1Q6QA

Structure of 3-keto-l-gulonate 6-phosphate decarboxylase with bound xylitol 5-phosphate
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
214
structure length
213
Chain Sequence
b'SLPMLQVALDNQTMDSAYETTRLIAEEVDIIEVGTILCVGEGVRAVRDLKALYPHKIVLADAKIADAGKILSRMCFEANADWVTVICCADINTAKGALDVAKEFNGDVQIELTGYWTWEQAQQWRDAGIGQVVYHRSRDAQAAVAWGEADITAIKRLSDMGFKVTVTGGLALEDLPLFKGIPIHVFIAGRSIRDAASPVEAARQFKRSIAELW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-keto-L-gulonate 6-phosphate decarboxylase
molecule tags Lyase
source organism Escherichia coli
publication title Structural Evidence for a 1,2-Enediolate Intermediate in the Reaction Catalyzed by 3-Keto-l-Gulonate 6-Phosphate Decarboxylase, a Member of the Orotidine 5'-Monophosphate Decarboxylase Suprafamily
pubmed doi rcsb
total genus 81
structure length 213
sequence length 214
chains with identical sequence B
ec nomenclature ec 4.1.1.85: 3-dehydro-L-gulonate-6-phosphate decarboxylase.
pdb deposition date 2003-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1q6qA00
4ZQPA 3QQ0A 3HB9A 3QYQA 3L21A 4A22A 1H7PA 3E0IA 1TV5A 1D3HA 5HWJA 1OFAA 3LI1A 1PVNA 1GTHA 2X2GA 3UWQA 2V8ZA 3A22A 4OV9A 4O1BA 3NL6A 3BO9A 4GRSA 4HSOA 1H63A 3UWVA 3HPXA 5AHNA 4DQWA 2H3BA 2G97A 4AMAA 3S6DA 3T4CA 4NJGA 1M7PA 1ALDA 2CZFA 3PF3A 2YYUA 3GXPA 3W7EA 1JULA 3S1UA 2QJIA 2BXVA 5EMUA 2VXNA 4A3UA 3P80A 3QRHA 3P84A 3M0ZA 4JTJA 4TMCA 1FUYA 3RMJA 2QUUA 3WK0A 1SSGA 3LRKA 5D32A 3CPRA 3VE9A 3ZWTA 4O12A 4MZ8A 1K7EA 3JR2A 1TPWA 3W7RA 1GWJA 3BGJA 4H4IA 4IPJA 1QMLA 4QITA 1XXXA 1ZNNA 3GLCA 3KAOA 3Q58A 3P81A 4XBKA 4O10A 4Y96A 3S1XA 2VC6A 2G95A 5KZEA 4JXCA 2NX9A 5F2IA 5TIMA 1M6JA 1S5TA 3IGUA 3DI1A 2F7FA 5FF3A 5I3GA 4N02A 3IEBA 3C2FA 3B06A 3I68A 4ML9A 1P1XA 1YTEA 4MFDA 4UR7A 3MMTA 5AHLA 4I7UA 5LNWA 1G7VA 1GYNA 2YXGA 5DCEA 1UCWA 1ICPA 3QC3A 1W37A 5F4WA 5F4XA 1FY6A 4GNJA 3IVSA 3LHVA 3B03A 3W75A 4O13A 4YLWA 3E9AA 4NNBA 3UY8A 1ZJIA 3PSVA 1VQTA 2FIQA 1LROA 1LOSA 4MUZA 2NUWA 4X3ZA 4PFMA 2QEZA 3UXAA 2V81A 1SO4A 1QO5A 3C2EA 5LSMA 5H2ZA 1DVJA 1BEUA 3GNNA 1G4EA 3F1QA 3A24A 3ZFHA 3TV8A 3TU9A 4CNNA 4G1KA 2QJHA 4TMBA 1L6YA 4A29A 1YTDA 1O5XA 1XDLA 3OVQA 4AVFA 1TTQA 1W56A 2CLEA 3HO8A 3NQCA 3ABOA 1K8ZA 4JTKA 3GR7A 5HWNA 2R14A 1PCWA 4NT0A 4JTHA 3BLFA 1OFDA 3DHFA 1UBSA 3NEVA 1FDYA 4BK9A 1VCFA 2TSYA 3PBUA 2CWNA 2ZA3A 3CT7A 2X16A 1N7KA 5AHEA 4HT3A 3NA8A 3EX1A 4IWWA 4I7VA 2VEKA 3C6CA 1H7NA 3U6WA 3UY7A 4UMAA 4UTTC 3HQ1A 3MBDA 1OG0A 4RV8A 1XI3A 3R12A 2JKAA 4K38A 4Q32A 2Y7DA 1RV8A 1JCYA 2NXHA 2WPBA 4OV4A 3LCIA 3TMQA 4ADSA 1Q6QA 4AH7A 5BRBA 3I7RA 5LGZA 2X1TA 4IXHA 1DOSA 3PUOA 4XWUA 3SI9A 1KM3A 1JCNA 2QCEA 1C29A 4H6KA 2H3DA 1AL8A 1R2RA 4IMCA 4FIRA 2Y62A 4N6FA 1HFBA 4N4PA 1RQBA 3O6DA 3W70A 5TBOA 3QSRA 1BTMA 4AEOA 5DXYA 3M44A 3DKLA 3KVLA 1WOBA 1B57A 2I9EA 4OQVA 3DKJA 3W1QA 4JTUA 4XKYA 3W22A 4C1KA 1KLYA 4NVTA 3LCLA 3O6CA 3GDMA 1JUEA 4FO4A 4FX6M 4RJEA 1YDNA 3N14A 2CLHA 3QQ1A 3GDKA 1QPQA 3UWWA 3IIZA 2IQTA 3BW4A 2PRHA 4WJEA 3EX2A 1XBVA 1XFBA 2DJXA 5D02A 5CGQA 2E68A 4JTSA 2C3ZA 2TRSA 4M7SA 2QDGA 1LCOA 5DY3A 1JCMP 1I2PA 3CIXA 5HR6A 5DBUA 2ABAA 3LCXA 3QMRA 4JY9A 2CLFA 4BI6A 4D2JA 1BKSA 3MP4A 3NAVA 3W1TA 4O0ZA 3CHVA 1GQNA 3N3MA 4NJJA 5LNSA 2Q8ZA 1I2QA 2FB3A 1KM0A 3R5EA 1TSIA 5AHIA 2ZDRA 1V5XA 3B8DA 4KFPA 2QJGA 4BR1A 4RZ5A 1IF2A 4UFJA 4UTMA 4JD4A 5D2WA 4EF9A 5HINA 3H53A 1H7WA 3L9CA 3FLUA 2DZTA 3W2JA 3FYOA 4FEZA 4N9CA 4HNUA 5G2IA 1PHWA 4AWUA 3TE9A 1J2WA 1IXOA 5U4NA 3I7SA 3W3OA 3DGRA 3UYCA 1ZY9A 4GUIA 3W72A 4ZZ9A 3WK3A 3M16A 2J9YA 3EX3A 2OT1A 5IBXC 3W85A 2VFFA 1OX5A 2AAMA 1LZOA 4UFLA 4IX2A 4QQ3A 3MYPA 3QM3A 2ZRYA 3MBFA 3W1LA 1GVQA 1JRBA 3S1VA 5D2YA 4O1AA 4O28A 2Z0IA 2C15A 2J24A 4QNEA 4RXGA 2QKFA 4MY8A 4EWND 2ZZ2A 2NZLA 5L6UA 4WY0F 1G4TA 1OFOA 2O7SA 5HWMA 1OFBA 2OZ0A 2JGYA 4GJ1A 3TR2A 1KFLA 3LBCA 3HGRA 4LOCA 4JDYA 3NQAA 1KTBA 2ZZ5A 2WSYA 2CZDA 3P67A 3TCEA 3V75A 1JQXA 3DXIA 5FI8A 4RCXA 3KRSA 4HNVA 1Z48A 4O14A 2BZNA 1NF0A 4AF0B 5DXXA 1LP6A 3N9SA 3W2UA 3W9ZA 3C8FA 3NQDA 3SGZA 1TPEA 1WYIA 2AQWA 1I4NA 2FPTA 1HG3A 3W84A 4EF8A 1B4EA 3IGXA 3MUXA 3LHTA 2ISVA 4UTWC 1SW7A 1QPOA 2OX1A 4LVGA 2CFFA 4BI5A 1S5VA 1IIGA 1D3GA 3T55A 1QAPA 5EY5A 3IIOA 3LM7A 1LBMA 4ZL1A 4UC5A 4HHPA 1YADA 4O4VA 5F2LA 1L9WA 1CI1A 1JJKA 3NQ7A 1KFCA 5EBUA 1XBXA 5I3FA 1L6SA 2E5BA 3DZ1A 2Z6JA 1SUXA 4GFSA 2QAFA 2DZVA 2DJLA 3LERA 3TMLA 1MXSA 3G24A 2Q8LA 3SZ8A 1GPWA 2Z6IA 4PCFA 3RFAA 1ZCOA 3NQGA 3MP3A 3G1YA 4O0KA 4M5PA 3QW3A 3MYOA 2WQPA 2ZFAA 2A1YA 3WFAA 4FIQA 1ZFJA 3W7MA 2Y7FA 2YSWA 2XN2A 3W7QA 1THFD 1PV8A 1I45A 3NZ1A 3KVJA 1SZGA 2I1OA 5EL1A 1OYCA 3FJ6A 2X1SA 1SO5A 3HPSA 2B4GA 4UXDA 1WQ5A 4N9BA 1FCUA 1W31A 5CZ0A 3G0UA 3EX4A 2GQAA 2ZZ6A 3O05A 2YCEA 3TQVA 4DF0A 5LKYA 5EPDA 4NJKA 2A21A 5CZJA 3N34A 5D2VA 2B0MA 3IIPA 3CQ0A 1P5BA 5D33A 3W1UA 3C52A 4DO6A 4HNTA 4LRTA 5D03A 3KRUA 5HMSA 5AB3A 3G3DA 3L67A 5F4SA 4LUIA 1VHCA 5A8GA 1G4SA 1P0KA 1R46A 3W7CA 1OVDA 2DZSA 2CLMA 4Z1BA 3TA6A 4FB7A 3UZ5A 5HJLA 2WNNA 3MHFA 4Z0JA 1TTPA 1EB3A 2VFHA 4P2VA 3STFA 3N19B 3SW6A 3LLDA 1X1OA 1H50A 1EX5A 1JQVA 3A21A 2FPVA 4WOQA 2Z1BA 2QCDA 4XBSA 1LLWA 4NU7A 2ZRWA 5ABTA 1TMHA 2FB2A 1LOLA 2V82A 4WXYA 1TPC1 2A6NA 2DP3A 4ZQOA 3V1PA 2G96A 5G4EA 3O16A 2CZEA 4R33A 2VKZG 3CIWA 4CCEA 1DJNA 3IVTA 1TTJA 4K7YA 2A7RA 2DZUA 4JTIA 4ONVA 1SW0A 1DV7A 3WK2A 4IXXA 3PY2A 5G5IA 3LX9A 4MYXA 1GTEA 4JX6A 2LLEA 3WJWA 1XC4A 4XKYB 4FXRA 3M6YA 3RNDA 5LZLA 6TIMA 3TFCA 2WO5A 3C0JA 2RH9A 3NO5A 5EKYA 4GXMA 5BNKA 1EWDA 5G1YA 4K36A 3TROA 3TFXA 1O4UA 4ZMGA 1SZNA 3VCRA 3W2MA 1HO4A 2QCHA 3G1SA 2VENA 4GC4A 3IRDA 3P61A 2NX1A 3HGOA 3W23A 4L4LA 2ZZ3A 3GYEA 3USBA 3CEPA 1FWNA 3R13A 2YGYA 3EWBX 3DFOA 2OMAA 3KX6A 1F05A 4J9JA 4NX0A 5FF4A 3ANYA 3S9YA 3H54A 2V9DA 3LBMA 5C5YA 3EWUA 3FKRA 4O54A 1C8VA 5E0KA 3JS3A 4DF1A 3W1RA 5D2TA 2RHGA 3NL5A 4A2RA 3PVFA 1N55A 3DH7A 3PM6A 3LV6A 4I9AA 4Z08A 1SO6A 2C13A 1OJXA 3RF9A 3PUEA 1AMKA 3L66A 4FNPA 2ZRUA 4U28A 4O11A 5HULA 2GJLA 5D38A 3TC7A 5G2HA 3EXRA 3Q2DA 1QNVA 3Q37A 2WSRA 3SFKA 2GVLA 3HMJG 3KRZA 4TU1A 1ICQA 4JGDA 7TIMA 3HJZA 1P4CA 1YTKA 1K02A 3UWZA 2YFOA 5C2XA 1GG1A 4MLRA 1KW1A 3IIVA 3SSJA 4WY0B 5E93A 1AW1A 5CPNA 1MZHA 3N73A 3TAKA 1QCWA 1YXDA 2NV2A 3NM3A 1NF7A 4O17A 4DO4A 2G5WA 3VFLA 2WSQA 3RLVA 1BWLA 2C14A 2WKJA 1OFRA 1J5TA 2DZXA 2NWRA 1GVFA 3CTLA 3PULA 4UNKA 3ABQA 2A5HA 1F7BA 4FNTA 2Y7GA 3W7NA 3PBWA 2NUXA 2ZYFA 3MHUA 5K7JA 4MVAA 4ZVJA 1UASA 3OBKA 1FWSA 1Q6OA 4LUJA 3W1AA 3LRLA 4IMGA 8TIMA 3EWYA 1QDSA 3LTSA 2E6FA 2EGZA 1JUKA 3B04A 3IGSA 2TMDA 2VFIA 3T78A 3U2OA 1HTIA 2QCFA 1S3HA 3M1ZA 1RQHA 2V5LA 3U8GA 4UFHA 1GOXA 3I65A 3VE7A 1WAUA 2E5DA 4O50A 5C55A 3EXTA 3G8RA 4JNMA 5FEZA 4JYDA 1G69A 4PTNA 4ZQMA 1GEQA 4TX9A 3NQVA 2PRMA 5I3KA 5CPMA 4N4QA 3TXVA 3S1WA 1OHLA 3NPVA 1TO3A 1OFQA 4Q33A 4POCA 5HQEA 1SPQA 2C6QA 4X2RA 3P8JA 3W2NA 5G2WA 3PUDA 3G8EA 3TQKA 4O19A 6ALDA 3PB0A 1RD5A 5D37A 5K9XA 4S2CA 1VCVA 3O1NA 2D73A 1VHNA 4K37A 3P82A 4MZ1A 3OA3A 1KFEA 1Z42A 2QR6A 3LHZA 3FYPA 1GVRA 1K8XA 3B0UX 4R7JA 1TPUA 2JGQA 3HG3A 4YMZA 1LBFA 1TPB1 2YDAA 4DBDA 3KXQA 2A85A 3NQ8A 2NX3A 4X9SA 1TPVA 4UTLA 1U83A 4WZHA 1T99A 2NXGA 3P60A 1UUOA 3L0KA 3O07A 3EWWA 1H1YA 3GXNA 3W7OA 3UD6A 1VGAA 1Y0EA 3QMSA 2QCDB 2RDUA 1IXNA 4M6QA 1H61A 2WJZA 1LLZA 2E5CA 2PRLA 2GUUA 3L5MA 2PCQA 3RK8A 2YW3A 3B0PA 3NQMA 1PHQA 4WOZA 2Y70A 3MI6A 3WJXA 1ZHAA 3UNDA 1OK4A 2P10A 4ORIA 2F84A 4OE7A 1A53A 1YPFA 3NQEA 4Z1CA 1LRQA 1Q6LA 2EKCA 1VC4A 3DBPA 1A5SA 3QSTA 5AFDA 2VOMA 1JRCA 4Y6GA 2HS6A 1NEYA 3WJSA 1KV5A 1W5PA 2VFGA 1AW2A 3W87A 3PSWA 1ADOA 1K7FA 3L68A 3VKJA 1DKWA 1OFPA 4JEQA 3W2LA 1RPXA 5DLCA 2EPHA 4OWGA 4DEFA 4UFKA 1DQXA 4ADUA 2VEMA 3TDFA 4Y9AA 4UFIA 2QF7A 2Q3OA 1E51A 1MO0A 4PC8A 1TQXA 3C2VA 3FFSA 2ZA1A 4MOZA 2ZA2A 1A50A 4LVBA 4FNSA 4K7VA 5CSRA 3SECA 4OT7A 3AO0A 4O53A 2FPYA 4CNPA 4IUOA 4UMCA 3R8RA 1QOQA 1I2NA 4Z0SA 2ZZ7A 2PC4A 2Y85A 2B7OA 1H5YA 3EWXA 2X1RA 1SZFA 2ZZ4A 3W6YA 3R2GA 4CQAA 1JR1A 3OVRA 5HUPA 4IMEA 4JX5A 3SR7A 1VLWA 4E38A 3GDTA 4DXVA 5K3VA 3GZ3A 3THAA 4OBTA 3MWAA 1VYRA 2HTMA 1IGSA 3IVUA 4N6EA 1W3NA 3LB0A 3NPXA 4LW7A 5KMYA 4OU1A 1GT8A 4MJZA 3S8HA 4UTJA 4UUIA 1B9BA 3DENA 2WNZA 4S1FA 3L2IA 5BW6A 2Y6ZA 5AC6A 4QM1A 2YR1A 1LRTA 3E49A 4XQ6A 3DFSA 4GUFA 4UTUA 2KZHA 4CCDA 5FF0A 3ZR4A 3C4UA 4M19A 2ISSA 5FF7A 3STGA 1XCFA 1FWRA 2QAPA 3GX9A 4ICNA 2V30A 3DAQA 3G1AA 1DQWA 2C1HA 3BG3A 3FIGA 4JX4A 4PEKA 3P5YA 2Z2UA 4O4WA 3QJAA 4K8EA 1H1ZA 2DZPA 2CLKA 4ALDA 5F2GA 4AHPA 1FBAA 1LM1A 4O57A 5LNRA 3EEGA 2YX0A 2EF9A 1LORA 2VFDA 5E1QA 3NPUA 5AC8A 2J9ZA 4OGZA 2E6AA 3A5FA 3W76A 4WQ6A 3DFPA 3CU2A 1YXCA 3R89A 1NVMA 3LCHA 3T7VA 4GBUA 3LXAA 3GVGA 2E6YA 2C0AA 1EA0A 3MO7A 1TTIA 1PCKA 3W71A 1FX6A 1KTNA 3LCWA 5I3IA 4AXKA 4Y90A 3SJ3A 1F6PA 3BLIA 2FJKA 1K3UA 4L4MA 2VELA 1IIHA 3TKFA 2A7PA 3MI2A 3SIZA 1KTCA 1XDMA 1RQEA 3W73A 3BW2A 5BMWA 3F4NA 2GQ9A 1EEPA 2E09A 1F6KA 5CPLA 2P0OA 2GQ8A 2R8WA 1XUUA 3E12A 3G1HA 3ABRA 3GKAA 3HIJA 1HL2A 4IX0A 2EHHA 3DI0A 2VEIA 1Q3NA 3GAKA 1W3IA 4EVZA 1GZGA 1OF8A 3OHIA 4CCCA 2FTPA 2TYSA 5SWUA 3KFTA 4JICA 1LBLA 3TX9A 1F76A 2X1UA 4UR8A 1YLVA 5CPOA 1QWGA 3ABSA 3TQ0A 4JIQA 3L65A 4WD0A 3W7GA 2JKEA 4QIUA 1X6UA 4YCOA 3B0VC 1ME9A 3W74A 1J4EA 5D09A 1FDJA 1VR6A 2ABBA 4TIMA 1VZWA 1ONRA 2QUVA 2NXIA 3W7HA 1N8FA 1EP1A 1LDCA 4MPQA 2YPIA 1C9DA 1F5ZA 3LXBA 4DBEA 1A5AA 1MEWA 3ATYA 2BX7A 3DU0A 3UQNA 3LHYA 3M9YA 4MFEA 3LHUA 1VJIA 3C61A 4TO8A 2W6RA 3D0CA 3G22A 5DN1A 3LGEA 5FF2A 3LOTA 5HR7A 1I2RA 5GVJA 3S0CA 4FX7A 4BWLC 4MLJA 3GDLA 1SZEA 1O95A 5KZDA 3WJZA 5G4WA 1A5CA 1TRIA 3WK1A 1VYPX 3O06A 1NAL1 4ORMA 3PBYA 1AG1O 3H55A 1SFLA 1YDVA 5KITA 3W1NA 1M5WA 1B4KA 3N2XA 4MKNA 4XTDA 4ZQRA 1I8JA 1JVNA 5MHBA 3PG8A 3GR8A 2J9XA 2CZ5A 3NM1A 4PODA 1OX4A 3NGJA 3NZRA 2FDSA 5L9FA 4RZ6A 3OG3A 5AHFA 2DU2A 5AYZA 1TYGA 4UFMA 2V5BA 3S5ZA 2DZWA 1SQ7A 1L2UA 1ZAIA 2CLLA 3W83A 3M41A 1JCXA 2VEPA 5AHMA 1G67A 4Z1AA 1P0NA 1HO1A 4UTTA 1HUVA 3LTPA 2OT0A 4QNWA 1DL3A 4FXSA 4UTWA 1XL9A 3GIYA 1SSDA 1UB3A 3QH2A 3GK0A 4PH6A 3DFNA 3GNDA 4PL1A 3HG4A 1W5MA 4FF7A 4LVAA 4AB4A 4IPIA 3TC6A 2CU0A 1GYLA 4FHAA 2V2DA 2YYTA 1QR7A 1X7FA 3KVMA 1IXQA 2CLIA 4NJIA 1WOAA 3N2MA 3OEXA 1YYAA 3C3NA 1PE1A 4IMFA 5KINA 1DORA 2O7QA 4N9EA 3M7WA 1H7RA 5HUOA 4W9TA 2CLOA 1G4PA 2QCCA 3FJLA 2P1FA 5LHFA 2C16A 2YZRA 5D30A 3EX6A 4DPPA 3KHJA 1FQ0A 3S5YA 1GVSA 3T44A 1TJPA 1T0OA 3INPA 3TSDA 2ZZ1A 3NQ2A 3S5NA 4CQ9A 3G1FA 3CB8A 3BG5A 3PAJA 3QFEA 4NXKA 3CM4A 4ADTA 1DBTA 2NLIA 3E96A 1WBHA 3LI0A 3FS2A 4AWSA 3BVJA 1W54A 1FXQA 3GXTA 1VRDA 3NNTA 1SFJA 1W8SA 1TQJA 4CQ8A 3WJYA 4GE8A 1GJPA 4R53A 3TW6A 1ZALA 4S2BA 2FQIA 3UPWA 3O8AA 1KBJA 1OF6A 4FX8A 3G1XA 2WNQA 5F1VA 2V2CA 2A2IA 1FCVA 1YPIA 3NR0A 3NPWA 4WXZA 4GUHA 4M6VA 2JK2A 4NZJA 4LTSA 3CEUA 4RKAA 1OX4B 4RXFA 4RLIA 1MSSA 1SU5A 4UMBA 1TCDA 1TRDA 3EWZA 4BF9A 1X1ZA 3HOJA 4BWLA 4LS0A 1XM3A 3LLFA 4NNCA 1ML1A 1XBYA 1X8FA 1LOQA 2V0TA 3TIMA 4LY8A 2H6RA 3G0SA 3P74A 2XN1A 4JTLA 4LV9A 3QPZA 3ZS4A 5FEWA 1W5QA 3S42A 1JUBA 5LNVA 4YXGA 2ZRZA 4HN4A 3VI2A 2HMCA 1RR2A 3B05A 4XZ9A 1FWWA 2J6XA 2PE4A 3E02A 4K6AA 3MW7A 5EA9A 4Z1DA 3HG2A 3LTYA 2A6LA 1EUNA 1F2JA 4O52A 4MZYA 1AW5A 4YL2A 2RKXA 4A2SA 1XKYA 1RZMA 3HG5A 1CX9A 5CSSA 3BW3A 1B3OA 1KV8A 4LWWA 3W7JA 4O1DA 1OK6A 1R2TA 2FFCA 2NUYA 3P5ZA 4HNNA 2QCGA 4IOTA 2W0UA 4OHQA 4AHQA 3BGGA 1T8XA 5TQLA 3BARA 1DHPA 2BWGA 3PS7A 1AL7A 2HSAA 1WV2A 2ZRVA 5AOUA 4HKPA 2R94A 1YXYA 1VLIA 5F2MA 5H91A 2RDTA 2RDWA 3TUUA 3W7KA 2JBMA 4LU0A 4GWEA 4E2BA 5FEPA 4JIPA 3M47A 1TREA 3STCA 1DJQA 4O1CA 4NQ1A 3QMTA 5AN7A 2Q3RA 3W88A 1KBIA 1QFEA 1WDWA 2EAWA 4LV4A 2WOQA 4X22A 2C18A 1KFJA 4WUIA 1JCLA 2GOUA 2NV1A 1KM4A 1EP2A 3PBVA 4FNRA 1H7XA 3NQFA 2RFGA 1ZAHA 1WXJA 3PR2A 3NXFA 1QO2A 4BI7A 5LNUA 3W1MA 2ZRXA 1K7XA 2A7NA 1PIIA 1VPXA 3MP5A 3HGSA 2GPTA 4PL2A 2UV8G 5AYYA 4LRSA 4AAJA 5D2XA 4MY9A 5BMXA 1JCJA 3FKKA 3O63A 2DORA 3TW7A 1TV7A 1FXPA 1U5JA 3STEA 3LCGA 4HSNA 1KM6A 2B7QA 5K4ZA 1I2OA 4UCGA 1WA3A 4WY0A 5C6MA 2C19A 5FEXA 4JYFA 4RZ4A 4LT9A 1H62A 2XN0A 1R30A 2YFNA 4LS1A 4LS2A 4LVDA 1H60A 4UTIA 3W7IA 3LRMA 3M5ZA 3BV4A 4AWTA 1LYXA 5DBTA 1KFKA 3LXCA 5BOOA 4O15A 1LRNA 4GUJA 3LDVA 1TPDA 2X30A 2ATMA 4ZQCA 3L5LA 5FESA 1VH7A 3JRKA 2GVJA 3M5VA 1QPNA 1W5NA 3W7DA 1MEHA 3GKFA 2WV8A 1KLZA 3AJXA 4UIOA 3DFTA 3W1XA 4HPXA 3C2RA 5DCDA 3ATZA 3EKLA 3CC1A 3M5YA 4DF2A 1V7YA 2TPSA 2GJNA 3CWNA 3W2KA 5EYWA 3RLUA 2R91A 3SGUA 3PC0A 2V2HA 3PG9A 1G6CA 1SR9A 4QJ1A 1KM5A 4GUGA 1EWEA 2H8ZA 4KKXA 3T40A 4DELA 5KSWA 1Q45A 1TJRA 4UTHA 1NSJA 1K8YA 1PL9A 1FDZA 3RU6A 4UTKA 1O5KA 5J5DA 5G1TA 4XTIA 3F03K 1WX0A 3P62A 4NXSA 3W86A 4JTGA 4EOUA 1TIMA 1OX6A 4IJBA 5DY2A 4KFNA 3TJLA 3TSBA 3SY5A 4N2YA 4WX2A 3PWAA 1KM2A 4K39A 1KA9F 4P61A 3PB2A 3TNOA 3C56A 1SW3A 5CZSA 1W5OA 4FNQA 4Y8FA 4JY8A 3BK0A 4CNOA 3Q94A 4NZFA 3TSMA 1CW2A 3FOKA 4JTEA 4B5NA 4NJHA 4C1LA 3GAYA 2ZTJA 4MIMA 5D04C 5D05A 4R34A 2Y7EA 2E1DA 4YCPA 3A9IA 3EKZA 4FNUA 3CWOX 5C54A 3G1VA 4XUGA 3LHWA 1IXPA 2HS8A 3F4WA 1Q6RA 3TK7A 4QSHA 3I7QA 3KVKA 1W0MA 3NQ6A 3LV5A 4RX0A 1KM1A 2PURA 2BLEA 4K8HA 5DELA 5IBXA 4ZQNA 1QPRA 3G1DA 4JYEA 1OYAA 2AGKA 4RK8A 4LC6A 2BTMA 4E0CA 4IMDA 5I3HA 3HGJA 4MYAA 4KWWA 1AK5A 3UWYA 3NYZA 1K03A 1NFBA 2ALDA 2I14A 2W79A 1M7OA 3NL3A 2XFWA 3EB2A 4O16A 3UPBA 1Z41A 1EIXA 1XBZA 3HPZA 3S5OA 3L0NA 4H3DA 4N9DA 2ATSA 2Y88A 4U4MA 3TAOA 4E2DA 3MJYA 1O60A 1S5WA 1F74A 3P8IA 3TH6A 2A0NA 2OCZA 2VFEA 4I7WA 3W7PA 3DHDA 1RVGA 3W7LA 5J5RA 1W1ZA 5DCBA 3YPIA 3G18A 5F1UA 1FCQA 1ICSA 3K30A 3G0XA 2B7PA 4LVFA 4EIVA 2OJPA 5I3JA 3VNDA 3GB6A 3NL2A 3THQA 1TPH1 4JDBA 2NWSA 4M6PA 4JR5A 3BLEA 3FEMA 1D9EA 4TR9A 4UNLA 3C2OA 3W07A 4NUWA 5LGXA 1H51A 1F73A 2CW6A 3QW4B 4AHOA 3HBLA 5K9CA 2FLIA 2QDHA 3O6YX 4RR4A 5IM51 2H8XA 3NOEA 2ZQ0A 1LTDA 1ME7A 5T26A 3IIXA 1A5BA 3N9RA 5CKSA 1R47A 2Y61A 2GVGA 4HIBA 3UWUA 4NNAA 3L0GA 2B7NA 1MEIA 1ZAJA 3W1PA 1GG0A 2A4AA 1T96A 3GDRA 4LNYA 1L6WA 1VS1A 1H7OA 3ELFA 4CLMA 3BPWA 1BWKA 1OFEA 1XUZA 4Q4KA 3UZJA 3TJXA 4IGHA 2J88A 1W3TA 5CZTA 5HNRA 1SO3A 1OYBA 3OVPA 2QCMA 2JKPA 2YW4A 3EXSA 1GVOA 4JS3A 2BSLA 3O15A 3QZEA 5U7SA 4A21A 4KFOA 1PS9A 4BFAA 2E6DA 2E77A 1ME8A 1ZENA 4YWIA 3QPYA 5AYXA 4AF0A 3ZWSA 4QAIA 4JN6A 3DFQA 3A5VA 3QEZA 3P7YA 2QCNA 3L5AA 1VCGA 3KOFA 4MY1A 5AC7A 5K9DA 3UXDA 3FA5A 2ISWA 3TXZA 4QISA 1EUAA 4JTFA 1FCBA 1KFBA 1R2SA 5LHEA 3HF3A 2J27A 3OIXA 3NDOA 1WBJA 2Y63A 1VYSX 3B4UA 1EPXA 3BG9A 3LCFA 3G3MA 4PA8A 3A23A 2H90A 1G7UA 2ZTKA 4NX5A 3IV3A 5A5WA 4DO5A 1OABA 5KZMA 4KWVA 1YDOA 2Y89A 3QF0A 4O18A 4MJMA 1EP3A 2QUTA 5K2ZA 3M5XA 3NVTA 1TB3A 1Z44A 5K4XA 1UJPA 3M43A 3MHGA 4DPQA 1UUMA 4LC8A 2QCLA 1O94A 3NG3A 5KTLA 3CLMA 1QOPA 2ZCGA 3I6RA 4HPJA 1FWTA 1TV8A 4M7TA 4JTTA 2ZBTA 3MI3A 4O8RA 5CG7A 4IQLA 1TPFA
chains in the Genus database with same CATH superfamily
2W67A 3HB9A 1XPYA 3L21A 1PWMA 1A47A 3E0IA 1QI5A 1TV5A 2J6VA 1OFAA 4Z17A 2X2GA 5J8LA 3UWQA 4OV9A 3CASA 2JF7A 3UWVA 5AHNA 4BA0A 3S6DA 3T4CA 3GTXA 3W28A 1ALDA 2CZFA 3PF3A 2YYUA 2WHMA 4Q8MA 4P8VA 4QE1A 3W7EA 1VF8A 4QSFA 2BXVA 4C91A 3FNDA 3GXMA 3QHOA 1FUYA 4UCFA 3WD4A 2VC5A 1SSGA 5LA1A 4S39A 5C9WA 3VE9A 4I9JA 4O12A 4WK9A 3WKZA 4MZ8A 1K7EA 2OZ3A 4F0MA 4HK7A 1GWJA 3BGJA 1XXXA 3L7RA 2OG9A 4NRSA 3KBVA 1QNSA 4XBKA 3FCPA 2GJXA 4Y96A 3S1XA 1R9XA 2Y8UA 3OBEA 1A0CA 4F66A 3ME3A 5F2IA 4EXBA 3IGUA 4N02A 5BXTA 1EXBA 5GQBA 3SBFA 2WZTA 4MFDA 5M03A 4O1EA 2UY3A 2W61A 2H9AB 4IIEA 2ANUA 4YS1A 1W37A 5F4WA 5F4XA 3ARPA 1FY6A 4GYFA 2YBUA 2CC0A 1YIXA 3GBDA 1ZJIA 1VQTA 1L6FA 1B3YA 2WNWA 4X3ZA 3NDZA 1W3HA 3UXAA 1SO4A 4WF7A 2EJAA 2BGSA 3GTHA 1XIIA 4FZIA 4JKKA 1G4EA 4GISA 2PDFA 4KPLA 3A24A 1MVYA 4DNHA 4TMBA 5A6BD 3SSZA 4IIDA 2XH7A 1O5XA 3OVQA 1W56A 3HO8A 1WDPA 4JTKA 1SZRA 4FOJA 3LGGA 1MDLA 2WJEA 3F4CA 3UR5A 1UBSA 3F5KA 4KESA 1M03A 2E25A 2XGBA 1VCFA 2VUNA 2TSYA 3PBUA 2CWNA 2ZA3A 3CZJA 4C60A 1LL6A 3LPOA 3NA8A 4IWWA 1R3QA 1VEOA 2VEKA 3SCNA 3V0UA 3HQ1A 3R12A 4K38A 4Q32A 2Y7DA 3W81A 3H21A 3TN6A 3CPUA 1B30A 3T9PA 4S3EA 4NYUA 1NU5A 1DOSA 3RJXA 3SRFA 1A49A 1JCNA 2QCEA 1UR9A 4H6KA 1XLHA 1AL8A 1R2RA 3C8NA 4IMCA 4JN7A 4PUEA 4N4PA 1BTMA 3OOQA 3EOOA 3BL3A 1G9HA 3DKLA 4XZNX 3I3EA 3PFMA 3KVLA 2OWXA 4TTUA 3U3HA 4JTUA 3WFZA 2TAAA 3UYIA 4NVTA 3O6CA 1JUEA 4FO4A 4TX8A 4LJ3A 3N4AA 4FX6M 4RJEA 4AX6A 2V69A 2BY2A 1BQCA 3KOZA 3DUGA 2PEVA 3GDKA 3RN6A 4YVXA 5CSUA 2PRHA 1U1JA 4GVHA 1CXLA 3I4KA 2HNEA 4JBRA 1E0TA 1IQ8A 1K9EA 3H6OA 4MTVA 5M5DA 4L80A 3T0CA 3K4WA 1E56A 4IF2A 2ABAA 5FD0A 3LCXA 1H5VA 3WD1A 4JY9A 4BI6A 3BQ5A 3NAVA 1HP5A 4O0ZA 3A4XA 3RCYA 2CBUA 4OTKA 3N3MA 4NJJA 1I2QA 1SJBA 2FB3A 4D6EA 4PMJA 2GGIA 1KM0A 1TSIA 2XG9A 1IEQA 3H2MA 1IF2A 4RZ5A 4UFJA 5D2WA 2VZUA 4L4PA 1R87A 3H53A 3W2JA 3FYOA 4FEZA 2FVMA 4R5EA 1PHWA 4ZOAA 1B31A 3L4ZA 3WMSA 2ZVIA 3WQ8A 3W3OA 1E9YB 1PWLA 4R27A 1HVXA 1GOOA 4GUIA 4ZZ9A 5ECVA 2OT1A 1W3LA 3W85A 3SQSA 3BJSA 2VFFA 1OX5A 1P48A 3AS2A 1V3LA 1PX3A 4IZGA 4IX2A 2PBOA 1R3YA 3QM3A 4BCEA 3AS1A 3KL5A 2PPGA 4G8TA 1QK2A 3S1VA 4C6BA 4O28A 4RXGA 3QN3A 4RE4A 1C3FA 1OT1A 1JZ5A 5L6UA 1YNYA 2NVCA 4FXJA 5CAKA 2YB4A 3H23A 1WDSA 3TR2A 1ZGDA 3HGRA 4LOCA 2WSYA 4DVOA 5CGMA 4D1JA 1TUFA 2BOGX 4HNVA 4DJDD 1VPQA 4Q4OA 3NOYA 2BZNA 3WMBA 5CC5A 4AF0B 5DXXA 1LP6A 4H83A 4DWSD 1K6AA 1CPUA 4NILA 1TPEA 2FPTA 1I4NA 4HN8A 5CZKA 4Q8VA 3RG6A 3MUXA 4GX9A 2ISVA 4AXNA 1QPOA 5JU6A 1S5VA 1IIGA 3IIOA 3LM7A 4F4RA 4ZL1A 1NJJA 4UC5A 5TD4A 3IJ6A 3R7MA 1CI1A 3NQ7A 5EBUA 2X40A 2Z6JA 3AFBA 3GC5A 4GFSA 4NI8A 2GFTA 1OT2A 3RRXA 1S2WA 1UD6A 3SZ8A 2FH6A 2Z6IA 3ZMRA 1S1RA 3RFAA 1K4GA 1OCBA 3G1YA 3CWHA 5BROA 3QW3A 1FHUA 1P7TA 5DQPA 4H01A 3WFAA 2INEA 3BSGA 1LT7A 1REQB 4X9YA 1FOBA 1THFD 1PV8A 1I45A 4F9JA 1S2UA 4FA3A 3DG6A 1OYCA 3FJ6A 3HPSA 1WZAA 3HQOA 3GH5A 4UXDA 4YTUA 4N9BA 1FCUA 5C0QA 5CZ0A 2J7CA 2OGJA 2GQAA 2ZZ6A 1NELA 1POKA 3O05A 4HA1A 3TQVA 5LKYA 5EPDA 5C2GA 3CQ0A 1P5BA 5D33A 4HP5A 4HNTA 2DEPA 2V63A 5D03A 1SMDA 4NAFA 2AMXA 3GYCA 3G3DA 5F4SA 1J0IA 1VHCA 5BCAA 2IW0A 1RHCA 4HA0A 1F9CA 3W7CA 2PMQA 4FXFA 3WNLA 3TP4A 4FB7A 2DY3A 1XD1A 3CAWA 5CJ5A 1Y8BA 4YYFA 2Y5EA 5J04A 5BWAA 4HNLA 3QHMA 2HBVA 3PANA 1X1OA 4Q8UA 1MUCA 2VD8A 4G56A 2QCDA 4NU7A 5ABTA 4HYWA 4E8CA 3O3RA 2OKTA 1Q7MA 3I6TA 2JALA 2FZ8A 2G96A 4QE5A 1V4YA 2BHYA 3CBWA 1GW9A 3IVTA 1B54A 3VOFA 2RGMA 1PKYA 1TTJA 2A7RA 4JTIA 3UJ2A 1E70M 1SW0A 1W8GA 3BC9A 3WK2A 3H24A 4IXXA 2G4JA 1SR0A 3LX9A 1TV3A 1GTEA 3QKZA 4MYXA 4HZMA 4ZTXA 2LLEA 4ERAA 3WJWA 4PUMA 1XC4A 1Y5WA 2VGGA 3M6YA 3ORWA 3WG6A 5LZLA 2B81A 1ZTVA 3TFCA 2PDHA 2P3ZA 2OZTA 4Z2HA 4GVIA 1RXOB 3QTPA 4HMCA 5CPQA 3EAUA 3UZWA 1TCMA 1EOKA 4K36A 2XFYA 4FLQA 1EC7A 4W88A 3AAMA 1HO4A 2QCHA 3G1SA 4FOKA 3NVDA 4L4LA 4X2PA 2ZZ3A 4F48A 5GJPA 2QS8A 3PJXA 4DBUA 3VD3A 1RD6A 1KNWA 3POCA 3RRAA 3H54A 4ROPA 3N2CA 4S3JA 1QHOA 1C8VA 4DAFA 3KTCA 3JS3A 5B7ZA 4DZIA 1JZ4A 1VFUA 2RHGA 2F9RA 3WLLA 1E55A 1YNPA 3FDKA 1IGWA 1N55A 3CL8A 1QJWA 3PM6A 4P7LA 4GKLA 2CEQA 2WZMA 3FDGA 3MPGA 4GGBA 4U28A 3MB9A 2GJLA 1EHNA 3TC7A 3EXRA 2W5FA 3ZO9A 2GWGA 2WSRA 2GVLA 2QPXA 2FH8A 4JGDA 4C5ZA 3KM8A 4RPQA 1YTKA 2XWEA 4M82A 3NGFA 4LF1A 1LWIA 3LNMA 1GG1A 4UOJA 3S9IA 5JVLA 3GO2A 3MMWA 1CCWB 4QG9A 1QCWA 3NM3A 1JDDA 1NF7A 4O17A 1VAHA 1JNDA 2G5WA 4W7UA 4AD1A 4CNUA 2WSQA 3KE0A 5G1MA 1DIOA 1XICA 5T9CE 1EGMA 1W1PA 4PUUA 1GVFA 2EEXA 4XZLX 4UNKA 5F7UA 3E2RA 7REQB 5AY7A 3AWOA 2Y7GA 1JNEA 1KXTA 3R11A 2P8BA 2PWGA 2NUXA 3VIIA 3CQHA 3O0KA 5K7JA 4MVAA 2QVHA 1UASA 2ZE0A 3F2BA 4IMGA 1X38A 2E1WA 4AC7C 3B04A 4GFIA 2VFIA 1TZZA 1I1XA 3IUIA 3VE7A 2XIBA 1F3XA 4O50A 5FEZA 4JYDA 4DIAA 4XB3A 1SJCA 1G69A 4PTNA 4ZQMA 5I3KA 3VNJA 1LQ2A 4DX3A 2R6OA 2YXOA 1LT8A 4HU3A 1OFQA 4Q33A 3WH7A 1SPQA 4S3FA 1Q6FA 4X2RA 2GSJA 1ZBKA 4O19A 1HKMA 1UA3A 3VMOA 4W85A 4XZHA 5K9XA 2VL4A 1VCVA 3DC8A 5I5RA 3MV11 3OA3A 1KFEA 1C8QA 4KWOA 4R3UA 1A5LC 1VFTA 3OODA 2JGQA 1AH0A 2YDAA 2CNCA 5ENLA 2E9MA 3AMDA 1VB9A 1FWIC 1TPVA 4WZHA 3UF9A 1XLAA 1H1YA 1MYRA 3GXNA 2G37A 2AMGA 3UZZA 2QCDB 3RGTA 1FWGC 1CDGA 1IXNA 4W84A 4CVWA 1H61A 2WJZA 1MQQA 3RK8A 1U33A 3KCLA 3B0PA 3NQMA 3MI6A 1ZHAA 1OK4A 4UB9A 4RE2A 3NQEA 4Z1CA 1LRQA 2EKCA 2WXDM 2XIJA 3GXDA 2NQ5A 1A5SA 3R58A 2PAJA 4QCFA 1XLGA 2Z28A 1NEYA 4DJDC 2HE5A 1KV5A 2R24A 1AW2A 3W87A 5CQ1A 1ADOA 1Q8AA 3L68A 1EDQA 1ZUAX 3VKJA 4B2DD 1DKWA 3AQUA 1P43A 3W2LA 1CLVA 4UFKA 5ABHA 5T9BG 4ADUA 1JD7A 2VEMA 4Y9AA 1X7IA 4NHVA 4IP7A 3VZZA 3HFTA 4LAOA 3A4WA 1A80A 3H7VA 1R3WA 5CSRA 3SUWA 3XISA 2MUCA 3AO0A 4BQ5A 4UMCA 3R8RA 4D1IA 1B9ZA 4W7WA 2PC4A 1YBQA 3EWXA 1OC6A 3W6YA 3R2GA 5A94A 4PR4A 1JR1A 3O0FA 4IMEA 3SRDA 3SR7A 1EYWA 1VBRA 4PMYA 4AZ5A 3RJYA 2I56A 1QNRA 2EXOA 3VABA 4DNMA 2Y8VA 3U9IA 3MWAA 1V79A 1XLJA 3IVUA 3XIMA 1W3NA 4LW7A 4MJZA 3GFZA 4UTJA 3H2FA 2IPGA 3DENA 4NZ1A 4S1FA 2ACQA 4HA4A 3MQTA 4X0NA 2GGHA 2V3DA 5CPTA 4GUFA 1RUSA 2KZHA 4UTUA 2OQYA 3STGA 3LPFA 1QW8A 2XISA 1XCFA 5BU6A 2V30A 3G1AA 2C1HA 1UZ1A 2CZVA 4IL2A 1UROA 4O4WA 1ZP4A 1DJZA 2QIIA 4K8EA 1H1ZA 3T8LA 3VOCA 4LCSA 4AHPA 1H4PA 3UR2A 1LM1A 5LNRA 5E1QA 5AC8A 5KEZA 3W76A 3DFPA 3CU2A 2J25A 1YXCA 1NVMA 3ZOAA 2BVWA 1GJWA 1UMYA 1L2QA 3GVGA 1IEXA 2I7GA 4HOXA 4EPEC 3FA3A 2WQDA 4U3AA 5CSYA 3D3AA 3SJ3A 3BLIA 3FN9A 2FJKA 2P88A 2VGIA 2BGNE 1E71M 4LPCA 1IIHA 1KTCA 1XDMA 1CLKA 1RQEA 3VGFA 3W73A 1HJVA 4GY7A 3U2EA 2ZUUA 1TE6A 4CQBA 2XVPA 2P0OA 2FYMA 3BE7A 3ABRA 3B4YA 3HIJA 1R3TA 2VEIA 1W3IA 1ITXA 3OHIA 1U2YA 2FZBA 4IMAA 2O55A 3CL6A 4HPGA 3TX9A 3VIPA 3L65A 1VFSA 3VILA 1C7TA 1UPMB 1T6MA 3W74A 3AIEA 4M1RA 1FDJA 1BWVA 1VZWA 5MKGB 3DYOA 1K9TA 3OLDA 3HJEA 2XDFA 3IJQA 3SJNA 4H7VA 4TVCA 2YPIA 1PTDA 2EPNA 5FOOA 1MEWA 2Q8XA 1PSCA 3UQNA 3LHYA 3LM3A 3VIMA 5A8QA 1UWQA 1VJIA 3MCOA 4B5VA 1WNOA 2ESCA 3ONCA 3N6JA 2YIHA 4GO8A 2HZGA 3CZKA 1AQFA 3W25A 4QQUA 4MLJA 3GDLA 2IXVA 4ICCX 1BPLB 1CECA 4DJFC 2HISA 3O7UA 1A5CA 4XZIA 1VYPX 3SEPA 3O06A 5I0DA 3UXLA 4HCHA 5LXXA 3O9NA 3H55A 1SFLA 4W8LA 1J0JA 4OJYA 2Y5SA 3N2XA 1OC7A 2DT3A 3PPHA 4WDXA 1I8JA 1BRLA 1S46A 3GR8A 2J9XA 3KUMA 2ISFA 2CZ5A 1OX4A 3NGJA 3URQA 5L9FA 3OG3A 5TNVA 1LF1A 2V5BA 3S5ZA 2DZWA 1L2UA 2PSNA 2CKSA 2BXYA 3W83A 3B9NA 3M41A 1JCXA 2VEPA 3RDKA 2EPKX 1P0NA 1HO1A 4B91A 2QNEA 2PGRA 4PYSA 2GDUA 4UTWA 1R5YA 1UB3A 3QH2A 1MUWA 1DXFA 2DUAA 3GNDA 1EXPA 4PL1A 3KHDA 3HG4A 1W5MA 4FF7A 6XIAA 3TC6A 2CU0A 2V2DA 1QR7A 3PTDA 1AJZA 4NJIA 5HANA 3V35A 3OEXA 3CMGA 1YYAA 3C3NA 4Q6JA 4IMFA 4NRRA 3TYAA 3SUSA 3M7WA 4ZGYA 1H7RA 1JG9A 3BMVA 1G4PA 2F61A 3FJLA 3UESA 3SQMA 2YZRA 1XYMA 3E3HA 3EX6A 4UOZA 4DPPA 1XG4A 4FR6A 1T0OA 3INPA 4BF5A 4CQ9A 1PDYA 3QFEA 4ADTA 3A13A 4JTDA 4AWSA 3TYUA 4S3CA 4JCLA 1W54A 3USZA 4A35A 1TQJA 1M01A 4CQ8A 3WJYA 4H9TA 1MDRA 1ISWA 4JN8A 3G1XA 4CU8A 4IJCA 2A2IA 3NR0A 1GKQA 3NPWA 1HXJA 1MXDA 1K1DA 4QAWA 4J3WA 3ZSTA 4HOWA 1WZMA 1CIUA 3EWZA 1WB0A 4BWLA 5I77A 1XM3A 1ML1A 2PU1A 3R10A 4GQBA 5AC4A 3TIMA 1V6UA 3G0SA 4JTLA 2XN1A 3H4XA 4Z2GA 3ZS4A 1E6NA 5FEWA 4TOQA 1W5QA 5GJNA 1JUBA 1W6TA 2VCCA 3IUDA 2Q6ZA 5HAOA 3W26A 4XZ9A 3T0AA 2YA2A 4K6AA 4PUKA 4KETA 4KWUA 5I24A 3S5SA 2A6LA 3PZQA 1H1NA 1BTCA 1AW5A 2FGLA 5LXEA 2MANA 4A2SA 4RNFA 1RZMA 1RBLA 3Q45A 4X0VA 3GC4A 1RH9A 3K2GA 1OK6A 2HQAA 4HNNA 4Q4PA 3AIRA 4IOTA 4NZ4A 4OHQA 4AHQA 4DJEA 2IKGA 3OBAA 1GOWA 5PTDA 2BV9A 2BWGA 2HSAA 5FL1A 5I7GA 1QU4A 1XD0A 2ZRVA 1XGDA 2R94A 1VLIA 3C86A 1UP2A 2EJ1A 2BASA 4ML4A 4AIOA 1FKXA 1TREA 1WUEA 1EBGA 2BBFA 2IMRA 1ZBCA 4PBGA 2Q3RA 3W88A 1KBIA 1ZPTA 3V5OA 3N9KA 1O6IA 4WUIA 2NV1A 1KR1A 4BQ2A 2CESA 1XDJA 3NQFA 2O9OA 2D1ZA 3AYTA 3RPTA 1L8PA 3MP5A 5LIWX 1IYXA 2VQUA 1QASA 4MY9A 5BMXA 1W2VA 3O63A 2DORA 1FXPA 1V93A 4QGCA 4HSNA 3DIPA 2EG8A 3UFYA 1QW9A 1HP4A 4JYFA 3TYEA 3ZT5A 1TJ1A 1R30A 2YFNA 1JYXA 3ZYZA 2QDDA 3CTTA 4JQ4A 2GK1B 3W7IA 1UC4A 1LG1A 3B8WA 3M5ZA 2YJQA 3B0YA 2W9MA 1XLMA 2J7FA 4JKMA 4O15A 4GUJA 4U5KA 1JCTA 2VCAA 2JEPA 3VVGA 3IJ9A 1VFLA 1UR3M 1XSKA 3M5VA 3GKFA 4X63A 3COTA 4V2XA 1KLZA 2FTYA 3DFTA 4G9PA 1ISZA 4S3KA 3ATZA 3QXBA 4DF2A 1XKJA 2CXEA 1FH7A 1V7YA 2TPSA 3W2KA 3RLUA 2V2HA 2EQDA 4QJ1A 4GGHA 1EWEA 2H8ZA 4KKXA 4C7GA 4M0XA 3R79A 1HN1A 1TIWA 1PL9A 3AOFA 3RU6A 1XSJA 5M17A 4J3VA 2X09A 3WENA 2WC7A 1WX0A 1CXKA 4NXSA 3W86A 4GI8A 3SUUA 3H2CA 1JD9A 3K46A 4N2YA 3PWAA 1XQKA 2XM1A 1KA9F 5HA7A 1RY0A 4C90A 3VINA 5CZSA 3G1RA 3RM4A 1W5OA 4FNQA 5CCZA 1EA9C 3SCWA 4MWAE 1G5AA 1DWIM 1UJQA 3Q94A 3SDOA 4YHEA 1XLBA 2PP3A 3PZGA 4LH8A 5D05A 9CGTA 4R34A 3ZR5A 1M3UA 4URIA 3EZ4A 4K1WA 5C54A 3LHWA 4Q3MA 4OIFA 5AECA 2HS8A 5CXPA 3F4WA 2QV4A 2YL8A 4XZBA 3KVKA 4RX0A 3TN3A 1ZP3A 2PURA 1DHKA 4HMDA 4Q7NA 2BLEA 5REQB 4ZQNA 5T91A 1GKRA 3NZQA 4E0CA 8A3HA 3HGJA 4LUSB 4C6LA 1NFBA 2ALDA 4R9OA 2WZEA 2I14A 1RALA 2VX5A 3DHUA 1DWFM 4HK5A 1XYLA 3UPBA 3LZ5A 4LUSA 1QXLA 1XBZA 3S5OA 3BMXA 1TV2A 2V5KA 3KOYA 4U4MA 3TAOA 3DDMA 4E2DA 1S5WA 3L4UA 2GGJA 6REQB 1XFCA 3TH6A 3NIYA 3FVMA 1J79A 2CETA 1O12A 3W7PA 3DHDA 4Y2WA 3W7LA 3CB3A 5DCBA 1FCQA 4YN5A 5E9AA 1DE6A 4ACYA 1Q66A 3VNDA 3THQA 4JDBA 3T2QA 4GZ7A 4M6PA 1D9EA 3W07A 1QT1A 4NUWA 5LGXA 4LX4A 3L12A 5K9CA 2YZ5A 3WQOA 4KBXA 2E9LA 3O6YX 3V5CA 3NOEA 1V6VA 3T2OA 5A6BA 3VA8A 5T26A 4GABA 3IIXA 3N9RA 5CKSA 1R47A 2VDIA 5ABEA 2GVGA 4NNAA 3L0GA 1Z3NA 1Q7ZA 4LNYA 4E2OA 4DWSB 4HA3A 1PZ2A 2DVTA 4AW7A 2DT2A 4PUNA 4Q4KA 5D9OA 3TJXA 2J88A 1W3TA 5CZTA 1SO3A 2WYSA 2YW4A 3N13A 2BSLA 1BXBA 4BEUA 4RUBA 4KCTA 1HNYA 4JCMA 3I4EA 3CUIA 3QPYA 2VC9A 4AF0A 1Q6CA 3ZWSA 4H19A 4JN6A 1AH4A 3HFYA 4KEVA 3P7YA 3CHFA 1CXIA 2DVXA 3V1HA 5K9DA 2EG7A 1VIZA 2V3FA 1EO5A 2ZC1A 1KKRA 3WELA 3N11A 3PZUA 1FCBA 1F07A 1TX2A 3R0UA 2ZICA 2E4TA 4XK2A 3TVAA 3BG9A 5A3HA 2P5NA 3IS4A 4H8VA 3KLLA 3L2MA 4C6QA 1TJ0A 4AZIA 4K3ZA 4HNCA 1HGWA 2Z1SA 2ZTKA 4C6OA 4CGTA 3PN8A 1T8QA 4OKDA 4JL1A 1P6WA 1EP3A 2QT3A 3SAZA 1Z44A 1D7KA 1E0WA 4DPQA 1UUMA 4AG0A 1O94A 5KTLA 1QOPA 4PMRA 2DH3A 1TV8A 3BUVA 3U4FA 3MI3A 3DX5A 5CJMA 4OBSA 1FWAC 1CT5A 3ZQ9A 3QYQA 5JMUA 4J40A 3VNIA 1E72M 1D3HA 2Q02A 1JDAA 3LI1A 1PVNA 4IQJA 1E6PA 1IEWA 2W63A 4DQWA 1FHLA 2H3BA 2D22A 4AMAA 4GACA 4BZYA 3QY8A 2J7GA 2UZ9A 4B5UA 1BVWA 2QJIA 1PIGA 3LU2A 5EMUA 4Y9OA 2VXNA 3ITVA 1KXHA 5BOEA 3N1AA 3P84A 3M0ZA 2OFJA 3RMJA 1XIHA 4QG8A 4IFOA 5D32A 3U5UA 4GD0A 3IACA 1JPHA 4Z1YA 1EPVA 3W7RA 4F0LA 4C1NB 4H4IA 2OO0A 4LBUA 4IPJA 4QITA 4J2PA 4JNYA 1R3SA 3GLCA 3UJSA 4O10A 3LK6A 2Z1XA 2VC6A 2G95A 2PDYA 2FZMA 2XIQA 4C6KA 4NAEB 2FHFA 5BXSA 5TIMA 3ANUA 4U3CA 3E0WA 3K5XA 3VO0A 4PULA 1JGIA 2BFGA 4ML9A 1UYQA 4PN2A 4UR7A 5AHLA 5LNWA 5DCEA 1UCWA 2AKZA 2PDKA 2O9TA 3H7UA 4OFCA 2PDMA 3UCQA 3WIJA 3IVSA 1BHGA 3B9OA 1EJ7L 2WMJA 3LHVA 1ENUA 2OOGA 3J7HA 4O13A 3UY8A 2VDGA 3PSVA 2FIQA 1OINA 4F8XA 1LOSA 3A3XA 3MUZ1 2XGIA 4YJ5A 2QEZA 4QS6A 1QO5A 1J0ZA 3C2EA 2PGFA 4ENLA 5I06A 4U5IA 4JIHA 4O1FA 4F0KA 2NQ9A 4GJJA 3KS6A 1IT8A 5LIYX 2C8NA 3TV8A 4GYKA 3T05A 3VIKA 4B92A 3PUGA 1RY8A 1I1WA 4Q8WA 4AVFA 3LQGA 1ADDA 4JTHA 2GVEA 3DHFA 1CTNA 3EGJA 4PSRA 4AZ7A 4XAPA 4ACZA 4ZTYA 3CT7A 2W27A 3HQNA 3KOWA 1N7KA 1JZ2A 1YQ2A 4KCVA 3EX1A 3R8GA 3C6CA 4I7VA 4RV8A 4ZFCA 5AC5A 3WQPA 4KF1A 2IKIA 1JCYA 2D3LA 4KWSA 1ZRQA 2BS9A 4AH7A 5LGZA 4IXHA 4HU0A 3PUOA 4XWUA 3SI9A 3SCQA 2H3DA 4IIBA 3V5FA 3T0DA 4FIRA 1RQBA 3O6DA 3W70A 3U0HA 3AIWA 5D4YA 2I16A 1U5VA 4DBSA 1WOBA 1UKTA 2VWTA 3QGAC 2WSPA 3BAYA 3LCLA 3GDMA 3N2TA 1M65A 4JL2A 3GNOA 1YDNA 3N14A 1ELSA 1YX1A 4KT2A 4JQ1A 1NM9A 1PB0A 2VEGA 3OPSA 3QKEA 2IQTA 3BW4A 3GHRA 1XBVA 4L5ZA 2C79A 2E68A 2PWVA 1RLDA 3QOMA 2PDJA 4W86A 2WHLA 5DY3A 2PU0A 3U57A 3CIXA 5HJYA 3SUTA 3DYPA 1Q6DA 1B5TA 3QMRA 4GK8A 2CLFA 3OGVA 4H7ZA 4DJFD 2HNHA 3L4TA 1O1ZA 1UG6A 1JEZA 3R5EA 1XIBA 1OEPA 4KFPA 4BR1A 4B5XA 5B7YA 4UTMA 4JD4A 4HJFA 3V0TA 5HINA 1VBGA 1CWYA 1KB3A 1H7WA 3L9CA 4DLMA 2DZTA 4N9CA 4N7QA 4HNUA 4AWUA 1K4HA 4HPHA 4D6CA 5CGTA 2D3NA 1J2WA 2YA0A 3GIPA 4ATLA 5GNYA 3UYCA 3W72A 1GW1A 4IFKA 3URNA 3QLDA 1MNSA 2AAMA 1LZOA 1UKSA 4C6PA 2A3LA 3GHTA 1BGAA 2OLAA 1HKWA 2ZRYA 3W1LA 1GVQA 3RCMA 3TYZA 4WCJA 4P5UA 4P8WA 4O1AA 2C15A 4YVVA 4MNMA 1VENA 2ZZ2A 2ACRA 1WXZA 3HA1A 4GYPA 4WY0F 1G4TA 4CCZA 3MO4A 4E4FA 1OFBA 1X6LA 3TTQA 3H4WA 1GVYA 3WZ0E 3ITGA 3N4EA 4KEZA 3CNYA 1V6XA 4JDYA 2F8QA 5EFFA 2XVNA 4OOUA 5A2CA 3WLQA 5EMLA 3TCEA 2XJ7A 3V75A 2GDVA 2IQ0A 3NZGA 3UEQA 4RCXA 3DG3A 3MKCA 3TN4A 1Z48A 4O14A 3E0VA 5HNTA 1UR4A 1NF0A 1S2CA 4BS0A 3RPDA 5JH2A 3N9SA 1DWAM 3UETA 3W9ZA 1S3TC 2OZ8A 3C8FA 3BAKA 1WYIA 2AQWA 4J28A 3W84A 4ZSUA 3CUGA 1MQRA 3VDCA 1Q85A 2D2HA 1ZZMA 5D9NA 1SW7A 1P0BA 2TODA 1NH6A 3UERA 2OX1A 3AU2A 4MNJA 2CFFA 4BI5A 1AVAA 3T55A 4IM4A 1TWWA 4KH2A 2V67A 3PTMA 4KW2A 3GNXA 1UWUA 4HHPA 1YADA 1W1B1 4GJIA 4E6MA 3U4AA 3AXXA 2ZUNA 1HJXA 2IKHA 1UMLA 5I3FA 3WEOA 4DJDA 4HMNA 5HBFA 2DPEA 2DDXA 2BVYA 4PUJA 1XYAA 3TMLA 5CBIA 3G24A 2GJPA 3TN5A 2Q8LA 1R7AA 3HN3A 1KQYA 4PCFA 1ZCOA 4O0KA 4M5PA 3URBA 4FALA 4JHMA 5IFTA 3MYOA 1EC8A 1ZFJA 3APGA 1DJYA 3HV9A 2DUXA 2GZXA 3AXHA 3W7MA 2XN2A 3VKBA 4M8UA 4ZB0A 1A3HA 5HK4A 4H41A 4NKCA 5EL1A 1UA7A 3PJUA 4EXQA 1SO5A 4AD2A 2EKGA 1A5UA 1CEOA 3AMCA 5CPSA 3FGCB 2GWNA 2CYGA 1O1HA 3OQ8A 4TTGA 3K8MA 3WLTA 1FKWA 3IIPA 4A3RA 4DO6A 3C52A 4Q7BA 1BXNA 4DLFA 1BFNA 3KRUA 5HMSA 2PFHA 3TZFA 5AB3A 3TOYA 4G7EB 1EGVA 3VZXA 2ZXBA 1G4SA 2CXGA 4GIEA 2CLMA 3GW0A 4Z1BA 3WH5A 2MNRA 3TA6A 3UZ5A 4HB7A 4L65A 1XLLA 4Z0JA 3OLIA 2VFHA 4DXKA 2BVTA 3CHCA 2WVVB 1LUCB 2FPVA 3ZVIA 5EMMA 4KMQA 3PTQA 2DW6A 1TMHA 2V82A 4WXYA 4WVXA 2PDGA 2A6NA 4ZQOA 1RBAA 3V1PA 5G4EA 3O16A 1JZ3A 1MRAA 2QJJA 3NEHA 2PTZA 4R33A 2YXXA 2DZUA 3PTKA 4JFTA 1JL8A 1EJVC 3UG4A 5G5IA 1OC5A 2J66A 1C90A 4XKYB 3QC0A 4WJ8A 6TIMA 2RH9A 3NUKA 4NASA 5REQA 2WWCA 1EWDA 3O6AA 4D8AA 2Z2AA 4AY7A 1N8IA 3TFXA 2QUNA 1O4UA 4E5TA 1J6PA 3NCOA 3ES8A 4O0QA 3KCOA 3W23A 2PWDA 3GYEA 2XTKA 3R13A 2YGYA 2O9RA 3EWBX 2OMAA 3KX6A 4PTMA 3VNZA 3N29A 3LYEA 2V9DA 4H1ZA 1R7OA 2VR2A 4D9PA 3RIKA 4O54A 3KZSA 4PMXA 4ZR8A 4DF1A 3W1RA 1E0XA 4A2RA 5D9PA 3DH7A 1MFUA 3T1GA 1VFOA 1SO6A 3T2PA 3IK2A 2C13A 2CWXA 1OJXA 3RF9A 4YTRA 1AMKA 2ZRUA 5HDRA 1ITCA 1F4HA 1HZYA 3Q2DA 3UCDA 4IFRA 2OWCA 3HMJG 3V16A 1P4CA 4CD8A 4MLRA 4MDOA 3VNYA 1YPXA 3IIVA 4PTDA 4WY0B 4XO6A 2AL1A 5CPNA 1NOUA 3N73A 1YXDA 2NV2A 1Q2RA 2C14A 3MCMA 1XLEA 3WNKA 1F3TA 3ZLFA 3CTLA 4MG4A 3AHZA 5DT5A 3TWBA 3ABQA 4W89A 4AZBA 4ZA0A 3W7NA 2CBVA 3MHUA 2OSYA 4ZVJA 3OBKA 4LUJA 3W1AA 2WANA 4TV5A 1AJ2A 2FZDA 4FPSA 4YTTA 3IGSA 4GZJA 4XBJA 2QCFA 4GVFA 2P53A 3B9DA 3M1ZA 2V5LA 4UFHA 1JF5A 4AD3A 2W92A 3VOHA 2E5DA 4DB7A 4JNMA 3LS9A 1D3CA 3PZTA 4KCWA 3VIFA 3B8IA 2WK2A 2E28A 4Z2JA 1UWAA 1UQYA 1GEQA 4TX9A 3NQVA 2L5HA 2INZA 5C9RA 1KRMA 2UY2A 1J2BA 3ARTA 1J11A 4W8BA 3PZOA 3RILA 1LL7A 5HQEA 3TYCA 1JGMA 3P8JA 3W2NA 5G2WA 3CO4A 3TQKA 6ALDA 1RD5A 4S2CA 3B9AA 1AUSL 3P82A 3WQ5A 3LHZA 3FYPA 1KGXA 3RM9A 3AIBA 4IPLA 3B0UX 1DJGA 3WL0A 2XZ7A 1C93A 2XFRA 4XD3A 4IPPA 1CZ1A 3GS6A 4X60A 1VGAA 1Y0EA 3QMSA 3WF4A 1UC5A 1BF6A 1N82A 3K1GA 4TXEA 1LLZA 2E5CA 1R8LA 1L6GA 3DCPA 3FXGA 2Y70A 3WJXA 3UZYA 3UNDA 2ZUVA 4PBEA 1EQCA 2P10A 3ITLA 4OE7A 1A53A 5HATA 4XG1A 2FJUB 2HK1A 1Q6LA 2VDHA 3GUGA 4I5UA 1BSIA 1MWOA 3DBPA 4LALA 2PLMA 1AZ1A 3OGSA 1S5NA 3CMFA 3PSWA 3SY8A 4C6FA 9XIMA 3JZEA 1XWYA 1OFPA 3LPGA 1F8IA 4JEQA 5E09A 4GY1A 1XQLA 4MKVA 2EPHA 1XLCA 5IHSA 2O4QA 4UFIA 2Q3OA 1TQXA 2ZA1A 5CBBA 3UA3A 4MOZA 1NQ6A 2ZA2A 3EB4A 4IUOA 2Y85A 1H5YA 2WCGA 3TJ4A 2ZZ4A 1Q13A 1UHVA 3EOSA 2CCRA 3A4AA 2PWHA 2OQLA 4E38A 3OLEA 1WDQA 3MUY1 3GDTA 5DFAA 4QXIA 4GI6A 3GZ3A 2IKJA 4OBTA 1VYRA 4GINA 3TCSA 4YTSA 1KRCC 1QK0A 3LB0A 2GLKA 1JDEA 4OU1A 3S8HA 4UUIA 4AEEA 5C8BB 1LWJA 2XSXA 2YR1A 3BOLA 4DZHA 4AD4A 3DFSA 2CKRA 4CCDA 4M80A 5FF7A 3N6HA 4PMVA 1WXYA 1TG7A 3GX9A 1P1MA 2VUYA 2ZXDA 1W9XA 5A2AA 3P5YA 3AXIA 1V7AA 1KQZA 3NJ3A 3ERPA 4YTQA 2DZPA 1TVPA 5F2GA 3EEGA 4HZ6A 1DWJM 4OGZA 3ES7A 3EMCA 1PDZA 3R89A 3T7VA 4GBUA 2NQJA 3LXAA 3EEZA 3BLDA 4UWMA 5IHRA 2E6YA 2C0AA 4LQ1A 3CH0A 1J0HA 1YEYA 2Y2WA 4AXKA 2Y4SA 4R7OA 1RCQA 2ZUMA 3DGBA 3JVAA 4NY2A 4L4MA 4PSPA 1VRXA 4AVNA 5DMNA 1C8XA 4KCUA 2DVUA 2PP1A 1TX0A 3F4NA 2E09A 3NSMA 4C6CA 3M7SA 2GQ8A 2F2HA 2R8WA 1OY0A 3G1HA 4FLSA 1Q63A 4IX0A 1EJRC 1RAKA 5RUBA 1Q3NA 4S3DA 1KR0A 3E2SA 3OJGA 2FTPA 3GU1A 2TYSA 3KFTA 1W32A 1E6ZA 1LBLA 4FR1A 1F76A 2X1UA 1QWGA 4P8XA 3TQ0A 1UP3A 4BQ3A 3L4VA 1EDGA 4QIUA 2GDQA 1ZCCA 1X6UA 3UWEA 3AXMA 1YW1A 5D09A 4EK7A 3KLKA 1EF3A 4XAYA 3WQ4A 4PB4A 2NXIA 3W7HA 1W3JA 1GHSA 2BX7A 3CAKA 4AFYA 3QYSA 2FMOA 4TO8A 1WZKA 3G22A 5DN1A 2J13A 1BKHA 3LGEA 3EMZA 5HR7A 5GVJA 3VUPA 2FDMA 3AHYA 3R6IA 3EYPA 3Q65A 3QVQA 3RMEA 5JQ9A 1TRIA 2Z24A 3MC5A 3WK1A 1AZ2A 2ASHA 1L8NA 2VZSA 1NAL1 4GIAA 4ORMA 1Q4NX 3ZIZA 3NXLA 4D6GA 4BY3A 1EH9A 3SCUA 1AG1O 3UA4A 3CZ8A 1M5WA 1B4KA 4MKNA 3BLLA 4ZQRA 1B3WA 1H09A 4HHLA 4GC3A 3NM1A 2FDSA 3RHGA 2DU2A 4JZ5A 2GYIA 1BYBA 1HJSA 3GE7A 4Q8QA 1SQ7A 1R85A 2F6XA 3N12A 2OODA 3OHMB 3GY1A 3KRBA 2PB1A 2QV5A 1HUVA 1SMAA 3LTPA 3HURA 2OT0A 1DL3A 3AIVA 1XL9A 1RCXB 1SSDA 3BAJA 4JFSA 2P50A 2ONEA 3ARVA 1LL4A 4H7CA 1XG3A 4AB4A 4IPIA 2QHAA 2C1IA 3P0XA 4L7ZA 1WOAA 2SFPA 3N2MA 4R7WA 4C5YA 4O8AA 5KINA 1WE5A 2O7QA 3R94A 2VNCA 4W9TA 3RPMA 5LHFA 2VZVA 1QOXA 3KHJA 4Q8TA 3B0XA 4AEFA 1AQ0A 1KGUA 1GVSA 3T44A 1A0EA 3TWAA 3APYA 4DUVA 1IWBA 3GNRA 3NQ2A 1ZSXA 1GQJA 3S5NA 3A47A 1EZ2A 2GUBA 3G1FA 3CB8A 3PAJA 5D9MA 4QJ4B 3WDJA 3CM4A 3SN4A 3LI0A 2GOKA 4GG9A 1FXQA 4CN6A 3NNTA 4HCDA 3GUWA 5HNUA 4GE8A 4R53A 4XAZA 3TW6A 1H41A 1H49A 4MWAD 4FX8A 3IK4A 2V2CA 4WXZA 4GUHA 2JK2A 4NZJA 3CEUA 4RKAA 1OX4B 4RXFA 3W02A 3BJFA 1TCDA 2PD9A 4BF9A 4XVDA 5LIKX 1X1ZA 1V6TA 3LLFA 1MNZA 2EO7A 4YHGA 5DRIA 3GHUA 2V0TA 5EU9A 2YL9A 1B3VA 2OEJA 8XIAA 2P76A 5FSDC 2KAUC 4IGMA 4MM1A 3WY1A 3C5QA 4PMDA 3ZXWA 8XIMA 5JUVA 2IPWA 1RLCL 2C71A 3LMYA 3TTOA 3PBMA 3GU9A 1YE4A 2R1NA 2DIKA 3ZJ7A 1EUNA 4HHHA 1U1UA 1PPIA 1XF0A 4G1NA 4PTXA 1XKYA 1MW0A 1CX9A 5CSSA 4RV3A 4LWWA 5C71A 2FFCA 2WHJA 1Z32X 1M7XA 2EPOA 4UZSA 2W0UA 3IPWA 4DO7A 2VWSA 2ZVRA 1GORA 3HPAA 3GHSA 3HU7A 1BSLA 3FYYA 1YXYA 5FJPA 3ARRA 1W1YA 4AIUA 1DXIA 3TUUA 1V0MA 4GMEA 4ZO8A 7PTDA 2BMBA 5A8PA 2YBVA 4E2BA 1OZMA 4UR9A 2J4GA 4MGGA 3WH8A 4O1CA 4NQ1A 4DWDA 4HVXA 1KRAC 1QFEA 7ODCA 2WKLA 4LV4A 1ADSA 2WOQA 4GIYA 2VHLA 4I6KA 4QLKA 2GJRA 3ZJKA 1EP2A 3FJNA 3VC6A 3PBVA 1O68A 1UZ4A 1H7XA 1WXJA 2QIWA 3PR2A 4GH3A 4BI7A 4U10A 3K4AA 1K7XA 1Z89A 4K1GA 1VPXA 4I8DA 3EPNA 2WJFA 1V6YA 3W53A 3QR0A 5D2XA 3L2LA 2CHRA 5FIPA 3FKKA 3H22A 3TW7A 2YCLA 1S38A 3LCGA 1E3XA 3V7PA 4W87A 1KD0A 3GG7A 1I2OA 4UCGA 1WA3A 2VCBA 3U5YA 4DRSA 2PDXA 5C6MA 3QGKC 3CYVA 3MMUA 3WLIA 1G0CA 4QE4A 4LS1A 4LS2A 1OB0A 3IARA 1MZRA 1H60A 3TLQA 2HPIA 3LRMA 3VOIA 3FVDA 3SCTA 3LZ3A 4ZOBA 4CN1A 1LYXA 5DBTA 1KFKA 3ABZA 1I9CB 3OZYA 2X30A 2ATMA 4ZQCA 4AISA 5A6JA 3L5LA 5FESA 5HPOA 1J6OA 3KTSA 4KQNA 4UQBA 2R9RA 2F2KA 2POTA 2GVJA 2OLSA 1W5NA 2PP0A 3QPEA 1ITQA 3W1XA 4GKTA 4HPXA 1Q8JA 5DCDA 3M5YA 4AD0A 1E6QM 1YDYA 5AZ1A 2PLJA 1KM5A 3T40A 2O9PA 1Q45A 4UTHA 4UQDA 1J0YA 4UTKA 5J5DA 4XTIA 4QCEA 1HKKA 4ZE5A 1BD0A 3OB8A 1NIUA 3BAWA 4JTGA 5EMKA 8RUCA 4JFWA 1OX6A 3VK5A 1CENA 1WPCA 1JAKA 1NDVA 4KFNA 3TSBA 3I10A 3RO6A 3SY5A 3OYXA 4MJ4A 4P61A 3PB2A 3LENA 4MPKA 2AQVA 4A3QA 4N0RA 2I57A 4JPGA 4Y8FA 4JY8A 3AHVA 4CNOA 2OXNA 1RBOB 3VYLA 3BZGA 3BAXA 2J77A 1WKDA 4MDPA 5M1TA 1UOKA 2E1DA 1OCNA 3EKZA 4ZEPA 2DT0A 2BGQA 3V4BA 3UP8A 1V3KA 4C6EA 3AIQA 2AAAA 4KS0A 3TK7A 4QSHA 2WC3A 3QGVA 2EPMX 1JI2A 1WKEA 3I7QA 3TQPA 3LV5A 1NFGA 5CC3A 4K8HA 5DELA 3G1DA 4J2MA 4RK8A 3FXYA 4ILSA 4HOZA 3VKAA 1TUXA 1AK5A 4KRTA 4M81A 4DN1A 1K03A 1EJTC 4P7NA 2RDXA 1NTHA 1OIMA 1AMYA 1M7OA 4K8GA 4ZXLA 1EIXA 3L0NA 2YA1A 4H3DA 4N9DA 2ATSA 1XYBA 3FSUA 3UW6A 4MB4A 2GJXB 4KIEA 2JFEX 1F74A 1GEHA 2A0NA 4JFVA 2OCZA 2VFEA 1J93A 1YMYA 4FI4A 1E9ZB 2Y1HA 3G18A 5F1UA 3MU7A 4Z2IA 2B7PA 4LVFA 2OJPA 5HNNA 5LIUX 1AH3A 3AHTA 3VD7A 2DIEA 3VNLA 1I0DA 1W91A 1RK6A 2E40A 1GNXA 2IS7A 1Q6EA 1WDRA 1PO9A 1H51A 1F73A 3QW4B 1TWSA 4AHOA 3HBLA 2RUSA 1M04A 1XR2A 2QDHA 5HJXA 5IM51 2ZQ0A 3GXIA 1PKNA 2BP1A 1W9BM 3QZ6A 5I07A 3VGEA 1E4LA 3EDFA 4CNTA 1GG0A 2XIOA 3S2MA 3GDRA 3UCCA 1XYCA 1H7OA 3ELFA 1ZL1A 3BPWA 1E1FA 1XUZA 2RGLA 4KEUA 3REQB 2PDUA 4QX4A 4IGHA 3H8AA 1XLIA 1E3ZA 3OVPA 2QCMA 2JKPA 3EXSA 1GVOA 5CLTA 4A21A 3D47A 4MNLA 3SCRA 1QTWA 1CGUA 2E77A 1ME8A 1ZENA 2FHBA 3QZAA 3CGTA 3EKGA 2ZOXA 4QAIA 3ARZA 5AVNA 3STPA 4EP8C 2WBKA 4QLLA 3K8KA 4MY1A 2ICSA 1FA2A 5AC7A 3UXDA 3FA5A 1EO7A 4QP0A 1E6SM 3FHAA 4H04A 2PBGA 3NO3A 1X1NA 3KBSA 3TXZA 4JTFA 4MMWA 1GGOA 2J27A 1WBJA 1GQLA 1VYSX 3B4UA 3M0XA 2X42A 2Y8KA 3G3MA 4PA8A 4I3GA 5A6MA 3CV1A 3SN0A 3E38A 4WIWA 5FKYA 1OCJA 1G7UA 2XPKA 1VFMA 3WLSA 1OABA 1YDOA 3S2CA 4MJMA 2QUTA 3SRHA 1NWUA 1TB3A 5K4XA 4OZOA 2X0YA 4IPNB 2PDPA 3CLMA 1MW1A 4AVOA 2VX6A 1TKKA 2ZBTA 2AL2A 4LUYA 2OVLA 4L9XA 5CG7A 1F6PA 1A5OC 3DBNA 4ZQPA 5C9UA 1HKVA 4GLEA 4GYPC 3ALGA 5LYRA 2JF6A 5HWJA 3GVRA 4HU4A 3A22A 3WX7A 3MWCA 4O1BA 3NL6A 4HSOA 3S4TA 1K70A 4IP4A 4Q4QA 3HPXA 1IWAA 1EYEA 3SGGA 2QLYA 3MV01 4NJGA 2WLYA 1M7PA 2DH2A 3WYZA 4AZGA 2AGTA 3GXPA 1JULA 4WGXA 3S1UA 4US6A 4XO7A 1NOWA 3GH7A 4A3UA 3P80A 4WSJA 2HXUA 1OCQA 4TMCA 2PLCA 5I00A 1OGBA 3CPRA 2DW7A 2VRQA 1XJBA 4JIEA 3JR2A 1HF6A 1TPWA 3POHA 4GOAA 1QMLA 1Q2SA 1ZNNA 3Q58A 1WAWA 2OKOA 2QJMA 2D0FA 5KZEA 3RR4A 2PDLA 2J74A 4L6OA 1M6JA 4EE9A 1S5TA 4ZXOA 2F7FA 5FF3A 5I3GA 3IEBA 1EGZA 3MMTA 1G7VA 5C70A 3O2LA 3P6LA 4NYYA 2QYGA 2D2JA 2R1LA 4V28A 3UJRA 2ZX6A 1EHAA 4GYJA 4QR6A 4GNJA 3E5PA 4H9VA 1TA3B 3SCVA 4YLWA 4NNBA 3P93A 1TE1A 2NUWA 3TJIA 5LSMA 3WQFA 5H2ZA 1DVJA 2JE8A 3AWNA 4ZBCA 3GNNA 4H9UA 3F1QA 1BVZA 1GOIA 3TU9A 4G1KA 1JYWA 1L6YA 3AICA 4A29A 1YTDA 1YBQB 4Q4RA 3NQCA 2CLEA 3ABOA 3SUVA 3H12A 2WLZA 2R14A 3BLFA 3VGDA 3WQDA 3NEVA 4KRUA 1FDYA 2VM8A 4BK9A 4UQAA 2J7BA 4FOUA 3TTYA 3PJWA 4P7OA 2X16A 4DWSC 1O66A 4HT3A 4C65A 1QI3A 4YYCA 3U6WA 1H7NA 4UMAA 2QPUA 4WJXA 3MBDA 4WLCA 2QZRA 1OG0A 4XD6A 1RV8A 1AFSA 4A4AA 3DECA 4FK9A 4OV4A 4G2DA 2WPBA 3LCIA 4WDTA 4WKHA 1PZ3A 1XIDA 1DPMA 2WPGA 3ARQA 3JU2A 5GNXA 2XIMA 1V0NA 5C2CA 2X1TA 1OD8A 1KM3A 4NAEA 1W9UA 5A6LA 1C29A 4B9YA 4Y8EA 4ZO6A 4N6FA 2Y62A 2Z1VA 4AEOA 4B3LA 4XZWA 5DXYA 4GY0A 1FWEC 2I9EA 3THDA 1LJYA 4XKYA 1PTAA 4C1KA 1JDFA 1D2KA 5ABFB 1NWSA 3WCZA 2O4MA 2CLHA 5A6KA 2B31A 3QQ1A 1VBUA 1QPQA 4H2CA 3UWWA 1KRBC 4J7RA 3W24A 4AWEA 2DJXA 5D02A 5CGQA 5A2BA 3TTSA 3MUAA 4ZOCA 4M7SA 2VRKA 1LCOA 3DN5A 2EG6A 5HR6A 5DBUA 7TAAA 4DM2A 2W91A 1I60A 3MP4A 4HBKA 2YCKX 3CHVA 3ISIX 5XIAA 5LNSA 5IRPA 1UR2A 1MMFA 5AHIA 2ZDRA 1CXFA 2QJGA 1E9LA 3ARXA 4LAUA 4EF9A 4BQ4A 4G7EA 3T09A 5DO8A 5G2IA 3TE9A 4KGLA 3N04A 4H6EA 1PEZA 1IXOA 5U4NA 2DV0A 3I7SA 1IEIA 1ZY9A 1XRVA 1Q65A 3WK3A 3M16A 2X7VA 2J9YA 3EX3A 5IBXC 4GH1A 3RX2A 4LYKA 4ERIA 4JHZA 3BXWA 4HK6A 4AC1X 3ZJ6A 3MYPA 3REQA 4J27A 3VNMA 3MBFA 3BH4A 1JRBA 3Q67A 4Q8NA 2OSWA 2PS2A 4H6RA 3WDHA 4QNEA 4MY8A 4EWND 2DQXA 3MUIA 1BRLB 1AD4A 1LLOA 2O7SA 5HWMA 2G3MA 3CUFA 3HPFA 1JPKA 2JGYA 3OTRA 4NAFB 3RYSA 3LBCA 3PNUA 4E2VA 3AMLA 5E6YA 1ESWA 2QULA 5LIXX 3PZMA 1UWRA 3QV9A 1FP9A 3SCSA 3BOXA 4RE3A 3DXIA 4DI8A 3KRSA 1TA3A 4HTBA 3A12A 4M51A 1RSCA 5A8OA 2HVNA 2VT0A 2ALRA 1V77A 3SGZA 1V3IA 3QQWA 1HG3A 1E73M 4EF8A 1CGXA 1TMQA 4LVGA 1E0UA 1D3GA 4N42A 5EY5A 1R86A 4IIFA 2PTDA 1AQMA 2V68A 4O4VA 5F2LA 1L9WA 1E1EA 1XBXA 1PAMA 2E5BA 4RW3A 3R43A 2QAFA 3BGAA 2DJLA 3HTWA 3LERA 1IR1A 3KDNA 1Y5XA 2X8RA 4E3TA 3BV7A 1GPWA 1V08A 2QGYA 2FVLA 3TA9A 2WQPA 1H0GA 2ZFAA 2A1YA 3B8SA 1NWRA 4IL0A 4A3YA 1LWHA 2YSWA 3W7QA 3NZ1A 3LN3A 1SZGA 3BANA 1AQHA 2I1OA 1CYGA 4WRHA 5TAOA 3N2BA 5JBDA 1KWKA 1TJ2A 1WQ5A 3SRKA 1GYMA 5DF0A 1ECEA 3MCNA 3P0WA 4MJ2A 4CQDA 3G6MA 2YCEA 2A21A 4IP5A 1XLKA 3W1UA 2E0PA 3L67A 1HKIA 5A8GA 4GBDA 3T0TA 4HGXA 3H2AA 1J5SA 1GZ1A 1UWSA 1UD2A 3KL3A 3MHFA 4C7DA 4MB3A 4M3PA 2W62A 1EB3A 4L56A 3STFA 3N19B 3LLDA 4NP7A 1MQPA 3AZSA 5JH1A 1H50A 1EX5A 1CLXA 4XV0A 3A21A 4WOQA 2Z1BA 3VAVA 4XBSA 3HZ3A 1LLWA 2ZRWA 2D0GA 2HV5A 2OTDA 2YCLB 2UBPC 3BWWA 2FFIA 3ZVHB 2P8CA 1A5MC 2X0SA 1LOLA 1EJUC 3H2NA 1AODA 4PCTA 3WLKX 4AUBA 2CZEA 2WM1A 5D8WA 1Z69A 4F2BA 3A64A 4KEMA 4D6IA 5HPCA 1GOMA 4K7YA 4D6HA 1ISXA 4ONVA 1BF2A 1IZCA 1B90A 5FACA 3URAA 1XLFA 4K68A 2VTFA 4JX6A 3WBXA 1W1TA 5IFPA 3RNDA 1D8CA 1Z7AA 1MW2A 3NO5A 1GVIA 4E8GA 4I6VA 4GXMA 2A3CA 4LXFA 2PDCA 3M4HA 2VOTA 1Y65A 4UNIA 3AS0A 3TROA 4PFHA 1UBPC 2VX7A 1Z9AA 1SZNA 3VCRA 4AIEA 4OVXA 1GOKA 2Z27A 3IRDA 3D5HA 2WWDA 1KO0A 1VPYA 3CZLA 5AKQA 4CU6A 2KX9A 1FWNA 3DFOA 5HMEA 2J75A 4J9JA 4NX0A 3ANYA 2HJPA 1QPKA 2H9AA 3S9YA 3LBMA 5C5YA 3IAPA 2HVOA 3K1DA 4C6JA 3FKRA 5E0KA 1EIBA 4R88A 3GR4A 3T0BA 4AY1A 1U30A 5D2TA 3NL5A 3MA8A 2ZUSA 3NURA 3PVFA 1XIMA 1ZBVA 3CL7A 1I75A 3FJ4A 3LV6A 3UZXA 1R3VA 4Z08A 4XISA 3S6TA 3PUEA 3L66A 1JZ8A 4RPPA 4FNPA 4GQRA 3WH6A 3KDOA 5HXMA 5G2HA 1QNVA 3Q37A 1NFPA 4Z2KA 3KRZA 1ICQA 1OSEA 4IGSA 1K02A 3UWZA 5C2XA 3CXOA 1KW1A 1DWHM 3SSJA 3V18A 1SGJA 1B3ZA 5E93A 3MY9A 1AW1A 3VDHA 4XZMX 3TAKA 2HK0A 1FWHC 4R85A 4ICMA 4DO4A 3CPGA 3VFLA 4LYRA 1BWLA 1OFRA 3BOFA 5CEWA 3LSBA 3LNPA 2XH0A 1X98A 1XIEA 2NWRA 3MVTA 1SFTA 3PULA 2VGFA 3RO8A 2A5HA 2WAGA 4S23A 1F7BA 4J3ZA 1QNPA 4RE0A 4EACA 1REQA 3VX0A 2QGHA 3PBWA 3QTGA 1DIKA 5I23A 3RAOA 3S2JA 1FWSA 4UBPC 3LRLA 8TIMA 3EWYA 1QDSA 3LTSA 2EGZA 2TMDA 1JPIA 1WKFA 2J78A 2VRJA 3U2OA 1HTIA 1VFHA 1S3HA 5BRPA 4BF7A 3EA1A 2PD5A 3U8GA 3ZR6A 1PX4A 1RA5A 1GOXA 3H4GA 3I65A 1WAUA 3EXTA 3G8RA 4YU1A 2CLPA 1J9YA 2ACUA 3CHEA 5BYWA 2PRMA 1FWBC 4Q8OA 3KZPA 3PWIA 3AS3A 3TXVA 4DJEC 3S1WA 4CKQA 1TO3A 4QEEA 2ZUTA 3V0SA 2C6QA 4XIAA 1YRRA 3G8EA 3AYRA 3S6OA 1WP6A 1QHPA 3O1NA 1VHNA 4K37A 4MZ1A 3ZLHA 3F5LA 1EDTA 1Z42A 1BG9A 1NDWA 2DQWA 2D20A 3S9ZA 3FV9A 1K8XA 5CBJA 4HU8A 4OUIA 1XCWA 2Y0FA 1TPUA 3HG3A 4J1OA 3THCA 4YMZA 4H8UA 1TPB1 4DBDA 3KXQA 6A3HA 4LY4A 2A85A 3NQ8A 1JXKA 5I3DA 1SJAA 5BXPA 1P6CA 4X9SA 4UTLA 4Q4MA 3UR8A 2NXGA 4M29A 4D72A 3L0KA 1DIEA 3UD6A 2VZOA 3QFWA 4M6QA 1UH2A 2AQOA 3UXKA 1W17A 2GUUA 2PCQA 5DT7A 3TONA 1UW9A 2BB0A 4ORIA 3DEQA 1OZQA 3QBUA 3PPGA 1XV8A 1EFZA 1G94A 4LSBA 2VOMA 1ZB5A 4Y6GA 1E1CA 2OYLA 3VD5A 2PC8A 1W5PA 2JEQA 2VFGA 2E8YA 4ZE4A 1XX1A 5DLCA 2VD9A 3VKKA 3WLOA