1W2VA 2QUUA 3LA4A 4AYSA 4NT0A 4C65A 2X1UA 4GIYA 3QHNA 5I3GA 1FWBC 5ENLA 5KZDA 4AWSA 3UG8A 1QUMA 3W07A 2ATSA 4I5UA 4Q4MA 2YDRA 3VNKA 3OHMB 1E40A 3SN0A 1LUCA 3ZT7A 2UY4A 2BTMA 5CPSA 1X6UA 3O6CA 4OECA 4EOUA 5G2HA 3IAQA 2CESA 4PMYA 3P60A 4L6DA 4LW7A 2IPJA 1UPMB 2VEKA 4FNUA 3FXGA 4ZOAA 1XLHA 4Y96A 3TQPA 4LANA 2VC6A 4KEMA 1UKOA 2BS9A 1DHKA 4GISA 1RCOB 2G0WA 1BKHA 1ONXA 3GYEA 4J3ZA 1CXLA 4MG4A 4MWAA 3THDA 3NVTA 4GKLA 3GXNA 1JF5A 3FKKA 1GVIA 1P5BA 4WDWA 1MWOA 1DJHA 4F3HA 3W53A 1IEQA 4K2SA 1XLDA 4GNVA 2PF8A 1Q66A 1XKJA 1MSSA 1KR1A 1MFVA 3FFSA 2WV8A 1G6CA 1XUUA 3AYSA 3UU0A 2WLYA 3WDHA 4AHOA 4DZ5A 4JIPA 3NZPA 4HN4A 1RY0A 3VNYA 1FHLA 3C2RA 4QQ3A 3S9YA 1TQXA 1F3EA 1XYAA 2OSYA 1C8VA 4IGSA 2IPWA 3R94A 4B3LA 3PN8A 7A3HA 5HANA 1FWJC 3FVMA 2XGBA 5HXMA 1WO2A 1VQTA 3PZQA 2V5JA 1C29A 3BE7A 3CIWA 3H6OA 4ZE4A 4PN2A 1R9YA 1CXHA 3VKKA 3CBWA 2YJQA 3WJSA 5H1WA 1UZ4A 3NG3A 2BHZA 1JZ6A 3QKZA 3UBPC 4CQBA 1BTMA 2PRLA 2ZRXA 4EF8A 4Q4QA 4RL3A 4R7OA 5H91A 5LYRA 3W27A 4U2YA 1JL8A 1E4LA 2ICSA 2NX1A 2AMGA 4WEVX 3MHGA 4H4IA 2D2JA 4LYQA 2DV0A 2OJPA 3RM8A 2HQAA 4ILSA 3JZUA 5HK4A 3WLLA 3SUVA 3UZJA 4TVDA 4UR8A 1GJPA 1FFRA 4CEXC 4MZ1A 3M0KA 3DKJA 5BROA 1GTHA 1RPXA 4PCPA 4R9XA 4QG8A 4LCQA 1C93A 3OVQA 1H60A 3O1NA 1W3JA 3H4XA 1ZJAA 3MA8A 4JX6A 4DM1A 3HB9A 1B9BA 1FUYA 1O94A 3SAZA 3UCDA 4WKAA 1RH9A 4H00A 1AG1O 1CB2A 2BGNE 3GAYA 3KHDA 3RIKA 3MUXA 1GOKA 2V5BA 5AY7A 3U57A 3B8TA 3NTYA 1TVPA 4UOQA 6ALDA 4GXMA 5CC7A 4B16A 3FA5A 2D23A 3GC5A 1VFOA 3V4BA 4EKJA 4E38A 4BS0A 5FL1A 3W26A 4JTGA 1RA0A 3DFTA 2VVNA 4UQBA 3VDHA 1LT7A 1OK6A 3SCTA 1F3TA 4L4LA 1PKMA 2GOUA 2GGIA 2Q71A 3QRHA 3PFMA 3IUIA 1PZ2A 4OE7A 3RJYA 3VA8A 4ZFMA 4NKCA 1JCNA 3F7JA 4JOMA 3T55A 1F6KA 3B03A 4I9JA 4IM4A 3RJXA 1ZENA 3R4IA 2ACQA 1F8IA 1RUSA 1XH1A 4JIHA 4LYKA 4FXJA 4S3GA 2VD8A 2WCGA 3IJDA 2D20A 4URIA 1X96A 3LPOA 3CL7A 2WWCA 4JFSA 3UG4A 1TJ1A 3NQAA 2OWCA 4HZ8A 4LUJA 1N55A 3V1PA 4EXQA 4IX0A 1SJBA 1V6WA 1IR1A 3LGEA 1IT8A 4TQTA 5F4XA 3P81A 4QEEA 4GIAA 3RLUA 4FPSA 4LUTA 1CB7B 1TR9A 3LQGA 1PXGA 3QOKA 1XH2A 3LM3A 5HR7A 2QUTA 5F2MA 3VTRA 1W9BM 4XZWA 2ZYFA 1KCXA 2CZDA 4CQDA 1HJXA 2BX7A 3QZAA 3NZGA 4TUFA 3UJRA 5I3HA 3PY2A 5IRPA 1OCNA 4HA4A 4C6NA 3VIMA 1UWAA 4GI9A 4Z2JA 3HG3A 3VDAA 4XV0A 2TSYA 4E8DA 3UGRA 4GY1A 3L4TA 1VFUA 1GYNA 3EOEA 5HMFA 1XRFA 3CZLA 1YDVA 3W2NA 3WH9A 2FZ8A 1W17A 2VX6A 3KOXA 4XIAA 4K38A 3DIPA 3HF3A 2WYSA 1L6FA 1W8SA 4J5NA 3GY1A 4RE4A 4LY8A 1E6ZA 4UFKA 4DI9A 2EO7A 2YW3A 5D2TA 4DI8A 4DJED 4HQVA 6TAAA 2OZ3A 2J88A 1DQXA 4XSLA 3BG3A 5KINA 4F8XA 2D2HA 2QCCA 3BUVA 4M24A 3UF9A 3QC3A 1R5YA 3LHUA 1AMYA 3NJ3A 3WLTA 4Q4SA 5JBEA 2ZTJA 2FGLA 2HEJA 1JEZA 2GDVA 3G0UA 4PE8A 1W5OA 2B81A 2JKPA 4K8HA 3ARPA 4GVGA 3K4WA 1KFLA 4A21A 1US2A 3MJMA 2QV4A 2DZVA 3BL3A 3TZNA 3U6WA 3PC0A 1HP5A 1Q5MA 3GXMA 1UMLA 2BBFA 1XYBA 2HE5A 4ZOBA 1I2QA 1RJRA 1XJBA 3UVIA 4XX6A 2FPTA 1EJXC 1R2TA 1VLWA 3WJWA 5D05A 2C16A 3QV6A 4UTTA 3PNZA 1MUMA 1ADSA 1JYVA 3GIPA 1REQB 3C2OA 3KTCA 5F4SA 1B3WA 5KEZA 2XHYA 3TROA 3MMWA 1JPHA 2AL2A 2WZTA 2NW0A 4IMEA 2X7VA 3KL0A 3O9NA 3H2AA 2ZZ7A 1OY0A 2W9MA 1H61A 1XH0A 1P0EA 1UD3A 2VP8A 1HIZA 2VNCA 4Q8PA 2DFAA 3DU0A 4EP8C 4PUEA 3VNMA 5A6AA 3A4WA 3HQPA 3S5NA 4E3TA 4C6DA 1SO3A 1UYQA 2D3NA 1WZAA 2BMBA 2PBGA 1NM9A 5REQB 3GDTA 1EB3A 3RPMA 4IUOA 4FLOA 2OT1A 4JTFA 4KGJA 3WCZA 3NZRA 1WZMA 3C0SA 4PMXA 2Q3RA 3E38A 3BLFA 9CGTA 1V03A 1FBAA 3LZ5A 2W63A 3WX7A 4K39A 3DFNA 3UNDA 1BWVA 4BFAA 2YA0A 3IJ9A 4H8NA 3GNNA 3WH5A 3W9ZA 1FCUA 5A6LA 4RE0A 1SJAA 3UP8A 2YL8A 4N02A 3PF3A 1GVSA 3E74A 2QYGA 5B80A 4KCTA 2V3EA 3S46A 1H63A 3TYDA 4ACYA 3DESA 2YB4A 3BDKA 4G1NA 4RDVA 1LZOA 1DXEA 4DBEA 3N9RA 1FP9A 1R3SA 3M9YA 5FJUA 2Z6JA 4PRTA 2NQ9A 4S1FA 1XFBA 3QM3A 3FKRA 4L9ZA 2PEVA 1CXFA 1B3OA 3NM3A 3IVTA 1Y8BA 1WAWA 2YCLB 6PTDA 2NUXA 2JGQA 1OYCA 1YHTA 2Y24A 5JIPA 4ZQRA 3R7MA 5D9MA 4EPKA 3RAOA 1M03A 2OO6A 2ZA2A 2PGRA 1KLYA 3WKZA 3M0HA 2CHNA 3V75A 4Q8QA 2J8TA 1EIBA 2Y2WA 1HW6A 1JI1A 3W6LA 1RQBA 3LGDA 4C90A 3ABOA 2E5CA 1EKOA 4ZO9A 5IFPA 1XSJA 3FY1A 2WSYA 5H2ZA 2XIQA 5IHSA 5FESA 3WLSA 1I1WA 4AD1A 2D24A 3CT2A 1S46A 4KWUA 1XLJA 4W9TA 5ABEA 1PZ3A 3P80A 1UD8A 1UQYA 3DGBA 1KNWA 3SDOA 3GR4A 2L5HA 4BHYA 2YXGA 3TTEA 1SZRA 3V7PA 1HJQA 5AZ1A 3HFTA 1T8QA 3EDJA 4O16A 2AGTA 3EMZA 3EOLA 2Z1KA 2C0AA 4ONVA 4IH3A 4CQCA 3CZGA 2CLPA 2XWEA 1LJYA 5HQEA 4CCEA 1EPVA 1KFEA 4K36A 1ISWA 1XINA 5RUBA 2XFWA 3L0KA 5JU6A 3A13A 2GVLA 1GOQA 1KBIA 4ACZA 2VUYA 1XIDA 3FJLA 3BGGA 3GH4A 3ORWA 3MU7A 3TAOA 3G1FA 1MDLA 1YRRA 3S8HA 4QJ4B 3WLQA 3ZO9A 3NQDA 1YTKA 2ON3A 1O95A 1LL7A 1LQ2A 4C7DA 2JK2A 3KL3A 3PVFA 4HT3A 1UP2A 1JQXA 2PDMA 3BURA 4FO4A 2PDJA 3UXAA 4P5UA 5HPCA 1LWJA 3H2NA 4H19A 3G77A 4NZ3A 5FF0A 2FPVA 1SM9A 1VBHA 4CNTA 2XIOA 4LB3A 3HGJA 1GTEA 1OM0A 1Q6RA 3WLNA 1OK4A 2V68A 3AROA 4R53A 1OEPA 3R58A 3IAPA 1JDDA 4GQGA 4M7TA 1Q6EA 2ZBTA 1PYFA 4E4FA 1E70M 1FH7A 1ZFJA 1BG9A 4DPPA 2X1TA 2FJUB 3LHTA 1GQNA 4OWGA 4QE5A 4DZHA 1W9PA 3NDZA 3CQKA 4HNVA 2J47A 3DKLA 1JCYA 2ZZ2A 4J3XA 1GGOA 2A7PA 2YPIA 2A3AA 3P7YA 4N9BA 1WZLA 1K70A 5A69A 5CSYA 5CPLA 3QW4B 3BG5A 1WDSA 3AXHA 3KRZA 4FXFA 3DI1A 3MKKA 1W5QA 1P6BA 2A21A 1EJWC 2BVYA 1OFQA 3U9IA 1LBLA 5C55A 3MP4A 3C2EA 4W87A 4S23A 5F2LA 4S3CA 3TFCA 1B3YA 1Q7MA 4D8LA 5LNUA 1OD0A 2PDHA 4R9OA 1FCBA 3ITCA 4F48A 5E0CA 3RDKA 3REQA 1KWGA 3HBLA 1V02A 4HCHA 3TTYA 2HVNA 4GOAA 1O60A 2RDWA 3TIMA 1H49A 3WUEA 1C92A 3KP1A 2VVSA 3G1DA 1DORA 1L6SA 3GH7A 3N15A 3W2MA 4H9TA 4JYDA 3FIGA 1D9EA 3WH7A 3L2LA 4DJEA 4K37A 1GG1A 3INPA 3GS6A 4JIEA 2I56A 2PLJA 3L9CA 3HO8A 1JXJA 3G24A 1QT1A 1XXXA 4ICCX 1I60A 4BCEA 4O1EA 1SFTA 3KLLA 3KL5A 3T2OA 3VD5A 3LK6A 5EU9A 3L5MA 4EPDC 2PE4A 3PB2A 3A12A 3PZUA 3PPCA 4ZEPA 1W1B1 3BOFA 4W5ZA 4YNGA 4ZMGA 5IM51 3ANVA 4IPJA 3WLKX 1CLVA 1K4HA 3B9NA 4XTIA 5H8MA 3L0GA 3MV11 4PMVA 3NQ8A 4GA8A 4QISA 1F61A 4OZOA 2QCFA 4N9CA 1XGDA 4JN7A 5CC6A 3S2LA 2DT3A 1K9EA 1OC7A 5BXRA 1T8XA 4KWVA 5AN7A 3GDRA 5TQLA 4CQ8A 4RK8A 1JRCA 4JFWA 3BCDA 3VZXA 3N13A 4AMCA 3TQKA 1E3XA 1XG4A 3MMTA 3C8FA 4JL2A 1AJ0A 5A8MA 4DF1A 1OIMA 1DJGA 5DBUA 3AZTA 1HO4A 1PSCA 4ZXOA 3R25A 1QHPA 4F2BA 1AH4A 5E1QA 2FZNA 4F66A 3ZJ6A 3WYZA 5IBXA 2H3DA 3U2OA 3JZEA 3H24A 3C2YA 1B5TA 3OO2A 3N19B 1UKPA 2PP0A 1HL9A 1XLFA 3RU8X 1BHGA 2DH3A 3VDBA 3NAVA 1C9WA 1A5MC 4NJJA 5FL0A 1IEIA 3EMQA 3TONA 1BLIA 2GGHA 3RGTA 2AQOA 4AZ6A 3DDMA 5H8UA 1RJPA 4CNSA 3S1XA 1RLDA 1J0ZA 4GLEA 4XZ9A 1R30A 2YX0A 3OHIA 2ZWYA 5I79A 3WZ0E 2E1DA 3AICA 4GCAA 2YL5A 5KITA 1WDRA 1WKEA 1Q7ZA 4MGGA 1YDOA 2MNRA 1ZS2A 3VDCA 5FD0A 1R6WA 4WGXA 3ZXWA 2NZLA 4IZGA 1R3TA 3R8RA 4YU1A 1AZ2A 4DWDA 3KTXA 3S47A 4Y8EA 4Z1CA 1L6GA 4QBXA 1PCWA 4OUEA 4C6CA 2PWVA 5F1UA 3EEGA 4BQ5A 2PWDA 1VFTA 3NZQA 4EX4A 2J7EA 4CLMA 3VE7A 4FF5A 3SM0A 1Y7VA 2MANA 2A2IA 2H8XA 4FNQA 1QNOA 1M04A 1FWEC 2Y8KA 2QPUA 2ZKMX 1VFSA 2WNWA 1JULA 4DO7A 3R2GA 2PDGA 3VOFA 2BV9A 3O2LA 4ZQOA 2CIPA 2FJKA 5EA9A 2OFJA 4FXSA 4G9PA 2XWDA 4D71A 2J77A 4G8TA 1YNYA 4ZO7A 3JUGA 2ALRA 2HBXA 4L1XA 1ISZA 5DT5A 4AZBA 1U5JA 3IJIA 1RQHA 4DELA 1ZAHA 1TMQA 4EXAA 4IP4A 1GUVA 3FEQA 1FWHC 3MUZ1 3WQPA 1V77A 3OLIA 1FHDA 3O6AA 1D8CA 3VKDA 3CYJA 2CYGA 2ZZ3A 3GKAA 1EOMA 5DT7A 1BVZA 2OEMA 3MYOA 1KM6A 2OKOA 4PBEA 3E2SA 4UQAA 4YIWA 5BXPA 1V3LA 1DJYA 4KCUA 3MDUA 2YDQA 1PWMA 3PZMA 4V1YA 5AHFA 2NV2A 1EX1A 4ZGYA 2CITA 3PUGA 3P5YA 1OSEA 1JI2A 3GTFA 4HB7A 1E6SM 3VKCA 7ENLA 3W7NA 3EKLA 3D3FA 3GVQA 5FACA 4FP1A 4QG9A 1KRCC 1A5SA 1KM4A 1UR3M 3AMKA 3S1WA 3GG7A 4TXEA 4ADTA 5AC8A 1FH9A 4PB3A 3ARZA 3W2JA 2GQ3A 5K3VA 1M7PA 2V8ZA 5DMLA 1GJWA 4S3AA 3CZJA 1VB9A 1XG3A 3HMJG 3N4AA 3URNA 3T40A 1HJSA 1O66A 3E1F1 1Y5XA 1BVWA 4OBTA 4RCXA 1HGWA 4AVNA 1YXCA 4RW3A 2P76A 4X22A 4HU3A 4X61A 4J28A 3H7UA 1V7YA 1VBGA 1GOXA 4CU7A 2H9AA 1SW7A 4RNIA 1OZMA 3L4WA 1SFSA 3WQFA 3KOYA 2DJXA 2B7PA 3LEPA 2E9BA 4JFUA 3HA1A 4GGBA 2FKPA 4MPKA 2HV5A 4LWWA 4UQ9A 4AZCB 5M5DA 2PDQA 3FDKA 2OU4A 4X0VA 5G4WA 5FJIA 1CTNA 2WMGA 4YVVA 4QJ3B 4IX2A 4WX2A 5LXXA 1J0HA 1FHUA 1FWWA 4IP7A 4OV4A 1P7TA 1PKNA 1T96A 5A94A 1QCWA 4XKYB 5LNVA 1KA9F 2ZC8A 5EB8A 3PJTA 1TUFA 2YCEA 4A8LA 4XAPA 3W75A 4AZ7A 1G01A 1LYXA 3EX2A 1GPWA 1QU4A 3GNPA 3MI3A 4J2MA 2R82A 3H4WA 3BLOA 2ZX5A 5AOUA 2C8NA 3O6YX 1EJUC 1W1A1 3XINA 2VGIA 5DCBA 4MUPA 4V28A 4NSBA 3LOTA 1XD0A 1US3A 1C8XA 2Z25A 3S5SA 3MSGA 1ME9A 4CD5A 4HYRA 4GNKB 4O10A 4DIAA 4C6PA 4MWAE 5C54A 3BH4A 3W22A 1KTCA 3VX1A 3O0FA 1WAUA 2PGWA 3IANA 5AHNA 1VCGA 2ZUWA 2BY1A 1F3XA 4ERAA 3AI0A 1PIFA 4AEOA 1AD1A 3CAQA 1MRAA 2VMFA 3QPEA 5CSSA 4WD0A 6A3HA 3WQVA 5FI8A 1ONRA 4AHPA 4QITA 1W1TA 1SO4A 5D2VA 2C1HA 2R94A 4NRSA 5C9WA 1VFFA 4X0NA 3BV4A 3RHGA 5E6ZA 3WH8A 3TW7A 4P8UA 4OOUA 3GTNA 2EJ1A 4M56A 1XIMA 1T99A 1W3IA 4JGDA 2AL2B 1SO5A 3CJPA 1QFEA 2E9LA 3GE7A 2EPOA 2PWHA 1ZU8A 1VPYA 4TO8A 1FKXA 3UA4A 2QGYA 3AOFA 4E2VA 3IK2A 1J93A 1S3HA 4K7VA 1UKQA 2CXEA 1QXLA 5KZEA 1YPIA 3VIKA 1TA3A 4K7YA 3WNNA 1QPOA 2ESCA 2G3FA 4JDBA 2Q8XA 5AHLA 1VRDA 3SIMA 2CZFA 1KV8A 1ZZMA 4FAMA 5K9XA 3KCJA 4FX6M 2NVAA 3W1UA 5TF0A 1EPXA 9RUBA 2RGLA 1UD2A 3TC6A 3B4YA 4B5TA 1A4MA 2VDIA 1RK5A 4EK7A 5A5WA 4ZSTA 1VFLA 3CWOX 3QY7A 3VOIA 4I6VA 4QTGA 4D1IA 1H7RA 4E0CA 1UWRA 4XQ6A 4M6UA 4RLIA 5D9OA 1P7TB 1QJWA 4OFCA 2DT0A 2CHRA 3VI2A 1TZZA 2E4TA 1VJSA 2PS2A 2YSWA 2ZA1A 3N2OA 2BHUA 3ECQA 5FSEC 3JRKA 4DM2A 3WY1A 1LWIA 3A5FA 1PIGA 2Z1VA 3Q37A 1K7XA 3VGFA 3F4WA 4JTRA 1M7XA 1BEUA 3EDKA 3G1VA 2E28A 1WDWA 2Y1HA 1KXQA 2WKJA 1UR8A 1EDQA 4DX3A 1UW9A 4DWSD 1LP6A 1GT8A 4AD3A 5G2WA 4KPLA 4ORMA 5G4EA 3SRFA 4JS3A 5EMLA 2H90A 4WCJA 1EDGA 1AJ2A 2VRQA 2Q8LA 4UCFA 3COTA 3OW1A 2A3CA 3N1AA 4PUJA 3DFQA 3IVSA 3TR9A 4XZHA 3O0KA 4H9YA 3PBYA 2JQXA 3ZVIA 4GQRA 5D9NA 1I2RA 3T0AA 5CCZA 2YYTA 2P50A 2HMCA 4AUBA 4MF4A 5CZTA 3F4DA 1B2YA 4ZOEA 6TIMA 3K30A 3GVRA 2PTYA 1WDDA 4QSHA 3LBOA 1X8CA 3L0NA 2CLHA 4LB4A 5H6HA 1FDYA 3E2VA 4XO7A 3U2ZA 2OZ8A 4KRTA 4M6VA 4MB1A 3N2BA 2P3EA 2GQ8A 4DBUA 3EWWA 1HJVA 2P10A 4JIRA 3TEVA 4RE2A 5LGXA 4JX5A 1TPWA 2F61A 4JNZA 3RO6A 1TMHA 3B9DA 4PUKA 2BGSA 3TSDA 3KOZA 3AC0A 1IXOA 1R8LA 4QDWA 3W2UA 2Y6ZA 2D2OA 2JBMA 2CLLA 1X98A 1LQAA 1LCOA 1Z44A 3TYAA 3R0UA 3PZOA 2Z27A 2FH6A 3SQLA 1F5ZA 5I5RA 4MWAC 1OG0A 4G1KA 1MXDA 4K1WA 1V6YA 1EGVA 3VGDA 1HF6A 2OYMA 3UY7A 3IUHA 2JKAA 4GUHA 4C6LA 3SGUA 2ZFAA 4HBKA 4C6IA 3NQVA 1EGZA 1A3WA 3T05A 4PUDA 1FTXA 5EMYA 2OLHA 3SCRA 2V6AA 2GSHA 2DSVA 5HAOA 3QBUA 4H7CA 2VJXA 1VFMA 3L2IA 1AQHA 3VKJA 1I6NA 4YHEA 3A6OA 3NPWA 4IQJA 3LUTA 1SMDA 1TV7A 4AD5A 1N8WA 4HOZA 1XIHA 4W89A 5AC5A 3GWQA 3LPGA 4MKVA 5G2IA 2E6DA 2DSZA 5CKSA 4DXVA 4MZYA 4QE4A 4LNCA 4GI8A 3S2CA 4CNUA 3CAKA 1IXPA 3RLGA 3T1GA 1C7TA 3TSMA 1R86A 1JZ4A 3WJZA 2TPSA 3I68A 3PANA 1X1ZA 5BNKA 1ICSA 1Z32X 3RO8A 1A0DA 1DTNA 3EX6A 1OG6A 4HU4A 4RJEA 2XTKA 2PTZA 5CC3A 5A8OA 1U1HA 4FR1A 1DQUA 1GQKA 1KXTA 2E5DA 3G0SA 4GJJA 5I3IA 1AODA 2J74A 1V51A 4J9JA 3PG8A 2I16A 5JXQA 1SU5A 4IQDA 3WNKA 1KBBA 1OABA 2E6FA 1K1DA 1Z8AA 3FGCB 3N9SA 4V15A 5CGTA 1R0MA 2E6YA 3IGHX 3WF1A 3KVKA 4MPQA 4H6RA 1DJWA 1EEXA 1V3KA 4UB9A 4LAMA 1SPQA 3L21A 1RP9A 3MO4A 1VIZA 3AXXA 4JTJA 6ENLA 3UXKA 4J40A 1T41A 3A64A 3MI2A 2ISSA 2V5DA 4HSNA 1GVEA 3TXVA 4OVXA 5AYBA 4XZLX 3GC2A 2ZCGA 4L6OA 2GWGA 3UZZA 5I0DA 1IT0A 3FAXA 5A8NA 3ARQA 5GJNA 1ZJHA 3SFWA 5AC4A 2ZXDA 1E9YB 3WD3A 3IIPA 3BOLA 1TX0A 4A8IA 1EX5A 2PWUA 2O9OA 2NSXA 2HWGA 4NNCA 2J24A 3C52A 1QAPA 1S1PA 4GPNA 5EBAA 3VIGA 1A49A 3TQVA 5AC6A 4IHCA 1QR7A 2QDGA 2DUAA 1WPCA 4JXCA 4O13A 1M9HA 5FEXA 4IJRA 4U31A 4U10A 4HPGA 2O7QA 2CEQA 2Q3OA 3MP5A 3IACA 4DJFD 3MSRA 4LCSA 2B7OA 4L1WA 3CMJA 1HJWA 3EA2A 1FRBA 2X1RA 3SI9A 1Z42A 1XLAA 1KFCA 1YBQA 3EGJA 1U22A 2EG6A 4UTMA 2EF9A 4POCA 1G94A 3EWCA 1M1BA 4W4QA 1V3HA 2HSAA 3IK4A 4IPIA 4IT1A 4LV9A 5BXTA 4HN8A 4LUSA 4KH2A 1JAEA 3UWEA 1VF8A 4DHGA 2Y89A 3VU2A 3MKVA 1AW5A 4JEQA 3RR4A 5AYZA 3GFZA 5JVLA 3MPGA 4FMVA 4Q4PA 3H7VA 4WQ6A 2CFFA 1LTDA 4O18A 1GNXA 2PDLA 1NQKA 4GIRA 2BWGA 4CU8A 1J4EA 3C56A 4IIHA 1O6IA 2TRSA 3GVVA 3GHTA 5K2ZA 1EWEA 2PBOA 1LWHA 2P8BA 4IGMA 4HTBA 3GTHA 1WBHA 1BQCA 2YR1A 3GZ3A 2GL5A 3NXFA 1FWRA 3BLKA 1J8VA 3QYSA 4KCVA 3TU9A 3M16A 3T44A 1VIWA 3EX3A 5A6BA 4Z2IA 2NUWA 4LT9A 4AWTA 1PX8A 2RH9A 2G50A 3CASA 1OFOA 3AQUA 1AFSA 2AOSA 1T5AA 4QS5A 1FDZA 1DIKA 2XJ7A 4E2DA 2IS7A 2R14A 2HBVA 3NO5A 1UZ1A 2ACRA 3NL2A 2BXVA 1OIFA 3QV7A 1UH3A 3ZLHA 1N82A 3CV6A 4WDTA 4A3YA 1V8EA 4ICMA 5I02A 3KTSA 1FWTA 1Q45A 2D3LA 1YTDA 2VOTA 5U4NA 2BOGX 2VC5A 5C9ZA 2VGBA 4O4VA 3UERA 3B4UA 1FFQA 1TJ2A 3DG6A 3OU8A 3P93A 1P1XA 1ZCOA 4H41A 3CHCA 4FHAA 2GWNA 1V4YA 3QVQA 4FNTA 2W66A 5KETA 3KDOA 3O06A 3ZR5A 4PCFA 1E1CB 2EBNA 2OCZA 4N7QA 1EWDA 5SWUA 1WNOA 4FX7A 4F0LA 2QAPA 4Q22A 4UXDA 4AQLA 1IYXA 4RDZA 1I0BA 2LLEA 1EBHA 3R6IA 4QLJA 5CAHA 3CZEA 1OHLA 3LYEA 1UC4A 1FVPA 4QNEA 1WBJA 4EE9A 4XD3A 5BOEA 1L2QA 1X6NA 2VHLA 4DJDA 2A6LA 4OGZA 4UTUA 4LUSB 1TTIA 4U5IA 5CJ5A 1GEQA 3CHVA 4F0KA 3MQTA 4ICNA 4F2TA 1EJVC 3C2FA 4BF7A 1W1YA 2PURA 1R38A 3HPAA 1RR2A 1H7PA 4CNPA 1W3TA 4JTTA 5HQLA 4HNCA 1PDZA 3HG5A 4TTUA 4CKQA 4O0ZA 2I17A 1UUMA 1C91A 3VIJA 4M6PA 3LCGA 3H53A 1U5HA 1BKSA 2XVKA 1E0TA 4QCFA 1V0KA 1X1NA 3RM9A 3CUFA 3GW0A 3EXSA 1G7VA 4WKHA 3T09A 2PDKA 1H51A 3FHAA 1GORA 4RKAA 1Z89A 4GFSA 5LIUX 2CW6A 3CXOA 3WBYA 1SVDA 3W1RA 1LL6A 1F76A 3KVJA 1TJ0A 3LS9A 3B06A 3D47A 1TV5A 3DC0A 4RXGA 4AB4A 3D5HA 1CGXA 5BWAA 1QI4A 1TWIA 4ATLA 2DT1A 2J8GA 3BLEA 1GEHA 4JHMA 4AZCA 1AL8A 4XZNX 2X2GA 2VI0A 4AD0A 5HOSA 4D6DA 4PB5A 1SFJA 5EFDA 2VZVA 2V2DA 3QFEA 1YKWA 2EKGA 2JALA 3VINA 3HV9A 1F05A 2OQYA 4DXKA 5A2AA 1OT1A 2PD5A 1T0OA 3QPZA 3N29A 2H8ZA 5A1AA 2Z1XA 4O11A 1RVKA 1H5VA 1FKWA 2Y7DA 3KX6A 3VZYA 1W32A 4RZ4A 3AJ7A 3CO8A 3W7LA 2VFIA 4LS0A 1AQMA 2PUZA 4M1RA 3SRKA 3NL5A 3C2VA 1UD4A 5DY2A 3P3BA 3ATYA 1E5NA 3HQ1A 2HTMA 5AB3A 3P0XA 1ZHAA 2OB3A 5D32A 4Q7IA 2GK1A 4XO6A 3PSVA 3CH9A 3GR8A 3OOQA 3WDIA 3GG8A 2DEPA 1XLGA 2VEIA 1KGWA 3LPPA 1QI0A 2AKMA 1HO1A 2QHAA 3IUDA 3MCMA 3TN5A 1IE7C 2GQ9A 2GUBA 3OQEA 3VOGA 4LQ1A 3SRDA 4MFEA 2DPEA 5FF4A 3BGAA 5LXEA 1GQLA 2WZMA 1M01A 5DRCA 4OBRA 2QR6A 3QTPA 4A4AA 3ALFA 4DNHA 2QCHA 2WMIA 4LYRA 1DXFA 5CG7A 3SADA 3RX2A 4IGNA 3EB3A 1ECEA 1S38A 3PJUA 3UZ5A 3QR3A 3OGSA 2QF8A 1RCQA 5JH2A 4B15A 2G8ZA 4LVGA 3A23A 4BJHA 4JTUA 3C3NA 4YVXA 3HGSA 1MQRA 4TX8A 4GKTA 3I4KA 4DWSB 2FVKA 4XISA 1JZ3A 1E5JA 4S3EA 1KR0A 2VURA 3LMZA 1VHCA 2XSXA 1PCKA 4DUVA 5HJXA 1BVNP 1PJ9A 1V6UA 3AS0A 1E9ZB 2XVGA 3W1XA 4FLSA 4IOTA 2OODA 3LHWA 4GZEA 2X2YA 2JFEX 2QJIA 4PCSA 3T4CA 3RYSA 1A53A 3HOJA 4B5VA 2GJXA 1QW8A 2MUCA 4J35A 1J0YA 4A35A 1ZBWA 4UBPC 1PS9A 1MRQA 3EX4A 3THAA