1B3XA

Xylanase from penicillium simplicissimum, complex with xylotriose
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
302
structure length
302
Chain Sequence
EASVSIDAKFKAHGKKYLGTIGDQYTLTKNTKNPAIIKADFGQLTPENSMKWDATEPNRGQFTFSGSDYLVNFAQSNGKLIRGHTLVWHSQLPGWVSSITDKNTLISVLKNHITTVMTRYKGKIYAWDVLNEIFNEDGSLRNSVFYNVIGEDYVRIAFETARSVDPNAKLYINDYNLDSAGYSKVNGMVSHVKKWLAAGIPIDGIGSQTHLGAGAGSAVAGALNALASAGTKEIAITELDIAGASSTDYVNVVNACLNQAKCVGITVWGVADPDSWRSSSSPLLFDGNYNPKAAYNAIANAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Family 10 xylanase
molecule keywords PROTEIN (XYLANASE)
publication title Xylan binding subsite mapping in the xylanase from Penicillium simplicissimum using xylooligosaccharides as cryo-protectant.
pubmed doi rcsb
total genus 127
structure length 302
sequence length 302
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 1998-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1b3xA00
4MNLA 1KQZA 4PRWA 3ARXA 4E4PA 2WM0A 4MB1A 1JZ2A 3QR3A 5A6LA 4DUXA 3A4WA 3PZNA 1EHAA 2PC8A 1CDGA 4QP0A 3MMWA 2HISA 5CLTA 4Z2LA 3SURA 1WDRA 4BF7A 5I24A 1H5VA 1ZL1A 4ACZA 4GZJA 1LG1A 2YL9A 1TE1A 3WL1A 2G4FA 1BVZA 1E1EA 4FLOA 1YHTA 3NCOA 1EOKA 4TVUA 5ABEA 5A6KA 3POCA 1M03A 3AISA 1TA3A 3SCOA 1C92A 4W7WA 3LPFA 1RP9A 4YPJA 3WQ5A 4D6CA 2YLAA 5IDIA 3OZOA 3RJYA 3VIMA 4DWSB 3ARTA 1SFSA 2OSXA 2NW0A 4DUVA 1DP0A 3MO4A 4QAWA 1NP0A 3LPPA 2QLYA 1WDPA 3VU2A 3ARUA 3WUBA 4MJ4A 1E72M 1W9PA 4UOZA 2VZUA 3AQUA 3A4AA 4J3WA 1CXKA 5A6JA 3QGVA 3HN3A 4PCTA 2O9OA 1G9HA 5JBFA 4UTFA 3SCRA 2WC7A 2EPMX 4B3KA 2VC9A 2C0HA 3OG2A 1K9EA 4GQQA 4JFWA 3WDJA 2ZX5A 4ZXLA 3WMBA 1C91A 3K1DA 4PMNA 1CEOA 1R8LA 1W91A 3MUAA 3SUTA 2G3IA 2EQDA 4QCEA 3AMLA 3ZJ8A 3RM8A 3ALGA 3UCQA 3VM5A 4B3LA 1FHDA 4H7VA 1ISZA 1GQKA 3VIHA 2DT0A 5A6AA 4CCDA 1NWSA 1MW3A 3IANA 4MNKA 4W85A 5EFDA 4ZE4A 1BGAA 4AMCA 4UFMA 2OWWA 1ZBVA 3AZRA 3VGFA 2WKLA 4MPKA 5E09A 3BLKA 2FH6A 3OLDA 4S3JA 4A3HA 1MW1A 1B90A 1GPFA 2XPKA 1UG6A 4HMEA 2WCSA 1VEPA 1JZ4A 2OYMA 4PSRA 5AC5A 1GHSA 4GZEA 1B31A 4JHOA 2D0GA 3E1F1 1UD8A 5A3HA 1P6WA 4U31A 2YIHA 3W82A 3K4DA 2VRJA 2VZTA 4JCLA 5DMYA 4W86A 2CPUA 3M6DA 3AFBA 3GBDA 4FMVA 5A1AA 2JFEX 4M29A 3EMZA 4U2YA 3ARSA 3WDQA 1H11A 1OWQA 1MQRA 3CZLA 2V3EA 1CLXA 4U2ZA 1NQ6A 1D2KA 2ZX8A 4HTYA 1GONA 2YBUA 1FOBA 4P7NA 4YHGA 3N9KA 2E8YA 2CXGA 1GW1A 3ZSSA 3CUGA 4N0RA 3VOCA 2CITA 3L4TA 3DYOA 4PUEA 4W88A 2O9TA 3IJ8A 5EFFA 2F8QA 1LWJA 3QHOA 4JKMA 2WVVA 4U5IA 3DECA 2WPGA 1W1VA 3L4WA 4HOWA 1LG2A 2CCRA 1QNRA 8A3HA 2OSWA 2EPNA 3FY1A 1QW8A 1E3ZA 2WW5A 2B31A 3AIWA 1SMDA 1NWTA 4OJYA 4GKLA 4JL2A 3MUZ1 1GOIA 3SCUA 3WL0A 3W0KA 2JF7A 2A3EA 1W3HA 4AD1A 3WBEA 2W67A 1TVPA 3K8LA 1KFWA 3W4RA 2V5CA 5A6BA 3AROA 3CHEA 2JEPA 2WNWA 3ZJ7A 2VCAA 3WNNA 1Q6CA 3WDPP 1WZKA 2OYKA 1C8QA 1A47A 1PIGA 2GDVA 4JKLA 2VCCA 4HZ7A 1DHKA 1JFHA 1ODZA 3N11A 1K9FA 1JNDA 1XSJA 3AYSA 1VB9A 2BVYA 2V3GA 3DHUA 3S2CA 4AIUA 1BSIA 5CZKA 1HX0A 1MFUA 2O9PA 1IZJA 4TVCA 1CXEA 2W92A 4WKFA 2DT3A 1U2YA 2JIEA 4XV0A 3AJ7A 2W63A 1R7AA 3FN9A 3BAJA 1ZJBA 1KCLA 1J12A 2X0YA 2F61A 2ZUTA 2WMHA 1B3ZA 1E4MM 5HOSA 3MS8A 4D6GA 1BAGA 4CD5A 1RH9A 1KB3A 1HNYA 1ISWA 1D7FA 3SUSA 1BFNA 2VR4A 4AZHA 3EBVA 1H4PA 1GORA 1BYAA 3W29A 3PN8A 3EDEA 5F7UA 3FW6A 1ODUA 4MJ2A 3CPUA 4FLQA 4IPNB 3A6OA 3UR7A 4M56A 1ITXA 5C8BB 3OA5A 3MUY1 1OM0A 3QOMA 1QHPA 4FK9A 1J18A 1C7TA 5LA2A 4D6HA 4AW7A 5IXEA 4L4OA 2V38A 4PMOA 1UYQA 5AYIA 2VL4A 1OGGA 3W26A 4CN1A 3PTMA 4HMDA 4J3UA 1EQPA 1E5JA 1PBGA 5ECUA 2XVLA 1SR0A 2W61A 3W25A 4ZEPA 4LXFA 2WVVB 1WDQA 1EIBA 4C7DA 2J4GA 4MAVA 1E1FA 5A8QA 3UG4A 1UH3A 4FLRA 4LGXA 1KXQA 1JF6A 2BY0A 3SCVA 5KZ6A 5HPOA 2FHCA 4X9YA 4PMUA 3S6TA 2XHYA 5CSUA 4B15A 3KWXA 1E5NA 2MANA 4P8UA 3WNMA 2YDQA 3PHAA 4XB3A 5DEZA 2XM2A 1WDSA 2G3JA 1BF2A 2E8ZA 2GVYA 1UA7A 4H8UA 4ATDA 3ZO9A 3B9DA 4AZCB 4PMRA 5A6MA 2PWDA 1OD8A 1NOUA 2V5DA 3ARQA 3CO4A 5KEZA 1W1TA 4UFLA 2WHLA 4V2XA 1JGIA 3ZOAA 1IZKA 1UWSA 2Y8VA 5A6BD 1W9UA 3EMCA 1HJSA 1V0MA 3WH8A 3ZSTA 1E4NA 2G3MA 1PPIA 1JF5A 1VRXA 5FOOA 2ZX6A 1V0NA 2VURA 4NRRA 1HJXA 5I77A 4WIWA 3BMVA 2XYLA 1MWOA 3IK2A 3VUPA 2O9RA 1DWGM 2PB1A 2WCGA 4J3XA 2JIWA 3GXMA 4ZENA 1Y7VA 1FH9A 2DT1A 2GJRA 1K9TA 1BGGA 3MKKA 4GO8A 1R86A 2E0PA 5M17A 3WN6A 2J79A 5CLWA 3U7BA 4W8AA 1E0VA 1W9VA 2J62A 3WF4A 2QMJA 3U5YA 4W5UA 1GOOA 1KBBA 1VAHA 1QBBA 4IUGA 3D5HA 3T2QA 3VNYA 2DSZA 3WD0A 2VVSA 1FFRA 3MMDA 3BAKA 1E6PA 4AY1A 4DWSA 1EO7A 4JFUA 1H0IA 1OT2A 1E6XM 4P8XA 3CHCA 2VUYA 2XGBA 2PF0A 2ZIDA 4W7VA 1V3HA 4CUCA 1BYDA 3K8KA 1DWHM 3LPOA 4AWEA 6TAAA 4P7RA 2WLYA 3UG5A 1JZ7A 4PYSA 4M24A 2CBVA 1OSEA 3GNOA 3ZM8A 2AMGA 4TX6A 1E73M 4Z2JA 3VD7A 1HJVA 4GPNA 5TD4A 2J74A 1OGBA 3FAWA 3W37A 2EXOA 2WVSA 3CGTA 2YOCA 2Y24A 1LF1A 1V3MA 2WWCA 3SEPA 3O2LA 3WQVA 2JEQA 3VD5A 2GK1A 3UG3A 3I3BA 3NJ3A 4KRTA 1NOFA 4PTVA 4AXNA 2YKKA 3WIJA 1JYWA 4F79A 2CEQA 4C7GA 2J78A 1JD7A 1V6XA 3VIGA 1KQYA 4QLLA 3VDHA 4AD3A 3AZSA 3A4XA 5BWFA 4B9ZA 1C90A 2Y5EA 2OYLA 3SUWA 1CPUA 1R87A 5BCAA 1IV8A 4H8HA 4R5EA 3KL0A 3OB8A 2A3CA 3WSUA 3KE0A 3WQWA 4J27A 1WZLA 3WQ8A 4ACYA 2OLHA 1BHGA 1E9LA 4BA0A 4KWUA 1G5AA 3WD4A 2YL5A 5D4YA 4V27A 5M3WA 1VEMA 3AHZA 5I23A 4WLCA 4UR9A 1VJSA 1E6ZA 2HVMA 3NIYA 3ECQA 1UKTA 1EA9C 1OT1A 4NRSA 1AQHA 1KGWA 1NOWA 1KXHA 3VGBA 1JXKA 3M46A 2FHFA 2WK2A 2PWHA 3VO0A 5M5DA 1HL8A 1CXFA 3CZKA 4LQ1A 2C8NA 2E4TA 3EDJA 3SCTA 2ZWYA 3AOFA 4NZCA 2WMGA 1UKQA 2XJ7A 3I3EA 2EO7A 3JUGA 4PN2A 3FHAA 1RD6A 2E3ZA 1HIZA 4JL1A 4GI9A 2CBJA 1CGVA 1J10A 2J7BA 1NH6A 2G8ZA 5DT5A 2G3NA 4YHEA 2QHAA 2UY2A 2XIBA 4UZSA 3N15A 1XRVA 3VIOA 1CNVA 1W32A 3OLIA 3ZT6A 5I79A 5CGMA 3WH5A 3T0DA 1JYNA 4BS0A 5A8MA 1VBUA 1N82A 4HA4A 4AIEA 2CBUA 1JG9A 1GJUA 4HP5A 2GJXB 1CXIA 5D9OA 2J77A 3RDKA 1ZBKA 1WZMA 1WE5A 1HKIA 5E6ZA 5C70A 4W93A 1KBKA 1UD3A 3AS0A 1V6WA 1H3GA 4DWSD 3BCDA 4PEEA 1JDAA 2X8RA 1E15A 1XH1A 3WH7A 4UOJA 3PZMA 1ISVA 1JI1A 1QI2A 1MQQA 1W9XA 2GK1B 3CHFA 4UFKA 3L4ZA 3NDZA 2D2OA 1X6NA 2XWDA 1PIFA 3VIPA 2D23A 2YL8A 2BHZA 3VD3A 1TR1A 3SCWA 4M1RA 2VZVA 1E6RA 4MADA 3RILA 2G41A 4AD2A 2DGAA 4M8UA 1XV8A 3ARWA 4PMQA 1ZBWA 2D0FA 1PX8A 2YA1A 3K4AA 3GNPA 3SCPA 3N1AA 4B9YA 4XX6A 1CZ1A 2VT0A 3SUVA 3BGAA 2OWCA 4P8WA 2XGIA 4CD7A 3AHXA 3AMCA 5HNNA 3VM7A 4HU8A 1W3KA 1W3JA 4J28A 4ZE5A 3T08A 2JF6A 3O9NA 3BCFA 1CIUA 1E4LA 3CUFA 2XFFA 2XIIA 3AXHA 3G6MA 1CBGA 3LPGA 5GNZA 1U33A 4CGTA 2WWDA 4UNIA 1ZS2A 1NWRA 3RJXA 1FFQA 2FH8A 4URIA 1UQYA 3DYMA 2QV4A 3IAPA 1ZBCA 1CGTA 1E43A 2VQUA 2V3DA 2W62A 3ZT5A 1JZ6A 1DWJM 1XSKA 4AZGA 1XH0A 1C8YA 5A8NA 1Z32X 1V0KA 1JZ5A 3OGRA 4AZ5A 4CKQA 7A3HA 1OGSA 2XFRA 2X1IA 4EKJA 1C8XA 1QI5A 2W66A 4EANA 3BXWA 2GUYA 4OZOA 1HVXA 1TFVA 1G01A 2J47A 3AIEA 1QHZA 2BHUA 1KXTA 2EEXA 3QHNA 4DUWA 1JZ8A 2VNCA 4KMQA 1CTNA 3WH6A 3CZJA 2WCAA 4AEFA 2DSWA 4WJXA 2VTFA 4PTMA 4TTGA 3HJEA 1W3LA 4AC1X 1W1YA 3TA9A 4UFJA 4R27A 4CCEA 2BVDA 3F5JA 4X0VA 3SUUA 3GDBA 1QNSA 5E0CA 4XUYA 1E0WA 3AXIA 3RM9A 1QVBA 1C7SA 3THCA 1SYTA 1XD0A 4Z2IA 1HKJA 2GFTA 4JHZA 3PZGA 3VPLA 2W91A 1UQZA 4FLSA 2FGLA 4AZCA 1V6VA 2RGMA 4P7OA 4EE9A 4PTXA 1BVNP 3VMOA 2W5FA 1H1NA 4QFUA 2WBGA 2O92A 4MTVA 5A95A 1E70M 1QOXA 3J7HA 5JIPA 3SCNA 1ZU8A 4GIAA 1JAKA 1V0LA 1AMYA 3VIIA 4GI6A 1ITCA 4LYQA 2BVTA 4PUDA 4Z2KA 1JXJA 1VFFA 2UY4A 3UR8A 1DTUA 2CBIA 4WK9A 3VX0A 4W5ZA 1F4AA 4C7FA 2DDXA 1GQIA 3RIKA 4OIFA 1CENA 3W81A 3F5LA 5CSYA 2BY1A 1OB0A 2X05A 5E0FA 2VX7A 3CUHA 1J0ZA 1AVAA 1WO2A 4D6FA 2PI6A 3WQ6A 1H41A 3MUIA 5IFTA 1WAWA 3AIBA 1SMAA 4PMYA 3A47A 4Q7NA 1EGZA 2WB5A 2AAAA 5I78A 1XH2A 1W9BM 3NSXA 5FKYA 1JIBA 2CKSA 3RM4A 4ATWA 4ML4A 4L4PA 5FIPA 2OWXA 2WSKA 5HDRA 3EYPA 1FH8A 1J11A 4MNJA 1I75A 4HZ8A 3ZQ9A 1KGUA 1NM9A 4OKDA 2XVPA 1MW2A 3OBAA 3M7SA 2A3HA 4AISA 1WCGA 2E9MA 3OGVA 3WNPA 3TTYA 3CZ8A 5LA1A 1VF8A 1WPCA 1CLVA 1UZ1A 1UA3A 5A69A 3L2LA 2YL6A 4UQAA 4JAWA 5BROA 1PX4A 4RE2A 4BCEA 4JIEA 3VGHA 1J0HA 3PZIA 1BG9A 2OSYA 1XCWA 2J25A 1J0JA 4LX4A 3BAYA 1B3WA 3TP4A 3GXDA 1GVYA 4CN4A 5CPTA 2XUCA 2VI0A 2XTKA 4M82A 4UQ9A 1M01A 3T2OA 5GNXA 1G1YA 4MDPA 1UD6A 3KZSA 4D6JA 2J7CA 4CD6A 3AHVA 5JIWA 2CHNA 4P7LA 2BFGA 1X6LA 2ZE0A 5AC4A 1V6UA 5BRPA 4HU0A 3GNRA 1BG4A 1EDQA 3GYCA 2NSXA 1HL9A 4GINA 4PMDA 1PEZA 3MV11 2WC3A 5A2BA 2Z1KA 2WVUA 3W6MA 2ZUMA 5E70A 3MU7A 4U5KA 1MXGA 3VIKA 1H09A 3GM8A 4AD0A 3K46A 1QPKA 3CZEA 4CU6A 2V3FA 4LPCA 2PBOA 3TTOA 4UQEA 3AYRA 3T0BA 3WEZA 2YA0A 5GPRA 3CIVA 4N42A 1O6IA 1QNQA 1VEOA 4D6DA 4MB5A 5JUVA 1VENA 1LL6A 1TG7A 2EPKX 3SCSA 1MXDA 1VIWA 5A6SA 4CD4A 2CYGA 4CCCA 5HXMA 1UHVA 3PZTA 2J7FA 4YN5A 3LMYA 2DQXA 5I5RA 1VFOA 4OBSA 3ZR6A 2EJ1A 4HA1A 3W27A 4LYRA 4HOXA 5IHRA 2DIEA 5BXTA 1O7AA 4S3KA 4TTUA 1ISYA 3OGSA 2GJXA 7CGTA 2VX4A 2XVKA 4AEEA 5E6YA 2Y4SA 4RE3A 2J7EA 3SCQA 1J0YA 1B0IA 4B16A 2WMIB 4AZ6A 1MW0A 1HVQA 1R85A 2J7GA 2YBTA 3EMQA 3SIMA 3WD1A 2VX5A 2WANA 4AIOA 4FF5A 1V3KA 1UR0A 2D0HA 1UWIA 1BPLB 4ZXOA 4EK7A 5HBFA 1FH7A 1JDCA 1NARA 5D9PA 3VDAA 4NSBA 1BYBA 1GJWA 1HT6A 5D9MA 4NI3A 3PZOA 3ARZA 3WDRA 3MV01 5DF0A 2DIJA 1GQLA 3GZAA 3N12A 3WFZA 4AYSA 3WDHA 3L4YA 5CXPA 3PZUA 3N17A 4U3CA 1GUVA 1OINA 3BAWA 4QCFA 5JBDA 3AI0A 2CIPA 1JD9A 3VD4A 3PBGA 2ZX7A 1CGXA 3IJ7A 1UD4A 3VGDA 1VBRA 2EPOA 4UQDA 5E9AA 2ZX9A 4GZIA 2WHKA 2NT0A 4GI8A 1HKKA 1YQ2A 2EBNA 1TVNA 1LL7A 2CNCA 5D8ZA 3WKZA 1E55A 2ZXBA 3CUIA 3U7VA 3T09A 3WUGA 1GCYA 3L2MA 3W38A 1V02E 2WMJA 2EPLX 1ISXA 3AIVA 2BV9A 1FHLA 5CGTA 2VMFA 1QHOA 2BXZA 1H49A 4D1IA 5ABFB 1Q6GA 3VDCA 1UD2A 2J8FA 4BQ3A 4QLJA 4BQ4A 3FHQA 5BYWA 2BHYA 1ESWA 4Z2HA 2YLLA 2WMFA 3NSNA 2WHJA 5FCZA 5I0DA 3N13A 5GQBA 4D6EA 4W84A 1D3CA 2GJPA 1PJ9A 2WXDM 4JKKA 3VX1A 2F2HA 4EAMA 3BLPX 3AIQA 3DHPA 5FL1A 2VJXA 3GXIA 2AOSA 5HPCA 5EB8A 2UWFA 3ZMRA 3BMWA 3KL5A 3VGEA 1QW9A 3GTNA 3DYPA 5M03A 1UH4A 3WD2A 2ZXDA 2XFYA 3PZVA 4DWSC 5I6SA 3AHYA 2XVGA 2D3NA 3K8MA 2BS9A 4HOZA 4WSKA 4WSJA 3ZJKA 4BZYA 1CYGA 1HKMA 3N04A 2DSVA 1XGZA 2BNJA 2GSJA 1TCMA 2ZUSA 3AS1A 4D71A 2CESA 1G0CA 1S46A 3IJ9A 1U30A 3WFLA 3BSHA 2ZXAA 3ARRA 1KGXA 1QNOA 4DM1A 1DWFM 2FDMA 2ZICA 5JBEA 1DEDA 1OIMA 2E9BA 4OBRA 4WKAA 3AICA 5AYBA 1HJQA 3VIFA 1E40A 1DWIM 5AY7A 4HZ6A 1VFUA 2BY2A 4QDMA 4U33A 1B9ZA 1W1PA 2GDUA 8CGTA 5EMYA 2XVNA 1JYVA 1BLIA 1B30A 5EBAA 2QPUA 1UR1A 2VR5A 4K68A 2DH3A 3RMEA 4P7QA 1KR0A 3EDDA 4U3AA 4PMZA 4CVUA 1PZ2A 1CXLA 1F4HA 3AIUA 4TVDA 2DSKA 1WKYA 5GNYA 2VCBA 3CMGA 1HJWA 3WF0A 3AHTA 2J8GA 4GO9A 4UCFA 1CWYA 2WZIA 1EH9A 1B3XA 1KR1A 1UWTA 1XYFA 4KH2A 3ZIZA 1E71M 1C93A 4TX8A 3FNDA 3AZTA 1JZ3A 1VJZA 1M04A 1OIFA 2PBGA 7TAAA 3BSGA 1E3XA 5BXSA 2VZSA 5A94A 3ALFA 1OCQA 1HF6A 3II1A 2WBKA 3WD3A 2PWGA 3GXFA 4E8DA 1OBAA 2WAGA 1V08A 2YA2A 1LL4A 1KCKA 3F4VA 1UH2A 1E4IA 1JI2A 2CETA 1US2A 1PZ3A 1I1XA 4ACZB 1B2YA 4IPLA 4QLKA 4PCSA 4GQRA 1ZJAA 3GH7A 3BC9A 3G6LA 3W6LA 1EDGA 1ZB5A 2DH2A 2BXYA 2A3BA 4M80A 1FP8A 3A3HA 1H2JA 1TA3B 3EDFA 3CHDA 3GH4A 3U5UA 4MB3A 1XYZA 3ARPA 3NDYA 1B1YA 4D6IA 1WZAA 1AQMA 3UETA 4MDOA 1EO5A 4DM2A 3PZQA 4M81A 2WMKA 4BQ5A 1JAEA 2QPSA 1KXVA 3B9AA 4PBGA 1FP9A 3WQ4A 1GZJA 1B3YA 5CG0A 4HMCA 3VMPA 3L4XA 1UWQA 1J01A 1JFXA 3POHA 3GH5A 5IHSA 3THDA 1I1WA 2Z1SA 1UKPA 1JYXA 1WP6A 4MNMA 2X2YA 4W8BA 1NWUA 5BXRA 3AXXA 1A3HA 5CPQA 1JDDA 1V3LA 1US3A 3VINA 2E9LA 1E56A 1V03A 2VOTA 2FGZA 2VX6A 1UOKA 2WZEA 4ATLA 2PWEA 3EDKA 2C7FA 4IISA 4A3YA 1JL8A 1GNXA 3MSGA 3ZR5A 1AQ0A 2Q8XA 1UKOA 4H8VA 3TTSA 4OUEA 1HXJA 3I3DA 3VDBA 2DEPA 2A3AA 5CQ1A 4J3TA 2D24A 4E2OA 2Y2WA 3VVGA 1GQJA 3GBEA 4OOZA 5C71A 3CZGA 3OZPA 3W53A 2VZOA 3CMJA 1Q4NX 4PMVA 2ZXQA 4AZ7A 3WMCA 1EXPA 2D3LA 3F5KA 2J7DA 1CGWA 2VQTA 5FD0A 5A2CA 2QF8A 5BRQA 1UR2A 3T0AA 2ZUNA 2W4XA 4TUFA 1UD5A 3KL3A 4D72A 1XD1A 1K6AA 3CUJA 4WF7A 2WVTA 5BXPA 1L0PA 5LA0A 2ZUWA 3UESA 1UWUA 2UY5A 2XM1A 4W89A 4UQCA 1R7OA 2RGLA 3AMDA 1KWKA 2ZOXA 4V28A 3NSMA 3BAXA 4GXPA 4MB4A 2BY3A 2UY3A 2XSAA 3VILA 4P8VA 4CU8A 1EDTA 3WUEA 2TAAA 3B8SA 3L4VA 3ZT7A 5I3DA 1J0IA 1RP8A 3ARVA 3OIHA 1V6YA 3WELA 3QOKA 1UUQA 3WNKA 1E6QM 2WMIA 4UFIA 1LQ0A 3APGA 1LJYA 4J7RA 2QMKA 3W28A 4CU7A 5A8OA 4WKHA 3UEQA 4A4AA 6A3HA 9CGTA 3ARYA 4UOQA 4PTWA 4HA3A 4H2CA 4JCMA 3T2PA 1HN1A 3VIJA 2E40A 2IXUA 4AD4A 2JE8A 1GOQA 2D20A 1QNPA 4JFTA 1IT0A 2YJQA 3WF3A 1OD0A 2YDSA 3FAXA 3L4UA 1X1NA 3WNOA 1B3VA 1GHRA 3CH9A 4UFHA 2VO5A 3BAIA 4J3SA 2XWEA 2WZHA 4CN6A 3RO8A 3WUFA 1QI0A 1QI3A 3N18A 2IXVA 3QHMA 1HP5A 4CVWA 3AMKA 1CXHA 1W2VA 6CGTA 1L8NA 2CERA 1UWRA 1HJUA 1GOWA 1GOMA 1Q6DA 5CJ5A 1UZ4A 1WNOA 4LYPA 1Q6FA 5A2AA 3NUKA 2J7HA 1GVIA 2VVNA 3WDIA 4F8XA 1XCXA 1XC6A 3B9EA 3TTQA 4F9DA 1BQCA 1HP4A 3AIRA 3IAQA 5IFPA 1RPKA 3M07A 1Q6EA 1TMQA 3WENA 4TOQA 5ABHA 1VFMA 3CTTA 3RCNA 2CHOA 3DC0A 1J9YA 2DT2A 3VGGA 3VD9A 4MAZA 3WMSA 1CECA 1LWHA 2IUZA 2NT1A 1CGUA 3O6AA 2DPEA 5ABFA 3PZ9A 1BTCA 2WHMA 1TZ7A 4AD5A 2YDRA 1TUXA 3HU7A 3OLEA 3CLWA 3AMGA 3HMCA 1XSIA 4NF7A 2ZUUA 4F66A 4KRUA 3MSDA 1MVYA 5CPSA 3RPMA 1PAMA 2X09A 1KWGA 1W9DM 4HPHA 2VRQA 2XG9A 5FL0A 4JFVA 4PSPA 3WBAA 4XZWA 1V3IA 3MANA 3VMNA 1MQPA 1EHNA 2WYSA 5DFAA 3WEOA 1PX3A 1UR4A 4Q22A 1DWAM 4BQ2A 3OLGA 1V3JA 2D1ZA 1C3FA 5DO8A 3VKKA 2JALA 1ECEA 4W7UA 1K9DA 3UERA 3VTRA 3KEHA 1NP2A 1M7XA 1MFVA 2D22A 4AZBA 2ZUVA 4H41A 2WLZA 3ZJ6A 2FHBA 1E6NA 2CKRA 4JFSA 5A8PA 1UR8A 4TXEA 3WNLA 4RE4A 2DSUA 1JNEA 4CD8A 1UKSA 5D9NA 3U57A 1QI4A 4RL3A 1XHGA 5ABGA 2WSPA 1EQCA 2ESCA 4Y7EA 4UZUA 3WF2A 2J75A 5LYRA 4J3VA 1CGYA 4HPGA 1EOMA 3CBWA 3WEMA 4UQBA 2ZWZA 3NYDA 1UR9A 4OOUA 1V02A 1E0XA 4X0NA 4AZIA 1LLOA 1M53A 3TONA 5D8WA 2WKGA 5DT7A 1FA2A 1WB0A 3FXYA 4W87A 4W8LA 3TOPA 1E6SM 4JZ5A 4XZBA 3WH9A 2PWFA 3PTKA 4KGLA 4E8CA 1BYCA 4D1JA 4IM4A 2X0HA 1G94A 1J0KA 3WF1A 3W24A 3AS2A 1W2PA 2Y8KA 4PMXA 1H0GA 3WY1A 4F9JA 3AS3A 2WC4A 4H04A 4ZFMA 1GOKA 4KGJA 3D3AA 2XSBA 3VNZA 1QBAA 5I2UA 4Z2GA 1MYRA 3MMUA 3BH4A 3PTQA 2VRKA
chains in the Genus database with same CATH superfamily
1GW9A 1KQZA 3EWWA 1DJYA 4QEHA 1FCQA 1JZ2A 4I5XA 3PP7A 3VA8A 4CNUA 3FA5A 2QS8A 3H8AA 1CDGA 3BUVA 4O11A 1FTXA 4DJFA 4JICA 2JKPA 1ZL1A 3ITYA 1SO4A 2YL9A 1EP3A 1YHTA 4PRRA 4O28A 1OK6A 4MIMA 2R14A 4TMCA 5ABEA 3EOUA 2IW0A 3WBXA 3F1QA 3UPBA 2ZC1A 3FJLA 4KFNA 3POCA 4WD0A 3SCOA 3GS6A 3LPFA 3P74A 1W56A 8XIAA 1JCMP 1S1RA 2QUMA 5IDIA 3RJYA 4FXFA 3VIMA 4DWSB 2PFHA 1K4GA 2PURA 3RUBL 1QUMA 4QAWA 1YNPA 3ABQA 4E2DA 1FWAC 3BLOA 4DVOA 3DKJA 2HS8A 2QIWA 3SRFA 3TQ0A 1GEQA 1C8VA 1JQXA 5A6JA 5HINA 4PCTA 1NQKA 1W0MA 4UTFA 3SCRA 2EPMX 4B3KA 4OT7A 2C0HA 2E1WA 4XUGA 1VCVA 3UXIA 2ZX5A 3WBYA 3WMBA 1C91A 2ABBA 4PMNA 3S4TA 1CEOA 1W91A 3MUAA 3EOSA 5HATA 1DPMA 4WEVX 3EPMA 5JH2A 1GVEA 3LNPA 4FNUA 3GDRA 1YEYA 2R8WA 3N2MA 3E2VA 4DF0A 4CCDA 3L21A 1NWSA 1FWEC 4MNKA 2VGIA 1ZENA 4B4FA 5EFDA 5TBOA 1S5VA 2P88A 1VYPX 1BGAA 4AMCA 2OWWA 1ZBVA 3H55A 4JTGA 3W1RA 4IQJA 3RX2A 4MPKA 3AAMA 3BLKA 3QZ6A 2W0UA 3KRZA 3QYSA 4C1LA 5K9CA 4D8AA 2NVAA 4ECLA 1GPFA 4X22A 4DBDA 2XPKA 4HMEA 3F4WA 5JMUA 2OYMA 3MYOA 3USZA 3RRXA 1KFBA 3W82A 1SW0A 3K4DA 2VZTA 5DMYA 3S5OA 3VOHA 2GL5A 4FMVA 5A1AA 1HL2A 4R7JA 1M6JA 2JFEX 4M29A 1JRBA 2ISVA 4U2YA 5G1MA 3TN3A 1VP5A 3QM3A 3GC5A 2FVMA 1PHQA 1OWQA 4HBKA 1MQRA 3CZLA 4AYGA 3BK0A 4XO7A 4U2ZA 1D2KA 6REQB 2YBUA 2CLOA 4YYCA 1U22A 5I03A 4XIMA 3W7MA 2VEFA 2GGGA 3CUGA 4RPPA 3VOCA 2CITA 3L4TA 3T8LA 4UC5A 3IJ8A 5CZ0A 1U5HA 2F8QA 1XIIA 3BOLA 3NM1A 3DECA 2WPGA 4A8RA 5TNVA 1LG2A 2QAFA 3UQNA 3W87A 1RPXA 5FJPA 4JN6A 3G8EA 1SMDA 1NWTA 4OJYA 4GKLA 4YJ5A 4MG4A 4A21A 1A80A 1XINA 2DVXA 4LSBA 1W3HA 3IVTA 4K1WA 3WBEA 4PB5A 2BTMA 3TC3A 3LTSA 1KFWA 3W4RA 4WDTA 5A6BA 2F84A 3I6EA 2VCAA 2HSAA 2IPFA 3WNNA 1MXSA 1C8QA 3Q45A 2GDVA 4HZ7A 1EA0A 3RCMA 2I17A 3W7OA 1K9FA 1VPYA 1IXPA 1EEXA 4JX5A 3SZ8A 1QDSA 2V3GA 3MSYA 2Z27A 4IGMA 4C6MA 1M65A 1HX0A 2QCFA 1IZJA 1CXEA 1O1HA 3UZZA 5E5CA 1GKRA 2DT3A 2JIEA 2ZBTA 4ZO6A 1J6OA 3VCNA 3AJ7A 2W63A 4NAFB 3H6OA 3FN9A 4ZO9A 1S2UA 2X0YA 4IPIA 1KM3A 3ORWA 1B3ZA 3QV8A 5HOSA 1FQ0A 1BAGA 3B0PA 1RH9A 3SJNA 1OF6A 4JTLA 5HQMA 3FYPA 4EPBC 3QMRA 1BFNA 3MKCA 1ZHAA 2J6XA 2J9YA 4B5SA 3SBFA 1Y65A 3P5YA 1BYAA 1GJPA 2BBFA 2BWGA 1ODUA 1ITXA 5FJOA 1F05A 4REQA 1QFEA 4C1NA 3AALA 1C7TA 3KCOA 3SM0A 4IQDA 5IXEA 4MJZA 2YB4A 1OC7A 2J27A 2V38A 1BWLA 4NL1A 3TYUA 1VR6A 3W2JA 4J3UA 1E5JA 4AEOA 1J5TA 4YNGA 3GVWA 3W25A 4PL2A 3NQDA 3B40A 5KZDA 3VOGA 4KCWA 1EIBA 4C7DA 5HMDA 1XLDA 3EXTA 4RK8A 4BF5A 1E1FA 1SO3A 2FMNA 3W7PA 4FLRA 3TX9A 2DVTA 1JF6A 1T96A 3D46A 2FHCA 3TJ4A 4PFHA 1AH0A 3P61A 4N9CA 4B15A 3KWXA 1R3YA 4P8UA 2P0IA 1PTDA 2FGBA 1XLFA 3PHAA 3BGGA 4X2RA 4ATDA 3CV6A 1OD8A 3R13A 5F4XA 1W1TA 5C9XA 3DFNA 5I09A 1IZKA 1SR9A 1UWSA 2Y8VA 3EOOA 3EMCA 3S5YA 2Q8LA 1V0MA 1JUEA 3Q94A 3M64A 3PUOA 1PPIA 3NPVA 2ZX6A 3GDLA 1FDYA 2JKAA 1MI3A 3HOJA 1KLZA 1O60A 3R0DA 1DWGM 3DZ1A 2ACSA 2Y85A 2Y0FA 3PFRA 1KRMA 3TN6A 1Y7VA 3WQPA 3C4UA 4RNJA 1NFBA 2C0AA 3P84A 5FF2A 1HW6A 4HHHA 3U7BA 1W9VA 6XIAA 4JTHA 3U5YA 1KBBA 1PO9A 3V5OA 3WK2A 4IUGA 3D5HA 3T2QA 2DSZA 1A0EA 1FFRA 3PBYA 1E6PA 1XBXA 4AY1A 4XAGA 4DWSA 4JFUA 4CQCA 1KM4A 2OR2A 4W7VA 4MYAA 4CUCA 5D03A 1BXCA 6TAAA 1AODA 1RVKA 3UCDA 4PYSA 4LS1A 5D33A 1OSEA 1VPXA 3NQ8A 2FZ8A 1XC4A 2J74A 1OGBA 4O16A 1P43A 2WVSA 4LV9A 2C3ZA 3NQ7A 1LF1A 1GPWA 3O2LA 3GXNA 1W54A 3N6QA 2GK1A 4XQ6A 3UG3A 5EBUA 1TJ2A 5HQEA 3KDNA 1JYWA 4F79A 2CEQA 2J78A 3UWZA 3SFKA 3H22A 3QN3A 4H9UA 1B3OA 4Q8NA 4QLLA 3AZSA 2OT0A 5BWFA 3KTXA 4B9ZA 1C90A 2OQYA 5C0QA 3UR2A 4PH6A 1CPUA 1R87A 4ORMA 2YFNA 3T81A 3T4WA 4H8HA 4R5EA 2A3CA 5BRBA 3WSUA 3WQWA 2NWSA 3GXPA 1BHGA 1YE6A 3THQA 3N2XA 3CH0A 1VEMA 4UR9A 5JU6A 1VJSA 1A50A 1E6ZA 1KFLA 1YDNA 3FGCB 3KHJA 1WOAA 2NQ5A 4NQ1A 1KGWA 5I7GA 1KXHA 2BGQA 2FJKA 1HL8A 1CXFA 2I56A 3GU1A 3OOQA 4Q4OA 3RU6A 2PGRA 3CZKA 4LQ1A 1IEVA 3TAOA 4EWJA 2C8NA 1Y8BA 3KBWA 1VQTA 4NZCA 1UKQA 4S3EA 6XIMA 3H4WA 4PN2A 3FHAA 1LROA 3BCJA 1MMFA 1J10A 5MHBA 4O15A 4A3UA 6REQA 4MPQA 2QHAA 2XIBA 2WSQA 1XRVA 1W32A 3OLIA 5H8PA 3ZT6A 5I79A 3WH5A 1EF3A 4RUBA 1PUDA 3QYQA 3QW3A 1J93A 1N82A 3WQFA 3QQ0A 1GJUA 4HP5A 4LV4A 4JR5A 2BXVA 3RO6A 1MDLA 1JVNA 6TIMA 1ZBKA 3N9SA 3ABXA 3V75A 4W93A 4E4UA 1I9CB 1T0OA 5AN7A 3LI1A 1OFEA 2ZADA 3EB2A 4GYPA 3N3MA 3WH7A 3O0FA 2CLKA 3UU0A 1REQB 1ICQA 1P0DA 1ISVA 3UWUA 2BG5A 5J04A 1W9XA 3CHFA 4UFKA 3L4ZA 3NDZA 2D2OA 1X6NA 2XWDA 3E0IA 1KRAC 4R7OA 3ZWSA 2P10A 1A49A 5PTDA 4UR7A 1XV8A 3GDKA 4IXHA 3ARWA 2VEMA 2YXXA 1PX8A 3CU2A 4ALDA 3SCPA 1YTEA 4XX6A 1UP2A 3MQTA 4LBSA 1K02A 2QCHA 3LBOA 4NAFA 3B0YA 4BI5A 5I02A 1W3JA 6ENLA 3T08A 3W2NA 1WX0A 1MUMA 3VZXA 2IS7A 4GRSA 3WJSA 3K4WA 3M16A 4EXQA 5CPMA 4V33A 1U33A 5DMMA 4NJKA 2WWDA 3BLIA 4UNIA 2AGTA 3M43A 2ZYFA 3W3OA 1F61A 1W1B1 4Z1DA 4RJEA 3MTWA 1E43A 2VQUA 2V3DA 4X2PA 3TN5A 1U5JA 4DJFC 2P53A 1C8YA 5A8NA 5SWUA 3OGRA 1XLCA 4DXXA 5DMLA 2QQ6A 4ML9A 4CKQA 3GX9A 3M9YA 2PS2A 4LJ3A 5XINA 4QG6A 4OZOA 2NXHA 4C6KA 1BQGA 2J47A 3G1FA 3M0IA 4KMQA 2ZRZA 3WH6A 3IIOA 1T8XA 4A8IA 2WCAA 3KTSA 4AEFA 2DSWA 4WJXA 5G2HA 5CAHA 1GVQA 4IF2A 3GIQA 4TIMA 1DXEA 3N2TA 3P81A 1XIMA 4R27A 2DJXA 3F5JA 4X0VA 4AMAA 1DKWA 1XS2A 1QNSA 5E0CA 4LYKA 2CLHA 3AXIA 3G0SA 4DYJA 3NQFA 1FVPA 3T40A 3CUXA 5E9XA 4FLSA 2BGSA 2FGLA 3IEBA 1V6VA 4P7OA 3VMOA 4LOCA 4QFUA 3KCLA 3W9ZA 4DZHA 3ZS4A 2PDMA 2HZGA 1MNSA 2OZ0A 5JIPA 3SCNA 3TQKA 1AMYA 3E0FA 3LHVA 5HJLA 3NO1A 4PUDA 2ICSA 2KZHA 3ISIX 2PC4A 3RR1A 2V2HA 4MUPA 2VFGA 5CSYA 1QMLA 3K5XA 5ECVA 1EJVC 1OFQA 4C6OA 2VX7A 3CUHA 4NZ4A 1J0ZA 1WO2A 4D6FA 4H6RA 3W7DA 5XIAA 3W86A 2NV2A 3W7EA 2DZSA 1KTCA 2H8XA 2WB5A 1XRTA 1EC7A 2PP3A 2CKSA 5EU9A 2OWXA 4JYFA 2WSKA 4L56A 1J11A 3F2BA 1A5NC 1W1ZA 5BWAA 3N2CA 3WLLA 1NM9A 4GQ0A 3JVAA 1P5BA 1MW2A 3OBAA 1A0CA 2VEIA 1TMLA 3E49A 4AISA 3EEZA 2R6OA 4S3AA 4NX0A 4O12A 4WOZA 1Q63A 1FCVA 5H8MA 4F48A 4RE2A 5EMJA 5BMXA 2NLIA 3S5SA 1FWBC 1LYXA 1BG9A 2OSYA 1XCWA 2PDHA 1Z44A 1T8QA 1P0EA 3CYJA 3TP4A 3XISA 3OTRA 4CN4A 1F3WA 3CV1A 2VI0A 3IJIA 4UQ9A 5AHFA 1XM3A 5GNXA 3FDKA 1UD6A 4XZLX 2R9RA 1Z6KA 1X8FA 3QC0A 3EPNA 3LRMA 4JN8A 2CHNA 4P7LA 4AVFA 2PDUA 2ZE0A 3I6TA 2QAPA 1VH7A 5BRPA 4HK7A 4AY8A 5CH9A 3GNRA 4KRZA 3P93A 5G1TA 2QF7A 2CLFA 2NSXA 1A5SA 3PC0A 5FEZA 3LHZA 3N2OA 4Y6GA 4S3FA 4IXXA 3FGCA 4M19A 3E02A 5D04C 4ZCWA 3VIKA 4AD0A 1EBGA 2CLIA 3HZ3A 4FOJA 2V3FA 3L5AA 5GJMA 3NEVA 2RKXA 2V5BA 4NJGA 1J2WA 3AYRA 1QWKA 4UTKA 2HK0A 3T0BA 1TRDA 2BB0A 1PV8A 4V15A 4FSAA 4N42A 1O6IA 2B81A 1QNQA 4IIDA 4FOKA 4DO5A 4JXCA 4D6DA 1VENA 3NO3A 5EY5A 1FCUA 1LL6A 1TPEA 1TG7A 2EPKX 4CD4A 3DXIA 5HXMA 3RF9A 3CQ0A 5EA9A 2GZXA 3V1HA 3V16A 1NTHA 4HSHA 3M0YA 2PCEA 4HA1A 3W27A 3UYIA 4IL0A 1TELA 1XLIA 3C3UA 3A23A 3CL8A 2GWGA 2G97A 3PWGA 1FKXA 3S9IA 3S0CA 2VFFA 2OOFA 2G50A 2GGIA 3KWSA 3KHDA 4RW3A 4XD5A 1SJCA 1J0YA 4QQUA 1SJBA 4GJJA 4AZ6A 1OF8A 1MW0A 1HVQA 4NJIA 3CL6A 1VBHA 1R85A 1DQWA 2J7GA 1WXYA 2YBTA 1X7FA 1W1IE 4AIOA 4FF5A 1UWIA 3H12A 4ZXOA 1REQA 2W9MA 1VIZA 4LTSA 5D9PA 3VDAA 1BYBA 5DF0A 3N12A 3WFZA 1S2AA 3WDHA 4LNYA 2NX1A 3N17A 1GUVA 4QCFA 3AI0A 1JD9A 4DXVA 1UD4A 5C7HA 2V9DA 2NT0A 4AUBA 5LIWX 1AH4A 5HJYA 1Q7MA 2V5JA 1F73A 2X41A 4IJCA 3TH6A 3B03A 2OKTA 2G96A 2FFCA 2OG9A 3T7VA 5G2WA 1I6NA 2BV9A 2VMFA 3B06A 1PE1A 1RA5A 5FF0A 4H6QA 4KCTA 3I68A 1VBGA 4AF0B 1YDYA 1ZP3A 5ABFB 1UD2A 2J8FA 2VC6A 4BQ4A 2HRWA 4N02A 4GH3A 5I0DA 3TA6A 2GJPA 3LG3A 3NZRA 4XZHA 2F2HA 1TPH1 4HT3A 4X61A 5FL1A 5MKGB 4ERAA 2AOSA 4V1YA 3GU9A 4LEFA 3OBKA 3PZVA 4GYFA 4DWSC 1AW5A 3QPEA 4BR1A 2WV8A 3D47A 1KKRA 1S3HA 1XWYA 1XBVA 1KBJA 3LV6A 1TPC1 4HOZA 4WSKA 4JIHA 4KCVA 4WSJA 6ALDA 5FESA 3ZJKA 4WCJA 3W1TA 3R8GA 4G1NA 2BNJA 2NXIA 2ZUSA 3FFSA 4D71A 1UPMB 3IGSA 1U30A 3ZLGA 1XLBA 3WFLA 2WPBA 4NAEB 3UXLA 3MJMA 1QNOA 1DWFM 5JBEA 1DEDA 1G69A 3HG3A 3SB0A 2E9BA 2YR1A 4OBRA 3AICA 4NZFA 5AYBA 1DTNA 4C6LA 1L2QA 1HJQA 3VIFA 1E40A 4GMEA 3H23A 5H8UA 2YDAA 1B9ZA 2I5QA 5K3VA 3E2QA 5I3HA 3W1XA 3TTEA 1W1PA 1IE7C 1W31A 1DV7A 1OZQA 4AWTA 5AHIA 1JYVA 1BLIA 3K30A 2DUXA 2QPUA 2VR5A 4DJDD 4P7QA 5CPOA 4U3AA 1EJTC 2YCIX 1T41A 4CVUA 1PZ2A 3UT0A 1CXLA 3G1XA 1V77A 1WKYA 2P76A 2JGYA 3KOXA 3TXVA 2OT1A 1RHCA 1FWIC 3CIWA 4UCFA 4MJMA 1EH9A 1RCOB 2NXGA 1PDYA 3STPA 4RKAA 1JZ3A 4H1ZA 3W00A 4ZOCA 3W7GA 3BSGA 1LORA 4O17A 5BXSA 1QU4A 3WD3A 2WBKA 3GXFA 1XBZA 1LL4A 1P1MA 2NQZA 2NUYA 3LGDA 2C71A 4E38A 1US2A 2ON3A 1PZ3A 5K9XA 3KUMA 4ZMGA 4NIRA 2FPVA 3GH7A 3BC9A 1H7XA 4Z42C 3UA3A 1M5WA 4KESA 1TA3B 1MEHA 1YYAA 1LTDA 3L0NA 1Z8AA 1B1YA 3EZ4A 4R9OA 4FALA 3PBVA 3CQHA 1B4KA 3WK1A 2WMKA 2QGHA 2QPSA 1XPGA 3B9AA 5LIUX 1OZMA 1GZJA 1B3YA 4H3DA 1HKWA 1MRQA 3L4XA 3KP1A 4GYPC 5IHSA 1W5MA 3WQDA 4KPLA 2UZ9A 1CLKA 3THDA 2A3LA 4ZO8A 1ZJHA 3W74A 1TIMA 3NQEA 4FIRA 4L64A 4B3ZA 1V3LA 1ZALA 2VOTA 1K8XA 4UBPC 3V36A 2PWEA 3UXKA 3WBWA 4K7VA 3MSGA 2AMXA 2Q8XA 4KEUA 1XR2A 3LM3A 1LWIA 2FTPA 2A3AA 2RAGA 3VVGA 1P4CA 3SGGA 1RAKA 4LY4A 4YS1A 3CAWA 3CZGA 4DF1A 1FUYA 2VZOA 2V2DA 4L7ZA 4PMVA 2VFEA 1EXPA 4ZR8A 5H2ZA 1KV5A 4ENLA 1PKMA 2J7DA 5F2IA 1M7OA 2FVKA 3JS3A 2AL1A 3B0VC 1UR2A 1XUUA 5C54A 3P14A 3KL3A 4WF7A 3UYCA 5U4NA 3GAKA 3NEHA 5BXPA 2ZUWA 3SGZA 1J6PA 3H4XA 5CGQA 4ES4A 4W89A 4UQCA 1B54A 1J4EA 3AMDA 3LLFA 4YWSA 4H9XA 3SY5A 2GVLA 3VILA 3FVDA 2O0TA 2TAAA 3B0XA 1LT8A 4FEZA 1TE6A 1J0IA 1X38A 2BGNE 3G1DA 3EWDA 1TMHA 2QVHA 3WNKA 3MHFA 4UFIA 1LQ0A 4J7RA 1K8ZA 2QMKA 3UEQA 6A3HA 9CGTA 4UOQA 3BOFA 3R1ZA 3M0JA 3T2PA 5DY3A 1DJWA 4AD4A 1P48A 3QLDA 3MHGA 3QRHA 1VHNA 3PBUA 2CXEA 3WF3A 4DQWA 2YDSA 2WM1A 4OUIA 1X1NA 2EHHA 3WNOA 4S38A 7XIMA 1GHRA 2XH7A 2VO5A 5DCDA 4HN4A 2DV0A 2XWEA 1TTPA 2HBVA 3DCPA 1WDDA 5DXXA 1QI3A 1PWMA 3QHMA 1HP5A 4XBKA 1CXHA 4HU3A 3CASA 3WLPA 3G2GA 1PWLA 2EKCA 2QJGA 5CJ5A 1UZ4A 1WNOA 4RV3A 3NUKA 2VVNA 4HPXA 4K37A 5K4ZA 3U2EA 3IAQA 3NQVA 1S38A 1Q6EA 1TMQA 3WENA 3R11A 3DG7A 2VP8A 3DC0A 2JGQA 2DZUA 2DW6A 2DZBA 5JXQA 1LWHA 3W76A 1CGUA 1I60A 2DPEA 5ABFA 4Y9PA 2ZA2A 4WGHA 3PZ9A 1BTCA 3TMLA 2PTDA 4AD5A 2I5IA 3PJWA 1TUXA 5HR6A 3HU7A 4BKNA 4F66A 1MVYA 3RPMA 1H5YA 2X1UA 5K7JA 2X09A 4IGNA 1EJRC 4HPHA 5BW6A 2VRQA 1XYMA 3IIZA 3MANA 3VMNA 1MQPA 2WYSA 4O1DA 5DFAA 1UR4A 5MKGA 2NUXA 2D1ZA 1N8FA 3MO7A 5DO8A 1HO4A 3VKKA 2Q71A 3DG3A 1PZ1A 3DFOA 2JALA 3HQ1A 4TO8A 1EZ2A 4DY1A 2E25A 1ZJIA 1VCFA 4E4FA 4QQ3A 4EIVA 4GZ7A 3GHTA 5GVJA 3TZNA 1M7XA 1MFVA 2Y7GA 2D22A 2Z1VA 3PK7A 4AZBA 4KF1A 1E6NA 4RR4A 1SO5A 4DN1A 2CKRA 1AFSA 1H1ZA 2ZRXA 5D9NA 1QI4A 1XHGA 4GYKA 4EOUA 1CGYA 4HPGA 1AW2A 4IJBA 5HQLA 1R38A 3CEUA 4Y2WA 4PEKA 3HPAA 4L6OA 1TTQA 2VOMA 3LMZA 4AZIA 3KVLA 1KFJA 3TONA 3F03K 5D8WA 3NQ2A 4CQAA 2WKGA 1FA2A 1WB0A 1JUKA 4HN8A 3TOPA 3WH9A 4XZBA 1TV4A 1VKFA 4O19A 2HPMA 1XDMA 3ABSA 4KGLA 2QDDA 2PDGA 1H50A 2XN1A 3NWRA 1Q66A 2PU0A 3FVMA 1ZSXA 4D1JA 2X0HA 2RJHA 1TRIA 5CEWA 4GHRA 4QJ5B 2ZRVA 2Y88A 1UP3A 4MWAD 3CT7A 4LH8A 1XIDA 3W24A 3M0KA 1OC5A 4UMAA 1H0GA 4F9JA 3AS3A 3PPCA 1ZP4A 2QJHA 3TYZA 5I2UA 3ZXWA 3T6CA 3PUEA 3UP8A 1TJ1A 3MMUA 1IF2A 4MKSA 3OA3A 2XINA 4PRWA 4E4PA 4OGZA 1AQFA 2AQVA 3ES7A 1UCWA 1H61A 2Z28A 3QR3A 4DUXA 4NASA 4QJ4B 1OC6A 3PZNA 4EF9A 1EHAA 1JCLA 3MMWA 3ZVHB 4K8GA 4Z2LA 1WDRA 4X63A 4BF7A 5I24A 3EA2A 1TCDA 4JTSA 3N2BA 3P0WA 1E1EA 2ZRUA 3PPGA 2ZFAA 5EYWA 4TVUA 4IIGA 5A6KA 1R3TA 4G5DA 3WQEA 1TA3A 1EGMA 3TXZA 3HFYA 3ITLA 2ZZ3A 4XTIA 4IX2A 1UZDA 4X3ZA 1SFSA 1LDCA 2NW0A 5F4SA 1WDPA 4GFSA 4Q6JA 4MJ4A 1XL9A 1E72M 3TN4A 1OCNA 4UOZA 3W2MA 4DO7A 1MSSA 3GE7A 3GG8A 2AQOA 1FWDC 4LEQA 1A4LA 1CXKA 4HCDA 3FKKA 3HN3A 4X9SA 3IVUA 1XICA 2O9OA 2QEZA 5JBFA 2WC7A 3C52A 7ENLA 3LCWA 3QPZA 3OG2A 4K7YA 1K9EA 4GQQA 4ZXLA 4NNCA 3OO2A 2EQDA 5T9CE 1RK5A 3AMLA 4PMJA 1TJPA 1Y0EA 3ALGA 3UCQA 3VM5A 4H7VA 1ISZA 1GQKA 3U0HA 2B7QA 2OELA 4GUFA 1FWWA 4IFKB 4HCLA 1MW3A 3IIXA 1LOLA 3T42A 3TLLA 1RY0A 1MUWA 3TFXA 3R25A 1O94A 2NX9A 5BU6A 4P61A 4PZVA 3QGAC 4UFMA 3LA4A 3ANVA 2TSYA 2FH6A 2Y70A 3OLDA 3STGA 4AB4A 4DX3A 3U3HA 2PAJA 1Q65A 3WG6A 1UG6A 4UUIA 1VEPA 3USBA 5AC5A 1GHSA 3W1MA 4GZEA 3B05A 4G56A 4JHOA 2D0GA 3E1F1 1UD8A 4MGGA 4Z08A 2YIHA 3M5XA 3Q65A 4UIOA 4JCLA 3TIMA 3DFQA 4W86A 1M3UA 2OJPA 2CHRA 2KAUC 3ARSA 3GO2A 4O53A 1CLXA 1S2TA 4Q8PA 4QITA 2ZX8A 4HTYA 1DOSA 1XFBA 1DXFA 1OFRA 3ITGA 2CXGA 1N2VA 1GW1A 3ATYA 3ZSSA 4XIAA 4N0RA 3I7RA 4GVFA 1VPQA 5EFFA 4Z1BA 1A5CA 3SIZA 3A9BA 5HMEA 3T07A 4GY7A 4S2BA 4XZNX 4QAIA 2ASHA 1QNRA 5ENLA 2PDLA 4YTSA 4JN7A 2WW5A 2XDFA 1ICSA 1HKVA 3MUZ1 1GOIA 1PL9A 2QCGA 4MY8A 3TSDA 4KEVA 1W37A 4UB9A 2JF7A 3PJUA 2PRMA 3K8LA 5G1YA 3H54A 2V5CA 3U48A 3CHEA 4LF1A 1SVDA 2WNWA 4CEUC 3ZJ7A 2EPHA 4JKLA 1A47A 4RNIA 3SSZA 1XFCA 1PYFA 3W2UA 4JPGA 5CC5A 1J79A 1XSJA 2Q3RA 2WSYA 4Y9NA 1X1OA 4K8EA 5FEPA 2O9PA 4TVCA 4QIUA 2W92A 4L1XA 1U2YA 3L12A 4B5WA 1OFBA 4UTHA 4XV0A 4ZSTA 4G7EA 3L67A 3QY8A 1ZJBA 3SO7A 2VDGA 3A12A 1J12A 2F61A 2ZUTA 2WMHA 4Q32A 4GVGA 3DOPA 5C6MA 4D6GA 2OOGA 1KB3A 2PCQA 4RZ4A 4JNYA 1TO3A 3LHTA 2VR4A 4C91A 4ZFCA 2OXNA 2PDQA 2X0SA 4GLEA 1RLCL 1GORA 3W29A 3MHUA 3FW6A 1YIXA 3CPUA 2OEKA 4IPNB 1VYSX 3UR7A 3T8QA 3OA5A 2VXNA 2PMQA 1RQHA 3LQLA 3N29A 2DVUA 4ERGA 4FK9A 4PULA 1KRCC 3BLEA 2Y7EA 4KIRA 4PMOA 1D8CA 4P2VA 3IARA 1YPIA 1OGGA 3H2FA 3JRKA 4CN1A 2R1PA 3PTMA 4NNAA 4QSHA 4G7FA 4HMDA 1D9EA 1QK2A 1OCJA 3S5NA 3V3WA 3IVSA 4O8AA 1SR0A 1ADSA 2WVVB 1A5OC 4LAMA 4S1FA 4MAVA 3TU9A 5M2FX 4MKNA 4B2DD 5A8QA 1IT8A 2BY0A 3B8IA 3FLUA 1MDRA 5REQA 4LC6A 4X9YA 5AC6A 3PAJA 4PMUA 2F7FA 4PTDA 3K2GA 4YTTA 1AA1B 1O95A 4JIIX 3WNMA 3RPDA 1Q6OA 3NQ6A 1SQ7A 1TWIA 3SSJA 2G3JA 3LCGA 3W7KA 2E8ZA 2GVYA 4A3RA 4BWLA 1Q2SA 2PWDA 4XZ9A 5DRCA 3GG0A 2QDGA 3BANA 2WHLA 3ZOAA 2GLKA 1EJUC 1HJSA 1SM9A 1GQNA 4LB4A 4YVPA 1V0NA 2VURA 2PDCA 4MWAE 1HJXA 1Q6LA 1TTJA 3ZVHA 3SY1A 2XYLA 4IQLA 3OYZA 3S1VA 3IK2A 3VUPA 1S5MA 3DESA 2WCGA 5AHNA 2C16A 2JIWA 3OYXA 3CJPA 3MKKA 4XISA 2E0PA 4GVHA 3GVGA 5CLWA 3NO5A 2J62A 2IKHA 1VAHA 5LHFA 1QBBA 1GOXA 4XD6A 2IQ0A 1KD0A 3THUA 2EJAA 2XH0A 4ZBCA 3GB6A 1JGMA 1TPB1 2VVSA 3MMDA 3FCPA 1GG1A 1EO7A 1H0IA 1OT2A 2YX0A 1E6XM 4LWWA 4P8XA 5FJTA 2PF0A 2CLEA 2XH2A 2ZIDA 3C2EA 4YTUA 4XKMA 4DYEA 3NQGA 3K8KA 3LPOA 4AWEA 3P67A 4P7RA 2WLYA 3IGUA 3UG5A 1JZ7A 4M24A 4QTGA 2CBVA 3ZM8A 4TX6A 3GKFA 4Y8EA 1E73M 3NG3A 3VD7A 1HJVA 1TQJA 5TD4A 3SFWA 1ME8A 3FAWA 1YPXA 3WJXA 2EXOA 3W37A 2Y24A 3SEPA 2X7WA 4DJED 3C8NA 3WQVA 4C6DA 3VD5A 2D2JA 1VLIA 4Y9AA 3P62A 3BPWA 4M3PA 3QKZA 3I3BA 3NJ3A 1IXNA 4KRTA 4N4PA 2HTMA 3R79A 3UJRA 2DUAA 1XQLA 1KQYA 1DIDA 2HV5A 3VDHA 4AD3A 1W5OA 3A4XA 4I8DA 3QQ1A 4AAJA 2Y5EA 2OYLA 3RLHA 3CC1A 2FZ9A 2YYUA 3TE9A 3PB2A 4NX5A 3VUSA 3PUGA 3KL0A 4GJIA 4N6EA 1WZLA 3EWXA 4L6HA 1Z41A 2OLHA 1E9LA 3WYZA 3ZFHA 3CB3A 4KWUA 1G5AA 4XAPA 3TYEA 4V27A 5D09A 4HK5A 4UTWA 3NIYA 2VGBA 3ECQA 1OT1A 4NILA 4A6GA 3B4YA 1CW2A 4M7TA 1AQHA 2E6DA 3VE9A 1NOWA 2Q02A 3VGBA 3AUJA 1FHVA 1SZRA 1VYRA 3M46A 3S47A 3ICJA 2WK2A 1P6BA 1UASA 2PWHA 3NL2A 1R3VA 4DO6A 2Z1BA 3WLTA 4RXFA 1Q7QA 2ZWYA 4GJ1A 3AOFA 2WMGA 2XJ7A 1FWFC 3I3EA 1H7NA 4PBFA 1RD6A 2E3ZA 4JL1A 1CGVA 3S1WA 3QZEA 4Q8OA 4BI7A 1IR1A 3N4FA 4AVOA 3VIOA 1CNVA 3WLQA 5LNRA 1E9ZB 4IH3A 3BQ6A 3MZ2A 2PWVA 3T0DA 4BS0A 2AL2B 1OCBA 4IJRA 1R2RA 4JTEA 3GR4A 4AIEA 1Z69A 2E77A 5GJPA 4I7VA 1Q8JA 3MJYA 1B57A 2YPIA 1UMYA 3RDKA 3LX9A 3STCA 1KBLA 1WE5A 4I7WA 5C70A 1UD3A 4B91A 3CS2A 4F0HA 1H3GA 1JDAA 4E8GA 1E15A 4QG9A 1Y5XA 3H7RA 3A5VA 5D37A 2PRHA 4NJJA 3GC4A 3KOFA 4UTUA 1NF7A 1FXQA 3NQBA 3NGJA 3VZZA 2BSLA 2OX4A 3RAOA 1PIFA 3SGUA 3UW6A 3VIPA 2YL8A 3B04A 1NVMA 3VAVA 5CSSA 1TV7A 3UWQA 2ACRA 3CO8A 4GK8A 1ZCOA 4MADA 4RZBA 2GUUA 3RILA 3QFEA 4DWDA 4M6PA 3LRLA 2DZTA 3IACA 3N1AA 4B9YA 2VT0A 2FJUB 3BGAA 2Z7GA 3A22A 2X1TA 4CD7A 2FPYA 3H2CA 4ZQNA 4NU7A 4HU8A 2XU2A 3UGRA 2J24A 2JF6A 3BCFA 2J9ZA 4F40A 4IGHA 3DIPA 3CUFA 3LNMA 3NL3A 2P3ZA 3IV8A 3U2ZA 4IT1A 4ADTA 3LPGA 1CBGA 5GNZA 4YLWA 3N4EA 1JRCA 4DELA 1KM5A 2D2HA 1NWRA 3A3WA 4R33A 1JDFA 2Z4GA 3HGJA 2QV4A 3IAPA 4L9YA 1TWWA 4CNPA 1XLLA 4RNFA 3QEZA 2E5CA 1DJNA 3ZT5A 1OABA 1DWJM 1XSKA 2QCCA 1B9BA 1JZ5A 5LHEA 7A3HA 2XFRA 2X1IA 1C8XA 5FI8A 1UUOA 3ATZA 1RJRA 4I8YA 2GUYA 1HVXA 2Z6JA 4H6KA 4O1BA 3AIEA 5LKYA 5L9FA 2HNHA 1FWSA 2EEXA 3RRAA 2O7SA 3CZJA 4J2PA 1FWGC 2VTFA 4Z0SA 4TTGA 2QCNA 1V93A 3CQIA 4AHOA 1W3LA 3G22A 3TA9A 1F5ZA 1X1ZA 1HZYA 4KERA 4XUYA 1TREA 1E0WA 5A5WA 3DKLA 2HWGA 3GUGA 1SYTA 1F3EA 4JHZA 1FWHC 3PM6A 3RR4A 2W91A 2Z0IA 3S2LA 5T91A 4ERIA 2BVWA 2R1NA 4WY0F 4IHCA 3GHUA 5DBTA 1S2WA 8RUCA 1H1NA 3T55A 2H9AB 1QOXA 4GOAA 4F3HA 4TV6A 1JAKA 2HJPA 1X6UA 4GNJA 3PWIA 3VIIA 1ZAIA 3SDOA 3FYYA 4GI6A 4LYQA 4Z2KA 1VFFA 1DTUA 2FKPA 2F6XA 3GHSA 4IZGA 4WK9A 3NXLA 2V6AA 1F4AA 2PZ0A 4RXGA 4OIFA 4A29A 4HJWA 3W81A 4CNTA 3F5LA 3KXQA 1OB0A 4J5NA 3QC3A 2PLMA 1ECQA 3BWWA 5E0FA 3AWNA 2E6AA 3GHRA 3NR0A 3QMTA 1TX2A 1WAWA 3AIBA 4MFEA 4WUIA 5IBXA 1BXBA 4PMYA 1KNWA 5BMWA 5LZLA 4GG9A 4Q7NA 4FR6A 5I78A 3KCJA 1V51A 1JIBA 3RM4A 3ABZA 5FIPA 2D73A 3AU6A 1L6WA 1FH8A 2OMAA 4MNJA 3EX1A 4WRHA 4HZ8A 1KGUA 1N8WA 3DI1A 4GFIA 2XFWA 3LYEA 1X7IA 4J2MA 2XVPA 1O68A 1AMKA 4LCQA 4E3TA 4FAMA 3PAOA 3E12A 1WCGA 3HGSA 2DZAA 3W02A 3ZVIA 2OCZA 1A53A 2VGGA 4WDXA 3O15A 5A69A 4UQAA 4JIEA 4XWUA 2HPIA 1DL3A 3PZIA 1ALDA 3QQWA 4JQ1A 4LX4A 3BAYA 3GXDA 4N9DA 3TYCA 2XTKA 3VCCA 3T2OA 1ONWA 3NL5A 1Q2RA 2GQ8A 5A6TC 4CD6A 5AC8A 3AHVA 1PS9A 5JIWA 3AYVA 1YXCA 4Q4SA 1EDQA 1MZRA 3C0LA 1HL9A 4GINA 1PEZA 4ZQMA 2WVUA 3W6MA 2V68A 4EXAA 4JYEA 1IEWA 3GRIA 2QUTA 3GM8A 3PTDA 5HNRA 1QPKA 2J88A 3CZEA 5AZ1A 1OX4A 3HBLA 3ZWTA 3TTOA 2V5LA 2PDPA 4LALA 3WEZA 5C9ZA 4QE5A 3CIVA 3HTWA 5D2YA 3UFYA 2PLJA 3TV8A 5JUVA 3P80A 4KCUA 3W7LA 5KZEA 4QJ1A 4CCCA 1Q85A 2PGEA 1D8WA 3GIYA 3PZTA 4QHRA 2NWRA 3G5EA 4YN5A 1KFCA 2DQXA 1VFOA 4JTQA 4CQDA 1YXDA 3W85A 3PSVA 4HOXA 4LYRA 5IHRA 2AL2A 2DIEA 3WLOA 1FWRA 4S3KA 1RCQA 3P60A 3OGSA 3P5ZA 2HBXA 5FJUA 2NV9A 4C6CA 3S1GA 2RHGA 2VX4A 4LCRA 2I1OA 3K13A 5E6YA 1GKPA 4RE3A 2PD9A 2IKIA 1UBSA 1B0IA 4B16A 1TUFA 3NOYA 3HF3A 3W6YA 1ME9A 1FWCC 2ZZ7A 3EMQA 3SIMA 2VDHA 2WANA 2IQTA 1UR0A 3THAA 5HBFA 2XZ7A 2BASA 3KVKA 1FH7A 1NARA 3UWWA 1W5QA 4KT2A 4NSBA 4N6FA 1GJWA 5D9MA 3PZOA 2ODOA 3ARZA 1EPXA 2ALDA 4WZHA 4AYSA 1LUCB 5CXPA 4U3CA 3S9ZA 4O4WA 5FJRA 1C9WA 5D38A 1Z3NA 3KOYA 3CV7A 3G3DA 3VD4A 2HNEA 4MWAB 2XIJA 4NY2A 1Q45A 3IJ7A 2EPOA 4UQDA 2BZNA 2ZX9A 4JOMA 3MI2A 4GI8A 4HNNA 1F6PA 1HKKA 3OODA 1LL7A 1W6TA 1IHIA 2CNCA 1ZCCA 3SQMA 1E55A 1T7LA 3U7VA 4S3CA 5TAOA 3WUGA 4BWLC 4IIFA 3M0VA 3W38A 4LUYA 1V02E 1GVRA 2NQLA 4DBEA 3AIVA 1FHLA 4HK6A 4TMBA 4GABA 3LHYA 1FDZA 1H49A 3LV5A 4H19A 1ZRQA 4D1IA 3UPWA 1Q6GA 1R2SA 3FIGA 5DX7A 4QLJA 3TZFA 1I2OA 4UXDA 4Z2HA 2WMFA 2WHJA 4HJFA 2E67A 4B5XA 1VBJA 4WJ8A 4W84A 1D3CA 2R82A 3LHWA 2CWXA 3UZJA 2ISFA 2OZTA 2G3FA 3NNTA 3TCSA 5HPCA 1QW9A 3MA8A 4NP7A 3NOEA 1UH4A 2ZXDA 4NZ5A 1JCTA 1UC5A 3W2LA 4Y9MA 2XFYA 3V0TA 1R2TA 1I2PA 1JJKA 5FJJA 1KFEA 1SU5A 5C9WA 4UTLA 1OFPA 3K8MA 1HO1A 2C19A 4V1XA 3N04A 3OP2A 1LQ2A 3HFTA 3W1QA 2CC0A 3GTFA 2O4MA 4GH1A 3AS1A 1XIFA 1O4UA 1S46A 4DZIA 4ZVJA 4JIRA 4PL1A 3G1HA 4H9ZA 1K4HA 2Y5JA 4O0ZA 2ZXAA 1KGXA 3HGRA 2ZICA 5T9BG 4WKAA 4OE7A 2H9AA 1K70A 4YYFA 3HQPA 1DWIM 1R9ZA 1VFUA 4FXRA 2BY2A 3P8IA 4DXKA 4U33A 4HNOA 4ZB0A 4DI9A 2A79A 2XSXA 3ITCA 1RALA 1B30A 2HVNA 4ZL1A 4FOUA 3RMEA 1W5NA 3TNBA 1KR0A 4IMGA 2SFPA 1ZAJA 4OHQA 4PMZA 4LUJA 3W7CA 3ITXA 3UWVA 1DHPA 3HQOA 4TVDA 2OODA 2VCBA 1HJWA 4GACA 1CI1A 3LRKA 4M51A 4GO9A 4L6DA 4AU0A 4UTWC 1B3XA 2GDQA 2OZ3A 1KR1A 1UWTA 1XYFA 4KH2A 5HNUA 3WCZA 9XIMA 1RJQA 2HE8A 4TX8A 1OIFA 2NQHA 4GKTA 4ICCX 2DZPA 1HF6A 3II1A 2PWGA 1OBAA 2WAGA 2NZLA 2YA2A 1KCKA 1S2CA 1I1XA 4B5TA 2ZE3A 4IPLA 3BO9A 3VXGA 4A8LA 1LBMA 4O14A 3G18A 5FSDC 2PDYA 4HPNA 1F7BA 3GTXA 4GQRA 1XKJA 3G6LA 3AU2A 1ZB5A 3NXFA 3RNDA 3A3HA 1H2JA 3TYDA 2ZDRA 3P8JA 4LVGA 3U5UA 4HQVA 4MB3A 1XYZA 4W9TA 1E0UA 1AQMA 3UETA 1X98A 3PZQA 1LOSA 3EOLA 4BQ5A 1FP9A 3R5EA 2VC5A 3SJ3A 3DU0A 4Q3MA 2X16A 1JFXA 3GH5A 1EFZA 1MEWA 1WP6A 2Z1WA 1NWUA 1A3HA 1JDDA 1US3A 3VINA 1Q6RA 3M0ZA 3H7UA 2G0WA 3IRDA 4JDBA 4LBUA 3LCFA 2C7FA 4F0LA 4IISA 5C55A 1US0A 4OV9A 3TTSA 4E2OA 3V7PA 5DRIA 1E0TA 5TF0A 1GQJA 3GBEA 3LBMA 4U4MA 3MI3A 4DB7A 4QGCA 2PEVA 1A3WA 3O6DA 5C71A 2R94A 3W53A 3FS2A 5D2WA 1KW1A 4AZ7A 3TOYA 5EMUA 2D3LA 3R6IA 3W1LA 1EF2A 3F5KA 3I7QA 4CQ9A 4IP7A 2QF8A 5BRQA 4O57A 4A2RA 2R1KA 1H7PA 1T5AA 3TSBA 4XD3A 1K6AA 3UESA 3VNLA 3YPIA 1F9CA 1UWUA 1R7OA 2RGLA 3QBUA 2ZOXA 1V79A 4V28A 1JPKA 1ADDA 4P8VA 3MBFA 3B8SA 3PPFA 5CBIA 4IICA 2NVDA 1RP8A 3ARVA 3QOKA 1UUQA 1XGDA 3APGA 3WQGA 1LJYA 4WKHA 3ARYA 4DLFA 4PTWA 4HA3A 2FB3A 3B3DA 4IIEA 2IPJA 1W5PA 2IXUA 2JE8A 1GOQA 2MUCA 4H9MA 2D20A 4PTNA 1ENUA 4US5D 3W23A 2GYIA 2YJQA 4UCGA 1OD0A 4DPPA 3L4UA 4FR1A 5I3KA 4BHYA 4JX6A 3W7QA 4UTTC 4I5RA 3BAIA 1LUCA 2WZHA 4CN6A 3RO8A 4BY3A 3NM3A 2VFHA 4GGBA 3VNDA 3S46A 4DZ5A 1GOWA 1DORA 1YBQB 3KW3A 1YNYA 3QSRA 3A5FA 4GIYA 3W7JA 5RUBA 3DAQA 2R24A 1XC6A 3TTQA 4DYKA 3V4BA 1BQCA 2F6UA 3C86A 3AIRA 3KP0A 1NY1A 5ABHA 5IOBA 3CTTA 3EWBX 3TQVA 3PF3A 3MVIA 3ID7A 1OQFA 4O1FA 4JIPA 1J9YA 1XQKA 2DT2A 3GK0A 3UWEA 1ML1A 2IUZA 3PG9A 4LB3A 3WLSA 3GXTA 5LNSA 3GNXA 3KS5A 1EPVA 1G4TA 3WLMA 1TZ7A 3DH7A 3Q4DA 3G1YA 4OQVA 3HPXA 4M6VA 4M6QA 3FYOA 1BRLB 4IOTA 4KRUA 5CPSA 1W9DM 5FL0A 4PSPA 3WBAA 3NZ1A 1P1XA 1PX3A 1OYAA 1DWAM 4BQ2A 3O8AA 5KSWA 1V3JA 4HTBA 5IBXC 3EX4A 3PJTA 4W7UA 3UERA 3KEHA 4JNZA 4AHQA 3JW7A 2Y89A 3C61A 1UZHA 2FHBA 3AXMA 2ZTKA 4JFSA 5A8PA 2BP1A 5F1UA 3URNA 3RLVA 4CD8A 3P6LA 3U57A 4RL3A 2YCEA 4ZTYA 1JQVA 1DIOA 2ESCA 1Z42A 3WF2A 4NKCA 3VNMA 3CBWA 4UQBA 3OVRA 1E0XA 4L4MA 2GWNA 1POKA 1M53A 1DBTA 1RY8A 5DT7A 3FXYA 4W8LA 4JZ5A 3PTKA 1L9WA 3FSTA 2V5KA 1EYEA 1THFD 4Q33A 1L6FA 3UCCA 4JTCA 2Y8UA 5HJXA 1NDWA 1G94A 2VENA 5DELA 4Q6XA 1WUFA 1W2PA 2TRSA 3WY1A 2WC4A 1VGAA 3AO0A 3T1GA 3D3AA 4RNHA 3VNZA 5DCEA 3SI9A 4E0CA 3N9RA 4QS6A 1QPQA 4H9YA 3WQCA 5G4EA 4GNKB 3BH4A 3PTQA 4MNLA 2QIIA 1FWTA 2WM0A 3L0GA 1QPNA 2A7PA 4C6PA 3W7HA 3BVJA 2PC8A 1QATA 4QP0A 4EVZA 2HISA 2YBVA 4XAFA 5JQ9A 5AYZA 4FX7A 4O1AA 5HWJA 2X7VA 4D8ZA 3ERPA 3IUIA 3BURA 4FIQA 3RFAA 2ZDSA 4FLOA 1IXOA 5LSMA 3NCOA 2O56A 1EOKA 5DBUA 3CAVA 2REQB 1XDLA 1OX5A 1SW3A 3TJLA 4W7WA 3WX7A 3Q58A 1GT8A 1MNZA 4D6CA 2YLAA 3OZOA 4PA8A 1OADA 2OSXA 3GUWA 1DP0A 1NP0A 1SZEA 3G1RA 3SR7A 3WUBA 2PDBA 2A5HA 2VZUA 3BARA 5EKYA 3A4AA 4OBTA 4AWSA 3TYAA 2Z7KA 4HGXA 4J3WA 3OVGA 1R3WA 4J9JA 3QGVA 3KLKA 1GTEA 1D7KA 2E09A 2VC9A 4HNVA 2F9RA 1CX9A 2J13A 1J2BA 2PLKA 2Y61A 1BKHA 4ZOBA 3GTIA 2VDIA 3H2AA 1R8LA 3SUTA 3R8RA 5AVHA 3KDOA 3OQ8A 3O16A 4Z1CA 2FZMA 4QCEA 2EG8A 1F3TA 3RM8A 4CCZA 3CXOA 4B3LA 4XG1A 1XI3A 1PDZA 3TKFA 3VIHA 2DT0A 3QXBA 4O13A 1E9IA 2I5GA 1X96A 2NX3A 4W85A 5F4WA 4GC3A 3RCYA 2FLIA 1VRDA 4ZE4A 2QULA 3CQJA 2NUWA 1HQTA 1R5YA 1BSLA 3RXZA 3URQA 4S3JA 2I7GA 4A3HA 3QY7A 4HZMA 3HIJA 3ABRA 4I9MA 4JY8A 4QX4A 1JZ4A 4IFRA 1QO2A 3S8HA 1HTIA 4QJ3B 1B31A 4LY8A 3RLGA 3UJ2A 1S5NA 1P6WA 2CPUA 4I9JA 3M6DA 1LCOA 1WA3A 3GBDA 3EMZA 1K7XA 1H11A 4GBDA 4LBRA 2V3EA 3WK0A 1VJIA 1N55A 3F4DA 1FOBA 3LLDA 4YHGA 3N9KA 2E8YA 1KKOA 2EAWA 2FZNA 1QO5A 3ITVA 1XPYA 3KOZA 3DYOA 3N19B 4W88A 2VEKA 3S42A 5I3JA 2XISA 2PTXA 3QHOA 4JKMA 2Q8ZA 1VZWA 3Q2DA 3RHGA 1W1VA 3KFTA 1DJZA 3S2JA 8A3HA 2OSWA 3BJFA 1YBQA 3FY1A 4O50A 1QW8A 1E3ZA 1CT5A 1XUZA 3HG2A 3KVMA 1T6MA 4HSOA 4HHPA 4PUNA 4CQ8A 4GQGA 3B8WA 1HUVA 4DZAA 2H3BA 1LRTA 1Y5VA 3KAOA 3KS6A 5LNWA 2W67A 2D69A 2ZVRA 2JEPA 3WDPP 2OYKA 3QR0A 1O5KA 2VCCA 3KRSA 3DFHA 1JNDA 3AYSA 1VB9A 3UZ5A 2P3EA 2BVYA 2I16A 1OHLA 3MUCA 3BJSA 1TV3A 3LCHA 4LAZA 3SECA 1MFUA 3CM4A 1OVDA 3VFLA 2J8TA 3TW6A 1R7AA 3BAJA 2A6LA 3DGRA 1NDVA 2PDKA 3S3GA 3MB9A 5K4XA 2WJZA 3MS8A 2I9UA 1D7FA 3EA3A 4AZHA 4OWGA 1K03A 3EBVA 2PU1A 3A24A 1JPIA 5AYYA 3EDEA 3BZGA 2DJLA 4MJ2A 4AVNA 3A6OA 3F2DA 1WUEA 3E5BA 4O0KA 4GXWA 1EP2A 4O54A 4NZ3A 3A21A 4HB7A 1RA0A 4IIHA 1J18A 1K6WA 3FA3A 5LA2A 5I06A 3ZYZA 3CWOX 4L4OA 2PGFA 4RDVA 4MLJA 3B9OA 2V82A 5AYIA 1W8GA 3GFXA 1FX6A 4Q7IA 2HMCA 4I9AA 4C6EA 3HMJG 4QRNA 2W3ZA 3E0VA 1TV8A 5B80A 5ECUA 4F4RA 4MLRA 1UOZA 1M68A 2XVLA 2W61A 3D3FA 3CUZA 1YTKA 5LXXA 1WDQA 2J4GA 3LXCA 1MUCA 4LCSA 4ADSA 2EGZA 5CC6A 1UH3A 4JYDA 4R53A 2OZ8A 4ZODA 4JTJA 3SCVA 1QPOA 5HPOA 3B97A 1QW7A 5MF5A 2VWTA 1AL7A 1AZ2A 2DQWA 3R43A 3WFAA 5CSUA 3GNDA 4R88A 4H01A 1LZOA 2VC7A 1LT7A 1E5NA 5IRPA 5DEZA 1UA7A 3L0KA 1WKFA 3B9DA 4AZCB 4PMRA 4MOZA 5A6MA 4NZJA 2TPSA 1NOUA 3CPRA 2V5DA 3OG3A 3ARQA 3CO4A 4K38A 3QVQA 4UFLA 4PR4A 4IX0A 3SRHA 1F76A 1W9UA 1EEPA 3NURA 1NELA 3WH8A 3ZSTA 3UBPC 2CLLA 3BW4A 2G3MA 4NXSA 4ZQRA 1JF5A 1VRXA 1UW9A 3EWCA 4QDWA 5I77A 1A0DA 4L80A 4WIWA 2QJNA 4LF2A 2VM8A 2O9RA 3O63A 2Q6ZA 3B0UX 2PB1A 2ZKMX 4J3XA 1OYCA 2WJFA 2DT1A 4QS5A 3EX2A 2A0NA 1K9TA 1BGGA 5C2XA 4A05A 5M17A 3WN6A 1K1DA 2A7NA 2PE4A 4W8AA 1E0VA 2AAMA 2QMJA 1GOOA 4GUHA 4KBXA 2REQA 3RX3A 1XYCA 1IWAA 3M5VA 2O55A 2OB3A 3BAKA 5E0KA 5CZSA 2C15A 4YVVA 1OEPA 2Y62A 3CHCA 1XIEA 3LCLA 2PDXA 1BD0A 3MP3A 3PBWA 3E0WA 1Q5MA 4JQ3A 2VHLA 3BZJA 4H7CA 1EUAA 4F2UA 3G1VA 5LNUA 2HXTA 2AMGA 4Q4PA 4Z2JA 4GPNA 4GUGA 4JS3A 1A5BA 4IFOA 3LY0A 3CGTA 2YOCA 1V3MA 1QRQA 1XLAA 4RDYA 1JPDX 4GD0A 3COTA 1V8EA 3TJXA 4YMZA 2YYTA 3H2OA 1NOFA 4AXNA 4DBUA 2X1RA 2AKZA 1JD7A 1XCFA 4NZ1A 2F6KA 5HNTA 3SUWA 3APYA 3VI2A 5BCAA 3M5ZA 4J35A 4PC8A 2V69A 4LAKA 2OKOA 3PFMA 1YMYA 3OB8A 4DUOA 3KE0A 4NI8A 3MYPA 1QWGA 6PTDA 3QTGA 4BA0A 1XLGA 7PTDA 2YL5A 5C2CA 4WLCA 4FNTA 4QE4A 4FI4A 2XIOA 1I4NA 5FF7A 1UKTA 1EA9C 4WDUA 3O6YX 1W3TA 4HNLA 4BJHA 4AIBA 1KTBA 3BTNA 5IDZA 1AG1O 1SW7A 2FHFA 4ADUA 5LGXA 3VNKA 4ROPA 3VO0A 5M5DA 2ACQA 1L6GA 3P82A 3MDUA 3EDJA 5KINA 3SCTA 3R89A 2EO7A 1FDJA 3JUGA 2W27A 5BOOA 2IPWA 2CBJA 4C6IA 3AUOA 1WQ5A 5C9RA 5DT5A 4RW5A 3QTPA 4YHEA 4CNSA 3VC6A 4NUWA 3W1NA 4H6EA 5G4HC 5A8MA 4HA4A 4LT9A 1JG9A 1JCYA 1U5VA 2INFA 4EF8A 1Q6QA 3HJZA 3TUUA 5D9OA 5G2IA 2J77A 1SFJA 1WZMA 4RV8A 4DLMA 5E6ZA 3R8HA 2NQ9A 3UJSA 4ZTXA 1V6WA 1X97A 1EJXC 4JQ2A 2X8RA 1VFHA 4R85A 2B4GA 3V0UA 3T0TA 1Z7AA 1H60A 3R10A 3UA4A 1W8SA 4UOJA 4HKPA 1JI1A 3W70A 2IMRA 2GK1B 2GJNA 4IP5A 1HG3A 2D23A 2BHZA 4LW7A 4KWOA 1TR1A 3C5QA 1IIGA 1LLZA 3EXSA 4AD2A 3W07A 1PZ0A 2DGAA 1UIPA 3OW1A 3HURA 2YGYA 4JEJA 2D0FA 3K4AA 3GNPA 4Z1AA 1H62A 3LENA 3V5CA 4PRTA 3TMQA 1SPQA 4P8WA 1WBHA 1Y5WA 4CEXC 1V5XA 4ZB2A 4N4QA 1UMLA 2P50A 3VM7A 1XRFA 3LCXA 2QJIA 4NNBA 1E4LA 1DJHA 1Z9AA 2V8ZA 3GU2A 2E7FA 2XIIA 1OX6A 3AXHA 3G6MA 4DNMA 4CGTA 2HVOA 2PA6A 4PUWA 5EGRA 2JBMA 1IXQA 4O0QA 3RJXA 1DQUA 1KV8A 2FH8A 2W6RA 4PUJA 4Y9OA 5AFDA 4IMCA 1ZBCA 1CGTA 4HHLA 5C9UA 3CWHA 4OECA 1G7VA 5CJNA 1U1HA 2W62A 1PYMA 3VZYA 1Z32X 3O6CA 4PB4A 2DORA 4AZ5A 3VNJA 4EKJA 2P8BA 2F2KA 1QI5A 1OFAA 3GVRA 1TFVA 1NDYA 3EAUA 4UWMA 1OJXA 2BHUA 1I2RA 5H6HA 4DUWA 1JZ8A 2VNCA 1K77A 4HD5A 4YIWA 3C6CA 2QVNA 1EGVA 4J4KA 4MKVA 3HJEA 3NZGA 3UY7A 1ICPA 1D3GA 3HG4A 4UFJA 3S6OA 4CCEA 2BVDA 2OEMA 2WJEA 4XD4A 2YXGA 4FNRA 3DUGA 1VHCA 1QVBA 2F38A 1GTHA 3THCA 3H24A 4JTAA 4Z2IA 2VWSA 1UQZA 2RDXA 3TR2A 4AZCA 1L2UA 4PTXA 4WX2A 2VUNA 2C14A 2W5FA 2ZCGA 2TODA 1V7AA 2WBGA 2O92A 4C1KA 5A95A 3VFCA 1V4YA 3J7HA 1ZU8A 4GIAA 4FA3A 5D2TA 4B5NA 5HR7A 1IWBA 1ITCA 2BVTA 1JXJA 3UR8A 5D2XA 3GG7A 2CBIA 4YL2A 3E9AA 3VX0A 4WQ6A 4ZOEA 4C7FA 2DDXA 4E6MA 1XG3A 1GQIA 4Z17A 3RIKA 1CENA 4QSFA 3PJXA 1SZGA 4ZQCA 2BY1A 3O05A 3OHMB 1Q7ZA 2QUUA 3VOFA 1AVAA 3WQ6A 3IJQA 1S1PA 4D2JA 1IIHA 3WK3A 3MUIA 1SMAA 2A21A 3L66A 3KOWA 1XKYA 4DBSA 2GGHA 1TV5A 2AAAA 1XH2A 4O52A 3TFCA 3NSXA 5FKYA 3FSUA 1MRAA 4ML4A 3UF9A 3VK5A 4L9XA 5HDRA 2GQAA 3SW6A 3ONCA 5FAJA 2CZDA 4WDWA 3I4KA 1I75A 3TDFA 1R47A 4C5YA 2WOQA 4GWEA 1VFTA 4DF2A 1X39A 2A3HA 2E9MA 3OGVA 3WNPA 3D6NA 5F2GA 1QJWA 3CZ8A 4JDYA 2PDNA 3SAZA 3W71A 1W1A1 1CLVA 4QM1A 4POCA 5EMMA 3L2LA 5AVNA 4JD4A 2CW6A 1OK4A 3RG6A 3UZYA 4AC7C 4BCEA 3MT1A 1P0BA 3W1AA 4M5PA 4XBJA 1J0HA 4LVDA 3LERA 4H4IA 1J0JA 3CAQA 3V1PA 1B3WA 1QASA 1RZMA 3U4FA 1GVYA 2H3DA 3R94A 3LK6A 3N73A 4MY1A 3DBNA 3GY1A 3UJFA 4M82A 3GVVA 1RV8A 3ABOA 4D6JA 2XIQA 5L6UA 5J8LA 2BFGA 1X6LA 5AC4A 1V6UA 3HV9A 2YW3A 3OZMA 5C2GA 4GQBA 1XDJA 5CAKA 3GYCA 1RVGA 4K6AA 1GGOA 1AJ0A 4PGLA 4ZZ9A 3MV11 5A2BA 2Y6ZA 2J66A 3CPGA 4O10A 2EG6A 3TJIA 1RBAA 2C6QA 3BE7A 2BLEA 3EOEA 2TYSA