1Q6QA

Structure of 3-keto-l-gulonate 6-phosphate decarboxylase with bound xylitol 5-phosphate
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
214
structure length
213
Chain Sequence
b'SLPMLQVALDNQTMDSAYETTRLIAEEVDIIEVGTILCVGEGVRAVRDLKALYPHKIVLADAKIADAGKILSRMCFEANADWVTVICCADINTAKGALDVAKEFNGDVQIELTGYWTWEQAQQWRDAGIGQVVYHRSRDAQAAVAWGEADITAIKRLSDMGFKVTVTGGLALEDLPLFKGIPIHVFIAGRSIRDAASPVEAARQFKRSIAELW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-keto-L-gulonate 6-phosphate decarboxylase
publication title Structural Evidence for a 1,2-Enediolate Intermediate in the Reaction Catalyzed by 3-Keto-l-Gulonate 6-Phosphate Decarboxylase, a Member of the Orotidine 5'-Monophosphate Decarboxylase Suprafamily
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 81
structure length 213
sequence length 214
chains with identical sequence B
ec nomenclature ec 4.1.1.85: 3-dehydro-L-gulonate-6-phosphate decarboxylase.
pdb deposition date 2003-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1q6qA00
3UPBA 3NM3A 2HTMA 1QO5A 1QR7A 4N9CA 1JQXA 1IIGA 3NQDA 4ZL1A 3LCXA 1JRCA 5D37A 3P80A 4Z0SA 1W56A 1MSSA 2CLHA 3E49A 3M7WA 4UTMA 3W72A 2WV8A 1O4UA 1X1ZA 3KFTA 1KBIA 4IX2A 3NEVA 3OA3A 1F74A 1JUKA 2A0NA 1LM1A 5TIMA 1LLZA 3SSJA 2RFGA 5MHBA 3GYEA 3TW6A 3W7JA 4E38A 1RR2A 1FWWA 2TPSA 4UFHA 3WJWA 5FEPA 3UWYA 5AYYA 3NQAA 3DH7A 2I9EA 3C2OA 3LCLA 3VE7A 3MI6A 2Y62A 1P0NA 2W79A 3VCRA 1R2SA 5E1QA 5AYZA 2OMAA 2YX0A 4IOTA 5EY5A 1ZAIA 2ZDRA 2FPTA 1K7FA 2AGKA 4C1KA 4LWWA 4KKXA 1FCQA 5DCBA 2VFGA 3R8RA 4MJZA 3W7RA 4JTSA 1W5OA 4NJJA 3P62A 2Z2UA 1YDOA 1YTDA 5BMXA 1NVMA 5EL1A 4FNUA 1TV5A 2V2HA 3OHIA 4R7JA 3D0CA 1FBAA 3KVJA 1ZENA 1TTIA 2H3BA 5J5RA 4XBSA 3IEBA 3C2FA 1R47A 1P0KA 2J88A 3S42A 2A7RA 4O0KA 3TQVA 1Q6LA 2UV8G 2YW4A 1OFAA 5AFDA 1AMKA 1DV7A 1KM2A 1S5VA 1FCVA 4LS2A 3FFSA 5C5YA 1T0OA 2ZA1A 3M44A 4O52A 4ZQNA 3DENA 4O28A 3S1VA 3TJLA 5AC8A 2JKAA 2ABBA 2WJZA 4QQ3A 1KM4A 1EPXA 4L4MA 1GEQA 3P67A 1XDLA 5K4ZA 3O16A 3KRUA 1ZY9A 4U4MA 4UC5A 2NWSA 3W75A 3PSWA 3TQKA 3W7DA 1VLWA 5BOOA 2OX1A 2C6QA 2P10A 4PL2A 3UYCA 1RVGA 5E0KA 2HS6A 2V81A 5AYXA 4RR4A 5KINA 1T96A 3OVQA 4O13A 1UCWA 5AHEA 1ZCOA 4AF0A 2J9ZA 1O94A 4FO4A 3QRHA 3HGJA 3KVLA 3W1NA 5HWJA 3NO5A 5CPLA 2F7FA 3TJXA 5KMYA 4O17A 4M6PA 1GYLA 1KLYA 2YW3A 3LX9A 4LUJA 5FF7A 3TC6A 4MVAA 4WY0A 5F4WA 1J4EA 4EWND 4WD0A 1UUMA 2YPIA 1RQHA 2NXHA 3GB6A 3QYQA 4NXKA 5U7SA 5AB3A 1H63A 2QCEA 1H50A 4WY0F 3IIOA 4XQ6A 4K39A 2QAFA 1OFEA 2YYUA 1I2PA 3G1SA 1TIMA 2E77A 4O8RA 1GZGA 4MIMA 1SW3A 5D2TA 1OABA 2H3DA 2HS8A 3F4WA 1ZAHA 3PBUA 3TFCA 3EX4A 5BMWA 4HIBA 2QCDA 1WOBA 2OZ0A 3L5MA 1MXSA 3P5ZA 3G24A 1KV8A 3QC3A 3GDKA 3HQ1A 1R30A 4XBKA 3BW3A 2YR1A 1C8VA 3G0SA 3NPWA 3QPZA 3W71A 4ONVA 4FIRA 4XKYB 5FF0A 3P8JA 3JRKA 1OFDA 3B0PA 4JYDA 1K8YA 3LHYA 1KFBA 2ZRYA 3RU6A 2QCLA 3G0XA 1I2QA 2QCHA 4MPQA 3WFAA 2P1FA 3LCFA 2TMDA 3MWAA 3LTSA 5F4SA 1HL2A 1CW2A 4ZQCA 5G2WA 5LGZA 4UTTA 1JCLA 1VC4A 3UNDA 2V82A 2Y7FA 5I3HA 4JTIA 1NAL1 2IQTA 4JIPA 3QEZA 2BLEA 1A5CA 2I14A 5KSWA 4OHQA 4FXRA 5CSSA 5I3IA 2VENA 1DL3A 4GNJA 1ICQA 3BK0A 3QZEA 4RZ5A 3W85A 3HO8A 7TIMA 3DHDA 4K38A 1G69A 5DXYA 6TIMA 4QJ1A 2NV2A 2ZRUA 3C0JA 4YCOA 2C14A 3LI1A 4K8HA 1S5TA 1TJRA 4AHPA 3BW4A 3F4NA 4OWGA 3M5YA 3B4UA 3STFA 3B0UX 2G95A 5HR7A 4HNVA 2E68A 2R91A 3N14A 2V0TA 1ZJIA 3O8AA 2FPYA 3QMRA 3TMLA 4LT9A 1W5PA 3LBMA 1BEUA 3LTPA 1KM1A 1G4TA 2PE4A 4IJBA 4NUWA 2WOQA 2BWGA 1DQWA 4B5NA 2V30A 3HGOA 2X2GA 1LRQA 1WYIA 1KFJA 2BX7A 3T40A 1UB3A 4QISA 4I9AA 4O10A 1K03A 1EP2A 3DU0A 4M19A 4X2RA 3HB9A 4S1FA 1T99A 4BF9A 2NUWA 3EWWA 2Z0IA 1TPVA 2D73A 5G2HA 3R89A 3BW2A 3UWVA 4JNMA 3R13A 1IIHA 3N34A 1TSIA 3VE9A 1Q6RA 3HG4A 1VZWA 5CZSA 2GQ8A 2YFNA 3EB2A 4LNYA 3S5NA 1XUUA 1WXJA 3CTLA 4I7UA 5U4NA 3BV4A 3MHUA 3LHWA 2BXVA 2ISVA 2Y85A 3M41A 4RJEA 1LZOA 1VJIA 3TNOA 1H51A 3W7NA 1G4PA 1JUEA 1GVSA 4GC4A 3QMSA 1QWGA 3PG9A 4A22A 3TE9A 1ME8A 4NNBA 4AF0B 3NNTA 4EIVA 1B4EA 3LRLA 3LHUA 5KZEA 4OGZA 1LBLA 3FA5A 4JTFA 3BLIA 5AHLA 3CWOX 2VEIA 4WY0B 4QNEA 4A29A 1XXXA 4BWLC 4UXDA 3NVTA 3PB2A 1EWDA 1SZNA 1L6YA 1SPQA 5CGQA 5CPMA 2V8ZA 2TSYA 3ZWSA 5F2LA 3N2XA 4PC8A 4FNTA 4IWWA 4JD4A 4MLRA 5AHFA 1S3HA 4K6AA 3VI2A 1JULA 4ML9A 3NDOA 5KITA 1BKSA 3BG3A 2VFIA 4O15A 3NAVA 3DHFA 2A1YA 2DZPA 2J27A 1F73A 3C2EA 3A24A 4HN4A 1AW5A 3CU2A 2CLLA 3RK8A 1DOSA 1F6PA 4AHQA 4O57A 2GQAA 4NVTA 1JCXA 4FF7A 4N9BA 4DF2A 1MEHA 3SJ3A 3DBPA 1MEIA 3T55A 4AB4A 1PCKA 4PL1A 3G3DA 3EWXA 4Z0JA 3B8DA 5D09A 2YGYA 3L2IA 5HMSA 4JDBA 2C16A 1KFEA 1FDZA 2PCQA 3I7SA 4WXZA 1F7BA 3TU9A 3USBA 3RLUA 3SGZA 5TQLA 2A21A 4Z08A 3GK0A 1TPDA 4UTUA 4IMGA 4ZQMA 1RQEA 1QAPA 3LRMA 3STGA 4JEQA 4YL2A 2Y70A 1N7KA 2V5LA 3C2VA 3LLDA 1W31A 4Q32A 2A6LA 2QDHA 4WX2A 4X3ZA 4BR1A 1PS9A 4NJIA 3ZWTA 1WX0A 3HPSA 5IBXC 1WV2A 4UFLA 4UTLA 3S9YA 3V75A 1G4SA 1OFBA 1XM3A 2WKJA 3L5LA 3EXTA 1VCGA 3W7LA 1VQTA 1EIXA 4AXKA 1I2NA 1SU5A 3UZ5A 3NQFA 4MY8A 1GVQA 1Q45A 4X9SA 2CLOA 1EUNA 2CU0A 3EEGA 5D32A 4LC6A 4JS3A 1NFBA 1LTDA 4JTHA 4JY8A 1MO0A 2CLIA 3OEXA 5FEZA 4MFDA 4BWLA 3C3NA 1YXYA 3IGSA 3LCGA 3U6WA 4O1DA 1TPFA 4LOCA 4LUIA 3OIXA 4TR9A 3S0CA 1KTBA 4IMEA 4CLMA 3ZR4A 3WJSA 3L0NA 4LC8A 1PIIA 5HULA 3NQ6A 4NX0A 3SY5A 1W0MA 3CQ0A 3NOEA 1RQBA 2VFEA 1FX6A 4PEKA 3NQMA 4ADTA 2E1DA 2W6RA 4Q33A 4ADSA 3FLUA 1OK4A 1G7VA 2WQPA 3LTYA 3P5YA 1A5BA 2NUYA 2ZQ0A 5D03A 5T26A 4QSHA 1D3HA 3C6CA 3FKKA 2ZTJA 5ABTA 2QEZA 3QQ0A 2WSYA 1L2UA 2QF7A 1K7EA 3MW7A 3C8FA 3NM1A 3TR2A 1EA0A 3ELFA 3GKAA 3IRDA 4UIOA 4JTGA 4H4IA 3W1QA 1A50A 3W7OA 2RKXA 1GOXA 3GDTA 4MZ1A 5HR6A 3S5YA 1PHWA 4OU1A 3O15A 4NJHA 3IVTA 3QM3A 1OJXA 1LP6A 3DXIA 4DQWA 1KA9F 1JQVA 4QNWA 2NXGA 2CLEA 3NQCA 3RLVA 1SZGA 5DELA 5FEXA 2GUUA 3MYPA 1QDSA 4MYAA 1OK6A 3G8RA 3HG3A 3BARA 3P7YA 4AWSA 4IPJA 5E93A 3W07A 1Z41A 3TMQA 3M6YA 5IBXA 3M43A 1O60A 8TIMA 5G1TA 5LKYA 3DGRA 2RH9A 3W2UA 2O7QA 5LHFA 1MZHA 3KRZA 3NPUA 2E5CA 2NX3A 3SGUA 2G97A 1W5QA 2EGZA 4RZ6A 1QPNA 2ZZ7A 3W86A 5K4XA 1AW1A 1HG3A 3PG8A 4N02A 5C2XA 3AJXA 4M5PA 3DI0A 4KWVA 4GUGA 3F03K 1HUVA 1G7UA 3UZJA 4JX6A 4AWTA 3B06A 3L5AA 5F1VA 3THQA 2WO5A 5G4EA 3L66A 5J5DA 4JTTA 3TAKA 3LHTA 2QAPA 4GRSA 5LZLA 1TQJA 5CZ0A 1FWSA 4OQVA 2Q3OA 4Z1BA 4EF9A 1J5TA 1MEWA 1W3NA 4UR8A 4UTWC 3GNDA 1XI3A 3C56A 3GX9A 1SFJA 3NQGA 3EWYA 2ZA2A 4LW7A 2YZRA 3NL6A 1TPUA 2V2CA 1IXNA 1H1YA 2CZEA 3M5ZA 3PC0A 4K7VA 3SECA 3R5EA 4C1LA 4FX6M 3MHGA 1SFLA 2LLEA 4FEZA 2CW6A 1PHQA 4JTJA 3SI9A 5CKSA 3QW3A 4X22A 3M9YA 3RF9A 1ZNNA 3HJZA 5L9FA 4J9JA 4EVZA 1Q6QA 5FF4A 4UFKA 5C6MA 4NQ1A 4RK8A 3T4CA 3S8HA 3KVMA 1B4KA 4FIQA 2XN1A 4JR5A 1UJPA 1W54A 2NUXA 3TK7A 3EWBX 4UTTC 1ICSA 4DPPA 2Z6IA 1FDYA 3MMTA 3NG3A 1XL9A 1KLZA 2PRLA 2RHGA 1M5WA 2FIQA 1UUOA 1K3UA 3TSMA 3PY2A 4TIMA 1EP3A 1YXDA 3EWZA 3S1XA 4HNUA 3GXNA 2C15A 2NX1A 3IV3A 1LBMA 5DBTA 3MI2A 3OVRA 2R8WA 3B0VC 1JR1A 1AL7A 2B7NA 3AO0A 1I8JA 1A53A 3LXAA 2BZNA 1M7PA 3W7EA 3W7GA 3PWAA 2VEMA 3L21A 4NZJA 4BK9A 4H6KA 3TXVA 4K8EA 3M47A 4MZYA 4RV8A 2FJKA 3PR2A 4UR7A 2ATSA 2QJHA 3W74A 3PUDA 4YLWA 1OG0A 3FOKA 1FCBA 5HQEA 2GPTA 4TO8A 3MHFA 1AW2A 2J6XA 3PF3A 3PM6A 2GJNA 4CCDA 4RZ4A 1LROA 3NL3A 3UD6A 3EWUA 3O07A 4O54A 3LOTA 1YTKA 3G1XA 4CQ9A 3HGSA 3T44A 2QCMA 1VH7A 4GFSA 3W1AA 3FYOA 1KM6A 5KZMA 4OBTA 4RXFA 3W1XA 1OYBA 4UTWA 4NJGA 1AK5A 4LVGA 3UWUA 3W83A 1OYCA 3NR0A 5AHMA 1VCVA 1PV8A 3U2OA 4HSOA 3KRSA 2B0MA 4AMAA 4IUOA 3W87A 4EOUA 2VFFA 1DHPA 1FCUA 3UQNA 3R2GA 2QUTA 3TCEA 4UFJA 1LOLA 5H2ZA 4E0CA 5D30A 4E2DA 4HPXA 4WZHA 2VELA 3OBKA 3TH6A 4WUIA 1ZFJA 1YDNA 3CIWA 1XBZA 4O18A 1RPXA 4G1KA 3NA8A 2G5WA 4MY1A 3CIXA 2ZZ4A 2VEPA 1GVFA 4DF0A 2KZHA 3E9AA 1XBYA 1O5XA 3O05A 3TDFA 1SO3A 3A22A 4QAIA 1M6JA 1YLVA 2GVLA 3BGGA 5BRBA 4ZVJA 3GR8A 1VGAA 1RD5A 1OX5A 4JTLA 3GNNA 1KV5A 1SZEA 1AL8A 3M0ZA 1JRBA 1OX4A 3W84A 2R14A 3MUXA 3PBVA 3KHJA 1EWEA 4S2BA 3W2MA 3TC7A 4L4LA 4JIQA 5I3GA 1KM0A 3YPIA 2AQWA 1I4NA 1OF6A 1OF8A 4DO6A 3QQ1A 1KM5A 1TPC1 2CLFA 1TQXA 3TA6A 3WK2A 1VR6A 1R2TA 2VC6A 4TMBA 3W1TA 1WAUA 2B7QA 2QKFA 1ME7A 4UTKA 1OHLA 1TREA 3PUEA 4ORIA 5EMUA 2FPVA 1FDJA 2Q3RA 2X1TA 3I6RA 1TCDA 4LVDA 3CLMA 4JTKA 1FUYA 4UFMA 1W8SA 1P5BA 3LDVA 5A5WA 4O0ZA 3HG5A 2VEKA 1G6CA 3T7VA 4HSNA 3BPWA 1SSGA 3W7IA 1JVNA 5AC6A 4ZQRA 3NQ7A 3GXPA 4YMZA 2VOMA 3E02A 1V5XA 1KM3A 3M16A 5FI8A 1EB3A 3O6DA 1GG0A 4CQAA 1OFOA 2CZFA 4FNSA 3TXZA 3S5ZA 3WJZA 3FJ6A 3N9SA 5LHEA 1QFEA 4RXGA 3DAQA 3IVSA 5A8GA 1G67A 2ZCGA 4NU7A 4R33A 1QO2A 3L0KA 4N6FA 2ZYFA 3VKJA 5DCEA 4AAJA 3G1DA 1C29A 3TW7A 4O53A 3A23A 4LV4A 3S1UA 4HKPA 2NX9A 5G2IA 1VS1A 4N4PA 1L6WA 5HUPA 4E2BA 2PRMA 4RKAA 1JCJA 1FXPA 4TX9A 1L6SA 3BLFA 4XUGA 3IVUA 5EA9A 1CX9A 4YXGA 3W3OA 1F5ZA 3W70A 2JBMA 3P61A 3CM4A 2ISSA 2ZA3A 1GQNA 3ATYA 1K7XA 4HPJA 4A3UA 2W0UA 3LHVA 4MOZA 4RLIA 4QITA 4PFMA 3L67A 4FX8A 3C2RA 2PURA 2NLIA 1HTIA 1DVJA 2E09A 4WJEA 3LCHA 2J9XA 1LYXA 3W1UA 3IIXA 1QOPA 1OFPA 1HO1A 4O1CA 2JGQA 1DJQA 1TPWA 1X1OA 4DPQA 2QCCA 3HMJG 2ZRXA 2C13A 3LI0A 2QUVA 4GUFA 1L9WA 2ISWA 2HSAA 4M6VA 1H5YA 3B03A 4DEFA 1W5MA 2X16A 4O4VA 4LRSA 4UNKA 5EYWA 3A21A 1FWRA 2DZSA 4M6QA 1RV8A 3G1YA 1C9DA 3NPVA 3TUUA 4WOQA 3PULA 4JY9A 2V5BA 1VPXA 1SO6A 2QCDB 3LCWA 3N9RA 3G1VA 3BG5A 2QJIA 1HFBA 1GVOA 4Y90A 2ZRZA 5LSMA 1R46A 5I3JA 1ZAJA 4FB7A 3MYOA 3QW4B 5CZJA 3BLEA 2E6YA 1DORA 3N73A 4ZZ9A 4DBEA 1F2JA 1LOSA 4RX0A 3PVFA 5LNUA 4WQ6A 1B3OA 2A5HA 3EXRA 4NX5A 1LORA 2FTPA 1OFRA 3NZRA 3UWQA 2X1UA 3NXFA 1OYAA 2CLMA 3H53A 4UMAA 3LV5A 5L6UA 1SQ7A 3ANYA 1GVRA 1JJKA 4PH6A 4WOZA 3DZ1A 4ADUA 1U5JA 1XCFA 2Q8LA 3CT7A 4KFOA 2OJPA 4CNOA 4XWUA 2X1RA 4P61A 2ABAA 3QF0A 5KZDA 4I7VA 1OX4B 4NXSA 4OE7A 1IGSA 2CZ5A 3SR7A 2NV1A 3MO7A 4WXYA 4CQ8A 3L65A 2JKPA 5DN1A 3QSTA 2A4AA 1X8FA 5FF3A 1SSDA 1H62A 2YYTA 1DKWA 1H1ZA 2Y63A 3GLCA 5HINA 1WOAA 4KWWA 2PC4A 4O11A 3C61A 3IGUA 1VYSX 3BGJA 4TMCA 2EKCA 3KAOA 1EEPA 4AWUA 3NGJA 1YDVA 3KX6A 1GYNA 2C19A 1PVNA 3THAA 2F84A 2WSRA 1HO4A 4UMBA 1U83A 1GT8A 5K9XA 2BSLA 3Q94A 1I45A 2OCZA 4FNQA 4KFNA 5F1UA 1QPRA 2B7PA 1D9EA 4JXCA 5HWNA 4FNPA 4DF1A 3TAOA 3N19B 2BTMA 1UBSA 1TTPA 3P8IA 2Y7GA 1FXQA 3MI3A 1KFKA 3MBDA 4IXXA 1FY6A 3C4UA 4R53A 3HOJA 4XTIA 5LNSA 3UXAA 4O1BA 3P84A 4R34A 3RFAA 1KFCA 2Q8ZA 3W88A 1E51A 3CC1A 1VLIA 4PA8A 3BG9A 1IXOA 3QJAA 3W22A 2C18A 1VHCA 2VXNA 2YSWA 1TO3A 1PL9A 1Q3NA 1QPOA 3NL2A 3WJXA 1NSJA 3IIVA 3HF3A 3W2JA 4IMDA 1QMLA 4IXHA 2ZZ2A 3W7CA 1X7FA 3QMTA 2A2IA 3GDMA 4UCGA 1VHNA 1EP1A 3UWZA 5SWUA 1TPEA 2FB3A 2DZTA 1Z42A 2OT0A 4NZFA 2O7SA 3LHZA 3STEA 3P74A 5LNRA 2QCNA 4HHPA 5LNVA 4DBDA 1ONRA 4I7WA 3W1RA 1IXQA 3NYZA 2B4GA 1W1ZA 4GBUA 3O06A 4DXVA 3DFTA 4Z1DA 4BFAA 2DZWA 3CHVA 2JK2A 4UTJA 2CWNA 2YDAA 4PCFA 4FX7A 4JYFA 3TKFA 2JKEA 3PBYA 5K7JA 4HNNA 5AN7A 2PRHA 3MBFA 4JN6A 3H54A 4O12A 3IIZA 4GUIA 3ABOA 1IXPA 3W7HA 4H3DA 1GTEA 4JX4A 2XN0A 1OVDA 3PAJA 4Y96A 2QJGA 3W23A 1AG1O 3W76A 1W3TA 4QIUA 3F1QA 1EUAA 4IQLA 3RNDA 1F76A 3ZFHA 4NT0A 4JGDA 1DJNA 3GVGA 3PSVA 4JICA 3DKLA 5F2MA 1VYRA 4UFIA 1ICPA 4GWEA 3W9ZA 1QOQA 1OFQA 1I2OA 4K7YA 3HPXA 2QDGA 3SIZA 3A9IA 3EKLA 1Z44A 2H8XA 3MJYA 4ZQPA 1KFLA 2H6RA 2OT1A 1TTJA 3LCIA 1H7RA 3A5VA 3FYPA 4XZ9A 3NQEA 3JR2A 4LS0A 1TRIA 1SUXA 3A5FA 5HUOA 4LVAA 1M7OA 2QR6A 5HJLA 3TIMA 3G3MA 1XDMA 3VNDA 2ZRVA 1TJPA 2JGYA 1S5WA 2E6FA 4MZ8A 1G4EA 5CPNA 3BO9A 1BTMA 3FKRA 5K2ZA 3O1NA 4XTDA 4FNRA 3LGEA 1FQ0A 4IPIA 4IMCA 4K37A 1LRNA 1H7XA 4AHOA 3NPXA 2WNNA 3N2MA 2Y7EA 1H7WA 3LB0A 3KOFA 2FQIA 1XFBA 3GR7A 1TMHA 3GAKA 2DU2A 1K02A 4K36A 1KBJA 2RDWA 3KXQA 3P60A 2DORA 4N2YA 4CCEA 5CZTA 4D2JA 3CPRA 4LV9A 1H61A 5G1YA 1XKYA 3W2LA 3HGRA 3I65A 3TV8A 3HG2A 5FF2A 2Z6JA 3UPWA 1TV7A 3NQ8A 2GQ9A 3S5OA 1VCFA 1YADA 4NNCA 3KVKA 1IF2A 3MP4A 2CZDA 3O6YX 3NZ1A 3LRKA 1O5KA 3K30A 3W73A 1DQXA 4NNAA 1XBVA 1N8FA 1WDWA 4FHAA 3DFQA 4UNLA 1TYGA 3WJYA 4RCXA 2E6AA 1QPQA 2DZUA 3G1AA 2FLIA 1XC4A 1TPB1 4MKNA 3DFNA 3MP5A 4UUIA 2AAMA 4GE8A 4NJKA 5EKYA 1V7YA 3DKJA 4GUHA 2ZZ5A 1TB3A 2A7NA 5I3KA 2QCFA 2ZZ3A 5FEWA 4JTUA 3B04A 5D38A 2WNQA 4CNPA 3FJLA 3L0GA 2DZVA 4ZQOA 3B05A 2ZBTA 3IGXA 3H55A 1OX6A 1YTEA 3W1LA 4YWIA 2H90A 3O63A 1K8XA 1YYAA 4Y9AA 3P81A 4OV4A 2GVJA 2G96A 1GWJA 3PUOA 1VYPX 3W7MA 4HNTA 6ALDA 3WK3A 3LXCA 4LY8A 4M7TA 4IX0A 1PE1A 2EPHA 3HPZA 2B7OA 1UASA 1D3GA 2YFOA 5D02A 1SO5A 1Y0EA 5D33A 2VFDA 3V1PA 5AC7A 2A6NA 4O1AA 4PTNA 2V9DA 4BI5A 5GVJA 3LLFA 2CLKA 4GUJA 1SW7A 2A7PA 5CPOA 4N9DA 1LDCA 2Y89A 3CEUA 1KTCA 4AH7A 2XFWA 5DLCA 3EX1A 1LBFA 1O95A 4LS1A 3W1PA 3UY7A 1P1XA 1THFD 2C1HA 3GDRA 2Y61A 3TROA 1CI1A 1DBTA 3SZ8A 5FESA 4BI6A 4N4QA 3T78A 3ABSA 2YCEA 5DY2A 4OT7A 4POCA 4EF8A 5HWMA 2R94A 5K3VA 4PODA 4ZMGA 3M5VA 3W7KA 5CG7A 1H7NA 5BW6A 1T8XA 2DZXA 1WBHA 5AHIA 4LVBA 1LLWA 3TX9A 1SW0A 4ORMA 3WK1A 3U8GA 3NQ2A 2CFFA 4O50A 2YXGA 3G0UA 3HBLA 4UTHA 1VRDA 2X1SA 4IGHA 3GXTA 5K9CA 3LBCA 2QUUA 2P0OA 1FWNA 2ATMA 4CNNA 1TTQA 2DJXA 4Z1CA 1K8ZA 1I2RA 3IIPA 5LNWA 5C55A 4O14A 3GDLA 3G18A 3Q2DA 3STCA 3ATZA 3DFPA 3Q58A 3EX3A 3LXBA 1TPH1 4M7SA 4MLJA 1H60A 1FWTA 3QH2A 2WSQA 4UMCA 2EF9A 4JYEA 4BI7A 5F2IA 1YXCA 3GZ3A 3N3MA 4YCPA 5I3FA 4A2SA 2E6DA 2Y6ZA 3HIJA 3QPYA 1KW1A 3EX6A 1BWKA 5D05A 2VFHA 3OVPA 4W9TA 3EKZA 2FB2A 2QCGA 4MJMA 2ZRWA 5KTLA 3E96A 4MUZA 5D2VA 1ZHAA 1NEYA 2ZZ6A 1XUZA 2NZLA 2GVGA 4MFEA 2RDTA 2Y88A 3CWNA 3LERA 2ZTKA 3TQ0A 3M5XA 3C52A 2XN2A 3PS7A 3VFLA 1W3IA 1ME9A 5DXXA 1PCWA 1TV8A 4O4WA 3M1ZA 3W7PA 1B57A 3P82A 3UWWA 5D2YA 4UTIA 1LCOA 1W5NA 2X30A 4O19A 3TFXA 1ML1A 2J24A 3PBWA 3CEPA 4Z1AA 1GPWA 4AEOA 1NF7A 2EAWA 5TBOA 1X6UA 1YPFA 3G22A 2GOUA 3O6CA 1H7PA 2RDUA 2WPBA 5EBUA 4MYXA 3R12A 2A85A 5G5IA 4TU1A 1LOQA 4QM1A 3DFOA 2H8ZA 4MY9A 1RZMA 3L68A 3G1FA 1SZFA 5IM51 4N6EA 4JTEA 4N9EA 3I68A 3UY8A 3NQVA 4ICNA 3OG3A 2C0AA 2C3ZA 4FXSA 2ZFAA 3PB0A 5D2XA 2ALDA 1J2WA 1F05A 1QCWA 2TYSA 4DELA 1JCMP 3W6YA 4JDYA 2J9YA 1A5SA 4O16A 1WA3A 3INPA 3ZS4A 2Y7DA 3I7QA 1XBXA 1R2RA 3QSRA 3ABRA 4OV9A 2E5DA 3W2KA 1Z48A 4U28A 4CCCA 3EX2A 4LRTA 2VKZG 3QFEA 4GJ1A 3DFSA 4P2VA 5LGXA 3CB8A 5C54A 5CSRA 4AVFA 1GJPA 3LM7A 4S2CA 2I1OA 3G1HA 4DO4A 4Y8FA 1EX5A 4Y6GA 4LU0A 1KTNA 3W2NA 2Z1BA 1ALDA 3Q37A 3E12A 3TSDA 5F2GA 5G4WA 3GKFA 3FIGA 4JX5A 5F4XA 5AOUA 5EPDA 2DP3A 3G8EA 5D04C 2HMCA 3W1MA 1YPIA 2V2DA 1JCNA 1QNVA 5H91A 3W7QA 1LRTA 1JUBA 3TSBA 3S1WA 2FDSA 3MP3A 5BNKA 2FFCA 3RMJA 3BVJA 3SFKA 1A5AA 2TRSA 2EHHA 1SR9A 1N55A 1ZALA 3DI1A 3S6DA 3GIYA 2NWRA 3L9CA 5D2WA 1WBJA 3FS2A 1BWLA 3NL5A 5AHNA 4IMFA 1B9BA 3SW6A 5K9DA 4A21A 1GG1A 3UXDA 4A2RA 4LTSA 3FEMA 5DBUA 4GXMA 1F6KA 1Q6OA 4KFPA 3WK0A 3JS3A 2NXIA 4DO5A 2DJLA 2WNZA 4XKYA 2ZZ1A 1W37A 5HNRA 4LVFA 3ABQA 5DY3A 3I7RA 1H7OA 2E5BA 3E0IA 5DCDA 2GJLA 3LV6A 1TRDA 4ALDA 4HT3A 1WQ5A 1ADOA 1GTHA 4Q4KA 1SO4A 3EXSA 3GAYA 1JCYA 1NF0A 1P4CA
chains in the Genus database with same CATH superfamily
1TIWA 1JZ5A 1QO5A 1E5JA 1VFMA 5MKGA 3LCXA 3CL7A 5D37A 4RW3A 4Z17A 3WQ6A 2VD8A 3KFTA 4H9VA 3S5SA 3NEVA 4ICCX 1P0EA 1FHVA 1JUKA 4XAPA 3T0BA 7A3HA 3BLPX 3SSJA 4DYKA 3TW6A 1XX1A 4E38A 3EBVA 4UFHA 3WJWA 1EJRC 1FH8A 3W24A 3DH7A 2DDXA 3CZ8A 3QY6A 3I3DA 4D8LA 5E1QA 3TONA 3RLHA 4X60A 3DYPA 1K6WA 4LWWA 3H2AA 1FCQA 2Z1SA 4IIFA 3R8RA 3RLGA 4X63A 1V6XA 4CKQA 1ECQA 2XPKA 3VOJA 1YDOA 1YTDA 3IJ8A 4D6HA 4LUSB 1XPGA 5EL1A 1SJCA 2ODOA 4DBSA 1UD3A 2V2HA 3OHIA 4R7JA 3OPSA 4ACYA 1ZENA 3SSZA 4PFHA 5EFFA 2G3FA 2JFEX 3WEMA 1VFLA 2DFAA 4Q8TA 4QCEA 3TQVA 1GYMA 3GSMA 3CAKA 5REQB 1OFAA 1A47A 5AFDA 1FH7A 4DJDA 3VU2A 2BVYA 4EXQA 5C5YA 1T0OA 2ZA1A 4JQ1A 4CD8A 2CBUA 3R0DA 3DENA 4LAMA 3S1VA 3TJLA 4Z2HA 4Q8MA 2JKAA 1O7AA 1PZ2A 1XDLA 4JQ4A 3KRUA 2CC0A 1UZHA 2JIWA 3TQKA 5D9PA 5BOOA 1VLWA 2EG6A 1KCZA 2P10A 5E0KA 5AYXA 3ARTA 5KINA 4O13A 1J96A 1O94A 4R7OA 4M82A 4W7UA 4QDMA 3RRAA 3NO5A 1M68A 1XCWA 5KMYA 2YW3A 4LUJA 1EJTC 3N18A 5FF7A 2ZUUA 3MU7A 3PHAA 4QBXA 4N0RA 3VM7A 4CQCA 5ABFB 3UCCA 1RQHA 2NXHA 3GB6A 1B3YA 1QWKA 1R3TA 4QJ3B 2QCEA 1H50A 4WY0F 4DWSD 4Z1YA 3LGDA 3SADA 4XAYA 1GZGA 2OEKA 1SW3A 1L6GA 3PBUA 1DXEA 3VIHA 2VZTA 2OZ0A 3L5MA 2J4GA 5C2GA 1A5KC 3P5ZA 3M07A 2EEXA 3G0SA 3NPWA 3GC5A 4LBRA 3HFYA 2W61A 4XKYB 4AZ6A 2PFHA 2J75A 3B0PA 4JYDA 3E2VA 3EOSA 3G0XA 4ZFCA 2V38A 4H9TA 3LCFA 3MWAA 3GYCA 1K4HA 3VX1A 5C71A 1CW2A 4ZQCA 3MDUA 4UTTA 1JCLA 2PTWA 3UNDA 1UKSA 1QNRA 1X38A 1NAL1 4JIPA 3CZEA 1OC7A 4OUIA 5I3IA 1EBHA 3PZOA 4B3KA 4EPKA 2VENA 1B90A 1J6PA 1LWHA 4RZ5A 3W85A 2PGWA 3CGTA 7TIMA 5HBFA 1O66A 4ZR8A 2FVMA 5DXYA 6TIMA 3L2LA 4YCOA 3M64A 2VDIA 3NURA 4TQTA 1R9YA 1MRAA 1XSKA 3WLMA 1DJYA 3QQWA 4JAWA 3F4NA 2MUCA 2OOFA 2OOGA 1F8MA 1Z6KA 4O1FA 4IICA 1G1YA 2OEMA 1IGWA 3EGJA 1M1BA 3APTA 2R91A 2CHRA 3N2OA 1TWSA 3KOYA 2VC5A 1W5PA 3WLJA 4H00A 3RN6A 3LTPA 1XQKA 1KM1A 4GX8A 2GJPA 4NUWA 1QI3A 4DM1A 3LU2A 4LBSA 2X2GA 2PGRA 1PYFA 4O10A 4F40A 1ODUA 2XVLA 3HB9A 4S1FA 3ARUA 3EWWA 2ZVRA 1TPVA 3UWVA 4JNMA 3NFUA 3N34A 4OIFA 1TSIA 1PIFA 1Q6RA 2PC8A 4W84A 1KKOA 2GQ8A 2YFNA 4ZGYA 5GNYA 1FWCC 3EB2A 3S5NA 3SY1A 4L6DA 3CHCA 3OOQA 4LB4A 1IWAA 4RDWA 4XX6A 3T08A 2OX4A 3M41A 1Z89A 3TNOA 2EJ1A 1XH2A 1ZLPA 1QW9A 4XVDA 1GVSA 4CN1A 4GC4A 2G8ZA 3QMSA 1QWGA 5CJMA 3VNYA 3APGA 4HD5A 2R24A 1TMQA 3T0TA 2Y5JA 4IZGA 4AF0B 3NNTA 1B4EA 1UA7A 3LHUA 1EJUC 4A6GA 4Q22A 4AZCB 4HSHA 5AHLA 1QATA 2OQHA 1F61A 3RPMA 1W9UA 1TA3A 1XIDA 5FKYA 3NVTA 1BYBA 1SZNA 1WDRA 3BLKA 4IPLA 1BQCA 1VPQA 2NQ9A 3S6OA 5F2LA 3N2XA 4PC8A 8CGTA 4IWWA 4KRZA 4JL1A 3MS8A 1G94A 2ZADA 3NDOA 5KITA 3BG3A 4O15A 3BAJA 2DZPA 1XLIA 1V0NA 2CLLA 3VGEA 5CC7A 1AMYA 5FD0A 4F0RA 4N9BA 3PWGA 3T55A 1UZ1A 2PCEA 4Q8NA 3G3DA 3EWXA 4PUKA 2NSXA 2J8FA 3B8DA 3GTXA 1HKWA 2PWEA 4J40A 1PJ9A 5TQLA 3CMFA 1UUQA 2V5KA 2O9OA 4E6MA 4ZQMA 4A3RA 4MG4A 3ZT7A 5DMYA 4HZMA 2Y8VA 4HZ6A 2YIHA 4AWEA 2WAGA 3LLDA 3BSGA 1CXFA 2HVMA 1PS9A 4GYPA 4D6IA 3HPSA 3OU8A 4GI6A 4UTLA 1KRMA 1QNQA 1Q6CA 1ISWA 2OYLA 4MY8A 4QP0A 1GVQA 1Q45A 1WAWA 4JS3A 1E9ZB 4P7RA 3V16A 3H2CA 5D8ZA 3IGSA 3TNBA 3LCGA 3U6WA 4O1DA 5G1MA 4GCAA 5HULA 1R86A 3SY5A 2ZX5A 3VKCA 2VFEA 3ZT6A 4PEKA 4C6CA 3NQMA 3ZT5A 4Q33A 3FLUA 1XYAA 1G7VA 2I5GA 3LTYA 1B5TA 2G3IA 2NUYA 4NYUA 3C6CA 3AIWA 3FKKA 3QV8A 3VGFA 1L2UA 1K7EA 4GVFA 3NM1A 3GNRA 4UIOA 4H4IA 1A50A 3AISA 2YDSA 5FJIA 2YZ5A 3FXGA 1GOXA 1W91A 5HMDA 3EOLA 1QASA 1MQRA 4M24A 2BY2A 3A64A 1OJXA 1LP6A 4FS9A 3THCA 4QNWA 1UKTA 4EAMA 2NXGA 3TJIA 5HNUA 2CLEA 4J3ZA 3DDMA 3BAWA 4FR6A 4D6FA 3RLVA 2OWWA 1C8XA 3AYTA 3HG3A 4WSKA 3A47A 1MWOA 2P53A 2VX4A 5JMUA 3M6YA 5IBXA 3SUVA 1EPVA 4DUWA 1O60A 5G4HC 3W2UA 2XH0A 3F4DA 1YRRA 2G97A 3EA2A 1BRLA 4RZ6A 2Y5EA 2ZZ7A 3W01A 1HG3A 7ODCA 1QU4A 1MFUA 4KWVA 4MWAD 2OLHA 2V3GA 3RCMA 3D3FA 3L5AA 6REQA 3RCYA 2WYSA 4GFIA 1B31A 2A3HA 4BF7A 2DGAA 3E2SA 4ROPA 2HCVA 1JPHA 2PWHA 3W02A 5J5DA 4K8GA 3QPEA 1TQJA 1FWSA 4DLFA 4OQVA 2Q3OA 1DXFA 2QXWA 4Q8QA 1R3WA 4Q8OA 1GONA 3WLKX 2QLYA 3C56A 3M4HA 4X0NA 3HPAA 3NQGA 4YTUA 3MA8A 1UJQA 1OT2A 2YZRA 3EDKA 4XD5A 4F66A 2HXUA 4YYFA 5I78A 3SECA 2FZ9A 3ONCA 4C1LA 3UXIA 2BXZA 2CW6A 1PHQA 4JTJA 2JF6A 3M9YA 3FY1A 2GGGA 1ZNNA 1EFZA 2O9TA 4UFKA 3LPFA 3Q4DA 3T4CA 1R3YA 3AWOA 4JR5A 2QV5A 2NUXA 3EWBX 1EF3A 4UTTC 4YTSA 1FDYA 2V5JA 3LPPA 1XL9A 2XINA 5M3WA 2FIQA 2PSNA 4IL0A 4TIMA 4MWAE 2XVNA 3EWZA 1UR2A 4FOKA 3OVRA 2R8WA 2CEQA 3KOXA 2B7NA 4GBDA 3AO0A 1I8JA 3W7GA 2BZNA 5LA1A 3HU7A 4NZJA 4C7FA 1O68A 4A8RA 4K8EA 2XSXA 4MZYA 2UY4A 4UR7A 1WZKA 1OCQA 1OG0A 3FOKA 4C7DA 2BOFX 5JU6A 3MHFA 3PF3A 1XSJA 3OO2A 3GC4A 1V3KA 3VIGA 4C6BA 3UZXA 4TXEA 4CCDA 5I5RA 4P7OA 4XZLX 5DMMA 3Q45A 3CO4A 3EWUA 3O07A 4GA8A 2GDVA 3LOTA 3M0XA 4N42A 1AH4A 5FJTA 1TR9A 4US6A 4WF7A 1VH7A 3W1AA 3FYOA 5CBJA 5KZMA 3KL0A 1NOWA 4UTWA 4NJGA 3V0TA 2VM8A 4LVGA 3W83A 1OYCA 3NR0A 5AHMA 4DJDD 2OODA 3FVDA 1EZ2A 1PV8A 4HU0A 3C0QA 1V08A 4IUOA 4IGNA 4LALA 1W3JA 2DT0A 3FA4A 2VFFA 1E73M 4NIRA 3R2GA 2QUTA 5H2ZA 4E0CA 4J2MA 2QQ6A 3R10A 4HPXA 4ZXLA 4XB3A 1YBQB 3TOYA 1ZFJA 3CIWA 5EBAA 1VAHA 1RPXA 4PMDA 2FHCA 2D0GA 4L9YA 2E25A 5FSDC 5E70A 1ITQA 2ZDSA 2KZHA 1W17A 1XLCA 3O05A 2GZXA 2R1NA 1SO3A 2QUMA 5BRBA 5GPRA 4ZO8A 3P0WA 3URAA 1OX5A 4JTLA 3GNNA 1JRBA 1OX4A 2HVNA 1UMYA 3PBVA 4QJ5B 1O1ZA 3EDDA 1KM0A 1TZZA 1HKIA 1OF6A 4DO6A 3QQ1A 2G50A 3PZTA 3WK2A 1R2TA 3DHUA 2ANUA 4D1JA 5T91A 1N8WA 2H9AA 3WO8A 2FPVA 1Y5VA 4ATWA 1H5VA 2BHYA 1AVAA 1P5BA 5A5WA 3PTQA 4O0ZA 3WCZA 3ERPA 4HSNA 3BPWA 3QR1A 4ZQRA 1ECEA 5F7UA 3GXPA 2GFTA 5CJNA 3M16A 4F0MA 1EB3A 2CCRA 1JYVA 3O6DA 2E40A 3CHDA 5DRCA 3OB8A 2GWGA 1GOOA 4FNSA 4S3CA 5LHEA 2YCLB 4RXGA 3IVSA 1OEPA 5LA2A 2ZCGA 4NU7A 4R33A 1TV4A 1WZAA 4HMDA 2YL8A 3PPCA 4S3AA 5DCEA 3B8TA 4QROA 3N04A 5DRIA 1HJSA 4QRNA 1JXJA 2BODX 3UG4A 4KH2A 5G2IA 1VS1A 1OWQA 2G3NA 2EPMX 2PRMA 3NGFA 4Q4PA 4AD1A 1Q4NX 4KWUA 3IVUA 5EA9A 3T05A 1JZ8A 1CX9A 3IARA 2AQVA 1JI1A 1JYNA 2F8QA 3TTEA 3SQLA 4HHHA 1JDCA 3CM4A 4GYPC 1GQNA 1CGUA 4QG8A 4MOZA 4RLIA 4PFMA 4FX8A 2BOEX 1E72M 2CXEA 1YIXA 4U2ZA 2WBKA 3IIXA 4JIEA 2WVSA 3TTQA 3O3RA 3R43A 4O1CA 1F8IA 3HMJG 2PDNA 4YVXA 2BNJA 4JIHA 3IJ6A 4ERIA 2ZXDA 1L9WA 1E9IA 1KB3A 3B03A 2WW5A 4O4VA 1NFGA 1UWIA 3KBMA 2WKGA 3A21A 3BMXA 4PTMA 2DZSA 2HWGA 1C9DA 3NPVA 3KTSA 3M0JA 2AL1A 4EE9A 2VTFA 1VPXA 2QCDB 1JDAA 2VT0A 1L0PA 3BG5A 4XZWA 2QJIA 2ZC1A 1HFBA 3EPMA 3W82A 4HHLA 4Y90A 5CCZA 1E1FA 1ZAJA 1FA2A 4FB7A 5I23A 3MYOA 3QW4B 3RU8X 5CZJA 3GC2A 3NCOA 4REQA 1LOSA 4RX0A 3ZMRA 5RUBA 4JFWA 2A5HA 2J7GA 3UXLA 2G4FA 3NZRA 4S3FA 5E0FA 3CBWA 4U3CA 4C6QA 2X1UA 4OBRA 1OYAA 3H53A 4CD6A 3NDZA 3RO8A 1M9HA 3ZLFA 1F4HA 1V0LA 4WOZA 4B15A 4QAWA 1QVBA 2Q8LA 4AIOA 4GMEA 2OJPA 1VBUA 4XWUA 4P61A 4AYSA 3ARSA 2BVTA 2VC9A 3SR7A 4WXYA 3L65A 1CWYA 1K9EA 3QSTA 3TN5A 5FF3A 3VGGA 4QDPA 2YYTA 3ES8A 4Q3MA 4S39A 1EHAA 1VYSX 1ITUA 2W67A 3PZVA 4L7ZA 1IYXA 3GE7A 3PPGA 4HU4A 1WUEA 1PZ3A 1RPKA 3DEQA 2C91A 3FHQA 1RCXB 2J7HA 3BGAA 3UCDA 5ENLA 2QGYA 1U83A 4E4FA 2BSLA 4P8VA 2X40A 5F1UA 3SY8A 1IE7C 2CBIA 3S2NA 2B7PA 1D9EA 4JXCA 1JZ2A 4FNPA 4DF1A 4JKMA 3TAOA 2BTMA 3N12A 3VINA 3SCTA 1TVNA 3SCSA 1VFFA 3P8IA 1FP9A 2QDEA 3MBDA 4L1GA 3C4UA 4XTIA 1UMLA 3UXAA 4M0XA 4LUTB 3W88A 3GFYA 1VLIA 2XH4A 3H26A 3GTIA 2C18A 1VHCA 2WVUA 1EC8A 5JH2A 3NL2A 1S1PA 2PDJA 3LA4A 2Z26A 4AG0A 3ZSSA 4IMDA 1QMLA 1XIJA 4H9ZA 4IXHA 2ZZ2A 4GKLA 4B5VA 4XIAA 1TPEA 3QLLA 4DZIA 2OT0A 1GUVA 3TP4A 3BSHA 1GVEA 3A9BA 4QJ4B 4IF2A 3UPMA 4QLLA 1W1ZA 4GACA 4K1WA 3O06A 2PZNA 5I02A 4Z1DA 1X8CA 2J13A 4UTJA 2CWNA 5XIAA 1OIMA 4FX7A 4IH3A 1DJXA 5H6HA 3PBYA 4MB4A 1HGWA 4HNNA 2PRHA 2XIBA 4HQVA 3RYSA 3MBFA 3QR3A 4O12A 3FCPA 3W27A 4GUIA 4IG2A 1AQ0A 1BKHA 2WQDA 2ZOXA 1AG1O 3W76A 4C6EA 4QIUA 4IQLA 3DESA 3W81A 3Q65A 1Q63A 4Q8PA 2YLAA 1GOQA 4UFIA 1J2BA 3W9ZA 1QOQA 3UR2A 1ONWA 3QV9A 4AQLA 1CDGA 6CGTA 1SR0A 2IKIA 3HPXA 3CWHA 4HMCA 3AIVA 3EKLA 2EKGA 4IGSA 2VGGA 4ZQPA 4B91A 1TTJA 3LCIA 4Q4QA 2I56A 3A5VA 4DXXA 3NQEA 4LS0A 2YA0A 2C79A 3E0FA 1CGXA 1U1HA 2QR6A 2VQTA 3G3MA 4QTGA 4HOXA 2JGYA 5H1WA 5CPNA 3BO9A 4XTDA 4FNRA 1FQ0A 1W9VA 4J4KA 2PODA 3DG3A 1VRXA 2Y7EA 3LB0A 2Q6ZA 4R3UA 2HK0A 3WLTA 3CAQA 1TMHA 3FXYA 2RDWA 1M41A 5HOSA 2AL2B 1QHPA 2DORA 3ITYA 2GUYA 2BXYA 3WDHA 2YBUA 4LV9A 1H61A 4GISA 4F0HA 5I7GA 3W2LA 4E2OA 1R3QA 5C9XA 3HG2A 2Z6JA 5HNNA 3UPWA 1TV7A 3NQ8A 2GQ9A 3S5OA 1FKXA 3KVKA 3EOUA 2HBXA 4EPBC 1JAEA 1O5KA 4NNAA 4IT1A 3JW7A 3CB3A 3CAVA 1TYGA 1MZRA 1QPQA 3MQTA 1KWGA 2XISA 1QHZA 1R6WA 1YEYA 3H7UA 3F7JA 1R3VA 3A13A 3GH7A 1NDVA 3AS2A 3DKJA 4GUHA 4ZXOA 1AFSA 4JIRA 1E9LA 3AIBA 1CB7B 3B04A 4FALA 3W37A 5ABGA 3WEOA 4ZQOA 3WF4A 1LT8A 4RW5A 4CN4A 3H55A 1OX6A 3UGVA 3W1LA 2PTYA 1IV8A 3TTSA 1HN1A 3TLQA 1XINA 2H90A 2JALA 4ERAA 1YYAA 1A4LA 2CLPA 2Z29A 4FLRA 4GIYA 1G01A 2DY3A 3ZJKA 1GWJA 1GJUA 2GOKA 4OOZA 2PP1A 4M7TA 4QDWA 4IX0A 4WRHA 4L6HA 3CIVA 4XZIA 3ZJ8A 4FOUA 1SO5A 4A4AA 2PD5A 3HM7A 2ZX8A 2V9DA 4BI5A 4G7EA 2UZ9A 1XYCA 1MUWA 4N9DA 3QV7A 3CEUA 4MJ4A 4M80A 5DLCA 3W1PA 3UY7A 1RJPA 1EJWC 1P1XA 3B8UA 4JKLA 3UJSA 3TROA 3CZKA 1CI1A 1D7KA 1ZUAX 3SZ8A 1PZ0A 1Z9AA 4OBSA 1P1MA 3ABSA 4J35A 1E4MM 2YCEA 3L4UA 2QNEA 4EF8A 2PEVA 1V93A 4PODA 1B3WA 5BW6A 1J0HA 2DZXA 1WBHA 5AHIA 3F4CA 1LLWA 1SW0A 3WK1A 3WN6A 4PBFA 3RX4A 4O50A 3PBMA 4UTHA 4IGHA 3GXTA 1KBBA 5BRQA 1FWNA 1TTQA 4P7NA 5C55A 3FVMA 1D2KA 3SRHA 4DN1A 3DFPA 1EJSC 1OCBA 4CD5A 4MLJA 1FWTA 1R9XA 2DIJA 2ALRA 3N3MA 4MGGA 2Y6ZA 1AJ2A 3HIJA 3TEVA 1KW1A 3EX6A 1BWKA 5IRPA 3ZR6A 3OVPA 1KR1A 3TN3A 2FB2A 4MSSA 2X1IA 4B5UA 3E0WA 1NEYA 2ZZ6A 4HMNA 2NZLA 3JZUA 2RDTA 3C52A 4KT2A 1KXTA 3WMLA 1XSIA 1N2VA 2IKGA 1F3XA 3NSXA 3M1ZA 1JIBA 3UWWA 3DG6A 2I5IA 1PB0A 3V4BA 3RPDA 3EOEA 1XJBA 2QT3A 2HROA 1HJUA 3QKZA 3CEPA 1ADSA 2IUZA 5CJ5A 4AEOA 5EMYA 4H7ZA 2EAWA 5CPQA 5TBOA 1UIPA 2RGLA 1J93A 2PDUA 3WLIA 4XAZA 4J5NA 2WBGA 1E6XM 1RZMA 5H8UA 2Y1HA 4ICMA 3AHVA 2A3LA 1UD4A 2RAGA 3MC5A 1R3RA 5IM51 4N6EA 4HTBA 3I68A 1NJJA 3UY8A 2VZVA 1RH9A 1FP8A 2C3ZA 2OGYA 4FXSA 2ZFAA 3PB0A 1MFVA 3RCNA 4G8TA 4QS6A 4IQEA 4FF5A 1J2WA 4IPNB 1EQCA 2VEFA 3BAIA 1TZ9A 1QCWA 4DELA 3REQB 4J3VA 2J9YA 1OGGA 3ZS4A 3I7QA 4TX8A 3RX2A 2PBGA 4TVUA 1XBXA 1J5SA 1US3A 4O1EA 3ARVA 4OV9A 4AZGA 3W2KA 1Z48A 1CXIA 4U28A 1JD7A 3H4GA 3OTRA 2E3ZA 4CCCA 1U1UA 4GJ1A 3DFSA 4P2VA 4LCSA 5LGXA 3CB8A 3S3GA 4AVFA 1P0BA 3G1HA 3FGCA 4NILA 3AAMA 3B97A 1NU5A 5E9AA 4LU0A 2J62A 1TWDA 3AUJA 3Q37A 7TAAA 4RE4A 4KESA 4PTXA 3P3BA 3V3WA 5AC4A 5D04C 2HMCA 1YPIA 2HDJA 2V2DA 4W4QA 4GYKA 2VQUA 2XH7A 4WGXA 4WR3A 1M7JA 1QNVA 3TSBA 1JUBA 1G9HA 3O0KA 5BNKA 3SFKA 3R58A 1A5AA 2EHHA 1A0DA 3S6DA 2PWVA 2BB0A 5D2WA 1WBJA 3WLLA 3BCDA 3FS2A 4GHRA 5D8WA 4H9UA 1YE4A 4W5UA 5AHNA 4LB3A 5A6MA 4B4FA 4IMFA 3SW6A 3CZJA 5K9DA 4A21A 1P7TA 3KZPA 4GZJA 1UWUA 1DE5A 5CLWA 1KGWA 4ZO7A 4HTYA 4GXMA 3NEHA 4LVFA 2ZXAA 1E6QM 2E5BA 5DCDA 1H49A 1KGXA 2D2HA 3QTPA 4Q4KA 4MHBA 1JCYA 2GSJA 3MTWA 1FHUA 3NM3A 4D6CA 2WMIB 1REQA 2EQDA 4N9CA 1QR7A 3EB3A 3NQDA 1KXVA 1UG6A 2ZWZA 1UD6A 1UWTA 3E49A 5DX7A 3W53A 2ZE0A 2QF8A 1KBIA 3RM8A 2E28A 5XINA 4PMQA 3E0LA 6XIAA 5FJRA 2RFGA 5MHBA 4C7GA 4NZCA 2P76A 4W89A 3E3HA 3VOFA 3R0KA 5AYYA 1Q6GA 3NQAA 3LCLA 4LX4A 1BXCA 4CQBA 1IR1A 2YX0A 1F6YA 1ZAIA 1J0IA 1UWRA 3KCJA 3WBAA 3MVTA 5DCBA 2QJJA 4F9DA 4LAOA 3CMJA 2HEJA 2VRJA 4DZ5A 5E6YA 4BS0A 5BYWA 1FKWA 1E4NA 2J6VA 1DEDA 4GI8A 4FNUA 5IXEA 3BICA 1FBAA 3AZTA 3KVJA 2V5CA 3GBEA 3MKCA 1QNOA 5J5RA 4XBSA 1T8QA 3O6AA 1P0KA 3TR9A 4B9ZA 1JF5A 1L8PA 1QPKA 3BV7A 2WLZA 1WKYA 2GGJA 2YW4A 1W9XA 1QW7A 1AMKA 4S3KA 1S5VA 1FCVA 5LYRA 1YQ2A 1KBKA 3ARYA 1JDFA 4X9YA 3M44A 1RBOB 1JZ6A 1C91A 5CQ1A 3BLOA 1AH0A 1XLFA 3SJNA 5AC8A 2ABBA 3WDJA 2WJZA 3TLLA 4PTVA 4L4MA 3P67A 4ZFMA 3VDBA 3O16A 3AJ7A 4H19A 3WY1A 4Q8VA 1VJZA 1ZY9A 3VGBA 4B2DA 1EO7A 1ZU8A 1UD8A 3ARQA 4PL2A 3UYCA 4PMRA 5FL1A 5C9RA 1RCQA 3HQPA 5HA7A 2XFRA 5AHEA 2IKJA 3VABA 3KVLA 4DO7A 3BMVA 3WLSA 5HWJA 3WL0A 3IUHA 1Q8AA 3RM4A 1KLYA 3TC6A 4MVAA 2G4JA 2XGZA 3TTYA 1X97A 3SCOA 1UUMA 4M1RA 2CZVA 2E0PA 2CBJA 2OWXA 4Q4MA 4NXKA 5E09A 5AB3A 3BC9A 4BA0A 1NQ6A 2PDHA 2MANA 3PFRA 4GQQA 2Z28A 1OADA 1I2PA 1ZBKA 3S47A 3G1SA 4O8RA 4L56A 3QN3A 4Y7EA 5D2TA 4MWAB 2ADAA 1AD1A 1K70A 2H3DA 2HS8A 3F4WA 1ZAHA 2AAAA 3L4YA 5BMWA 1VBHA 2QCDA 1WOBA 3GY1A 1WDQA 3GDKA 3PWIA 1R30A 4RDYA 4Q8WA 1OG6A 4GYFA 3QPZA 1B2YA 4ONVA 1KQYA 1MW2A 4RE3A 1XQLA 1OFDA 1SFTA 4PMZA 1KFBA 1V02E 5CBBA 2ZRYA 3RU6A 3DIPA 4YHEA 1I2QA 3K4WA 3WFAA 3KBWA 3KRBA 2P1FA 4RE0A 4WLCA 4Z2GA 3DC8A 4Y9OA 3BZGA 5F4SA 2ON3A 2PLJA 5G2WA 3TN4A 2NLYA 1VC4A 5CH9A 1UPPA 5MKGB 1AJ0A 2IQTA 2QVHA 3MCOA 4QXIA 4OHQA 3QGKC 5DEZA 1Y5WA 2GJXA 4FXRA 1XGEA 5CGTA 3B9DA 3K4DA 2JEPA 1W1B1 1WB0A 3HTWA 1F3TA 3HO8A 3GG8A 2X2YA 4EPEC 3WBYA 1ITXA 2YJQA 3AOFA 2PDBA 5TNVA 4BKNA 2C14A 3LI1A 5JH1A 2GK1A 1TJRA 1QI4A 2V3FA 4PUUA 3R0UA 2XZ7A 1FWGC 3AMLA 4XD4A 2RGMA 3B4UA 2IQ0A 3B0UX 2G95A 1XLDA 5CC5A 5HR7A 2E68A 2VI0A 3O8AA 4LCRA 2W5FA 4B16A 1T5AA 4WGHA 5B80A 1RA0A 2V5DA 1A5NC 2BWGA 2VGIA 1DQWA 2CETA 3HGOA 1S3TC 3T6CA 2BX7A 3T40A 4QX4A 1QBAA 2ZXBA 1UB3A 2VMFA 1IT8A 1VIZA 4GVIA 1CNVA 1EP2A 3I6EA 2HE5A 2OGJA 1T99A 1XICA 1V3IA 2NUWA 1LL6A 3R89A 4I5RA 4B4HA 3R13A 3URNA 1IIHA 3VE9A 1VEPA 4LNYA 1XUUA 4A3YA 3BAKA 3CTLA 4I7UA 4NL1A 3MHUA 5XIMA 3W00A 4CU7A 4ZSUA 4GI4A 2ISVA 2Y85A 4RJEA 1LZOA 2D69A 1VJIA 3GIQA 1KO0A 2ZUSA 1G4PA 1K1DA 3PBGA 4RZBA 1JUEA 1H11A 1KRAC 2DEPA 1V4YA 3PG9A 3TE9A 4KCVA 3P0XA 4UBPC 2NQ5A 4V1XA 4NNBA 4EIVA 5H8MA 4P8UA 3VMOA 1RBAA 4OGZA 4PMXA 3BLIA 3CWOX 2QPSA 1QOXA 4HCLA 1ISZA 1XLKA 2VEIA 3H2MA 4H8VA 1ZL1A 1XXXA 5HPOA 4BWLC 1EWDA 3WMCA 1SPQA 3ZWSA 4MNKA 1EO5A 1XFCA 2WM1A 1E40A 1QW8A 3ORWA 4C6JA 3U2EA 1BSIA 4ML9A 1A0CA 1XLLA 1RBLA 1F73A 3C2EA 3A24A 4PZVA 2FHBA 1NH6A 4H8UA 3J7HA 4O57A 2GQAA 1JCXA 3QY7A 1MEHA 4GZIA 4ZE5A 4H6RA 1G5AA 2Y24A 1PCKA 2Z00A 1EX1A 2PBOA 4Z0JA 5D09A 3BXWA 5HMSA 4JDBA 4KS0A 4QEEA 1FDZA 3I7SA 1F7BA 4NHVA 1YPXA 3TU9A 1NWSA 4WKAA 3SGZA 1RLDA 1TVPA 3O2LA 2A21A 2PWUA 4E3VA 2PDPA 2BMBA 1TPDA 1OCNA 2YOCA 4DNMA 4IMGA 1RQEA 4DAIA 3ONBA 3VC6A 1A3HA 4YL2A 1LWJA 3VCCA 2Y70A 1W31A 4Q32A 4B3LA 3DFHA 3OZMA 5BZAA 2OO6A 1WV2A 3CT2A 1NOUA 2DH3A 3V75A 1G4SA 1NP2A 1XM3A 2WKJA 3STPA 3EXTA 3QY8A 4AXKA 1TWIA 4L1XA 1S2WA 2CLOA 1EUNA 2WVVA 5D32A 4GIRA 2PGEA 4LC6A 3GIPA 1NFBA 2BASA 1MO0A 1H0IA 4ZB5A 4E5TA 3OEXA 5FEZA 1LQAA 5C9WA 3F2BA 1W2VA 5HPCA 1WKFA 3UR7A 1TPFA 4XKMA 3OIXA 4TR9A 4IMEA 3PP7A 3ZR4A 5FOOA 3L0NA 4K2SA 1K77A 4W88A 2SFPA 3O7UA 1FX6A 3T2OA 2W6RA 4I90A 1W3HA 4EXBA 3P5YA 4WCJA 1MNSA 2DIEA 1IEQA 2VDHA 1AQMA 1E0WA 2EXOA 3QQ0A 2WSYA 1MI3A 3DG7A 1K8CA 3TR2A 3NYDA 1V0KA 3ELFA 1R7AA 4JTGA 4GXWA 2XUCA 1SGJA 3GDTA 3GFXA 5HR6A 4HCHA 3S5YA 4NJHA 4LNCA 3VK5A 3IVTA 4PMUA 3MSDA 2DIKA 3E6EA 5FEXA 2DT3A 3WH8A 3MY9A 2VP8A 4AC7C 3G8RA 3P7YA 1NWUA 3L4TA 4XVEA 3FAWA 1QNSA 3N29A 4NRRA 1NDWA 1E15A 4PRRA 5M17A 2FVLA 3BURA 4TTGA 1MZHA 1MXGA 3H8AA 4A8NA 3NPUA 2PLCA 4LH8A 4M8UA 3OW1A 3W86A 5K4XA 1JDEA 1UKOA 4A3QA 3MO4A 4N02A 3HFTA 5A8MA 3AJXA 3DI0A 2JF7A 1HUVA 1YNYA 1G7UA 3PPHA 2HNEA 5FL0A 3RM9A 3PTKA 1TA3B 2GDQA 1I6NA 4KEZA 2WMKA 1U30A 3K46A 3LQGA 3OGVA 3SBFA 4KPLA 3OHMB 1VKFA 5AECA 3N25A 4I9MA 4DUOA 1JDDA 5JXQA 3LHTA 4EF9A 4XAFA 1MEWA 1OM0A 4UR8A 3CUFA 1S1RA 2B31A 3IJLA 2DW7A 3GX9A 2WZEA 3NL6A 2XSBA 4IFRA 1NELA 3MMDA 9XIMA 4M51A 3MKVA 2A3AA 2BG5A 3BANA 4FX6M 3MHGA 3U48A 3ITXA 1DJWA 4FEZA 3QW3A 1J10A 1RK5A 4H9MA 5L9FA 4J9JA 5FF4A 3ANUA 3MSGA 4CD7A 3KVMA 4LAUA 3FK4A 2XN1A 1UJPA 1W54A 4GKTA 4UQ9A 1ICSA 4KCTA 3MMTA 4AUBA 3GU9A 3UR5A 3TSMA 3BCFA 1W1IE 1BYCA 3GXNA 3B0VC 3S1GA 1AL7A 3W7EA 4HYVA 1QRQA 2QMJA 5FCZA 3M47A 4HP5A 2FJKA 4RV8A 1UKPA 2PLKA 2GPTA 7CGTA 2CITA 3DCPA 3WQCA 2GJNA 4RZ4A 3GW0A 3NL3A 3UD6A 2YXOA 1YTKA 3G1XA 4R27A 3WUEA 4CQ9A 3KBSA 1KR0A 4OBTA 4UOQA 3KTCA 4RXFA 2ZVIA 3VNZA 5HATA 4TV6A 2ZUVA 4PULA 2WWDA 3RMEA 1KKRA 3OGSA 2B0MA 4EOUA 2W3ZA 1FCUA 1MDRA 3UQNA 2PU0A 5BOEA 2DQWA 2NQLA 5PTDA 1Q2SA 3BCJA 3SN1A 4E2DA 4WZHA 1W9BM 1XBZA 4B5TA 1JZ7A 4B2DD 4CU6A 1W9PA 4HU8A 3EWDA 2G5WA 5A6JA 3REQA 4NRSA 2ZZ4A 2PD9A 4DRSA 5AC5A 2R1LA 3K8KA 1XBYA 5D4YA 3E5BA 4QG9A 2VO5A 2ZUWA 3TDFA 4NKCA 2EPKX 4HVXA 5C8BB 4PB5A 2F9RA 4QAIA 1JD9A 1M6JA 2GVLA 4ZVJA 4JTQA 2ASHA 1VGAA 1EA9C 5T9BG 3W28A 4QG6A 2XFFA 1KV5A 3W84A 3MUXA 2REQA 4AC1X 4H8HA 1EWEA 1OB0A 3W2MA 4PSRA 3TC7A 4L4LA 4Q4RA 5I3GA 4G7FA 2AQWA 1AUSL 1K6AA 4YWSA 3I10A 2NW0A 1KM5A 1BRLB 2OZTA 1VR6A 3GXFA 2VCAA 4HJWA 3T0DA 4MB5A 5I09A 1TREA 3IK4A 1X1NA 1JFHA 5EMUA 4MADA 3TYUA 1W6TA 4GABA 4HYRA 1TCDA 3CLMA 1TE1A 6REQB 1FUYA 1W8SA 1ZQ5A 3LDVA 4GY0A 4HK6A 3HG5A 5M2FX 3AFBA 3NTYA 4PB4A 3NQ7A 3E02A 1KM3A 5FI8A 2E4TA 3H24A 5CEWA 3T1GA 1UWSA 3W6LA 1XLEA 3WD4A 5HAOA 3P14A 2OSWA 1HX0A 2CZFA 3CV1A 1R85A 1SYTA 1QFEA 3DAQA 1K9TA 1G67A 1T40A 1H4PA 3IJQA 5A2BA 1QO2A 3L0KA 4E4PA 3R79A 1UR0A 4EPDC 3GUGA 2E8ZA 3MANA 4O53A 3QTGA 1S2AA 3CS2A 4PTDA 4LV4A 2NX9A 4HJFA 2PDFA 1L6FA 4RKAA 1JZ4A 1L6SA 4YYCA 4JN8A 1UH4A 3BE7A 1POKA 3W3OA 1PKLA 2G37A 5HXMA 3CXOA 1F5ZA 3FSUA 4U31A 2ZA3A 7REQA 1K7XA 4A3UA 3RG6A 4QITA 4I5XA 2NLIA 1K9DA 3LCHA 5A69A 4F3HA 2J9XA 3MVIA 3KCLA 1QOPA 1OFPA 1V03A 1UD2A 4WVXA 2FMOA 2QCCA 4WSJA 1SJAA 2Z24A 4GUFA 4XG1A 2GVYA 4Q7BA 2BDQA 2ISWA 5M03A 2X16A 4B9YA 4UNKA 1B1YA 3WLRA 1FWRA 4NAEA 4M6QA 3G1YA 2IW0A 1T6MA 2V5BA 4E3TA 3G1VA 1RY0A 2Z4GA 3V36A 2P50A 2WCAA 2ZRZA 5LSMA 2YL5A 3OZOA 4GNKB 1DORA 4ZZ9A 3CNYA 1W1A1 1OY0A 4DBEA 1F2JA 4DNHA 2DQXA 3MV11 8XIAA 1W8GA 3VNJA 1B3OA 1ISXA 2F6UA 4AEFA 2X41A 2FTPA 1DJHA 1UROA 3NXFA 4XAGA 2OFJA 1KBLA 1SQ7A 4UQCA 2DSWA 4PH6A 4ADUA 4J7RA 1XCFA 1PYMA 2C7FA 1IZJA 3CT7A 1U2YA 2Z7GA 3FNDA 2CBVA 1CGVA 1OX4B 2GYIA 3G6LA 4NXSA 3DGBA 4OE7A 2QYGA 1IGSA 2FZMA 2VWSA 2CZ5A 3T4WA 2JKPA 5DN1A 1X8FA 1SSDA 3H23A 5CBIA 3WZ0E 1H1ZA 3GLCA 4KWWA 4O11A 1XG4A 4FOJA 3BGJA 5CAHA 2EKCA 2WLYA 3KAOA 2H9AB 4AWUA 2YCJA 1WO2A 4AYGA 3VOIA 4ZENA 3WQFA 4JEJA 4F2BA 4DJFA 4XZHA 3F5JA 4H6QA 3Q94A 3OLIA 1I45A 3K2GA 2A79A 3DX5A 4FNQA 4KFNA 1QPRA 1XDJA 2DVXA 1E0UA 3T0CA 1YW1A 1BAGA 2YXXA 1XYFA 1KFKA 2FDMA 1FY6A 5CXPA 4YPJA 5DMLA 3HOJA 1XRSA 3P84A 3D3AA 4NP7A 4OTKA 1PXGA 3W29A 3T8LA 1E51A 1CXHA 1A49A 4PA8A 3B0XA 4GCXA 4ZE4A 2RDXA 2OQLA 4JKKA 1VBJA 3WJXA 1UQZA 2VGBA 5LXXA 1ZJAA 5HJXA 3V5FA 3W7CA 4MJ2A 3QMTA 2PDXA 3SGGA 4UCGA 2CNCA 3ARZA 3GTHA 4J3SA 3LHZA 3N15A 3E74A 3PUGA 1KD0A 5LNRA 2QCNA 4HHPA 3VD3A 4IFKA 2C1GA 1J79A 3N6QA 5LNVA 1ONRA 1W1TA 1IXQA 3NYZA 1VFOA 4GBUA 3MUCA 3BH4A 3VAVA 4IP5A 2DZWA 3IRSA 2YDAA 2WCGA 1QT1A 3TKFA 4CCZA 4YU1A 2Y8UA 1HZYA 1N8IA 1OT1A 4JTAA 1IXPA 3W7HA 1BG4A 4JX4A 2XN0A 3H6OA 1RK6A 4Y96A 2QJGA 1P48A 3TYBA 3CPGA 5DFAA 1EUAA 3OA5A 1F76A 4JGDA 2XWDA 3PSVA 1AJZA 3DKLA 5F2MA 4GWEA 4HN8A 3OIHA 4REQB 4HA0A 4KIEA 2RJGA 1IZKA 2QDGA 3A9IA 7ENLA 1KWKA 1ZTVA 3MJYA 1KFLA 3ID7A 2H6RA 4UOZA 2OT1A 2VR4A 4W8LA 1B3ZA 2CWXA 4XZ9A 2QPUA 3U3HA 3JR2A 2ZUNA 3LSCA 2J74A 2PWGA 3A5FA 1U1JA 1GHSA 2OXNA 4LJ3A 6XIMA 3TIMA 1QJWA 3ITOA 2HBVA 2VX6A 4C6LA 3VNDA 4G5DA 4J27A 1TJPA 1S5WA 1G4EA 1XGDA 1BTMA 2F6KA 3GHRA 4D6DA 4IPIA 5CLTA 4MTVA 1I1WA 1DJZA 2OWCA 3NPXA 3CL8A 1IWPA 3N2MA 3KOFA 1AD4A 1Q6DA 4F0KA 1ZBVA 3ARWA 2A3CA 5LIKX 3P2VA 3USZA 1K02A 1KBJA 4MM1A 4J1OA 4BJHA 1EXPA 5CZTA 3QZAA 5G1YA 5FF2A 3NSNA 3VGDA 3S2LA 3VPLA 1VCFA 1YADA 3D46A 2ICSA 3IAQA 3MP4A 2CZDA 3LRKA 3K30A 1XBVA 1N8FA 3UESA 4ZB0A 1RSCA 3E38A 2DZUA 4MKNA 4UUIA 1ZCCA 4GE8A 5EKYA 1PKNA 2ZZ5A 5FAGA 1TB3A 2A7NA 5I3KA 1L2QA 1XRFA 3WKZA 2V69A 2X7VA 3THUA 2RUSA 1DJIA 4GH1A 2AQOA 3GTNA 2B81A 2NT0A 4I6KA 1V8EA 4PEEA 4YWIA 3LNMA 4GQBA 3UU0A 2C8NA 4OV4A 3RDKA 5EMKA 2QV4A 3N4FA 3PUOA 3W7MA 4HNTA 4RDVA 1FTXA 4L65A 1PE1A 3VOHA 4F9JA 3CUGA 4KERA 4UZUA 2VURA 4CVUA 4AIBA 2WHLA 2YFOA 5KETA 4KIRA 5D33A 3V1PA 4AD5A 5KEZA 2X0SA 4O1AA 1E0TA 2PDIA 3HQNA 5GVJA 3LLFA 3I6TA 1UHVA 4XSMA 1M01A 3PZNA 4WSHA 1RP8A 2DSKA 2A7PA 1LDCA 2Y89A 2BVWA 1RD6A 2J7EA 1BFNA 3VD9A 3LYEA 3EX1A 1O95A 1OIFA 1THFD 3RR1A 3GDRA 3SUUA 4Q7IA 2OLSA 3L4WA 4DBUA 1JF6A 3MSRA 3UJFA 4LEFA 3VD5A 4IG2B 1A3WA 1MW1A 4OT7A 4NZ5A 4POCA 4JFVA 5AY7A 5T8GA 3C5QA 3M5VA 3UW6A 3FSTA 4GLEA 3U4AA 4PBGA 2QUUA 1X6NA 4CNNA 2BHUA 2DJXA 1JGMA 1CIUA 4E4UA 1K8ZA 5BU9A 3GBDA 1I2RA 3IIPA 1DIOA 3G18A 1XIFA 2WPGA 3Q58A 3K4AA 3LXBA 5BXSA 2FVKA 5J8LA 1J6OA 2EF9A 1E6RA 4JYEA 4BI7A 4WDTA 4OECA 1HJWA 3DERA 3PZ9A 2DZBA 4GGHA 2C1IA 4UQEA 5D05A 4W9TA 1XH0A 4C6IA 4UR9A 2E7FA 2OB3A 2ZRWA 3E96A 3CLWA 4MUZA 2YA1A 3CJPA 3PTDA 3LERA 2ZTKA 4JQ2A 3VFLA 4QLKA 3E5PA 1PCWA 3CL6A 1TV8A 1D7FA 4O4WA 3VNMA 3W7PA 3P82A 4L80A 4IMAA 5D2YA 1LQ0A 1LCOA 3TC3A 4CD4A 1W5NA 2X30A 3TFXA 4DHGA 3O9NA 3PBWA 4Z1AA 1V3JA 1RVKA 1FH9A 2XM2A 2GUBA 3EMQA 1PAMA 4ZTXA 3TZNA 4XISA 4ASTA 3SRDA 1JL8A 3TA9A 4DJFC 3O6CA 3OGRA 2X05A 1UIOA 2XVKA 5EBUA 2Y5SA 3VOGA 1HGYA 2A85A 4TU1A 4PUMA 4D9PA 2HNHA 2HXTA 4MWAC 4JTEA 3ARXA 2DV0A 3OG3A 3VFCA 5C9ZA 4ROQA 2D22A 4GVHA 4RNHA 1OC6A 1GQKA 3AXXA 1C9WA 3W6YA 4DJEA 2X0YA 1WA3A 3RHGA 3INPA 3KE0A 3VVGA 2WZTA 3QVQA 4MPKA 2V3EA 2A3BA 1R2RA 3QSRA 1R5YA 3GDBA 2E5DA 1P0DA 2GGHA 2ACQA 1UWQA 2FH8A 4LRTA 3EX2A 3QFEA 4FI4A 1O5QA 1KCLA 4DO4A 3O0FA 4Y8FA 2QZRA 2YL6A 3W2NA 4FAMA 5F2GA 2OSYA 2P0IA 5G4WA 3GKFA 1CLKA 5AOUA 4G7EB 3AS1A 4ZA0A 3G8EA 2PB1A 4QE5A 4ZODA 3ZLGA 1JCNA 1V6UA 3ITTA 2J25A 1NDYA 5H91A 3W7QA 1LRTA 1TFVA 4H7VA 4KMQA 3S1WA 2FDSA 3MP3A 1FWHC 3AYVA 2FMNA 3CK5A 2X09A 2FKPA 3DI1A 4DZHA 2W92A 3K8LA 4I9JA 4EAYA 3L7RA 3BQ6A 3VIOA 5EU9A 1RJRA 5BOFA 1GG1A 4LTSA 4V15A 5DBUA 3MCNA 1MNZA 3OP2A 1BGAA 3SUWA 2IXUA 1QUMA 4OZOA 1PDYA 4QS5A 1Q6OA 1XYMA 4KFPA 2DJLA 3POCA 1W37A 4XD6A 4YJ5A 2NT1A 5DY3A 1QK0A 2GJLA 2I57A 3BTNA 2P8BA 3LV6A 1WQ5A 4DJDC 3S9IA 2WHMA 5HK4A 1SO4A 2CERA 2BGNE 1NF0A 3AIRA 1XW8A 3A3HA 3EPNA 3SCPA 2HTMA 3H22A 1BHGA 4PMYA 2QGHA 4AISA 1JQXA 1IIGA 1GPFA 1JRCA 3EA3A 2MNRA 2CLHA 3M7WA 4UTMA 4CUCA 4GY1A 5EMJA 1X1ZA 4XZBA 2OEJA 2PZ0A 3OA3A 4IX2A 3A4AA 3ECQA 1CLVA 1F74A 1MMFA 4PCSA 5BU6A 3VM5A 4GINA 3RGTA 2PWDA 4NSBA 1PTAA 3EMCA 3AZRA 4L1WA 1RR2A 1FWWA 2TPSA 1QXLA 1YNQA 3FN9A 3UWYA 2I9EA 3C2OA 4G1NA 3VE7A 3ISIX 4DJFD 5GNZA 1KXHA 4ZCWA 3UVIA 4FLSA 1P0NA 2W79A 3VCRA 1R2SA 2PDKA 3AHYA 5AYZA 2OMAA 5EY5A 2ZDRA 2FPTA 4QSFA 3SEPA 3U5YA 1SMAA 1U33A 3LZ3A 1DJGA 3GRIA 4NJJA 3P62A 3WX7A 1XLJA 2WHKA 1NVMA 2PA6A 1HJVA 3FJNA 1JNEA 3D0CA 4HZ7A 5A3HA 2DUZA 4PBEA 3TZFA 5LIYX 3IEBA 4DWSA 1R47A 1WZLA 2PMQA 5EMMA 3S42A 2A7RA 2HJPA 3SURA 3IJ9A 1K4GA 4YTTA 1UOKA 4DI8A 2BP1A 4D1IA 1KM2A 2XZ9A 1DYSA 2DPEA 1WDDA 3GHTA 3FFSA 3OLEA 1EEXA 4O52A 1FHLA 5C7VA 3WNMA 3A6OA 2Z2AA 4RDZA 4O28A 1GOWA 2Y8KA 4QQ3A 4G6CA 2R1PA 4HB7A 3PNUA 5LXEA 1QI0A 3T42A 4AD2A 5AZ1A 4AY8A 5EB8A 3EDEA 3WQDA 2XIOA 3PSWA 2OX1A 5FACA 2C6QA 5H8PA 1RVGA 3FGCB 2V81A 1HT6A 3A4JA 4RR4A 3N1AA 3OVQA 3PZMA 1UCWA 1ZCOA 4FO4A 3QRHA 3HGJA 3V1HA 1R87A 2XWEA 1XS2A 5CPLA 3RJXA 1TV3A 1GYLA 3LX9A 2ZC8A 4O8AA 1JYWA 4BHYA 1BVNP 4DYEA 3OG2A 3L4XA 3S4TA 3PJWA 4WY0A 4S3EA 5F4WA 1J4EA 4WD0A 2HPMA 2YPIA 1MYRA 3RX3A 3QYQA 4C60A 1H41A 1H63A 4XD3A 1Q4WA 4XQ6A 1PUDA 4K39A 2QAFA 4Q4SA 5J04A 1PIGA 2YYUA 1TIMA 3WL1A 4M56A 4S3DA 3ZZ1A 2BVDA 2VDGA 3TFCA 3EX4A 3H70A 4HIBA 3KDOA 4LY4A 4YN5A 1P7TB 1MXSA 1GKRA 2J79A 1KV8A 2C0HA 4IJRA 1EF2A 3BW3A 3LQLA 1C8VA 4OFCA 2WZMA 4KWSA 3W71A 1HW6A 5FF0A 2R6OA 3QGAC 3JRKA 1KRBC 3DYMA 3C2YA 1Z8AA 4JTRA 2GL5A 3UG5A 3SRKA 2QCHA 4MPQA 3NVDA 5AYBA 3N4EA 1S5MA 5LGZA 3H2FA 1REQB 4B5WA 5I3HA 2F2KA 1Z69A 3IAPA 4F2UA 3QEZA 1A5CA 2I14A 5KSWA 1P6BA 1GOIA 5DO8A 1VEMA 5CSSA 4W7VA 4IP4A 2IXVA 3U7BA 1DL3A 4GNJA 4JBRA 1ICQA 2QVNA 4HK7A 1Q6EA 1E71M 2WC4A 4MAVA 1EDQA 3DHDA 4K38A 3CQIA 2NV2A 3C0JA 1XRVA 1CXKA 4K8HA 1TCMA 4HK5A 3S2JA 4AHPA 3D5HA 2E1WA 4W87A 1XISA 4OWGA 2YLLA 3STFA 3KWXA 3WSUA 2PDGA 5I03A 4HNVA 4O0QA 3CH9A 1ZJIA 4YIWA 3RXZA 3TMLA 1P43A 1XLGA 3NZQA 3OODA 3P93A 1G4TA 3CPUA 5A8PA 4JTCA 2V30A 3QXBA 4Z42C 1Q2RA 4YVVA 1LRQA 1WYIA 1I75A 2PF8A 4I9AA 4C1NA 4DXKA 2ZUMA 1K03A 3DU0A 1ISYA 1HL9A 4MNLA 5AYIA 3ARRA 3BW2A 2W63A 4EWJA 3MUIA 2VZUA 2J66A 3HG4A 1EIBA 1U5VA 4LXFA 5U4NA 3VXGA 3BV4A 3LHWA 4GVGA 1DE6A 3GVWA 1B0IA 2JE8A 5FJOA 2X0HA 2ZUTA 4CVWA 2OTDA 4L6OA 3W7NA 4GI9A 4RE2A 4GOAA 4DLMA 2JEQA 3PJXA 4GIAA 1ME8A 2GJRA 4W93A 3WH9A 4J3XA 5CZKA 3LRLA 3GG7A 1LBLA 1RUSA 3FA5A 4JTFA 4OUEA 3C0SA 1F07A 3AHZA 2WXDM 3CUJA 2ZIDA 3UFYA 4GPNA 4QNEA 3ANVA 3PJUA 3VMPA 4A29A 3VOCA 3PB2A 4JQ3A 4KRUA 3S9ZA 1S5NA 3N4AA 5CGQA 5CPMA 4AIUA 1CCWB 1HKJA 3MUZ1 3NSMA 4FNTA 3ZIZA 4JD4A 3ZR5A 4K6AA 3GO2A 3T81A 1JULA 1DHKA 3NAVA 3DHFA 4AVOA 2FGLA 3AHXA 1AW5A 1E6SM 3CU2A 1VPYA 3WFLA 4NVTA 3SDOA 1ZB5A 3D47A 3VNKA 3SJ3A 2CHNA 4D6EA 1XP3A 2WKLA 4PL1A 1BWVA 4RV3A 3G1RA 1Q7QA 4ACZA 5IHRA 4HZ8A 1S2CA 3L2IA 4YTRA 5E6ZA 2C16A 1E1CA 2PCQA 1OZMA 1I9CB 3RAOA 4AY7A 3RLUA 3AIQA 4AY1A 1U22A 2VC7A 3R8HA 3ZQ9A 3HZ3A 4B3ZA 1UC4A 4MB1A 1QAPA 3LRMA 3WH7A 4JEQA 1N7KA 3PPFA 2BOGX 4HOZA 1RAKA 2A6LA 2QDHA 4PTWA 4WX2A 4MUPA 4LSBA 3WUFA 3UG3A 3ARPA 2GJXB 4BR1A 3RJYA 3ZWTA 1WX0A 1XF0A 5IBXC 4UFLA 3SCNA 3PAOA 4JFTA 4PCTA 4F79A 1OFBA 1C8QA 1TJ1A 3BWWA 3W7LA 2E9LA 2Q71A 1EIXA 1I2NA 1SU5A 3T07A 3W26A 3VZZA 5GJPA 3W25A 2GK1B 2OQYA 3EEGA 4FSAA 3U2ZA 4MFDA 1BVZA 1F9CA 1FRBA 3C3NA 1YXYA 3CO8A 2W91A 1FOBA 1E55A 4LUIA 8RUCA 3S0CA 5I24A 4CLMA 5BXRA 3GM8A 2IQDA 1E0XA 3R1ZA 3IV8A 4YVPA 4Z2IA 3U9IA 1W0MA 3CQ0A 3NOEA 2R82A 5A6SA 3TJ4A 1OK4A 3A4WA 1A5BA 1XIBA 4JN7A 4N7QA 4CEUC 5T26A 4QSHA 1D3HA 3WYZA 4G56A 1UBPC 1HIZA 4ZEPA 5ABTA 2QF7A 4KWOA 3MW7A 4EP8C 4GIEA 3AXKA 4P8XA 1XIMA 1QK2A 1J12A 3OZYA 4MZ1A 2RKXA 1PX3A 4LYQA 3UVAA 1AZ2A 3KP1A 4JIIX 1FFQA 4DQWA 1E3ZA 1KA9F 3UGRA 1HF6A 2XHYA 1GVIA 1R0MA 4AZHA 2D24A 4XO7A 5CGMA 1SZGA 4PMOA 1PKMA 2VHLA 3MYPA 4Q4OA 1OK6A 4AXNA 3BARA 4AWSA 4Q6JA 2BBFA 3W07A 5HDRA 1Z41A 3TMQA 1VIWA 3M43A 3NZPA 2QDDA 4JFSA 5G1TA 5LHFA 3KRZA 2NX3A 1SVDA 3SGUA 2P3EA 4AU0A 5E0CA 3WDQA 1AW1A 2ACRA 3PG8A 3EEZA 3N6HA 2BY3A 1I60A 4PE8A 4CEXC 1FWAC 4GUGA 1BXNA 1KQZA 4JX6A 3RRXA 4UZSA 2BGSA 3M0MA 4U10A 1YMYA 1SZRA 2QJMA 3EKGA 4FP1A 3L66A 4PMVA 2KX9A 2OKOA 4GRSA 4US5A 4A05A 4Z1BA 1J5TA 1XGZA 4UTWC 1E4LA 1XI3A 4GO9A 2ZX7A 1WKEA 3TYEA 4XUYA 3EWYA 1XLMA 3R11A 2HQAA 4LW7A 1IWBA 2V2CA 4H01A 1E43A 3PC0A 4W5ZA 4XV0A 2F2HA 4LYRA 3I4EA 2LLEA 2Q02A 1S46A 5CKSA 1Q6FA 4X22A 3HJZA 1W32A 4EVZA 4PUDA 4RNIA 5C6MA 1B4KA 2D2JA 3FAXA 5HJYA 3HJEA 4RNFA 4UNIA 2D3LA 2Z6IA 3A3WA 4TOQA 3M0IA 1ZP3A 1M5WA 1K3UA 1PTGA 3M46A 3PY2A 4LPCA 1EP3A 1UP2A 2C15A 2NX1A 1LBMA 1MXDA 4ILSA 1PWLA 3RO6A 3WQEA 4C6NA 1A53A 1M7PA 1UZDA 2VEMA 5A2AA 1ESWA 4H6KA 3GUWA 3GHUA 2YB4A 2DVUA 1F4AA 1FFRA 2AKZA 1FCBA 5HQEA 1MW3A 1EKOA 4TO8A 1AW2A 2PDYA 2J6XA 2WVVB 1GZJA 3PM6A 3GVVA 1FWIC 4Z2JA 2PP0A 4O54A 1EC9A 1US2A 2QCMA 1NP0A 2VRKA 5ECVA 1WP6A 3W1XA 3GS6A 5FJPA 3VCNA 1AK5A 4UTFA 3UWUA 2G41A 3M0YA 4NASA 5IDIA 3U2OA 4HSOA 1B54A 2Z2BA 3QHOA 4MNJA 4DZAA 3TCEA 4UFJA 2GVEA 2XH2A 4JNYA 3PANA 1UPMB 3FDGA 3OBKA 3TH6A 3A12A 2IPJA 3CASA 3G6MA 4WUIA 4QEHA 3KL3A 4F0SA 1WZMA 4GX9A 4G1KA 2G3JA 5AKQA 1GEHA 2YL9A 3MUY1 4NZ1A 3L4VA 5GJNA 4MY1A 2GWNA 4UCFA 4HOWA 3CIXA 2VEPA 4DF0A 3AALA 1MDLA 3E9AA 5I2UA 4ML4A 2XVGA 1O5XA 4GQGA 3LGGA 2BGQA 3WDPP 4W7WA 3A22A