4YLWA

Crystal structure of human dihydroorotate dehydrogenase (dhodh) with no.33 compound
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
364
structure length
363
Chain Sequence
GDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human dihydroorotate dehydrogenase (DHODH) with No.33 compound
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Dihydroorotate dehydrogenase (quinone), mitochondrial
total genus 139
structure length 363
sequence length 364
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2015-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4ylwA00
1M7PA 3L5AA 1N8FA 3SW6A 5CPMA 4JXCA 4MPQA 1OHLA 5FF2A 1QPRA 3NPVA 8TIMA 4HHPA 4NNCA 2A7PA 4L4LA 3INPA 4O4VA 1G6CA 3KX6A 3LBCA 3LRLA 1W37A 2V2HA 3JS3A 4ADSA 3TH6A 2ZA3A 2YPIA 3W7RA 2A2IA 1THFD 2ZFAA 5AC8A 1HFBA 2E5CA 3ATZA 5HWMA 3TDFA 2J27A 3GX9A 3CM4A 3MP5A 1FWNA 3HGJA 2VFGA 4EF8A 3HGRA 2ZQ0A 1XC4A 4YCOA 1QPOA 3UWVA 5CZTA 2HSAA 5FF0A 2V2CA 3QPYA 3GDRA 1I2QA 4RCXA 3KRUA 1LTDA 3WK2A 1RPXA 2G96A 1U5JA 2DU2A 1W5QA 3G3DA 2ISWA 2Z0IA 5E1QA 3KVLA 3S0CA 1KA9F 3NDOA 4MUZA 3IEBA 3B05A 3MI3A 3GR8A 2WOQA 3PBVA 2DZTA 4O57A 5K9XA 3FIGA 3ZR4A 4YWIA 3NQ8A 5D05A 3S1VA 1MEHA 3W2LA 3O6CA 3NQFA 1RR2A 3FLUA 4FIRA 3T4CA 1DL3A 2A85A 3QYQA 3KOFA 4JY8A 1A5BA 1B3OA 5CPNA 1VHNA 2C18A 3L67A 1QPQA 1G4EA 4CQAA 3M5VA 3V1PA 1JVNA 3S8HA 1VYSX 2R91A 1LROA 4B5NA 4QQ3A 2EAWA 2C19A 5DLCA 4QITA 4MYAA 1SUXA 3W7DA 3DFTA 4DF1A 4X2RA 1FWSA 1I4NA 2XN2A 3HOJA 1K8ZA 4HNUA 1QPNA 2FB3A 3I7QA 1EUAA 1EUNA 5K7JA 2QUTA 1JCNA 3LCWA 1UCWA 3UWWA 1TREA 3ABRA 1DBTA 3L21A 4O8RA 3KFTA 1TJRA 4DEFA 1Q6OA 3W1XA 1WXJA 1FXQA 1TPUA 4JTTA 3FKKA 3NQCA 4M6VA 1R2RA 1WBHA 4R7JA 3RU6A 3MYPA 3IVSA 5AHIA 1ZJIA 4Q4KA 2X1SA 2JK2A 2X1TA 3H54A 2BTMA 3PR2A 1TV7A 5DBTA 5H2ZA 3RLVA 3CEUA 1LOLA 3NQ7A 4AVFA 4P2VA 3EX3A 5E93A 3NQEA 2RH9A 3SZ8A 2A21A 2NUWA 2B4GA 3UYCA 3MW7A 1HUVA 4AH7A 5F1UA 1GWJA 3TQVA 5D04C 4I7WA 3VE7A 2DZWA 2V5BA 1QFEA 1DKWA 4A3UA 3PS7A 2WKJA 3C6CA 3N14A 5CZSA 1GYNA 5D2VA 4NNBA 2YYUA 3E0IA 4LC6A 1FDZA 5I3GA 1QOPA 3RFAA 3V75A 1KFBA 3P81A 3G1HA 1TRIA 1MO0A 4AB4A 4OU1A 2Y61A 1DJQA 1GT8A 1QO5A 3NO5A 1TV5A 2P1FA 1S5WA 3P8IA 3NGJA 1HL2A 3LRMA 1KTCA 3HB9A 5D38A 2ALDA 3PUOA 4UTMA 1S3HA 2FDSA 2WJZA 1G69A 1P1XA 4XBKA 3EWWA 3M44A 1NSJA 1VCGA 4AXKA 4K8HA 1VLWA 1OFEA 5H91A 1AW1A 5AB3A 1IIGA 5J5RA 4LW7A 1OFBA 3QFEA 4WD0A 3PM6A 3RNDA 3M5XA 1H7WA 1DV7A 2DORA 3L5LA 1P0KA 4NU7A 5BOOA 2ABAA 4AF0B 2Y7EA 3DH7A 5HWJA 1OFQA 1TPFA 3W86A 4TU1A 4ZQNA 3QM3A 5DBUA 4UC5A 3IVUA 5CSSA 3B8DA 5DY2A 1JR1A 3S5NA 4GBUA 1VR6A 2PCQA 2DZPA 2O7QA 1JJKA 1A50A 1XBVA 1OG0A 5HUOA 2EF9A 1KLYA 1GQNA 5HINA 4JN6A 2BZNA 5DY3A 3MI6A 1LOQA 3DKJA 3PB0A 1P4CA 4JDBA 5KSWA 4MFDA 3PB2A 2VKZG 2Q3OA 4O15A 2ATMA 1D9EA 1ADOA 3QQ0A 4QISA 1TRDA 1GVOA 4LV4A 1PHQA 3U2OA 1KM2A 3P61A 2WSQA 3ANYA 2YW3A 3NYZA 4R53A 1W3NA 4JEQA 5D2WA 3TC7A 1LRNA 5AHLA 6ALDA 4O1AA 2CZEA 3PY2A 3S5OA 2W6RA 3THAA 3BPWA 1B57A 1IF2A 4MZ1A 3PG8A 3LTPA 3MMTA 3NM3A 3ZWSA 3EB2A 4CQ8A 2C14A 1UBSA 1KFEA 3GDLA 3M43A 4LVBA 4M5PA 3USBA 4FNQA 3FJ6A 3G1SA 4BR1A 4OWGA 3TX9A 5CZ0A 5AHEA 2HS8A 3MYOA 3IV3A 2JGYA 4WJEA 1IXPA 3G1YA 3P5ZA 5FF4A 4E0CA 3TA6A 2V82A 3MBDA 3WK0A 4JS3A 2B0MA 4YCPA 5EKYA 2W0UA 5AOUA 1RQHA 1OK4A 1TO3A 5D32A 2NWSA 1CI1A 3F4NA 4IX0A 3C2EA 4BWLC 3O07A 1DORA 4WY0B 1W1ZA 1DOSA 1KV8A 2IQTA 3UWYA 1SO3A 1LRQA 1PVNA 1TPEA 4HKPA 1NF0A 1SO4A 3SJ3A 3R2GA 4LU0A 4JTEA 1SU5A 2R94A 2JKEA 2EPHA 2GPTA 1J2WA 2YFOA 1KM4A 2FIQA 3M16A 3W7IA 3KVJA 3LV6A 1OYCA 4OV9A 2X16A 3STCA 4Y96A 2ZRZA 5K9CA 1FWWA 3TAKA 4O13A 3BG9A 2VENA 4UFHA 1RQEA 3MHGA 3IGSA 2V8ZA 4Q32A 3NQVA 3Q2DA 4DO4A 5KINA 1WQ5A 4UTWA 3LXBA 5ABTA 4MLRA 3YPIA 5BMXA 5CPLA 1XCFA 1A5SA 4FIQA 2FB2A 2A4AA 3PC0A 1KM3A 2GUUA 1I2OA 5K4XA 2QR6A 1TQXA 4RV8A 1P0NA 3P67A 3P80A 1KTNA 2OZ0A 2QJIA 1DVJA 2Y88A 1NVMA 1YPFA 2WPBA 3UPBA 1UUMA 3CLMA 4MY9A 5DELA 3FS2A 3W76A 5G4WA 4FF7A 4HPJA 3VFLA 2HTMA 4JTFA 3R12A 4NJJA 2NWRA 3C2VA 3IIOA 3L0NA 4JYEA 4DQWA 3VCRA 1SO5A 2JBMA 3MUXA 3DZ1A 2C16A 3CIXA 4O4WA 2Y7FA 4U28A 5F4SA 3UD6A 2B7PA 1PIIA 3DBPA 5AC6A 3PAJA 3W7MA 3TMQA 4Y8FA 3O6DA 1ME7A 3LBMA 3T40A 4NXSA 3TNOA 5BRBA 4QNEA 1FX6A 3W7HA 5DN1A 5BW6A 1MSSA 3G8EA 3P74A 4NNAA 3THQA 5TQLA 3KVMA 1MZHA 4U4MA 4ZQPA 1OFOA 4CNPA 1H50A 3DFPA 2QF7A 1B4EA 4BI6A 3C0JA 5LHEA 4POCA 3NOEA 4UTWC 3S5ZA 1TTIA 4MKNA 4RXFA 2J88A 1XXXA 1BKSA 2DP3A 3E02A 2Y7DA 4LOCA 3NQAA 4Y6GA 4FHAA 2BLEA 3NZRA 1VC4A 1W3TA 4K36A 4K37A 4XQ6A 3EX1A 1NFBA 4MY8A 2E5DA 3BW4A 3TW6A 2X2GA 2ATSA 1X1ZA 4TMCA 1X1OA 3P82A 5KMYA 3NM1A 2H90A 3G0SA 3OHIA 3S6DA 3GKFA 3O15A 4K38A 2ZRYA 2Y70A 4RZ5A 1VQTA 3CU2A 1A5CA 2RKXA 3M6YA 2QCMA 3GLCA 4JDYA 3A23A 1R30A 2QCDB 2FPTA 3TXZA 4LVAA 1JRBA 4IMCA 1G7UA 1ZY9A 4XWUA 1QO2A 4PL1A 3P7YA 4HNVA 2PE4A 4FX6M 4BWLA 1D3HA 3TSBA 5AYZA 3C2RA 3W22A 4D2JA 1Z42A 1NEYA 2VELA 4C1KA 2R8WA 4BK9A 4EF9A 5EBUA 3HPZA 2P0OA 1W31A 4NJKA 1GVFA 4FXRA 3WK1A 3LCLA 3ZWTA 4IXHA 3LGEA 4UTTA 1OX4A 4OT7A 1XFBA 2QDHA 4BFAA 4NX0A 3GXPA 3O05A 2CLHA 5FEWA 1SZEA 1TCDA 3GAKA 5D09A 1KFLA 1OVDA 1GZGA 1W5PA 2QCLA 3SR7A 3C3NA 5D03A 3WJYA 2Y63A 1IGSA 2JKPA 1EP2A 4HNTA 3W7NA 2V5LA 3TCEA 4O16A 4DBDA 2CWNA 4NQ1A 1LRTA 4ZQMA 4XKYB 2ZZ1A 4FNRA 2LLEA 3EWBX 1JQVA 3S5YA 2YDAA 3GIYA 1HTIA 2GJLA 3GK0A 4OHQA 3UXDA 4ZQOA 4EOUA 1LBFA 1RZMA 5EY5A 3W1LA 1AG1O 2GJNA 4N02A 2CLKA 2CLLA 3QZEA 1KBIA 4N9CA 3UZ5A 3WJWA 2ZZ5A 4WOQA 2GQAA 3HG5A 1VPXA 3AO0A 3LCFA 1TYGA 2OT1A 1XDMA 2FFCA 1TPWA 2QJGA 1EP1A 3QJAA 3G3MA 4NJIA 4WXYA 1ONRA 3CIWA 1HO4A 4CCCA 3LB0A 3GDKA 4MZ8A 3UWZA 4X9SA 1OYBA 5KZMA 2ZA2A 3LDVA 2ZZ2A 1UUOA 1R47A 1F74A 4UXDA 1DHPA 4GJ1A 1GTEA 5D02A 4NX5A 4FO4A 4JX6A 4M19A 3W1UA 1PV8A 3L68A 2NXIA 3LCHA 1F5ZA 2NUXA 3DENA 3Q37A 4A29A 5MHBA 3S42A 2DZSA 2ZA1A 5I3HA 1UASA 3DAQA 3LOTA 3EWXA 3VKJA 3NQ6A 4ZQCA 4IJBA 4GFSA 5F2MA 5KITA 4YLWA 3S1WA 4GWEA 1LLZA 3ATYA 3O8AA 2GQ9A 1M5WA 3SI9A 2XN1A 4JD4A 1YDNA 3GXTA 5CPOA 5KZDA 4ALDA 2FTPA 1C8VA 5HR6A 3UZJA 3HIJA 3T78A 1G7VA 2RDUA 2G97A 3W73A 2YGYA 1WOAA 2ZCGA 3CQ0A 4TR9A 4N4PA 4TX9A 4Z1AA 3CWNA 1ML1A 3NQDA 3P5YA 3GDMA 4GNJA 5TBOA 2ABBA 1TSIA 2I1OA 4O11A 4UFJA 1LOSA 4C1LA 3LI0A 1LP6A 3LX9A 3NL5A 4CQ9A 1R2TA 3W2MA 5K2ZA 1GVRA 1GPWA 4UTJA 2CLMA 2NX9A 1KFKA 1T96A 3QW4B 3N3MA 1ZAJA 2TYSA 4JICA 4UR7A 3CPRA 1XUZA 3W88A 4HSOA 4PFMA 5D2YA 4OBTA 3TROA 3WFAA 1H7XA 2NLIA 4KWVA 2J6XA 3TSDA 5DXYA 3WJZA 1Y0EA 2Z6JA 1QR7A 4N2YA 1WYIA 4DPQA 4YMZA 4AWUA 5IM51 5U7SA 4MOZA 5LHFA 3PG9A 3B0VC 4IOTA 3HO8A 3MP4A 3P60A 3LHZA 3PWAA 4FXSA 3C4UA 3ELFA 1A5AA 3MI2A 5F4WA 2VFIA 5CGQA 1JCLA 3GDTA 5K4ZA 2ISVA 3BLIA 3JR2A 4NVTA 4WY0A 1SSDA 4KFOA 3W1RA 2X1RA 1TTPA 2NXHA 2NX1A 3IRDA 1CW2A 1TPH1 1OYAA 3W1QA 3FJLA 2YSWA 1H60A 5G2HA 4WXZA 1GYLA 3I7SA 3G0XA 1LORA 2ZDRA 3ABOA 2QKFA 1W0MA 2YFNA 2YZRA 4LS0A 4DPPA 1OFAA 3TQ0A 2DZVA 2A7NA 4XUGA 1JCXA 1GOXA 4LV9A 4O52A 1KV5A 2FLIA 4FNPA 1HO1A 4ZMGA 1Z44A 1WAUA 2B7NA 2W79A 5C54A 2H8ZA 4JTJA 1QAPA 4N9EA 5I3FA 3T55A 1K3UA 3L5MA 2NZLA 4FEZA 2B7QA 5G1TA 3W70A 4E2BA 4Z1BA 5KZEA 1J5TA 3W75A 3LCXA 3PSWA 2E6YA 3QPZA 2X30A 2Z2UA 2XFWA 3FFSA 4UCGA 2QCCA 3TU9A 2E6FA 4TO8A 1GEQA 5F2GA 1K8XA 2E6DA 4JTGA 2QCFA 1PCKA 3PBUA 4DO5A 4GUHA 3HMJG 4HPXA 4LRSA 4NJHA 4ONVA 1Q6QA 1ME9A 1I8JA 4JTLA 1FCVA 4RR4A 4IXXA 3BG5A 2FJKA 1TIMA 1FXPA 4MJZA 2TPSA 3HGOA 2B7OA 1FQ0A 4ZL1A 5C55A 3VE9A 4YL2A 4IMFA 3HG4A 4WOZA 3GNNA 2AQWA 4E38A 1WV2A 1VH7A 2VC6A 2HMCA 2HS6A 3LHWA 3K30A 3KRZA 3NPUA 3LHYA 4P61A 5G5IA 3OVQA 3N34A 1A53A 1CX9A 2V9DA 3W7PA 1AMKA 4JYDA 1YXDA 3S1XA 2CZFA 2ZZ3A 4J9JA 3G24A 5KTLA 1OABA 4NJGA 1FUYA 3EWUA 1OJXA 1N55A 4UTKA 3S1UA 4IUOA 4K7VA 4MZYA 1W3IA 4RZ6A 1MEWA 4K8EA 3TIMA 4LRTA 4CCEA 4H3DA 3A21A 1T99A 3FEMA 3ZFHA 1WOBA 5EYWA 4UFIA 5A5WA 3IIZA 4YXGA 1MXSA 3W7CA 2QAFA 1ICQA 3U6WA 1FDYA 4UNKA 4N9BA 1KM5A 2ZTKA 3UXAA 1ME8A 4JY9A 1F76A 4GXMA 4O50A 3AJXA 2WQPA 4HSNA 3A22A 5EA9A 4M7SA 2ZYFA 1AL7A 5FEXA 3LXAA 4H6KA 3NL2A 1F6KA 2WNZA 4KWWA 4QSHA 2VEPA 1M7OA 2Z6IA 3TR2A 1JCMP 1EEPA 3W3OA 3T44A 5L9FA 2Y6ZA 2QUVA 4S2CA 3NEVA 1W8SA 2ZZ6A 2QEZA 3W7JA 1JUEA 4XZ9A 4R34A 4I7VA 1YTEA 1TPC1 2NUYA 3A24A 1Q6LA 3FKRA 3CB8A 4LVGA 3W07A 2Q8LA 3DFSA 2C0AA 1JRCA 3G22A 4XTIA 5FESA 3CHVA 3C52A 2ZZ4A 3DFQA 1QMLA 1Z48A 1ICSA 5DCBA 5C5YA 1YADA 2FPVA 3G1VA 2EGZA 3ZS4A 4BI5A 1VRDA 4Z1CA 2H3BA 4O10A 1T8XA 1U83A 3NA8A 4UUIA 1H7PA 2CW6A 3PF3A 3EKLA 4TMBA 3BW2A 2D73A 1FCBA 3R5EA 4QNWA 4ZVJA 1SZFA 2C6QA 4UTUA 4S1FA 2Y85A 3UNDA 1H63A 4KFPA 2VEIA 3OEXA 4AWTA 1EWEA 2FPYA 3TAOA 4I7UA 3PBYA 1O5XA 3G1AA 1KM6A 4O0KA 4AMAA 1I45A 4ML9A 4JTUA 3RMJA 1H1YA 3M1ZA 3C56A 5LNVA 5FF7A 3PUEA 2Y62A 1VJIA 1EIXA 5FI8A 3TK7A 1VYPX 3DI0A 4AHOA 4O12A 3L65A 3LV5A 4HN4A 2A1YA 3Q58A 5DXXA 3UQNA 4GC4A 4Z0SA 1ZCOA 3NAVA 4LNYA 4ORMA 3KRSA 4UMBA 3TJLA 3N9RA 5D30A 2ZRUA 3DFNA 2J9XA 1XL9A 2VFEA 1WBJA 3BVJA 3EX2A 1YTKA 4HT3A 1FCQA 2ZRVA 4LS2A 4KFNA 3B04A 4GUJA 2BXVA 1S5VA 3O1NA 2C3ZA 5CG7A 3L0GA 5CSRA 5LNWA 3LM7A 1LLWA 4AHQA 4CLMA 1VS1A 3W71A 3W2KA 1OX6A 1QWGA 4TIMA 4JR5A 4O1CA 1UB3A 1L6WA 5D37A 3TFCA 4LVFA 3BLEA 3MP3A 5CKSA 2GQ8A 3NQGA 4FX7A 3TJXA 2JGQA 3P8JA 4O53A 4LWWA 1I2RA 4PL2A 2A7RA 4QJ1A 1TPVA 3WK3A 4GRSA 2YX0A 4WX2A 1EWDA 3OBKA 3B0UX 3BLFA 1X8FA 1L6YA 1Q3NA 3IGXA 2PURA 1SQ7A 3NQMA 5C2XA 3NPWA 1O60A 4I9AA 3G8RA 4PC8A 3G1FA 1ZFJA 3H55A 5F2IA 1W56A 2BSLA 3NZ1A 5HULA 3N73A 5F1VA 2BWGA 3SY5A 2TMDA 2PC4A 2DJXA 1P5BA 3TKFA 4JTKA 4UTLA 2YW4A 2WO5A 2GVLA 2I14A 1TMHA 4PA8A 4A22A 2NV2A 2CLOA 4UFLA 1D3GA 2WNQA 3QEZA 3OVRA 4GE8A 1WX0A 3MHFA 1JCJA 4WY0F 4M6PA 1TTJA 1EPXA 3UY8A 5DCDA 2QCHA 2ZBTA 3EXSA 1ZENA 3EX6A 5G4EA 4AAJA 1O5KA 4UTIA 5F4XA 5BNKA 3DU0A 4JX4A 4HNNA 1TJPA 2OJPA 3BK0A 4BI7A 1FWTA 3GYEA 1YYAA 4EVZA 1DJNA 4FNTA 2A6NA 3B06A 2GVGA 3IVTA 5G2WA 3Q94A 4PEKA 2H6RA 1I2NA 3L66A 4O14A 2H8XA 2E09A 3OIXA 1EX5A 3QMTA 2ISSA 3HBLA 3LLFA 3SGUA 2BX7A 3KVKA 3HJZA 2QCNA 4EWND 5EL1A 3GR7A 3IIPA 4JTSA 1TB3A 1YXCA 1HG3A 5FEPA 1BWLA 4LT9A 7TIMA 3PULA 5TIMA 3O63A 1TV8A 4JTIA 4DXVA 1H62A 2QDGA 3W7LA 2R14A 2AGKA 2P10A 1O4UA 1KW1A 1LM1A 2QAPA 3W1PA 3EEGA 4Z1DA 3RLUA 3W6YA 1X7FA 1IXNA 1YDVA 4WZHA 1SW3A 1X6UA 3QH2A 3TQKA 2I9EA 2CLIA 1GVSA 4JGDA 2JKAA 1V5XA 3N19B 1TTQA 3MBFA 2V81A 2RDTA 3BARA 1VGAA 2A5HA 4LC8A 2OT0A 4RKAA 3M7WA 3QMRA 2RFGA 1AW5A 3U8GA 3W72A 2CLFA 5U4NA 3TXVA 4UNLA 3W1AA 5GVJA 3LRKA 3C2FA 4OV4A 3W85A 1GTHA 3TE9A 4UTTC 5F2LA 2VEMA 5AYXA 1H61A 5D2XA 3ABSA 1KFJA 3LI1A 1RVGA 2AAMA 3G1XA 1VYRA 2C13A 5FF3A 3W1MA 3G18A 5DCEA 4K39A 4MFEA 1G67A 1YLVA 4EIVA 1KFCA 3TSMA 3W9ZA 1K03A 3W7OA 5FEZA 1RQBA 2CU0A 3MWAA 3MHUA 3STEA 3LHVA 4OQVA 1KBJA 1R46A 2TRSA 1VZWA 3HGSA 3CT7A 3OG3A 3GKAA 1M6JA 3TC6A 3NG3A 1SZGA 1W5OA 3DXIA 2E6AA 3NPXA 4R33A 1SW7A 3TMLA 1L9WA 2X1UA 4MLJA 4FNSA 5AHFA 1GG0A 4ADTA 3SFKA 1PS9A 4UIOA 3W1NA 3DHFA 3IIVA 3EKZA 3DFOA 3PVFA 4RZ4A 2WNNA 1JCYA 1XBZA 3PUDA 4FB7A 4W9TA 1BWKA 3LERA 5LNSA 1PHWA 1QCWA 1FWRA 1JULA 4LVDA 5J5DA 5LNRA 4X3ZA 1C9DA 3NL6A 4ZZ9A 3SSJA 3F4WA 3CEPA 1F6PA 1IXOA 3HG2A 4PH6A 3HQ1A 1VCVA 3E96A 4PCFA 1W54A 3D0CA 1Z41A 2C1HA 1O95A 3BO9A 5AHMA 5HR7A 4O17A 3M5ZA 5I3KA 3FA5A 3TFXA 1LZOA 3EXRA 5HJLA 2YCEA 2V30A 3KXQA 1EB3A 3QSRA 2WSRA 1W5MA 2EKCA 3N9SA 3CTLA 3A5VA 1LDCA 4Q33A 5BMWA 1FBAA 5LNUA 4LTSA 2Q8ZA 3N2MA 3C61A 4RK8A 3S9YA 1NAL1 3CWOX 1DQWA 1SPQA 3HF3A 1GJPA 1RD5A 3W84A 4N4QA 4DF2A 1F7BA 1G4SA 1K02A 3I68A 4PODA 4MYXA 4WQ6A 4AF0A 3ABQA 1FDJA 3W74A 3NR0A 3DGRA 5EPDA 1H7OA 2CZDA 1ALDA 1GG1A 1XDLA 1LCOA 1B9BA 2XN0A 2RDWA 4XTDA 2YXGA 1N7KA 1FY6A 2Y89A 1H5YA 3KAOA 2WV8A 2FQIA 4DO6A 2O7SA 5LGZA 2A6LA 2VFFA 4IWWA 1WA3A 3E49A 4UMCA 3GZ3A 1OK6A 2A0NA 4CCDA 3SECA 1H1ZA 4IGHA 3EWYA 4O19A 2CLEA 2OX1A 5HWNA 3FOKA 4IQLA 3WJSA 3SIZA 1R2SA 1KM0A 5IBXA 3GXNA 1SR9A 1ZAHA 2NX3A 1OFRA 5AYYA 5LKYA 1G4TA 3UPWA 4IMGA 5AFDA 4UR8A 4S2BA 2DZUA 4AEOA 1SZNA 2OMAA 4DBEA 1IIHA 4DELA 2ZRWA 1TQJA 3QRHA 5K3VA 4DF0A 1K7XA 3W2NA 4JIPA 1OX4B 3EX4A 2E68A 1F73A 3E12A 2PRMA 4L4MA 3W2JA 4GUIA 3FYPA 4NZJA 3HPSA 1YPIA 3PSVA 5HMSA 5IBXC 3LTSA 2G5WA 3I7RA 3RF9A 2YR1A 4AWSA 4O1DA 4JNMA 1OF8A 3LLDA 3MJYA 5D33A 3B4UA 1JUBA 1ZAIA 3R13A 4GUFA 4QAIA 1SFLA 1W5NA 4MIMA 3I65A 2J9YA 2GOUA 3LCGA 1G4PA 2CFFA 5LGXA 4LUIA 4IMEA 4FX8A 4AHPA 1AL8A 5AHNA 4UMAA 3CC1A 1YXYA 1QOQA 1O94A 4OGZA 3HPXA 1S5TA 1XKYA 1EP3A 3GAYA 4FNUA 2ZZ7A 5C6MA 1ZNNA 3O06A 2RHGA 4A21A 3BGGA 2KZHA 2VEKA 3L9CA 1H7NA 1NF7A 3A9IA 1LBLA 1VLIA 1OF6A 1MEIA 4A2SA 4E2DA 3M5YA 3QSTA 1XM3A 3O16A 1SO6A 4UTHA 2NV1A 3W7QA 2ZTJA 3BV4A 3DI1A 1OFDA 1JUKA 1XBYA 3IIXA 3G1DA 2V2DA 3I6RA 3NL3A 4HIBA 3L2IA 3NQ2A 1SSGA 3O6YX 4NXKA 2J9ZA 2Y7GA 3UWUA 4ORIA 2E5BA 1TPB1 1L6SA 4H4IA 3M47A 4N9DA 5HQEA 1VCFA 2QCEA 1YDOA 4MJMA 2ZRXA 3RK8A 3HG3A 2VOMA 3M0ZA 3P84A 4RLIA 4O0ZA 3C8FA 1ICPA 2NXGA 5CZJA 2VXNA 3NXFA 4MVAA 1SFJA 3KHJA 2QCGA 3MO7A 1Q45A 2PRHA 1VHCA 4K7YA 2E1DA 4IPJA 3R8RA 3W2UA 3JRKA 3R89A 1JQXA 1PE1A 5HNRA 1KM1A 1XBXA 1DQXA 2VFHA 2F84A 3P62A 3PBWA 1E51A 4RXGA 1H7RA 4CNOA 3LTYA 2Q3RA 3N2XA 1RV8A 2YYTA 4PTNA 3DKLA 3EXTA 1F2JA 4LS1A 1YTDA 2DZXA 2H3DA 3A5FA 4MY1A 4Y9AA 1T0OA 5LSMA 4ICNA 1XUUA 5D2TA 4RJEA 4A2RA 6TIMA 1PL9A 3LHTA 3C2OA 5L6UA 2F7FA 4ZQRA 5G1YA 4O1BA 3GB6A 4LY8A 4N6EA 3G0UA 3DHDA 3TW7A 3STFA 1QDSA 1PCWA 1LYXA 2DJLA 3FYOA 4RX0A 4ADUA 2V0TA 1GVQA 1UJPA 5G2IA 4IPIA 1LBMA 4Y90A 3LHUA 3OVPA 4XBSA 4BF9A 3W87A 3TUUA 4JTHA 1I2PA 3W7EA 2WSYA 5T26A 1XI3A 1Q6RA 3F03K 3WJXA 4Z0JA 4O54A 1H51A 4NZFA 1QNVA 4Z08A 4UFMA 3M41A 4IMDA 4IX2A 4NUWA 1B4KA 1OFPA 2QUUA 3B03A 4K6AA 3STGA 4CNNA 3EWZA 3TV8A 4OE7A 3F1QA 1C29A 2E77A 3W83A 3QF0A 1OX5A 4GUGA 4JX5A 3W23A 5AC7A 4QM1A 1TPDA 2PRLA 3QW3A 1L2UA 3IGUA 3SGZA 1WDWA 1KTBA 3LCIA 1J4EA 4KKXA 1KLZA 4NT0A 4M7TA 3QMSA 3QQ1A 2Z1BA 3VI2A 4O28A 3BGJA 1SW0A 3GNDA 3W7KA 5A8GA 5SWUA 1BEUA 3BW3A 1BTMA 3UWQA 3B0PA 4M6QA 4G1KA 5K9DA 2TSYA 4UFKA 3L0KA 2OCZA 2VFDA 1V7YA 3H53A 1IXQA 3NVTA 3NNTA 5AN7A 5HUPA 2G95A 3UY7A 4JIQA 1AK5A 3W1TA 5LZLA 4JYFA 2GVJA 2UV8G 3M9YA 3LXCA 1K7EA 2QJHA 4O18A 1F05A 3E9AA 3W7GA 1K8YA 4WUIA 3BG3A 4X22A 3QC3A 5E0KA 2C15A 5I3IA 2CZ5A 5EMUA 2J24A 4LUJA 3GVGA 1EA0A 2QCDA 3OA3A 5I3JA 3VNDA 1ZHAA 1ZALA 1FCUA 3T7VA 4QIUA 4XKYA 2EHHA 4N6FA 1AW2A 1K7FA
chains in the Genus database with same CATH superfamily
1M7PA 3MV11 5H8PA 1QPRA 4JEJA 2HRWA 1A5LC 1G6CA 3NJ3A 4O4VA 2BXZA 3LRLA 4LYRA 1FWAC 3JS3A 4ADSA 1DE6A 1T5AA 2YPIA 3W7RA 1THFD 2G50A 3BAYA 1DXEA 3TJIA 3FGCA 1ZJHA 3CM4A 3QGAC 2FZDA 3UWVA 2H9AA 4QX4A 2V2CA 1H5VA 3KRUA 1LTDA 3S5SA 2ZKMX 3JU2A 3FAXA 4ACZB 4MB3A 3PZGA 2O9PA 3KVLA 1L2QA 1W2VA 1KA9F 4HQVA 3IEBA 2OB3A 3GR8A 4C6DA 3NQ8A 4ICCX 3S1VA 2YCIX 3W2LA 3T4CA 4KT2A 5JU6A 1DL3A 3KOFA 4BY3A 2OGJA 1A5BA 2PLKA 1GJWA 2OR2A 3AIBA 4CQAA 4F66A 5T8GA 3M5VA 1XW8A 1UH2A 2XGZA 1E72M 1TX0A 5EU9A 4B5NA 4QQ3A 4AMCA 3WBWA 5DLCA 1R3RA 3W7DA 1O5QA 4PB3A 2IKHA 3G77A 1FWSA 1F07A 1K8ZA 5DQPA 4L9ZA 4XB3A 3RCNA 5C9XA 4REQA 2FH8A 1R85A 4HNLA 4DEFA 1LL7A 4MKSA 5E6ZA 4FS9A 1X38A 3WQOA 1VKFA 4HMDA 3N13A 2EPNA 3NQCA 1J10A 1WDSA 1WBHA 1MRQA 1A0DA 2PBOA 3VC6A 1ZSXA 5CLWA 1ZJIA 2X1SA 2X1TA 2CEQA 3PR2A 3NURA 5DBTA 4AVFA 2BV9A 2MUCA 3UNTA 1B54A 1ONEA 2V6AA 1HUVA 3MW7A 4GYJA 1DIEA 3REQB 3N6HA 5D04C 3ISIX 5CAHA 2DZWA 3B4YA 5CZSA 4XUYA 4PUKA 2PDQA 3UZXA 1MO0A 4I9MA 4OU1A 5A8OA 2FHBA 5TNVA 2Y61A 4MADA 2ZX5A 1TV5A 1FWGC 3WLTA 4H19A 3QN3A 3NGJA 1XV8A 1KTCA 3KS5A 3PUOA 1S5NA 4EKJA 1TWIA 2HCVA 3WD1A 1BRLB 1VLWA 3GVQA 3M0JA 2OG9A 1J2BA 2WMGA 3VGHA 1IIGA 1W1PA 3REQA 5IHSA 5I6SA 1JZ7A 4OJYA 4JKKA 2DDXA 2G0WA 3UG3A 3PM6A 4INFA 3WLPA 3BDKA 1V4YA 2EG7A 4IFKB 1AVAA 1P0KA 1W9UA 5BOOA 4DWSA 4L61A 4BCEA 1ISYA 1RVKA 2PLMA 3RO6A 2HXTA 3QM3A 3EDEA 4BQ3A 4UQEA 5DY2A 1JR1A 2DZPA 2E28A 4NASA 2O7QA 1A50A 3H2OA 1XBVA 1UWSA 4LBRA 2BVWA 4JN6A 2BZNA 2VWTA 5DY3A 3PB0A 1JXKA 1ZP4A 8A3HA 4AZ6A 4LANA 3WX7A 2ATMA 1E4IA 4AD3A 3E38A 3QQ0A 1FWFC 3GHSA 5HK4A 4AZCA 3PN8A 1A3XA 1TFVA 3THUA 1KM2A 3P61A 3ARVA 3ANYA 2YW3A 1W3NA 3VNZA 2YCJA 6ALDA 2CZEA 3PY2A 4IQDA 3S5OA 3A13A 3THAA 4H6RA 1CXIA 2F6XA 3AU2A 3LTPA 6ENLA 3GHUA 1KFEA 3F7JA 3H22A 4J1OA 5CZ0A 5AHEA 3VVGA 2VGIA 3G1YA 4PMUA 1KRAC 3WK0A 1NDZA 4YCPA 2W0UA 4L6HA 5AOUA 1DIDA 1OK4A 2IPGA 1TO3A 5BXPA 5BRPA 3O07A 5A2CA 3AWOA 1W1ZA 3DDMA 3UWYA 1SO3A 3CUXA 3FGCB 2DV0A 4KF1A 4J3ZA 1TPEA 2QMJA 1WDDA 1CXLA 2WCGA 3R2GA 4JTEA 3OTRA 2R94A 5TD4A 3RXZA 2VRKA 2EPHA 3PNUA 2GPTA 5E6YA 1U1HA 1J2WA 4OECA 1ZRQA 2YFOA 1KM4A 3GRIA 2OWWA 1W3JA 2Z1WA 4AX7A 1D7KA 5J8LA 1KXQA 2ZRZA 1HGWA 4GQ0A 5AYIA 1FWWA 4O13A 3WELA 3BG9A 1V3KA 3CLWA 3RX3A 1W3HA 4W7VA 4C6LA 3KBNA 2BS9A 4Q32A 3DC8A 4WDWA 3NQVA 1O6IA 3D3FA 3AUJA 4Q8TA 3CT2A 5ABTA 3K13A 4MLRA 4MDOA 1UZHA 2I56A 3TW9A 3SSZA 1TQXA 2Y2WA 3P80A 1UWRA 1DVJA 1UUMA 3CLMA 4H6EA 4HU8A 3W76A 5G4WA 4HPJA 5FACA 2XM2A 3DG3A 4XISA 1VBUA 4AX6A 3ZO9A 4NJJA 3IJIA 3OYXA 3IIOA 4REQB 5FJUA 3RM4A 3DZ1A 2WBKA 1KQYA 4G2DA 3T09A 4S3KA 1PIIA 5AC6A 1U22A 3O6DA 4UZSA 4PYSA 5CEWA 3B9AA 4XD5A 3LBMA 3SCNA 3T40A 3VIFA 3TNOA 1RH9A 5BRBA 4GINA 5DN1A 5JIPA 1V3IA 6PTDA 5BW6A 3GHRA 3G8EA 3LGGA 3O7UA 3W6MA 4F40A 3ZQ9A 2X41A 3THQA 1WZMA 1AH4A 3AMLA 3KVMA 2O4MA 1S2CA 3GG0A 4A8NA 4Y7EA 5C9WA 4GKTA 3I3EA 2VC5A 4B5WA 1ECEA 1IEVA 4UTWC 2Z1VA 1TTIA 4MKNA 2J88A 1BKSA 4KEUA 2DP3A 2VWSA 3E02A 2Y7DA 3NQAA 1XIFA 1W3TA 9XIMA 1VPQA 4B5TA 4K37A 3UWEA 4Z2LA 1BF2A 3SB0A 4XQ6A 3EX1A 1RCQA 2E5DA 4TMCA 4A3QA 2H90A 1OT1A 2JEPA 3GKFA 2WK2A 4QLLA 1GYMA 1VAHA 1Y5WA 1UBPC 4Y8EA 3AIUA 3F4DA 1NQKA 1TZ9A 3EYPA 3WF3A 2RKXA 2PDLA 4JDYA 3A23A 3VGDA 2QCDB 4FK9A 3IJQA 3TXZA 3GTFA 3B8WA 1ISWA 2QUNA 1TZ7A 1YDYA 3H7RA 4IMCA 1G7UA 1VP5A 2WVVB 1HVQA 5HNUA 4P8XA 4PL1A 3N04A 3VKAA 1EGMA 3MQTA 4ILSA 2V3DA 4GI6A 4MG4A 4C1KA 1NEYA 3FYYA 3CJPA 4KEMA 5LIWX 4R88A 5EBUA 4NJKA 2E1WA 4FXRA 3LCLA 1BPLB 1OX4A 3DG7A 3O05A 2CLHA 5MF5A 2WCAA 4RE0A 3S47A 1Q63A 4P5UA 1GZGA 5FJOA 4AVNA 4IISA 4W85A 1ZGDA 3VIHA 5D03A 1OM0A 1EP2A 2HPMA 3W7NA 2P50A 1PZ0A 2RGLA 1IZJA 3D5HA 4ZQMA 1ZBCA 2LLEA 1GNXA 1JQVA 1YE6A 3V1HA 4WF7A 4OHQA 2HE5A 4ZQOA 4EOUA 1R3YA 2CLKA 1KBIA 3U0HA 1CGUA 1VPXA 3AO0A 5BRQA 3C86A 1TYGA 2FFCA 1TPWA 4R7OA 3QJAA 3G3MA 4JTDA 3TNBA 3FCPA 2OFJA 2D2JA 4WXYA 3CIWA 5GNYA 1KGUA 1HO4A 3VZYA 1I0DA 3VO0A 4CCCA 3LB0A 4I6KA 2OEMA 3RDKA 4X9SA 1OYBA 3MVIA 4A3RA 3KL0A 1A4LA 3LDVA 3F5LA 3BAIA 1R47A 2X2YA 4GJ1A 4OOUA 4KIRA 1D3CA 4XK2A 2EG8A 2AQOA 3T0CA 9XIAA 4FO4A 5C9ZA 4JX6A 4YNGA 2PDNA 4M19A 2OLSA 1O12A 1HT6A 2EPOA 5DMYA 1PV8A 4B4FA 2AMGA 3LCHA 4QE4A 2VOTA 4A29A 4C7GA 5MHBA 3W26A 2ZA1A 4C6FA 2WZHA 1E9IA 1T6MA 2VGBA 2OZTA 4NHVA 3S6TA 3EWXA 1C3FA 4IJBA 3T42A 3W0KA 3CZ8A 3QLDA 5KITA 1JDDA 4YLWA 4GWEA 2G3IA 1QWKA 2OTDA 1ZL1A 4JD4A 1YDNA 4ALDA 1CCWB 5KZDA 1NWUA 3AXIA 3TOYA 3WNPA 3TJ4A 3LSCA 2GWGA 3PNZA 3BJFA 4B16A 2G97A 5JXQA 4BEQA 2HROA 1B1YA 2XVGA 3AJ7A 1ML1A 3L4ZA 3LA4A 1TVNA 1EOMA 3SY8A 1JYNA 2XH0A 2IQ0A 2I1OA 4UFJA 1LOSA 1RBLA 1P7TB 4CQ9A 1IEIA 4ZO7A 2PGRA 3CV2A 1GPWA 4UTJA 4CVWA 2GLKA 3TOPA 3NSMA 3WN6A 4HSOA 4PFMA 1T8QA 1D7FA 4KWVA 1NIUA 1H09A 2AMXA 2W91A 4HZMA 4WSKA 4W86A 3I3BA 1D8CA 2GK1B 3PG9A 4WCJA 4FXSA 2XFFA 1JCLA 3GDTA 3SM0A 4JNYA 3CHCA 2BASA 2V3GA 1TTPA 2NXHA 4UQ9A 1TPH1 2BHYA 2D69A 1HKJA 2YSWA 2W67A 2I17A 2O56A 1IE7C 1WZKA 2YZRA 3CZLA 3H7VA 2REQB 2ZE0A 3ARUA 3IJ8A 1P6BA 4FA3A 2A7NA 3PZQA 4LV9A 5CXPA 4CGTA 3WD3A 3O9NA 1Z44A 4F0LA 1QVBA 3U2ZA 3TTYA 3T55A 2NZLA 3FV9A 5G1TA 1TCMA 1EPVA 1AZ1A 1J5TA 2PP3A 2E6YA 4HCLA 3M4HA 3KW3A 5HNNA 1E6ZA 2WNWA 5M1TA 3WQGA 4TO8A 3IK4A 2E6DA 4JTGA 1PCKA 4M51A 4Q8MA 4JQAA 4WIWA 1RCOB 2ACQA 1LLOA 4NJHA 4ONVA 4JTLA 2FJKA 2O9RA 1W9DM 1FXPA 4MJZA 1FQ0A 4ZL1A 1TJ1A 4WOZA 3GNNA 3UPMA 4S3GA 1VH7A 3A3WA 3KRZA 3LHWA 4DZIA 2PZNA 3VNLA 1PX3A 2CZFA 3G24A 6XIMA 3EWUA 4BQ2A 3LPGA 3UERA 4DWSB 4IUOA 5JVLA 4CVUA 2FMNA 3KZSA 4MZYA 3TIMA 1IWAA 2OOGA 1UOKA 3N4AA 3ZFHA 4GYKA 3N4FA 1WOBA 3AC0A 1XKJA 3W7CA 1FDYA 1LL4A 2OSXA 3UXAA 1SJBA 3KWSA 4GXMA 1MXDA 2QVNA 3AJXA 4CD4A 2QJNA 4HSNA 1JZ4A 3CB3A 5EA9A 4M7SA 2ZYFA 1G94A 3A4JA 4MJ2A 1VIZA 3LXAA 5LIKX 1EC9A 2VEPA 2PWVA 3TR2A 1JCMP 2R1NA 4HBKA 5IFPA 2FDMA 4R34A 2PTWA 4I7VA 1YTEA 1TPC1 3FKRA 1UD8A 3L2LA 3SCOA 3G2GA 2WC4A 4HSHA 3DFSA 4XTIA 3C52A 4I3GA 3ITLA 4XV0A 1QMLA 3CMJA 1ICSA 1XDJA 4OUIA 2D22A 4HB7A 3ZS4A 2WYSA 3R5EA 1FCBA 4DJDD 1WP6A 4PTMA 4LYPA 5LYRA 5CGMA 4UTUA 1OG6A 4GJIA 5REQB 2POZA 2VEIA 3M07A 3BV7A 1MUMA 1LT8A 1KGWA 3BXWA 2VDIA 4UBPC 2IMRA 3VMPA 1KXHA 3GE7A 4ML9A 2L5HA 1D8WA 3PUEA 1VJIA 1KD0A 1P6WA 1US2A 3WKZA 2NW0A 4Y9OA 3DI0A 3HU7A 3EPNA 4O12A 4JQ4A 4M8UA 4GX9A 4BS0A 1BGAA 5DXXA 1VJZA 4Z0SA 3NAVA 3KE0A 2YL9A 2CBIA 3AIVA 4ES4A 1B90A 1K70A 3DFNA 3OQEA 3T0TA 1XISA 5GNXA 1WBJA 3EX2A 4HA3A 3H26A 1FCQA 3HFTA 4H9XA 3V18A 4RW3A 4U2ZA 4KFNA 1HJVA 4AZGA 4LNCA 2BXVA 1S5VA 5CG7A 5CSRA 3W71A 4GYPA 1TMQA 2C79A 3AS2A 1X7IA 4L1WA 2DH3A 1ELSA 4O1CA 1L6WA 5D37A 2BOFX 4UQDA 4S23A 4LVFA 3BLEA 5CG0A 1C90A 5EGRA 1E6QM 3NQGA 4FX7A 1UWAA 3TJXA 1QXLA 4FXFA 1KCXA 1E1CA 4QJ1A 3WK3A 3S2LA 4C60A 4JKLA 1H1NA 4BHYA 1JI1A 3PJTA 1VFHA 3NPWA 1O60A 4I9AA 1XIGA 3VNIA 2ZVIA 1EYWA 4B9ZA 3G1FA 1DWJM 2CCRA 4IH3A 2BSLA 3ITOA 5FKYA 2EG6A 5HULA 3ZJ7A 3CAVA 4HA4A 5F1VA 2O4QA 4HTYA 5A6SA 2TMDA 3R4IA 3N2CA 1JAEA 3ZXWA 2GVLA 3VDBA 3N2BA 4LCRA 3KEHA 5A3HA 1TMHA 3BSGA 3NDYA 1BVWA 1UD3A 3KUMA 5BOFA 4QROA 4UFLA 4GE8A 4FPSA 2IXVA 3GG7A 3RM9A 1TTJA 2XU2A 1ZENA 2GJXA 3EX6A 5I79A 3KCJA 4AAJA 1O5KA 1EKOA 5I09A 4BI7A 4GX8A 1FWTA 4FNTA 2A6NA 4PBFA 3BAXA 5G2WA 1LT7A 3Q94A 1NP0A 1YIXA 1QK2A 3E2QA 1XRFA 2H8XA 1EX5A 2ISSA 1X96A 3HBLA 3LLFA 3U4FA 1V6YA 2BX7A 3HJZA 3TWBA 2QCNA 3WG6A 5FL1A 1BWVA 3GR7A 2G4JA 2OO6A 3IIPA 7TAAA 2AL2B 1TB3A 3ZVHA 1VFFA 2J7HA 3PULA 5TIMA 1TV8A 1EBGA 4B92A 1MI3A 1H62A 4E2OA 1U2YA 3CHEA 4B3KA 4Q4SA 1O4UA 4C7DA 1JF5A 3T2QA 4BQ4A 3GNXA 3TN4A 3KL3A 3AZRA 3RLUA 4Z1DA 1OGGA 2YCLA 3GXMA 1UG6A 3QH2A 3TQKA 2CLIA 4JGDA 2JKAA 3GZAA 3N19B 3MBFA 3BARA 3A6OA 1VGAA 1NTHA 2A5HA 4HNCA 3GVWA 1AW5A 3ME3A 3VDAA 4IG2B 1YQ2A 1FH8A 2PA6A 3PZNA 4DZAA 6TAAA 3W85A 2PGFA 4JN7A 3TYAA 3VGBA 5F2LA 2GWNA 1LQ0A 4HN8A 5D2XA 4ATDA 3WSUA 2G37A 2XGBA 3GVRA 1MNSA 1KFJA 3PUGA 4DJFD 1EQPA 1RVGA 2C13A 4JN8A 1UA7A 3GTHA 4K39A 2GSHA 1YLVA 4DHGA 3KP0A 1K03A 2GGGA 3SRKA 3W7OA 2FHFA 1AQHA 1Z6KA 4DJDC 4E4FA 3HM7A 1J12A 1ADDA 1NOUA 1R46A 4ZSTA 2E3ZA 2J47A 5BYWA 3HGSA 1OGSA 1MZRA 1Q6CA 1EJUC 1WXYA 4H9VA 3KTCA 5GJNA 1VEOA 2E6AA 1J18A 3U5YA 2Z1SA 2X1UA 4YIWA 4MLJA 3FW6A 1US0A 2FVLA 1GG0A 1PS9A 3AU6A 3EKZA 1KC7A 3VDGA 3SQSA 4RZ4A 4F9JA 4PMOA 2RGMA 3NWRA 4GIEA 1BWKA 3LERA 4D71A 2PDHA 4NI8A 1C92A 5J5DA 5LNRA 1HL8A 4X3ZA 1C9DA 1CXKA 2WMHA 4ZZ9A 4Q6JA 3EPOA 3SSJA 4C7FA 4BEUA 5BWAA 1B3YA 1PIFA 4PH6A 4UZUA 5A6MA 4Z2HA 3D0CA 4DJDA 4D1JA 1GEHA 1A0CA 4O17A 2JF7A 3B8IA 4MHBA 1LZOA 5BXTA 1PX4A 1CXHA 4WKFA 2FZBA 1GONA 2DH2A 2XINA 4FI4A 1UKTA 1W5MA 3UZYA 3TYUA 3N9SA 5E0FA 2VL4A 3T05A 2WHJA 5BMWA 2Q8ZA 3CBWA 3WQ6A 3P0XA 3S9YA 3CWOX 4Q4OA 1F61A 1JEZA 4OBRA 4PRTA 1VPYA 4JCMA 2IKJA 2INZA 3DGRA 3B9NA 5HA7A 1H7OA 2PFHA 2CZDA 3VOIA 1XDLA 4KEZA 2XN0A 2R24A 2WV8A 4U10A 1TA3B 4IWWA 3UXKA 1DJWA 3E49A 3RR1A 3OPSA 3WNMA 4UMCA 3T8LA 3V16A 3GZ3A 4XZIA 3EWYA 4IUGA 3MVTA 5A6BD 2Z26A 1R0MA 4Q7IA 4C1NB 3WLOA 3WJSA 3SIZA 1PUDA 1KM0A 3GXNA 5EMLA 1FHLA 5AYYA 1OFRA 4NAFB 1E43A 3SCUA 4Z2JA 5AFDA 4ZGYA 1H49A 4UR8A 1M65A 5BXRA 3VM5A 1WNOA 4S2BA 2EO7A 4AEOA 3R25A 4DBEA 1IIHA 2DW6A 2ZRWA 3LPPA 1DJZA 4DF0A 3VFCA 4JIPA 3W25A 3EX4A 1H3GA 1YW1A 4JQ3A 3DUGA 3IACA 1YPIA 3I7RA 2ZUUA 3CAWA 3IPWA 2ZUWA 3LLDA 4TX6A 1EZ2A 1UKQA 2WMKA 1JUBA 4WDTA 4GUFA 2Y8UA 3VOHA 3EBVA 2WMJA 1JD7A 3IRSA 3I65A 5A8QA 1B3XA 4C6NA 4Q8UA 3TONA 4IMEA 1AL8A 4PUDA 3P0WA 1U5HA 1S5TA 3CV1A 1EP3A 3VD4A 2KZHA 2VEKA 2Y5EA 3QHMA 2XYLA 3A9IA 4QG9A 2OKOA 1OF6A 2X7VA 4JFUA 1QHZA 1E9YB 1AQ0A 4A2SA 4IF2A 4ROPA 1PTGA 3QSTA 1XM3A 2QIIA 1SO6A 2W66A 1VD6A 2NV1A 2HQAA 3DI1A 1PDZA 4IPNB 1JUKA 2DVUA 1BYCA 3NL3A 3QY7A 4HIBA 1NARA 5EBAA 2WCSA 2DT1A 2WMFA 3C8NA 3L4TA 3F4CA 2Y7GA 4E8DA 1XRSA 2E5BA 3N4EA 2YBUA 5DX7A 4H4IA 2QCEA 5BROA 1I9CB 1YDOA 2A3EA 3N3TA 2ZRXA 1XQLA 3HG3A 4RLIA 2Y24A 1GJUA 2NXGA 3OGRA 2ZX9A 1JPDX 2WWDA 4MVAA 2QCGA 3MO7A 4W87A 2ZUTA 1VHCA 2G4FA 2E1DA 4IPJA 4WHBA 4Q22A 4G7EB 3JRKA 2ASHA 3AAMA 3UR8A 1XLCA 4AZHA 1KM1A 3ID7A 3P62A 2BBFA 3F2BA 4KPLA 1YE4A 3N2XA 3P14A 4JBRA 5DFAA 3N6JA 1UKOA 3DKLA 3NGFA 4LSBA 4LS1A 1YTDA 5IHRA 1EIBA 2VCAA 4U33A 1V93A 4GQRA 2HJPA 7REQA 3ZSSA 3LHTA 2BFGA 2F7FA 4HTBA 1U33A 3GB6A 4LY8A 3AIQA 3MDUA 4N6EA 1OSEA 3DHDA 4MB4A 3TW7A 2WZTA 3T6CA 1GKPA 2RJHA 4XO7A 1LYXA 4MKVA 3FYOA 1OY0A 1EO7A 2YBTA 3ITXA 1YBQA 4YYFA 2QUMA 2PDWA 3NOYA 1LBMA 1CTNA 2ZOXA 3CIVA 4DZHA 3KTXA 4HCDA 2GGJA 4DI8A 4MF4A 1XI3A 1Q6RA 2BGNE 3EPMA 3WJXA 4FF5A 7XIMA 4O54A 4Z08A 4UFMA 3M41A 4GY7A 4IMDA 4IX2A 1B4KA 1NH6A 3RLGA 1OFPA 2OLHA 2WM1A 4CNNA 4OE7A 2OSWA 4MSSA 3FJNA 1WO2A 1A49A 1OQFA 1ISVA 2RJGA 3PFRA 4D6HA 2E9LA 1XSJA 1TPDA 2PWDA 4XD3A 3LY0A 1NWSA 3SGZA 1WDWA 1R3WA 1J4EA 4KKXA 4IICA 2OGYA 5LA0A 1KLZA 4NT0A 4GZJA 4M7TA 1I1WA 2Z1BA 2J66A 4O28A 3WDIA 2FGLA 4Z42C 2C1IA 2Z1XA 5H1WA 4XAPA 5A8GA 1BXCA 4GK8A 6REQB 5G1MA 4W8BA 1F3TA 1K6AA 1QJWA 1UR8A 4M6QA 2Q71A 2DUZA 4PMDA 3TR9A 1XLEA 3H53A 3NVTA 3NNTA 2G95A 3UY7A 1WCGA 4JIQA 4JOMA 1C8YA 5LZLA 4JYFA 3GBDA 2UV8G 2J78A 3M9YA 3VMNA 3LXCA 1WKFA 5C9RA 1F05A 3W7GA 1U1UA 2NQHA 4X22A 4BQ5A 5DT7A 5IXEA 1S2AA 4W8AA 4B5SA 4HOWA 3UBPC 5EMUA 3FVMA 1DXIA 1Q65A 2WVUA 3VNDA 4S3EA 1ZALA 1FCUA 2EHHA 4D6JA 3M64A 1E0VA 4ZTYA 3KBWA 3BSMA 4H8VA 3L5AA 5ENLA 1V03A 4MPQA 1OHLA 5FF2A 4BF5A 1UR1A 2A7PA 3ES8A 3KX6A 1CLXA 1W37A 4LGXA 3MCOA 1HFBA 2E5CA 3MU7A 4TQTA 5HWMA 3TDFA 3GBEA 3CTTA 3H23A 3WCZA 3GVVA 3A64A 1I2QA 4RCXA 2AL1A 2ZC8A 2Z0IA 3BLPX 3DCPA 1HJUA 1DJYA 4TV5A 4CU7A 3B05A 3GQYA 1OWQA 2WOQA 5K9XA 1XH0A 3FVDA 4ENLA 2UY4A 1GOOA 3ZR4A 1QI0A 2J79A 3VINA 4J2PA 4PMRA 1QTWA 3FLUA 1KB3A 3NQFA 5A6JA 2A85A 5M3WA 2YB1A 1XIMA 5H8MA 4HYRA 2C18A 3L67A 5DMLA 1JPHA 3V1PA 4HYVA 1JF6A 3N1AA 4IL0A 3UG5A 2R91A 3UU0A 3QLLA 4MYAA 4L56A 4NZ5A 1I0BA 4X2RA 4IGSA 1QPNA 2FB3A 3I7QA 1EUAA 1EUNA 2QUTA 1KCZA 2ZUNA 1DBTA 4N0RA 2A3HA 2FZ9A 4GO9A 1Q6OA 4O8AA 1HKKA 1QK0A 1FXQA 3MKVA 4W84A 1Z3NA 3FKKA 4M6VA 4EPKA 1R2RA 5EMMA 2V63A 3RU6A 4K8GA 1XRVA 1TV4A 5FSEC 3IVSA 3VNKA 1OCJA 3H54A 5E5CA 2BTMA 1TV7A 4AY7A 1KBKA 3RLVA 1LOLA 4A05A 1RA5A 4CCZA 2HVNA 1C8QA 1XGEA 5F1UA 3E0FA 4B2DA 1GWJA 3TQVA 4ML4A 4QR6A 2JIEA 3I6TA 1QFEA 1DKWA 3N14A 1GYNA 1XGZA 5I3GA 1V02A 3II1A 2PWUA 4AB4A 4E3TA 4H1ZA 3D3AA 4NAEA 1DJQA 3D46A 3NO5A 3VIMA 2P1FA 3ERPA 2BMBA 1QATA 4AUBA 1HL2A 2TAAA 3LRMA 3HB9A 3TC3A 3LUTA 1CXFA 3EDDA 2FDSA 4XBKA 3EWWA 4K1GA 4J3XA 3BC9A 4AXKA 2NQ5A 1OFEA 4YPJA 5AB3A 4J27A 4LW7A 1OFBA 1WZAA 4DX3A 3QFEA 3RNDA 4CD7A 3M5XA 2VX7A 1H7WA 2IS7A 1DV7A 4WJ8A 3L5LA 2OO0A 2ABAA 4AF0B 2Y7EA 4HGXA 4ZQNA 4PB4A 1KWGA 5ECVA 4MJ4A 5E0CA 1W91A 4UC5A 4DM1A 4GBUA 2PCQA 3SCTA 1QI3A 2A3LA 1W8GA 1HKIA 4Y9NA 4H7ZA 2X0HA 4CD6A 1GW9A 2EF9A 3AYSA 3UYIA 2TODA 5B7YA 1WKEA 3DKJA 4C6CA 1EJWC 3PB2A 4O15A 2CBUA 4W89A 2XIMA 4X9YA 3FSUA 3NDZA 4LV4A 1XLIA 5CJNA 4IPPA 3TC7A 4JEQA 3P6LA 1L8PA 1LRNA 5AHLA 4GC3A 4GQGA 4O1AA 4QGCA 4CNSA 3S83A 4L4PA 2WC3A 3VIPA 4MZ1A 3LLXA 1CB2A 3NM3A 2ZWYA 2BY3A 3PHAA 4M5PA 3USBA 4FNQA 3O3RA 4OWGA 1HKMA 3TX9A 1QASA 3IV3A 2J8TA 4WJEA 1IXPA 3P5ZA 2VURA 4X0NA 4IFRA 3ZZ1A 3TA6A 2V82A 1VBJA 1XPYA 4UQBA 4JS3A 4ACZA 1RQHA 2CESA 3F4NA 3ICJA 3C2EA 1J0ZA 1GQKA 1DORA 4WY0B 1E0WA 1E3XA 1DOSA 2F6KA 1LRQA 3AXKA 2VQTA 4CNTA 3BL3A 3OA5A 4UQAA 3APYA 3UJEA 4MNLA 1EF3A 1OGBA 4YHGA 2W3ZA 4ZEPA 1XH1A 4H01A 4AD5A 3LV6A 1ZUAX 1OYCA 5DT5A 4OV9A 4CQBA 4B9YA 3TN3A 5I02A 4IIBA 1F3WA 3TAKA 2Z29A 3POHA 2VZTA 1BYDA 2G3JA 3UVIA 4UFHA 5BWFA 3VILA 4ZO9A 2QMKA 3Q2DA 3H70A 1E1FA 1WQ5A 1MUWA 4JCLA 1W1VA 1DPMA 1GZJA 2GJRA 4QLKA 5CPLA 3C0LA 3IJ9A 1XCFA 2YA1A 4FIQA 4A35A 1XD1A 1NM9A 3PC0A 4NKCA 3XIMA 1LG1A 4KMQA 1V79A 2OZ0A 3B8VA 4CEUC 1IEQA 5I07A 3AYRA 3QHNA 3VU2A 1NVMA 3UPBA 3GR4A 4RDZA 4MY9A 3OG2A 2BOGX 3ZOAA 3GS6A 4NZ1A 5CBJA 2OPJA 4JTFA 3R12A 3COTA 4EXAA 3MC5A 3GM8A 3N17A 4CUCA 5HATA 3L0NA 3GSMA 1BG9A 2PD9A 3EWDA 2C16A 3VD9A 1V8EA 3CIXA 3HN3A 4PUUA 4O4WA 5F4SA 4U28A 3XINA 3W7MA 1VEPA 1TIWA 3OJGA 1GOMA 4CN4A 1S46A 3OZYA 4LH8A 2E40A 1W9BM 2D1ZA 2YJQA 1FX6A 3W7HA 2XFRA 4HZ7A 4Q8WA 4XAGA 1MSSA 3VK5A 1UZDA 5TQLA 5CPQA 3SCSA 3IAPA 1CBGA 3ORWA 3LMZA 4LF1A 1J6PA 2ZX7A 3DFPA 1B2YA 1RSCA 1XF0A 2QF7A 3BICA 1GKRA 2EXOA 5LHEA 4POCA 3EA3A 4WKAA 3OBEA 1POJA 3H12A 4BA0A 1EJRC 4RXFA 1FOBA 2X7WA 4HP5A 2BLEA 1XYZA 3NZRA 2X42A 2WZIA 1GKQA 1NFBA 3NSXA 5JUVA 3BW4A 1X1ZA 3G0SA 3OHIA 3IUDA 2VZVA 3O15A 2GJPA 3GH5A 3RRAA 2RUSA 4A3HA 2J7DA 1A5CA 1MXGA 4Q3MA 4HZ8A 1A47A 9CGTA 1R30A 3UJFA 3R0KA 4IIDA 4I9TA 3PZIA 4LVAA 2DIJA 2PDCA 1JRBA 1E15A 4D6GA 3P7YA 4FX6M 3TSBA 2J4GA 1P48A 2VELA 3A4AA 3HPZA 1JGMA 3URNA 3ZWTA 4UTTA 4OT7A 1XFBA 2QDHA 4BFAA 5FEWA 1SZEA 1JDFA 2OYKA 1KFLA 3O6AA 1P1MA 2NQ9A 4GHRA 3FDKA 4Q8QA 1HXJA 2FTYA 3WBXA 3SR7A 4AEFA 4CQDA 4J3UA 1QNRA 5ABHA 4HNTA 2V5LA 3BTNA 3TYEA 6A3HA 1LRTA 1YMYA 4XKYB 2PEVA 2I5IA 2ZZ1A 4FNRA 3TTSA 2V68A 1QHOA 3GIYA 1W32A 1HTIA 4NZ3A 1F9CA 3UXDA 5XIMA 2GJNA 1FWEC 3SIMA 2FMOA 4BZYA 2ZX6A 2V67A 3NUKA 1QUMA 1IR1A 3LCFA 3R8GA 8XIMA 2F61A 4EK7A 1MQPA 1J96A 2ONEA 3VD7A 1NWRA 3GU2A 3GD6A 1RJRA 1ONXA 1AH0A 3WL1A 1M04A 3OQ8A 2ALRA 2P8CA 5ABFB 1WZLA 3RAOA 4MZ8A 4LEFA 1P6CA 3AOFA 1R87A 4YS1A 2GL5A 3MUIA 3GYCA 2ZZ2A 2PC8A 2WMIB 3EMZA 3OBAA 4HOZA 5D02A 1WDPA 4NX5A 3CO8A 2W4XA 1ISZA 3UXLA 4ZE5A 3W1UA 1CECA 1VFMA 5HQMA 5EB8A 3DENA 3OZPA 2HZGA 5IFTA 2DZSA 3NO3A 4KQNA 2VYOA 3H4WA 3EMQA 5D9MA 3K8KA 1OC5A 3LOTA 2NSXA 3NQ6A 4C5ZA 1EA9C 2PBGA 1UP3A 4FLSA 1LLZA 1HNYA 3ATYA 3O8AA 1U5VA 3PPHA 3SI9A 2XN1A 4KCTA 1N2VA 4Q8OA 4ZTXA 2FTPA 4OZOA 1E4NA 2ACRA 3M0KA 3U9IA 3W01A 3T78A 2ZUMA 2DQWA 2OEKA 3W73A 2YGYA 2AOSA 3SQLA 4W7WA 5C2CA 3UFYA 4TR9A 4N4PA 3M7SA 4Z1AA 3CWNA 1O1HA 5FL0A 1MDLA 1QNQA 5TBOA 2PTZA 4C1LA 1REQA 1CT5A 3AICA 3NL5A 1R2TA 4KW2A 2NX9A 4PTWA 2VUNA 3F4VA 4UR7A 1V6WA 3PPCA 3W88A 3UG4A 3V5FA 4GI4A 3WFAA 3FY1A 1H7XA 1W1TA 2NLIA 3TSDA 1JIBA 1Z8AA 1ZLPA 1Q85A 4E2VA 4N2YA 1DJGA 4YMZA 5H8UA 3DX5A 5IM51 4X2PA 4DBUA 5U7SA 3LG3A 5IDIA 5LHFA 2PB1A 1JZ6A 2PTDA 2Q8XA 3B0VC 1G1YA 3HO8A 3P60A 4DWDA 3PWAA 3C4UA 3IUIA 3RM8A 3ELFA 4LALA 4WRHA 3TCSA 2VFIA 2QNEA 2VTFA 3GH7A 4RDYA 1B3ZA 3BLIA 1VBGA 1DYSA 3JR2A 2QULA 4KFOA 5D8ZA 1FKWA 1ODZA 3S9ZA 1ADSA 3GTXA 2PTXA 4PSPA 3W1QA 3GTIA 3URAA 4H9UA 3GG1A 1LORA 3ABOA 2XIJA 1W0MA 1KR0A 1SJCA 2YFNA 3FEQA 4DXXA 3KLKA 4OBSA 4LS0A 4DPPA 4KH2A 3TQ0A 3NZGA 1JCXA 1GOXA 4O52A 1KV5A 2FLIA 4GNVA 1N8IA 1TJ2A 4ZMGA 1WAUA 2W79A 1XYBA 4JTJA 1RJQA 1QAPA 4N9EA 5I3FA 1K3UA 4E2BA 3T2OA 2GDQA 4Z1BA 5KZEA 1EOKA 4QTGA 3W75A 2X8RA 3QPZA 2W63A 1VJSA 2X30A 2Z2UA 3ZR6A 2J7BA 4GNKB 1GEQA 4DAFA 4AC1X 7CGTA 5F2GA 1AJ0A 4XIAA 3QGKC 1MFVA 3PBUA 2NQZA 4DO5A 3HMJG 1DIKA 1I8JA 2R1PA 1FCVA 2DY3A 3BG5A 4IQJA 2V5CA 4KWSA 4D6IA 1ZJBA 1UJQA 3DECA 2KAUC 4LCSA 2TPSA 1WKYA 3B3DA 3W4RA 4LB3A 3HG4A 5IOBA 2VC6A 2HS6A 3HQOA 4P61A 1GVEA 3OVQA 3N34A 3PBGA 2VVSA 4AG0A 3ABZA 1CX9A 3W7PA 2WMIA 3E0VA 1VFSA 1YXDA 3V0SA 1E5JA 2ZZ3A 4J9JA 1BQCA 5KTLA 5MKGA 1OJXA 4F0RA 4UTKA 2OSYA 4GY1A 2PU0A 4K7VA 4YWSA 4AY1A 1W3IA 1K6WA 2OZ3A 4QP0A 4LRTA 5E9AA 3W24A 1MW1A 2YDSA 3R43A 4GD0A 1V51A 2DUAA 4UFIA 3IIZA 4F0MA 4A4AA 4UNKA 1LF1A 4B91A 4H2CA 4JY9A 1YHTA 2F8QA 4O50A 4E8GA 1AL7A 1CEOA 1F6KA 3AYTA 4B4HA 4KWWA 4AVOA 1JYWA 4MAZA 3LS9A 1UIOA 1V6XA 4PUJA 3GUGA 3NEVA 1W8SA 1RXOB 2ZZ6A 3W7JA 1JUEA 1Q6LA 3B0YA 2OU4A 2VZOA 4AIBA 3GC5A 3W37A 4QCFA 1KRCC 5FESA 4AFYA 1PKYA 2NVDA 3WLMA 4GBDA 3GXIA 5DCBA 2YZ5A 3F2DA 4F3HA 3RO8A 4L5ZA 3RPMA 1XIEA 4Z1CA 3GC4A 1W2PA 2Y8KA 3NA8A 4PMXA 3POCA 3FHAA 1JXJA 3BW2A 4QNWA 1HN1A 1SZFA 2BHUA 1LG2A 4S1FA 3K4WA 3AROA 3P93A 4X60A 4AWTA 1EJXC 2FPYA 1Q66A 3TAOA 4CKQA 4F0KA 1YX1A 2DIEA 4E4UA 1L8NA 3G1AA 4XKMA 4RDWA 4O0KA 3FK4A 4IP4A 3T0AA 5EFFA 3BSHA 3BCJA 1H1YA 3A3XA 3M1ZA 5LNVA 5FF7A 2Y62A 4K2SA 2XISA 2CERA 1JZ2A 4S3AA 1J93A 4I5XA 3L65A 4P8WA 4HN4A 4DLMA 3CH0A 2Q09A 3Q58A 4E6MA 2VGFA 4GC4A 5I77A 2GUBA 2IKIA 3MSRA 4ORMA 1PBGA 1C7SA 3TJLA 3WBAA 2ZRUA 5XIAA 1XL9A 2XSXA 1XCWA 3FSTA 5REQA 1S1PA 5EMKA 5LXEA 3MPGA 4CLMA 4M82A 3B9EA 2D2GA 4LEQA 2VEFA 5I7GA 2VR4A 2X0YA 4JR5A 4TIMA 2RAGA 8CGTA 4W8LA 1BSLA 2AGTA 5CKSA 3BMVA 2JGQA 4O53A 2DSWA 4NRRA 4FALA 4PL2A 2YX0A 2XSBA 3RJYA 4HMCA 3H2CA 1NDWA 4P7OA 3EDKA 5C70A 4X0VA 4ZFCA 2P0IA 1ZFJA 1UP2A 3H55A 3L2MA 2DIKA 3MKCA 3H2FA 3VKBA 1ZP3A 4RL3A 3E2RA 3P3BA 2WHLA 3AZSA 1MFUA 4C1NA 3ARSA 2YW4A 4PA8A 1UHVA 3VIGA 2V69A 3UT0A 3WQWA 3QGVA 3ARZA 1KFWA 1RK5A 2NV9A 1TA3A 4P7QA 1EPXA 1Q7QA 5DCDA 1TV3A 3MZNA 2ZBTA 4ZXLA 3IJ7A 3EXSA 1FWDC 5G4EA 3WMBA 5A6KA 4G1NA 3CPGA 1ENUA 3GU9A 4US5D 2VQUA 3DU0A 4NI3A 3VZXA 1TZZA 3VXGA 1KGXA 3BK0A 4LBUA 1MYRA 1Q6GA 4JL2A 5I24A 2GVGA 2GSJA 4DI9A 4PEKA 3AS1A 4O14A 4KETA 2E09A 1EGVA 3DERA 3OIXA 3G1RA 4PCSA 3SGUA 2XGIA 1Y7VA 5EL1A 4QDWA 5BU9A 4QS5A 2DT2A 3PAOA 1DJIA 5FEPA 4LT9A 1FFQA 4JTIA 4HVXA 2R14A 4D6EA 2AGKA 5DO8A 4B3LA 3MUZ1 1XINA 2QAPA 2YKKA 3EEGA 3J7HA 3GNPA 4WZHA 5I00A 4UCFA 1YEYA 2I9EA 1GVSA 3TEVA 1V5XA 1X8CA 1EJSC 4IIGA 4Y9MA 3Q65A 3U4AA 3V7PA 3QPEA 2DT3A 3UA4A 1XLDA 2XIQA 2CLFA 3DIPA 3ZJKA 4HPNA 5GVJA 4XZMX 1B9ZA 4OV4A 1RP9A 1W9VA 3ZSTA 1XWYA 3TE9A 4UTTC 3GG8A 2VEMA 4CU6A 1H61A 2E8ZA 2J8FA 3DG6A 3WH6A 3R0DA 4BJHA 2AAMA 1MVYA 5FF3A 3LZ3A 4FLRA 3VKDA 3W1MA 2PP1A 1S38A 4BKNA 4B5XA 4ZBCA 3CASA 3SBFA 3W9ZA 4DAIA 3SY1A 3WQVA 2CU0A 3MHUA 3LHVA 2E9BA 3MDWA 4CQCA 3ZMRA 4ECLA 4S38A 3OG3A 1DEDA 3TC6A 4AXNA 3NG3A 3DXIA 1MW3A 3CXOA 4QEEA 4PBEA 4R33A 1E0TA 3EGJA 4H41A 3N29A 2XWDA 1W1YA 5AHFA 3TYCA 1UA3A 4B15A 1RLDA 4RE4A 4LJ3A 3W1NA 3N12A 3VGFA 3K4AA 1UH3A 4GKLA 4BF7A 4PMJA 3PVFA 1PJ9A 4R7WA 2WNNA 1JCYA 3PUDA 3ITTA 4PEEA 4GVHA 1XYFA 1PHWA 2YDQA 2PWHA 2VHLA 4LVDA 1BHGA 1UC5A 1FHDA 1RA0A 3WFLA 3UR7A 2UZ9A 1QBBA 2FH6A 4WR3A 3NL6A 1JNEA 3F4WA 2FHCA 3OGSA 1FKXA 1IXOA 1VCVA 4Q6XA 3E96A 4P8UA 1Z41A 2C1HA 1O95A 3BO9A 5AHMA 5HR7A 3M5ZA 4MWAD 1GQJA 2D0GA 2YBVA 5I3KA 1G5AA 3EOUA 3TFXA 4UOJA 1S3TC 2XUCA 2YCEA 3QHOA 2V30A 1VEMA 4GH3A 2FKPA 2P3EA 4EANA 3WQFA 4XBJA 3CTLA 1LDCA 3UCDA 1FBAA 3EZ4A 1NFPA 3B8UA 2CXEA 1JPMA 3LENA 4M80A 5HPCA 4RK8A 1JZ5A 2WZMA 3H24A 4JTRA 3WQ4A 5C0QA 5HANA 3W84A 4N4QA 1RPKA 3MWCA 2IPFA 3PZVA 3I68A 5CBBA 4UTFA 4JIHA 1SZRA 4WQ6A 3ABQA 3ALFA 4JHZA 2PLCA 2BHZA 2PZ0A 5EPDA 4N42A 3UXIA 1IQ8A 1GG1A 3K1GA 5A69A 2QHAA 2G8ZA 2RDWA 2YXGA 3PK7A 1N7KA 4FAMA 3KAOA 2YLAA 3T2PA 3USZA 4ZCWA 2FQIA 5GQBA 3T07A 5LGZA 2A6LA 2VFFA 1B30A 1WA3A 2IKGA 2Z7GA 4KRUA 3RX4A 2A0NA 2DSZA 4CCDA 4IGHA 3DEQA 2CLEA 2OX1A 2XHYA 5HWNA 5HJYA 1ITQA 3WEOA 1UZ1A 3QTPA 4XZWA 3E2VA 1Z32X 4A3YA 2O9OA 2OOFA 1R3VA 5LKYA 3V5OA 4DJED 1Z89A 2AQVA 4WGHA 3UPWA 2W9MA 3CMFA 3I10A 1TWZA 1XLGA 5CAKA 1SZNA 4WDXA 3BLOA 1V02E 4FR1A 4FOKA 5ABEA 2BP1A 1L6FA 4AZIA 1JZ8A 3PJWA 4LUSB 1OX4B 3E12A 1XYLA 2CKRA 2DSVA 1TR1A 3FYPA 1BG4A 1Q7ZA 2HWGA 1EQCA 3RF9A 2XTKA 1OF8A 3IJDA 3B4UA 4JHOA 1ZAIA 2J9YA 2Z2BA 5D9OA 5FSDC 5A8MA 3W53A 3WDHA 3B8SA 1AODA 2WM0A 3ZT6A 7REQB 4LAUA 1QOQA 1O94A 4OGZA 3FAWA 1XKYA 3GAYA 4FNUA 4FZIA 5C6MA 3BGGA 3VA8A 3L9CA 4B2DD 1H7NA 1NF7A 2ZUSA 1VLIA 2PF8A 1BKHA 4L80A 2ZXAA 1ZBVA 3M5YA 3CV7A 3GFZA 4J3WA 4QE1A 3W7QA 3BV4A 4KWOA 5A6BA 5I5RA 5AC5A 1UQZA 3SCQA 1WDQA 2V2DA 3SRFA 5A8NA 2FFIA 3NQ2A 1CB7B 2E0PA 3O6YX 4NXKA 1Q2SA 3ZR5A 3UWUA 4Z17A 2FTWA 5HQEA 3M47A 4LPCA 3RK8A 3M0ZA 4YTUA 3P84A 3CUHA 3KL5A 2GVEA 3VOJA 3C8FA 2QIWA 3AUOA 3QVQA 4P7LA 3CUJA 2A3CA 5CZJA 5JQ9A 2R6OA 1SFJA 2VRQA 1S1RA 4K7YA 3UJ2A 3FN9A 1ZTVA 3S6OA 1XCXA 3R89A 1JQXA 2PDUA 1DQXA 1QW7A 2F84A 2ZXQA 1H7RA 1IWPA 1O1ZA 3LTYA 2PDPA 2Q3RA 4PTNA 2J7GA 3EXTA 1F2JA 4MY1A 3IAQA 1EFZA 1JFHA 1TWWA 1T0OA 4IP7A 5D2TA 2DGAA 4NAEB 3CV6A 5L6UA 4F9DA 4ZQRA 3T1GA 4O1BA 5M2FX 3G0UA 3STFA 4RE2A 4O1FA 2DJLA 4RX0A 3MJMA 1SJAA 3ARWA 2EPMX 5G2IA 4RPQA 4Y90A 3OVPA 4XBSA 3W87A 3MUY1 4JTHA 1I2PA 1XLKA 4LUTB 2WHKA 2WSYA 5T26A 2GDVA 1M41A 3WDPP 4NF7A 2CYGA 3NQBA 4NP7A 1H51A 4NUWA 1R8LA 1X39A 3B03A 3STGA 4WJXA 3EWZA 3L4YA 3TV8A 1E56A 5G4HC 1C29A 2E77A 1DJHA 3HZ3A 3W83A 4PBGA 1ITCA 3KOWA 3VUPA 5AC7A 5T9BG 2PRLA 3QW3A 4W5ZA 1L2UA 4ATLA 1HP5A 3A3HA 1KTBA 3FX4A 4TVUA 4LAZA 2JFEX 1W1B1 5HDRA 3CO4A 1EJTC 4RZBA 3GNDA 5SWUA 1BEUA 3SRHA 5HBFA 4V1YA 1BTMA 3UWQA 3UF9A 3QY6A 3W6LA 4UNIA 3D47A 3S2NA 1YKWA 1C9WA 4M56A 3ITGA 2VX6A 2TSYA 1J6OA 2QLYA 3CUGA 3BE7A 1I1XA 5CJ5A 1IXQA 5T9CE 3ZLHA 1RALA 3GFXA 1KBBA 3CAKA 1SJDA 3WNNA 4Q8NA 1PO9A 2CHOA 2P53A 1IEXA 3VOCA 5KEZA 2QJHA 4O18A 2VT0A 1O7AA 1HKWA 3GNRA 2PP0A 3E9AA 4FOUA 2VR5A 3VNYA 3L23A 2Z28A 4GQQA 5I3IA 1D2KA 1E6NA 3KLLA 4LUJA 2O9TA 4H9ZA 1ZHAA 4LAKA 3CPUA 4AZBA 3T7VA 2OWCA 1XQKA 1H4PA 1OD8A 2ON3A 2GK1A 3B9OA 2INEA 1H0IA 4JXCA 4QG6A 2YL8A 3NPVA 1RD6A 3PZ9A 4NNCA 5BU6A 3INPA 1SFSA 7PTDA 3LBCA 3G6MA 5D4YA 5CSUA 2V2HA 2I7GA 4TX8A 2ZFAA 2QVHA 4NRSA 4PUMA 4QJ3B 2J27A 1RY0A 3GX9A 1PAMA 3HGJA 2VFGA 4GY0A 2ZQ0A 1QPOA 5CZTA 1QI4A 5FF0A 4NIRA 5FCZA 1ISXA 1RPXA 2ISDA 1EHAA 2G96A 2WVSA 1KKRA 1U5JA 1NP2A 1LQAA 3KCOA 2DU2A 3G3DA 1FP8A 1UC4A 5CQ1A 4MUZA 2YA2A 3MI3A 4QCEA 1CGWA 1JYXA 1W3KA 1WKDA 3BJTA 2DZTA 3MCMA 3MUAA 3RCMA 5LA1A 1IZCA 1E9LA 3CQJA 1O66A 5CGTA 2PDKA 1MEHA 1XGDA 3MCNA 1QW8A 4JY8A 2R1KA 2Y8VA 3N2TA 1CWYA 1T40A 1B3OA 3GTNA 1A5OC 3MKKA 4GVIA 5DANA 1V0NA 1JVNA 3RITA 3EOEA 1LROA 3FA4A 2EAWA 3GUWA 1HVXA 3SN1A 4QITA 4DNMA 1SUXA 2CETA 3DFTA 3KBMA 4DF1A 1R9XA 4PRWA 4KGLA 1I4NA 3CK5A 3HOJA 3K4DA 1XSKA 2GQ3A 4Y2WA 1JCNA 3LCWA 3WH9A 1UCWA 1US3A 1TREA 1UR0A 5E09A 1PB0A 4PCTA 3GU1A 1IV8A 1TJRA 3MA8A 4PMVA 3WFZA 3W1XA 4K68A 1WXJA 4ASTA 3QV6A 1TPUA 4JTTA 1UROA 4R7JA 1ITXA 3VNMA 1EBHA 3MYPA 3HMCA 3QOKA 3AWNA 5H2ZA 3LQGA 1PXGA 4D6DA 3CEUA 3WH8A 3NQ7A 4EACA 3NZQA 1EO5A 1EDGA 3SZ8A 2A21A 2GDUA 2NUWA 2PMQA 2B4GA 4TOQA 8XIAA 3U7BA 4AH7A 4W93A 1TJ0A 5A2BA 2V5BA 1RHCA 4IQEA 1PYFA 3PS7A 5AKQA 4NNBA 3S3GA 1QOPA 3RFAA 3QKZA 5EMYA 3P81A 3G1HA 2QJMA 3SDOA 1TRIA 4JIRA 2BVYA 3TN6A 1QI5A 2VM8A 2OX4A 3E0LA 3E0WA 3Q4DA 1X6NA 2CC0A 3PWIA 1GHRA 4JFTA 4GIAA 1RBOB 2ALDA 2WJZA 3GNOA 1E4LA 4JTCA 1P1XA 3AXXA 2O0TA 1K9FA 1C93A 5H91A 3R11A 4H00A 4U3AA 2P8BA 4WD0A 4A8RA 3VC5A 1E1CB 4GJJA 3IJ6A 4HMNA 1AH3A 4NU7A 4ZODA 2J6VA 5HPOA 3N25A 3DH7A 4EAYA 3KP1A 5HWJA 1OFQA 1TPFA 3W86A 4DY1A 4TU1A 3V4BA 4GXPA 2BDQA 5M17A 5DBUA 4KRZA 1HIZA 3IVUA 2VP8A 1VR6A 3SUUA 4JFWA 1IR2A 1OG0A 5HUOA 1M01A 1X1NA 5HNTA 3PZMA 4J2MA 1GQNA 5HINA 4R3UA 3BWWA 3MI6A 1LOQA 5KSWA 4MFDA 1XHGA 2Q3OA 1D9EA 1E55A 1ADOA 3T0BA 1TELA 1M03A 2BNJA 1PHQA 2WSQA 3NYZA 1UR9A 1A80A 5D2WA 5CLTA 4HPHA 1JPIA 2W6RA 4CNUA 1FRBA 3BPWA 1B57A 3E6EA 3PG8A 3MMTA 3AXMA 3EB2A 2PCEA 2C14A 1UBSA 3VPLA 2XG9A 3GDLA 1AD1A 3M43A 3G1SA 4BR1A 1QPKA 2Z7KA 1V0MA 1AZ2A 2CLPA 3AQUA 3KS6A 1CGXA 4S3JA 1XICA 5FF4A 4G6CA 3RR4A 4E0CA 4ZA0A 3MO4A 1BF6A 2B0MA 1J8VA 3V35A 5D32A 1R6WA 4W4QA 3N2OA 1A5UA 5CPTA 4BWLC 4TV6A 5AZ0A 1AMYA 1KV8A 2IQTA 4GYPC 4HKPA 3SJ3A 3K2GA 2OZ8A 3QZ6A 2EPLX 1KXVA 1V3LA 2HVMA 3OYZA 5LXXA 3ZJ8A 2FIQA 3W7IA 3V3WA 5AVNA 3KVJA 3MSYA 3UETA 2X16A 1DXFA 3STCA 3WEZA 5HXMA 1XLHA 3NTYA 1UR3M 5K9CA 2BY2A 4C6QA 5HAOA 2VENA 3IGSA 3NZPA 5A6TC 2XJ7A 5TAOA 3UA3A 4UTWA 5BMXA 1A5SA 1U1JA 2A4AA 1KM3A 2GUUA 3M46A 4F2TA 3RCYA 5C71A 3CL6A 4DJFC 1P0NA 3CQHA 4KS0A 2CHRA 2HVOA 4DJEC 5D9PA 3WF1A 2DUXA 3QKEA 4TTUA 1YPFA 2WPBA 4C90A 2Z4GA 5DELA 3FS2A 3E74A 4H9MA 4FF7A 2HXUA 3VFLA 2ADAA 5D9NA 2UBPC 4G9PA 3W27A 3QR0A 4HK6A 4MPKA 4DQWA 4RDVA 2Z24A 1SO5A 2JBMA 3GXDA 2PPGA 1GK8A 1MNZA 3AHXA 3RG6A 2QPUA 3UD6A 2WANA 2XIIA 3DBPA 1KRBC 3LPFA 3WO8A 3PAJA 4LQ1A 1B3WA 3TMQA 4FMVA 4ZR8A 4Y8FA 3TTOA 3LSBA 3BCDA 1ME7A 4J35A 3VKCA 3WUEA 1CLVA 2PDIA 3BQ6A 3QV8A 3DYOA 3W29A 4LXFA 3VUSA 4NNAA 4NY2A 4GFIA 4ZOEA 4S3FA 3WH5A 2NT1A 4U4MA 4ZQPA 1IT8A 4CNPA 1EYEA 1B4EA 1C7TA 3AI0A 1DE5A 3WBYA 4BI6A 2Z00A 2A79A 3KM8A 3DHPA 2BGSA 3NO1A 3ZT5A 4DRSA 4RUBA 3S5ZA 1XXXA 1Q4WA 3RN6A 4Y6GA 4PB5A 4K36A 3BAKA 3CHDA 5H6HA 1RLCL 1QBAA 2WKGA 1A5MC 5KMYA 3S6DA 5HMFA 3BOXA 2ZRYA 3OODA 4RZ5A 1VQTA 3A9BA 4X63A 2D24A 4V15A 1OIFA 4CEXC 3U5UA 3GLCA 4D9PA 3V0TA 2W61A 4FR6A 4PCPA 4V28A 1ZY9A 4XWUA 1QO2A 2PE4A 1BQGA 4US6A 1D3HA 1ZBKA 1GOIA 3C2RA 3W22A 2OXNA 1Z42A 2ZDSA 2R8WA 3PTDA 4BK9A 4EF9A 4TUFA 3WBEA 3SCVA 3VGGA 5FA5A 1GVFA 1XJBA 2PDMA 4IXHA 1SMDA 4NX0A 3GXPA 3KDOA 1TCDA 1WDRA 1OVDA 4JZ5A 5JMUA 3SQMA 3L4WA 4PFHA 4PUWA 1W5PA 2VDHA 1XP3A 3C3NA 4ROQA 1B5TA 2VRJA 4HMEA 3WJYA 3UJSA 2HEJA 4J40A 4TXEA 3TCEA 2BG5A 4HNOA 2CWNA 4ZE4A 4C6EA 3DYPA 4DN1A 1W1IE 3AMCA 2Y4SA 3MSGA 2C91A 1RZMA 5EY5A 3W1LA 3QZEA 1JCTA 4N9CA 3KBJA 3WJWA 1HJWA 2W92A 4WOQA 2OT1A 2DVTA 3T4WA 3PZTA 1DWIM 3U2CA 1ONRA 4URIA 6CGTA 4Y9PA 3GDKA 1UPPA 3UWZA 5LIUX 4C6JA 2E4TA 5KZMA 2Z27A 2ZA2A 3PZUA 3H4XA 2DW7A 1V3MA 4OFCA 5F7UA 4LYKA 3BCFA 4HA0A 4D8LA 1MMFA 3NIYA 2NVCA 2I57A 1CZ1A 3IANA 1F4HA 3L68A 2NXIA 4D1IA 1F5ZA 1X6LA 3O0KA 2F6UA 1MDRA 2VD9A 3OU8A 3T81A 3VKJA 2ANUA 4LYQA 1OADA 4GFSA 4LB4A 4J4KA 1TKKA 3ANUA 3ZT7A 4HPGA 1JAKA 5CPOA 3WLLA 1C8VA 1JFXA 5HR6A 3UZJA 3HIJA 1G7VA 1J9YA 4GCAA 2E7FA 1WOAA 2ZCGA 2WJDA 3CQ0A 4TX9A 2ZUVA 3NQDA 3GDMA 2WPGA 5JIWA 4IHCA 4XVEA 2VX4A 2NLYA 3DHUA 1GVRA 2CLMA 3HTWA 3ITCA 1T96A 3BH4A 2FGZA 3N3MA 2TYSA 3MUCA 3CPRA 3L4XA 4GOAA 1N8WA 5D2YA 4OBTA 5DF0A 3QBUA 2J6XA 5DXY