1B3XA

Xylanase from penicillium simplicissimum, complex with xylotriose
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
302
structure length
302
Chain Sequence
EASVSIDAKFKAHGKKYLGTIGDQYTLTKNTKNPAIIKADFGQLTPENSMKWDATEPNRGQFTFSGSDYLVNFAQSNGKLIRGHTLVWHSQLPGWVSSITDKNTLISVLKNHITTVMTRYKGKIYAWDVLNEIFNEDGSLRNSVFYNVIGEDYVRIAFETARSVDPNAKLYINDYNLDSAGYSKVNGMVSHVKKWLAAGIPIDGIGSQTHLGAGAGSAVAGALNALASAGTKEIAITELDIAGASSTDYVNVVNACLNQAKCVGITVWGVADPDSWRSSSSPLLFDGNYNPKAAYNAIANAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (XYLANASE)
publication title Xylan binding subsite mapping in the xylanase from Penicillium simplicissimum using xylooligosaccharides as cryo-protectant.
pubmed doi rcsb
molecule tags Family 10 xylanase
total genus 127
structure length 302
sequence length 302
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 1998-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1b3xA00
1C7SA 1CTNA 3VU2A 4MNKA 1WZKA 4AZ5A 2WPGA 3CO4A 3CH9A 1J0YA 4J3VA 2XIIA 1E6NA 1K6AA 2BVYA 3NJ3A 3QHNA 3OZPA 2YIHA 1JDCA 1E1FA 1MQQA 3VDBA 5M5DA 1O7AA 3AMGA 1GOMA 1KWKA 3WFZA 3HN3A 4MPKA 2O9TA 4EKJA 3WF0A 5C71A 3SCNA 3ZMRA 4BQ4A 5A8MA 5I79A 1W32A 5BROA 1EO5A 1ODUA 1EA9C 2YL6A 1CNVA 1XGZA 1JD7A 3VMOA 1QW9A 1FA2A 1QI0A 4OOUA 4BF7A 3VIPA 1QPKA 5E6YA 1KR1A 3WDPP 4W7WA 1R87A 5IDIA 3T08A 2WHJA 1UZ1A 4E8CA 3GXDA 4YHEA 3B9DA 5GNZA 4XZWA 4Q7NA 2VZSA 3CHCA 2CEQA 3WH8A 3K8KA 1TE1A 5BRQA 4DWSD 3AS2A 1Q6EA 2D1ZA 4W8AA 2QPUA 5DFAA 6TAAA 4OBSA 4OOZA 4R27A 5JBEA 5A6BA 1BVZA 4GIAA 3T09A 3AHZA 3WD3A 1HKJA 2ZXAA 4UTFA 4DWSB 2G4FA 4FF5A 4ZE4A 1V03A 2FHCA 1OGGA 1BPLB 5AC5A 1WDQA 2GJXB 3MO4A 4PMQA 4PUEA 4W88A 4AD1A 1AQ0A 3FHQA 1OIMA 4M56A 2EPMX 1EOKA 3N12A 1UYQA 5A8QA 1VIWA 3EDKA 4JFVA 3VIHA 4CD4A 2V5DA 4RE2A 4OKDA 3IANA 4CCEA 5FKYA 1CENA 3GXFA 2PWFA 3VKKA 3RO8A 4PUDA 4V27A 2C7FA 2JEPA 1MFUA 2CESA 4UQDA 3QHMA 4MTVA 3EBVA 1RP8A 1WE5A 1HVQA 4AIOA 4W7UA 5DF0A 1D7FA 3THDA 5CJ5A 1JF5A 2CITA 5I23A 2G3JA 3W38A 4J27A 1LL4A 2EPLX 1UH3A 4JFUA 5AC4A 5CSYA 2PWEA 5D8ZA 5ABFA 4CD6A 2WCSA 4HA4A 2ZWYA 2G3IA 2W67A 1UKSA 3WBEA 1UR0A 5LA0A 3MKKA 2YJQA 3MUY1 2BY0A 3SUWA 3ZIZA 3AIEA 1FOBA 3WD4A 1JL8A 2BY1A 3ARVA 3N11A 1MQRA 2YL5A 1G1YA 2J7DA 4BQ2A 2X09A 1BQCA 1GQIA 5CPTA 5DEZA 2GDUA 1FHLA 1B9ZA 4QCEA 4GZIA 3BCFA 5AYIA 4CCDA 2NT1A 1NP2A 2XHYA 2WYSA 5E6ZA 1KCLA 2XVLA 3UR8A 1NWSA 3RCNA 5BXSA 3I3EA 4PMDA 3VM7A 4WF7A 5I78A 3WNMA 4H04A 2BV9A 3M6DA 1QOXA 3CUJA 2GK1B 1VENA 2QHAA 5IXEA 1XV8A 4GINA 3UESA 2WB5A 4JAWA 4MAVA 3PZVA 4X0VA 4M81A 4D6CA 2VZOA 5AYBA 3IJ9A 2GDVA 2J47A 4PMUA 3OG2A 1R7AA 3ARXA 2GJPA 1IV8A 1EHAA 1CLVA 4CUCA 3GXIA 2XPKA 2QPSA 4B9ZA 1W91A 1V02E 4AIUA 4UQ9A 2VQUA 1ISZA 1E3XA 2RGLA 2EJ1A 1BTCA 4J3WA 3AXIA 2V5CA 4D6FA 3TTSA 1GOWA 3ZSTA 6A3HA 4GXPA 4NRSA 1W1YA 4GZEA 2VX7A 3BSGA 1E6PA 1KGUA 3BMWA 1K9EA 3UR7A 1UWTA 3W81A 2VX6A 4FMVA 1V3LA 4JKLA 2WC3A 2CBJA 1VFOA 3MMUA 4GZJA 1G9HA 4WKHA 1CXFA 3T0AA 5JUVA 4ZXLA 2GUYA 1JZ5A 2WMJA 1US3A 3E1F1 3EMCA 5DT5A 2XGIA 1J0KA 4HOZA 5I77A 4U5KA 4QLJA 2D3NA 4UZSA 1BGGA 1QHOA 4PMVA 4WKFA 3L4ZA 3GYCA 3SEPA 1IT0A 3SCPA 1BYCA 2WAGA 1UD4A 1XC6A 2XJ7A 2OSXA 3CMGA 2WSKA 1FH9A 2WWCA 3BAXA 2FHFA 3AROA 1CGVA 4BS0A 2AOSA 1FFRA 4GI8A 4ZEPA 1L8NA 2XSAA 1GJUA 1TG7A 4WIWA 3ARSA 1G01A 1GVIA 2VURA 3LPPA 1BFNA 1W2PA 3KE0A 2XVPA 4H8VA 4N42A 2BNJA 1MWOA 2WVTA 2WC7A 2ZX8A 3UG4A 4D6DA 1UR1A 2A3HA 2DIJA 3AS3A 1M01A 4CD8A 1CGYA 1ISWA 1E56A 3RMEA 5CGMA 1W9PA 3OGSA 2J79A 3SCVA 2A3EA 3SCSA 1HL9A 4MB3A 5DMYA 1UKPA 4P8WA 2YBUA 3SIMA 3MANA 1JFXA 5A1AA 1LJYA 1FP9A 4CCCA 1H49A 1ISVA 4HU0A 4HMEA 4MAZA 1LG2A 2YKKA 1A47A 3IJ8A 3GNRA 4RL3A 1HP4A 1E0WA 4PN2A 3UEQA 2CIPA 4DUWA 1FH8A 2QLYA 1E43A 1V6VA 1UHVA 3AHVA 1UR8A 3W24A 2VR4A 1MW1A 2CHOA 3WQ5A 4D72A 2QMJA 2X0HA 2NSXA 2XM1A 1E4IA 1CLXA 2XVNA 3FAWA 2UWFA 4XUYA 3CHEA 1KXHA 2VT0A 4BA0A 1XD1A 2D24A 1V3JA 5M3WA 4ACYA 4UQAA 5CPSA 1NP0A 1I1XA 4GI6A 1UZ4A 7A3HA 4ZXOA 3EDFA 3WNOA 2WWDA 1QI4A 1NOUA 2W4XA 1V3KA 1MYRA 4JFTA 1CIUA 3ZT7A 2VO5A 2J74A 3ARRA 3VGBA 3WKZA 5M03A 2O92A 4AZIA 4Y7EA 4KWUA 1R7OA 3NIYA 3DHPA 3SUTA 1Q6FA 1MXDA 1H3GA 4D6IA 1L0PA 2OWWA 3FXYA 4QCFA 4PTMA 2VJXA 4AEFA 5CLWA 4H2CA 1SFSA 2XYLA 4HU8A 3A4XA 1W3HA 1XHGA 1JZ6A 2YLLA 4WJXA 8A3HA 3UCQA 2OYMA 3RM4A 5HBFA 5I24A 1CDGA 3SCQA 1E3ZA 2EEXA 2DSZA 2J8GA 1WKYA 4CN4A 1W1TA 3WMCA 2A3BA 5A69A 4W8BA 3A3HA 3EYPA 1RP9A 3CHDA 1GPFA 1JNDA 3MUAA 4D6JA 4HMCA 1M04A 3BAKA 2J7GA 1UWUA 1EDQA 4JKKA 3AHXA 4AZCB 6CGTA 3VIKA 1H0GA 2XIBA 1AQHA 4EANA 1R8LA 5CXPA 1J9YA 1E6RA 4NZCA 4UQEA 1GOKA 1OD8A 1UWSA 1F4AA 2XUCA 2PBGA 3ARUA 3WQVA 4UFIA 1JZ3A 4ML4A 4LQ1A 1RPKA 2BHUA 2IXUA 4KRTA 1QNPA 3N13A 2WLYA 1GORA 2X8RA 3WL1A 2VTFA 1G94A 1E0VA 3FY1A 4W86A 1OGBA 1PJ9A 1VRXA 2A3AA 7CGTA 3DYOA 1PAMA 1UR9A 1VF8A 1BF2A 4NSBA 4M82A 1J0JA 5CSUA 1E72M 5EBAA 3WSUA 4NF7A 4M8UA 1XSKA 1HKMA 4GO8A 1W9DM 1KGXA 3AISA 3APGA 3GM8A 4HPHA 4UFLA 1HJQA 1PEZA 2YDSA 2DT3A 3AIRA 5JIWA 1OB0A 5D9OA 4AXNA 3AMCA 3ARWA 2DT2A 2JF7A 4AZ7A 1WAWA 2ZIDA 1OBAA 1U33A 4OIFA 4D6EA 4TVCA 3MMWA 4B3KA 1GJWA 1DWAM 3A4AA 3EMZA 3PTKA 4W5UA 2F2HA 1DWFM 1HP5A 4CN1A 4A3HA 3WMSA 3KL3A 1MW0A 3MS8A 4E8DA 5A6KA 3O9NA 4H41A 5E0FA 1QBAA 5A8OA 2E0PA 2DDXA 2D0HA 3WEOA 1CBGA 4PMRA 3IK2A 2WZIA 1KCKA 2VCBA 4HZ8A 3OBAA 3WELA 1BLIA 3EDEA 1UOKA 5D8WA 2V3EA 4XZBA 3VD7A 3U7BA 1AVAA 3BAJA 1WZLA 1PPIA 1B3ZA 1H1NA 2W61A 5BRPA 1WDPA 3AI0A 2XVGA 3VM5A 1J0HA 2PB1A 5KZ6A 3W4RA 2WHLA 2D3LA 1ITCA 2EO7A 1VFMA 2CXGA 3U5UA 1TZ7A 1PZ2A 1JYWA 4HOWA 1ZL1A 1TVPA 4TXEA 1Y7VA 2ZXDA 2E9BA 3ARYA 5BYWA 3VD4A 4L4PA 3UG3A 1BG9A 1NOFA 4E2OA 4JL2A 2JFEX 3TOPA 2PC8A 1B3XA 3OB8A 1JZ8A 2OLHA 4JCLA 3K4DA 2WKLA 3WUEA 1OGSA 2WLZA 3ZR5A 2DT0A 2FHBA 1B3WA 1GHSA 3F5KA 2DGAA 2X1IA 1HJXA 4NI3A 3VGFA 5CGTA 3PTMA 4Z2JA 4JCMA 3N04A 5HNNA 1BSIA 2VNCA 4WSKA 4AEEA 1UKTA 1Q4NX 4OUEA 3N15A 2E40A 2JF6A 1A3HA 4Z2IA 5CQ1A 4LXFA 2DH2A 1JYNA 1V3HA 1JDAA 4TX6A 4W8LA 2V38A 1EO7A 1BGAA 3K4AA 5CZKA 3GBDA 3VGGA 2J62A 1HN1A 4AYSA 3NSNA 5FIPA 3WDHA 3WNNA 4CU7A 4PCTA 4PBGA 5A95A 5BXTA 1SMAA 4LYRA 1VEMA 1HJSA 3QHOA 1JG9A 1C92A 5M17A 4PSPA 3DYMA 2WZEA 1J18A 1KXQA 1TR1A 4WK9A 2EPKX 3VIOA 4AZ6A 1M53A 2PF0A 2W62A 4JFSA 3AS0A 4Q22A 4GO9A 2ZX6A 1KQZA 5E70A 3PZMA 1OSEA 1HIZA 2V3FA 2E3ZA 2PI6A 4DWSA 4TTUA 1I1WA 1E0XA 1E6SM 2GJXA 1UR4A 4PCSA 2YLAA 3LPGA 4IUGA 4HPGA 1LWJA 3OLDA 3WF2A 4MADA 1HL8A 1ISXA 3CZ8A 5I0DA 1MW3A 5LA2A 1TA3B 2IXVA 2VZVA 1YQ2A 4UFMA 3PN8A 3S2CA 1PIGA 3A6OA 1B3YA 1BAGA 4MNLA 5IHRA 2ZUSA 2PWGA 1D3CA 4URIA 1D2KA 2Z1KA 1OINA 3L4TA 3WEMA 1B31A 1CGXA 1QNOA 3NSMA 1V0LA 1ESWA 1UD3A 1TFVA 2WCGA 3AZTA 3GH4A 1LL7A 4GI9A 1JGIA 1M7XA 3HMCA 5EFDA 1X6NA 3OLGA 4PMZA 3SCWA 3WDJA 2W91A 1E4NA 5ECUA 1K9DA 4Z2LA 4MDPA 3QOMA 1UD8A 2CYGA 3F5LA 2AAAA 1QI3A 3U7VA 2ZE0A 3ARZA 3VTRA 1E5JA 1VJSA 2YA1A 4FLOA 2VL4A 1ZBWA 4ATDA 3BH4A 2ZXQA 3AIUA 4CVWA 2VR5A 1CXEA 1GQKA 3B9EA 3GH7A 1OT2A 1UQZA 1C8QA 2OSYA 4UOZA 2FGLA 4AZHA 5CLTA 1WP6A 2GK1A 4UQCA 2RGMA 4D71A 3CZGA 1KBKA 3WF4A 3LMYA 3PZTA 4PMNA 3IJ7A 5ABGA 3SCTA 8CGTA 4FK9A 4AW7A 5EMYA 2OSWA 4CU6A 2FGZA 5FD0A 1PIFA 4WLCA 2BY2A 3U5YA 1DWGM 2J78A 5A6JA 9CGTA 3UERA 2E4TA 4M24A 4TVUA 2YA0A 4MJ4A 3CGTA 1V0KA 3OLIA 5A94A 4J3XA 1CXHA 3VPLA 2YL8A 3TA9A 2PWDA 4F66A 3VVGA 1H41A 1J11A 1HF6A 4U33A 3L2LA 5BCAA 1E70M 2EPNA 5HPCA 3ZQ9A 1PX3A 1GHRA 1HKKA 1LQ0A 3CUGA 4GKLA 1VBUA 3KZSA 4B3LA 3KWXA 2DSWA 1MQPA 1VFFA 3QGVA 4PMYA 1PX8A 2DIEA 4H7VA 2C8NA 3SCUA 2XG9A 1H5VA 1MW2A 1Q6GA 1PBGA 2ESCA 3GNPA 4ACZB 1DHKA 3F4VA 3GH5A 3L4UA 1XSJA 1QVBA 1GVYA 2QV4A 2ZXBA 4N0RA 3THCA 2D0FA 3WUFA 3M46A 3SUVA 2PWHA 4A3YA 1BYBA 4AY1A 4J28A 4W93A 1UUQA 2OYLA 4OZOA 3VDAA 2NW0A 1C7TA 5EB8A 2UY2A 2WBKA 3L4WA 5E9AA 2WMGA 1UG6A 1JXKA 1CPUA 3POHA 3T2OA 2QF8A 2JIEA 4HMDA 3ZOAA 4AWEA 3W6MA 2J7BA 3VNYA 3PZIA 2WZHA 1GQJA 5KEZA 4HOXA 2J25A 5FOOA 3BAYA 1CZ1A 3WQWA 2D2OA 2XM2A 2X05A 1H09A 4R5EA 3VGDA 3AMKA 1C91A 2J7FA 4IPNB 4HA1A 5D9NA 2EQDA 3G6LA 2UY3A 3CZJA 5DT7A 4BQ3A 4P7OA 1GCYA 1TVNA 1Q6DA 2V3GA 3W53A 3WNKA 5A2AA 1XYZA 4U3CA 3POCA 3SCRA 1QW8A 2VZTA 1W3JA 1HX0A 2VX4A 2JALA 3NYDA 4GPNA 1KXVA 1U30A 1QI5A 3MV01 4OBRA 2BY3A 1K9FA 3ALFA 2VUYA 2V3DA 5FL1A 4CKQA 4ZE5A 2Y8KA 3BXWA 3FN9A 4Z2KA 2ZUTA 3BCDA 1B90A 3WQ4A 4D6GA 3WENA 1J0IA 1TUXA 3W26A 3WIJA 1V0MA 1E4LA 4QDMA 3SURA 3U57A 3DYPA 4DWSC 2WHKA 4YPJA 3EDJA 2TAAA 2JEQA 4S3JA 3AMLA 1XH2A 7TAAA 3W29A 4AD5A 2J7CA 1JZ4A 3AIBA 3ARTA 4M80A 3FHAA 4F9JA 4J3SA 3VDCA 3J7HA 4P8XA 5HPOA 4CD7A 3L2MA 2OWXA 4L4OA 3VIIA 4TTGA 2WMFA 5IFPA 3VILA 4BQ5A 1W9UA 3WF3A 3T0BA 2DEPA 4AMCA 5E09A 1JF6A 5LA1A 1CXKA 1HJWA 5EFFA 1UWQA 3I3BA 4J7RA 1JDDA 4AD4A 2VMFA 1K9TA 3BGAA 4AZBA 4PTWA 2VZUA 2WM0A 2ZX9A 4CVUA 2EPOA 3VUPA 3PHAA 3AZSA 2WANA 3KEHA 5A6SA 1UR2A 2IUZA 1G5AA 4QFUA 3ZM8A 5FL0A 1FHDA 4U2YA 3SCOA 1WPCA 3ECQA 5IFTA 3PZUA 1DWIM 3CIVA 1GNXA 1JYXA 1KGWA 3OIHA 1V3MA 3VD5A 1CXIA 1KBBA 1ZBCA 1IZJA 2VVSA 2VX5A 3FNDA 1W1VA 4AZCA 3WN6A 3DECA 2W5FA 4KMQA 2UY5A 5I3DA 1QHPA 3GDBA 1OT1A 2ZUUA 4Z2GA 1NWRA 1V02A 3A47A 3VIGA 2WK2A 1XSIA 2CNCA 1VEPA 4V2XA 1G0CA 3ZSSA 4C7FA 3ARQA 3OA5A 3RPMA 1WDRA 3QR3A 4UOQA 1ZBKA 4F79A 4AZGA 5C8BB 3WD2A 1E15A 4U5IA 1UA3A 4YHGA 2J7HA 1EQPA 1V3IA 4QLKA 3ZJKA 4MNJA 1C8XA 1GOQA 2XWEA 1EH9A 4LX4A 1B30A 4UNIA 1QI2A 2CBUA 4F9DA 1HJUA 3ZT6A 4HA3A 4DM2A 3T0DA 1BVNP 1PX4A 1CGUA 1ZBVA 5A6BD 1SMDA 2G8ZA 1OM0A 4IISA 3AFBA 4MB5A 1WZAA 4W7VA 1VBRA 3MSDA 1HKIA 2BXZA 1SYTA 5A8NA 1QNSA 1M03A 2E9MA 1LG1A 1UKQA 4UCFA 5DO8A 1Z32X 2O9OA 3W0KA 3AXXA 3VX1A 2OYKA 4KH2A 3CUIA 1E9LA 3RM8A 1ITXA 1V6WA 3PZOA 2Z1SA 1KB3A 2VRQA 1CWYA 3WH5A 3WNLA 1JFHA 1NWTA 1CXLA 3HU7A 3ZO9A 1UD5A 2CETA 1HT6A 4D1IA 2Q8XA 5A8PA 2BVTA 2GVYA 1C90A 1GUVA 3PBGA 3OGRA 4ZFMA 4YN5A 3RDKA 2A3CA 1FFQA 2ZUVA 5F7UA 4AISA 1J01A 1EGZA 4U31A 3AYSA 3BMVA 2VC9A 1ODZA 4W87A 4RE4A 3K46A 2QMKA 4JHOA 1UWRA 5IHSA 3PTQA 3BSHA 3AHYA 2D20A 5ABHA 2Y24A 1CECA 2EBNA 3NUKA 2VCAA 2J4GA 2C0HA 1JI1A 3RJYA 4KRUA 5BWFA 2YOCA 3CZLA 4HZ6A 3AMDA 5GQBA 4BCEA 3DHUA 3MU7A 1CGWA 4E4PA 4XX6A 3BLKA 4U2ZA 4A4AA 5ABFB 3MMDA 1WDSA 4DUVA 1MXGA 3AYRA 5JIPA 3WH7A 5A3HA 4XV0A 3W28A 3TTQA 2XFRA 1C8YA 3WH9A 2CKSA 1JYVA 5FCZA 1EQCA 1ZB5A 4LYPA 4UFJA 3VGHA 2ZWZA 2YL9A 5A6MA 1EDTA 3WDQA 1NARA 1EDGA 1F4HA 4JFWA 5JBDA 2NT0A 3AZRA 1SR0A 2G3MA 2VI0A 2J77A 3W25A 2E8YA 3VNZA 1JI2A 2WMKA 1P6WA 2BS9A 3MV11 1B1YA 3WL0A 2BVDA 2DSVA 2CERA 1DEDA 4AD3A 1XD0A 4P7LA 2B31A 2OWCA 2FDMA 3AIWA 1WZMA 3QOKA 3W6LA 2CBIA 2UY4A 2VRKA 1DTUA 2XTKA 4D6HA 4LYQA 1B3VA 1MVYA 3I3DA 2PBOA 4PSRA 5BXRA 1XH1A 2O9RA 1V6YA 3EMQA 3CBWA 4ZENA 2DH3A 2J8FA 3WNPA 2ZUWA 2MANA 3GNOA 2ZUMA 4FLQA 2WBGA 3VIJA 2F8QA 1JAKA 3WUGA 3NDZA 2XSBA 3B9AA 5I2UA 1CEOA 5ABEA 3CUHA 5I6SA 1VAHA 3OZOA 4M29A 5C70A 4U3AA 3N9KA 1WB0A 3GXMA 4JIEA 5I5RA 1B0IA 1E6ZA 1MFVA 3A4WA 3WF1A 4S3KA 4B15A 3UG5A 1E4MM 2YBTA 2HVMA 1ECEA 2Y2WA 2BXYA 4UOJA 2EXOA 3PZNA 1AMYA 3PZQA 1EOMA 4UZUA 3K8LA 3N1AA 1JIBA 3NCOA 5GPRA 1AQMA 1PZ3A 1JNEA 3BC9A 4IM4A 2XGBA 2YDQA 4TX8A 3WH6A 5CPQA 3VINA 4F8XA 3WFLA 4DUXA 1W3KA 5AY7A 1J0ZA 4CU8A 3CZEA 3D5HA 4B16A 1X6LA 5GNXA 2JE8A 3F5JA 1TA3A 1XCWA 1I75A 2BFGA 1XH0A 4PEEA 4K68A 1QHZA 1YHTA 1EHNA 3CZKA 3KL0A 3MUZ1 3WDIA 1NM9A 2CCRA 5HXMA 3W37A 1OD0A 4C7GA 3AHTA 3LPOA 3N17A 1OWQA 4P8VA 1LWHA 1GQLA 1BYAA 3VIFA 2D23A 3ZR6A 3T2PA 1UQYA 4LGXA 4PTVA 3WY1A 1OIFA 4UFKA 2DSUA 1GONA 1BHGA 4MB4A 1LLOA 3VOCA 2D0GA 3SUUA 1NOWA 1QNRA 1NH6A 3GZAA 4EE9A 5A6AA 2WMIB 1U2YA 3S6TA 1H0IA 4QAWA 1XCXA 1JD9A 4PMOA 4M1RA 1QBBA 1KXTA 2CPUA 1ZJAA 3UETA 3WMBA 3EDDA 3FAXA 2E9LA 2W92A 4W84A 1H4PA 4OJYA 5CG0A 1ISYA 1QNQA 2GSJA 3CTTA 4XB3A 3DC0A 1Q6CA 4AC1X 1J12A 1CGTA 2GJRA 4J3TA 3JUGA 2X2YA 5A6LA 5LYRA 2DPEA 3VD3A 4CN6A 3VMPA 1EXPA 3TTOA 4EK7A 1R85A 2ZX5A 3AIQA 3OGVA 1JZ2A 1R86A 3WBAA 3AIVA 1UD6A 3CMJA 3CUFA 1ZJBA 1VB9A 1OCQA 4BZYA 3WUBA 2WMIA 1FH7A 1RH9A 4AIEA 4HTYA 1HVXA 1XRVA 1UKOA 1B2YA 4PYSA 4W85A 4UQBA 1KQYA 3GBEA 4J3UA 2O9PA 2VOTA 1UA7A 2XWDA 2ZUNA 2GFTA 4D1JA 2XFYA 4PMXA 1IZKA 1DWJM 3PZ9A 3TTYA 4MB1A 2XVKA 1RD6A 2ZOXA 3W82A 3WD1A 4H8HA 3T2QA 2DT1A 5D9PA 3TONA 3GTNA 2WVVB 3L4VA 4FLRA 2ZX7A 2WW5A 4W89A 4FLSA 1DWHM 4PTXA 1E6XM 1H2JA 1UH4A 3AJ7A 4GQQA 4ACZA 3M07A 3VX0A 1E5NA 4LPCA 1S46A 1DP0A 3LPFA 3K8MA 3M7SA 2DQXA 4HZ7A 4TUFA 2X0YA 4X9YA 2E8ZA 3G6MA 2CKRA 3PZGA 1FP8A 3CPUA 2YA2A 2AMGA 1NQ6A 5BXPA 1W2VA 3K1DA 2D22A 4KGLA 4MDOA 4ATWA 1GOOA 2J7EA 4B9YA 4P7RA 3CLWA 1VEOA 4UFHA 3RJXA 3AOFA 1ZU8A 2WVUA 4ATLA 5TD4A 2HISA 4CGTA 3VD9A 1C93A 3O2LA 2VQTA 1EIBA 4HP5A 1VFUA 3ARPA 5GNYA 4DM1A 1C3FA 2FH8A 3BAIA 3WQ8A 3WDRA 2WVVA 4PRWA 1WCGA 2BHYA 4QP0A 3ZJ7A 1LL6A 4P8UA 1HXJA 2Y4SA 3VO0A 3VMNA 4EAMA 1V6XA 3NSXA 1TMQA 2Y8VA 2VCCA 3L4XA 2VVNA 1UH2A 4IPLA 4NRRA 2CBVA 5D9MA 2Y5EA 1LF1A 3VDHA 4AD2A 1WNOA 1X1NA 1ZS2A 3B8SA 5A2CA 4MNMA 3CHFA 3ALGA 4CD5A 1US2A 3L4YA 4TOQA 1HNYA 1UD2A 3RIKA 4QLLA 5E0CA 3D3AA 3FW6A 3HJEA 4JZ5A 2BHZA 4UR9A 1W9VA 3SUSA 3ZJ8A 4WKAA 3KL5A 3TP4A 3ZJ6A 2FH6A 1W9BM 2F61A 3MSGA 4TVDA 2W66A 1HJVA 3II1A 2J75A 3BLPX 2W63A 2WKGA 1VJZA 4P7QA 3MUIA 1JZ7A 3W27A 4H8UA 2CHNA 2ZICA 1E73M 1J10A 4MJ2A 4V28A 1KWGA 1TCMA 1E1EA 1W3LA 3VGEA 3IAPA 3IAQA 4Z2HA 1E40A 1KFWA 4JHZA 3N18A 2JIWA 1E55A 5A2BA 1GOIA 3RILA 1WO2A 2WNWA 5HOSA 3NDYA 2WMHA 3RM9A 1CYGA 1V0NA 3BAWA 1NWUA 4X0NA 2G41A 2WC4A 1O6IA 1E71M 1W9XA 3O6AA 4RE3A 1XYFA 4JKMA 4JL1A 2XFFA 1JAEA 2WXDM 1BG4A 1GZJA 4C7DA 1V6UA 1JXJA 1V08A 1W1PA 2VRJA 5D4YA 1H11A 4KGJA 3AXHA 4WSJA 3WEZA 3AICA 1E6QM 3OLEA 2DSKA 1UWIA 1GW1A 3ZT5A 2WVSA 2G3NA 3AS1A 3WD0A 3WQ6A 2WHMA 2WSPA 4P7NA 2YDRA 1BYDA 4GQRA 1KR0A 2WCAA 3AQUA 3VIMA 5HDRA 4AD0A 4W5ZA 1N82A 5JBFA
chains in the Genus database with same CATH superfamily
3BSMA 2QDEA 3VU2A 4B90A 1WZKA 1A4MA 3A9BA 3CH9A 3CAQA 4J3VA 1GZGA 3P62A 3PS7A 4H9ZA 2DFAA 3IIVA 2X1UA 2YIHA 1JDCA 1QDSA 1E1FA 4ZO7A 4BI6A 4E2VA 4JQ1A 4DBWA 4JOMA 4Z1BA 1F8MA 1S5WA 3N6HA 1GOMA 1KWKA 1ZTVA 4UB9A 4Q8VA 5HULA 1I60A 2QJIA 4QR6A 3DKJA 1XIDA 3WF0A 5C71A 3SCNA 2C1HA 2QZRA 4I9AA 4IGMA 5I79A 2XIMA 4DO4A 3NPXA 4MWAA 5BROA 1EO5A 3P5YA 2V9DA 1EA9C 1EJ7L 1QOQA 1CNVA 3T81A 5HR6A 3E0WA 1TPUA 4IH3A 3CL8A 1QW9A 2PDNA 4H1ZA 2LLEA 1QI0A 3VIPA 5E6YA 3TEVA 5I3HA 3GXDA 3B9DA 1G7UA 5GNZA 1EZWA 3WH8A 4KPLA 1KC7A 1TE1A 2GDQA 1V4YA 4DWSD 3NQDA 1X96A 2YCKX 1ZPTA 2D1ZA 1OCJA 1R3WA 6TAAA 2YCLB 3KLKA 4OOZA 4US6A 1QO2A 4LBUA 4DLMA 4GIAA 2VFGA 3WD3A 2YSWA 3MDUA 2PDXA 4DWSB 4UTFA 5F2IA 4FF5A 3TMLA 1XIMA 2G37A 1AQ0A 3IGSA 3H70A 4M56A 5TQLA 4XISA 1SR9A 4OT7A 1UYQA 3QW3A 3RNDA 4S38A 2HZGA 3ABXA 1IIHA 4JFVA 3UGRA 4Q8UA 2V5DA 3MWCA 2F2KA 3GDLA 4LRTA 3GXFA 5EA9A 2PWFA 3WZ0E 1BKSA 2GGIA 4M7TA 3VOHA 4HPXA 3BCJA 3YPIA 2CESA 3QHMA 1RP8A 4EPDC 1KM6A 3W1RA 3THDA 5DXXA 4J27A 1LL4A 4JEJA 4JFUA 4K7VA 2PWEA 2WCSA 1UR0A 5LA0A 3MKKA 4BEUA 2PC4A 3BQ6A 3ZIZA 3EWXA 1FOBA 1JL8A 4JYFA 1T7LA 1G4TA 3N11A 5FI8A 2Z27A 1G1YA 4O14A 4V1XA 1KTNA 1ZFJA 3NEVA 2PCQA 4ZSTA 3BCFA 5K3VA 4CCDA 5M2FX 3FDKA 3VXGA 2XHYA 1RK6A 2WYSA 4ORMA 1RALA 3UR8A 5DELA 3RCNA 5BXSA 4ZOCA 3I3EA 3IRSA 4LS0A 5JVLA 5I78A 5AHIA 1KO0A 3FX4A 3DG7A 3FA5A 2GK1B 3MHFA 4EWND 1S2VA 5G4WA 2VR2A 3MCOA 4K8EA 2C16A 5IXEA 4AC7C 1YKWA 2R24A 4MAVA 3PZVA 4M81A 3GD6A 3S0CA 2J47A 4PMUA 4UR8A 1UWAA 4LS1A 1ZP4A 1EUAA 1KM5A 1IE7C 2P8CA 2HROA 3WLLA 2ANUA 1Q7QA 4FEZA 4AIUA 5K7JA 2XIOA 1E3XA 2BG5A 1GG1A 4N4PA 2EJ1A 2PSNA 3EWBX 3URAA 1MI3A 1RZMA 2H8ZA 4D6FA 1GOWA 1YDVA 3KBMA 1E51A 4NRSA 2XH0A 2ISVA 2P88A 3KCLA 3TQKA 4FMVA 5LKYA 3C2OA 4LUTB 2BODX 1VFOA 2QYGA 1G9HA 1V93A 2D73A 2X41A 4BF9A 5EY5A 3IV8A 2WMJA 1US3A 3E1F1 3EMCA 4LT9A 4GY7A 1J0KA 5DXYA 3CV7A 2PGWA 5G1TA 3GYCA 3VYLA 4O0QA 1BYCA 1SJAA 2WAGA 3P0WA 3REQA 3FJNA 2QCEA 2XJ7A 1YE4A 2OSXA 2WJZA 2RH9A 3BG5A 3GSMA 2UV8G 1FH9A 2WWCA 4QNEA 3K30A 4O0KA 3GX9A 2AOSA 4GI8A 5JH2A 1TG7A 1G01A 1Q85A 1RLDA 2ICSA 1XDJA 3AWNA 2R91A 3KE0A 5DX7A 4H8VA 1A0EA 1Y5WA 3W76A 4N42A 2BNJA 1FWSA 3UG4A 3C0JA 3TFXA 1HGYA 3KVMA 2AMXA 1X38A 3DAQA 1P43A 1ISWA 2FTYA 3H2FA 2HBXA 2O4MA 2V8ZA 2GWNA 1EXBA 2A3EA 5KZEA 1UKPA 4HZMA 2YBUA 3SIMA 2E5DA 7REQA 5A1AA 2OX4A 1MRQA 5HNRA 3QEZA 4H7ZA 1U1JA 1FP9A 4XKYA 4XUGA 4HU0A 2R8WA 3EWDA 2ALRA 2YKKA 1L6YA 1DOSA 4PFHA 5LNRA 4M6VA 3IJ8A 3UEQA 4DUWA 3TYCA 1V6VA 1UHVA 3Q2DA 3HG2A 3WQ5A 4JX6A 1E9ZB 4P61A 2QMJA 2X0HA 4JTAA 2CC0A 1CLXA 1LRQA 4RNHA 4A05A 4XUYA 1KXHA 4C5YA 4JICA 1ADDA 1RUSA 4BA0A 4N7QA 5L6UA 2D24A 4ACYA 3CS2A 1LBLA 3VKDA 3MMTA 4H6QA 4DO7A 5SWUA 1QI4A 3S2LA 1R3QA 4ZMGA 2E6DA 3ARRA 4QXIA 3UW6A 3VGBA 3PUOA 2O92A 3KVKA 4AZIA 1IR2A 1R7OA 2NVAA 3DHPA 3LSCA 4L61A 3H7RA 1S1RA 3UZXA 1L0PA 3V0UA 4PTMA 3ENLA 5I3FA 5B80A 5CSSA 4C91A 2VYOA 4IIFA 4S3EA 1W3HA 1XHGA 2WPBA 2OKTA 2YLLA 2RJGA 2Y88A 4ZA0A 8A3HA 5HBFA 3LBCA 1E3ZA 2J8GA 2DSZA 1WKYA 1R9YA 2Y7GA 1UB3A 3GVGA 5A69A 4W8BA 3A3HA 1GPFA 3W1MA 2E7FA 5D2XA 1UWUA 1EDQA 3S9ZA 2CLIA 3GIPA 4ZBCA 3VIKA 2P1FA 5AYXA 4JTTA 4LNCA 4QJ4B 4UQEA 1I9CB 1F2JA 2X7VA 2ZKMX 5HWNA 4G2DA 2XUCA 4X2RA 1TMHA 3QGAC 3KWSA 3WQVA 1JZ3A 3KP1A 4QQUA 3CV1A 3CAVA 1F61A 4KRTA 1QNPA 2C15A 2X8RA 3O06A 4KFPA 2OCZA 1G94A 1E0VA 2QF7A 3FY1A 4W86A 4IGSA 4ORIA 4QE5A 1OGBA 1PJ9A 1VRXA 5T9BG 3DYOA 3MZNA 4DIAA 1UR9A 4H9UA 4NSBA 5AHLA 2PWVA 4NF7A 1ME9A 2VM8A 1HKMA 4GO8A 1W9DM 1Z7AA 2H3BA 2OJPA 4XZIA 4HPHA 4UFLA 2NUWA 2HS6A 3AJXA 1PEZA 1NELA 3PG8A 5JIWA 3AIRA 4MHBA 3FIGA 1T40A 2DT2A 2JF7A 4IQDA 1W5NA 3MQTA 1U33A 4GIYA 3O15A 4D6EA 4MWAD 3STGA 4IJCA 4PFMA 4HHMA 3EWWA 4W5UA 1DWFM 1HP5A 4CN1A 3SY5A 3WMSA 1MW0A 3VA8A 1TJ1A 2E6AA 2EG6A 2X7WA 5A8OA 3SRFA 4REQB 2DDXA 1MZRA 1NJJA 4H01A 2GQ8A 4S2BA 5J5DA 3OBAA 4DZHA 3LGEA 1UOKA 5D8WA 2NQJA 3BAJA 5J04A 1B3ZA 4Q4OA 4ZO9A 2GVEA 3G1HA 3T0CA 2XVGA 3FV9A 3H7UA 1YRRA 3APYA 3LD5A 2D3LA 3N2OA 1VCFA 2CXGA 1RCOB 3U5UA 2OO6A 5D37A 2QGYA 2Q8ZA 3QV6A 3C0SA 5FEXA 1H7WA 4HOWA 3WK3A 4UTKA 2IKJA 1Y7VA 3EWZA 4B5XA 1POJA 1SVDA 4S2CA 3ARYA 3VD4A 4HU3A 1JULA 3UG3A 4KFNA 1BG9A 1NOFA 1A5SA 3F4WA 4KCWA 1FQ0A 3WQDA 2JFEX 3B05A 1B3XA 3TFCA 2Y61A 3LNMA 3TNOA 2OLHA 4JNMA 4JCLA 1X98A 5D02A 3WUEA 1OGSA 4Z1AA 4FX8A 1GHSA 1TELA 4GYPA 3CT2A 2QEZA 1OABA 3VGFA 3PJWA 3PTMA 1BSIA 2OMAA 1EC7A 4OUEA 3N15A 3DFHA 3EOSA 2DVTA 2FMNA 2JF6A 2HRWA 1A3HA 3UPBA 4L1GA 4BY3A 1V3HA 4TX6A 4W8LA 1EO7A 3W02A 4AFYA 3W72A 3K4AA 5CZKA 3GBDA 4C6OA 2J62A 5D05A 1ZCOA 4AYSA 3NSNA 4ES4A 4PCTA 2A6LA 3W74A 1SMAA 1XIGA 2ZA1A 1GOXA 4S23A 4FP1A 3QHOA 2GGEA 1KXQA 5F2LA 5JU6A 2ZADA 4AZ6A 3G1FA 2I5GA 4J2MA 2W62A 3AS0A 3MZ2A 5BZAA 6PTDA 1HIZA 2PI6A 4YCPA 3UZWA 4HNVA 3LSBA 3LBOA 3N25A 1WV2A 3MB9A 4PCSA 4DELA 4C1NB 1OG0A 5BOOA 4KWVA 1P0KA 3Q94A 4HPGA 4O12A 3LCGA 7TIMA 4MADA 4O11A 5LNUA 3CZ8A 3PBUA 4KEVA 3DFOA 5LA2A 1OZMA 4FHAA 4FB7A 4GGBA 1YQ2A 3KS6A 3LRMA 4O4VA 2FZNA 1S2UA 4GK8A 3TX9A 1D3CA 3Q58A 4ADUA 3G3MA 1D2KA 2PDWA 3D47A 1OINA 3WEMA 3QLLA 4HB7A 3T4CA 1B31A 4PBEA 1KBIA 1XIFA 3TZFA 1QNOA 2ZBTA 1EP1A 2YBVA 3OU8A 1V0LA 4TX9A 3LLFA 1UD3A 1LCOA 2WCGA 2ZYFA 1LL7A 1XF0A 3CM4A 3OPSA 4C6BA 3QMRA 4NXKA 1LLWA 3WDJA 3HV8A 5ECUA 3CTLA 5D2TA 2ZRXA 3O63A 3URBA 1SPQA 2Z1VA 2PD5A 2VL4A 3NEHA 4MJZA 3W2KA 3O05A 3AIUA 4ZB5A 5FEWA 3AAMA 3VOIA 3LLDA 3N29A 4Q7BA 4UOZA 3R0UA 1JCLA 2QCFA 4GH3A 4M0XA 4D71A 4O8AA 5ABGA 4G6CA 4F2BA 3ES8A 1YW1A 2IKHA 2YB4A 3P0XA 1FUYA 5F2GA 3L5LA 3AALA 2V82A 1RJQA 2BY2A 5MKGA 3L0GA 2J78A 3GDTA 5A6JA 2H3DA 3R2GA 4GC3A 1BWVA 4UMCA 3MI6A 4TVUA 3OVGA 4MJ4A 5HMSA 4CEXC 1V0KA 1Q2SA 3OLIA 1S38A 4DBDA 4HNOA 1O60A 3ERPA 1H41A 2HS8A 3JZUA 3L2LA 5C9RA 2HK0A 5G5IA 3UBPC 1E70M 1MXSA 3C56A 1U5JA 3L7RA 4KFOA 3CUGA 4DZAA 1VBUA 3NQFA 1DIKA 4JTLA 1SO4A 3QGVA 3DHFA 3IJDA 1DXEA 1PX8A 4N6EA 5FJJA 3SGUA 1UW9A 3SCUA 4XTDA 3SSJA 1Q6GA 4M6QA 2ESCA 3GNPA 4LC8A 4B5VA 1DHKA 4L9XA 2EGZA 4MZ1A 4N0RA 3M46A 3SUVA 3PUDA 4W93A 3SGZA 4UTTA 4GIRA 1G67A 3VDAA 1CI1A 5IRPA 3UCCA 5EB8A 2UY2A 5CJMA 3GC2A 3EXSA 3U0HA 2WMGA 1YTEA 1TV3A 4DQWA 4IMFA 5D30A 4HMDA 4QISA 3W6MA 2J7BA 4IIHA 1ICPA 3VNYA 1GQJA 3O16A 5KMYA 5KEZA 4HOXA 1OC6A 4YTTA 4Z0SA 3BAYA 1CZ1A 3WQWA 2XM2A 3OEXA 3MCNA 3RR1A 4A3UA 1XXXA 3OYZA 4IPNB 4UNKA 3G6LA 3KDOA 3P80A 2V81A 3CZJA 3WLTA 4BQ3A 4XAZA 1N8IA 1D7KA 1TRDA 1PO9A 1KKRA 1Q6DA 3FVMA 3GTIA 3GU9A 4FXFA 3BW2A 2Z7GA 3KRUA 1SZEA 4JIPA 5A2AA 4U3CA 4WDUA 3SCRA 2V5JA 1QW8A 1HX0A 3NYDA 2XH2A 4GIEA 3GAYA 3QZEA 3TYBA 5T91A 1U30A 1G4PA 3TXVA 2BY3A 4I5UA 4CKQA 4CQBA 1R47A 3NO5A 4Z2KA 3UR2A 4P2VA 2WSQA 1ITUA 1TUXA 2AL1A 3WIJA 3SURA 2JKEA 3W01A 3EB3A 7TAAA 3W29A 1FWNA 3GG7A 4MZYA 3AIBA 3FA4A 3CAKA 3W7EA 4M80A 5TF0A 4F9JA 4J3SA 3VDCA 1PCWA 1TREA 3GY1A 4L4OA 3VIIA 1MNZA 4B5TA 1N8WA 4XTIA 1Z42A 3E3HA 5IFPA 1B4EA 2QNEA 3MSRA 1NF0A 3NQCA 4G1NA 3T0BA 1SJDA 3E2SA 2RDWA 4MLRA 4NAEB 4KIEA 2PRMA 2PGRA 3NGFA 1KRMA 4MJMA 1QRQA 1UIOA 3ANYA 3K1GA 3UWEA 4AD4A 1K9TA 4DNHA 2AL2A 4CVUA 3VUPA 2OVLA 3AZSA 2WANA 5A6SA 1UR2A 1G5AA 3ZM8A 1I2NA 3H2OA 3HPXA 3LRLA 1XC4A 1J5SA 5LNSA 1UPPA 3QVQA 3W7KA 3CUZA 1DWIM 3DDMA 1GNXA 1KGWA 3OIHA 3VD5A 1CXIA 4AU0A 1B9BA 1IF2A 4HNTA 1R2RA 3DG3A 3ZXWA 2W5FA 3OHIA 4X63A 1K1DA 1QHPA 3NQBA 2REQB 4Z2GA 1NWRA 1O94A 4I7WA 3W1XA 2QULA 4IWWA 2PRLA 1XSIA 4YYCA 3IWPA 2ACQA 3ARQA 5DBTA 2PURA 2FTPA 5K9CA 4Q8PA 3SN4A 3EA1A 1ZBKA 4LBSA 3C2RA 4U5IA 1UA3A 3V35A 2J7HA 1NF7A 4PR4A 4XIAA 1VGAA 3W83A 5DMNA 4IFKB 3V16A 2CBUA 1Q66A 2OB3A 4DM2A 3T0DA 2X1SA 1BRLB 3KTXA 3R10A 3T7VA 3KCJA 2BBFA 3CQ0A 3SGGA 3DFSA 1SMDA 4MB5A 1J79A 3MSDA 1HKIA 2BXZA 5A8NA 1QNSA 5F4WA 1SJBA 2BGSA 3QF0A 3GFXA 1AJZA 3W0KA 3AXXA 3VX1A 4KH2A 4QS6A 1PHWA 1OFBA 3KHDA 3RM8A 1ITXA 4IFOA 3HF3A 3WH5A 4J3ZA 4NILA 1Q7MA 3ZO9A 1UD5A 1HT6A 4M1BA 4BI7A 4AWTA 4J1OA 1TVLA 2BVTA 2GVYA 1GYLA 1RPXA 4B2DD 3RDKA 1YXCA 3MY9A 1H7XA 1FFQA 1F05A 2ZUVA 3UT0A 4AISA 1J01A 1PL9A 2C0AA 1ODZA 4GXMA 1IXQA 4ZOAA 1HL2A 4NAFA 4E2BA 5H2ZA 4C6PA 5HMFA 2XIQA 3OBEA 3ABOA 2EBNA 4RNFA 1NQKA 3GTHA 4LF2A 3A23A 1JI1A 3RJYA 4KRUA 4XIMA 5DRIA 2YOCA 3PULA 3GHRA 2WZTA 4E3VA 1N8FA 3DHUA 1CGWA 5GJNA 5ABFB 3MTWA 4DHGA 1XPGA 4DUVA 3WH7A 4MUPA 4C1LA 3TTQA 2XFRA 3LTYA 2WJDA 1PUDA 2AQVA 4LVDA 3TSDA 3S5YA 4HYVA 2NX3A 4K2SA 3KFTA 5A6MA 1LORA 3B04A 5G2IA 1F4HA 1MUCA 1CCWB 1FRBA 3KBJA 3VNKA 3BG9A 1HGWA 2G3MA 4JX4A 1IGSA 4FR6A 2Z28A 1DJWA 2E8YA 4YXGA 3MV11 3S2JA 3WL0A 3DERA 5REQA 3CHVA 4GQ0A 1T8QA 5KSWA 1DEDA 1R46A 3MT1A 4RXFA 4AD3A 4HPJA 3PFRA 2PF8A 4DJEC 4O4WA 3W6LA 3BICA 1DTUA 4D6HA 3V1PA 3H2EA 1MVYA 1NAL1 4JQ4A 2PBOA 1K7XA 4PSRA 4ZOBA 4B5SA 1YTKA 4I5RA 2O9RA 4RZ4A 3WNPA 2ZRYA 4GVGA 1XLAA 2ZUMA 1VZWA 2F8QA 5ABTA 4A8LA 3NDZA 3W7JA 2XSBA 1XYBA 1Z69A 3DOPA 4RV3A 5I6SA 3MWAA 1VAHA 5C70A 2I7GA 2ZZ1A 1ZALA 3M0HA 3W7LA 1E6ZA 3A4WA 4NU7A 3IVUA 3KUMA 4B15A 2ATMA 2RJHA 1TPH1 4UOJA 3TIMA 2O7QA 1P5BA 2ONEA 4GJIA 4EXQA 2YXOA 1O5QA 3W1LA 2YDQA 4TX8A 5DCEA 3VINA 4F8XA 3WFLA 3MHGA 3D46A 1J0ZA 3CZEA 4GA8A 4UMBA 4PULA 1X6LA 6REQA 3LERA 1UP3A 1TA3A 3NXLA 5K4ZA 1BF6A 1YHTA 1EHNA 2W6RA 2YB1A 3TSBA 2A1YA 3B9OA 4YS1A 4YTRA 3IARA 2J9YA 2V30A 3ZR6A 3T2PA 1Z89A 1UQYA 1ZLPA 3UPMA 3WY1A 2DJLA 1KFKA 1NFPA 2QAPA 3UWYA 3IIZA 1OCNA 2ZRZA 3BE7A 3SUUA 4HYRA 3GZAA 3VNIA 2WMIB 4GE8A 4FNQA 3KBSA 1H0IA 2J9XA 4QAWA 3A12A 3VC6A 1VHCA 3TXZA 1PZ1A 4BWLA 4WZHA 3RN6A 3WMBA 3EDDA 2NVDA 3W7PA 3UVIA 5H8UA 4QROA 3PBWA 2FFCA 3R6IA 3A9IA 1ME8A 1Q6CA 3CU2A 2HNHA 2GJRA 5HJXA 3JUGA 4A8IA 2WNZA 3TR2A 5A6LA 2DPEA 4CN6A 3VMPA 1EXPA 1XS2A 4CNOA 4Y9AA 3SB0A 1ELSA 2QCDB 1FY6A 2DIKA 3I68A 4IOTA 2PZNA 4PCFA 3ICJA 1VB9A 2V69A 1XRSA 4GMEA 1PWLA 2X30A 1S1PA 4AF0B 2NXHA 1B2YA 1KQYA 1HQTA 3D3FA 1TIWA 4J3UA 2ZUNA 2E1DA 4D1JA 2XFYA 5BOEA 2YPIA 1DWJM 3M6YA 2YDAA 1IQ8A 4MB1A 2XVKA 1RD6A 3WD1A 3W82A 4JDBA 4ZQRA 2MNRA 4H9VA 3UZJA 2WVVB 2ZX7A 1BD0A 1DWHM 2WSYA 3GDMA 4QDWA 3LYEA 1UH4A 3TZNA 3MBDA 2PS2A 4ACZA 3JR2A 2GPTA 1DP0A 3K8MA 3M7SA 1EX1A 4TUFA 3G6MA 2CKRA 4E0CA 5FESA 1IEQA 2AMGA 1NQ6A 3K1DA 1VFHA 3UZ5A 4IX2A 3QFEA 5CBJA 3PANA 5JXQA 3M0KA 4B9YA 2PDPA 3T0TA 4PUKA 4B3ZA 4Q8QA 3PM6A 3G22A 2NV1A 2W0UA 4C6CA 4D8LA 1EIBA 4KWOA 5A6TC 2WKJA 3OJGA 3BAIA 3WQ8A 3WDRA 3TAKA 4PRWA 3TN5A 3ZJ7A 2F7FA 4HHLA 3VO0A 3VMNA 1DIEA 3KP0A 3SBFA 3RX3A 1HUVA 4EAMA 1JR1A 2RDTA 3ANUA 3ZR4A 2FZDA 3NSXA 1AJ2A 2Y8VA 4GH1A 3NR0A 1AMKA 7XIMA 3A21A 1UH2A 1VLIA 2Q3RA 5D9MA 3ZWTA 4IQLA 1Z44A 3FXGA 4CD5A 4DYEA 2ISWA 3L4YA 1SQ7A 2R82A 4XD4A 3RMJA 4F0SA 3D3AA 1WKDA 3FW6A 2IMRA 3LOTA 1W9VA 5I3IA 3PP7A 1EB3A 4E4UA 3TP4A 1K02A 3RPTA 3ZJ6A 1W9BM 2F61A 3G3DA 3K5XA 4O15A 4PB4A 3MSGA 3IVSA 1OVDA 1BXBA 2OODA 2RKXA 1HJVA 1H50A 3UF9A 2J75A 3BLPX 3P60A 4ZQCA 1Q6LA 1JZ7A 4GUHA 5I7GA 1E73M 1I2RA 4A3RA 3IK4A 2FPYA 1W3LA 1LTDA 4L4LA 2YFNA 3IAPA 3ID7A 3V75A 1L8PA 2Y7DA 3BQ5A 4JHZA 4PL1A 1E55A 4LAUA 4XSMA 5HOSA 3NDYA 3C2EA 3RM9A 1V0NA 3R58A 4X0NA 4A29A 1OX5A 2G41A 2XFFA 4JGDA 3AYTA 1GTEA 4C7DA 1A3XA 3NQ2A 1JXJA 1V08A 2VRJA 4ZB0A 1H7NA 1MUMA 3QMSA 4V15A 2O55A 3AXHA 2YXXA 4WSJA 1FWIC 2DSKA 1UWIA 4CCZA 3ZT5A 5CZJA 3OO2A 3TSMA 2WVSA 2G3NA 3WD0A 2WHMA 4P7NA 2XINA 3VIMA 5HDRA 5TNVA 1PS9A 1P0BA 1DJYA 2WQPA 4AZ5A 3CO4A 2X40A 1NEYA 4NUWA 2XIIA 1K6AA 1EGMA 1LDCA 2R1MA 3NJ3A 1MQQA 3UY7A 4OHQA 2ODOA 2QJMA 3HN3A 3AYVA 1DYSA 2ZVIA 2O9TA 4EKJA 2YGYA 1PDZA 3BV4A 4LB4A 1T41A 2PCEA 4DLFA 3MC5A 1XFBA 1JD7A 4ERIA 2GZXA 3M16A 3LHUA 3UWUA 4OOUA 2VEPA 4BF7A 1ZGDA 4ZL1A 1KFJA 2HSAA 5HR7A 1KR1A 3WDPP 3T08A 4GACA 1P1XA 4YHEA 3APTA 2CLEA 1PSCA 4XZWA 2D2GA 1Z3NA 2VZSA 2CEQA 2I56A 2WM1A 3LCFA 1J4EA 4NJHA 3C2VA 3AS2A 4GXWA 3UVAA 5HUPA 3VNLA 4ZB2A 2JGYA 1Q6EA 3E96A 2QPUA 2GSHA 5DFAA 4DUOA 1S5NA 3ZZ1A 4R27A 5JBEA 3SN1A 5A6BA 3NFUA 1BVZA 3P8IA 2PDYA 3SN0A 3H53A 2G4FA 5GJPA 4L7ZA 1C29A 5AC5A 2GJXB 4EACA 5G2HA 4QEHA 4PUEA 2A79A 4AD1A 3FHQA 2V63A 1TZ9A 4HSNA 1IXPA 4RDWA 2A4AA 5DN1A 3STEA 2VOMA 2GGJA 3IV3A 1VIWA 1YBQB 5A8QA 2RDXA 4WSHA 1GJPA 3VIHA 4CD4A 4RE2A 2DZUA 1IEWA 1YDYA 4OKDA 1YADA 3IANA 3U2ZA 5FKYA 3I7RA 4H83A 3RO8A 4YVXA 3KLLA 2XGZA 2DUXA 2JEPA 4HMNA 4JN7A 4UQDA 1V79A 4AWSA 2NV9A 4CNSA 3INPA 5T8GA 1ZJHA 3DEQA 1QW7A 1W17A 5CJ5A 3TC6A 2CITA 3MSYA 1ONXA 1FCVA 2QCGA 1PB0A 4RR4A 2P0OA 3MP4A 2QIWA 3W3OA 5AC4A 5CSYA 3RX4A 1W6TA 1IWBA 1KFLA 3URQA 1UKSA 4Q32A 3UWZA 4XO6A 4NX5A 5PTDA 1JEZA 4DF0A 5LGXA 1EL3A 3I7SA 1MQRA 5C7HA 4BQ2A 1GQIA 3O6DA 2GDUA 3BO9A 3IUDA 1FHLA 1B9ZA 4Y9OA 5AYIA 1KCLA 1FWDC 5C5YA 2XVLA 4PMDA 2OGYA 1VIZA 3VM7A 4WF7A 1VFTA 4R7WA 1FWGC 4JTHA 3UJRA 2H9AB 4R9XA 3M6DA 5ECVA 3HQNA 2PGFA 3B8IA 1LRNA 2QUUA 4JTFA 5KETA 2WB5A 4GBDA 1I6NA 3G77A 1EJRC 4X0VA 2CHRA 1O1HA 4AH7A 4D6CA 1IWPA 1RBAA 2E67A 3C0QA 3OG2A 3RAOA 1RD5A 1TPEA 3BLOA 3GXIA 3W1UA 2VFDA 2NLYA 3EB4A 2QPSA 3LV6A 1ZP3A 2VQUA 2J6XA 3OG3A 1LZOA 3THAA 2OT0A 2GQ3A 4J3WA 1CX9A 4K7YA 1A5CA 1ZAIA 2QDDA 1W1YA 3BG3A 2VX7A 3BSGA 1A53A 1E6PA 1KGUA 1K9EA 1DHPA 4XD5A 1UWTA 3TQPA 4JKLA 2J66A 2WC3A 3MMUA 3O8AA 3RXZA 1O5RA 1CXFA 3T0AA 2FJUB 5AHNA 2EHHA 4ZXLA 2GUYA 1RY0A 3CEPA 2HV5A 4QG9A 4Q4SA 4L6DA 2D69A 4HOZA 3G0XA 2WSRA 4R33A 1SZRA 4U5KA 1JPDX 4QLJA 5IOBA 3E2VA 3GG8A 4UZSA 1IT0A 3SCPA 3IUHA 4JTUA 3SSZA 1XC6A 3VNDA 5XINA 3CMGA 9XIMA 4UTMA 2IW0A 1VKFA 4NYUA 3ISIX 3DCPA 1IHIA 2OEMA 4Z08A 3HBLA 4BS0A 3HGOA 4D8AA 1L8NA 2XSAA 5FJRA 1GVIA 2DZPA 3LPPA 5CC7A 1MWOA 2WVTA 2WC7A 3HIJA 1TPWA 4D6DA 1H62A 2PDFA 4JTCA 1M01A 1V6TA 3BOLA 3DG6A 3TH6A 1E56A 1W9PA 4H6EA 3OGSA 4XD3A 2J79A 3W84A 1VS1A 2EJAA 3KXQA 4RPPA 3W7CA 3GIYA 4MB3A 3NQEA 1EJSC 5DMYA 2CU0A 4LAOA 3MANA 4I7UA 3GXTA 3W2JA 2I17A 4PB5A 4DJED 1G4SA 3GU1A 4RL3A 2HK1A 3CXOA 4G7EA 1O1ZA 3L0NA 3AHVA 2VR4A 1CB7B 1MO0A 1XWYA 4YU1A 2P76A 1VH7A 3FAWA 2UWFA 3CHEA 2VT0A 4UTHA 1XD1A 3CJPA 3ZVIA 3SQMA 2PZ0A 2XSXA 2EG8A 5F4XA 1I1XA 4O57A 1U22A 3VKJA 4QHRA 3CL6A 1UZ4A 3WNOA 1TQXA 3JVAA 5GJMA 3HGSA 2W4XA 1RQHA 1F76A 3HA1A 1V3KA 1MYRA 4JFTA 1CIUA 3WLHA 4FALA 1MEHA 1QPNA 3WKZA 2I16A 2H90A 2DQWA 4Y7EA 4KWUA 3SUTA 4DJDA 3S2MA 1KCZA 3WLSA 1H3GA 3HQPA 4D6IA 3W07A 2OWWA 4ZQNA 2QUMA 2YYTA 4AEFA 1YTDA 1NY1A 4AAJA 1AW2A 1W5PA 4H2CA 4V1YA 1QFEA 1L6SA 4RW5A 2XYLA 4L1XA 4L5ZA 4WJXA 4WOQA 4L80A 2DZSA 5CZSA 1FX6A 1O4UA 3SCQA 3TN6A 1I0DA 5LIUX 4CN4A 3WMCA 3W7IA 4R53A 4CQCA 1JNDA 1GYNA 3QY6A 2J7GA 2WV8A 1XBVA 2ZC8A 4AMAA 6CGTA 1XDMA 2XIBA 5HUOA 4EANA 1R8LA 1J9YA 4MFDA 3CLMA 3MA8A 3EX4A 1GOKA 5D32A 4O28A 1THFD 1UWSA 3ARUA 4ERAA 3D6NA 4LQ1A 4ML4A 1IZCA 3KRSA 2C6QA 2BHUA 3V3WA 3PUGA 4B4FA 1FWWA 2IXUA 2JBMA 2PFHA 3IIOA 1AK5A 3T55A 3KDNA 5AVHA 1JPKA 1YPFA 3O0FA 1FDJA 3CQIA 5C54A 2R9RA 3B0PA 5FJTA 1AA1B 2HMCA 2KAUC 3SIZA 1VF8A 1BF2A 1M5WA 1J0JA 1FHUA 2VWTA 5CSUA 1ZHAA 3DX5A 4M8UA 4M51A 1SJCA 5F2MA 3QQ0A 1HJQA 2YDSA 4L56A 1OB0A 1T99A 4AXNA 3ARWA 1A50A 4R3UA 4L9YA 3AU2A 4H7CA 2ZIDA 1Y5VA 4OIFA 4TVCA 3PB0A 4B3KA 3V5FA 1GJWA 3LU2A 2V2DA 3A4AA 3PK7A 3EMZA 2YCIX 3ANVA 3TV8A 4PTNA 3KL3A 2NQHA 3WO8A 5BMXA 3RHGA 4WXYA 4H8NA 1OHLA 2VGIA 1IEVA 1TSIA 1UMYA 1ZJIA 2HQAA 5EYWA 3WLIA 1ZENA 1F6KA 1KCKA 3WELA 2CW6A 4XZBA 1WZLA 1DVJA 1PPIA 2GGHA 2W61A 2Q3OA 3DC8A 3C8NA 3TN4A 4ZO8A 1J0HA 3PWGA 2BLEA 5KZ6A 3ABQA 3W4RA 2FZ8A 4UWMA 1Q45A 2EO7A 3OQEA 3TE9A 4QIUA 5EBUA 3F4NA 4IUOA 3S9YA 1PZ2A 3AWOA 2F38A 1AZ1A 2SFPA 2ZXDA 3W1PA 3PJUA 3HPSA 2VHLA 1KTCA 5BYWA 2E6YA 4OQVA 3TOPA 2PC8A 2Z2UA 5AOUA 3NL6A 4G5DA 1VLWA 3F5KA 1EEPA 2DGAA 1IT7A 1F9CA 1HJXA 4Y9MA 1X97A 1AJ0A 3HV9A 4MZ8A 4NG3A 4K38A 4Z2JA 1YIXA 3NPWA 1Q4NX 1F3EA 3W1AA 1H60A 1EBGA 4IPJA 5J5RA 4GD0A 2MUCA 3BGJA 3NNTA 2V38A 1J93A 4I7VA 1JCJA 6XIAA 3P82A 1XLIA 1DIDA 4ZODA 3KAOA 1HN1A 2HEJA 4YMZA 3GUGA 4KS0A 5KINA 3WDHA 4UUIA 1VPYA 4CU7A 3LHWA 4NNAA 4PBGA 2BDQA 4LV4A 2Y8UA 4IMDA 1C8VA 4EPBC 4LYRA 2JKAA 4GNVA 3E2RA 3JU2A 5M17A 1K8CA 2VKZG 1J18A 2EPKX 1TUFA 3UU0A 3VIOA 3ZFHA 4LVGA 2YCLA 3STCA 2DZXA 4JFSA 1RJRA 5IBXA 4GO9A 4ZR8A 2ZX6A 3AXKA 3PZMA 4XD6A 1TMLA 4IG2A 4NQ1A 3KS5A 4QDPA 4LAZA 4U10A 4DWSA 4FXRA 3W7QA 2VDGA 3AXMA 3UXIA 1XIIA 1RQEA 4A2SA 2HPMA 1LOSA 3LPGA 1DORA 1L2UA 3DFYA 4JY8A 1LWJA 1EUNA 3OLDA 4N6FA 3BLIA 1W3TA 1HL8A 4I9MA 1S3TC 5I0DA 1SSDA 2B0MA 1SUXA 2VZVA 1S39A 4FOUA 3TJXA 4UFMA 4DXXA 1FWJC 2Q6ZA 3ITXA 4MYAA 1UUMA 4E8GA 1W37A 1B3YA 1ONRA 1BAGA 4URIA 3LCWA 2P50A 1O12A 1NFBA 2Z1KA 2YCJA 3L4TA 4JPGA 3M0YA 2FMOA 3H2MA 3R8GA 3RCMA 4HCHA 3G1YA 1CGXA 5FF3A 3NSMA 3RPDA 2YYUA 1ONWA 4H2HA 4IXXA 3AZTA 3WCZA 3QKZA 3N2TA 4PMZA 1U1UA 2W91A 2E68A 1K9DA 4Z2LA 1UD8A 4O13A 1DKWA 2OZ0A 2AAAA 1TE6A 2ZE0A 3LLXA 3VTRA 1AW1A 3R1ZA 3SY8A 4C90A 2YA1A 4ATDA 1ZBWA 1Q63A 4N4QA 4LVFA 3W75A 3S2NA 4CVWA 1AD1A 1CXEA 1GQKA 3SI9A 2BVWA 3HOJA 3GH7A 1OT2A 3ZLGA 1UQZA 2OSYA 5EKYA 2BZNA 2FGLA 3V5OA 3PPGA 2GK1A 3CZGA 4WHBA 3IJ7A 8CGTA 2DZWA 4FK9A 4GZ7A 3RU6A 1KD0A 5EMYA 4BF5A 3W2MA 3LHZA 2VFHA 4WR3A 3S1XA 2FGZA 4GFSA 1XINA 4MSSA 1YLVA 9CGTA 3UERA 2E4TA 3LQLA 4OBTA 4KQNA 4XVDA 5A94A 5HQMA 5H91A 2YL8A 3EX1A 1J11A 1HF6A 5G2WA 4U33A 1M3UA 3MJYA 1DJGA 4A8NA 5E93A 4KBXA 3QZAA 4UTWA 3ZQ9A 2V5KA 1HKKA 5C9XA 4GKLA 3KZSA 4IGHA 4B3LA 3KWXA 1FWFC 2DSWA 4LC6A 2Q01A 2QVNA 1ITQA 2C1GA 2ZZ4A 4MWAE 4H7VA 2C8NA 3DZ1A 5T9CE 2XG9A 1MW2A 2OXNA 1PBGA 1DTNA 4F4RA 1TPB1 3TYZA 1ZAJA 3BGGA 3GH5A 1QVBA 1GVYA 2QV4A 2D0FA 3WUFA 3LGDA 2PWHA 4AVOA 3RLVA 3ZLHA 4J28A 2OYLA 2NW0A 4DJDD 5BMWA 5C9UA 3L4WA 1KCXA 3S83A 3P7YA 4YLWA 1JXKA 3COTA 1LWIA 4WDTA 4AWEA 1AH0A 2GUBA 2WZHA 4PUWA 1RA0A 1WDDA 4H19A 3OYXA 3S5ZA 4R5EA 3VGDA 4KEUA 1G6CA 2O56A 4GNJA 4HA1A 5D9NA 2ACRA 3C0LA 2UY3A 4RLIA 2QKFA 1GCYA 3MCMA 1Q65A 4PH6A 1XYZA 4LY8A 4H9YA 4PUMA 3POCA 3TCEA 4CNPA 1W3JA 3NPUA 1KXVA 2OLAA 4ZFCA 1QI5A 3ALFA 3MDWA 1JPIA 2J27A 1TTPA 3FN9A 4WOZA 2ZUTA 5I07A 1B90A 4H9MA 2B81A 3BOFA 3EWYA 5MHBA 2V6AA 1V0MA 4ZSUA 2PDKA 3U57A 3DYPA 4GUIA 1Y8BA 2AGTA 3WLOA 3CH0A 3S5SA 5A8GA 3EDJA 2TAAA 5D33A 5H6HA 3AMLA 2Y0FA 1JZ4A 1VBGA 4B92A 3LMZA 3FHAA 4XG1A 3S1UA 3L2MA 4EVZA 5C9ZA 4DB7A 2BB0A 3VILA 3M5XA 1XLLA 2Q02A 3WF3A 3GKFA 3BTNA 1JF6A 2QT3A 1BEUA 1QXLA 5EFFA 4JS3A 2R1PA 3BGAA 3WJSA 4PTWA 2VZUA 3T8QA 2ZX9A 3WK0A 2QVHA 3KEHA 1SZFA 1FHDA 1UJQA 3B03A 4E5TA 3RX2A 1Z8AA 2YR1A 1SW7A 3QC3A 4Z1CA 2QJJA 1FVPA 2VVSA 2VX5A 4AVNA 3NQGA 1W1VA 4HNCA 3WN6A 1FBAA 3UZYA 5I3DA 1KKOA 3SADA 3Q4DA 1EJXC 1OT1A 4GWEA 5HMEA 1V02A 3V0SA 3VIGA 3U8GA 2PA6A 2WK2A 2PU0A 3KRZA 1G0CA 4C7FA 1TPDA 1WBHA 3QR3A 1XQLA 1UBPC 4WDWA 5C8BB 5FF7A 3BVJA 5D38A 1E15A 3USBA 3E5PA 2R6OA 1V3IA 4QLKA 4LAMA 3I65A 3W22A 1RBLA 3OVQA 1A4LA 1QI2A 5G1YA 1O5KA 4I8YA 4F9DA 1R2SA 3ZT6A 4DYJA 1BVNP 5H8MA 1KM4A 1KBLA 1EZ2A 3SZ8A 2E09A 1CGUA 1F6PA 1U5HA 3E5BA 2A0NA 1YNQA 1OM0A 2G8ZA 4IISA 1LBMA 1VBRA 3A3WA 3EKGA 1M03A 1K77A 4XZMX 3W2UA 1LG1A 5DO8A 5FACA 1GG0A 4MM1A 4CNTA 2PODA 1AQFA 1OFRA 3PZOA 2Z1SA 1CWYA 3WNLA 1JFHA 5EMUA 3HU7A 4BKNA 3FYOA 1XBXA 5I03A 5A8PA 2ACUA 3PBVA 3VKCA 3B8WA 2WNQA 2EPHA 1QK0A 2VEIA 2VC9A 3C8FA 4RE4A 1WA3A 1Q8AA 3K46A 2FJKA 4F0LA 1AL8A 1RCQA 4JHOA 2ABAA 9XIAA 1NIUA 3PTQA 4EIVA 3V4BA 2BMBA 2Y24A 3V1HA 1GK8A 3NUKA 2OPJA 5TAOA 3F4CA 2IS7A 3W7DA 2R1NA 5F4SA 1DXIA 4JQ2A 4JTSA 1VC4A 3QPYA 4XX6A 3BLKA 2OX1A 3MMDA 1WDSA 3AYRA 5G4HC 1A5KC 4XV0A 1GVOA 1C8YA 3W7OA 4RE0A 4Y90A 3T1GA 1PYFA 1EQCA 4JTQA 1XP3A 1ZB5A 2JGQA 1LP6A 2YL9A 1EDTA 1W5QA 5CC3A 1NARA 1XIBA 4JFWA 3C3NA 2A7NA 2HJPA 1T96A 3EA3A 4N9BA 2NT0A 3L23A 5I06A 3CWOX 4XK2A 1OCBA 2J77A 3IACA 1FWCC 3W25A 3CWNA 4Q8TA 1JI2A 4Z1DA 2GJNA 4MVAA 1SFTA 2CERA 3JRKA 4R7OA 2FDMA 4E2DA 2HTMA 3SDOA 2W3ZA 1B3VA 5H8PA 4C5ZA 5BXRA 3NURA 1XH1A 5FEPA 1V6YA 4ZENA 1UP0A 4B5WA 5MF5A 3U4FA 1ENUA 2Z00A 4ECLA 3M0MA 4OWGA 2MANA 2AQWA 4FLQA 4MOZA 4GCAA 4A35A 1T5AA 2VEMA 1JAKA 5CZ0A 3WUGA 5HJLA 3ITYA 4HBKA 1PXGA 3CO8A 4ADSA 4US5A 6ENLA 3CASA 2QQ6A 3UYIA 3SJNA 1D3GA 4WUIA 3OZOA 1FDZA 1NTHA 4DI9A 3N9KA 4UMAA 4JIEA 5I5RA 3N6JA 4JN6A 4S3KA 4GJJA 1ZNNA 3BJSA 2VEGA 2XN2A 2EXOA 4Z17A 4UZUA 4C1NA 4ZQOA 2QGHA 4IM4A 4DO6A 4NHVA 2HE5A 4RCXA 1W3KA 2GJLA 3URNA 3ABZA 1F7BA 5GNXA 4AHOA 2GQAA 4MMWA 3NL5A 3NVTA 5HATA 1I75A 2BFGA 1S2TA 4K68A 4KWSA 4H9XA 3CNYA 3CZKA 4IZGA 3KL0A 4JYDA 3DN5A 1NM9A 3MI3A 2CCRA 1MNSA 5HXMA 3W37A 1OD0A 2NLIA 3R5EA 3XINA 3W2LA 3H2AA 4QG6A 3FK4A 5FAGA 1OWQA 4EOUA 1M1BA 1K3UA 2PUZA 2UBPC 4JTEA 1BYAA 2VWSA 4PTVA 2X0SA 4HK5A 5AFDA 1WAUA 4XBJA 1BHGA 4MB4A 2D0GA 3WLRA 1LUCB 1QNRA 3MPGA 1AH4A 4LCQA 2OFJA 2NXGA 5LNVA 4JR5A 4IF2A 3CUXA 1LQ2A 5C2GA 3WX7A 1KA9F 3QPEA 3LUTA 1QBBA 4MY8A 1R30A 2IQ0A 4J4KA 5AYYA 3UWWA 1A5NC 3ATZA 2G0WA 2E9LA 4JEQA 2X42A 4Q4MA 3ONCA 3E0IA 4OJYA 3DI1A 3UPWA 1QNQA 1L9WA 2GSJA 2C3ZA 3QYSA 3MYOA 4AC1X 2BP1A 1QASA 1TTQA 3R79A 4RXGA 1MZHA 5CKSA 2IPJA 1RR2A 4LVBA 4JX5A 4K1GA 3AIQA 1TRIA 2CWNA 1ZZMA 2BOFX 4RK8A 3EX6A 1JZ2A 1VD6A 5AC6A 3WBAA 3AIVA 1UD6A 1ZJBA 3QQWA 1OCQA 3WUBA 1OYAA 2A3LA 1RH9A 4WY0B 1HVXA 1H7RA 3GBEA 1XIJA 2DV0A 4ZGYA 4HJWA 2XH7A 4DZIA 2VEKA 1AZ2A 2BOGX 3BK0A 4LF1A 3C6CA 2P53A 4GY0A 3GTNA 3UWQA 3SW6A 4FLRA 4F0KA 3U2OA 2WW5A 1AW5A 4J2PA 1E6XM 1H2JA 2G3FA 2C91A 2FZBA 1XLKA 4LPCA 3UXAA 1R5YA 3LPFA 1UP2A 3BANA 3M64A 2DQXA 2X0YA 2C18A 2E8ZA 1FP8A 3TJIA 4EF9A 1TYGA 4C6JA 4D2JA 5BXPA 4TMCA 1GOOA 2BX7A 1IEIA 4P7RA 4ALDA 1F3TA 3THQA 4J35A 1VEOA 4UFHA 3RJXA 3AOFA 1ZU8A 2WVUA 4ATLA 1ML1A 2EKCA 1C93A 3KM8A 5BRBA 2HE8A 3GTFA 5GNYA 2FH8A 3EX3A 4XQ6A 1G4EA 4FNTA 2BHYA 1LL6A 1JUEA 3LCHA 3T05A 2VCCA 3H54A 2ISSA 2PDQA 4XO7A 3NXFA 2FVKA 4FX7A 1EFZA 1WUFA 1AG1O 2CXEA 2Y5EA 1LF1A 1P0EA 3VDHA 4MGGA 4AD2A 2Y7FA 1WNOA 3B8SA 3CHFA 3EPNA 2OQHA 4FOJA 3RIKA 3QFWA 4QLLA 1SO5A 4RX0A 2GSEA 4FX6M 2BHZA 3HB9A 2I14A 4WKAA 4ILSA 4NZ5A 1M65A 2O7SA 1FKXA 5EMLA 1BSLA 2Z26A 2W63A 4KT2A 1VJZA 4P7QA 3MUIA 3GWQA 3W27A 2PTXA 2ZICA 1J10A 4V28A 4HCLA 3IAQA 1A5OC 4C6LA 4Z2HA 1ALDA 1GVSA 3RILA 5B7ZA 1WO2A 4WY0F 2QS8A 4JNYA 1NWUA 4NAEA 1EC9A 2WC4A 4KIRA 3O6AA 4RE3A 4I8DA 1XYFA 4JKMA 1B57A 1JAEA 4JN8A 3LHYA 1V6UA 4RDZA 1W1PA 5D4YA 4QX4A 1H11A 1XLBA 4KGJA 2NWSA 4C60A 3WEZA 3AICA 3L66A 2BOEX 1NDVA 3HGJA 4LS2A 3WQ6A 5FSEC 1H1ZA 2HNEA 2WCAA 2Y85A 1UUOA 2QCMA 3UR5A 5IM51 5FAJA 5U4NA 4IMGA 1CTNA 2F6XA 1OY0A 2GL5A 4KESA 2REQA 1E6NA 3LENA 2BVYA 4RW3A 3QHNA 3LS9A 1ADSA 3M5VA 4X61A 3VDBA 3A5VA 4UTJA 5M5DA 4X60A 1O7AA 2Z1BA 3AMGA 4FF7A 5EMJA 3WFZA 4MPKA 1TX0A 3BLDA 3EOOA 3DHDA 3LY0A 5FEZA 2ZDSA 3TTEA 4BQ4A 4BEQA 4IFKA 1M6JA 1W32A 1ICQA 1ODUA 3S6OA 3H4GA 5HQEA 3VMOA 3I7QA 1QPQA 5XIAA 1BRLA 1QPKA 5AZ0A 5HK4A 3TC3A 1LT8A 4W7WA 1R87A 1VRDA 1Q7ZA 4E8CA 1N7KA 2F84A 4G9PA 3H23A 3M41A 5CBIA 3M1ZA 2X16A 1R0MA 3K8KA 5AHFA 2ZA3A 4JIQA 3H22A 1LQAA 3E49A 4W8AA 5JQ9A 1OC7A 1M68A 4HKPA 4OBSA 5CSRA 3M43A 4RNIA 3FYPA 3T09A 3AHZA 1HKJA 3PY2A 1V03A 1BPLB 3CB8A 4BK9A 2P3EA 1P7TA 4IMCA 2PLJA 3CK5A 3P84A 2EPMX 1EOKA 3N12A 4DRSA 5E9XA 1S5VA 5CPMA 3TJLA 4ZO6A 1F6YA 2RUSA 3TR9A 4US5D 3IIXA 4QJ3B 1OZQA 4CCEA 4B2DA 3B4UA 3VKKA 2CLLA 4PUDA 4V27A 5LZLA 3GW0A 1PTAA 1WE5A 3LM3A 4YTUA 1HVQA 1EJUC 2XN1A 4AIOA 3T9PA 4W7UA 3MHUA 3ITGA 2CZDA 1JF5A 3EWCA 1SM9A 2G3JA 3W38A 2ATSA 1GVFA 3CEUA 7ENLA 2FTWA 2YW4A 2EPLX 2G50A 5ABFA 5D8ZA 4CD6A 3ONBA 2Y63A 4HA4A 2G3IA 2W67A 2YJQA 2BY0A 2CLPA 3O3RA 3AIEA 4YCOA 3N4FA 5CCZA 2PDGA 2BY1A 4NKCA 3ARVA 3LZ5A 5D2YA 4NNCA 2YL5A 3XIMA 2FZMA 1UMLA 2J7DA 2X09A 1P1MA 5CPTA 5DEZA 1NSJA 2DJXA 2Y62A 1X1ZA 2DVUA 4QCEA 1VYRA 4GZIA 2NT1A 1NP2A 1TIMA 3NM3A 5DBUA 2B7OA 4PC8A 1EYEA 3RO6A 3BDKA 3KVLA 4H04A 4E6MA 2BV9A 2PGEA 2PP1A 4DAIA 3CUJA 4O52A 1OF8A 2ALDA 2QHAA 2W79A 3JW7A 4PRTA 1XV8A 4AUBA 4GINA 3UESA 4JAWA 4GCXA 3PBMA 1JDEA 3IIPA 1OQFA 3G8EA 2VD8A 4O8RA 2VZOA 3SFKA 3IJ9A 1R7AA 1SW3A 4DF1A 2GJPA 1IV8A 3L5MA 4CUCA 3M9YA 1S3HA 1XW8A 4H4IA 3WLMA 4CNNA 4LTSA 3T44A 4DJFC 1ISZA 2AKZA 4AHQA 2VUNA 2RGLA 1BTCA 3R0KA 3AXIA 1W1ZA 3TTSA 6A3HA 1TJPA 3PB2A 4EF8A 4Q8NA 1TR9A 3TYAA 1E9YB 3UR7A 1SGJA 4M6UA 3VZXA 3CWHA 2CBJA 2NQZA 4WKHA 3PPCA 1JZ5A 1MDRA 1MMFA 5AVNA 2OT1A 2XGIA 1KM2A 1CLKA 4DBSA 1FWAC 2VC7A 4HT3A 1DXFA 3AUOA 4WKFA 3L4ZA 4Q33A 4Q6XA 3RU8X 1Q4WA 1UD4A 5F1VA 1HO4A 3BAXA 1OK4A 2FHFA 2QV5A 1CGVA 1FFRA 4O0ZA 3T78A 4YL2A 4ZEPA 3CAWA 1XI3A 1NDZA 3W6YA 1H51A 3K13A 5G1MA 2VURA 1XDLA 3CQKA 1BFNA 2PD9A 1W2PA 1EPXA 2XVPA 3C3UA 3QY7A 4GNKB 3QRHA 2ZX8A 3RLGA 1EF3A 3F4DA 1UR1A 2DIJA 3GK0A 4GHRA 4MWAC 4NJIA 4L6OA 3RMEA 2A5HA 3O1NA 5CGMA 2QAFA 4GYFA 3OZYA 3PBYA 1JRCA 3DENA 3I4EA 1RBOB 4DO5A 1LT7A 1L6GA 4R34A 1OG6A 1ZSXA 4HMEA 4MAZA 5FA5A 1PKNA 1LG2A 1GWJA 2BGNE 1TJ2A 4HPNA 4FIRA 1A47A 2I5IA 1HP4A 3FGCA 4Q4PA 1E43A 1N2VA 1UR8A 2NXIA 3W24A 1MW1A 2CHOA 5K9XA 2NSXA 2XM1A 1E4IA 4FS9A 3P81A 2FZ9A 4L6HA 5M3WA 3PTDA 3B0VC 2J13A 5CPSA 2QCDA 1RK5A 1JPMA 1W1IE 4GI6A 3UJSA 1YXDA 7A3HA 4DYKA 3EDFA 1R6WA 2WWDA 4I9JA 1XYAA 2AAMA 1QCWA 1HZYA 4AF0A 1PKLA 1V8EA 2VO5A 2J74A 3VE9A 2Z0IA 3BL3A 3GVRA 1JGMA 3NIYA 3U9IA 1P0DA 1Q6FA 1MXDA 1QTWA 5CJNA 3RUBL 1Z9AA 2Z2BA 3FXYA 2FFIA 4QCFA 3GFYA 3CV6A 4LBRA 3GNDA 5FJOA 4KWWA 1SFSA 3A4XA 1DQXA 4KEMA 1D8CA 1W3NA 3RM4A 5I24A 2C1IA 4YWIA 1CDGA 1UBSA 1OJXA 1VPQA 4R85A 4MIMA 4FZIA 2A3BA 5AKQA 3DGRA 2ZZ2A 3FEQA 3EYPA 4PL2A 3MUAA 4D6JA 4YTSA 1M04A 2Z4GA 2VFIA 3GUWA 3ZLFA 4AZCB 5C2XA 4MLJA 4PE8A 2OZTA 1AQHA 1TJRA 2BASA 3P74A 4GJ1A 3ITTA 1R3RA 1E6RA 2TRSA 1ME7A 3F1QA 4ZZ9A 1F4AA 2PBGA 3WJZA 3E38A 3EPOA 3PUEA 4QM1A 3CQJA 4UFIA 3AC0A 5J8LA 1UROA 1R3YA 1TKKA 2XDFA 3P14A 4KCUA 3LNPA 2V2CA 2WLYA 1K03A 2FVMA 1GORA 1QOPA 4I3GA 1TV5A 1F73A 4M19A 1LROA 3RG6A 3KOYA 1PVNA 2WO5A 2A85A 1PAMA 1E72M 5EBAA 1P4CA 5EMMA 3WSUA 1XSKA 3IJQA 3AISA 3APGA 1K8XA 4LUSB 2IKGA 1US0A 2QJNA 3S8HA 2DZTA 5DQPA 1UZHA 1WAWA 3E12A 3QH2A 3PVFA 4ROQA 1QUMA 3MMWA 3WBWA 1YNYA 3O0KA 3UJEA 1DWAM 1EC8A 3BWWA 3R89A 5GVJA 2XZ7A 3BW4A 2FKPA 3MKVA 1E0UA 4UIOA 4LEQA 4HJFA 3MS8A 3HG4A 4TR9A 3U2CA 4E8DA 3O9NA 5E0FA 3F2BA 2YXGA 4EAYA 1H61A 3H12A 2E0PA 2D0HA 3WEOA 7PTDA 4Q8WA 3IK2A 2WZIA 1HW6A 4HZ8A 4I9TA 1BLIA 5HINA 3MVIA 1YNPA 4GX8A 3VOGA 3VD7A 3U7BA 1AVAA 2YCEA 3V36A 1R3TA 1JCNA 1H1NA 3SQLA 5BRPA 1WDPA 4MY9A 1DL3A 2G96A 2PB1A 2RAGA 1QR7A 2WHLA 3ORWA 3QSRA 1ITCA 3N2BA 3VCNA 3PSVA 4YTQA 3OBKA 1J6OA 2E28A 2QUVA 3QTGA 1PHQA 1TZ7A 1GKQA 1JYWA 3TUUA 3GB6A 3NM1A 4AY8A 4FXSA 2Y5SA 1PV8A 1VYSX 1ZL1A 1K6WA 1K4GA 4RDYA 4OU1A 3LA4A 4QTGA 4I6VA 3VCRA 5LXXA 1I2QA 4L4PA 1L6FA 1VR6A 4S39A 2OKOA 4E2OA 3GG0A 4JL2A 4BFAA 3R12A 1GGOA 1FXQA 2CZEA 3EGJA 2FHBA 1DJIA 3DH7A 2X1IA 2PDCA 4CEUC 4NI3A 2VNCA 5C0QA 4IG2B 4HNUA 1O5XA 2HCVA 4OGZA 2GOUA 4Y6GA 2E40A 3G1DA 3GC5A 4Z2IA 5CQ1A 5CC6A 4LXFA 2VGFA 5DANA 4PCNA 1AUSL 2DUAA 2CFFA 4N9EA 1TZZA 1XL9A 4CQ8A 4OFCA 5FIPA 3USZA 3WNNA 3GNXA 2I5QA 3FFSA 3QR1A 3LXBA 3LTPA 4XSLA 1RSCA 1W1A1 1T0OA 3G0SA 1JG9A 5I00A 1TR1A 1JVNA 4KERA 4Y96A 3RLHA 4F48A 2QR6A 3MVTA 1IT8A 3G8RA 4Q22A 1GEHA 2OQLA 5HQLA 5E70A 3W1TA 1OSEA 4IIDA 4IIEA 4HNNA 1JCMP 2E3ZA 1I1WA 2FDSA 1WUEA 3M0ZA 4IJRA 2XN0A 1E0XA 1E6SM 2GJXA 1UR4A 3CB3A 4JTRA 5HAOA 3QC0A 2VELA 5B7YA 3GNNA 4DXKA 1YBQA 4IUGA 4NI8A 5LSMA 3WF2A 2V67A 1ISXA 3CL7A 3DU0A 5AHMA 2INFA 4AVFA 1MW3A 1WXZA 3GHTA 2A21A 4L1WA 1OK6A 1PIGA 1V5XA 2NV2A 1GPWA 3W1NA 3PAOA 1PYMA 5IHRA 3BOXA 4C6IA 2HBVA 4UC5A 2NQ5A 1GKPA 3WQEA 4N02A 3B0YA 3W7GA 3LI1A 5I02A 2G97A 3SQSA 1TFVA 4HQVA 4GI9A 3GH4A 1FKWA 3S5OA 1M7XA 3HMCA 1A0DA 1X6NA 3SCWA 3B40A 4AWUA 4MDPA 3MUXA 3NZQA 1GVQA 3BLFA 1OX4B 2C14A 3U7VA 3ARZA 3EX2A 4PUUA 1VJSA 3WJYA 4B91A 1K70A 2ZXQA 3QPZA 1E1CB 1YMYA 2VR5A 2Y5JA 3KX6A 2H9AA 3P67A 4AZHA 5CLTA 4UXDA 4UQCA 4LU0A 4FNPA 4WEVX 1ZCCA 4PMNA 1WXJA 2Z7KA 3SY1A 1VP5A 3H4XA 1KV5A 1UC4A 3P8JA 5L9FA 3OHMB 3UY8A 1PIFA 2E6FA 3V5CA 1A5MC 2TMDA 1IR1A 2YA0A 3Q37A 3CGTA 3LV5A 2X1TA 3FSTA 2PWDA 4F66A 3KW3A 3VVGA 1F3WA 5HPCA 1GHRA 3VKBA 5JH1A 3UG8A 3N73A 5AHEA 4F2UA 1VFFA 2QCCA 2O0TA 4PMYA 3WLNA 2DIEA 4XZHA 5DCDA 2IPGA 2VC6A 1TO3A 3UNTA 1I8JA 1DQUA 1XBYA 4P5UA 3F4VA 3MP5A 1XSJA 3NQVA 2C13A 3WLPA 2WJEA 2ZXBA 3PF3A 4Q7IA 4ZQPA 4NASA 4D8ZA 4UTLA 4DVOA 4ZOEA 4A3YA 3STPA 3C4UA 1UUQA 4GQBA 1C7TA 3BW3A 4MKNA 3W88A 4S1FA 1Z6KA 3M44A 5CGQA 1X39A 5E9AA