4YLWA

Crystal structure of human dihydroorotate dehydrogenase (dhodh) with no.33 compound
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
364
structure length
363
Chain Sequence
GDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human dihydroorotate dehydrogenase (DHODH) with No.33 compound
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Dihydroorotate dehydrogenase (quinone), mitochondrial
total genus 139
structure length 363
sequence length 364
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2015-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4ylwA00
4O52A 1W5NA 1EP1A 2A1YA 1ME8A 1IGSA 3G1HA 3PBWA 3PUDA 2GQ9A 2C19A 3NNTA 1KFBA 4GUGA 3EWWA 3L67A 2R14A 3PG9A 2PRMA 3RMJA 3UWUA 1O5KA 4K8HA 3W7QA 1FQ0A 1T8XA 1PV8A 2PRHA 1KW1A 1W5PA 4IMFA 5L6UA 3M47A 4O53A 3LLDA 4LVDA 3M0ZA 1PIIA 2ZBTA 4ZQPA 5IBXC 1FDJA 4AWUA 3Q58A 3NQEA 2CLLA 1JQXA 3DBPA 3LTPA 2FPTA 5FEXA 1AW5A 1W5MA 3BLIA 1P0NA 3KRZA 3P82A 1JCYA 5C55A 3GR7A 2E68A 1OFQA 3G0XA 4J9JA 3MMTA 3PM6A 5DXXA 4EIVA 3O07A 1L6YA 4FNSA 4O10A 4JDYA 3H53A 1W5QA 3C52A 4OU1A 4HSNA 3C61A 1DVJA 2J6XA 4AHQA 5T26A 1ME7A 1TCDA 4TMBA 3YPIA 3GX9A 4M7TA 2RKXA 2JK2A 2NUWA 3W1LA 3S8HA 2QUTA 1TQXA 4L4MA 1XI3A 3TW7A 2ZA3A 3BW4A 3W7IA 4QNWA 1JR1A 1X1OA 3C8FA 5FF7A 4H3DA 2YSWA 2Z2UA 1AMKA 3W2KA 2V81A 1HUVA 4JXCA 1H1YA 2VFGA 1TTIA 3G1XA 3M5YA 1VH7A 4QM1A 4UFLA 1EB3A 3OVPA 1OF6A 4A3UA 1SR9A 1XM3A 4BR1A 4UMAA 1DORA 1V5XA 3P5YA 4GNJA 3VI2A 5BRBA 5FF0A 5FEPA 3W83A 2WO5A 1SO6A 3F1QA 5F2MA 3NPXA 3ABSA 5AHFA 2VKZG 2ZA1A 4NJKA 1D3GA 1SO3A 2Z6JA 5FI8A 4BI5A 3JS3A 2PE4A 3G8RA 3W75A 1IIHA 4O19A 2X1TA 1U83A 4N6EA 4ONVA 2F84A 1JUBA 3A9IA 2A6LA 3W7HA 1K3UA 2ZDRA 2ZZ1A 3CT7A 5F2LA 3MO7A 2QUVA 3OHIA 5K9CA 1R2TA 1NVMA 3L21A 1VHCA 4OQVA 4S2CA 2VFEA 1FWNA 3GK0A 2GQ8A 1G4EA 4CCDA 2WJZA 3EWBX 3FEMA 3DHDA 4UC5A 2O7SA 2NUYA 2EGZA 1XDLA 3W6YA 1GG0A 3HBLA 5H2ZA 2TYSA 4KFNA 1AW1A 4N6FA 1YTKA 4MY1A 3B0PA 2H90A 3MP5A 5KZDA 4JX4A 3CHVA 3HGOA 5AN7A 1AW2A 3L5LA 3T7VA 4MFEA 4AEOA 4C1LA 5I3JA 3Q94A 3RNDA 3O05A 4N9EA 3S1UA 4AF0B 3W1QA 5LNRA 4Y8FA 1LBFA 1G7UA 3QQ1A 1ICQA 2EF9A 4U4MA 1S5TA 4RZ6A 4EOUA 2PC4A 3FYOA 1IXQA 1LLZA 5LNWA 3U6WA 3LXAA 1OFAA 2BX7A 3HG4A 4I9AA 3UD6A 2Y70A 4RJEA 4Y90A 4IUOA 3O8AA 4JTGA 3CWNA 3S1XA 4UFKA 5HWMA 4WY0B 3G1YA 1BTMA 1YPIA 3UPBA 4WZHA 5LNUA 4L4LA 3TJXA 1G6CA 3ZS4A 3ATYA 1W3NA 3LRKA 3SFKA 4JICA 4HPJA 4QITA 3LI1A 3DENA 3I68A 3KVKA 1S5VA 1VCVA 3KRSA 1FBAA 2ZRXA 4A2SA 3S1WA 5F4SA 3KHJA 4JS3A 4Y6GA 4JTSA 2DZUA 1Q6OA 3TW6A 4Z1AA 4KKXA 4XKYB 2V2DA 1LOQA 3TSBA 4O4WA 4PA8A 1L6WA 3B03A 3R89A 2YDAA 1F6KA 1PCKA 4JX6A 1MO0A 4Y9AA 5E93A 1AG1O 3BW2A 3N2MA 2FB3A 3NM1A 4O54A 2E1DA 2VOMA 4YMZA 3O6CA 3N2XA 4AWTA 3O15A 2I14A 3KOFA 4ORIA 3W71A 2A7NA 2EPHA 2QF7A 2G96A 3BGGA 3W1PA 2VELA 4FIRA 4PODA 3NZ1A 3N9SA 5G5IA 3QEZA 5CZ0A 5KZEA 2YW4A 1VRDA 4OHQA 1C29A 1FXQA 4XBKA 4O1AA 2I1OA 1FCQA 1GVOA 4JR5A 3MP4A 4KWVA 1JCMP 4GFSA 3G3MA 1JVNA 4XWUA 4GUHA 3HPSA 2YCEA 3G1VA 3CPRA 1L9WA 2ABBA 3FS2A 4PTNA 5CSRA 4UIOA 2A4AA 1BWKA 5HUOA 2Y89A 1C8VA 2QCCA 1H61A 5IM51 2NWRA 4ZQOA 3DXIA 2WNZA 3UY8A 2VXNA 2FDSA 2Z0IA 1K7EA 3P74A 4IJBA 5I3HA 5DBUA 3KXQA 1TRDA 2B0MA 3TSDA 2ISWA 2A21A 3UXDA 3HQ1A 1WXJA 1M5WA 5AC7A 5F4WA 1TTQA 2ISSA 2PCQA 1XBZA 2GPTA 3LERA 3LOTA 4YL2A 3PBVA 2QCMA 4X9SA 4LS2A 2X2GA 4A2RA 3C56A 3OA3A 5L9FA 4UTTA 2YR1A 2A5HA 5BW6A 3QW3A 3UXAA 1GYNA 3B4UA 1M6JA 4Q32A 1XDMA 3EX1A 3W7EA 3BG3A 4XTIA 3PB2A 1FWTA 1XBXA 1YTEA 3FLUA 3LHYA 3G1SA 1KBIA 4Z0SA 4ADTA 3CIXA 1VZWA 3LX9A 1KM1A 5G1YA 4AMAA 5DY3A 3W87A 4BWLA 5DN1A 4AHOA 3VKJA 2OT1A 1U5JA 4R53A 4EWND 8TIMA 3P84A 5FF2A 2ZRWA 3EKZA 5G2IA 1LP6A 3OBKA 3L65A 3NZRA 4S1FA 4AH7A 4RCXA 3ELFA 4Y96A 2VFHA 1LYXA 5AC6A 4IX2A 4BK9A 1KTNA 3TR2A 2Q3RA 1RR2A 1SFLA 4BI7A 3T40A 5K9XA 1L6SA 2C3ZA 2Y7EA 3EX3A 4JTLA 3N3MA 1SZGA 3HO8A 3PC0A 4N02A 2QAPA 2YYUA 2OX1A 3BLFA 1R2RA 4CLMA 1NF7A 1UBSA 1W0MA 3QF0A 2ZZ3A 1TPWA 2CLKA 3C2FA 4BFAA 2ATSA 1GQNA 4TU1A 3C3NA 4AB4A 2R91A 5DXYA 2I9EA 4Q33A 3QYQA 4JYFA 1ZALA 2DJLA 5AHMA 1Z41A 1NEYA 3F4WA 4I7VA 3LXBA 3O6YX 1OFOA 1SZEA 3NQFA 4RLIA 1H7RA 1B4KA 1OFEA 2HS6A 1QCWA 4G1KA 2JKAA 3NM3A 1YPFA 1SQ7A 3GKAA 3PSWA 1L2UA 2AQWA 2QCDB 3G0SA 3NDOA 2JGYA 4BI6A 4ALDA 4M6VA 1W5OA 4O0ZA 1THFD 1Q6RA 4N9DA 3KRUA 4X2RA 3TUUA 1JCNA 2TMDA 3PUEA 5DBTA 1TV8A 1W56A 3STCA 3T4CA 2GJNA 4XUGA 5LZLA 4M19A 3NOEA 4NJJA 4FNPA 3PBUA 4WOQA 4UTKA 2Y63A 3G24A 3LBCA 3W76A 3AO0A 3TDFA 3QRHA 4MZ1A 1TV7A 1W31A 3B0VC 4HNTA 4DEFA 3QSRA 2RH9A 5F1UA 3CU2A 4GUFA 4HHPA 5BMWA 3MBDA 1I2OA 5KZMA 4LRSA 3NL3A 1VGAA 2R94A 3TX9A 4MYAA 4KWWA 5AOUA 1F7BA 3UWVA 1H1ZA 3USBA 2OMAA 1CX9A 4AWSA 4S2BA 4DELA 4MLRA 1J2WA 1PL9A 3NPVA 1SO5A 3C2OA 2H3BA 2V2CA 1OK4A 4LRTA 4NNAA 1ZY9A 1KM4A 5D37A 2P1FA 4FEZA 2C13A 5AB3A 3LHWA 2VEIA 3SECA 3L5AA 4ADSA 1TPFA 2NZLA 4NU7A 2ZZ6A 3TXZA 3WJYA 4D2JA 1WA3A 1X6UA 1JCXA 4B5NA 2WQPA 2QCGA 2QEZA 3TC6A 4O28A 1KFJA 5HWNA 2F7FA 1DOSA 3LTYA 4ZZ9A 5C6MA 2A7PA 3W7KA 4KFOA 3PF3A 4E2DA 1LROA 5LSMA 3PUOA 1GZGA 3SGZA 3ANYA 4GWEA 3V75A 3M44A 4GUJA 2OJPA 3N9RA 3S5NA 1QOPA 3KFTA 2OT0A 4POCA 1ICPA 4FX6M 3W2UA 1GTHA 3DFSA 1OK6A 5D04C 4YWIA 4RKAA 2CZ5A 3BPWA 1EP2A 3NYZA 2QCFA 4HT3A 4IWWA 3NL5A 1TTJA 3DKJA 2EHHA 4LC6A 1CI1A 1A5SA 3BARA 1IXPA 4PH6A 3OIXA 3IIVA 3RU6A 1P0KA 5DCEA 3AJXA 3GDRA 1B3OA 2WKJA 1NFBA 3CWOX 1R47A 1JCJA 5AHNA 2FB2A 4P2VA 5U7SA 4LOCA 4FXSA 3EKLA 4MIMA 2J9XA 1A53A 3K30A 1A5BA 2AGKA 5C2XA 2GOUA 1GG1A 2Y7DA 1P1XA 3LCFA 3OEXA 1MZHA 1E51A 1F6PA 3C6CA 2VFDA 2V2HA 1RZMA 4GJ1A 3WJZA 2X1UA 3HB9A 1GPWA 5D2YA 1ZCOA 3SIZA 1IXNA 2YX0A 3VFLA 2QCNA 2QDGA 3C2VA 4MOZA 5G2HA 4JDBA 3A22A 3R8RA 3UPWA 4MLJA 5AC8A 3DH7A 4CCCA 3PULA 2TSYA 1RV8A 3I65A 2RDTA 4LNYA 2Z1BA 4FNTA 1QOQA 1QO5A 2XN0A 2YXGA 4UTTC 4XQ6A 4HKPA 3NQ6A 1JULA 1LORA 3L0NA 5TIMA 1NF0A 4MFDA 4IPIA 3RLVA 3P62A 4O13A 1O60A 1N7KA 3E96A 1S3HA 4OT7A 3N34A 4CQAA 1QPOA 4MJZA 4PCFA 1GVQA 4UNLA 3W1RA 4LVBA 3MI2A 3GDMA 1JJKA 3IEBA 3W7NA 3TU9A 3CM4A 3OVQA 3S5YA 2GVJA 3MWAA 1VR6A 1XL9A 4UFJA 1ZAJA 1H7PA 3DHFA 1S5WA 5MHBA 3QFEA 4O14A 2GQAA 1VYSX 5CZTA 4UTLA 3N19B 1XBYA 2EKCA 1NSJA 3IRDA 3W2JA 3EWZA 4A22A 3IIZA 2JGQA 1TPDA 3S5ZA 5K3VA 3MHFA 2ZYFA 4LU0A 3IVSA 5J5DA 1FUYA 3FJLA 3A23A 3CEPA 5C5YA 4BF9A 2CZFA 2ZTKA 1EUNA 1IIGA 1TPUA 2A0NA 4MYXA 4O17A 1SUXA 4UTWA 3LBMA 4M6QA 3W73A 2WOQA 1GVSA 3OVRA 3CLMA 2E77A 1G4SA 5LKYA 3TMQA 4K38A 3NO5A 5CZJA 3HMJG 3G22A 3NQVA 3G3DA 1ML1A 1WV2A 1ONRA 3O16A 4E38A 5U4NA 1FWWA 1FCVA 2FPYA 2DJXA 1MSSA 4DBEA 4FXRA 4CQ8A 4DXVA 3T55A 2X30A 4K6AA 2E6DA 4OE7A 3LHVA 5D38A 3WK2A 4JGDA 2BXVA 1O95A 4EVZA 2E6FA 3MUXA 5D32A 5J5RA 4PC8A 2O7QA 4NXSA 5KTLA 5AYXA 3BG9A 3W23A 1KFKA 1SPQA 3GXNA 4R7JA 3TFXA 3H55A 1ZHAA 4XZ9A 1ME9A 1T96A 1LBMA 4UXDA 3R13A 1G67A 2V30A 3L0GA 1BEUA 1X1ZA 4AXKA 3Q37A 3ABQA 1EA0A 1H62A 1KV5A 1RQHA 3HG5A 4NNBA 4HNUA 3GNDA 3LGEA 3W07A 3KX6A 4RX0A 3SZ8A 3TK7A 4IXXA 2WV8A 1OVDA 2EAWA 4I7UA 1GOXA 5CPNA 1GEQA 3TSMA 1QDSA 2CZDA 4JTUA 3UY7A 4PL1A 5C54A 3TE9A 4DPPA 1LZOA 3M43A 1TPH1 3TXVA 1GTEA 5D33A 3EB2A 2KZHA 3HIJA 2JBMA 2B7NA 3IIXA 2V5BA 1OF8A 2Q8LA 3HGRA 3NQ7A 1YXCA 1H7XA 2V0TA 3L9CA 3W74A 4QQ3A 2ZZ4A 3BV4A 4TIMA 1TIMA 3C0JA 1QWGA 2FIQA 2G95A 5D2TA 3M9YA 3BK0A 3A5FA 2XFWA 2E6AA 3L68A 4LS1A 5GVJA 3P7YA 1UJPA 2ZCGA 2NWSA 5K9DA 1SSDA 2DZSA 4EF8A 3B04A 5I3FA 3THQA 3EX4A 5AYZA 4UNKA 3EXRA 1YTDA 1VC4A 4DQWA 2DP3A 2RFGA 4CCEA 4OGZA 4BWLC 5KINA 5K7JA 2NLIA 3TNOA 1M7OA 1W3IA 2ZRYA 3SSJA 4O15A 1RVGA 3HPZA 4JEQA 3P80A 1Q3NA 2WSRA 1RD5A 2CLMA 3SGUA 4JY8A 4E2BA 4ZVJA 5HJLA 4M6PA 1VQTA 2LLEA 4JTTA 2OZ0A 1N55A 2YGYA 1TQJA 2BSLA 4HN4A 4RZ5A 2B7QA 1OX5A 4CNNA 5F2IA 4QSHA 5F1VA 2FFCA 5A5WA 1R2SA 5KSWA 3GB6A 1YXDA 4HNVA 1XCFA 3RLUA 2ALDA 2ZRVA 3I7QA 3FKKA 2CLHA 3TIMA 1TO3A 3P61A 2AAMA 5EYWA 1V7YA 1FDYA 3C4UA 3IIPA 3MP3A 4RZ4A 3W7GA 4ZMGA 1FWRA 2E5BA 2Y62A 4JX5A 1B57A 3TAKA 5K4XA 2BTMA 1ZAIA 1F76A 2A85A 1PVNA 2ZZ5A 4FNRA 1YXYA 5D30A 3MHGA 2BLEA 4LWWA 5I3KA 3GZ3A 2RDUA 2YW3A 1KTBA 5AHIA 5EKYA 3SW6A 4O18A 3BVJA 3L2IA 3FFSA 3E9AA 3EWXA 3TQ0A 1VHNA 4TX9A 1P5BA 2C0AA 2ZZ7A 4Z1DA 2HMCA 2V5LA 3W72A 5KITA 3F03K 5HMSA 2E5CA 3NR0A 3TKFA 1Y0EA 3GIYA 1VYRA 1PHWA 2NXGA 1YDVA 3LB0A 1O4UA 4RXGA 1W1ZA 2UV8G 2RDWA 1FXPA 3GDLA 1G7VA 3TAOA 1QPQA 2PURA 1WYIA 2YPIA 1A5CA 2WNNA 2CLIA 5EL1A 5CPOA 1YDNA 4Z1CA 1RQBA 2ZFAA 3GAKA 4A21A 3B8DA 2QJHA 3DFOA 3NQAA 3QMTA 1Z44A 2C6QA 2QR6A 3TMLA 1TPB1 4WD0A 1VS1A 3LCWA 2XN1A 5I3IA 1LLWA 4UTJA 4W9TA 1JRCA 3LCIA 3S0CA 3TFCA 4O12A 3GXPA 5HUPA 5K2ZA 3W3OA 3SY5A 2ABAA 4Q4KA 4TMCA 3LCGA 3UWYA 5LNVA 1HO4A 3ZWTA 3O6DA 1WOBA 4UFIA 1RPXA 2ZTJA 4N2YA 3HG2A 3FYPA 3H54A 1KBJA 1MXSA 4YCOA 5EMUA 2ZQ0A 3VE9A 2HS8A 2J88A 1G4TA 4DO4A 4H6KA 4QNEA 4JTHA 2WNQA 4K8EA 3IVTA 3NQ2A 2VFFA 2ATMA 4X22A 1XC4A 3I7SA 4WY0F 2DZXA 3BO9A 5DELA 2VC6A 1MEIA 1TYGA 3SR7A 1GVFA 3W7LA 5CPLA 4WX2A 1EX5A 3LDVA 1I8JA 1A50A 3PAJA 3NG3A 5D05A 1LM1A 1VCGA 1SO4A 5LNSA 4K37A 2WPBA 3NL2A 3W86A 1YDOA 1OX4B 3BW3A 1KA9F 1SSGA 3N14A 3QW4B 2E09A 1DQWA 1H63A 4FF7A 3NL6A 5AHLA 1H60A 3G1AA 3LLFA 3WK1A 5G4EA 3SJ3A 5CGQA 1Z48A 2J24A 4FB7A 5LHFA 1K7FA 2Y61A 2YZRA 3CC1A 5TQLA 5HQEA 1LOSA 2Q3OA 4UR8A 6ALDA 1G69A 4O0KA 1WOAA 3U2OA 4NZJA 1HTIA 4O57A 3S1VA 4OV9A 1AL8A 4NJHA 5FESA 3CTLA 4CNOA 3GKFA 3W7PA 3WFAA 1FX6A 5HINA 5CZSA 1QO2A 4LTSA 1KM2A 4NUWA 2JKPA 2WSQA 2Y7FA 3QMSA 1T0OA 5EY5A 4JTIA 2YFNA 3M5ZA 1GT8A 3I7RA 1LRNA 2Y7GA 3NQCA 4JTJA 4ZQRA 1DJNA 4LUJA 5HNRA 3L5MA 3STFA 1QPRA 2W6RA 2E6YA 2J27A 4GE8A 3W7MA 5D2WA 2A7RA 4LV4A 3LCHA 1X7FA 3WJWA 3DI0A 4FHAA 4UMCA 3FA5A 4JYEA 3V1PA 3P8IA 5FF3A 3WK3A 4NX5A 2GVGA 4LV9A 4RR4A 1I4NA 2ZA2A 1DBTA 1YLVA 1BWLA 2H6RA 5DCBA 2TPSA 3F4NA 5TBOA 4CQ9A 4UTUA 2NXHA 4ZQMA 2VEKA 1LTDA 3NGJA 1AK5A 1W8SA 1DKWA 3M5XA 5A8GA 2GVLA 3EX6A 3P67A 1TB3A 3UQNA 3LRMA 3UNDA 4DF0A 4I7WA 5EBUA 2J9YA 1UASA 3W7DA 2NV2A 4EF9A 3MHUA 1QFEA 1R46A 2DU2A 2B4GA 3CEUA 3MYOA 3NA8A 4LVGA 3W7JA 4HSOA 2IQTA 5G4WA 2R8WA 5CSSA 2X1RA 1OG0A 1GWJA 4MY8A 1DJQA 2XN2A 4Z08A 2FTPA 1TPEA 3TQKA 3RK8A 4UMBA 3M5VA 2G97A 1VYPX 3M16A 4JYDA 3M6YA 4RK8A 2DZWA 3W1MA 1VLWA 3LHUA 3DFQA 3GDKA 5HR7A 3RFAA 3ZR4A 4DPQA 3KVMA 1I2RA 2FPVA 5AHEA 1KV8A 4UR7A 1K7XA 3FJ6A 1SFJA 3L66A 3UWWA 3Q2DA 1JUKA 3ABOA 2C14A 1XUUA 3GXTA 3GNNA 3CQ0A 2V82A 1GYLA 4QIUA 1IF2A 3M41A 1LRQA 4UTIA 3IVUA 2BWGA 3TC7A 4IGHA 4K36A 4CNPA 1TMHA 2CLOA 4E0CA 1TRIA 3P8JA 3MI6A 3NQ8A 4IQLA 3W7OA 1XXXA 1RQEA 5BNKA 3EXSA 3PY2A 1PS9A 1T99A 4R34A 2WSYA 2V8ZA 2YFOA 2P0OA 4XTDA 4FX8A 3TA6A 2W79A 5BMXA 5EA9A 2VEMA 3A5VA 1KLYA 1SU5A 3P60A 3W85A 2GJLA 1SW3A 1LBLA 3LCLA 4HNNA 4TO8A 3WJXA 4DF1A 1EWDA 1I2PA 1H7WA 1ZJIA 4MZYA 1TREA 4JTEA 3W7CA 3EXTA 4O50A 3CB8A 1KM5A 5FF4A 3OG3A 1WBHA 3S6DA 1QAPA 5D09A 3N73A 1A5AA 4QJ1A 4DO6A 1KTCA 3TQVA 3W88A 1VJIA 1D3HA 4N4QA 1FCBA 1CW2A 2BZNA 1O94A 4GXMA 2QKFA 3DZ1A 3QM3A 1KFEA 1ALDA 2NX9A 1K8XA 1NAL1 2A6NA 4A29A 5DCDA 4WOZA 4UFMA 1EIXA 1LRTA 7TIMA 2NXIA 3HOJA 5LHEA 1XBVA 1OFRA 1W3TA 1MEHA 1H51A 4NJGA 4NVTA 3EX2A 1QNVA 4DBDA 5DY2A 3O63A 3QQ0A 1QR7A 4UUIA 4NXKA 4O4VA 3O06A 1VPXA 2QCDA 1TTPA 4O1CA 1OFDA 4XKYA 3STGA 1LOLA 4O16A 1SW0A 1LDCA 4PL2A 2NX3A 1I2QA 2QUUA 4LT9A 3ABRA 3UWQA 3NQMA 3MI3A 1TV5A 4WQ6A 3R12A 3P5ZA 2H8XA 3UYCA 2ISVA 3E0IA 1C9DA 1AL7A 2C15A 2Y6ZA 3G18A 5SWUA 2A2IA 3G1DA 4FNQA 5KMYA 1F74A 4ZL1A 1KM0A 2X16A 4UTHA 1X8FA 5DLCA 3C2EA 3A21A 1ZAHA 4IMEA 1QMLA 2VFIA 1OFBA 4JN6A 4YCPA 1J5TA 1FDZA 3W1XA 1LCOA 1ZNNA 3UZJA 4MJMA 1DL3A 4JTFA 3KVJA 2RHGA 5HULA 5AFDA 3G0UA 4PEKA 5D2XA 3B0UX 1P4CA 3GYEA 3UZ5A 2C16A 1UUOA 4WJEA 1XKYA 3DFPA 2H3DA 3GR8A 4JTKA 3TJLA 2CLEA 2QCLA 2JKEA 4LUIA 4N4PA 1PCWA 1XUZA 4OBTA 4UCGA 2CLFA 3LM7A 3NPWA 5D02A 3WJSA 1OJXA 2C1HA 2FQIA 2ZRUA 3VNDA 4IPJA 1WAUA 2G5WA 3THAA 2B7OA 1K8YA 2HTMA 2Q8ZA 5E1QA 3T44A 3QH2A 3B06A 1WBJA 3BG5A 3NAVA 3M1ZA 2QJGA 3INPA 3W1TA 5FEZA 1WDWA 5E0KA 3W2MA 1EWEA 4HIBA 5EPDA 2QAFA 4PFMA 2E5DA 3BGJA 3W2LA 5H91A 4ZQNA 2B7PA 3MW7A 3LXCA 3PSVA 3IGSA 4JNMA 3QC3A 5I3GA 1BKSA 1UUMA 1TPVA 3TH6A 3W1UA 3HGJA 3EEGA 3BLEA 3QSTA 4IMGA 4UTMA 1HG3A 2NX1A 3E12A 3HF3A 3HPXA 1F05A 3C2RA 3HJZA 5HR6A 3E02A 4AHPA 4XBSA 4ORMA 3FIGA 3IIOA 1GVRA 2QDHA 1ZENA 3W84A 3TROA 3PBYA 1YADA 2J9ZA 4RV8A 4DO5A 4GRSA 5HWJA 1H7NA 3FOKA 3MYPA 5D03A 5IBXA 5CG7A 3B05A 1I45A 3MBFA 2C18A 1MEWA 2NUXA 1OX4A 1B9BA 1OYAA 3JRKA 3QPYA 5G1TA 3S9YA 1VCFA 1F2JA 4FX7A 1JRBA 5LGZA 4MKNA 4IX0A 4ML9A 1ADOA 3G1FA 4AVFA 3NXFA 3IV3A 4MUZA 3LRLA 1OYBA 1OFPA 2DZTA 4WXZA 3DU0A 4O11A 4MZ8A 2DZVA 1UCWA 5K4ZA 3W2NA 1TJRA 4LS0A 4TR9A 3HGSA 3ATZA 3RF9A 5LGXA 2P10A 2D73A 4AAJA 3I6RA 1Q6LA 3UWZA 1ICSA 1N8FA 1O5XA 4R33A 4GBUA 3IGUA 3D0CA 4YLWA 2VEPA 3KAOA 1TSIA 2ZRZA 2OCZA 4AF0A 2H8ZA 4K39A 3E49A 3PR2A 3S42A 3GLCA 1WQ5A 1DHPA 1KM3A 3VE7A 3VCRA 4ADUA 3M7WA 3IGXA 3NEVA 3S5OA 3GAYA 3DAQA 1IXOA 3FKRA 1KM6A 2CZEA 3SI9A 1EEPA 3QZEA 4K7VA 1XFBA 1TPC1 2NV1A 4N9CA 3GDTA 4Z0JA 1J4EA 5F2GA 1QPNA 4RXFA 1B4EA 1JUEA 4OV4A 4WUIA 3DI1A 4WXYA 3DKLA 3ZWSA 4UTWC 4FIQA 4MVAA 3LHTA 1SW7A 2X1SA 3O1NA 4ICNA 4GUIA 3MJYA 3EWYA 4NJIA 1G4PA 1SZNA 3LHZA 3R2GA 1H7OA 4OWGA 3T78A 4DF2A 3DFNA 2CFFA 1WX0A 5F4XA 4U28A 3NVTA 3EWUA 1H5YA 1FWSA 4H4IA 1H50A 3TCEA 4MPQA 5G2WA 3A24A 3KVLA 3QJAA 1Q45A 2Y85A 1R30A 4GC4A 1TJPA 4LVFA 1W54A 4FO4A 3U8GA 2VENA 4QISA 4JY9A 2W0UA 5CPMA 2PRLA 1HO1A 3QPZA 5CKSA 1Z42A 5FEWA 2DORA 3W1AA 4IMDA 3P81A 2GUUA 1I2NA 1KFLA 3W70A 2ZZ2A 1HL2A 4UFHA 3W7RA 1KFCA 4N9BA 2QCHA 1K8ZA 2YYTA 3LV6A 3ZFHA 2FLIA 3LTSA 3QMRA 5ABTA 4WY0A 4O1DA 3GVGA 3STEA 4MY9A 1M7PA 1W37A 1EUAA 3PVFA 2FJKA 3NQDA 1HFBA 3G8EA 4HPXA 3PS7A 1OHLA 2Z6IA 1VLIA 2QCEA 4NNCA 4NZFA 1PE1A 1DQXA 1F5ZA 1OYCA 5AYYA 1PHQA 1SZFA 3JR2A 4YXGA 2CWNA 4C1KA 4NT0A 4LVAA 4O8RA 3TV8A 3W1NA 3NPUA 3W22A 3LCXA 3PG8A 4IOTA 4M5PA 2DZPA 3PB0A 4JIQA 1JQVA 1FCUA 1D9EA 2TRSA 3LI0A 3WK0A 4Z1BA 4P61A 4LY8A 3L0KA 5D2VA 1F73A 2V9DA 4FNUA 3HG3A 4X3ZA 6TIMA 4M7SA 1OABA 2CW6A 1JCLA 1KLZA 1FY6A 1EPXA 4ZQCA 4IMCA 4KFPA 3CIWA 3DGRA 1YYAA 4NX0A 1EP3A 2Y88A 2HSAA 1DV7A 3DFTA 4LC8A 1UB3A 4K7YA 1K03A 3NQGA 4JD4A 1GJPA 5BOOA 3PWAA 1ZFJA 1Q6QA 1OX6A 3LV5A 4LW7A 1K02A 2CU0A 4IXHA 3R5EA 4QAIA 4O1BA 3W9ZA 2QJIA 4NQ1A 4JIPA
chains in the Genus database with same CATH superfamily
1VRXA 4O52A 3GBDA 3VABA 1OQFA 3GHUA 3RJYA 2FZDA 3NNTA 1KFBA 2R14A 3PG9A 2PRMA 3NDZA 3AZRA 4IJRA 1RBOB 3W81A 1OD8A 4YYFA 4Q8UA 1EJTC 5IBXC 3Q58A 7A3HA 1JQXA 3LTPA 3AXXA 3E2RA 1W5MA 2E0PA 1Y5VA 3ISIX 1OFQA 4GXPA 3AROA 4IM4A 1TIWA 3VCCA 3RLGA 4OTKA 2VNCA 3CAKA 1XLCA 3UXIA 3AMKA 4O10A 4TV5A 1EQPA 1J79A 5JH1A 3GXIA 3UJRA 3ABZA 1FTXA 3C61A 1DVJA 1E0WA 2FZ9A 5T26A 3GX9A 3PPFA 3VMNA 3W1LA 4XK2A 1XI3A 3TW7A 4H9TA 2ZA3A 2X40A 2IKIA 2OVLA 3QV8A 4H3DA 4KPLA 1XLAA 2YSWA 1AMKA 2WW5A 3WD0A 3WLQA 1HUVA 4L6OA 1WZKA 4JTCA 2POZA 2HXUA 1TTIA 4G8TA 3PZNA 2Q6ZA 4A3UA 3LA4A 1SR9A 4UMAA 1QI0A 2WZMA 4ML4A 3Q65A 3GIPA 3UR2A 2UZ9A 3FHQA 2NQ9A 3QLLA 1W91A 1IQ8A 4W7VA 3PWIA 4QFUA 1XYCA 4S38A 5JUVA 3H21A 4W4QA 2PE4A 3W75A 1IIHA 2WZEA 4O19A 4PB5A 2X1TA 3PZQA 1U83A 3C0SA 4ICCX 2XIOA 1JUBA 4P7NA 2A6LA 2ZZ1A 3PTDA 4C7DA 2QUVA 3OHIA 3L21A 1ZS2A 4OQVA 4S2CA 3GK0A 1I9CB 4UC5A 2W9MA 3CO8A 4ZB5A 3VVGA 2Y5SA 5I09A 3G2GA 4QP0A 2FZ8A 2FVLA 3I3EA 4RW3A 3WD3A 2XIIA 4D6EA 3BAIA 1KNWA 2D0GA 1EFZA 3B0PA 3ZM8A 1M7XA 1JYVA 4JX4A 3VCNA 1AW2A 4MFEA 4C1LA 3BSHA 1Z7AA 3O05A 4N9EA 2VCCA 2EKGA 3JZUA 3FGCA 3W1QA 4Y8FA 1WAWA 2VD8A 1ZZMA 2EF9A 4RZ6A 2PC4A 1IXQA 3TONA 3EA2A 3U6WA 1FVPA 3WLRA 2BX7A 4KESA 3C0LA 1AZ2A 2Y70A 2VZTA 4Y90A 2G3NA 4IUOA 2QJJA 4D72A 1W9PA 4FLSA 4ZO6A 4UFKA 4B5XA 5HWMA 1BTMA 5LNUA 4L4LA 4NSBA 3ZS4A 1CGVA 5LA0A 1BVZA 4AYGA 4QXIA 4XAPA 3RIKA 2ACUA 3AIWA 4N0RA 4PN2A 2ZRXA 3U2CA 3W25A 1S2WA 3OB8A 5JBFA 1U30A 3APTA 2DZUA 4PTVA 1Q6OA 3S4TA 1TWDA 3KM8A 1K9TA 4KKXA 3CZKA 3R89A 4L1XA 2YDAA 4F40A 4Y9AA 4JNZA 3O15A 4DYJA 2I14A 2XJ7A 1L6GA 2NV9A 1IZJA 3QXBA 1IZCA 5ENLA 2VELA 4QJ3B 3NZ1A 3N9SA 4DLFA 2PTDA 3KLKA 4GI6A 5KZEA 5CJMA 3VINA 1FXQA 3DHUA 4XBKA 2I1OA 1FCQA 1GVOA 4JR5A 3LBOA 4GFSA 1TA3A 4XWUA 4LXFA 4ZFCA 3HPSA 3DFHA 1L9WA 1PKMA 1SFTA 3VIHA 2VC5A 3C86A 3ZMRA 4JFWA 3R8HA 3SCQA 2WNZA 4IJBA 1CGXA 1TRDA 2P76A 4MMWA 4QCEA 4J5NA 3NTYA 2ISWA 5FSEC 3IWPA 2X41A 4MHBA 4CN6A 1TWSA 1TTQA 3HQNA 3I3DA 1XBZA 2GPTA 1UKPA 3QGAC 4X9SA 3IJIA 2X2GA 4A2RA 3AAMA 1Q2RA 2QXWA 3A64A 3C56A 3OA3A 3PZTA 4W7UA 1OM0A 3WLHA 4F3HA 4KW2A 1R7AA 5BW6A 3ARQA 1PX8A 1JYWA 3B4UA 4CQBA 2QPUA 4B16A 1M6JA 4H8VA 1XDMA 2PDJA 1UZDA 3UJSA 1D7FA 4JEJA 3PB2A 1FWTA 1XBXA 1YTEA 3FLUA 1EEXA 1TUFA 2ONEA 4Z0SA 4AMAA 2FZBA 4BWLA 3VKJA 3A4JA 3KOXA 1Q7MA 4GGBA 2OEMA 5G2IA 1RAKA 5HPOA 4FALA 3L65A 1P7TA 2ZXQA 4L64A 2NT1A 3WBXA 3TR9A 3P2VA 1EYWA 2VFHA 5AC6A 4H19A 4BI7A 4GC3A 3F5KA 2WBGA 3GVVA 4GNVA 2C3ZA 4LCRA 4LALA 2BS9A 3EX3A 2CC0A 2D2OA 4I9JA 4WEVX 3K4AA 5CJNA 2OSWA 3ZJ7A 1H5VA 3BLFA 1R2RA 1XYBA 5CCZA 1UBSA 1TZ9A 2IW0A 3MCOA 4BFAA 1GQNA 4I6KA 2R91A 5DXYA 4Q33A 4LQ1A 3M0IA 3GC5A 4PGLA 2A3LA 5AHMA 1A4LA 2XSXA 1ISVA 3GFYA 3CV1A 4I7VA 3WD2A 1E0UA 1DIOA 3JUGA 1S2AA 4ATWA 3WEZA 2YCLB 2WMIA 1OFEA 1SGJA 4ECLA 2ON3A 1JXJA 1ZBVA 4JTAA 1IR2A 4A3QA 2PB1A 3W29A 4S3DA 3FA4A 4PULA 4XO7A 4BI6A 2R1MA 4H6EA 4M6VA 3B0XA 3L4XA 4ZODA 1Q6RA 4N9DA 3TUUA 4GY0A 2GJNA 4F0SA 4NJJA 3RITA 2FH8A 1Q63A 3AO0A 4QAWA 1TV7A 2OWWA 1X6LA 1EX1A 4HHMA 1UP3A 3PJWA 1NP0A 5C2CA 5F1UA 2XVPA 3MBDA 1XYZA 3MMUA 1I2OA 4YYCA 3NL3A 2R94A 3TX9A 3VDHA 3R11A 4KWWA 1H1ZA 2OMAA 3IPWA 4QEEA 2PWGA 3ARSA 1N8WA 5FL1A 2CNCA 2C1IA 2TODA 3APYA 2GLKA 4NNAA 2YLAA 4FEZA 2C13A 3L5AA 4PCSA 2O92A 2NZLA 2ZZ6A 3TXZA 2FJUB 4FXFA 1X6UA 8XIMA 2WQPA 2QCGA 1DJWA 1Q6FA 2ANUA 4ENLA 4O28A 1KFJA 5HWNA 2PC8A 1EHAA 5HBFA 5A8NA 3GD6A 3V75A 3M44A 3ARRA 2QVNA 1CT5A 1CXIA 2OT0A 1UZ1A 4POCA 4AD3A 4GJIA 1ICPA 1R3QA 3W2UA 1EXPA 2X0HA 4WRHA 3BPWA 3NSMA 4NZ5A 4HT3A 3U0HA 1EXBA 3GDRA 3BMVA 3QYSA 1NFBA 3DC8A 2BG5A 3AYSA 3SB0A 2FB2A 4H7VA 3TYEA 2JIEA 4MB1A 3CV6A 1A53A 3K30A 5C2XA 2GOUA 1JI1A 1NWRA 1P1XA 3F7JA 4CD5A 4LUYA 1E51A 4PRTA 1XLFA 2XFRA 3V0UA 4C6CA 1RZMA 2Z2BA 1YHTA 2X1UA 1PDYA 3HV9A 3ME3A 4PCPA 1ZCOA 3VZZA 3VFLA 4AY7A 5G2HA 1Q6EA 4MOZA 1GJWA 2OLHA 3OHMB 4YVVA 4C6PA 1W1A1 1X96A 3PZVA 4CCCA 1RV8A 3I65A 3IUDA 2AGTA 1MNZA 4MFDA 4B15A 1S2UA 4X2PA 3RLVA 2F8QA 4O13A 1O60A 2WKLA 3VKBA 3CQJA 4CQAA 4W86A 5ABFA 3TN3A 3W1RA 1DIDA 1Z69A 1MW3A 4FAMA 2EJAA 3GDMA 2YLLA 3UA3A 3W7NA 4J28A 3S5YA 5A3HA 1VR6A 1TZZA 1UHVA 1V0NA 3GC2A 1XGDA 4AZ5A 3AUOA 5D9PA 1RA0A 2RJGA 3EMCA 4O14A 3UP8A 4P7OA 4PYSA 3TOYA 2A79A 5CZTA 3VIFA 3N19B 2WJDA 2R1KA 4A22A 3IIZA 4URIA 1TPDA 4B5UA 5K3VA 1J5SA 3IVSA 4BF5A 1YMYA 4BF9A 4X63A 2IXUA 3ONCA 1XLHA 4GX9A 3VNMA 1JZ2A 1XLKA 2XIQA 2C0HA 4UCFA 4MYXA 5FJOA 1R9XA 3C2YA 2PS2A 3WH8A 4I5UA 3S2LA 2DPEA 5CZJA 3CLWA 2HWGA 3G3DA 2G8ZA 2FPYA 2E7FA 1MWOA 3R25A 1UG6A 3S9IA 3K8MA 3W24A 4OE7A 4YTUA 3LHVA 1I60A 1K6AA 2VZVA 3VAVA 3BMWA 1W8GA 1J96A 2E6FA 2FGZA 4PC8A 3BJFA 4MPKA 5KTLA 5AYXA 3WUBA 3MKCA 3T9PA 1CXFA 3GXNA 1EH9A 1FFQA 1F07A 3AXKA 4TXEA 1LBMA 2YBUA 2YDSA 1G67A 3R13A 2B81A 2DZAA 3WD1A 3MV01 1F3XA 3S2JA 1H62A 3MUY1 4HNUA 3OLDA 3GNDA 2OWXA 3LGEA 1VFMA 3UGRA 3BLDA 1BSIA 2YCLA 1UWRA 3MDWA 1PZ3A 4BCEA 3WLPA 3TSMA 3H2MA 3D6NA 3VZYA 2GJXB 4LBRA 3T0DA 1B3XA 3VOFA 1LZOA 1OCNA 4MG4A 5M1TA 2XGZA 1XV8A 3NXLA 3E3HA 2J47A 2B7NA 3CYJA 2J7EA 3OGSA 5EBAA 4WSKA 2X1IA 3HGRA 1WB0A 1YXCA 1H7XA 3QY8A 2GGEA 4QQ3A 2GJXA 2W3ZA 2ZZ4A 1UIOA 4GH1A 3C0JA 4EPKA 3M9YA 3V5CA 3BK0A 3KOYA 2XFWA 2PTXA 3AOFA 4ZSUA 1DXIA 1UJPA 3CAWA 2E8ZA 3EOLA 5I3FA 5FJPA 5HMEA 4UNKA 3RR1A 3GHSA 1RD6A 3NSXA 1IYXA 2OYMA 3W01A 3QFWA 1GK8A 5I24A 4HD5A 3WY1A 4JIIX 1M7OA 4QJ5B 1W1YA 1RVGA 3HPZA 2X09A 2PDBA 1M7JA 1PB0A 1GKRA 1HQTA 4WLCA 5HJLA 4BA0A 4M6PA 3TTEA 2LLEA 4JTTA 1TQJA 4JQ4A 3BQ6A 4HN4A 1RBLA 1SMDA 3RX3A 4HMDA 3OPSA 1R2SA 4DWSC 3GB6A 2Z29A 1TV3A 2WMGA 2VHLA 4X0VA 1TO3A 2WK2A 1XICA 5EYWA 4ZR8A 4ATLA 4ZMGA 4JX5A 1B57A 1IEQA 1E1CA 1HN1A 4Q4SA 4ZTXA 3N6HA 3BCFA 1PVNA 1B3VA 2ZZ5A 3K5XA 1EL3A 3GZ3A 3T6CA 4DWDA 5AHIA 3SW6A 3L2IA 3EWXA 1VHNA 1FH8A 4MWAD 1NOWA 3AMCA 2YCIX 2ZZ7A 2GFTA 3QY6A 5KITA 2FZNA 3K46A 2E5CA 5HMSA 3BTNA 3B9OA 3FJNA 3NR0A 3TKFA 1Y0EA 4ZFMA 1BPLB 1VYRA 3CMGA 2XSBA 4E2VA 3N6QA 1JCTA 3TAOA 2J8TA 1A5CA 3UG8A 4DAIA 3EDDA 2G3JA 2CLIA 1F9CA 2C79A 4A21A 4IFRA 1XYLA 3HV8A 4AD1A 1HGWA 5EU9A 1ONEA 1MFUA 4GH3A 1KGWA 3ZOAA 2QMKA 4WD0A 1WUFA 2XN1A 4UTFA 1XSKA 4PSPA 1LLWA 4W9TA 3BOLA 1KXQA 5A6KA 4D6FA 2J74A 3RCYA 4TMCA 1MW1A 4B91A 3UWYA 1E55A 3GYCA 1SJAA 1Q4NX 3BMXA 2MUCA 4DJEA 1RPXA 5EMYA 1IEXA 5LA2A 2WZIA 4YCOA 2V38A 3GU9A 3SCRA 1EJXC 2WCAA 1EYEA 4FR1A 1H4PA 2WNWA 2VR2A 4NI8A 1AQFA 4K8EA 3MANA 2VFFA 2ATMA 1EGVA 3QLDA 1XC4A 1K8CA 1QU4A 1QATA 3SR7A 3WYZA 1GVFA 4Z42C 2YZ5A 1EX5A 3PAJA 2DT3A 5J8LA 4M3PA 1WKFA 3ZIZA 2J6VA 4K37A 1YDOA 3HQOA 1SSGA 4GISA 3NL6A 3G1AA 4O1EA 3LLFA 5G4EA 5DFAA 5CGQA 2ZUTA 4FB7A 1C9WA 3KDOA 4FI4A 4Q8QA 3P14A 1U1JA 1ZSXA 2QJNA 3CC1A 2AMXA 1KXTA 4JCLA 4O57A 3TC3A 5FESA 4CNOA 1A5KC 2GQ3A 2HK1A 4WGHA 3W7PA 3WFAA 3IARA 1FX6A 5HINA 2Y0FA 1YNPA 1KM2A 3SRDA 1VPQA 4LYQA 2VP8A 3U9IA 1LRNA 4JTJA 1V3LA 3N04A 1MDRA 4LUJA 5HNRA 1WKEA 3L5MA 2E6YA 1VFFA 4GE8A 3W7MA 2Z1VA 4YTRA 5D2WA 4PUDA 2A7RA 4PMOA 3KL3A 3LCHA 3KZSA 4FHAA 3S47A 3FA5A 4JYEA 4D6CA 4IGSA 3WK3A 2GVGA 1K4HA 4KGLA 4W93A 3W26A 3LSBA 4ZSTA 3THDA 4PB3A 1Y5XA 1UR9A 1BWLA 4D6HA 2H6RA 5TD4A 5TBOA 5AY7A 4UTUA 2W63A 2ICSA 1JPDX 1LTDA 1QPKA 4G7FA 1AK5A 3T2OA 3M5XA 2WC3A 2GVLA 5CC3A 3EX6A 4DF0A 1VD6A 3W7DA 2YOCA 3BGAA 2DU2A 4M0XA 2JF6A 3CEUA 3MYOA 1UQZA 3NA8A 4K8GA 4L9ZA 1VKFA 3LZ5A 2IQTA 5G4WA 1DJQA 4Z08A 2FTPA 1WNOA 4UMBA 3M5VA 3KHDA 4FOKA 3D5HA 5GJMA 4RK8A 2D3NA 5IDZA 3W1MA 3LNPA 1ITUA 5HR7A 3ZR4A 2SFPA 4CEUC 2DH3A 1UYQA 4I8YA 2J8FA 1KV8A 4UR7A 1GPFA 1AD1A 3Q2DA 3NDYA 3ABOA 2PDFA 1IT8A 2UY3A 3GNNA 4XD4A 4AW7A 1GYLA 4QIUA 1IF2A 3M41A 1SYTA 3K1GA 4PEEA 2BWGA 4LEQA 3TC7A 3NJ3A 3ITTA 1TRIA 3MI6A 1XRVA 3W7OA 3H2NA 4D9PA 3PY2A 1FKXA 3WLKX 2WSYA 2CPUA 2V8ZA 4DRSA 2UY5A 3WFZA 1V0LA 3VTRA 2BXZA 5E09A 1IWBA 3TA6A 5BMXA 1KLYA 3BAKA 3P60A 3WF3A 1YIXA 4IH3A 5CC5A 5EMMA 4CD6A 3FA3A 3WEMA 2WBKA 1UWSA 1KD0A 6CGTA 5FF4A 1WDQA 3SCWA 2P53A 3HURA 1P48A 1UP2A 1VJIA 3DEQA 2QF8A 1FWGC 3OGVA 4GXMA 3DZ1A 4QQUA 2WPGA 4FA3A 1HKIA 4UFMA 1EIXA 4G2DA 1AH0A 4A3HA 5JVLA 3KS6A 3WLOA 1BHGA 1OFRA 4H9VA 4XZIA 3LS9A 2GUBA 4NVTA 3WQOA 3QQ0A 4UUIA 2PODA 3RYSA 2RGLA 1LWHA 3STGA 4W5UA 2Z00A 2NX3A 2OOFA 2QUUA 4LT9A 2AAAA 3WQWA 4L56A 3MI3A 4B5VA 2P3ZA 3V5OA 4HOZA 1D3CA 2PI6A 3R12A 5DT5A 1MRAA 2C15A 1AL7A 3UG5A 4FNQA 4F48A 1F74A 4ZL1A 2VEFA 1QHZA 2G3IA 2P3EA 4PUMA 6REQB 1X8FA 5DLCA 3C2EA 4MWAC 3UZYA 3HPFA 4S3GA 4JN6A 1FDZA 1LCOA 4KWOA 2WHMA 1LG2A 3KVJA 4RE4A 4CQDA 3ITGA 4WJEA 3GXMA 2JIWA 4P8UA 1PCWA 3QV7A 1XUZA 4F8XA 4UCGA 2WMIB 3NPWA 1PPIA 1OJXA 2VZUA 4W87A 5KZ6A 2G5WA 1XSJA 4HYVA 2ZE3A 1BFNA 5E1QA 3QH2A 2DSUA 2Z7KA 3INPA 4Z2HA 3VDBA 3WH6A 1K9EA 2ALRA 3NUKA 4HIBA 5EPDA 2WLZA 1ADDA 3P6LA 1MW2A 3FW6A 1QUMA 4H9MA 3IGSA 2HROA 5I3GA 1CGYA 3OZPA 1BKSA 1TPVA 1E73M 3BLEA 3AQUA 3L4VA 4X9YA 1HG3A 2NX1A 3HF3A 4LF2A 4RL3A 2ISDA 1YPXA 2VDGA 1L8PA 3E02A 4AHPA 4XBSA 1IGWA 4ORMA 2IPWA 2QJMA 2WMJA 3PBYA 1W9BM 2J9ZA 3M0MA 1VIWA 1WDSA 3MYPA 1I75A 1I45A 2DQWA 3MBFA 3N3TA 5LIXX 2D0HA 2NUXA 1OX4A 1B9BA 1BD0A 1JYNA 3MKKA 3JRKA 5G1TA 1S3TC 3S9YA 4AXNA 4B2DD 3OU8A 2DW7A 1VCFA 4IX0A 3AI0A 1ADOA 3G1FA 3IV3A 4MUZA 3CB3A 1E0XA 3F5JA 1DEDA 4MF4A 3RN6A 1W9UA 3TYZA 4XZWA 2DW6A 4CN1A 1W17A 2P10A 2D73A 3I6RA 1UWUA 1O5XA 5J04A 1VF8A 3SCVA 1DP0A 3UR8A 1CLKA 3B8VA 3D0CA 4F0HA 4YLWA 2VEPA 3KAOA 1TSIA 1PBGA 1XPYA 3IJDA 3R0KA 5DRCA 3B8SA 2XIJA 4K39A 1RLDA 2VM8A 2XTKA 2VWSA 1DHPA 3IGXA 1DIKA 3S5OA 3GAYA 2CZEA 4IPNB 3GU1A 2BGSA 4B90A 1F8IA 4ZGYA 2NV1A 2XUCA 3GDTA 1J4EA 5F2GA 1QPNA 4OV4A 1MZRA 4UTWC 1V4YA 1Y65A 4DBWA 4O1FA 4MVAA 3LHTA 5GPRA 4WDXA 3T81A 3QGKC 4NYUA 1SW7A 1L6FA 2OQLA 2X1SA 1FP8A 1MQQA 1R5YA 4LAZA 3MJYA 3LUTA 4QCFA 2V63A 3EWYA 1ISZA 4LAOA 2R1LA 3G1RA 2QPXA 2GDUA 3F5LA 4U28A 3EB3A 4R88A 5I00A 3VFCA 1UC5A 4HPNA 4H4IA 1H50A 2YKKA 3TCEA 3GUGA 3A9BA 3QJAA 2RUSA 1BG9A 1IEIA 2V3GA 1JNDA 4FO4A 5GJPA 5A6SA 4J3UA 3MCNA 5EGRA 4JY9A 2W0UA 1L0PA 1J0ZA 2PRLA 4E4PA 5I06A 2WZHA 3MMDA 5FEWA 5HJYA 3WF0A 1JDCA 4OZOA 5M3WA 3WBWA 1I2NA 4PMQA 2C91A 3BOXA 2ZZ2A 4UFHA 3LV6A 4GI9A 4JIEA 5ABTA 3UPMA 1DE5A 1M7PA 1JDFA 3GH4A 3N18A 4UOZA 2Z6IA 1VLIA 1LLOA 1R38A 4S3EA 2NLYA 5AYYA 1H0IA 2DFAA 1XSIA 3AIQA 3OO2A 1WE5A 3W22A 3SRFA 4AISA 1JQVA 4MB3A 4G5DA 3UXLA 3V16A 2ZX5A 1AQ0A 1DWGM 1MFVA 1S2TA 5PTDA 3VKKA 1GYMA 1QK2A 5E6YA 2EPMX 2Q09A 5D2VA 5MF5A 3VD5A 1F73A 2UY2A 3LEPA 4FNUA 3HG3A 1HJVA 4X3ZA 1ZU8A 3GRIA 1JCLA 4QHRA 4KQNA 1FY6A 4KFPA 3CIWA 6XIMA 2CBVA 4NX0A 4LJ3A 1EP3A 3GH7A 4H7ZA 4K7YA 3V5FA 5BOOA 1GJPA 4MTVA 1K6WA 4L1GA 3LV5A 4LW7A 3V18A 3GR4A 3UJFA 1K02A 2CU0A 1MMFA 5BXSA 1XDJA 3H23A 1QW9A 2GDQA 4WGXA 3PTMA 4C6MA 3GTHA 3JU2A 4JBRA 4BEUA 1EP1A 2A1YA 2A3BA 1ME8A 1IGSA 2PDHA 3G1HA 3QZAA 2QDEA 3NZPA 3PUDA 2GQ9A 2X0YA 2PDKA 1FHDA 1PYFA 4LX4A 1VENA 5AZ1A 1H49A 3RMJA 3UWUA 4YVPA 1JZ4A 3WUFA 3KCOA 3W7QA 1FQ0A 4JQ3A 4HZ8A 1W5PA 5L6UA 1QTWA 2BGNE 2Y5JA 1XRSA 3PPGA 3LQLA 1PIIA 4MNLA 3R10A 3HM7A 3KTSA 2PDXA 3GNPA 3DBPA 4HTBA 2W91A 3WZ0E 2QGYA 1AW5A 3HU7A 4PBGA 3GR7A 4RE2A 2ZADA 1VP5A 1NQKA 3E6EA 4AMCA 2WCSA 4FNSA 4KH2A 4DWSB 5DANA 4JDYA 3H53A 1VJSA 4NY2A 4C91A 1TCDA 1UJQA 4TMBA 3YPIA 5LIKX 4HMCA 2RKXA 2NUWA 4Q4RA 3S6OA 2PWVA 2QUTA 1ZLPA 3LENA 1A5OC 4XVEA 4JHMA 3R94A 2Z2UA 4MWAE 4MAZA 1TWIA 3W2KA 3VNLA 1H1YA 2GWGA 2VFGA 3LK6A 4LCQA 3G1XA 1VH7A 1EB3A 3CH9A 1JDDA 2XYLA 4DI8A 1WZLA 3T0BA 1DORA 4IQEA 1V5XA 3LQGA 3NWRA 4J3VA 4ATDA 5BRBA 5FF0A 2YA0A 1SO6A 5F2MA 3NPXA 1KCXA 1SVDA 3ABSA 2R1NA 2XINA 2VKZG 5AHFA 1HW6A 4GIEA 1KCLA 4NJKA 4QE4A 1E9IA 5FI8A 5BU9A 5H8MA 2VCBA 5CBJA 3G8RA 2VEGA 1KGXA 2GZXA 4N6EA 3WNPA 1PO9A 3AYVA 4C1NA 4Y8EA 4H01A 5F2LA 3FXYA 4DUXA 1WDPA 3MO7A 5CLTA 1QI2A 1VHCA 4PUKA 3SY8A 2WJZA 4P8XA 3E5BA 4HA1A 3FEMA 3WLSA 2XZ9A 3WQPA 4OJYA 1JG9A 2TYSA 2E9MA 2VVSA 3DHPA 4RNHA 1YTKA 5AYIA 3TNBA 1J0IA 1RCOB 2E8YA 1E40A 4NRRA 3CHVA 3HGOA 4YHGA 1KRCC 4DJED 2Z25A 5I3JA 4C6JA 5JH2A 3RNDA 1VBUA 4AF0B 1GVEA 3V0SA 1G7UA 3ALFA 3QQ1A 3AYRA 1GUVA 3N9KA 3TYCA 5IHSA 1ITCA 2EG7A 3BOFA 2D22A 4I9AA 3UD6A 1US2A 4JQAA 4B92A 3TYAA 3O8AA 4JTGA 4E3VA 2YL8A 4WY0B 3G1YA 3W27A 4H6RA 3HMCA 2FZMA 2P50A 1W3NA 3LRKA 2WC7A 3E1F1 3EDKA 1Z9AA 4K68A 3SFKA 3UW6A 3NO1A 3I68A 3KVKA 4XAYA 1TWZA 3WN6A 5I2UA 2F2HA 1EJ7L 4M1BA 4HYWA 1E43A 3EZ4A 3S1WA 2P8CA 4GI8A 1M03A 2C7FA 1QNQA 3M0HA 5A6MA 1ZCCA 3NIYA 3CL6A 1VFSA 2V2DA 3MUZ1 1LOQA 4MWAA 3TSBA 1LQAA 3B03A 4HCLA 3XISA 4CD8A 3H7UA 3BW2A 3NM1A 1QBBA 2IXVA 4UR9A 3O6CA 3N2XA 1JYXA 4ERIA 3EWDA 3KOFA 4ORIA 3W71A 1G5AA 2EPHA 2G96A 3BGGA 3W1PA 2GYIA 2YL5A 4DZ5A 2CLPA 3AC0A 1VRDA 2ZKMX 1C29A 1V93A 4D6GA 4O1AA 3PNUA 4KWVA 4DNMA 3APGA 4I9MA 1JVNA 2BXYA 2YCEA 4UB9A 3G1VA 3CPRA 2ABBA 4PTNA 1CENA 5CSRA 4UIOA 1BWKA 3GW0A 4JL2A 3LMZA 5E5CA 1WZAA 2PWFA 1ADSA 1C8VA 2QCCA 3CUHA 1H61A 3DESA 3IAPA 4YTTA 3GU2A 3MUCA 4HU0A 4P7QA 5I3HA 4RUBA 5AZ0A 4WHBA 4U33A 4XSLA 3WDPP 3J7HA 2FH6A 3WF1A 3V35A 4PMVA 2QPSA 5AC7A 2G4JA 4PUWA 3PTKA 2ISSA 2QCMA 3AS3A 3UXKA 1CLXA 3QC0A 4W8LA 2PDQA 1O1HA 3AIUA 5L9FA 1SJBA 3L2LA 4UTTA 2BASA 5KETA 3CUZA 4PRRA 1J93A 5BZAA 1K9DA 4AIUA 1R86A 1GYNA 2BOGX 2HQAA 1A3HA 4W89A 1GQJA 3EX1A 3BCDA 3S2MA 4XTIA 3LHYA 1UR0A 3QHMA 4ADTA 4JKLA 2ZUUA 4B2DA 5C9XA 3KP0A 5DY3A 5DN1A 2Z24A 1U5JA 5A95A 3P84A 5FF2A 2OKTA 3W37A 3OBKA 3GH5A 1EC7A 3NZRA 4PR4A 4Q3MA 1BF2A 4ZTYA 2BMBA 2XM1A 4Y96A 1GEHA 5I77A 4XIAA 3E0FA 1LYXA 4MDPA 4NP7A 2CBJA 3TR2A 3S1GA 3T07A 1V0MA 4MKSA 5CAKA 2PWDA 4NKCA 3N3MA 4ICMA 3HO8A 2EQDA 4W8BA 3N1AA 2YYUA 2IKHA 4CLMA 2DH2A 4GZIA 3QF0A 4C6NA 2ZZ3A 1TPWA 4W88A 1EA9C 2ATSA 4M1RA 4EAYA 1O6IA 1GQIA 3QYQA 2DJLA 2XPKA 1LQ2A 5CC6A 1XINA 1UIPA 1NEYA 3F4WA 4D8ZA 4OOZA 4H9XA 1OFOA 4RLIA 1H7RA 2BHUA 4F0RA 2HS6A 4G1KA 2AMGA 2JKAA 3NM3A 4PCTA 1RLCL 1SQ7A 1VJZA 2GJPA 2HJPA 2OKOA 1L2UA 2AQWA 4HCDA 1CGTA 2O4QA 1B90A 4O0ZA 1UOZA 2WM1A 1THFD 4X2RA 1EJRC 2E9BA 2TMDA 1TV8A 3STCA 3T4CA 4G56A 1UWQA 2INFA 1RH9A 1UUQA 2Y63A 1OIFA 1SJCA 4XSMA 3MZ2A 2WSKA 2JE8A 1PXGA 3ES7A 1X39A 4KWUA 4HNTA 4DBUA 3WNNA 3FDGA 4DEFA 4UQ9A 4RNJA 2RH9A 3CU2A 4UZSA 5BMWA 1BVNP 4LRSA 2WVSA 3BLOA 5JBDA 5HA7A 5FJJA 3L4YA 2WHLA 3LN3A 1CX9A 9XIMA 1J2WA 4HJFA 4UOQA 1DIEA 1UKTA 2DUZA 1AQMA 4C6DA 1BXCA 1TWWA 1ZY9A 3VX0A 1QNOA 2Y8KA 4Y7EA 3WMLA 4M80A 4DWSA 1E6XM 4NAEA 1GNXA 5LIWX 3H4XA 2ZVIA 4LB3A 4D2JA 1WA3A 2VRKA 3QZ6A 2QEZA 5A6TC 4QDPA 1J01A 4KCVA 4OUIA 2F7FA 1DOSA 4PSRA 4OUEA 2A7PA 2PWHA 3LLXA 4H9ZA 4E2DA 1LROA 2OQHA 3PHAA 1UQYA 3KOWA 3CYVA 2WCGA 1OWQA 2HEJA 2NT0A 5BXTA 1QOPA 1BYCA 1PDZA 3WLNA 3WNOA 4DAFA 4LUTA 3RU8X 3GXFA 5HAOA 3DFSA 1OK6A 2PBGA 4YWIA 3LPGA 2V69A 2CZ5A 3AZSA 1MUWA 2XFFA 2BVDA 1EP2A 3NL5A 5CSUA 3AFBA 1A5SA 2PLCA 2FGLA 3OIXA 3IIVA 3AJXA 2XM2A 3COTA 2WKJA 3THCA 3C8NA 3CWOX 1UROA 1JCJA 3TYDA 4MIMA 3ZJKA 3AIVA 1WKDA 1RPKA 1J11A 2J9XA 3MVIA 1GG1A 2CKRA 4LAUA 5B7ZA 1KCKA 1F6PA 2PD5A 3C6CA 2VFDA 3L12A 3WJZA 4DN1A 3VDGA 3LGDA 4UQEA 4BQ3A 1GPWA 4L6DA 2YX0A 4UQBA 4PMJA 4K1WA 3IJ7A 4TQTA 3C5QA 4JN8A 5CZKA 4A05A 4KEVA 4JTRA 2PDLA 3DDMA 4DJFC 5AC8A 4MNMA 3WDIA 3PULA 1HKKA 4DIAA 1BYDA 2RDTA 4LNYA 4XQ6A 4UTTC 2BY3A 3NQ6A 4HKPA 1JULA 1LORA 3L0NA 1BSLA 3RX2A 4IPIA 3P62A 1N7KA 2BB0A 3E96A 2DY3A 5A8MA 3N34A 3SY1A 1QPOA 4MJZA 5IFPA 4EKJA 4AUBA 5IHRA 2QQ6A 2J8GA 4LVBA 3EOSA 3UEQA 1GZJA 5FIPA 2D20A 2BVYA 3TU9A 1Z8AA 2BOEX 1XL9A 4UFJA 4ZENA 4Q8TA 4B9ZA 5MHBA 1RSCA 2YXOA 2GQAA 4J40A 3SCSA 1NSJA 3W2JA 3UERA 3EWZA 2HRWA 2DV0A 4U31A 2PWUA 3S5ZA 3KLLA 2ZYFA 3MHFA 1N8IA 2FVKA 5J5DA 1FUYA 1I0BA 4DUVA 3CEPA 2D2GA 3SDOA 3OGRA 1EUNA 5A1AA 3ZLHA 1QK0A 2A3AA 1E56A 4GCXA 3LBMA 4M6QA 2DSWA 2E77A 3M64A 1VFHA 4K38A 3HMJG 4GLEA 3G22A 1NQ6A 3RMEA 1ML1A 3QKZA 2UWFA 3OODA 3DOPA 5U4NA 1FWWA 1FCVA 1FHUA 2PMQA 1E1FA 4WDWA 2DJXA 2DIEA 3BC9A 3BLLA 3P93A 1MSSA 4D8AA 1BKHA 3O0KA 4CQ8A 3EPNA 2V68A 4K6AA 5ABHA 1P0DA 2E6DA 3WMCA 2X7WA 4JGDA 2BXVA 1PWLA 4EVZA 4TVCA 3MUXA 1UP0A 2O7QA 4CNSA 3W23A 3KBSA 2X8RA 3TFXA 3M0KA 1T96A 2V5CA 1SFSA 3DN5A 2ISFA 1QWKA 3Q37A 5DEZA 4PUNA 4C6IA 2F61A 1FWAC 1O12A 4FZIA 2WANA 3ABQA 4FS9A 1VBJA 1XP3A 1Q66A 4GVFA 1C8YA 4XZHA 1W9VA 3W07A 2OZTA 3KX6A 2JQXA 3SZ8A 1UR1A 5I7GA 1QDSA 2CZDA 4JTUA 3TE9A 4CEXC 2RGMA 4AEFA 3EB2A 2KZHA 3HIJA 3EYPA 3IIXA 1OF8A 4BEQA 1POJA 3UG4A 2V0TA 2WHKA 4W7WA 4RZBA 3VIMA 1UD2A 3BV4A 1OZMA 1FWFC 1QWGA 2FIQA 5LIUX 3TA9A 2ZVRA 3KTCA 2E6AA 2YCJA 5CEWA 4YHEA 1XS2A 2AL1A 3P7YA 1M04A 4NZ3A 5K9DA 2E25A 3UNTA 3TTOA 3B04A 4HCHA 1IWPA 3EX4A 5AYZA 2CZVA 1XJBA 2HK0A 3TYUA 1UW9A 5A8PA 1EZWA 1YTDA 2DP3A 2GOKA 3KBMA 5T9CE 4JIHA 5K7JA 2NLIA 3RHGA 1W3IA 3SSJA 4AX6A 4MADA 1I1XA 2WSRA 4EPDC 2OLAA 2CLMA 3BAYA 3SGUA 4E2BA 3N2CA 3TZNA 2PDMA 2ACSA 1U22A 1FKWA 1VQTA 1GQKA 2YGYA 2BSLA 4S39A 3MT1A 1QHPA 4V33A 4QSHA 5F1VA 4DI9A 1RBAA 3B9DA 5DF0A 2VYOA 1YXDA 4HNVA 1XIGA 3WCZA 4H7CA 4D71A 1E4LA 4QX4A 2CLHA 3PZGA 3TIMA 4GIRA 4KRTA 2W92A 4RE3A 7ODCA 1XH2A 2AAMA 1V7YA 3MP3A 4L6HA 3GZAA 1TV2A 1FWRA 1YQ2A 2E5BA 3GUWA 2BTMA 1PUDA 3MU7A 4FNRA 1YXYA 3PUGA 5D8ZA 3MHGA 4LWWA 2YW3A 2DIKA 1Z6KA 3E9AA 3TQ0A 2C0AA 2QS8A 4Z1DA 5EFDA 4PTXA 3F4DA 5AYBA 3NVDA 3F03K 3PTQA 3WH5A 4NAFA 1DWAM 2PDGA 1O5QA 3CZ8A 1C8QA 2UV8G 2YA1A 2HVNA 1WYIA 5D8WA 1B3ZA 4CN4A 2Q71A 3ARYA 6TAAA 3ORWA 4AU0A 4NZ1A 4JFVA 4S3KA 3AHYA 1JDEA 1Z44A 1P43A 1TPB1 3CS2A 2QVHA 2G37A 1BTCA 2CXGA 3TN4A 1EQCA 4KGJA 1C7TA 2PDNA 2P5NA 3ZLGA 4O12A 3GXPA 5K2ZA 3W3OA 3QR3A 5CPSA 3SY5A 2ABAA 4AIBA 1HO4A 5HMFA 3ITYA 3P0XA 3ZWTA 3CL8A 1WOBA 1NDWA 2ZTJA 4N2YA 3AXIA 3H54A 1KBJA 3BE7A 3VE9A 2ZOXA 3SCNA 2WVVB 4QNEA 4MGGA 1VEPA 2WNQA 5EFFA 3IVTA 3NQ2A 3WELA 1A49A 1TZ7A 1I0DA 4Y2WA 3BO9A 3KL5A 1TYGA 4IPPA 4AEEA 3RDKA 4WX2A 1A50A 1CNVA 3SRHA 1VCGA 5HNNA 1SO4A 2WPBA 3W86A 1OX4B 4LUSB 3KCJA 1KA9F 1ZBCA 3G6LA 3N14A 4PUJA 1B31A 1H63A 2PLJA 5AHLA 3BLPX 1H60A 3WK1A 2ZC8A 2WQDA 3PFMA 3TQPA 2YZRA 1VEMA 1POKA 2QHAA 3OTRA 1G69A 4O0KA 4NZJA 4OIFA 3PZOA 1AL8A 3KBJA 1YNQA 1BXBA 1GJUA 5CZSA 3HN3A 3KTXA 1E6NA 2JKPA 2WSQA 4B3ZA 1NWTA 1GOKA 2YFNA 2KAUC 3I7RA 4AWEA 3UVIA 4QBXA 2Y7GA 9RUBA 2OLSA 4ZQRA 1US0A 1B5TA 4ZB0A 3STFA 1QPRA 1E6PA 2J27A 3UZXA 4C65A 1T8QA 1XGZA 5HOSA 2WWCA 3WJWA 5CAHA 4AVOA 2VOTA 1XR2A 1K77A 2PDCA 4L5ZA 2EXOA 1VAHA 4NX5A 1XGEA 1XC6A 5C9RA 1I4NA 1DBTA 2NVAA 2QLYA 1YLVA 1DWFM 2OELA 2PWEA 5DCBA 3MMWA 4CQ9A 4ZQMA 4RV3A 1NU5A 1W3JA 2F9RA 2VEKA 2ZX9A 3REQB 1OCJA 1W8SA 4PRWA 1EJUC 5A8GA 3P67A 1TB3A 1QBAA 3KCLA 3UQNA 3LRMA 3KWSA 4I7WA 2QDDA 2NV2A 3RGTA 2CIPA 4B5SA 4MAVA 4EF9A 1QFEA 1DTUA 2B4GA 4J1OA 4LVGA 3W7JA 4KCUA 2D23A 1XD0A 5CSSA 1GWJA 2WJEA 4MY8A 3H7VA 4DZAA 3RK8A 4CVWA 2XHYA 3M16A 4JYDA 1J9YA 4ACZB 5JBEA 1UD6A 2J7DA 3CUFA 3RX4A 4R5EA 2CBIA 2W61A 3LHUA 3RFAA 3H2AA 5A6JA 1HF6A 4DPQA 3KVMA 5AHEA 4LYPA 1K7XA 4IG2B 1AJ2A 1SFJA 3BJSA 1TX2A 1O7AA 5D9NA 1QXLA 1JEZA 1W3KA 1U5HA 4K36A 4CNPA 1TMHA 1RK6A 1VB9A 2CLOA 4KRUA 3S2NA 4K1GA 1JI2A 2G41A 5GJNA 4HSHA 1PS9A 4EXQA 1X8CA 3QV6A 3WH7A 1PZ0A 4FX8A 3FJ4A 2W79A 4XD6A 1UOKA 1A3WA 1UH4A 1AH3A 4O0QA 1WPCA 4KRZA 5T8GA 4GINA 1I2PA 2PCEA 5FSDC 3W7CA 2WZTA 3W4RA 4LB4A 3ZR5A 4O50A 3OG3A 3S6DA 4AC7C 3N73A 1UKSA 4QJ1A 4QE5A 4Q7IA 1R7OA 1D8WA 1D3HA 1FCBA 4GXWA 2G50A 3QM3A 4S3FA 3CNYA 1X98A 1NAL1 2A6NA 4WOZA 5LXEA 4W85A 3STPA 3PZ9A 7TIMA 3HOJA 4GIYA 4QG9A 1W3TA 3GNRA 2OO6A 4US5A 4DBDA 2CITA 3O63A 3QTPA 3FK4A 4NXKA 3O06A 1W32A 2QCDA 3VZXA 2NQ5A 1S2VA 3FYYA 1SW0A 3II1A 3O3RA 1I2QA 1XQKA 1HKJA 2OOGA 3ABRA 1PX4A 3UWQA 4F0LA 4Q7NA 2XU2A 4HU4A 1O66A 1C9DA 3H2CA 4GA8A 1GVIA 2CBUA 4GO8A 1I1WA 1OADA 5KMYA 4JN7A 2REQB 1KM0A 3ITXA 2X16A 4Z17A 2BGQA 1JFHA 3GNOA 4QG6A 3A21A 4E3TA 4QEHA 1ZAHA 3D47A 4P7RA 4IMEA 2ZX7A 5ECVA 1J5TA 3W1XA 5BROA 3VU2A 3KWXA 1DQUA 3GHTA 1V6WA 4HNLA 1M41A 3DX5A 5HATA 3DC0A 3VNIA 4Z2KA 2C16A 1UUOA 2XZ7A 3DFPA 4GPNA 1A5NC 4GYPA 2JKEA 4LUIA 3GY1A 4CCZA 3R79A 4N4PA 1F8MA 3BAJA 4AD2A 2J7HA 3PBMA 3WJSA 4DZIA 2QYGA 4XZLX 4IPJA 3THAA 2B7OA 3RILA 1WBJA 4EP8C 3N4FA 1E0VA 4JNYA 4AZ7A 1WDWA 3TW9A 3W2MA 3DG7A 2QAFA 3H6OA 2VUNA 3K8KA 4PFMA 2VJXA 2PGEA 1BF6A 3OYXA 3F2BA 3TH6A 5GQBA 3WUEA 3E12A 3HPXA 1BVWA 5G1MA 3HJZA 3F4CA 2VC9A 3IIOA 4Y9NA 2PLMA 4GRSA 2GGJA 3FOKA 5IBXA 5CG7A 3MPGA 4V28A 4JFTA 2C18A 2XDFA 1MEWA 3S46A 3FXGA 1WKYA 2EEXA 3QPYA 9XIAA 3HA1A 4FX7A 4AIOA 3A47A 2F6XA 4MKNA 4ML9A 2V6AA 3NXFA 4ES4A 1UC4A 1VBHA 3LRLA 3M07A 3FDKA 1OFPA 2DZTA 1AMYA 4WXZA 5G4HC 2AQOA 2HZGA 4O11A 4MZ8A 3VNZA 2DZVA 4AZHA 1VBGA 1L2QA 4LS0A 3HGSA 3ATZA 1RCXB 3WF4A 4R33A 4GBUA 5HPCA 1UWIA 4GMEA 3GVWA 2ZRZA 3IS4A 4GZ7A 3WF2A 3OBEA 1GOIA 2H8ZA 3G6MA 4O8AA 3IK2A 7CGTA 1GOQA 1OBAA 3GLCA 2PA6A 1F3EA 4WR3A 3EWCA 4PTWA 3VC5A 1EO7A 3LD5A 2Z4GA 5C71A 3FKRA 4GQ0A 3S5SA 3SI9A 4AIEA 1B0IA 3CAQA 3E2SA 4K7VA 3WNKA 1Q6GA 4Z0JA 1IR1A 4L9XA 2XH2A 4RXFA 1B4EA 1JUEA 1G94A 2VZSA 2WVUA 1YKWA 2VD9A 3FSUA 4FIQA 4QTGA 4DM2A 3U7BA 2GDVA 4AQLA 3M7SA 4HPGA 3OJGA 1EC8A 3VIJA 4XO6A 2WLYA 3ARTA 4DM1A 1WX0A 3E2QA 1ELSA 5BWFA 3TCSA 1UD4A 1H3GA 1H5YA 5EMJA 4MPQA 5HNUA 3KVLA 3WDRA 3ERPA 5FOOA 1Q45A 2Y85A 1R30A 3ANUA 4H9UA 1TJPA 1R3SA 4KWSA 3WQEA 1CECA 5HMDA 4BF7A 2VENA 5EMLA 4QGCA 2VGBA 3CXOA 1HJUA 3W1AA 4IMDA 4TX8A 3HFYA 3VOGA 1ZBWA 1K8ZA 3ZFHA 2FLIA 3LTSA 2IQDA 3QMRA 1R3YA 2PD9A 1W37A 1DTNA 3NQDA 4K3ZA 3G8EA 4C5YA 4HPXA 4KIEA 1GZ1A 3H2FA 4NZFA 3CMFA 4AZGA 1DQXA 1F5ZA 1YW1A 3EMZA 4JQ1A 3W1NA 3MJMA 3KRBA 4IT1A 3VOHA 4QROA 5A2CA 2DZPA 2V5KA 4JCMA 4IIBA 3WK0A 5I23A 1FP9A 1TG7A 3L0KA 4GVGA 5A6BD 3AHTA 1IZKA 2V9DA 5FJUA 3QR1A 3B9AA 2QT3A 5DMNA 4M7SA 1FHLA 1OABA 1UA3A 2BOFX 1EPXA 4ZQCA 3UR5A 1YYAA 2GSEA 3ZT7A 4IMAA 3QV9A 1QI5A 2Q8XA 3AHVA 2GGGA 1UB3A 3TP4A 1UR3M 2FTWA 3PWAA 1Q6QA 1DYSA 1MQRA 4EANA 4QR6A 4ZBCA 4JHZA 3IAQA 3EOOA 2QJIA 3NEHA 4DJFA 1SMAA 4C1NB 4CU8A 1CXKA 3LY0A 2DUAA 3VD7A 1YX1A 3C3UA 5IXEA 3N13A 4GY7A 2C19A 2OG9A 4XVDA 4GUGA 3EWWA 1O5KA 4K8HA 4Y9OA 1T8XA 1PV8A 2VX4A 4IMFA 1NWUA 2BY0A 3M47A 4O53A 3LLDA 3K1DA 5CBBA 3CASA 4OFCA 3XIMA 4L4PA 4ZQPA 1FDJA 2BODX 4DWSD 2YL6A 3UU0A 1PTDA 3NQBA 5DMMA 5FEXA 2AKMA 3BLIA 1P0NA 3KRZA 1C7SA 3E2VA 3CQKA 1JCYA 1MW0A 4IG2A 5C55A 2E68A 4GVHA 1GONA 3G0XA 4A8LA 2PEVA 1V08A 2CERA 2XVKA 3PM6A 4IFKA 4MB4A 1R3WA 5DXXA 4EIVA 3O07A 1L6YA 3M6DA 1KB3A 4MSSA 4JTQA 2DT0A 4PMDA 2OODA 5FA5A 3C52A 4OU1A 2CHNA 3AZTA 2J6XA 3FAXA 2WXDM 4QLKA 4B4FA 2D0FA 2JK2A 2RJHA 5GNYA 1DJXA 3S8HA 1E9LA 3GNXA 2J4GA 3BW4A 3W7IA 4QNWA 3W38A 3C8FA 5FF7A 1VBRA 4DXXA 3SUUA 3MVTA 3POHA 5CXPA 4J4KA 4Q6JA 5A6AA 3R7MA 1KXHA 3VDCA 2D2HA 3SN1A 1QNPA 4HJWA 4UFLA 4R9XA 3OVPA 3H4WA 2HV5A 1NFGA 1OF6A 3SRKA 1VIZA 3H8AA 4BR1A 1KWKA 3KP1A 3VMPA 3P5YA 4GNJA 3VI2A 3IJQA 2R1PA 3OIHA 3W83A 2WO5A 3F1QA 2QUMA 4PMZA 1E6ZA 1RJQA 3CUIA 1D3GA 1SO3A 2BVWA 4QLLA 4BI5A 3JS3A 1QNSA 4D6JA 2HPIA 2F84A 4PBFA 1AODA 3A9IA 4GYKA 4MB5A 3BANA 1K3UA 3CT7A 4C6LA 5K9CA 1R2TA 3QBUA 1BRLB 3FHAA 5IRPA 1G4EA 4CCDA 3DHDA 3WD4A 3WBEA 2O7SA 2NUYA 2OXNA 3WQGA 3HBLA 1Y7VA 5A8QA 4KFNA 1AW1A 4ZA0A 1Q2SA 5FCZA 1ZBKA 4MY1A 3N25A 5I0DA 1VFTA 3MP5A 5KZDA 1TVPA 1CXLA 3U48A 3LPFA 5AN7A 3T7VA 3Q94A 3I4EA 4HHHA 3S1UA 5LNRA 1LBFA 7PTDA 1KRAC 2ZUVA 4CU6A 3FYOA 1HKWA 1LLZA 2ZUMA 5LNWA 1NH6A 3LXAA 1OFAA 3HG4A 1X1NA 4RJEA 1M65A 5A2BA 2YJQA 4WZHA 1GW9A 3ATYA 3ZVHB 5BXPA 1H11A 3ZJ8A 1H2JA 4QITA 4HPJA 3LI1A 1EDQA 4E8GA 1EBGA 3DENA 4U3CA 1NIUA 4H2HA 4U5KA 4US6A 1S5VA 1VCVA 1JL8A 1R9ZA 3KRSA 3LU2A 5XIMA 4GO9A 4A2SA 4BHYA 3S83A 1Q6DA 5CG0A 1RCQA 1GKPA 4PE8A 4JS3A 3DFYA 2OFJA 2DT2A 4XKYB 4O4WA 4PA8A 1L6WA 3HQPA 3QQWA 3UZWA 1CCWB 1V51A 1F6KA 1PCKA 1MO0A 1AG1O 2FB3A 4O54A 1BWVA 1T41A 2A7NA 3T0CA 4UWMA 1ISXA 1N82A 4FIRA 1J6PA 5CZ0A 1CIUA 1EPVA 2DSVA 2YW4A 1UR8A 4OHQA 3WQ8A 4RPQA 3VDAA 1TJ1A 1JCMP 2VRJA 3G3MA 1GOOA 4GUHA 2JFEX 2ZXBA 3UCCA 4LY4A 2A4AA 5C9WA 1M1BA 2P88A 1YE6A 1ECQA 1E1CB 1YBQA 2Y89A 2TAAA 5IM51 2NWRA 4ZQOA 2VXNA 2Z0IA 1K7EA 5DBUA 2B0MA 3N2TA 1D7KA 4XZNX 4REQA 2A21A 5HDRA 1FFRA 3HQ1A 1WXJA 4NIRA 4F0MA 3OZYA 4WJ8A 4D6DA 1E5NA 5A6LA 3PK7A 4CQCA 1F4AA 2PCQA 3LERA 4LS2A 2XH0A 3TJ4A 1E0TA 4A8IA 2YR1A 4XG1A 3WMSA 2OGJA 3OOQA 4KF1A 3UXAA 1YBQB 1LQ0A 3W7EA 2YA2A 1KR0A 1ONWA 3ZT6A 4E6MA 3G1SA 5CJ5A 1KBIA 3VOJA 3CIXA 1VZWA 1ZQ5A 2GK1A 2VO5A 4HK6A 3MWCA 1CBGA 2GWNA 2Z26A 4A3RA 3HTWA 3AMLA 4EWND 1LWJA 3ITLA 5RUBA 1GGOA 5JIPA 5E9XA 4LYKA 3VIOA 2O56A 3KZPA 4J3WA 1XG4A 2IPFA 1S1RA 4LSBA 3ELFA 5MKGB 4IX2A 5FJIA 2VDIA 1BGAA 1RR2A 3KDNA 1SFLA 2PSNA 4LUTB 3MSDA 1EZ2A 3GO2A 4H8HA 2VURA 1XIBA 1Z89A 1WP6A 1PKLA 2OEKA 3PPHA 1VEOA 3AXMA 1R0MA 1KWGA 3QHOA 4WKAA 1F61A 3C2FA 2PGRA 2FHBA 4TU1A 4DYEA 3C3NA 4AB4A 4EXAA 1HKVA 2FFIA 4M8UA 2FHCA 2QULA 1Z41A 3WDQA 4HK5A 2WC4A 2ACRA 1YEYA 3O6YX 1SZEA 3NQFA 5E70A 3B97A 2VR4A 5A94A 4GHRA 2FMNA 3A3WA 1YPFA 1XIEA 3GKAA 3PSWA 4V1YA 2QCDB 3SSZA 2CESA 3NDOA 4ALDA 1DJIA 3ZLFA 1W5OA 3KRUA 2OZ8A 4LNCA 1W56A 1OC5A 4QJ4B 1AZ1A 4XUGA 2DGAA 4M19A 3VUSA 1V0KA 3KS5A 3PBUA 4UTKA 3G24A 1EC9A 3LBCA 3W76A 2HE8A 3TDFA 4LBUA 3OA5A 1W31A 3N17A 4X60A 1XIFA 3ZO9A 3KBVA 3QSRA 1C8XA 1V3MA 4GUFA 4HHPA 4GI4A 2QW5A 4UOJA 1MNSA 1VGAA 4MYAA 3TN5A 1S5MA 5AOUA 3RPDA 5JXQA 3MSGA 1W1PA 4FR6A 3USBA 4AWSA 4S2BA 2J79A 4MLRA 1PL9A 1JPIA 4RPPA 3CUJA 3NPVA 1E6RA 1SO5A 3C2OA 2V2CA 1D8CA 3OLGA 1LG1A 4LRTA 1XLBA 1KM4A 5D37A 2VMFA 1A5LC 2DSZA 3A4AA 1RJRA 2WMFA 3LHWA 2VEIA 4LPCA 1QI4A 1PYMA 4NZCA 2HNHA 1TPFA 2ZX6A 3H2OA 4L80A 1MUCA 3PPCA 4N7QA 5KEZA 4B5WA 1JCXA 4B5NA 2XIBA 4DJDD 3TC6A 1KRMA 3R6IA 1TMLA 5H8UA 4FK9A 4ZZ9A 4HQVA 5C6MA 3W7KA 3I3BA 3PUOA 3W6LA 4BQ4A 3CBWA 3HFTA 3S5NA 4BY3A 4F4RA 1OZQA 3KFTA 4ZEPA 5JIWA 3UA4A 3PWGA 2NVCA 1GTHA 5D04C 5CGMA 4RKAA 3AIRA 4A6GA 1Q8JA 3NYZA 2PU0A 2MNRA 2VCAA 4QLJA 4LC6A 4PH6A 1K4GA 3MO4A 3UVAA 5DCEA 3BUVA 3O2LA 1B3OA 3D46A 4HK7A 4JTDA 1R47A 5AHNA 4LOCA 1G0CA 4FXSA 3EKLA 4IISA 4TOQA 1A5BA 3KUMA 2Y7DA 3HZ3A 2CWXA 3LCFA 5DRIA 7XIMA 1F6YA 1XYAA 2OPJA 1FWEC 2V2HA 2VI0A 4ACZA 3HB9A 3CZGA 3VOCA 4H8UA 5CSYA 3SIZA 3C2VA 4M82A 1HIZA 4FXJA 3A22A 4B3KA 3L4UA 2BY1A 3UCQA 3UG3A 4H41A 4GFIA 1BYAA 3DH7A 5AVHA 1GCYA 1P1MA 6A3HA 2Z1BA 4FNTA 1QO5A 2XN0A 3PN8A 4LBSA 3GXDA 1FOBA 1NF0A 2V3EA 4S3CA 4DLMA 4OT7A 2H9AA 4PCFA 1GVQA 1NOFA 1RP8A 4U2YA 3MI2A 3ALGA 1U33A 4NL1A 3K13A 3CM4A 3OVQA 2CHRA 3MWAA 3QOMA 5CQ1A 1S5WA 3QFEA 3B9EA 3BV7A 3JVAA 4UTLA 2EKCA 2J78A 3IRDA 3R43A 4KEUA 3D3FA 5FD0A 1U1HA 3ARVA 3G77A 4TVUA 3B8WA 2JGQA 4TTGA 1B3WA 3V4BA 3BSGA 4LU0A 3BZGA 3FJLA 4AY1A 3A23A 3SUWA 4RDVA 2ZTKA 3CUGA 3U4AA 2P0IA 3L4TA 4O17A 1SUXA 3W73A 3GG1A 1X7IA 3T0AA 2WOQA 1R3RA 3CLMA 3T42A 1G4SA 3GM8A 2O9RA 3Q45A 3NO5A 3SM0A 3EMQA 2E67A 3NQVA 3TZFA 1ONRA 4KCWA 1G01A 3VGDA 2CXEA 4GD0A 3M0JA 4DBEA 4FXRA 2J77A 4GYPC 4F66A 3OW1A 4IGNA 3SCOA 4HZMA 2FMOA 5D38A 3WK2A 1XFCA 4KCTA 4H04A 1XRFA 1TUXA 1Y8BA 1O95A 2NW0A 1FWCC 3LPPA 1OINA 5J5RA 5D32A 4NXSA 3IV8A 2XH7A 1QOXA 3ID7A 3H4GA 3BG9A 1KFKA 3GSMA 3URQA 1WUEA 4GQQA 2HCVA 4RE0A 4JAWA 4E8DA 2GUYA 1H1NA 1HP5A 1HXJA 2V30A 3L0GA 1BEUA 1CLVA 4AXKA 4DJFD 5I5RA 2WVVA 2J75A 3PFRA 4QDMA 2J66A 1KV5A 3ITCA 3ARUA 2BBFA 2OYKA 3TK7A 1PSCA 3FN9A 4IXXA 3IACA 3RLHA 1GQLA 4I7UA 1GOXA 1VFLA 5CPNA 4C7GA 1GEQA 4CNTA 4OBRA 4DPPA 2PAJA 2XISA 3M43A 1TPH1 5D33A 1HKMA 1TFVA 4HYR