4JL2A

Crystal structure of a bacterial fucosidase with a monovalent iminocyclitol inhibitor
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
438
structure length
438
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEKMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Exploring a Multivalent Approach to alpha-L-Fucosidase Inhibition
doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords alpha-L-fucosidase
total genus 164
structure length 438
sequence length 438
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4jl2A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4jl2A01
3F4VA 1I1XA 4QFUA 1UYQA 3LPPA 3IAPA 3GXDA 1H0GA 1SR0A 3AISA 3TOPA 2CKRA 4UZSA 2YDQA 3FHAA 3OLIA 2RGMA 2EBNA 1W2VA 4TVCA 8CGTA 2ZUUA 5HPCA 1GOQA 3BVVA 4ZXLA 4S3JA 4AIUA 4PMQA 1VBRA 2VZUA 2HVMA 4XZBA 1FHLA 4OBRA 2OYKA 9CGTA 4B3KA 3L4VA 3BSHA 5JBFA 1JDCA 3TV8A 1CGWA 1XD1A 3HU7A 4M1RA 3WEZA 2DEPA 4AZHA 1PEZA 3AQUA 3CZEA 3CMGA 2DT0A 3W6LA 4BF7A 3NSNA 3BAIA 1QNRA 4P8VA 3A24A 2VX7A 4CU8A 2CBIA 4JIEA 2F7QA 5A6BD 3ZJ6A 3KE0A 2DSUA 4MB4A 3VVGA 1PBGA 5HNNA 1GUVA 3AICA 2Z1SA 1LLOA 1JYNA 4HOZA 5DT7A 2QV4A 4X0NA 3ZJKA 1UR9A 1HIZA 1UQYA 3ZIZA 4W7UA 3ARZA 1KQYA 3LPFA 1JI2A 1FHDA 1SZNA 1UA7A 2D0FA 5A6KA 3MKKA 2TAAA 2JF6A 1DP0A 1O6IA 2VR4A 1GZJA 2J78A 1BFNA 4DO6A 2C7FA 1VJZA 2OYMA 3IJ7A 3VMPA 4QLKA 4HZ7A 3ZR6A 1CGTA 3ZT6A 3FHQA 2C8NA 5CZKA 2VUYA 1WO2A 2WMKA 1CXIA 2QHAA 1ZL1A 4FNPA 3G6LA 3BH4A 1V6XA 3ARPA 1R33A 2X2IA 3U5UA 1XYZA 2CKSA 2EO7A 4FF5A 3SIMA 1CLVA 3AJ7A 1ZJBA 5M3WA 1GOWA 1OD0A 1V0KA 2WKGA 3PZVA 4AW7A 1G0CA 4PMOA 4MAZA 2Y8KA 1RD6A 4W84A 3EJQA 1PAMA 1ISVA 1UD6A 4CD7A 2OW6A 4CU6A 1QX1A 4PMDA 3HN3A 2XVLA 3GH4A 5BWFA 2BFGA 4P8UA 2XWEA 1WZLA 4PEEA 4ZFMA 4AD3A 1R46A 2XUCA 3L4XA 3AI0A 4J3XA 3W53A 5GQBA 3WNLA 1JFXA 2V5CA 1G94A 4P8XA 1J0HA 2WZIA 4HA4A 4Z2IA 2CXGA 2WHJA 1KXVA 3WQWA 1DWIM 5HOSA 1UD2A 5E6ZA 1BYBA 2XM1A 2NT1A 1WDSA 3SCOA 2GDVA 2GFTA 3T0AA 4E8DA 3NDZA 3PZUA 2E9MA 4UOQA 3H53A 1HL9A 2YDRA 4W7WA 4KGJA 1UA3A 3S5YA 3KL3A 1QHOA 3WQ6A 2X2JA 4QLLA 1RH9A 2D3NA 5HPOA 3VO0A 1LG2A 2YL9A 4F9DA 1UH3A 1UR4A 2CPUA 3ZJ7A 4PSRA 5A8PA 4GZIA 1DWFM 4UCFA 1UR8A 3E1F1 1W9PA 3NIYA 1ZB5A 2PB1A 1GQJA 4IPNB 1CLXA 1Y7VA 3AZTA 1E43A 4D1IA 3UG5A 3ECQA 4ZENA 1HP4A 5HDRA 4BZYA 4WKAA 3EDJA 3VIFA 1NWUA 1UD8A 3PZNA 2XTKA 4U3CA 3DDGA 5AC5A 3VD3A 1A47A 3AIEA 3VGHA 3ARXA 4MAVA 4D1JA 3VIPA 2WZHA 2FH8A 1RPKA 1XC6A 2FHBA 4JFVA 2BY0A 1EO7A 2O9OA 4ATLA 2EPKX 1CXHA 1GHRA 1H11A 3BAXA 1WNOA 3WEOA 2EEXA 1US2A 4EKJA 4M81A 4AZ7A 2YIHA 4L4OA 3HMCA 1DWHM 3WN6A 3F5JA 1QWNA 2EABA 3CV5A 1E6RA 4JFSA 3T2QA 4GI6A 3DHPA 1H4PA 4PYSA 3T2OA 2O9TA 3ALGA 4MNMA 1WCGA 4CVWA 5C71A 1C8XA 3OA5A 1BVZA 2VX4A 4UFKA 1W1TA 3VDAA 2WBGA 4D71A 4F79A 2YFOA 4HPGA 5IFTA 2VQUA 5E1QA 1KXHA 2BXYA 1V6WA 4CCCA 3KLKA 2DDXA 5A6MA 4V28A 3A6OA 3KLLA 6A3HA 3MMDA 3VSUA 1SMAA 2CESA 5FCZA 4NSBA 1VIWA 1BTCA 2PBOA 1C8QA 2ZIDA 2ZUMA 1R75A 4PUDA 3WUFA 1HKIA 2D73A 3GH5A 1QW8A 3K1DA 2VCAA 1EDGA 1ZJAA 4GKLA 2D20A 1PX3A 3M7SA 5AY7A 2UY2A 3MI6A 4FLOA 3RM8A 4P7RA 4Z2GA 3W81A 1JZ2A 2IUZA 5F7UA 1KGWA 4R27A 5A6AA 2GJPA 4RE4A 1WDQA 3GXFA 1U2YA 4D6JA 4AYSA 3WY1A 3WEMA 2WVTA 1IV8A 2XFFA 3B9EA 1OGBA 2BV9A 3RDKA 1TMQA 1VAHA 3A23A 4M29A 4PMXA 1FH9A 3GTNA 4CCEA 4OOZA 4Q7NA 4Z2HA 5BXRA 4WLCA 1SYTA 5FKYA 3NJ3A 4EK7A 2WKLA 3AXHA 2JF7A 2F61A 1G1YA 1FA2A 4HTYA 2JIWA 1OINA 1OCQA 1KTBA 3GBDA 1XGZA 5AC4A 1GW1A 1CDGA 3GNRA 3CUJA 3AIQA 1JIBA 3WY2A 3D4YA 3DC0A 2VVNA 3VINA 1QNPA 3BMWA 4UQ9A 3MSGA 2ZICA 4P7QA 3WH8A 1F4AA 4QCEA 4LYPA 4N42A 4OUEA 3NUKA 1Q6DA 1TQUA 2F7PA 1ISWA 1BYCA 1CWYA 4BQ5A 4JKLA 4MNLA 3N12A 1FFQA 1EH9A 4DWSA 1OSEA 5I6SA 1TFVA 2OSXA 3GZAA 3ZOAA 3KL5A 1NH6A 2DIJA 3K4AA 1PX8A 1OD8A 3KEHA 2V38A 1V08A 4LX4A 3EJTA 1CPUA 4LPCA 3CIVA 2RGLA 1J0KA 4JKKA 1UWIA 2NSXA 1VB9A 1B9ZA 2PBGA 3QHOA 1J18A 4FLRA 2ESCA 3ARYA 3WUEA 1V3LA 1BGGA 1HL8A 4CCDA 4JFUA 3PZTA 1QPKA 4HMCA 1E6QM 3WF2A 3VD7A 2VTFA 3OGSA 1VBUA 1QVBA 5IHSA 3UESA 1AQ0A 1UWTA 3VIIA 2W63A 2D23A 1NOFA 1E0WA 3THDA 1PX4A 3SUVA 2OW7A 1D3CA 3HG5A 3VIJA 5DT5A 2JEQA 5E0FA 1JZ4A 1C93A 3TTSA 2YBTA 5CLWA 3PZGA 1LL7A 4NZCA 3NCOA 1UKOA 4HMDA 4YN5A 3W82A 3A47A 1PPIA 2WVVA 2OWCA 2WSPA 3MMWA 4H8HA 2YJQA 4DM1A 3LX9A 2ZXBA 5DF0A 3AS0A 5CPTA 1VEMA 1BAGA 4DUVA 1VF8A 1J10A 3A5VA 1W1YA 3A4WA 1LWJA 1DWGM 1HVXA 2YBUA 3WUBA 2VZTA 4AZBA 2A3BA 4UR9A 4QAWA 2WVUA 1R47A 4CN4A 5FOOA 1JNEA 3AHTA 3AIBA 1UD5A 4MB1A 2WCAA 1HWWA 4GZEA 2J8FA 2WC3A 2WMGA 1BLIA 2BS9A 1UD3A 3ZO9A 1CECA 3EDFA 2WAGA 1H0IA 1ZBCA 1E6XM 4CU7A 5IDIA 1XD0A 1GQKA 3SUWA 3A4AA 3CZNA 1H5VA 4AEEA 3MUY1 2EPMX 3SCPA 4D6CA 5I79A 3WNNA 5CLTA 3WMCA 1CXLA 1E4IA 4GZJA 1CIUA 3DX0A 3ARRA 4D6GA 1V02A 1KBKA 3VX0A 4UZUA 1MWOA 4D6DA 4UQCA 2WHKA 2W61A 3WD4A 3AHXA 5KZ6A 2XN2A 1UWQA 4HA3A 2BHZA 1UWUA 2DPEA 3VPLA 1DWAM 1GNXA 3CBWA 4JFTA 4CD4A 5CPQA 4HMEA 3OBAA 2DIEA 5I5RA 1MW0A 2Y24A 3TTOA 3AS1A 3I3DA 4TTUA 3VIHA 4Z2LA 5D9MA 1NP0A 4AD4A 2XM2A 3NYDA 1OB0A 4MTVA 1XYFA 4MB5A 2J77A 2ZXQA 3QR3A 3T0DA 1E1FA 4AISA 1N82A 1E6NA 3WQ8A 4B16A 4B9ZA 3M07A 4X9YA 2J7EA 2YLAA 1JG9A 2GUYA 1E40A 1B3VA 1H2JA 2FDMA 5M03A 1OT1A 3T2PA 2J7HA 1MXGA 3FAWA 5M17A 2D22A 4AMCA 2F7RA 3BAKA 1QI2A 3BGAA 1J0JA 4M80A 1MQQA 4GPNA 3HJEA 3GXNA 2Z1KA 3BVWA 4WK9A 4AZIA 4M8UA 4TTGA 3BVTA 1X6LA 3TTYA 3RCNA 2XYLA 3O2LA 4MJ2A 1WZKA 2ZX6A 3CO4A 4NXKA 3ARSA 3WQ4A 4DWSD 3IAQA 5TD4A 5FL1A 1KGXA 1B3ZA 3N18A 1ISZA 1TZ7A 3APGA 1JAKA 3CLWA 2W67A 1R7OA 2XFYA 4OOUA 4QDMA 1SFSA 3L4WA 5I24A 2XFRA 4AZGA 3VD4A 1LG1A 2E8ZA 3TONA 4P7OA 2G3IA 5D9NA 4V27A 4NXSA 4CGTA 3M6DA 1EHNA 3I3EA 1HTYA 3ZR5A 3MO4A 4XV0A 2YFNA 4OKDA 1HJVA 3A3HA 4CVUA 1TQTA 1LL4A 1CXKA 5FIPA 1DEDA 2WM0A 4E2OA 1UWSA 4D6EA 2X0YA 2FHCA 2DH3A 4TVDA 2GDUA 2PWGA 3N17A 3BCFA 3BUIA 2Q8XA 5CGMA 4MJ4A 2G41A 2DT3A 4M56A 2ZE0A 4UFJA 4YHGA 5HXMA 5BCAA 4AZ5A 1E3ZA 1JDAA 1CNVA 4RE2A 4U5KA 3WNOA 3MU7A 1L8NA 2AAAA 3I3BA 4TX6A 1TVNA 2VOTA 3BVXA 2GVYA 2CCRA 1GJUA 3UCQA 5BROA 3WFZA 2F18A 2AOSA 4W7VA 1LQ0A 5A8MA 2YDSA 4NI3A 3WL1A 1BGAA 3VUPA 4F8XA 3FXYA 3AMLA 3LRKA 3MV01 4GO8A 3VNYA 1JF6A 5EMYA 3VSVA 5BYWA 1W9DM 3EDKA 1W9BM 2XHYA 3HG4A 2XIIA 1UR0A 3S5ZA 1BG9A 3WQVA 1KXQA 2YKKA 1HJUA 1J01A 2VX6A 1JXKA 1W3LA 3AYSA 8A3HA 3THCA 1VFOA 1E4LA 2J7BA 5CJ5A 1JDDA 3ZSSA 4AMXA 5LA0A 2JE8A 2ZX7A 1MVYA 3D51A 1UHVA 2JALA 1UWRA 1V02E 4FNSA 2GK1A 1BQCA 1M01A 4H41A 1J0IA 4UNIA 3WY4A 5A1AA 1EHAA 1NOWA 1C8YA 1ZBVA 3RO8A 3S2CA 1GOKA 1R85A 1YQ2A 3SCRA 5I78A 2WPGA 2VVSA 3W29A 2EXOA 1JI1A 3WSUA 2E0PA 4UFHA 1GONA 2UY4A 3WD0A 2XGBA 5JBEA 2XIBA 1E5NA 1UZ4A 2J62A 5A6BA 2PWHA 4W93A 2FH6A 5GNZA 3F5KA 1WAWA 3HZ3A 3PZOA 1E70M 2WANA 3IJ9A 1GORA 5EBAA 1ITCA 5A8NA 2ZUTA 3T0BA 5E9AA 1UKTA 1B1YA 5GNYA 3TP4A 4M82A 4PRWA 3ZSTA 1UASA 3CHDA 4KRTA 2Y5EA 1F4HA 3ZM8A 3OLDA 2O9PA 5A95A 2E8YA 3MV11 3L4UA 1JF5A 3CHFA 3FY1A 3B8SA 4JL2A 3AHZA 4J3SA 1C7SA 4PCSA 1B3YA 1W3KA 1KQZA 3U7BA 3W0KA 3VIMA 4AD1A 2EJ1A 5IXEA 4HU8A 2XVGA 4E4PA 2DT1A 1MQRA 1HX0A 3WNPA 1V0LA 2F1BA 5M5DA 2PWDA 3VM7A 2ZXDA 1PZ3A 1JNDA 4HZ6A 4AD5A 1JL8A 3SCWA 2JFEX 3D3AA 3MS8A 4DM2A 4MNJA 4BQ4A 1VFFA 4S3KA 3JUGA 1GJWA 3AROA 1XH2A 3NSXA 2VR5A 2Y4SA 1G9HA 1MFUA 3POCA 4DO5A 3DYMA 1CGVA 1R34A 1OM0A 3OLGA 4TX8A 3ARUA 3FW6A 1JZ3A 1ESWA 1HVQA 5IFPA 4XB3A 5D9OA 3VM5A 5I3DA 2VZSA 3T08A 2XVKA 1TUXA 1R87A 4U2ZA 4W8BA 3WDRA 3WKZA 3MANA 5E0CA 2FYVA 4JHZA 3MSDA 1L0PA 1GVIA 1T0OA 2X1IA 2MANA 4LGXA 2NW0A 1CGXA 3OZOA 3BUDA 2D0HA 5DO8A 2J47A 3O9NA 3MUZ1 1ZS2A 5E70A 4PN2A 3BLPX 4LYRA 1UKQA 2W66A 4H8UA 4X0VA 2D2OA 1V3KA 4ACZB 2WC7A 2E9LA 1EIBA 1NQ6A 2BNJA 3WQ5A 3D5HA 1H09A 3B9DA 2WMHA 3AZSA 1AQHA 2ZWYA 4PTXA 3N11A 1UH4A 3CTTA 3CUIA 1P6WA 3ZT5A 3AIVA 3VGFA 4LYQA 1XHGA 1DHKA 2CYGA 3VDCA 1QBBA 2EPLX 1HP5A 5D9PA 4U2YA 1NP2A 5I23A 3BUPA 3VTRA 1QBAA 1VFMA 3W28A 3IGUA 1CENA 3DECA 4QCFA 1DTUA 2GSJA 2J7DA 3VMNA 1XCXA 3ZMRA 4NF7A 3BLBA 2F7OA 5DFAA 1TE1A 4IPLA 4HA1A 3J7HA 4D6IA 3HG2A 3IJ8A 3VGGA 2VRJA 1PJ9A 3CZKA 3EDEA 1NARA 1UOKA 3EYPA 3SCQA 3ARTA 1ISXA 3SCVA 1FOBA 1HXKA 2AMGA 1ZBWA 5GPRA 4DO4A 1JZ6A 3VGBA 4WF7A 3WELA 2XN1A 1UZ1A 2XWDA 4MPKA 5CG0A 1TA3B 1BYAA 3K8KA 1CYGA 4J3UA 1QI4A 5I0DA 3WL0A 2WBKA 1J9YA 1HF6A 1V3JA 4PMRA 4FLSA 1C91A 1NWSA 2YL8A 1RP9A 1HT6A 1TQSA 2OSWA 2VZVA 4FK9A 3K8LA 6CGTA 3WY3A 2IXUA 2YL5A 4CD5A 1VEPA 1C7TA 2VL4A 3RMEA 1EA9C 2A3HA 2ZX8A 3KZSA 3O6AA 5FL0A 4LQ1A 3RILA 3QOKA 1E0VA 4WKHA 1WZMA 1JYVA 3BMVA 1ECEA 3EJPA 2ZUNA 3WENA 1AVAA 1XRVA 4RL3A 2VRQA 2EQDA 3AOFA 1MFVA 2YOCA 3EJSA 1JZ5A 3W25A 2E3ZA 3BCDA 2WCGA 1MW3A 2VC9A 4P7LA 4GI8A 5A94A 4MADA 4F9JA 4FNRA 2OWWA 1XH1A 1KB3A 3L4YA 3VKKA 1R7AA 4KRUA 2VCBA 1EDQA 3CGTA 3CZSA 1W1PA 2O92A 3CH9A 4AWEA 1J12A 3WH9A 1EDTA 3AFBA 3K46A 3K4DA 3ZJ8A 3POHA 1OIMA 1V6UA 3BC9A 4W5ZA 4W85A 1HKMA 4AD0A 1QI3A 2BVDA 1BG4A 2VURA 1V3MA 1VEOA 3PZIA 1H3GA 3PHAA 3PTMA 1US3A 3AYRA 1UQZA 3H54A 3VIOA 4W87A 1GPFA 3BXWA 2W92A 3W26A 5BXPA 2NT0A 3WBAA 2ZOXA 3WH7A 3WMBA 1WPCA 1MYRA 2VO5A 5BRPA 4D6HA 1I1WA 3QHNA 2CITA 2OYLA 2ZX5A 4LXFA 1ODZA 1Q4NX 3AXIA 1I75A 1V3HA 2X09A 2WK2A 2XSBA 3N1AA 3BSGA 1V0MA 1H41A 3GNOA 3NDYA 2EPOA 3WH5A 4HP5A 1E6PA 1UKSA 2ZXAA 4Z2KA 3PBGA 4GQRA 1BHGA 3N04A 2DGAA 2GJRA 4PTMA 3DYOA 1WDPA 2CERA 5JIWA 5JUVA 7CGTA 1A3HA 2V3DA 4FMVA 4GI9A 3WF3A 3SCNA 2V3EA 5D4YA 3W4RA 2CBVA 4B15A 1TR1A 3L2LA 2QLYA 1QW9A 1W9UA 1JFHA 3W6MA 3AXXA 1QOXA 3CUGA 2WMJA 5A8OA 2DH2A 4YHEA 2G3NA 1HXJA 5HBFA 1O7DC 2FE0A 3OLEA 3CZJA 1XCWA 3QHMA 4EANA 4MNKA 1PS3A 1FFRA 4IM4A 2WYSA 3WD3A 3BVUA 1Z32X 4NRRA 2QF8A 4PTVA 3GNPA 2BVYA 3W27A 3EMCA 1V3IA 2EPNA 4PMZA 3WDPP 4JKMA 5GNXA 2JEPA 3WIJA 3LMYA 2W62A 1GVYA 1Q6EA 3AMDA 5CQ1A 3VDBA 1VRXA 1FH7A 2DT2A 1E56A 5CSUA 1U30A 4OJYA 4GINA 3LPGA 1IT0A 2BHUA 3W24A 3OGRA 4AY1A 1EQCA 5CSYA 2DSKA 2GJXB 2J79A 3CMJA 5A3HA 3VOCA 1EOKA 4OIFA 1X6NA 1M03A 4KH2A 4AC1X 3ARVA 5FD0A 4H2CA 3WDQA 1E0XA 3UERA 4TUFA 1Q6GA 5D8WA 1PZ2A 5A8QA 1O7AA 1UH2A 1B31A 1FP9A 1HJXA 2VZOA 1J11A 4NZJA 2DSZA 1WB0A 4ZE4A 2D24A 3CHCA 3D50A 4OZOA 1QNSA 1U33A 1NWTA 4CKQA 2Y8VA 4A4AA 4GQQA 4W88A 4J3WA 1C3FA 4WIWA 2PI6A 2X8RA 1BYDA 4MB3A 2CIPA 1GQLA 4ACZA 4PTWA 4YPJA 5A2BA 3IK2A 6TAAA 1WKYA 1PIGA 3RM9A 1GHSA 1E55A 1JD7A 4PBGA 4HOXA 3VX1A 2WWCA 3TTQA 4F66A 2ZUSA 3AMKA 2QPUA 1XV8A 2WCSA 4ATDA 1XH0A 1MQPA 4TXEA 2X05A 2X0HA 4PMNA 2EAEA 1JXJA 2YLLA 4UQEA 5DMYA 1W2PA 1OT2A 1KXTA 4UFMA 1JAEA 4FNUA 1PIFA 2WHMA 4PSPA 4GXPA 4CN6A 1KFWA 1KR1A 5I2UA 4XUYA 4CD8A 4Q22A 5AYIA 4HPHA 3SURA 4V2XA 4AYGA 2CNCA 1JD9A 4DUXA 3CC1A 1B3WA 2ZUVA 3DX1A 4W89A 2PC8A 3GXIA 3SUTA 1Q6CA 1C90A 3LXBA 1ISYA 1E15A 3S6TA 2O9RA 3N15A 2E4TA 3CZLA 1G5AA 4JHOA 3CZ8A 5JBDA 5A6LA 1B3XA 1QHPA 4AZCA 2XJ7A 4URIA 2WMFA 4AD2A 4L4PA 5E09A 3EJRA 2OLHA 4PUEA 2QMKA 3AZRA 4BS0A 4WJXA 1FH8A 1JZ7A 4ACYA 4Z2JA 1W32A 3GXMA 2C0HA 5IHRA 2IGTA 2IXVA 1HKKA 3D52A 2G4FA 3CUFA 2J25A 7TAAA 4MDPA 2HISA 2X2YA 2WVVB 3ARQA 1HN1A 3VGEA 4DWSB 4XZWA 4ZEPA 1IZJA 1TCMA 4P8WA 1WDRA 4WSKA 4ZE5A 3OB8A 1GOMA 1OGGA 1CGYA 4IUGA 3EJUA 3WF4A 1E73M 3VNZA 4GIAA 1M04A 2XN0A 4FLQA 1HNYA 1WZAA 1BVNP 2ALWA 4UQDA 1QHZA 1W9XA 1QNQA 1AMYA 1GCYA 4JL1A 4J3TA 5C8BB 3VD9A 1XSJA 2VT0A 2WZEA 1H1NA 3WBEA 4B3LA 3QOMA 4BCEA 3UEQA 1CBGA 3EDDA 4CD6A 2BVTA 5CPSA 1E4MM 3N9KA 4NX0A 3D4ZA 2Y2WA 3L4ZA 2WXDM 3LXAA 1KTCA 3EBVA 2V3GA 3VIGA 4EAMA 1AQMA 1UD4A 1EQPA 3BUQA 3CUHA 1JGIA 2PWFA 1D7FA 3AIRA 2VNCA 1NOUA 4KMQA 3DDFA 3UG3A 4U3AA 1B2YA 4J27A 3DX4A 3AMGA 3DYPA 3FNDA 4W8LA 2QPSA 2CHOA 5EFDA 3VGDA 1KWKA 2WLZA 3A21A 1JZ8A 3F5LA 3PTQA 4R5EA 3A4XA 3WD2A 2VJXA 1E6SM 3LXCA 4DWSC 3HG3A 4N0RA 1LF1A 4JCMA 3BAWA 3PZMA 2FGLA 1MW2A 1UKPA 2F1AA 1MXDA 4WKFA 3BLKA 1GQIA 3VMOA 1RP8A 2BHYA 2DSVA 1V03A 1CXEA 2G3MA 2QMJA 2CBUA 3GXPA 4UQAA 5AYBA 3SCUA 2A3AA 3H55A 1CZ1A 4DUWA 1K9DA 3ZT7A 1W1VA 3WDIA 4AZ6A 3OGVA 3U7VA 1EGZA 1CTNA 1HJWA 1W3HA 5D8ZA 3CHEA 3BUBA 2V5DA 2FHFA 3TA9A 2B31A 3CPUA 1OGSA 3AMCA 4JFWA 2UWFA 4D72A 2VRKA 2ZX9A 4W86A 3BAYA 5EB8A 2EADA 2X2HA 2CEQA 3VIKA 1VFUA 2J75A 4FNTA 1K9EA 4CN1A 4U33A 5DEZA 5BRQA 1E5JA 5CXPA 3CZGA 3OZPA 5LYRA 5CGTA 4UFLA 1J0ZA 2J7CA 4JAWA 5I77A 1UR2A 4H04A 2XSAA 1BSIA 1OBAA 4NRSA 3WF1A 4OGZA 1FP8A 2WLYA 4GO9A 4A3YA 1XSIA 4UOZA 1ITXA 3WF0A 3AS3A 3B9AA 1E71M 1KGUA 3PZ9A 3WUGA 2UY3A 2G3JA 3ALFA 4MDOA 1W91A 3AIWA 1E1EA 4UQBA 1ODUA 1NWRA 3VSTA 1M53A 3WFLA 3AIUA 3G6MA 3WNMA 3AHYA 3WDJA 5ABFB 2J7FA 3UR7A 1VJSA 2BY2A 3DHUA 4K68A 3RJYA 4U31A 1EO5A 4W5UA 2WSKA 1HJQA 4PMVA 1BF2A 4JCLA 4AMWA 4D6FA 1J0YA 3UETA 3PTKA 2XVPA 5LA2A 3OG2A 1TA3A 2OWXA 3UG4A 1B30A 1H49A 5LA1A 4FNQA 1EOMA 2XPKA 4AIOA 2DSWA 4W8AA 4TVUA 2WVSA 3BAJA 2ZUWA 2WB5A 3WDHA 1M7XA 3RPMA 1TVPA 3N13A 3WD1A 1X1NA 1C92A 3EMQA 3WMSA 2V3FA 2WW5A 1LL6A 2BY3A 2DQXA 3ARWA 2OSYA 2CETA 5A69A 2CHNA 1JYWA 3FAXA 1E4NA 1DWJM 1WE5A 1D2KA 4CUCA 3L4TA 4PMUA 1QWUA 2W5FA 4AEFA 4AIEA 1ZU8A 4U5IA 2GJXA 3KWXA 3ZQ9A 2XVNA 3VDHA 2UY5A 3AHVA 1BPLB 1VENA 5JIPA 1TQWA 2A3EA 5C70A 1UG6A 3WNKA 2VQTA 1E72M 1W9VA 5A6JA 3U5YA 3GYCA 1OIFA 2G8ZA 3RJXA 3UR8A 3MUIA 5EFFA 4C7FA 1K9FA 4KGLA 3OIHA 1V6VA 1B0IA 2WWDA 5ECUA 3T09A 5ABFA 1R86A 4QLJA 3W37A 3GH7A 3IANA 1E9LA 2VMFA 3SCTA 1SMDA 4PMYA 1QI5A 1YHTA 2PWEA 4M24A 4ZXOA 2GK1B 3SCSA 4HOWA 1GOOA 7A3HA 2VI0A 1TQVA 1E3XA 3SUUA 3U57A 4J7RA 4IISA 2D0GA 3GXTA 4AXNA 1TG7A 2E9BA 1OWQA 2D1ZA 1KCKA 4KWUA 3PN8A 1KCLA 5BXSA 3AS2A 4UFIA 4BA0A 3W38A 1W3JA 1Q6FA 4JZ5A 4A3HA 1S46A 5A2AA 3LPOA 2D3LA 3DX2A 1HJSA 4H7VA 1HKJA 2CBJA 3EMZA 4P7NA 2WNWA 1EXPA 5ABGA 4H8VA 3VD5A 3QGVA 4ATWA 4C7GA 2J7GA 3RM4A 2XGIA 4TOQA 1GOIA 2WC4A 5BXTA 2WMIA 2J8GA 3MUAA 1IZKA 5E6YA 2VX5A 2F2HA 3VILA 2F8QA 4UTFA 4J3VA 4QP0A 4NZFA 1WP6A 2WHLA 3SEPA 4RE3A 5ABEA 1ZBKA 3MMUA 3K8MA 3II1A 4WSJA 3FN9A 2VCCA 4Y7EA 1UR1A 3SUSA 1XSKA 3GDBA 2BY1A 1KWGA 1MW1A 3PZQA 4EE9A 2YA0A 2W91A 4ML4A 3VU2A 1CGUA 2YA1A 3LRMA 2E40A 3GBEA 1B90A 3A22A 2JIEA 3KL0A 1E6ZA 4B9YA 3NSMA 1LJYA 3M46A 1JYXA 2YA2A 1CEOA 4HZ8A 3LRLA 2FGZA 2XG9A 4BQ2A 2J74A 2A3CA 4AZCB 1CXFA 2J4GA 4OBSA 3WH6A 1R8LA 1KR0A 1K9TA 2PF0A 1K6AA 4J28A 1QNOA 4C7DA 3DX3A 4HU0A 5ABHA 3RIKA 5KEZA 1KBBA 1QI0A 1UUQA 2EACA 1LWHA 2W4XA 5A2CA 1G01A 4E8CA 4BQ3A 3GM8A 2BXZA 5A6SA 1V0NA 1V6YA 3L2MA 4XX6A 4UOJA 2YL6A 2WMIB 2ZWZA 4PCTA 1NM9A
chains in the Genus database with same CATH superfamily
3WYRA 3FRUB 1I1XA 1FAIH 5GRJH 5FUZH 2WWMD 5FWRA 4Z7VA 4QFUA 1UYQA 4M7LT 4J2MA 4PTTB 4N5ED 4AAJA 2VAAB 1I8LC 4Y4HB 4R9HA 1OVDA 4Q4QA 1Z2KA 4HAGA 3ZIYA 4NJ9L 1ZT4A 3S97C 4JG0H 1BTMA 1AS8A 1SR0A 1BA9A 2NUWA 3DGCR 2C3GA 3RB5A 2YDQA 1E4KA 4Z1PA 3FHAA 2A4AA 1KPVA 3FU9A 1N5YL 4PI2A 5AZEH 4U05A 1QJWA 4G6JL 3LUTA 3RJQB 4KDVA 4LSTL 1BQHG 1S7UA 4QHMB 3CE1A 1QVOA 2GUUA 3PXJA 4I0KA 2NXYC 4BE6A 3P4OB 1E2WA 5KYUB 1M41A 4S3JA 4HZ1A 1A0EA 3NVDA 2EDOA 4PMQA 4Q8NA 4YOKA 2VZUA 1F00I 5TQ0H 1MRQA 3UO8B 1TUFA 4N8VB 2MQ0A 1U92B 4PBFA 2QT3A 2B20A 3QXTA 2BOFX 2OTUA 3OPZH 4QXTB 5HGDA 4KRZA 3RWDA 1XD1A 5DRWB 1TLMA 4QROA 3CH1B 1IC7H 3VW3L 2FVMA 4PWEA 3UP1A 1HOCA 3WEZA 1H9VA 1CFNA 1PEZA 2CLLA 2WZMA 2HRGA 3HPXA 5FB8A 2DT0A 2UZYB 3FYIB 4BF7A 2PUQT 1DBTA 3MW7A 3KG5A 2IPUK 3W01A 1B4EA 1GYAA 3L66A 4N2FA 1Q94B 1RD5A 3WFAA 1BKHA 2HNEA 2VX7A 5F96H 4J5NA 4PJCE 3AWNA 2PCFA 4BK9A 1YMMB 5DJYA 3FQNA 4UQ3A 4YSDA 5LCVL 3BWWA 1XGUA 5CPMA 4JTRA 4MB4A 4PVBA 4YHKH 1QPXA 2C3VA 5D7JD 4Y9OA 3D0VA 2Z31B 2B7NA 2KDYA 1ZHNA 5AAMC 5DT7A 4RMTA 1GYUA 1I2RA 3FU5A 2EF9A 3G0SA 1MKFA 3ZJKA 1UR9A 3PG2A 3VFTA 4JHVA 4LS2A 5C0BA 1HIZA 1O1HA 5FF4A 4XN5A 5EU3B 1UQYA 4BK5A 4H1LH 3OAYK 4NUMA 3GJFB 1UC4A 4NZTL 4NUGH 1L2UA 5LBSL 4F7MB 3DV6A 2GEQA 4H25A 3RVUC 3G1HA 1BAWA 3NSCA 1A5MC 3BXNB 2PYFA 1FCBA 2PP1A 2CH8A 2OT1A 4WY0F 4QS5A 2IQTA 2O30A 4J4PC 4GY7A 2DJ4A 2H32A 3IMUA 5AOZA 2DJUA 3PQYD 4LKCB 4ZO7A 5E5MB 3PS7A 4UTJA 4Q9CA 4M6OH 3VQ1C 3KS6A 4Y16A 3KPQA 3W0WB 3QEQD 4GG6A 2BVQA 3JUZA 3MJ7A 2YPIA 3UWZA 5IHRA 2DICA 1VJZA 4X7SH 1ODAA 3WLMA 4K37A 4BF9A 4Q74A 4HZ7A 3P4LA 1CGTA 4X7TB 5CZKA 2C8NA 1P48A 1XI3A 1RZKC 3FYOA 2YPLB 2VUYA 1N19A 3IMTA 5I9QC 2WMKA 4LVGA 3EF7A 3P4OA 2VFGA 5FKAA 4DEFA 3NTYA 2BRRL 3HBGA 1QTSA 1UADC 4Z7UB 3C2SA 3WKPA 2W79A 1N64L 4BI7A 4O58L 2B2XL 3KJ4B 1LMIA 1R33A 4P57A 5D7LD 3KX6A 2CUAA 1SLUA 2O7QA 1EC9A 2HQAA 4NJJA 3U5UA 2PCQA 4Z7IA 3AJ7A 1G0DA 1H61A 3TJHC 4L9ZA 3ZKSD 4NNXA 1T7XA 3L1FA 1MH5A 2VCOA 1Q72L 3IJSB 3RAJL 5J6HA 2BZDA 1OD0A 3VG9B 4JB9L 2AGTA 3TOYA 4BYHA 3O2DH 1NEZB 2V4LA 2WKGA 3QCVL 4H26A 4UTAA 5AW4B 1A0CA 3RPDA 1G0CA 4LHUB 1WTLA 3L1GA 3F6JA 4QHUA 2C1HA 4AF0A 5ACLA 4HYRA 2YWZA 3USBA 4W84A 1B54A 4S10A 2DAVA 4GQZA 1RFDL 4YXGA 1LNUB 2J88H 3PK7A 3VXRA 2AANA 1S5HA 2AQ3A 3RUGB 3MJWA 4JTCA 3SKJL 2QQKL 5I1LA 2Q9OA 2OW6A 3TJEL 4CU6A 2BS71 3LY6A 4UNVA 3TBVA 3GMOB 4YR6A 1WZ1L 5CEXA 1DFBL 2YC1A 4EIBA 5IW1A 1ZKAA 2YD2A 4PJBA 1FVDB 1WVZA 5TGBA 5A2IH 1BXNA 4WEUD 4NWUL 4ONOA 1DO6A 2MNRA 3OXRB 4WW1B 4CVXA 1MCCA 3SY0A 2YCLB 2XWEA 1WZLA 2C16A 1GGTA 4M5PA 5EO0A 3TEXA 3ML8A 5E7BA 1AR1B 3L4XA 2DLHA 3W53A 3O8XD 2PEVA 4H8WL 4YTTA 4F7MA 2XN9A 4WFFE 3RUGE 3QJAA 2V5CA 1G94A 2JWYA 3MKVA 1PY0A 2CNYA 1M05B 1OD7A 4XBPA 2G2RA 3QUZC 4A2MA 4X60A 4K5LA 2OJEA 3LV6A 4LU5L 1VPXA 3G6AB 2I5QA 5IW3A 4M02A 4JTDA 1T5XB 4ZMYA 6FABL 3ABRA 4F5CA 3QPEA 2O61B 2XM1A 1BYBA 2HG5A 3CFJA 1MAMH 1IEHA 4DVBA 1S7RA 3HNSH 4MVAA 4NDMA 5BNKA 3O3BB 3O45A 1ZLPA 2CLKA 4XTDA 3QPZA 4E8DA 4XPHL 3QIUD 3UJJL 3PZUA 3HJZA 3DETD 1KIQA 5FKAB 5CBAB 2G96A 4O50A 2PDJA 3AC0A 5C0AB 3UX9B 5LXXA 5DGRA 1QSFE 3GSNB 3QWRA 4Z7QE 1KCRL 4PRRA 2PPCA 5DLML 5I0XA 1A5BA 4R4FH 1MCPH 5JXED 2HFFA 3C8HA 1A4KB 1ZLUH 1ADWA 3CZFB 4W7WA 2V7NB 1JHKH 4BEUA 1U95A 4NFBA 3PBUA 3R12A 3HFFA 1XRSA 3UAAA 2WJ7A 4YIQB 1OABA 1QK2A 2D3NA 3WFDL 3BCJA 5EU5A 3U9UA 2QLVB 3PAVA 2NY3C 4URTB 4X50A 5ES4B 2NUXA 4N68A 3O05A 2R14A 4LAOA 3W6YA 2YXFA 3E8UH 1OAUH 2E7MA 3N3MA 1OK8A 3I2CL 2BVOB 2V2DA 2EC9T 3WK3A 2C79A 4F40A 4MFHA 4Y0GA 4OZHF 4F8QA 1XMWA 1HH9B 4IOIA 2PB1A 4NUWA 4ZUUA 2ZXGA 2ABBA 1OX4B 3LHWA 1Q8MA 4IPNB 3EO0A 4KXCA 3SKNB 5CN3A 2W8CA 3MRKA 4GW4B 3EFOA 3E6FA 4UTIA 4HUUA 5AHEA 4KI5C 1T3FB 4A67A 1AXTL 4FA6A 1A3QA 5B3JF 2ZZ6A 1JWSB 4RAVB 5HDRA 2G5BA 2P24A 5EO0B 3DSNA 1BX2B 4XWUA 1A4BA 2A77H 3EDJA 2WJZA 3F03K 4GAJH 3WEAA 3LHAA 1AL8A 4EWJA 3DDGA 1SHSA 4X8CA 5D1XE 5TJWK 3PFQA 3VD3A 1H3UA 4IBSA 2XRAH 5IMKB 1FTXA 1A47A 2KS0A 4FFWC 3UTTA 1BFVL 4I0PD 4B92A 5HJYA 1HSAA 1TJHH 3AIEA 5HHOD 3QVAA 2HT2D 4LCVA 3ARXA 1CLYL 3KPSB 1EHLL 3C6LD 2WLIA 3B4UA 3C61A 2AABL 2BVPB 2FH8A 1KJVA 3WCYA 3F7LA 3H9SA 4P2RA 2FHBA 4EIVA 2V5TA 1CFQA 2OXGA 2BIOA 3S88L 3WLPA 5JDJA 5DHDA 3E7JA 3MRMA 2VC2B 3VZXA 4C6JA 4G6KH 1FWBC 1M6UA 2P5EB 1E4XL 4WK4B 1O1ZA 4TVPE 4LCCC 2MCG1 3WIHA 2WQDA 3E2VA 4RMRA 2H90A 4P59L 3Q13A 5IESL 1NC4D 3B8YA 3WHXA 5I5IA 2R91A 3BTNA 3UWUA 4EKJA 3PTDA 3J27A 4N86A 4X8GA 5I28A 2NY4D 2YIHA 4QOKE 3X14B 4L4OA 1L0XA 1EX5A 4P4KA 2WBJA 1JWMB 2NY1D 1OK4A 3RGTA 1CK0H 1QRKA 2XX1A 3VOIA 4GNVA 1Q4WA 3CPRA 2F58L 1QWNA 4XP6H 2VLJA 1A4KA 5CP3H 1MCFA 4PWHA 5CMAB 4AQAB 5BZDA 1E6RA 1FRBA 5AYXA 1RJCA 1U95B 3T2QA 3T2OA 1LLWA 4PYSA 1I9IL 3MACL 1AH3A 4NM4H 1TU2A 3D18B 2EGZA 3LQMA 3DJRA 4AJ0A 5CCKH 2J9XA 2ETWA 4LH8A 3G1YA 3QZEA 1GC1H 3CT7A 3VDAA 4IU3B 2WBGA 5AVNA 4D71A 1AYOA 2YFOA 3GMRA 1LL1A 1PZBA 1PG7L 1I53A 3CFDA 3FOLB 3MTRA 3FBKA 4Y88A 1DLFH 5IFTA 3PQYE 1ZD6A 1OZTG 2Z6IA 5HYQA 5IFJB 3HPAA 1IFRA 5CD3A 2FJKA 1M6JA 3W7QA 3DGGA 3DOSB 3WKML 1JK8A 1MCWM 4XNQB 2Y06L 1R3HA 1YPFA 1NGZB 3GWJA 3NZUA 4AXNA 1T0NB 3KLKA 5L8KB 3SECA 5KSVB 2XH4A 2JCCA 2BGQA 5F1UA 4MLRA 4GKZA 1AW1A 3VFSA 1W8OA 4I3RH 5JOFA 2EKGA 4OFDA 3VIPA 1GZPA 3N73A 4BCZA 1I8AA 4IICA 6XIMA 1QKZL 2VSCA 1GA2A 3UMTA 3WN5B 2HS6A 1I8KB 3MA7B 5KSUB 3OQ8A 3WFHB 1I8UA 4QXGH 3MRJB 5EU4B 5F6IC 2CESA 1DVFB 1TENA 1LP9B 2OTWB 4PJ7A 3SO5A 1AH0A 4M4RB 2V2HA 4OLVL 4NSBA 2CGRL 3FT2A 3KYOA 3DTDA 3O0LA 1RVKA 1Q2SA 5LHFA 5L2KA 3DOPA 1YEEL 2ZUMA 1X7QA 2OS7A 3HNVL 1QSEE 2TYSA 1YECH 2LHAA 2VC6A 1K4CA 7FABH 4HW6A 1Y5XA 4QRUB 1HKIA 4P23B 3WK0A 1MUJB 2VDPL 2NY6B 1WXYA 1QW8A 1FWCC 2EDMA 3EXLA 4Q8WA 3SQSA 5ABAA 4MA7H 2CZ5A 3ZKMD 1E4XH 4GKLA 3GQYA 4ECNA 1QBLH 2XWRA 4IBTA 5FO9A 2FJUB 3VTAA 2IWGA 1AMKA 2UY2A 4YWGH 1W72L 1YDPB 2JBMA 5H94A 1A7PL 4R3SB 2DT3A 5IM7B 3QG7H 4F0LA 4P61A 4P7RA 1H3PH 1T83C 4Z2GA 3MXVH 3S3CB 1A22B 3CHXA 3U6XA 3GY1A 3Q6GL 3FXGA 2FPTA 2PD5A 3KTSA 5I5JA 5LAXA 3BEVB 1HEZA 4FXKA 1AHMA 3LEYL 1U4EA 2FWUA 3KPOB 4R27A 3RX2A 1AGDA 1WFJA 4UC5A 2KYIA 1OPGH 2X6UA 3GLAA 4IKJA 1WDQA 2ACUA 1NMBL 4PGZA 3KLHD 3EXRA 1VLWA 1T89C 1W5QA 1OFEA 2BMBA 3KTCA 4AYSA 2IANB 1J5DA 4IRJD 4ZB5A 3LS9A 1T5WA 4XNZC 5C0NC 2BP8A 1QASA 4JM2D 1IV8A 2GAZB 1WCBB 2XCMC 5FM5O 4Q89A 4H19A 1NAKH 4Q6KA 5FV2A 3ABGA 4AFYA 2DQTL 1W1ZA 4N0CD 1BFOB 4GRLC 2UX6A 1DBKH 1DSFH 3S37L 3CU1A 1TV5A 1WV7T 2HE8A 4H9MA 5CD3B 3T2NH 4KUZH 3LSOA 3C5XA 4XOEA 4G70B 1YKWA 4A05A 5F44A 4K5MA 3PJWA 2G5WA 1OP5H 4FQJL 1V7MH 1LEKA 2R69A 4AQEA 2BP0B 4ZSOE 3ZTEA 1DVJA 4HF5L 2ZC1A 4I9AA 4QJ1A 4BKNA 2DMKA 5AALA 3KCPB 5FKYA 4IM8A 2VKXA 4AQOA 2A2IA 3LOWA 5AVRB 3AXHA 4NAEB 4D0BB 5T1LD 3ULUH 2F61A 4C4UA 1G1YA 3WTWA 3LOTA 2Y7DA 1CFSA 3HNTH 1P4CA 3FKKA 3R4DA 1TMHA 2PU1A 3AM8C 3AXLA 2WINB 3X11A 5JIMA 4PREA 4N2BA 4XP4L 1RUSA 3REQB 4P4RA 4OFVA 4GSDL 2HFEB 1IAIM 2IBBA 3CS2A 4MWAE 4LLWB 3TO2A 4PG2C 3S6CA 4PJIA 1OB1A 4X99B 1IBDA 2DWDB 5F1IB 3RFAA 1IILE 4X6BB 4UQ9A 5L0QC 4PV9B 1SW3A 5K5YA 4HUNB 1LCOA 3HGJA 1GPOH 3QIBD 3QDJB 5I6XB 1FZMA 1OGAA 4QCEA 1BQGA 1B6DA 1KBPA 1KLFA 1LO4L 2EXYC 1S9XB 3LQAL 4LYPA 1DVFC 1KLUA 1E9IA 2VKZG 1TQUA 1VERA 2F7PA 1BYCA 1FZKA 1CWYA 1XICA 4YQXH 4LSPL 4BQ5A 2GGGA 1TJXA 1FFQA 4MMYB 3TBYB 3N12A 3SCMA 4EVNB 1A7QH 2FZ3A 2ZAIA 3ARFC 3G08B 5E5RB 5J9PA 4OZIF 1VYSX 2DLEA 4HCRH 4M9OA 2E6YA 1QTYT 1TEYA 2E56A 1FL6A 3H7LA 4L2LA 7TIMA 2NWRA 2OL3L 4MQTB 3MMEA 1HYRC 2EAWA 1CF8H 3K4AA 2Z1WA 4GYPA 2Q10A 4MZYA 2WQRA 4XMXA 3O63A 1AFVL 3ESVF 3L6FA 4HH8A 1ONWA 4ZQKA 3CASA 4PBDA 4GIOA 1FYTB 5JPNA 2IAMC 5IEKA 1P7QB 4LX4A 1ZVSB 2FO4A 4M5YL 4CBZA 1AZRA 1MIMH 5FW6A 3CN4A 4WI2A 1AS6A 1POKA 1NL0H 1JPFB 4S1DD 3B43A 4ZNEA 1I9RL 4OD2A 2E27L 1E4WL 3MACH 3TQ0A 4NSKA 5IVOA 4QRPE 2W81C 4J6IA 3ZMEA 3ID7A 4CQ9A 4WUUA 1BGGA 4HXAH 5IVZA 5G4MA 5AVTB 1ECQA 3M0ZA 2BP0A 1I9RH 3G22A 3GR4A 3U9WA 3VVWA 1AACA 4HIJB 4HMCA 3C2AH 5U4NA 5BWAA 5I1HH 3QO0A 5KSWA 3O6CA 3DFPA 5JO5A 1WIPA 3OGSA 5L7XH 1VBUA 1QVBA 5IUSA 3CSPA 3W00A 1HQ4B 2G9HB 4UANA 3ESPA 3CSYA 2RALA 1S7VB 3UR5A 1VESA 5GJSH 3OQEA 3GDKA 3QQ3A 1GVRA 4LCCB 5CU9A 1WAEA 5BS0D 3NQ2A 5K2ZA 3R0NA 3ZL2A 1P1ZB 4WO4A 5HYEA 3UXIA 2X4TA 1K77A 3V6ZA 2G60H 1J1XL 1EJFA 4A2GA 1ORSB 2BOCA 5DJ8A 2NX9A 1YADA 4IPPA 3BLIA 1R5YA 2C3VB 2E76C 3QZWB 2JKSA 3TV3H 1DHPA 3LHTA 4RFOL 4Z9KB 2ITCA 4P2QA 4OVVA 3SY6A 1EGJL 1YN7B 1O5QA 1ZPUA 3ZK0A 5ID0A 3G8RA 5BRZA 2LT9A 1EFXB 1I8LA 3LV3A 1S2UA 5CLWA 3QDJA 1FWTA 3U36A 3LQAH 1LL7A 4JLRB 7ODCA 2W65B 3NJIA 4NZCA 4JOMA 5J6SA 3RVVD 3TN0A 1KLUB 3ARDA 1WJ3A 4Y4FD 4W9HC 3FTUA 3EPMA 3TYUA 3D85D 4Y19E 3DSFL 5AW9B 5KBKA 3W2NA 1X1ZA 2WVVA 1EUAA 2OWCA 1INDL 3L3DB 4NC1C 4ODUB 2HPTA 3KOZA 1HYSD 3STCA 4YAQA 2F7IA 3P0VH 3DO7A 1XF5A 1P69B 4XN7A 5SWSD 4YXHL 2C9XA 1OFDA 2ERJC 4PV8B 3HI6H 2ZXBA 3LX9A 3HC4H 3CB8A 1UIPA 4PUJA 1E3FA 1QMUA 3R4IA 1J10A 5C08B 1NEYA 2WLNA 4MKVA 3D06A 1DWGM 2NY2B 5DZOA 4F8PA 1JCYA 1MUCA 1RCQA 2G4JA 2EDWA 2DEXX 2QCLA 3UJIL 5KVEE 3V0WH 1FFPB 4L29A 1AHWC 1NCWL 3GWQA 4YO0A 1G4PA 4UR9A 4QAWA 5LGHH 4BUQA 1I3UA 5SV4A 4NUJA 1OC5A 3FF7A 4CN4A 1KPUA 3GUWA 4NWTH 2AJ3A 3TFBA 3ZY7A 1UD5A 2J44A 3GU2A 1QNZH 2JIXD 1A6VH 3THMH 4YDLB 4PJGA 2QUMA 4GE8A 1CCZA 4B53A 5LNVA 3NZ8A 5B8CC 4FL4B 4UIOA 1XYBA 2DQTH 5F3FA 2ZUQB 3BZEB 4MM1A 5A6SA 2ZF9A 2GSGA 2MFNA 5DRNB 4RFEB 4XN1A 5I0VA 4K7PY 1Q13A 1IAOB 3ZO9A 1N4XL 4H0LC 4PCPA 3O4OB 2NUPB 3QC5X 4JFQA 4RWHA 3EDFA 4YZWA 2WAGA 3PFMA 3QULB 4LIQH 4AF0B 5LHDA 3TH3T 4H7CA 4CU7A 3SM0A 2DVXA 4S3BA 3WBYA 3QH3A 4LCIH 1DCEA 1HQRB 3A4AA 3SUWA 1PKMA 3U9PL 3ZHDA 5FOBA 4G6MH 1WT5C 1OFBA 3LHUA 1CE6B 1DIKA 4OHQA 5H91A 4EF8A 1B2WL 1AKPA 1SF5A 1T7YA 3HE7B 3V4BA 3L1OH 5LIUX 4JTHA 3T77A 1VADA 2A83B 2DL9A 3KPPA 1NCGA 3QEHB 5CLTA 1Z8AA 1A8ZA 5HDQH 4DPCX 1CIUA 3PAUA 3DX0A 1RCOB 4D6GA 2HLFD 2PTXA 4BDVB 1M68A 3FS2A 4H83A 2XT1B 2ICWI 3VX0A 3TN0B 3P7YA 1FCGA 4K7VA 1VLIA 1UA6L 4KK6D 5H6HA 1PL3A 3HMXL 3SB0A 3CLFL 3O9WB 3I75B 5DX7A 4O8AA 3W86A 3VE0B 1Q0XH 1FG2A 4JYEA 1WUFA 4DF1A 5CKGA 5F9JB 1OP3H 3BUTA 1JQVA 2VFDA 3PJUA 2VLJE 3KYKL 4NKOB 5E5LA 5ADPH 2W61A 2ADGB 3AHXA 2OJEB 3O8XC 3QSTA 4ILSA 4XTIA 4Y9AA 1KB5A 3W5MA 1HJCA 5J13C 2YAMA 4HUMB 1A1OB 3AAMA 2BHZA 1DL3A 3K5XA 4TO8A 1VJIA 1UWUA 1I82A 2DPEA 3CK5A 3LKOA 1DWAM 1F58H 2J6WA 3CBWA 3IDJA 4K3JL 3TO4B 4EX4A 4Q4PA 1FC1A 5HAOA 1KPRB 4JUTA 3KVKA 1HILA 4N0FA 1F42A 4OD1L 5LKNA 2R56H 4TUUA 3RTLA 4MUZA 3UC0L 1NOLA 3RVTD 1F86A 1PBYA 5HGHB 1NP0A 2K4AA 2BGNE 3H2QA 2OEKA 1HZYA 1PFOA 4KRPD 4R7NB 1A6VL 2R29L 3THML 3OQRA 2XM2A 1SOSA 3NYDA 2KPNA 4ZMAT 1SLWA 4O4YH 5BO0D 1N7KA 1NWPA 5H4YA 4MB5A 5J1AA 1XYFA 2ZXQA 2VN6A 3ZQXA 3HS0C 3DG3A 4C47A 3NA9H 4JQ2A 2OMUB 5DHVB 3T0DA 5F2FA 4AISA 1JPIA 4AQ8A 3WQPA 4N2YA 3D69B 3KS0J 4YXKH 1ICQA 4Q4IA 5INCA 1IT9H 1INEL 3DX6A 1E4KC 4X9YA 2XOTA 1M3UA 2GUYA 5MENE 1E40A 4I18A 1FDZA 1ALDA 1XGDA 1J88A 2AF2A 4HT1L 3KDNA 4MYAA 4ZO9A 1UM5H 4RGND 3BURA 4GT0A 4KQ4H 1OT1A 4QJ3B 1HH9A 4IOIB 4LUTB 4OLXL 1XIDA 3MV9A 3T77B 1UOLA 1VADB 3KWUA 1MXGA 4ZSTA 4DGIL 1G9ML 4AMCA 2ZWNA 3QCUH 3C8KA 4DVRL 1T7ZA 1QI2A 4X7EC 2C1OB 1ZTXE 3F7PC 4XNUH 3GSRA 1H60A 2DQCH 4NI6A 1MQQA 5BQ7B 1JNHB 2X0UA 1AJ7L 1ITQA 3I50H 3GZ3A 1A4MA 4PJFF 2P42B 3S5NA 3QQ0A 2BNRE 2X70B 3CVHL 1X6LA 2ZCKL 5HHOA 2WAHA 1MMFA 2QIWA 3ZRSA 2Z1XA 5FAGA 1I3GL 3OHMB 3RCNA 1NFDF 3JQOB 4NXKA 4TQIA 5J8OA 3LKRA 5SX5H 4Z77B 1TTCA 3H9SD 4NQCE 1NFGA 3A12A 1C8PA 1PG7W 1L9QA 2BSTB 2DQCL 4PUUA 4DWSD 4CVZB 1NIAA 2AITA 1H6FA 4YHKL 3H1ZA 1G9NL 4I9WE 3UFYA 4B4HA 2Z25A 4NQSA 4BSJA 3APGA 4Z42C 3CLWA 4OTXH 5LGYA 2XFYA 5SWSE 4QDMA 1R0AL 4O02A 1L6WA 3BE7A 2D7PA 5JXQA 3ZYJA 4EF9A 4OR1A 2FIKA 4LC6A 3L4WA 4A8LA 2OZ3A 5I24A 5L88L 3VD4A 1LG1A 2HSAA 3CU2A 4ROPA 3FPXA 4R97C 3TT1L 3FLUA 4B3EA 2E8ZA 4IZGA 2E68A 3CWGA 3ZDYE 1XF3B 5K9CA 1CD1B 5DCEA 3M6DA 4NQDA 4GNKB 2GGEA 1EHNA 5HHQB 3GHEH 4ZTPL 1FBIH 2LVCA 2M8XA 4O1CA 3U6XS 3DKJA 4QLWA 1EEZA 3MO4A 2YFNA 4OKDA 4CVUA 2I9TB 1TQTA 4FQLL 1LL4A 5JQIB 3L0NA 9XIMA 1NZRA 1KGJA 3E0LA 1XIFA 3SY5A 4JKWA 1ES0A 3WMLA 4MNQA 3QE5A 2APTA 5C9JA 4XZHA 1NUFA 3TX9A 1UWSA 1YYLL 3CFDB 3AWGA 3DHFA 2DH3A 1QWKA 3FSZA 5A2FA 4S1DC 3VAEA 2PWGA 4HKJA 4JG0L 4L5ZA 4A1RA 2DMBA 4ZS6D 2XFWA 1ZTMA 4C6OA 3K2UH 4D8PB 4TVSa 3NCMA 2HRLA 1WIUA 2BH0A 4DEWA 5JPMC 4C6QA 4PJ5D 4UOW0 2BNQA 1S2WA 2R7EA 4YSPA 3MTWA 3VXSA 4XD6A 1F6LL 1JDAA 5D7KE 3S96A 4W9LC 4Y6GA 1MIML 4ISVA 5C0CE 3MLPA 1F73A 2Z4GA 3UZ5A 2ZTBA 2JK5A 2WHVA 4Y2DD 1OEPA 3I9GL 2GGIA 1CVRA 4X7DC 4L3ED 1YDNA 2E86A 2FB4L 2JI3A 5IQ9A 3MU7A 3QLLA 4QG8A 2Z35A 5J11B 3I3BA 2H8XA 3K1GA 2RQEA 4TX6A 2IG2L 4MTMA 3DMMA 5K33A 1D3HA 5FUOH 3IWUA 4S3FA 4PRID 3WFZA 1K4CB 3QZNA 5BOJA 2AOSA 3WBXA 1GW9A 1JUBA 1Y6NR 1T40A 5A8MA 3UAJC 1X6UA 2KZKA 1GZQB 5I17A 3WL1A 1CLZL 3NJGA 1BGAA 4IMLA 5KUMA 1DPMA 2G0WA 3L5XH 3WD5L 1JF6A 4MVBC 1S7TB 1KCXA 3PNUA 1F4XH 1WYIA 3H7RA 3UYPB 2E09A 1Y0LB 3Q2CA 1W9DM 4Z1DA 2Y07L 4Z8FH 4R7WA 5KS9B 2BHFA 3QK0A 1BFSA 1XR8A 1F07A 3OKEA 1PTAA 4HPYL 1W9BM 2OX5B 1IC5H 1Z3GH 3HG4A 4AQ1B 4PH6A 1RMFH 4CQAA 2XIIA 3L2IA 5IB4B 3S5ZA 1XF0A 3IDGA 2WMPA 1BG9A 4IS6B 1U8PA 3TW9A 4UQ2A 1J01A 3PUDA 1JXKA 2YD9A 3AYSA 1HHKA 3NPVA 3CBJB 3HNVH 3KNBA 4HD5A 2D3JA 1E5AA 4JRYD 1BWMA 4IRJA 5I3KA 1AGDB 2VDKB 3THCA 1SLXA 3U8GA 2JH2A 3I6KA 3GZPA 2KUTA 4Z7AA 3FFCD 2R9HC 1E4LA 1L6SA 1GS7A 3ZKNC 2DUZA 2A0LC 1EJTC 4EACA 5LA0A 3V6OA 5ANHA 3BICA 1JULA 3E2QA 2JE8A 3N6HA 6TIMA 1IYXA 5EU7E 1IF2A 1YEFH 4FA7B 1PZ0A 4MD4A 4MWAD 1BF8A 2P8LB 5AUMB 3N9RA 5IY5B 4YU1A 2HJFB 1CIDA 2WYIA 4WUKH 2C15A 2EKSB 3QMTA 4KRNA 2JV6A 5HHXL 2P88A 2VDOL 2WQWA 3L8QA 1U8OB 3HC3H 1Z9SA 3FSTA 2PA6A 3IU3B 3U4EA 3FONB 2ZA3A 2PDUA 1ZS8A 5A1AA 5C9ZA 4LBUA 2HVJB 1UBPC 5E00A 1QTPA 3BHBB 3S2CA 4PJCF 1ZBVA 3CAQA 3OJDA 4YNYA 4DH2A 3SCRA 2A85A 3ZKND 3WJZA 3N2CA 4K2UL 3F12B 4UT6A 3WAKA 4KBXA 4DJDD 3W29A 3U4AA 3VACA 4XPFL 1R30A 4NNYA 3HC4L 3V0HA 1JMXA 3CQPA 4J4PD 1NFDA 3BWAB 1R9ZA 4X2PA 4JAMA 5HJXA 1EZWA 4EKXA 1MO0A 3MRCA 1ZRQA 3WXVL 2XGBA 1DVQA 1U8LB 4L5FE 3CEUA 5JBEA 8PAZA 4H13C 4L1GA 4K38A 3N40F 4MZ3A 5F7DB 2HVKB 2H5UA 4ABWA 1R3YA 1UZ4A 3AXLB 3DX5A 4IL2A 2NY5H 3OKMB 3KPLB 4A2HA 4ZYKA 1KJ2L 5E99L 1HEJC 1N7MH 5T3XL 2DY2A 3N41F 1UYWL 4U3XA 5AZUA 4AHPA 2HZGA 5GNZA 4IU2B 1AQFA 3HE7C 2WYZA 1L9SA 3HZ3A 3MRFA 3PZOA 3KPSD 5F7KC 5D6DC 3VI4E 4R83A 3LKQA 3E0GA 1E70M 3RFZB 3OVPA 2R1XB 3EZ4A 1G4TA 1NGWB 3QPQD 2CKNA 3BVDB 3OG4B 2WXIA 3T6WA 1T1XA 1HOEA 3VXOA 4ETQB 2YX0A 1RBLA 2ZZ3A 1SY6H 2QDVA 3PV7A 5BMFL 4J5VA 2PDKA 4LKXA 2V0TA 4TUKH 3HB3C 4G1KA 1B4JH 5E9AA 5J6GA 4ESKA 1W1A1 2X3BA 4QKXB 4UWMA 1KBLA 4GP8B 3TP4A 3A6CH 3T0EA 4IH3A 2Q2LA 1IKNA 5ALCH 1T8QA 3I02A 1ASOA 3MBXH 7REQA 2Y5EA 4U1LA 3TFCA 1K02A 2AK4E 3QISA 3PL6D 1P7TB 2O9PA 4HWBL 1KJ3H 1FL6B 3JRKA 4EIZC 5E56A 1A3XA 1FWWA 4S3CA 1SO5A 4AJVA 1QOKA 2J1KA 1A1NA 5KYNA 3MV11 2X4NB 3CFKB 3CNKA 3L4UA 3MFFB 4WWKC 4Y19A 4IKIA 5DJ0A 3CHFA 5F0LB 2NWSA 2QV2A 4P04A 3HLAA 4RRPM 3H2MA 3GINA 5FUCC 1AG6A 1XLBA 4WNSA 2PTZA 3KBEA 1B3YA 5GZNA 3HF3A 4GVGA 4NGHL 3AWEA 5IXEA 3HNSL 4DT2A 2DQFB 1W54A 4HU8A 1RV6X 2HVJA 3E2HC 3QJSB 5E9DE 2X3AA 3UZQA 5JQHC 4E4PA 2DT1A 3TZVB 3HPLA 1T04B 2WD0A 3GSVB 4JQAA 2XICA 5M5DA 1OTSD 2PWDA 1U5JA 4MY1A 1RJZA 4PR5A 3ZE0F 1I7TA 4C6IA 3LGGA 3ABSA 4RXFA 3FO0H 3VM7A 1NFDB 2PDBA 2WWMC 3QDMD 3DXAA 3ES6A 4E9SA 1JNDA 3B05A 1A6TB 5CJ8A 4NYUA 3OJMB 4QTIL 2IH8A 4WO4D 1R3RA 1LO2H 3TBSA 3R8QA 3D6NA 1YY8B 2F54A 1DVFD 3T3PE 2JFEX 2NY1C 4R9XA 2AKZA 3E5BA 4Y2OB 4L8SC 4LSBA 4V2BA 3JUGA 3B06A 4MOZA 4BI5A 3G5VB 2AMXA 4E2DA 3AROA 4NHCL 1U93A 1XM3A 4APQB 1LTXA 3WEXB 1MFUA 5IFAH 1DXEA 4D9PA 5HVHB 4KCWA 3MREB 1WBJA 3BQVA 4W9IC 4RZ5A 4PJAE 1AC6A 4FERA 5LG1A 4GUOA 3ARUA 3FW6A 3C8FA 3VGAB 3ATFA 1NSJA 2PXYC 1JZ3A 1CICD 1Z89A 5FJOA 5CP3A 3BKMH 4A3QA 4DZ8A 1BXCA 5T1MA 1HVQA 3QI9A 3OODA 5JBFA 1C12B 3D85A 1G7MA 3GKZA 1X8CA 3BP7B 3GRWH 4ZBCA 5D9OA 3VM5A 3P69A 4Z7VB 2LFEA 3P77B 3V6OE 3LBMA 1AZZC 2XVKA 3IJEB 3Q1SL 4PJBE 1XR9B 4X42A 4QRPD 1PQZA 2QEZA 1AXTH 4JM4L 1LTDA 3VH8B 4LVFA 4N02A 4HT1H 4DCQA 3WDRA 3MDJA 3GC4A 1S6NA 3L3DA 1WUZA 1FWNA 4AYFB 1D9KA 2CCLA 3RZCD 1XL6A 2ZWSA 4H8PA 5FKPB 1GVIA 3MYZA 3OGCA 1BZ9A 2WLJA 2FLBT 3O2DL 5HGBA 4JDZA 3MV7A 3OZOA 1UXWA 4WFHE 3VFRA 1BQ5A 2QQNH 4J2QA 2W9DL 2D0HA 4F93B 3BW3A 5GS3A 3GW0A 1GC1C 4XE0A 2WTOA 2Y6SC 3CH1A 3C86A 4LNRA 4Y5VB 2DRUA 1H6TA 4NI8A 3K4WA 4H6QA 1MY5A 1LO0H 3PJTA 4DXKA 2WQUA 1N0XH 1ED3A 2DS4A 4BFKA 4D2JA 3T3MB 1ZAIA 4H8UA 5I8KL 2JK2A 3HCVA 4X0VA 2R0LH 3QUXA 4R96B 4ZUVA 3WI9A 1TZOA 3VFMA 2VDLL 4ZAKD 4LQFL 3STZB 3FK4A 2Y3NA 4K3ZA 2P0OA 4BIKA 4HLZH 4YH6A 1ZDQA 1SZRA 2JQZA 5T1LB 1M71A 4Q0XH 3KS0H 3U82B 3IRPX 4RMVA 5EUKB 1H09A 3AZSA 4JO1L 1JZDC 1YEYA 3QULA 3N11A 2ZP9A 1UH4A 3CTTA 4R26H 1K1DA 4N4QA 4ODSL 1LK2A 1LEIB 4GQGA 1TXKA 5TDOA 2NX5E 4B9CA 4FE9A 2VD9A 4MMZC 1KCVL 4L48A 1MDAA 5EC1B 2EG6A 1V4YA 4X0KA 4F2UA 3GHEL 4LP8A 5MEOB 2WXLA 2YBVA 1HP5A 1Q1JL 1RU9L 1D2OA 1M56B 2XZ7A 3QDGE 3ZTJG 1MJJB 2W60A 2WBXA 3BOFA 2V2CA 2WTPA 3MAWA 5DT1H 1NP2A 2PO6D 4K8RL 2AZAA 4LLMB 3MROB 1F02I 5E0KA 2CLPA 4S1RH 3VTRA 2LW3A 4DK6A 5DC9B 4CQDA 2RTTA 4XCEA 3NM1A 1T22B 4ROQA 3W28A 5DY3A 3DECA 1CENA 4QCFA 1DTUA 3OJVC 5D96C 4N7QA 1CU4H 5FF6B 4I0PA 4Z7VE 5FYKE 2Z4QB 1B9KA 2Z0BA 2WUCH 3T2LA 1ZAJA 3ZMRA 3T3PF 2FNBA 3FSWA 2G3ZA 4RX4A 5SV3A 4NF7A 2F7OA 2PC4A 1X7FA 3QRHA 1CFVH 4JGJA 1EMTH 4IPLA 1U8MB 1NFAA 1FZJA 3TA6A 1BIIB 3N3EA 3TBTA 4GG8A 5DTFA 1ZSDB 3PUGA 1MRCL 3QNFA 1UXSA 1YUHA 3ZE0E 4GRLB 3CV1A 1WT5A 4EXAA 4XXCC 3QZPA 5HGBB 2MJWA 3HZKB 1WBHA 3MRDB 2FMOA 4GZ7A 4ADUA 3UZYA 5FO7B 3FA5A 5D72H 5FGBA 3VGGA 1T1YB 2B16A 4KWWA 3O2WL 5IG7B 3WIFA 1UTDA 2LU5A 1A21A 1N6VA 4LNRB 4PI0A 5DQJA 4LF1A 4C6LA 4F2TA 4NCDA 1G7JB 1MDRA 1UOKA 3QHZH 3SCQA 4H26B 3VWJB 1ISXA 2W0FB 2K4WA 4BZ1A 5CR1A 2AMGA 1ZBWA 1R5VB 2ZSVA 4XAWL 1A7PH 4DP8X 4ZQOA 5D1ZB 4HAKA 4WF7A 1GKQA 5B21A 5EOTB 2HXUA 1A3ZA 2XN1A 3DPDA 4PD4J 2DYSB 2RBLA 2XWDA 3P8JA 2AXJA 3QJTB 4WUUE 2I07B 2HBXA 1HCVA 4H2HA 3LM7A 4MPKA 1NGQL 1NGPH 4NVTA 5K59E 3S46A 4MZIA 4A37A 1BYAA 1ZGDA 3K8KA 5F21B 3SDDC 1OP3K 1CYGA 1MPAL 2BODX 2C26A 4IJBA 1IRAY 1N70A 3UTZA 5IR1A 3OXRA 1C5CH 4WW1A 5AVUB 4M93C 3WLOA 3S7GA 1V3JA 4AGNA 2NX5B 4F57L 3S3BB 1A7NL 5MEPB 5L2JA 4OI7A 1C91A 3HMWH 1RP9A 4EI6B 5BVJB 4FZEH 3SE9L 4LOEA 2OSWA 1NVMA 2NV1A 3FQWA 2NUTA 2EINB 1MPAH 2XN9B 1UJTA 3K8LA 4EIUA 1ERNA 1NSNH 4JYDA 2YL5A 1UZ6F 1VEPA 1G87A 2TSBA 2DQGL 5AVVB 2VL4A 4NAFB 4DBUA 1JNJA 4M6AA 1MFDH 5BOPA 1QOPA 5E2JA 2A3HA 3A6CL 4AXWB 5I73C 1GMIA 1XLGA 4L4VA 1OVZA 2ZCLH 4XCCL 3O6AA 4XMKL 1DQUA 3GO2A 3SGUA 4YPGB 3FJTA 5C3TA 4MZ2A 2FEEI 1X7TA 3UC2A 4LMQE 3BD4A 1AGEA 1OP9A 2HXAA 3EX4A 3PR2A 1ILUA 1BIIA 1J6PA 5EBLA 1J5TA 1XBYA 3NAAH 3G3LA 4GRWB 1JGLH 4KITB 1XRVA 1A66A 3B8UA 2VRQA 2CLIA 4N5UA 2EQDA 4FG4A 5KG9A 3AOFA 1MFVA 3HZKA 1OCJA 4K1WA 2XSKA 3TKFA 3CLEH 4JFHD 4NZ4A 3BCDA 5D2NB 5FO7A 2UZ9A 3RBSA 3D9AH 5D7IE 2VC9A 4FIQA 2WJFA 1FFOA 4LDEB 2X6MA 1M7PA 3APCA 4MADA 3JUYA 4X4YB 3MVTA 1XF3A 4FNRA 3V0VB 4ZFFB 2ZADA 3KDOA 1XH1A 1R7AA 3N4FA 1AY1H 3MYJA 4ZNEE 4YVVA 1OCCB 1VCBC 4NYLB 1IEWA 4MNQD 2O92A 3G5YB 5I74C 5IKCB 1BCIA 4AWEA 3R7RA 3WIHL 1JDEA 4GC4A 4GRWF 2AL1A 3ZJ8A 2K78A 1XBZA 2XXFA 1U3HC 1OIMA 1V6UA 1E51A 3O11A 2XV6B 4W85A 3BSZA 1GS6X 4HK3N 2QQLH 4XAYA 5F7YC 3FTGA 2Y7NA 2ED8A 3DX7B 3NDZE 4YUEH 4IIGA 1VEOA 3PZIA 3C5ZA 1NDVA 3PHAA 1AG0A 5IW1B 2XWTA 4FX7A 3NCBB 4NO5B 4RNRA 4ZDHA 5D7JB 2MCMA 4NRSA 5EBMB 4FZEL 3SE9H 1F4WH 5HYJA 1U5HA 2X2GA 3BXWA 2W92A 4A2DA 4KERA 4CVXB 2YCLA 3SY0B 3FDKA 2ZOXA 3WBAA 3WMBA 2DKUA 4N2MA 2VO5A 4Q4EA 2A7NA 2CMRH 4ODSH 4LL1A 4LUTA 4NO2A 5TFSH 1T2XA 2VN5A 3OAUH 4MJHA 4XCNB 2Z2AA 4DJFD 4OCXL 1HK6A 4LSTH 3OVUB 2ZX5A 4LXFA 2HZHA 5IBLD 1BWLA 4H1ZA 5DEJA 3AXIA 1LRNA 4QHRA 3A6BL 4WGHA 1M05A 2WK2A 2C7UA 4M03A 1YNYA 1UOVA 1DDHA 1H41A 3GNOA 1AP2B 4GSDH 2GDQA 4OM0L 2EPOA 1A6WL 2H0JA 1RZQA 3WH5A 2WIIB 2F6AA 2MQGA 4Z2KA 5EFIA 3PBGA 1BQLH 4O0KA 1L8PA 1FKXA 1USQA 2IQDA 2GK0B 4DGVH 1MNUH 3PQYB 4OT1H 3T4WA 4QHKI 3OVRA 3P3BA 3TTEA 4E4UA 1UZGA 3X14A 3C2RA 5CSRA 1P5UC 1WDPA 2X16A 1FO0H 2G60L 1IXQA 4OZHB 5T5NF 4XMLH 3DC8A 1A3HA 1UCBH 2YD4A 4XNXH 4A7GF 4NM8H 3W07A 3H12A 5D2NA 4GI9A 1TJ0A 1GGIH 3SCNA 5C0AA 4ZTOH 2TRHA 2CE6A 5EU6A 1XQLA 3W4RA 2ZRVA 3NPSB 1TR1A 4Q14A 4FN0A 2ACSA 3UZXA 1MCHA 1NMAH 3EOYG 4K94L 1DJNA 2V7NA 4ZZKA 1SFJA 5E93A 4Q8OA 1WV2A 4LBAA 4U1KA 3RKDD 1W9UA 2W9LA 5J5EA 1S7XA 5D7LB 3SDCA 5B38B 4WQ6A 3HJ0A 1RHHB 4AEIL 2F5AH 3MHZA 1KULA 1QOXA 3B1UA 1KBGH 2ICWB 4XVTH 4MBRA 3APDA 1IGTB 1H0DB 3E80A 5ERWB 5AYTA 3LIZH 3MUUA 3V0DA 5A8OA 4UTAH 1D5RA 2G3NA 4IMFA 1JCNA 4YSCA 4AGLA 1QATA 4XBEL 3GYRA 3CZJA 2FE0A 3EA2A 2KZHA 3QHMA 3VJ6B 1KBJA 4RDWA 4MNKA 5IHLB 4EANA 1F4XL 4I0CC 1GVEA 4UDUB 4FEZA 4YLWA 4AMAA 1PS3A 2KT6A 5FPIA 4UMBA 4G8FA 4RESB 3WLWD 1MOEA 2AK4D 4IP7A 5A8GA 1G6VK 4WUUD 4HULB 3NZHL 1MN4A 3PAOA 1XIWD 3NFNB 4OU1A 4M7KL 4RGNB 4NJAL 1UT9A 4PJHB 5D2LF 4DEUA 1UFGA 4KCVA 4KQ0A 1NUNB 3FTZA 4FYTA 5JW4R 1F7BA 3ABMB 3TC3A 1A5CA 1XZWA 2XPGB 5C09B 2APFA 2NZ1A 1E90A 1WA3A 4LCSA 5DLCA 3USZA 1DQJA 4QCIA 5FEPA 3LMYA 3TYAA 2W62A 1KTJA 1X5IA 1I7ZA 2K6ZA 1H15B 3W1RA 7PTDA 3ILEA 1PTDA 5AVXB 3O16A 3U7AA 4YXLH 2B7DT 1I9JL 3O8XB 3QQWA 1ZJHA 3FCGA 3GSQA 4AVHA 3QJHA 1MFAL 3GSXA 1I85C 1I85A 4GINA 4OJYA 4C83B 1DIOA 3FBQA 1YMYA 6ENLA 1JHLL 1LYXA 2MQ3A 1I9JH 2IBZX 2YKLH 2BP5M 2QSVA 1GTNA 1P0EA 3N6JA 2WSQA 1T1ZA 3NOYA 1XT5A 3Q7JA 4KW2A 3A0OA 4UIKH 3CMJA 4C6BA 5MP6L 3U2EA 4TNFA 3IXTA 5F89B 2YQBA 1GPWA 4CEUC 4JTSA 3TJLA 1EOKA 3QQ4A 4OIFA 4CKVX 1Q72H 3RAJH 1QP1A 4AC1X 1W8GA 2YKLL 1QRNE 2ADFL 35C8H 3ARVA 3FN0L 1JWMA 1CMOA 2DFAA 4NU7A 2ATKB 3QJUB 3MJMA 2OJPA 3PL6A 1FNEA 4L8SA 3EH1A 1FNHA 1H6UA 3WGVB 1J79A 1FAKT 4AIXA 1JGMA 3S36X 1RFDH 3GKFA 3I9GH 3P3RA 1T1WA 2EYSB 3PABA 3S6DA 4O4VA 4WQOA 1IBGL 3AT8A 4AH2A 1B31A 1YEHL 2FWOA 1FP9A 5IROD 1HJXA 3FOKA 4FF7A 4ZPTB 3SBPA 1NBVL 2O5NA 2OR7A 3ZHFA 1J11A 3EX1A 4GIPD 2DSZA 3P5YA 4L6OA 4ZE4A 3VFWB 2YD3A 4WWKD 4M8QB 3LSOB 3IS1X 1BD2A 1ZALA 2D24A 3ISIX 3TLLA 3WK2A 4RIRA 1MFCH 4YSUA 4EBQH 1I7UB 3DI0A 3WEBA 3CHCA 1IJNA 1GGBH 4NP9A 4PAZA 4HJ1A 1T41A 1O5KA 2V8ZA 3QYNA 2CRZA 4IF2A 4CKQA 2EEAA 5H37A 1O68A 2CHRA 3W2KA 2CDEA 3D0AA 3QUHA 1NBVH 4HCFA 4KK5C 3M8OL 5FSDC 3GGWA 2J9YA 3K6OA 4W9DC 2Y5JA 3B0PA 4NAEA 4ODVL 3RN6A 3TT1H 2VLRD 5DR5H 2DTSA 3GSOB 4KOBA 2A1WL 3RVXD 4BRVA 4MHHI 5CD5D 5D9SB 4M1CC 3GMNB 1C8VA 3LZFL 2IKIA 3N06B 3LCHA 4YPJA 1VZGA 3TLRA 2TRSA 4PTWA 4ACZA 5T3XE 1T4KA 4L3FA 1I8KA 2VDKH 3MA7A 2NXZD 3IK2A 4NBYB 1WKYA 3NA8A 1FUYA 2PCFB 3RM9A 4FP1A 3SRKA 3IVSA 2P3YA 3T3ME 4C6PA 3NBNA 3MRRA 4M4PA 3SKMB 2PRHA 4L8BA 2E9JA 3Q8BA 2WWCA 1U41A 4Y4KB 2Z31A 2IWKA 3DFQA 4MWAB 4X8JB 2YMXH 3VG0H 4TX9A 4XCYA 4OFCA 2FZBA 2EVFA 5JQ6H 4LU0A 5SWZB 4TNGA 4G6ML 2QDDA 2FJHA 2AV1A 3GG1A 4HNUA 4QWWC 1UT1A 2BWGA 2PR9A 1P6AB 3AY4A 3RI5K 1EF2A 2N7SA 1JOIA 5JW4Q 3BPNB 5FO9B 4AY1A 4NZ8A 2P1FA 1WFOA 1NBZA 4KDTC 5DD3H 4Q7BA 3IXTB 5F89A 1EQWA 2EAEA 1JXJA 3O3EA 1IEAA 1O6SA 5TPWH 3OPSA 2C4XA 4FQ1L 3C2OA 1N0LA 3MBWA 3GBML 1BRLA 5FGCB 3QEZA 4WW2B 4G9FE 2VKWA 5DYOA 3FUFA 4NQ1A 4X6CA 1Z9NA 5SX4I 3EKLA 1JAEA 3GZOA 1SJEA 1XR9A 1XTLA 3D87B 3OKLB 2WHMA 3ZVIA 4OV9A 4Y16B 4HJGB 1KFWA 2KLRA 1D9KD 1KIPA 1KXTB 2PR4L 3C12A 1SZGA 2DV0A 5FHBH 4UT9L 4XUYA 2H26A 5F96L 4HK6A 2YEZA 1ZT4B 5T3ZE 1EGJA 3UMNA 1EUTA 1XWYA 1VPOH 1FP5A 1OZMA 5E2UH 2G3XA 4AYGA 2CNCA 1ADOA 1UOWA 3CQHA 5CCZA 1OD9A 2ESVA 3EA3A 5I06A 4MNHA 4Z0XA 1LD9B 1N8ZB 3CC1A 4HKPA 2W95A 4W89A 4LARH 1RH8A 1SLVA 2F9RA 5AFAA 2PC8A 1S7UB 4QHMA 4FOUA 3SUTA 4PRBA 5LGJB 2XQBH 2CIIA 3D4CA 4LJ3A 4ZMOA 1K5NA 4ZW7A 5HK4A 3LXBA 1E15A 4M5SA 5KSAA 2JGQA 4NZ1A 4QHPA 2VQ1B 2G0KA 2HKFH 2IKJA 3D05A 1T5AA 4XC3L 3CZ8A 3VKAA 1UPMB 1LDPL 1BAFL 3F04A 1QPRA 4FQCH 3FA3A 4ODWA 3W7LA 3I68A 4GLRH 5CFHA 4QHUB 2Q71A 1KZQA 4A22A 1K6QL 2B81A 1EERB 3NXLA 3BPWA 5E4OA 3RNQA 3QC0A 2NY5C 4O2EA 4B0MM 3RCYA 4F91B 4AD2A 2BNRD 1S5HB 4KROB 3RUGA 5FGCE 1SEBB 2I17A 3ITXA 3EJRA 1IWAA 1VGEL 3SYCA 4MWAA 5C0RL 2QMKA 3FCSA 4HJIA 3REVB 3AZRA 3VABA 4JANA 1FH8A 3ME0A 1L4IA 3GDMA 3KRUA 4X80H 2ASHA 4IL0A 5IREA 4MQXD 1AFSA 5SWZE 4X5XB 4PJFB 4QRSB 3B9OA 4F4RA 5EF3A 2C9AA 5K9QI 3DGRA 4NAMA 1Q8AA 2FB4H 1RZKL 3O3AB 4O18A 1KKRA 5FI8A 2WVVB 3ARQA 3PHQA 5FLUA 2TSYA 2GHWB 3NH7L 4P05A 3VA8A 4DP1X 3L3OC 3SCMB 1MRAA 4XZWA 3DHJA 4Q6XA 3DX9A 4ZS6C 1IEQA 2A6KB 5JIDA 2JQXA 3ECBA 3EZJB 3O6DA 4C6EA 3NH7H 5BUAA 4P8WA 3MRGB 3VIOA 4PJ8A 1WDRA 4TXVB 4XZUB 1UUNA 4YX2L 3W39B 4OLZH 2J6EH 4ZFZA 4G2AA 2O61A 3LD8C 4MA1C 3ZQWA 3A3YB 4N25A 4A68A 1VYRA 4L1SA 4UM8B 4XX5A 4YNGA 4XRCB 4FI7A 3KPQB 1ACXA 3KPRA 3O3UN 2K3TA 3MRBA 4FQXA 4GIAA 4PGBB 3T0EE 3AAZB 1DJGA 2ESVB 3MSPA 3SPVB 4AM0B 2ITDB 3M64A 3GS4A 4PJEB 3BEWA 2JJVA 1WZAA 1BVNP 4UQDA 4YO0B 4POZC 1QHZA 2CO6A 2Q5BA 4B5XA 4AIZB 3N2TA 3CYJA 1UGKA 1JPFA 1YNTB 2D3VA 3HMXA 3NO5A 3MRIA 5DD5L 1FIGH 1CE1L 2Z2BA 1LGVA 3GPSA 1XGTB 1R3IL 2YUXA 4MSWB 5DJCA 3WIIH 4FHKA 4LAMA 5KVGE 4B3LA 3ABKB 1FNSH 4HKBB 4ODXA 4CD6A 3N42F 2YJLA 2HJKB 2QTVA 4BEQA 1I1AC 3KVQA 3DRQA 2XXCB 3QWNA 5BV7L 1MH5B 3PJSB 4MJ6B 4Z0BH 2OFJA 3UPRA 3CO8A 3FN3A 5ECVA 3TWYA 1ASQA 3UO1H 5I09A 1MFNA 1DN2A 4LSRH 4I2XB 4X4XB 1HXYA 3EH3B 4EUPG 2Y2WA 1AHWA 1Q9LB 5GGUB 1K5WA 3HPSA 2OR9L 3LXAA 3F7JA 1KTCA 3EBVA 1SMOA 5ICYB 1XW8A 2V3GA 4LBSA 4AEHH 1EQPA 3P80A 1SHXA 3STPA 2ZTJA 3HUJB 1W1B1 3BLOA 1Z6KA 1JGIA 3BW9B 4M3PA 4D8ZA 3V9CA 5I1IL 4DI8A 2VNCA 1OARH 1NCCL 4XAKD 3DDFA 5KBLA 3FT3B 4OD3H 3S4SA 3N55A 3X1EA 4OZFB 8FABA 1A3RH 3AREB 2DQJH 3NN8A 1B2YA 4U3AA 5B7MA 4X5WA 2GQ8A 3AMGA 1A1MA 4I0PC 3W7CA 3N42B 4I88A 1KCZA 1DUYA 2CJUL 1SZEA 2EVHA 2XTJB 3WGUB 1DL7L 4GFSA 2RA1A 2PDHA 2W65A 1JTOA 3L21A 4JPWH 1BJ1H 1FL5A 2I60H 4LAQH 1P84K 3DJSA 3KJ6H 5C7ZA 5CR8A 1CICB 1OOAA 1JZ8A 2BZNA 3BKYL 3PTQA 3ALPA 4ORMA 4H8NA 4GSXA 3WD2A 3D30A 1K4DB 4WV1A 3UY8A 3LXCA 1LQ2A 1QYGH 2B8OT 3HG3A 3QSRA 3U30B 3RIAF 3CL8A 1EZVY 2GABA 1JK9B 3FRUA 5HGAB 4D3CH 2ZRUA 3SY8A 4Z1AA 4ZW8A 4FULA 5EF2A 3KUMA 2FYMA 3H0TA 2VSDA 4ZBJA 2Q8BH 5KS9E 3LKOB 1TPDA 4PB0H 2EG8A 2CK2A 1MXDA 4GA8A 5FAJA 4PGDB 2P80D 1E4HA 3PHOA 1BXUA 4Q58C 2XFGB 1OKEA 3H21A 3T8MA 3L95A 1ETJA 4M8VA 2D2CC 3MODH 3RZCB 1K7EA 5H35B 5IMOA 3VZZA 3BRFA 3ROOA 1TYJA 3HAEB 2R0ZL 5C0IB 2NY3D 3FU7A 2OXHA 4JFDB 5MENA 3SCUA 5CC7A 1P7QD 5DZAA 3TYGL 3ILPB 2ZPKL 3JWDL 5EZOH 4NUJB 1W1VA 3JV4A 5KSAC 3W7DA 5TQ0L 2PLKA 2XZ9A 4BQBA 5I75C 2ZJSL 2ZC8A 2UZXB 2MCAA 2X1TA 1V7YA 2WNNA 1SNRA 4RMQA 3OGVA 4LP5A 3ECWA 4JVWA 1S4IA 4F7TA 2XZAH 1TPXB 4QNPE 1PEWA 5DRWA 4Q3MA 3S35L 5GGVH 4DQAA 1CTNA 2UUDH 1GKOA 1W3HA 5AOUA 3G6JE 1EHKB 4LRTA 1WF5A 4AWSA 5LGZA 3IT8D 5HYSA 4K3DL 4O02L 2Q0ZX 3UIYA 3BUBA 1XUZA 3QSKB 4JMXA 2PURA 4FJZA 1B4RA 3VRIB 3QFJA 1TVLA 4KI5E 4HJWA 1NFPA 1N10A 4FKKA 5DO2C 3ALXA 2A74C 1WDAA 3R89A 4HBQA 1OE2A 2G4EA 5DWUL 5GISL 1IQDB 5CJNA 4BBWA 1MCQA 1T66D 2EADA 3BQUB 4PCKA 4H9XA 1A1MB 1QABA 3AALA 2Y25A 1VFUA 3HZMA 4Z3GA 1ADQL 4JPSA 2F19L 5D1QE 2J75A 4GXWA 4FNTA 4MLJA 5DI8A 1IVTA 1AH1A 2YPVH 4REQB 3S3GA 5KBPA 2WGXA 1SUHA 3MV8A 4QRRA 4KNQA 1ZSHA 2EIDA 3ARFA 1QO5A 1XIHA 4F24A 5JMUA 4AT6B 1E9OA 5BRQA 5I6OA 3X12B 3DSNB 1TZ8A 5IWLA 2P8BA 4P0DA