4W5ZA

High resolution crystal structure of catalytic domain of chitinase 60 from psychrophilic bacteria moritella marina.
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
323
structure length
323
Chain Sequence
GTITSQDDNVVVGYWHNWCDGRGYQGGNAPCVELKTVNPQYNVVNISFMKVYDIAEGRIPTFKLDPTIALSEAEFIAQIDTLNSQGRSVLIALGGADAHIELTRGDEDALAAEIIRLTDLYGFDGLDIDLEQAAITAKDNQFVIPAALKMVKEHYRKTGDNFMITMAPEFPYLTANGAYTPYLTELDGYYDFINPQFYNQGGDGLWIEGVGWIAQNNDALKEEFIYYIADSLINGTRNYHKIPHDKLVFGLPSNIDAAATGYIQDPQDLYKAFDRLKAQGQPLRGVMTWSVNWDMGTDAANNSYNQQFIKDYGNFIHNQLPPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chitinase 60
publication title High resolution crystal structure of catalytic domain of Chitinase 60 from psychrophilic bacteria Moritella marina.
rcsb
source organism Vibrio marinus
molecule tags Hydrolase
total genus 126
structure length 323
sequence length 323
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2014-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4w5zA00
5ABFB 4ZE5A 2J75A 3W4RA 2WMJA 1BG9A 5EB8A 3PZOA 4CKQA 1VJZA 1E1FA 3MUAA 4H41A 4IM4A 4AEEA 2ZXDA 4HMEA 1OWQA 1QBAA 3BSGA 3AOFA 4XZWA 3VD5A 4BQ2A 4C7DA 5DF0A 1GJUA 1V3HA 3EDFA 3AJ7A 2CBUA 1HJUA 1US2A 1ESWA 1OIFA 2EBNA 3GDBA 2FDMA 3S2CA 2D22A 4JHZA 1FHLA 1A47A 3LPGA 3PZMA 4GZJA 2G4FA 1KR1A 2PWHA 4X9YA 1GVIA 5A6BA 1HXJA 4WKHA 1EDTA 1VEOA 4TVCA 4QLLA 1BVZA 2J77A 2WVSA 1E4IA 1E56A 2E40A 4GXPA 1CENA 2GDVA 4P7QA 2ZUMA 3RM9A 3BAYA 1KQYA 4YN5A 3WBAA 1CGXA 4WLCA 3SCOA 1MXGA 1UZ1A 1C3FA 4AC1X 1H41A 2ZIDA 2W66A 1ODZA 1UD6A 5CLWA 3EYPA 3VGDA 3WDPP 4P7NA 2WMIB 4UFKA 1HIZA 3TTSA 3SEPA 3ZSSA 5KEZA 4M81A 3VIPA 3MV11 4HZ6A 1V6YA 1J0JA 1CDGA 1R87A 4AEFA 1ISXA 4K68A 4PUDA 3MUZ1 3NDYA 4TVUA 1Q6CA 1B3VA 1TZ7A 1DEDA 4UQ9A 1GZJA 2WC3A 4W5UA 2XYLA 3S6TA 1OSEA 2BY2A 2BY1A 4DUWA 3ARUA 3TONA 1QI3A 5KZ6A 2W92A 4JKLA 1PPIA 2WHMA 3EDEA 2A3CA 4R5EA 1CPUA 3PZTA 4NI3A 1BYDA 3UG4A 2W4XA 3KWXA 1G01A 1QNOA 1KWGA 4S3JA 3OLIA 1UWQA 3F4VA 2WMHA 3THDA 1VBRA 2XG9A 1TFVA 3CUFA 1GPFA 3ZJ6A 5HPOA 5GQBA 4UQAA 1LJYA 4RL3A 2XUCA 2J7FA 1LG1A 1B3WA 1U33A 5ABFA 2WZEA 1JZ2A 3WDRA 1EQPA 1VFFA 1UKOA 3N9KA 3GBDA 1E55A 3WN6A 4L4PA 5I0DA 1B3XA 5A69A 3KEHA 2W63A 4AZBA 4A3YA 5FL0A 3RIKA 1XC6A 3L4ZA 3F5JA 2NSXA 5IDIA 5BXTA 3FAWA 4PMNA 3ZT5A 1KB3A 3AIBA 4GI9A 2BNJA 3L4UA 3OGRA 4XUYA 3FN9A 3AXHA 3FXYA 3GH5A 4UNIA 3MSDA 2QMKA 3T08A 3W26A 1UWIA 3OBAA 1BAGA 3WEOA 4KH2A 1V08A 4UOJA 1ECEA 2WVUA 3VIFA 1HJSA 1WZMA 2VZVA 3MMUA 2J8FA 5E09A 2DSWA 3NCOA 2V38A 3MS8A 3GH4A 1EOMA 4J27A 4CD4A 3BLKA 1J0KA 3WY1A 3AHYA 1UR0A 3AS1A 3UETA 1R7AA 1JAEA 1H5VA 1EDGA 3ARZA 4U5KA 1G94A 2YL9A 4FLQA 4TXEA 5BXPA 4W93A 1Y7VA 2PWDA 4JFTA 2QMJA 1UWTA 2C8NA 5AC5A 1W9PA 5CZKA 5EFDA 5A1AA 5IFTA 3VD9A 2WMIA 4GI8A 4HA3A 3QHMA 2WM0A 1W9VA 4BQ3A 3AXXA 1UR4A 3WUBA 4Z2LA 2QHAA 1DHKA 4W8LA 4WSJA 3W81A 2BV9A 5JBDA 3WIJA 1H49A 1C91A 3RJYA 1E6PA 2QPUA 1VEMA 4N42A 1MYRA 3CTTA 1XHGA 1F4AA 2VQTA 2AMGA 1QNQA 3SCQA 1B3ZA 2E4TA 1W2VA 1CNVA 1E0VA 8CGTA 1F4HA 4D6IA 3K8MA 3KZSA 1KGUA 1K9EA 4V27A 3AIUA 4OOZA 3AIRA 3W28A 3G6MA 2DGAA 3A6OA 3OG2A 1EGZA 4AYSA 4HOWA 3K4DA 3SUUA 1VB9A 1HL9A 1M7XA 1RPKA 2F2HA 3ARWA 5A6KA 1NWSA 5CGMA 2W67A 3WH6A 1W3HA 2O9TA 5GNXA 3VD7A 3ARPA 3DYPA 1CWYA 1UUQA 1CGVA 1HP4A 3WEMA 3VM7A 2WMFA 2BXZA 2VCAA 1FOBA 2XFFA 1HVXA 3AYSA 4GZEA 4U33A 4ACYA 5FCZA 1HP5A 1W1YA 5D4YA 3PN8A 4BS0A 1WNOA 3PTMA 1R8LA 1WKYA 3KL0A 5A6AA 3CZJA 4EK7A 1WPCA 2EXOA 2WC4A 1V0NA 4DUVA 1E6XM 5BXSA 4UQDA 4B9ZA 1BGAA 2V3DA 2ZX7A 1TA3B 3L2MA 3WF3A 3VX0A 3NIYA 1JD7A 2IXVA 1MW0A 3GYCA 1UH4A 5HBFA 1GJWA 2PBOA 1QI4A 2Z1SA 2A3HA 3LPPA 2G3MA 1XSIA 4LYQA 3WELA 3ALFA 3DHPA 2BVDA 3GNPA 1H4PA 1XYZA 4EE9A 1KQZA 2ZWZA 1C7TA 1UD2A 4OUEA 4MJ2A 2ZUVA 1WP6A 2DH3A 4AZCB 3VILA 2VZUA 2J8GA 3AQUA 1J11A 2Q8XA 4RE4A 1V3LA 2BXYA 3O9NA 5A8MA 1KCLA 1SR0A 5CQ1A 2WHKA 4JHOA 1G1YA 1N82A 2J7DA 3AS0A 3OA5A 4AZ7A 3FAXA 2G8ZA 3SCWA 5A6MA 3MU7A 1JZ6A 3I3DA 3VIJA 1JDCA 1JL8A 2G3NA 1HKKA 2WVVB 1CGYA 1IZJA 2J7CA 1TCMA 3A3HA 2UY5A 1XH1A 3L4YA 5BCAA 1A3HA 2YA0A 4FMVA 1M01A 2D23A 1UYQA 3OLGA 3BAIA 1ZBWA 1B90A 3II1A 3K46A 2QPSA 3ZJ7A 4UR9A 1BGGA 2JALA 2CEQA 4A3HA 2CBIA 1DWFM 4AD4A 1UQYA 1JG9A 2XSAA 2V3EA 1HJVA 2ZWYA 3CZGA 3W29A 1ISWA 3B9DA 4P8VA 1OGSA 2E8YA 5FD0A 1ITCA 4WIWA 3CZ8A 1JYNA 1BQCA 4JKKA 3ZM8A 2EPNA 3AHXA 1QI2A 3GBEA 2DIEA 2VJXA 1O7AA 3M46A 4PTVA 5D9OA 3AHVA 3EMZA 3PZNA 4KGLA 5CSYA 4U2YA 5A2CA 3PZVA 3IAQA 2WXDM 3ARRA 2PF0A 3T0AA 4S3KA 1PIFA 1IT0A 1G9HA 5E0CA 3POCA 3BMVA 4D6FA 2D2OA 2WK2A 3EMCA 2DT3A 4FLRA 4CCEA 3OZPA 5BRQA 2XIIA 1WDSA 4PMYA 3T2QA 3AZTA 4GQQA 4UQEA 2VRQA 2GFTA 1TA3A 3SCRA 2ZUWA 3ZR6A 2VC9A 1CLXA 3CO4A 3WEZA 1FP8A 3WF2A 1H2JA 3SUVA 1PIGA 5D8ZA 2WZIA 1LL6A 1MQRA 3L4VA 4TVDA 3VMOA 1JZ3A 3PHAA 3VU2A 3GTNA 2XFRA 1GOQA 3AIWA 3QGVA 1BLIA 3ZJKA 4DWSC 1R85A 3WF4A 4NRSA 4EKJA 1MQQA 4ACZB 1ZL1A 3UR7A 3WDHA 5JBEA 2WZHA 4M8UA 2O9RA 1CZ1A 5CXPA 4ZXOA 1CTNA 2WCSA 1NWRA 2J4GA 4ZXLA 3RCNA 2D24A 2JIWA 4W87A 2C0HA 3OB8A 3AS3A 4AZCA 2D20A 4PYSA 1ITXA 4PMXA 3RDKA 4HA4A 4WKAA 1QVBA 1QW9A 5M17A 2BS9A 1OD0A 1V0KA 3WMBA 3T09A 1CGWA 2Z1KA 1WZLA 1RP8A 1I75A 5JBFA 4QDMA 4ATDA 3L4WA 3VDBA 1I1WA 3UCQA 2IUZA 2O9PA 5ECUA 5IHRA 1VIWA 2WAGA 1HJQA 4HZ7A 5E6YA 2VX4A 3AISA 4TX8A 3VGHA 2ZUUA 1Z32X 4TTGA 1LF1A 1XH2A 1E6QM 3EDDA 4P7RA 3AFBA 4ZEPA 2W61A 2F61A 1UD3A 2GK1B 1E3ZA 4C7GA 3A4WA 3WDQA 3MMWA 4OJYA 5C71A 3WKZA 2OWWA 1X6NA 1VFMA 1JYWA 3IJ9A 4AD2A 1GONA 2CESA 2VRKA 5A6LA 1X6LA 4W85A 3GM8A 4CD8A 3AZSA 4GINA 3U5UA 1WO2A 1RD6A 1Q6GA 4WKFA 3U7VA 4HMCA 1K9FA 3DYMA 1Q6FA 4PMOA 1GNXA 1NOWA 1QNPA 4AIOA 1GHSA 4CN6A 4F66A 1HN1A 6A3HA 1WE5A 1V02E 3SUWA 4UFJA 1AMYA 3D3AA 4XX6A 1SFSA 3NYDA 1D7FA 3VIKA 5E9AA 4H8VA 4MNKA 1TR1A 4JKMA 1SYTA 2FH8A 5DT7A 1V3MA 2VVNA 2CCRA 3BGAA 1GQLA 3GNOA 1WAWA 1HVQA 5IFPA 3JUGA 2BHYA 1V6UA 4PCTA 3CUJA 2PI6A 2OSWA 5I3DA 4Q7NA 1FH7A 2VZSA 3L2LA 1W1PA 3K8LA 4PCSA 2YLLA 5I79A 3SCPA 2YL8A 4ACZA 5JUVA 3G6LA 2PWEA 4JZ5A 2E8ZA 3WD0A 4WK9A 2YDSA 2BY0A 3CZKA 4J3WA 3WNLA 1E40A 3ZT7A 1J0IA 4R27A 3ZR5A 1IV8A 3T0DA 1G5AA 1BFNA 1X1NA 4OIFA 3AIVA 2DEPA 2NT1A 2X2YA 4Z2HA 4J3TA 2V3FA 4M1RA 4CGTA 2MANA 3CIVA 3VD4A 1E73M 4D6DA 1UR9A 3TOPA 1W3JA 4V2XA 1ZB5A 1PJ9A 3AMLA 4HPHA 5I6SA 5BRPA 2DT2A 1E43A 3PZ9A 4PBGA 3MUIA 2XVPA 3TP4A 1JDDA 5FOOA 2E9BA 5EMYA 5FIPA 1VF8A 4M80A 3BMWA 4MB5A 3N11A 1JFHA 4QP0A 2WCGA 1V03A 3NDZA 3O6AA 5AYIA 5HPCA 1UR8A 3FHQA 2ZXQA 2GK1A 3WFZA 1D2KA 3CHFA 4CD6A 1RH9A 4JIEA 1UKTA 1UZ4A 3EBVA 1K9DA 3VGBA 4P8WA 2CYGA 2VO5A 3ARVA 4DUXA 3W6MA 4KWUA 4W7VA 3OGSA 1J18A 1J12A 3RM8A 3BAJA 2OWCA 2BHZA 4PMUA 4TOQA 4Q22A 5DEZA 2W91A 4QLKA 1E71M 1MFVA 2YBUA 1MVYA 1J0ZA 4HU8A 3FW6A 2TAAA 2BY3A 1W3LA 2WBGA 1EQCA 3UESA 1BPLB 2DDXA 3BAWA 4TTUA 3HU7A 4U3CA 5LA0A 1E0WA 4RE3A 2ZOXA 1JYVA 4IPNB 1OT2A 5E6ZA 2VTFA 4CCDA 3TTQA 4AZ6A 2YLAA 3CUHA 2XFYA 4E4PA 1QNSA 4WSKA 2WBKA 2FGLA 1PZ3A 4MADA 1J0HA 3CHEA 2DT1A 2G3JA 4FLOA 3A47A 4CUCA 4AMCA 3CHDA 3O2LA 4AY1A 1MWOA 3W82A 1HT6A 3VVGA 3AROA 4Y7EA 3HJEA 1QI0A 5D9NA 4AXNA 3UG3A 3WD3A 1Q6EA 1MW3A 1RP9A 1QW8A 3ARSA 4HP5A 1C8QA 1GQKA 2XGBA 3WQ4A 3SUTA 5CJ5A 1EDQA 2E3ZA 2VCCA 3BCDA 2EPOA 2NT0A 3U5YA 2DT0A 2WWDA 1E5NA 2J79A 1WDPA 1H0GA 1E0XA 1GORA 2UY3A 1LL4A 1E3XA 3THCA 3VMPA 3WUFA 2FGZA 4H2CA 3ZT6A 1XRVA 7CGTA 3SCTA 1E4NA 1GQJA 1JFXA 4B3KA 3IAPA 1UKQA 2GSJA 4HU0A 4H04A 1V02A 5ABGA 3PBGA 1NOFA 3WQ8A 1QHPA 2GVYA 2XVLA 3CBWA 3AYRA 4A4AA 5CPTA 1PBGA 3VDHA 3ZQ9A 1E6SM 1UA3A 3PZQA 4AIUA 2VR5A 1E1EA 1VFOA 3WFLA 3UG5A 2ESCA 5A8QA 1BTCA 2YL5A 3PZIA 2PWGA 1W9XA 1FH9A 3BSHA 4ATLA 4AWEA 3NUKA 3WH5A 2ZE0A 2PC8A 1IZKA 4JL1A 3ARQA 2VL4A 3UR8A 3BC9A 1GOKA 2WLYA 4ZENA 2X05A 4PTWA 4XV0A 4NZCA 2YJQA 8A3HA 2C7FA 2CIPA 4F9JA 1WZKA 1R86A 1YQ2A 1UR2A 3QHOA 2UY2A 3ARTA 4NF7A 4GO8A 2DIJA 1KXHA 4UFHA 3CGTA 3SIMA 3VDAA 4E8DA 3ARXA 2F8QA 4H8HA 4JAWA 4OBRA 4CVUA 4PN2A 4ZFMA 3QOMA 3VIOA 3WQ5A 5BWFA 1W1TA 1UD4A 4D1IA 3WQWA 2YL6A 2J25A 3L4TA 3KL3A 4CU6A 3WH8A 5ABHA 1M04A 2VRJA 2CHOA 2WKLA 4ZE4A 5CPQA 1W9UA 1KXTA 3RPMA 2HVMA 1NH6A 3CUGA 5I78A 1JXKA 1S46A 2CBVA 1C92A 2CITA 2XHYA 2XM1A 4HOZA 1OGBA 4MDPA 5I5RA 3PTQA 3OZOA 1LL7A 1GOMA 2WMKA 1ISYA 1OCQA 3QR3A 4CD5A 2B31A 1VENA 3AICA 3WDJA 3NJ3A 3CUIA 2OWXA 1JYXA 2DPEA 4YPJA 3W24A 1BVNP 3K4AA 2DH2A 2EQDA 3WF0A 3W53A 1HJXA 2CPUA 4HMDA 4CCCA 2ZX5A 3EDJA 4W5ZA 5AC4A 1AQHA 2V3GA 1EA9C 4MB1A 2ZUSA 4UTFA 3U57A 2UY4A 4KMQA 4LX4A 5DT5A 1LG2A 5D9PA 3VINA 3WSUA 1KWKA 2JE8A 1GOOA 1JNDA 5A8NA 4M56A 3SCVA 4DWSD 3AHTA 3KL5A 3VIHA 3WD4A 1LWJA 2QV4A 5A6SA 4JFVA 3CMGA 1UD8A 3QHNA 4MB4A 4B15A 3GXFA 1H3GA 3CPUA 2WSPA 2AAAA 2X1IA 4W8BA 2YKKA 3W38A 4PMVA 4QFUA 4AD0A 4BCEA 5EBAA 1OM0A 4QCFA 4WJXA 1ZJAA 2D0FA 3I3EA 4D6EA 4WF7A 2DSKA 1PEZA 1UR1A 1CGUA 5I23A 2EPLX 3N13A 1C7SA 1JGIA 3AHZA 3J7HA 1AVAA 2CETA 2Y2WA 4L4OA 2BFGA 1EOKA 7A3HA 1VJSA 2VI0A 1H0IA 1YHTA 5CG0A 3W0KA 4MPKA 4JCMA 3ZOAA 1L0PA 1CGTA 4NRRA 3MANA 1JZ5A 1EHAA 1H11A 4F9DA 4B16A 3SCSA 2ZUTA 4PMQA 4M29A 1TVPA 3D5HA 4IPLA 2WNWA 4MNLA 2UWFA 4OOUA 4FK9A 5D8WA 4JCLA 4D71A 4BZYA 4AZ5A 4LGXA 3DHUA 3EDKA 3I3BA 1ISVA 2WANA 1WCGA 3EMQA 2VX6A 4IISA 5C70A 4LXFA 1JI2A 2BHUA 4HA1A 1SMAA 3W27A 2FHCA 3RJXA 3AXIA 3BAKA 2YDRA 4PEEA 2D0HA 3OLEA 1ZBCA 1M03A 4CVWA 3ZSTA 4PRWA 2OYMA 2XGIA 1HF6A 1XH0A 3MKKA 3IK2A 4H7VA 1DWIM 1W1VA 2WWCA 2VOTA 4E8CA 2WHJA 2VX5A 1DWHM 4MB3A 2CXGA 4D6GA 3OIHA 1NARA 1UKSA 1XSJA 4JL2A 4PSRA 1H1NA 1KCKA 4U2ZA 3AIQA 1JIBA 2YBTA 2YA2A 4OBSA 1JF5A 1CIUA 3ZJ8A 1O6IA 1W3KA 3PZUA 3WUGA 4ATWA 2WVVA 4MDOA 2JEPA 4MAZA 1UWRA 2VT0A 4UOQA 2RGLA 1MW2A 2VVSA 2VCBA 1J0YA 5CGTA 2WHLA 3IANA 1XV8A 1V3KA 2CERA 2YA1A 3AS2A 1VAHA 3T2OA 4MJ4A 4B3LA 4LYPA 4DWSB 2GJPA 2XWDA 4YHEA 2WMGA 5FKYA 3VGGA 3LMYA 1TUXA 4D6JA 1H09A 2WLZA 3E1F1 1AQMA 3NSNA 4M24A 1HL8A 4PMRA 1NP2A 1UWSA 2CKSA 1E72M 1PX8A 2BVYA 3RO8A 4PMZA 5M5DA 2VZTA 1HNYA 4GI6A 1C90A 1JZ7A 1W9BM 4D6CA 5BXRA 4GKLA 4EANA 1DTUA 2J78A 5M3WA 4CN4A 3TTYA 1P6WA 1JXJA 2W62A 2Y24A 1KBBA 3VDCA 4Z2JA 2D3NA 1QOXA 4U3AA 4C7FA 1CEOA 2ZUNA 3VGEA 4X0VA 2XM2A 3M7SA 3MSGA 1PX3A 4J3XA 1GQIA 5I24A 1ODUA 1E6NA 3WMCA 4LYRA 3WNNA 1HKIA 4W8AA 1HKMA 5EFFA 3WUEA 3HMCA 1KXQA 1CXEA 1UOKA 3PZGA 3VD3A 1TVNA 1JDAA 1J10A 2NW0A 4GIAA 1LLOA 1EXPA 5A2BA 5A94A 2CBJA 3U7BA 4UCFA 4F79A 2VZOA 2Y4SA 1ISZA 4U5IA 5A95A 4LQ1A 1OD8A 1CBGA 4JFWA 1QBBA 5DO8A 3OGVA 3RMEA 1V3JA 3ZO9A 5GPRA 1NQ6A 5HNNA 4PTMA 1XCXA 2E0PA 4BQ4A 3T0BA 3VOCA 1C8XA 1OBAA 4D72A 2D3LA 4GZIA 2ZXAA 4QCEA 2QF8A 2D1ZA 3IJ8A 3VTRA 2WPGA 5C8BB 2E9LA 3VO0A 1UA7A 1EHNA 2J7GA 1DWAM 1D3CA 2J62A 1KBKA 2DSUA 1E6ZA 2J7EA 2ZX6A 4Z2GA 1FH8A 1UD5A 1CXFA 1ZU8A 1ZBVA 1WDRA 1JF6A 2XTKA 1XYFA 4AD5A 1MFUA 4W7WA 1OINA 1OB0A 3WNPA 3ARYA 4MTVA 4CU8A 2PB1A 4ML4A 2XPKA 3CLWA 1VRXA 4IUGA 3WDIA 4UQBA 3W25A 2BVTA 3NSMA 2XSBA 1JZ4A 1JAKA 5E70A 1E15A 1DP0A 4W89A 1V6VA 1FFQA 4DWSA 4TUFA 1B2YA 2FHFA 3VNZA 2OSYA 1AQ0A 3RILA 4B9YA 2JF7A 4CN1A 4TX6A 3KE0A 1ZS2A 5BYWA 2J7HA 3ZIZA 1EIBA 1GUVA 4PSPA 5A8OA 1E5JA 4BF7A 1E70M 1Q6DA 1FA2A 3VGFA 2EJ1A 3QOKA 1J01A 4UZSA 9CGTA 1UH3A 4D6HA 1B1YA 1W32A 3WMSA 3LPFA 1C8YA 1CXLA 4V28A 1QHZA 4DM2A 3F5KA 4GQRA 3APGA 2A3EA 4J3VA 2WB5A 1XCWA 1C93A 1UH2A 4N0RA 4CU7A 3SCNA 3MV01 1Q4NX 3WF1A 1UKPA 3CMJA 2Y8KA 1E4MM 1PZ2A 1GHRA 3LPOA 4P7LA 3DYOA 1XD0A 3VIMA 2VQUA 1DWJM 2WYSA 4BA0A 1GW1A 1NWUA 3GXIA 3WD2A 4CD7A 3VIIA 2WSKA 1OGGA 1ZBKA 4FLSA 1TMQA 1HKJA 1FFRA 3WNKA 1V0MA 2J7BA 1US3A 3N12A 2JIEA 4PUEA 3FNDA 4J28A 4UFMA 3WH7A 3SCUA 2OYLA 1VBUA 2D0GA 4XZBA 1BHGA 2X09A 3M6DA 5E0FA 1QHOA 3AMKA 1SMDA 3CZLA 1E4LA 1WDQA 4AZGA 4KRTA 4EAMA 3AIEA 3B8SA 5HXMA 2A3BA 4MAVA 4U31A 3OLDA 1BYAA 3VM5A 3W37A 2GJRA 5CPSA 4Z2IA 4AIEA 4J7RA 6CGTA 2E9MA 1PAMA 4E2OA 4FF5A 3VPLA 3WNOA 5LYRA 2YOCA 2FHBA 4AD3A 4RE2A 1W2PA 2GDUA 3AMCA 3FY1A 4AZHA 4UQCA 5IHSA 2WW5A 3SURA 4AW7A 5JIWA 2CNCA 4M82A 2YDQA 1QNRA 3L4XA 3N04A 5F7UA 1W9DM 2V5DA 2VUYA 4BQ5A 1NM9A 1B3YA 1BYBA 5HDRA 1KGXA 3BCFA 5A6BD 1NOUA 1FP9A 4UFIA 1BG4A 4GO9A 2VX7A 1EO5A 4JFUA 1VEPA 1NWTA 1QI5A 1UWUA 1XGZA 5M03A 3BLPX 3RM4A 2FH6A 4J3UA 3K8KA 2J74A 5GNYA 1LQ0A 2DSVA 4JFSA 3WL0A 5A6JA 2ZX9A 1M53A 2Y5EA 1CXIA 1BYCA 2O92A 3VNYA 1HX0A 1FHDA 4Z2KA 5FL1A 4MNMA 4P8UA 2CKRA 5HOSA 2WKGA 5CSUA 2XVNA 1MQPA 2XWEA 2IXUA 3N1AA 5AY7A 1CXKA 1JI1A 3MMDA 4H8UA 5DFAA 5BROA 2HISA 1OT1A 3W6LA 1HJWA 1XSKA 4QAWA 5GNZA 1JNEA 3VX1A 3DC0A 3GXMA 3AZRA 5A3HA 2ZICA 1XD1A 3VMNA 4F8XA 3WBEA 3CH9A 2EPKX 2DSZA 3WH9A 2GJXB 3VIGA 3GZAA 4OKDA 1KFWA 1KXVA 4PTXA 1GOWA 4J3SA 1CECA 3BXWA 4AZIA 1E9LA 3B9EA 3ZMRA 3GXDA 3K1DA 4HOXA 1QPKA 4P8XA 2XVKA 1J9YA 1R7OA 3N18A 2OLHA 3AI0A 5ABEA 5I77A 2WVTA 5A2AA 3MUY1 2VNCA 4UZUA 3UERA 3POHA 1MXDA 5A8PA 4X0NA 3ALGA 3A4XA 4GPNA 4HZ8A 2YIHA 1LWHA 4DM1A 1WZAA 4MNJA 3WENA 2JFEX 4KGJA 5I2UA 1BSIA 1V3IA 4W86A 3VUPA 2GUYA 4URIA 4UOZA 1VFUA 2G3IA 5CLTA 1CYGA 1CLVA 1V6WA 4XB3A 2EO7A 1KGWA 1MW1A 2J47A 2O9OA 1JZ8A 1UHVA 1PX4A 2JEQA 3WD1A 1U2YA 3F5LA 2X8RA 1TE1A 1U30A 1B30A 1UG6A 2A3AA 5AYBA 1G0CA 2XJ7A 1CXHA 1GOIA 1L8NA 4KRUA 3WL1A 1JD9A 1V6XA 2AOSA 2EEXA 1K6AA 5IXEA 4NSBA 2OSXA 1KR0A 2QLYA 2X0YA 4HPGA 1B31A 3B9AA 4HTYA 6TAAA 1B9ZA 1K9TA 3TTOA 1E6RA 4QLJA 4UFLA 2RGMA 3ECQA 2ZX8A 1V0LA 2DQXA 1B0IA 4D1JA 1EO7A 2EPMX 5TD4A 3PTKA 3AMDA 2JF6A 1W91A 3GH7A 3BH4A 2XVGA 2VMFA 3N15A 5D9MA 3CZEA 4AD1A 1NP0A 3IJ7A 2PBGA 3UEQA 3WQVA 2V5CA 2X0HA 3VKKA 3WNMA 4YHGA 2CHNA 3DECA 3NSXA 3FHAA 1DWGM 3MO4A 1WB0A 2WC7A 1UQZA 2XIBA 4P7OA 3BAXA 3SUSA 2ZXBA 1OIMA 2VR4A 7TAAA 1I1XA 4W84A 2PWFA 5LA1A 2GJXA 1GVYA 3AMGA 1BF2A 2OYKA 4OZOA 2G41A 3WQ6A 3N17A 1ZJBA 2WCAA 3GNRA 4AISA 5LA2A 4LPCA 2Y8VA 2W5FA 4W7UA 1EH9A 4W88A 3CHCA 1TG7A 3TA9A 3A4AA 3HN3A 3M07A 2VURA 5DMYA 3T2PA 4PMDA 1GCYA 5JIPA
chains in the Genus database with same CATH superfamily
1BWVA 1IYXA 4LW7A 2J75A 3W4RA 2V5KA 1FDJA 3GVGA 1E9ZB 2WMJA 1XLBA 4G7EA 3CWOX 3RPTA 3A9IA 4WRHA 1P0BA 4FA3A 3MUAA 5BRBA 2ZXDA 1KV8A 3HPSA 4LF1A 2DZUA 5G1MA 1R30A 3DX5A 1YNYA 4DJDC 1YMYA 4L1WA 3AJ7A 1KRMA 1WKDA 4XD4A 1ESWA 2EBNA 3GDBA 3S2CA 3IVTA 4HKPA 2I16A 3DN5A 1FHLA 4K1GA 5C2CA 3MBFA 1MO0A 9RUBA 4GZJA 4M6UA 4UTJA 1KR1A 2PWHA 4X9YA 3FXGA 4N2YA 5A6BA 2OX1A 3A3XA 4WKHA 1MUCA 4WY0A 2J77A 1C29A 4LUJA 1KLYA 3VOHA 4GXPA 4WQ6A 4L6OA 4XBSA 4OGZA 3NZQA 2YXGA 1YLVA 2WPBA 3HG3A 2NV1A 3BV4A 1CGXA 5KMYA 3PUGA 4WLCA 2F84A 6TIMA 3H2AA 3LBCA 4ZODA 4UMCA 1MXGA 4TU1A 4DBUA 1ZP3A 1LBFA 3VGDA 4UFKA 5G2IA 3QZ6A 3TTSA 3CJPA 4LT9A 2PRLA 3W76A 3JZUA 1J0JA 1CDGA 4KEZA 2ZFAA 3RPDA 2J9XA 1ISXA 2GVLA 3H2OA 4PUDA 5C9WA 1Z7AA 3OEXA 4TVUA 3RX2A 4UQ9A 1K8ZA 1TJ1A 2XYLA 3CL8A 1OSEA 4QEHA 2QUTA 3VNKA 1JDEA 1I60A 3R12A 3H54A 2W92A 2CZFA 5LZLA 2A3CA 1CPUA 2QVNA 2R9RA 3GS6A 3PTDA 1SZEA 4S3JA 3F4VA 3GC4A 2C6QA 3ITXA 2W0UA 3WCZA 4AHQA 1VBRA 3K30A 3C56A 3ZJ6A 5GQBA 3DGRA 3NQBA 3W22A 2WSYA 4S3DA 4NNBA 1WOAA 2X1SA 2Y89A 1B3WA 1U33A 5LGZA 3CPGA 4QGCA 3S9YA 1JZ2A 4C6PA 1GEHA 3WDRA 4CQBA 4OVXA 2WO5A 5B7YA 3WN6A 1Q3NA 4N6FA 5I0DA 3NPUA 1TTJA 3Q4DA 2H8XA 2NSXA 1KA9F 1U5JA 5IDIA 2VFIA 1VIZA 4G1NA 4IICA 2XH4A 1KB3A 4DI8A 3L4UA 4FP1A 5HJXA 4ZQOA 1ZCOA 3AXHA 4UNIA 2QMKA 1QK0A 1UWIA 3AYTA 2EG6A 3OBAA 3U4FA 1BAGA 4H6RA 3S1VA 1V08A 4EIVA 3LTPA 4J5NA 4C91A 2NVCA 5CH9A 1WZMA 3MMUA 1J93A 3SN4A 4H3DA 2A21A 3BLKA 1A5LC 4X60A 2WNQA 2JBMA 2BX7A 4DXKA 1H5VA 3ARZA 4U5KA 3W7NA 3WLPA 4TXEA 2OOFA 1A50A 3RLVA 1F74A 4C90A 4JFTA 4Q7BA 3A3WA 2QMJA 2C8NA 1OABA 4PBFA 2EG7A 5A1AA 5IFTA 3MI3A 4AG0A 3FLUA 1W5QA 3KP0A 4IFRA 1DHKA 2FLIA 5D03A 1PSCA 2BV9A 5JBDA 1H49A 1E6PA 3MVIA 1E1CA 1MYRA 4KCUA 4N42A 3TXVA 3W70A 3W2LA 1XHGA 3M5YA 3KTXA 2AMGA 4H83A 4DZAA 1T7LA 4DI9A 3M5ZA 2PGWA 2OB3A 1B54A 3RAOA 4DO7A 2I5IA 1KGUA 4IUOA 4B5UA 2FGBA 3W28A 1V6TA 2PDCA 3MZNA 1EGZA 2HNHA 3WJWA 3CQHA 3TTEA 1HL9A 1M7XA 3SECA 3IVSA 5JVLA 5CGMA 3ARPA 4MOZA 3UG8A 3P0WA 1K02A 1P6CA 4WX2A 3NXLA 1NSJA 2WMFA 3S5ZA 2VCAA 3B9NA 4JS3A 1FOBA 2XFFA 1FDYA 1HVXA 3AYSA 4U33A 1KFBA 5FCZA 1E0UA 3MVTA 5D4YA 4BS0A 3DFOA 1XWYA 3PTMA 1CCWB 1WKYA 1GVSA 3W7QA 4N9BA 3WYZA 3BGGA 3Q2DA 3NEVA 4EK7A 1WPCA 4L80A 3WJYA 2V3DA 4ZO7A 5LNRA 1TA3B 3GO2A 3BO9A 3PWIA 3EOEA 1SJBA 1PS9A 1OHLA 2Z1SA 1LDCA 5G1YA 2G3MA 1XSIA 1TPB1 3ALFA 2BVDA 2FZBA 3DZ1A 1KQZA 1R9ZA 2PP0A 2ZUVA 3ISIX 5CCZA 4NUWA 1R3RA 2E77A 3WLTA 1F6PA 2Z7GA 1T8XA 3QM3A 3SBFA 3E2VA 3A5FA 1VYSX 1G1YA 2J7DA 5A6MA 3VIJA 4GIEA 1JL8A 2G3NA 4C6FA 4KEMA 2AQWA 2INEA 2WVVB 4UTMA 4QNEA 2J7CA 1TCMA 4GNJA 2UY5A 2ACQA 1A3HA 3T07A 2YA0A 4FMVA 2D23A 3CQIA 3APTA 1UYQA 3LM7A 5D30A 3C6CA 3II1A 2JALA 2CEQA 1GTEA 3NO3A 1HJVA 3LMZA 3CYJA 4HPXA 3B9DA 4P8VA 3NVDA 3D47A 3VE7A 1OGSA 5E0KA 1J5SA 2QR6A 3USBA 4WIWA 4IXHA 3CZ8A 1JYNA 3W75A 3AHXA 2IPGA 3WLHA 2PLKA 2F38A 5J5RA 1KCZA 3TNBA 1XQKA 4Y9NA 3PZNA 1P7TB 1EF2A 2PCEA 2WXDM 3ARRA 3B9OA 1XBXA 5HWMA 1IT0A 5E0CA 2AAMA 3POCA 3NGFA 2QNEA 4LH8A 3B05A 4E3VA 2D2OA 4K2SA 4BF9A 4X61A 4FLRA 1PZ0A 5L6UA 1JCYA 3AZTA 1ONWA 4GQQA 3BLEA 1YKWA 2GFTA 4R7WA 3SCRA 4IQJA 3GSMA 3WF2A 1PIGA 3NZPA 5D8ZA 4XIMA 1MQRA 5EYWA 5FSEC 1JZ3A 3VU2A 3ZJKA 1R85A 2C1GA 4C6MA 4MMWA 1PKNA 4NRSA 5CGQA 4XAYA 1EX1A 1XLMA 4FNUA 4PUKA 1DTNA 2O9RA 5CXPA 1FDZA 1CTNA 3LRLA 1HZYA 4JTUA 2DW6A 3RCNA 4B2DA 2Y61A 5J5DA 4XZ9A 1MZRA 5M17A 2BS9A 2ALDA 1OD0A 1V0KA 3WLOA 2Z1KA 4XO7A 4RX0A 3GFXA 5JBFA 4QDMA 4PL1A 1EPXA 3VDBA 1V4YA 3UCQA 2Q6ZA 2YB1A 3BLDA 5G1TA 1DQWA 1EF3A 3F2BA 3AISA 4FB7A 1LF1A 2OO0A 3EDDA 4MZ1A 3AFBA 2W61A 5A6TC 1IF2A 4WY0F 4UTHA 3A4WA 3WDQA 3MMWA 4OJYA 2Z0IA 3GX9A 3L66A 5AVHA 2J66A 1JYWA 4AWUA 4YIWA 4WDWA 5D02A 5A6LA 2HPIA 2PTDA 2VKZG 4W85A 3OZYA 4CD8A 1UASA 3AZSA 3MQTA 3LA4A 2BXVA 4RPPA 1JR1A 3W83A 3U5UA 4DO5A 1D8CA 3TQKA 4L9XA 3PAJA 4WKFA 4CQCA 3JZEA 1Q6FA 4PMOA 1GNXA 1AJZA 3QEZA 2RDXA 4F66A 2IPFA 1YTEA 3KBMA 5EU9A 3CPRA 1TR1A 5I3HA 3O07A 4JKMA 1BTMA 2Y62A 1SYTA 1XIFA 4M6PA 6REQB 1V93A 1WA3A 4DQWA 4RKAA 5E1QA 4JNMA 4FNQA 1UR3M 4CNUA 5IFPA 1G4EA 3GTHA 3CUJA 2P8BA 5K7JA 2QUVA 4DN1A 3LQLA 3QTGA 1VS1A 4PCSA 4FX7A 5HULA 2YLLA 1XLGA 4NJJA 4ACZA 5JUVA 2PWEA 4ZA0A 2BY0A 3CZKA 4A2SA 3ZT7A 1DKWA 2DY3A 4R27A 3MUXA 3T0DA 1BFNA 1YE6A 3AIVA 3NQ8A 1REQA 4LNYA 1Q6LA 4M1RA 1DQXA 3TOPA 1W3JA 4V2XA 3CV2A 4GG9A 1ZB5A 3NVTA 2OQHA 2G0WA 4FNTA 3G22A 3N2TA 4I8DA 1UW9A 2OLAA 5TBOA 2PMQA 1L6YA 2WCGA 2X0SA 5LIUX 4AX7A 2PDIA 1GZ1A 3ANVA 1THFD 3VNDA 4C6OA 5BOFA 4YVXA 4GVFA 2RHGA 1XFCA 1XQLA 1X8CA 3NNTA 3EBVA 1L6WA 3QLDA 1EYEA 2CZEA 3B4YA 2GUBA 4DUXA 3ARVA 3W6MA 4KWUA 1Q8JA 3TYCA 2OWCA 5C2XA 1N8FA 4B92A 4XKYB 1XLDA 3AUJA 3KVLA 3U9IA 1A5CA 1E9YB 3PVFA 3QMTA 4QLKA 4RNIA 2YBUA 1UP2A 3NL3A 2TAAA 2WBGA 1BPLB 2DDXA 4TTUA 3HU7A 3HFTA 3IGHX 2CZDA 4ZOAA 3V0UA 2FZ8A 4I5XA 1JYVA 2VTFA 2QULA 1JPKA 1L6GA 1OQFA 2XZ9A 3CUHA 3S42A 1F76A 3VDGA 1TWZA 4KCVA 4B90A 1J0HA 3N4EA 3CHEA 1TQJA 1L6SA 1RLDA 2L5HA 2NUYA 4FLOA 1QMLA 4CUCA 5A8GA 1MWOA 3CIXA 3VVGA 3ITLA 1X98A 3KCLA 4OTKA 3FX4A 2QAFA 4O0ZA 4QSHA 3W2MA 1XXXA 3DGBA 1QW8A 4H4IA 3SUTA 3VE9A 3N6QA 4FXRA 5CJNA 1ITUA 1XRTA 2FJKA 2XGZA 2WWDA 2IS7A 2BBFA 4PB3A 2VELA 1PKYA 2F6XA 3PANA 4IMGA 5F2LA 3VC5A 4IX0A 1GORA 1A5UA 3FEQA 3IIZA 3THCA 3VMPA 4I7WA 3WUFA 2QV5A 2G96A 5DQPA 1GG1A 3N4AA 1E4NA 3SCTA 3IRDA 4EOUA 4KBXA 4ONVA 1GQJA 1JFXA 2XH0A 3QFEA 4CQ9A 3AYRA 1PBGA 5D05A 4NAFB 1ZQ5A 4RZ5A 3RGTA 1VFOA 5MKGA 1FWEC 3EWWA 1AW2A 3W2KA 3H2FA 3TN5A 1U22A 3B0VC 2OZ3A 4PCNA 3NL6A 1FH9A 4BEQA 3FKRA 3IUDA 2E6YA 3NUKA 2ZE0A 4LV4A 2PC8A 4KERA 2VL4A 1FKWA 3E0WA 5HNUA 4ZENA 3VOIA 4Z0JA 3BJFA 4LUIA 2PTXA 1AH0A 3UWVA 5HMSA 1R86A 3ARTA 4NF7A 4GO8A 8XIMA 4XISA 1H50A 3MCNA 2DIJA 3BLLA 4FNPA 1F2JA 2ZRUA 1OY0A 2F8QA 1K6WA 4ZQMA 4H8HA 3MMTA 4NXSA 5GJMA 2HMCA 3VFCA 5DX7A 2J9ZA 1W1TA 2Y85A 3BQ6A 4D1IA 3CXOA 1HW6A 3KVMA 1R5YA 3UW6A 3L4TA 1TPWA 3DFHA 1X6UA 3OYXA 5ABHA 1M04A 2CHOA 4ZE4A 3S9IA 3DIPA 4V1XA 2HVMA 1AH3A 1NH6A 1I0DA 3SY8A 3CUGA 5I78A 1S46A 2CITA 3HPAA 1POJA 1LLZA 2QJJA 5I5RA 2YZRA 3OZOA 3PTQA 4DJEA 2XIQA 1RQEA 2WMKA 3C5QA 1XLEA 1M7JA 1VENA 3N6JA 3AICA 3WDJA 4K39A 1BVNP 4AHPA 1HJXA 2CPUA 1LUCB 5DXYA 3EDJA 4GA8A 3EB4A 3R10A 2V3GA 4GIYA 2ZUSA 2JK2A 3L0GA 5DT5A 1TWWA 1YNPA 2PWUA 1RVGA 3RO6A 3OJGA 1JNDA 4M56A 3ABRA 3SCVA 4G7EB 2PGEA 3KZPA 3FVDA 4S3AA 3CMGA 1UD8A 4B15A 3TYZA 3CPUA 4O53A 4MJMA 5JU6A 3O16A 1VJIA 5AC8A 3E9AA 4QCFA 1ZJAA 3H7VA 3I3EA 2GVJA 4O1EA 4S3FA 4BF5A 1VH7A 2IKJA 2PZ0A 3BW3A 1H7RA 1CGUA 1PV8A 1LCOA 3UPBA 3ES7A 1O94A 1JGIA 3J7HA 3P80A 2Y2WA 2DZSA 3S6OA 3I6TA 1LT7A 4L6HA 3BMXA 1EOKA 7A3HA 4Q33A 3EWBX 1YHTA 5CG0A 3W0KA 4JCMA 1CGTA 1W3IA 3SM0A 3IK4A 2DZPA 2QDHA 1EHAA 1PIIA 3SCSA 3U8GA 3B0PA 1FY6A 1OYCA 1SU5A 4IPLA 4MNLA 2YCEA 4D71A 1N8WA 3DHUA 3I3BA 2DVUA 1ISVA 3TLLA 2YFOA 3PR2A 2WANA 1M7OA 3ONCA 3GXPA 1JI2A 2BHUA 3GLCA 5HWJA 3TR9A 1WXJA 4H9TA 5I07A 4PEEA 1B9BA 2QUUA 2RDWA 1CB7B 4HNOA 3FJ6A 4GY1A 5T9BG 3LB0A 4PRWA 2OYMA 1EJSC 2PD5A 3FDGA 1VLWA 3LSBA 1W1VA 2VOTA 4E8CA 2WHJA 4MB3A 3L0KA 2W27A 4D6GA 1DJYA 4Q8QA 1VR6A 4KRZA 2PDJA 2YBTA 5F2MA 8RUCA 1CIUA 1ITQA 1LZOA 3GDTA 3WUGA 4FALA 1X8FA 4MDOA 2JEPA 1J0YA 4EP8C 4I8YA 5HQMA 1QW7A 4LYPA 2GJPA 4EXAA 2H9AA 1F3WA 3VCCA 5FKYA 2VXNA 1JJKA 3LMYA 3JW7A 1S5WA 4IZGA 3C8NA 1FWBC 3RFAA 3W2JA 2ZRVA 4L7ZA 1HL8A 3FGCA 5HK4A 3RO8A 2VZTA 3RK8A 3NR0A 5JH2A 4FR6A 2ON3A 1XJBA 1ICQA 4GACA 1W5NA 3TTYA 2W62A 3PJUA 1BD0A 1QOXA 3OW1A 2D2JA 1ALDA 2ZUNA 1YADA 3M7SA 2WV8A 1PX3A 5JH1A 1RJPA 4C6DA 4K3ZA 4MY9A 4QISA 4NNCA 4CEUC 3MW7A 1HKIA 4W8AA 1M5WA 2E6FA 1XINA 1HKVA 3E02A 3H4GA 5AYXA 2DZAA 2QJMA 4NJHA 1FCVA 3M0YA 3WUEA 1Z48A 3LCFA 3PZGA 3VD3A 2NW0A 1J10A 1KTBA 1UC5A 1VCGA 5A2BA 3VOJA 4XVDA 4UR7A 1A5SA 4ZL1A 1ISZA 2HDJA 3TUUA 4LQ1A 1CBGA 5DO8A 2C18A 4WOZA 3RMEA 1M1BA 1FWFC 4S38A 4PTMA 1TPEA 1HGWA 3WMLA 3T0BA 3VOCA 1F05A 2D3LA 2E28A 1E1CB 2ZXAA 4QCEA 1XUUA 1OCBA 1XYCA 2FVKA 2WPGA 3OQ8A 5C8BB 2OPJA 2D2GA 1UA7A 1WBHA 3M0XA 1DWAM 2Y7FA 2VEPA 4C1LA 1Q8AA 1M6JA 4GUFA 2PD9A 2XTKA 4B5XA 3RCMA 1QFEA 2HE5A 4V33A 1LLWA 3OP2A 1TPVA 3P2VA 5D37A 2XSBA 4L6DA 1DP0A 2OTDA 1MEIA 1V6VA 2A5HA 2DUAA 3YPIA 2VEFA 1B2YA 3ABXA 1RCXB 8TIMA 2CHRA 3RILA 1ZY9A 4MPQA 4EXBA 1FX6A 4CN1A 5TF0A 1XLHA 4DVOA 5BYWA 2J7HA 3GZ3A 2ZBTA 2QVHA 5D2WA 3C0SA 1NF0A 1FA2A 2FPVA 3VGFA 3W7GA 2EJ1A 3F1QA 9CGTA 2PU1A 5IDZA 1B1YA 4EF8A 2OELA 3WMSA 1K70A 3LPFA 4E2BA 1A53A 3V0TA 1G7UA 1QHZA 4MFDA 3F5KA 5DRIA 1O12A 1GKQA 3GVRA 1XCWA 1C93A 4LS0A 1TKKA 4REQB 4WDUA 3CMJA 1PZ2A 3LPOA 4AX6A 3DYOA 4R34A 1DWJM 4W4QA 1NWUA 3QPZA 5HR7A 1KTCA 2TRSA 3WD2A 2VGFA 1OGGA 4FLSA 3T4WA 3FA5A 3UXKA 4IMEA 4A05A 4DWDA 3N12A 1DJHA 3KVJA 3W1AA 4B2DD 4J28A 1QU4A 4Y6GA 5I06A 1ICPA 2GOUA 1LQAA 1SMDA 2QJGA 1E4LA 4GBUA 4KRTA 2V30A 1MNZA 2A3BA 3A24A 3OLDA 3W37A 1EJTC 5KSWA 4UTIA 5J04A 3LCLA 3CAQA 4J7RA 4OT7A 1PDZA 3LK6A 3B8IA 2VGIA 4FF5A 4LAUA 8XIAA 1YDOA 4J9JA 3WNOA 5LYRA 2UV8G 4A22A 1ZGDA 4DYJA 2VDGA 3PC0A 2FHBA 3R94A 4RE2A 2VUNA 6XIMA 3FY1A 3UVIA 4UQCA 1SO4A 4H9ZA 2BG5A 5IHSA 3G3MA 3NO1A 2O4MA 1ADDA 3N04A 4YMZA 2V5DA 3EWDA 4GH1A 5AHIA 4BQ5A 3HGSA 3QFWA 3BCFA 1DHPA 1FP9A 1T8QA 4LYKA 3P61A 3RHGA 3UR2A 2Z00A 3QPYA 1GWJA 2VX7A 1V5XA 4JFUA 1VEPA 2EJAA 1PTAA 4GXMA 3EWUA 1TIMA 3BLPX 4AMAA 4GMEA 3SN1A 1WYIA 2J74A 3EX2A 3O63A 1LQ0A 2C13A 4JFSA 2FFIA 3WL0A 2ZX9A 1M53A 4Q8UA 3SSJA 3B4UA 4IH3A 4J2PA 4KT2A 1V79A 5LIKX 4IL0A 5FL1A 4P8UA 1T5AA 5DRCA 4QS6A 2FFCA 4A8LA 4FXJA 3QJAA 5I02A 1OT1A 4JQ2A 2Z1VA 4QAWA 5GNZA 4Y96A 4TV6A 2F6KA 3AZRA 1U5VA 4LBSA 1XD1A 1Q45A 4BWLC 4RJEA 3WBEA 3CH9A 2EPKX 2PWVA 3L5AA 2GJXB 2OLSA 2A0NA 3GZAA 1VBGA 1F7BA 1PZ1A 1Y65A 3NQVA 3BXWA 3ZMRA 4IF2A 1F61A 4NX0A 3GDMA 3PP7A 1O5RA 1QPKA 1J9YA 3KDNA 2DP3A 4AUBA 3KOYA 3LSCA 4C1NA 5A8PA 1MXDA 3C52A 3UXAA 2E5DA 4DLFA 4NU7A 1SVDA 2YIHA 3RLUA 1LWHA 3RMJA 1WZAA 5LNUA 3TIMA 2JFEX 3W9ZA 1BSIA 1V3IA 3LRMA 3C2EA 3CU2A 1JCLA 3QN3A 2JEQA 1ZAIA 1TRIA 4NP7A 1P4CA 5LNSA 3P6LA 1B30A 3TLQA 4HZMA 2A3AA 4M7TA 4ZQRA 1G0CA 4KRUA 2D69A 3FJ4A 2AOSA 2EEXA 3N2XA 2Z6IA 2B4GA 1JDFA 2OSXA 5AECA 3UZWA 3TYAA 3LLFA 3V5CA 2Q3RA 4NJGA 4QLJA 4A6GA 3ECQA 3M44A 2VFFA 3EA3A 4FXSA 1HFBA 3AMDA 1W91A 4Z1CA 4F2BA 1RY8A 5D9MA 2X7VA 5CC3A 4E2DA 3IJ7A 3UEQA 1ZENA 3WQVA 2V5CA 3B8TA 1MRAA 4YHGA 4V1YA 2AL2A 1G69A 4HBKA 2V5LA 4HCLA 3UGVA 3TCSA 3BAXA 2ZXBA 1SZFA 3I10A 3DFTA 4C6QA 7TAAA 1IHIA 1X39A 3CT2A 4QNWA 4MZ8A 1BF2A 2OYKA 4OZOA 5C9XA 4UNLA 1AW1A 1IT7A 3WQ6A 2H3DA 3QKZA 2PLJA 1ZJBA 3H23A 2F6UA 2R1KA 4W7UA 3CHCA 4DLMA 2Z28A 3OQEA 2ADAA 4ENLA 4K8HA 1ZJHA 2VURA 3T2PA 5ABFB 4ZE5A 2Y0FA 1RJQA 3HPFA 1BG9A 1FWCC 5EB8A 2QCNA 3KVKA 1E1FA 2I57A 4GCAA 4LV9A 3G0UA 4IM4A 3QV9A 4RLIA 1JCNA 1QDSA 1W5MA 3GVWA 4XZWA 4IMAA 4C7DA 3I4KA 1GJUA 3SQMA 1HJUA 1Q13A 4NNAA 2D22A 4JHZA 5LXXA 4G2DA 1A47A 3CV7A 4HN8A 3TW9A 1GW9A 3H2NA 3KM8A 1SFTA 3FV9A 4TVCA 1JCXA 1OFBA 1PDYA 2VFDA 4QLLA 1BVZA 4KESA 1SZGA 3V3WA 3QSRA 4RXFA 2QCMA 1CENA 2Z27A 3EKLA 2GDVA 2A1YA 5AVNA 4P7QA 2X1RA 2ZUMA 1GVFA 3RM9A 1S5TA 1KQYA 3WBAA 2G37A 4XBKA 2PF8A 3SCOA 1R9XA 1C3FA 4AC1X 5I7GA 2W66A 2YDAA 3R5EA 2CWNA 2I5GA 4P7NA 2WMIB 1HIZA 1IEIA 3ZSSA 1IT8A 3VKAA 3VIPA 4BI7A 3M41A 1R3VA 5C0QA 3O1NA 3MYPA 1R3TA 4FI4A 1R87A 4ZBCA 3M7WA 3LGGA 4TMBA 3MUZ1 3NDYA 4DJED 4ICCX 1LBMA 4Q8NA 1I0BA 1TZ7A 3SR7A 2WC3A 4CQAA 1SFJA 3C2FA 1TUFA 3G3DA 2AKZA 7TIMA 2BY1A 4DUWA 1GG0A 1PPIA 1LYXA 3UG4A 2DFAA 4O4WA 2OVLA 2W4XA 2R8WA 1KWGA 5FF2A 1W1A1 4PGLA 2QCDA 3A21A 3THDA 2XG9A 3GIPA 4ASTA 4PFMA 2BMBA 5HQLA 1A3XA 4KCTA 3TXZA 5TIMA 4UQAA 2R1LA 3R0DA 2Y70A 4MLJA 3FCPA 4RL3A 1FCUA 2J7FA 3V7PA 3UZYA 3DFNA 4I5UA 2WZEA 1I2QA 2V2DA 1MZHA 3VNJA 1EQPA 1L2UA 2I17A 1E55A 1DXFA 5A69A 5TNVA 2DZTA 2B7OA 1XIDA 3AO0A 2Y8UA 3RIKA 1YYAA 3BOLA 3E0FA 3L4ZA 3P5YA 3F5JA 4BY3A 5BXTA 2IKGA 3UNTA 1XYLA 3AIBA 2BNJA 5I3IA 3FXYA 3ITTA 1ZUAX 3IWPA 3MSYA 4UOJA 4LEQA 5BU6A 3TSMA 5MHBA 2DSWA 3MS8A 4J27A 3BOFA 3WLNA 2Y1HA 4IXXA 3UETA 4KWOA 1JAEA 4ZO8A 1G94A 2YL9A 2NV2A 3V5FA 3CV6A 1H7OA 3UA4A 3T6CA 5AC6A 1UWTA 4QHRA 7REQB 1RPXA 2AL1A 3G8RA 1W9VA 4LBUA 4BQ3A 3GUWA 1IEXA 3B8UA 3W81A 4IGNA 1YDNA 4UB9A 3HM7A 3QMRA 3N2BA 1XG4A 1C91A 2QPUA 4LF2A 1VEMA 3GVVA 3CASA 3HO8A 2RFGA 4OUIA 3W87A 2POZA 2VQTA 3OA3A 1B57A 1QNQA 1B3ZA 5F1UA 1W2VA 4QE5A 1CNVA 1E0VA 4XD3A 3ZLFA 4JQ4A 2C91A 1F4HA 4TIMA 2ACUA 4O1BA 3AIUA 3BJSA 1Q7MA 3TK7A 3A6OA 3OG2A 1W0MA 4MWAC 3U4AA 2B81A 3K4DA 4JTRA 2C3ZA 3T40A 3BDKA 2F2HA 4MYAA 3ARWA 3GG8A 2W67A 3LBOA 1W3HA 2O9TA 1XBVA 4Q8VA 2OEMA 1UUQA 1HP4A 3LD5A 3T42A 3WEMA 1KD0A 3FS2A 2Q01A 4GZEA 1UUOA 2QUNA 3UWZA 3SJNA 1WNOA 2NZLA 2R14A 3C86A 1P0DA 4HA0A 1GOXA 3GAYA 3CZJA 1O95A 4Q4RA 1RBLA 4NHVA 2I14A 3OPSA 3EWYA 1P48A 4DUVA 3EPNA 3P8JA 4UQDA 1H1ZA 3UBPC 1BGAA 3VZZA 3VX0A 2GSHA 4UR8A 4GFSA 1JD7A 2IXVA 3HPXA 4JTJA 4JQ1A 4E4FA 2PBOA 3G8EA 4OWGA 3P93A 2A3HA 4ADSA 2PP1A 4L56A 2TSYA 3TJXA 5CPOA 4ROPA 4AFYA 1H4PA 4G56A 1XYZA 1RA0A 4MM1A 4OUEA 4YTQA 2ASHA 1DXIA 1FRBA 1XKYA 3M47A 2DH3A 3TC6A 1F3EA 1DJWA 2E6AA 4AZCB 3WBYA 2VZUA 1J11A 2Q8XA 3L23A 4RE4A 3MDWA 3PB2A 1OCJA 5HWNA 5GVJA 1YX1A 2WHKA 1N82A 3WJSA 2YYUA 2G8ZA 3QV8A 5BMXA 4AQLA 3GR7A 1S5NA 3EEGA 3K4WA 2QAPA 4BHYA 1HKKA 1F3TA 1XCFA 3ATZA 4ZO9A 3L9CA 1CGYA 5HNTA 5BW6A 3O6YX 4FO4A 1KBLA 1A3WA 1GKPA 5C2GA 3PBUA 3S6DA 3MHFA 3NDOA 3MI6A 3W73A 1B5TA 3HPZA 2Q09A 3ELFA 4A3HA 2BGSA 1DWFM 2A79A 2CBIA 1UQYA 4LFYA 2V3EA 4ERIA 4RNFA 3I7RA 1PE1A 4YTSA 4QX4A 1ITCA 2V8ZA 3ZM8A 2EPNA 3KFTA 1OK4A 2BGNE 4JEQA 4PTVA 5D9OA 1U83A 3GAKA 5BU9A 4U2YA 3T8LA 5A2CA 1ZAJA 3MJMA 1ECQA 3IAQA 2B7NA 3W7EA 4O0QA 2X41A 4D8ZA 1BEUA 3VOFA 2QS8A 1Q6RA 2P3ZA 4Y9AA 2PODA 5CBBA 2WK2A 3QC0A 2DT3A 4KEVA 2QJNA 5DMMA 3OZPA 2XIIA 4PMYA 3F4WA 4UQEA 3W1TA 1TA3A 5FEXA 2ZUWA 3ZR6A 2VC9A 4ZSUA 2Y5JA 2CLPA 1P5BA 3QSTA 4PULA 4PB5A 2DUZA 3SUVA 4KEUA 1T6MA 1Y5XA 1JUBA 3NA8A 3IGXA 3UXLA 2XFRA 3TKFA 3AIWA 3QGVA 1NDVA 2J6VA 4DWSC 4DJDD 3UR7A 1XPYA 4IQEA 1R3SA 4GX9A 3WQGA 2WZHA 4LJ3A 4PL2A 4N9DA 4WHBA 2WCSA 1N2VA 2J4GA 4TO8A 1TV8A 4ZXLA 1EEPA 2D24A 2BGQA 4W87A 3AS3A 4YTUA 4DYKA 2ZQ0A 1ITXA 3RDKA 3E0IA 4HA4A 3MWCA 1CW2A 1QW9A 2CLFA 2CLKA 3LNPA 3M0JA 5E93A 3T09A 1CGWA 3R25A 4IPPA 3L4WA 3PWGA 1I1WA 2IUZA 2O9PA 5ECUA 4E0CA 1FWHC 4HZ7A 2XIJA 2FTWA 1DXEA 2GUUA 1XH2A 4MLRA 2MNRA 1I6NA 2PZNA 4NZ3A 1BKSA 2GK1B 1E3ZA 5C71A 1HKWA 1KFCA 5IBXC 5M2FX 4JTFA 1G4TA 3IJ9A 1KKRA 2CESA 3P81A 2ONEA 1X6LA 3GM8A 1H7XA 2DVTA 1EUAA 3DFQA 4UTTC 1WO2A 1H5YA 3TVAA 5FEPA 4GC4A 1RD6A 4MFEA 1LOLA 2UZ9A 4PFHA 2PGFA 3DYMA 5H2ZA 1P7TA 1QNPA 4AIOA 1GHSA 4CN6A 1J4EA 1EKOA 2ZZ3A 3SIZA 3P14A 3SUWA 1POKA 2FZ9A 4UFJA 1R3QA 4XX6A 3D3AA 1SFSA 3CT7A 4IHCA 2Z2BA 1FWWA 4MNKA 3C0JA 3N3TA 4RZ6A 3QV7A 1WQ5A 1K8CA 2CCRA 3UWEA 4YL2A 2AGTA 3R0UA 5LIWX 4R88A 3JR2A 2GVGA 4GYKA 4RV3A 3S5OA 5I3DA 1VPQA 3LY0A 4Q7NA 3L2LA 3M5XA 3K8LA 5C9RA 2F9RA 1NFPA 2HVNA 3FDKA 3GW3A 1CX9A 4AF0A 2YL8A 3G6LA 4QQUA 3L65A 1SFLA 5FEZA 4DJFC 4UWMA 3TFXA 4WK9A 4NASA 2DVXA 2QPXA 1E40A 1J0IA 4FNRA 4JX4A 2BDQA 1X1NA 3BZJA 2NT1A 2X2YA 5FJJA 2P50A 4IQDA 2EKCA 1S2VA 4GLEA 4J3TA 2V3FA 4CGTA 3WLJA 3HQOA 3W7IA 3CIVA 1YTKA 5CC6A 2OKOA 2VC5A 2X1UA 3AMLA 5HANA 4LVFA 3ANUA 3P84A 9XIMA 2XVPA 1QRQA 3TP4A 2NX3A 1EXBA 5HMEA 5FOOA 1FWIC 5EMYA 4DO6A 5FIPA 1JFHA 1EJWC 3GQYA 4QP0A 4S2CA 4GWEA 3VKBA 3LGDA 3MDUA 3PPGA 5HPCA 1UR8A 3FHQA 1XIEA 1F8MA 4O15A 4QS5A 1FWGC 5I3JA 2OZ8A 2XIOA 3OO2A 4WOQA 1UKTA 1UZ4A 2KZHA 1K9DA 3A9BA 4P8WA 3SDOA 4W7VA 3W72A 2PPGA 3L2IA 1J18A 3RM8A 3BAJA 4EPDC 4PMUA 2YCKX 1UOZA 4GYJA 1BQGA 3SW6A 1E71M 3URNA 3TV8A 3ICJA 4WR3A 4XG1A 1J0ZA 1EQCA 1VP5A 4YU1A 4XK2A 2R1MA 4NZ5A 3IGSA 2ZOXA 4RE3A 3DUGA 3C2OA 5E6ZA 3TOYA 3VK5A 3PJWA 4ZR8A 6REQA 3N34A 4GVGA 1QNSA 2R94A 1KKOA 4XSMA 2WBKA 1PZ3A 4MADA 3TEVA 1XYAA 1PTDA 4ZMGA 2G3JA 4Q4KA 3WK3A 4AMCA 1FHUA 1GVRA 2PDXA 3SQLA 3BGJA 3KS6A 3W82A 3A4JA 1YPIA 3HJEA 1QI0A 1Q4WA 4AXNA 1TJRA 3WD3A 3TJIA 1Q6EA 4LNCA 1RP9A 5F4WA 1KM1A 4KFNA 3Q65A 2PGRA 4IPIA 4HP5A 1C8QA 1GQKA 3RITA 3WQ4A 1A4MA 5CJ5A 2J9YA 3STFA 2VCCA 3BCDA 2Y5SA 2EPOA 2NT0A 3UZZA 1AD4A 1WDPA 3TN6A 9XIAA 1E0XA 2FPYA 2FIQA 3F4DA 3Q45A 3UD6A 1E3XA 1RV8A 1Y8BA 5AHNA 3S5YA 1V7YA 3G1XA 4H2CA 3ZT6A 3UYCA 4UTWA 4YJ5A 7CGTA 1H51A 4C1NB 1LRQA 2VM8A 2VC6A 3PBGA 5LSMA 1NOFA 2GVYA 1TR9A 3VDHA 1CLKA 3A12A 4AIUA 4PC8A 3BLIA 3I68A 3M0LA 1RHCA 1DJGA 4INFA 3WFLA 1YBQA 1YTDA 3UG5A 2C19A 1SR9A 3BLFA 5A8QA 4L61A 1SSGA 2PWGA 4JL1A 3LG3A 3ARQA 3LU2A 1V7AA 1RK5A 4ICNA 4XV0A 4XKYA 2V9DA 1DORA 1OG0A 1LBLA 2C7FA 2YCLB 1TJ0A 2I7GA 3R8GA 5DLCA 2JQXA 1ZFJA 4PODA 1YQ2A 1UR2A 1XBZA 2UY2A 3H4WA 3AWOA 2C16A 2ZRYA 1S2WA 4ECLA 4UFHA 5LNWA 1PB0A 3LXCA 4ILSA 1ADSA 5EY5A 3QOMA 5AHLA 1BVWA 4S23A 5EL1A 3WQ5A 3R6IA 5BWFA 1A0CA 1VZWA 1S5VA 2ZDRA 2G97A 3WH8A 4TX9A 3CIWA 4GH3A 1KXTA 1RCQA 1L2QA 2XHYA 1C92A 2XM1A 3I65A 5K4XA 3UWWA 2WJZA 4MYXA 5CBJA 2B31A 3N2CA 1DJNA 4IJCA 1ZSXA 3G77A 4YPJA 2E5CA 3D46A 2EF9A 1AH4A 3K4AA 3CMFA 4C6LA 4S3GA 3TA6A 3C0LA 1FWSA 4W5ZA 3T0CA 2GWNA 1KRCC 2POTA 4GYFA 1XLFA 2UY4A 5D9PA 3VINA 1QXLA 3WSUA 1KWKA 1FWNA 3GHRA 3WD4A 1LWJA 1FWTA 5A6SA 4JFVA 3PG9A 5K2ZA 2AAAA 2ZTKA 3R4IA 4WVXA 4W8BA 3IJ6A 4BCEA 3KOWA 5EBAA 1W8SA 3URAA 1VBJA 1OM0A 4WJXA 2D0FA 4NAFA 5FJOA 3F2DA 2DSKA 4WCJA 4XZMX 2JKAA 1QPOA 4LRTA 3V5OA 1PEZA 3GFYA 3WZ0E 3N13A 3MJYA 3AHZA 5DY2A 4LTSA 1UROA 1AVAA 2CETA 2YFNA 2GGEA 5U7SA 4L4OA 2OGJA 3A64A 4MPKA 2PURA 1DQUA 4GUGA 4B16A 3BW2A 4PMQA 3W1XA 4L1GA 3D5HA 4XD5A 3E74A 2QT3A 3MCMA 4JCLA 4BZYA 1TB3A 4OHQA 1US0A 1WCGA 3EMQA 3GY1A 3EX3A 3W27A 2FHCA 2Z25A 3M0IA 4JYDA 4V15A 2ZDSA 2YDRA 5AYZA 3M64A 2D0HA 3GDRA 3LLDA 3ZSTA 1KV5A 3S47A 1HF6A 1XH0A 3MKKA 3IK2A 1KFLA 1DE6A 3IIXA 2ZZ4A 4JL2A 4PSRA 1F6KA 1KCKA 1JIBA 1JCJA 2YA2A 4LAZA 3TW6A 3TCEA 3P5ZA 3W1LA 3ZJ8A 3REQB 3PZUA 3KCOA 2HV5A 2VGBA 4ATWA 5CAHA 5CZ0A 4MAZA 2VFHA 4ZB2A 1LUCA 3G1RA 3NQ2A 4YTRA 4JBRA 3W7OA 1VYPX 1LM1A 4ZCWA 3GTXA 3HV8A 3AS2A 1VAHA 4MJ4A 3QY6A 5KTLA 3EPMA 2XWDA 3E3HA 2V68A 4RNHA 1IGSA 5CPMA 4POCA 3V36A 4N4QA 3NOYA 5EKYA 1TUXA 4D6JA 1H09A 3E5BA 3E1F1 1AQMA 3V0SA 2GWGA 4QJ4B 4M24A 4O54A 2CKSA 4MGGA 4LS1A 2BVYA 1N7KA 1RXOB 1ONXA 4Z0SA 1W1IE 3H24A 3LS9A 3DG6A 5M3WA 3VDCA 4Z2JA 3U2CA 4AB4A 5HUOA 3G1DA 4U3AA 1DIEA 2PDUA 3VXGA 4DZ5A 4J3XA 3LCWA 1GQIA 1ODUA 1MDLA 4I6KA 3WNNA 1RALA 3MP4A 3OVRA 1HKMA 1S2AA 5HAOA 1K4GA 5EFFA 1KXQA 3ME3A 5LHEA 4GI4A 2OFJA 3A13A 2RAGA 3KWSA 1JDAA 4GIAA 1ZLPA 5A94A 1Z69A 3U7BA 4UCFA 2WJEA 3GUGA 4YCPA 1R38A 4EXQA 1KRAC 3IJDA 1OD8A 4JFWA 1QBBA 1EP1A 3ZO9A 5GPRA 5HNNA 1XCXA 1IWBA 1VFTA 3WO8A 5FA5A 2J6XA 4Y8EA 3EOOA 1C8XA 1P1XA 3IJ8A 1OFDA 4LY4A 1FWAC 4G5DA 1ZHAA 4Q7IA 3AC0A 4QTGA 3VO0A 4AH7A 4C6IA 2J7GA 4DRSA 3LRKA 2GOKA 4AY8A 3L0NA 2H6RA 4LCRA 2DSUA 1E6ZA 2J7EA 2ZX6A 1CXFA 1WDRA 1K8XA 1OINA 2E68A 3ARYA 3L21A 3MKVA 4MTVA 4CU8A 4E2VA 4ML4A 3CLWA 4IUGA 3WDIA 4UQBA 3W25A 1J6PA 2ZZ2A 4XUGA 1JZ4A 5DMLA 4K7VA 1E15A 3WX7A 4AYGA 1P6BA 3WK0A 4TUFA 2OR2A 4N9EA 4N02A 4HNCA 2OSYA 5TAOA 3KHDA 4TX6A 3KBJA 1ZS2A 3QMSA 1UP3A 2PDKA 3ZIZA 1EBHA 1EIBA 1O68A 2PDBA 1GUVA 5A8OA 1R2TA 1Q6DA 1OFQA 3WLLA 2FTPA 1BXBA 3NM3A 3QOKA 2FYMA 1J01A 4UZSA 4BKNA 2ZZ5A 1UH3A 2BP1A 1W32A 1U5HA 4PRRA 4LCSA 1C8YA 1CXLA 4V28A 3EA2A 3V1HA 3PBYA 3APGA 2REQB 3CEUA 2WB5A 4ROQA 3SCNA 3MV01 5AFDA 3WF1A 1IXOA 1UKPA 3OTRA 2Y8KA 4B4HA 1GHRA 1TV4A 1B4KA 1K1DA 2BLEA 4X2RA 1XD0A 4UUIA 2VQUA 4RDYA 2VWTA 2WYSA 5REQB 3O15A 4PUNA 4BA0A 3KTCA 1ZBKA 3ITOA 3RG6A 1FFRA 3P82A 5BWAA 1KFEA 3W1NA 1WXZA 2JIEA 4CNTA 2O7SA 3KBWA 4OECA 2V2HA 3WH7A 3DG3A 3AJXA 2CLHA 5K9XA 1VBUA 2D0GA 1YW1A 3AMKA 2JGYA 3DH7A 3GKFA 4NILA 4HCDA 3G1VA 3E49A 4JGDA 3T8QA 4AZGA 4Q6JA 3W7HA 3SN0A 3AIEA 3B8SA 4OV9A 1P0NA 4NT0A 3N6HA 4Z2IA 4R3UA 3MO7A 3W1RA 3P60A 6CGTA 4M6VA 4EX4A 1PAMA 7ENLA 4HHLA 4KWVA 3VPLA 4CNNA 1KNWA 3ORWA 4IG2B 1SW3A 5H6HA 4M0XA 5F1VA 3SURA 1G6CA 5JIWA 4KCWA 3KLLA 5F2GA 3THQA 2YDQA 4UXDA 5F7UA 1W9DM 4NY2A 3SY1A 1XLIA 3BANA 3EGJA 2VUYA 2O55A 3DG7A 4GVHA 5DANA 4H9UA 2P53A 4LAKA 4JDBA 3W07A 5HDRA 1KGXA 1PWMA 4YNGA 2A85A 4JTGA 4KQNA 4UFIA 3GNXA 2IKHA 2ZZ7A 3W23A 1F6YA 3UPMA 1A4LA 5M03A 1FKXA 4K6AA 3RF9A 2FH6A 2ACSA 4J3UA 4MKNA 3K8KA 1CXIA 3QRHA 5ECVA 2O92A 4ZSTA 4JTSA 4Z2KA 4MNMA 2I56A 5HOSA 5CSRA 4GXWA 1TV3A 5CSUA 4JTQA 4JQ3A 3S1GA 1OC6A 4REQA 3ZR4A 3G1SA 3N1AA 5AY7A 5EMMA 1MNSA 1OK6A 2QIIA 1JI1A 3MMDA 4PH6A 3TW7A 4IGSA 2BOEX 2PAJA 4IFOA 2QW5A 1PHWA 5A3HA 5D2XA 2ZICA 5K9CA 3VMNA 4PUJA 3R0KA 3M6YA 2DSZA 4M51A 3UJFA 3VIGA 4OKDA 1GVQA 3TSDA 1TX0A 4NG3A 4PTXA 1X7FA 5DY3A 2J24A 4GC3A 3GXDA 3TDFA 3MA8A 2YGYA 3K1DA 1UZDA 1XRFA 4K1WA 1A0EA 1A5KC 4JNZA 2EPHA 2OLHA 3W7DA 3PSVA 2P5NA 5ABEA 5I77A 1H60A 2R24A 1KW1A 3P0XA 3HG4A 3A4XA 3C3UA 4JPGA 2I9UA 2YR1A 3NZGA 4DM1A 1TWSA 2O7QA 4MNJA 4QITA 5I2UA 1Z8AA 4W86A 1VFUA 2G3IA 1CYGA 2ZA1A 1CLVA 4KWWA 4XB3A 1NY1A 1RBAA 3GWQA 5SWUA 2YPIA 1MW1A 4N6EA 2J47A 1JZ8A 3EKGA 1PX4A 2AQVA 4CNPA 3F5LA 4UNKA 2PDPA 2YXOA 3THAA 1GVOA 1VKFA 4QE4A 2XJ7A 3TN3A 1L8NA 2IPWA 1OG6A 4RZ4A 5M1TA 1V6XA 4EAYA 3LLXA 4DPPA 1D3HA 5IXEA 1UJQA 1KR0A 4S2BA 4HPGA 2DQWA 3RLHA 3M4HA 3U48A 6TAAA 4JDYA 1UCWA 3T4CA 1ONEA 4UFLA 2RGMA 2OG9A 3PUOA 2ZX8A 1B0IA 1EO7A 3DI0A 5TD4A 3O6DA 4S39A 3VYLA 3GH7A 2QDDA 2NLIA 3CZEA 4AD1A 4XAGA 3E38A 3HQNA 3TYUA 2CHNA 3DECA 3C3NA 4NZJA 4AF0B 1WB0A 3IJQA 1UQZA 5C7VA 3EA1A 2BSLA 2GVEA 2JKPA 2D73A 3SUSA 3ZWTA 1QUMA 1AJ2A 4DBWA 1Q65A 1ZZMA 3GD6A 3CYVA 2GJXA 1SSDA 4WUIA 4C60A 4J4KA 3AMGA 4Q4QA 1XGEA 4IMCA 3GNNA 3SRHA 4LB4A 4R7JA 3GNRA 3GE7A 2W5FA 2V5JA 4W88A 1GJPA 5DCBA 1TG7A 5G5IA 2NWRA 4DAFA 3QVQA 3NL5A 1BRLB 1DJIA 5DMYA 1F5ZA 4DF0A 1NDYA 3BPWA 4DNHA 4YCOA 3N3MA 4LUTB 1FQ0A 3PZOA 4CKQA 1VJZA 2E1WA 4UMBA 5FF3A 3THUA 4H41A 3N73A 2WQDA 5LGXA 4HMEA 2C1HA 4HHMA 1QBAA 2AQOA 3DESA 3W1PA 3RLGA 4GJ1A 1XIIA 1EC8A 1US2A 5FJTA 2FDMA 4P5UA 2FZNA 1G7VA 1ME7A 1SUXA 3V16A 3OHIA 4HTBA 2G4FA 2DZBA 1GVIA 1AQFA 1HXJA 2BOGX 1EDTA 1VEOA 2C0AA 1T41A 2PLCA 5D2YA 1E56A 2QGYA 1JULA 1CB2A 1K3UA 2LLEA 2HBVA 1H63A 4RCXA 3SGZA 2OJPA 4GQBA 3WLIA 4O28A 4E8GA 1EJ7L 1ODZA 5CLWA 3KRUA 3GIYA 2KAUC 4QROA 3EYPA 4C6EA 1UBPC 4JN6A 4FIQA 4U28A 3LCHA 3SEPA 1JEZA 4H6EA 5KEZA 4M81A 4HHHA 3MV11 4HZ6A 5K9DA 1OX6A 3WBXA 5BNKA 1Q6CA 1B3VA 1Q85A 4W5UA 2P0IA 3S6TA 5DBTA 3ZZ1A 3ARUA 4ZO6A 3TONA 1IGWA 1QI3A 5HINA 5KZ6A 2QDGA 4JKLA 1AZ2A 3DXIA 2WHMA 1XM3A 2C15A 4GNVA 3NG3A 2GQ9A 3TFCA 1G01A 1FXQA 3G5EA 3OLIA 3GDLA 1P43A 1TFVA 2G95A 2QCFA 3CUFA 3IV8A 3CM4A 5I00A 5HPOA 2HBXA 3PBVA 4Q4OA 3PNUA 1EP3A 1LG1A 5ABFA 2V63A 1F3XA 4C6CA 1UKOA 5F4XA 3CNYA 4J40A 3QF0A 2ISSA 3B8VA 1YBQB 1WDWA 4A21A 4AZBA 5FL0A 4EVZA 1XC6A 3QYSA 4KETA 1I2PA 3PJXA 1V77A 1OF8A 4PMNA 3NQMA 4GI9A 1O5QA 4IWWA 3QH2A 3FN9A 3GH5A 3TAOA 3MSDA 4EWJA 4L65A 3STEA 1SZRA 3GYEA 4PCFA 3HBLA 4QAIA 1EX5A 3N29A 1ECEA 3OODA 4IIDA 1IXPA 4Q8OA 4J2MA 2W79A 5C5YA 1ZJIA 2QCCA 2V38A 3GH4A 4CD4A 3U3HA 1J0KA 3WY1A 2MUCA 3AHYA 2WZTA 1UR0A 3AS1A 1R7AA 1WAUA 3MT1A 1EDGA 4H19A 3G18A 3RXZA 4FLQA 4GQGA 1AK5A 5BXPA 4W93A 4KS0A 4QJ1A 4I5RA 1XICA 3TQ0A 5AC5A 3LHVA 1W9PA 1NAL1 5EFDA 1TPUA 3VD9A 2WMIA 4HA3A 2C1IA 3QHMA 2WM0A 3H53A 3N9SA 4PUUA 3STCA 1UR4A 3HQPA 3WUBA 4Z2LA 1YDVA 3WIJA 3RJYA 4JICA 4C6KA 4HGXA 4FAMA 1AUSL 5D09A 4GVIA 1ZTVA 2NQ5A 1RY0A 1TYGA 2WSRA 4WEVX 2VFGA 3LN3A 1EPVA 3TR2A 5D04C 3DAQA 8CGTA 4Q32A 3CWHA 3TSBA 4D6IA 4C6NA 1J2WA 4OOZA 3G6MA 4DZHA 4BJHA 3OVPA 1JPIA 2WM1A 4HOWA 4IQLA 1RPKA 3CUXA 4JXCA 4NAEB 3QPEA 1OYBA 2QJHA 1CGVA 1VGAA 1TPH1 1VRDA 3VM7A 4A8IA 3VFLA 4G1KA 3UXDA 2BXZA 1G4PA 4C65A 4C6BA 3M5VA 1YE4A 3E0LA 1HP5A 2Z1WA 1W1YA 4LC6A 1R8LA 3URQA 4HYRA 3V4BA 3SFWA 4WZHA 5RUBA 1ZP4A 1TZ9A 5A6AA 4G9PA 2ISDA 4CLMA 4H9MA 4LEFA 1V0NA 1E6XM 3OVQA 5FI8A 5BXSA 1H62A 1R47A 5JQ9A 3TE9A 5AZ0A 3P67A 2OZ0A 3L2MA 5CEWA 3WF3A 3H7RA 2HROA 3AU2A 3HF3A 1MW0A 3GYCA 3ABSA 5HBFA 1R2SA 1I8JA 1KBJA 1LRTA 4O4VA 4RUBA 1QATA 3GTIA 1TIWA 2HS8A 3BQ5A 2VR2A 3LERA 1FUYA 3FYYA 4GYPA 4LYQA 3WELA 2ALRA 3DHPA 3GNPA 2PDMA 1EZ2A 3ABOA 1C7TA 1RK6A 1UD2A 2CXEA 1IR2A 1Q5MA 5HATA 3KXQA 2PSNA 3UR5A 3VILA 3DKLA 2W9MA 2J8GA 3AQUA 3LTYA 2Y7DA 3CQJA 7REQA 5FEWA 4HK5A 3O9NA 4QJ5B 4XWUA 3NO5A 5A8MA 4JHOA 2RJGA 3AS0A 3OA5A 1K7EA 3FAXA 3SCWA 4FXFA 3NQGA 1FHVA 1JZ6A 3I3DA 2Z24A 1JDCA 3JU2A 1XLCA 2VD9A 3CTLA 5HJYA 3VABA 3DHFA 2DW7A 3GG0A 3M1ZA 1U1JA 1RZMA 3A3HA 3KUMA 3H4XA 1XH1A 3L4YA 4US6A 3STGA 3BAIA 1ZBWA 2E67A 1B90A 1R6WA 3DBPA 4FOUA 2ABBA 4QJ3B 3FIGA 3OU8A 4AD4A 1VHCA 2XSAA 3VAVA 1ISWA 1UZHA 3PF3A 3UYIA 2O4QA 2E8YA 3IJIA 3QQWA 4RDWA 1O60A 1QI2A 3NGJA 3M0MA 2VJXA 4MY1A 1O7AA 1XLLA 3AHVA 3EMZA 3W74A 5CSYA 4EACA 3PZVA 3QGAC 1D3GA 4ZVJA 2NVDA 3R79A 1W5PA 1PKLA 2QUMA 3T0AA 4K8GA 1G9HA 4QM1A 1WXYA 3BMVA 4AVNA 2GJNA 2H3BA 5AOUA 1I9CB 5J8LA 3EMCA 2BTMA 1HG3A 1UC4A 4ORIA 1H1YA 3T2QA 4LAOA 1ZAHA 3FYOA 2VRQA 5HJLA 4US5A 2NX1A 4Z1DA 5T26A 3WEZA 1FP8A 1BKHA 4JIPA 3CQKA 1LL6A 3L4VA 4TVDA 3PJTA 3PHAA 1ZALA 3GTNA 1GOQA 4LVAA 3QKEA 1MQQA 1ZL1A 3KHJA 1Q66A 3WDHA 4HPNA 4AHOA 2PTYA 2GQ3A 4ZXOA 4W9TA 1IZCA 2P88A 3R11A 4ZOBA 4AZCA 2D20A 2FZDA 4PMXA 2OCZA 2CU0A 1QVBA 1S1PA 4WKAA 1NFBA 1MDRA 1S3TC 4OE7A 3WMBA 1I75A 4IL2A 3ABQA 1L8PA 1XC4A 4I7UA 1VIWA 2FPTA 4Q4MA 3FSUA 1HJQA 5E6YA 2PDLA 2CLMA 3W85A 3T0TA 2ZA2A 4L1XA 3O8AA 1E6QM 1KTNA 1YNQA 4P7RA 4ZEPA 1M3UA 3FA4A 5I03A 1OC5A 3WKZA 5CZJA 1IWAA 4LUSA 1VD6A 3W02A 4A3RA 1YXYA 3AUOA 3G24A 2QEZA 2VRKA 2XZ7A 1Q7ZA 2OODA 3IVUA 4I90A 1W31A 2BB0A 3VNIA 3DCPA 4LCQA 3S2LA 4KW2A 1TQXA 3P3BA 5D33A 4H7CA 1HQTA 3PUDA 1Q6GA 3ZVHB 3U7VA 4HMCA 1FCBA 1K9FA 1W3TA 3TMQA 1W17A 1HGYA 2FKPA 3O6CA 5EA9A 1SQ7A 6A3HA 1W5OA 1WE5A 1V02E 3UCCA 1AA1B 3VIKA 2NQZA 4B4FA 1IE7C 2NVAA 1DIOA 2FH8A 5DT7A 3SY5A 1V3MA 2VVNA 2GSEA 2R1NA 3BGAA 5FJUA 1GQLA 4G6CA 5KINA 4A8NA 3GNOA 1UMLA 4ZOCA 4CQDA 2BHYA 1V6UA 4PCTA 2PI6A 2OSWA 3LBMA 2VZSA 4Y9OA 4O8RA 2HSAA 3M0KA 2C79A 3SCPA 2PRMA 4JZ5A 3MP5A 2E8ZA 5HA7A 3WD0A 3QZAA 2FMNA 4J3WA 1IV8A 4CCZA 2Z2UA 4HN4A 2NLYA 1X96A 3WG6A 1W3NA 2GDQA 4OIFA 3TWAA 2PE4A 3QW4B 1VFHA 2H90A 3MUCA 2MANA 3VD4A 3NAVA 1UR9A 5T91A 4D6DA 4PBEA 2HCVA 3IEBA 4GKTA 1QCWA 1PJ9A 4HPHA 4J3ZA 5I6SA 1WKFA 1UUMA 1K8YA 3GHUA 3PZ9A 6PTDA 4AWTA 4IIEA 3KW3A 3S9ZA 3ZLGA 3JS3A 1DBTA 1O5KA 3CC1A 2E9BA 2X42A 3AXKA 2A6LA 1VF8A 4M80A 1A5MC 4MB5A 3N11A 3BK0A 3NDZA 3O6AA 4F40A 1GT8A 2GK1A 3UCDA 4CD6A 4FF7A 4L5ZA 4HU3A 3NQ6A 4O8AA 2BWGA 1S2UA 3PFMA 2PFHA 2VO5A 5FACA 3BURA 3EX6A 2OZTA 4C1KA 3N2OA 1R3YA 3OGSA 1J12A 4O52A 3R58A 4M5PA 2BHZA 2F7FA 4PZVA 1KM5A 4DY1A 1O66A 5DEZA 4P2VA 2ANUA 1PYFA 3XINA 3VZXA 1TELA 3FW6A 1W3LA 3UESA 3DEQA 3ITVA 3BAWA 4O57A 4C5YA 3I7QA 4LY8A 1E0WA 2R91A 4QXIA 1UMYA 4IPNB 2XDFA 4MWAD 4LUYA 4CCDA 1FWDC 4AZ6A 2YLAA 2XFYA 1PL9A 4JX5A 2RDUA 5LNVA 2V82A 2ZVRA 1KO0A 2DT1A 3GHTA 1XBYA 4LS2A 2A2IA 4FSAA 1MEWA 2X30A 1K03A 3CHDA 4JY8A 3R8HA 4UTKA 3HTWA 1Q6OA 4DJDA 4Y7EA 2AMXA 3WFAA 1C9DA 3NQCA 2Z1XA 3QY7A 1EDQA 2E3ZA 4DBEA 5EGRA 3U5YA 4JTKA 2J79A 2QQ6A 5ABTA 1H0GA 4JTIA 4MWAE 1QO5A 1GZGA 3DBNA 2UY3A 3PNZA 5DELA 1WUEA 3OYZA 3H26A 4NJIA 4IP4A 3TQVA 4BI5A 3LEPA 2QDEA 1UKQA 4HU0A 1EBGA 1C8VA 3LV6A 4HB7A 4PTNA 4HCHA 4Q6XA 3CBWA 3W2NA 4A4AA 1BWKA 3H2MA 5KZMA 3FSTA 3PZQA 3E2QA 1O1ZA 1PHQA 3DERA 2VR5A 1A5OC 1E1EA 5D38A 4OV4A 1N55A 1QTWA 3NWRA 1IEWA 1AODA 2CW6A 1BTCA 2YL5A 4JTTA 4F0HA 1R0MA 3UZJA 3GR4A 4A3UA 1W9XA 4KIEA 4AWEA 3GIQA 3B04A 3R7MA 1VLIA 1XDMA 1IZKA 3H2EA 4O11A 3UR8A 1T96A 3IIPA 2WLYA 4JYFA 1OFEA 3W1UA 4L9YA 3NL2A 2ZRZA 4GGHA 2TPSA 4HD5A 4NZCA 4TR9A 2Y7EA 2Z1BA 2Y6ZA 2CIPA 1OFRA 4HNUA 3C4UA 4F9JA 4DX3A 3VKJA 1QK2A 3QZEA 1M68A 3ANYA 1W6TA 2IQDA 3EOUA 2W3ZA 4JIQA 3UWYA 1EZWA 3TWBA 3T81A 2HEJA 4MWAB 4ADUA 1B3OA 2ZA3A 4KFOA 4E8DA 1FVPA 4RZBA 4UC5A 3ARXA 1TO3A 4OBRA 4PN2A 2IW0A 3VIOA 3U2EA 3QC3A 3EOLA 4IOTA 2YL6A 2J25A 4RDVA 4NQ1A 3KL3A 4AVFA 2VRJA 4IIGA 2WKLA 4A8RA 5CPQA 3EX1A 1W9UA 2QCHA 3RPMA 5DXXA 1OX4A 1JXKA 1OGBA 2VC7A 3PPFA 1LL7A 1GOMA 3KBSA 1ISYA 1OCQA 4CD5A 1YXCA 4H9YA 2GGJA 2OWXA