4W5ZA

High resolution crystal structure of catalytic domain of chitinase 60 from psychrophilic bacteria moritella marina.
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
323
structure length
323
Chain Sequence
GTITSQDDNVVVGYWHNWCDGRGYQGGNAPCVELKTVNPQYNVVNISFMKVYDIAEGRIPTFKLDPTIALSEAEFIAQIDTLNSQGRSVLIALGGADAHIELTRGDEDALAAEIIRLTDLYGFDGLDIDLEQAAITAKDNQFVIPAALKMVKEHYRKTGDNFMITMAPEFPYLTANGAYTPYLTELDGYYDFINPQFYNQGGDGLWIEGVGWIAQNNDALKEEFIYYIADSLINGTRNYHKIPHDKLVFGLPSNIDAAATGYIQDPQDLYKAFDRLKAQGQPLRGVMTWSVNWDMGTDAANNSYNQQFIKDYGNFIHNQLPPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Chitinase 60
publication title High resolution crystal structure of catalytic domain of Chitinase 60 from psychrophilic bacteria Moritella marina.
rcsb
source organism Vibrio marinus
total genus 126
structure length 323
sequence length 323
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2014-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4w5zA00
3IK2A 1GW1A 3FAXA 2G3JA 2GVYA 3F5JA 4Z2HA 4D1IA 1F4HA 4AC1X 1JZ7A 2WWDA 4CCCA 5HBFA 1O6IA 4OIFA 5BYWA 1R87A 3SUTA 4PYSA 5FIPA 3KE0A 1W9UA 2EEXA 1DWIM 1E1FA 4BF7A 1VRXA 2VCAA 1E4LA 1D7FA 2WC7A 3WD2A 3WUBA 5JIWA 1E0VA 2PWGA 4UQEA 1DTUA 1C91A 4RE3A 3RM4A 3MU7A 3IAQA 4HZ6A 1CNVA 1QNSA 1NOFA 4AD1A 4PSPA 3PN8A 2ZIDA 3PZVA 1KCLA 4A3YA 2QV4A 2YKKA 3N04A 3S2CA 2V3GA 5E6ZA 2CEQA 3ARPA 4GZEA 1DWJM 1DWAM 5EBAA 3WQ5A 2E4TA 5JBDA 2G3MA 3OLGA 6A3HA 3QOMA 3WNMA 1BVZA 3WF1A 1B3XA 1FA2A 3WF4A 5HOSA 3ARUA 5A1AA 3HMCA 2JIWA 4H41A 4W89A 3VIFA 3W0KA 2EQDA 2BS9A 3BXWA 2VRQA 4M24A 5GNXA 4AZCB 3KL0A 5I5RA 1JYNA 1UQYA 5ABEA 3CZKA 1NOWA 1GVYA 1IZKA 1WE5A 1E72M 1PX4A 4P7NA 1E6PA 3ZO9A 1E3XA 1GCYA 1OCQA 5CG0A 2JEPA 2IUZA 3W28A 4MTVA 3WENA 4LGXA 4QLJA 3MSGA 4J3VA 2X1IA 1GOQA 1TA3B 4WKAA 4YPJA 2DT1A 2WVUA 1VENA 2V3EA 2FGLA 3NYDA 3W37A 2JF6A 2MANA 2PF0A 1CEOA 4ZXOA 4TTUA 3KL3A 2D0HA 1OBAA 3DYOA 4D1JA 1JAEA 2CIPA 4NRRA 1H3GA 1WB0A 2PC8A 1JF6A 4J28A 4UR9A 3ZOAA 1JZ2A 2XVNA 5CXPA 3T2QA 1WDQA 2WZIA 4M56A 1J01A 3MV11 4U33A 4M81A 1MWOA 2J7HA 3D3AA 1L8NA 3RO8A 2DSZA 1GJWA 1MQQA 3L4YA 3VIKA 2AOSA 1W1VA 1B1YA 3GDBA 5BWFA 1E1EA 1S46A 2JFEX 2EPMX 2D22A 2AAAA 2CKRA 3VGFA 1CXEA 1JG9A 3F4VA 2XFYA 3VGBA 1F4AA 1LG1A 5E6YA 2CERA 1CGVA 2WVTA 2X09A 2O92A 4V2XA 4WIWA 4HU0A 2J62A 3BLKA 1GPFA 4JHZA 1BF2A 4WJXA 4F9DA 3UG3A 2CXGA 4P7OA 1CYGA 2ZUUA 2NW0A 4PMDA 4S3KA 1LL4A 5HPOA 4QAWA 2WVSA 4CKQA 1GZJA 1ZL1A 2VTFA 1J0ZA 3SCVA 4BA0A 8CGTA 3L4VA 4U2YA 3VPLA 1TA3A 2VX6A 2V38A 1BYAA 1TVPA 1VFFA 2E8ZA 5KZ6A 2XVGA 1OIFA 3G6MA 3WF3A 3WNNA 3OLIA 1UQZA 5EB8A 4JZ5A 1HN1A 3VIGA 3W81A 2BHYA 2JALA 3T0AA 3WF0A 3W38A 4D71A 2OYKA 2FHFA 4BQ2A 1J0KA 4CVUA 1KR1A 5CQ1A 5E70A 2YA0A 1UZ4A 3BAJA 3EDJA 3SUVA 1UKQA 1KXVA 1QI0A 3RM8A 4YN5A 1HJSA 1NP0A 1HL8A 4JL1A 5ABFB 3MMDA 1UWSA 3MUAA 3N17A 4WSKA 1W3KA 4URIA 3WEOA 1XV8A 2WVVA 3WQ6A 3BH4A 4AZ6A 1XC6A 4CUCA 5D9PA 3PTQA 3CUGA 3AHTA 2V5DA 4GIAA 1TE1A 2G8ZA 3LPFA 2WANA 3I3BA 1V0KA 4U2ZA 1MW0A 4TVCA 3AIBA 4IPNB 1WNOA 2ZWZA 3RJXA 3UR8A 1WZKA 2YBTA 1XH1A 4J3TA 3AICA 4JIEA 1JZ6A 4PSRA 1US2A 3ZT7A 3ALGA 3OLDA 2EPOA 2WMHA 4ATLA 2Y4SA 1GJUA 3K8MA 4GZJA 1JZ4A 1Q6FA 1J0YA 4EE9A 1WO2A 2DSUA 3ARZA 4GZIA 1L0PA 4GPNA 9CGTA 2VURA 4WSJA 4GO8A 4P8XA 4HU8A 2DPEA 4UQAA 5FKYA 1FFQA 4HMEA 1JZ8A 3OZPA 1KXTA 2BFGA 3AS2A 4N42A 2ZX5A 3AISA 1GVIA 2XFFA 3PZMA 3CUIA 1ZU8A 4HMCA 4Y7EA 1XSKA 2ZICA 3OA5A 1OGGA 2XSAA 4MDOA 1GOIA 4NZCA 1UG6A 4AEEA 3ZSTA 1OSEA 1BYBA 1KQYA 5ABFA 2E9BA 3GYCA 1UR8A 5DEZA 3AYSA 3RPMA 4LXFA 2ZX9A 2WMFA 1UWTA 4L4PA 3WQVA 3W29A 1R7AA 3VIHA 3NSNA 2XVKA 1V3HA 3ZT6A 3ALFA 4CN6A 5JBFA 4DWSB 4PMQA 1W1TA 1B3VA 2VVSA 3ARYA 5JIPA 3UESA 3TP4A 3QR3A 4JAWA 2YLLA 1NWRA 3CUFA 4UNIA 2QMKA 1CGTA 5A3HA 5HDRA 1CGWA 1XHGA 1UH3A 4V27A 4KRUA 1OD0A 2YJQA 3GBDA 2WNWA 2YIHA 1E9LA 1VFOA 4A4AA 1GORA 1E4NA 2VI0A 4HA4A 2VNCA 3NJ3A 1UZ1A 1B3ZA 3MKKA 3PZQA 3SCOA 3WMCA 1Q6EA 3GNOA 1CLXA 2VMFA 2QLYA 2WBKA 2X8RA 4R27A 4QLLA 1CXIA 3MO4A 1MFUA 1HP4A 1LG2A 3EBVA 3ZJ8A 5I24A 1CXLA 2G4FA 4B15A 4PTMA 4AYSA 1E71M 2W63A 2WK2A 1FFRA 3CBWA 4W8LA 2NSXA 4U31A 3T2PA 1HKKA 1TR1A 4ATWA 2W5FA 2GSJA 2WMJA 3L4ZA 4XUYA 2BHUA 2VOTA 1DP0A 1W1YA 1QNPA 3VD3A 2Q8XA 4DWSD 2BXYA 1PPIA 1J18A 2PB1A 2VC9A 2F2HA 1E5JA 1AMYA 1G94A 1V02E 3W6LA 2O9PA 4MJ2A 2ZXAA 3O2LA 1QPKA 2XSBA 1V3MA 4UZUA 3B9DA 1RD6A 4QFUA 4PMOA 5EMYA 2DH3A 3VD7A 5ABGA 4DWSA 8A3HA 1DWGM 1PBGA 3WNPA 3ZM8A 3SIMA 2D20A 2WHKA 3E1F1 1G9HA 4C7GA 1AVAA 4P7QA 1CBGA 3CH9A 3VDCA 1KWGA 1QOXA 5DT5A 3AIVA 5LA0A 3WFZA 2C8NA 3WD1A 5LA2A 4AD3A 2ZX6A 1HNYA 3WIJA 2OSXA 3CHCA 1JFXA 5I23A 2E8YA 4CD4A 1C3FA 3AS1A 4KRTA 1H11A 3GH4A 1IT0A 4NRSA 1OD8A 3AMLA 4MNLA 1JD7A 4PN2A 4AEFA 3CHDA 1BG9A 1UKTA 4AD2A 3PZGA 2XJ7A 3EDEA 3NCOA 1ISVA 2BVTA 4BQ3A 1E6NA 3K4AA 4UQDA 5DT7A 1JNEA 4FLQA 1B2YA 3WMBA 2VQUA 1C8XA 5A6AA 1K9EA 1M01A 1PX3A 4W93A 1HIZA 3UG4A 2PWEA 1WZAA 4ACZB 1CDGA 5A6SA 5HPCA 4RE2A 4B16A 3WDIA 5M3WA 1Q6CA 4C7FA 3A4XA 5EFDA 1HF6A 1JD9A 3GTNA 3MUZ1 1H49A 1JFHA 4FLRA 3QHNA 5FCZA 3VMNA 3GXIA 1H5VA 4JFWA 1PIFA 2J8FA 4PTWA 2W61A 3AIEA 3MANA 1CXHA 5A8NA 4N0RA 4QCEA 4DM2A 1G1YA 1UH4A 2BHZA 3K8LA 2J7GA 4MB1A 4CGTA 4HTYA 3N11A 5BXPA 4EK7A 5JUVA 3ZQ9A 3GNRA 3VVGA 2VR5A 3AZTA 2XM1A 4AD5A 2UWFA 3WQ4A 4PCSA 1BG4A 3BAXA 4D6HA 1QI3A 3VNYA 1SYTA 3WELA 4MB4A 3OG2A 4W5ZA 4J3XA 1EO5A 1KGXA 4A3HA 3B8SA 3WQWA 4HPHA 3LPGA 3WNKA 1EHAA 3A3HA 1W2PA 1VEPA 2J7DA 3IJ9A 1E0WA 5A95A 5A6KA 2WMKA 1B90A 1B31A 1HX0A 1UD6A 4BZYA 3M46A 1FP8A 3BLPX 4JL2A 2J8GA 3AYRA 4W8BA 4AZGA 4ZE4A 1WDSA 1J0HA 3AXIA 4ACZA 2O9TA 1V6VA 3PBGA 3CMJA 1E4MM 4JKLA 4TX6A 4Z2JA 2Y8KA 1HKJA 1EOMA 2ZX8A 1CENA 3W24A 2EO7A 4PCTA 2YL6A 1TVNA 2WLZA 1LWHA 3OB8A 4JCMA 5D8WA 4AMCA 3WQ8A 1MFVA 1QI5A 3SCNA 2FHCA 3AHXA 4XB3A 1W3HA 3W25A 2WM0A 1MQPA 4CN1A 2ZXQA 5F7UA 3VIIA 2WXDM 1PEZA 1JIBA 1FH9A 4M29A 3BMVA 3T0DA 1EDGA 1LWJA 2VT0A 4PMXA 2FDMA 3FAWA 4ZFMA 4HOZA 1W3LA 1IZJA 1E55A 1EGZA 1HJUA 1HJWA 3BGAA 3WN6A 1K9FA 2TAAA 4Z2GA 3GM8A 1J9YA 1B3YA 2J77A 3HN3A 3UEQA 4W7UA 3O9NA 3AMDA 2J7EA 1LLOA 1OT2A 2YDQA 3GXFA 3VD9A 3AMCA 2VZSA 1K6AA 1MXGA 1W9DM 4EAMA 5A8OA 1K9DA 2WC4A 5FOOA 2WSPA 2D2OA 2WYSA 4GI9A 2WAGA 4M82A 2DT3A 2XIIA 1U30A 3HJEA 3DHPA 2Z1SA 1BVNP 4RL3A 1NWSA 5M03A 4W84A 2X0HA 2UY2A 3TTOA 4J3SA 4BS0A 3S6TA 5C8BB 2GUYA 3DC0A 4MAVA 3M07A 4HOXA 2WCGA 4CD6A 5IFPA 2DIEA 3WH8A 4AZ7A 2WCAA 2WVVB 5I0DA 3FY1A 1NH6A 2VL4A 2GK1B 4W8AA 1W9XA 4IM4A 2UY5A 3WH7A 4F9JA 3CO4A 5HNNA 1VJSA 3WUEA 2VCBA 5ABHA 2IXUA 4Z2LA 2GJXA 2GFTA 1V0MA 1DWFM 2J78A 3WFLA 4AY1A 2WHJA 1UWUA 2ZUVA 4WLCA 2A3BA 2XVPA 2VUYA 4RE4A 5M17A 4OKDA 4X0VA 1TFVA 4CU6A 2OSYA 3AZSA 1VF8A 1VBRA 4XZBA 1FOBA 3PZNA 3FHQA 3DHUA 6TAAA 4UFJA 1BLIA 1KGUA 3OGSA 1BHGA 1KWKA 3U5UA 1SMDA 3VGHA 5GPRA 1WPCA 3MUIA 3CGTA 4GINA 4QDMA 1OIMA 2XPKA 3A4WA 1JDCA 1EH9A 4DUXA 2W66A 5HXMA 2BXZA 1N82A 1UWQA 2VX5A 4IPLA 4ZENA 3ZR6A 2J25A 3MUY1 1KCKA 3EYPA 3THDA 1KR0A 3K1DA 1EOKA 1JAKA 1V6XA 2CCRA 4L4OA 2PBOA 4CN4A 1V3KA 2YA2A 1V03A 4AD4A 1OGSA 2VO5A 4PBGA 1MQRA 2JF7A 5A8MA 4B3KA 3OZOA 3OBAA 2GK1A 1V0NA 4LPCA 2NT0A 2ZE0A 2YA1A 3VNZA 4UCFA 3GH7A 4WKFA 4OOZA 3CMGA 3UETA 1UHVA 3JUGA 2WMGA 4UFKA 3AHVA 2BNJA 2BY3A 3AIQA 1G5AA 1X6NA 1VBUA 3EDKA 4NI3A 5A2BA 4ATDA 1FHLA 2RGMA 3CHEA 1MYRA 3A6OA 2ZUSA 4D6EA 1VEMA 1XYFA 2DT2A 5E0FA 3ARTA 3WD0A 1BQCA 1R7OA 1V6WA 5A6JA 5I6SA 1ZBVA 1OGBA 4U3CA 3BAWA 2BV9A 4UFLA 3W4RA 3IJ8A 1KGWA 4W87A 4HZ8A 1ITXA 3WDQA 3SUWA 5FL1A 4QP0A 2DEPA 3BAIA 4LYPA 3SCSA 2ZUNA 1UWIA 2BY1A 4MNKA 4JHOA 2EBNA 1VB9A 3T0BA 1TMQA 1TG7A 1JI1A 1G0CA 1V3JA 1UR2A 1ECEA 2DIJA 4R5EA 5LYRA 1DEDA 1U2YA 1GQIA 3J7HA 2YL5A 1H4PA 1UKOA 3B9EA 3HU7A 1QNQA 4FLOA 4E8DA 4W86A 3VMOA 2WZHA 1EDTA 3N13A 1ISWA 2J4GA 3VM7A 6CGTA 4PUDA 3POHA 5D9OA 1K9TA 5A2AA 1R86A 3DYPA 2E3ZA 3L4WA 4P8VA 2G3IA 5I79A 1UR1A 1WP6A 1W2VA 1CZ1A 2UY4A 3WEZA 1RH9A 2D3LA 1QI4A 3WUGA 3VMPA 1UD3A 4XZWA 1D2KA 1NOUA 1C8YA 1XYZA 3AI0A 1UWRA 4IISA 1HVQA 3AROA 2WPGA 1NWUA 4TOQA 2O9OA 1E40A 1BPLB 3K4DA 2OYLA 2J75A 2EPKX 1EXPA 1SFSA 1CGYA 3AIWA 3VM5A 4IUGA 3BAYA 5I77A 1SR0A 1OINA 4QCFA 2XWDA 2A3CA 1EQPA 4PUEA 1J12A 1NQ6A 1XD1A 3AQUA 1V0LA 4KGLA 1VEOA 4J27A 2WC3A 3AMKA 1VJZA 5A2CA 3VD5A 1ZB5A 2C7FA 2OYMA 2EJ1A 2JE8A 2WZEA 4D6CA 1SMAA 3ZMRA 4OBSA 3K8KA 1GUVA 2J74A 4HA3A 1ISXA 4AIEA 2VQTA 3VGEA 1ISZA 2FH6A 2JEQA 1QHZA 1BFNA 1KXHA 1R8LA 2WB5A 4GO9A 3U57A 3UG5A 4YHGA 4HPGA 1CXKA 3ZSSA 1HL9A 1BGGA 4W85A 1TUXA 5IXEA 2GDVA 1CECA 2XHYA 4B9ZA 4P8UA 2D0GA 2EPNA 4CCDA 5I2UA 2WKLA 1XGZA 4D6FA 5CPSA 2QF8A 2CNCA 1LJYA 4FMVA 1HT6A 1E6ZA 2CBJA 2EXOA 1QVBA 3BAKA 5FD0A 3I3DA 4KMQA 5A8PA 4PEEA 3M7SA 3CZEA 1RP9A 1UR4A 3WBEA 4AZBA 3ZJ7A 4OZOA 1PIGA 1JDDA 1NM9A 1KBKA 4U5KA 2BVDA 3RM9A 5E0CA 4KH2A 1O7AA 1V6YA 3PTKA 1YQ2A 4UFIA 2PWHA 5BXTA 4Z2KA 1E3ZA 3ARSA 3GH5A 4U3AA 2O9RA 4H04A 3ECQA 1I1WA 4GQQA 3IJ7A 1H09A 1R85A 4TVDA 1JZ3A 1PX8A 3NIYA 4AIUA 5CPTA 4XV0A 1W3JA 2J7FA 4JFVA 2YDSA 2DH2A 4Q22A 3PZUA 3SEPA 2WMIB 1FH7A 3IANA 3L4XA 1J0JA 1LL6A 2CHOA 3O6AA 2CBIA 4CD5A 2HVMA 4TTGA 1UR0A 4H8UA 2W67A 1XCWA 3CIVA 2WKGA 1NP2A 3TA9A 1M7XA 1W9PA 5D8ZA 3RMEA 3WH6A 1HVXA 4GXPA 2E0PA 2OWCA 3RIKA 3SCQA 2EPLX 3AJ7A 5C71A 1WZMA 3QGVA 2CBUA 5DMYA 1EHNA 1A3HA 1P6WA 4PMZA 4PMRA 2YOCA 4ZXLA 3G6LA 2DSKA 2W92A 2ZX7A 3AHYA 4E8CA 3MS8A 3ZJKA 4B3LA 3N15A 1HJVA 3WL1A 1HKIA 3U5YA 1US3A 1W1PA 3THCA 2CPUA 1MW2A 4H7VA 1AQMA 2X2YA 1XRVA 1GQJA 1JI2A 1XCXA 1Y7VA 4V28A 4D72A 2IXVA 2ZUMA 4BQ5A 3WDJA 2PWDA 3M6DA 3SURA 1W32A 4GI6A 4D6GA 4W5UA 4MJ4A 1E56A 2VJXA 3N9KA 3T08A 3IAPA 1DHKA 4OBRA 1JXKA 2VVNA 2DSWA 1E6RA 1CWYA 2DGAA 2XUCA 1MW1A 1XSJA 1Z32X 2PWFA 4WF7A 3SCUA 2WMIA 3ZT5A 4ZE5A 1FP9A 1NARA 3CZLA 3UCQA 2FGZA 5DFAA 1EQCA 3WH9A 4W88A 3MV01 2XIBA 3GXMA 5M5DA 4H8HA 5GQBA 3AXHA 1EDQA 4TVUA 1KB3A 3GNPA 1OWQA 4HA1A 4LQ1A 5TD4A 4E4PA 3AHZA 2VX4A 3U7BA 1B9ZA 1U33A 1JGIA 1BTCA 2V3FA 1NWTA 1OM0A 1ESWA 2Y5EA 3QHOA 1YHTA 3RCNA 4UZSA 1J0IA 2J47A 4D6IA 2WBGA 1UKPA 1UD4A 1TCMA 3MMUA 4P7LA 2A3HA 2ZUWA 3TOPA 3BCDA 1E6SM 3A47A 3ARQA 3NSMA 1JL8A 2CKSA 1E0XA 1UA7A 3W53A 2VX7A 3PZTA 1AQ0A 2XTKA 3WDRA 7A3HA 1X1NA 2GJXB 2WHMA 2C0HA 3AIRA 5IDIA 1ZBKA 2OSWA 3TTYA 4TXEA 1QBAA 4FF5A 3SUUA 1JYWA 4LYQA 7CGTA 1H2JA 2ZXBA 3A4AA 4HZ7A 3EDDA 3WUFA 3VILA 1B30A 1PZ2A 4AD0A 3FNDA 1E4IA 4EKJA 4TUFA 3W82A 5D9MA 1GQKA 3OLEA 4NF7A 2QPUA 3EMZA 5BXSA 3CZJA 5A94A 4CD7A 4C7DA 3VO0A 2VZTA 3WD4A 4MNMA 3GXDA 3NSXA 4J7RA 1W91A 1OT1A 1X6LA 3L4UA 3WDHA 1CGXA 4B9YA 1MVYA 2WCSA 1C90A 4J3WA 3N12A 3ARVA 1UA3A 1C92A 2W62A 2WLYA 3K46A 3WY1A 4AW7A 1HXJA 3FW6A 2QHAA 2XG9A 2YBUA 1GONA 1G01A 1V08A 4CD8A 2J79A 5D9NA 3RDKA 1BSIA 1FH8A 1JDAA 4J3UA 4BCEA 2WHLA 3EDFA 3SUSA 3DECA 2OLHA 4HMDA 1CIUA 2CHNA 4D6JA 4DM1A 4FK9A 2GJPA 1QNOA 1HKMA 2Y24A 1Q4NX 1UOKA 2XGIA 1GHSA 4UOZA 1MW3A 1C7TA 2A3EA 2HISA 2YL9A 3AFBA 3OIHA 4X9YA 1KXQA 3PZ9A 1XH0A 2VZOA 2VZUA 1VFMA 1HJXA 5A8QA 1E6XM 1QW8A 1E6QM 3VIMA 4AZCA 3AXXA 1IV8A 3BMWA 1C8QA 3NDYA 1QBBA 4W7VA 2CETA 5A69A 1Q6GA 1V6UA 3POCA 1AQHA 4GI8A 1V02A 1QHOA 2ZOXA 1ODZA 4DUVA 4P8WA 5CSYA 1GOOA 1CPUA 4KGJA 4UOQA 3CUHA 5D4YA 3KZSA 4H8VA 1ITCA 1CTNA 4AZHA 4UTFA 3SCRA 1WAWA 2XYLA 4UOJA 2YL8A 1E15A 2VR4A 1ZBWA 4JKMA 5KEZA 2DDXA 3CTTA 3FHAA 2RGLA 2BVYA 5BRQA 1I75A 1KFWA 3VUPA 2BY2A 3AS0A 3CPUA 4GKLA 3VDBA 3VD4A 2NT1A 2CBVA 4HOWA 4H2CA 2VRKA 2YDRA 4LYRA 4X0NA 4Q7NA 4MNJA 4DUWA 4OUEA 1H41A 1BYDA 4XX6A 2W91A 3FXYA 3APGA 1WCGA 2E9LA 3BC9A 2D24A 5CSUA 5AC4A 3NDZA 3N18A 3MSDA 1JYXA 1C93A 4AIOA 1H1NA 1CLVA 2J7CA 1LL7A 4M8UA 3PZIA 2OWXA 4LX4A 3VGDA 2G41A 2GDUA 5CPQA 1GNXA 1H0GA 5AY7A 3RJYA 2WSKA 4GQRA 1M04A 5GNYA 5AYIA 5CJ5A 3CUJA 4AWEA 1ZJAA 2FHBA 7TAAA 3I3EA 1LF1A 3WSUA 3N1AA 3VDAA 3ZR5A 2QMJA 5C70A 1QHPA 5GNZA 5AYBA 3UR7A 1DWHM 1OB0A 2DQXA 1V3IA 3OGRA 4JCLA 3ARXA 1JZ5A 4PMUA 4PMYA 1J11A 3VKKA 3WNLA 2YLAA 1I1XA 2XVLA 5FL0A 3SCTA 2X0YA 1JF5A 4PTXA 1V3LA 1PJ9A 1XSIA 2D3NA 1ZJBA 2VCCA 1GQLA 4MDPA 1GOWA 2XM2A 1UUQA 3CLWA 4YHEA 4MB5A 4E2OA 2G3NA 2XGBA 1A47A 2X05A 1TZ7A 3ARWA 4NSBA 4M80A 2PBGA 5A6BD 3TTSA 3WKZA 5EFFA 1UYQA 3VINA 1ZBCA 1E5NA 3ZIZA 3GBEA 1M03A 3VIPA 5E9AA 4K68A 1H0IA 3WH5A 3VOCA 1ZS2A 5A6BA 3PZOA 4F79A 2D23A 5JBEA 2V5CA 3ARRA 4DWSC 2XFRA 5ECUA 1JNDA 5IHSA 4F66A 3OGVA 1UKSA 3AMGA 1CGUA 3QOKA 3WL0A 3W6MA 3L2MA 3AZRA 1W9VA 4JKKA 1BYCA 2CESA 2J7BA 2WW5A 2QPSA 3PTMA 1E73M 1XH2A 4MB3A 1ODUA 2F61A 1E70M 2E9MA 4MADA 5DF0A 5BXRA 2CYGA 1KBBA 5CGTA 5CLWA 5I78A 3VIOA 4AZ5A 2PI6A 1J10A 2VRJA 3GZAA 4PMNA 4JFUA 3VIJA 1UD2A 3NUKA 1UD5A 3LMYA 3VTRA 1ISYA 3PHAA 3T09A 4WKHA 3WMSA 1E43A 2Y2WA 2BY0A 3TTQA 2GJRA 3BSGA 5IHRA 4JFTA 2AMGA 4FLSA 1EIBA 3W26A 5DO8A 3FN9A 2E40A 4ZEPA 2ZWYA 4CU8A 1BGAA 4QLKA 4S3JA 3LPPA 3MMWA 3WEMA 1UH2A 3L2LA 3EMCA 1CXFA 1UR9A 4W7WA 3VU2A 2A3AA 4BQ4A 2CITA 5CGMA 3CHFA 1VIWA 4OOUA 1LQ0A 2ZXDA 1UD8A 4P7RA 3VDHA 2ESCA 1M53A 3UERA 3KEHA 5BRPA 3U7VA 5CLTA 3WNOA 2D1ZA 5BCAA 2DSVA 1GHRA 2JIEA 4WK9A 1B0IA 2F8QA 1FHDA 3AS3A 2DT0A 4AXNA 3QHMA 4MPKA 1Q6DA 3SCPA 4CU7A 1GOKA 2UY3A 4AISA 3TONA 3BSHA 3D5HA 3B9AA 3VX0A 3WD3A 2B31A 1JYVA 3KWXA 1WDPA 1VAHA 2V3DA 3BCFA 3F5LA 5CZKA 3KL5A 3DYMA 2ZUTA 5AC5A 1XD0A 1QNRA 2D0FA 4PRWA 1EO7A 1HP5A 5IFTA 2Y8VA 4OJYA 5I3DA 1JXJA 3LPOA 3VX1A 5A6MA 1VFUA 3ZJ6A 1KQZA 3SCWA 4TX8A 3WDPP 4ML4A 4EANA 4UQ9A 2VZVA 1GOMA 1C7SA 1WKYA 3VGGA 3AOFA 1RP8A 4JFSA 1PAMA 3II1A 4MAZA 4U5IA 3EMQA 4HP5A 1QI2A 1D3CA 1W9BM 4Z2IA 1B3WA 3AIUA 3W27A 2OWWA 4F8XA 4UQCA 4ACYA 1BAGA 2Z1KA 2WWCA 5A6LA 4CVWA 2FH8A 3RILA 4AZIA 1WZLA 4D6DA 1PZ3A 4KWUA 5LA1A 4CCEA 1EA9C 2W4XA 4UQBA 1MXDA 1WDRA 4M1RA 4PTVA 5E09A 3WBAA 3L4TA 1HJQA 5BROA 3WF2A 1QW9A 4PMVA 3T2OA 4UFMA 3CZGA 3CZ8A 4UFHA 3F5KA 2XWEA 1RPKA
chains in the Genus database with same CATH superfamily
4DYEA 2ADAA 2YFOA 2OLSA 1I2RA 2Y70A 1XDMA 1K1DA 4Z2HA 4I3GA 3IPWA 3GAKA 1DHPA 1GWJA 1GKQA 1NELA 1O6IA 2ZDSA 3ANVA 4G1NA 5CPMA 2PRLA 2EG7A 3N4FA 2TRSA 4GIRA 1QO5A 1VRXA 2VCAA 5JIWA 3Q2DA 4UQEA 3B8UA 2DU2A 3T6CA 3T1GA 4QNWA 3VA8A 1KCLA 1EJXC 4A3YA 2QV4A 3ARPA 4GZEA 5TF0A 1G4SA 1KFEA 2E4TA 3R11A 3KBJA 6A3HA 5C9RA 3QOMA 1BVZA 1G7VA 2XH0A 1GVSA 3LCXA 1B3XA 1FA2A 3WF4A 5HOSA 4JTUA 5A1AA 3HMCA 4JX6A 4W89A 4NI8A 3PJWA 3L65A 2G0WA 3BXWA 5GNXA 4X61A 1AA1B 2PLMA 4DJDD 4GRSA 5CAHA 2X7VA 4L7ZA 1OF6A 1MRAA 4WVXA 4JX4A 1E72M 1BXBA 5FEPA 1GOXA 3LRKA 2W9MA 3PWGA 3VC5A 2JEPA 1A5NC 3LGGA 3E3HA 3EA1A 4AUBA 3AYTA 4DJDA 5A6TC 2I9UA 1WKEA 2AL2B 3T8QA 2X1IA 4MPQA 4NZ4A 3W37A 2JF6A 3CIXA 4GUJA 2PF0A 1CEOA 2NQLA 2X1TA 4TTUA 2QF7A 3Q67A 4WHBA 1H3GA 2QCGA 4LV4A 3BK0A 1JF6A 4J28A 4EXQA 2XVNA 4YIWA 3T2QA 3QZAA 4M56A 4MZ1A 1M68A 1H63A 2YXOA 3H2CA 1CT5A 2J7HA 4LUIA 2DSZA 2CLOA 3N25A 4Y9MA 3VIKA 1W1VA 2R9RA 2HK1A 3BMXA 3QC0A 1RQEA 2BG5A 2EPMX 4WOQA 1AZ1A 2AAAA 2CKRA 3TC3A 5T9CE 2XFYA 2MUCA 1LT7A 2J66A 2WVTA 2NUWA 2X09A 4BEUA 1ME7A 3BLKA 3OVPA 4JHZA 4WJXA 2GJLA 1JCMP 1KM1A 4S3KA 3RMJA 4QAWA 1XJBA 1V4YA 4C1NB 3C3NA 1ZL1A 3L68A 2GSHA 2IPGA 2VEKA 2ONEA 3L4VA 4U2YA 8CGTA 1IEQA 1TVPA 5KZ6A 3IUIA 3P93A 4C91A 1ZCOA 3QMRA 2RDTA 3GFZA 3MVTA 4N4QA 3W81A 1X96A 1GZGA 4Q4MA 1J79A 4RZ6A 1Z9AA 2A4AA 3NQ8A 4N9EA 2OYKA 4D71A 3ABOA 4RZ5A 3NQ6A 2X1SA 3EEZA 1RK6A 1Y5VA 1EJUC 3EDJA 3VXGA 3N14A 4PCPA 4RNFA 3MTWA 1UKQA 2Y61A 1NP0A 4JL1A 4A8RA 1MNZA 1X7FA 2NUXA 1LQAA 2GWNA 5ABFB 1T8QA 1UWSA 4UBPC 1XWYA 1Q3NA 2FDSA 4O52A 1QWGA 4URIA 2Y6ZA 2A85A 3AHTA 1N2VA 4GIAA 1E1CB 3WJSA 3R7MA 4U28A 3LPFA 3H22A 2ALRA 4GMEA 2OT0A 2WANA 1I45A 5DMMA 2R91A 3EWXA 4U2ZA 1K4GA 3AIBA 1EJSC 2QNEA 4GQBA 2OZ8A 2XH2A 3EX3A 2YBTA 3UR8A 4EX4A 1DYSA 1UOZA 1VPQA 4M0XA 3AICA 1JZ6A 1US2A 2ZKMX 3G3DA 4ATLA 3GAYA 2Y4SA 4GZJA 3K8MA 3GG7A 1Q6FA 4C1NA 1WO2A 3ARZA 1P7TB 1XINA 4WUIA 3LX9A 3LG3A 3A5VA 2XSXA 4A21A 3FYYA 2PWUA 3UYIA 3M43A 3W71A 1KXTA 3R10A 4N42A 1D3HA 3A9BA 3BJFA 2PODA 2E25A 2WPBA 5C9WA 3COTA 2QGYA 5GJMA 4AEEA 3UGRA 1BYBA 5ABFA 2NQJA 3RPMA 3XISA 4LBRA 3CYJA 2ZX9A 5K9XA 4JTEA 3V3WA 3WG6A 5D30A 1VHCA 3B3DA 3FJ6A 2DW6A 3ORWA 4DI9A 2PDJA 5HJLA 1E1CA 2OO0A 3FJ4A 1YNYA 3VNLA 4PMQA 1W1TA 3WX7A 3QR3A 4JAWA 3PPHA 2R24A 4B5XA 3W7EA 2QMKA 1CGTA 1XHGA 2QIIA 1TQJA 4XUGA 4S1FA 3CH0A 2YIHA 3QLDA 1YE4A 3PFRA 2DZAA 2HBVA 2Y63A 1P7TA 3CV1A 4QSHA 3I65A 3WMCA 5LNVA 1Q6EA 3GNOA 1QPNA 4GGBA 3ICJA 1GGOA 1GJPA 3BOLA 4YS1A 2OXNA 3RG6A 1OFEA 5I24A 1FDJA 5HR6A 4KCVA 8XIMA 3E2SA 2NSXA 3T2PA 3HGRA 3IK4A 1Q6RA 2GSJA 4XUYA 2BMBA 4OWGA 2VOTA 4GACA 1D8WA 1EKOA 1VD6A 2YZRA 3VD3A 3NEHA 4PRTA 1PPIA 1J18A 1PS9A 3SM0A 1ENUA 3EAUA 1R3YA 3UD6A 2VC9A 2Y1HA 5CPLA 5EY5A 3H8AA 1T40A 1V02E 1IHIA 4XTIA 3W6LA 1YIXA 3O2LA 5EMJA 5FJIA 4UZUA 1QPQA 1EEXA 2PDIA 4FX7A 2DH3A 3HPSA 4B4FA 3K2GA 2QZRA 4PB5A 1XLIA 3KDNA 3WLLA 1I9CB 1CBGA 1K7EA 2YGYA 1QOXA 4DO7A 4LALA 1CB7B 4DEFA 4GH3A 4NIRA 1OYAA 3WD1A 4AD3A 3WLHA 1HNYA 1RCOB 1Z69A 4MYAA 1JFXA 1HO1A 4AMAA 1UZHA 3R1ZA 1QASA 1C3FA 1EP3A 1PCWA 3GH4A 1QK2A 1IT0A 1ZJIA 3C2RA 4QTGA 4C6BA 5HINA 4LAKA 4MNLA 4PN2A 4WY0B 2AKMA 4GLEA 1UKTA 4AD2A 2PURA 2XJ7A 4QG8A 4JDBA 4ZOCA 4B2DA 4UQDA 4FLQA 3URQA 2ZZ3A 4FA3A 4W9TA 1AG1O 5A6AA 1JR1A 2Q8ZA 4IMDA 1BWKA 4JIIX 3UG4A 5A6SA 5HPCA 2OQYA 2QCDB 4RE2A 4IMEA 4XKYB 2EF9A 2X2GA 3W2JA 1TJ2A 3DGBA 3MUZ1 4DLFA 2A21A 3HG2A 4ENLA 5I02A 2Y7GA 5H8UA 4FB7A 3B9NA 3MCMA 2J8FA 1NDVA 3MANA 1HL2A 3RPTA 4N0RA 4NNAA 3TXVA 3Q4DA 3ITLA 3TC7A 4ZQCA 3W86A 1FWSA 3K8LA 5BXPA 3TYAA 4N6FA 1SJCA 1VRDA 4DF0A 3T9PA 4PCSA 1JCNA 5AZ1A 3BAXA 3P61A 3PVFA 3W7DA 2G97A 4MB4A 3KRSA 3OG2A 3KBWA 4J3XA 1S2TA 4WRHA 4MZ8A 2EAWA 3B8SA 3C2OA 3WQWA 4UB9A 4WY0A 3CEUA 4RNJA 1VEPA 3QSTA 3M6YA 3R13A 2OZ3A 1HX0A 3W6YA 1NQKA 3TYZA 3MO7A 3AYVA 4Z0SA 2VGFA 3UXDA 3PBGA 2QCDA 4MMWA 1E4MM 4JKLA 4L1WA 4Z2JA 1ZNNA 5B80A 3H2EA 4XKYA 2EO7A 4PC8A 2OKOA 4YCPA 5HAOA 5D8WA 4PH6A 1QI5A 4EVZA 3RCYA 5CZ0A 3K5XA 3AHXA 3H2NA 2V5JA 2AGKA 1W3HA 4GC3A 1F5ZA 1MQPA 1A5OC 2HTMA 5F7UA 3B0UX 1JIBA 1FH9A 3CQHA 2ZC8A 1EDGA 2VT0A 4XVEA 3MP4A 4ZFMA 4HOZA 1FDZA 1OC6A 1E55A 1EGZA 1AFSA 3WN6A 3VCCA 1K9FA 2FGBA 3HN3A 4W7UA 2V5LA 2YDQA 1YNPA 1U83A 3CT7A 2VEPA 2NQ5A 3B97A 2VZSA 1POKA 1MXGA 4PA8A 5D09A 5HWNA 3PUOA 2WC4A 2XZ7A 3W7NA 3H53A 3NM3A 3BE7A 4AX7A 1BWLA 2Z1SA 4LS1A 5EMUA 4KS0A 3UY8A 5M03A 1S2WA 2HE5A 1DQXA 2QIWA 3ELFA 3TTOA 4BS0A 2BGSA 3T42A 3HV8A 2IKGA 4FXFA 5D38A 4QRNA 3WH8A 2CLPA 3GUGA 3NL6A 5DXYA 2BASA 4DZHA 2VL4A 1W9XA 2UY5A 3WH7A 1TO3A 4KCWA 1D9EA 5G5IA 5HNNA 3WQOA 3W7JA 1Q7ZA 3IJLA 3G1DA 4LY8A 2P0OA 3EEGA 1U22A 5ABHA 1R0MA 4Z2LA 2GJXA 4HK7A 4HMNA 3MUXA 2CFFA 1KBLA 2WHJA 3LHZA 4WQ6A 4XZNX 4F3HA 2A3BA 1UB3A 4Y2WA 5DN1A 2VUYA 4LVBA 5M17A 1EJVC 1P0EA 4YJ5A 2ISDA 2OSYA 1VF8A 1VBRA 4XZBA 3FKKA 3IGUA 3DHUA 4UFJA 3NL5A 1QW7A 3HA1A 2X42A 1UJPA 2W3ZA 1S5TA 1HUVA 3U5UA 4AEOA 3UVIA 5GPRA 2XIQA 3MUIA 3CGTA 3BLFA 3ZWSA 3BLOA 6REQB 5LNWA 3A4WA 4O14A 4IQJA 4DUXA 5B7ZA 5C6MA 2QCMA 2PDHA 2VX5A 3TAOA 1OFDA 4GKTA 4Q6XA 4OFCA 3K1DA 4RDYA 1JAKA 1V6XA 1RY0A 3UZ5A 2P50A 2PBOA 1V3KA 1V03A 3HMJG 1ITUA 1YDNA 4B3KA 2NT0A 1UJQA 4O0ZA 4QXIA 3USBA 4ILSA 3GH7A 4OOZA 3KBNA 1UHVA 1T0OA 2BY3A 1GQNA 3HGOA 1BQGA 4KEZA 5LXXA 3RLHA 4DX3A 2VELA 4DF1A 4FNRA 3LLFA 2RGMA 4XIMA 5B7YA 3UWZA 1XYFA 4MWAE 5E0FA 3HFYA 4HNTA 4QS5A 2PD9A 4L6OA 3MZ2A 3ARTA 4PODA 4PZVA 2YB4A 3WD0A 1BQCA 1R7OA 4HJWA 2BV9A 2J6XA 4LNYA 1Y5WA 4JY9A 4WZHA 2C19A 2YR1A 2DEPA 5AC6A 4LYPA 3CB8A 3W07A 2ANUA 3MBFA 1RA5A 1VB9A 4GJJA 3B40A 4GBUA 1VCGA 6REQA 2QJIA 1GQIA 3CWNA 4JEJA 4W86A 3VMOA 2WZHA 2OELA 3RLVA 4KIEA 4Z17A 1A53A 3POHA 5A2AA 1DL3A 3A21A 4LW7A 4OGZA 2E3ZA 4OE7A 3UF9A 3BOFA 2D3LA 1DVJA 3A22A 4YWIA 3W2LA 1PIIA 2E6DA 1OFAA 3AI0A 3BLLA 1UWRA 3ISIX 1Y65A 1HVQA 1W1IE 3K4DA 1FWAC 1Q8JA 3ABXA 4B5SA 4GIEA 4OHQA 2A3CA 2QCEA 3GG8A 2GQAA 4UR7A 5H1WA 1J12A 2ZRZA 1BSLA 4V1XA 2OODA 3SN1A 5DRCA 2WC3A 1OEPA 1RVKA 3UZWA 2R1LA 3VD5A 4YCOA 5PTDA 1VPYA 4PTNA 4D6CA 3ZMRA 1UBPC 3EWYA 1GUVA 4DBWA 2J74A 4HA3A 1BXNA 1ISXA 4IP7A 2V2DA 1X1ZA 4AIEA 1GK8A 2VQTA 4N4PA 1GKPA 3OU8A 2JEQA 3HBLA 1BFNA 2PCEA 2DZWA 5LSMA 1XLFA 3DBPA 4GO9A 4HPGA 3RAOA 2I17A 3UXAA 2PGWA 2EPNA 4CCDA 4RLIA 2CNCA 3TQVA 3VOJA 4XIAA 1PWMA 2PEVA 4EPKA 1SQ7A 2CBJA 2EXOA 2Y85A 3BAKA 1XIGA 4KMQA 3TCSA 3TV8A 4AZBA 4OZOA 4JIQA 5KMYA 3A23A 1PIGA 1JDDA 1NM9A 2ALDA 1CW2A 4MY8A 1O5XA 5K7JA 1OX4B 1QWKA 4POCA 1V6YA 1YQ2A 2DUZA 1E3ZA 4KPLA 3ARSA 1I2PA 4BI6A 3U9IA 2PDKA 3ECQA 1KRCC 3O06A 4GQQA 3IJ7A 4NAEB 4TVDA 4Z1YA 2ZTKA 1PX8A 4WD0A 4G9PA 2RJGA 1B3OA 2J7FA 1DJZA 2YDSA 4ZGYA 3H4GA 1NFPA 2Z25A 3M5YA 3SEPA 1M5WA 3K13A 4GFIA 3M4HA 2CHOA 4XO7A 4WJEA 4TTGA 3DKLA 2JKPA 4TV5A 4O57A 1UUOA 1AW5A 1M7XA 4DAFA 5D8ZA 1HVXA 2E0PA 1TV8A 2OWCA 3SCQA 1ME9A 3AJ7A 1F3TA 1WZMA 4DBEA 4BJHA 2QCNA 3T78A 1A3HA 4Q8NA 5EYWA 4R85A 4PMZA 4PMRA 2GSEA 3MUCA 3G0UA 2HCVA 3BARA 4LUSB 2W92A 3D6NA 3SY8A 3MS8A 3ZJKA 5KTLA 5L6UA 4B3LA 5AYXA 4WGHA 1HJVA 4RNHA 1HKIA 2I5IA 1US3A 2CPUA 1US0A 3E38A 1XRSA 3SADA 3TWBA 3NPXA 1ZSXA 1Y7VA 1QT1A 1JQXA 2IXVA 3WDJA 4D6GA 3GHSA 1EC7A 2XN1A 5FJJA 4MJ4A 1EGVA 2RH9A 1MEIA 3TFCA 4K39A 4NAEA 4OBRA 4FX8A 2Q02A 3O63A 1G7UA 1XSJA 4WF7A 4XG1A 3LYEA 4MOZA 3H55A 3SY1A 3ZT5A 1DBTA 1FP9A 1IGWA 2QEZA 3FLUA 4DJDC 5DFAA 1EQCA 3MV01 4O18A 4CNPA 4IJCA 1LLZA 3B04A 5GQBA 1EDQA 4TVUA 4HA1A 2AMXA 3M0KA 4ADSA 1B9ZA 5FA5A 4C6IA 3O15A 1JRCA 1JGIA 1NWTA 3T07A 1QNVA 2BB0A 4LB4A 3QHOA 3RCNA 4UZSA 1H60A 2J47A 1UKPA 4C1KA 1SO5A 4MSSA 1EX5A 1W5OA 3LK6A 3GTHA 3UW6A 3VI2A 3A47A 3W1XA 4FXRA 3H12A 3A5FA 1KLYA 3RFAA 1JL8A 3GIPA 3TH6A 3EPMA 4Q8WA 3PZTA 3QVQA 1AQ0A 2W27A 5IDIA 1QAPA 4TXEA 1F3XA 1TCDA 5K9CA 4LYQA 4L80A 1DORA 2R82A 2P5NA 1ICQA 3IIXA 3SGUA 2ISWA 1B30A 1PZ1A 4IG2B 4JPGA 1E4IA 4EKJA 3PSWA 4TUFA 3LCFA 4K36A 2BZNA 4JIPA 3GFYA 2GVEA 3EMZA 4LBUA 1E51A 3CZJA 3B03A 2EKCA 1LLWA 1VFLA 6ALDA 3L4UA 2DFAA 1N7KA 3W2UA 2ZRUA 2FKPA 2I5QA 3K46A 2WLYA 5E1QA 4Y90A 1XLCA 4I5RA 2PDQA 1HXJA 3IVSA 2QHAA 4WX2A 1GONA 4FI4A 4I9MA 4YTQA 5IBXC 4JNYA 1A5SA 2J79A 4I5UA 1S5VA 1W3TA 1G4PA 3L0GA 3RNDA 4XWUA 4NZFA 2QJHA 2GJPA 1SSDA 1Q4NX 1I60A 2XGIA 4S3EA 5I3HA 1J4EA 1F9CA 2QDEA 2VD9A 3PZ9A 4RJEA 3FA4A 1XH0A 4IIFA 1PDYA 2FFCA 3NO1A 1IWBA 4C6PA 4IG2A 3VC6A 5CG7A 4I9AA 3NDYA 5A69A 2WJDA 1R47A 4GI8A 1BKSA 1V02A 4Z1CA 1REQB 1G67A 3WFAA 1KBJA 2Q6ZA 4RPQA 2G3FA 1FQ0A 2CU0A 4LVAA 4XAFA 3S9IA 3GNXA 3CUHA 3R2GA 3KZSA 1ITCA 3EWBX 2IQTA 3SCRA 1WAWA 2XYLA 2YL8A 1UP2A 1LWIA 3BW2A 4JKMA 3CTTA 2RGLA 1B4EA 4NX5A 3P62A 1KFWA 3VUPA 4QITA 2Z24A 4GKLA 1RSCA 4JQAA 1XRFA 2FQIA 2QCFA 3CQJA 1V77A 4HNUA 2QR6A 2VGIA 3G1YA 4O4VA 4MG4A 2PGRA 2VWTA 1ICPA 3M44A 3CAKA 2W91A 3FXYA 3APGA 3MHUA 3RX4A 1LDCA 5AC4A 4R7JA 4M1BA 2C15A 3W7CA 1C93A 4XZ9A 2VDIA 4RV8A 4M8UA 2FLIA 1U1JA 3AC0A 5CPQA 1TSIA 4M6VA 1H0GA 3RJYA 1EFZA 3OOQA 5GNYA 1MDRA 2REQA 2PDYA 3MSYA 5CJ5A 2FHBA 3BSMA 5CH9A 2QMJA 3FIGA 3IRDA 1KV8A 5GNZA 5AYBA 3UA4A 3UR7A 2DQXA 3OGRA 1QU4A 3SN4A 1AK5A 4GYPC 1REQA 3TW7A 3TR2A 4A8LA 5I3GA 2YLAA 2ABAA 4DZAA 2A1YA 3GDRA 5F4XA 1TB3A 3HPZA 5FL0A 3KOXA 3SCTA 2PDFA 1JF5A 4PTXA 3TX9A 1XSIA 4RCXA 4MVAA 2VCCA 4IHCA 5FEXA 1J93A 1UUQA 3HG3A 3M64A 5D32A 4MB5A 3GS6A 4OQVA 1OYBA 2FVMA 3TN6A 4ECLA 1NFBA 3ARWA 2ZRYA 3FA3A 4O13A 5A6BD 3S5NA 3R43A 1AH4A 5EFFA 3FCPA 1LOSA 1M03A 3VIPA 5E9AA 2ZCGA 1X98A 3WH5A 5C0QA 5A6BA 3PZOA 4LH8A 3CNYA 4F79A 1K8XA 5JBEA 2ZZ7A 3N6HA 1ZALA 3QXBA 4S3GA 1RBAA 3DG6A 3V0UA 4ZZ9A 1JNDA 5AKQA 5IHSA 1FUYA 2PD5A 4CQ9A 3WL0A 3W6MA 3MW7A 2G95A 4IIHA 2CESA 2Q3RA 2QPSA 3PTMA 5DANA 1FKXA 4DYKA 1ODUA 2F61A 4XSLA 2ZTJA 1JRBA 3PUEA 5DF0A 1TV4A 1ZP4A 2QVHA 2OFJA 4QGCA 2Y7FA 3HOJA 2CLFA 1J10A 5GJPA 2WKJA 3QW3A 4IQDA 1FWBC 5ENLA 3VIJA 1UD2A 2Z7KA 1PDZA 1V7AA 1KRAC 1V93A 1ISYA 2BOGX 3PHAA 4WKHA 5CBIA 2BY0A 1KFBA 3TTQA 4BF9A 4JNMA 4ZEPA 4OT7A 1R9YA 4DIAA 1BGAA 1ZAIA 2ZVIA 3CUXA 3MSRA 4JTRA 1LBLA 1S39A 1G4TA 4NZJA 1GVFA 1UH2A 4ZTXA 3EMCA 4CQ8A 4W7WA 3ITCA 3VU2A 3IEBA 2A3AA 3LHWA 3H24A 4BQ4A 3CHFA 3CPGA 1LQ0A 2ZE3A 2ZXDA 5AC8A 5KINA 3VDHA 2ZA2A 3KEHA 4RDWA 4KCUA 1FRBA 3HG5A 4GVIA 1W56A 3L9CA 2D1ZA 1GHRA 4LC8A 4DZ5A 3VNJA 3S47A 2JIEA 1IZCA 2F8QA 2HVNA 4OV9A 1W5QA 4AXNA 4MPKA 3C3UA 1R38A 2OGJA 3VKAA 3VX0A 3EWUA 3WD3A 3U2EA 1AZ2A 2V3DA 3F5LA 1DKWA 1B57A 1EF2A 4H1ZA 4JNZA 4Z0JA 4MWAB 3LXBA 4Q8TA 3RR1A 4O0KA 3NYZA 4OJYA 1JXJA 4HPXA 1VFUA 2I9EA 3F4NA 2E6FA 3VK5A 3RO6A 4MGGA 4EANA 4UQ9A 1XLAA 1K7FA 1Q13A 4R53A 1XL9A 3AOFA 1GPWA 4UXDA 5I3JA 3CL7A 4HIBA 3TIMA 4O19A 1KM0A 2BLEA 4GCAA 1TJPA 4F8XA 4UQCA 1RD5A 1WUEA 4MLRA 2I1OA 4N9BA 1P0KA 2A7PA 2FH8A 3B8WA 4JTHA 3GK0A 1XISA 5LA1A 3PBYA 3UZYA 1WDRA 1TPVA 1TPFA 2CW6A 1OC5A 3WF2A 2I16A 3L5LA 2PDMA 4O1CA 3F5KA 3IK2A 3F4WA 4AYGA 1O12A 3WYZA 8RUCA 3FAXA 3D0CA 3F5JA 4E4FA 3SJ3A 3W7GA 1JZ7A 4U10A 5HBFA 4Q4QA 3L12A 4C6OA 3WLIA 1YX1A 3EOOA 3SUTA 3KE0A 4LT9A 1DWIM 5CBBA 2PU0A 4BF7A 2QUNA 4MWAA 1DV7A 1Q6OA 1A5AA 1B54A 3WD2A 1E0VA 3UR2A 1YRRA 4G6CA 4FNQA 3G1HA 4AD1A 3PR2A 2QVNA 2YKKA 2PC4A 2PFHA 3LI1A 2O55A 2CEQA 3H54A 4N7QA 1DWJM 3E74A 2VWSA 5EBAA 3PB2A 4K1GA 1XIMA 1IR2A 3WBYA 5BNKA 1IIGA 3M9YA 4HJFA 3VE7A 3TJ4A 4NNCA 3G22A 3TWAA 4H41A 3VIFA 3W0KA 2VRQA 1TTQA 3LCLA 3QZ6A 3N29A 1JYNA 3LN3A 3YPIA 4JDYA 1V6TA 5E9XA 5C9UA 3P82A 3NQGA 1PX4A 4K7VA 4N9CA 1KBIA 2HSAA 2J6VA 4MTVA 1E9IA 1XG3A 5D37A 3NQEA 2E28A 1GOQA 2E68A 4WKAA 4YPJA 2DT1A 2DZPA 2OEJA 2E5CA 3T40A 2HS8A 2Y5SA 1TWIA 2H3BA 4IP5A 4NNBA 4E5TA 4ZO6A 4ZXOA 4HNVA 3V4BA 3SBFA 3DYOA 2GGIA 4J4KA 4D1JA 1JAEA 4MJMA 2NXIA 2J9XA 5HNUA 4MFEA 1WB0A 3ZOAA 3QBUA 3ZVHB 3PP7A 3LQGA 1TV5A 4LUTB 5CXPA 1LROA 2WZIA 1TPEA 4AHQA 3MV11 4ZO9A 3QY6A 4QJ3B 4ZVJA 1GJWA 1JUBA 2BSLA 3CMFA 3CV2A 5BWFA 3GDBA 3AU2A 3NOYA 1SJDA 1BEUA 1S46A 3W1TA 5BWAA 1VFTA 2D22A 2BGNE 3LXCA 3W23A 5AECA 2A5HA 3FV9A 1JG9A 4DPQA 3VGBA 1LG1A 2CERA 4F0SA 1CGVA 3HPAA 1FTXA 1A0DA 4GI4A 4WIWA 3RK8A 5T9BG 3QZEA 1BF2A 4F9DA 2CXGA 1CYGA 4HD5A 2ZUUA 4YVVA 4CKQA 1F7BA 1OY0A 2YX0A 2PDXA 4PFHA 4DJFD 3AUOA 1J0ZA 4BA0A 2DZVA 1Q2SA 2PPGA 3WF3A 3HPFA 1YPIA 2YPIA 2GZXA 3WLTA 4L9YA 3VIGA 4DJFA 1JPKA 5CZSA 2JALA 2H8XA 3W38A 2FHFA 3HPXA 1J0KA 3P5ZA 4CVUA 4A05A 3ZVHA 4LWWA 1UZ4A 4I8YA 3CAVA 2E6AA 3E12A 4LUTA 1THFD 4RDZA 3SUVA 2JGYA 3CL6A 1Z8AA 1KXVA 2QT3A 1QI0A 1XYLA 3B8DA 4DJED 1HJSA 2P8CA 1HL8A 3THQA 3DFHA 2IQDA 1GYMA 3G18A 3MYPA 3H2FA 3BZGA 4IX0A 3MUAA 3E6EA 3TZNA 1XKJA 3DESA 5LIXX 4QJ5B 1XV8A 3WQ6A 1EUNA 4DJEA 5D9PA 2V5DA 3W70A 3E96A 1AD4A 1TE1A 2G8ZA 3I3BA 1L6WA 2GQ8A 3MKVA 4JTIA 4IPNB 1OFRA 1WNOA 1OFOA 2ZWZA 1FX6A 1B9BA 3CO8A 3ATYA 3SDOA 1IE7C 2E7FA 5K3VA 2X41A 3IIOA 4DWDA 5FF0A 4UTMA 4IFRA 4GZIA 5FI8A 2WOQA 1ADDA 2HMCA 3MKCA 3OBEA 2DPEA 3F03K 4NKCA 1LZOA 3ZZ1A 1OFBA 1FFQA 4NZ5A 1SJAA 3AS2A 4UTWA 2QDDA 1GVIA 5FJRA 2XFFA 2H8ZA 3EWCA 3CUIA 5JU6A 1ZU8A 4Y9AA 2ZICA 2DUAA 4EP8C 4MDOA 1RQHA 5JMUA 3IJDA 3UXKA 3ZSTA 3TW9A 1PWLA 4KESA 2E9BA 1XPYA 3AYSA 2WZTA 2V2CA 4LXFA 1YTKA 4L4PA 5M2FX 3S1UA 1XXXA 1P1XA 1TPDA 1M7JA 4K8EA 3ZT6A 3GU2A 4CEUC 5JBFA 3G0SA 4FP1A 4XBSA 1B3VA 2VVSA 3DIPA 3ARYA 3TP4A 5G4WA 1NWRA 3W7IA 2Q3OA 3CUFA 3BG3A 3Q37A 3MDWA 5A3HA 5EBUA 3N2CA 5KZMA 4JQ2A 3GC2A 2YJQA 3GBDA 1WOAA 1LORA 2NXHA 4JTAA 2WNWA 1PSCA 1VFOA 4A4AA 3JS3A 3FOKA 1LP6A 2Y0FA 1AJZA 3FA5A 2YW4A 3PSVA 3NJ3A 2VNCA 1PXGA 3HB9A 4HA4A 1B3ZA 1VJIA 2RHGA 3PFMA 3MKKA 1R9XA 2HEJA 4HSOA 3O0KA 4K2SA 3U4FA 2WNNA 4PMJA 1CXIA 3MO4A 2FYMA 1CXLA 1RZMA 2G4FA 1J2WA 4B15A 4PTMA 3N4AA 4IPIA 4IICA 2W63A 5D2WA 2GYIA 3HO8A 3CBWA 4E2DA 2FTYA 2PDGA 1F2JA 1HKKA 1KC7A 4H7ZA 3IJ6A 4ATWA 1VBGA 2WMJA 3QRHA 4IIGA 1AD1A 1DP0A 2CHRA 3LB0A 1JCXA 1RY8A 1AL8A 1VFHA 4CNUA 4CNOA 3B8IA 1G94A 4RR4A 5F4SA 1Q2RA 4O17A 4ERGA 3R12A 1TR9A 4E2BA 2V2HA 3VD7A 3W7HA 3WLSA 1M6JA 2ACQA 2Q09A 3MWCA 4IWWA 8A3HA 4YMZA 1F73A 3VNIA 1PBGA 1O1ZA 3SIMA 3UXLA 3SQMA 4KEMA 4C7GA 3NQDA 1WBJA 5HNTA 1YTDA 5HR7A 1IXQA 1AH3A 3AIVA 4FOUA 3STCA 3I7SA 4LS0A 5JVLA 1A49A 4PUJA 4NHVA 2ZX6A 4S2CA 1XRTA 3F7JA 2OSXA 4IMAA 2ZZ1A 3VCRA 5I23A 2B7OA 4DRSA 4JTKA 1M1BA 2G4JA 4L1XA 1H7PA 5G2HA 3AMLA 4AEFA 1SZNA 1BG9A 3PZGA 4RW5A 1O95A 2HNHA 5DT7A 5BU9A 3WMBA 1R3WA 4NZ1A 4HK6A 1PX3A 1WKDA 3TLLA 1HIZA 3L5AA 1WZAA 4ACZB 3RU6A 3DH7A 4XAZA 4B16A 1Q6CA 3TSMA 3KDOA 1K70A 3OQEA 3AU6A 1P5BA 1HF6A 3CQ0A 4W4QA 1JFHA 5ABTA 2E1DA 4DHGA 3BQ6A 4XZHA 2TODA 3GIQA 2PSNA 3SRHA 3KAOA 2RJHA 3KRBA 5A8NA 3KRZA 3KTXA 3BO9A 2WJZA 1EUAA 4RX0A 2HXUA 3QFEA 3QR0A 2J7GA 4CGTA 4M7TA 4I9JA 1ZAJA 3PY2A 3ZQ9A 3GNRA 4US5D 3VVGA 3GR7A 1JULA 4HSNA 1MEWA 1IQ8A 3S2LA 3TEVA 2NX3A 3DERA 4F0RA 3VCNA 4MYXA 2P8BA 3QFWA 4RNIA 1QI3A 3VNYA 4ZQRA 1A5UA 3S9YA 3RLGA 4W5ZA 4US5A 4IMFA 3LMZA 4HPHA 3CXOA 3WNKA 1EHAA 2J7DA 3KX6A 1E0WA 5A6KA 1B90A 3SGZA 4UWMA 2YCKX 1B31A 3WLJA 3TAKA 3NOEA 3CU2A 3MI3A 4JL2A 3S6DA 4GUGA 1ONRA 4AZGA 4ZE4A 1J0HA 1S1RA 4ACZA 4C90A 1V6VA 1EOMA 3C2YA 3C6CA 5I3IA 2Z27A 3GVGA 1TVNA 4AMCA 1MFVA 4M5PA 1T96A 2PA6A 1TWZA 3Q58A 3FSUA 1TJ1A 4PFMA 3W25A 3NO5A 3UZJA 1P43A 2WXDM 3S1XA 3BMVA 2C79A 2E67A 1A4LA 4H9UA 1LWJA 3O3RA 5TQLA 2SFPA 3WQPA 3VKJA 3FAWA 2V30A 4JTJA 1W3LA 4FNPA 1IZJA 4QG6A 1HJUA 4PL2A 4C65A 1OZMA 2TAAA 4Z2GA 1H7WA 1J9YA 3UEQA 3O9NA 1A80A 1EC9A 4L5ZA 3VD9A 5G1TA 1NDZA 4PGLA 4A3UA 1K9DA 3KBMA 2D2OA 4GI9A 2I5GA 2XIIA 3HJEA 4H83A 3DHPA 4S39A 1BVNP 4RL3A 3S5ZA 4B91A 2UY2A 5DCDA 1E9YB 2Z00A 2CWNA 3M5ZA 4H3DA 3S6TA 4MAVA 3M07A 2WCGA 5IFPA 2DIEA 4CNNA 2WVVB 4H4IA 1LQ2A 4KBXA 2IPJA 4FS9A 3UNTA 4OBTA 2HPMA 5D33A 1VJSA 5AOUA 2GOKA 1TIWA 1O94A 2GFTA 4X2RA 1V0MA 2J78A 3WFLA 3VFCA 4QE5A 4FEZA 4OKDA 3IIPA 4X0VA 1M7PA 1TFVA 2Z28A 3CK5A 4RXFA 1WV2A 3LQLA 4JICA 2Q8LA 3W75A 3PZNA 2FZMA 1U5VA 3I10A 4QSFA 3N3TA 2A7RA 3NA8A 3OGSA 4Q4KA 1EZ2A 4XK2A 1KWKA 1MO0A 3G1VA 5HMFA 3VNDA 4C6DA 3S1GA 1JDCA 1EH9A 3NAVA 1AJ0A 2BOEX 2GQ3A 3H4XA 5F2MA 1UWQA 1XCFA 4IPLA 2ZVRA 3GVQA 2J25A 3MUY1 1KCKA 2G50A 2JKAA 1KR0A 3THDA 2GVJA 3WQFA 5IRPA 1S3TC 4CN4A 5HWMA 4FNSA 3VAVA 2VO5A 1RPXA 4PBGA 1MQRA 2JF7A 5CSSA 1KFKA 2OQLA 4LPCA 1YW1A 4B90A 2ZE0A 4UCFA 4ZQOA 1RJQA 1HKVA 4UFKA 2BNJA 4HYRA 5JH1A 3DHDA 1X6NA 1VBUA 3EDKA 2DORA 3W7QA 1TKKA 3UWEA 1FHLA 4C1LA 4GVGA 5H91A 3ES8A 1SPQA 3A6OA 4IGMA 1DE5A 4REQB 3QQ0A 4FNUA 1MUMA 1XLMA 4FR1A 1F61A 3W4RA 4WJ8A 3TR9A 1KGWA 4W87A 4HZ8A 4C5ZA 2PF8A 3DU0A 1RALA 4QP0A 3LHUA 3SCSA 2ZUNA 2C1HA 2P53A 5CKSA 3TYCA 5I3FA 1ZRQA 2ZBTA 4MNKA 3ZLHA 1PKNA 5AHNA 3LI0A 3RRXA 2GGJA 4Q8OA 1G0CA 5BOEA 2XGZA 5LGZA 5MF5A 1H4PA 1UKOA 3HU7A 3CV6A 1QNQA 1ZPTA 4FLOA 4E8DA 3N13A 1XBZA 1ISWA 3AALA 2J4GA 1VC4A 3GNDA 4PUDA 5D9OA 1K9TA 4J2MA 1R86A 1HGWA 3TK7A 3LGEA 2G3IA 2ZA1A 3XINA 1WP6A 1W2VA 3R5EA 1SW7A 4CNTA 2YXGA 3OHMB 2GGGA 3WUGA 3BUVA 3VMPA 2HBXA 1NOUA 1C8YA 4Q8PA 1DTNA 4IISA 4NVTA 4TOQA 3W84A 4IZGA 2O9OA 3ZWTA 1EXPA 3W72A 3GRIA 3VM5A 2Z1XA 4HA0A 4Z1AA 4YL2A 1G69A 1SR0A 4QCFA 1M7OA 2XWDA 1FCBA 3OA3A 3BTNA 4PUEA 1PYMA 3C61A 4IFKB 1SGJA 4ZQNA 4Q7BA 3AQUA 4Q3MA 5HANA 1T41A 4REQA 3T81A 5CGQA 2H9AB 3PPCA 1OCNA 3AMKA 1VJZA 5A2CA 4IL2A 4F2BA 2JE8A 1K02A 3LS9A 3H7UA 3GKFA 1FXQA 3E49A 3TN3A 1FWWA 2HPIA 3PJXA 3NPVA 4DO5A 3SR7A 1R8LA 5DQPA 3BW3A 3U57A 4B5TA 1CXKA 3ZSSA 1BGGA 1TUXA 5IXEA 3QGKC 3FYOA 2YYTA 1LOLA 4B9ZA 1H7NA 1WAUA 1XGZA 4D6FA 5CPSA 3V1HA 2QF8A 3VABA 4XZIA 3B0PA 4F0LA 4LB3A 2ZRXA 2B0MA 3DXIA 4DY1A 2Z29A 1KM4A 3PANA 1PL9A 2FJKA 2F6KA 3M7SA 3C0SA 3CZEA 4NXSA 4Q8VA 3WBEA 5AHIA 1KBKA 3FGCB 2GOUA 1O7AA 2CLEA 2ZFAA 2JKEA 3PM6A 3R6IA 3RN6A 3QH2A 3STFA 3GH5A 1WOBA 1ML1A 2O9RA 4H04A 3QV8A 3OPSA 4IFKA 3R25A 1H09A 1R85A 2BP1A 1TQXA 1PYFA 3EX6A 2GVLA 3M0HA 1VFSA 4UTIA 1YYAA 5HNRA 1XYBA 2H9AA 1FBAA 4LTSA 1W3JA 1JPHA 2GGEA 5XIMA 1IXNA 1ITQA 1DXFA 1W3IA 3PZUA 4DNHA 1FH7A 2QULA 3IANA 3L4XA 4CD5A 2HVMA 4I5XA 1IEIA 4H8UA 5FF4A 4LCQA 2WKGA 1NP2A 4UTTA 1W9PA 4GGHA 2WQDA 5G4HC 3RMEA 4YTRA 3R0UA 2QXWA 4KW2A 4GXPA 3RIKA 3C2VA 3GE7A 3V0TA 2PDNA 2CBUA 2V81A 3I7RA 3N9RA 3G0XA 3UZZA 2KZHA 1QDSA 3GXPA 2ZX7A 4YTSA 3AHYA 1MEHA 4YU1A 4FO4A 3KM8A 4GK8A 3EOEA 2IKIA 5F2GA 1NTHA 3O16A 2O0TA 4D8LA 3WLNA 3ITTA 1W1PA 3R8GA 1KO0A 1EPVA 2NX1A 5AYZA 1GQJA 2FVLA 3LZ5A 3THUA 2Y8UA 3FFSA 1XCXA 2ZUMA 4QDPA 2PWDA 3VYLA 6TIMA 2HK0A 3EXTA 1E56A 4K38A 2OMAA 3T08A 3IAPA 2NV9A 1JXKA 4O10A 2DSWA 4QG9A 3GX9A 5HJXA 1I6NA 2XUCA 2VFEA 2RKXA 5KITA 2PWFA 3GU1A 3F4CA 2ZA3A 4ZE5A 1NARA 2V82A 1LCOA 4LV9A 2VEIA 3KRUA 1XFBA 3TSBA 1ME8A 1RA0A 1NEYA 3DFYA 2VHLA 1R6WA 3GXMA 1F3EA 2VC7A 3S9ZA 4XD3A 2F7FA 4H8HA 5AHMA 1OCJA 3AXHA 4E0CA 1OWQA 3DCPA 1XIHA 4LU0A 3AHZA 3AAMA 3LTYA 1U33A 2W79A 4WDXA 1CI1A 2V3FA 1HFBA 1OM0A 2Y5EA 1ZY9A 5G2IA 1YHTA 1FVPA 1J0IA 4DXVA 3CEPA 4D6IA 2PDPA 4XBKA 3S5YA 4YTUA 2ZUWA 4GX8A 3BCDA 1XX1A 4L6DA 1E0XA 1T5AA 1UA7A 2VX7A 1QOPA 1UR3M 2XTKA 3VKCA 3S8HA 4A3RA 3WDRA 7A3HA 4FX6M 2C13A 4OTKA 3SO7A 1M65A 2C0HA 3UPMA 3N2BA 1ZBKA 2NVAA 2OSWA 4FF5A 3SUUA 3V36A 3OYXA 3T05A 5LXEA 4QDWA 4BFAA 7CGTA 3TCEA 3LLDA 3EDDA 5G2WA 3VILA 3KCOA 1PZ2A 2VXNA 4AD0A 2HQAA 1FCQA 1ZJHA 1GQKA 3OLEA 4NF7A 2QPUA 1DJXA 3MBDA 1YE6A 2IKJA 1UMYA 3B4UA 1GEQA 2YCLB 5I06A 2OJPA 4CQCA 3IV3A 3GXDA 3WDHA 1A5CA 1MVYA 5IM51 1WUFA 1QFEA 3URAA 4O53A 5DY3A 1UA3A 4DJFC 1QOQA 1OADA 1A3WA 2OKTA 1JCTA 3FW6A 2XG9A 2ZZ6A 1V08A 3KWSA 4CD8A 5D9NA 4ICMA 5EMKA 1XR2A 1BSIA 1OYCA 4J3UA 4BCEA 2WHLA 4HCDA 3SUSA 4L4MA 4JS3A 1OCBA 2CHNA 4GQGA 1FWFC 1OC7A 3A4JA 1FHVA 1HKMA 2Y24A 4NYYA 3V1PA 1UOKA 3NXFA 4DJEC 4TQTA 2PU1A 1MW3A 1DOSA 1EL3A 2YL9A 4X9YA 3UA3A 1R3TA 2FPYA 2VZUA 2OPJA 1HJXA 3TYUA 5A8QA 3HURA 2GUBA 1E6QM 2IS7A 3AXXA 5LNUA 1IV8A 2OZTA 2HDJA 2XDFA 4ICCX 4IQEA 2V63A 3R89A 1V6UA 1S5NA 1QHOA 1V5XA 4P8WA 4HZMA 3U2ZA 4LAOA 1QK0A 2JK2A 2C0AA 3DFOA 1XLHA 3SECA 2AL2A 4UOQA 5AFDA 4UTFA 1VYRA 2PGFA 1UP0A 4UTUA 3SN0A 3UZXA 2EHHA 3U8GA 3GDLA 3QTPA 3ABZA 3DKJA 4BI7A 4JTDA 5LHEA 3H7RA 1VH7A 5IDZA 3VDBA 2DJLA 3PJUA 2NT1A 2CBVA 1RLDA 5REQB 2P1FA 1YDOA 4Q7NA 1EXBA 1J5SA 3ZR4A 1PZ0A 1KTNA 1H41A 1I2NA 4XX6A 2VENA 3C86A 3MJMA 2UZ9A 2E9LA 3M5VA 2PAJA 4MUPA 1SU5A 5AHEA 3NDZA 4Y9NA 3G1RA 4AIOA 1EWEA 1CLVA 1H1NA 1UIPA 1WYIA 3PZIA 2E09A 4Q4PA 4OUIA 3KBSA 1OJXA 2G41A 2YB1A 3FVDA 3S3GA 4ML9A 3BANA 4LYKA 2WZMA 4GABA 4G56A 3T55A 1RJRA 3REQB 3WSUA 3ZR5A 4LSBA 1ZUAX 3FJNA 4JN7A 1OB0A 2PTZA 1ZZMA 3W87A 3ARXA 4PMUA 1J11A 1VCVA 3ZVIA 1HZYA 2D3NA 1Y5XA 1GQLA 3EXRA 4LVGA 1HW6A 4Q6JA 4E2OA 2NWSA 1A47A 1TZ7A 5I00A 5REQA 4FSAA 4PUKA 2PBGA 3M16A 2QDGA 3UCDA 4TU1A 2AAMA 4K68A 3U4AA 3E02A 1KM2A 3UJEA 3QF0A 2V5CA 3LERA 3GXTA 2XFRA 1KM6A 1VKFA 3B0XA 2PTXA 5FACA 4PB3A 3GHRA 4XAYA 1UKSA 4O1FA 4YLWA 1IEVA 3REQA 3L2MA 3AZRA 4H6KA 1Q6QA 1W9VA 4JKKA 4WY0F 4GNKB 3ITOA 2WW5A 4Y8EA 2BVWA 3NQFA 1E73M 4MB3A 2FIQA 3PBMA 5CJNA 1YMYA 2GDQA 5F2IA 1OZQA 5KZEA 4J1OA 2MNRA 4MADA 3WMLA 3A24A 5BXRA 4AY7A 5CLWA 1G6CA 3U0HA 4WGXA 1PUDA 3VIOA 1F74A 3QM3A 4FIQA 1XICA 2PI6A 3TROA 3DENA 1JVNA 4LJ3A 3GZAA 1Q5MA 2FMOA 5DBTA 4GYJA 1RCXB 3I4KA 3CM4A 4O12A 3WMSA 4S38A 1E43A 4KWWA 3MJYA 4JFTA 4Q7IA 4BEQA 2PTDA 5FEZA 1OK4A 2AMGA 4FLSA 4QBXA 2DQWA 3MVIA 2F6XA 3FN9A 1GVOA 3IGSA 2DZXA 4CU8A 1S3HA 1FCUA 3H21A 3G1AA 4LANA 3LPPA 3NDOA 4GJIA 3CASA 5A8GA 1E0UA 2FZ9A 1UR9A 3UP8A 3N6JA 1UWAA 2CITA 4OOUA 1UD8A 3U2CA 1M53A 1AUSL 1KRMA 4AHPA 5U7SA 1QCWA 3U7VA 4IP4A 3T0CA 4AXKA 5H8PA 5BCAA 4C6CA 4UCGA 3TYBA 4WK9A 3KP0A 4MKVA 1B0IA 3DBNA 3MZNA 5L9FA 1Q45A 3W7LA 1M41A 2H90A 2HWGA 3TTEA 3QHMA 1JCLA 3SCPA 4CU7A 2UY3A 4AISA 3GHUA 3HG4A 2Z2BA 2QS8A 2VDHA 3UBPC 3LCHA 3BSHA 9XIAA 2B31A 1WDPA 1VAHA 1YPXA 3BCFA 3OBKA 1W5MA 5CZKA 4GY1A 1A50A 5AC5A 4BHYA 1QNRA 3L5MA 4NUWA 2D0FA 2BX7A 1HP5A 4B2DD 1ZLPA 2Y8VA 4UTHA 3VX1A 5A6MA 3ZJ6A 1KQZA 3SCWA 1X8FA 3A12A 4ML4A 1EC8A 2PLCA 5K2ZA 1F6KA 3EKLA 1Q85A 3GU9A 4JFSA 2P0IA 1UP3A 2ABBA 1PAMA 4IGHA 4MAZA 4U5IA 1P6BA 3EMQA 4HP5A 4I8DA 2FMNA 5E0KA 1FCVA 6XIMA 3TJIA 3W27A 2OWWA 1ADSA 3LHYA 2Z1KA 2WWCA 5A6LA 4K8HA 3BV7A 4UTKA 3N2OA 1JQVA 1IT7A 2AGTA 3QR1A 3KOWA 4UMCA 4IJBA 2PE4A 2DZTA 3FSTA 4AY8A 1RAKA 3L4TA 3FJLA 2C6QA 1EJWC 4UMAA 3T2OA 4RXGA 1XM3A 5AZ0A 3W2MA 3GXNA 4R7WA 4ZOAA 2ICSA 1GW1A 1KCZA 4ICNA 4I6KA 1A5KC 5JQ9A 2G3JA 4D1IA 4AC1X 3G5EA 2WWDA 1W8GA 3EX4A 4CCCA 4OIFA 1R87A 4C6JA 4S23A 2AL1A 3E0WA 4IH3A 1W9UA 2EEXA 4ES4A 2Z26A 4J2PA 1E4LA 2QDHA 4JD4A 2WC7A 1QXLA 2I57A 3RITA 4S3FA 3SQLA 4LOCA 3RM4A 2Z6JA 2QUVA 1CNVA 1LM1A 3GG1A 1NOFA 3A3WA 2ZIDA 3OEXA 1N8WA 3S2CA 3QV9A 4NAFB 3O7UA 1DWAM 2WSYA 4B5VA 2YCJA 1C9WA 4XO6A 2NUYA 2QQ6A 3OLGA 4C60A 1Y8BA 3OZMA 4H9MA 4IGSA 3WF1A 1E9ZB 4IFOA 2A2IA 3H26A 3BPWA 3AJXA 3QY7A 3ARUA 4CEXC 1VS1A 1GG0A 2EQDA 4M24A 1PE1A 4AZCB 3KL0A 3B8TA 5ABEA 3CZKA 3UG8A 1NOWA 1UCWA 1IZKA 1WE5A 4P7NA 3ZO9A 1E3XA 1GCYA 3DFPA 5LIYX 3PULA 4BWLA 4EPDC 3W28A 2IMRA 3MSGA 2C71A 4J3VA 1TELA 2PRHA 3P6LA 2QV5A 2F2KA 2V3EA 3ANUA 2J27A 2GLKA 2MANA 3MCNA 1NDWA 3KL3A 5FSEC 2D0HA 2FZNA 2CIPA 1ZP3A 1DXIA 2PC8A 2WM1A 3H2MA 3TNOA 4UR9A 4HNCA 1JZ2A 1XW8A 4V1YA 4YWSA 3EX1A 4MHBA 4U33A 1MWOA 4S3DA 3R0DA 4NAFA 3D3AA 1L8NA 4V15A 1GTEA 1MQQA 2JGQA 3P80A 3PS7A 4O1BA 1X8CA 4A2SA 1TPH1 1CX9A 1SO4A 3FDKA 3LV6A 1R2SA 2PDBA 3I7QA 1LRTA 1YBQB 3QLLA 4V2XA 1AW1A 3LM7A 3PK7A 4D2JA 2FPTA 1XLEA 4I90A 3UG3A 5LIWX 8XIAA 2HROA 2NW0A 4XSMA 1LL4A 2WVSA 3W74A 1GZJA 1ECQA 2VTFA 4GVFA 3S46A 3HGJA 3VPLA 1BYAA 4NU7A 2XVGA 1OIFA 2J13A 3EGJA 3I6RA 3WNNA 1UQZA 4JZ5A 1HN1A 2OR2A 1VGAA 3WF0A 3MA8A 1WA3A 4BQ2A 5FJUA 1KR1A 5CQ1A 4LEQA 2YA0A 3UT0A 3PBWA 1BXCA 2R1KA 4R34A 3RM8A 3KFTA 3LRMA 3W2KA 3URBA 5DMLA 3S6OA 4G8TA 3MMDA 4ONVA 1H1ZA 4WSKA 5FESA 4KETA 1LBFA 3ITYA 4AZ6A 1XC6A 4CUCA 4NP7A 3CUGA 4GUFA 3BJTA 1SO6A 1OHLA 1DJGA 1YBQA 4TVCA 1J8VA 2GJNA 1PV8A 3PPFA 3NZQA 2HRWA 1XH1A 3V75A 4DXKA 4JIEA 1WXJA 3OLDA 4YVXA 5D2XA 4H2HA 1GJUA 1JZ4A 1O68A 2WSQA 4QR6A 1J0YA 1KTBA 4JEQA 1L0PA 4GPNA 1DQWA 2W0UA 3W01A 4P8XA 2C14A 1XIDA 5FEWA 4UQAA 4YTTA 2P3EA 4ROPA 3M1ZA 1EPXA 4HMEA 3QTGA 2BFGA 3SAZA 2PMQA 3AISA 3KTSA 1IWPA 2B7PA 4HMCA 4O0QA 4Y7EA 3OA5A 1OGGA 4WEVX 1TX2A 2F6UA 2XSAA 1UW9A 4NZCA 1UG6A 2IKHA 1HGYA 3WQGA 4AQLA 1F6PA 1J6PA 1UR8A 2R14A 5DEZA 4JQ1A 3USZA 1QO2A 4B3ZA 3W29A 1R7AA 4M6QA 4ZSTA 1RV8A 3VIHA 2TYSA 2VGGA 2XVKA 1V3HA 1S2UA 3ALFA 2HZGA 2OTDA 2E6YA 2YLLA 1QR7A 4UNIA 5F1VA 5HDRA 1UH3A 4V27A 4KRUA 3MYOA 3KZPA 2H3DA 4MUZA 4PB4A 5LHFA 5LIUX 2GPTA 5D2VA 1GYLA 1GORA 1E4NA 4K6AA 4AX6A 3BZJA 1HG3A 2DZUA 2DW7A 3PZQA 3SCOA 1XLKA 3LBOA 4KFOA 4Y9OA 3WBWA 3O8AA 2VUNA 2WBKA 5C54A 2Z2AA 1KKRA 2OLAA 1LBMA 1MFUA 1LG2A 3EBVA 3ZJ8A 3UWWA 3AO0A 2NX9A 4AYSA 4PCFA 4XISA 1H7XA 2PUZA 3QPYA 2FPVA 2WK2A 1FFRA 2EGZA 3RLUA 5XIAA 1VR6A 1N55A 2ZZ2A 4U31A 4W8LA 3TMLA 3TXZA 1TR1A 2X40A 5E93A 4F40A 3VNKA 3L4ZA 1P6CA 3NTYA 2BHUA 4IIDA 1QNPA 5DRIA 2BXYA 2PB1A 4DO4A 1Z7AA 1E5JA 1AMYA 2ZZ4A 2O9PA 3K4WA 2QCHA 2ZXAA 1OF8A 1QPKA 2DZBA 3O6CA 1V3MA 4E3TA 3B9DA 4PMOA 5EMYA 2CLMA 3Q45A 1O5QA 2CXEA 3HQPA 1F07A 3IRSA 2YXXA 1R3QA 1VHNA 1SZEA 2WHKA 3E1F1 1G9HA 4P7QA 4IXXA 1DPMA 1PKYA 3VDCA 3GVWA 5DT5A 3QYQA 5LA0A 4K7YA 1TPWA 2C8NA 3WLRA 5LA2A 3LUTA 3WIJA 1PHWA 3QV7A 2EG6A 3ITGA 3MQTA 1TV2A 1YDYA 2VD8A 4CD4A 1W3NA 3KCJA 4KRTA 5FF2A 1H11A 2BDQA 4GFSA 2CZDA 4HBKA 1Q65A 1W5PA 3CHDA 1OX6A 3PG8A 1OABA 4N2YA 3EDEA 4LFYA 3NCOA 3U6WA 1ISVA 2BVTA 3JZEA 2ZRVA 2I14A 5BRBA 1E6NA 3K4AA 1JNEA 1C8XA 1EBGA 1K9EA 1L9WA 3LTPA 4W93A 2PWEA 2QJMA 1CDGA 2ATSA 3SFWA 4ZBCA 2C16A 2QW5A 3HQ1A 1SZFA 4X3ZA 4ALDA 4I9TA 1K8CA 1WBHA 1XDJA 5EFDA 1JD9A 3GTNA 4Q4OA 1H49A 4FLRA 4S3AA 3EZ4A 3QHNA 4XAPA 1UASA 3EOUA 5D2YA 3NVTA 3VMNA 3GXIA 1H5VA 1DIKA 4HT3A 1IR1A 4JFWA 1OX4A 1PIFA 4O50A 3THAA 2OEMA 3W73A 1GVQA 1CXHA 4QCEA 3R94A 4DM2A 4E3VA 4QROA 1UH4A 1LT8A 4MB1A 1TVLA 4HTYA 4EK7A 5JUVA 5HQLA 1LYXA 2ON3A 1FXPA 3AZTA 5J8LA 2XM1A 2UWFA 4H19A 3WQ4A 3LSCA 3GFXA 1BG4A 4CCZA 4D6HA 1SYTA 4KRZA 3TYEA 2R6OA 1EO5A 1KGXA 3PNZA 4A3HA 4XZMX 4GUHA 3LPGA 3A3HA 1W2PA 3M47A 4C6MA 2WMKA 4K3ZA 2A79A 3QQWA 3M46A 2O7QA 2J8GA 3WZ0E 3TZFA 4F4RA 1XYAA 4Q4RA 4BR1A 1TRIA 2ATMA 4MIMA 5D02A 4LUSA 4IUOA 1PO9A 2A6LA 1CENA 3P0XA 3W24A 2RDUA 3VOHA 5I07A 2YL6A 3OG3A 1GVEA 1A5LC 2WLZA 1LWHA 4AC7C 3H70A 1I0BA 1EIXA 4GD0A 2FHCA 3WBXA 2Q01A 4XB3A 2DZSA 2Z7GA 4Q4SA 2WM0A 5DBUA 1RXOB 4CN1A 1JDFA 2EPHA 1GW9A 2G96A 3FVMA 3R4IA 3P2VA 4PMXA 3ENLA 4GYFA 5K4ZA 3S2JA 2FDMA 3DN5A 3HIJA 3L67A 4GXWA 3C0LA 4KEVA 1SZRA 3W1RA 1K6WA 5I09A 5HMSA 1SJBA 1X1OA 1VYPX 3NQBA 2DV0A 3GM8A 2J77A 5M1TA 3QMTA 2J7EA 1LLOA 3GXFA 3MP5A 3LBMA 4HB7A 1K6AA 3W88A 1YXDA 4M3PA 4AB4A 4EAMA 5A8OA 3EKZA 2WSPA 2YBVA 2WAGA 2GWGA 2DT3A 3WQEA 1U30A 4DN1A 4NQ1A 3URNA 3MWAA 5CSRA 1NWSA 1XBYA 4W84A 5I03A 2X0HA 4J3SA 1A0EA 4EF9A 4N02A 3EXSA 5C8BB 4NXKA 4HOXA 4CD6A 4AWSA 2J24A 3OO2A 3CWOX 2WCAA 4PULA 1EZWA 1H1YA 3FY1A 5I0DA 4IPPA 2GK1B 4NASA 1XQLA 4R88A 2OVLA 4IX2A 1YXYA 3PNUA 2LLEA 4GY7A 4A8NA 1W0MA 7TIMA 4G1KA 3WUEA 4A29A 2IXUA 2Z1BA 1FKWA 3U2OA 1Z3NA 2P3ZA 2XH4A 2FZ8A 3W00A 1EJ7L 4WLCA 2HE8A 3NQMA 2D2GA 1JDEA 2XVPA 1PB0A 3P8JA 4M6PA 1MUCA 1DJQA 1R2RA 1TV7A 3LXAA 2V5KA 4CU6A 3EPOA 3P7YA 1FOBA 6TAAA 1KNWA 1MNSA 4PUNA 1KGUA 1BHGA 3NEVA 5BU6A 3VGHA 4H6RA 5I3KA 4GINA 4QDMA 4XBJA 2XIOA 2XPKA 1FWGC 5IBXA 2W66A 3R0KA 1XUUA 1TREA 3VKBA 3DFNA 4B5WA 4ZENA 3DAQA 1R9ZA 3STPA 4RUBA 3ZR6A 1Q7QA 3WLMA 1EOKA 2CCRA 1YKWA 4H6EA 2YA2A 1OGSA 2YDAA 4ZCWA 3G8RA 2GK1A 1V0NA 4EAYA 3ABSA 3RXZA 3APYA 4LAUA 3VNZA 3OW1A 3CMGA 3O6DA 3JUGA 3AHVA 2PTWA 4BK9A 5I7GA 3E0LA 4LUJA 1ONWA 1H7OA 2P88A 3K30A 3UGVA 1BKHA 3CHEA 4UR8A 1H61A 2NVCA 4DVOA 1VEMA 4DI8A 1V6WA 5BZAA 5A6JA 1OGBA 2O4QA 1IXPA 4U3CA 4E8GA 3IJ8A 1L2UA 4DLMA 3Q94A 3SUWA 4NJKA 2VFFA 5FL1A 3T0TA 2AQWA 4AVFA 3A64A 3EB4A 4JHOA 3T0BA 3WJZA 1TMQA 1JI1A 1V3JA 1ONEA 2NLYA 1UR2A 1ECEA 4R5EA 5LYRA 2NV2A 1XIBA 4O15A 3LENA 1U2YA 1TMLA 4TO8A 3B9EA 1EDTA 1C29A 1EYEA 3ONCA 4LC6A 5F4WA 3GTXA 2QAFA 3H7VA 2J8TA 4O11A 4FR6A 3NZPA 4KFNA 3DYPA 3STGA 3L4WA 4P8VA 5I79A 1UR1A 4FOJA 4PCNA 2XFWA 3H2OA 4UTJA 2UY4A 4WR3A 1RH9A 2EKGA 2DY3A 4UUIA 1GT8A 2BTMA 1UD3A 3PWAA