4YLWA

Crystal structure of human dihydroorotate dehydrogenase (dhodh) with no.33 compound
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
364
structure length
363
Chain Sequence
b'GDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (quinone), mitochondrial
publication title Crystal structure of human dihydroorotate dehydrogenase (DHODH) with No.33 compound
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 139
structure length 363
sequence length 364
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2015-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4ylwA00
2J9ZA 3CEUA 4DO6A 4ICNA 1W3TA 3MJYA 1M5WA 3IVTA 1L6SA 3IGSA 3S1XA 1DJQA 4DQWA 2D73A 3RNDA 1W0MA 5CGQA 3TFCA 3WK0A 2ABAA 3O6CA 4HSNA 5DXYA 4AWUA 1EB3A 1TPFA 3LHVA 3W85A 4UIOA 2GVJA 4XWUA 3WJWA 1FDYA 4LNYA 5IM51 1VC4A 3QRHA 4RR4A 3LM7A 4YWIA 2ZRUA 3QSRA 3Q2DA 2BSLA 4ZMGA 4UTWC 3M43A 2C15A 1K7EA 3HG4A 4PH6A 4M6VA 3N73A 2NXIA 3UD6A 3T40A 5FF7A 3SR7A 2EGZA 4PTNA 4N4PA 3MHFA 4IMCA 3DAQA 3GDRA 3TC6A 3W7IA 1FY6A 2QUTA 4JTGA 4OBTA 1TQXA 1VR6A 1M7OA 3HGSA 1WQ5A 4GWEA 4H4IA 3DENA 1YPIA 2Y7FA 1OF6A 1EP3A 4Y96A 2XN1A 2QJGA 1ZENA 3BARA 3PSVA 4GRSA 3SSJA 1YTEA 5A8GA 1QOQA 1KLYA 2BLEA 1GPWA 2YXGA 4JTUA 2GVLA 4GBUA 4TX9A 3NXFA 4JY9A 4UMCA 5KZMA 2Q3OA 3PG8A 2QEZA 3G0UA 3PB2A 2DZSA 3G1SA 3L67A 4XTDA 1R47A 2QCFA 3LXCA 2ATMA 4FNSA 1TQJA 2ZRVA 3KX6A 1ICSA 3O16A 3UPWA 4O19A 3IV3A 5D04C 1K7XA 3S1VA 4E2BA 2YZRA 1M7PA 1Q6OA 1EX5A 2NWSA 4XTIA 5CZJA 4A29A 5DBUA 5EMUA 2NZLA 3E02A 3LXAA 3ATZA 4UR8A 1FDZA 2CLEA 4NJHA 1XL9A 2WSYA 4NXKA 3C6CA 3VCRA 3W2NA 2LLEA 1G4EA 4K8HA 2QUVA 3CWOX 3T7VA 1GTEA 3B0UX 1FWWA 1KTNA 2B7NA 4FIQA 4GFSA 1G6CA 1P0KA 3BW3A 2UV8G 3O8AA 3BV4A 3QSTA 4WD0A 5HQEA 1R2SA 1AK5A 1ME9A 3W7NA 2ZFAA 4WX2A 1CX9A 3NZ1A 3QMRA 4AXKA 4O10A 2XFWA 4PODA 1HFBA 3LV6A 3NOEA 4TU1A 1GTHA 1Z41A 3HBLA 3GNNA 4CNPA 3QMSA 1EA0A 4WQ6A 3WJSA 5FF0A 3O1NA 4NXSA 4L4LA 3UNDA 3VI2A 3G1HA 5FF2A 3NQEA 5LSMA 1OYCA 4NNBA 3W1NA 2JGYA 4Y6GA 3FKKA 1QPQA 3EXRA 1A5AA 2X1UA 1RQEA 3M5XA 4YLWA 1GYLA 2FPYA 3IEBA 3MUXA 4FNUA 5E0KA 2FDSA 4CNNA 5D2WA 3W2JA 4W9TA 4OV4A 1AL7A 3LTSA 4EF8A 5AHLA 3CTLA 3M5VA 1FWSA 1QAPA 3OVRA 1WA3A 1SZNA 3C2RA 4HPXA 2Y89A 2TPSA 4RZ5A 2VEKA 1F6KA 4M7SA 2A4AA 2Z0IA 1FCBA 4FO4A 2QAPA 3HG5A 7TIMA 1O5KA 4Z1BA 1TCDA 3W1AA 1N55A 3D0CA 1NF0A 2VFIA 3CHVA 4HT3A 1SO3A 4DF2A 4LRSA 2QAFA 4MJZA 3NL2A 4R33A 1LRTA 1ZNNA 4Z08A 3W1PA 4EOUA 1OFEA 3SZ8A 1T96A 2OJPA 1ZAJA 3W1MA 2NUXA 5CPMA 4HHPA 3EXSA 4JYDA 3LCIA 1MSSA 3C4UA 3EKLA 4NVTA 2RH9A 1WYIA 2CLLA 1KW1A 3UYCA 2QR6A 4UTLA 1DL3A 3HJZA 1VLIA 4AB4A 3W7JA 3M7WA 1IF2A 1GG0A 1W3IA 1IIHA 1H61A 1L2UA 1H5YA 3TDFA 2WV8A 3QW4B 4K7VA 3ABOA 1BWKA 3BLIA 3TU9A 2XN0A 1VZWA 3P60A 1B3OA 1W5MA 3DU0A 1H60A 1SW3A 4XZ9A 2TYSA 4PL1A 1SFJA 1LCOA 2JK2A 5K2ZA 5H91A 3GVGA 3QEZA 1OX4A 1LORA 3LCWA 5HJLA 1OFPA 3KRSA 3QZEA 3B4UA 2V81A 3PM6A 5AHIA 3A5VA 4LVDA 3O63A 4O1DA 1OJXA 2CW6A 3L5MA 3LHYA 4O1CA 3TV8A 4MOZA 4UR7A 1XC4A 5EKYA 2EPHA 2YSWA 4AHPA 3P61A 1DOSA 3RK8A 2CLMA 1K3UA 2WQPA 1Z48A 1PCWA 5DELA 5T26A 1JCXA 4I7VA 4HKPA 1TJRA 1NAL1 2AGKA 4O17A 3GR8A 3G1XA 2GUUA 3SIZA 1XDMA 3TQVA 5I3JA 3MP5A 4NJJA 1X6UA 1G4SA 2R94A 1SO4A 1VCVA 4MYXA 1YPFA 1FCUA 3O07A 3JR2A 5I3FA 3DFNA 1FWNA 2E1DA 2NXHA 1MZHA 3NQVA 4MLRA 2Y62A 4Y90A 2PC4A 2Y61A 4LVBA 2Y85A 2YDAA 1QOPA 3I7RA 1SO5A 3W22A 4FF7A 5FESA 3MBFA 5D2YA 4QITA 3Q58A 3MHUA 2C0AA 5EL1A 1BKSA 3LB0A 1XKYA 3TSBA 1PL9A 2ZQ0A 4Z1AA 4RJEA 3TIMA 5K4XA 2TMDA 4JS3A 4IJBA 4O53A 4TO8A 3NQDA 4CNOA 5F2IA 1P4CA 5AB3A 3S1WA 3L9CA 1B4KA 1TV5A 4ZQOA 4FNQA 4ADTA 1H7NA 5I3KA 3P62A 4O28A 4D2JA 1U5JA 2C6QA 3H53A 3FEMA 3S5ZA 3LBMA 3NPXA 2J27A 4NNAA 1ZAHA 2A0NA 4S2CA 4MY8A 4WZHA 1O4UA 1TPUA 1W37A 1WV2A 3JRKA 1QO2A 2ZZ1A 4IX0A 2V5BA 3ELFA 4ZQCA 1W31A 4E2DA 1NF7A 3GDTA 4BI5A 3OG3A 1SSGA 1LP6A 4NNCA 3PUDA 1LBMA 3G1DA 2CZ5A 2NX9A 3FKRA 1Y0EA 1W5PA 5TQLA 4GUIA 2ZRXA 5F1UA 3NYZA 2GJNA 3TNOA 1K8YA 3CC1A 4X22A 3PAJA 3DFSA 5AHEA 3IIXA 3QF0A 1DVJA 1KM0A 1JJKA 1OK6A 4UFLA 3LTPA 1XXXA 3TKFA 3GAKA 6TIMA 2E5BA 4R53A 5AHFA 3GIYA 4QISA 3TMLA 1G7UA 2X1RA 2V82A 4UTJA 1TRDA 3BW4A 4XKYA 1PHWA 4XUGA 3GNDA 3A23A 1H7RA 1JRCA 3I7SA 4P2VA 3O15A 3HGJA 2YR1A 3FYOA 1H7WA 4O57A 3B06A 1QWGA 3DFPA 4OWGA 4WUIA 1W5NA 3T78A 3TMQA 3W7KA 3B0VC 2DJLA 3O6DA 1EWEA 2CZFA 1ICQA 3KVKA 3CIWA 1DKWA 3PUOA 5LHEA 1H50A 1SSDA 3C61A 1XUUA 3YPIA 1OX4B 3F03K 3QYQA 1C29A 4G1KA 4UFMA 3ABSA 3U8GA 3QPZA 5AN7A 1WDWA 5F2MA 3EX4A 4Y8FA 1FWTA 2R14A 3S42A 3W6YA 2ALDA 5D37A 5K3VA 2ISVA 3EX1A 3P80A 5G5IA 2EF9A 4MY9A 3M44A 4N9DA 3MBDA 3W1UA 2FLIA 3E0IA 5C54A 4O12A 3OVPA 4HNTA 2NLIA 2ZTJA 3F1QA 2QCGA 3KRZA 4OT7A 3NG3A 4UCGA 2AAMA 3IIVA 4BFAA 4WY0A 1R46A 3SGUA 1W5OA 3P84A 5D2VA 4U4MA 1LRNA 1OFRA 5G1TA 5MHBA 1W3NA 2DZXA 5IBXC 3FJ6A 5F4WA 2QDGA 3W07A 3NQ8A 4HSOA 4AH7A 2CU0A 1OX6A 1FX6A 3W72A 1WOBA 2FPTA 2WNQA 3KXQA 3VKJA 1K03A 4DXVA 4BK9A 3EXTA 4IMEA 3GDKA 4AWSA 3HF3A 2WSQA 4JNMA 2QCLA 4ML9A 2Z6JA 5GVJA 1O95A 2CLOA 1ONRA 1PS9A 3TROA 4JTIA 4M6QA 3UY8A 5C6MA 3GKFA 3DXIA 4Q33A 5DBTA 2FB2A 5K9CA 2O7QA 3NL6A 5DY3A 1TJPA 4JR5A 3BK0A 2FJKA 4OV9A 3LCLA 4NZJA 1PHQA 1VCGA 4N2YA 4IMDA 4TR9A 5F2LA 3DHDA 4IUOA 3SI9A 5I3GA 5LNVA 3QMTA 1KM5A 3MHGA 3PR2A 2CZEA 2VEIA 1H7PA 2NX1A 3AJXA 3ZWTA 4O50A 3CQ0A 5K7JA 4LVFA 1N8FA 1PV8A 1W8SA 2JKAA 3QH2A 3LCXA 2ZYFA 1RQHA 1KLZA 1OVDA 1KBJA 1VHCA 4N4QA 3K30A 2NV1A 4HNVA 3R8RA 2B7QA 1ME7A 3DFQA 1SZGA 3NM1A 5TIMA 4JY8A 4O15A 4FXSA 3HMJG 2VELA 2ATSA 3MI6A 3ZWSA 1VYSX 1RV8A 4ZL1A 1L6WA 4BWLA 4KFNA 3P81A 1D3GA 3W73A 2ZZ3A 3TXVA 3F4WA 3NL3A 3UWYA 4UTIA 1AW2A 1ICPA 1EIXA 3EX2A 2ZZ2A 2V5LA 3L66A 4MKNA 4XKYB 2DZVA 3KFTA 3P82A 2DZPA 3LGEA 2VOMA 5L9FA 3OA3A 4N02A 3A5FA 1TTIA 4JTSA 4O1BA 2GJLA 2Y6ZA 2A6NA 1SW0A 5EYWA 4Z0JA 3H54A 1VS1A 1TTJA 3W1XA 1FXPA 5LNSA 3MMTA 3KHJA 3G1AA 3N9RA 1Z44A 3CT7A 5AFDA 2JKEA 4UTWA 4XQ6A 3QC3A 2DU2A 1SFLA 2YCEA 3LXBA 4LVGA 4IPJA 3TCEA 3W71A 5BOOA 1OYBA 3BLEA 3W3OA 3LTYA 3STCA 4UFKA 5D03A 2H8ZA 4UTKA 1RPXA 3GXTA 4O0KA 1FQ0A 3WK2A 4A2RA 1K8XA 3HG2A 4QQ3A 1F5ZA 2A6LA 4E38A 3QQ1A 1XFBA 3S5OA 1JCJA 3UZJA 3VFLA 5EA9A 3G1VA 4DELA 2A85A 3MWAA 3IIZA 3G22A 1NFBA 4WY0B 1GYNA 1TPC1 3NR0A 1SZEA 3W1RA 1C9DA 1TRIA 1IIGA 1X1OA 3OEXA 2OZ0A 5CZSA 4RCXA 3L5AA 5AHMA 5U4NA 3O06A 5AOUA 4O4VA 3PSWA 3VNDA 2PRHA 4M6PA 4UFJA 1PIIA 4NQ1A 4EIVA 5DCEA 5FF3A 3S1UA 5C5YA 1ZAIA 3B0PA 5K9DA 1KFEA 1KBIA 2DZUA 3EWZA 5CZ0A 5C55A 5CG7A 2YYUA 2ISWA 3L2IA 3P74A 1G4PA 4RXFA 3A22A 3LHZA 4ORIA 1OFAA 3UWVA 2QCDA 3RLUA 4DPQA 5KTLA 3I6RA 4AHQA 3UPBA 4JYEA 2PRMA 3PC0A 1TV7A 1VCFA 5LHFA 3A24A 3OHIA 1Q6QA 2J6XA 3SW6A 5CSSA 4O0ZA 1OHLA 1MXSA 3TX9A 2G97A 3S8HA 3DKLA 3NO5A 4LS1A 2V2CA 1WBJA 4FNTA 3TJLA 4UFHA 1JUBA 1AG1O 3NM3A 1GEQA 1L6YA 1O60A 3WK1A 3MYPA 2YPIA 4POCA 2V2DA 3TFXA 1F05A 5KINA 3P5YA 2J9XA 5CPOA 3R2GA 4RX0A 3TA6A 4YCOA 3BW2A 1LYXA 2A1YA 3WFAA 3TAKA 3TW7A 3U2OA 3LI0A 3W76A 4QAIA 1NSJA 2Y88A 2V8ZA 4PEKA 4QSHA 2NWRA 3G0XA 3GX9A 3WJYA 5DCBA 3LOTA 3E96A 1XM3A 4TIMA 5A5WA 4O54A 4ZVJA 1LBFA 5FEXA 4X3ZA 2J88A 2TRSA 1LM1A 5LNRA 1KA9F 2QCMA 1FWRA 3G3DA 4C1LA 1GT8A 3W7RA 1DQWA 1K7FA 1KFLA 2A5HA 3STFA 3HG3A 4LU0A 4FXRA 1F6PA 3CPRA 3DFTA 4LUJA 5D05A 1H51A 2WNNA 1XBXA 3STGA 3R13A 3RMJA 3W84A 4R7JA 1WAUA 3BVJA 3KRUA 3GR7A 3QPYA 4ALDA 2X16A 4O13A 1RQBA 1SW7A 1DQXA 3Q37A 4LUIA 1N7KA 1IXPA 3LBCA 3QM3A 1UCWA 1Q6RA 2Q8ZA 3TW6A 1I8JA 3AO0A 1F2JA 1YYAA 3GXNA 4O11A 3TXZA 1A5CA 2DJXA 1LOSA 2VKZG 3M16A 3GB6A 4AF0A 2HSAA 2V2HA 3NPVA 3R5EA 3UWWA 4KFPA 5D09A 3HIJA 3KVMA 3C52A 2BXVA 2W6RA 3DZ1A 1YTDA 2HS6A 2ZRWA 3FYPA 2ZZ7A 2YGYA 2W0UA 4N9CA 3UY7A 3M41A 4NJGA 4JTKA 1A50A 4RZ4A 4KWVA 3IIPA 3TQ0A 4U28A 4BI7A 3C2OA 4MZYA 1GVRA 2Q8LA 4AMAA 3NQFA 3W70A 3EWYA 5EPDA 5KZEA 3EWXA 1KV5A 2PE4A 4K6AA 1MEWA 3P8IA 1E51A 4JIPA 1DORA 2VC6A 3OBKA 4YXGA 4MFEA 1ZJIA 2DZWA 2ZZ6A 5G1YA 2CLKA 3G3MA 4ZQNA 2ZDRA 1TPB1 4JTHA 3LI1A 1JUEA 1LZOA 2QCDB 4IXXA 5D38A 5K9XA 2RDUA 1D3HA 4MFDA 1YDOA 2PURA 5EY5A 1OFOA 1SO6A 1TPWA 1GVOA 2RFGA 3TR2A 3B04A 2CLIA 3W7PA 4RKAA 4NT0A 3UWZA 3G1YA 1TTPA 2F84A 3EKZA 3G8EA 3W7GA 5I3IA 2Z1BA 2YW4A 3W1TA 2OX1A 4K8EA 1JCLA 1XDLA 2A7PA 2VXNA 4PL2A 5HUPA 3M47A 3JS3A 5F4SA 2QCHA 5EBUA 2B0MA 1T0OA 3L5LA 3EWWA 3UXAA 4LC6A 5AYZA 4YL2A 4DBEA 3THAA 1AL8A 2V9DA 3M5ZA 2PCQA 5AC7A 3HGOA 3LLDA 5C2XA 4JTEA 4LV9A 3G18A 3W9ZA 1I2RA 1G7VA 1HUVA 3ZR4A 4ADSA 1X7FA 2ZCGA 3FOKA 4FNPA 1SPQA 3U6WA 1VGAA 1C8VA 1LLWA 2C1HA 3LHTA 4LY8A 3L65A 4BR1A 3GDMA 4QNWA 4UNLA 3NEVA 1KFBA 3C56A 2X1SA 5D32A 4IWWA 5J5RA 1TB3A 3W7EA 3HGRA 4IX2A 1WX0A 4CCEA 2GOUA 3FFSA 4Q32A 4DF1A 2YX0A 2NXGA 4HNNA 3LHWA 5BW6A 1CW2A 5KSWA 3N2MA 4C1KA 2NUWA 2YW3A 1SQ7A 1VH7A 4LRTA 2P1FA 3E9AA 3S6DA 1S5VA 5AYXA 3L0KA 3T44A 5L6UA 1UUMA 1FCVA 4NZFA 3W7DA 6ALDA 3W1LA 4LW7A 3CU2A 2RDWA 2WNZA 5D2XA 2ZZ5A 5HUOA 1WXJA 3S5NA 5LKYA 5FI8A 3DI1A 1MO0A 1H1YA 5HWMA 4UTTA 3TUUA 4MLJA 1LRQA 2GQ8A 1G69A 3EX3A 3CEPA 1GWJA 3NQCA 4JTFA 3NGJA 1DJNA 2HTMA 3QW3A 1QPOA 1LBLA 1QPNA 2EAWA 3L0NA 3R12A 3L0GA 3C3NA 1FDJA 3MI2A 4K39A 5DXXA 3NQAA 4NJKA 4JEQA 1B9BA 2VENA 4M19A 4JDYA 2WKJA 4A3UA 4JXCA 1J2WA 3EB2A 1QO5A 3BG3A 2E6AA 1TPEA 1OF8A 2H8XA 4FEZA 1PE1A 5KZDA 1YTKA 3UWQA 2EHHA 4I7WA 4O52A 4CCDA 2Y7DA 4HNUA 1LTDA 5I3HA 2ZA3A 1VYPX 3DBPA 5G4EA 3PS7A 2OCZA 1ALDA 3FA5A 3LERA 4O18A 4JTJA 4LOCA 2V0TA 3MI3A 3G8RA 1U83A 1XBZA 2Z6IA 2DP3A 3T55A 2Q3RA 1VRDA 3TK7A 3HOJA 3BGGA 3M6YA 2C3ZA 5E93A 3NPUA 4FX8A 1YXDA 2H3BA 1TPVA 3P7YA 1KM1A 5CKSA 4H3DA 1R30A 5DN1A 4RK8A 5TBOA 1YDVA 5CPNA 3Q94A 3SGZA 1Q6LA 4MZ8A 3GLCA 3NZRA 1TMHA 2JKPA 1YADA 5AC8A 2E6FA 4UXDA 1OFBA 4YCPA 3MP3A 5IBXA 3W86A 3WK3A 2I14A 4RLIA 5ABTA 3VE9A 5DY2A 4UMBA 1I2PA 2GVGA 4E0CA 2CLFA 2HMCA 3L21A 3USBA 4DBDA 2F7FA 3N2XA 4UMAA 5F1VA 4OU1A 1UUOA 4LS2A 3CLMA 2ISSA 4DEFA 1YXYA 1QR7A 1A5BA 3H55A 2QKFA 2B7OA 2I1OA 1PCKA 1CI1A 1UBSA 4MUZA 2RHGA 4X9SA 1ML1A 2C16A 2Z2UA 3TE9A 1OG0A 3W2UA 1EUNA 2GQAA 3WJXA 4B5NA 1KFKA 3MP4A 1NVMA 1R2TA 4N6FA 1KM4A 2NX3A 4JTTA 1I2NA 2NUYA 3RF9A 3W1QA 5CZTA 1G4TA 2XN2A 4PCFA 2ZTKA 1HG3A 3E12A 2AQWA 1I45A 2BTMA 2YFOA 3PWAA 3EEGA 4JICA 1OFQA 5CSRA 3HB9A 3HPZA 3QQ0A 1ZCOA 3GKAA 2CFFA 4K37A 1IXQA 4KKXA 3N3MA 3RLVA 3RU6A 2QCCA 1A5SA 1J4EA 4M5PA 3UZ5A 3WJZA 4K38A 4JD4A 4Z0SA 1H7OA 4AAJA 2R91A 4O8RA 3NQ6A 2QCEA 4ORMA 3IGXA 1W1ZA 2E6DA 3C2FA 1FXQA 1KFCA 1P0NA 1R2RA 5G2HA 1QNVA 4S1FA 4JDBA 4AWTA 4NUWA 1ZY9A 2QCNA 3HPSA 4JYFA 1RR2A 2YFNA 3LV5A 1O94A 2FIQA 4GUHA 5AHNA 5LGZA 3NQMA 1WOAA 2OT1A 2A7NA 5SWUA 3B05A 2FQIA 3DHFA 4UTUA 2WPBA 4Z1CA 4K7YA 8TIMA 2H90A 4EWND 3NQ7A 3M5YA 5HMSA 5BRBA 4NX5A 1GOXA 1PVNA 1Q45A 4O1AA 3TC7A 4IMGA 4FIRA 3THQA 2QJIA 3FJLA 1M6JA 3SJ3A 3O05A 4RZ6A 5KITA 1B57A 4XBKA 3W2MA 1YXCA 2ZBTA 5LNWA 3GYEA 3PUEA 1OFDA 4UTHA 3PBVA 2A2IA 3GAYA 3F4NA 1TPDA 4WY0F 4MY1A 3W7QA 1QPRA 3ZFHA 2ZA1A 4TMCA 2JGQA 1UASA 4AHOA 3LDVA 3BLFA 3G24A 4J9JA 5F2GA 1W5QA 4MIMA 3NQ2A 4H6KA 3A21A 1OK4A 3EWUA 1AMKA 3C8FA 4JTLA 4A21A 1P5BA 1LOLA 1IXNA 4LS0A 1SU5A 3I65A 4IGHA 4MZ1A 3DGRA 3SFKA 3L68A 5HULA 1OX5A 3CB8A 1TIMA 1K02A 1FBAA 4WOZA 4MYAA 3LRLA 3LRMA 4JX5A 1V5XA 2V30A 3CIXA 4S2BA 3IGUA 1S5TA 1QDSA 4I7UA 5D33A 1D9EA 3FIGA 2ZZ4A 2ZA2A 1Z42A 1KM6A 1V7YA 2QUUA 2B7PA 1I2OA 3KVLA 4LC8A 3GK0A 2FPVA 4HIBA 3UWUA 1EPXA 1TTQA 1RD5A 1JUKA 3B03A 2R8WA 4LWWA 4NJIA 3I68A 1UJPA 2PRLA 4LV4A 3R89A 4LTSA 4ZQRA 4MVAA 4HN4A 2BZNA 4PC8A 4FX6M 3PBYA 4ADUA 4O14A 2G95A 4NX0A 1GVSA 1MEIA 3STEA 3PBWA 4CQ8A 4DO5A 2W79A 4JN6A 4PFMA 1DBTA 2KZHA 3FLUA 2WSRA 1A53A 2Y70A 1S5WA 2VFEA 2FB3A 3HO8A 4GNJA 1F76A 1ZFJA 2YYTA 3LCHA 5H2ZA 2EKCA 2Y63A 2FFCA 4GJ1A 2ZRZA 1HO1A 1T8XA 2X2GA 1TREA 4N9EA 4OQVA 1VJIA 3TJXA 3TSDA 5AC6A 3BPWA 2RDTA 4WOQA 3BG9A 3MO7A 3V1PA 5HNRA 4AEOA 1JCMP 4WXYA 4IMFA 1EEPA 3NPWA 1SZFA 2A21A 4HPJA 1JR1A 1LROA 4DO4A 5DLCA 1FCQA 4Q4KA 2H6RA 3OVQA 3LHUA 4O16A 5BMXA 2G96A 4WJEA 3NAVA 2IQTA 1S3HA 1GVQA 3W83A 4UFIA 4FX7A 3HQ1A 1KFJA 1XCFA 3PY2A 2X1TA 4CCCA 4P61A 1F73A 1JQVA 1JRBA 3C2EA 4GXMA 4OE7A 1ME8A 5G2WA 1TYGA 2P10A 3LLFA 3LCGA 2WOQA 1VLWA 1VHNA 4A22A 2GPTA 1EWDA 1RZMA 3LRKA 3W7HA 2E09A 4OHQA 1TO3A 5K4ZA 1X1ZA 4M7TA 4Z1DA 3W7CA 3P5ZA 1WBHA 5FF4A 1XI3A 4KFOA 1ZALA 1H62A 3P8JA 3NL5A 1LLZA 5BMWA 2ABBA 3NA8A 1TV8A 4XBSA 4ZQPA 1VQTA 3IIOA 3S5YA 5D02A 3T4CA 3W7MA 4GC4A 4IQLA 4ZZ9A 2VFGA 1F74A 3PF3A 3E49A 1JVNA 1G67A 2CZDA 1KTCA 5KMYA 3B8DA 2WJZA 1L9WA 2CLHA 3ANYA 4IOTA 1KV8A 3OIXA 3SY5A 1H1ZA 1GQNA 2HS8A 3W88A 4NU7A 4YMZA 3NVTA 4N6EA 3HPXA 5LGXA 1IXOA 3QJAA 2C18A 4QJ1A 3BGJA 3M9YA 5HWNA 4DPPA 3DI0A 4WXZA 1RVGA 1I4NA 1XUZA 1IGSA 5D2TA 2P0OA 2I9EA 4A2SA 2Y7GA 4R34A 2ZRYA 1BEUA 5J5DA 3BO9A 3TH6A 3W2LA 4O4WA 4JIQA 4EF9A 2VFHA 3SECA 3PVFA 5G4WA 3DFOA 4QNEA 3TAOA 1MEHA 3IRDA 3N19B 3PB0A 2FTPA 1OYAA 1I2QA 4CQ9A 4IPIA 1VYRA 2QJHA 2X30A 5LNUA 4JX4A 1KM3A 2GQ9A 2E68A 4JGDA 4L4MA 1LDCA 5DCDA 3KVJA 1LOQA 4MPQA 4CLMA 2VFFA 4KWWA 5E1QA 1JCYA 5AYYA 5FEZA 1X8FA 3GDLA 3IVUA 5HWJA 1SR9A 4X2RA 4Y9AA 1O5XA 3GZ3A 2G5WA 3ABRA 3P67A 4LVAA 4RXGA 2RKXA 1JULA 3GXPA 2DZTA 4UTTC 3S9YA 3KAOA 1GG1A 1H63A 1GJPA 4JX6A 4UNKA 4EVZA 4QIUA 1FUYA 2TSYA 2VFDA 1W54A 3N9SA 2J24A 3MW7A 4FNRA 3DH7A 3M0ZA 3UXDA 3FS2A 3TQKA 3DKJA 4CQAA 4ONVA 1THFD 4DF0A 4QM1A 2QF7A 3C0JA 2BX7A 4UC5A 4IXHA 3PBUA 5LZLA 2OT0A 2Y7EA 5FEPA 3IVSA 1HTIA 3V75A 1GZGA 1T99A 3ZS4A 2A7RA 2OMAA 1P1XA 4UUIA 3NQGA 1F7BA 3RFAA 1UB3A 1BTMA 3W2KA 1AW1A 1OABA 3CM4A 1SUXA 1VPXA 1YDNA 4GUJA 4PA8A 2CWNA 3TSMA 1NEYA 3VE7A 3W7OA 3W7LA 4BI6A 5U7SA 1ADOA 1XBYA 4GE8A 3I7QA 1H7XA 3LCFA 3UQNA 3LX9A 1KM2A 3S0CA 1QMLA 3W75A 2H3DA 3MYOA 2JBMA 3W23A 5BNKA 2WO5A 1Q3NA 1XBVA 3NNTA 5D30A 3W74A 3G0SA 2E5DA 2E5CA 4AF0B 4FHAA 1HO4A 2E77A 3BG5A 3N14A 2C13A 3W87A 1TPH1 1W56A 3A9IA 3INPA 3G1FA 2QDHA 4GUGA 1YLVA 3EWBX 4GUFA 1BWLA 3ATYA 4FB7A 2NV2A 3M1ZA 2C14A 4TMBA 4LT9A 3NDOA 1QCWA 4BF9A 4RV8A 1B4EA 5CPLA 1J5TA 2VEMA 3N34A 4ZQMA 4MJMA 2E6YA 2C19A 3PULA 3CWNA 4I9AA 4AVFA 4UTMA 1JCNA 3EX6A 4N9BA 3PG9A 1EUAA 2B4GA 5HINA 1ZHAA 3KOFA 1DHPA 5F4XA 1TSIA 2O7SA 1HL2A 1GVFA 2DORA 1EP2A 5HR7A 2J9YA 1EP1A 4K36A 3QFEA 5HR6A 1K8ZA 5G2IA 2VEPA 2BWGA 1DV7A 5FEWA 4BWLC 3C2VA 3ABQA 1KTBA 1QFEA 1JQXA 3O6YX 1AW5A 4OGZA
chains in the Genus database with same CATH superfamily
2J9ZA 4GYKA 3UT0A 1W3TA 2QV5A 2INFA 3RNDA 3BH4A 2Z26A 4KRUA 4LB4A 4RL3A 5FJOA 1W0MA 5BXSA 3WLKX 1AH3A 4PB5A 3E0LA 1CGYA 4C6EA 1HKJA 1WPCA 2RJGA 1TPFA 3SY8A 3E5PA 2WNWA 2GVJA 4D8ZA 4IZGA 4XWUA 4HU4A 1FDYA 1X8CA 1XKJA 1OGSA 4L6HA 4MSSA 4C90A 1RBOB 4AISA 3S47A 1VC4A 1NP0A 5D9OA 3Q2DA 4XSMA 1FHDA 3UERA 4ZTXA 2NQJA 1CIUA 4UZSA 2UY3A 3W53A 1K7EA 2WMGA 4F48A 4M6VA 2XISA 3UD6A 3T40A 2EGZA 3JU2A 1JPDX 3LGGA 4IMCA 4IPLA 4EXAA 4I6VA 4P8UA 1TQXA 3ZZ1A 1VR6A 1M7OA 3HGSA 3WNPA 1T5AA 2Y7FA 1EP3A 3NWRA 2XN1A 2QJGA 1ZENA 3BARA 3PSVA 2G41A 3SSJA 1YBQA 5C9XA 4JTUA 4H7ZA 4UMCA 5KZMA 1ZS2A 2XFRA 2QEZA 3G0UA 5I23A 2DZSA 1KGUA 3L67A 4XTDA 3DYOA 3LXCA 3NCOA 1HNYA 2XM2A 2ZRVA 3LN3A 4RZBA 4DWSD 3KX6A 1ICSA 2XZ7A 3OLIA 2G37A 1G01A 2OKTA 1FWFC 4DBUA 4J3WA 2Z1VA 5DBUA 2J8GA 2NZLA 3E02A 2XVLA 3ATZA 4QRNA 1ZP3A 5FJJA 2UZ9A 2WSYA 3C6CA 2VURA 1IEIA 2YDRA 1GTEA 1ZU8A 1FWWA 1KTNA 2GQ3A 1JNEA 3FHAA 3PPGA 2HJPA 2INZA 5KETA 5CQ1A 1BXNA 4YTRA 3HQOA 2W66A 3F4CA 2V63A 2O4QA 3QSTA 3ECQA 5HQEA 1HJSA 4ACZA 3W7NA 2WM1A 4Q4OA 4D6HA 3QMRA 3RRAA 1Z9AA 2ZXAA 1SMDA 1GTHA 4PCNA 3RO6A 4E6MA 4DHGA 1UA3A 4JQAA 1V3LA 1EHAA 3SUVA 1EA0A 9CGTA 4AD1A 4QS6A 2DFAA 2Z1KA 4D6CA 2RJHA 3VI2A 4INFA 3QHMA 3NQEA 5C71A 3WBYA 3W1NA 2HVNA 2JGYA 3FKKA 1UKPA 1A5AA 4ASTA 4GO9A 5CSUA 3PZ9A 1RQEA 3M5XA 3KL0A 3M0MA 3MUXA 1W3JA 4QJ3B 4AIUA 1Y5VA 2WAGA 5B80A 3LTSA 1BD0A 1WDSA 4Z2HA 3ITOA 3TYZA 3C2RA 2VEKA 3DCPA 1F6KA 4M7SA 1UWRA 2G3IA 2Z0IA 1FCBA 1GOWA 3VTRA 2QAPA 3WBXA 2PGFA 3R58A 4PUNA 1H3GA 3A64A 2FH6A 1J0YA 3CMJA 3IJQA 3KP1A 1JYVA 4R33A 4HNOA 1CPUA 3VNYA 1JAKA 1MRQA 4Z08A 2FHBA 5EU9A 1WKYA 2PLJA 4HZ8A 2FZNA 3ANUA 2OEMA 1V8EA 2QVHA 1PPIA 5AVNA 2CLLA 3U2EA 3DUGA 1DL3A 3HJZA 1Z89A 3BUVA 5HDRA 2F38A 4ZODA 3HA1A 5GJMA 4XG1A 3WFZA 3BMVA 1YW1A 1H61A 1H5YA 2QLYA 4A4AA 1NTHA 2WV8A 3ABOA 1BWKA 1VZWA 1B3OA 4Q4QA 3DU0A 2J7CA 4PL1A 5K2ZA 1LORA 2BG5A 3LCWA 7ODCA 4QAWA 1TVLA 3OQEA 1OFPA 1CGVA 3QZEA 3A5VA 3G5EA 2P3EA 2XIOA 1RHCA 3O63A 5FSEC 3LHYA 3TV8A 3KBVA 1WXZA 2DSVA 3A13A 5EKYA 1FWAC 1OINA 2YSWA 4AHPA 3E74A 1DOSA 7XIMA 2XVKA 6XIAA 3NIYA 1Z48A 1PCWA 4F2BA 5T26A 3MKVA 4MJ2A 3URNA 4IGMA 1RH9A 2AGKA 3GR8A 3G1XA 4FS9A 2GUUA 4FMVA 4JN7A 3SIZA 1TV4A 3MP5A 4NJJA 2BXYA 1KWGA 4MYXA 2ONEA 1YPFA 3B3DA 3O07A 3JR2A 4D6GA 2XG9A 3AIVA 1F3WA 3NQVA 2GDVA 4J4KA 2V3GA 1VF8A 5A3HA 1C8YA 4RNIA 2PC4A 1XGEA 2VEFA 3E5BA 3QV8A 3RU8X 3I7RA 2G3JA 3QLLA 2VR4A 5D2YA 3V5CA 1NOWA 3HPFA 4JPGA 4Z1AA 2XGIA 4JS3A 4IJBA 4JFSA 4O53A 4YJ5A 4W89A 1A4LA 3S1WA 4XO6A 3ISIX 4ADTA 1IYXA 1XPYA 4O28A 4D2JA 2PDQA 4FR6A 4S3BA 4IIBA 1WDDA 4GVIA 4J35A 1E0UA 3ZSTA 4NNAA 1ZAHA 4S2CA 1O4UA 3CMFA 1QO2A 1ODZA 1EJ7L 3BGAA 3ELFA 1DP0A 3LMZA 3NSNA 1UG6A 1EBHA 5CAKA 2JF6A 3EMQA 8XIAA 4DYEA 2PDLA 1LBMA 1A0DA 3FKRA 1W5PA 2EBNA 4GUIA 4FSAA 2I5GA 2PDGA 3COTA 3MZ2A 4H9XA 3FGCA 4X22A 1SGJA 4QS5A 1EIBA 5JQ9A 2Y5JA 2IPGA 4S3GA 1U1JA 4O1FA 1KM0A 1JJKA 3PFRA 4C6DA 1CGUA 4R3UA 4FXJA 4XD6A 5IHRA 2EPKX 4XZNX 3TKFA 6TIMA 1QNPA 5AHFA 1G7UA 4UTJA 1TRDA 1AQ0A 2ZIDA 4JEJA 4XUGA 4NY2A 1JRCA 4P2VA 3HPAA 2OEJA 2PD5A 4OWGA 3TONA 4WUIA 4Q4PA 1CXHA 1W5NA 3H26A 4H7VA 4RE3A 3MDWA 3OZPA 3CIWA 1W1PA 1U5HA 1H50A 4P5UA 2EPMX 3M64A 4W5UA 5DMMA 3ABSA 1UQYA 5H8PA 1WDWA 2YLAA 2J8TA 1FWTA 3UGRA 2ALDA 5D37A 1OIMA 3EX1A 2G50A 3WD0A 3P80A 2VHLA 4PMDA 2FLIA 1PWLA 3ONCA 2C1GA 2C7FA 3OVPA 4UOZA 5AVHA 3D3AA 3VYLA 2QCGA 3NG3A 4IM4A 3T2OA 1EGVA 1W5OA 3P84A 3KCOA 1JD9A 2DZXA 3P6LA 4M8UA 3W07A 3KE0A 3W72A 4KRZA 4Q7NA 4I3GA 2PLKA 4RE2A 4DXVA 3WD3A 4IMEA 2WSQA 4JNMA 1CECA 3LPPA 4YTSA 1F61A 3UY8A 3GKFA 1UKQA 3QY8A 2O7QA 4JR5A 1JFXA 4OV9A 5MF5A 1PHQA 1UC5A 4N2YA 5F2LA 3DHDA 1KRBC 1ZSXA 4I9TA 1KM5A 1TUXA 3VMNA 1YE6A 2VEIA 2NX1A 1LQAA 3FJ4A 5C9RA 2OSXA 5EMKA 5K7JA 1PV8A 5M1TA 2QGHA 4US6A 4NZ1A 2ZYFA 3LGDA 1OVDA 1GOIA 2TAAA 1VHCA 4N4QA 1EL3A 2YDQA 1UR2A 4F0SA 4GIEA 4FOKA 2X7WA 4TUFA 4GYJA 3V7PA 4C6BA 4BS0A 4PTVA 2IPWA 4L1XA 4QP0A 4C6NA 3HMJG 2ATSA 4P8VA 1O5QA 3WFLA 4BWLA 5I24A 3N13A 3P81A 4CD4A 3SDOA 3RN6A 2WVVB 3B8TA 1F3EA 1OWQA 3UWYA 1FP9A 1ICPA 4EACA 3GG0A 2XDFA 2VO5A 5M03A 1H0GA 4Q3MA 1HKWA 2DZPA 3LGEA 3P82A 3CQIA 2IS7A 2VOMA 3OA3A 4BQ4A 5L9FA 1TTIA 4JTSA 2GJLA 1SW0A 2CBVA 2O0TA 5EYWA 4Z0JA 4GHRA 1TTJA 1IE7C 4Z2KA 2ZE0A 3KHJA 3G1AA 1VJZA 1UYQA 3ZXWA 3VD7A 2PWDA 1XQKA 4XQ6A 3QC3A 2DU2A 4IPJA 5A8OA 3HMCA 1OYBA 2VUNA 1V93A 5D03A 2H8ZA 2OPJA 1HKKA 2PBGA 3HG2A 2A6LA 1R38A 4W8LA 4E38A 1O6IA 4I5UA 3QQ1A 1JNDA 4LAOA 4FP1A 3VFLA 4DELA 3N29A 3MWAA 2OG9A 3GM8A 2QYGA 4Q8QA 3NR0A 4W4QA 4H2HA 3ARRA 1WKFA 2ZXDA 2JF7A 1E6QM 5XIAA 5A6BD 4DZ5A 5AHMA 5U4NA 2WCAA 1RJQA 2WKGA 2J78A 2WVTA 4JQ2A 2QMJA 2R1NA 5I79A 1MZRA 1PIIA 4EIVA 5DCEA 5FF3A 1ZAIA 2Y2WA 3B0PA 2VZSA 2R9RA 3VIMA 4F0LA 4AY8A 1KBIA 1MI3A 3QOMA 2VD9A 3PWIA 4GZEA 1W9BM 2GZXA 4GQBA 2X0SA 4AC1X 3RMEA 2ISWA 3WH9A 1XRSA 1ZBWA 4O1EA 4Y9MA 1A5LC 3VABA 2POZA 3I6RA 4AHQA 3UPBA 3FX4A 2XH2A 3E0VA 5LHFA 5E6ZA 2OWXA 2J7DA 1V7AA 3U2CA 3SW6A 5CSSA 1OHLA 1MXSA 4NZCA 3VOJA 3WDJA 2MNRA 4LS1A 1E71M 3L4ZA 4FNTA 3M0HA 3R0KA 3PANA 1CBGA 4DRSA 4KWSA 1IEQA 3EOOA 4POCA 3TFXA 1AZ1A 3MO4A 9XIAA 1XIEA 1LYXA 1JZ2A 4TVCA 1V79A 2A1YA 3TW7A 3U2OA 1NSJA 4ZB2A 5ECUA 2NWRA 4TIMA 2C8NA 2BGQA 3WQPA 4Z2LA 4O54A 1Q6DA 2CHNA 1P6BA 1KA9F 1A5MC 3WLRA 1GT8A 1DQWA 3STFA 1JDDA 5LXXA 1K9FA 4FXRA 1K77A 2QJMA 3CPRA 3DFTA 5D05A 2ACQA 1K6WA 3STGA 5FJTA 3RMJA 3PJXA 2BVWA 1E0XA 3BCJA 3RILA 3VIKA 3PZMA 3QPYA 3VNIA 2V5CA 4FXFA 4ALDA 1W3LA 4J3XA 3NO3A 3Q37A 2O9RA 5E9XA 1XISA 2XIJA 1E6NA 2Y5EA 4Y7EA 1UCWA 1I8JA 3AO0A 1F2JA 2QW5A 3GXNA 2DUAA 4ZBCA 1A5CA 2DJXA 2YA2A 5TF0A 3AUJA 2J77A 3TYEA 5FL1A 2HSAA 3NPVA 3UWWA 1KR1A 1QNQA 3HIJA 3C52A 3FXYA 3S6OA 1D8CA 2BXVA 2MUCA 2HEJA 2J6VA 1HT6A 3MUIA 2W6RA 2HS6A 3FYPA 1O7AA 2ZX9A 2ZZ7A 1P1MA 1XG3A 1UR8A 2XVPA 3QV9A 4FZIA 5DRIA 4EX4A 2VDHA 4KWVA 2VR2A 1WB0A 2XVGA 3IIPA 4P8WA 3RPDA 4BI7A 4MZYA 3EDJA 1GVRA 2Q8LA 4AMAA 2DSUA 3NQFA 3W70A 3EWYA 3BJTA 1HVQA 4S3JA 3Q4DA 1LWJA 2A3BA 4ZOAA 1DORA 4AC7C 3W24A 1EQCA 4AD2A 2DZWA 1W91A 4I8YA 3UZWA 2KAUC 3PWGA 2DZBA 1VKFA 4Q8PA 3AHYA 2F61A 2QCDB 5D38A 3ZT7A 2RDUA 3H2AA 1YDOA 1SO6A 3O0KA 5I02A 4B2DA 4PULA 3CGTA 4M1BA 3OBAA 4NT0A 3UWZA 3UCQA 3MB9A 1CZ1A 2F84A 3EKZA 5I3IA 1JL8A 2Z1BA 2UBPC 2OX1A 1GK8A 4JL1A 4LEQA 1JCLA 3M0XA 3DDMA 3MUAA 5HUPA 1JAEA 3GTNA 2DQWA 3M47A 5F4SA 5EBUA 2B0MA 1KGXA 2Z7GA 4IICA 5AYZA 3THAA 2PCQA 4PSRA 3ZLHA 4U33A 3LLDA 3G18A 3W9ZA 3Q67A 1UMLA 1G7VA 3LY0A 3ZR4A 2XSAA 1IWBA 4E4PA 4BCEA 3FOKA 4E8GA 4S3AA 5EMYA 3U6WA 1ZJAA 1VGAA 1GUVA 1KFBA 1R6WA 4IWWA 4LCQA 5J5RA 1L8NA 1X97A 2GOUA 3QLDA 2YX0A 5KSWA 1XLKA 2NUWA 3UESA 2YW3A 1C7SA 3WF0A 4IP4A 2P1FA 3TYDA 3RPMA 3IJIA 5AYXA 3L0KA 5L6UA 1TE6A 3CU2A 4LFYA 3FSTA 3QV7A 3HU7A 5D2XA 1WXJA 2XJ7A 5LKYA 4GZ7A 2C91A 3DI1A 4CUCA 2ACSA 4LJ3A 5E0FA 5CBBA 5GNZA 2FZDA 3UJSA 3KWSA 3AMGA 3EX3A 3CEPA 2IKJA 1GWJA 3M6DA 1QPOA 2BFGA 3R12A 4A05A 2REQB 1FDJA 3MI2A 3NQAA 1XSJA 4JEQA 3KTXA 3O2LA 1TWSA 5CCZA 4M19A 2OR2A 5G4HC 3V0SA 1NFPA 1J2WA 4TXEA 1NIUA 4E4UA 4EKJA 1UPMB 1OF8A 1QHOA 4FEZA 1XSKA 1PE1A 1YTKA 3UWQA 4DYJA 4O52A 4I7WA 1ADSA 2E1WA 4AZBA 1S39A 1AQHA 1LTDA 5I3HA 4V27A 1HJUA 4HA1A 3O9NA 4QTGA 4PUWA 1XBZA 1ZQ5A 2I57A 2DP3A 2Q3RA 1VRDA 2BODX 1R86A 3K4WA 2C3ZA 3B9NA 5E93A 1F07A 4GGBA 2OYMA 3G1RA 2PGRA 2ZUWA 1Y7VA 4PZVA 2Q8XA 3R8HA 3P7YA 1M01A 7REQA 1UZDA 1AA1B 1JFHA 2Y24A 3JZUA 1XH2A 3KHDA 4AMCA 4RK8A 3N2BA 3EMCA 3QZ6A 4GINA 3OLDA 3KRBA 4F79A 5CPNA 1OZMA 5T8GA 3STPA 4HMEA 2I16A 1KBKA 1ISYA 1YADA 5AECA 1OFBA 3MP3A 5IBXA 3W86A 3IJLA 1EYEA 2Z1SA 1Z6KA 3I6TA 3MTWA 3NSMA 1I2PA 4RW5A 2CLFA 3L21A 4M3PA 3I4KA 1X6NA 3N2XA 3BICA 4OU1A 1AH0A 1FHUA 4HHMA 1QR7A 5I3DA 4R9XA 3UWEA 3K8KA 3H55A 2QKFA 1UR0A 1XLDA 3WY1A 1CI1A 4I9MA 1O5RA 1XLGA 3GVQA 3TE9A 1OG0A 3W2UA 2GQAA 1KFKA 1YDYA 5CBIA 1R2TA 1R85A 5A2CA 3RUBL 4B9ZA 2NUYA 3CMGA 1G4TA 3DESA 2XN2A 3N4FA 2AQWA 3QTGA 1I45A 4IIDA 3PWAA 1XG4A 1OFQA 2RAGA 1MMFA 1VFLA 3C2YA 3O6AA 4IUGA 4KKXA 3II1A 1Z32X 1DWIM 3ZMRA 1T41A 4K38A 4Z0SA 2AL1A 4AAJA 1PXGA 2QCEA 4A35A 1FXQA 3C0SA 9RUBA 1QNVA 1V4YA 5IRPA 4G2DA 2POTA 2A3CA 2CITA 3TTQA 1RR2A 3GUGA 5JBDA 1KCXA 2PGWA 2YFNA 1UKTA 4LGXA 2FIQA 3NQMA 1WKDA 3DHFA 5C7VA 2L5HA 1HKMA 4C6CA 3HQPA 1QOXA 3NQ7A 4C65A 5JU6A 4MB4A 3EWCA 3TC7A 4IMGA 3DBNA 4FIRA 2CXEA 3FJLA 3ARZA 2D0FA 5LNWA 3CS2A 2A2IA 4WY0F 3ZFHA 1EJRC 3APGA 4MDOA 2JGQA 1UASA 5ENLA 1NDYA 1V6VA 3G24A 3L2MA 5F2GA 2FGZA 4AZIA 4GNKB 3MDUA 5BWFA 2GK1A 3WDPP 3EWUA 1Q4NX 4JTLA 5BCAA 1SU5A 4IGHA 3SFKA 1OX5A 1VFOA 1CTNA 3SJNA 1TIMA 2G4JA 1HW6A 1FBAA 4WOZA 1VD6A 3LRMA 3LRLA 4LYKA 3ZIZA 3C0QA 4S2BA 2XGBA 2PAJA 1QDSA 3I3BA 1R3VA 4M56A 2AKMA 2BVYA 2WWCA 2QUUA 1I2OA 3AYVA 3H4GA 4LC8A 2I7GA 3V1HA 3AHVA 4XKMA 3ERPA 3I4EA 3KDNA 4C7GA 1BG9A 1PKLA 1TZZA 4NJIA 2GDQA 5JXQA 3EA2A 3SBFA 3GTHA 2BZNA 4GQRA 4FX6M 2CXGA 5M2FX 4XZIA 4AYSA 3STEA 4DO5A 1V6YA 5IHSA 4PFMA 1DBTA 2QNEA 2ACUA 1A53A 1S5WA 3UG5A 4DJFA 4JIEA 3EGJA 2AOSA 4HOXA 2IPJA 4GJ1A 5HNNA 1TREA 3BMWA 3TSDA 1B1YA 4WOQA 3KLKA 3N1AA 3R25A 1MVYA 2VX6A 4GQGA 1EEPA 3AXKA 3NPWA 4GG9A 3VDCA 2A21A 3WMCA 3G2GA 4WSHA 1LROA 4DLFA 1HGYA 4HA4A 4LSBA 1FCQA 2H6RA 3OVQA 4UZUA 1UOZA 2YBUA 3LHUA 4O16A 2G96A 4WJEA 1MUWA 3CNYA 1JEZA 3CV2A 1GVQA 3DN5A 4UFIA 4DWSB 1MW2A 1BSIA 4P61A 1W2VA 1W9PA 4GXMA 1R5YA 1TYGA 4HZMA 1BXCA 3WDRA 1VHNA 3TEVA 2GPTA 1EWDA 1UOKA 2E09A 4K3ZA 4FI4A 5K4ZA 1EDTA 4HTBA 1XRVA 3GFYA 3W7CA 2EXOA 4KFOA 1O66A 3B8UA 4W88A 1LL7A 1TE1A 3FHQA 2E7FA 1TX2A 3V4BA 4GC4A 4IQLA 3RCYA 3AYRA 1LT8A 2PTWA 5CH9A 4IP5A 2NV9A 2JEQA 3KBJA 3GUWA 1G67A 2EO7A 3FJNA 3JZEA 2WJZA 3L4XA 3UPMA 4WJXA 1OB0A 2VRKA 4DZHA 1GQNA 2HS8A 1US0A 3NVTA 3HPXA 4PN2A 1P43A 2ZXQA 1X96A 4W8AA 4QJ1A 1FTXA 3AS1A 4NHVA 4PBFA 1GQIA 4GXWA 4IGNA 4WXZA 3CUJA 3ITVA 1PTAA 1IGSA 1OADA 5EMJA 4WF7A 2I9EA 3ARTA 3P2VA 2IQDA 1QNSA 3OU8A 4XB3A 3TH6A 4EF9A 2Z00A 2CCRA 2WZEA 3SECA 4L1WA 3PVFA 4F2TA 3RJXA 3DFOA 4QNEA 4F0RA 2NQLA 3VMPA 1UR4A 1MEHA 1MQPA 4B2DD 4CQ9A 4IPIA 2Q71A 1GQJA 4AEFA 1V0MA 2X30A 5LNUA 1KM3A 1KCZA 3IJ8A 1KRMA 1DQUA 2E68A 3PN8A 3SCOA 5E1QA 5FEZA 1X8FA 1EF3A 5BRPA 2DDXA 3IVUA 3PTKA 5HWJA 1SR9A 3KW3A 2OYLA 4PTXA 2OQHA 2G5WA 3ABRA 4PMZA 1QW7A 4RXGA 1JULA 4IIEA 4UTTC 5TD4A 3S9YA 3KAOA 1GG1A 4EPBC 4EVZA 4Y2WA 1XSIA 2YL5A 2TSYA 3CPGA 4UOJA 4JHZA 1BWVA 2J24A 1MDLA 2IMRA 3ZT5A 4Y9OA 2WHJA 1KQZA 3CB3A 1ODUA 2PWVA 1HP5A 2OT0A 2Y7EA 3IVSA 4RNHA 1MWOA 1GZGA 2J74A 3R11A 4GLEA 1T99A 5REQA 1P1XA 2XIIA 5E70A 4BQ3A 4UUIA 2P50A 1UB3A 2JFEX 2X42A 4M1RA 3KCJA 4UNIA 3CM4A 1YDNA 2CWNA 3TSMA 2NT0A 4B5TA 3D47A 1NEYA 5ABEA 1UWQA 2UY4A 1HL9A 3BLOA 4BI6A 3N2OA 4ZO6A 4A3HA 5A6LA 3FV9A 1GZJA 1H7XA 3LCFA 4AD5A 4A8NA 2ZC1A 1RLDA 1QMLA 2H3DA 2CESA 1KXTA 3T1GA 3CL6A 4IFRA 1Q3NA 3GTFA 2E5DA 3IV8A 1HO4A 3BG5A 2BVTA 2C13A 1TPH1 3KLLA 5GQBA 4MTVA 3ATYA 3BLPX 3M1ZA 3TLQA 2NLYA 1E9YB 3VZYA 4AD0A 1UUQA 2W3ZA 2XWDA 4LT9A 4KERA 4RV8A 1B4EA 5CPLA 3V5OA 1MUCA 2E6YA 3PULA 5AY7A 3CWNA 1EBGA 4UTMA 1S3TC 3ZLGA 4B3ZA 1TUFA 3EX6A 4MWAE 4N9BA 3T9PA 4XAGA 4LBRA 1ZHAA 3KOFA 1DHPA 3GR4A 4IFKA 3W82A 3EA1A 1SM9A 5HR7A 4K36A 4RPQA 5CC5A 5HR6A 5G2IA 4IFOA 3GS6A 4IJRA 3UW6A 4BWLC 3UVAA 3N6JA 3TTOA 1QFEA 3O6YX 2PDKA 3MMWA 2DT1A 4C6IA 1M5WA 5KEZA 3QGKC 1DJQA 4DQWA 1P0EA 1KR0A 4N0RA 5CGQA 4FR1A 2DH3A 3WK0A 4DIAA 3GRIA 4AWUA 1CNVA 4JTDA 1J0HA 4DJEA 4UIOA 3WJWA 1FA2A 4YWIA 3LM7A 4PE8A 1UBPC 4ZMGA 3CHEA 4R88A 3M43A 1YPXA 3VGDA 1OC7A 2QT3A 1ZJBA 4PH6A 3KCLA 1UA7A 3N73A 5GPRA 2NXIA 3SR7A 3E2VA 4PTNA 2VCAA 1E72M 2QUTA 4JTGA 4V1XA 4D6IA 4H4IA 3DENA 4EAYA 4Q7IA 1OF6A 3LENA 4Y96A 4AX6A 3F2CA 1LF1A 1GORA 2ISFA 3TWAA 1M04A 1YTEA 2WHMA 2BLEA 4GBUA 1PKMA 1VJSA 4W84A 1MRAA 3RR4A 5E9AA 4CNSA 4JCLA 3P3BA 1R47A 1XLFA 2J7BA 2QCFA 2ATMA 2W63A 4G56A 3UPWA 2ZKMX 2JE8A 1WDRA 4IL0A 3S1VA 3A3WA 4DJDA 2YZRA 1M7PA 5XINA 1Q6OA 1EX5A 4A29A 5EMUA 4B3KA 3LXAA 3IGHX 4UR8A 1PAMA 3PZOA 3SCRA 4QG6A 4NXKA 2OB3A 4WDWA 5DRCA 4L61A 2CZVA 4TV5A 4XIMA 1EZ2A 1Q7ZA 4Q8MA 3H70A 3N9KA 1CCWB 3B0UX 3WH7A 4RE0A 2B7NA 3VIPA 3L4VA 4Q6XA 2X05A 4GFSA 1AD1A 1P0KA 1XX1A 3QVQA 3O8AA 1OSEA 5DT5A 3GG7A 3KBWA 4AVOA 1YNPA 2GL5A 1OZQA 3GHUA 1CX9A 4AXKA 4O10A 2XFWA 3GSMA 3J7HA 3LV6A 5H8UA 4TU1A 3S6TA 3GNNA 3T0CA 3QMSA 1V0NA 5FF0A 3GQYA 3UNDA 3G1HA 4NNBA 4W8BA 3W00A 1R0MA 4Y6GA 1PIFA 4PYSA 3RITA 1UP0A 1TMQA 5LIXX 3VCNA 1GYLA 2HE8A 2FDSA 1EF2A 4ZFCA 4EF8A 4H9YA 3CTLA 3RGTA 5MKGB 3M5VA 4DXXA 1TVNA 2OZ3A 1QAPA 1UD4A 1DWAM 1WA3A 1SZNA 4HPXA 2Y89A 3AIWA 4RZ5A 3CUZA 2EJ1A 1MQRA 4FO4A 4RDZA 3HG5A 1O5KA 4Z1BA 2FYMA 1N55A 2VFIA 3CHVA 4LRSA 4MJZA 4XIAA 5H6HA 1LRTA 4UQEA 3PP7A 2J66A 2Z25A 3SZ8A 3L4WA 1N8IA 2OJPA 1ZAJA 4DJFD 3S1GA 2NUXA 3TLLA 1F3XA 4A3YA 3MVTA 3S2LA 1EC9A 3EXSA 2Q02A 3S9IA 4NIRA 1UROA 3EKLA 4NVTA 2DSKA 4PMJA 3G77A 1O12A 4HU8A 1EC8A 1XFCA 2R6OA 1WYIA 3GHRA 2W4XA 1KW1A 2O9PA 3SCNA 3R0DA 4KW2A 1BGAA 3TR9A 3WEZA 3PK7A 1YBQB 1IF2A 1GG0A 4GI6A 2WC7A 4PTWA 4IPPA 3TDFA 1VFFA 3OLGA 1J2BA 3BLIA 3TU9A 2XN0A 5FL0A 3XISA 1W5MA 3AYSA 4UB9A 2PZ0A 3C8NA 5H91A 1OX4A 5HJLA 1XLMA 2Z28A 3B4UA 3PM6A 1WZAA 4LVDA 1ZLPA 4HA0A 3WCZA 3BANA 1OJXA 1KCLA 3CHFA 2VWSA 1ONXA 3H22A 3BAXA 4O0QA 1UKOA 1Y65A 3RK8A 3THDA 2CLMA 4EXBA 2WQPA 2REQA 1PZ3A 4GX8A 4B5VA 1NAL1 1O1ZA 1QK0A 2KX9A 4IIHA 5C7HA 5BXPA 1X6UA 1G4SA 2R94A 3MCMA 1WZMA 3DFNA 1FWNA 4HOWA 3OQ8A 2Y62A 2OLSA 3GBDA 4LVBA 4MM1A 2ODOA 2Y85A 4Q4SA 2YDAA 2PDFA 4IJCA 1SO5A 4QITA 4E4FA 3UJFA 1XKYA 1PL9A 2ACRA 4RJEA 4BF7A 4MMWA 3BL3A 3NQDA 4U3CA 2WMFA 2F2HA 5F2IA 4R7WA 3T09A 2CBIA 4ZQOA 1H7NA 4LYPA 1US3A 3WNNA 1U5JA 1TIWA 3LBMA 3DFHA 1HJXA 3NPXA 2J27A 4LH8A 4AD4A 4MY8A 4TOQA 3BZGA 2ZZ1A 4IX0A 4DY1A 2GGGA 8XIMA 4ZQCA 1V3KA 4C5YA 1EJVC 1NF7A 3GDTA 3OG3A 5B7YA 4HPNA 3OGRA 1LP6A 2JEPA 2I17A 4V1YA 3SCQA 2ZOXA 5TQLA 1UWAA 3VD3A 3WLNA 1Z69A 1K8YA 1RY0A 5A6MA 1WO2A 3M7SA 3U7VA 2HE5A 2R1PA 4L6OA 1OK6A 2DW7A 4R53A 4QISA 2XH0A 1W1B1 2P0IA 4FLSA 3T0BA 3MV01 1JDAA 2WHLA 3VVGA 5T91A 1H7RA 3O15A 4PUUA 2NSXA 1C3FA 1VB9A 4O57A 3AXXA 1DIOA 3T78A 3TMQA 3W7KA 4J7RA 2DJLA 1V3IA 1EWEA 2EG8A 2CZFA 4JKKA 1EXBA 2YIHA 2VYOA 1XGZA 3GG8A 2BS9A 3PUOA 1AODA 4H9MA 3TNBA 1V08A 2PLCA 4WDUA 3QYQA 1C29A 1WE5A 3TYUA 2YBTA 4UOQA 3KOYA 3IANA 5F2MA 4Y8FA 3W6YA 3F2BA 3ZR5A 2DY3A 2ZX5A 3P0XA 4KGJA 5G5IA 2EF9A 4MY9A 3M44A 2X09A 4F4RA 4AUBA 4H6EA 4O12A 3QHNA 1AMYA 2ZC8A 1ZPTA 4WY0A 3V16A 3PJWA 1R46A 3T0AA 5D2VA 1OFRA 4XK2A 5G1TA 4ZCWA 5MHBA 5JVLA 5IBXC 3FJ6A 4HSOA 2CU0A 1OX6A 3LLXA 5AYBA 4B5WA 4F66A 2WWDA 1I1WA 1EPVA 4K8GA 4D6JA 3ENLA 1BKHA 3S3GA 1GOKA 5HQLA 4IQDA 2VZUA 2QCLA 3AZTA 4GZJA 1JPIA 1PS9A 3OIHA 3QTPA 4JTIA 4KEVA 1WUFA 4Q33A 1W9VA 1S2AA 4DN1A 5FIPA 2PDYA 3AIBA 2XSBA 3BK0A 2FJKA 4NZJA 2PDBA 2GVYA 5I6SA 3ANVA 4IUOA 3GY1A 1DJZA 4NZ4A 4I6KA 3RAOA 4GJIA 3HJEA 3PR2A 3VD4A 1NFGA 4IMAA 3ZWTA 3CQ0A 3RR1A 1CGWA 1KRCC 4L5ZA 2JKAA 4YHGA 1BYAA 3LCXA 2R1LA 2WCSA 4QE4A 2FGLA 3VU2A 4LBUA 4GIYA 4L9XA 1E1FA 1AQMA 1ME7A 3DFQA 5TIMA 2E9LA 1FWHC 3FGCB 3VM7A 1MFVA 5LA0A 1CXFA 2VELA 1VYSX 3TCSA 2GGHA 3BWWA 1D7FA 2WMJA 2GUYA 1VEPA 3TXVA 3F4WA 4LY4A 3LNPA 3AZRA 1TWIA 4PMQA 3L66A 2XPKA 1R3SA 2D24A 2DZVA 4UQAA 3KS6A 2BXZA 1GOQA 4G7EA 4N02A 3IK4A 3NZPA 3XINA 2W61A 4WR3A 4X0VA 4GACA 1J01A 2CIPA 1RP9A 1TKKA 3LU2A 3N9RA 4DWSA 1FFQA 3U5YA 5DMYA 1Q63A 1RBLA 2JKEA 3VMOA 2YCEA 2VZVA 4MWAD 3VX0A 4DJDD 5I7GA 3TCEA 3NZGA 1Q4WA 3SRHA 1FWEC 4YHEA 2WMHA 5JBEA 3LTYA 4UTKA 5HBFA 4Q7BA 3EWDA 3GXTA 1RPKA 4GK8A 1FQ0A 2BOFX 3BXWA 1R3QA 1G1YA 1F5ZA 1QI4A 2E9MA 2WB5A 3EDEA 4AX7A 2OYKA 1JCJA 4BZYA 1RSCA 3IIZA 1XF0A 1GYNA 3WH5A 1Q7QA 1EJWC 4F9JA 3W1RA 1NWUA 4EP8C 2A3AA 1TRIA 3PTDA 1X1OA 4IG2B 3OEXA 4NL1A 3IAPA 4RCXA 5H1WA 1EZWA 1J0KA 3L5AA 4IPNB 2V67A 3VPLA 3EDDA 2PRHA 4M6PA 3LK6A 3SURA 4NQ1A 4GVHA 5C5YA 3NYDA 1S46A 1KFEA 5D9NA 1P6CA 3E6EA 3EWZA 5LIKX 5CZ0A 2G0WA 2QPXA 5CG7A 4DJFC 4MUPA 4GGHA 3P74A 2CERA 2CBJA 3DOPA 3A22A 3GH4A 4LUYA 1XIIA 4ORIA 1NP2A 4PMUA 2ZVIA 3IACA 5D9MA 2PFHA 4DPQA 2HVMA 4IQEA 3F7JA 5EB8A 3B97A 3VD9A 5A6KA 4L6DA 1E55A 4JFUA 4MB1A 3OHIA 1Q6QA 2J6XA 5HOSA 4WRHA 2DPEA 2G97A 3QY6A 1B3WA 2XUCA 4V2XA 5DANA 2F6UA 3TJLA 3VGEA 3VAVA 1KC7A 3MY9A 1AG1O 1GEQA 1O60A 3WK1A 4F0MA 3THCA 2PWGA 8CGTA 2V2DA 3QC0A 2J9XA 3WNLA 2OSWA 4ATDA 5DT7A 1DHKA 4Z17A 4KGLA 3JUGA 4QAIA 4PEKA 3N4AA 3MSDA 2Q09A 3L4YA 5CPQA 1XM3A 2G3FA 4BJHA 1LBFA 2D2HA 4X3ZA 4FOUA 1NWTA 1LM1A 1FWRA 3W7RA 1K7FA 4FPSA 1VIZA 5EGRA 3CHCA 3HG3A 1F6PA 3WQ8A 3TQPA 3FNDA 1L6FA 2PWFA 4PCPA 4YIWA 3WNOA 1V6TA 2E40A 2NQZA 4MAZA 4ERAA 3KRUA 3GR7A 4GQQA 2IUZA 1U1UA 1DQXA 4J2PA 4LUIA 1JYNA 3GC4A 1IXPA 3ARSA 3QM3A 1UD8A 2VQTA 4DI8A 3TW6A 1C8XA 2GSHA 1BF6A 5LA2A 4O11A 4GYPA 2FJUB 3DC0A 1DE5A 3M16A 3ZJ8A 2W67A 2V2HA 2RGLA 3UXIA 5BOFA 4JIIX 3WF2A 3CH9A 1IWAA 1ZGDA 4KS0A 1DEDA 3UY7A 5I06A 1A50A 4RZ4A 3URQA 1MXGA 3C2OA 4HMDA 4C91A 2G8ZA 1A80A 5KZEA 3EWXA 1KV5A 2W92A 4PB3A 1MEWA 3P8IA 4JIPA 2VC6A 4J27A 3WF3A 2HROA 1IR2A 3W28A 5G1YA 2ZDRA 4B15A 4LQ1A 4IXXA 1OFOA 4UWMA 3TR2A 3B04A 2CLIA 2YCJA 3T8QA 3G1YA 4NAEA 1A3HA 5IOBA 5I09A 3D46A 1REQB 3W1TA 4K8EA 4CEXC 2A7PA 1ISZA 2VXNA 4PL2A 4LF2A 1OBAA 1I6NA 3EWWA 4JTAA 2YDSA 1OCBA 4YL2A 4DBEA 4UQBA 2V9DA 3HGOA 5C2XA 2XWEA 1P48A 2AQVA 1BRLA 1X7FA 2ZCGA 4HMNA 4PRTA 4IQJA 2PTXA 2QUMA 3LHTA 4LY8A 4LX4A 3SGGA 4IF2A 1DIKA 2X1SA 4Q4RA 2OVLA 1TB3A 3T2PA 3TN4A 3HGRA 4IIGA 1GQKA 4DF1A 2OXNA 4HNNA 1FWGC 1CW2A 3N2MA 5J8LA 2VVSA 4HVXA 3WQVA 4JKLA 1SQ7A 2DVUA 1DJIA 4DZIA 3T44A 1UUMA 1FCVA 3W1LA 3QPEA 1RA0A 3F2DA 2WNZA 2VC5A 2E67A 5HUOA 2R1MA 3GG1A 1BYBA 2BY2A 3S5NA 5FI8A 1G0CA 3SN4A 4B16A 5HWMA 2Z7KA 1Q6EA 5E5CA 3TUUA 1RLCL 1UC4A 4JZ5A 4M29A 4DX3A 4H00A 1T40A 3OTRA 3WLJA 3NQCA 3NO1A 3P0WA 3NGJA 1DJNA 2HTMA 2VNCA 1LBLA 5FJRA 2EAWA 3EBVA 1XINA 3C3NA 2V3EA 5DXXA 4RDVA 3MUZ1 1B9BA 4DUXA 3P93A 1V3MA 3ARWA 4XD5A 2WKJA 1NU5A 4A3UA 4OZOA 4YYCA 1QO5A 4ZA0A 2E6AA 1TPEA 2C0HA 1UP3A 1Z8AA 4QE5A 3ARVA 4ZGYA 4D6DA 1PKNA 1R87A 7CGTA 5CSYA 4G7FA 3GVRA 1ZB5A 1KKRA 2PD9A 3PS7A 2OFJA 2OCZA 1ALDA 3LERA 3HTWA 4DJEC 1R9YA 2V0TA 3MI3A 3G8RA 3SQMA 1IT8A 2Z6IA 1YIXA 3ZQ9A 3GC2A 3TK7A 3BGGA 1KFWA 5GJNA 3NPUA 3UJ2A 4EK7A 3BQ5A 4H04A 1US2A 1TPVA 4YTUA 3A6OA 5A6TC 5CKSA 1I75A 1R30A 1XLIA 3OYXA 1QJWA 4GCAA 5DN1A 1EGMA 4NASA 5TBOA 2HK0A 3AFBA 3WBEA 2XHYA 2GJRA 3FY1A 3Q94A 3AS3A 3SUTA 2JKPA 1ECEA 3ARUA 5AC8A 2E6FA 4UXDA 5HMFA 1R3TA 3WEMA 3QYSA 2DH2A 3PJUA 3WK3A 5MKGA 2BY1A 2I14A 4QJ5B 1UR9A 1A49A 5T9BG 3K8MA 4KCUA 2GVGA 3CZJA 1F6YA 4PSPA 2F7FA 2OQYA 5F1VA 1XIBA 1YXYA 1OGGA 4GI8A 4LAZA 1A5BA 3KOWA 3AU6A 3VGFA 1UIPA 3AHZA 4R9OA 1NQ6A 2AL2A 4MUZA 4J40A 4X9SA 1D2KA 2VVNA 2Z2UA 1EUNA 5ECVA 4N7QA 2HRWA 1KM4A 1IEVA 1M9HA 1I2NA 4KBXA 1KQYA 3RF9A 5CZTA 3W1QA 2YCIX 3CJPA 4CCZA 4QR6A 3EEGA 1E70M 1AQFA 3QQ0A 1JZ5A 1ZCOA 4QFUA 3AXIA 4K37A 1IXQA 2QCCA 4M5PA 3U57A 4F3HA 4JD4A 2CPUA 3NQ6A 1W1ZA 2E6DA 5G2HA 1I1XA 4YWSA 2PEVA 4YNGA 2QCNA 3TOPA 2BP1A 1XGDA 4LXFA 1HJWA 4Z2IA 2VX7A 3UNTA 4MB3A 2BOGX 2GUBA 1BYCA 2A7NA 1ZTVA 1W1IE 5SWUA 2FQIA 3XIMA 2WPBA 4CD8A 2VRQA 8TIMA 3K1DA 1UZHA 5HMSA 5BRBA 1JYXA 1RCQA 1JXJA 2FMOA 1R9XA 3VXGA 3THUA 2QJIA 1M6JA 5KITA 3U2ZA 4YU1A 3BE7A 4XBKA 3W2MA 1YXCA 1JYWA 1QTWA 3FXGA 2YBVA 1Z7AA 4EWJA 4J3TA 1TV3A 1TWWA 3PBVA 2R1KA 1HKVA 4MY1A 1RJPA 2I5QA 2ZA1A 2QZRA 4TX6A 2BY3A 5A6BA 2ZUMA 3BLFA 4XZWA 3NQ2A 3A21A 3W37A 1NY1A 2JIEA 1P5BA 3QR1A 3I65A 1HXJA 4PBEA 3DGRA 4YYFA 3WDQA 4DNMA 3D6NA 1TA3B 3CB8A 1V02E 4JX5A 7REQB 3CIXA 1W8GA 1H2JA 5D33A 4GA8A 3NEHA 4QSFA 1M53A 3GK0A 4JAWA 2FPVA 3UWUA 5RUBA 1TTQA 3VKCA 5GNXA 2Z1XA 4I90A 1L8PA 3I68A 4LV4A 4MVAA 4HN4A 5IFPA 4C6OA 3OG2A 4O14A 1J11A 2W5FA 3PBWA 3GHTA 4H1ZA 1GPFA 3GXIA 3FLUA 4QLJA 3BAIA 4GNJA 1F76A 3LCHA 2EKCA 1OCJA 1RJRA 1T8XA 1H09A 2X2GA 4PR4A 7ENLA 4N9EA 3TJXA 4OOUA 4RNFA 1JCMP 4WXYA 1SZFA 1VPQA 4H7CA 1F8IA 1SFSA 4DO4A 5DLCA 2ON3A 4Q4KA 3EDFA 1QNOA 3MUY1 4E2OA 3IPWA 4U3AA 4ZB0A 3MPGA 3U7BA 3KOXA 3MCNA 4FX7A 4AWEA 1A3WA 1FH8A 1KFJA 2WCGA 4ICCX 4OE7A 3UJEA 3LCGA 4B5SA 3LRKA 3VO0A 3TW9A 2Y5SA 1SJBA 3R79A 4Z1DA 3KEHA 3AUOA 1ZALA 3QOKA 3P8JA 3NL5A 3SAZA 5BMWA 2ABBA 3NA8A 3KZPA 1EA9C 4XBSA 4ZQPA 2WBGA 1VQTA 1WP6A 3IIOA 3S5YA 5I78A 3T4CA 3W7MA 3DEQA 4ZZ9A 1B54A 2VFGA 3AJ7A 1X38A 4DNHA 2CZDA 3VOIA 5KMYA 2CLHA 2OX4A 4IOTA 3OIXA 1A3XA 7PTDA 1X98A 2W9MA 4YMZA 2GK1B 3VIIA 3BGJA 3TP4A 5HWNA 3EOSA 4DPPA 3DI0A 2AMGA 2CC0A 1ZP4A 3WLIA 5HNTA 2P0OA 3RDKA 4TVDA 4R34A 1BEUA 3S4TA 4ZOBA 3BO9A 4Y9PA 1B3YA 4JIQA 3R94A 6REQB 2TODA 2FHCA 1XCXA 3BAKA 4CD7A 1QBAA 3PB0A 2FTPA 3W25A 1I2QA 2WZHA 2QJHA 4ACYA 3LSCA 3UG8A 4DB7A 3EB4A 4JX4A 3N6HA 2NT1A 4AY1A 3QGAC 4JGDA 1QW9A 5DCDA 1MW3A 4C6QA 4MPQA 4KWWA 1EJSC 3OLEA 2X41A 3GW3A 4DLMA 2EJAA 4X2RA 4QG8A 3P67A 4LVAA 2RKXA 1HX0A 2DZTA 3FK4A 3KDOA 4AFYA 5IXEA 3NFUA 1H63A 2OGYA 3PHAA 3UBPC 4JX6A 1AFSA 3A12A 3EOUA 1FUYA 3N9SA 3VKBA 2E4TA 2SFPA 4FNRA 3DH7A 4G5DA 3M0ZA 4RPPA 4H8VA 4H9ZA 4OJYA 4CQAA 3DGBA 3ARQA 3DG3A 4UC5A 5LZLA 3V75A 1E5JA 3ZS4A 3E2QA 1XLLA 2A7RA 1BFNA 2OMAA 4H8HA 3NQGA 5AC4A 3VIFA 1P7TA 3SN1A 1AW1A 1SUXA 1YX1A 5CLWA 3GXDA 3IRSA 1B2YA 2FZ9A 4H6QA 3AQUA 2DVTA 3OO2A 2OKOA 4LUTB 4MG4A 2J13A 3I7QA 3T2QA 3H21A 1CXKA 3GU2A 7TAAA 1ISWA 2IKIA 2FMNA 2ZICA 5BYWA 3W75A 4MNJA 5HPCA 5BNKA 3U3HA 4J1OA 1DXEA 4FAMA 1XBVA 3G0SA 4PUJA 4FHAA 1TMLA 2WVSA 3A9IA 2DUZA 3GC5A 4GUGA 1YLVA 5I77A 4GUFA 1BWLA 4FB7A 2MANA 1KWKA 4TMBA 1QCWA 3PAOA 4RNJA 1S2VA 4IG2A 3N34A 4ZQMA 4MJMA 1UHVA 5G1MA 4I9AA 4MAVA 1SYTA 3EEZA 4U31A 3WQ6A 4GY1A 2OEKA 2ZDSA 4HHLA 4YVPA 3W6LA 1TSIA 1Y5WA 3IARA 2O7SA 2YL8A 4IH3A 2DORA 3GWQA 1E1CB 1EP1A 2W91A 3QFEA 4A6GA 2P88A 3OYZA 2VEPA 2BWGA 1FWJC 1W9DM 1QUMA 2OGJA 1XIHA 3C2VA 3SADA 3ABQA 3WG6A 2CNCA 1E3XA 1JQXA 3CEUA 2PUZA 1PDYA 1L6SA 3IGSA 4NILA 5C2CA 4PUMA 1E4IA 3T81A 2OO0A 3GFZA 1JGMA 4ZE5A 5DXYA 1OT1A 3BOLA 3U0HA 1OM0A 1I0DA 2INEA 4ROPA 3LHVA 5HANA 4YVXA 4P8XA 3N18A 2X8RA 1BTCA 3ZM8A 2PF0A 3V0UA 4LNYA 4DWSC 5IM51 2ZRUA 3QSRA 4BKNA 4CD6A 4AZ5A 3HG4A 3MMUA 1TFVA 4W86A 3QY7A 4HK7A 5FF7A 4Z2JA 4N4PA 3MHFA 4RDYA 4I5XA 3GDRA 3TC6A 4OBTA 3QHOA 4GWEA 1YPIA 3SCTA 2C79A 4GRSA 3SIMA 8RUCA 1POJA 1KLYA 2GVLA 4TX9A 2Q3OA 2PZNA 3PG8A 4BQ2A 5C2GA 1PTGA 5REQB 4WSJA 3PB2A 1RA5A 3G1SA 1QT1A 4XAPA 3L12A 1ECQA 4PGLA 4IGSA 4LNCA 3ES8A 2QV4A 1TQJA 3PTMA 3O16A 4XZHA 4C6KA 4O19A 1H41A 1FWDC 4E2BA 2QGYA 3QZAA 2BHUA 4XTIA 2NWSA 5CZJA 3H6OA 1V0LA 2D23A 4GXPA 2CLEA 4NJHA 2O4MA 3EZ4A 3VCRA 2LLEA 4K8HA 1F3TA 4KH2A 3T7VA 4JIRA 1GKRA 4QE1A 2RGMA 4FIQA 1G6CA 3M0KA 5A8NA 3RLGA 1C90A 2VL4A 2HVOA 1VFSA 4WD0A 1U30A 1R2SA 1AK5A 4M82A 4BA0A 3NZ1A 1GJWA 4PODA 1HFBA 1EH9A 3NOEA 4DUWA 1MNZA 3HBLA 3NJ3A 1U2YA 4WQ6A 3WELA 4XZBA 4NXSA 4L4LA 1WAWA 4IFKB 1W1YA 2G3MA 5FF2A 1YNQA 1OYCA 2OOFA 3DX5A 1QPQA 4M0XA 3AIEA 2X1UA 1KXVA 4YLWA 1LWHA 3PZUA 2FPYA 3IEBA 1LL4A 4LEFA 5BXRA 3MS8A 3MC5A 3WN6A 4CNNA 5D2WA 1EOKA 2IKHA 3ONBA 1CYGA 5AHLA 3SRFA 2CKSA 2HISA 3EOEA 1S1RA 2VQUA 3RM4A 2TPSA 5PTDA 1REQA 5C9UA 2A4AA 2BVDA 1TCDA 3D0CA 1NF0A 3ABXA 4HT3A 3K4DA 1JDFA 4DF2A 1RXOB 4NAFB 2QAFA 1S2TA 3NL2A 3T0DA 4GPNA 3VUPA 3N15A 1PUDA 1LQ2A 4EOUA 1OFEA 1LJYA 2DSWA 2ZUTA 5CPMA 3OB8A 3ZVHA 3LCIA 1MSSA 3C4UA 2RH9A 5I0DA 3UYCA 2QR6A 3RX2A 1D7KA 3BURA 2YCLB 2HZGA 1LUCB 4AB4A 4ICMA 3W7JA 3M7WA 1W3IA 2ZUNA 1E1EA 4CNUA 1L2UA 3AOFA 3OZMA 1TZ7A 1IT0A 5DMNA 3QW4B 4LUSA 3UVIA 1DWJM 3FN9A 1RP8A 2EPOA 3P60A 2OO6A 1H60A 3GXFA 1SW3A 4XZ9A 3CASA 1LCOA 3LSBA 3GD6A 3W4RA 3GVGA 3QEZA 4PMYA 3LPGA 4XUYA 4PMNA 2V81A 4AZCB 2GFTA 3FAXA 4UCFA 3EPMA 3L5MA 4O1CA 4JTRA 1FWCC 3AS2A 2V38A 3S2CA 4B90A 4MOZA 4JTCA 3CZLA 2YLLA 4UR7A 5D9PA 3D3FA 2WJDA 2HNHA 1GHRA 3LMYA 1SVDA 4G9PA 1TJRA 3GBEA 4O17A 1ZCCA 2PDWA 3WNMA 3I3DA 5A6AA 3V5FA 3QR3A 1UKSA 3TQVA 1Y8BA 2Z4GA 1XIDA 2HK1A 1HL8A 4WKAA 1VCVA 5ABHA 5I3FA 2NXHA 3TYBA 4MLRA 3LM3A 1LQ0A 2D20A 2HV5A 1W3HA 3CUXA 5HXMA 2Y61A 3UR5A 4B4FA 3VKAA 1R8LA 3Q65A 4M51A 3MSYA 4FF7A 5FESA 4DBSA 3MBFA 1E56A 3M4HA 1J6PA 5EL1A 1JDEA 4H8NA 1FKWA 3TSBA 4KT2A 5CPTA 1EO7A 3DYMA 2EPLX 3UF9A 1U33A 3S46A 4CNOA 1PYMA 3BQ6A 2J7GA 1P4CA 2DZAA 4CQBA 4QJ4B 3L9CA 1B4KA 1TV5A 3S2NA 3WENA 5I3KA 3P62A 3ITCA 1QI2A 2EEXA 3H53A 3S5ZA 1UPPA 3LYEA 3MKCA 3QN3A 2A0NA 1H0IA 3WLOA 4WZHA 1TPUA 1W37A 1UIOA 3B9DA 2A3EA 3ORWA 2V5BA 3OGSA 1W31A 1QHPA 4BI5A 3MKKA 1E0TA 4WIWA 1KKOA 4NNCA 3UZXA 1XLHA 3GXMA 3PUDA 2WMIA 2CZ5A 2NX9A 2NVDA 2GJNA 3TNOA 5FAGA 3CC1A 3PAJA 1POKA 5AHEA 4KWOA 3GFXA 4H41A 1HGWA 1RCOB 1S2UA 4MNMA 4UFLA 5EFFA 3LTPA 4KEZA 3GAKA 3CV7A 2E5BA 3FVDA 3TMLA 2X1RA 2V82A 3A3XA 4XKYA 1F9CA 3GNDA 3AXMA 3I7SA 2YR1A 3ARYA 3NSXA 1QWGA 3DFPA 4HSHA 3B0VC 1QVBA 3VOHA 3O6DA 2YXXA 1ICQA 1YQ2A 4JFWA 1JPKA 3HZ3A 3V36A 1DKWA 5BRQA 1E15A 5LHEA 1SSDA 3E0WA 3MMDA 2BMBA 3YPIA 4C7FA 1OX4B 4IL2A 4WKHA 3WZ0E 5JMUA 3H23A 3U8GA 3EX4A 2WM0A 2QJJA 4N9DA 5HK4A 3GHSA 4MDPA 4L65A 4UQCA 3MBDA 3W1UA 3E0IA 1T7LA 1KCKA 3VDAA 2ZTJA 3KRZA 3W6MA 2AAMA 4BFAA 3PJTA 4XAYA 5CJNA 4NG3A 1E40A 3PBMA 1JZ3A 4GMEA 2Y8VA 3BAYA 4WKFA 3FDGA 2QDGA 3NQ8A 3T6CA 1GZ1A 1FX6A 1E0WA 5C9ZA 4IP7A 4OVXA 2FPTA 2WNQA 4JKMA 3VKJA 4B4HA 3KL5A 2DIEA 3NXLA 3ID7A 2OWCA 3GDKA 4AWSA 4WJ8A 3HF3A 3EPNA 2Z6JA 5HATA 2GWNA 2VMFA 4F9DA 3CAWA 5CC7A 2CHOA 4M6QA 4REQA 3LQLA 3DXIA 1TA3A 4OFCA 3N04A 2VZTA 1W6TA 3VIHA 3NL6A 5DY3A 2OLHA 2ZUUA 3VNKA 3LCLA 2Y8UA 4TR9A 4NSBA 3MT1A 1S2WA 5I3GA 5LNVA 1WNOA 3QMTA 3MHGA 3K5XA 2CZEA 4L4PA 4M6UA 4DWDA 5AKQA 4O50A 3B8SA 3ITLA 4GNVA 3WBAA 2FGBA 1N8FA 2CBUA 1W8SA 1VFUA 2GOKA 1B5TA 4E5TA 4AXNA 1A0EA 4GD0A 2V5DA 3TOYA 2NQ5A 5C9WA 2QPSA 1KBJA 1BF2A 4Q8TA 3K30A 4HP5A 2NV1A 4HNVA 1JGIA 1XYMA 4F40A 4GI4A 2VC7A 1SZGA 4FA3A 3W29A 1LLOA 3AHTA 3S83A 4FXSA 2FTYA 4XZMX 4IISA 1DTUA 3MI6A 1DPMA 3ZWSA 3NZQA 1RV8A 4ZL1A 1L6WA 5CXPA 1D3GA 2ZZ3A 3Q45A 3ZJ6A 3NL3A 2XFYA 4UTIA 4MKSA 1AW2A 2V5LA 1TX0A 4MKNA 2NQ9A 3KUMA 1B0IA 3KFTA 1W1VA 1W2PA 4GH3A 3H24A 4TTGA 4ZXOA 4O1BA 3WQ5A 2QDDA 1QBBA 2A6NA 3H54A 1VS1A 5A8QA 3W1XA 4U2ZA 3R0UA 5LNSA 3TN3A 5ABFA 1Z44A 1GVEA 2X1IA 2P8CA 4UTWA 3LXBA 4LVGA 4E2VA 4ML4A 5BOOA 1XLCA 5FA5A 3BLEA 3W3OA 4UFKA 3DYPA 2ESCA 1RPXA 1VPYA 1CWYA 3RM8A 1K8XA 4QQ3A 3A9BA 2C1IA 1QATA 1C92A 4P7NA 1E43A 3G1VA 5EA9A 1PO9A 2A85A 3G22A 4WY0B 3BOXA 3M07A 1TPC1 3BDKA 1C9DA 2Z1WA 3T08A 4HYRA 3CO4A 2PMQA 3WDIA 4NF7A 3WL1A 1FFRA 3BAWA 3VNDA 4AIEA 3GVWA 3MWCA 3NDYA 4ZB5A 1E3ZA 3VCCA 5K9DA 3ITYA 4F8XA 4Q8OA 5HA7A 3HFTA 2DZUA 1GKPA 1N2VA 2DGAA 3L23A 4AZ7A 4CU8A 2BNJA 2YYUA 3L2IA 4LAUA 1NDWA 3AIUA 2X0YA 4WDTA 4PTDA 1EDQA 3CBWA 4S3KA 3HN3A 3LHZA 4LCSA 3SUWA 2XZ9A 5KTLA 4JYEA 6REQA 3RX3A 3UETA 1M7JA 1MYRA 1TV7A 2Z2BA 3A24A 2O55A 3UU0A 3ZJKA 4O0ZA 1FH9A 3TX9A 3B9EA 3S8HA 4GFIA 3MUCA 3SUUA 4NI8A 2V2CA 4Z1YA 1JIBA 3W27A 3N11A 1I9CB 3WDHA 2WVUA 3MYPA 1F05A 3P5YA 5CPOA 3R2GA 1RALA 3TA6A 4AZHA 8A3HA 3I3EA 1KXQA 3WFAA 4D6FA 4HA3A 5BWAA 3UGVA 4HJWA 3W76A 1TWDA 2Y88A 2V8ZA 4KCTA 4QSHA 3W01A 3AIQA 3GX9A 4GC3A 3M0JA 4XISA 2BASA 4TQTA 3RHGA 1KGWA 4CN1A 4AEEA 5FEXA 2VZOA 4O8AA 2J88A 5F7UA 1A4MA 4QCEA 4C1LA 1KFLA 2A5HA 4G7EB 3SN0A 3AU2A 3E1F1 5GNYA 3ALFA 4LU0A 2ZX6A 3GE7A 1NWSA 3M0IA