1B3XA

Xylanase from penicillium simplicissimum, complex with xylotriose
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
302
structure length
302
Chain Sequence
b'EASVSIDAKFKAHGKKYLGTIGDQYTLTKNTKNPAIIKADFGQLTPENSMKWDATEPNRGQFTFSGSDYLVNFAQSNGKLIRGHTLVWHSQLPGWVSSITDKNTLISVLKNHITTVMTRYKGKIYAWDVLNEIFNEDGSLRNSVFYNVIGEDYVRIAFETARSVDPNAKLYINDYNLDSAGYSKVNGMVSHVKKWLAAGIPIDGIGSQTHLGAGAGSAVAGALNALASAGTKEIAITELDIAGASSTDYVNVVNACLNQAKCVGITVWGVADPDSWRSSSSPLLFDGNYNPKAAYNAIANAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (XYLANASE)
publication title Xylan binding subsite mapping in the xylanase from Penicillium simplicissimum using xylooligosaccharides as cryo-protectant.
pubmed doi rcsb
molecule tags Family 10 xylanase
total genus 127
structure length 302
sequence length 302
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 1998-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1b3xA00
1UH2A 3ZT6A 2J77A 2VI0A 3AHXA 4AD5A 2F2HA 4M8UA 1UD3A 3BCFA 2J62A 1R85A 2YLLA 3UG3A 3W4RA 3ARRA 3MUAA 1W32A 4URIA 1BQCA 2WPGA 7CGTA 2FHBA 3GBEA 1W2PA 3ZO9A 2DSUA 1O6IA 4ML4A 1L0PA 2XJ7A 2JF7A 4JL1A 3WF2A 1VEOA 3NYDA 4B9ZA 1WCGA 2E8YA 4W84A 4Z2HA 1XSJA 4AZBA 3T0AA 4W8LA 2XG9A 4MB3A 4Z2JA 4W5ZA 3O6AA 4W8BA 4FF5A 3I3DA 2PWHA 1B3WA 1HJVA 1QW8A 1NWSA 2DQXA 4AD0A 4CVUA 1LG1A 3SCQA 1G1YA 3PTKA 2WCAA 2V3EA 3OLGA 4J3TA 1CIUA 3WUFA 1C8XA 4MADA 4AIOA 4W5UA 2XUCA 1DWAM 3T08A 2QHAA 2CHOA 2YKKA 1V6UA 4HZ7A 3VPLA 1X6NA 2F61A 3PZTA 4J7RA 1O7AA 4AD2A 4JKKA 3CUIA 1B3XA 2A3EA 2WC4A 2VX4A 2XVPA 4OOZA 4UQEA 2VVNA 4U2YA 3EDJA 4D6FA 1E6XM 5JBEA 4CD4A 3SUTA 3AMDA 1B90A 2D0GA 1C91A 4TX8A 4TVDA 3VU2A 1JDCA 3ZOAA 5FIPA 4PSPA 4AEEA 4QCFA 3WFLA 1XC6A 2WC7A 1H41A 5A8PA 3AMLA 2EPOA 1W9BM 1CGXA 1GQJA 3PZMA 5F7UA 2E4TA 4Z2IA 4AWEA 2X09A 3VVGA 2EPLX 4KMQA 1W3LA 2PBOA 3RJYA 2WMHA 4UFLA 1QBBA 4F9DA 3WFZA 4HOWA 3CGTA 3LPGA 4JHOA 5E0CA 3FAXA 5A6BD 5A6AA 4GQRA 3NDZA 3HMCA 4F79A 3VOCA 1V3IA 1BF2A 3VD7A 1TFVA 4PTMA 2VT0A 2WLYA 4WF7A 3AHYA 3WDHA 4YN5A 1SR0A 3ZSSA 1I1XA 2XIIA 2Z1SA 2GJPA 4P7OA 2ZUMA 3BXWA 1HJQA 2UY4A 5A6SA 1Q4NX 4Y7EA 1XHGA 4CD8A 3AI0A 2OSWA 4AZ5A 1OBAA 4DWSA 1W2VA 2Y8KA 4LYRA 4NRSA 4OJYA 1VFOA 4DUVA 5I77A 1JG9A 2C0HA 1FOBA 5GNZA 4F8XA 3CUHA 3NIYA 4PUEA 4HMEA 1OIMA 1OT1A 1BGGA 2WBGA 4ZFMA 5A6LA 1JAKA 1UHVA 1V0KA 4HP5A 4JL2A 2ZXBA 4KGJA 2AOSA 2TAAA 1E71M 3BLPX 5HXMA 4IPNB 1CGWA 1VAHA 3KL5A 1UYQA 3WDQA 3GDBA 1V3LA 4GZJA 2W5FA 1RPKA 3QHNA 4MDPA 2WKLA 1J0KA 3MMDA 3WUEA 1H0IA 3WDPP 5EBAA 2VR4A 4QDMA 3IJ9A 4PMNA 2UY3A 2XFRA 3WQ8A 3L4YA 2WVUA 2VOTA 4P7NA 5GNXA 1EOMA 3BSGA 2WXDM 4D1JA 2W91A 3OIHA 2DT1A 1GOWA 1KCKA 3VGBA 2GDUA 2EQDA 1C8YA 3TTOA 3VKKA 3L2MA 4JHZA 1VBRA 1J9YA 3PZIA 2WMJA 3DYMA 3RIKA 4D72A 5I0DA 2VRJA 3N15A 3QHMA 1KXQA 3KWXA 3DC0A 5TD4A 2NSXA 4TTUA 3IAPA 1E4MM 1JNDA 3RCNA 4Q22A 1GW1A 1R8LA 2YBUA 4S3KA 3VIOA 1NWUA 4WIWA 3SCRA 4M24A 2WZHA 1SMDA 1FFRA 3ARSA 5CPSA 5CPQA 3RPMA 1UUQA 3PZQA 1OIFA 3EMQA 5CZKA 4UQCA 3RM8A 1MXDA 4AISA 1DTUA 1W9XA 2J7EA 4E4PA 3G6MA 4B9YA 2ZXAA 3WF3A 3AICA 1RP9A 1SFSA 4CVWA 3WD2A 4OIFA 2Q8XA 4HZ6A 2O9OA 4AC1X 4QLLA 2GVYA 4LGXA 4Z2GA 2VCCA 1UD4A 4MB1A 3PHAA 1AQ0A 1EOKA 4UFIA 1XSIA 1J0JA 5LYRA 2C8NA 1OGBA 3CUFA 3POCA 2WVSA 1V6YA 1C7TA 1M04A 1FHLA 2J8FA 5CXPA 4TOQA 2EPNA 1WP6A 3L4XA 2CKRA 4WJXA 1PX8A 2RGLA 1LL6A 3ARWA 1FH8A 1BG4A 1HJSA 2JIWA 1JYWA 3BAKA 1ITCA 4DWSC 1HJXA 1GZJA 2VZVA 2A3CA 4HA3A 1ZBVA 3MV11 3MO4A 3BGAA 2OYLA 4BZYA 1UR0A 3MS8A 2VL4A 1V3HA 2ZXDA 3AIUA 1BSIA 4H41A 4U5KA 1U33A 3AYRA 1EXPA 4M82A 1TR1A 2DSWA 3VM5A 5C8BB 1MQPA 4RE4A 1ISXA 1KWKA 2XGBA 4U2ZA 3LPPA 2WWCA 4JAWA 3AISA 1V02E 3GNPA 4WKHA 1LL7A 1RH9A 2DIEA 1W1YA 3WENA 2VNCA 2VO5A 1EHNA 5ABFB 1BYDA 1QPKA 1QNQA 3O2LA 5CLTA 3ZMRA 1LWJA 2ZE0A 5EMYA 4PMRA 3L4UA 3ARZA 4MNJA 1XGZA 4V2XA 4QCEA 1HN1A 5FL1A 3M7SA 4WKFA 4J3VA 2YL8A 4JCMA 3S2CA 4OKDA 2YL5A 3WH6A 3UERA 2YA0A 4B3LA 2W63A 1TE1A 3EDFA 1UWUA 5A8OA 1EDQA 4XUYA 1VRXA 3LMYA 1IV8A 2VJXA 1JZ3A 1L8NA 3AIVA 1GQIA 3VIHA 3WD1A 1C90A 4YHGA 4AD1A 5DEZA 4B3KA 1LWHA 3TTSA 1B30A 2FGZA 3NDYA 1A47A 1LL4A 4U31A 1UD8A 4LPCA 4M56A 4QFUA 4C7GA 1AQMA 3TONA 1CXEA 2DT3A 3WQ4A 1UR1A 2YL6A 3UR7A 4GKLA 3CUGA 4HPGA 2J75A 3WQVA 3AJ7A 1QI0A 1YQ2A 1Q6EA 1KXVA 5CSUA 4FMVA 1BYAA 3B8SA 1PIFA 1WZKA 3WF0A 1H5VA 5IFTA 5ABEA 2O9RA 1VJZA 5FCZA 5I2UA 4MAZA 4UZUA 2DEPA 2B31A 3VMOA 3MMUA 1BYCA 3VMPA 3VDCA 2QPSA 3M46A 2YOCA 3W25A 1OSEA 2CXGA 4BQ5A 1JI1A 2ZXQA 1HL9A 1N82A 4BCEA 1E1EA 1OINA 1XCXA 3GNOA 4IPLA 3W81A 3PZUA 2E0PA 4L4PA 1JDAA 1GVIA 2WKGA 2WVVA 3WF1A 2A3BA 4UCFA 1CLXA 2ZUWA 4BQ3A 5I78A 5A8NA 2ZUUA 3EYPA 4J3SA 1JF5A 2V5CA 1W3JA 3VILA 4P8VA 4PMXA 3GH4A 1ZJBA 3VGGA 3BC9A 1MXGA 4A3HA 4CKQA 5ABHA 2CIPA 3II1A 1XD1A 1OGSA 1K9EA 5GNYA 3VD4A 1OGGA 2XSBA 3DHUA 1MQQA 4MNLA 1EH9A 4LX4A 3ZJ7A 7A3HA 4AZIA 1V0MA 4DM2A 2W62A 1V0NA 2XGIA 4JKLA 5JBFA 4JFWA 2RGMA 2PF0A 4Q7NA 1MFVA 1E73M 3GXIA 3WD3A 1WDPA 1BYBA 3A3HA 4HZ8A 2JEQA 4TXEA 3AROA 4F9JA 1K9TA 1UOKA 4H2CA 3VGFA 1UR9A 4OZOA 1FFQA 3UESA 1PBGA 5EFDA 1I75A 2VZOA 2Y5EA 2W4XA 1NOUA 3PBGA 3IJ7A 1QI2A 2X1IA 3WELA 3A4XA 3OA5A 1Z32X 2BY2A 3WEOA 2WZIA 1ZU8A 4PN2A 3PTMA 2AAAA 2WMKA 3OGSA 1GQKA 1WPCA 1D7FA 4OUEA 1J0IA 1EGZA 4H8HA 7TAAA 3UR8A 2CNCA 4TX6A 3EBVA 3AHTA 4WKAA 2BHZA 3VGHA 3VDHA 1CGYA 1BG9A 4OBRA 2ZX8A 1K9DA 2XHYA 4OBSA 2DSZA 2J7GA 4GPNA 3OB8A 4W88A 2DGAA 3RM4A 1H4PA 1KGWA 5A2BA 1NP2A 2G3JA 5KZ6A 5HDRA 3AZRA 2J7CA 4GINA 3BAYA 1C7SA 3WIJA 3VIJA 4AZHA 4QLJA 4WSJA 1EIBA 3A4WA 1E1FA 3W29A 1HL8A 2GK1B 4AZCB 1TUXA 5D9PA 1UKSA 5ABFA 2EO7A 3PN8A 3VD5A 4KRTA 2DDXA 3WNPA 1VIWA 5D4YA 4GO8A 2QPUA 2X2YA 1ISYA 1EQCA 3VUPA 3VX0A 2GFTA 1NP0A 3ZQ9A 3WQWA 3MANA 1MWOA 4UQBA 1WZAA 1JZ4A 2WW5A 2CEQA 1NWRA 1E0WA 2XVLA 3W0KA 4GI6A 3APGA 3OGVA 2OWXA 1BHGA 1KGUA 1OT2A 3TTQA 4PEEA 2Y2WA 4AZ6A 4PRWA 4B15A 1F4HA 4ZENA 1UKTA 2OSYA 5CGTA 1ISWA 1JD9A 4W87A 2VRKA 1E72M 1XYFA 3RILA 2VCAA 3PZNA 3N11A 2W61A 2Y24A 3B9AA 4KGLA 4P8XA 4UQ9A 5AYIA 4UQDA 5A6MA 3WSUA 2ZWZA 3DECA 3VIGA 3KZSA 4KRUA 4GI8A 2D3LA 1EA9C 3ARXA 5A69A 1CZ1A 3FXYA 1E56A 3BLKA 4LYPA 2YDQA 1QNOA 1H09A 2PWGA 4PMUA 1K9FA 4PTXA 5FKYA 4X0VA 4MB4A 5BXSA 3THDA 4GI9A 3RJXA 3RO8A 2XSAA 3W27A 2ZX5A 3CMJA 3I3EA 5JIWA 3TP4A 1S46A 4HOXA 1BGAA 1GVYA 2JEPA 2J25A 2E9BA 1NQ6A 2E9MA 5E6YA 1NOFA 3WEZA 4XZBA 2PBGA 3CH9A 3K8MA 3VIKA 2Y4SA 1EO7A 4PMZA 4RE2A 3ZR5A 2VUYA 3WMCA 1ITXA 5M17A 4TTGA 4AZ7A 2JALA 1UQYA 3B9DA 4U33A 5D9OA 4PCTA 2J7BA 1UZ1A 3AS3A 2VX6A 3VMNA 3SUSA 3ZJ6A 1DWIM 5A1AA 3L4WA 2XYLA 1JYXA 2BHUA 2V3DA 3GYCA 1H1NA 1VBUA 1H11A 1RP8A 2VZTA 2WBKA 2FDMA 4R27A 5CLWA 1X1NA 1ODZA 1MW1A 5BXPA 3AHVA 2YA2A 1JYNA 3CHEA 4LXFA 3WKZA 2V38A 3ZT5A 4AD4A 4WSKA 2WMFA 3ZSTA 1UWQA 5A8QA 4BQ2A 3WY1A 1XH0A 3RMEA 2FH6A 1UA7A 1E70M 1SYTA 3AXHA 3T2QA 3ARVA 3GM8A 3HN3A 3AMCA 2HVMA 1GJUA 1HKMA 5HPCA 4ZE4A 3VIIA 3ARYA 5CQ1A 2G4FA 3AXIA 1HXJA 3TOPA 1KB3A 3AXXA 4NI3A 1J18A 2QMKA 4V28A 3KE0A 5DT5A 1E6NA 3VNYA 5HPOA 1WAWA 4H7VA 4CU8A 3ARTA 2D24A 5FD0A 5BYWA 2PWEA 2FH8A 2XTKA 3U5UA 2VRQA 2D20A 2NT0A 3W24A 3ZJ8A 1W9DM 1TCMA 2O9TA 3FY1A 5LA0A 1HKIA 1US3A 5A6JA 2ZOXA 5EFFA 5LA1A 3MMWA 1KBBA 4XV0A 2V3FA 1AVAA 3AIEA 1MYRA 3K1DA 3SCVA 3AZSA 1UA3A 1XYZA 2X0YA 3VDAA 2GK1A 4AZCA 4PMYA 4GZEA 2NW0A 3VTRA 1MQRA 2XFYA 1JL8A 4W86A 1CGTA 4NRRA 1ZBWA 3CHCA 5A3HA 3VO0A 2J7FA 2VQTA 2WSKA 1Q6GA 3QHOA 2J74A 2Z1KA 1W91A 2WMGA 1E3ZA 1HKKA 1UKOA 3GH7A 3BMWA 1G0CA 1PJ9A 1E4IA 3UCQA 1W9PA 1R87A 3N9KA 5BXRA 5A2AA 1XSKA 3SCPA 3J7HA 3NUKA 3CHDA 1E6RA 2VCBA 3ALFA 1DWFM 1M53A 4J27A 4MDOA 3BAXA 2V5DA 1KR1A 1MVYA 1MW2A 1H2JA 3L4TA 1R7AA 5GPRA 5DF0A 2EEXA 8A3HA 1VFUA 2W92A 4J28A 3NJ3A 3NCOA 5M03A 3WMBA 3W37A 3GZAA 1UD6A 1JZ6A 1C3FA 4PUDA 4ATLA 4EKJA 1GCYA 4UFKA 3SEPA 1HNYA 3OLIA 2QF8A 5IHRA 1UQZA 4XX6A 3LPOA 4DWSD 3WMSA 3WNKA 4LQ1A 5HNNA 4MNKA 1GOIA 4CGTA 1BAGA 1D2KA 3CZJA 1JFXA 2CESA 2WAGA 1KR0A 1MFUA 1KBKA 3KL0A 3BAJA 2VX7A 4D6HA 3M6DA 2A3HA 4C7FA 3MUZ1 2D2OA 3VIPA 3ZIZA 1U2YA 3GH5A 1F4AA 1GONA 2OLHA 1H3GA 1AQHA 1W1VA 4JFVA 8CGTA 3CTTA 1E4LA 1VF8A 1E40A 3PZVA 3IAQA 4S3JA 4M81A 2PWDA 4HPHA 3VD3A 2HISA 1CXKA 1E4NA 2YBTA 4GQQA 1Y7VA 1CDGA 2UY2A 1TZ7A 1HX0A 2YIHA 2WWDA 2OWWA 2E3ZA 4PMDA 1RD6A 1C8QA 1VFMA 3WF4A 1XD0A 4HOZA 3ARQA 1WDRA 2WHMA 4HTYA 5E9AA 3ALGA 4YHEA 1ODUA 2CYGA 3WDIA 1BVNP 1J01A 5A95A 1JDDA 4JFUA 4AZGA 6A3HA 1UH4A 3VDBA 1LLOA 4IUGA 3F4VA 5CGMA 3CLWA 1C92A 1ISVA 1EQPA 1YHTA 1JXKA 4PTVA 1GOOA 1OM0A 4AIEA 4A4AA 1G94A 4XB3A 1HJUA 3WH9A 1KXHA 1KXTA 2JFEX 4GO9A 1BVZA 4ACYA 4E2OA 2YJQA 2BHYA 5DFAA 1UH3A 1UD5A 3MV01 3GTNA 2GJXB 2E8ZA 1QHZA 2PI6A 2IXVA 1KWGA 1E0XA 1TVNA 1CWYA 2C7FA 2V3GA 3D3AA 3M07A 2WANA 1ZL1A 3BMVA 4EE9A 1V6VA 3GXFA 1V08A 5D9MA 3W53A 1QNPA 1CLVA 3F5KA 4MAVA 3U7VA 4NSBA 5JBDA 4UR9A 4JCLA 5AC4A 1VEPA 3EDEA 3NSMA 1JI2A 4B16A 4W7UA 2ZUNA 4N42A 3JUGA 5HBFA 3W82A 4J3UA 1DP0A 2BVYA 5AC5A 4ATWA 4CD5A 3SCWA 2PB1A 1G5AA 2ZUSA 5I24A 1I1WA 3EMZA 1DWJM 1VB9A 4J3XA 4M29A 1IZJA 1QW9A 3GXMA 5A6BA 2E40A 3VGEA 3CBWA 3KL3A 1QHPA 4H04A 5BXTA 1QI5A 1OCQA 6CGTA 2J79A 3AIRA 5IXEA 1AMYA 5BCAA 2ZIDA 3TA9A 3SIMA 1M7XA 1HP4A 2BVTA 4W85A 4V27A 3UEQA 3PZOA 3AQUA 4MB5A 4ZXLA 1CEOA 1A3HA 2J7DA 4F66A 1ZS2A 2EBNA 3OGRA 4CU6A 2MANA 2D3NA 3FHQA 1QVBA 1UWSA 2XIBA 1B1YA 2W66A 3OZOA 1FH7A 1V03A 3ZJKA 5FL0A 1K6AA 2WC3A 3W26A 4BQ4A 1V3JA 3FAWA 2VC9A 1CECA 1E5JA 1JAEA 1IZKA 3WUBA 3EDKA 1HVXA 4JFSA 3OZPA 3I3BA 3S6TA 4P7QA 3BCDA 2BXZA 2JIEA 4D71A 1W9UA 1J10A 3T0BA 2G3IA 3GXDA 5EB8A 2BNJA 1W9VA 4W7VA 4E8CA 1JYVA 1DWGM 2YDSA 5GQBA 4PMVA 5DO8A 3ZR6A 2D22A 4P8WA 1JZ5A 3VD9A 4WLCA 1GHRA 1IT0A 5DMYA 1BTCA 2O92A 2XM2A 3CIVA 1CXIA 1E55A 3DHPA 3W28A 3L4VA 4UTFA 3ARUA 1TA3B 2JF6A 3K8KA 1KGXA 4TUFA 1W3KA 1JNEA 1R86A 2J47A 1VENA 1CBGA 1ZB5A 2VTFA 4UOQA 3T09A 2VZSA 2ZX6A 1GORA 5A94A 4UFHA 1V6WA 3UETA 1US2A 2VVSA 1LQ0A 3QOKA 3WBAA 5E09A 4NZCA 3W6MA 5A6KA 1FP9A 4D1IA 3VX1A 2J8GA 5KEZA 1XH1A 1WZLA 5IHSA 1MW0A 3AHZA 4UFJA 1CXHA 2XVNA 3K4DA 3VIFA 1ESWA 2EPMX 4JKMA 2ZX7A 2WSPA 4HMDA 4RE3A 3AZTA 4D6IA 2VR5A 4D6CA 2WCSA 5D8ZA 4ZEPA 3SUVA 2QV4A 3KEHA 3WEMA 5BWFA 1E43A 1J12A 2X8RA 5M3WA 2ZUTA 2XWDA 1UR2A 2DH2A 3N18A 1WKYA 4HMCA 5E70A 4AXNA 2J78A 3WD4A 4DM1A 1CGUA 1QNRA 4CUCA 1XV8A 4PMOA 4ACZB 2OYMA 3WBEA 2GSJA 2CITA 1UD2A 1UR8A 1M01A 4PBGA 1B3ZA 1H49A 3FNDA 3UG4A 4RL3A 1EHAA 2GDVA 2GJXA 3GBDA 4QP0A 4Z2KA 4X0NA 4PTWA 1HJWA 2WM0A 3PTQA 1E6QM 4EAMA 1E9LA 1CXFA 2VZUA 1GPFA 3WDRA 4M80A 3T2OA 2UY5A 2BY1A 1UKPA 2CPUA 4CN1A 3CZKA 1J11A 2DIJA 3OLEA 1X6LA 5CG0A 2IXUA 1DWHM 1B3YA 4CU7A 3NSNA 4MTVA 3N13A 2XWEA 1JF6A 5JIPA 2GUYA 3BAWA 3CZ8A 4JZ5A 1UWIA 4CD7A 3IJ8A 1JFHA 4MJ4A 4CN6A 3ARPA 3SCNA 1H0GA 1HT6A 4CCDA 3UG5A 1LG2A 3VINA 4WK9A 4UOJA 5ABGA 1UZ4A 3QOMA 2CBVA 4AIUA 4D6JA 1PX4A 3AMKA 1B31A 3VM7A 1Q6CA 1OWQA 4W93A 4BF7A 3A4AA 1GJWA 3AS0A 2BXYA 4UNIA 5BRQA 3ECQA 2D23A 3CUJA 2CBUA 4LYQA 1WNOA 1WDQA 2QMJA 4YPJA 3AIBA 2WMIB 1CPUA 3VGDA 4J3WA 4P7LA 3A47A 2ZWYA 4N0RA 5FOOA 1Q6DA 1GHSA 1CNVA 2PWFA 2WCGA 4X9YA 5A2CA 1E3XA 3B9EA 5I79A 3AIWA 5CJ5A 4H8UA 4CD6A 2WHJA 5BROA 5CSYA 3PZ9A 4ZXOA 1JD7A 1TVPA 4TVCA 3VIMA 3AS2A 3CPUA 1G9HA 4P7RA 5IFPA 4EK7A 2D0HA 4XZWA 3OLDA 2X0HA 2WVVB 3GNRA 4L4OA 1R7OA 3SUUA 4HU8A 2E9LA 4FLQA 1CYGA 1E6SM 1KQZA 3BH4A 4AY1A 5AYBA 2DSVA 4UQAA 1NOWA 1TG7A 2ESCA 1JZ8A 3MKKA 3WD0A 1OD8A 5E0FA 1FHDA 1ZBKA 1ISZA 1UKQA 4UFMA 3F5LA 4GZIA 3AFBA 4UZSA 4D6DA 4C7DA 4ZE5A 4AYSA 5I5RA 3VNZA 2UWFA 3WNOA 4QAWA 4QLKA 4U5IA 3SCOA 1TA3A 4D6EA 3RDKA 5ECUA 4CCCA 1PIGA 1WE5A 3SUWA 4R5EA 2A3AA 2OYKA 2CBIA 1QI4A 1EDTA 1UWRA 1M03A 1DHKA 1GUVA 2BV9A 4PYSA 1PPIA 3MUIA 1QNSA 4A3YA 4AMCA 2WVTA 3CO4A 1NARA 3SURA 1XCWA 4D6GA 1LF1A 2ZICA 2YDRA 1B0IA 1W3HA 3N04A 1JZ2A 4Z2LA 1J0HA 3WH7A 3WH5A 3CMGA 1C93A 3AS1A 2FHFA 2EXOA 3N1AA 1ECEA 2DPEA 1E6ZA 1VFFA 1HIZA 4P8UA 1WZMA 1KQYA 2XM1A 1V3MA 4AD3A 3WN6A 4IISA 1V02A 3ZM8A 2VURA 1U30A 2NT1A 4HU0A 5D9NA 3RM9A 3K46A 4KWUA 1BPLB 1B9ZA 2YA1A 4ACZA 2FGLA 2YL9A 2WHLA 3IANA 2F8QA 1BFNA 3U57A 2WLZA 4HA4A 2CCRA 3IK2A 2YLAA 4PCSA 4U3CA 1E5NA 2CBJA 1GOQA 1UWTA 2XVGA 1E15A 4OOUA 2BY0A 2DT0A 3MSDA 4E8DA 4DUXA 2VMFA 2OWCA 5I3DA 4AEFA 1GQLA 1SMAA 1DEDA 4W8AA 2G3MA 4EANA 3QR3A 3AIQA 2AMGA 5JUVA 5C70A 4CCEA 1OD0A 1JGIA 2QLYA 2BVDA 1FP8A 3T2PA 1UR4A 1HVQA 3AYSA 5I6SA 2BY3A 2FHCA 2DH3A 4GXPA 1WO2A 2DT2A 3G6LA 3SCSA 4M1RA 5CPTA 1PAMA 4GIAA 4U3AA 1VEMA 4HA1A 3AOFA 4DUWA 3HJEA 4FK9A 2G8ZA 4FLSA 9CGTA 4W89A 5D8WA 4BA0A 1WDSA 3W6LA 1GNXA 3TTYA 5I23A 3WQ5A 2J7HA 2D1ZA 3WL0A 3L4ZA 3WNNA 3SCUA 1G01A 2GJRA 3U5YA 3HU7A 3FW6A 3U7BA 5C71A 4NF7A 5IDIA 5HOSA 2CETA 1KCLA 3PZGA 1B2YA 1CENA 4UOZA 1D3CA 2DSKA 3CZLA 2WZEA 2WB5A 1V3KA 3QGVA 2WMIA 1V0LA 1TMQA 3WL1A 3POHA 1JXJA 3BAIA 3OG2A 3MU7A 2XFFA 2CERA 3EDDA 3WNLA 3WDJA 2G41A 2G3NA 4MJ2A 5BRPA 1XH2A 1JIBA 3ZT7A 1GOMA 2J4GA 3AMGA 4AW7A 1WB0A 3NSXA 3WH8A 5M5DA 1PEZA 1QBAA 1E0VA 4W7WA 2WYSA 5E6ZA 1BLIA 2W67A 4MNMA 1GOKA 4JFTA 3N12A 3EMCA 3DYPA 1QOXA 3FN9A 1HKJA 3CZGA 3N17A 5LA2A 4PMQA 3DYOA 2ZX9A 1MW3A 3K8LA 3T0DA 1J0YA 2EJ1A 2XPKA 1OB0A 1QHOA 3W38A 4CN4A 5AY7A 1EO5A 4TVUA 2CHNA 1PX3A 4H8VA 4DWSB 2XVKA 3L2LA 4PSRA 1FH9A 3FHAA 1LJYA 1W1TA 5DT7A 3THCA 1HP5A 2JE8A 2Y8VA 1CXLA 3MUY1 4IM4A 1UG6A 2WNWA 1NM9A 3SCTA 1PZ3A 4BS0A 1XRVA 2WK2A 4MPKA 2D0FA 2PC8A 2BS9A 3WNMA 1ZJAA 4JIEA 4FLOA 1Q6FA 6TAAA 5A8MA 2CKSA 1JZ7A 1PZ2A 1B3VA 3E1F1 1NWTA 1V6XA 3D5HA 4KH2A 2WHKA 2X05A 1NH6A 3WQ6A 3CZEA 1HF6A 3K4AA 3O9NA 1J0ZA 1VJSA 1FA2A 2ZUVA 1KFWA 2VX5A 3LPFA 1CTNA 3MSGA 2O9PA 2IUZA 1E6PA 3OBAA 3BSHA 2BFGA 3F5JA 4K68A 3A6OA 2OSXA 3WUGA 2EPKX 4ATDA 1QI3A 4FLRA 1ZBCA 3CHFA 2VQUA 1W1PA 1P6WA 1CGVA 1EDGA
chains in the Genus database with same CATH superfamily
3AHXA 2WSQA 3GR7A 1R38A 2J62A 3RRXA 4IOTA 2YLLA 3UG3A 3W4RA 1W32A 1ZP4A 2WPGA 1W2PA 2R1MA 2D2HA 3XINA 3W1XA 3NZRA 4ML4A 1L0PA 2XJ7A 2JF7A 2Z1WA 1NAL1 2IPFA 4B9ZA 5FJRA 3N2BA 4H00A 4IGHA 2E8YA 1Y5WA 4JTHA 1XSJA 2VGGA 4NYUA 3WQFA 4MB3A 1UWAA 4Z2JA 5LNRA 3LLXA 4W5ZA 3M64A 2VFFA 3TLLA 1OYCA 2PWHA 1B3WA 4IFOA 1Y5VA 4O12A 1VH7A 1NWSA 3W83A 4G56A 3PFRA 2ZRWA 4GUJA 2V3EA 1ZTVA 1P4CA 1OX6A 4IL2A 4AIOA 1EGVA 3W75A 1FCUA 3DBPA 4CNOA 4J7RA 1KM4A 1TELA 2A3EA 2WC4A 3B40A 3O06A 5AHLA 2VVNA 3EDJA 1E6XM 4H4IA 4CD4A 5JBEA 4QISA 3DBNA 4KQNA 2WV8A 3GC2A 3VU2A 4PR4A 3ZOAA 2RAGA 3M0YA 3WFLA 1XC6A 5CBJA 3PBYA 1H41A 4DJDA 5F1UA 2FPYA 4L64A 2E4TA 4Z2IA 4AAJA 4AWEA 3A3WA 4I9AA 3G18A 3VVGA 2EPLX 4XZHA 1UC4A 3P67A 3RJYA 3STFA 1OFPA 1O1HA 1UPMB 3C0LA 3KLKA 4DELA 3T1GA 3LPGA 4DF2A 3Q58A 1XL9A 4JHOA 3KDOA 3RX3A 1K03A 3G8RA 2SFPA 1FX6A 3GUWA 4GQRA 3NDZA 4F79A 1XLBA 4Y8EA 1TFVA 4PTMA 2WLYA 3W76A 3WDHA 1EBHA 3GTFA 1SR0A 3OVGA 2XIIA 2OO6A 4JYFA 1FTXA 2YZRA 4P7OA 3PBUA 1RQEA 4DQWA 1IIHA 5A6SA 1TJ1A 4Y7EA 2YCLB 4IIGA 4RDZA 3RLHA 4N9DA 1H63A 2C0HA 2PRHA 1AH3A 4ORIA 4ERAA 1FOBA 3CUHA 4C6OA 1OIMA 4PRRA 4NILA 3MHGA 1V0KA 3LGDA 2OLAA 3DGRA 3BLPX 3GU2A 5HXMA 4CNPA 3CB8A 3HZ3A 4OECA 4TO8A 1UYQA 2VXNA 4GZJA 3UWVA 3TR2A 2CZDA 4KCVA 4PMJA 1JDEA 1LBMA 2ACQA 2PCEA 3WDPP 3UXLA 4ZZ9A 3BLIA 3NQAA 4A8LA 4UNKA 3MC5A 4IHCA 5BU6A 1TWZA 4HHLA 5DMNA 3WQ8A 4QJ1A 3RG6A 5GJMA 2VOTA 3G3MA 4WDUA 2GSHA 2PDYA 2WXDM 1NY1A 1Z42A 2DT1A 4JOMA 1KCKA 2XGZA 4A3QA 1TQXA 1C8YA 3TTOA 4JEJA 1J9YA 3B04A 2VOMA 3RIKA 2P1FA 3AWNA 4WSHA 3G2GA 1KXQA 1SW0A 1BTMA 3SN4A 4K8GA 3UWYA 3DC0A 2NSXA 4O10A 5HR6A 1Q66A 4S3KA 4MVAA 4WIWA 3I7QA 4M24A 2P76A 4IZGA 2HWGA 1FFRA 4KS0A 5CPSA 1TO3A 2ZZ4A 3H6OA 3EMQA 3BTNA 5CZKA 4UQCA 1DTUA 2QUTA 4E4PA 2WNQA 3UJRA 2V5LA 4XSMA 4XZIA 3IGUA 4LRTA 3W01A 4KWWA 2DJLA 1EFZA 4HZ6A 3L66A 2Z2AA 1YDYA 1R46A 3GUGA 2PAJA 2G0WA 1VFSA 1UD4A 3PB2A 4UFIA 3FYPA 2DZSA 4MGGA 5LIYX 4QROA 1C7TA 2J8FA 4FEZA 1YKWA 4AIBA 4ZR8A 4WOZA 3W02A 4K1GA 4WJXA 3C0QA 1G69A 4IP7A 3IJ6A 1QASA 3BAKA 2NZLA 1VCGA 1HJXA 2HE5A 2QJGA 1N2VA 4AHOA 3PJUA 3AWOA 2A3CA 2A0NA 4ADUA 2OYLA 4S1FA 3QR0A 4ZQMA 3F4DA 1V3HA 3LSCA 4H41A 2IKHA 3AYRA 4ICNA 2DSWA 4RE4A 3NFUA 1GW9A 3WFAA 1BRLA 1R3YA 3LPPA 1D3GA 1V02E 3GFZA 3FKKA 2VO5A 1QPKA 1LWJA 2X16A 1S1PA 3WO8A 1KLZA 3UJSA 4PMRA 1F05A 3HGSA 1XGZA 4GOAA 1VFTA 2OU4A 4J3VA 4JCMA 1KBJA 5LNWA 4UTIA 3WH6A 4NJJA 1V7YA 3RU6A 1U83A 3R6IA 1EDQA 4IX0A 4ZO9A 1ZAIA 3LMZA 1A49A 3LMYA 1I60A 3S2JA 1HKVA 2VJXA 7XIMA 3DOPA 1PDYA 1X7IA 3EA3A 2PDLA 3TTSA 3IK4A 3NDYA 1ZZMA 5K3VA 1A3WA 4LPCA 1HTIA 4NZ5A 1AQMA 3TONA 2W27A 1OFAA 1SZRA 2ZCGA 2DT3A 3E2QA 4X2PA 3WQ4A 5CPMA 3ZFHA 1TX0A 2J75A 1Q6EA 3SN1A 4FMVA 1PTAA 1YNYA 2FVKA 3WF0A 1H5VA 3P81A 2D2JA 1A53A 4UZUA 4LVGA 3UFYA 3S9YA 5JXQA 3BDKA 4O1CA 1BYCA 2C0AA 3VMPA 1PSCA 4RZ5A 4IWWA 1BXBA 3YPIA 4BQ5A 4GH1A 3L21A 5LNVA 1UMYA 2O0TA 4IPLA 3IWPA 3DI1A 1L6YA 1MEIA 3S9IA 2WKGA 3GU9A 3GDLA 2FGBA 1M5WA 5AN7A 1KLYA 4Q4OA 2ZUWA 4MY1A 4AMAA 3BJTA 5I78A 2ZUUA 3LX9A 1EJTC 4XD4A 4P8VA 5DMMA 5E0KA 1S2AA 1A0EA 2V5KA 1DKWA 1R9YA 1TMLA 4A3HA 4CKQA 5H91A 2ZZ3A 3II1A 3JW7A 3OG3A 3P8IA 4DZIA 3VFCA 2XSBA 1MQQA 2INFA 2R1PA 2VGIA 4R33A 1LTDA 1GEQA 3ZJ7A 4EPDC 4DM2A 3WK3A 2FVLA 4RE0A 4Q7NA 4AG0A 2Q09A 1E73M 4RPQA 4X60A 3GXIA 3W85A 1Q8JA 3A3HA 1RCQA 4PCNA 1W5NA 1EL3A 1AA1B 3W87A 3VOHA 2V0TA 4FALA 5SWUA 4H2CA 5H8UA 3VGFA 1OJXA 4B3ZA 1TTPA 4UTJA 2VZOA 1QI2A 3W73A 2CXEA 4M7SA 5CJNA 2WZIA 3LXBA 1ZU8A 2OKOA 3DEQA 4PN2A 3G1HA 2AAAA 3BGGA 2JKEA 4KT2A 3UR8A 3EBVA 1DJGA 3AHTA 2IPJA 3IPWA 2YYUA 1AMKA 3KVKA 5FJUA 5H6HA 4OBRA 4FO4A 4H6EA 4IJBA 4IMCA 1L6GA 4OBSA 3LY0A 1A5AA 4K37A 3GS6A 4GPNA 3OB8A 4OHQA 1F73A 1NP2A 2YCKX 3M5ZA 3V1PA 2J7CA 1UIOA 4M5PA 3NDOA 3WIJA 5IDZA 4M6VA 4IP5A 5HMEA 1LP6A 4QLJA 3BSMA 2AQWA 3GO2A 3K5XA 2GK1B 4AZCB 1TUXA 5CPLA 2EO7A 3PN8A 3AYVA 3O3RA 4S38A 3KBJA 4KRTA 4LH8A 3WNPA 4E2DA 4I7UA 1VIWA 3O07A 3M0LA 2QPUA 4QJ4B 1ISYA 3CAQA 4IGSA 4E2VA 1JUKA 3A21A 3BLLA 4QE5A 1T99A 1NP0A 3Q37A 2ZRXA 1WZAA 3O6YX 2WW5A 1EJXC 4WX2A 1NVMA 8XIAA 3IEBA 3TV8A 1ZNNA 1G4TA 4F2BA 3VC5A 3GHUA 1OT2A 3LHYA 3STPA 1F4HA 1K1DA 1A5NC 3OVPA 1EZ2A 4GA8A 4RDVA 3KHDA 4N02A 4JX4A 1E72M 4J9JA 2VCAA 2QAPA 4GIYA 5MKGA 2PDPA 1KFKA 4QX4A 3DECA 3B0VC 1F6KA 3KZSA 3N3MA 3R8GA 1SVDA 3BLFA 3FXYA 2QS8A 2PDQA 3B03A 1T8QA 2YDQA 4IFRA 3RUBL 1O1ZA 1B9BA 1H09A 4O1DA 4PTXA 4X0VA 2QQ6A 3LDVA 2OZTA 1YYAA 2QZRA 4HYVA 3WLRA 1YXDA 1GYMA 1OFDA 3B8DA 2V5BA 4KIEA 2ANUA 3PB0A 3I3EA 5HWMA 5JIWA 1EJVC 1W3TA 4FR6A 1RY0A 2JEPA 2DW7A 4LY4A 4XWUA 2E9BA 1Z7AA 4UMBA 2GYIA 4B5UA 4XZBA 1A0CA 3ANYA 3VIKA 4RE2A 3SAZA 4Z1DA 4G7EA 3ZR5A 2VUYA 3R43A 1R9XA 2DZUA 5M17A 1GKRA 1YXYA 5I3FA 3TNOA 5LHFA 3T05A 4XO6A 4PCTA 2J7BA 2F7FA 4EWJA 1WXJA 4UTLA 3BV7A 1W37A 5TBOA 2YCEA 3FXGA 4WGHA 3SUSA 1C8VA 3ES7A 4IJRA 3DFSA 5A1AA 2XYLA 4HCLA 4PRTA 1WDDA 3N34A 4OV9A 3BJFA 2BHUA 3ABOA 4KWOA 3GYCA 4DAIA 1H11A 2V2HA 1RP8A 3HURA 4LW7A 3V0SA 5ECVA 3O1NA 5MF5A 2WBKA 4ZOAA 2HNHA 1X1NA 1ODZA 2YA2A 1ITUA 4J40A 1VR6A 1JYNA 4LXFA 1F7BA 3O15A 4IMDA 1T96A 3ZT5A 1P48A 1WX0A 2A21A 3CEUA 3THUA 3SR7A 5A8QA 1WDWA 1XRSA 3EOOA 1S2WA 2QIWA 3OZMA 3E74A 2VWSA 1UA7A 1RXOB 3PWAA 4ILSA 3E6EA 4CNNA 3NZGA 3T2QA 3DUGA 3P14A 2VYOA 2ZZ7A 3AMCA 2GJNA 3P82A 4NXSA 4ZE4A 3VIIA 3LLFA 4XTDA 3AXIA 3GVVA 2NQ9A 1OADA 1BKSA 4D8ZA 1KB3A 2WJFA 3SGUA 4MKSA 1M6JA 2QMKA 4DBEA 4YVVA 4IQDA 2P3ZA 3KE0A 5DT5A 4B5NA 4IG2A 4EPKA 1E6NA 3MHFA 3SIZA 3ARTA 2PUZA 2E25A 2PWEA 2FH8A 2B7NA 3Q67A 4JTTA 3W24A 3ZJ8A 3UVIA 2O9TA 3FY1A 5LA0A 4IIBA 4ZOEA 4QRNA 4H9XA 3EXRA 4IIHA 3FSUA 5LA1A 3AYTA 1Z3NA 3AIEA 3C3NA 3K1DA 5L9FA 1CT5A 3T4WA 1JRCA 1JL8A 3T8QA 4IMEA 4KKXA 3PUGA 2BXVA 2VQTA 2NLIA 1N8IA 4DZ5A 2WMGA 4R7WA 5I3JA 1H7XA 4QE4A 5REQA 4L1GA 1G0CA 3UCQA 2H8XA 5BXRA 3C2VA 1RD5A 3J7HA 1PIIA 3NUKA 2C1IA 3KCJA 3CHDA 3ALFA 3A4JA 1DWFM 4F0HA 1FWBC 1QXLA 3ABSA 1UBSA 4MDOA 3BAXA 1MVYA 5GPRA 2PSNA 2EEXA 1P7TB 1VFUA 5FSEC 2JBMA 3GR4A 4Q3MA 3HPSA 3MWAA 3UJFA 3W37A 4ZVJA 1JZ6A 3FVDA 1SGJA 4N4PA 1PWMA 4EKJA 5XIMA 1HFBA 3OLIA 1OVDA 4FS9A 4XX6A 5C7HA 4L61A 3I65A 3CNYA 5HJLA 2PGFA 5FAJA 1TPC1 1JPMA 3KLLA 4LQ1A 3WK0A 4MNKA 1H1YA 1KR0A 1KBKA 1AK5A 2VX7A 4H9UA 1S2UA 3M6DA 2Q01A 3BL3A 4C7FA 4MM1A 3TR9A 3VIPA 3ZIZA 3GH5A 5C5YA 1F4AA 1H3GA 3W1AA 3W86A 8CGTA 3VKCA 4GNKB 4AWUA 1EX1A 1B54A 4C6EA 2H3BA 1E4LA 1XLGA 5CSRA 4M6PA 3NGJA 1F74A 1RBOB 3M5XA 3HOJA 4HPHA 3W1UA 3NQDA 1CXKA 3I6RA 4DI9A 2UY2A 4GQBA 3UPMA 2GGEA 4N4QA 2VFHA 5D04C 3DGBA 4KEZA 4HOZA 3VCRA 5E9AA 4OU1A 3ERPA 1ODUA 2CYGA 3RPTA 1M68A 3N2CA 4JPGA 5A95A 1JDDA 1RSCA 6A3HA 1LLOA 3LHUA 4IUGA 3F4VA 3CLWA 1C92A 1ONXA 1R2RA 1XP3A 3HGOA 4JNYA 4F0RA 3M9YA 2C14A 3HBLA 1OF6A 3GTHA 1XIJA 1G94A 4H7CA 3LERA 5D37A 3WH9A 4IXXA 3IIVA 4O0ZA 5TNVA 4XAYA 4GO9A 1BVZA 2CLLA 5DCEA 4GFIA 2YJQA 4HSOA 3M47A 3MV01 3GTNA 2AL2B 4HTBA 2E8ZA 4UC5A 1KWGA 4I3GA 4E3TA 1E0XA 1CWYA 3RYSA 3QZEA 3TROA 2V3GA 2F9RA 4WD0A 3D3AA 3KCOA 1KM6A 4H9YA 1K7EA 3KBWA 5K9CA 3H2AA 2GSEA 5D9MA 4R7OA 4YWIA 2VD8A 4LNCA 3SN0A 5C9RA 4BEUA 4RCXA 1VEPA 4JTLA 2DUAA 3G8EA 1AL7A 1XLMA 1KFCA 4GLEA 3LI1A 7TIMA 4J3UA 1DP0A 3SY1A 4ATWA 3M0XA 3C86A 4EACA 1S3TC 4XUGA 5FACA 2WNZA 3B97A 4J3XA 2ZRYA 4CNTA 1IZJA 3GXMA 1VZWA 2BOFX 4PCFA 4H04A 1OZQA 3WLKX 2J79A 1RCOB 4CQ8A 5IXEA 1AMYA 3K30A 3O7UA 1SSDA 1OC6A 3SIMA 1M7XA 2BVTA 5LXXA 3FA3A 3AQUA 1OHLA 3HB9A 4MB5A 3DERA 1GOXA 3G22A 3GIQA 4LRSA 2FZ9A 1ZS2A 5MHBA 5G4WA 4PBEA 2G50A 4LWWA 1RQHA 3PANA 4BF5A 2VR2A 1UROA 4RPPA 3USZA 4NXKA 1K6AA 3IIOA 3MDUA 1F9CA 3W26A 2CLHA 3LBCA 4P2VA 5HQLA 1KFBA 5D2WA 1IZKA 3WUBA 5HK4A 1DQWA 3LK6A 5HWNA 4JFSA 3OZPA 4P7QA 1UC5A 2BXZA 3TC3A 2CW6A 3GXNA 4GKTA 3GIPA 5EB8A 3GXDA 1W9VA 1JEZA 4XVEA 4AFYA 4YCOA 1DWGM 1UR3M 1DOSA 4DBUA 5GQBA 2NV9A 3DFNA 4GNJA 1ME8A 3CC1A 2WJDA 1E0TA 1NDZA 4P8WA 5IOBA 4WLCA 4H2HA 1BTCA 2D2GA 2WSYA 2YW3A 3LHZA 3CMFA 3CS2A 3CIVA 2XM2A 1DQUA 1E55A 3ES8A 1KGXA 3P62A 4YMZA 5I07A 2J47A 1FWFC 1TPH1 4A35A 2ZX6A 1V6WA 1US2A 3H7UA 1K4HA 2IW0A 2W79A 5A6KA 4WRHA 4TV5A 3QC3A 2V69A 1G6CA 2JKAA 1XH1A 1Q6OA 4UFJA 1CXHA 3K4DA 1SO6A 4LAZA 3V18A 1AJ0A 2GOKA 5LNSA 3H7RA 4JYDA 3AZTA 4D6CA 3BW3A 1KO0A 1E43A 2Z26A 3R8RA 3BCJA 5EPDA 1ZJHA 1ENUA 4QG9A 1E1CB 4HB7A 1F6YA 2DVUA 1GWJA 3E38A 2O55A 3QMTA 3G0UA 1CGUA 1QNRA 4CUCA 1RBLA 1XV8A 2RJGA 3WBEA 2B7PA 3KOWA 2CITA 1M01A 2DU2A 1B3ZA 4Q8UA 2VEIA 3SFWA 3UCDA 3MT1A 4I6KA 4QP0A 1A5OC 1ZPTA 3PTDA 2V81A 2VM8A 3T4CA 3ATZA 1W56A 2WM0A 3STEA 4C65A 1CXFA 3R89A 2VZUA 1GPFA 3TAOA 1D9EA 5FEPA 3GG8A 2UY5A 1QT1A 4A3RA 3AJXA 1TSIA 1F8MA 2VDHA 1AJZA 2PU0A 3N19B 3CZKA 1EP1A 2VC5A 1XLCA 1X6LA 5CG0A 3HQOA 2IXUA 1J6PA 4MTVA 2XWEA 4K6AA 5LKYA 2NQZA 1TWSA 4PUWA 3WZ0E 5AHNA 3C5QA 3CZ8A 4IGNA 4JZ5A 4GY0A 1GG1A 2VFIA 3IJ8A 2PODA 3CAKA 3MCMA 4PE8A 3ARPA 4HBKA 1UASA 1DV7A 1EA0A 3KRBA 1JCJA 1ZAHA 4WK9A 4UOJA 3S2MA 1VCVA 3F1QA 4CEXC 3OQEA 1TREA 3G1SA 5H2ZA 3CM4A 5K4ZA 5BRQA 3ECQA 2D23A 3GY1A 2QMJA 1B4KA 1CPUA 3VGDA 4FNPA 4ZQCA 5T91A 3N2MA 1Q6DA 1GHSA 2WCGA 4LBSA 4X9YA 4ZL1A 1A0DA 5CJ5A 3GHRA 3PPHA 2OZ0A 4E3VA 1KM0A 5CSYA 3S6DA 4AC7C 3ZVHB 2QCDA 4GIEA 3CPUA 1Z69A 3SY5A 3CWOX 4JIQA 4P7RA 4EK7A 2D0HA 2R82A 2X0HA 3BW4A 4ZB0A 4L4OA 3GC5A 2QCHA 1Q6QA 4HU8A 2E9LA 3CQIA 4LAKA 2DV0A 1E6SM 3MP5A 4ADTA 2B4GA 1PKNA 2XIJA 5AYBA 3SM0A 4MUPA 3NQFA 3PS7A 3L2IA 1W5PA 4IQLA 3OVRA 3E9AA 3QSRA 3DENA 4D2JA 4JTKA 4LOCA 4GWEA 3RU8X 4D6DA 3PVFA 1TR9A 4C7DA 4H3DA 3VNZA 3AXKA 5CEWA 4U5IA 3UZ5A 5ECUA 3R5EA 1XIMA 4FNQA 4R5EA 1OYAA 2E1WA 2CBIA 2AMXA 2PCQA 1M03A 4MZYA 3RFAA 1S38A 4PYSA 3MUIA 4A3YA 4AMCA 3GHSA 3ZR4A 3LCLA 2ZC8A 4Z1YA 2ISWA 1TE6A 3RPDA 1JZ2A 4Q8PA 4Z2LA 3WH5A 2QCLA 3CMGA 5K7JA 3AS1A 6ALDA 3NQBA 3N1AA 1ECEA 4DLFA 4FOUA 2DPEA 2H90A 2C71A 1EEXA 1V3MA 2NLYA 2LLEA 4LAMA 3VOIA 3LN3A 4YTQA 3GXPA 3WLIA 3ZM8A 5D9NA 1QO2A 2CZFA 3ITTA 3OODA 3SQSA 3NR0A 1WYIA 1BPLB 2PTDA 4ACZA 4WHBA 1I2RA 3LHVA 2F8QA 3U57A 3OPSA 3G5EA 3H2OA 2AGKA 1WKDA 3G77A 5CC5A 2GGGA 2YLAA 3LBOA 3H21A 4GISA 1VS1A 4E8DA 2PGEA 1DIOA 2VMFA 1K8YA 4L6OA 4AEFA 1BSLA 3PSWA 3ZWSA 2G3MA 3QR3A 3W1LA 4L4LA 1H1ZA 4H8NA 3WLSA 3TJ4A 1OD0A 4UR7A 3W7IA 2QLYA 5I00A 2R9RA 2NVCA 3E0FA 3HG3A 3TYUA 1SO4A 1QU4A 1WO2A 3WLPA 4KERA 5CPOA 5FF7A 1W3NA 2J24A 3AOFA 3HJEA 5KITA 9CGTA 4XSLA 3FK4A 1EC8A 1VBGA 1GNXA 5CBIA 3RLVA 1XDJA 2D1ZA 4C6MA 2VEGA 1PXGA 3HU7A 3FW6A 1DXIA 4LBRA 4QXIA 1KCLA 3C3UA 1ZCOA 3UNTA 2DSKA 2BODX 2WB5A 3QQ1A 1JCTA 3LUTA 3QGVA 3S1VA 2VDGA 3TSBA 3NA8A 1V0LA 2PTWA 2HS8A 1EXBA 5EYWA 1JXJA 3RR4A 3OG2A 3F2DA 3MU7A 2XFFA 3A24A 1LOSA 3SSZA 4C6CA 3GQYA 4JY8A 2XN1A 5FESA 2E09A 3R0KA 4XK2A 1KBLA 5BRPA 4WGXA 4L4MA 1O68A 2J4GA 4GC4A 3L67A 1DYSA 5H1WA 3LGEA 4I5RA 3TMQA 4MNMA 2X41A 4NNBA 4MHBA 3WK1A 3DYPA 3FN9A 3W84A 3CZGA 1XLLA 5LA2A 2YCJA 4PMQA 3UWUA 1XIBA 4NAEA 4HN8A 3K8LA 4C6DA 2C18A 2ZTJA 1QHOA 4AX6A 2IKIA 1MZHA 1PX3A 5C0QA 3GIYA 1LJYA 3THCA 1WKEA 3UR2A 1TPVA 1HP5A 2JE8A 2PLKA 2Y8VA 1CXLA 3MUY1 4IM4A 2VFEA 1NM9A 4NG3A 5DMLA 3SCTA 3W1MA 1K6WA 1XRVA 4FA3A 2WK2A 4KFOA 2E6DA 2PC8A 1Q6FA 3E0IA 3NTYA 6TAAA 1JZ7A 1R3QA 4Q8MA 3E1F1 4O13A 1NWTA 4WEVX 2PFHA 4KH2A 2WHKA 1M7JA 4MWAE 3O9NA 2FQIA 3VYLA 1VJSA 2ZUVA 1CTNA 2DZAA 2NQ5A 1PS9A 1TQJA 1DJHA 3F5JA 3W7JA 1BWVA 4B90A 3K13A 3KUMA 3NZ1A 1X8FA 1JR1A 4HSHA 4OT7A 5T9CE 1P6WA 1CGVA 1ZALA 1EDGA 3WBXA 2GLKA 1VD6A 2J77A 4AD5A 1J6OA 1W3IA 2F2HA 3MDWA 4PUMA 5EA9A 5HJYA 2ZVRA 3BCFA 3UVAA 3PBMA 1R85A 2V5JA 2VKZG 3CT2A 1BEUA 3MUAA 2FHBA 3GBEA 2CLKA 2DSUA 1O6IA 3SGZA 4JL1A 3CJPA 4R34A 2R14A 4HNUA 4JYEA 4HYWA 3DG6A 4LBUA 2OXNA 5K4XA 4AZBA 4ROQA 2ZZ5A 2XG9A 2PPGA 2P0IA 2NUWA 3I3DA 3R25A 4J2MA 4L7ZA 3IS4A 3KS5A 1YDNA 3MJYA 2DQXA 1Q13A 1CIUA 3WUFA 1YXCA 1XLHA 4W5UA 2R24A 4DZHA 1JVNA 1DWAM 3T08A 2QHAA 2YKKA 1V6UA 2VC6A 4HZ7A 3GTXA 1X6NA 4XISA 4O11A 4MJZA 5AVHA 2PP1A 7ODCA 3PUOA 3NZPA 3CEPA 4JKKA 1G4EA 4C1LA 4WXYA 3ZVIA 4D6FA 3PAJA 4I8YA 3NXFA 3BVJA 3SUTA 4NL1A 4PULA 4Y8FA 4Q4PA 4Q6JA 4IIFA 1PHWA 1F3TA 1C91A 3FJ4A 4MWAC 5FIPA 1PTGA 2WC7A 4E2BA 5A8PA 3I6TA 1LZOA 4R7JA 3Q94A 4RX0A 3GC4A 3PZMA 4XKYA 4R85A 4Y96A 1YTEA 1AJ2A 2OQYA 1SSGA 2X09A 1ICPA 1DIEA 1W3LA 2HZGA 2OO0A 3UJEA 1AW5A 4F4RA 1XCFA 4UFLA 3H53A 3F4WA 2Y5JA 4HOWA 4O57A 3CGTA 3B8WA 2VEPA 1FXQA 1YBQA 4FR1A 4O16A 3HMCA 3WBYA 4ZODA 3N2TA 5AVNA 5I3GA 2REQA 3H26A 4LS2A 3F2CA 4BWLA 2CLIA 3ZSSA 1I1XA 3H22A 2Z1SA 3GVRA 3UZJA 3OBKA 4QAIA 2HV5A 4DHGA 4YTSA 2OX4A 2UY4A 3MSYA 1JPHA 4CD8A 3W1PA 4AZ5A 2O4MA 3I4KA 3U0HA 4KEVA 2AKMA 4AXKA 1T41A 5I77A 1Y5XA 1SJAA 5E5CA 2QKFA 2QULA 2WBGA 1BGGA 2BDQA 1WV2A 4JL2A 3LLDA 4KGJA 2AOSA 1E71M 1VAHA 4B91A 4X61A 3GDBA 1V3LA 3CLMA 3ELFA 1RPKA 3QHNA 1J0KA 1FQ0A 3WUEA 5LIKX 1XLIA 4JX6A 1DJNA 1FCBA 3IRSA 2PLCA 3P5YA 4HYRA 4PMNA 1KKOA 1C9WA 3CO8A 3GZ3A 4AHPA 3L4YA 2WVUA 1F76A 4ADSA 4GJIA 1EB3A 1EOMA 3BSGA 1XI3A 2W91A 3OIHA 3UXKA 1GOWA 4FNTA 3SQLA 5JH2A 4RZBA 4M1BA 1FXPA 3TYDA 3VXGA 1LRTA 3PZIA 3VNJA 3DYMA 3VCCA 8RUCA 4I9JA 2VRJA 3N15A 4KEUA 1EBGA 4JTCA 3W1NA 2PDJA 4V15A 3KWXA 2KX9A 3IAPA 1E4MM 2WKJA 4HNCA 3KBNA 4DPQA 1GW1A 1R8LA 2YBUA 3P3BA 1NWUA 2J6XA 1L6WA 1LT8A 1SMDA 4I6VA 5BMXA 3NQ8A 1PB0A 1M3UA 1ONWA 5D2YA 2GDQA 4N9CA 2GQ9A 3GRIA 4AISA 4H7ZA 1W9XA 3R0UA 3LNMA 3G6MA 3INPA 2ZXAA 3WF3A 1NFGA 3R94A 5T8GA 4EPEC 2WZMA 2A3LA 4CVWA 2P88A 3EZ4A 5KINA 1PL9A 2Q8XA 1JPDX 4JTUA 3NEHA 2GVYA 1TPEA 4L1XA 3TOYA 4Z2GA 4BKNA 1V77A 4LCQA 3DCPA 3PHAA 3URAA 4JTQA 1S5MA 3CUFA 3POCA 2WVSA 1V6YA 3FV9A 4ZFCA 3QZAA 5FA5A 5G2IA 3MJMA 4NAFB 1NEYA 5CXPA 4TOQA 2EPNA 1WP6A 4JS3A 3S1WA 1PX8A 1LL6A 4GQ0A 3BPWA 1HJSA 4RNIA 1GZJA 2VZVA 1S3HA 1ZBVA 4GJJA 3CYVA 4BZYA 4S3CA 2VL4A 4L5ZA 2ZXDA 3AIUA 3CB3A 3MCOA 4U5KA 1JCYA 1U33A 1TMHA 2XZ7A 1L2QA 4YL2A 4U2ZA 2WWCA 4JAWA 3AISA 3GNPA 4WKHA 1LL7A 1RH9A 1O12A 4HNTA 1ML1A 1US0A 3TQPA 2VNCA 3SB0A 2NV1A 1EHNA 5ABFB 1XG4A 5CLTA 4RKAA 5C9WA 3EB3A 3EX2A 4QM1A 3E3HA 1RPXA 1P1MA 4MNJA 2OVLA 4N2YA 4WKFA 2YL8A 4Z1AA 3S2CA 1MNZA 1YDOA 4OKDA 3O6CA 2DY3A 4O54A 2YDAA 2YA0A 4B3LA 2QCGA 3GG7A 3EDFA 4GJ1A 2R6OA 2FFCA 5DXYA 2FIQA 3WQEA 3TTEA 2BGQA 4GCAA 1GQIA 2YCLA 3WD1A 2PD5A 3P7YA 4YHGA 5DEZA 3QV7A 1LWHA 4B3KA 2FGZA 1A47A 3UYCA 2ZZ6A 1LL4A 3P60A 3TXVA 4M56A 3R0DA 3EOEA 4XAPA 4WY0F 2QJNA 3E5BA 1UR1A 2YL6A 3EB4A 3CUGA 1DE6A 1H60A 1QI0A 1Q2SA 3N4AA 3B8SA 4Z08A 3QMRA 3UF9A 1W17A 3S4TA 5I09A 2V2CA 2V6AA 4OBTA 4QR6A 4IP4A 2DEPA 1QJWA 1JUEA 3UY8A 3EWCA 3U4FA 4YXGA 3QPEA 5F2IA 3QF0A 3M46A 3RAOA 3W25A 2Z1BA 1HL9A 1OQFA 5IRPA 2P50A 3RXZA 4LF2A 4UMCA 4JN7A 7REQB 3PZUA 4KCUA 1AZ2A 2OODA 4L4PA 1GVIA 2A3BA 3BE7A 2C1GA 4I7VA 1CLXA 3E12A 2WOQA 5FF3A 3GH4A 1ZJBA 3TLQA 1H61A 1XYAA 5K9DA 2CIPA 4JIPA 3WLHA 3T9PA 4GX9A 1MRAA 2V30A 1K9EA 5GNYA 3VD4A 1XPYA 5GVJA 1OGGA 4HNOA 4RNHA 4MNLA 5LIUX 1EH9A 4DXVA 4W4QA 3RRAA 1SZEA 3D6NA 3CQKA 3Q45A 2W62A 1W1IE 2RGMA 3CAVA 5F2MA 4L1WA 4ZBCA 3TYCA 3WD3A 1BYBA 4S2BA 4HZ8A 4AVOA 4TXEA 4F9JA 1K9TA 1TPWA 1XIIA 4OZOA 2PLJA 3UESA 1PBGA 5EFDA 2Y5EA 1SJDA 3B06A 2W4XA 3GFYA 3QBUA 4HHHA 3PBGA 4O28A 4S39A 3WELA 3A4XA 3OA5A 3Q65A 3JRKA 1Z32X 4UTUA 1T6MA 4O1AA 3OGSA 1GQKA 4ICMA 1D7FA 4FXRA 3DFYA 4OUEA 4C6FA 4H8HA 2CZVA 3F4CA 4L65A 4XG1A 2BHZA 2Q71A 1FWIC 5J5DA 2TRSA 4NZ1A 2ZX8A 1K9DA 4TV6A 2J7GA 4HIBA 1GKQA 1SR9A 4DYJA 1LORA 1WXYA 4IXHA 1H4PA 1DTNA 4NI8A 5A2BA 1JULA 2POTA 3BAYA 3W1RA 3VIJA 1Y65A 3WLJA 3A4WA 3W29A 5CPNA 3PFMA 1HL8A 2CWXA 1UKSA 1TIWA 3R11A 2R1LA 3QV8A 2ZA1A 4GO8A 5C7VA 4LF1A 3OBEA 2X2YA 3LBMA 4LUSA 5FAGA 4FNSA 2AAMA 5FJPA 3WQWA 3ZQ9A 3MANA 1MWOA 2FZNA 2G3FA 3H4XA 2CEQA 1IR1A 2XVLA 3W0KA 1OFEA 1EGMA 3ZXWA 2OWXA 1BHGA 1KGUA 3TTQA 4AZ6A 2Y2WA 1VYPX 4PRWA 4RLIA 4B15A 4ONVA 2NXHA 4MG4A 4ZENA 4H6KA 5HNTA 4X22A 5F4WA 1SZNA 2OSYA 1ISWA 2VRKA 1CCWB 4LANA 1SUXA 2QCCA 4GXWA 4LVFA 3N11A 2A7PA 2Y24A 3B9AA 4P8XA 4UQ9A 5KETA 4A3UA 3GYEA 3VFLA 4JTAA 1XIFA 4C91A 4KWSA 2ZWZA 4RZ6A 4KRUA 2VENA 1XLFA 2D3LA 3ARXA 4GI8A 2PP3A 5DXXA 1TTJA 1QNOA 3EEGA 3IJIA 4O53A 2WJEA 2PWGA 4MWAD 5FJJA 5H8MA 1QTWA 4MB4A 5BXSA 4DO4A 4GH3A 3WJZA 4UNLA 3ZLFA 5F2LA 3W27A 3RJXA 2X30A 3RO8A 4Z1CA 2ZX5A 1H51A 3CMJA 3BARA 2GVEA 3P93A 3TP4A 1KW1A 1LUCB 1BGAA 1S46A 1GVYA 4H9VA 3B0YA 1NQ6A 5E6YA 1NOFA 2PBGA 3K8MA 2Y4SA 4PMZA 4MPQA 4BF9A 3WLTA 2JALA 2QR6A 2PMQA 2H3DA 1EC9A 3ITVA 1E9IA 3APYA 3OHIA 1G7UA 4WXZA 3APTA 3AS3A 4IQEA 2XN0A 4Q7BA 3VMNA 3ZJ6A 4E4FA 3L4WA 3OJGA 3LCIA 2HQAA 3CQ0A 2GVJA 5CLWA 4FOJA 4J3ZA 2TYSA 1QOPA 2WM1A 2V38A 1JRBA 2V8ZA 3TYZA 3HPAA 3P5ZA 3G1RA 4Q4KA 3ZSTA 3NXLA 1LRQA 4BQ2A 3ZLGA 1K8XA 1A5BA 4K8HA 1Z6KA 4ALDA 1XH0A 5KZDA 4HT3A 3RMEA 2OT0A 1VYSX 2EHHA 2I17A 4EVZA 1E70M 4YYFA 1J96A 4MKNA 3ARVA 3HN3A 1GJUA 1LT7A 3IV3A 3ARYA 1DXEA 3W7HA 4JQAA 3IUIA 3QW3A 2P8BA 3TOPA 1J18A 1TWIA 3EEZA 2BOGX 4A8NA 3VKAA 4NJHA 2I9EA 1R9ZA 4BI5A 4HHPA 1X96A 3PSVA 4CQBA 1LQAA 4GI4A 3AAMA 3ORWA 2D20A 4QQUA 3F2BA 1UUMA 2NT0A 1W9DM 3MVIA 1HKIA 1QPQA 1US3A 4R88A 2ZOXA 2Y7GA 1KBBA 2V3FA 1MYRA 2Y63A 1OEPA 3AZSA 2X0YA 4GFSA 4YVPA 2GK1A 4AZCA 1ZHAA 3VTRA 1MQRA 1R3RA 1R2SA 4NRRA 3CHCA 4B5TA 4MFEA 3NO1A 2J7FA 4MWAB 1Q6GA 3QHOA 2J74A 1ELSA 5AOUA 4DAFA 1E3ZA 3N6HA 3GH7A 2I1OA 4HCDA 1R87A 4C6KA 3N9KA 4Y9OA 5KZEA 4JTIA 3W88A 4Z1BA 5HMFA 2V68A 4DUOA 1NDVA 3W2NA 4A21A 1E6RA 3ANUA 1M53A 5C55A 1GKPA 1DIDA 1R7AA 1UP3A 2YR1A 1IWAA 4XAGA 4O50A 2ZKMX 4J28A 5CZ0A 3VNIA 2Y61A 5M03A 3TQKA 3MP3A 1RJRA 4Y9NA 3S3GA 2G37A 1KFEA 1C3FA 2NUXA 3W7EA 1M7OA 2A79A 4H9TA 1GCYA 1JPKA 3SEPA 4NP7A 3VE7A 2R94A 4K7VA 5CG7A 2BASA 4H9ZA 4B5WA 1FWRA 3LPOA 4RXFA 1S5TA 2PDIA 1RA5A 4OGZA 4US5D 3BMXA 3CK5A 1W0MA 4FHAA 1D2KA 2HVOA 3M41A 2WAGA 4K7YA 2RDTA 2ALRA 1NIUA 2E6AA 2KZHA 3CXOA 5EMLA 4D6HA 4Z17A 2A3HA 3QGAC 1RJPA 2D2OA 1ZCCA 2ALDA 1JUBA 1GONA 4HSNA 3TWBA 1Q6RA 1OC7A 1AQHA 1V79A 4HNVA 3ATYA 1NDWA 3RX4A 1IR2A 1XIGA 1FWDC 3MBDA 3TVAA 2HISA 4EXQA 2YBTA 1KA9F 1N55A 2DJXA 3TZNA 2YIHA 4WR3A 4QDPA 1MMFA 1KV5A 1O5RA 2UZ9A 3WF4A 1XD0A 1NDYA 3QY8A 3BLEA 1WDRA 2DZXA 1KRBC 1DJYA 3ALGA 4YHEA 3B9OA 2X2GA 1YLVA 2ACRA 3WDIA 1BVNP 1ONRA 3W1QA 4GACA 3P61A 4AZGA 1UH4A 1GVSA 3FIGA 3URBA 5CGMA 4F0MA 5FF0A 2ZA2A 3IUHA 5HNUA 1ISVA 3UZZA 1YHTA 1TTIA 1JXKA 2WQPA 4PL1A 5C6MA 1LQ2A 3GDKA 1KXTA 4C6QA 1L9WA 1RJQA 3H2MA 4KCWA 2PC4A 1UH3A 1UD5A 3LRMA 3FJLA 2GJXB 2IXVA 2Y85A 3NQMA 3EXTA 4DNMA 3AU6A 3VE9A 5KSWA 1DL3A 2BTMA 1TJPA 4ZQOA 4AEOA 3JR2A 1ICSA 2G95A 4ERIA 2WANA 4F48A 1ZL1A 4YU1A 3C8NA 3GXFA 2V2DA 3W53A 3A9IA 1MUCA 4L56A 1BKHA 5JBDA 4UR9A 4LB3A 5AC4A 3D46A 3LCWA 4OWGA 4EPBC 3S8HA 4PTDA 4B16A 3QYQA 3JUGA 1T5AA 3LTSA 5C9XA 2XIOA 4QS5A 5HBFA 4ZSUA 5AC5A 2NV2A 2YSWA 2P0OA 4DYKA 2OB3A 1DE5A 3CYJA 2VC7A 5A6BA 3VGEA 3CBWA 3W7CA 1QHPA 3B0XA 3S83A 5BXTA 3TK7A 4V1XA 4N7QA 1MUMA 3IJLA 4G1KA 4O0KA 4HK6A 2GVLA 3O16A 1GVEA 4ZO7A 2Y8UA 1HUVA 3UBPC 3UEQA 1NJJA 4ZXLA 4C5ZA 1P7TA 5AHFA 2EBNA 1OX5A 3PBWA 3FHQA 4INFA 1QVBA 1BD0A 2XIBA 2ZDRA 5LNUA 2W66A 2VFGA 3UPWA 4XZ9A 1V03A 1G7VA 1R47A 2DUZA 2WC3A 1WOBA 3T78A 3VI2A 3ZS4A 1CECA 5T26A 1E5JA 1JAEA 3TE9A 4H6QA 2I9UA 3DX5A 1HVXA 3W72A 3I3BA 3S6TA 3BCDA 1XKYA 4WJ8A 2JIEA 4K8EA 4Q32A 2YXGA 4L80A 1J10A 3BGJA 3T0BA 4EAYA 2PDKA 4Q7IA 1X39A 5A5WA 2QDDA 3N2XA 1F3WA 3KX6A 4JICA 3DESA 3VUSA 1TRDA 3BOLA 2HXUA 5DO8A 3ZR6A 1KTCA 4GUIA 1SJCA 3A3XA 5FJTA 2PZ0A 3VD9A 1GHRA 2NX9A 4IFKB 2OZ3A 5DMYA 3UGVA 1CXIA 5HQMA 1P1XA 3DHPA 3ARUA 5DBTA 1TA3B 2XINA 1W3KA 3N14A 1ZB5A 4DO7A 2Z24A 3FSTA 3KP0A 2VZSA 3I10A 3OHMB 3EKLA 3DDMA 3WBAA 4RW5A 3KDNA 1XG3A 2YBVA 5I3HA 1X1ZA 3WJSA 3PJTA 2ZX7A 1VHNA 2WSPA 3H2CA 2VR5A 2WCSA 4ZEPA 1BF6A 3G1AA 3E49A 3KXQA 3LQGA 3KEHA 4F0LA 3S6OA 3QMSA 1MI3A 3B4YA 3N18A 5EMMA 3WD4A 3NZQA 1UIPA 4O8RA 2A85A 2GSJA 4K2SA 1UD2A 1UR8A 1AD4A 4LS0A 4PBGA 1OZMA 1GYNA 1IEIA 2UV8G 4OQVA 2Y7FA 3SZ8A 4Y9AA 4RL3A 1ZAJA 3EWXA 2AL2A 3GBDA 5LGXA 4S3GA 3NGFA 1QWKA 4EP8C 4ZMGA 1Q8AA 1A5SA 4MJMA 3TEVA 3HQNA 3LGGA 5C2GA 1EYEA 3KRSA 2BY1A 1UKPA 2FZDA 1J11A 3RCYA 1TPUA 4DYEA 2XSXA 1E51A 2OELA 2GGIA 1KD0A 3NSNA 2GUYA 3CV7A 4B5SA 2EG8A 3BAWA 1LLZA 3TSDA 1UWIA 3QXBA 4CD7A 1QO5A 4GD0A 4FP1A 4HPNA 4MJ4A 3S42A 4CN6A 4JTFA 4UIOA 4CCDA 3VINA 1U5HA 3QOMA 1XPGA 4D6JA 4AIUA 1DJQA 4YVXA 2B81A 3A4AA 5AFDA 2BXYA 4UNIA 2C19A 5I3KA 4HN4A 5CZJA 1DQXA 4A2SA 1VBHA 2PD9A 1KTBA 4J3WA 4P7LA 2E6FA 3A47A 3B3DA 2EGZA 5FOOA 3UXIA 1CNVA 1RVGA 1E3XA 1DJIA 1TV4A 3AIWA 5I79A 3IARA 3U8GA 3TMLA 1KRAC 3PZ9A 1Z89A 3H8AA 1ZFJA 3MKCA 4ECLA 1PUDA 5F4SA 5ABTA 5IFPA 4KBXA 4O4WA 1E9ZB 4XZWA 4Z0SA 1W31A 4JY9A 3OIXA 3OLDA 1TYGA 1RCXB 3QV6A 1I2NA 4O0QA 4FLQA 1CYGA 3DIPA 4XIAA 1KM3A 3D3FA 3MKKA 4GCXA 3IGHX 3LZ5A 1FHDA 1ZBKA 2WNNA 1I8JA 3W23A 1XBXA 4GZIA 4KFPA 5H8PA 4ZE5A 4Y6GA 3VDGA 4AYSA 5I5RA 2EKCA 2W0UA 3BO9A 4AVNA 1G67A 5HA7A 3H2FA 2HCVA 4YIWA 3DHDA 4QAWA 4QLKA 3F4NA 4X63A 3QJAA 2DZBA 3MZNA 5FEXA 1XUZA 1PIGA 1WE5A 4GZ7A 4LT9A 4C6PA 2FFIA 1XJBA 2YX0A 4LVDA 1YPXA 1GUVA 2BV9A 4DF0A 1J5TA 2CLOA 4ZTYA 1QNSA 1J2BA 3PM6A 3SURA 1XCWA 1VPYA 4PB3A 1EKOA 2FTWA 1RAKA 1C93A 2EXOA 1HKWA 2Y0FA 4DB7A 2ZRUA 4HMNA 1FBAA 4JNZA 2XISA 1MUWA 3URNA 4DN1A 4AD3A 4WQ6A 1Q63A 3G1YA 4HNNA 1E1CA 2QW5A 3E0LA 1V02A 3RM9A 1U30A 2NT1A 4HU0A 1CX9A 1FWTA 3MQTA 1MZRA 4M6QA 1TIMA 3T0CA 2A4AA 3EXSA 4HNLA 4YTUA 3V0TA 3IANA 2P3EA 3DZ1A 1PO9A 2G4JA 2WLZA 1I4NA 4WY0B 4PCSA 2Y6ZA 2J6VA 2B7OA 2QYGA 2Z28A 4R53A 3L23A 2NQHA 2DT0A 3NVDA 1NSJA 4U10A 1EX5A 1H50A 3R10A 4PB4A 4W8AA 4EANA 3AIQA 2AMGA 2ISVA 3PUEA 4BI7A 1F07A 2PTZA 4LUSB 2BVDA 1UR4A 1YPIA 2BY3A 1POJA 2FHCA 2DH3A 2DT2A 1TV3A 3G6LA 3NQ7A 3REQB 4GIAA 1XUUA 1VEMA 5HNRA 2VP8A 3BURA 2PGRA 4DUWA 4FK9A 2G8ZA 1A5KC 4FLSA 1XINA 4XZNX 4MY8A 4Q8OA 1IEQA 4W89A 1DJXA 2C13A 4BA0A 3W6LA 7PTDA 4HGXA 2J7HA 3MY9A 4A22A 4B5XA 1JGMA 1U5JA 1LBLA 3SECA 1FDJA 2GJRA 3U5YA 5C71A 5I06A 6PTDA 3URQA 3O6DA 1KM2A 4LEFA 1D3CA 2UBPC 2OQLA 3UNDA 1AW1A 3A9BA 2WZEA 4JD4A 4H19A 1I45A 3NPWA 3BAIA 2E5BA 3FCPA 1FWAC 1VP5A 2CERA 5LSMA 4B2DA 1FWCC 3BANA 3HQPA 4MJ2A 3P0XA 3DAQA 1EJUC 3ZVHA 4AW7A 1A5LC 5M5DA 3PPFA 2O7SA 1PEZA 3M16A 3U2CA 2YGYA 6XIMA 1E0VA 4WDXA 1BLIA 3U9IA 1GOKA 4JIHA 3CV1A 2HE8A 1HKJA 1RQBA 3N17A 1V5XA 3ABRA 2VELA 3VCNA 2ZX9A 1MW3A 2CLFA 1PZ1A 2XPKA 4FB7A 1OB0A 5EMUA 1EO5A 2JGYA 4H8VA 4DWSB 2ISFA 4BK9A 3EX4A 3L2LA 4PSRA 4EOUA 1P6CA 1FH9A 4Q8QA 3CL8A 3V3WA 1W54A 1SFJA 2WNWA 5G2HA 4BEQA 1M65A 3ANVA 3WNMA 4FLOA 2VEKA 3ITGA 4PGLA 3SDOA 1CB2A 1NH6A 2PDCA 1K3UA 3K4AA 1J0ZA 1FA2A 1GVRA 1KKRA 1KFWA 1XYCA 3ID7A 3KBVA 4MKVA 4LC8A 2PDMA 4NZJA 2IUZA 2EKGA 4M6UA 3NQGA 3A6OA 3OU8A 4K68A 3QV9A 4GE8A 3WUGA 4JN6A 1HGWA 3W3OA 1XRTA 3TQ0A 3CHFA 3VC6A 1W1PA 1QCWA 1UH2A 3ZT6A 4FI4A 3TU9A 2VI0A 3GNNA 4QITA 2J13A 1GG0A 4WVXA 1Q7QA 2JGQA 3ARRA 4URIA 1BQCA 2HROA 1ZRQA 3DFTA 3EKGA 1QNVA 4FIQA 3V5CA 3OQ8A 2WPBA 1H7NA 4KIRA 3GAKA 1A5MC 1P5BA 1WCGA 3TAKA 3SRDA 4QBXA 3T0AA 2Y88A 3TSMA 1GVFA 2FYMA 3O6AA 4W8BA 5DY3A 4V1YA 4WOQA 1GJPA 6REQB 5AHMA 1HJVA 4EIVA 4CVUA 1G1YA 1BQGA 4HCHA 2J66A 3IIXA 5G2WA 3OLGA 4J3TA 3T81A 1AH4A 4QTGA 4I5XA 4UTKA 4TMCA 4Q8NA 4GGBA 3S1UA 2PU1A 3E02A 2CHOA 3VPLA 3L5LA 4QDWA 1O7AA 4UTWA 3CUIA 1A3XA 4Y9MA 3QZ6A 3WLLA 3KVMA 4OOZA 1REQB 1L8PA 4U2YA 3SGGA 4ZCWA 5F1VA 2NQJA 3QQWA 1B90A 5EMJA 1IXPA 4TX8A 4TVDA 3HG2A 1H5YA 3JZUA 3NL3A 1JDCA 4RZ4A 3B8IA 4PSPA 3HMJG 4N9BA 3SFKA 3AMLA 2CC0A 1GQJA 5F7UA 1QWGA 4L9ZA 2OX1A 2BGNE 1LCOA 4LVAA 2NWRA 4MY9A 3S0CA 3R1ZA 4KMQA 3RX2A 2PBOA 4LALA 4M51A 1EWDA 2DORA 2DZPA 4K39A 4F9DA 3WFZA 1YEYA 3QGKC 1MSSA 4R9XA 4NKCA 3FAXA 5A6BD 3HG4A 5A6AA 1XFCA 1V3IA 1BF2A 1RZMA 4OTKA 3VD7A 4ZB2A 1SO5A 2X7VA 4WF7A 1J79A 4KESA 4JTSA 3S5YA 4AH7A 2GJPA 4L9XA 5GJPA 3LM7A 5BZAA 2QF7A 2ZUMA 3BXWA 5RUBA 4DXKA 2OT1A 2BWGA 1Q4NX 1O66A 3E2VA 2OSWA 3WQOA 1OBAA 4NRSA 2Y8KA 4NJIA 3SO7A 1B5TA 5FEWA 1K7FA 1VFOA 4FIRA 4DUVA 2AGTA 5XINA 2Z2BA 3TKFA 2DZVA 2EG6A 4LS1A 2Z0IA 2ZRVA 2GOUA 4S3BA 4F8XA 3AC0A 3KVJA 3NIYA 6XIAA 4HMEA 4BHYA 3B8VA 5B80A 1OT1A 1JAKA 1UHVA 4HP5A 1G4SA 4N6EA 2ZXBA 3E0VA 1RR2A 4JIRA 1CGWA 3VZYA 2W5FA 2WKLA 4S3DA 4DPPA 3MMDA 1AG1O 1EJSC 5C2XA 3AUOA 1H0IA 4FXFA 4UTTC 5EBAA 2QT3A 2VR4A 3IJ9A 3W7KA 1H7RA 2UY3A 4REQB 2XFRA 3GG1A 4RR4A 3UA3A 3G24A 4XBKA 3R2GA 4YJ5A 4UTWC 4D1JA 3A5VA 4MFDA 3FVMA 1V93A 3VKKA 1S5VA 3L2MA 1QUMA 2ZBTA 2WMJA 3QRHA 1DHPA 2VHLA 1T8XA 5I0DA 3KM8A 3QHMA 3N9RA 1UBPC 1QW7A 4J1OA 3LQLA 1P43A 5TD4A 4TTUA 4XAZA 2OEKA 3CIWA 3RCNA 3H12A 3C2FA 3SCRA 1SZFA 4DXXA 3ARSA 5CPQA 5D33A 1UUQA 3PZQA 3HPFA 4YNGA 1OIFA 1FHVA 1V7AA 3ZLHA 1AODA 3TWAA 1R2TA 2CLMA 4O18A 1LLWA 3SI9A 1XS2A 1B57A 5F4XA 4B9YA 3E2SA 4CLMA 1RP9A 3HJZA 1SFSA 3W74A 2Q3OA 1U1UA 3N3TA 3UWWA 3WD2A 3O05A 1N8FA 3GWQA 1WAUA 4LGXA 4BI6A 4JX5A 1OFRA 4MB1A 1AQ0A 1XSIA 1J0JA 4HD5A 3I4EA 3LZ3A 1TJRA 3STGA 2C8NA 1EF2A 1M04A 3CU2A 1FHLA 1OX4A 4WUIA 1SJBA 2B0MA 3CV2A 4N6FA 2NVAA 3BQ6A 3L4XA 2CLEA 5G1TA 4FAMA 3ARWA 5IM51 3WCZA 1BG4A 3MMTA 1GGOA 1M7PA 2VUNA 3R79A 3MV11 3MO4A 2V63A 4G9PA 4I9TA 5E1QA 1UR0A 3MS8A 1Q2RA 1BSIA 1EYWA 4QGCA 3R13A 1EXPA 3U3HA 1TR1A 3VM5A 1KWKA 2XGBA 3M6YA 1UMLA 1MRQA 1QR7A 2FMOA 4PUJA 3EWWA 3EA1A 3BUVA 2DIEA 2KAUC 1W1YA 1GT8A 2IKJA 1QPOA 3RLUA 5L6UA 3G1XA 3M0JA 3O2LA 3ZMRA 2GVGA 3M44A 3HA1A 3L4UA 3ARZA 4V2XA 4QCEA 1VLIA 2YL5A 3UT0A 3CUZA 1TE1A 3LOTA 2G97A 1UWUA 1JZ3A 3CT7A 3GX9A 1C90A 4GGHA 5CZSA 3RCMA 2NVDA 3OZYA 4U31A 1W1B1 1UD8A 4C7GA 2HRWA 3TYEA 3ITXA 3N4EA 2HDJA 3UR7A 2IPWA 1HO4A 4HPGA 2V67A 3AJ7A 3WQVA 1YQ2A 3DFPA 4QJ5B 3KTCA 1KXVA 5CSUA 4LSBA 4XO7A 1BYAA 1PIFA 4KFNA 3IIPA 3LCHA 5DBUA 3W00A 5IFTA 2ZQ0A 2BMBA 1VJZA 5FCZA 5I2UA 4MAZA 4L6HA 5HULA 2Y7EA 3C4UA 3CL6A 4XZMX 2ABAA 1W5OA 3VDCA 3DG3A 2QPSA 2BLEA 2YOCA 5HAOA 2QJJA 3SJNA 3WX7A 3GE7A 2QUMA 2CXGA 2A2IA 2ZXQA 4BCEA 3KBSA 3W1TA 1RBAA 3GNOA 3W81A 2E0PA 2Q6ZA 1R3WA 2WVVA 2FMNA 2PF8A 1HG3A 1IEWA 2DUXA 2XIMA 4IICA 4UCFA 2ZZ2A 1JCNA 3W6YA 1FKXA 3P84A 3L0NA 5TF0A 2XH4A 2IPGA 2GJLA 3PNZA 4J3SA 3WLNA 1GQNA 2V5CA 3VILA 3TIMA 2HBVA 4PMXA 4O1FA 3VGGA 3N9SA 1MXGA 4AVFA 1XYBA 1OGSA 3NYZA 5D2VA 1XRFA 1VLWA 3GU1A 4M3PA 5AECA 3PP7A 4F2UA 4LX4A 1V0MA 2HNEA 1V0NA 4JKLA 4JFWA 3GB6A 2V9DA 3W7LA 3LCFA 1WDPA 4UXDA 3TXZA 5CCZA 1UOKA 1CLKA 1TJ2A 4Z0JA 1NOUA 3IJ7A 4NAFA 2X1IA 2BY2A 3BV4A 4X2RA 3PTMA 2WMKA 1T0OA 3UXAA 1J0IA 3WG6A 1EGZA 3NVTA 2CNCA 3NO3A 1VCFA 2JK2A 2Z6JA 3M5VA 3VDHA 4LUYA 5I7GA 1SO3A 1Q45A 3UWQA 1P0EA 2XHYA 2WSRA 2TMDA 5CSSA 1OCNA 3HV8A 2DGAA 4CEUC 1KGWA 2G3JA 3FDKA 5KZ6A 5HDRA 3AZRA 4GINA 4K3ZA 1ADOA 5G1MA 4YTTA 3JS3A 5XIAA 3TN4A 5D9PA 5ABFA 3VD5A 2DDXA 4YYCA 4DRSA 5D4YA 5HMSA 4GQGA 3AXMA 1EQCA 4CQ9A 3TW9A 3HV9A 2WO5A 1JZ4A 2I16A 1DXFA 1O60A 1OK4A 2OOGA 3PBVA 2ZTKA 1OCBA 4GI6A 3OGVA 4Y90A 5CBBA 2YXXA 2W3ZA 4B2DD 5M2FX 2BZNA 4LCRA 1UKTA 3VNLA 1X8CA 5CGTA 2DVTA 1UPPA 4W87A 1XYFA 3RILA 3P2VA 3PZNA 2RKXA 3P80A 4ICCX 2OGJA 1K8ZA 3MPGA 1QDSA 4C1NB 3NAVA 1EP2A 5AYIA 4ZQPA 3GW3A 3HGRA 4ENLA 4UQDA 5KMYA 3WSUA 1HQTA 3VIGA 1XDMA 5A69A 1EEPA 2QJHA 3BLKA 4LYPA 1JJKA 5FKYA 2YCIX 3BOFA 3WBWA 4Q4RA 4AWSA 3P8JA 2XSAA 4QJ3B 3U2OA 7REQA 1X6UA 4JR5A 1SFTA 2J25A 4J5NA 3OVQA 4HVXA 3GVGA 3PY2A 2IMRA 3UY7A 2QJIA 3WMCA 3FA4A 2A1YA 1TZ9A 1ICQA 3B9DA 4U33A 4E6MA 3ZYZA 5D9OA 2RHGA 1UZ1A 3FEQA 3EGJA 4QIUA 2VX6A 4F2TA 1IGSA 2Y1HA 3D0CA 1UJQA 5FJIA 4PFHA 1A5CA 2VZTA 1Q4WA 1ECQA 5BRBA 4R27A 1TV5A 3CAWA 3AHVA 3KZPA 4FX8A 3ITYA 4MYAA 4AB4A 4AD4A 4WSKA 3M43A 3B0UX 2FZBA 2QV5A 3S46A 2VWTA 1XBYA 3WY1A 3KFTA 2GQAA 1OCJA 1XICA 1IYXA 2BVWA 1KC7A 3FOKA 1AZ1A 1D8WA 4ZOBA 4YS1A 5CZTA 4L9YA 3W7OA 1KRMA 3S47A 4C6IA 3TC6A 4FOKA 4IGMA 4KCTA 4V28A 3VNYA 3B05A 5HPOA 1WAWA 3W71A 9XIAA 4DJDC 3ABZA 2D24A 5FD0A 2PURA 4MMWA 2XTKA 4GIRA 3C61A 3O8AA 2VRQA 1GZ1A 3OA3A 2DFAA 1I0BA 2ATSA 1ZY9A 1TCMA 3W7GA 5A6JA 5EFFA 3MMWA 2QUVA 4XV0A 4UCGA 1KNWA 4JXCA 1XYZA 1IXNA 3L65A 3VDAA 4PMYA 3M0MA 4GZEA 3KRZA 2NW0A 2XFYA 3CV6A 2D69A 4NNCA 3UGRA 4NY2A 4ERGA 4W86A 1CGTA 1ZBWA 3BG3A 5A3HA 1IXQA 3EPMA 3U4AA 3QEZA 2Z1KA 1W91A 1UKOA 3HPXA 3FGCB 3MSRA 2ZRZA 3BMWA 4CNSA 2ISSA 3TZFA 3MTWA 3GVQA 4HJWA 5A2AA 3LA4A