4YLWA

Crystal structure of human dihydroorotate dehydrogenase (dhodh) with no.33 compound
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
364
structure length
363
Chain Sequence
GDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (quinone), mitochondrial
publication title Crystal structure of human dihydroorotate dehydrogenase (DHODH) with No.33 compound
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 139
structure length 363
sequence length 364
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2015-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4ylwA00
1A5SA 3TW6A 1GTHA 3VNDA 1KFEA 2BXVA 4JYEA 4KWWA 2GUUA 3G18A 1MSSA 1G67A 5KITA 4UFKA 5LZLA 4UFHA 5DXYA 1H50A 2J24A 2QDHA 4NXSA 3G3MA 4QIUA 5K9CA 4X22A 5G1YA 1SZNA 1EEPA 4XTDA 1B4EA 2ZTJA 4TMBA 4PCFA 2VENA 3LGEA 1H60A 1W8SA 3LX9A 3TIMA 2FFCA 1K7EA 1RPXA 1W3NA 3BGJA 1I4NA 3MJYA 3CIXA 1PCWA 1SZGA 3KRSA 4FO4A 1KBJA 1GVFA 3IVSA 4O19A 3IIXA 1PL9A 4MLJA 2CFFA 4JTKA 2PRHA 5LHFA 3LLFA 4LS2A 2OX1A 4RJEA 3FEMA 3O15A 1CW2A 2E68A 1JCYA 1KTCA 5CPOA 1O95A 4JDBA 2ATSA 2EPHA 4O17A 3TSDA 2YFNA 1UUMA 3QEZA 1MXSA 4IMFA 3S5OA 4CLMA 4A2SA 1TTIA 1OABA 4IXHA 4JEQA 1G7VA 5I3HA 3Q37A 4YL2A 4C1LA 3W1TA 2J6XA 2CLFA 4NU7A 3TAOA 3P7YA 1XL9A 1MEWA 2JKAA 2YPIA 3LI0A 1DL3A 3M41A 4H4IA 3S9YA 1H7OA 3IVUA 1N55A 3OVRA 4MZ8A 3SZ8A 3L0KA 3GZ3A 5D2VA 1HG3A 2PURA 3THAA 3BVJA 3TFXA 1JCLA 5EYWA 1TRIA 1IXNA 1RD5A 4LU0A 3LCLA 1VHCA 2A0NA 2Y7DA 3RK8A 1FY6A 1OX4A 3CWOX 2X1RA 4CNNA 3L5LA 4LV9A 1WBHA 3G1YA 1F73A 3FKRA 3W07A 1W3IA 4UFLA 3ZWSA 4M7TA 4UTWA 3NM3A 2JK2A 4DXVA 5AYZA 5DBUA 3CPRA 1AL8A 4I7UA 3TQ0A 4WOZA 1DV7A 3UWUA 3C2EA 3S1WA 2I9EA 3LB0A 5FI8A 3TJLA 7TIMA 1YLVA 5CPNA 1YXDA 4PC8A 3P8IA 2ZA2A 3WJZA 4MYXA 3QRHA 1LLZA 3LXAA 3B06A 5IBXA 1JUKA 1W5PA 2HMCA 3NQCA 4O14A 1KV5A 3GK0A 3O8AA 1XUZA 4LRTA 2Q8LA 5T26A 1YDVA 3LI1A 4LOCA 3N3MA 4N9BA 2ZRZA 3G0XA 3W7KA 1TRDA 2YR1A 1JRCA 1WV2A 3QSTA 4O1CA 2WSRA 4QAIA 3NQAA 3MBDA 4XUGA 4QQ3A 3ZR4A 4Z0JA 3KRZA 3VE9A 1M5WA 2R91A 1H7NA 2C15A 2C16A 1OK6A 1M7PA 3O6DA 1TPWA 1SW7A 5FEXA 4AF0B 3GIYA 1G4PA 2YGYA 5FF4A 1P1XA 5BNKA 4K6AA 2CZFA 3I65A 2VFIA 2BSLA 1QDSA 4UTHA 1NSJA 2VKZG 1FWRA 4A3UA 1OX5A 3GDMA 4JN6A 3P5YA 4JX4A 4A21A 3E9AA 1K8YA 4ADUA 4IX2A 3PB0A 1H62A 1R2SA 3GXTA 3QMTA 2GPTA 5J5DA 4K37A 2VEIA 2P10A 3IIPA 3B03A 4DO4A 1WX0A 4O0KA 3MP5A 3PBWA 4Y6GA 3G1HA 3BLFA 1W5NA 3NL2A 1T99A 2JGQA 4O0ZA 1GG1A 1L9WA 4JTTA 5IM51 1JCMP 4KFNA 5HULA 3P81A 2J27A 3KAOA 2AGKA 4I7WA 4ZQCA 2AQWA 5HJLA 3W83A 3JS3A 3SY5A 3UWVA 5HUPA 2NUXA 1W3TA 1I8JA 4LC8A 2NX1A 3FYOA 4O11A 1TPB1 4EOUA 1BEUA 1RZMA 4BF9A 4HN4A 4N6EA 2ZRVA 4LVBA 3KVJA 4BI7A 1C29A 5D37A 3W1QA 3Q2DA 3L65A 3ANYA 2F7FA 1I2OA 2FB2A 4HPJA 4IMDA 4QSHA 3KRUA 1ZFJA 4UTJA 5EBUA 2VEMA 4LVFA 1B4KA 3GLCA 4WXYA 2H8ZA 3FA5A 3HPZA 2E6YA 2VFEA 3W74A 4AF0A 5AC8A 2QR6A 5I3JA 1KLZA 3W1UA 3TROA 4PL1A 3W1NA 1LM1A 3B4UA 2NWSA 3SGUA 1EP2A 1FQ0A 3LHVA 3TH6A 4NT0A 5HUOA 5CZJA 3LCWA 2Z1BA 2QCMA 2NXHA 3TFCA 1FXPA 3HGRA 5I3IA 1FBAA 1SZEA 4S1FA 3S8HA 3QYQA 3Q94A 3DKLA 5D33A 1X1OA 2WQPA 4Q32A 1VR6A 4Q4KA 2ISSA 1NVMA 2FPTA 3EX3A 1R46A 2KZHA 4N9CA 3A24A 3W22A 4K39A 4PH6A 3M5YA 4Z1AA 3E02A 4DPPA 1YDOA 3L0NA 2G97A 2ZZ6A 4UFJA 4A29A 1VC4A 3TXZA 2ZRUA 4A2RA 1LOQA 4UTUA 2VFHA 2QCNA 2P1FA 1VH7A 3OBKA 1YXYA 3QQ1A 1YTKA 2CU0A 3TMQA 1RVGA 4RLIA 3V75A 2NXGA 4O15A 2E6FA 2X1SA 2DJXA 3L21A 5U7SA 1F7BA 3W23A 1SFJA 3B04A 4ZL1A 4BFAA 5ABTA 1GVOA 3TQVA 2YZRA 4EIVA 3GDKA 3EXRA 2FQIA 3T40A 3OHIA 5I3KA 3A5VA 1MEHA 1AG1O 4JY8A 1XBVA 4JX6A 4JTIA 4NJKA 5C6MA 3BG3A 1XKYA 3W7HA 1F6PA 1NF0A 4FNSA 4KFOA 5DY3A 2ZDRA 1BTMA 4XBSA 1S3HA 4Y96A 1KTBA 3GXPA 1QWGA 3EX1A 3DGRA 2HS6A 5F1UA 1FWTA 3TNOA 1DVJA 1EPXA 1N8FA 3KFTA 3R5EA 1TJPA 3HG5A 3I7RA 3N9SA 3HGOA 4WZHA 1NF7A 5DBTA 3GR8A 5BRBA 2QKFA 3TJXA 3LXBA 2WSYA 3NL6A 1RQHA 5E93A 3DFSA 3W2JA 3AO0A 4J9JA 1Q6OA 3MHGA 4FEZA 1HO4A 3USBA 1SUXA 5IBXC 1A53A 1TTQA 5J5RA 1R30A 4BWLC 1WA3A 4HHPA 4QM1A 3G0UA 3ABSA 5K4ZA 3DKJA 3M9YA 4QISA 4RXGA 1SO4A 4R7JA 4JTLA 2B0MA 1VLIA 1GYNA 3UPWA 3KVLA 1ICPA 1GEQA 2I14A 5CG7A 2YX0A 5K9XA 3FOKA 2VFDA 3IRDA 4IGHA 4ZVJA 2UV8G 3KVMA 2E5BA 3LCFA 4IPIA 1H61A 1LZOA 4FIRA 3RMJA 3THQA 3BLIA 1QMLA 5AOUA 2V30A 1THFD 1F74A 4BR1A 4JYDA 3LTPA 2NUWA 3BW4A 4AB4A 4DF2A 1WOAA 4UTKA 2V0TA 3UPBA 3W1LA 2YDAA 1KFCA 1RR2A 2VXNA 3LM7A 1GTEA 2QDGA 4RK8A 1R2RA 2O7QA 1SO5A 1LBFA 3PS7A 4AHOA 4K38A 2YSWA 1DJNA 3TX9A 3GDLA 3LERA 1LBMA 1L6YA 1UB3A 1OFQA 4FNUA 4MY1A 2NWRA 2NV2A 3KX6A 5DLCA 4K7YA 3VE7A 3L2IA 4L4LA 3HIJA 3NQ2A 2JKEA 1HTIA 4L4MA 3A21A 3UWWA 3SGZA 4XTIA 5CPMA 2G96A 4MY8A 5EA9A 4UIOA 2F84A 1V5XA 3P80A 1NAL1 4EF9A 1QR7A 4N02A 2ATMA 3PWAA 4Z1BA 2V5LA 3P60A 3ABOA 2AAMA 3WK0A 4JNMA 4GUGA 4LVGA 5D05A 3EWBX 3F4WA 1TPUA 3U8GA 2QCHA 1V7YA 2ABBA 2QUTA 3W88A 2FB3A 3QMRA 2QUUA 3LV6A 2ZZ5A 4Q33A 2VELA 1FWWA 3QC3A 2LLEA 5CGQA 1A5CA 2GVLA 3LRLA 4MYAA 2ZYFA 5G2IA 5HINA 3CTLA 4ADSA 3G1FA 1AW1A 3L9CA 1K7XA 3QSRA 2XFWA 4OHQA 4NNAA 1EUAA 5H2ZA 1MO0A 1EWEA 2QJIA 4M7SA 3W7NA 1SO6A 2CLIA 4S2CA 3SSJA 2DZTA 3EX4A 1Q3NA 4KWVA 4MFEA 4UMBA 2W79A 3WJSA 4UNKA 4JR5A 4N9EA 5LNWA 1H63A 1A50A 3TV8A 5AHIA 3LHWA 3W7RA 1JCJA 5AB3A 3CWNA 3T7VA 4A22A 3R12A 3MI2A 1OX4B 2EGZA 4AHQA 5F2MA 5I3FA 2RHGA 5D2YA 2RDTA 2E77A 1TREA 1OK4A 2E5DA 4MVAA 5LNVA 3EKLA 6ALDA 4OU1A 2E1DA 2Y62A 3M7WA 3W1MA 3TC7A 5L9FA 4UUIA 4N4QA 3NGJA 4GUIA 3PY2A 3UNDA 3R89A 3KOFA 5I3GA 2BTMA 1O5KA 1SU5A 2WO5A 1KM1A 2OJPA 2ZRXA 1LRTA 3QPYA 4CQ9A 1FDZA 2Y7GA 3C0JA 3EB2A 3B05A 3NEVA 3W9ZA 5K2ZA 3CIWA 1S5VA 3HPSA 3UWQA 5LNRA 4WUIA 2V2DA 2V82A 4JYFA 3EXSA 2VEKA 2ZZ4A 3LOTA 1C8VA 3NQEA 3QW4B 3PAJA 4Z1CA 1SSGA 2O7SA 5KZMA 4XKYB 1IIGA 1LLWA 2CZ5A 1VCVA 2RDWA 3OVQA 4OT7A 1XDMA 4XQ6A 1DBTA 1LDCA 1ME9A 5KTLA 1VCGA 3M5ZA 3TQKA 1W54A 3W2NA 3CU2A 4O12A 3PSVA 2ZQ0A 5D04C 5G1TA 3LLDA 2TPSA 1X8FA 5LGZA 3L5MA 3S6DA 1OFEA 2GOUA 3EEGA 4YWIA 3DH7A 4JTGA 1KTNA 2E5CA 4R33A 3CB8A 2CLEA 2X16A 2G5WA 1EP1A 5AHNA 3W7DA 1GVSA 1WOBA 3UXDA 2QCDA 1IXPA 2Y89A 1Z44A 1QNVA 4CQAA 1H7PA 3CM4A 2TRSA 5G4EA 1KM5A 3GDTA 4DPQA 2WOQA 4JIPA 2DZVA 4LUIA 4JICA 3S5NA 3W6YA 5G2WA 4YLWA 3PF3A 1IGSA 1PIIA 3KVKA 2A6NA 1GT8A 4RV8A 4RKAA 1QPNA 2ZZ7A 3W76A 1LROA 4WX2A 1XUUA 3W7LA 3FJ6A 2GJNA 5DCEA 1G4TA 4O13A 4M6PA 4CNPA 1TB3A 1D3GA 1LRQA 3HO8A 4MZYA 1DORA 3NYZA 1TPH1 4IXXA 1JUBA 4DF0A 2Q3OA 1TYGA 1KLYA 2ZFAA 5AYYA 2Q3RA 3GNNA 3V1PA 1VHNA 3WFAA 5DELA 4I7VA 3HG3A 4AEOA 2HSAA 5FEZA 1K8XA 3JR2A 3C6CA 2ZA1A 4ZQNA 2H3BA 4DBEA 3NO5A 3B0VC 2C3ZA 4XKYA 5EL1A 1FUYA 3LHZA 3W7MA 3HG4A 5CSRA 4X2RA 5HNRA 3HB9A 5KMYA 5KINA 2C19A 4NXKA 4JGDA 2C0AA 4GFSA 1OVDA 1HL2A 1QOPA 1HUVA 2A2IA 4PEKA 4MZ1A 3W84A 2OCZA 3NAVA 2ZRWA 4PL2A 4HPXA 2VFFA 1DKWA 1VS1A 3N2XA 1W37A 1W1ZA 2X2GA 4O57A 2PRLA 3W7JA 2RDUA 4WJEA 1GVQA 3W7GA 3A23A 4CCEA 4UTTA 1O94A 4GBUA 4AWTA 2ABAA 3NXFA 3A9IA 3C56A 5E1QA 3S5ZA 3NR0A 1G4SA 1KM2A 4DQWA 3W85A 3E49A 1DQWA 2DZWA 4FIQA 1RV8A 3LCGA 2NV1A 4MY9A 4H6KA 4WXZA 1ZENA 1QPOA 3K30A 4S2BA 3BG9A 1L6SA 4HT3A 1GPWA 3W2MA 4Z08A 4FX6M 3NDOA 1D9EA 2QCLA 1Z48A 3M16A 3O05A 3GDRA 1WQ5A 2R8WA 3P74A 3M0ZA 1RQBA 3EXTA 3IIOA 4B5NA 1K7FA 2GVJA 1OYCA 1AW2A 2XN0A 5SWUA 2A1YA 3EWXA 2WKJA 4ML9A 1JR1A 4UFMA 1SZFA 3DBPA 4P61A 3IIVA 4AWUA 5D2WA 2RH9A 3M1ZA 1YPIA 3WJYA 4JTHA 3NPXA 1K02A 1HO1A 3HBLA 4O53A 1OYBA 1AMKA 1AW5A 2A7RA 2CLHA 2P0OA 3GB6A 3TC6A 1G6CA 4UTIA 3WJWA 1LBLA 3C52A 3P82A 3TW7A 1WXJA 2DZPA 1X7FA 2A6LA 1X1ZA 2B7OA 3FIGA 1ZJIA 3NOEA 5KSWA 2ZBTA 4FHAA 1LOSA 1TCDA 5LKYA 5K9DA 4QITA 3QW3A 2YW3A 2WPBA 3TA6A 3G1AA 3LCXA 3BW3A 5F2LA 4AH7A 4ORIA 1M6JA 3NM1A 5CZSA 4I9AA 5LHEA 3LHUA 4UNLA 5G5IA 1BWLA 5C55A 3EWZA 1VYSX 3G8EA 3M5VA 3EX2A 5FEPA 4FB7A 1ICQA 3N73A 3W73A 4UTMA 4TU1A 2OT0A 2W6RA 1T8XA 4O1AA 4GWEA 5LGXA 4ONVA 3AJXA 1VQTA 3W2KA 1QO5A 1EB3A 4LY8A 3TCEA 2B7PA 1TPDA 2DZSA 2E09A 2X1UA 1LRNA 2YXGA 3BGGA 3T4CA 4OBTA 3JRKA 4JS3A 1TPVA 1LCOA 4Z0SA 1KFBA 4XWUA 1O60A 3N34A 4LS0A 3LBMA 3A22A 5FF7A 4M6QA 2NX3A 1TV8A 3B0PA 3DENA 3IGUA 1SR9A 4AVFA 3DHFA 4U28A 3MHUA 1K3UA 1HFBA 1F2JA 3A5FA 3UY8A 2G95A 1GJPA 4Z1DA 1RQEA 1XFBA 4O28A 2CZDA 4ZQRA 4RZ5A 4U4MA 1I2PA 2BWGA 3TDFA 2XN2A 3PC0A 1F5ZA 1FCBA 1OYAA 1QPQA 1TPC1 1YYAA 1ICSA 1Z42A 3C3NA 3NZ1A 2A7PA 4HNUA 3P5ZA 4HKPA 1LOLA 1WYIA 2X30A 3HPXA 2C1HA 4HNTA 2VEPA 4OE7A 3M44A 3SFKA 4UTWC 1FXQA 2OZ0A 2DZUA 2Y63A 1YTDA 3TK7A 3WK3A 2WJZA 1OJXA 5CPLA 1YPFA 1N7KA 4MOZA 4HIBA 2DJLA 1XXXA 1TTJA 1SO3A 2Y6ZA 1EWDA 4UFIA 2ISWA 3OIXA 3PB2A 1W5MA 3QZEA 4QNWA 4TO8A 3VKJA 3PG9A 1H7XA 3ATYA 3R13A 4PA8A 3MHFA 1TQJA 2PCQA 1FWNA 3GXNA 3F1QA 1I2RA 1B3OA 2B7NA 3L5AA 2C13A 3DU0A 1AK5A 1GYLA 4N2YA 1WAUA 3NPVA 2QAPA 2YYTA 3LV5A 1OX6A 4BI6A 1I2QA 2V2CA 4K8HA 3EWUA 4IUOA 2DORA 1PE1A 2Y85A 5C5YA 4FXSA 4E2DA 2QF7A 1KA9F 3BK0A 3RU6A 4DEFA 3NG3A 5DY2A 3W70A 1F05A 4GUJA 1JULA 3LBCA 5FF0A 1A5BA 2V8ZA 3F4NA 1E51A 2DP3A 4RX0A 1S5WA 5TBOA 4OV9A 1TTPA 4LC6A 2NLIA 3C8FA 3DZ1A 3NQDA 4N4PA 4UTTC 3W72A 2QJGA 3TU9A 4E0CA 3CHVA 1H51A 1KM4A 1KV8A 4ZQOA 1U83A 4ZQMA 2NZLA 5G2HA 1PCKA 2TSYA 3RFAA 3LRMA 3N19B 5LNUA 1OFPA 1QFEA 1ZAIA 3C2OA 2FIQA 3NL5A 2CLKA 1JQXA 1BKSA 3CEPA 3G24A 4AAJA 3W7OA 3EWWA 2OMAA 1H1YA 1G4EA 1JUEA 2Z6JA 1C9DA 3HF3A 3KXQA 4FNTA 3TKFA 4YXGA 3GVGA 5F4SA 4O50A 3W7PA 2GJLA 3CEUA 4AXKA 4K8EA 1ZNNA 2QCFA 3GKAA 1Q6RA 3MUXA 3NNTA 3DAQA 4M5PA 4JY9A 5K3VA 2WV8A 5D03A 3MI3A 2HS8A 1TO3A 1UUOA 1Z41A 1WDWA 3HJZA 2R14A 5CZ0A 3BW2A 2Z6IA 4MKNA 2OT1A 1ZALA 4E38A 2H6RA 2PC4A 5DN1A 3NQGA 1LORA 5AN7A 4FXRA 3FKKA 3GAKA 3TE9A 3NQ8A 4XZ9A 3BV4A 3IIZA 4EWND 6TIMA 2FPYA 1JCNA 3WK1A 2QCDB 2XN1A 3KHJA 3L67A 3N2MA 5F4XA 4JX5A 4ZZ9A 3STGA 3B0UX 3FS2A 1XBZA 3FJLA 2J9YA 5A5WA 4NX0A 4BK9A 4POCA 3I7SA 5C2XA 3PVFA 3MO7A 3TSBA 3G1XA 2ZZ1A 4O54A 3M6YA 1TJRA 4UC5A 4GXMA 1JQVA 2CLLA 5E0KA 1JJKA 1Y0EA 4NJIA 1FX6A 1VJIA 2RKXA 2J9ZA 1IXOA 4LUJA 3OA3A 1TMHA 3O16A 1SSDA 3U6WA 3UYCA 4O8RA 4R34A 3NZRA 2BX7A 2V81A 3I7QA 4O16A 3O6CA 1VLWA 1TPEA 3CQ0A 5EPDA 3SECA 2Y61A 3MP3A 1QAPA 4MPQA 5H91A 4OWGA 3GNDA 1VYRA 1Q6LA 3OVPA 1EA0A 3ELFA 4N6FA 1ZHAA 2TYSA 4GE8A 4WY0B 3HMJG 1XM3A 3TR2A 1R47A 2E6AA 3MMTA 4AHPA 3LHTA 2Y70A 4LW7A 4JTSA 1KFJA 2ISVA 4NX5A 1ALDA 4K7VA 4TR9A 3I6RA 1EUNA 1LTDA 4ORMA 3LTSA 3CLMA 1NEYA 2C18A 3HOJA 1G69A 5AHMA 2QAFA 3LHYA 2YYUA 4GJ1A 1OF6A 3NVTA 3QQ0A 5TIMA 1YTEA 3IVTA 1TQXA 3STCA 3NQ7A 3STFA 3W2UA 2EHHA 1PS9A 2QCCA 4Y8FA 4NVTA 3GKFA 3S42A 1T0OA 4PFMA 3UWZA 1GG0A 3VI2A 5BMXA 1GWJA 5F2IA 4O52A 4NNCA 3W1PA 4O1DA 8TIMA 4MUZA 3PR2A 3IV3A 3NQFA 3FYPA 3IGSA 1LP6A 3W71A 4NNBA 1VYPX 3HGJA 2EKCA 1VRDA 3TUUA 2A85A 3Q58A 2C14A 2J88A 3L68A 4TX9A 1SQ7A 1W0MA 1ZAJA 2JKPA 2CZEA 1G7UA 4C1KA 1EIXA 4BI5A 1KBIA 3H55A 2ZZ2A 4X3ZA 3QMSA 3W1RA 3W7IA 3C2VA 1FCUA 1YXCA 2BLEA 3SW6A 1VZWA 3FLUA 3P62A 3UZ5A 3DFPA 3H54A 4FX8A 3MBFA 2ZZ3A 4YCOA 2ZCGA 3WK2A 4CQ8A 3P67A 5K7JA 4EF8A 2FDSA 4JD4A 3S1VA 3C2FA 2CLMA 3BARA 4NJJA 3SI9A 4PTNA 3PUDA 1ZAHA 4IQLA 2V2HA 3O07A 1DJQA 3C4UA 1SW3A 4AWSA 1SFLA 4WQ6A 4IPJA 4WY0A 4GRSA 3SR7A 1GOXA 1B9BA 4BWLA 5D2TA 3G22A 3LXCA 2H3DA 5KZEA 3QM3A 4MLRA 3TMLA 4LRSA 2VFGA 1KM0A 1JRBA 5HWJA 5FESA 3G8RA 2YW4A 2CWNA 3EWYA 1KFLA 2W0UA 1IIHA 3PUEA 2Q8ZA 2PRMA 3CC1A 1KM3A 3GYEA 5HQEA 3I68A 1FDJA 3TXVA 1L6WA 2NXIA 1I2NA 3SJ3A 1KFKA 1MZHA 2V9DA 1XDLA 1ADOA 3W7EA 5AHLA 3LCHA 3E96A 2FPVA 4OGZA 2EAWA 2ZA3A 4YCPA 4RR4A 5TQLA 4RXFA 3EKZA 4LWWA 4DO5A 1Q45A 3QJAA 1B57A 4ZQPA 1ZCOA 2E6DA 3VFLA 4D2JA 1KM6A 2GVGA 3NQ6A 4HNNA 4IOTA 4JTFA 5F2GA 5HR7A 4DF1A 5AFDA 2DZXA 1K8ZA 2YCEA 3W86A 3R8RA 2A21A 1YDNA 2D73A 3CT7A 1ZY9A 1PHQA 2HTMA 2FLIA 2VOMA 2WSQA 1OFBA 3C2RA 5BOOA 4KFPA 2FJKA 2JBMA 3E0IA 2GQAA 4H3DA 2R94A 1YADA 3UY7A 5AYXA 4UR7A 4K36A 3M43A 4WD0A 3L0GA 4NJGA 3ZS4A 2WNQA 4LS1A 3ZFHA 1CI1A 4IJBA 4Y90A 4FX7A 3S1UA 3P84A 3H53A 3NQMA 1P0NA 3C61A 4ADTA 1OHLA 1LYXA 2GQ8A 4M19A 2A7NA 1FCVA 3DHDA 5HWMA 4O4WA 3MI6A 1FCQA 4ICNA 4UTLA 1CX9A 5A8GA 4UR8A 5DXXA 3G1DA 3UZJA 1GVRA 1ME7A 2CLOA 2NX9A 3DI1A 3IGXA 2VC6A 4PODA 4QNEA 1O4UA 5DCBA 4LV4A 1J5TA 1JVNA 2B4GA 3R2GA 2CW6A 2QUVA 3W75A 3E12A 1GZGA 5DCDA 5FF3A 1M7OA 3INPA 5EMUA 2ZRYA 4NZFA 3G0SA 4IMEA 3GR7A 4OQVA 4IMCA 1K03A 4NZJA 4W9TA 1L2UA 1T96A 1W56A 5D38A 2DU2A 4IMGA 1UJPA 3DXIA 3OEXA 1W5OA 1P5BA 3ABRA 4GC4A 3B8DA 2V5BA 1TV5A 1IF2A 3N9RA 1GQNA 1DOSA 1ME8A 4AMAA 1X6UA 5EKYA 4HSOA 2RFGA 4TMCA 5AC6A 5G4WA 1FWSA 1KW1A 3DFQA 3T78A 2GQ9A 3QFEA 1P4CA 3NPUA 5D09A 3S0CA 4UCGA 4WY0F 4FNRA 3RF9A 4LVAA 1H5YA 1PVNA 1EX5A 3L66A 3N14A 3ATZA 1IXQA 2EF9A 4CCDA 2QJHA 3GAYA 5FF2A 4CNOA 1OFOA 2NUYA 4FNPA 1BWKA 3F03K 5F4WA 1AL7A 3IEBA 5LSMA 1PHWA 5CKSA 3W2LA 5HWNA 4QJ1A 3S5YA 5LNSA 2J9XA 4MJZA 2Y7EA 4UXDA 4GUHA 4UMCA 1P0KA 3QH2A 3BPWA 5D2XA 3W1AA 5AC7A 3RNDA 3W1XA 1D3HA 1W31A 4MFDA 2TMDA 4R53A 2H90A 3BG5A 1SW0A 3MYPA 3TSMA 5L6UA 3M47A 1A5AA 3PUOA 5AHEA 1XBYA 3HG2A 4FF7A 1OFRA 2JGYA 4X9SA 5C54A 3FFSA 3BO9A 1U5JA 4JXCA 3WJXA 2WNZA 3MYOA 3PBVA 3RLUA 3UQNA 5F1VA 3LCIA 4WOQA 1F76A 5MHBA 1VPXA 2QCGA 2BZNA 2I1OA 4M6VA 4HSNA 3QPZA 4Y9AA 3TAKA 1H7RA 4LT9A 1H7WA 3P8JA 3UXAA 3YPIA 3W87A 1XBXA 1VGAA 2ZTKA 3U2OA 1TV7A 3DFTA 1QO2A 4XBKA 3HQ1A 1W5QA 1QCWA 3NQVA 1OFDA 3DI0A 4NJHA 4JTJA 3ZWTA 1ML1A 1F6KA 1R2TA 2Z2UA 5KZDA 1QPRA 3MP4A 4IX0A 5D32A 4P2VA 1H1ZA 4JIQA 2A5HA 3G3DA 1DHPA 2YFOA 3GX9A 3VCRA 1O5XA 3MW7A 4DELA 5K4XA 3O06A 5EY5A 1EP3A 5U4NA 5D02A 2Y7FA 3PULA 1DQXA 4GNJA 4KKXA 3LTYA 1J2WA 2QCEA 3RLVA 1TSIA 4HNVA 3NA8A 4ALDA 4G1KA 2C6QA 3STEA 1FDYA 1OG0A 5BW6A 3O63A 4O4VA 2ALDA 5FEWA 4LVDA 1XC4A 3O1NA 2WNNA 3PSWA 3W7QA 1TPFA 3S1XA 2FTPA 3HGSA 4CCCA 3LRKA 4JDYA 1XI3A 1Q6QA 3NL3A 3PG8A 4LNYA 3MWAA 3M5XA 1XCFA 1OFAA 4E2BA 4OV4A 2A4AA 4MJMA 3OG3A 2IQTA 3UWYA 3W7CA 3D0CA 3PBUA 1VCFA 5D30A 3EX6A 5HR6A 1UBSA 1TIMA 3ABQA 3BLEA 4DBDA 3SIZA 3G1VA 2X1TA 5GVJA 1OF8A 3PBYA 4IWWA 3DFOA 5BMWA 1ONRA 4FNQA 3G1SA 1J4EA 4UMAA 3DFNA 2PE4A 1S5TA 1WBJA 3P61A 4JTEA 4O1BA 3QF0A 1JCXA 3T44A 2H8XA 1QOQA 4RZ4A 4DO6A 5HMSA 5CZTA 4N9DA 4NUWA 5AHFA 1PV8A 4O18A 4MIMA 4ZMGA 4RZ6A 1NFBA 3PM6A 4NQ1A 4GUFA 1UASA 3LDVA 4EVZA 3UD6A 4YMZA 4O10A 1MEIA 3T55A 4LTSA 1I45A 1SPQA 5CSSA 3NPWA 2QEZA 3W3OA 4RCXA 2Y88A 4JTUA 2Z0IA 1UCWA 3O6YX 4TIMA 2B7QA
chains in the Genus database with same CATH superfamily
1HJUA 3GHUA 1A5SA 4IIEA 2BVDA 1DIOA 5BZAA 3GHTA 4J7RA 1E3XA 3GVVA 3KOZA 4QG6A 3AYVA 4MWAE 1MRQA 3WD2A 3AXKA 5LZLA 3RN6A 4C91A 1DHKA 2J24A 2Z4GA 3R11A 3G3MA 4Z42C 1Z9AA 6ENLA 1JPKA 1WE5A 1B4EA 4EXAA 3P93A 4YS1A 1FWHC 3CUFA 1MUWA 1A5MC 4OZOA 1K7EA 1QBBA 5AYIA 2VX5A 2ZX7A 3MJYA 1PCWA 1SZGA 4O19A 3BV7A 2PPGA 5I24A 1ECQA 3R10A 1PL9A 6PTDA 3FVDA 2BNJA 4JTKA 2UY3A 1ZBWA 1OIFA 5D4YA 2H9AA 2OX1A 3FEMA 3H7UA 4QJ4B 1W1B1 2E68A 1JCYA 2UY4A 1XJBA 1PB0A 4NAEA 3MKVA 8RUCA 3GFYA 1FWFC 2YL5A 3O7UA 1O1HA 1UUMA 3ARTA 3UZWA 2V69A 3OQ8A 1MXSA 3S5OA 1Y8BA 4IXHA 3NEHA 3Q37A 4PCPA 1RCXB 2D0FA 4A3RA 1P0BA 5D9PA 1QUMA 1OZMA 3OVRA 3SZ8A 1ELSA 3DG7A 3BVJA 4G7FA 3DG3A 1JCLA 3TFXA 4C6QA 1TRIA 3N4EA 3QV9A 2WHLA 2PDBA 1DWHM 3AMLA 1NDZA 1PEZA 3CWOX 4CNNA 3B9AA 2G50A 1W3IA 1CIUA 1B1YA 1L8PA 5A95A 3M0LA 3ITOA 1UC5A 5DBUA 4PUEA 3CPRA 2E4TA 4Z2IA 2I9EA 3LB0A 5FI8A 1E0WA 3L4YA 4DLMA 1R3VA 1XH0A 4MYXA 4WF7A 2QGYA 2XM2A 2DT1A 3GDBA 3B06A 3M0HA 3UVIA 1UH2A 2HMCA 3NQCA 3SURA 5JQ9A 2D0GA 3GK0A 3O8AA 4LRTA 3FX4A 5T26A 1PZ3A 2XZ7A 2VZVA 2PDCA 2XVKA 2F2HA 1DJIA 2Q8XA 3G0XA 1JRCA 4XG1A 4O1CA 2WSRA 4QAIA 3CZ8A 5AYBA 3ZR4A 5D9NA 1NOWA 1UD5A 2YZ5A 2C16A 2O4MA 4FR1A 1TPWA 4N7QA 4HHLA 1W9DM 5FF4A 2B81A 1G9HA 4JHOA 3LPPA 5HMDA 4QAWA 4KEMA 2VFIA 2BSLA 1FWRA 1XICA 2P8CA 4A3UA 4L65A 1OX5A 4JX4A 4DJDC 4K68A 3KBJA 4A21A 5B7ZA 1K8YA 4DYJA 3SRFA 1H62A 1R2SA 3GXTA 2YL8A 1P43A 2GPTA 4B3LA 1W91A 3S6OA 2CEQA 3SBFA 5KZ6A 2P10A 4FLOA 3TR9A 1WX0A 3GNRA 3MP5A 2DEPA 2P3EA 1XRFA 1NM9A 3SRKA 1L9WA 4R7OA 5HULA 1R3TA 2AGKA 3EDEA 3CT2A 4BA0A 4LC8A 2NX1A 4O11A 3SIMA 1J2BA 2J79A 2NT0A 4BF9A 1WKEA 2FYMA 1A0EA 2ICSA 2Q02A 3PZVA 4L4PA 3GXIA 4LVBA 3BOLA 1C29A 4IIHA 3PUGA 3ANYA 3CUJA 1UQZA 2FB2A 3WMSA 1ZTVA 1ZFJA 2VEMA 4LVFA 4XZNX 5DMYA 3GLCA 2H8ZA 4B9YA 3HPZA 4AZ5A 3IACA 3GW0A 3B4UA 3PP7A 4R3UA 3KOYA 2HRWA 3TFCA 1M03A 2PWFA 3OQEA 3H6OA 2X7WA 1O68A 3Q94A 2W4XA 4AC7C 1B5TA 1WPCA 3MCOA 5D33A 1X1OA 2UBPC 2GSJA 2WQPA 4Q4KA 1IT8A 3LU2A 1NVMA 2XH7A 2ZX9A 3RR1A 3A24A 3W22A 3CTTA 1V02A 4H00A 3E02A 3VIIA 2ZZ6A 3AJ7A 4ATWA 1E4IA 1LOQA 4DZ5A 3WQVA 3OA5A 3OBKA 4V27A 3BCDA 3TMQA 4RLIA 3V75A 1Z8AA 1L2QA 3H70A 3LSCA 4H9ZA 4D72A 1JFXA 4WHBA 1I1WA 7TAAA 1F7BA 1ZPTA 4MADA 2UY5A 4BFAA 3CUXA 3TQVA 4EIVA 1Q65A 3T8LA 5I3KA 1MEHA 4JY8A 5FL0A 4JX6A 4JTIA 2J6VA 1XKYA 4QLKA 3BZJA 3W6LA 4KETA 2Z24A 1NF0A 4FNSA 5DY3A 2ZDRA 1BTMA 1S3HA 1KTBA 3GXPA 1C8YA 1K77A 4R27A 1FWTA 1KGUA 3KFTA 4JNZA 3N9SA 1IQ8A 3HGOA 5DBTA 4XUYA 5BRBA 4XSLA 4MB4A 3TJXA 2PGFA 2WSYA 4NZCA 4DXXA 2BGNE 4C6BA 4CGTA 3ZM8A 1Q6OA 4ZB0A 1ISYA 1HO4A 2UWFA 2CHNA 1E0VA 1A53A 1CENA 5IBXC 2ZXBA 3GC5A 3NZGA 1XLKA 4AEEA 1PO9A 4R7JA 4JTLA 2B0MA 4QE5A 1H5VA 1GEQA 2I14A 5CG7A 1XIGA 1IWBA 1P7TB 3IRDA 4ZVJA 1XPGA 4KGLA 3KVMA 4FIRA 1LZOA 4GJJA 1SGJA 3RMJA 3PJWA 4DHGA 1UWSA 3BLIA 4JZ5A 1HP5A 2VD8A 5M03A 9CGTA 3LTPA 2NUWA 4AB4A 4NZ4A 3N6HA 1WOAA 2VEGA 2YXOA 2V0TA 1XSJA 1GW1A 4Q4RA 3VOIA 4LYRA 4XVEA 3VD5A 1MQQA 1S2CA 3TTQA 2O7QA 1GQKA 1LBFA 3QFWA 3O9NA 2XWEA 3LERA 2BODX 4L1WA 1UD6A 4Q8MA 1UB3A 4MY1A 1OFQA 4FNUA 5DLCA 4K7YA 4L4LA 1HTIA 1XD0A 5E09A 1XYBA 3UWWA 4XTIA 2YCIX 1RA5A 5CPMA 4HB7A 4OVXA 4UIOA 2WVTA 2F84A 2P88A 4GZEA 2XSXA 1QR7A 5CC5A 3PWAA 3UF9A 4Z1BA 4MWAC 4GUGA 3F4WA 1TPUA 2ABBA 3QZ6A 4XISA 5FACA 9XIAA 3LV6A 5D8ZA 5ABEA 1E0TA 2O4QA 5CGQA 1J12A 1YIXA 1V6UA 4NRSA 1AW1A 3CZJA 4ZXOA 3QSRA 4NZ1A 2XFWA 4BKNA 1P7TA 4H9XA 5ABGA 5E6ZA 3MV11 3AZTA 1CDGA 2QJIA 3W7NA 2OZTA 3S83A 4S2CA 3B3DA 2R1KA 3OBAA 4E8DA 1FHLA 1UP3A 3EX4A 4HU3A 3FJ4A 3V35A 4CD6A 1RY8A 5HQMA 2QMKA 5LNWA 3WG6A 1J0IA 3H23A 3GW3A 3LHWA 1JCJA 1FFQA 5CC7A 3W26A 1JZ7A 1EBHA 2PUZA 3U5YA 3R12A 1XIDA 1KQYA 4L1GA 3Q4DA 3WQDA 4KH2A 3N15A 3HPFA 2RHGA 1XLCA 2A3LA 1TREA 2E77A 4MVAA 4JTRA 3EKLA 4ZCWA 3CHDA 2Y24A 5EMKA 3TC7A 5L9FA 3NJ3A 3NGJA 2ZUSA 3WF1A 3ITCA 1B3VA 5I3GA 3S9ZA 3KLLA 4XB3A 1TWWA 4E3TA 2OJPA 1LRTA 3NO1A 4H8NA 4R9OA 3QPYA 1EOMA 4D1JA 2IKJA 3UJ2A 1YBQB 2Y7GA 3WD1A 1E5NA 3B05A 1G94A 2PLKA 5K2ZA 4PBGA 4J2MA 2V2DA 4QRNA 1TFVA 4JYFA 4UCFA 2VEKA 3A3WA 3LOTA 3HJEA 1BVWA 4JL2A 1OB0A 4AISA 4Z1YA 1SSGA 4XKYB 1LLWA 2XH0A 2DQXA 4OT7A 1DBTA 2W91A 2PGWA 3DHUA 3MO4A 3RM8A 4O12A 3CZGA 3NYDA 4HYRA 3WH9A 5D04C 4MNKA 4C6CA 1CGYA 5A8MA 3UYIA 5KEZA 5A6LA 5A2CA 4PTWA 1OFEA 3LNMA 1ZJAA 3AWNA 4L80A 3WFZA 5AHNA 5ECVA 4CEUC 3KBSA 3M4HA 1B3WA 3UXDA 2Z00A 3QOKA 3GBEA 2TRSA 5G4EA 3VD9A 2J7HA 1ECEA 2BY1A 1Z89A 4LUIA 2GGGA 2ZE3A 2DW6A 5G2WA 4YLWA 3EPNA 4AZGA 2A6NA 4LUTB 3SFWA 1V7AA 4RKAA 3R0KA 3VMNA 3LPGA 4WX2A 4HK6A 1HW6A 4ZO7A 1G4TA 4O13A 2I7GA 4DVOA 1F3WA 1LRQA 1XYAA 4DRSA 2ZXQA 3HO8A 2ZUMA 3B0YA 3ES8A 1T41A 3PNZA 1YBQA 4JFTA 4DF0A 1DJYA 5AYYA 1DIKA 3GQYA 3V1PA 3NO3A 1VHNA 3HG3A 2EXOA 4IIDA 5FEZA 1K8XA 3WLNA 2ZA1A 4F0RA 1F4AA 5I07A 3WZ0E 3ZVHB 4C1NA 2HROA 3B0VC 1E55A 4XKYA 1FUYA 5KINA 2EPKX 4NXKA 4JGDA 2FH8A 1XIHA 3FSUA 4AFYA 2C0AA 4GFSA 3BLPX 2YKKA 1UWAA 3AIBA 4PEKA 1VBHA 1YNPA 4Q6JA 2VFFA 1F8IA 1VS1A 3N2XA 4MB1A 1W37A 4J3UA 2W63A 1JIBA 4XK2A 1V08A 3UJEA 1W1IE 3EWCA 4CCEA 4PFHA 2ABAA 3NXFA 3CH9A 4ACZB 1VJSA 1JL8A 3UWEA 2W3ZA 4GVHA 3U57A 2DZWA 1VFUA 4H7CA 2NV1A 3FVMA 4GHRA 4LX4A 3GFXA 4LUTA 3WBYA 2F2KA 1QPOA 1E56A 3RRXA 4S2BA 5GNXA 1L6SA 1GPWA 3T1GA 4MB3A 3ITGA 2QCLA 1Z48A 1MQPA 2E0PA 5I7GA 3OHMB 3R94A 3A47A 4B5NA 1K7FA 2YDQA 5J8LA 1W8GA 2O9PA 4CVWA 5LIUX 2A1YA 3AMGA 4TUFA 4P61A 2QNEA 3ZVHA 4JQAA 2AKZA 2J75A 3IK4A 2OOFA 1YPIA 3WJYA 3NPXA 5I09A 1EH9A 1HO1A 4H9YA 4O53A 1JI1A 1OYBA 3BLKA 3CNYA 4I8YA 1AMKA 2A7RA 2FHBA 1JPHA 3TC6A 4FI4A 4US6A 3WD3A 3TTEA 3DYMA 3OU8A 3C52A 4YN5A 2CWXA 3ME3A 4OFCA 1T8QA 4IPLA 3SRHA 1NJJA 3ORWA 4H9MA 4GYPA 2PZ0A 4C65A 2YW3A 3LCXA 3BW3A 4IQEA 4H6QA 3POHA 4I9AA 4ACZA 2HVOA 3LHUA 5C55A 2C0HA 1VYSX 3WMCA 5FEPA 4FB7A 1ICQA 4GC3A 5H1WA 4UTMA 1V0KA 3VOHA 2E1WA 1VFHA 4OOUA 4WIWA 1T8XA 1O7AA 2YCJA 4HOZA 1EF2A 3S46A 3W2KA 4H8VA 2PWHA 1EB3A 2E09A 4EKJA 4L6HA 2GGJA 3BGGA 1NH6A 1WZKA 3JRKA 4JS3A 1LCOA 1M7XA 1KFBA 4LS0A 3LBMA 3GNOA 1Q63A 2VUNA 4ECLA 3WUBA 3MHUA 3GH5A 4JN7A 4G5DA 1XRSA 8XIAA 5FJJA 4B5WA 2FZDA 4MMWA 4IIFA 2VZOA 4O28A 1V6WA 4RZ5A 2NQJA 1F5ZA 1FCBA 1LT7A 1QPQA 3VUSA 1ADDA 1EDQA 4ES4A 1ISVA 3C3NA 1CGTA 2YB4A 3CB3A 3DIPA 1YE6A 1QI2A 2X30A 3HPXA 4UTWC 5JH2A 5C9RA 2VVNA 2Y63A 1YTDA 3MSYA 2L5HA 5FAJA 1OJXA 1YPFA 3O0FA 4I6KA 3AMCA 3TP4A 3MVIA 2DSWA 4HIBA 1XLMA 4PMXA 1XIFA 3TZFA 1B30A 1SO3A 5LA0A 3O3RA 1W5MA 1EDGA 1CZ1A 1RBOB 3AAMA 3QZEA 4REQB 3LYEA 1H7XA 1RY0A 3SAZA 4Q8NA 2HNHA 1RK5A 3U3HA 3L5AA 4UR9A 4K1WA 2J7CA 1GYLA 2PDUA 3B8WA 3NPVA 4E4UA 2YCLB 2QAPA 2WZIA 1OX6A 3T8QA 2E8ZA 1I2QA 4K8HA 4LB4A 1UBPC 3O6AA 4HNOA 1PE1A 1EJUC 3ONBA 2QF7A 1KA9F 3V0UA 3BK0A 3RU6A 1E70M 2DIKA 1F05A 1JULA 4P8XA 5FF0A 4PMNA 4DUOA 1BQCA 2DP3A 1S5WA 3HU7A 3EDFA 1HGWA 1TTPA 4C7FA 3DZ1A 3NQDA 4UTTC 1QVBA 3TU9A 1PYFA 3CHVA 4B2DD 1H51A 4ZQOA 4DLFA 3B8SA 4ZQMA 1K9DA 1R86A 1JXKA 3BE7A 1FWGC 2FTYA 3RFAA 4GZJA 3W0KA 3BMVA 1Z3NA 4BF5A 3AIRA 2P5NA 4CU7A 2CLKA 2XFRA 4ZGYA 4ASTA 2NQHA 2RJGA 3G24A 4HN8A 4HZ8A 3C5QA 3W7OA 4QJ5B 1G4EA 2Z6JA 2FHFA 2ZUTA 1F9CA 4YXGA 3GVGA 2A3CA 4REQA 3QR0A 4B2DA 1DTUA 1ZNNA 5EBAA 4JOMA 4DX3A 1R85A 1Z7AA 3ZOAA 3MI3A 3K46A 2XU2A 1W9UA 4UWMA 2R14A 1WB0A 2YCLA 3TJIA 3VTRA 2Z6IA 4E38A 1K4GA 2Q09A 5DN1A 4YTUA 1LORA 4C6KA 3AICA 3FKKA 3TE9A 2NQ5A 3N13A 2GJXB 4HMEA 3N11A 1QBAA 4BCEA 1JFHA 6TIMA 1JF6A 3WK1A 4I3GA 4OJYA 4MF4A 4JX5A 2IXUA 2WYSA 3LZ3A 4IMAA 5DANA 4HCDA 3FS2A 4PMZA 1Q4WA 1EC7A 1KCLA 4LCQA 4L9XA 3RM9A 3IANA 3C86A 5BRPA 2ZZ1A 2VNCA 2WZMA 4O54A 2CYGA 4UC5A 4GXMA 2YB1A 4AY1A 2CLLA 2AOSA 4NJIA 5KETA 4G8TA 1LLOA 3STPA 2PU0A 3VIKA 2J9ZA 1IXOA 3HV9A 2EO7A 1TMHA 4O8RA 3H2NA 2FVKA 1GZ1A 3UR8A 3FA4A 4DI9A 1ZL1A 3I7QA 3O6CA 2BXYA 1TPEA 1U5VA 2Y61A 3MP3A 1NARA 5H91A 3MTWA 4OWGA 3AFBA 3OVPA 5LIWX 4QS5A 4KT2A 3B4YA 1IYXA 1R47A 1V79A 3MMTA 2PP3A 3SCVA 1UZ1A 2Y70A 4JTSA 4LAUA 4NX5A 1E40A 1XLGA 1LTDA 3VFCA 4PTVA 1NEYA 4C6FA 1J10A 2QAFA 1XP3A 3E5BA 2PODA 3PPCA 5BXRA 3WKZA 2GJXA 4C6NA 3HFTA 1TQXA 3STCA 3W2UA 4QDWA 5C71A 1BPLB 2EHHA 1V3JA 4Y8FA 3GKFA 1P6BA 4B92A 1T0OA 4PFMA 5IDZA 4LEQA 2RGMA 3TOYA 4LSBA 2Z27A 4B91A 3W1PA 3EA1A 1LWIA 3PR2A 2PGRA 3WQ6A 5CPQA 4C5YA 1UWUA 1DQUA 2RJHA 3IGSA 3UGRA 3TA9A 2VC9A 2E9BA 5I03A 2EKCA 1VRDA 4J3TA 1US0A 1SQ7A 1P0EA 1DXIA 2GSHA 4BI5A 5B7YA 1D8CA 4X3ZA 3W7IA 3C2VA 3IUHA 2QV5A 1YXCA 3DESA 3FLUA 4I6VA 3H54A 1FOBA 4FX8A 3MBFA 5CC3A 2ZZ3A 3QBUA 2ZCGA 3WK2A 4CQ8A 3P67A 4U2YA 2FDSA 3C2FA 1EDTA 3BARA 5E5CA 2W62A 3PUDA 1F8MA 4CU8A 3E6EA 1R9YA 1UW9A 2VRJA 1D8WA 1SW3A 4WQ6A 4PB4A 1RSCA 1B9BA 4Q4MA 3EPMA 4BWLA 2H3DA 3GVQA 1O5RA 1XV8A 5C2GA 5CGTA 1VBGA 4NHVA 2YW4A 4A4AA 3EWYA 4B3ZA 4RNFA 3ECQA 2I16A 4XZWA 3CC1A 1KM3A 3ZR6A 4B5XA 3I68A 4FZIA 3MKCA 3VKBA 1L6WA 1I2NA 3ARPA 3UFYA 4Q4OA 4JTCA 2F61A 4UOQA 2FGZA 4X9YA 5AHLA 3LCHA 3N1AA 2ZA3A 3VABA 4RR4A 4RXFA 3URQA 1QK0A 3I3EA 1ZCOA 4D2JA 3VD3A 1KM6A 2GVGA 3NQ6A 4TTGA 3TVAA 1LQ2A 4JTFA 1WP6A 3R8HA 2J8GA 2HXUA 4BEUA 3VIHA 1GK8A 1I6NA 1E0XA 3R8RA 3VMPA 1ZY9A 3LM3A 2GWGA 2HTMA 4H9TA 4U31A 3E0IA 1CGWA 4HZMA 4JTAA 1GPFA 4K36A 1Z69A 1EIBA 3U9IA 4MNJA 2AQOA 3M6DA 4IJBA 1FA2A 3LS9A 1E6XM 4RNHA 2MUCA 3C61A 3OLDA 2GQ8A 4E3VA 5FJIA 2XM1A 1KR1A 5AY7A 1BXBA 3B9NA 4JKMA 3WN6A 3VIJA 1FCQA 1S2VA 3UT0A 3KHDA 1A3WA 4HNCA 2Z7KA 1GKRA 3G1DA 4I90A 1GVRA 2C8NA 2VC6A 1ZU8A 4YU1A 1JVNA 1MMFA 3E2SA 1XFCA 1ISXA 2VDIA 3TJ4A 4Z17A 5EMUA 4JIHA 3VC5A 3GR7A 5HNUA 4AQLA 1C90A 4UQCA 1XIIA 1GOKA 2WHJA 1IGWA 5I3DA 4LYQA 1W5OA 1P5BA 2P76A 4IQJA 4I9MA 3AHYA 3H4GA 4AMAA 2RFGA 4DM2A 4TMCA 3IRSA 2JF6A 3NPUA 2VP8A 3BAWA 3EB4A 3A4AA 1XLJA 4LVAA 1PVNA 2OKTA 5H6HA 2EF9A 5FF2A 1H09A 4FNPA 2V63A 3F2BA 1VJZA 4CQDA 1SR0A 2VDHA 5HWNA 1OEPA 2J9XA 7ENLA 2Y7EA 3KZSA 4L64A 4BY3A 1P0KA 4O0QA 3JU2A 1IHIA 3GG1A 4JBRA 3ID7A 3W1AA 2EKGA 5AC7A 3GYCA 3LG3A 3RNDA 1ZBCA 1J9YA 1W31A 3EOEA 4MFDA 3T0DA 2TMDA 2QDEA 1HKMA 3P0WA 4LH8A 3TSMA 1R7AA 3WH7A 3CQJA 4LYKA 5AHEA 1XBYA 1XYFA 3HTWA 3FFSA 1J0ZA 3BO9A 4GINA 4ZBCA 3KDNA 3MYOA 3PBVA 3G6LA 2XVGA 5F1VA 3H2FA 3LCIA 1F76A 4W87A 1YQ2A 2X0HA 4M82A 3QPZA 4AD2A 4CNUA 3TAKA 4J3WA 4EPEC 5A6AA 1H7RA 3L12A 1XH2A 3U2OA 4XBKA 2OOGA 3GH4A 3ZMRA 1PKMA 1YKWA 5M1TA 2INFA 3CPGA 1RAKA 1KGWA 1EOKA 1NFPA 2ZUNA 4PMRA 1ML1A 1VENA 3VKAA 3GXFA 5KZDA 4IX0A 3K13A 4JIQA 3G3DA 1DHPA 2PDHA 3GX9A 3MW7A 4D6GA 1TUXA 3QZAA 2OSXA 3PZ9A 4PMDA 1EP3A 4KESA 3LUTA 5D02A 2GVEA 2Y7FA 4DJDD 2YJQA 4HMCA 1H1NA 2HISA 2QCEA 3ERPA 3SY1A 3NA8A 3K8KA 4ALDA 1BYDA 1OG0A 3TW9A 3F5LA 3MQTA 4DBUA 4Q8TA 2ALDA 4CQBA 3WLMA 2TODA 2WNNA 3PSWA 1WUEA 3H21A 1AH4A 3LRKA 3OLGA 3PG8A 2FFIA 4FMVA 3M5XA 1JAEA 4DJDA 2WLYA 1XCFA 1OD0A 4E2BA 3R1ZA 1OCQA 4BQ5A 3MU7A 4MJMA 3WD0A 1EXPA 1RK6A 1S2AA 3OG3A 3WLIA 3PTKA 4R9XA 3WUGA 3PBUA 4HA3A 2YIHA 2OVLA 5D30A 1TIMA 3BLEA 5BYWA 3WIJA 5DQPA 2X1TA 5GVJA 3PBYA 1FTXA 3PNUA 2VJXA 4FNQA 3G1SA 1J4EA 3GY1A 5GQBA 2PTDA 3SCSA 2DZBA 1E73M 3P61A 1ZCCA 4C7GA 1TX2A 1VF8A 1QOQA 1S3TC 3T4WA 1G1YA 4N9DA 2QJMA 1R8LA 4HZ7A 4AW7A 4NQ1A 4GUFA 1JZ5A 1UASA 1J0KA 4EVZA 3T55A 1WAWA 4XIAA 3WQPA 5A6TC 3P0XA 4GKTA 9XIMA 1AQHA 3W37A 2QEZA 1FP8A 4JTUA 3VZXA 1W2PA 2FMNA 3O6YX 4CD7A 1SJAA 3TW6A 1XLHA 4JYEA 5LA2A 3NURA 3BDKA 1IEVA 5E9AA 4K2SA 4LPCA 5KITA 4AIOA 4UFKA 2BOFX 3EB3A 4UFHA 1H50A 2QDHA 5K9CA 3IJ6A 1EEPA 5IXEA 2CC0A 2ZTJA 1UPMB 4GIRA 2VENA 3LGEA 2X05A 3G6MA 3I4EA 1W3NA 1I4NA 3SN1A 3KRSA 4FO4A 3WFLA 3QY6A 3CBWA 4GH3A 4RPQA 3IIXA 3EDJA 1T7LA 1FWAC 4MG4A 1EC8A 1PZ1A 4IFRA 1CW2A 3CS2A 5CPOA 3UA3A 2X41A 4J3SA 3SCOA 3LNPA 5A6BD 3FCPA 5LXXA 4QCEA 4IMFA 1TTIA 4FLSA 1G7VA 4YL2A 4C1LA 3W1TA 3TAOA 2D2GA 3KL3A 3P7YA 2OR2A 3CAKA 4GLEA 1UKTA 3AIWA 3M41A 4ZO9A 4H4IA 1DXFA 2XH4A 3GZ3A 1OCBA 5A6BA 3THAA 1AUSL 4JTDA 1XLDA 3ARYA 4F9JA 4XBJA 3F4CA 5EMJA 5CC6A 1IXNA 1RD5A 3V0TA 4IGMA 2Y7DA 3RK8A 1FY6A 1OX4A 1TR1A 3BAYA 4HYWA 3AHZA 2RAGA 3G1YA 1F73A 2CERA 4JHZA 4Q8WA 3FKRA 3W07A 4S3FA 2GLKA 4UFLA 3ZWSA 2WC4A 5IDIA 4WOZA 2FVMA 4Z2HA 3UWUA 2CHOA 4H6RA 4ENLA 3WBXA 4IISA 4ZTYA 3P8IA 2ZA2A 4F40A 3L4WA 4PGLA 4RV3A 5IBXA 3CUHA 4DIAA 4O14A 1XUZA 1I60A 1YDVA 3LI1A 3CQHA 4L6DA 3N3MA 4N9BA 2ZRZA 1WV2A 4XUGA 1RLDA 2Z26A 3EMZA 1JGIA 2R91A 1DWIM 2QV4A 3SCTA 3RJXA 5DRCA 1OK6A 1M7PA 3GUGA 4PCTA 1SW7A 5FJRA 4GVGA 1G4PA 2J7EA 4OOZA 2YGYA 3ITTA 1UKQA 3H2OA 5BNKA 2D3LA 2CKRA 3ANVA 4PSRA 3WNPA 2GVYA 4UTHA 3GIPA 2VKZG 4JN6A 4F3HA 1MUCA 1L0PA 4ADUA 4PMYA 3PB0A 2D2JA 1ZUAX 1KR0A 1NWUA 4MNMA 2BXZA 2G4JA 2VEIA 2G3IA 2FZMA 3LENA 3D3AA 1NY1A 3NL2A 4BHYA 2JGQA 2XSAA 1JCMP 3P81A 5BRQA 3BUVA 4I7WA 1HKKA 3V4BA 3JS3A 1EQCA 3SY5A 1UHVA 3E0FA 3RU8X 1TJ2A 4GFIA 5HUPA 3UWVA 2NUXA 2GZXA 1I8JA 4FF5A 3FYOA 3ONCA 1DWJM 1TPB1 2E9MA 1XIMA 3B9EA 4HN4A 1BF6A 4G9PA 2XINA 4PTDA 1XLLA 3KVJA 5D37A 1NOUA 2QYGA 3EOSA 2X0SA 1I2OA 1Q8JA 2OX4A 4IMDA 4UTJA 1BYAA 1UJQA 3BC9A 3PJTA 4OBSA 4DYEA 3IJ8A 2E6YA 2VFEA 3W74A 2QR6A 5I3JA 2G3NA 5IHSA 4PL1A 2NWSA 5T8GA 1MDRA 2D22A 1FQ0A 4M8UA 3LHVA 3OODA 3TH6A 3LCWA 3MUCA 5AC4A 3F4DA 3WLJA 3SUTA 1V3MA 1IEXA 4WDTA 1OM0A 3VKDA 1XRTA 4U2ZA 3DKLA 5DFAA 2ADAA 1GJWA 1UD8A 3WH5A 4Q32A 1VR6A 1JYNA 2FPTA 4FLQA 4N9CA 4KERA 2A3BA 4K39A 4PH6A 3E2VA 2XIOA 2R1MA 4UFJA 3E74A 1VC4A 4D8ZA 5DEZA 4HJWA 3SB0A 4UTUA 1FWJC 2VFHA 3UERA 4TVUA 2WK2A 1QASA 4NZ3A 1PX8A 4FXJA 1RVGA 1RBLA 4Y9OA 3VXGA 1A5UA 4GMEA 4GNVA 1Q66A 4MJ4A 4X61A 2X1SA 3DYPA 5U7SA 3AS1A 5TF0A 2W67A 3HV8A 3BAIA 1A0CA 2XVPA 3ZSSA 5ABTA 1GVOA 4HPGA 3EXRA 1LQAA 3N18A 3WX7A 3IJQA 2P50A 1XGZA 2V3GA 3M0MA 4ROPA 3SCWA 4PUNA 3UR7A 4Y96A 2WMHA 2VGGA 1POJA 1QWGA 5IRPA 3CAQA 4JIIX 1DVJA 1EPXA 3R5EA 1TJPA 1DEDA 4WZHA 3VOCA 1R87A 3LXBA 5E93A 3CH0A 3DFSA 2J77A 1GNXA 3AO0A 2FDMA 4J9JA 2CESA 4U3AA 2J7DA 3UGVA 1RP8A 4IP5A 3USBA 1SUXA 1R30A 2OKOA 3IJIA 4HHPA 4XVDA 3ABSA 3AZSA 4A05A 4FSAA 3U4AA 1SO4A 4DI8A 3AXMA 3U2EA 4NYUA 3UPWA 3KVLA 1RCQA 2YX0A 3OB8A 4IGHA 4TX8A 4P8UA 3LCFA 3TCSA 4X0NA 1H61A 5AOUA 2V30A 2VCCA 4UOZA 1VPQA 4DUWA 3L4TA 4BR1A 4JYDA 1VIZA 4UTKA 3UPBA 2YDAA 3SCUA 3VX0A 1M68A 5AVHA 1WZLA 3S47A 1RR2A 2VXNA 1FKXA 3NFUA 1GTEA 4FXFA 2QDGA 4RK8A 1R2RA 2MANA 1SO5A 4AHOA 4K38A 4LCSA 3TX9A 3GDLA 4HOWA 1L6YA 2C1GA 3HFYA 2NWRA 3KX6A 3NQ2A 1UWQA 1C8QA 2XH2A 4ROQA 1GYMA 2G96A 2WZHA 3VYLA 2J66A 4GYFA 2WMGA 1V5XA 4EF9A 4AIBA 2ATMA 5FJPA 2V5LA 3KWSA 4JNMA 3EWBX 3U8GA 2QCHA 2QUTA 2V6AA 3GU9A 4OIFA 4Q8OA 1QW9A 2WKGA 3A64A 2FB3A 4GI6A 2QUUA 1TWDA 4EANA 1E6RA 3FN9A 3VIMA 2XISA 1FWWA 1VFOA 3VGGA 4H7ZA 4C5ZA 1B2YA 2V38A 3QC3A 2LLEA 4FK9A 4MYAA 4TVCA 3CTLA 4ADSA 4LBRA 3G1FA 4RDYA 2VYOA 1K7XA 1R7OA 4RUBA 2ZC1A 1IZJA 1MO0A 3ZYZA 1K6AA 3A3HA 1VIWA 3Q67A 3ZJ7A 4KWVA 3KEHA 4UMBA 2W79A 3R25A 3TV8A 1A50A 4WGHA 3W7RA 1SJBA 3CWNA 1PPIA 3TTSA 3W25A 2PWVA 4P7LA 3N25A 1DTNA 4H8UA 4CD8A 3CIVA 1UKPA 4AHQA 4QDMA 5I3FA 1BTCA 3RRAA 5I79A 1RH9A 6ALDA 4OU1A 2E1DA 2Y62A 3M7WA 3UG5A 2J7GA 1MW0A 3MDUA 4E8CA 3QTGA 3VNIA 1O5KA 3RM4A 1SU5A 2WO5A 3UCCA 2VZUA 1ZZMA 1W3JA 3NCOA 1V77A 1XCWA 1YMYA 1YHTA 1U1HA 4JAWA 1S5VA 3TN5A 4J40A 2HBXA 3HPSA 3UWQA 4AZHA 1RD6A 4US5D 3FGCB 4WUIA 1ISWA 4MGGA 2V82A 3EXSA 2ZZ4A 3CMGA 4LUSB 3NQEA 2DSUA 2OQYA 1KXTA 3PAJA 4Z1CA 5KZMA 2O7SA 2X8RA 3H12A 1C93A 1IIGA 1VCVA 2RDWA 1LDCA 5KTLA 3M5ZA 3W2NA 1GHSA 2G4FA 2ZQ0A 1PZ0A 1TUFA 3EOUA 3E0WA 4US5A 3GH7A 5T9BG 1X8FA 4EACA 5LGZA 2HPIA 5A69A 3EEGA 1HL9A 4YWIA 3DH7A 4JTGA 5AKQA 2E5CA 2CLEA 1UH3A 1EP1A 3W7DA 1GVSA 3RX2A 5F7UA 3QR3A 1Q2SA 4CQAA 1IT7A 4RDWA 4B15A 1V02E 1IWAA 4DPQA 1NQKA 1V51A 4OBRA 1CGVA 4GQGA 3FAXA 2OGYA 4JIPA 4IICA 3H7VA 2BY2A 4DUXA 1J93A 1E6ZA 1IGSA 4ATLA 2WBKA 2V5DA 3AIUA 3KVKA 2PTXA 3U0HA 2ZZ7A 4H8HA 4S3GA 2Z29A 3W7LA 4Y8EA 2GJNA 2ZVIA 1W1VA 4M6PA 4RPPA 1TB3A 4MDPA 1FWDC 4W7WA 1C8XA 1DORA 4IXXA 2Q3OA 1KLYA 3LSBA 2Q3RA 1DPMA 3C0LA 5BXTA 1BXCA 1QT1A 2ZC8A 2ON3A 4I7VA 1XKJA 1GKQA 3ZLGA 2XG9A 2W66A 1XYZA 2H3BA 2YBUA 4L1XA 3N9KA 4PUKA 4GG9A 3K4WA 3UG4A 2PD9A 3W7MA 3MCNA 4X2RA 5HNRA 3HB9A 5ABFB 2BY3A 1HL2A 1D3CA 1QOPA 1HUVA 2A2IA 1ZB5A 2OCZA 2OFJA 4YYCA 3MSRA 1UD4A 1EL3A 4IG2B 1GVQA 1HN1A 1E4LA 3A23A 4UTTA 4GGHA 1O94A 3GRIA 3E5PA 4PMJA 1VFLA 1XH1A 3S5ZA 3H7RA 4EAYA 5D8WA 1PTGA 1XIBA 1HJWA 3E49A 4FIQA 4H6KA 3B8UA 3E2QA 1ITCA 3MDWA 4QG9A 8CGTA 3W2MA 3NDOA 1D9EA 3S1GA 2J4GA 3M16A 1GGOA 3GDRA 1WQ5A 3WCZA 5DO8A 3M0ZA 1W1PA 3AXXA 3IIOA 1LUCB 1OYCA 4ICCX 1AW2A 1O1ZA 5SWUA 5JH1A 2WKJA 1QU4A 1JR1A 1UR8A 4JN8A 5CEWA 1PIGA 2NW0A 1A0DA 1JYVA 3IIVA 3F5KA 1K02A 5B80A 4RE3A 3ZLHA 5ABFA 2GJRA 1EJ7L 2CLHA 3PZNA 4IFKB 3EBVA 4UTIA 2G37A 1OGBA 3ZVIA 2DSZA 2WZEA 2DZPA 2OTDA 2Y8VA 3NGFA 1QNQA 3NOEA 5DF0A 1YDYA 4XD6A 1LOSA 3OGRA 4IG2A 2QIIA 2VL4A 3QW3A 2BDQA 4AH7A 4KGJA 4UNLA 5G5IA 1BWLA 1JYWA 3G8EA 3GWQA 5LYRA 2NT1A 3KBMA 3CO8A 2PI6A 2OT0A 2IPGA 1ONEA 4XD4A 4ZO6A 1R38A 3TYZA 4GWEA 1TE1A 3AJXA 1GOMA 3SUWA 3QPEA 3WH8A 3TCEA 2ACSA 2B7PA 3WYZA 2DZSA 4WR3A 3T4CA 3BJTA 2XZ9A 3ABXA 3TYDA 3VVGA 4B16A 4GABA 3RPTA 1LUCA 5FF7A 3BAKA 1HF6A 1ZGDA 1E9ZB 1SR9A 4GK8A 4AVFA 2J47A 3DHFA 3EA3A 2PDLA 1F2JA 1OG6A 5EMLA 2G95A 1GJPA 2YOCA 4Z1DA 1RQEA 3VDCA 4YHGA 1XFBA 1QPKA 2O9TA 3GS6A 2CZDA 1BAGA 3TDFA 1OYAA 4Q4QA 1TPC1 5I78A 4IFKA 2CBVA 1Z42A 4HNUA 1GORA 1O66A 1JEZA 1WYIA 3RX4A 1AJ2A 1CTNA 5LIYX 4WDUA 2VEPA 2O92A 4PBEA 3TK7A 1MXGA 4QSFA 5IFPA 4O1FA 2ZVRA 1H11A 1N7KA 1V03A 2J13A 3A6OA 3CV7A 4UZUA 4PN2A 5C9WA 1TWSA 3BLOA 1Q6EA 4JKLA 1M41A 1EWDA 3WMBA 2ISWA 3LGGA 2VD9A 3PB2A 4QNWA 4TO8A 3S2LA 4QEHA 3UU0A 3R13A 1AZ2A 3EDDA 4OECA 3MHFA 3VX1A 2PCQA 3GE7A 1B3OA 3R6IA 4PMOA 2INEA 5GJNA 2CPUA 2VX7A 1TZ9A 1TE6A 1A3XA 3N2CA 2YYTA 4BI6A 1YEYA 3WBWA 1TG7A 2EQDA 1OT1A 2C79A 4FXSA 4E2DA 1EJVC 3CAVA 3UJSA 4DEFA 3OZMA 4B3KA 3MMDA 3LBCA 4UNIA 3ARZA 1A5BA 2XTKA 3VD4A 1P6WA 5A3HA 5BXSA 5A6JA 4YVXA 2R1LA 3UG3A 4LF2A 2NLIA 5REQB 3W72A 2XFFA 4E0CA 4W86A 1P0DA 2A3HA 4KBXA 1U83A 2NZLA 3OGVA 3N2BA 3LRMA 1MW2A 1E9LA 3MS8A 1QFEA 1ZAIA 1R9XA 3WF4A 3NL5A 3UZZA 1GOQA 4XO6A 1XLIA 3CO4A 2V68A 1J0YA 1WZMA 5GNZA 1CLVA 1ZLPA 1JUEA 1RJRA 2PWDA 1VEOA 3ARVA 3KXQA 4R85A 4FNTA 3FNDA 4PUMA 2VM8A 4O50A 3SM0A 4AXKA 3PHAA 2AGTA 4WJXA 3MUXA 4M5PA 4JY9A 4GIAA 4HU4A 4C6DA 2WV8A 3TWAA 2WWDA 3CUZA 1H4PA 4V1XA 1TO3A 3BL3A 1WKYA 4KCVA 3WENA 1UUOA 1Z41A 3WQWA 5LXEA 2DSVA 4MKNA 2OT1A 2SFPA 3PZUA 2HPMA 4FXRA 3GAKA 2YL6A 1EEXA 4Q3MA 2PF8A 3VAVA 3IIZA 4AWEA 2QCDB 3KHJA 5F4XA 3PZGA 2W92A 4QLJA 1GZJA 4ZZ9A 4A8IA 1WUFA 1UMLA 1XLAA 2VCBA 1EA9C 3ARWA 3T2OA 4IFOA 5REQA 2BB0A 5A8OA 1AQ0A 3MO7A 1V6TA 3G1XA 1FH7A 2HBVA 1OWQA 1MI3A 3FY1A 4K8GA 5E0KA 1JJKA 1Y0EA 2RKXA 1XX1A 3WLSA 3RYSA 3OA3A 1BSIA 4L5ZA 1ZP4A 4R34A 2ZX5A 3PPFA 1ONWA 4QCFA 2Y5EA 2V81A 1LL6A 2NSOA 5DRIA 4O16A 3GM8A 2EPOA 2WMFA 4MPQA 4GGBA 2Q6ZA 3PZIA 1Q6LA 4WDWA 2FGBA 2TYSA 4WY0B 4ERGA 1XM3A 1XF0A 5CJNA 4AHPA 4EPBC 3KTXA 1MFUA 3EDKA 1NU5A 4TR9A 4GISA 3LTSA 3CLMA 2PTWA 3VPLA 5CSYA 1KKRA 3LHYA 2NQLA 3NVTA 3QQ0A 1HGYA 1BQGA 4F0KA 1QOXA 5TIMA 1YTEA 2DW7A 1JNDA 2XIMA 1PS9A 2VDGA 1PWMA 3JZUA 1Q85A 1G0CA 1GG0A 1GWJA 5D9MA 5F2IA 2WC3A 3TYUA 4O1DA 4HTYA 1A49A 4QP0A 3GFZA 1UZDA 2AL2B 4ZFMA 3W71A 4NNBA 1VYPX 3A9BA 4L9YA 5HBFA 2G3FA 4LYPA 3TUUA 2A85A 2C14A 4TX9A 1W0MA 1ZAJA 1FKWA 2JKPA 4IIGA 1G7UA 2EEXA 2HVNA 2R82A 1EIXA 2ZADA 3H55A 2O9OA 4HJFA 4C1KA 5HJYA 1FCUA 4BQ4A 1JZ2A 4QX4A 1VZWA 3PBMA 3QGKC 3REQB 4HA1A 4P7OA 3QQWA 3THCA 4CEXC 4YCOA 1EPVA 4JD4A 2PBOA 4DWDA 4NJJA 5BWAA 3RDKA 5AZ1A 2V2HA 1DJQA 2VT0A 3C4UA 4KCUA 2PDQA 4WY0A 2XIBA 4LCRA 1IEIA 3LXCA 5H8MA 2IKGA 3BMWA 3TMLA 1DE6A 3IAPA 5TD4A 4KPLA 3HA1A 5FESA 4M80A 3G8RA 2CWNA 3II1A 1DP0A 1KFLA 1IIHA 2Q8ZA 2DH2A 3VOJA 5HQEA 1FDJA 3CMJA 4AIEA 1B54A 1RVKA 3KCOA 1CBGA 3PPGA 1R3SA 2E3ZA 2XYLA 3CK5A 1NTHA 3VZYA 3C0QA 3SADA 1ZJBA 2AL2A 2WNWA 4GVIA 3ZQ9A 1Q45A 1B57A 4OKDA 4GCXA 4HPNA 3VNLA 2D2OA 3M0YA 3FXYA 3WDHA 2A3AA 1S5NA 2PCEA 5HR7A 4LEFA 5AFDA 4HD5A 2DZXA 3KOWA 1JZ3A 1OC5A 4FLRA 3HM7A 2RUSA 4WEVX 3W86A 3REQA 1W32A 1YDNA 2D73A 1E1CB 3CT7A 1PHQA 2DY3A 2JIEA 3VKCA 2FJKA 2JBMA 2GQAA 4J4KA 1VP5A 3A3XA 2ACUA 1X97A 3WDIA 1XQKA 1YNYA 3AMKA 3CGTA 1YNQA 1XGDA 4IPPA 2ISDA 3SJNA 3QVQA 1T5AA 3F7JA 5E9XA 5HNTA 5CG0A 4J5NA 2ZUVA 3CV1A 4Y90A 2PMQA 1KBKA 4DUVA 3NQMA 1A4LA 2A7NA 2X40A 3WLRA 3VOFA 3MI6A 3PTDA 4ICNA 1CX9A 1TV4A 1QHZA 2XFYA 2ONEA 4X63A 2OO0A 1F4HA 3VIGA 1KRAC 3RIKA 2NX9A 3IGXA 2KX9A 2OB3A 6XIAA 1TMLA 4PODA 3R4IA 5DCBA 3R8GA 4W89A 3J7HA 1J5TA 3W75A 3K4AA 1GZGA 3MANA 1M7OA 3KTSA 2ZRYA 3G0SA 5JBFA 3D6NA 4ATDA 4IMEA 3ZIZA 2V3EA 4IMCA 1KRCC 4NZJA 4W9TA 2EG8A 1EGZA 5HDRA 1WZAA 2V5JA 1UJPA 2QPSA 4EPKA 1Q6DA 3ABRA 1WKDA 3B8DA 1AJZA 4H6EA 4KW2A 4XZBA 1DOSA 1ME8A 1X6UA 4QG8A 2BP1A 3ITVA 5EKYA 3B9OA 1E1CA 1LJYA 3SUUA 1P4CA 5D09A 4UCGA 1PDZA 4FNRA 3PK7A 3ATZA 2C1IA 4CCDA 2DV0A 3WQEA 2NUYA 4I5XA 4AVNA 3RUBL 5LSMA 1PHWA 1LL4A 2EPMX 3VM7A 5CKSA 4QJ1A 3S5YA 4XD3A 1HNYA 4MJZA 3AYTA 2CLPA 3RO6A 3WELA 4WGXA 3ZLFA 4GUHA 4UMCA 3QH2A 2GGIA 2DVTA 1D3HA 3CUGA 4R53A 4Y7EA 1BYBA 2ZDSA 4M81A 3BG5A 3MYPA 4JFSA 4PYSA 5L6UA 2JALA 1A5AA 2O9RA 1E71M 1S46A 2A3EA 3HG2A 1WO2A 2OSWA 5JU6A 1OFRA 2JGYA 4Q4SA 3CHCA 1KFWA 4JXCA 3WEOA 2WNZA 4WOQA 6A3HA 5MHBA 2VRKA 2I5IA 3WLLA 4WDXA 2QHAA 1EYWA 4Y9AA 4JTQA 4M1RA 4LT9A 3WLQA 2QUMA 3WEMA 2VMFA 3P8JA 1Q2RA 3YPIA 3W87A 5CPSA 3EPOA 5A6SA 5DX7A 3W02A 1VD6A 1XIJA 2VRQA 3MC5A 3WLKX 4XKMA 1QO2A 4ZSTA 2DT2A 3NOYA 3ICJA 2FGLA 3M0JA 3ARSA 3W53A 1CECA 2WW5A 4J27A 3ALGA 2I9UA 3ZWTA 1HKWA 4I9JA 2Z2UA 3VGDA 2R6OA 1QPRA 4AYSA 4RE2A 2YFOA 3AUOA 1S38A 3VCRA 4GY7A 2PP1A 4ZSUA 4PUWA 3LTYA 1J2WA 1OC7A 3URAA 5BW6A 2VWTA 3O63A 3T09A 1MNZA 2CCRA 4O1EA 4D6EA 3QLDA 3W7QA 3CL8A 3PWIA 3GG8A 3HGSA 2E28A 1ENUA 1XI3A 3SEPA 4PUJA 5CBJA 3TYAA 2OEJA 2P0IA 4C6EA 1OFAA 4OV4A 2IQTA 3UWYA 3GR4A 3W7CA 4L6OA 3D0CA 2HK0A 3CLWA 3EOOA 5HR6A 1UBSA 5I2UA 4DBDA 3G1VA 2EG6A 3RXZA 5GNYA 1ISZA 1OF8A 1FRBA 4IWWA 5BMWA 3T0BA 4UMAA 2PE4A 4JTEA 4HNLA 1WBJA 2DGAA 1OQFA 4O1BA 2OQLA 4URIA 2NLYA 2WC7A 3QF0A 4B5SA 5M2FX 2Y8UA 5I5RA 2G3MA 3PJXA 3FW6A 4NUWA 1NQ6A 4O18A 4RZ6A 1NFBA 4J3VA 3COTA 2OPJA 4O10A 1MEIA 3B40A 3NPWA 2HVMA 4GYPC 1ZP3A 1UZHA 5M17A 1UCWA 2B7QA 2OELA 1U1JA 3VNDA 1KFEA 4W8AA 3TYEA 3DGBA 2GUUA 2PDYA 1TR9A 2WSPA 1G67A 5FIPA 5DXYA 4ZO8A 2VWSA 4IJRA 4S3KA 4QIUA 4X22A 5G1YA 1SZNA 1BGGA 4XTDA 2VTFA 3DDMA 3CASA 2BMBA 1JDEA 2WJEA 6CGTA 1FVPA 4PCFA 2UY2A 1H60A 1W8SA 1J0JA 3LX9A 2FFCA 3BGJA 1AODA 4B9ZA 4LNCA 3IVSA 3WBAA 4MLJA 2CFFA 2PRHA 3H4WA 3LLFA 1K8CA 3LQLA 1F6YA 3U7BA 1X96A 2X09A 3L4UA 1O95A 1XG4A 2FTWA 4O17A 3TSDA 2YFNA 3FHAA 4CLMA 4A2SA 2W5FA 1OABA 1VBUA 2J7BA 3T0TA 7REQB 1OCNA 1EZWA 2J6XA 2CLFA 3GD6A 3OLEA 4NU7A 3GTXA 1XL9A 4F48A 1MEWA 2JKAA 3LI0A 1DL3A 4HGXA 1HL8A 4YWSA 3AISA 3S9YA 3MZ2A 3IVUA 4UQBA 1N55A 4MZ8A 2Y5JA 4W85A 3CL6A 4KS0A 5D2VA 3ZT6A 2PURA 3V5FA 3VCCA 3XIMA 5EYWA 1AZ1A 1TV3A 1VHCA 3B9DA 3AC0A 3L5LA 1WBHA 5CJ5A 5E0CA 1AVAA 1GVYA 4TV6A 4AEFA 4BQ3A 3A12A 3NM3A 4DXVA 4MJ2A 4W88A 1AL8A 3TQ0A 2XPKA 1UR3M 1CXIA 5I6SA 3PZQA 1DV7A 3S1WA 4XAPA 1W9VA 5CPNA 3FXGA 4MTVA 5CPTA 1LLZA 2ISFA 1JUKA 1KV5A 4QEEA 3ZT7A 1BGAA 3L4VA 2Q8LA 5AZ0A 4LOCA 2GWNA 4Z2JA 3GIQA 1TRDA 1NDVA 4B90A 1HP4A 3AIEA 2DT0A 3NQAA 3MBDA 1WXZA 4Z0JA 2OGJA 4J3ZA 3KRZA 1OCJA 1H7NA 2C15A 1X1NA 4LAKA 2ACQA 2WCGA 7REQA 3O6DA 4C6IA 1KCZA 1QNPA 5FEXA 1B9ZA 3VDBA 5I02A 1P1XA 2W61A 4JIRA 3U4FA 1YRRA 4D6JA 4KCTA 4E2OA 2CZFA 4DWSC 2BHUA 1QDSA 1NSJA 4E2VA 1YX1A 4A3HA 2QT3A 4AC1X 4W93A 4HK7A 2Y1HA 2JQXA 2XUCA 4KF1A 3E9AA 1O5QA 3M0IA 5FD0A 1PKYA 2CBJA 3QMTA 2OQHA 4YTQA 1U30A 1P1MA 5J5DA 1GQIA 2JE8A 3LGDA 2RDXA 4DO4A 4O0KA 2XSBA 3WD4A 4Y6GA 4H1ZA 3G1HA 3BLFA 4S3CA 4QTGA 1T99A 4O0ZA 1GG1A 4WVXA 2NVDA 5IM51 4QROA 3KUMA 2PU1A 3KAOA 3RPDA 3KL0A 4S3DA 2AQWA 3BXWA 2POZA 4LBSA 4LXFA 1W3TA 2DIJA 3R0DA 4I5RA 4Q8PA 4RNIA 1XD1A 4EOUA 3URNA 3C8NA 1RZMA 1XLBA 4N6EA 1IWPA 1XC6A 2QQ6A 2ZRVA 1AQMA 1J01A 3W1QA 3TYBA 4HPJA 2FMOA 1K6WA 2VI0A 3BWWA 4WXYA 1EJWC 3FA5A 1AMYA 3R0UA 1KLZA 2ZXAA 3W1UA 3TROA 4RZBA 4IF2A 3W1NA 1JCTA 1LM1A 1MYRA 5IOBA 3GNXA 3SGUA 1PSCA 4NT0A 5CZJA 4GNKB 4QXIA 2Z1BA 2QCMA 2NXHA 2KAUC 1BWVA 4ML4A 4UQ9A 1FXPA 1QK2A 2BVYA 3S8HA 3QYQA 4Z2KA 1XRVA 3WLTA 4MHBA 1UA3A 3VGEA 1KD0A 4IIBA 1RALA 3W82A 3RAOA 3BGAA 1C91A 3U7VA 3EX3A 2KZHA 1IZKA 3QV8A 3M5YA 3WF0A 4DPPA 2OLSA 3L0NA 2G97A 2GL5A 3A4XA 4A29A 3H2CA 1US2A 4NF7A 5LA1A 2YCKX 3KRBA 2ZRUA 5C2CA 4A2RA 3RLHA 3KWXA 3V3WA 4AZ6A 4CD4A 2QCNA 5HPCA 3RX3A 1EQPA 1YXYA 3I10A 3W29A 1GOOA 3RG6A 1JPMA 5CAHA 1DYSA 1MWOA 4C60A 1JPDX 4F2BA 1H2JA 4P8VA 4WKHA 2NXGA 2Z1XA 4O15A 1XLFA 1O6IA 2WVUA 3W23A 1UR9A 3B04A 4ZL1A 4PTXA 3WQ5A 5J04A 4L4OA 4M6UA 2OSYA 1Z32X 1CGUA 2QMJA 1NELA 2YZRA 2Z1WA 2FQIA 3TTOA 1ITUA 3OHIA 3T40A 3A5VA 3W4RA 5C6MA 3BG3A 1OINA 3CHEA 3F5JA 1JZ4A 1XYMA 3QTPA 4ZOCA 2AMXA 5GJPA 1E6QM 3LEPA 3PANA 3AMDA 2BS9A 3S5SA 4GXWA 5AC5A 5F1UA 3M0KA 3I7RA 1NF7A 1EXBA 3GR8A 1E15A 2QKFA 5JUVA 2IKIA 1RQHA 3W2JA 4IPNB 3IUDA 2J25A 3MHGA 2CBIA 3IUIA 3AHTA 1TTQA 4BWLC 3DFHA 3T0AA 1SZRA 4QM1A 2J78A 3DKJA 2QDDA 4D8LA 2HDJA 2WCSA 1VLIA 1GYNA 2FHCA 4GY0A 3IK2A 1QXLA 4AVOA 3FOKA 3QHOA 1V3IA 3KW3A 3AQUA 4V15A 2OYLA 3U2ZA 3THQA 4L9ZA 2IPJA 1THFD 4WRHA 1F74A 3RLGA 4GI4A 3BW4A 3AXHA 3ABZA 1CXFA 4YTTA 2VC7A 1GONA 1G01A 4C6LA 3BQ6A 4IGSA 2YSWA 1DJNA 3K2GA 4WCJA 3WSUA 3PJUA 1PZ2A 1Q5MA 4GA8A 3L2IA 3N2OA 3UPMA 2VR2A 3BCJA 3A21A 3SGZA 2VQTA 1HJSA 3CZEA 4MY8A 4D6HA 3PPHA 3P80A 1NAL1 4N02A 2HXTA 3ABOA 2AAMA 3WK0A 4LVGA 5D05A 3W88A 3TN3A 1E6NA 4HP5A 3APGA 1KXHA 1ADSA 2VELA 1UD2A 3W38A 3P2VA 1IEQA 1A5CA 2GVLA 3AYSA 1C92A 1C9WA 3TWBA 3ZO9A 2ZYFA 5G2IA 3OPSA 4TTUA 1EHAA 3MSGA 4KCWA 2PWEA 1JZ6A 1B3YA 3EEZA 4R5EA 4IGNA 5C7HA 2VO5A 5H2ZA 3CV6A 5CGMA 5FL1A 1IE7C 1SO6A 2CLIA 4UBPC 5A1AA 2Z1SA 3VU2A 4DNMA 1Q3NA 4MFEA 4F0LA 3WJSA 4UNKA 3NUKA 4JR5A 5DMLA 5AB3A 4IM4A 1BD0A 1RCOB 2F8QA 3KL5A 1EO7A 1TA3B 2GSEA 3T7VA 2VGFA 3PFMA 4A22A 2WJFA 3MI2A 3WL0A 1UC4A 3EAUA 1BVZA 4KQNA 5D2YA 2RDTA 2E5DA 1OK4A 5H8UA 3TC3A 3DEQA 3W1MA 5EGRA 2AQVA 4M0XA 4UUIA 3C3UA 4N4QA 3UXIA 4GUIA 3AOFA 3UNDA 3DOPA 2IPWA 4HU0A 2D69A 3EZ4A 2BTMA 3QKZA 1KM1A 1KXQA 3SSZA 2PGEA 3BH4A 1FDZA 3C0JA 3KS5A 2WVVB 4NIRA 1YE4A 3VIOA 1E72M 3W9ZA 3GNPA 3CIWA 4I9TA 3PZMA 1QW8A 2DT3A 3WNNA 4I5UA 1OC6A 1NIUA 3WBEA 2PDMA 3VO0A 1NWTA 2BOGX 1C8VA 3QW4B 5E6YA 3WDQA 1ZSXA 4FPSA 3NVDA 3GU1A 4HK5A 4XQ6A 1XDMA 1ME9A 1VCGA 5BU6A 3H22A 3TQKA 1W54A 3QHMA 3CU2A 3QKEA 3PSVA 1PUDA 1BFNA 3H8AA 5CSUA 5G1TA 1J8VA 2TPSA 4CN4A 3S6DA 4DYKA 2GOUA 1KTNA 3CB8A 4FA3A 2X16A 1FWEC 2G5WA 4B4HA 2QVNA 1WOBA 3VNYA 1IXPA 4P7RA 1CYGA 1TA3A 5DT5A 1H7PA 2JEPA 1UR2A 3CM4A 1U5HA 2CBUA 1KM5A 2WOQA 2QJJA 3FEQA 1PWLA 4RW5A 4HYVA 3CZLA 3RMEA 3LPFA 1GT8A 1KKOA 4A6GA 1CLXA 3L7RA 4RV8A 2HV5A 4EE9A 1XUUA 4J1OA 4HCHA 5DCEA 1WDDA 3F4VA 1D3GA 1HKVA 3P14A 1E3ZA 3MJMA 3S2CA 3NYZA 1TPH1 3IARA 5BROA 1TYGA 3MV01 2WVVA 1UG6A 2ZFAA 4NYYA 3GNNA 3T05A 1TKKA 3WFAA 3OIHA 4AEOA 2PLMA 5A8NA 2HSAA 1FWBC 3JR2A 3C6CA 1F3XA 3SRDA 3UA4A 3BJFA 3GXDA 4DBEA 1NOFA 3NO5A 2C3ZA 1NFGA 3USZA 2YLLA 3HG4A 3NSXA 5KMYA 2C19A 5BU9A 1OVDA 5ABHA 4F4RA 4Q7IA 1KRBC 3NAVA 4PL2A 4HPXA 1DKWA 2OWXA