1Q6QA

Structure of 3-keto-l-gulonate 6-phosphate decarboxylase with bound xylitol 5-phosphate
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
214
structure length
213
Chain Sequence
SLPMLQVALDNQTMDSAYETTRLIAEEVDIIEVGTILCVGEGVRAVRDLKALYPHKIVLADAKIADAGKILSRMCFEANADWVTVICCADINTAKGALDVAKEFNGDVQIELTGYWTWEQAQQWRDAGIGQVVYHRSRDAQAAVAWGEADITAIKRLSDMGFKVTVTGGLALEDLPLFKGIPIHVFIAGRSIRDAASPVEAARQFKRSIAELW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords 3-keto-L-gulonate 6-phosphate decarboxylase
publication title Structural Evidence for a 1,2-Enediolate Intermediate in the Reaction Catalyzed by 3-Keto-l-Gulonate 6-Phosphate Decarboxylase, a Member of the Orotidine 5'-Monophosphate Decarboxylase Suprafamily
pubmed doi rcsb
source organism Escherichia coli
total genus 81
structure length 213
sequence length 214
chains with identical sequence B
ec nomenclature ec 4.1.1.85: 3-dehydro-L-gulonate-6-phosphate decarboxylase.
pdb deposition date 2003-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1q6qA00
4FB7A 3Q94A 3TMLA 4RZ6A 4GUJA 4IMGA 2I1OA 2C1HA 4RXFA 2VEMA 3NVTA 4XKYA 4JYEA 1WQ5A 3W76A 5K4XA 3VFLA 1QAPA 3DAQA 5D2YA 2CLMA 1K8ZA 5D2WA 2A7NA 4O11A 1GQNA 3M9YA 3NO5A 3T78A 3W7QA 1TPB1 1TQXA 2Y89A 2BSLA 3S1VA 4JIQA 5C54A 2JBMA 4N2YA 3PY2A 1SSGA 1NSJA 1KFEA 2BZNA 3T7VA 1TV7A 4FXRA 4N4QA 3NQEA 4O1AA 3G1SA 3W83A 4O1CA 2NLIA 3S5YA 4UMAA 4R7JA 5H2ZA 1I4NA 1MSSA 5KMYA 3JRKA 4CQ9A 5CPLA 1SO4A 1WDWA 1FWWA 1FCUA 4FX8A 4E2BA 1B57A 3QJAA 3QMSA 3W1XA 1X1OA 3TC7A 3GDKA 5D09A 1BWKA 1LP6A 1QO5A 3G18A 3WK3A 3DZ1A 1ALDA 4GUHA 3NQFA 4O14A 2AGKA 2J9YA 3JR2A 2V8ZA 1O94A 4FHAA 3O05A 3NYZA 3OBKA 3UXAA 2ZYFA 1HL2A 2NX1A 4NJHA 1S3HA 5EKYA 5LHFA 3P5YA 3BG3A 1LCOA 4RKAA 2W0UA 4IMFA 1GG1A 1JUKA 5AYXA 1FWRA 4JTFA 4EF9A 5J5RA 4LVFA 7TIMA 5IBXA 3NG3A 1D9EA 5BNKA 2QF7A 1Z48A 1G67A 2JGQA 1TB3A 3G22A 1A50A 3UPWA 2QCMA 2Z2UA 2JKEA 2CZDA 1GVRA 3O16A 3G1HA 4N9EA 4LVDA 4CCDA 3Q58A 3PG9A 4U4MA 1FX6A 5AC6A 3CWOX 3BPWA 3SY5A 5CG7A 3T55A 3NL2A 4S1FA 5AB3A 1KM1A 1ZENA 3MYOA 4OE7A 4HKPA 2J6XA 4N6FA 4H3DA 4JGDA 1VHNA 3OA3A 3H54A 1WOBA 3O6DA 2TRSA 5AHLA 1DQXA 4GFSA 1CI1A 3GIYA 1JCNA 1X1ZA 3ELFA 3QYQA 1TTQA 1UBSA 3M16A 3A5VA 2J88A 4O4WA 1VS1A 2X30A 2WOQA 3WJZA 2H8ZA 3T44A 3WJXA 3OVPA 2QEZA 3NA8A 4M7SA 3SGUA 2FDSA 3TROA 3N34A 1QPQA 5DY2A 4ZL1A 2DZXA 4DXVA 2ZZ7A 1ZY9A 3E12A 3NPXA 1SZGA 3N9RA 4JTHA 1BWLA 3M43A 3FYOA 1SSDA 2NUXA 1IF2A 2Y7GA 5KTLA 3SZ8A 2CLEA 1B9BA 4Z0JA 3NPVA 4O28A 5EMUA 2YCEA 3TMQA 1GZGA 3RFAA 1OFOA 2ZFAA 4JTIA 5HWMA 3UWZA 4GBUA 2AAMA 4FNPA 4UTWA 2DP3A 4XBSA 4EF8A 4IX2A 4UXDA 4WOZA 5I3JA 1VC4A 1YDOA 4JTKA 4TMBA 2FPTA 2FPVA 2Y88A 4PCFA 5AHIA 4ZZ9A 1KM3A 1I2NA 4A22A 3NQVA 3SFKA 1M7OA 1SPQA 2PRLA 2ZZ6A 4JYFA 2Q8ZA 1HFBA 3IIXA 4K36A 3G8EA 3W07A 3FIGA 1W37A 2Y7DA 3TSDA 5AHNA 3QQ0A 1OFQA 2H3BA 4A21A 3LCIA 3M44A 1L6SA 2A7RA 1GTEA 4GUIA 4PEKA 3NR0A 4RV8A 2VFFA 4HIBA 4TX9A 1EP1A 3LDVA 4LW7A 5U7SA 4MUZA 2WNZA 4O12A 3EX2A 5A8GA 3W6YA 3P5ZA 3A21A 3UWWA 3MP3A 4MY8A 4XTIA 1A5BA 3BW4A 1W5QA 3TSBA 3GDMA 3PWAA 3PBVA 1OG0A 2OJPA 2ZZ2A 3P8IA 1F6PA 1RR2A 3BV4A 2NX3A 5C2XA 1F76A 1G6CA 3MHUA 5MHBA 3LTYA 4N9CA 5G1TA 3SW6A 1Q6QA 4LV9A 3I7QA 2B7QA 3WJSA 1P0NA 2B7NA 5DLCA 1P4CA 1XDLA 1VPXA 3HG2A 1H7NA 1KM2A 1H7OA 2RFGA 3KVJA 3L68A 4PH6A 5HUOA 1T99A 3S8HA 4UUIA 1HO4A 4MLJA 4UFMA 1VJIA 4GXMA 3QZEA 1G69A 5AC7A 3S1WA 4O8RA 1W5MA 1DV7A 4YL2A 3E02A 4UFHA 5LSMA 3P80A 5HJLA 3ABQA 3NM1A 3W7CA 3LXCA 3KXQA 3LI1A 1HTIA 5F2GA 5ABTA 2YDAA 5DCBA 1W54A 1OVDA 3LHWA 3W2MA 2GVJA 1QDSA 1SQ7A 1EX5A 3MJYA 3R2GA 3O06A 5G4EA 3TV8A 5D30A 4AWTA 5G2IA 4ZQMA 1Q6RA 4OWGA 3H53A 5K9DA 4WQ6A 4LOCA 4JX6A 1WBHA 4UFLA 1AW5A 2ISVA 4JXCA 3B04A 3BO9A 5LHEA 3TCEA 1XBXA 1W3TA 4IMCA 5EL1A 4FO4A 2FPYA 3BG9A 1UCWA 3CU2A 4M6QA 4ZQPA 3ATZA 3QFEA 2DZVA 4OBTA 4LVGA 5U4NA 3LHYA 2ZDRA 4JTJA 4NNBA 3W2UA 3TFCA 4UR8A 1ZFJA 2V2DA 4QIUA 1DJQA 4TO8A 1J2WA 3UZ5A 4FEZA 2E5CA 3HOJA 4OT7A 2Q3RA 2EKCA 3M7WA 3P82A 3TAOA 3TQ0A 1SW7A 3STFA 3DI0A 3QMRA 1OYAA 1SR9A 2GQ8A 2A2IA 4K37A 5I3GA 1LBMA 5D2VA 5HUPA 4Q4KA 3G3MA 3G8RA 5TIMA 4O13A 3L5LA 2X1TA 1IIGA 1ME8A 1ZALA 4DEFA 2YR1A 4MY1A 1L6YA 3NQGA 3FA5A 2BTMA 3W71A 4AB4A 4UNLA 5HMSA 1FDYA 1QOQA 5DXXA 1OK4A 4AHQA 3PUEA 4KFNA 2X1UA 1O5XA 4CCCA 4DO4A 5K9CA 3HJZA 5GVJA 2PRHA 2C19A 3DFTA 1MZHA 1SO5A 3TSMA 2BXVA 3CC1A 1I2RA 1MXSA 1ICQA 3SECA 1ME7A 1TV5A 2QCCA 8TIMA 1I8JA 1GJPA 3TX9A 3RNDA 2TYSA 4NJGA 4A29A 4TMCA 5KZDA 2GJNA 3M5XA 1JCYA 1LRTA 1F6KA 1O5KA 4JICA 3SSJA 3S1UA 2YPIA 4O50A 2JKAA 4LC6A 4YCPA 3DXIA 1TRDA 1GVQA 5FF7A 2V2CA 2QCDB 3IIZA 4I7WA 1RPXA 1R2RA 1W5OA 4O52A 3U2OA 1QWGA 1XC4A 2HTMA 4I7VA 4NJIA 4BFAA 3TJXA 5BMWA 1OX5A 1YXYA 4UTMA 2GPTA 2RDWA 4Y90A 1YDVA 2V30A 3IGUA 4LRSA 3DFOA 4R33A 2G96A 3NM3A 1TRIA 1XCFA 1EB3A 1FWTA 3EKZA 4ONVA 3HGRA 3LHTA 3GDTA 2YGYA 2EGZA 4EVZA 4JR5A 3W7GA 4MJMA 5AOUA 5T26A 2R91A 5D38A 3GK0A 1Z44A 4HT3A 3HGJA 2J9XA 1ZAJA 2Y85A 4ICNA 3T4CA 4IMDA 4JD4A 2ZZ4A 1A5AA 3M1ZA 3C3NA 4IWWA 4CCEA 2NX9A 2QCLA 5G4WA 3N9SA 3STEA 1JRCA 3QM3A 4DO5A 3LX9A 5BOOA 1TIMA 4P2VA 4NXKA 4O10A 5HR6A 1DHPA 4N6EA 4BF9A 4NZFA 4KWVA 2Z1BA 4N02A 4WX2A 2F7FA 2XFWA 1L9WA 3LCHA 3W75A 4JIPA 3VI2A 1Z41A 3QPYA 4LS2A 1K8YA 3HG3A 1JVNA 3DGRA 4NX0A 1PCWA 4O19A 1YTKA 4OV4A 1PL9A 2QAFA 3ABRA 4K8EA 3P8JA 3CTLA 3LTPA 4QM1A 3L0GA 1LLWA 3CQ0A 3STGA 3R13A 4ORIA 4AMAA 4Z1CA 2WSQA 2R8WA 2Y61A 2DORA 4WY0B 2ZBTA 3W7JA 5L6UA 1C9DA 1H62A 4FNTA 4CQAA 2VFGA 1PHQA 4PTNA 1J5TA 3HGSA 1IIHA 3V75A 4O4VA 1O60A 3BLEA 4QNWA 3G1FA 4LVBA 4HPJA 1TPC1 3PULA 2A5HA 1TV8A 2ATSA 3DU0A 1TREA 3DHFA 4IUOA 2O7SA 4RXGA 1H7PA 4MPQA 5A5WA 2EAWA 3I6RA 3Q2DA 1WXJA 1ZAHA 4PL2A 4AF0B 2C14A 5EYWA 6TIMA 1A5CA 3GXPA 3FJ6A 3NZRA 4NT0A 5H91A 4QSHA 2QR6A 4O18A 4BWLC 3NQ2A 1UJPA 3MMTA 1EA0A 3NXFA 1ICSA 4UR7A 2VEIA 5CSSA 2WJZA 4DF0A 2W6RA 4JX5A 2YX0A 1PHWA 3QC3A 1Q6OA 4HSNA 4IJBA 1J4EA 1AL7A 1TPH1 3TXVA 2ZTJA 1RVGA 3QW4B 3RU6A 3TAKA 3M41A 3MWAA 3MUXA 5E93A 1F5ZA 4RK8A 1IXOA 2G97A 2ZRXA 4NJKA 5K3VA 4Q33A 1FWSA 4UTHA 2B0MA 2HS6A 4KKXA 2KZHA 2QJHA 3R89A 2YZRA 5AC8A 4TU1A 5D2TA 1IXPA 3A5FA 1DORA 3CM4A 3LCLA 1LOSA 1QPOA 5FEPA 1TYGA 3G1XA 4LC8A 4HNVA 3NQ6A 3KVKA 2GVLA 4QQ3A 2HS8A 2QCDA 2V0TA 2DJXA 3CHVA 3ZFHA 4W9TA 2VOMA 3OHIA 1G4PA 3QSRA 1WBJA 4LWWA 3YPIA 3DFSA 3CIXA 3SIZA 4KFOA 3W1TA 3W74A 4HN4A 3B0VC 3EEGA 3HPXA 1VQTA 2ZA1A 3GAYA 1HUVA 3EWXA 1AL8A 3NQDA 5LGZA 1SFJA 3RK8A 4ADTA 4UTTC 1TPVA 2G95A 1QFEA 1YADA 1DQWA 2YSWA 1Y0EA 3KVMA 5EA9A 4GC4A 3N19B 2A4AA 3HIJA 2CLFA 3TJLA 1I2PA 2BWGA 2ISSA 3MYPA 1H63A 1XKYA 5J5DA 5FF2A 2PRMA 3B0UX 3S9YA 3C2RA 3G1DA 3E96A 2OT1A 4MYAA 1YDNA 3QRHA 1NVMA 2LLEA 1SFLA 1QR7A 4RZ4A 2CLIA 2NV1A 5FI8A 4CQ8A 1H1ZA 2H8XA 4AH7A 4JYDA 3FLUA 1GTHA 1R2SA 1W31A 3GB6A 2J27A 3S6DA 1LROA 2WO5A 3EXRA 4RR4A 3UWYA 4ML9A 3W7OA 3G1YA 4NVTA 5TQLA 4MVAA 1H7RA 1SO6A 5LNRA 3KAOA 3BG5A 3G24A 2OX1A 4I9AA 2AQWA 2A1YA 4GNJA 5DY3A 3TDFA 3STCA 4K7YA 4DBDA 1YXDA 4WY0A 4YCOA 3U6WA 1OYBA 1H60A 2CLOA 3I65A 2C16A 3Q37A 4M6VA 1DKWA 3SGZA 4QJ1A 1SZFA 2V5BA 3GYEA 3W7EA 2CLKA 3FYPA 4L4LA 4U28A 3IRDA 5D03A 3OVRA 3DFQA 3B03A 2C15A 3THAA 2V82A 2PE4A 3EWYA 5CZSA 1QPRA 4K8HA 1LZOA 4H4IA 1BKSA 3KRUA 5F4SA 4DPPA 3INPA 2GOUA 3SI9A 2A0NA 1OHLA 1C29A 5DBTA 1O4UA 1Z42A 1LRNA 1JQXA 1Q6LA 2E5DA 3IIVA 4AF0A 5LZLA 5AFDA 1XI3A 4LS0A 5DBUA 4MLRA 1P5BA 3PM6A 2Q8LA 1KBJA 3GR8A 3W7HA 2FB3A 4Y96A 2ISWA 4WY0F 1JQVA 4LUIA 1N7KA 1GYLA 2ZA3A 2UV8G 3W73A 2V5LA 3UXDA 3ZWTA 3P67A 3W3OA 2IQTA 3B06A 4FX7A 1BEUA 4OU1A 4AHOA 2YYUA 1H1YA 4ZQOA 3MW7A 3EX1A 3NNTA 3LV6A 3RLVA 1F05A 1OFRA 4MY9A 5SWUA 3G0SA 5BRBA 1N55A 4IOTA 4LUJA 1D3GA 3NQAA 4O54A 3MHGA 1KFLA 3TFXA 1XBVA 3FKKA 2ZQ0A 1ME9A 4OV9A 4BI6A 4WJEA 5FF0A 3C52A 4JY8A 1GOXA 1SUXA 4IPIA 4O0KA 4QITA 4IMEA 5C6MA 3FOKA 3LLFA 1X6UA 5CGQA 2GQ9A 1PVNA 1KM4A 5IBXC 1WV2A 3U8GA 3CPRA 1F74A 2D73A 5HNRA 1KLZA 4POCA 2DZSA 3W70A 3LRMA 1KTCA 3EXTA 4FIQA 1GG0A 1JUBA 2RDUA 1LRQA 3MBDA 3PG8A 4Y9AA 3IEBA 3KHJA 3PSWA 3M5ZA 4N9BA 4UIOA 2ABBA 4KFPA 3DHDA 5IM51 4C1LA 3W7DA 4DF1A 4LV4A 3S1XA 3W9ZA 3A23A 2E68A 3DI1A 3W87A 2NXHA 2WQPA 4R34A 3B0PA 2B7OA 5G1YA 1OFPA 5AHEA 2CFFA 3UY8A 3GX9A 3C4UA 3NEVA 4NJJA 4FNRA 5LGXA 3HPSA 4Z1BA 3EX3A 2Y63A 3CB8A 3AJXA 1K03A 2NWSA 3PB0A 5KZEA 4PFMA 1WYIA 1GWJA 4Q32A 5G2HA 4IXXA 4PL1A 4O1BA 2WSYA 5EBUA 3O8AA 4BK9A 1JUEA 1RV8A 3P81A 2FTPA 4UTUA 4NQ1A 3ZWSA 2DZTA 4XQ6A 4ORMA 3IIPA 4Z1AA 3LCGA 5AHMA 1SW3A 3I7RA 1QOPA 3MI3A 3DFNA 4DPQA 4RX0A 4UC5A 4Y8FA 4HNNA 2VC6A 3MI2A 1KM6A 3E9AA 2NUWA 4A2RA 5FEZA 1F2JA 1KA9F 1F73A 3CLMA 3PC0A 4WZHA 4DO6A 1W5PA 1T96A 1XL9A 3N73A 4UTWC 4QAIA 4C1KA 1H51A 1RQBA 3HG5A 1FCQA 3QQ1A 1YPFA 2E6DA 1TPFA 5LNVA 5LNSA 3H55A 1NAL1 4CNPA 3PVFA 4AVFA 4FX6M 2I14A 3WFAA 4MZYA 2XN1A 3GDRA 5D04C 1YTEA 1TQJA 3L5AA 3BW2A 2YW3A 2CLHA 3LBMA 1R46A 1OFDA 3ABSA 3T40A 3QW3A 1VYPX 2Y62A 3MO7A 2OCZA 1JCJA 2QCHA 3PUOA 4O0ZA 1EWEA 1NEYA 5AHFA 3GXTA 1W5NA 1TTIA 2FIQA 1NF7A 1I2OA 1R47A 3C2OA 1U5JA 2G5WA 3BLIA 3RF9A 3UD6A 1SO3A 5KZMA 2EF9A 3F4WA 3UQNA 5C5YA 4UMBA 3B8DA 4FF7A 3TR2A 4O53A 3G1VA 4BR1A 1L6WA 5TBOA 2FJKA 3UYCA 2RDTA 3FFSA 2C3ZA 2R14A 4TR9A 4IXHA 3MP5A 5EPDA 1KV5A 1TTJA 1T0OA 2PCQA 3GR7A 1UUOA 3G1AA 1AG1O 3TU9A 1ZNNA 3FJLA 1DL3A 4GUGA 1A53A 4YLWA 4N4PA 4G1KA 3WJWA 5HINA 1OFAA 1YLVA 1M6JA 3EWWA 1P0KA 1ZAIA 4DELA 3KRSA 3M5VA 4DF2A 3NQMA 3LM7A 1SZEA 1AK5A 2VKZG 1ONRA 1LLZA 2QUTA 5CPMA 3W2NA 2I9EA 4IX0A 5EY5A 3EX4A 4NZJA 4QNEA 5HR7A 2NV2A 1DBTA 3PR2A 1ZCOA 3E0IA 1P1XA 3W1RA 3W1AA 4LTSA 3W88A 1NF0A 1B4EA 3L0NA 4OHQA 3GLCA 4O1DA 5I3HA 1EP3A 4CNNA 1KM5A 4OQVA 4AWUA 3S42A 5AYZA 5D33A 1VLWA 4GWEA 2OT0A 1FXQA 1K8XA 4CNOA 1LOQA 4UNKA 3IVTA 3W23A 1UASA 4J9JA 1OJXA 2A6LA 3B05A 5CZTA 3WK2A 1DVJA 2A6NA 1ADOA 1RQHA 1AW1A 1I2QA 1YTDA 3P62A 5L9FA 3I68A 2Y7FA 5HQEA 2B4GA 2QUVA 1WOAA 4LS1A 1X8FA 3L2IA 2NUYA 4HNUA 2QCFA 3BGJA 5HULA 2A7PA 2GUUA 5LNUA 3W1UA 3EWBX 1B3OA 1VYRA 3NOEA 3C8FA 4O57A 3G0UA 2EPHA 3L21A 5DELA 1E51A 1H50A 1H5YA 1K7FA 2Z0IA 3F1QA 1EUNA 1IGSA 4JDBA 4JDYA 1QPNA 1KFJA 4LRTA 2QKFA 3UWQA 4E38A 4ADSA 5DCDA 4K6AA 2ZTKA 3W2LA 3OG3A 1FCVA 1QCWA 4RJEA 3GNNA 2TPSA 1FBAA 2WPBA 5AN7A 2ZRUA 1H7WA 2J24A 2DU2A 1KFKA 1BTMA 3LI0A 1VH7A 4JTLA 2E5BA 1Q3NA 2F84A 1TO3A 3R5EA 3TXZA 3W7RA 4JNMA 3C61A 3W22A 4PA8A 3TE9A 4DQWA 5CPOA 4D2JA 4FNUA 1UUMA 5F2LA 1GVFA 1W3NA 3NPWA 4O17A 1JULA 2V2HA 5K7JA 1OX4B 5F4XA 5G5IA 5D02A 1V5XA 4LY8A 1UB3A 3PS7A 1MEHA 1U83A 3A22A 3NZ1A 4NU7A 4PC8A 4JTSA 4LT9A 2QCGA 1A5SA 1GYNA 1O95A 1X7FA 1S5WA 4MKNA 3TW7A 2O7QA 3I7SA 3LCFA 1H7XA 1WAUA 3BARA 2QJGA 5K2ZA 1ZHAA 2WNQA 4UFJA 1K7EA 4UTKA 4B5NA 3HGOA 1VR6A 2ATMA 3PUDA 3KVLA 1W56A 1LTDA 3QH2A 2E77A 3LBCA 4E0CA 1VZWA 1K02A 4M7TA 2Q3OA 1PS9A 4BI5A 3N3MA 1VCVA 5FF3A 1FQ0A 3M5YA 2WKJA 2E1DA 3TC6A 3TA6A 4JTGA 4UFIA 3BGGA 4IGHA 2PC4A 3S5ZA 5DCEA 3CT7A 4WUIA 1KM0A 2YXGA 4EIVA 3UNDA 4ZQRA 4XZ9A 3O1NA 3LRKA 3EB2A 3KRZA 4HHPA 2VXNA 3O07A 3O6CA 3O15A 3VE7A 5C55A 1KFBA 2GJLA 4O16A 3DBPA 1DOSA 3C2FA 3L9CA 5CSRA 5F1UA 1FDJA 1WA3A 1MO0A 4YXGA 2NXIA 2DZWA 2CLLA 1G4TA 4EWND 5FF4A 4NX5A 1TPWA 1RZMA 2VFDA 3PF3A 3DKJA 3WJYA 3C0JA 3NQ8A 3OVQA 1KTNA 3GXNA 4XUGA 3VCRA 1VCGA 4DBEA 3DH7A 2E6FA 3W7LA 3N14A 1FY6A 4YMZA 2J9ZA 3GKFA 3L0KA 3ABOA 3P60A 1OK6A 3TW6A 2WSRA 2H6RA 3NL5A 3W72A 1RD5A 2H3DA 2BX7A 2E09A 2CZEA 1KTBA 3C56A 2X1RA 3DKLA 1QO2A 3OEXA 3LOTA 3M0ZA 2FB2A 4ZQNA 4E2DA 1VLIA 3P61A 2DZPA 2ZZ5A 3W85A 4AHPA 1TJPA 3P84A 5LNWA 1CX9A 3LCXA 3C2VA 4O15A 3BW3A 4AWSA 2YYTA 2FFCA 4JEQA 4JS3A 4K7VA 3NQCA 4NNCA 3LXAA 3VKJA 2JGYA 4X9SA 1THFD 1W8SA 4GRSA 2YFOA 1FCBA 2C0AA 1OF8A 3TQKA 2QDGA 5D2XA 3HB9A 3BVJA 3S5OA 3TKFA 4FIRA 1M7PA 2R94A 1XBZA 5KINA 1NFBA 3M6YA 4L4MA 2EHHA 4HSOA 3W7MA 2VELA 1IXQA 1EEPA 1YPIA 5D32A 4K38A 5G2WA 3TK7A 1EPXA 2ZRYA 2FLIA 5KSWA 2P1FA 4ZMGA 3OIXA 3GNDA 4LVAA 2GQAA 2VFIA 3PSVA 4M5PA 4UFKA 1XM3A 4H6KA 3G0XA 5HWJA 3RMJA 1B4KA 3W2KA 1OX4A 3K30A 2JKPA 1D3HA 1H61A 1Q45A 2BLEA 1G4EA 3R12A 1VYSX 3MBFA 1TMHA 2NXGA 2ABAA 2X2GA 3QMTA 1JRBA 1XUZA 3GKAA 3VE9A 3ZS4A 1XDMA 2C6QA 5I3IA 4R53A 5LKYA 2ZCGA 3O6YX 3THQA 3LRLA 3QEZA 1GPWA 4EOUA 4MYXA 2ZA2A 1EIXA 2TSYA 2P0OA 1PIIA 2C18A 5I3FA 3W7KA 1K7XA 1FWNA 4AAJA 3LERA 4UCGA 2OMAA 3A24A 1W1ZA 3IVUA 3LV5A 1FUYA 1W3IA 1C8VA 2V81A 3UPBA 3LHZA 4Z08A 1W0MA 3S5NA 5KITA 4RLIA 3CWNA 2V9DA 2QCNA 3NAVA 1JCMP 1LBLA 3UY7A 3NGJA 3D0CA 4N9DA 1JCXA 1G7VA 1QNVA 2CW6A 1K3UA 3GVGA 4XTDA 3MP4A 3BLFA 4X22A 3BK0A 5HWNA 4MZ1A 1GEQA 1GT8A 4M6PA 1ICPA 3IIOA 2ZRZA 4NNAA 1JCLA 4X3ZA 1T8XA 4RZ5A 1LOLA 2RH9A 3W2JA 4PODA 4LNYA 4IQLA 1AMKA 4FXSA 2ZZ3A 3CIWA 3EWUA 4CLMA 2Y70A 5AYYA 2NZLA 5F1VA 3KFTA 4BI7A 3CEUA 3GDLA 1WX0A 2CU0A 3L66A 4HNTA 5CZ0A 3WK1A 3LGEA 2H90A 2ZZ1A 3C2EA 4I7UA 3PAJA 3TH6A 3NL3A 3HQ1A 1LORA 3QF0A 3IGSA 2CZ5A 3E49A 3M47A 2Z6JA 1YYAA 1HG3A 3L65A 4XBKA 3UWUA 4JTEA 1XUUA 2VFHA 4KWWA 3NQ7A 2XN2A 3B4UA 3W1QA 2X16A 3F4NA 1R30A 3HPZA 5CZJA 3LLDA 1I45A 4NXSA 1MEWA 1JR1A 1LYXA 3O63A 3N2XA 4QISA 3R8RA 3IGXA 3JS3A 2Y7EA 4S2BA 2QUUA 2YFNA 2QJIA 1TJRA 1YXCA 1FXPA 2WV8A 3N2MA 4MFEA 3IVSA 1CW2A 3DENA 3A9IA 3LB0A 2E6AA 4IPJA 3TIMA 1KLYA 2NWRA 3MI6A 3TQVA 1GVSA 1LM1A 4MOZA 1OYCA 4JTUA 1VRDA 3QSTA 2RHGA 5D05A 4XKYB 4JTTA 5D37A 4AXKA 2DZUA 4TIMA 3GAKA 1ML1A 2DJLA 3LTSA 3HO8A 4Z0SA 1OFBA 4S2CA 1FDZA 1SU5A 4UTJA 1G4SA 4Y6GA 1S5VA 2W79A 4RCXA 4WXZA 4OGZA 3C6CA 2E6YA 3KX6A 2ZRVA 1VGAA 2VFEA 2CWNA 4MFDA 3QPZA 4FNQA 3RLUA 4BWLA 5FEWA 5FESA 1R2TA 1ZJIA 1XFBA 5CKSA 2TMDA 2OZ0A 1LDCA 1KW1A 1PV8A 1L2UA 3DFPA 4ZQCA 3FS2A 5BW6A 3KOFA 4X2RA 1G7UA 3EX6A 4WOQA 2QAPA 2CZFA 3W1LA 1TSIA 4M19A 1EP2A 1GVOA 3L5MA 3P74A 4GJ1A 3LCWA 3NPUA 3PB2A 4UMCA 4A2SA 1HO1A 5F4WA 5F2MA 3HG4A 3IV3A 3V1PA 2Y6ZA 1EWDA 2A85A 2XN0A 3EKLA 4ADUA 5K4ZA 1TPUA 3PBUA 2QCEA 3L67A 5F2IA 2WNNA 3ZR4A 1XXXA 4UTIA 1N8FA 1VHCA 4GUFA 4MJZA 1PE1A 1TPEA 1AW2A 3W1NA 1PCKA 3ANYA 3W7PA 3NL6A 3CEPA 1F7BA 3HMJG 2VEKA 3MHFA 1SZNA 2GVGA 1TPDA 3TNOA 2VENA 1XBYA 1M5WA 1OABA 5DXYA 1LBFA 3EXSA 4P61A 1MEIA 2FQIA 5K9XA 3W1MA 3LHVA 1KV8A 1VCFA 4FNSA 2YW4A 3F03K 1KBIA 5BMXA 4XWUA 4UTTA 3USBA 1EUAA 2VEPA 2ZRWA 1S5TA 1RQEA 2C13A 3GZ3A 6ALDA 2P10A 4HPXA 2HMCA 4LU0A 4MZ8A 3WK0A 4JN6A 4Z1DA 5I3KA 5CPNA 5E1QA 4YWIA 2PURA 3SR7A 4AEOA 2HSAA 1KFCA 1OX6A 4WD0A 5FEXA 3HBLA 2B7PA 2QDHA 3S0CA 3PBWA 3ATYA 2X1SA 4GE8A 4K39A 3W7IA 1JJKA 5DN1A 3VNDA 4JY9A 2ALDA 3SJ3A 3TUUA 4ALDA 1TCDA 3UZJA 4UTLA 1TTPA 3G3DA 1SW0A 3FEMA 3PBYA 3AO0A 3UWVA 3W84A 5E0KA 3W86A 4A3UA 3W1PA 1OFEA 1IXNA 2A21A 1OF6A 2RKXA 3FKRA 1V7YA 3EWZA 4MIMA 4WXYA 3HF3A 4ZVJA 2JK2A 1QMLA 4NUWA 4JX4A 3W7NA 1DJNA 2Z6IA 3LXBA 3NDOA 3LHUA 3P7YA
chains in the Genus database with same CATH superfamily
1E4MM 2PDKA 3Q94A 4H1ZA 1F9CA 4RZ6A 3UG5A 5A1AA 2YZ5A 1C9WA 4NI3A 4F0KA 3UPMA 3NVTA 4XKYA 3FGCB 1NM9A 3OQEA 2CLMA 5D2WA 3RO8A 1YRRA 2VUNA 2Y89A 3AXHA 3PJWA 3S1VA 5C54A 4FSAA 2XGBA 1DIOA 1SSGA 3P93A 2I16A 2AMGA 4L61A 4N4QA 1FWGC 1W9PA 1HL9A 3VNJA 1IT0A 4F4RA 2GL5A 3MY9A 4UMAA 4HCHA 4AZ6A 1XH1A 1DXIA 1I4NA 3F4VA 2E7FA 5KMYA 4GQBA 1NWTA 1JGIA 3SY1A 1K6AA 3VIKA 1FCUA 4JAWA 1B57A 4Q8UA 4IIBA 1Q6CA 4WR3A 3VKKA 1X1OA 3PZNA 3WK3A 3NCOA 4LAZA 2PDJA 4HMDA 3L4YA 1UP2A 4O14A 1OWQA 4PR4A 4ACZB 1O94A 2C8NA 1PZ3A 5FJPA 3VVGA 3UXAA 4ZE5A 3V0SA 1HL2A 2NX1A 3VOJA 3ARVA 3LPGA 1GPFA 3P5YA 4RKAA 4IMFA 3DC0A 4C5ZA 4QG8A 3KBJA 5TAOA 2CWXA 1D9EA 1TWWA 1Z48A 4OOZA 4XAPA 3UPWA 2JKEA 1GVRA 3O16A 1ITUA 1TZ7A 3ICJA 4ZE4A 3VDAA 3PG9A 3MT1A 4U4MA 5GJNA 4OVXA 5CG7A 3NL2A 3S46A 2IKGA 4DLMA 5AB3A 3OLEA 2PD5A 4U31A 4GACA 4HKPA 2J6XA 4FOUA 5HDRA 5HPOA 1O1HA 2PDPA 3OA3A 1WOBA 5AHLA 1UD5A 1JCNA 1UD6A 3ELFA 1UC5A 3QYQA 4M81A 3N2CA 4O4WA 1VS1A 4LYKA 2X30A 3WJZA 3H2NA 1Z3NA 4MDPA 3BOXA 3TROA 4ZL1A 3VOGA 2DZXA 1WXZA 1X1NA 4DXVA 1A0CA 1Q5MA 4WK9A 4V1YA 3WQDA 1ZY9A 3NPXA 1ITQA 5DFAA 4KRTA 1S3TC 1SZGA 3ZT6A 3W81A 1ZGDA 5E9XA 2RAGA 3A9BA 2NW0A 3M43A 3FYOA 3VGEA 1IF2A 2Y7GA 2GQ3A 5KTLA 2CLEA 1B9BA 4Z0JA 1MQQA 2F38A 3ANVA 4AD4A 4CNUA 2V38A 3TMQA 4C1NB 2FMNA 3TYCA 2PTDA 4GOAA 2IW0A 1OFOA 2ZFAA 3A4WA 1AH3A 2X8RA 1QW7A 1XG4A 5A8OA 4GBUA 2AAMA 4FNPA 4XBSA 4IX2A 4UXDA 4ZB5A 4WOZA 1V02E 1Q7MA 1E43A 5C2CA 3SGGA 4PCFA 3NQVA 3GXIA 1M7OA 4EPBC 3BSGA 2ADAA 4K36A 3IJDA 3G8EA 4UOQA 5E0FA 1ZQ5A 2Y7DA 5AHNA 1K9EA 2J47A 1P7TA 1E0TA 1OFQA 4PYSA 2H3BA 4A21A 2A3AA 3M44A 4PEKA 3NR0A 4RV8A 2VFFA 1IEWA 1KXVA 4TX9A 3LDVA 4YHGA 4LW7A 1BAGA 3UZXA 1JZ3A 4F2TA 5A8GA 4B5SA 3SRFA 3MP3A 4D6CA 2VDGA 3GDMA 3PBVA 2HQAA 4H8HA 2GDQA 4S3EA 1VEMA 4EPEC 3AU2A 1G6CA 3MHUA 5MHBA 3UU0A 3DG3A 1B3WA 3WLMA 1L6GA 4LV9A 4WGXA 4EE9A 1P4CA 2P5NA 1XDLA 3HG2A 1KM2A 5I7GA 5HUOA 1T99A 1HO4A 5E6YA 1EGZA 4GXMA 5CBIA 5AC7A 4O8RA 3S2NA 4YL2A 4PUEA 4UFHA 3RM4A 4PTXA 1S2AA 2WHLA 4LPCA 4H41A 2ZUUA 3ABQA 3LXCA 1HTIA 5DCBA 3W2MA 3EOLA 2GVJA 1SQ7A 1CXEA 4K3ZA 2QV4A 1LL6A 3MJYA 4QROA 5G4EA 5H8PA 4AWTA 1KXQA 3WO8A 4UBPC 3H53A 2D3LA 1N2VA 3ZM8A 3AIRA 2WVTA 4LOCA 1XINA 4IFRA 2ISVA 1I0DA 3SIMA 4U2ZA 4XSLA 3BO9A 3GW0A 3AS1A 4IMCA 5EL1A 1T41A 4FO4A 4GVHA 4M6QA 4ZQPA 1PZ0A 4OBTA 3TFCA 2V2DA 2PS2A 2Q71A 4A3RA 4FEZA 5GNYA 4WDTA 2EQDA 4R9XA 3HA1A 2DW6A 1SW7A 3LNPA 1MW3A 1LWJA 3QMRA 5REQA 1SR9A 3WMBA 1UKSA 2A2IA 3AAMA 1K77A 5HUPA 3G3MA 1XISA 4TVCA 4O13A 2CBUA 1XIGA 2X1TA 2BY2A 3OPSA 3NQGA 3E0LA 1E0UA 2BTMA 4GGHA 2XM2A 1FDYA 4AWEA 1EC9A 4AHQA 1OB0A 3HJZA 5GVJA 2WMGA 1OGSA 3KHDA 3H4XA 1XGDA 1MZHA 3A3HA 3TSMA 1I2RA 3GU9A 4MM1A 1YBQA 4GZIA 3S2JA 1ME7A 3DG7A 1FH7A 4W8AA 1VBUA 6XIAA 1GJPA 4AZ7A 3RNDA 1SZRA 4NJGA 5KZDA 2GJNA 4HP5A 4WVXA 1GQLA 5MKGA 3SSJA 3S2LA 2YPIA 3R94A 4O50A 1AA1B 1IWAA 1L2QA 4BEUA 4Q8VA 4Q8PA 3QZ6A 5FF7A 2W91A 1GKPA 4O52A 2GDVA 4AY1A 1XC4A 3VNZA 4BFAA 1CBGA 2XIOA 2OYMA 1HJVA 3ITYA 1IGWA 4UTMA 2GPTA 2RDWA 2VI0A 1YDVA 3IGUA 3NM3A 1CGTA 1EB3A 4R85A 3VDHA 4ECLA 4EVZA 2AAAA 1M04A 1CENA 3GK0A 5BXSA 1Z44A 1NIUA 4HT3A 3HGJA 2ODOA 1J11A 3UJ2A 4IMDA 2YOCA 1M7JA 3EA1A 1JRCA 5HBFA 1XRFA 4DO5A 2Z1VA 4P2VA 2TODA 2PTWA 1DHPA 3MVTA 2HBXA 1OM0A 2OSWA 1L9WA 5DQPA 5CXPA 3VI2A 1K8YA 2ONEA 2VX6A 4G7EB 1EJTC 1PCWA 4O19A 4I6KA 1BQGA 1YTKA 4AD1A 4CUCA 3CTLA 4D8LA 1LLWA 3CQ0A 4HZ8A 3MA8A 3RCNA 1E55A 3GC4A 5DEZA 2R8WA 2WYSA 2PDHA 4KWSA 2ZBTA 3W7JA 1ZJHA 3KBWA 2VFGA 4RE2A 2ZWYA 1CIUA 2YBVA 3V75A 4O4VA 3LY0A 4RUBA 1POKA 5CSUA 2KX9A 4QNWA 6REQA 3V5OA 2VX7A 3O7UA 4HPJA 2OXNA 3MC5A 1SJDA 3KRBA 3KWSA 4RXGA 4LYRA 2EAWA 3I6RA 3CL7A 1WXJA 2DY3A 1NOFA 2C14A 5EYWA 2Y5SA 1E1CB 6TIMA 4NT0A 4L6HA 3SDOA 4AYSA 4QSHA 3WKZA 1FWHC 4BWLC 1MYRA 3EA2A 3AXXA 1ICSA 2E9MA 2VEIA 4DF0A 2WJZA 5LXXA 1QW9A 3W38A 4ZOCA 3P0WA 2YX0A 4P8VA 4OTKA 3T2QA 5TD4A 4ZA0A 2O92A 3L2LA 1E6XM 3TAKA 3O9NA 2CITA 3MDUA 2XM1A 1IXOA 1XICA 4NJKA 3IUHA 4KKXA 3CUZA 1J6PA 2QJHA 3R89A 2YZRA 3O6AA 2Y8UA 5AC8A 3C0SA 3KBSA 3VX0A 3WQPA 3A5FA 3DHPA 2J79A 4FF5A 1X38A 2WMJA 2HRWA 3QHOA 4LC8A 4HNVA 3GH7A 4LANA 4DBWA 2DJXA 1VP5A 3ENLA 4LUSB 4W9TA 3EEZA 2VOMA 1W3KA 5M5DA 3R8HA 3YPIA 3CIXA 2YLLA 4I3GA 2O55A 3HPXA 3KOWA 4Y9MA 2YBTA 3FN9A 3KBMA 4PUMA 1AMYA 1W3HA 2XPKA 1DQWA 1XIHA 4KBXA 2HROA 3KVMA 1EF2A 2OSYA 5I5RA 5RUBA 3NFUA 3HIJA 3PJTA 5G4HC 1XJBA 3MYPA 2WMIB 1XKYA 2DGAA 1DWGM 1UIOA 4IT1A 3WBYA 2FZDA 4C7DA 1YDNA 3JVAA 1J01A 3S9ZA 4RZ4A 4JFTA 2NV1A 5FI8A 1AD1A 1H1ZA 2H8XA 3A64A 4JYDA 2WC4A 3TTSA 1RD6A 4GH1A 1O6IA 2XH2A 1GOIA 1W31A 2PZ0A 3L12A 1K70A 5D9NA 4A3QA 4CEXC 1LROA 1F3EA 2WO5A 3W7OA 3AJ7A 3S1GA 1H7RA 4J5NA 1RK5A 5LNRA 4L1GA 3BG5A 2X0SA 3MSYA 4C5YA 2AQWA 5DY3A 3GHUA 2DQWA 5GJMA 2OLSA 4DYJA 3U6WA 1H60A 2CLOA 3I65A 1DKWA 2V5BA 3W7EA 4H9UA 3FYPA 4L7ZA 3QVQA 3SN1A 3WENA 3DFQA 3B03A 3GTIA 3HFYA 3T8QA 4K8HA 4H4IA 5JXQA 4KMQA 2GOUA 2A0NA 4W8LA 1V0LA 4LAUA 1O4UA 4EXQA 4GFIA 1JQXA 1CXLA 1EZWA 5AFDA 5DBUA 2QJJA 1GYMA 2Q01A 4IJCA 1KBJA 4KRZA 2ISWA 3BLOA 4LUIA 3E2VA 2ZA3A 2V5LA 3UXDA 4P7QA 4YVVA 1BEUA 2WKLA 1EGVA 1RLDA 4P7OA 2V67A 1JGMA 3FAXA 4XSMA 3MW7A 1TUXA 3EX1A 3LV6A 1F05A 4JHMA 1OFRA 5A6BD 1ZB5A 3G0SA 1ZP3A 2XFFA 3NQBA 3MHGA 1KFLA 1LUCB 4K68A 3G1RA 1CXFA 1G94A 1XBVA 3AZRA 2ZQ0A 3RLHA 2WJEA 4HHMA 3ES8A 1UMLA 1XSIA 4QITA 4IMEA 1X6UA 5CGQA 1C92A 4EX4A 3U8GA 3CPRA 2Z26A 4PRRA 1GVYA 1NTHA 3GM8A 1N8WA 2DDXA 3EXTA 3IV8A 4FIQA 3GXDA 4PRTA 5HPCA 3IEBA 5FACA 2ACUA 1TZ9A 2DPEA 4N9BA 2ABBA 3TWAA 1X6NA 3OB8A 2YCKX 2C1IA 4JOMA 5BXTA 1RJQA 3DI1A 3W87A 2NXHA 3H2MA 4DWSA 7TAAA 1Y8BA 1I75A 4NJJA 1F8IA 4FNRA 5LGXA 4A6GA 1QXLA 3AUOA 2Z00A 3AJXA 3PB0A 5H1WA 1MW1A 3GG8A 3PNZA 1V3LA 3DYPA 1KGUA 3F7JA 4J28A 1TFVA 4KPLA 1RV8A 3V1HA 1WAWA 3P81A 4S38A 4B91A 1XIBA 4H83A 3KM8A 4GY7A 2WVSA 4Z1AA 5AHMA 3I7RA 2A3LA 3MI3A 2F8QA 3MUAA 1PIGA 4P8UA 3VZXA 4HNNA 5CPSA 1F2JA 4WRHA 2YB1A 3CLMA 3FVMA 1XHGA 4WZHA 4D9PA 2XZ9A 1EHNA 1XL9A 3N73A 4Q4QA 3V0UA 4UTWC 3GG1A 4C1KA 2XHYA 3HG5A 1FCQA 2GK1A 2E6DA 2DW7A 4US5A 5LNVA 1UROA 3WFAA 1QASA 3APYA 1PKYA 1MFUA 2UY5A 3OTRA 7CGTA 3ARTA 3ABSA 2IKHA 4XD6A 1V8EA 5MF5A 3PUOA 2PDYA 1JZ7A 1EWEA 3GIQA 4KCVA 4ATDA 4Q8OA 1MNZA 1W5NA 1TTIA 1NF7A 1I2OA 1P1MA 3C2OA 2G5WA 3BLIA 3RF9A 4MKSA 2C71A 1DWIM 2Y4SA 1MVYA 3K4DA 2HE5A 1ADSA 4W7UA 1QHZA 5C5YA 2JF7A 1P6CA 3ARRA 1Q6EA 1L6WA 4WDXA 4B92A 2J7HA 4MWAD 2FJKA 4NZ1A 3VU2A 2WM0A 4BQ3A 2RDTA 1WKYA 2CHRA 2X2YA 4TR9A 3ZT7A 2VZSA 3QV7A 4CEUC 1KV5A 1T0OA 1UHVA 3G1AA 3HM7A 5FSDC 3RHGA 1JYVA 4GUGA 3EOUA 4UTFA 1ZL1A 3ITCA 4IPLA 2HISA 3EWWA 4JIHA 1J93A 2V5KA 4DELA 5XINA 1LQ0A 1ZBKA 3TC3A 4Z2IA 3M5VA 4DF2A 3NQMA 1SZEA 2QUTA 4HCDA 4PMXA 1H5VA 2YL5A 4FPSA 3GNRA 2DIKA 4LF2A 3B8IA 3R0DA 1ISVA 4H9VA 5CBJA 4NZJA 1J0KA 5LIUX 4MADA 3VM5A 4GYPC 3TZFA 5BROA 4OHQA 1B4EA 4CNNA 1QK2A 3RAOA 1RY0A 5AYZA 5D33A 1EXBA 1H11A 1VLWA 2OT0A 4GWEA 5FSEC 1K8XA 4MPKA 4CNOA 4UNKA 3NTYA 3CHCA 5HMDA 5C2GA 1XG3A 3RR1A 3B05A 4HA4A 1NDWA 1NELA 3UG3A 3WK2A 1ONWA 1I2QA 1YTDA 4Z17A 2HPMA 4HK5A 4C6KA 5L9FA 2VVSA 1R7AA 2OSXA 4DBSA 4M51A 3SB0A 4XZLX 4REQA 4QLKA 3EYPA 3NDYA 3U7BA 2A7PA 3FA3A 1YX1A 1B3OA 1VYRA 4H9TA 3WD4A 3C8FA 1TIWA 2EPHA 1DJIA 3L21A 4J4KA 2VGIA 5HATA 1ODZA 4JDYA 1E73M 3PZ9A 4R27A 4JCMA 2W5FA 4A3HA 1OGGA 1HL8A 4HU4A 2ZTKA 1KC7A 1JAKA 1QCWA 3GNNA 1FBAA 1AD4A 1HF6A 3UXLA 3OOQA 3VFCA 1BTMA 3LI0A 1JF5A 4ACYA 5I3DA 4BHYA 3W7RA 1VEOA 1PUDA 4JNMA 2VX4A 3EMQA 4FLSA 4DQWA 3O2LA 3HJEA 5CAHA 4FNUA 3BH4A 1A0DA 1SJAA 2I57A 4GY0A 4DJFA 2MNRA 3T07A 2X42A 4O17A 2V2HA 3U2ZA 1IEIA 1OX4B 3VOHA 5LIXX 3PZQA 5D02A 4JFVA 3IARA 1YNQA 2D3NA 2PDQA 1UA3A 4YNGA 3RITA 3PN8A 1X7FA 4MKNA 3TW7A 2O7QA 4PUKA 1IHIA 1ZHAA 4XIAA 3TTEA 4UTKA 4B5NA 3HGOA 2ATMA 1W56A 4KCUA 2PMQA 1TWDA 3TYAA 3VIHA 4PBEA 1A5MC 5KETA 1RALA 3UJFA 4E0CA 3BURA 2DVUA 4M7TA 1B90A 3N3MA 1R3QA 1VCVA 3FXGA 5D9MA 4RNFA 2VZVA 2ZUMA 3FSTA 4EPDC 4UFIA 3BGGA 1B3YA 3LM3A 4MSSA 4QXIA 3S5ZA 3WF2A 4E4UA 3GQYA 3DDMA 4QDMA 5DCEA 1MRQA 4ICCX 4WUIA 4EIVA 2ACSA 5I77A 4ZQRA 3EB2A 3LRKA 3O1NA 3VOCA 4HHPA 4B5WA 3VNIA 3IJLA 2PPGA 1I9CB 1XSJA 2J77A 5IRPA 1M03A 3TYUA 6ENLA 1DOSA 3C2FA 3ZLGA 1U1JA 4KH2A 4MTVA 3TN4A 4KEMA 3UNTA 4QLJA 3L9CA 5CSRA 1WZMA 1FDJA 1FKXA 2NXIA 3KBVA 4GXPA 5FD0A 3CJPA 4I8YA 1RZMA 1M01A 2KAUC 4HOZA 1FFQA 3PF3A 1SM9A 1NDVA 1IQ8A 2J7EA 4YVPA 3ZJ8A 3NQ8A 1GHRA 3POHA 1R6WA 4YMZA 2EEXA 3PFMA 3VKCA 2V3DA 1OK6A 3VKBA 3L4WA 4XO7A 2H6RA 2H3DA 2CZEA 1C7SA 2UY2A 2X1RA 3WLNA 3NJ3A 3I3BA 1BG4A 2IPJA 4AZHA 2CKSA 1C8XA 1ONEA 3W85A 5LNWA 1CXHA 3LCXA 3BW3A 2YYTA 4K7VA 4HK6A 3W6MA 2JGYA 4LBRA 1BRLA 1PTGA 2C0AA 4L64A 3HB9A 1ZPTA 3BVJA 3S5OA 3WL0A 4GQGA 5KINA 2DSKA 4IHCA 3U2CA 2EHHA 3W7MA 2VELA 1GJUA 4K38A 4L1WA 3TK7A 2ZRYA 2ZX8A 3CAWA 3OIXA 4PMUA 4LVAA 1EEXA 1U33A 1JDAA 3APGA 4DAIA 2GJXA 2GQAA 3NVDA 2WMHA 1IEXA 3R43A 3QOMA 1XM3A 4H6KA 5HWJA 3TN5A 3K30A 4AEFA 2XFYA 1Q45A 1LQAA 1G4EA 1I6NA 3MBFA 3OQ8A 4ZB2A 3V35A 1XUZA 2VJXA 4PCSA 5I0DA 2YBUA 3ZS4A 3DYOA 4R53A 3WFZA 2ZXAA 1RCQA 3O6YX 3UW6A 5MKGB 2ZA2A 2PDNA 2Z2AA 4Y7EA 3ZVHB 5HAOA 3GTXA 2C91A 1RA5A 2OMAA 4XIMA 3GUWA 1H41A 3DCPA 1W3IA 3LHZA 4PGLA 5CJ5A 4L4PA 2RJHA 1XLBA 1LWIA 2GOKA 4I90A 2J7DA 1AJZA 2WJDA 4JL1A 4MWAC 3UY7A 1ZU8A 5JBEA 4XD3A 1W1B1 3MJMA 3QTGA 4N9DA 2WVVA 4NHVA 2CW6A 4Z1YA 4B2DA 1JCTA 1K3UA 2EJAA 3GVGA 4IF2A 3BLFA 1ZJBA 4MZ1A 1GT8A 4G2DA 3CZEA 3W26A 3TZNA 3W2JA 4LNYA 1W17A 2EG6A 4IL2A 3CIWA 3EWUA 3F5JA 3RPTA 2XINA 5AYYA 1JI1A 2NZLA 4XD4A 7ODCA 3KFTA 3CEUA 3GDLA 3QPEA 5I07A 2CU0A 1NFPA 5CZ0A 3WK1A 3C2EA 4I7UA 3NL3A 2CZ5A 3E49A 1SYTA 1YYAA 1E70M 4LUYA 1HG3A 5CPQA 3PZGA 4H19A 2VFHA 4RDWA 2OFJA 3GHRA 2XN2A 3SUVA 3W1QA 2X16A 3F4NA 2XVLA 5CZJA 4JTQA 4M3PA 1EZ2A 4HK7A 1UR0A 4Q4SA 1OADA 3N2XA 6REQB 1CLKA 3IGXA 5ABFA 4O0QA 2BFGA 5FL1A 3O0FA 2WV8A 3REQB 2BVTA 3N2MA 2WC7A 1H3GA 4DJEA 3LB0A 2E6AA 4IPJA 3MI6A 1GVSA 1EJUC 1LM1A 1E6QM 3BC9A 4G7FA 5D05A 3RLGA 3RILA 2CKRA 1W8GA 2WZIA 3POCA 2DZUA 4YVXA 3SCPA 2DJLA 3LTSA 1D8CA 1Q2SA 1EHAA 1SU5A 3KOYA 4UTJA 1MUWA 1E9ZB 1IT8A 2VWSA 4RCXA 3KX6A 2ZRVA 3II1A 4MFDA 3QPZA 2XH4A 2Z1SA 3U4AA 3NSMA 3SY8A 3WQ8A 2OPJA 1F3XA 4GIAA 1S46A 3ITOA 4NZ4A 1W3LA 1LDCA 3SRKA 1ZLPA 4F0MA 2D0HA 3GDBA 4X2RA 1G7UA 1AH4A 2CZFA 4OIFA 2EPOA 1BYDA 3MO4A 4AIBA 4H6RA 4FOKA 3NPUA 2DIJA 5F4WA 1XQLA 5FKYA 3V1PA 2Y6ZA 1VFOA 3SFWA 5C9XA 2XN0A 3EKLA 2E3ZA 1V03A 2PFHA 2A3EA 4TVDA 1GCYA 5F2IA 1D8WA 1XLLA 4S3AA 4UTIA 1N8FA 1PE1A 3W1NA 1E3XA 1PCKA 3ANYA 1F7BA 3HMJG 4S3KA 2VEKA 3CLWA 3U0HA 4MGGA 1H4PA 2XUCA 3TLQA 1YDYA 3LU2A 4IFKB 1FWDC 1OABA 4GJJA 5DXYA 3N17A 3EXSA 3FCPA 3LHVA 1VCFA 1VPYA 2BDQA 5BOFA 5HJYA 2VTFA 1IT7A 3F03K 1KBIA 3PP7A 2HVOA 3USBA 2QUMA 3WNMA 2C13A 2P10A 3DG6A 1GVIA 3BCFA 2HMCA 3PZIA 2OQHA 4MZ8A 2G3JA 3WK0A 5I3KA 3WLIA 2RUSA 3RYSA 4L56A 3K4AA 1VFLA 3QYSA 1OX6A 1BSLA 2B7PA 2AMXA 3W7IA 1JJKA 5DN1A 2ALDA 1QK0A 3SJ3A 2MANA 4HMEA 4LBSA 2CXEA 4IG2B 1SW0A 1UKPA 3PBYA 2RGMA 3W84A 4XB3A 4A3UA 1FWBC 1OFEA 3W1PA 4XZHA 1MMFA 2A21A 1OF6A 3FKRA 5A6AA 4MIMA 3WD3A 2JK2A 3AI0A 3TONA 1XYMA 1BTCA 1MZRA 4JX4A 2BODX 3NDOA 1AQFA 4TUFA 2WCGA 3B9DA 4V27A 3WBAA 4FB7A 5D9PA 4G5DA 1ISZA 4GUJA 5C8BB 2BHZA 4M56A 3PJUA 3IK2A 4JYEA 1WQ5A 4QS6A 5K4XA 3ZSSA 2OEMA 1GZ1A 3BAYA 3EDJA 1QAPA 4O1FA 4NRRA 1XLMA 1K8ZA 4MKVA 1GQNA 2ACRA 1YKWA 2JBMA 2Y8VA 2ZWZA 1LL4A 3VKAA 2DSVA 3PY2A 4OECA 3SUUA 1CGWA 4P7LA 5JUVA 4HZMA 3NQEA 4O1AA 3BMVA 3P6LA 3A6OA 4PTDA 1XLFA 1Q6FA 3R1ZA 1XP3A 2FZ9A 3SO7A 2BOGX 2UBPC 4O1CA 2NLIA 3FSUA 4R7JA 5H2ZA 1T5AA 3JRKA 4CQ9A 3NEHA 3UCCA 1SO4A 2V6AA 1FWWA 4FX8A 4E2BA 3QJAA 8XIAA 3QMSA 2PEVA 3N4AA 3PTMA 3CAQA 4H2HA 3W1XA 4CCZA 3GDKA 3DZ1A 4B4FA 1IR2A 4DXXA 3R8GA 3UYIA 3B4YA 4Y8EA 4FXJA 1A5UA 3MUY1 3WLLA 1R3RA 4NF7A 3OBKA 4GVIA 1JZ2A 4NJHA 4W84A 2WHKA 1KRCC 1VENA 2BY0A 1BYAA 5AYXA 3URAA 2FH6A 4JTFA 4EF9A 5J5RA 3GVQA 4LVFA 3GU2A 2NV9A 2OVLA 1E56A 2QF7A 1G67A 1B2YA 3UERA 2QCMA 2Z2UA 4AU0A 2CZDA 5KEZA 2GGJA 2Q8XA 4CCDA 3N2TA 2P76A 3CNYA 1CCWB 1R7OA 2WLZA 5CC3A 2BVDA 2REQB 1W9DM 4Q4PA 3EB4A 1ZENA 3MYOA 4FALA 2CIPA 5H6HA 4IISA 2ZXDA 1E15A 1VD6A 4N6FA 4H3DA 4GLEA 1AZ2A 5HQLA 1UQYA 1DQXA 4GFSA 4MAZA 4C6PA 1XQKA 3I3EA 4FI4A 3O3RA 1UBSA 1E9LA 3M16A 2P3EA 1CB7B 3A5VA 2XH7A 2G50A 2PF8A 3WJXA 3NA8A 2FDSA 3N34A 3GU1A 1PKNA 4AZIA 4U2YA 2O9PA 3VGBA 5BXRA 3E12A 3ARSA 4M8UA 4C6JA 3QY6A 2GK1B 5CAKA 1OD0A 2ZICA 3N9RA 1BWLA 4HTYA 2B81A 4RNJA 5EMUA 1KB3A 1MW0A 4AVOA 2WZMA 3RFAA 1E5NA 1TE6A 5HWMA 1AVAA 4H04A 3VIJA 3UWZA 4D6IA 4US6A 4AIUA 1UKOA 1YDOA 3FGCA 1L0PA 4TMBA 2VL4A 2Y88A 4M1BA 1D7KA 2GVEA 4HCLA 2BMBA 4ZZ9A 1KM3A 3N12A 4TTGA 5GQBA 3KL3A 1L8NA 1EH9A 2ZZ6A 4JYFA 2Q8ZA 1HFBA 4MNKA 1Y5VA 3W07A 1W37A 1W9BM 3ONBA 4F3HA 9RUBA 2XG9A 2Z1WA 1L6SA 1GTEA 4WKHA 3PPGA 3WNKA 3TW9A 4J2MA 2GWNA 4AIOA 2CNCA 4MUZA 2WNZA 4O12A 3OGVA 3W6YA 3GNXA 3P5ZA 5CC5A 3UWWA 3WDRA 2NVAA 1LT8A 2J8GA 4UOJA 3U4FA 2PZNA 3P8IA 3DGBA 3S3GA 2AOSA 5FIPA 3W29A 4ACZA 2SFPA 2Q6ZA 2OKTA 4FOJA 3LGDA 3CYJA 4N9CA 5G1TA 2Q02A 3KW3A 3EGJA 4LAMA 3I7QA 2B7QA 1E4NA 3K1DA 3WJSA 2BB0A 1JDFA 4YIWA 5A2AA 2B7NA 3BCDA 3WDHA 4GKLA 5FCZA 1DHKA 1H7OA 3L68A 1QI3A 3AUJA 3MKVA 1VJIA 2OWXA 3NZGA 4TV6A 1DV7A 1US0A 3UR8A 1Y5XA 2DT0A 3E02A 3P80A 1ELSA 1W6TA 4UZUA 5HJLA 4TOQA 1BXBA 3NM1A 3LI1A 2J25A 5F2GA 4DRSA 5ABTA 4MB3A 1GZJA 1W54A 3BMWA 1EJRC 1CPUA 1XS2A 4IP5A 3BJSA 3TV8A 3R2GA 1WDRA 5D30A 1JXJA 2DH3A 4ZQMA 4HJWA 3M7SA 4WQ6A 2E8ZA 4UFLA 1AW5A 3GVRA 3N4FA 5LIWX 1EOKA 4QTGA 3FK4A 2XGZA 4REQB 1W3TA 3WH5A 1C91A 3BG9A 3L2MA 3CU2A 3QFEA 2DZVA 2XDFA 2ZDRA 1O5RA 4UR8A 4QIUA 1DJQA 4PTMA 3NGFA 3ES7A 3SUTA 2Z2BA 1PWLA 1GQJA 3HOJA 4OT7A 3UP8A 2EKCA 3TAOA 1DTUA 4EWJA 3TQ0A 4L4OA 1KNWA 1OYAA 2GQ8A 1RLCL 4NP7A 4CU6A 4Q4KA 1K8CA 3F5LA 1BFNA 1CNVA 3EDKA 1XYCA 1ME8A 4Q4MA 4E8GA 1XIFA 4MY1A 2D22A 1JDEA 1QOQA 4CCCA 4DO4A 4W87A 3WN6A 5HANA 2PRHA 3RX4A 1ISYA 1SO5A 2BXVA 1TV5A 3TX9A 1D2KA 1SVDA 5LIYX 1DE5A 2OWCA 4A29A 1B3VA 8XIMA 3QV6A 3M5XA 1F6KA 4QBXA 5CC6A 3FY1A 2F6UA 1C8YA 3JUGA 4MF4A 1UZ1A 1JAEA 4S23A 1WDQA 1E72M 2G3FA 3PZOA 1Z9AA 3WL1A 1EYEA 1R2RA 1WDSA 2CPUA 1W5OA 3TTOA 4PTWA 1QWGA 2HTMA 4NJIA 3GS6A 3TJXA 1OX5A 5BRPA 1P0DA 2V30A 4DBUA 4LRSA 2G3NA 2AQOA 6XIMA 2Z7KA 4TX8A 2E67A 1KO0A 2CCRA 3EKZA 4NSBA 4ONVA 3LHTA 3GDTA 2YGYA 3N13A 2EGZA 3W7GA 3LD5A 5T26A 3F2DA 1UA7A 5AZ1A 1ZAJA 2Y85A 3T4CA 4JD4A 1PYMA 3DEQA 4CCEA 2ZXBA 3QM3A 2PAJA 3RM8A 2PI6A 5BOOA 4R9OA 4O10A 3M0JA 4ZOEA 5HR6A 2V3FA 4N6EA 4BF9A 1MRAA 4NZFA 1V0NA 2O4QA 4WX2A 2XFWA 1DIEA 4GZJA 2WBGA 4LS2A 3EOOA 3HG3A 3LMYA 1JVNA 1JG9A 2X0HA 3H4GA 2VP8A 4WCJA 3VDCA 4OV4A 1BG9A 2QAFA 3RPMA 3ABRA 4K8EA 4KEZA 4G56A 2QGHA 3LYEA 2VURA 1C93A 3WLQA 3UR5A 3CL8A 3R13A 5LXEA 1UZDA 4Z1CA 2Y61A 1Q8AA 1P6BA 1C9DA 1RCXB 3A13A 4FNTA 2QYGA 4PTNA 1J5TA 1O60A 3G1FA 4LVBA 4J40A 7PTDA 1ONXA 2A5HA 2YB4A 2ATSA 3DU0A 3V0TA 1TREA 3DHFA 4ATWA 1H7PA 4MPQA 1ZAHA 4AF0B 3CUHA 3QGAC 2WANA 3IAQA 1BRLB 1UJQA 3EWDA 4O18A 3PTQA 5H8UA 3NXFA 4FLOA 2W6RA 3QC3A 1V02A 1J4EA 4TXEA 2BP1A 3EOSA 3T08A 1DJXA 3MWCA 3FHAA 2IXUA 3B8UA 3MUXA 4C65A 2NQLA 2YA2A 2D2GA 4Q33A 1B5TA 4F0LA 3S83A 4TU1A 5EGRA 2WCSA 1WUEA 5FAJA 1H1NA 3KCOA 4NZCA 5FEPA 2ZKMX 1KXTA 3KVKA 3AXIA 5IFTA 3PBMA 3VDBA 1V79A 3H2AA 1K4GA 1CGUA 3LA4A 4W88A 4ZFCA 3ITLA 2V5JA 2BBFA 1EXPA 4B3ZA 1P0BA 2E1WA 1W32A 1QNRA 5T8GA 3DFSA 3OJGA 3OW1A 3RX2A 1KWKA 4B15A 4YU1A 3W1TA 1NDYA 3F4DA 2ZA1A 3VABA 1SFJA 3RK8A 3WQVA 1QFEA 1YADA 2IUZA 1Y0EA 2MUCA 8A3HA 1PJ9A 3TWBA 3W6LA 3OLIA 2BWGA 2ISSA 1TJ1A 1H63A 3H22A 4HGXA 3S9YA 3NYDA 3E96A 4BCEA 4P8XA 5CJNA 2WSPA 4GK8A 2JQXA 2D24A 1DWHM 4PMOA 1AJ0A 2CLIA 1BF2A 5BU9A 1XLGA 4AH7A 1J0IA 3FLUA 1XW8A 2OYLA 1R2SA 3AC0A 4G7EA 2Z1XA 3BE7A 1A47A 4X63A 3EBVA 4XISA 2PDFA 3IPWA 5TQLA 2HBVA 4MVAA 6A3HA 2YL6A 3B3DA 1SO6A 3WDIA 1W1PA 1F07A 4GNJA 3WNPA 4RW5A 4RE4A 4GJIA 1XLHA 1YXDA 3DIPA 3UG4A 5EMKA 4RE0A 2CBIA 5CEWA 3GVVA 3Q37A 1E5JA 2C16A 3CV2A 3IJ8A 4M6VA 4QJ1A 4JCLA 4L9XA 2CLKA 3AYVA 3NO1A 3GTNA 5D03A 3OVRA 8CGTA 3R79A 2C15A 2PE4A 3EWYA 2YXOA 1BKSA 3OBAA 3INPA 1OHLA 2QJMA 2Y24A 1C29A 5A6JA 4LGXA 3IIVA 3NUKA 4LS0A 5FA5A 1MNSA 4MLRA 1E1CA 1P5BA 1UD4A 4H8NA 4GBDA 2FB3A 1S2VA 4FR6A 3GNPA 1GYLA 2XSBA 1UH4A 4PMQA 1DPMA 3W3OA 2IQTA 4FX7A 4MUPA 4J27A 2C0HA 4KW2A 1GVEA 4OU1A 1Q85A 3FX4A 2YYUA 3QN3A 1H1YA 3F4CA 1UOKA 2Y8KA 3GW3A 3S2MA 2J7BA 3RG6A 3EPOA 4MY9A 5SWUA 1B9ZA 3AMKA 1N55A 3BJFA 1W1TA 2IQDA 3RU8X 2DIEA 4QE5A 4C6DA 3KTSA 1ME9A 4GZ7A 2D20A 4K1GA 3ANUA 3E3HA 5M1TA 3AWOA 1GOXA 5C6MA 4PEEA 4AD3A 2R1MA 4IGSA 3LLFA 5IDZA 1WV2A 4B9YA 4IFOA 1F74A 2D73A 1PKMA 4F66A 2G3IA 3W70A 1KTCA 1GG0A 2RDUA 3UR2A 2QIIA 2EPKX 3WG6A 1E0XA 1EJXC 3ZYZA 4Q6JA 3VD3A 3KHJA 4GABA 1OCBA 3BTNA 4AY8A 1EKOA 3W7DA 5CQ1A 2FTYA 4QGCA 3S1XA 3W9ZA 3KUMA 3AIUA 1PBGA 2B7OA 3WLTA 2CFFA 3UY8A 3C4UA 4WLCA 1DWJM 3NEVA 2WMIA 4A05A 3S47A 4Z1BA 1TWIA 3EX3A 4C6OA 3B9AA 4GNVA 2WMKA 3CB8A 1K03A 5A2CA 3GC2A 2PGWA 4Q32A 1US3A 4H6QA 4IXXA 1XDJA 3DBNA 3KS5A 4QCEA 5EBUA 2PLKA 4WKAA 1GONA 1JPDX 4UTUA 3SM0A 3ZWSA 1HKKA 5C70A 3A12A 3SUWA 4BA0A 1VFTA 4UQEA 3ARQA 1JDCA 1QOPA 1EJSC 5M03A 7A3HA 3WQGA 3MI2A 5FEZA 1KA9F 1EO5A 4F0RA 1YE4A 4GGBA 4DO6A 4MJ4A 4D6EA 1T96A 4QJ3B 2WKGA 1NWUA 3T2OA 4I9MA 1G01A 4CNPA 1NAL1 3PVFA 4FX6M 1NOUA 2VD9A 3GDRA 2AL2B 5D04C 3VGHA 1YTEA 1TQJA 4QG6A 1XYFA 3L5AA 3BW2A 2YW3A 4AUBA 2HK1A 3LBMA 1R46A 3T40A 2Y62A 2O9RA 3B40A 4RZBA 5CH9A 1XIIA 4QLLA 3BLPX 1RUSA 2OR2A 1ZBCA 1SO3A 4Q8TA 5KZMA 1WCGA 1IZKA 1UUQA 3UQNA 1YNPA 1XYLA 3VAVA 3VPLA 3TR2A 4O53A 1HXJA 1PIFA 1QU4A 4BR1A 1HQTA 4NL1A 4H9MA 3CHFA 4LH8A 1RCOB 5C9ZA 5CGMA 5B80A 2NQHA 1TTJA 3BV7A 2PCQA 4PSRA 3GR7A 1UUOA 1W2VA 3UJSA 3WLHA 1AG1O 1V6UA 3TP4A 3AHZA 3FJLA 1DL3A 4GQRA 2BHUA 3BAXA 3CZJA 3ABZA 2D2JA 4XAFA 1DJYA 4G1KA 3WJWA 4H8UA 3BOFA 1P0KA 3PWIA 4R5EA 3HQOA 5C9UA 3OLDA 1H09A 4XV0A 3RJYA 2VEGA 5FL0A 1R9XA 3ZR5A 1BPLB 4RE3A 2VKZG 3VGGA 2HK0A 3BSHA 4Q3MA 3W2NA 3HQPA 4WJXA 1OBAA 5HR7A 3T05A 1EL3A 5EB8A 1DBTA 4W85A 3KS6A 5JH1A 1GW9A 3GLCA 4JTCA 1OT2A 1P0EA 1KM5A 4XK2A 2XIMA 4OQVA 3SUSA 4AWUA 1EJVC 4ATLA 4IL0A 5I2UA 2R24A 1OJXA 3ECQA 1RSCA 4L80A 3DYMA 5CZTA 3WIJA 1ADOA 1FH8A 1RQHA 4K1WA 3I68A 2GUYA 3MKKA 2B4GA 4GA8A 5AYBA 2F9RA 3HPAA 4W89A 1JYWA 4J3WA 4NASA 4HA0A 5EFFA 3T81A 2NUYA 3CZ8A 2VVNA 1ZJAA 2QCFA 2PDCA 4CN1A 3W1UA 1E3ZA 3EWBX 3PTDA 3N29A 2W27A 4O57A 1PSCA 4QJ4B 1E51A 3GC5A 1FOBA 1H0IA 1OEPA 2Z0IA 2VCAA 3F1QA 4HU8A 1IGSA 4ZB0A 4C6FA 3HZ3A 2QGYA 4Q8NA 1KFJA 4LRTA 4E38A 4ADSA 5DANA 1G9HA 3W2LA 1FCVA 4DWSD 4RJEA 5J04A 2J24A 2VZOA 4H2CA 2DU2A 1Q3NA 3PPHA 3NZQA 1TO3A 3R5EA 1ZTVA 6TAAA 3TXZA 3WMLA 3C61A 3W22A 1CXKA 1PTAA 4YTUA 4V33A 1UWTA 2QF8A 2VR2A 2VYOA 3I10A 4HPNA 1JI2A 1JULA 4PUNA 3TCSA 3C8NA 2J4GA 1TE1A 5F4XA 4UR9A 3PPFA 3VD9A 1V5XA 4LY8A 4KEVA 1U83A 1XD1A 1NDZA 1O95A 3FA4A 3URBA 3T4WA 3BARA 1IEQA 4QHRA 1B54A 2WNQA 1K7EA 4LCQA 4ZCWA 5EMJA 1POJA 2E77A 5DT5A 4US5D 4YHEA 4IP7A 3VZZA 1S2CA 4ZOBA 4JIEA 4BI5A 4HYVA 3LS9A 2OZTA 3Q45A 2E1DA 4WSJA 3TC6A 3LZ5A 5A6KA 2PP0A 2FZNA 2PC4A 3GE7A 3CO4A 3BL3A 3CT7A 1KM0A 4QX4A 2YXGA 3KRZA 3HFTA 2VXNA 3L7RA 3PUGA 5C9WA 3M0XA 1J0JA 4GI8A 3OGRA 4H7CA 2GJLA 1R5YA 3OODA 4DZIA 2OEJA 2HVNA 3WYZA 5DRCA 1QI5A 5I6SA 5AKQA 5DRIA 3A4JA 3Q67A 4C91A 4GHRA 1R9ZA 2DZWA 2CLLA 3M64A 1XLDA 2JIEA 3BZJA 4EWND 2VM8A 5FF4A 5TF0A 1LLOA 3N4EA 3RM9A 2VFDA 3WF4A 3W25A 4JFSA 3C0JA 1KTNA 4XUGA 3ZVIA 4DBEA 3DH7A 3W7LA 1ENUA 1FY6A 1E4IA 3MKCA 3L0KA 3P60A 2WSRA 1Y7VA 3NL5A 1RD5A 4QG9A 3W72A 2WWDA 2BX7A 5DMYA 4F0SA 4Y9OA 1FHVA 3LPFA 1FVPA 3H7RA 3M0ZA 4ZQNA 2BY1A 1RA0A 3C2VA 5A6MA 3V5CA 1EBGA 1IEVA 1PEZA 1DEDA 3BXWA 2WWCA 1THFD 4J3VA 3GNOA 7REQA 1FCBA 1OF8A 3TQKA 4X60A 2QDGA 2ZVIA 3MMUA 1OGBA 3G77A 2QV5A 1DJWA 4HSOA 4A35A 1EEPA 5D32A 5G2WA 3DN5A 1F6YA 2FLIA 3CS2A 5KSWA 3TR9A 3HMCA 4KWUA 1RAKA 3GFZA 1Q66A 5BCAA 1UR8A 4XG1A 3D47A 5EU9A 3G0XA 3GWQA 3RMJA 4XZNX 3W2KA 1OX4A 2CHNA 2JKPA 1D3HA 3GO2A 1H61A 2BLEA 3R12A 3LQGA 1VYSX 2P53A 5EMYA 4KEUA 2ABAA 2D2HA 3QMTA 1JRBA 3SQLA 3TYEA 3AHXA 3CT2A 1BQCA 1MUCA 5LKYA 4JNYA 1NQKA 1EBHA 4LYPA 4Q22A 4QS5A 2Z27A 1FA2A 3LRLA 3QEZA 3THQA 1UWQA 3ARZA 4EOUA 1F4HA 1EIXA 2VT0A 1PIIA 5I3FA 3W7KA 4JQ3A 3KCLA 1FWNA 3ABXA 1YW1A 4H8VA 4IQJA 2ON3A 1W1ZA 2YXXA 2PDUA 1GOMA 3PPCA 2V81A 4Z08A 1W0MA 5KITA 4W8BA 3CWNA 1ISXA 3KTCA 5J8LA 3QHNA 3JZEA 4E4PA 4GMEA 1JCMP 3GTFA 4Q4RA 4E4FA 3HURA 3RRAA 5E0CA 4XTDA 3MP4A 1K6WA 2J8FA 1GEQA 4CNTA 4ZBCA 2OLHA 3OYZA 4BJHA 1QHOA 3BOLA 1JCLA 4DJFD 4X3ZA 1LL7A 3N18A 1T8XA 1FRBA 4PODA 2PDMA 4IQLA 2ZZ3A 3EAUA 1XD0A 3FJ4A 1IYXA 2Y70A 4PUWA 3WF3A 4BI7A 3TYZA 3L66A 4HNTA 3VC5A 2H90A 3HQ1A 1LORA 1MXGA 3SCOA 4HYWA 3AHTA 2Z6JA 1WDPA 2FGLA 2PSNA 3CZGA 1KD0A 2CLPA 2VC5A 3UWUA 1RY8A 1XUUA 1UP3A 2PC8A 4V15A 2PP3A 1R30A 3HPZA 3RMEA 1XIDA 2PGFA 4OOUA 1LYXA 3O63A 4QISA 3TOPA 3R8RA 1QNQA 2QPSA 3WD0A 3N15A 3VIGA 4GY1A 2QUUA 2YFNA 3MMWA 1KRBC 3QKEA 1FXPA 3N6JA 4MFEA 3IVSA 2X1IA 3G2GA 3A9IA 3GHTA 4AZCB 1B3ZA 5LYRA 2NWRA 4IJRA 3TQVA 1Z32X 1M3UA 3DFYA 1OYCA 3LMZA 3WBXA 3U2EA 1VRDA 3MSDA 4CD7A 3K8KA 4WEVX 4AXKA 1SMDA 4PMDA 3GAKA 1ML1A 3HO8A 1SMAA 3M0MA 4GO8A 3V3WA 4HOXA 4Z0SA 1FDZA 3WQEA 4H01A 4XO6A 1SJBA 3ZLHA 4AZGA 4Y6GA 2NSXA 1R38A 4DHGA 4OGZA 3XIMA 3TVAA 4JTDA 1VGAA 2OQLA 4GO9A 4YYFA 3CTTA 5FEWA 3EDEA 1LJYA 4LEFA 1ZJIA 1GEHA 3LUTA 4HD5A 4IUGA 2EG8A 1KW1A 4ERGA 1L2UA 3DFPA 4HYRA 2AKMA 3FS2A 3R11A 4DWSC 1OG6A 4QDWA 3VIPA 3MQTA 3DHUA 5CPTA 5EMLA 3EX6A 3ZVHA 5PTDA 3W1LA 3BZGA 3VNYA 3CV6A 1XYAA 1GVOA 2BASA 4GJ1A 4UMCA 4A2SA 3B0XA 3IJ6A 4CU8A 5F2MA 4AG0A 3WMSA 4CKQA 2FTWA 4DUXA 3PBUA 2QCEA 1KRMA 3L67A 3ZR6A 5BWFA 4Z2JA 4WHBA 3UGVA 1EIBA 1AW2A 3W7PA 3NL6A 1CEOA 1W1VA 1JNDA 1UG6A 3MHFA 1SZNA 3MPGA 3WLJA 2NQZA 1XBYA 4CNSA 3VXGA 1M5WA 1KBBA 1U30A 3AZSA 1DWFM 1BLIA 4KGLA 3W1MA 4FP1A 1KV8A 4ROPA 2YW4A 1OC7A 5BMXA 3IUIA 4XWUA 1J10A 4UTTA 4PMZA 2VEPA 1S5TA 3GZ3A 1FWAC 4HPXA 1QRQA 3UFYA 4LU0A 1ZCCA 3N2BA 4JN6A 4Z1DA 4DNHA 2CBVA 3DESA 2PWVA 4I5UA 1T6MA 3K46A 3M0YA 2AKZA 1KFCA 4KCTA 5FEXA 1TVPA 3S0CA 1JZ4A 4E2OA 2QULA 4K39A 2OX4A 2Q09A 2VR4A 1GUVA 5CZKA 3QR3A 4LCRA 4EK7A 2BV9A 1BVNP 4M24A 4J3XA 3UWVA 3W86A 1L8PA 2PTXA 4J3ZA 2EG7A 2RKXA 3MDWA 2Z24A 3HF3A 4QAWA 5FJOA 1QMLA 3ID7A 1WE5A 2ANUA 2PP1A 2QZRA 3W7NA 4B2DD 3REQA 2OU4A 1XLCA 4ZR8A 3TMLA 3LN3A 2BY3A 4H7ZA 1RPKA 3V7PA 4D1JA 2I1OA 2C1HA 4RXFA 2VEMA 3S6TA 3V36A 3VFLA 3DAQA 4BEQA 2DUAA 2A7NA 4KT2A 1TR9A 3NO5A 3ARXA 3T78A 1TPB1 1TQXA 2BSLA 3CMFA 4N2YA 1NSJA 1VKFA 1KFEA 4JEJA 2BZNA 3T7VA 4FXRA 2GGHA 2IKJA 1VF8A 4OBRA 4OJYA 4DB7A 4UQAA 4D72A 3UVIA 1G5AA 2IQ0A 3W83A 5E5CA 1BSIA 2P50A 2XJ7A 3M0KA 1FWFC 3WLPA 1CDGA 1W2PA 1MSSA 1VFMA 3PANA 5CPLA 4U3CA 1WDWA 1CECA 3H2EA 1J96A 1VFHA 5AVHA 4A3YA 3VIIA 3G18A 1JZ5A 2WQDA 4HA3A 1UPMB 3NQFA 4AQLA 1EDGA 3JR2A 3V18A 2V8ZA 2YA1A 4FHAA 1S1RA 2WXDM 5AYIA 1YEYA 4C6IA 5EKYA 2QW5A 5LHFA 4DJED 1LCOA 1HKVA 4TX6A 2VDIA 4X9YA 5IBXA 3WNOA 2ASHA 3ZXWA 5CSYA 5I06A 5DMLA 2JGQA 4IFKA 3G22A 1TB3A 2P3ZA 4U5KA 4P5UA 3G1HA 4N9EA 4LVDA 2J66A 3RX3A 4FAMA 4DJDD 3DX5A 1ECQA 3DOPA 3CWOX 3BPWA 3CUXA 2Y1HA 2E4TA 4S1FA 1HGWA 1KBLA 4OE7A 2QQ6A 3GUGA 2ZX7A 1KQYA 4PUDA 3H54A 2TRSA 1TX2A 2G3MA 4MMWA 1C3FA 2YDSA 1V93A 3H23A 2WOQA 3T44A 3OVPA 4IG2A 2GFTA 4M7SA 5D8WA 3SRHA 2YL8A 3UZWA 4I5RA 4RW3A 4PBGA 4DJFC 2QHAA 3RPDA 2NUXA 5JMUA 1VBJA 1RJRA 1Q4WA 3AIVA 1BKHA 4O28A 5ENLA 4FMVA 1LG1A 4OZOA 3T0AA 4ENLA 2W66A 3B9EA 1GOOA 3ALGA 3VYLA 1NFGA 4O8AA 4JTKA 2FPTA 2FPVA 3K2GA 5AHIA 3I4EA 1I2NA 2OG9A 3NURA 3ITVA 1P6WA 3SFKA 4JBRA 1R87A 1SPQA 3CL6A 1JPHA 4BQ5A 1HNYA 3E2RA 5DF0A 4GX9A 3N11A 3FIGA 4GQQA 4H00A 1TJ0A 1A5LC 1R3SA 2A3BA 3VIFA 4DY1A 3LZ3A 4Q8WA 4HIBA 3WSUA 1EP1A 1M1BA 5U7SA 3OZOA 1JDDA 3B9OA 1WUFA 1EYWA 2W9MA 3APTA 1X98A 3A21A 4DX3A 2XTKA 5IHSA 4XTIA 5GJPA 1A5BA 1W5QA 2I5QA 1OG0A 1VFSA 2QVNA 4YJ5A 2ZZ2A 3CXOA 3VUPA 3BV4A 3WQ4A 1HIZA 1KRAC 3AXKA 3C0LA 4F79A 3H7VA 4ZXOA 4GIEA 4CN6A 3GXFA 3M4HA 1VFFA 3SW6A 5IFPA 1ITXA 1QOXA 2OO0A 4OUEA 4AW7A 1P0NA 1VEPA 4KF1A 1VPXA 3C3UA 1H7NA 3SEPA 3UZZA 3KVJA 4PH6A 3D46A 5FJJA 2V68A 4LSBA 4MLJA 1WKDA 4W86A 5H8MA 3BCJA 3QZEA 3S1WA 2BHYA 3ZJ7A 1AODA 1W5MA 2VUYA 4HB7A 1V0MA 5LSMA 4DXKA 1WPCA 5B7YA 3W7CA 1HKMA 3MTWA 4XAZA 2YDAA 2REQA 4MWAE 3SCSA 4JZ5A 3O06A 9CGTA 3UG8A 2XVNA 1Q6RA 1HJSA 5K9DA 2X40A 1R3WA 4JXCA 3ITGA 4P8WA 1M53A 4DI9A 3ZSTA 1UCWA 3SAZA 4LVGA 2B31A 3H8AA 5U4NA 1KCZA 3W2UA 4CQBA 2JALA 3LK6A 1X97A 1XGEA 2E5CA 3HN3A 4I5XA 4JTAA 4L6DA 1Q6DA 3M7WA 4PBFA 2O9TA 4KESA 2INEA 4KERA 4PMNA 3GG7A 2EPNA 3GH4A 1KGXA 4KIRA 1LBMA 5D2VA 2G41A 3G8RA 5TIMA 3UETA 3L5LA 1ZALA 3GRIA 2YR1A 1L6YA 5ABEA 4AB4A 4Z2HA 4UNLA 5HMSA 4OUIA 1OSEA 1OK4A 3N6HA 2O56A 3PUEA 4KFNA 5K9CA 1A3WA 5DMMA 4IZGA 3W27A 3AIWA 4JNZA 3DFTA 3K4WA 2HCVA 3MV01 3QR1A 3E0VA 1MXSA 3SECA 8TIMA 1HGYA 3CMJA 4L6OA 4Q7BA 1UR2A 3T0BA 4TMCA 2ZUWA 1JCYA 1R86A 1O5KA 2AGTA 4GZEA 1VAHA 3EDDA 3STPA 1TRDA 1GVQA 2QCDB 3IIZA 4E2VA 3MU7A 1RPXA 2FMOA 3VGFA 3U2OA 2P0IA 4MHBA 1YXYA 4ASTA 4Y90A 3S5SA 3ZOAA 3DFOA 4R33A 5A94A 1XCFA 3MB9A 1FWTA 1HP5A 1Q65A 1R3TA 1A49A 4KGJA 2G4FA 5AOUA 2R91A 2PUZA 1WO2A 2ZIDA 4HSHA 1OQFA 1H49A 4MJ2A 2ZZ4A 1A5AA 3C3NA 4IWWA 3WH9A 2NX9A 2VHLA 3UXKA 1GKRA 2PDXA 4OFCA 1TIMA 3BDKA 1KXHA 3UR7A 3LCHA 2W63A 5A2BA 2INFA 1OC5A 4NX0A 3WF1A 2DZBA 3PAOA 3XINA 4DUOA 2Z7GA 5M2FX 4GX8A 4MB1A 3LTPA 4C60A 4QM1A 3MVIA 4AD5A 3MUZ1 4GQ0A 3STGA 2JF6A 4ORIA 4AMAA 3R4IA 2WSQA 3CIVA 3PZMA 3ITTA 1B30A 3UXIA 4WY0B 4DJEC 3MUIA 1H62A 1V6VA 4CQAA 3FVDA 2XFRA 2BS9A 3HGSA 2HZGA 4ILSA 3C2YA 2BGSA 1RP8A 1EQCA 3G6MA 1KBKA 5A69A 1R8LA 1S39A 4IUOA 1A4LA 3Q2DA 2ACQA 1S2TA 4DJDC 4PL2A 1XCWA 1FWEC 5HNUA 1RK6A 3NZRA 2WSKA 4HBKA 5H91A 7REQB 2AQVA 2NVCA 1UJPA 3ZQ9A 4UR7A 5CSSA 1VJSA 2FJUB 4GVFA 1MUMA 4HSNA 4IJBA 3W4RA 4PZVA 1AL7A 3OIHA 3WNNA 3TXVA 2VRKA 2ZTJA 1RVGA 3QW4B 1JPMA 3RU6A 3M41A 1F5ZA 5C71A 4HHHA 1YNYA 5K3VA 2PGEA 3XISA 1FWSA 3WD1A 3QV8A 5I78A 4HMCA 4QR6A 4IH3A 2NVDA 2WMFA 1AJ2A 1IXPA 1QPOA 3WDPP 1J79A 1XRVA 1TYGA 4KQNA 1JF6A 4LY4A 3WLOA 2HS8A 1PXGA 1I60A 3GR4A 4PMRA 1FWIC 1JL8A 3ZFHA 1VIWA 1SGJA 3WEMA 3IS4A 3OHIA 3QSRA 1KKOA 1UH2A 3UT0A 3U48A 3BAKA 1A0EA 5FAGA 4HN4A 1F3TA 4UQDA 3GAYA 3KEHA 3EWXA 1AL8A 3NQDA 5LGZA 3KBNA 3BLDA 2DEPA 3P0XA 4ES4A 1A5KC 4LFYA 1GOQA 3GH5A 2HV5A 2A4AA 3VCCA 3CB3A 1SFSA 2IS7A 2XVPA 3TJLA 4W93A 3MZ2A 1C90A 1UZ4A 1PYFA 5FF2A 2PRMA 3G1DA 4Z2GA 2OT1A 2IKIA 3PZVA 2LLEA 1SFLA 3VIMA 2Z29A 4U10A 4LQ1A 5JH2A 4CQ8A 3FAWA 3OZMA 3B8WA 2J7GA 2WW5A 1HT6A 2PGRA 4XAYA 4RR4A 2OB3A 3CAKA 4ML9A 2BXZA 4UQBA 5IDIA 4J3SA 3KAOA 1Q2RA 4AEEA 4I9AA 3BMXA 3TDFA 4C6QA 4DN1A 4DBDA 3LBOA 3RJXA 4YCOA 1OYBA 3GYEA 9XIMA 3AS0A 3IRDA 2DQXA 5T91A 3THAA 2V82A 1V77A 3MMDA 5CZSA 1LZOA 5F4SA 3KRUA 4DPPA 3OG2A 3URNA 1UQZA 3UESA 4X0VA 1Z42A 1Q6LA 2E5DA 4AF0A 3EB3A 5LZLA 1E6NA 3SADA 4WSHA 4EACA 2Q8LA 3VKDA 3W7HA 4Y96A 1TUFA 4WY0F 1JQVA 2G37A 5FJTA 3UWEA 3W73A 3ZWTA 2XH0A 3M0HA 3OHMB 1WXYA 3TJIA 2QJNA 1M41A 4HJFA 4PMJA 4AHOA 3CV7A 4ZQOA 4ZENA 2W61A 4V28A 3WQFA