4YLWA

Crystal structure of human dihydroorotate dehydrogenase (dhodh) with no.33 compound
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
364
structure length
363
Chain Sequence
GDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Dihydroorotate dehydrogenase (quinone), mitochondrial
publication title Crystal structure of human dihydroorotate dehydrogenase (DHODH) with No.33 compound
rcsb
source organism Homo sapiens
total genus 139
structure length 363
sequence length 364
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2015-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4ylwA00
2X30A 4CQ9A 3TJLA 2FJKA 1H61A 2W6RA 3OG3A 5CZSA 4O1AA 3NVTA 3U6WA 1KFBA 1GTHA 2ATSA 3M1ZA 4MY8A 3TK7A 3TUUA 4KKXA 1MXSA 4DBEA 2P10A 3W1MA 5CSRA 1IIGA 5KITA 3W85A 4K39A 4JR5A 1EEPA 2DZPA 3LCGA 4CCEA 3KVMA 3H55A 2CFFA 4K36A 4N9EA 3IIXA 3FKKA 4WOZA 5TIMA 2BZNA 4MYXA 2VXNA 2A4AA 1AL7A 4OQVA 3KRUA 2A2IA 4JTIA 5AHNA 2QAFA 2QEZA 4PCFA 1OFRA 5LNUA 3TSBA 2P1FA 5HINA 1T8XA 1TSIA 4YWIA 1JULA 3EX3A 2H8XA 2Z2UA 1KLZA 4FIQA 4O10A 4LV4A 3M9YA 3W7QA 4LWWA 3RNDA 1Q6QA 4HSOA 1QOQA 3NGJA 1K02A 3NAVA 3R2GA 4UFJA 3L2IA 4DPQA 2DU2A 4AWTA 5U4NA 4AF0B 4HHPA 2CZFA 5L9FA 4AMAA 4OU1A 4I7UA 1XUUA 5AHFA 1PHQA 3KVLA 3TR2A 2V5LA 3ABSA 3EWWA 4WY0F 4AEOA 1SO6A 1ME7A 3S9YA 2ZBTA 3G0UA 4O28A 1Q6OA 1KBJA 1ZALA 2DP3A 3NQAA 1AW2A 1YTEA 2BTMA 2NWSA 2R94A 1TREA 1QO5A 3DBPA 1TPH1 2GOUA 4FF7A 1MEHA 4U28A 1KM2A 1FX6A 1GYNA 3O6CA 2NXHA 3T44A 4UR8A 5HWMA 3BV4A 1GT8A 1WYIA 4O14A 1OYBA 4O1CA 2BLEA 2DORA 4EVZA 3LOTA 4UFMA 2VOMA 3CEUA 3P81A 4QNWA 3A23A 2W0UA 5AC6A 3MI3A 3W1UA 3WK3A 1P0KA 1VHNA 5CZ0A 4C1LA 4PL1A 5CSSA 4WUIA 1JCJA 4A22A 5G1YA 1KM6A 2EAWA 3GDMA 5U7SA 5I3GA 4MIMA 3DFOA 3M7WA 4FXRA 4R34A 4IQLA 3V75A 5A5WA 2DZSA 4A2SA 3PAJA 1Q3NA 2DZVA 3L9CA 3TQ0A 2EF9A 1QCWA 1TV7A 3Q37A 1AW5A 4UTWA 2ZA3A 2CLFA 4FNTA 3R8RA 5LGZA 3P80A 4UCGA 1MZHA 3W3OA 4OWGA 4M7SA 2OT0A 5AN7A 3A24A 3A21A 4RXGA 4PFMA 2PRHA 4N2YA 4E38A 5K9XA 1YXYA 3NNTA 2TPSA 1VYPX 3NQ8A 4BI6A 1FWTA 3W7LA 3ELFA 4CNPA 3QSRA 1OFQA 3IVSA 3KHJA 3MW7A 3LV5A 1VRDA 3OEXA 3UWVA 4JTLA 3S0CA 4Z1BA 2AAMA 2OMAA 1SUXA 3STEA 2V8ZA 3HG4A 4FEZA 2FPTA 1LP6A 4LVDA 2NZLA 2A21A 4NX0A 1ZY9A 1ZCOA 1H1YA 4AHQA 3W07A 4JYEA 4YCOA 4I9AA 4LNYA 1DL3A 1Z44A 5G2WA 3S5OA 3B06A 3QW4B 1KM4A 1W37A 3NQGA 4O16A 1LBFA 1IIHA 3EWBX 2QCDA 3L68A 5K7JA 3T55A 3W70A 4ADSA 2PC4A 3OIXA 1YXDA 2AGKA 4JTGA 5IM51 2Y61A 3S5NA 4BI5A 4PODA 1TQJA 2V5BA 3BLFA 4ORIA 3F1QA 1WOBA 4O0KA 1BEUA 1OK6A 2OT1A 4QQ3A 3NO5A 3UWYA 1H1ZA 2X1UA 1W3NA 3GXTA 5LHEA 2QDGA 1O94A 2E6DA 3R5EA 5EL1A 3B8DA 4UFLA 3Q94A 5D2XA 3NQVA 1WBHA 5A8GA 5HWNA 2ZZ5A 3IEBA 4UC5A 1EX5A 1TRDA 3IGUA 1B4KA 3RLUA 3P7YA 1KTNA 2DJLA 1H50A 2J6XA 2VFIA 1VYSX 3NPVA 3KAOA 1YPFA 5F1UA 3FLUA 5DY3A 3GXNA 2CLEA 4EIVA 1O60A 4L4MA 2IQTA 3TC7A 1BTMA 3CTLA 2A6NA 1E51A 4PA8A 2FB3A 5DXXA 3CU2A 2E5DA 2DZUA 1OFBA 1IF2A 1K8ZA 2YXGA 1W3IA 1H63A 2V81A 4R7JA 4JDYA 1O5KA 3DHFA 1A53A 3W7NA 3PM6A 3TXZA 5KMYA 3EXRA 3WK0A 3Q58A 3W87A 4AB4A 1ME9A 3PB2A 3S42A 1SSGA 5G2IA 3S1VA 4DEFA 3W1XA 2NX1A 1YDNA 1KM1A 1U83A 1B4EA 5FEXA 2Y70A 1XBXA 3WJWA 4E0CA 2B4GA 3LLFA 2ZA1A 1KW1A 3QMTA 2A5HA 2CLKA 1TPWA 4W9TA 3PSWA 2O7SA 4S2BA 4FIRA 3IV3A 1JUKA 1TTIA 1SZGA 3ABRA 2VFGA 2PRLA 3LRLA 4XTIA 3N2XA 3TSDA 1OF8A 4AHPA 1WXJA 4BK9A 5LNRA 5LNVA 5LHFA 3THQA 1QWGA 3P67A 4PH6A 5AOUA 1QOPA 3UQNA 3B03A 2WKJA 3C2EA 3DHDA 3W9ZA 2QDHA 4RR4A 4HNNA 1SW0A 3L0GA 5F2MA 2R91A 3UYCA 2QCNA 4ADTA 2TSYA 1G7VA 3QF0A 3PBVA 3QMSA 4A2RA 4X3ZA 1BWKA 4GUIA 3NA8A 3QPYA 4FNQA 1F76A 5GVJA 3QFEA 1W5MA 1YTKA 5FF2A 2ABAA 1KFCA 3DKJA 1G4SA 2WNQA 3GKAA 2ZCGA 3MP3A 1JRBA 4DPPA 3ABOA 3MJYA 3NPUA 1FWNA 2ZFAA 1HO1A 1M7OA 2Y7FA 3TA6A 2YFNA 1AL8A 5F4WA 3TE9A 3S1WA 1KFJA 1PVNA 1RVGA 4ZQRA 1SR9A 1FY6A 1JCYA 3LBMA 3LHZA 3MYOA 3D0CA 1SQ7A 2WV8A 3LDVA 4H3DA 4JY9A 4Z0JA 5HJLA 2Y6ZA 3LCLA 2Y62A 3ANYA 4JTUA 1W5OA 4RKAA 2PCQA 1J2WA 1H7NA 3W7CA 5ABTA 4WOQA 4A29A 3W1LA 1D9EA 1RV8A 3DFPA 1PV8A 3CPRA 3QW3A 5D03A 3C8FA 3FYOA 2E1DA 4XBSA 4P61A 3M44A 2GVLA 5C5YA 1XM3A 2X16A 4GWEA 1F6KA 1DOSA 3C6CA 4GXMA 2RDWA 4OT7A 2EHHA 1QPQA 3T78A 1EP2A 3RLVA 1ONRA 3IIZA 5K9DA 2YCEA 5K3VA 1JCMP 4QSHA 4UFHA 2P0OA 2J27A 1K3UA 1QAPA 3O8AA 4DF2A 3IVUA 3DH7A 3TX9A 5MHBA 1I8JA 1LDCA 4HIBA 4LT9A 5LNWA 5F2LA 2Q8ZA 1TJPA 3PBUA 2QCFA 1PCKA 3INPA 2QCGA 1X1ZA 4UTJA 5D05A 3HG2A 1RQHA 4O53A 3PB0A 5D33A 3W7MA 3E12A 2FIQA 1FWSA 4ZQMA 4POCA 4A21A 2YX0A 4R33A 3FA5A 2WO5A 4UMBA 4OGZA 3DFTA 1EP3A 1FUYA 3TH6A 4YXGA 4O54A 3L0KA 2LLEA 2A7NA 2Y7EA 1THFD 4K38A 2BSLA 3PS7A 4O4VA 1JCNA 4NU7A 4WZHA 4QM1A 4O1BA 2PE4A 3R12A 2PRMA 5FEPA 3OHIA 1ICPA 3NL6A 4GC4A 1X6UA 4TX9A 1H7OA 2G5WA 3OVPA 1LBMA 3MBDA 4JTSA 3UZ5A 1F5ZA 1JR1A 5I3KA 4UUIA 5F2IA 4UTTA 2JK2A 2JGQA 2ZRYA 1SO3A 2GUUA 5D30A 3S1XA 1OVDA 1EUNA 1WQ5A 1W1ZA 5C6MA 3LCFA 4FNUA 4XUGA 3VE7A 2V30A 4M5PA 4CQ8A 1ZAHA 4Y90A 4X22A 1PCWA 4Z1AA 1ICQA 1UCWA 3G3DA 1J5TA 1JCXA 2JBMA 2TRSA 4LVBA 2XN1A 5DBUA 5J5RA 1L9WA 1N55A 3WK1A 1TPDA 3W2JA 3P8JA 1K7FA 1XBVA 1O95A 4JTTA 1TV5A 1DQXA 1UBSA 1EWEA 1I2OA 5C54A 3NDOA 2C3ZA 3I7QA 3PBWA 4AVFA 3HOJA 3L67A 3LERA 1TTPA 4DF0A 3S8HA 3DGRA 3QM3A 4WY0A 4YMZA 3MHGA 3LLDA 3WJYA 3N34A 3NQFA 1R2RA 4JXCA 4WXZA 1EP1A 3W88A 4X2RA 1S5TA 4UTWC 3AO0A 2Z0IA 1S5VA 1XFBA 4CNNA 5DCBA 3PC0A 2FQIA 3QYQA 1YDVA 3G8EA 5HNRA 1MEWA 2RHGA 3PUOA 1YYAA 3P84A 5AHMA 5KSWA 1QNVA 3NZ1A 1CW2A 4L4LA 1S5WA 3EX1A 5D02A 5KINA 2TMDA 1X7FA 5K4ZA 3B0VC 4NX5A 1TO3A 4NZJA 4O19A 5G4WA 3F03K 3LI0A 4TO8A 3FJ6A 1GTEA 3UNDA 1J4EA 1FWRA 2WPBA 1H7PA 4O4WA 1H7WA 1SZNA 3LTYA 3EXTA 1VS1A 3M41A 3IRDA 4WY0B 4DO6A 3E96A 3BW3A 2B7OA 3VNDA 1NF7A 1PS9A 4YL2A 1ZENA 5D37A 4GNJA 3SSJA 1JQXA 2V2CA 3Q2DA 4IX0A 1WBJA 5FEWA 3UD6A 2C13A 3N3MA 5I3HA 3MP4A 2QCMA 1JRCA 3HO8A 1YADA 1TPEA 1KBIA 4JICA 1EUAA 2B7NA 3W7JA 2DZWA 2X1RA 2CZDA 4P2VA 5HMSA 3GIYA 5AFDA 3PG8A 4ZQCA 3CEPA 3CC1A 2C16A 1AG1O 4IWWA 3W1PA 3M0ZA 2HS8A 5FF7A 3C52A 4HNUA 4O52A 4O50A 2ISSA 2XN2A 1I2QA 4UNLA 5CPMA 3PULA 2VEPA 2ZRWA 2YFOA 4UFIA 4JX6A 2R8WA 3RU6A 3FYPA 2RH9A 3NQ7A 4BF9A 1KTBA 1T0OA 2A6LA 3NL5A 2OCZA 1W0MA 1KV8A 3I7SA 3SECA 4RZ5A 1C29A 4MLJA 4O13A 4I7VA 2NX9A 4ZQOA 1W56A 3M6YA 1RR2A 3LGEA 1VPXA 4G1KA 2FFCA 1OX6A 2BXVA 3QMRA 1FDJA 1TRIA 3VFLA 1TJRA 3F4NA 5LKYA 3L0NA 4D2JA 1EPXA 3HGJA 4DBDA 1KM0A 4R53A 3BG3A 3CT7A 1AMKA 3GLCA 2VEKA 1CI1A 2ZZ4A 3FEMA 1LBLA 2QCCA 1VGAA 1Q6RA 4GUGA 1M7PA 1B9BA 1TTJA 3GDRA 3CHVA 3G0SA 4IX2A 5SWUA 2GPTA 3C56A 2YDAA 2I9EA 4FXSA 1IXQA 3M5ZA 4HNVA 3GB6A 4OE7A 1HO4A 2QUTA 2HTMA 2CU0A 1G7UA 1A5BA 1SFJA 4UMCA 2V0TA 4J9JA 2OJPA 5KZDA 1KA9F 1JJKA 3L5MA 4IXXA 4JIQA 3VE9A 3SFKA 1XXXA 4BI7A 3MUXA 1WAUA 3MMTA 1GPWA 4OV4A 4RJEA 1HG3A 3GR8A 5AHIA 4DQWA 5KZMA 2V82A 2D73A 2CLLA 4QISA 1HL2A 1G4PA 2V2HA 1XDLA 2YGYA 3T7VA 3CLMA 2FDSA 1SPQA 1AK5A 2QCLA 3W7RA 1QDSA 2YR1A 3GXPA 4E2BA 1SSDA 3U8GA 3O07A 1VH7A 2RKXA 2ZZ3A 5CG7A 2Z6IA 3QH2A 4MFDA 3R89A 3NPWA 1OK4A 4ICNA 3FKRA 1VC4A 4MYAA 3DU0A 2DJXA 4KFOA 4Q4KA 3QC3A 5EY5A 1VYRA 3LHUA 1L6WA 1WA3A 3C2VA 3UWZA 3BLEA 4O1DA 3VKJA 3JS3A 2QJGA 8TIMA 3EEGA 1H51A 3O16A 3MBFA 1A50A 2GVGA 3G1VA 2H8ZA 3QJAA 2YSWA 5I3JA 1LOLA 3KRSA 1QFEA 3B05A 4JD4A 2ZZ2A 2NLIA 3KXQA 1P4CA 1FQ0A 2VFEA 4MPQA 3FOKA 2QCDB 3CWNA 1LZOA 4LC8A 1XDMA 4JTJA 3G1AA 1PHWA 3OVQA 1HTIA 4N9CA 3MYPA 1TPVA 4JX5A 1GVRA 3LRMA 3RK8A 1KV5A 4Y9AA 3W6YA 3ATZA 4LY8A 1TIMA 5HWJA 3G1YA 1LORA 3W83A 4GBUA 3M47A 1Y0EA 2WSQA 2WSRA 3CIXA 4LRTA 1B57A 4GUFA 2Z1BA 2A7PA 3TIMA 3P60A 4RV8A 3YPIA 3W2KA 4YLWA 4GE8A 3MP5A 4LS2A 3EX4A 3GR7A 1R47A 3P61A 4QIUA 2Q3RA 4JEQA 2FPVA 2CLOA 3S1UA 3K30A 2CWNA 3GDTA 3HIJA 1NF0A 1W31A 4KFPA 3UPBA 2UV8G 3UY8A 4FNRA 1V5XA 4K37A 3W7GA 2ISWA 3W76A 3C2RA 1EIXA 4NNAA 3NM3A 3NXFA 2W79A 1Z48A 3H54A 1FWWA 3T4CA 1K8YA 1XBYA 2ATMA 2CW6A 2X2GA 1VR6A 4JN6A 2HMCA 4JY8A 1OJXA 1K8XA 1P0NA 3LX9A 3GDKA 2ZA2A 1T96A 4ONVA 1PL9A 3CM4A 3TMQA 2E5BA 2QCHA 2CZ5A 1OYCA 3A5VA 3O06A 5DBTA 1NAL1 3TQKA 1GVQA 5BNKA 4UTUA 3ZS4A 1H60A 3LCIA 1EA0A 1I45A 3G1SA 4NJIA 3EX2A 4Z1DA 3E02A 3MWAA 3A5FA 2GQ9A 3W7PA 3EWUA 5D38A 3B0PA 2RDTA 3M43A 3NQDA 2OX1A 1X8FA 5AHEA 4NNCA 1OFEA 1UUMA 2Q8LA 4M6PA 4JX4A 4QITA 2H90A 5HQEA 2ZQ0A 4RZ4A 1OFOA 5E1QA 6ALDA 4LUJA 1R2SA 3TFXA 1GOXA 1LRQA 3HG5A 1K7XA 1EWDA 1RQEA 3HB9A 1G4TA 4CCDA 1JVNA 3SI9A 1RZMA 1P1XA 1F2JA 4NXKA 4HSNA 3BW4A 3E0IA 3C2OA 1NFBA 2ZZ6A 3N9SA 5DLCA 3CIWA 3TW7A 3W7KA 1DHPA 4RCXA 4XKYA 3TC6A 4ZQPA 3TROA 2BX7A 3I6RA 4DO5A 1L2UA 4IGHA 2E09A 1G6CA 4OHQA 2NUXA 4QAIA 1ALDA 1G4EA 2DZXA 5CKSA 3CB8A 5TBOA 3CQ0A 4UTTC 1SO4A 3TFCA 5FF0A 1SW3A 1I2NA 2I1OA 1Q45A 3F4WA 4PL2A 5F2GA 2QCEA 4UTHA 4HN4A 4KWWA 4MVAA 4OBTA 4U4MA 4CLMA 1W5QA 3G1HA 3O6YX 3RMJA 2DZTA 5D2TA 1IXPA 4LRSA 3DXIA 4IMCA 2ALDA 3PF3A 3LTPA 3NZRA 3LCHA 3I65A 4LVGA 5CZJA 5AC8A 2Y63A 5TQLA 4WQ6A 5BMWA 3KX6A 1VLIA 3SGZA 4EF9A 1KM3A 4DF1A 3QQ1A 3GDLA 1DJQA 1FDZA 3OBKA 5AYYA 2I14A 3EB2A 4TMBA 4LS0A 4NT0A 5EPDA 1DBTA 3EWXA 1K7EA 2ZTKA 4NUWA 3W7DA 3W71A 5LZLA 3W74A 4JYFA 3USBA 4HNTA 2QJIA 3BK0A 3L65A 2VFFA 3GK0A 3NPXA 3PY2A 3NQMA 3KVKA 2GJNA 1OG0A 1G69A 1U5JA 2RFGA 3L21A 2V9DA 4CQAA 1KM5A 3UXDA 4NJKA 3DI0A 3QQ0A 4HPXA 4FB7A 2E5CA 4O8RA 1F05A 2C18A 4ALDA 3MI2A 3VI2A 3UWWA 1TMHA 3DZ1A 2OZ0A 1OYAA 6TIMA 5DY2A 4CCCA 1OABA 4Q32A 1NVMA 2CZEA 4AXKA 4BR1A 3G3MA 5BMXA 1RQBA 2VC6A 1LCOA 2E6YA 2X1SA 2GJLA 3NM1A 1B3OA 5EBUA 5DELA 1N7KA 4K7VA 3PVFA 3S5YA 2JKPA 3DFNA 3DENA 5IBXC 5K4XA 1TB3A 2Y89A 3LHVA 3W2MA 2A85A 3PSVA 3L5LA 4FHAA 3W1TA 4HKPA 3GVGA 3BG5A 2E6AA 2VKZG 4ML9A 1LOSA 3TU9A 3EWZA 4O11A 5J5DA 3GYEA 4UTLA 3W22A 4JYDA 4LC6A 2ZDRA 3SIZA 1TPB1 3TAKA 4HT3A 1ZNNA 3THAA 3MHUA 3TCEA 1OFDA 1R2TA 4YCPA 1R46A 2CLHA 1OFAA 1VCFA 4LTSA 4MJMA 3UXAA 3N19B 1K03A 1KFLA 4JIPA 4RXFA 5D04C 3ZFHA 3W7IA 3S6DA 1KFEA 1UUOA 3EX6A 4H4IA 5BW6A 2NV2A 2WNZA 4C1KA 3BPWA 3O1NA 5I3FA 2A0NA 1IGSA 1W8SA 3BGGA 3G1XA 1KLYA 3STCA 1Z41A 3NL2A 3W1AA 4N9DA 1R30A 3W7HA 3JRKA 1G67A 4S2CA 3OVRA 3W23A 1X1OA 1EB3A 4FNPA 1TPUA 5E0KA 3P82A 2VEMA 5F1VA 3WJZA 4AF0A 5H91A 2H3DA 2RDUA 1A5CA 4WD0A 3B4UA 3I68A 3NR0A 1VQTA 3UWQA 3IIVA 5AHLA 3UWUA 1MEIA 5HULA 5G1TA 3FJLA 1OHLA 4N02A 3E49A 3BGJA 2WOQA 3U2OA 3BARA 4Q33A 3FFSA 1L6YA 3LM7A 4FNSA 4K6AA 2F84A 3M5YA 4JNMA 3KVJA 4UIOA 1RD5A 3P8IA 5C55A 5IBXA 4GUJA 1UJPA 5F4XA 1NEYA 2ZZ7A 1DV7A 2HS6A 4UXDA 2B7PA 3AJXA 1OX5A 3G18A 3TJXA 2EPHA 5FF4A 4EF8A 2JKAA 3BW2A 1OF6A 5EMUA 5KZEA 4XWUA 2H3BA 5DXYA 2A7RA 2E6FA 3C3NA 3P74A 4O17A 4XBKA 3HPSA 2ZTJA 3P5ZA 4LVAA 1GQNA 2YZRA 2ZRVA 3OA3A 3QEZA 1FCBA 1WDWA 1ZHAA 3KRZA 1QPRA 1I2RA 2GQAA 3PR2A 1ML1A 4LS1A 4MJZA 5LSMA 3W73A 5EYWA 4UTIA 3HGSA 3G8RA 3EKLA 3LB0A 1LLZA 2Y88A 1W3TA 4JTEA 3UZJA 2J9YA 4N9BA 5F4SA 4CNOA 5E93A 3IGSA 3TV8A 2YW3A 4O15A 3LHTA 3M16A 1MSSA 2J9ZA 5CZTA 1WX0A 3C2FA 1GG1A 2NXIA 4OV9A 3W1NA 4FX7A 2A1YA 1DQWA 4N6FA 1CX9A 1UB3A 2E68A 5D32A 1FCUA 2VENA 1FBAA 1ICSA 3N2MA 3VCRA 3S5ZA 4MFEA 3W1RA 1VHCA 1SW7A 1GEQA 1D3GA 3PG9A 5HR6A 3TQVA 3G22A 3P5YA 3G0XA 4K8EA 3HPZA 1I2PA 3EXSA 1LROA 2NUYA 3A22A 3LCWA 4BWLC 5HUOA 3HGOA 4O18A 5H2ZA 5CPOA 3O6DA 1KTCA 4BFAA 4IMFA 1QMLA 2Y7GA 1C8VA 2QUUA 3GKFA 1DORA 3V1PA 4ADUA 3SGUA 3N73A 1N8FA 3QRHA 3N9RA 1M5WA 1YTDA 3W2LA 3O15A 4MKNA 2ZYFA 4FO4A 1LOQA 4TU1A 5DCEA 4M6VA 2WQPA 3LBCA 2FPYA 3ATYA 3UPWA 1DVJA 3WFAA 2Q3OA 2FLIA 4WXYA 3R13A 3W86A 1XKYA 3E9AA 4NQ1A 1JQVA 3L5AA 2VFHA 2YPIA 2ABBA 3LI1A 3IIOA 1JUBA 1UASA 1YPIA 1OFPA 1FCQA 3HF3A 2Y85A 5BOOA 3GX9A 1WV2A 4M6QA 5FI8A 3NEVA 4IMGA 5EA9A 1GZGA 1SFLA 5K2ZA 1ME8A 1RPXA 5G2HA 2EGZA 3TDFA 4KFNA 2ISVA 4PC8A 1P5BA 1IXNA 5FF3A 1O4UA 1LRNA 3SY5A 2G97A 7TIMA 1Q6LA 2ZRUA 5HR7A 1LTDA 1XC4A 4MOZA 1GG0A 3LCXA 2J9XA 3TAOA 2XFWA 2CLMA 2WJZA 3JR2A 5I3IA 4EWND 2AQWA 1WOAA 3ZR4A 3NOEA 4NZFA 1FCVA 4JS3A 4K8HA 1XBZA 3NQ6A 1GYLA 4Z08A 3LRKA 1VJIA 1GJPA 1GVSA 3MHFA 1BWLA 4RX0A 4ZMGA 3STFA 4MY9A 3DI1A 1H7RA 2NXGA 2V2DA 1GVFA 1NSJA 5D09A 3NG3A 1SZFA 3GNNA 4ZVJA 3SZ8A 1VZWA 3ABQA 4BWLA 2C19A 3PBYA 4LV9A 2QF7A 4AWUA 2NV1A 1ZJIA 1I4NA 4QNEA 1PE1A 3BO9A 3TW6A 1OX4A 3LXBA 5LGXA 4IJBA 2B7QA 1KFKA 1W5NA 4O57A 4B5NA 4H6KA 3DAQA 3BVJA 1FDYA 3EWYA 5FESA 4UTKA 1T99A 1XI3A 2WNNA 1TYGA 3RFAA 3SJ3A 3O05A 3W72A 4TIMA 1TTQA 1W5PA 3CWOX 5C2XA 4XZ9A 5G4EA 4GUHA 4IUOA 3W7OA 1GWJA 3HG3A 1ZAJA 1ADOA 1XUZA 3O63A 3G24A 4Y6GA 1BKSA 4NVTA 1AW1A 3KFTA 1O5XA 1F74A 1SO5A 4DELA 3HQ1A 4M7TA 3DKLA 3G1FA 2J88A 3HPXA 4XTDA 1F73A 5D2VA 2VELA 3LHYA 4JTKA 2QJHA 1QPNA 1YDOA 1TPC1 1OX4B 2YW4A 3GNDA 3WK2A 4M19A 2H6RA 3MO7A 3PUDA 4IPJA 2QKFA 3QSTA 4LVFA 4K7YA 5CGQA 5T26A 3MI6A 2C15A 1LRTA 3UY7A 4QJ1A 1D3HA 4GFSA 4UFKA 2VEIA 4IPIA 1TV8A 3W75A 2KZHA 4O0ZA 3GAYA 1TCDA 1YXCA 3ZWSA 4TMCA 4JGDA 4MZ1A 3GZ3A 1LYXA 3A9IA 2YYTA 3C4UA 1IXOA 1M6JA 3PWAA 2Z6JA 4UNKA 1Z42A 4IMDA 3N14A 3QZEA 4FX6M 1FXPA 1LM1A 4FX8A 2C1HA 1XCFA 4IXHA 5D2WA 3IIPA 2EKCA 5DN1A 4RZ6A 4X9SA 2X1TA 1C9DA 4WX2A 3H53A 3W2UA 4Y8FA 1HFBA 4XQ6A 1FXQA 1S3HA 5D2YA 3STGA 3SR7A 2C14A 2ZRZA 2GVJA 3HGRA 4ZL1A 4JTHA 5CPNA 3NQCA 1F7BA 1DKWA 4E2DA 3SW6A 2J24A 2QR6A 3RF9A 1ZAIA 5LNSA 3HBLA 2JGYA 4ZQNA 4AH7A 1JUEA 3W84A 1A5SA 3LV6A 4NJJA 4AAJA 3TXVA 1QPOA 2QAPA 1VCVA 4MLRA 3LTSA 5K9CA 2FTPA 4RK8A 3QPZA 4UTMA 3EKZA 4UMAA 4XKYB 1QO2A 3FS2A 1SU5A 4HPJA 1GVOA 1A5AA 4NJHA 2YYUA 1JCLA 3M5XA 1MO0A 2G95A 2E77A 2NUWA 4MY1A 4LU0A 4NNBA 4PEKA 2VFDA 3W2NA 4ZZ9A 1VLWA 4N4PA 4AHOA 2R14A 3NQEA 1F6PA 5FEZA 3M5VA 1VCGA 2JKEA 5HUPA 1PIIA 4DO4A 2NX3A 2ZZ1A 3W1QA 3TSMA 4IMEA 2WSYA 4I7WA 2XN0A 5CPLA 2C0AA 3G1DA 4JTFA 3TKFA 4KWVA 1TQXA 1H7XA 4S1FA 4MZ8A 1LLWA 2FB2A 2ZRXA 2CLIA 4TR9A 3P62A 3KOFA 3IVTA 3L66A 4PTNA 3DFSA 3T40A 4N4QA 2QUVA 3HJZA 4JDBA 4A3UA 5AB3A 4NJGA 3IGXA 3TMLA 3I7RA 4GRSA 4RLIA 2O7QA 4WJEA 3NQ2A 4Z0SA 1XL9A 3PUEA 4O12A 2BWGA 4UR7A 3GAKA 5KTLA 3WJSA 1TPFA 4NXSA 4N6EA 1QR7A 4DXVA 5G5IA 4AWSA 3LXAA 3C0JA 5AC7A 5BRBA 3W7EA 2HSAA 1L6SA 1W54A 2NWRA 4Y96A 5AYZA 3NL3A 4ORMA 3ZWTA 1DJNA 3HMJG 2TYSA 1YLVA 4EOUA 5DCDA 2GQ8A 2C6QA 4IOTA 5EKYA 3NYZA 2Y7DA 4Z1CA 4MZYA 1ZFJA 4LW7A 3DFQA 3TNOA 2F7FA 1HUVA 1V7YA 5AYXA 2PURA 3B04A 5L6UA 2B0MA 4MUZA 3FIGA 4LUIA 2G96A 3LXCA 3LHWA 1H62A 3WJXA 1H5YA 3BG9A 1SZEA 3B0UX 4GJ1A 3C61A 4LOCA 3BLIA
chains in the Genus database with same CATH superfamily
4CQ9A 4DUOA 3GFYA 1XWYA 3TN5A 3OG3A 4H6EA 2J7HA 3M1ZA 1FWHC 3GUGA 3VNZA 3TUUA 3TTYA 3O2LA 2DT0A 2PDIA 2XZ9A 2P10A 2VNCA 4HZ7A 1GQLA 4FR1A 4W5UA 5KITA 1K4HA 1Q7QA 1YE4A 1YRRA 4AXNA 1OSEA 1EEPA 3NXLA 3LCGA 3WX7A 4N9EA 1S2AA 3UJSA 2IW0A 4ZTXA 3MUAA 2A4AA 3CV7A 1KNWA 3SUVA 1UWIA 5AHNA 5JBFA 3OYZA 2QAFA 3VXGA 5C2CA 4WKAA 2BXZA 2Q09A 4M56A 1JULA 1F9CA 4Z42C 1F3EA 2VWSA 4W8BA 2G4JA 3M9YA 4HSOA 1XYAA 4PSPA 4AMCA 1K02A 1IV8A 2AMXA 3ZLFA 3NAVA 1UZDA 4UFJA 4P7OA 2WPGA 5LIWX 3WMSA 2DU2A 3VOIA 3UA3A 2UY4A 5CLWA 4AMAA 1J0YA 4I7UA 1D7KA 3S9ZA 1PHQA 2V5LA 4ZO9A 1V7AA 4HMNA 1DP0A 3G0UA 4O28A 3WLTA 1ZALA 1YTEA 3TTSA 2NWSA 3TYDA 4DZHA 3IUDA 3FGCB 1MEHA 1XF0A 3O6AA 3TYZA 1FX6A 1GYNA 2P3EA 2NXHA 3HTWA 3T44A 7CGTA 5HWMA 3UCQA 4H2CA 4CQCA 3BV4A 4HU0A 1DIEA 3EDKA 1NOFA 1FFQA 1B30A 4N0RA 3SJNA 1LQ2A 5CC5A 4QNWA 3A23A 2W0UA 3NSXA 5AC6A 3SRFA 4BF7A 4PL1A 1JCJA 3UU0A 4EP8C 5G1YA 1KM6A 2EAWA 3QYSA 3BE7A 3GDMA 5I3GA 4YYFA 3RITA 3DFOA 3UZXA 3PPFA 3VDBA 4FXRA 4IFKA 4R34A 4GYKA 3PZOA 2VT0A 4Z2GA 5A5WA 1HGYA 3WF2A 4D8LA 4A2SA 4EE9A 5FOOA 2DZVA 1WKFA 3Q37A 3BGAA 3SDOA 1NY1A 5LGZA 2PB1A 3SIMA 4L6HA 1ONEA 3TEVA 2W91A 1S46A 2BGNE 1Q66A 2D24A 4REQA 2EBNA 3WQVA 3TTOA 4D6FA 3GSMA 4ZE4A 1E4NA 4HOXA 3M0KA 1KGWA 4F40A 4YS1A 3WLQA 1UR1A 4PUEA 2V67A 3CL6A 1YX1A 1KRCC 1VRDA 4CU8A 1TE6A 4UQDA 2OMAA 2GLKA 5I78A 2V8ZA 5T8GA 2PDKA 4L1WA 2NZLA 2A21A 4HNOA 3V5FA 1H1YA 3T8LA 2O9OA 2Z00A 4JYEA 4AY8A 4JN8A 4I9AA 5BROA 4CCZA 1DL3A 3S5OA 3B06A 3WLPA 1XJBA 3NQGA 4H9UA 3W70A 1C9WA 4IG2A 2VCBA 2WANA 2AGKA 2VZVA 1HJXA 4NIRA 1S5NA 4PODA 2DH2A 3WN6A 3F1QA 4QQ3A 1DTNA 4JHOA 3E2SA 2X1UA 4PSRA 5LHEA 2E6DA 1LQAA 3L2MA 1K9TA 1E43A 1XQKA 3H23A 3DFHA 3UA4A 4KWUA 5HWNA 2ZZ5A 3CUGA 3WIJA 3UPMA 3BMVA 3CH0A 1EX5A 1KTNA 4Z2LA 5I06A 1H50A 1UP0A 1VYSX 3NPVA 4IP4A 3AQUA 1UD4A 5F1UA 1R38A 2Y24A 4JAWA 1VJZA 3WQOA 4L4MA 3VA8A 1HJUA 2Y5SA 3TC7A 1BTMA 4PA8A 1E51A 1PZ2A 4B91A 4DJDD 3URAA 3GIQA 1W1IE 4F79A 4GIAA 2V81A 2O9RA 5TNVA 2J7FA 3TXZA 1HP4A 2CBUA 3A12A 3UR7A 2YCLB 1BRLA 4LBUA 4US6A 4I3GA 2VX4A 3OZYA 1W3KA 1YDNA 3WLOA 4ACZA 1B4EA 4NYYA 3H2FA 1XBXA 2GGIA 3KBWA 3WJWA 5ABGA 4IHCA 2B4GA 1KW1A 1QOXA 3QMTA 4NG3A 3AWOA 4WK9A 2C1GA 2C79A 2O7SA 1CBGA 3IV3A 5FCZA 4QQUA 1WKDA 2PDFA 5CJMA 5FSEC 4PULA 2X2YA 4GMEA 3PZMA 4XTIA 4GKLA 3N2XA 4PB3A 4YVXA 5BZAA 3GO2A 1OF8A 1A5KC 1TR1A 1WXJA 4ZE5A 5LHFA 4HMCA 3S2JA 4PH6A 4FF5A 3VAVA 3UQNA 2WKJA 5EMMA 3W6LA 1JZ5A 3SQSA 3PTDA 2HISA 1SW0A 2R91A 2QCNA 2DZAA 1G7VA 3PBVA 5B80A 1CB2A 3WENA 1J0HA 4JCLA 1KWKA 2NLYA 3QFEA 3V35A 1W5MA 5FF2A 1AODA 4XD4A 4JZ5A 2ZCGA 1C7SA 1SFTA 1JRBA 4ATLA 3MJYA 4YPJA 2ZFAA 1HO1A 3VIIA 3V3WA 5A6BD 1LWHA 2I16A 3VOCA 3E0FA 1RVGA 3KZPA 1SR9A 3LBMA 4HQVA 1QNSA 4Z0JA 4QLLA 3CYVA 1OADA 4DI9A 2I5IA 1CT5A 3ANYA 1G0CA 3C86A 3KTCA 3BDKA 3PJWA 1CYGA 1KKRA 4JTUA 1W5OA 3H2MA 5AVNA 4L80A 4CD8A 4C6JA 4Q8WA 3T1GA 4US5D 1RV8A 4ECLA 1PV8A 3QW3A 3C8FA 3ZIZA 5M3WA 4IL0A 2E8YA 5C5YA 1J0IA 4GWEA 2RDWA 1J6PA 1TZZA 1QPQA 1BYDA 1HKMA 3SCTA 2WZMA 2ZDSA 1BVZA 4YTUA 4WLCA 3V16A 3NURA 1JD9A 4A3HA 3CQIA 3WBYA 5I7GA 5MHBA 4HIBA 2RDXA 3K46A 2GVEA 3UJFA 1U1UA 3E0VA 3HG2A 3B8TA 4O53A 4UOZA 4CUCA 1IEQA 9RUBA 2PZNA 3K4DA 2JF7A 2Z26A 2IPGA 5I07A 6REQB 4ZQMA 1FWSA 2CHNA 5DFAA 4R33A 2OOGA 1FUYA 3TH6A 1I75A 3E38A 4O54A 3L0KA 4O1EA 4IH3A 4XAYA 1EH9A 3PS7A 4UZSA 1JCNA 2CHOA 4QM1A 3TYBA 4JL1A 4O1BA 2PE4A 3GVVA 3DN5A 4PTXA 3T0BA 3NL6A 4QSFA 4C1NB 1X6UA 5A2BA 1LBMA 3WUBA 4UUIA 5CSUA 3RPMA 2CKRA 1T41A 2WVUA 1POKA 3ZQ9A 3LCFA 4FNUA 2V30A 3BWWA 3LD5A 3EPNA 4MWAA 3VX1A 4NAEA 3ITLA 1ICQA 1UCWA 1LL4A 4HZMA 2BOEX 2TRSA 1RCQA 3THCA 1TV2A 2TAAA 3NZQA 4MJ2A 5HPOA 1TPDA 3P8JA 1UD2A 4HCDA 4DAFA 2Z1VA 4LXFA 4OOUA 1VF8A 2J74A 2XFRA 1I2OA 4HD5A 2OZ8A 3NDOA 3ZO9A 1ZBKA 3L67A 1GOOA 4DF0A 2I56A 4YMZA 3OO2A 1M03A 3LLDA 3GWQA 3IJDA 1CGWA 2PTZA 2Z0IA 5LA1A 1OD8A 3WD2A 1YDVA 1K77A 1YYAA 1C8QA 3WQPA 2CCRA 5HBFA 1OEPA 1OG6A 5AHMA 1QNVA 3NZ1A 2IPWA 1S5WA 3EX1A 5D02A 1VBHA 1X7FA 3UWEA 4NX5A 2NQLA 4NZJA 5G4WA 1LT8A 1M04A 4G8TA 1VFLA 2D1ZA 4J3VA 4MNMA 4X61A 5ECUA 1P0DA 2WPBA 2Z1KA 1H7WA 3WLSA 4YHEA 1SZNA 1AQHA 2YL8A 3M41A 4WY0B 1XD0A 3QKZA 3OBAA 3OU8A 1NF7A 1ELSA 4GVIA 2VRKA 5AYBA 4F0LA 3Q2DA 5FEWA 3N3MA 5C71A 3MP4A 1QJWA 2QCMA 4EANA 4ZR8A 3PPGA 4JICA 4E2VA 1EUAA 2B7NA 4IGMA 5M17A 5F7UA 5EFDA 5HMSA 1CXFA 1JPDX 3SBFA 3PG8A 3P93A 2ZE0A 4OJYA 1U22A 1UWQA 1W1B1 2ISSA 1EOMA 2XIJA 3PULA 4QJ5B 2F38A 2A3HA 3H26A 3QTGA 2HXUA 3FYPA 3NQ7A 5A6TC 3L12A 2QIWA 2OCZA 2DIJA 1JDDA 1QHPA 4RZ5A 5A2AA 1CLKA 3DERA 4MLJA 1XGDA 1QRQA 4XZLX 1UKSA 1ZSXA 2BXVA 4QG9A 2ZWZA 3QMRA 3F4NA 1XLIA 2OWCA 3GM8A 3HGJA 4DBDA 2YDSA 2OGYA 4R53A 3H7RA 2VEKA 1CI1A 4GZEA 2QCCA 3LNPA 3CZLA 4KQNA 1Q6RA 5A1AA 1M7PA 1ADSA 2XSXA 3CHVA 1CXEA 5SWUA 2GPTA 1PKYA 4F0KA 3BH4A 5HJXA 5HNTA 3WCZA 1D8CA 5LIKX 1IXQA 3M5ZA 3W38A 4HNVA 2DGAA 5HMEA 5HAOA 2QUTA 2HTMA 1XLHA 1G7UA 3TOPA 4J9JA 4ACYA 4Z2IA 5KZDA 1TVLA 5DRIA 3M0MA 1K1DA 2XZ7A 1XXXA 4BI7A 3NIYA 1WAUA 3WG6A 1EXPA 5DT5A 4U31A 3VCCA 4M81A 5AHIA 4DQWA 2D73A 1HL2A 1EHAA 2V2HA 3M4HA 2FDSA 4GABA 1AK5A 1WKEA 4KERA 1XRFA 5T9BG 3K4WA 1BGGA 1QDSA 3VGEA 1FH9A 2ZZ3A 3TP4A 3NDZA 2OLAA 3ARRA 3NPWA 1SGJA 3DU0A 3QC3A 3FSTA 1WA3A 3NSNA 4FXJA 4KW2A 5DANA 3EEGA 3WF1A 2OO0A 3LK6A 3KRSA 2REQA 3CUIA 3AXXA 2ZZ2A 4MPQA 4GYJA 2QCDB 1V77A 3CZ8A 4AD2A 1OB0A 3LMZA 1L2QA 1NIUA 3MY9A 4PZVA 3MYPA 1FKWA 4R3UA 1GVRA 3LRMA 2E40A 3SCWA 4DM2A 3W6YA 4Y9AA 3ATZA 2VR2A 1LORA 3W83A 4GBUA 2G3IA 3CIXA 4LRTA 4IIBA 2VHLA 4OKDA 2F2KA 4RV8A 1FWFC 3W2KA 3K5XA 4YLWA 2J7GA 1JEZA 5GJMA 3P61A 2YXXA 1FWEC 3VIOA 2GGJA 4IICA 1WP6A 3RIKA 1NF0A 1W31A 4KFPA 4RUBA 5IHSA 8RUCA 4GLEA 2ISWA 1OC6A 4NNAA 2IQDA 1XV8A 2CWXA 2YB4A 4Z2KA 1FWBC 3IJ8A 1E1CB 3T4CA 1K8YA 4JN6A 2HMCA 3BUVA 1P0NA 4JY8A 5IRPA 1CXLA 1PL9A 2HROA 2E5BA 4B5TA 5DBTA 1NAL1 1GVQA 5EU9A 3C5QA 4AU0A 2PSNA 5D9MA 1A3HA 1EA0A 3VILA 1QNRA 3KE0A 4NJIA 3BMXA 1W1VA 4H7VA 3E02A 3THDA 3OZMA 2A3EA 1X8FA 3CIVA 4FZIA 4RZ4A 1OFOA 2W63A 5J04A 4LUJA 3TFXA 1LRQA 2R6OA 3UETA 1EWDA 3AIVA 3LGDA 3HB9A 4ZOAA 2A3CA 3MSDA 3SI9A 1UMYA 2HDJA 2GDQA 3KCOA 4XZHA 3WBWA 4TVDA 3BW4A 5BYWA 2PBGA 3TW7A 1S3TC 3URNA 1DHPA 4RCXA 3DYMA 4XKYA 4PBGA 3TROA 2BX7A 1HNYA 4DO5A 3MDUA 4QAIA 3BQ5A 6CGTA 1ALDA 4JQAA 1TV3A 4B9ZA 1J10A 3CB8A 4C6IA 4DLFA 3TFCA 4ZXOA 4C6KA 2XIBA 1Q45A 1E1EA 5F2GA 2QCEA 3B8VA 3BCJA 1IR2A 4MVAA 2PWFA 3B8IA 4LYQA 2RAGA 4UQBA 3RMJA 4LRSA 4UQAA 1ONXA 5M1TA 3PF3A 3LTPA 3MS8A 4AIBA 3RCMA 4LVGA 5CH9A 5FJTA 5AC8A 1M68A 2XIIA 5TQLA 3RHGA 4WQ6A 1FWJC 3N25A 3VOHA 2Z4GA 3WDRA 3UG8A 3ME3A 1R85A 1DJQA 1PTDA 3OBKA 2OODA 5AYYA 2I14A 3EB2A 4TMBA 2PTDA 4AC7C 4NT0A 4Y9OA 3CZEA 2O9TA 4GOAA 4PEEA 3TR9A 3EWXA 2ZTKA 3W7DA 3GVWA 3BAJA 4C6FA 2WK2A 1W9VA 3W74A 4B9YA 3LN3A 3USBA 2QJIA 1TWSA 3VUSA 5HANA 3A4JA 2IKGA 3L21A 3RCNA 2GVYA 2R1PA 1I0DA 2XTKA 4FB7A 1CDGA 2E5CA 1GOQA 1SMAA 4O8RA 5JU6A 3CGTA 4EPKA 5DY2A 1Z3NA 3K8MA 3F7JA 2BS9A 1XR2A 3VGGA 4YNGA 5REQB 1KCXA 4QHRA 3G3MA 3BCFA 5FKYA 4DZAA 1GORA 2GJLA 5EBUA 5DELA 5HDRA 4JTDA 4UOJA 3C8NA 4UBPC 1SYTA 3V1HA 2PDCA 3DG7A 1S5MA 3HPFA 3ZR6A 1C7TA 5A6SA 4ML9A 1EZ2A 3S2MA 3GYEA 3W22A 4LC6A 1SJCA 3NQBA 3TAKA 4JN7A 3MHUA 3BZJA 3H12A 3PN8A 3OYXA 1EBGA 4DJEC 4ROPA 1OFAA 2X7WA 4TV5A 3DECA 3BZGA 4LTSA 3RG6A 4XV0A 1RPKA 1KFLA 1D2KA 3NTYA 4DO7A 2XFFA 5D04C 1KXHA 1E6SM 2WC4A 1QBBA 1TA3B 1UG6A 1KFEA 4FP1A 4KF1A 4G1NA 4R7WA 3EX6A 4H4IA 1W9BM 3GHTA 2NV2A 2WNZA 2WZTA 3BPWA 3ZJ8A 3VNYA 1XLGA 3G1XA 4YTQA 3RU8X 2GWGA 2P8CA 1DYSA 1WB0A 4N9DA 2YCIX 3TWBA 4S2CA 3OVRA 4QEEA 1XYCA 5A94A 3WJZA 2HVNA 5H91A 3M6DA 4LAMA 3TTQA 1VQTA 3UWQA 3LG3A 2DSVA 5I02A 4HN8A 3WZ0E 1OHLA 2ZXBA 1F3TA 4N42A 1GW9A 1V6WA 1CIUA 1XYFA 2GSJA 4FNSA 4JFUA 4BEQA 5E70A 6PTDA 1IZKA 4JNMA 1O5RA 4JFWA 3FVMA 3T9PA 4UQ9A 2EG6A 1X98A 1BXNA 2VEFA 5EB8A 4GUJA 1UJPA 1NEYA 2WMFA 2DH3A 4RNFA 2B7PA 1XIIA 5LIYX 2EPHA 3BSGA 1XHGA 1OF6A 2WAGA 5EMUA 3H21A 4H9YA 4G7EB 4O17A 4XBKA 4FOUA 4INFA 1A4MA 4S38A 1GQNA 1M01A 4DJEA 4J1OA 3QEZA 5ABFB 2V3EA 1WDWA 1QPRA 2GQAA 3PR2A 4LS1A 1B3WA 1Z69A 4MJZA 7TAAA 5LSMA 2PWHA 2Z1WA 2DSKA 2Y88A 1LLZA 2VRQA 3LB0A 1W3TA 3UGVA 4JTEA 2E7FA 5AECA 2FGZA 1CEOA 4QCFA 3ZLHA 1CENA 4L4OA 4O15A 1MSSA 2OFJA 2J9ZA 3EMQA 3MT1A 1UOKA 3PANA 4FX7A 1EIBA 3ITYA 3LZ3A 3VOFA 1UB3A 2E68A 2WZEA 3HFYA 1FBAA 1ICSA 3SY8A 3IAQA 1SW7A 1XCWA 3GTFA 3G0XA 1DWGM 1R3QA 3ARWA 3I3BA 1HN1A 2WHKA 4GYPC 2WQDA 4ATDA 4IMFA 3CAVA 1QMLA 4G7FA 1C8VA 3RM9A 2QUUA 2WJDA 3V1PA 3QY7A 2QUMA 1P1MA 1YTDA 3W2LA 3RAOA 4MKNA 1LOQA 4M82A 4QFUA 3UPWA 3WFAA 2HBVA 1VBUA 1XIDA 1ZGDA 1QI4A 3R13A 1GOWA 1R3TA 2PLJA 1XKYA 1EJUC 4FSAA 1U5HA 1UR2A 4AW7A 4PUDA 1V3HA 2VFHA 3BLOA 5FSDC 3QV9A 3LI1A 1FP9A 8XIMA 1YPIA 2P88A 3R8HA 3CLWA 1Q6GA 3OGSA 2RGMA 3CB3A 2Y85A 1S2VA 8XIAA 2BOGX 3WQWA 2DSWA 4IPNB 3TJ4A 4M6UA 4ZCWA 4BA0A 1P5BA 3FX4A 5FF3A 4C6OA 1FHVA 1V8EA 4H19A 2J7EA 3B0YA 2ZRUA 5HR7A 4ZBCA 3U7VA 1LTDA 4MOZA 3GW0A 1VEMA 4DN1A 3TAOA 2P5NA 5FAJA 4EWND 2JEPA 4LALA 3D47A 3IJIA 4CKQA 1RH9A 3FHAA 3QV8A 1OINA 1U1JA 3LZ5A 1GYLA 2C8NA 3S6TA 3MHFA 4CD6A 3GVQA 2MUCA 4IL2A 1BYAA 1BF2A 2GYIA 2PDJA 1QNQA 1CNVA 3AUJA 3PBYA 4GYPA 2WLZA 1X8CA 3KLLA 2VP8A 4Q8OA 1ZJIA 1KBKA 1TWIA 1I4NA 3TW6A 4GNKB 1GJUA 4O57A 4H6KA 4HOZA 1UA7A 3PJXA 3ES8A 2IPJA 3KOWA 1V6YA 4GPNA 4IJCA 1PZ1A 5HPCA 2OGJA 4I9MA 1TYGA 3B40A 5FIPA 3W72A 1UZ1A 1PXGA 3CWOX 3N15A 4MUPA 4BZYA 2G4FA 1ADOA 1EJRC 3QGAC 4QJ3B 4PUMA 4A8NA 1O5XA 1F74A 4C6LA 2J88A 3V4BA 3ARYA 1KR1A 1QPKA 1B0IA 2J7DA 2VELA 2QJHA 4F8XA 1TPC1 1EJVC 1OX4B 1E70M 4M19A 1W9PA 2QKFA 4GHRA 4LVFA 4MMWA 4QJ4B 3WEZA 1TMQA 2C15A 3UY7A 2DUZA 4LX4A 4ZO7A 1B3XA 3TYEA 3WO8A 4GFSA 2VEIA 2G3MA 2J75A 3QKEA 3BJFA 1CGTA 2VRJA 3ZWSA 2ZUSA 2PLKA 4MZ1A 5B7YA 2YYTA 1M6JA 3PWAA 4P7NA 2J78A 1ODZA 1TWZA 4S3CA 4B5UA 4FX8A 5E9XA 2PWEA 1XCFA 4IXHA 4S3KA 2EKCA 4D6IA 4RZ6A 4EXQA 1C9DA 4MSSA 2V63A 1NDYA 1B54A 1FXQA 1S3HA 2X09A 3STGA 1JZ4A 5DX7A 2ZRZA 3HGRA 1MRAA 2RJGA 2VVSA 4E2DA 2QR6A 1ODUA 4A4AA 5BOEA 1EJSC 1ZAIA 3AHVA 5LNSA 1P6BA 3W01A 4W85A 1A5SA 4JFVA 3ZT5A 3AALA 3TXVA 1VCVA 2OB3A 4XAGA 4HU4A 1TX2A 1GOKA 4UTMA 3EKZA 4DB7A 4UMAA 1QO2A 2W9MA 2PDGA 5EMLA 5FJOA 4EAMA 4NJHA 1MQRA 2YYUA 4WDUA 1MFVA 2E77A 4MY1A 4LU0A 4NNBA 4WSHA 3VDGA 2W92A 2YA2A 2YOCA 5CPTA 3ARSA 3QY8A 2AKZA 4PEKA 2X8RA 3QGVA 1UR9A 1EGMA 5D4YA 3NQEA 5DMLA 4HPNA 3M5VA 1VCGA 3PFRA 4NRRA 1I0BA 1A3XA 1K8CA 4HK6A 4PGLA 5TAOA 3KHDA 5D9NA 3SCRA 3S83A 3ITCA 4JTFA 4MB4A 4H6QA 1ZZMA 1H7XA 1QI5A 4MZ8A 2CBVA 3M0VA 2ZRXA 3L66A 3DFSA 3T40A 4N4QA 4JDBA 5AB3A 4NJGA 5CBIA 1W6TA 4GRSA 1A3WA 2FDMA 3FW6A 5I09A 3PUEA 5G1MA 4AIEA 1O68A 3FJ4A 3GAKA 1EYWA 4N6EA 4GIRA 1QU4A 1QR7A 1ZS2A 3UG5A 1XLLA 1JGMA 4I5UA 5BRBA 3W7EA 2WWCA 3VZZA 5AYZA 1MYRA 5ECVA 3HPAA 2TYSA 4EOUA 5DCDA 2GQ8A 2V6AA 2F9RA 3NYZA 3WNNA 4Z1CA 1QVBA 3I6EA 3BLKA 1ZFJA 4MKSA 2BHYA 2F7FA 1V93A 1HUVA 4UOQA 5AYXA 1B9ZA 3WUEA 3VTRA 4Q4SA 3I10A 4MUZA 2QMKA 3KWSA 1JNEA 3WJXA 4L6DA 1SZEA 2FHFA 1UWRA 4MWAE 4GJ1A 3PPCA 1EDTA 3EOOA 4ZOCA 4W93A 4KCTA 3TJLA 5JXQA 3O7UA 4RZBA 2D3LA 2BVYA 1DXEA 3NVTA 1KFBA 1UUQA 3BTNA 1YNYA 3TK7A 3FDKA 1MXSA 1BXCA 3QBUA 4K2SA 1J8VA 4R85A 3U57A 5CSRA 4RPPA 1IIGA 1MW2A 3LNMA 4HZ6A 4E5TA 3APGA 3T0AA 4WDWA 2V5KA 4JR5A 4LAKA 3A3XA 4YJ5A 2DZPA 3XIMA 4AZ7A 2ACQA 3UBPC 2QV4A 3OA5A 4QDMA 1XIHA 2OQLA 2BZNA 3EB4A 5CEWA 1UC5A 4OQVA 1MDRA 3NGFA 5T9CE 3IARA 1NFPA 1WZLA 3CPGA 4JTIA 4L6OA 1J11A 4C6MA 3W25A 2QQ6A 1OFRA 4I9TA 3U4AA 1T8XA 1NP0A 4D8ZA 5D9OA 2Z2UA 4EXBA 1KLZA 4LV4A 3NEHA 3W7QA 1AZ1A 4LWWA 3WH9A 2PDBA 2V68A 1US2A 2HNHA 3NGJA 2UY2A 1F3WA 2XHYA 1XRTA 5AZ0A 3WD4A 4NHVA 1ISZA 1QXLA 1TWWA 5FD0A 4DPQA 1DEDA 5U4NA 3WDIA 2CZFA 5AYIA 1PSCA 3EMCA 3KLKA 3TR2A 5AZ1A 3MSYA 2WVSA 4WY0F 3QOMA 4E8DA 1Q6OA 2WNWA 4RE0A 2R94A 2WCSA 1QO5A 1TPH1 2GOUA 1KM2A 4V2XA 4UR8A 1WYIA 4O14A 4XISA 1OYBA 3WQ8A 2Z7KA 4EVZA 2OTDA 3LOTA 1HX0A 2ON3A 4UFMA 1BXBA 3CEUA 4EXAA 3P81A 4DNMA 3NJ3A 3CO4A 3WH8A 2QXWA 3MI3A 3W1UA 3WK3A 1P0KA 5CZ0A 4KRUA 5CSSA 3VNLA 1T8QA 1PIGA 3ISIX 3FAWA 4MIMA 4PMRA 4MM1A 3VABA 3FJNA 1CLVA 4DUVA 3UR2A 3EB3A 2G3FA 4DBWA 1KBBA 3TQ0A 2EF9A 3MJMA 2QVNA 4UTWA 2ZUNA 1DWFM 1C91A 4U10A 2WKLA 4FLOA 1PEZA 3W3OA 4S23A 4X0NA 4NZ4A 4M7SA 2OT0A 2PDQA 3A21A 1UROA 3GHSA 4PFMA 4N2YA 4E38A 1YXYA 4X9YA 3NNTA 4GI6A 4NY2A 1JXJA 1Z7AA 3ELFA 4NILA 4LUTA 4CNPA 4AC1X 3LGGA 3MW7A 4IFKB 3UWVA 3S0CA 1WNOA 1SUXA 2XFYA 4FEZA 1LP6A 4A05A 2QF8A 1JNDA 1FRBA 4NX0A 1ZCOA 4XSMA 4F2TA 4LNYA 3VD4A 5G2WA 3QW4B 2EKGA 4REQB 1CGXA 4O16A 1LBFA 1IIHA 3EWBX 2QCDA 5K7JA 2DV0A 3H2AA 1UWTA 2VDGA 2PC4A 3KW3A 2Y61A 4H41A 4BI5A 3W81A 3BLFA 1WOBA 4O0KA 3UWYA 1SZRA 3ANUA 1H1ZA 4NZCA 1DWHM 1W3NA 1O94A 4XZMX 2Z25A 4IPPA 4KMQA 3ZVHA 4LYKA 5D2XA 1MNSA 3T42A 4C7GA 5IDZA 4M29A 3NQVA 5A8GA 2V38A 1LF1A 4UC5A 4FAMA 3IGUA 4I5RA 1NM9A 2J6XA 3F5KA 3KAOA 3F2CA 4X63A 3FLUA 2CLEA 1O60A 4IG2B 1VPQA 2IQTA 3KS5A 7XIMA 1E9YB 2FB3A 1XLBA 2DZUA 1B3YA 2W4XA 1IF2A 1E3XA 1W3IA 1RAKA 1H4PA 1JD7A 1ZCCA 4W87A 4JDYA 3FNDA 1NH6A 4XVEA 1O5KA 1A53A 1DHKA 3DHFA 2Z1SA 3EXRA 3DIPA 3WK0A 4HK7A 3Q58A 4PUNA 4ZFMA 1PBGA 2V3DA 3PB2A 1JFHA 3W26A 4B3KA 4DEFA 1K6AA 1A5MC 1R3VA 2NX1A 4GZJA 4IP5A 2BMBA 2Y70A 2E9BA 2R9RA 4EKJA 2GDUA 4Q4QA 2QGHA 3HQOA 3CUJA 2X42A 1K70A 4F66A 2A5HA 1PDZA 1TPWA 3B3DA 3PSWA 1V0LA 4S2BA 2FHBA 2VOTA 3RRXA 4M3PA 1IWBA 2GQ3A 1TTIA 1SZGA 1UKTA 3ABRA 2PRLA 1VFMA 2AGTA 1UIPA 3AYTA 3UEQA 4XX6A 5LNRA 1EGZA 1JDFA 2PWUA 1BRLB 2BASA 1QOPA 3EGJA 1XIGA 4JIEA 1J9YA 3UYCA 3GC4A 4UCFA 4ADTA 3RLHA 4CD4A 3QMSA 4A2RA 4X3ZA 1BWKA 4GUIA 3G77A 2GJPA 2OX4A 1ITXA 1F76A 2UBPC 4GY7A 2WZHA 1K9FA 3DYOA 1XRSA 3A9BA 1BYCA 1KFCA 1UR8A 3I3EA 3TN6A 3DKJA 3AIQA 3RPTA 1XSJA 3W02A 1JPKA 4OBRA 3WH7A 4DPPA 4GXWA 3ABOA 5A6BA 1FWNA 2FVMA 3AHYA 5JBEA 1M7OA 1XFCA 3TA6A 1EPVA 2PGRA 4GGHA 1UYQA 5F4WA 3S1WA 1KFJA 3KL5A 4RDZA 1PVNA 2P50A 3ARQA 4ZQRA 1JCYA 5HJLA 4H3DA 4JY9A 3LCLA 3MSRA 3KBJA 3HZ3A 1PIFA 4LF2A 1H7NA 3W7CA 5ABTA 4WOQA 4A29A 4M51A 4M80A 3DFPA 2JEQA 3CPRA 3FYOA 2E1DA 4XBSA 4P61A 3M44A 2X16A 1F3XA 1DOSA 4JTQA 4QEHA 3C6CA 4IGNA 1RA5A 1ZU8A 3IJLA 3T78A 1EP2A 3B4YA 2XUCA 3IIZA 5K9DA 3CZJA 3AXIA 2WM0A 4U2ZA 1JZ6A 2PMQA 4X0VA 4QSHA 2P0OA 4UNIA 4H01A 4DF2A 4DLMA 1I8JA 1LDCA 3UP8A 5F2LA 3VMOA 2WC7A 3PBUA 1JPIA 1PCKA 2HWGA 2WVVA 3L2LA 3QPEA 1XKJA 4UTJA 3SUUA 3OLGA 4HTYA 4QRNA 3PWIA 3HMCA 3N13A 1JPHA 5D33A 3E12A 2FIQA 4UR9A 1ADDA 2ZADA 3FA5A 1KQZA 2ZXAA 2QPUA 5BXTA 1KKOA 3AZRA 4PRRA 3R6IA 2BP1A 4YXGA 1S2TA 2YIHA 4MAVA 1LLOA 3AYRA 4MAZA 5BWFA 3E2VA 1Y5VA 1R0MA 5FEPA 4TX8A 2I5GA 5HOSA 1PX4A 1H7OA 2QJNA 3MBDA 2GGGA 4DHGA 5I3KA 1T40A 3CMJA 2JK2A 3QY6A 2P8BA 1US0A 3TONA 4A35A 4F2UA 1JF6A 3GZAA 1WQ5A 4XUGA 1AJ2A 1IT0A 3I3DA 4Y90A 5I5RA 1XSIA 2Z28A 2VL4A 4X22A 1XYBA 1PCWA 4TTGA 4Z1AA 1EQCA 3TLQA 1J5TA 1L0PA 1JCXA 2OYMA 4HHHA 1VB9A 1JIBA 1NU5A 3W2JA 4J35A 4XK2A 1K7FA 4H1ZA 1VEPA 1XYZA 1QK0A 3OB8A 3QQWA 4AVNA 4PUJA 3AZSA 3VM7A 5HNUA 2C3ZA 4XB3A 2BY0A 3WBEA 3LERA 1TTPA 3OVGA 3DGRA 3QM3A 4QDWA 4XO7A 4C7DA 4F0RA 3WJYA 4JIRA 1RSCA 1E0XA 1CXIA 3H2NA 1MW1A 4X2RA 1M1BA 4EPDC 9XIMA 5DO8A 3CK5A 4QX4A 4NAEB 2DIKA 3VKDA 2RHGA 3PUOA 3P84A 3AIBA 5ABEA 3B9NA 4I5XA 2TMDA 5K4ZA 3V5CA 5HA7A 1QNOA 1TO3A 1VIWA 4B4FA 1CGUA 4XZNX 4Y9MA 3IJ7A 3LI0A 1O6IA 2INZA 4S3GA 1XLDA 1EC8A 4GZIA 3GXIA 3LTYA 2VURA 2XIOA 3A13A 4OUEA 4DO6A 1GEHA 5M5DA 1PB0A 3RR1A 1PS9A 1WZKA 3WQ5A 1EBHA 4GNJA 3SSJA 1E9LA 4V33A 2V2CA 4IX0A 5CXPA 1G5AA 2Q8XA 2X7VA 2B31A 1YADA 3LSCA 1R9YA 4P2VA 1WCGA 3T8QA 3GIYA 4GO9A 4TX6A 3CEPA 2C16A 1AG1O 4IWWA 3W1PA 5FF7A 3VIMA 4DJED 4MNLA 1R9ZA 4CN1A 1BLIA 2XIQA 5CPMA 2YFOA 3DC0A 4UFIA 4JX6A 1RXOB 4LF1A 2RH9A 4Q4MA 1BYBA 1KTBA 1S2WA 4L65A 2A6LA 3NL5A 1XQLA 3SECA 5I6SA 2NX9A 3GXMA 4ZQOA 3M6YA 1VPXA 4G1KA 2FFCA 1OX6A 1J01A 1FDJA 3H6OA 5CPQA 3VFLA 1CCWB 1TJRA 2YXOA 3L0NA 1EPXA 1KM0A 3E2RA 4FI4A 1AD1A 3BG3A 5CGMA 1AMKA 2O0TA 2BVWA 1DIDA 1E15A 3FEMA 3KL0A 1VGAA 4GUGA 3KOXA 2PEVA 3H24A 4JKKA 1IHIA 4U3CA 3JUGA 4A6GA 3AWNA 1VRXA 2J8FA 5GQBA 4ZENA 2CU0A 2Q71A 1A5BA 4IFRA 2DUXA 3J7HA 1JJKA 3MSGA 1PKLA 4JIQA 4ATWA 5CC6A 4K8GA 1GPWA 1HF6A 4OV4A 3AIEA 3HM7A 5HMDA 4RJEA 2V82A 4QISA 2EO7A 3QVQA 4IISA 3WNMA 4DBSA 1G4PA 2ZOXA 3GC2A 2YGYA 3BMWA 3AYSA 3T7VA 2WVTA 1H5VA 2CERA 1SPQA 2QCLA 2X0HA 3S2NA 4R88A 2YR1A 4C6DA 4E2BA 1JL8A 3T0DA 3MCNA 2HQAA 3O07A 3MC5A 1UZHA 4MNKA 4JKLA 4CN4A 3BAIA 1EF2A 1OK4A 4ICNA 3FKRA 4MYAA 2FZ9A 2QDDA 5EY5A 1VYRA 3LHUA 1ZL1A 3UWZA 3VNJA 3VKJA 3JS3A 8TIMA 3L4YA 2Y5JA 1H51A 3XINA 3DG3A 2GVGA 3G1VA 3QJAA 2YSWA 3UZYA 4KS0A 2DY3A 1B2YA 4QROA 3AROA 4MPKA 1BAGA 1XDMA 3B8WA 1XPGA 3E0WA 1DWIM 3HQNA 1TPVA 2J6VA 3VGFA 4JX5A 1IEWA 4LUYA 3AU2A 4GI9A 2OOFA 2GSHA 2R1NA 5HWJA 1C92A 3GS6A 3IV8A 5CBJA 4GUFA 2Z1BA 3TIMA 2PPGA 3VZYA 3YPIA 4JIIX 2VR5A 4GE8A 4LS2A 3GR7A 1R47A 3WF0A 4JEQA 1GPFA 2Y4SA 5C9WA 3S1UA 1IZJA 2CWNA 1E55A 3HIJA 2HPIA 4DIAA 5KZ6A 2FJUB 3UY8A 2B81A 2PBOA 1QATA 3RX4A 1J93A 4K37A 3ONCA 2AMGA 2Z2AA 3C2RA 4OFCA 1XX1A 4S3EA 5DRCA 3N2OA 2PP3A 2W79A 2ISFA 1Z48A 3H54A 1FWWA 3T05A 2X2GA 1JZ3A 2WJFA 2XINA 4B2DA 4B3ZA 3CM4A 2QCHA 1OYCA 3IJ6A 4B90A 4CU7A 4DY1A 9CGTA 1H60A 2EPNA 2EJAA 3G2GA 3EX2A 1UD6A 3A5FA 2ZUVA 2GQ9A 3CBWA 2XGIA 1J18A 2RDTA 2R82A 3M43A 3CAKA 2OX1A 3NQDA 5AHEA 4Q8UA 2OU4A 4M6PA 4B92A 2ZQ0A 4WF7A 1JDCA 3U3HA 1R2SA 1GOXA 1EJ7L 3UCDA 1G4TA 2GDVA 3H7UA 1RZMA 1P1XA 2YL6A 3W0KA 4R27A 1RD6A 4OTKA 1DPMA 3BL3A 5IDIA 3WLMA 4ZQPA 3I6RA 2F8QA 1RA0A 4RDVA 3ZT7A 4DM1A 2UZ9A 2ZUWA 3MPGA 3IJ9A 1BSLA 4N7QA 1UPPA 1V3KA 3FDGA 1EKOA 4UTTC 1SO4A 5FF0A 1W1A1 1I2NA 3F4WA 1KD0A 4UTHA 1GUVA 5GNZA 3IJQA 1DJWA 4CLMA 3REQA 5I77A 3IAPA 3G1HA 1UBPC 2FGBA 4AVOA 2PUZA 3NZRA 3LCHA 5CZJA 3R94A 4Q7IA 3SGZA 1KM3A 5GJNA 4IQJA 3GDLA 2PS2A 3CUFA 4AIOA 1RCXB 4LS0A 3KZSA 2WMHA 3WMBA 3PZNA 1DBTA 1IT8A 1K7EA 4HZ8A 4HNLA 3W71A 2VVNA 3CQHA 4IIDA 2WWDA 4GFIA 3SUSA 1X38A 4YTRA 4JYFA 1VAHA 3NPXA 4MB5A 1BGAA 3NQMA 3KVKA 4DUWA 4G6CA 1OG0A 1U5JA 2VDIA 3EMZA 3UXDA 3QQ0A 2ZUMA 5CBBA 2ZUTA 2C18A 2ZWYA 3VIHA 4QDPA 4JHMA 1OABA 1H3GA 3GNPA 1T5AA 1XP3A 3BLDA 4H8HA 1LCOA 2GK1A 2E6YA 3R58A 4EWJA 1Q85A 4QGCA 2POTA 4WSKA 1Q4WA 4K7VA 3PVFA 4J3SA 4RPQA 2JKPA 1P6WA 1HT6A 1V79A 2ACSA 3DENA 1RP9A 4J5NA 1EHNA 5IBXC 2IS7A 3W2MA 4Y2WA 2HK1A 2A85A 4GXPA 4IGSA 3ZSTA 4XKMA 3EYPA 3W1TA 3BG5A 2E6AA 4CD7A 2VKZG 3TU9A 1LOSA 3VUPA 5J5DA 5AVHA 2OKTA 3PZ9A 4JYDA 4UTLA 1S1PA 2WB5A 5B7ZA 2J7BA 4DJFC 4PTMA 2VX7A 4HT3A 4QS5A 1XIJA 3OIHA 3S6OA 4YCPA 4A8IA 5A3HA 2E4TA 2W61A 2V3FA 4MJMA 3UXAA 1VBRA 4IF2A 1K03A 3OZOA 4XD6A 1LL6A 3UJRA 1Y8BA 4LB3A 3H4WA 4RXFA 1NARA 4KRZA 3W7IA 1UC4A 4C1KA 3O1NA 5I3FA 3VZXA 1W8SA 4PRWA 2PCEA 2VJXA 3BCDA 1Z41A 3TWAA 1JXKA 1CB7B 3GNOA 1WUFA 1WDDA 3JRKA 1G67A 4PCPA 3W23A 5CLTA 4FNPA 3T2PA 4FOJA 2VEMA 4YWSA 5F1VA 1JYNA 5H1WA 1U1HA 4Q4OA 4D6JA 4DNHA 4L61A 4A8LA 1ECEA 1KQYA 3GTNA 4HA4A 3SCVA 8A3HA 3IRSA 1XISA 3ES7A 4Q33A 2FFIA 2DSZA 1GQJA 4RE3A 3QR0A 3GG1A 5CC7A 1Q2SA 4K6AA 3KP0A 2F84A 3M5YA 3KVJA 3OHMB 3PTMA 1H0IA 5I2UA 3VIKA 1RD5A 2NQJA 5IBXA 1NFGA 4HYVA 2IMRA 4ERIA 4GY0A 4UXDA 4PE8A 4CVWA 3WLKX 1OX5A 3TJXA 3II1A 4QE4A 3WH6A 1Q7ZA 1HJVA 4XWUA 1Q8JA 3UVAA 5DXYA 5BXPA 5KZEA 2BNJA 3C3NA 4DJFA 3P74A 4GQRA 1P0EA 3P5ZA 2VQUA 4JNYA 4AD4A 5FL1A 4YVVA 3P3BA 1L6FA 2ZRVA 3OA3A 3KTXA 4YU1A 3MUIA 1B5TA 3TYUA 3K4AA 3W73A 5EYWA 4UTIA 1UH2A 2PDXA 5F4SA 4CNOA 2CETA 3U9IA 4Z17A 1ISYA 3LHTA 3QTPA 5CZTA 1BD0A 1WX0A 1GG1A 2VMFA 3GTHA 2NXIA 4OV9A 4P8XA 2A1YA 4S3BA 4RDWA 3RGTA 5CSYA 2XWDA 3VIFA 2CXEA 2MANA 3MCMA 5D32A 4D6GA 1S2CA 4KESA 3S5SA 1YBQA 3W1RA 5HXMA 1VHCA 3PG9A 3TQVA 3WF3A 3EAUA 1JGIA 3LPGA 3W4RA 4GGBA 1DJIA 1CECA 1P6CA 4GI4A 3SAZA 1JZ2A 1I9CB 1LT7A 4JOMA 2EXOA 4YVPA 5DMNA 2VGGA 5CCZA 4ADUA 3SGUA 3N73A 3ID7A 1FHUA 4JKMA 3N9RA 3GE7A 2VUYA 3CUXA 2CZVA 1IR1A 1EO7A 2DZBA 5DCEA 4Z2HA 2FPYA 1DVJA 2FLIA 4BQ2A 4QXIA 4S3JA 3W86A 2VYOA 4TVCA 3N1AA 1Y5WA 4D1IA 4J4KA 1DWAM 1BWVA 3R8GA 3KCLA 3AU6A 5CJNA 2PU0A 4HJFA 1BVWA 5KEZA 4HNCA 4I6VA 3HF3A 5BOOA 3GX9A 1WV2A 1BKHA 4FPSA 2QJJA 3ZXWA 3NEVA 2YZ5A 4IMGA 4S3DA 5EA9A 2I7GA 4PMUA 4A8RA 1F61A 1RBLA 2EGZA 4NZ5A 4PC8A 1RVKA 1Q6LA 1K6WA 4GQ0A 3AICA 4ZODA 1XC4A 1GG0A 3LCXA 1ZTVA 2YLAA 3JR2A 5GJPA 1CXHA 3WNKA 3NOEA 4NZFA 1JF5A 4F9DA 4K8HA 1XBZA 3NQ6A 4Z08A 1JI1A 1RY8A 3EOSA 1GJPA 1GVSA 3SSZA 1BWLA 1NWRA 4ZMGA 2QT3A 1X96A 1HVQA 1ENUA 1AH3A 1TCMA 3UR5A 4ZO8A 4WKHA 1H7RA 3MMWA 2V2DA 1GVFA 1NSJA 2WM1A 2KX9A 1VZWA 3A47A 3ABQA 1Q13A 2G3NA 3BAKA 1I6NA 1V0MA 1GQKA 2QF7A 2C7FA 4AWUA 3BO9A 3KWXA 4IJBA 2B7QA 2ZXDA 1KFKA 1W5NA 3RR4A 1KCKA 4FLRA 3BVJA 3NO1A 4BCEA 5FESA 2W27A 4UTKA 2YJQA 3G6LA 5I3DA 4ZO6A 2PP1A 3KL3A 3M64A 2E8ZA 2GOKA 4QLKA 4Q3MA 3TZFA 2YA0A 1TTQA 1HKWA 1LWJA 2OELA 5C2XA 4XZ9A 5G4EA 4GUHA 4H7CA 1ZAJA 4B5XA 3O63A 2YKKA 3CV6A 3G24A 3TQPA 3KFTA 1XLAA 4C5ZA 4D72A 3ZZ1A 4JPGA 4DELA 3HQ1A 3G1FA 3DFYA 4XTDA 2OSXA 3N11A 4PBEA 4J3UA 4JTKA 2F2HA 3AS1A 2JFEX 3WK2A 3MO7A 3R7MA 1TR9A 3ZSSA 4K7YA 5CGQA 5T26A 4XIMA 1OIMA 1D3HA 4UFKA 3JVAA 4O0ZA 3GAYA 3SQMA 1TCDA 1EX1A 2C91A 3G5EA 4JGDA 1RJRA 3GZ3A 4EK7A 4WIWA 2RUSA 4F0SA 4GIEA 3ERPA 3USZA 1Z42A 2WBGA 4NASA 3FAXA 3QZEA 1HQTA 1FOBA 4C7FA 5JH2A 4TOQA 1UA3A 2VGFA 5D2WA 4P7LA 2G3JA 2X1TA 4WX2A 3W2UA 3ZVIA 3PZGA 1HFBA 1KGUA 4XQ6A 3WFZA 1BQGA 3WUGA 5LIUX 4DXKA 1JZ7A 2OEJA 2GVJA 1HKVA 4XSLA 3KOYA 2J24A 4J3WA 1R3WA 1GKPA 3T07A 2XSBA 5JMUA 1S2UA 3MMDA 4AH7A 1JUEA 3W84A 2D0FA 3QV6A 4NJJA 3NUKA 1QHOA 3LTSA 5K9CA 4WRHA 4DBUA 4XZIA 3WNPA 4HCHA 4TXEA 1SU5A 3DESA 3W82A 2CBJA 1FHDA 4HPJA 1R6WA 4MB3A 1J96A 1JCLA 4GC3A 3OP2A 3U2ZA 3VDCA 1YIXA 2I9UA 4NL1A 2WKGA 3UR8A 1DXFA 3W2NA 4N4PA 4M24A 1F6PA 2VGBA 5HUPA 2VX5A 4OZOA 3R25A 2J4GA 2FH8A 2XVKA 2WSYA 4I7WA 4H04A 2C0AA 2IQ0A 2D2HA 3TKFA 2BVDA 1TQXA 1TJ1A 2FHCA 4S1FA 1W1TA 1LL7A 3VNKA 4TR9A 3L4UA 3KOFA 3I4KA 4PTNA 1SJBA 2QUVA 3HJZA 2H9AB 2VC9A 4E4UA 5CAHA 3AIRA 4ZTYA 4LCQA 2O7QA 1EO5A 5BWAA 1W32A 1W3HA 4FR6A 1TPFA 2XGBA 3WJSA 3W53A 4DXVA 3T6CA 4Q7NA 3LXAA 1MW3A 1XS2A 3VX0A 2HSAA 4ZA0A 2NWRA 4Y96A 4KEZA 2PWDA 3NL3A 4ORMA 3AHZA 2PDHA 3ZWTA 1PAMA 1YLVA 3E74A 5AC5A 2Y7DA 3DGBA 4MZYA 3DFQA 3TNOA 2XM1A 4NYUA 2B0MA 1GGOA 4A3YA 3CUZA 3FIGA 1R9XA 3R4IA 1O7AA 1H62A 1HL8A 4HTBA 1YDYA 3NWRA 1M53A 4LOCA 5BOFA 2X30A 1HKKA 2O92A 2W6RA 3H4GA 5FA5A 5CZSA 3U6WA 1GTHA 3QHNA 4MY8A 4KKXA 2HVOA 2X0YA 4KWSA 4DBEA 4ENLA 1OCJA 1UWAA 3Q45A 2QIIA 1E73M 5EFFA 3BOFA 3W85A 4K39A 3MANA 3AIWA 4PMDA 4JL2A 4AZ6A 5A8MA 3H55A 2CFFA 1ISXA 3IIXA 3ZT6A 3PJUA 5BXRA 2HNEA 3WDPP 2VZTA 3OTRA 2BHZA 5TIMA 1ZP3A 1AL7A 4W88A 3ZM8A 2QEZA 4JNZA 4PCFA 3A64A 2OWWA 2XISA 1E71M 2P1FA 4NF7A 1TSIA 4YWIA 3EX3A 4B15A 1JFXA 4FIQA 4PTVA 1Q6QA 1ZJBA 3GC5A 3GTIA 3QLDA 2JQXA 2C71A 4PTWA 1PTAA 4AF0B 2NSOA 1J0ZA 5L9FA 2HE5A 4QE5A 3DHUA 1XUUA 4Q8MA 1YQ2A 3KVLA 3VFCA 2BY1A 2C0HA 3ABSA 1SJDA 1SO6A 1ME7A 4JFTA 1KBJA 4PCNA 2KAUC 1BTCA 2OWXA 1JYXA 4H83A 4U28A 2QDEA 3O6CA 4AZCA 2HCVA 4O1CA 1EXBA 2L5HA 2Y1HA 3OLEA 3UVIA 2DORA 3MKCA 2EG8A 1GHRA 1XGZA 1NWTA 1UKQA 4DX3A 4IIFA 1VHNA 2VC7A 4WUIA 1ISWA 2OYKA 4A22A 2WSPA 3K8KA 1NDVA 3VC5A 1PKMA 2QHAA 4LGXA 2NQ9A 3CZKA 1VPYA 4PRTA 2G37A 2OSWA 1E0WA 1W1YA 3V75A 4PMYA 4W5ZA 2DZSA 3LU2A 4Q22A 3L9CA 1QCWA 1TV7A 1AW5A 2ZA3A 3PPHA 4DWSC 4HVXA 5C2GA 2CLFA 4FNTA 3BLPX 3R8RA 2OEMA 2J62A 4UCGA 3VKBA 3CXOA 4OWGA 3AI0A 5LYRA 1G94A 2DFAA 4DUXA 4RXGA 4ILSA 2PRHA 1XLKA 1UMLA 3RJYA 3OGVA 2UWFA 3NQ8A 4BI6A 1KXQA 3QSRA 3IVSA 2CBIA 3OJGA 4CQBA 4QTGA 4XBJA 4ML4A 5CJ5A 2AAMA 2VD9A 1HIZA 1EF3A 1MZRA 3VGDA 3STEA 3W29A 5BU9A 4WKFA 1UP2A 1SJAA 3SN4A 1D3CA 1UR3M 3CT2A 1KM4A 2OZTA 1W37A 3WD1A 3L68A 4XUYA 3T55A 4C6PA 3BANA 1YXDA 5IM51 2DSUA 5E9AA 4J28A 1TQJA 2XH4A 4ZSTA 4H9TA 4GCAA 4GIYA 3R10A 4LUTB 3SRDA 2D20A 2BOFX 5G4HC 3TVAA 2QDGA 5HATA 1DJGA 3Q94A 3AXHA 5A69A 4H9MA 4XZWA 1WBHA 3IEBA 1TRDA 1Q2RA 4GO8A 3DDMA 3RLUA 3P7YA 2DJLA 3E3HA 3LQGA 2VFIA 3IS4A 1YPFA 1GQIA 3K1DA 3D3AA 1V3JA 2ISDA 2CEQA 3UG3A 2A6NA 5DXXA 3CU2A 2E5DA 4D9PA 4HOWA 1K8ZA 1L8PA 3M46A 3WLRA 1H63A 2HEJA 4IIHA 4NI3A 2ZC8A 1X6LA 1LUCA 3W7NA 3W87A 4AB4A 1ME9A 3HU7A 3S42A 4LSBA 5G2IA 3S1VA 3ZVHB 1OT1A 1KM1A 1XPYA 4MG4A 3QLLA 3V36A 2XH7A 3SCOA 2ZX7A 1MUWA 3WSUA 3LLFA 2ZA1A 1WXYA 2QJMA 4WDXA 4W9TA 2YBVA 1XICA 2HE8A 3BSHA 2F6UA 2YBTA 4H8UA 2VFGA 1O66A 4JIHA 1HJSA 2GGHA 3LRLA 4ICMA 5A95A 3TSDA 1W9DM 4BK9A 2EPKX 4WVXA 5LNVA 3CMFA 3THQA 4B2DD 4AWEA 1L8NA 5AOUA 2EQDA 3GTXA 2WW5A 3UT0A 1GVIA 4NKCA 3B03A 3W9ZA 4RR4A 3L0GA 5F2MA 4JBRA 4GBDA 4Q4RA 2TSYA 3QOKA 1A0DA 3N4FA 3NA8A 4Z1YA 1P43A 4OVXA 2YDQA 5GVJA 1JYWA 1YTKA 2WBKA 3ARTA 3U4FA 5DEZA 2F6XA 1M41A 1TIWA 3MP3A 2PWVA 1SM9A 4NI8A 3WEOA 1Q4NX 1AL8A 1A5NC 3LM3A 1MW0A 3TE9A 4KIEA 1PUDA 2CHRA 3D0CA 1SQ7A 4LNCA 3WEMA 1DJXA 3QXBA 4PTDA 1R7OA 5A8PA 3H70A 4RKAA 3SUWA 5MKGA 5DT7A 5HJYA 1AZ2A 3W1LA 2G50A 1YHTA 1DIOA 1WDRA 4L1XA 5HQLA 2GVLA 1XM3A 2EHHA 5FJJA 1DWJM 4W7UA 4F4RA 1B90A 1ONRA 1ZPTA 5K3VA 1JCMP 3EWCA 4HHLA 2D2GA 4UFHA 2J27A 2OR2A 2QNEA 3O8AA 5H8MA 3ZR5A 3IVUA 3DH7A 4LT9A 5LNWA 2Q8ZA 1TJPA 3ZOAA 4NZ1A 3F4VA 1SVDA 3VNIA 1X1ZA 5D05A 4J3TA 3PB0A 3FY1A 2Y8KA 3UERA 2QV5A 3GR4A 1MMFA 2W3ZA 2NT0A 2VDHA 4POCA 4A21A 2YX0A 3E1F1 2WO5A 2FGLA 4OGZA 3GYCA 3DFTA 1RBOB 1E72M 3P14A 4DRSA 3IPWA 1JYVA 2ZX9A 2A7NA 4MGGA 2Y7EA 3HV8A 2P76A 4K38A 4NU7A 4D1JA 3EOUA 1CPUA 3STPA 3R12A 1J6OA 2PRMA 4Q4PA 3OHIA 2WVVB 4E8CA 4CQDA 1B1YA 4TX9A 5E6YA 4GJIA 2XWEA 2G5WA 3KOZA 2J7CA 4DAIA 4JTSA 1JR1A 1R3SA 5F2IA 3FK4A 2JGQA 1SO3A 2MNRA 3LUTA 5D30A 3S1XA 2E28A 1OVDA 1EUNA 1W1ZA 4LEQA 4CQ8A 3O9NA 1R3RA 1NDZA 1P7TA 2D0GA 4W4QA 1V03A 2ICSA 2JBMA 4XAZA 4CN6A 3SCUA 4LANA 1XBVA 1O95A 3A4WA 3S47A 1DQXA 1MDLA 4CD5A 1UBSA 1GZ1A 3TN3A 1EWEA 1I1XA 3MZNA 1Q6EA 1JDEA 7REQA 5C54A 3PBWA 4AVFA 1UPMB 1WXZA 4WGXA 3SO7A 3RUBL 2BG5A 1EJTC 3N34A 4JXCA 3QZ6A 1EP1A 3W88A 3PJTA 1S5VA 1I60A 4U5KA 3PC0A 2FQIA 1DE5A 2ZE3A 3H2OA 1E5JA 1UWUA 2FVKA 2OVLA 3LQLA 4IIEA 5KSWA 3UG4A 1MXDA 1H11A 4L4LA 2QYGA 5KINA 1OGGA 4O19A 1DJYA 4JQ2A 1RJQA 1TUFA 3T09A 3FJ6A 4JEJA 1GTEA 1J4EA 1F4HA 1FWRA 3TNBA 3WMLA 3D5HA 2GWNA 1VS1A 3IRDA 4XD5A 3E96A 3BW3A 4PMJA 2VZSA 3ITGA 3VNDA 4YL2A 5D37A 1JQXA 4HU3A 1MWOA 3UD6A 3EA3A 2C13A 5I3HA 3ARZA 2PF0A 1VKFA 1Z6KA 1AQMA 1JRCA 1TPEA 1PZ3A 3HQPA 1EJXC 3W7JA 2X1RA 3FHQA 3UYIA 4DJFD 3L4XA 4ICCX 3CMGA 5AFDA 3HURA 1Y65A 3CC1A 2TODA 4CU6A 3M0ZA 2HS8A 4WGHA 4HNUA 1WUEA 4W84A 1PYMA 6XIMA 3WD3A 2D2OA 2XN2A 3VINA 1I2QA 1DQUA 3LS9A 2VEPA 3WQDA 2WHLA 3RU6A 4Q7BA 4AZ5A 3MA8A 2NSXA 1KV8A 1REQA 2FMNA 4G9PA 4PCSA 4HMEA 4KRTA 4O13A 2PC8A 1W56A 2XJ7A 4PMNA 2CC0A 1TRIA 4DYKA 5LKYA 4D2JA 3P6LA 3M0JA 4AUBA 4ASTA 3CT7A 3GLCA 4F3HA 3C3UA 1LBLA 4AX7A 1TTJA 2CITA 2DUAA 3G0SA 4IX2A 3C56A 1W91A 4OIFA 3FVDA 2I9EA 1V0NA 4FXSA 2GJXA 4BQ5A 4CNSA 3GB6A 4AZGA 1HO4A 5CGTA 1GVEA 1SFJA 1AVAA 1YPXA 2PD5A 4DI8A 3L5MA 2D3NA 3A3WA 3SFKA 4BKNA 3PFMA 3MMTA 2ZC1A 3GR8A 3L4TA 5KZMA 3WQCA 1D7FA 4J2PA 2VR4A 3RN6A 1XDLA 3I6TA 4TTUA 3LLXA 4C6NA 1LG2A 3W7RA 1VIZA 3GXPA 2OO6A 2WMGA 3U8GA 2HXTA 3T4WA 3UF9A 4AFYA 1BG9A 3SUTA 2D0HA 3QH2A