4JL2A

Crystal structure of a bacterial fucosidase with a monovalent iminocyclitol inhibitor
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
438
structure length
438
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEKMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Exploring a Multivalent Approach to alpha-L-Fucosidase Inhibition
doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords alpha-L-fucosidase
total genus 164
structure length 438
sequence length 438
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4jl2A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4jl2A01
2VT0A 1CXLA 4GI6A 1O6IA 3OZPA 5E6ZA 1SMDA 2J79A 3VX1A 3AHYA 4PTVA 4PMXA 3S6TA 4HPGA 3RDKA 1KXQA 4GZJA 4AMXA 4ZENA 3WDHA 4WJXA 3BAXA 4M29A 2XVGA 4PTWA 4KWUA 3M6DA 2YOCA 4BA0A 4S3KA 3CO4A 1JGIA 1E55A 3RM4A 1G1YA 2X0HA 1DWGM 5I79A 1NP2A 3K8KA 5IXEA 6TAAA 4WSKA 3WEZA 1OT1A 2ZXBA 4UZUA 4MNJA 5GNXA 1PX3A 2GUYA 2WSKA 3ARXA 3LXAA 3UESA 3VGBA 2ZUSA 1NOWA 2DH2A 4QLJA 3AI0A 4P8XA 4FNPA 2D0FA 4LQ1A 4HU0A 1BGAA 1LLOA 1V6VA 2DIEA 3VOCA 1NOUA 1D2KA 5A95A 1PJ9A 2VRJA 3B9DA 4JKLA 4JFTA 2X0YA 5FCZA 1FFQA 3CLWA 3SCPA 1ZS2A 3OIHA 1H2JA 3U57A 4FF5A 1WZMA 3FHAA 1UD4A 3N17A 1JZ7A 1TE1A 3BAJA 3LRLA 1HJVA 2XM2A 1US3A 5CZKA 5DT7A 1NWSA 1W3JA 1V3HA 2PWHA 3VSUA 1GUVA 4WKHA 2VRKA 1BHGA 2G3IA 2F18A 3GM8A 3PZOA 4QLKA 4P7QA 1J01A 2NSXA 1OINA 4P8WA 3BAYA 3H53A 2W66A 5FKYA 2J8FA 1HKMA 3T0BA 2F8QA 3CHDA 4M1RA 5FOOA 3VIPA 3VTRA 1KR1A 2VX4A 4F8XA 1R46A 1IZJA 4XX6A 1XSIA 2EADA 3SUTA 1E15A 1QBBA 1CIUA 2Y5EA 4CD5A 3CZNA 3SUUA 2DT0A 2VZTA 4D1JA 4H2CA 2D3LA 1OD0A 1H09A 1CNVA 4HU8A 1GJWA 1R87A 2A3EA 1OD8A 2CXGA 4MAVA 1C7TA 4GPNA 4DUXA 3CUFA 4J3WA 1B9ZA 3GNPA 4TXEA 1DEDA 4NZFA 1EQCA 4F9JA 3GBEA 1ODZA 5FL1A 2ALWA 1L0PA 1OBAA 1FP9A 2E8ZA 4KH2A 1UWTA 1GNXA 3VD3A 2WWCA 2BHUA 3QOKA 4JFWA 4AZBA 4A4AA 3UEQA 3AHXA 2J78A 4OUEA 1QNPA 3BSGA 3WL1A 2UY5A 2PBGA 1U33A 3GZAA 4CD7A 4DO4A 2X1IA 2ZOXA 1VEPA 3UR7A 3DYOA 3BXWA 3B9EA 4PMVA 4U31A 2WWDA 4CUCA 3AZTA 3CZKA 1WP6A 1TCMA 1UD5A 3A3HA 1I75A 5D9NA 1UKSA 1V3KA 4YN5A 1KGWA 2Y8VA 3RIKA 3W29A 2VUYA 2CCRA 2YL8A 4AZCA 3MKKA 5A2BA 2VR5A 4UOJA 1BTCA 1CXFA 1QHOA 1E70M 5EFDA 3N1AA 1KTBA 2PI6A 2C0HA 2YA2A 2ZUVA 2TAAA 3K1DA 2FHBA 1UR8A 2JIEA 4TTUA 2D0GA 3CZGA 1NWUA 1E6XM 4AMCA 4OKDA 3BUIA 4H8UA 1HP4A 3QGVA 3BLPX 4JHOA 2BV9A 3VKKA 1BAGA 5E0CA 4OBRA 1JYVA 5A8MA 1NH6A 5M3WA 3VIKA 1UWSA 2WMGA 3BAKA 2VZSA 1QNRA 3W38A 8CGTA 4J3XA 1I1XA 1Q6CA 1W1YA 1JI1A 3AS0A 1V02A 4MTVA 1V08A 3VPLA 2J47A 3NIYA 1VBUA 3PTMA 3WH6A 1DHKA 2FGZA 1KB3A 4H04A 2XPKA 1XHGA 3WH9A 1B1YA 2YA1A 4U5IA 3DX4A 3I3EA 3VMNA 1VJZA 2ZUWA 4OOUA 5TD4A 1WAWA 4W8AA 2VQTA 4E8DA 2O9PA 1C7SA 2XN2A 2V5CA 2BS9A 3CH9A 1KCKA 1C91A 2F1AA 1R7AA 4ATDA 3MO4A 3SCOA 5IDIA 5AC4A 1GJUA 5LYRA 1OB0A 1F4AA 4PRWA 3TOPA 3GXFA 1H4PA 4KRTA 1E40A 2WMIA 2DT2A 1A47A 1XGZA 4J7RA 3CZEA 1WCGA 3IAPA 3GXIA 3SCNA 2WHLA 1XRVA 2GFTA 4UFLA 3WQ6A 4DWSD 3SCQA 1FH7A 1R47A 5BXTA 5ABFA 1HIZA 5IHSA 4CN1A 1E6PA 1CXHA 4BF7A 2UY2A 1BF2A 1E43A 5I5RA 2XN1A 5A94A 2YL5A 1Q4NX 3ALFA 2J7HA 4P7LA 4HOZA 2WB5A 1CTNA 4GXPA 2JEPA 1DWFM 1XYZA 4D6JA 3MUAA 2W61A 5A6SA 4MNLA 3W4RA 3F5JA 1WZLA 2WZHA 4FLSA 2VCCA 2E0PA 1TQVA 1BYAA 2EPOA 4CVUA 3AZRA 2WLYA 2F7PA 1V3MA 3CHEA 4Z2HA 2WVSA 3A24A 1PS3A 1UQZA 3W0KA 2PWDA 1JXKA 4FK9A 3OB8A 2CPUA 5A3HA 1VAHA 5HNNA 3MUY1 4UTFA 1W2VA 3MI6A 2VL4A 4TX8A 3W25A 4FMVA 3BUQA 3EDJA 4JFUA 2JE8A 3EDFA 1D3CA 1RPKA 1PX8A 1UR1A 1GOOA 4HTYA 2WAGA 1CWYA 1BFNA 4HOWA 1EGZA 2DSVA 2YIHA 3AIVA 3CIVA 4NRSA 4TVDA 1GOWA 3NUKA 4W7UA 2AMGA 1EDGA 1KQZA 3L4WA 1RH9A 1QHZA 1V02E 4P8VA 1UH3A 4PMYA 4HOXA 3SCUA 2YBUA 4D6HA 1NWTA 3WENA 2XYLA 3TONA 1E5NA 3WD1A 1CGUA 4TVCA 3WEOA 2DSUA 4AZCB 1C8XA 1KQYA 5CXPA 3SEPA 3EJRA 1BLIA 3GXPA 2CESA 2O9TA 4UFKA 4LYQA 2OLHA 1HL9A 2EABA 3PZGA 1JZ2A 4HZ7A 3ZJ6A 1C90A 5DMYA 1DWHM 4GI9A 3CZLA 2CETA 1IZKA 5EFFA 5HPOA 2WCGA 3GXMA 2CITA 2XTKA 3E1F1 4QCFA 1EO7A 3VVGA 1EOMA 1VBRA 1W1PA 3G6LA 4UCFA 5E9AA 3PZMA 3PBGA 1LF1A 5HPCA 5LA0A 3FAXA 3ZIZA 1ZL1A 5ABEA 3WDPP 2EACA 1BVZA 1V3JA 2D23A 1PZ3A 1NOFA 1A3HA 3AS3A 2WKLA 4PSRA 1V3IA 2J7EA 3OLDA 5CG0A 3HMCA 2VMFA 2ZWZA 3VMOA 4OZOA 4EAMA 1W9BM 3DX3A 4N42A 3HG2A 1W3LA 3LRKA 2CNCA 4W89A 1VJSA 4UOZA 4PMOA 4PMRA 1KBKA 2V3DA 1B31A 1J10A 4DO5A 5A6BA 1W9VA 4W86A 1HKIA 1W9DM 2BHZA 4NXKA 1GW1A 1JAEA 1BSIA 1UWRA 1VRXA 4ML4A 3EDKA 3VGGA 1PEZA 4IISA 3WQWA 5I23A 4R5EA 2VNCA 1HP5A 1DWJM 3KL3A 3KZSA 1SR0A 1B2YA 1MQQA 3W26A 5CQ1A 5HXMA 2OWCA 3RILA 1V0MA 3ZQ9A 2QLYA 1G9HA 3WMSA 1L8NA 1NM9A 1BG9A 1GVIA 1JZ5A 2VURA 1B3VA 3MMDA 3AFBA 5I2UA 2MANA 3TTSA 3K4DA 1UWIA 5EMYA 2ZXQA 3AMGA 5CPTA 1MW1A 3H54A 4HZ6A 3CUJA 3AHVA 3BVVA 2EQDA 4UFMA 2XVKA 4XZBA 5E1QA 3FNDA 2DIJA 2VRQA 4E2OA 2CKRA 4JL2A 4U2YA 3F4VA 1BYCA 3WMBA 3FN9A 1XC6A 2J7BA 4Q22A 3MMUA 1UA3A 1H0GA 4GZIA 1JYNA 1MXGA 1Q6DA 3WFLA 4D71A 2EPMX 1EO5A 3QR3A 2YFOA 2ZICA 5A6AA 1QHPA 1KGUA 3AXHA 1OSEA 1KR0A 5BROA 2UWFA 5A6JA 2G41A 4N0RA 4KGLA 3WF0A 4UR9A 5ABHA 2DDXA 4B16A 3G6MA 3AROA 1OGSA 4AEEA 3NSXA 4GI8A 1SFSA 4TTGA 3CPUA 3ZR5A 3RJXA 3AMCA 3GBDA 5CGTA 2VZOA 1TA3B 4P8UA 3FHQA 1NARA 3VD5A 1KBBA 3WD4A 2J25A 1HJWA 4OIFA 1KWKA 4AD0A 1UG6A 3APGA 3VD4A 2DSKA 1J0KA 4WIWA 3AS2A 4W7VA 5A6LA 1E5JA 4DWSC 3NDYA 3WNOA 2EJ1A 4YPJA 3BVXA 3UETA 5GQBA 4CU8A 3QOMA 4J3UA 2XGBA 2PWFA 5I24A 5A8NA 2O9RA 1CDGA 3POCA 4V2XA 4J28A 1T0OA 3BAWA 5D8WA 4DM2A 2PWEA 1HXJA 3QHOA 3VU2A 5CLWA 3WY3A 4MNMA 3OGSA 2BVTA 2QMJA 2BY2A 3DHPA 5AYIA 4IM4A 1UR0A 4JAWA 1ESWA 5KZ6A 2G3MA 1TFVA 5I3DA 3CTTA 2VVSA 2Y8KA 1E6ZA 1Z32X 2WVVA 4ZFMA 3WF3A 2DT1A 1XD0A 3A47A 3D4YA 5DFAA 3DDFA 2WC3A 1E6NA 4PYSA 2WLZA 5C8BB 3FXYA 1UOKA 1KTCA 1FH9A 1W9XA 1JI2A 5FD0A 4LYPA 1NWRA 2XWEA 1MYRA 2WSPA 4XV0A 1WDPA 3WBAA 2EAEA 4WSJA 3ARWA 3WQVA 1C3FA 3EYPA 2X2YA 5FL0A 5JBEA 2XVLA 4M82A 5GNZA 1C92A 4ACYA 2WC4A 3EJSA 4TOQA 4FNTA 1CYGA 3GYCA 3EMQA 1FHDA 1KFWA 1WZKA 3VO0A 2F7QA 3WD3A 5DT5A 1K6AA 1M7XA 2WMIB 1JG9A 1MXDA 2DH3A 2A3AA 3A23A 2DSWA 2X2HA 4MAZA 2FGLA 3RO8A 2YDQA 4NSBA 2VZUA 1S46A 2E9BA 2QMKA 1J0IA 4MADA 2VCAA 4BQ5A 1IT0A 1EIBA 2ZX9A 5A8QA 1HKJA 1VFUA 2D3NA 5D8ZA 1EDQA 3MU7A 1QW8A 1GQLA 3RMEA 1XH2A 1UR4A 2F61A 2WCAA 1CLVA 4CCCA 4ATWA 2F7OA 3WDQA 5GNYA 3W6LA 3GNOA 2YKKA 3NCOA 2OW6A 4FNUA 4UQBA 1WB0A 3SCSA 5C70A 4FLQA 3GXDA 2WHJA 1GHSA 2VC9A 1DWAM 4UNIA 3GXNA 3TTQA 1ODUA 4URIA 1VFOA 2E4TA 4UQAA 2V3FA 3N18A 4M8UA 1E4NA 1QBAA 1AMYA 1PX4A 4HMEA 5AC5A 1JZ8A 5E09A 1HKKA 4U3AA 4M24A 1FOBA 3UERA 3EDDA 2PWGA 1MW2A 1CGWA 1JDDA 2FYVA 3WNNA 2WBKA 1XV8A 3S5YA 3N04A 4J3VA 2ZX5A 5JUVA 3EBVA 4C7DA 4U5KA 5HDRA 4XUYA 3K8LA 3CZ8A 4DWSB 4J3TA 4GQQA 3ZR6A 2GJXB 5DEZA 4H8VA 3VGEA 4D1IA 4D72A 1XH1A 4FNQA 1TZ7A 4MPKA 5KEZA 3W81A 4JCMA 2D20A 3T2PA 3CUGA 3BCDA 1HNYA 4JZ5A 1E3XA 4RE2A 4GZEA 3L4XA 1V6XA 1UZ1A 2GDVA 1BPLB 1RP9A 3L4YA 4AZ7A 4X0VA 2VR4A 3WUEA 4AD4A 4TUFA 4CCDA 3WUBA 4QLLA 2E3ZA 4AXNA 2VI0A 3VIOA 2OSYA 2FE0A 2VQUA 4V27A 1WNOA 3AYSA 3DECA 2JALA 3WH7A 2J7CA 1K9TA 1UWQA 3D5HA 2FDMA 3BVUA 4QFUA 3WKZA 3LXBA 1LWJA 4JKMA 3BSHA 3HJEA 3WH8A 3QHMA 1UQYA 1CPUA 4FLRA 4P7NA 4P7OA 2XSBA 4LYRA 4NZCA 1YQ2A 4BCEA 2O92A 4B3LA 4WF7A 4S3JA 1ZBWA 3VGDA 2BY1A 1ZB5A 3W6MA 2ZXDA 2CBUA 2J62A 2XM1A 5ABFB 5D9PA 4MDOA 3IJ8A 2W62A 3RPMA 2XN0A 2X2JA 1H49A 1GQKA 5EBAA 3BC9A 2QV4A 3SCWA 3BH4A 3UCQA 4W87A 1TMQA 1B90A 4WLCA 3WNKA 4OBSA 4CN6A 1JD7A 4AMWA 4X9YA 1TVNA 4LGXA 1CXEA 3K4AA 2X05A 4PTXA 1X6LA 2CHNA 2QPUA 2ZIDA 1MQPA 4DWSA 3PZIA 1CXKA 1WDRA 4HZ8A 2CKSA 3O6AA 3ZM8A 1QPKA 4PMQA 4AD1A 1CZ1A 3KL5A 3IGUA 2Y24A 4UQCA 3OBAA 2OYMA 3DYPA 2QHAA 5ABGA 1V6UA 3WDRA 2G3NA 3S5ZA 3WNLA 3CMJA 7A3HA 3CV5A 2J75A 3D50A 5DO8A 3VD9A 3U5YA 1UWUA 1TUXA 2C7FA 2VJXA 1UA7A 3AJ7A 2OYKA 2XUCA 4BQ3A 1XSJA 1BQCA 1E71M 3TTOA 3ZMRA 4F9DA 1NQ6A 4HA4A 5A8PA 3T0DA 3MUZ1 5ECUA 2YFNA 1JFHA 1JL8A 3VSTA 3RCNA 2A3HA 3ECQA 2YL9A 3VD7A 1K9DA 4AY1A 1SYTA 3WF4A 4UZSA 3IAQA 4L4OA 3DDGA 2GSJA 1ITCA 1WDQA 3WF2A 1NP0A 3PZNA 4CU6A 4KRUA 3L2MA 1AQHA 3ZJKA 2J7FA 4AZIA 3WF1A 4FLOA 3MSGA 4PMUA 1GHRA 4Q7NA 2ZUMA 3WD0A 1N82A 1VFFA 4DUWA 2XFRA 3WQ5A 2EPKX 2CEQA 3LPFA 1RP8A 1ISZA 5A2AA 3VDAA 1XSKA 2VX6A 1TG7A 4PUEA 1FH8A 3CGTA 3UG5A 1H41A 1JYXA 2JF7A 3WFZA 1C93A 3T0AA 1I1WA 1TA3A 2BXYA 3PN8A 1CBGA 1QNOA 1JF5A 2VZVA 4AD5A 3QHNA 3ARZA 5E6YA 1R85A 1R33A 1U2YA 1QWUA 3L4TA 2AOSA 2CBJA 3A4XA 4QDMA 2CERA 4LX4A 1J18A 5AY7A 1E6QM 2GJPA 5BRPA 3NYDA 1GOIA 1K9FA 1E0XA 2V5DA 1CGXA 4AIUA 3AZSA 2E40A 5D4YA 1CGYA 3HN3A 3OLEA 4B9ZA 2ZX6A 3ZJ8A 1ISWA 3D52A 3ARTA 3DYMA 5JIPA 1QNQA 3WUGA 3BUDA 1G5AA 2XJ7A 1PZ2A 2BXZA 2F2HA 3A4WA 4PN2A 4MB5A 5F7UA 2WVUA 3HG5A 4M56A 1GPFA 1H11A 1OIFA 4PUDA 1W3HA 3VX0A 4W88A 5E0FA 3S2CA 1ZBVA 1AQ0A 3AIBA 3L4VA 3UG3A 4L4PA 1HXKA 4B15A 1V0LA 4UFIA 3WDJA 5M17A 1BYBA 3J7HA 2WMJA 3GTNA 4AYSA 3T08A 1UD6A 7CGTA 1DP0A 4AWEA 3ZT7A 3O2LA 1E1FA 3AXIA 2WW5A 2Q8XA 2F1BA 3OLIA 4AC1X 4NI3A 4FNSA 2J74A 2DGAA 3LXCA 4NX0A 2ZUNA 1HX0A 3L4ZA 3WSUA 4TX6A 2EBNA 3I3DA 3SCRA 2VO5A 4EANA 1HJSA 1DWIM 2QPSA 1UYQA 1E1EA 2W4XA 1QX1A 3DX1A 1J0HA 3D4ZA 4GO8A 1BYDA 4R27A 3GH4A 3POHA 2XFFA 3BLBA 2UY4A 3VIJA 2GK1A 3NDZA 2HVMA 3B9AA 2PB1A 1R7OA 4D6GA 4NRRA 4Z2JA 1ZBCA 3N15A 1G0CA 1PPIA 3ARSA 3MANA 4E4PA 3LPPA 2BY3A 4JHZA 3NSMA 4W5ZA 2IGTA 3UG4A 4AIEA 4Z2IA 5LA1A 5CSYA 4MDPA 2WC7A 3A5VA 1XH0A 5A69A 1HVQA 1GORA 2WMFA 1LL7A 3GH5A 4DM1A 5BRQA 5A6BD 1E56A 1VENA 4CU7A 1HJQA 1E72M 2D73A 2XVNA 1VB9A 5IHRA 1QNSA 5CGMA 5I78A 1H1NA 4RE3A 1VFMA 3VM5A 2ZE0A 3ZT5A 1R86A 2EPLX 2WVTA 5BXPA 1R8LA 1GOMA 2VX5A 2OWWA 1ISXA 3MSDA 1TR1A 1ZJBA 3PZTA 5BYWA 3DX0A 1WPCA 3OLGA 1GONA 1C8QA 3GXTA 3FAWA 3AISA 4K68A 1UZ4A 3W28A 1PIGA 3THCA 4H41A 1UUQA 3WQ4A 1XCXA 1HTYA 2XIIA 3BAIA 1VEOA 2YL6A 3AS1A 4AZ6A 4HA1A 2EXOA 2G3JA 2BY0A 3CHCA 3WY1A 3AIRA 5D9MA 3AIQA 5JBFA 5IFPA 4MJ2A 3WL0A 1ZBKA 1W1TA 4HA3A 4AEFA 3FW6A 5AYBA 3AXXA 1ISVA 1JZ6A 2DEPA 2PBOA 2J4GA 1PAMA 4KGJA 4ATLA 3AIUA 2XWDA 1PIFA 1V0NA 4YHEA 4F66A 5E70A 3AHTA 4WK9A 1BVNP 3GNRA 5CLTA 5C71A 2VCBA 3KE0A 1WO2A 4GKLA 1B3YA 4W7WA 3CZJA 4CVWA 1MW0A 1GQIA 2WNWA 3BMVA 2XIBA 2WCSA 4U2ZA 3BLKA 3IJ9A 2O9OA 5HBFA 2XHYA 2WMHA 2W91A 1CENA 5CPQA 2QF8A 5JIWA 4AD2A 3JUGA 1IV8A 3A22A 2A3BA 1HL8A 3K46A 3L2LA 3WNMA 1VF8A 3BCFA 1E4IA 2AAAA 3MV01 1TQUA 1MQRA 4PMZA 1LQ0A 5FIPA 4A3HA 1H0IA 2FH6A 3U7VA 3BGAA 3CUIA 5CPSA 2FHCA 2V3GA 3TTYA 1EXPA 1LL4A 3LX9A 4AW7A 2VTFA 2WHMA 4H8HA 4NXSA 4W8LA 1GCYA 4LXFA 3AQUA 1GQJA 5M5DA 3WH5A 3EJPA 4ZE5A 2WVVB 1HF6A 1OT2A 1B3ZA 3MMWA 1M01A 3W53A 3VUPA 3ZO9A 1HJUA 4XZWA 3HU7A 3N11A 3WBEA 2ZUTA 1EH9A 3BUPA 1X6NA 4QAWA 3WELA 1J0ZA 5EB8A 3AMKA 1AQMA 3LPGA 3SURA 1JIBA 1GZJA 2DSZA 1QOXA 3N9KA 3M07A 1JAKA 2EPNA 3KLLA 3D51A 4HMCA 2OW7A 3AMLA 2D2OA 1XCWA 1KWGA 1EA9C 3W37A 1UKTA 4E8CA 2XVPA 2YA0A 2FHFA 1JF6A 1KGXA 2XSAA 3BMWA 1MW3A 2YLLA 1FHLA 1E9LA 1W1VA 4UFHA 1B30A 3VSVA 1KCLA 3KLKA 1ZU8A 5I6SA 1F4HA 4NF7A 4GO9A 4QP0A 1C8YA 3EMZA 2ZWYA 2E9LA 3HG3A 4W5UA 1W2PA 4GINA 2ZX7A 5JBDA 3LMYA 4XB3A 2WMKA 4MNKA 3K8MA 1OGBA 1GOQA 4W84A 4HMDA 2CYGA 2PC8A 3AYRA 1KXTA 5A8OA 3EDEA 4AISA 3WN6A 1QVBA 4D6EA 4D6CA 3VIHA 9CGTA 5A2CA 1HWWA 3MV11 1U30A 3ARYA 2D0HA 1KXVA 4JIEA 3W24A 1QWNA 3UR8A 3SUWA 1YHTA 3RM8A 5A1AA 1ISYA 2RGLA 4UQDA 2ESCA 3IANA 1J11A 1TVPA 2CBVA 5D9OA 1OM0A 4BZYA 2Z1SA 4QCEA 4UQ9A 3AMDA 4Z2KA 2HISA 1MVYA 1HT6A 3VDBA 3O9NA 3BVTA 4PSPA 2NT1A 3MS8A 2VOTA 1UR2A 1SZNA 1UKQA 4P7RA 3U5UA 3OZOA 6A3HA 4AYGA 3RJYA 3OG2A 3VMPA 4CD8A 3KL0A 3WY2A 2UY3A 1B0IA 2YJQA 4A3YA 4BS0A 2JIWA 3FY1A 3WQ8A 2CIPA 1Q6GA 4W85A 1UD3A 5LA2A 1JYWA 1WKYA 3M7SA 1M03A 3A21A 2W92A 7TAAA 4F79A 3T2QA 5A6MA 3T2OA 2ZUUA 3CUHA 1UKOA 3A6OA 3NSNA 1OGGA 2EEXA 3SIMA 1HN1A 1W9UA 4PMNA 1HVXA 3H55A 3W82A 4AIOA 1OIMA 3SUSA 1BGGA 4ZEPA 4D6IA 4RL3A 2W5FA 3VINA 2GVYA 2YDSA 1CXIA 4TVUA 3VM7A 3VIGA 1G01A 4UFJA 2WK2A 1E4LA 2GJXA 3PTKA 3I3BA 3EJTA 4RE4A 3DC0A 1J12A 1FP8A 5IFTA 4Y7EA 1QI4A 1E4MM 3SCVA 4JFSA 3ARUA 4AD3A 3BUBA 1V03A 2V38A 3VDCA 4CD6A 1G94A 3WNPA 3F5KA 2FH8A 2YBTA 3VNZA 4MB3A 2WANA 1LWHA 4W93A 3W27A 3VIMA 4AZ5A 2OYLA 1LG2A 3WUFA 3ARQA 1Y7VA 3WEMA 4EK7A 1JDCA 3VDHA 3THDA 2JEQA 3IK2A 5BCAA 2IXUA 3CHFA 3TV8A 2YDRA 4CKQA 1ECEA 3PZQA 2Y2WA 4KMQA 1QI0A 5GPRA 3KEHA 2E9MA 4V28A 1LG1A 1BG4A 2RGMA 2F7RA 2WPGA 2GK1B 3BVWA 2WZIA 1D7FA 4OJYA 4B3KA 2GDUA 1ITXA 2OSXA 5DF0A 4PMDA 5A6KA 2V3EA 1QW9A 4M80A 1JNEA 1MFVA 1J0JA 2NT0A 1P6WA 1QI5A 1XYFA 3ARRA 4B9YA 1E6SM 1WE5A 2X8RA 3EJUA 8A3HA 1J9YA 1O7AA 3A4AA 1W3KA 2W63A 5CSUA 2OSWA 2W67A 4MB4A 3SCTA 4D6DA 4GQRA 3EJQA 4ZXLA 4WKAA 3EMCA 1KXHA 1ZJAA 4JFVA 2D1ZA 4PTMA 4X0NA 3N13A 2G8ZA 1E0VA 1LJYA 1B3XA 3PZVA 4W8BA 2BNJA 4UQEA 2CBIA 2Y4SA 4J3SA 4CN4A 1UKPA 2G4FA 4DUVA 3PZUA 1UH4A 4UOQA 1MWOA 5I77A 4D6FA 1M53A 4ACZB 4HP5A 4OGZA 1WDSA 1UH2A 4PBGA 5BXSA 2IXVA 1WZAA 4PEEA 1V6YA 2D22A 1Q6FA 1US2A 1V3LA 2C8NA 1CEOA 4LPCA 2DT3A 1CGTA 1JFXA 4JKKA 1EHAA 1CECA 2NW0A 2JFEX 3VGHA 1MFUA 1K9EA 3RM9A 1DTUA 4ZXOA 3DX2A 1J0YA 3VIIA 1V6WA 3MUIA 2BHYA 1PBGA 2ZX8A 3T09A 4Z2GA 1E3ZA 1FFRA 1JZ3A 3DHUA 1JXJA 3ZT6A 4M81A 4WKFA 1JZ4A 3F5LA 4CD4A 1EHNA 2J77A 4ACZA 5HOSA 2BFGA 1OCQA 4FNRA 3HZ3A 2WBGA 3D3AA 1CGVA 3WIJA 3ZSSA 3VGFA 1AVAA 3AICA 3WMCA 4NZJA 4EE9A 2B31A 4DO6A 2XG9A 1UASA 1EQPA 3VIFA 3ARPA 3AIEA 4CGTA 3ALGA 4C7GA 2GJRA 6CGTA 3TP4A 4Z2LA 1CLXA 1QI3A 2A3CA 2E8YA 1UD2A 2WXDM 3TA9A 1VEMA 1UD8A 4HPHA 1W32A 1FA2A 1VIWA 4YHGA 2JF6A 3SUVA 3VILA 3WDIA 4AZGA 3ARVA 1O7DC 4IPLA 4PCSA 4PCTA 4AZHA 3IJ7A 3HG4A 1HJXA 3CBWA 1GOKA 3KWXA 2WYSA 1JD9A 4H7VA 1TQWA 2BVDA 2DQXA 4ZE4A 1SMAA 2WZEA 2VX7A 1W91A 2J8GA 5BXRA 3AIWA 5I0DA 3M46A 5CJ5A 1H5VA 3ZJ7A 2WHKA 1V0KA 1H3GA 1UHVA 1B3WA 1R34A 1TQTA 2XFYA 3AHZA 4JL1A 3LRMA 4J27A 1GVYA 1JNDA 3CZSA 4JCLA 3GH7A 2VVNA 3CMGA 1W9PA 4CCEA 3OGRA 2YLAA 2PF0A 5M03A 1LL6A 4U3CA 2XGIA 1EDTA 1OWQA 4MJ4A 4IPNB 1QI2A 4GIAA 2WM0A 3LPOA 4IUGA 3N12A 2Z1KA 2DPEA 5BWFA 2WKGA 1EOKA 1XD1A 3VNYA 3L4UA 3AOFA 4U33A 2OWXA 2D24A 2EO7A 1JDAA 3PTQA 3OA5A 1RD6A 1E0WA 3OGVA 4MB1A 2IUZA 1E6RA 3PHAA 4C7FA 2BVYA 3CC1A 4BQ2A 2ZXAA 3II1A 1E73M 3ZSTA 3GDBA 3U7BA 1M04A 4EKJA 3WD2A 2X2IA 2X09A 3WY4A 3PZ9A 2J7GA 3NJ3A 4BQ4A 4OOZA 2J7DA 1R75A 3ZOAA 1X1NA 1UR9A 1Q6EA 2CHOA 1TQSA 3B8SA
chains in the Genus database with same CATH superfamily
2VT0A 1L6XA 5AW9B 1FFPB 2F15A 2DQTH 4ZRGA 4CADA 4NCC1 4DTGL 2ZOLA 1GJPA 1ME9A 2ACQA 3RJDA 3NM1A 1OW0C 1A3RH 3VQ2C 3ALPA 3B9KC 3HNVL 5DRNA 3GG7A 4IX0A 5IW3A 5E6ZA 4A7GA 2HTLD 1RSCA 1FI8C 3SDCB 2ZZ1A 1NC2A 3IDJB 4KHTH 3N9SA 5EC1B 1OTUC 3MTRA 4IHCA 5KSUA 3PANA 2GY7B 1KXQA 2WSDA 4KFOA 1N2RB 3QIBC 3S3JA 1SXAA 2WV3A 3QUZA 1AH1A 1MZZA 1YG9A 4RPQA 1J8HB 1SXNA 3JV4A 3R8BB 2CLKA 2XVGA 4MCYA 3M6DA 4FZIA 5LNVA 4P23A 2YOCA 3WSQL 4S3AA 1RZJH 3KPSB 4A2GA 3CU1A 3SBWC 1T89A 2HJLA 4QG6A 4Z0XA 3PPGA 5HHXL 3QRGL 2GJJA 4GLRI 1NP2A 1UWEL 2JKRM 3K8KA 4WJ8A 5IB2A 4NAJA 1F41A 2ZWKA 1XDTT 2EXWD 2KT6A 4A2FA 1M7UA 1LK2B 1W2KT 2VRAA 1MCPH 4YOKA 4E9TA 4LSUH 3QZMA 4N6RB 3BIKA 3VFRA 4A2LA 3FJ6A 2XQBH 3OKNA 2VEMA 4ECLA 4LASL 3VQMA 1WFIA 1FPTL 7PTDA 4F0MA 2PRLA 3F7LA 1JZFA 1ADSA 2JV6A 3WTXA 4AL8H 1YN6A 2ZUSA 3GIVA 3VGBA 4K6AA 4E3VA 2VXUL 2E56A 3L16A 3W2UA 4B5SA 4TV6A 2K3HA 1XTMA 1XIIA 4ABWA 1ZP3A 2WZTA 2O26U 5IIEB 4E9LA 4MBRA 1PZSA 1ONRA 1RA0A 1V4YA 2WMPB 2Q02A 3E5BA 2BWIA 1O0VA 2B39A 3D34A 1IR1A 3ARBC 3TIDA 1OW0A 1BGAA 2ZBTA 3PFUA 1T21B 1LLOA 1V6VA 2R1NA 3FU5A 4XO6A 3VOCA 1J5HA 5IFHL 1BEUA 2ROYA 5LXVA 3W07A 5G1YA 1MF2H 1N18A 4KKAD 1PQZB 4QKTA 5DFWH 5I28A 3TYAA 2BFVL 4OKVB 2X0YA 3SJNA 2AXGB 1FWBC 3AJXA 3KRZA 5T1JA 3W7LA 3FFDB 3NCYP 4X5WB 2CHRA 4Y7MA 3U4EB 2P28B 5HDBF 3LCWA 3OIHA 3MRCB 3A67L 3BX7C 1LO5A 4PJCE 4ZODA 5FUOH 4FF5A 1FRBA 1X5HA 2B1OA 2DQUH 3BRFA 2Y0FA 3NQGA 4LAZA 2DQHH 2NUXA 3MOQA 3CM4A 1YRKA 4WVXA 3ZXWA 1OZUA 4YXLL 4JHMA 2DJXA 5CZKA 3SQRA 2BWQA 1NWSA 1XGDA 2BIIA 5E9XA 1W3JA 3CNKA 3CSFA 3HGSA 2QADC 3ZVHA 4WY7H 1NUFA 3VSUA 3V0GA 1GUVA 1IC4L 2IQ9L 1XLDA 1TE6A 2PP0A 3ULAB 2Y7MA 4H5SA 1EC9A 4MLJA 4WKHA 2BWDA 4N5UA 4ODWA 2PCFA 2R29L 2V0AA 4AYBA 3I74A 5DBTA 4Z17A 1UM6L 6PAZA 5K9QG 3CDYA 5ACZB 2BSEA 3FT2B 1LUCA 3H53A 2X9WA 3MODL 4ESKA 1HKMA 5DK0B 3H7RA 4K15A 1U3ZA 1IT9L 3CHDA 2NUPB 4M1RA 3NSYA 4AIOA 1KRCC 2ZONA 3AQYA 3CVDA 4J2PA 3MC0A 5IB3B 5EC1A 4ANXA 1S2EA 4YHNA 5FCUH 1KW1A 3ABXA 4Q4SA 2I9LB 1OTSC 4X7SH 4XX6A 2EADA 3NZ8B 1M68A 1MRAA 1INDH 2F8VA 5K1VA 1E15A 1N2RA 4GRWB 2DZUA 4JANB 4NBZB 3NZHL 3WKPA 4CD5A 3AQDA 3TC9A 1V5JA 1E6JH 3QS2A 3GUGA 4L4VE 2J44A 3V0DA 4P23B 1S2CA 3DI2B 5AB9A 1CNVA 3CH0A 2PU1A 4IIBA 4PP1C 3O9WA 3QFJA 2A4AA 5FDWA 3DIPA 2A3EA 4QISA 1IAOB 4L4TA 1DJIA 1FVDB 1LRTA 1DE6A 1VQTA 3QCTH 4FP8L 3KD4A 5FR3A 5KANG 2IPFA 5AYTA 1OD8A 3UY7A 4Z7WF 4MAVA 4JPIA 1BGXH 1F73A 3N0AA 4J3WA 1L9SA 4MHHG 5BVJA 3BN3B 2CCVA 3MLYL 4DGIH 5IESH 1L9WA 2FJKA 1TZHB 1ETB1 2P5NA 3LD5A 4ENLA 4ADGA 2GZXA 3CX5J 1L0PA 2YZ8A 2W0LA 3V0FA 2E8ZA 4HC1A 2KMWA 3MOAL 5G4HC 3BZ5A 5JXQA 3DG7A 3UGVA 1UWTA 3FB6B 1GNXA 1OAXL 2LU3A 3RTQC 2N7AA 3P9MA 4B5ZA 1SHSA 1UGNA 1OYCA 4AC4A 4IW4C 4KK9D 3OB0K 4D8PA 2BSBA 5AC7A 3BLFA 3KRUA 5I1AB 1PZ0A 2QCLA 3P84A 4FXKB 1RIUL 4HBQA 4HEPA 4OB5L 5DQDL 3M6YA 1XLCA 4Y9AA 1L6YA 2W95A 2E5EA 4IIHA 3QAZB 4YDMA 1PYFA 1SU5A 3WL1A 2B4CL 3EGSA 2UY5A 3K3QA 1JXGA 1ZT7B 4X5LA 5IB5B 5BXFB 2CW6A 2X1IA 1UEMA 1MREL 4JGNA 3H2NA 1CB7B 3DUUB 1OCWH 4TNWF 4YWSA 3UR7A 4UBDD 4Q9RL 2PUZA 4HHPA 1J88A 3B9EA 4XRCB 3W9EA 4RDWA 1RUAH 3L5AA 1IFRA 1OZMA 4LQFL 4XB7A 3RG6A 4F15C 3QFEA 4G1KA 4ZTPL 4I85A 5F6HJ 3FO0H 4F2MA 1XDLA 5EY5A 3ZVIA 4TPRH 3S1GA 5CD5D 4ES4A 4RFOL 3MXVH 2DVUA 1WP6A 1TCMA 1UD5A 5L88H 3A3HA 3HURA 1MRCH 1PDKB 4Q6KA 3RGTA 4PI0A 1KPVB 2WLJA 1UKSA 4K8RH 1V7NH 5AL0A 2ARWA 1HHJA 5DHYB 2PDCA 4NQTA 3NZ1A 1ZS8A 4WU7A 1JCXA 3GTXA 2NY5L 2VFHA 3LU2A 5K59E 3DETC 4BZ2A 1RZKC 5HHPB 3ZE2F 3OAZK 4FEIA 4V1DB 1QSZA 1YUHB 2VUYA 4AEHL 2CCRA 3GSQB 4I3SH 2XZAL 5A7BA 1N0XH 4MMZB 3SRFA 1RFDL 4KERA 1L7TL 4NUGL 5DK0A 1Z48A 1TCDA 1E70M 1N6QH 1KTBA 1M4KA 2PCXA 3C5JA 3CFBA 2PI6A 2YA2A 4K2UL 4KPHH 4L5ZA 5ENLA 3T8QA 2TAAA 3M8OH 1NQKA 2NY6C 1I7TB 2QGBA 3NCYS 4TMPA 5IBLD 1I82A 2I9LA 1E6OL 3MVSA 4TTUA 4LL9A 4HNNA 1ADQL 4G9DA 1CT5A 1E4JA 4JO4L 4AMCA 3P1VA 3L3GB 4K7PL 1CURA 1JBJA 3ATYA 2NY2B 3BZFA 4N1CA 3QGVA 1HP4A 3STFA 1VYRA 3N40P 4PGDA 4PR5B 4ELMF 4DP0X 5E0CA 4QRTA 4OBRA 2AJSL 5FYKL 3D2UB 4JG9A 4NUJA 1JYVA 1UWXH 1GPOH 2Y6ZA 5HQEA 4UQ3B 2EZ0D 3VABA 5M3WA 3W75A 1Y65A 4PS4H 3ZMEA 4HS8L 4XNZB 2CA3A 5E2TH 3W38A 1WFMA 5D6DC 2HWGA 3S5LG 1M1SA 3P2VA 1LROA 1TJHL 4GX9A 3EFFB 1TG8A 3ETBJ 5DZLA 1JMXA 4LAKA 3OHMB 2CU9A 3AS0A 4U6XA 3CG8A 1UACL 4LBSA 2H1PL 4XVUC 3SZ8A 4HKJA 3EEZA 3QH3B 3HI6L 4ZUWB 3PTMA 1Z3GL 4CNNA 4M93C 3QDMA 2BGQA 1DHKA 5FGBA 4G9FE 5CPMA 4M62L 1WIUA 3QULB 4NO5B 3RRQA 4U1LB 3THML 4JFFA 3ZHDA 3SW6A 4NS0A 3HC0B 4BV1A 3UYIA 3SY0B 2XPKA 3KBNA 3KTSA 4QROA 4XPBH 1JQVA 4X5RA 1B1YA 3WJLC 1YC7A 2BIQA 4OCXL 1LO0H 4EOUA 3TT1H 2VDOB 1Q0XL 4KTEH 1GYAA 1Z9NA 3II3A 3INOA 1YPIA 4AEIL 1XI3A 2XV6B 3HMXL 3QEHA 3UGUA 4KO6A 3VI4B 2ZUWA 2JB5H 1RJLA 1S7VA 2P52A 3Q01A 4Q8TA 3HTWA 4W8AA 5IY5B 3EH4B 4XMLL 3EUDA 1TTRA 2FATL 1NWOA 2PTTB 4MA8L 5FO9A 3KXFD 4NOFA 3FSAA 4PLJD 4E8DA 4IU2B 1MWAH 4N0UA 3IJHB 3KW3A 4PB4A 2WZPD 3T0VA 4RRPA 2KPWA 1EBPA 2F1AA 3SN6N 1A1MA 5IKCA 4W1TA 4UTCA 3NK4A 4KKBC 3MLUH 4AGLA 2HMCA 3SDDA 2VC2B 3K7UA 2XXMB 1EVTC 3HCVA 2BP0A 1O68A 1P5UC 4LUTB 5D1ZC 3S1UA 2K7PA 4RMVA 1RSFA 2NXZD 4PRWA 5LSMA 3GXFA 1Q9LA 4KRTA 2HT2D 2IQAA 4F0LA 4M7LL 3NZUA 1XRTA 4PM1A 2WMIA 4J12A 4LAMA 3A9BA 2QQLL 1OP5H 4R3SB 4Q4PA 3SQOH 3KBJA 3MQTA 1WCGA 3IAPA 2VDLB 1VLWA 3QZOA 2GFTA 3WQ6A 4JR9L 4ERSH 2QCCA 1FKXA 1KJ2H 3H7BA 1FH7A 1P1XA 2ASHA 2YRLA 3HFMH 3UGRA 4GFXA 4A8IA 1FH2A 4HGWB 4IMLA 2I16A 3AW5A 3OTTA 4URTB 3HUJB 2XWTA 4Q3MA 2OZNA 3GS4A 1OP9A 4L8DB 3RTQB 4E9VA 1NBYB 4GX8A 4Z1PA 2NZIA 4JX4A 1E28A 3IARA 4BF7A 3TYBA 4FADA 5A94A 1YZZA 3KPRA 4LCRA 4XP4H 1H15B 3VFOB 1QR1B 2YL5A 2CJUH 3X2QB 4BHYA 3E2HB 5DU7A 3TA3A 2I07A 1PLGL 1DO5A 2Z7WA 4UTBA 2VDOL 5BQDA 2PZNA 4XP5H 2C9RA 4MMXA 3MV7A 2YPVL 4ZMQA 2Z3FA 1ZHKA 1DWFM 2VLKD 5ID1A 3QNZB 1M1BA 4D6JA 3VG0L 5D33A 2IAAC 3QNFA 4KKPA 1EWDA 4RZKA 1R24B 1REIA 1WZLA 4DETA 2KAUC 3R89A 4JRXD 3EZ4A 3QPYA 3R4IA 5K4ZA 4FLSA 4GBXB 2JK5A 4PJXA 2VDQL 1I7UA 3RWGA 3FN0H 5FYLH 1BD2A 1S8DB 4LP8A 4U1KB 4B9IA 5G1TA 5H94B 1AO7A 1AGBB 3J07A 3QIUD 1A53A 4JN1L 4NJKA 2C9QA 2JTDA 4LC8A 2KDGA 2WLYA 5DJ6A 2YCEA 1V3MA 1R3WA 2HS6A 1HDMB 3CHEA 4JFFB 1E27A 2WVSA 3A24A 3UYOD 4F7EB 1ZY9A 4GMSH 2QIIA 1EJ6A 4OLXL 1I7ZB 1N64H 1QTSA 3W0KA 2PWDA 4I0PA 2Z4QA 4NJGA 5DCCA 3US9A 4OD2B 2WSRA 4LSBA 4QRFA 4GRSA 3W2KA 5A3HA 3KAAA 4XMZA 4EBQH 1VAHA 5LAXB 1GGOA 4XPHL 3WLHA 4DF0A 3NCCB 5B8CB 2A77H 4NQEE 2IFFL 5LGYA 2CU0A 4UTFA 3MFFA 4UI2A 5CUSH 3Q1SH 2D4DA 3G6JB 3V6OC 3EDJA 4ADJA 4QO1A 4FR1A 1NBVL 5E8PB 5ABAA 5HYSG 1G7HB 3EDFA 4NM4L 3VWKD 1V51A 3Q58A 1MF2L 4JFZH 4LLAA 2BSTA 4X6CF 1RPKA 4UTAH 4HZLB 5EORH 1CK0L 2G9HA 1UR1A 1GAFL 1NCTA 1DL3A 1GOOA 3QFWA 3W74A 2WAGA 1XF0A 1EEPA 4IJBA 2ZUXA 3NQEA 2DSVA 2POTA 4TVSa 4RDQG 1AHWB 4YR6A 1ED3B 3SDAD 4TVDA 1FLTX 2VFGA 4GRLA 4NRSA 3WIIL 2MUCA 1MLCB 2XC8A 1FVPA 4C6MA 3QF0A 2AGJL 4RE0A 3MKCA 4ZSTA 1Z69A 1NEZB 1JPKA 1RH9A 2C7UA 4P8VA 3BPWA 5D70H 4D9RE 3HOGA 4RDBA 5GS0L 2E3VA 4GYPA 3QH2A 1R3KB 3N2TA 4LCSA 4YNGA 5FLUA 3HF3A 1GGIH 3AGWA 3Q8AA 3KYKH 1U8LA 3QUZB 4JJHA 4PS7A 5CILL 2Q86B 5A2KH 3JV4B 5FUCC 5ICZA 2W0UA 1JPST 4TVCA 3CL6A 5EA0H 1XFPA 5IMMB 4YVXA 4AI7A 1KQYA 3T6CA 4R83A 3RTQA 4L8DA 4AT6A 4R90H 1LQSR 3QZWG 2WQVA 4HWUA 4K8RD 2GVGA 3VB8A 4B7IA 4S0HA 3KYOB 5CP7B 5JW3L 2W27A 4KESA 3KPRB 1Q8AA 1HK6A 5IB1A 3ARFB 4FQXD 4HCIA 1YW1A 2ZTBA 2XACC 4N6RA 4MY9A 2O9TA 5I26A 4U0QB 4I1NB 4GAAA 4PJEE 3GSWA 5JNYA 1JZ2A 1L6WA 3TH4T 1NL0L 3S8GB 3GZ3A 2JH2A 4BCZA 1E1CB 3MKGA 5HYFA 4YQXL 1DWHM 4GI9A 4E6MA 4NNXB 3P4MA 5EFFA 5KTLA 2QKSA 5F4WA 4KPLA 1RUSA 2CITA 2QTVA 1Y0LA 3E1F1 1UEYA 1WAEA 2JFCA 3LCGA 5MKGB 5KMYA 2PO6C 3OXRB 1EOMA 1KTDB 4UCFA 2LE9A 5CBEB 3FMGH 1HXYB 1S7WB 4MLIA 2PDGA 3CZFA 1CF8L 3NOIA 4WSGA 1F6YA 1U2CA 3MY9A 2XQYG 1KB5B 4X98A 3G5ZA 4YIQA 4IKIA 4ZFGH 1EAPA 1H7PA 4NN6C 1VADB 4MJ5A 1K6QH 1ESOA 4YXLH 4X4YB 5IV2A 3EO9L 3KM2A 1R3YA 3A64A 3OPZH 4S2BA 5J3HD 1FWHC 1IKNA 2WWNA 3JTSB 1Z9OA 4O02A 5AKTA 5KOMC 1W1A1 1BDYA 2BMKA 3ES7A 4X9SA 3QJQB 4IOSA 4LCWB 3REQA 1H5BA 5CAHA 3X14B 2LVEA 2CLFA 4ZFOL 2ZT9C 1HHKB 1I4FA 3OLDA 4K0OA 5F1NA 4KFMA 1F3WA 1G6CA 1NDYA 3B0XA 4AC7C 4XI5D 1I9JH 5GRVL 5T5FL 4OE7A 3ARGD 3HE7B 2ZWZA 5SWQA 1SVBA 3FSZA 5E08H 2FZ8A 5D2TA 4EAMA 5CC3A 1UJTA 4MSWB 1KC7A 4BWTA 1EZVX 5ILTL 2CNCA 4L80A 1RVKA 2C3XA 1VJSA 2XN9B 3PL6B 4UOZA 1B31A 2Y1ZA 3VFWA 3KMDA 1W9VA 2C1HA 1W9DM 3FK4A 3RY6C 3IXTB 1CL7L 1JAEA 3LMJL 3GIYA 1UWRA 2CO2A 1O1HA 3Q06A 3R1GL 5GRVK 1GY1A 1TSIA 1AFVH 5ECJE 1PEZA 4HXAH 4YVNA 2NW3A 5IF0A 5I23A 4H6EA 3UYRL 5FK9A 3SECA 1AH0A 3S9ZA 1HP5A 1DWJM 1SZEA 3M41A 4UNLA 1OSZA 1SF5A 3KL3A 1CE1H 1RJYB 2X4SA 3TYGL 5KBMA 3W1LA 4JFDE 2X4TB 1P7TB 2EO9A 5HXMA 3VXRA 3UMNA 2WSQA 3RILA 2NUTB 4UT9L 2WZ5A 4MWAE 1TNNA 1BZEA 3ARGB 3HE7D 1B57A 2R51A 4KFZC 5F8RC 1L8NA 3E9AA 1XGRA 1NM9A 5IBLC 2V7NA 3TN0B 3T78A 1BG9A 1JZ5A 3R0UA 3VWJA 1MG2C 4OZGB 5I15H 3KCLA 3MMDA 2XCMC 3MRQA 2BK8A 3AFBA 5IVXF 3NQDA 4D8LA 3RHWF 1NM4A 1OF0A 1M7IB 1OK0A 3PIQB 5LAPA 1E6OH 2XG5B 2EYTB 1EVUA 3Q8FA 4HPYL 4K71C 5KSBF 5EMYA 1TPH1 2BOBA 4ZFQA 5CKAA 1YEWA 2H0PA 2R2CA 3OR6B 4PWFA 3S8FB 2OK0L 3P60A 3QMTA 4H19A 1Q2SA 1FO0B 1WWCA 2DZEA 4FQXA 1EIXA 5ACMA 4L8BA 4H00A 1H8SA 3BVVA 2EQDA 43C9A 4YHML 4TSCH 1I9RL 2XVKA 2XZCH 5ICYB 4XZBA 2INZA 3GLEA 4W9EC 4DGVH 1BYCA 2VZ1A 1F6AB 4XOCA 3C8KA 3UP1A 2J7BA 1MFEL 2NLJB 2NZ1A 2VMDA 4G1EA 3HBZA 3FRUB 4Q9RH 4RAUB 4W4QA 3LSOA 3F7QA 3EF4A 5DJ8A 5CBEA 3XISA 1IBBA 2DWXA 2DJLA 3WFAA 3MZTA 4LOVA 3BJLA 4MS8C 2B7OA 1JGEB 5FF4A 1S9XB 1I8JA 1U95B 4E4FA 5IJBC 3AB0C 5D1QA 3UXFA 3ZHLA 1T03L 4E41E 3F1QA 3UWUA 5I2IA 4NI6A 4FOMA 2XRAL 4NQDE 4OLVH 1OCOB 3MXVL 5D05A 4E36A 1DXEA 3N1FC 1Z41A 4LVOB 1QHPA 2HNEA 1QYGH 1TPXC 3JV5A 1O6SA 2Y7EA 2JI3A 4O02B 5H37A 3R5EA 5BROA 3GSUB 1VLIA 2O56A 4X6EB 2Y8UA 2V67A 1ZVYA 2CCLA 1PDKA 4G6MH 8RUCA 5KVEL 3T2NH 2UWFA 3LCYA 5KETA 1HSAA 5AL8A 4S2SA 3U46A 3V5FA 3QUZC 3WKQA 1I4FB 1AG0A 1HHKA 1EXUB 5F1NB 1N0XL 5IUCA 2G41A 4M19A 4POCA 1W8NA 4MHHI 4G1MB 3WF0A 2JB6A 1UA6L 2C9VA 5E2JA 1ACYL 3VXOB 5AVVB 3ZKMD 2K6YA 4B0MM 1DIEA 2FZDA 2IH3A 3HA1A 3N4FA 3W76A 3P30L 4YGVB 3FDKA 2ICWI 3KXQA 2XA3A 2FYMA 3T05A 5FYJL 4QGYA 2WZ0A 3BE7A 3G6MA 2CDGA 1KFGA 3AROA 3N1MC 4X42A 2C1OA 4WAFA 3ITCA 1F2QA 1DLHB 2APVA 1OT4A 1TVHB 4GAJH 4AEEA 4L4MA 2C9SA 2VDQB 4GI8A 4PU2A 3GJEB 1TPEA 3VUAA 2PDWA 4DVRL 3FVMA 1ADDA 3V6FA 3TZVD 3HRZB 4R7JA 3EJZD 7ENLA 1O75A 2VZOA 1UJQA 4AM0Q 3CFCL 1TA3B 4BF9A 3IVSA 1NARA 2XWJA 2LAGB 3PWIA 4Z1DA 5D1ZI 3WD4A 4LSDA 1HJWA 3A6CL 1M1XB 4TOYL 2F6XA 1KWKA 3HS8A 4N90D 2JVUA 2F5BH 2GTZA 2HLEB 4U6YA 2C14A 2OX5B 1J1OH 2I5YH 3JBG7 4BUGA 3VD4A 5E03A 4W9TA 5FYKE 4MJIA 2DSKA 2FYYA 4XNBA 5KVDL 4J35A 2O6CA 4X6CB 1EXBA 2ZQ0A 2APXA 2VDRH 4IMAA 3RIAK 4FF7A 4W7VA 1XX9C 5I0WA 4CNPA 1X7TA 3WNOA 3KYNB 5EEZA 4IBWA 1UXSB 3DSFL 3RWCA 3WHE0 4P4KC 4PS8A 2QV5A 5GQBA 3IJQA 3SY1A 2PTXA 3DI0A 3QOMA 2XGBA 4NJIA 4B90A 2EE2A 4FG2A 4IJ3B 5EBMB 2MTPA 4PV8A 3EX3A 1QUMA 3V1HA 5IEHB 2Z00A 3ABSA 2O9RA 1CDGA 2WQDA 3BKCH 3POCA 4CMHB 5A8NA 4CW1B 3KPTA 1ID5I 4FKHA 3TO4D 3EO1B 4J28A 4Z5RA 4GH3A 1TV2A 1R6VA 4J8QA 4ZGYA 3ZE2E 4R7NB 1MEXH 4U1HB 5C7ZA 3QKZA 1VSCA 2PWEA 3MJ9H 3QI9D 4G9PA 4QSFA 2TMDA 1JHTA 1HXJA 3QHOA 3PNWB 3RGVA 1HFBA 4TF4A 1GKEA 1LO0L 4PL2A 3EYSL 3QBUA 4GYJA 1UT1A 3DJ9A 4JTQA 1JGUL 4LVHC 4B96A 1IARB 4HWNA 2NZ9C 1O6VA 2BVTA 3BW3A 3QY6A 3V5HB 4IPIA 3TURA 1G9ML 1KFBA 5AYIA 3SY8A 4OLZL 4NCDA 3QUKB 4JAWA 3FQWA 3IV8A 3D39A 4IH3A 1PZ5A 3Q8CA 1R19A 1KYOJ 4X6BA 4C56A 2VVSA 4P3DB 3VXMA 1Q85A 4PRIB 1KGYE 2WVVA 4MBOA 3UIYA 5H4YA 4YLCA 5HHOB 2OULB 3K71A 2IGFH 5HHQB 3A47A 5HBBA 2WJEA 3D4YA 1ENUA 3KBMA 1FYTA 2EG7A 4M48H 1RQEA 4DCQB 2ADAA 1NCWH 4OGYH 3IGLA 4GC3A 3MHUA 3TK7A 3MRPB 3PGFH 4PRPD 4HG4J 5ADOL 2JIXB 2W0KA 3PCYA 1EKOA 1QNZH 4IQEA 3FXYA 5FA3A 1OV8A 5BNXD 1W0WB 3IACA 3IFOA 2MOQA 3L9CA 2XTJB 2CLZB 4G8IA 1FH9A 1K8DB 2Q5BA 1BYNA 1YMHA 2BNUB 3RHWK 2NQDA 1DQLL 1TYRA 1BTMA 5M2FX 3GGWB 1CICC 5DRNB 3KPSD 2WSPA 2PF6A 1U42A 1RUPH 1EEUA 1IILE 4GKSA 3VXTA 3IB4A 4DN4H 2O4QA 5D1XE 4X7DC 1JCVA 2C1OB 3INUH 5F7KC 3TA4D 4HULB 5IP4A 1SXSA 4ZS6C 3QV9A 4PL1A 1I8AA 5T1KA 2X2YA 4NM4H 3FT3A 3OKKB 3TPKA 4NAMA 4HEME 1XWYA 3O06A 5J12C 3H2OA 3OIXA 4M82A 3QIWA 1B9BA 5JQIB 2WC4A 4TOQA 2A6IB 3D87B 1CYGA 1J7VR 1YDYA 2FMOA 5F7MC 1E5CA 4PCKA 4BEQA 4NN7B 3IWUA 5JXED 1WZKA 1M1XA 3I75A 2QGHA 3HNTL 1UWYA 4U6YB 4PJ5A 2QSQA 5I1EH 5M7QA 1FNEB 2ZOLB 4X8CA 5DT5A 2JELH 1M7XA 2UV8G 2W81C 4PJDE 3S37H 5IZ7A 2GI0A 2W94A 1E65A 3CPGA 4FAMA 4DPCX 3D85D 2OZ0A 2FLRT 5HJGA 4ZA0A 1JG9A 2DH3A 2GEQA 3A23A 1IWAA 5JHDB 3HG1A 4OD1H 4RFEA 5KSUB 2A7PA 2DZXA 4NASA 3H9SA 4IRSB 5LCVH 5CEZE 3C6LD 4HK3N 1RY7B 1ZXKA 5DD1L 1QWHA 2VZUA 2OELA 2DIBA 3CXDH 1TQBB 4LK4A 4GAYA 2V2WA 1SHWA 3ZKXB 2C34A 3RZCC 1IT0A 3LV3A 1A8JH 2J55A 3DBNA 1FE8H 2E74C 2GPTA 2CA4A 3NQKA 1ZWIB 3CQQA 3CAQA 1ETA1 2D3NA 4Z0BH 3IDYB 1OFBA 1C5DA 4HQQH 3N9GH 4XNYL 1DVFB 4KO9A 2HMID 4Y4HC 3FFCB 5JDJA 4N3TA 2Y36L 4F1ZA 1AQKL 1D6VL 2KDYA 1UR4A 3MJYA 1SLVA 3T8LA 5JYLA 2OCZA 5GNYA 2G75B 4L8CA 4IL0A 1HKLH 1XYAA 1G69A 3NA8A 2F9BT 5HJ3A 1A22B 4UQBA 3SCSA 1KC5L 5C70A 3GXDA 2WHJA 3E02A 1QUNA 2VC9A 4QUOA 3SOTA 5M94B 1DWAM 1OAKL 1IEBB 3DRQA 4UNIA 2WTRB 1FO0L 3UJ2A 3TTQA 1PKQB 4LU5L 4URIA 1Z1WA 4L3EE 3QA3A 3VCCA 4UQAA 1S5WA 1FG2A 2V3FA 3ITXA 1MEHA 2D7TH 2YCLA 1G7HA 4L2LA 5KSAD 5G4OA 5HQMA 3NQ8A 3CSYB 3QRHA 3QM3A 4AEOA 1AMYA 3WIIH 2P5EB 5SWSB 1RCQA 1MCLA 1E51A 3FKKA 1GMIA 2I9EA 5HNTA 3OO2A 32C2A 2OMAA 5F6HI 5I73B 1LE5A 4A7SA 1THFD 4U3AA 4Y5XA 1AIFB 2NXZC 3PY9A 4ZCWA 2PWGA 4OZ4B 4ABQA 4F8NA 1TT6A 2FYVA 3QMRA 3VE7A 2DTSA 4NP4H 3WNNA 3QDGD 3IN2A 4FXLA 2PS2A 3ZX1A 4N2HA 4TQIA 4Z08A 2JJTA 2YD5A 1SZRA 3N04A 4LRNH 3VFVA 3QXBA 4ALDA 4XCYB 1LVEA 5B21A 4Z7UF 4Y88A 4AE1A 1TO4A 1ZLEA 4HJ0C 4U5KA 1XL4A 2P3ZA 4H6RA 2J43A 2YMOA 4H5SB 5EN2B 2K6WA 3NWRA 1K2DB 3TJ4A 2EZ0C 4DWSB 5I74B 3N29A 4IFOA 1FF5A 3UZQB 5LIKX 2GJXB 5CLZA 4LYKA 3SQBA 3FQTB 5E6IC 3RI5K 3FCPA 3G24A 3WEXB 4M5PA 1OFOA 3O8XA 4X4ZA 1N7ML 1VGKA 3F7PC 3N85H 1EAJA 5HWMA 3UAJD 3PDOB 4ONVA 2OMXB 1P5UB 3W81A 4Z7QB 4JCMA 2WNXA 2D4FA 3T2PA 1RJQA 3V10A 3LLXA 3DAQA 2FWOA 3H4FA 4ES9A 1DBAL 4QOKD 5HYSB 4NQVA 3AITA 4AQ8C 2WPBA 4PEKA 5IM7A 5I0YA 4FTVD 1UZ1A 2AQ1A 3IDGA 2GDVA 1RP9A 2HK1A 4S38A 4BSWA 1RZIB 1CF8H 2ESVE 3X11A 1EX0A 3QFJD 5J3HC 3WUEA 5IROD 3TCXA 3WAKA 3VWKA 3WUBA 4QLLA 5TE4L 3T4YA 5H4ZA 2DQ6A 4L1WA 2E3ZA 4AXNA 4LJ3A 2OSYA 1E4XL 5C07A 1TO5A 3QB7C 1SLXA 1ZT7A 1DQWA 1C5DB 5JHDE 1F74A 3LCLA 3JTBA 1P7HL 2XPGA 2BOCA 3WH7A 2EH8L 2HXTA 3D5HA 1NGYB 2HBXA 2PFHA 1AXSA 1GZQA 1EJTC 3HBLA 4PJDB 1TZHA 1Z6KA 1XYBA 4NG3A 2X4RA 4TKWA 1A5LC 4F2MB 1Q45A 3M5ZA 2FR4B 1LWJA 2FX8H 1CD9B 3O6KH 4JM4H 2P3YA 4I5BB 4XPGH 4JKMA 3RAJL 3H8NA 3STPA 1I3RA 1FVCA 1KXTB 3LKRA 4PG9B 2GLKA 2QQ6A 3QHMA 5BMFH 2WO4A 4FQCL 1I8KA 5LGJB 1HHGB 3O8XD 4P7OA 1AO7D 5I1AA 4KDVA 3MRGA 4L3CA 2P5ED 4LPTA 5SWSD 5EIIA 5E8NB 2XSBA 3FJNA 5GS1A 5D1ZD 4KC3B 2KKQA 4B3LA 2YD6A 1ZBWA 3VGDA 2HUEA 5L6UA 4RMBA 5I6PA 2B4GA 4JR5A 4KDTA 3KBFA 2J62A 1XGUB 5ABFB 3IJ8A 2W62A 4HH9A 4Z76B 5F7EH 1AFVL 1H6FA 3PWPE 1J6PA 3TEZA 2YSWA 3B4YA 1AZRA 5GVJA 1QYGL 4XXCC 1T5KA 4XZUB 5DCEA 5LNGA 3FCGA 3U9UB 1KTRL 4DVBA 2AL2B 3RWJA 3OGOE 1MCEA 4IGBC 4W9KC 3ZTDC 4A2DA 1GVRA 3MCNA 4D0CB 1FIGL 2FECI 3BH4A 1J93A 1PVNA 2WOQA 4W87A 5ES4B 4YIWA 4RW3A 3W0WA 4KROC 4Q4IA 5F7LB 4K7FB 4WLCA 4WWPA 4LUJA 3TYDA 1T04B 4NPJA 4FD0A 1JD7A 1KV3A 4AMWA 4X9YA 4ZW7A 1TVNA 3JRKA 4FO4A 4E2DA 1YMYA 1GW6A 5K9KB 2Z35A 1U93B 4LVNB 4ZZFA 2CR3A 1Q94B 3MHFA 4PTXA 3JYBA 4XMPH 4QJ1A 4X61A 1QSVA 1X6LA 3MACL 2CHNA 4XNQA 5F7WC 2ZIDA 4B41A 1GXEA 4AWSA 4DWSA 5A5WA 4NUJB 3DGGB 4BWLC 2V7NB 2J8TA 3WTSA 2DZBA 4R4BA 5C3IA 3VWJB 4TUOA 3O6AA 1IAKA 4LEBA 3HVNA 3QFGA 4X2UA 3G5VA 3WEXA 4LY8A 1SYVB 2ZZ4A 4XNUL 3RLVA 1G6RB 2CLIA 1CZ1A 4PTUB 2XOTA 4F57H 2V5JA 2ZZ5A 3ZKXC 2R2HB 3QCUL 2X12A 5F7YC 1NC4D 4PJAE 2OYMA 1ITUA 5ABGA 2QHAA 2VJ0A 1MJJA 4J3OG 5BO1H 5CWSA 2QHRL 1JV2B 4ZUWA 3SE4C 3WNLA 7A3HA 2J75A 3D50A 3IGHX 3FA5A 1LL1A 1A9VA 3D3VB 1K72A 3VXUA 5IHLB 2FEDD 3U5YA 2WO3B 4DZ8A 4HUXB 2IDUA 2C7FA 2M8XA 3GIZL 4WI0A 2WBJD 3MV8B 4RMTA 4G71B 5IWLC 3EWCA 2HH0L 4CC4C 3LBMA 1HCVA 4XAWH 2OYKA 1WUFA 2XUCA 4C6CA 2UVFA 1J8VA 3TTOA 4KIRA 4KI5E 2IEPA 1TWIA 1PSKH 5ESAB 4BI6A 1EJFA 5TDPA 5I71B 1VGAA 2TSBA 1TPC1 3H9SD 1A49A 3C60A 3D5OF 1WUZA 1TNMA 5DTFA 5K93A 1QLFB 5HUPA 1INDL 1DQJA 4I9WE 3GRWL 2A3HA 4PJBA 4UILH 5E9DA 4K3EL 1MH5A 1YYMH 4LBAA 3FF7A 1K9DA 2OMTB 1HSBA 3U8GA 1I31A 3OAYH 3RWFA 2GT9A 3OPSA 4OLZH 3V8CA 3LK6A 1TIUA 2PPDA 5E2WH 5I8EA 5EOCJ 1XGYH 2QQNH 4H8WL 4P2QB 1KENL 1ELSA 1FORH 4A2MA 3T9WA 3FTYA 1XT5A 2BVOA 3ZQXA 3QUXC 3ROLA 3SDCA 3ZT5A 1LDPL 3P9WB 1RSYA 2A9BA 4WO4B 3QUMA 3LZQA 3CFCH 3L2MA 4F37K 4KRUA 4US5D 1NBQA 2WXPA 3WD5H 4LH8A 3VSQA 1IXQA 1ICQA 3BKMH 4JNMA 4L4LA 2L7EA 2R4RH 3QIBB 3SDCD 4AZIA 4DVBB 1I4NA 5F7NC 4PV9B 4FLOA 3PUOA 3IFPA 2H32B 4KQ4H 5AVWB 1GHRA 4Q7NA 4ZUSA 5T91A 1I8MB 1LOQA 3H2FA 3MRIA 2IPGA 1KYDA 4PVMA 1V93A 2NY4B 1F86A 2PCPB 3DSFH 3VRJA 1M57B 2KQMA 3NQIA 2XJKA 4X7CC 3EX1A 1EQWA 1BREA 1X7QA 1CQKA 2AVFA 4AYFB 5MENB 1JJKA 1A14L 4AWJC 1JRHH 3NCEB 4C1LA 3GVQA 3WQ5A 1TU2A 1VGEL 2WN2A 3DOPA 4OGXH 1RP8A 3ZL4L 5KSAB 1SOKA 3OAYK 5AUMA 1EO8H 5AD0B 1IUZA 4QM1A 3TTEA 4KJPC 4BK4A 2IQ0A 2HJKB 3RU8X 1TG7A 1NBZB 4AVNA 3CPLA 4BFKA 4NZCA 2ZAIA 3S3BB 2P9RA 3S96B 3EXLA 2JF7A 3OG6B 3WFZA 1U3HB 1C93A 1D7KA 3QEZA 4WFGD 3G5XB 1I1WA 2Q6ZA 2DLGA 3ARED 3JWNG 3KHDA 3PN8A 3NDYE 3H9YA 2Z34A 2WSYA 1JF5A 2VZVA 2DWTA 1UR3M 4AD5A 5IQ9A 4UAOB 1G4MA 3ARZA 5I9QC 3BANA 2HN7A 3KPMA 1K4GA 1U3YA 3E38A 3HQNA 3W1ZA 1FDYA 3L4TA 4HJUA 4ZZ9A 1JWSA 1NA8A 1UXMA 4PJ5E 3VRLF 2IDTA 3RGVD 2P76A 5BRPA 3NYDA 5LGXA 4LNRA 2JI1A 3EOOA 5F8QC 1MEWA 1Y6MR 2EIJB 1MNUL 1ETZB 2E40A 5LWYL 4GIRA 1TEGA 2V7HA 3GHRA 4PW4A 5MHSE 1MI5E 3LB6D 4PJBF 2ZCKH 2CALA 4XE5B 4UM9B 3K71B 3C60B 5DY3A 2YD7A 4H4NA 4U1GC 1LBLA 1FYTB 3DIFA 1EHXA 4DJFC 2IPTH 1BD2B 3SOBL 1JHLH 3ZE1E 1UWIA 4WJEA 2WJ5A 3BUDA 1NQBA 1PZ2A 3CHXA 1N8ZA 3NPSC 1R0AL 3EX6A 3VW3L 1M7DB 3HG5A 1EJRC 3LCIA 4PREB 4LFYA 1SEQH 3GT6A 2AEOA 1UYWH 4HJ1A 3B9NA 1JPGA 1W0VB 4PLOB 1AHWA 4WW2A 4E68A 1OIFA 4QWWC 3FFDA 1W3HA 4RR4A 4LCQA 3QQ9D 4W88A 4IK6A 3VRIB 4PH8A 3FIGA 3WIFB 1FAIL 4HOMA 3S2CA 2EINB 5DLMH 1XLIA 3SPHA 1VRDA 5AVXB 3S83A 4AMKH 4MZIA 3WS6A 2FQIA 2OTUB 4L4PA 3I84A 4XBPA 4LLMA 5BZWB 5T1DL 5AHIA 2FZ9A 3W7OA 1V0LA 3EWZA 2HT3C 1FV1B 3WDJA 4IDJH 2P80A 4I4WA 1MKFA 4H88H 4LSVL 1DBBL 2I17A 3DU0A 2OQLA 2KQNA 1HL2A 4AYSA 2P8MB 4AWEA 3HC3H 3ANUA 3SE3C 2DQCH 5MEND 5I1GL 1E1FA 1KLUA 2COQA 3QV7A 3AXIA 4GRWF 4UMSA 4N0FA 5TNVA 1CFNB 3LTVA 4HUWB 5CZVH 1FZKA 2F1BA 4MD4B 2Q8XA 4NI3A 3VNMA 1K3UA 4ZFCA 4D7PA 5EOCH 3D9AL 3LXCA 2R29H 2VW6A 1IGTB 1M6UA 1WHPA 3MRHB 3TEWA 5BNKA 2O72A 2QVMA 1WC7A 2F53B 3KGUA 3WZ0E 4R2GC 3NQFA 4GO6B 1J8KA 3RPTA 3TCEA 4TUUA 1V7AA 5HSFA 2BSED 2E7DA 1E90A 2KL6A 3UX9B 4M7ZC 2A4CA 1YLBB 3PL6D 3RA7L 5I8OL 1TPUA 4R96A 1ACZA 3DX7A 4CLMA 1YEJH 1E1EA 4H25B 2IANB 2O6DA 1NGPL 1XAUA 3D4ZA 4GO8A 1KTDA 1AHWC 3U1PA 1BYDA 3IUIA 4KCWA 3QQNA 1OWRM 1FWIC 2Y70A 4R27A 3IETB 4XX1E 5TQ0L 2O55A 3Q4DA 4RWYL 3NQ6A 2OMVA 4AV5A 4OZHB 5T1LD 1KB5A 3BLBA 4EZJA 5HY9B 3FA3A 3CDZB 1I3VA 2UY4A 2J2ZA 5HANA 4YDKH 2QGCA 2J8UF 1WAAA 3MJ6A 1UJ3B 4UF7C 5E6RB 1DR9A 3LQZA 2Y7SA 3UADA 4DJFA 4LE8A 1D7BA 1OALA 3L3KB 3FOMB 2AJXH 3FCBA 2AJYH 3DUSA 2PB1A 1HZHH 3UAJA 5DJCA 4OF8A 1XM3A 2B8OT 2CLLA 4FX8A 1EYEA 4LOCA 3Q2WA 3L3HB 1GG1A 3DKLA 1JTTA 3O3DA 1YPXA 4YK4B 3ITOA 4DF1A 1GW9A 4NFCA 2C3ZA 4Z2JA 1ZBCA 1UFUA 2PXYB 3UO8B 2EDWA 2CMRL 4FQ2L 5C0GB 4M6QA 3L1OL 1PPIA 3ARSA 3MANA 4XMVA 3B9KD 3UBXB 5I6KA 5KYWA 2NUWA 1M9HA 5CCZA 1OAXH 3W85A 1U4FA 1E4HA 1HQRB 1NAKH 3MBEB 3V5KA 3OODA 2BY3A 4JHZA 5CKGA 4A7GF 1KBGL 3SGEH 5HAOA 3LTYA 5CZ0A 1Z5HA 3GY1A 2XA8L 3ABKB 1KIPB 4BSVB 1CMOA 1UTDA 3PBYA 4EI0A 5JZ7C 3L65A 1KPRB 3TS8A 3EYUL 2WC7A 3TZVC 1ZHBB 2H9GB 3FO2B 4UYPA 4Q97A 1JV5A 3QUHA 4L2YA 4Y9MA 5I5MA 4FQCH 2K8QA 4MD5B 2XH2A 5I73C 3V9CA 3TBSB 1DVSA 1FFNB 3ISWA 4H9UA 4QEHA 2E6QA 1CLYL 2ZPKL 4JO2L 1IE5A 3DFQA 1FV1A 3N14A 3TV3L 4AWTA 1E56A 1XLAA 1VENA 2AMUA 3D09A 3NAAH 2R0ZH 4P3CH 4O8RA 1UT9A 3DETD 4Y4FD 3C2RA 4ANUA 1XIGA 1HJQA 1P7TA 4MNGE 2VH5H 2P8MA 1SRDA 3T4WA 4ZUUA 4QRTB 4A66A 5L88L 4P2OB 1K2DA 1MQKL 4IS6B 1QSEA 1FY6A 4NN6B 2NUYA 3QUZD 2QCMA 4FXSA 1N3NB 1VB9A 2IPKB 3GSXA 1QNSA 1RVFH 2Z64C 1U8MB 4HIEA 2K9FB 5I78A 3BWAB 1A4JA 2JLPA 4OQTH 5LBSA 2O1AA 3MRQB 2D03L 5J8OA 4MD4A 5CD5C 4P9MH 2WD0A 1SQ7A 1WXZA 1AANA 1TO3A 1ZANH 2AK1L 3PHOA 4X0KB 2NOYA 4NNYA 3X12A 3BUTA 3OAWA 4N2EA 1IGTA 4AUUA 3C2EA 2XG5A 4FP8H 3QARA 3E49A 1OHZA 5KZMA 1ISXA 3MSDA 3V55A 1RFDH 2O5YL 2ZWSA 1GTNA 5BZZA 4Z7NE 1KGCE 5D96C 2YD8A 1AZZC 2CZDA 1T83A 4HC1L 4FQXB 3PZTA 2IH8A 1CDHA 3CVHB 3DX0A 5GGVL 3SGDI 4DEPC 4BJHA 3GMRA 3JV6B 3BZFB 5BW7A 1C29A 3L1EA 3MGOB 3E8VA 3SPVA 1CLOH 3CC5B 3U1QA 3WN5B 3ZE1B 1LT8A 5LNRA 2RACA 1YEIL 5DR5H 3C86A 5D1QE 1GAFH 2ARJB 5GGRA 3QFDB 5AG9A 3K0YA 1P7KA 4LLDA 1X3DA 3V0IA 1UUQA 2PAJA 2WM1A 1KEMH 5DVMA 3O1NA 3NTCH 5TTRA 3RDJA 3EKLA 3Q2NA 1AQ8A 5BJTB 4UR7A 2J20A 4YMZA 1YY9C 2WQAA 4G7SB 2OOGA 4LFHD 4E9YA 5B4MC 3HG1D 4L1BA 1UXWB 1XAKA 3ZY7A 1J8SA 3W9DA 2NNFA 3C60C 4GA8A 3U79A 2P5WB 1OAZH 1X5GA 2A73B 1OP3K 5B38G 1RZ7H 3AU0A 1GGIL 3O6ML 4XI5C 5A6IA 4Z78A 1BLNB 4HUVB 4RGMC 4O8AA 2VL5A 4P9HC 1QFUL 3D48R 1BYOA 1I2NA 4EAEA 2OQJA 3ABLB 1INEH 3D69A 3WMPA 1VFBA 4IF2A 5TFSH 3KM1A 3F62A 4JDTH 1P4IL 4UDUA 2ADYA 1K85A 1OTUD 1QO3A 1F90H 1OY3B 3WK3A 1X5AA 3QYCA 4AQEB 3HV8A 3TUUA 3V4BA 3LZNA 1SY6H 4ATLA 3EXRA 1SUHA 1KGIA 4H40A 5H8DA 3RJQB 1KIPA 3OA3A 3OV6A 1JCMP 3DJTA 4XX5A 1YMMD 4HUNB 5HHNB 1K6WA 3BK0A 3ZLFA 5C7HA 2CZVA 2QFPA 3MJ9A 1XF2A 3V6FB 4TNVF 5AG8A 5CLTA 3V95A 4I3RL 4Y5YC 5AAMC 3TZFA 4R2GB 3CSGA 3TJHD 5CZXD 4DY1A 3KE0A 3JWNH 4JDVB 4XMPL 2W88A 1WO2A 4IMLB 4HX1A 2NY5C 3VXPA 5L2JA 2R8WA 3HZYB 2YXFA 1RZQA 4G1MA 1XISA 3OD3A 4HISA 4PTTA 5K33A 1TZIB 1ZGLB 5IFJA 4CVWA 4YSAA 3AXMA 2VLRD 2CRIA 5CSBA 1CF1A 2WNWA 3IDNB 3WX7A 3F12A 4U2ZA 3CCHA 3BLKA 2O9OA 1DQQB 3TZNA 2WMHA 1T8QA 2RDTA 4L6HA 4I13B 3V4PA 4B97A 1FN4A 4Z23A 1JUKA 1W5QA 3XIMA 5JIWA 2MH4A 3NCXA 4ZDHB 4AXWB 1PCKA 3JUGA 4EPBC 4L0ZA 2GUUA 3EO9H 4X4XA 4KUCF 3OJMB 5KVEE 2NX1A 2YLHA 4PCPA 4DO7A 5DVOA 4YNYB 4H9VA 1ZENA 1KJ3H 1R2RA 2A3BA 3CFTA 1SM3L 3D25A 3II2A 5F89B 2VR7A 4D94A 3MDWA 4W9LC 2B4CC 2QCEA 4LLVB 5K9JL 4JFPA 1ILSA 2X2UA 4BFAA 1S1RA 4CC0A 5G1MA 1IF2A 1AI1H 4OT7A 2ZDSA 5C0AB 4YHKH 3WQPA 3D3FA 1TJ1A 2PNDA 3QHFL 4KWOA 5CPSA 4ZOEA 2JCWA 1GYUA 2ZKYA 4NZUL 3TTYA 2MHAA 1IEQA 1EF3A 2VTFA 3LX9A 2OZ4A 4AW7A 4LOUD 3KOFA 5JIIA 5JW4R 4IBSA 2GYIA 1MCHA 4Z1YA 4W8LA 3QWNA 1YAIA 4A1RA 1N8WA 1GQJA 4M6MH 5M5DA 5JHAA 2BC4B 1JWUB 2WVVB 3EJPA 4OLEA 1HF6A 1I8LC 1O5QA 1OT2A 2B81A 5TDPB 1YYML 3OR7A 4Z7QF 1TTQA 2AKRA 4QLWA 3MMWA 3MV7D 2JB5L 1M01A 1FZOB 4GBXA 5E99H 5C0FA 6PCYA 5JW4N 1HJUA 3QV8A 4RCXA 4DF2A 2ZKWA 3TIDB 2D7QA 5DQJB 2ZUTA 1X6NA 3LD8B 4G56A 5XINA 3WBEA 6TIMA 2ZVRA 4Z78B 2KC0A 1CE1L 2XLLA 2LU7A 2OX4A 3R11A 1M6OA 2YD3A 4U3SA 1IEHA 1XQLA 1HDMA 2LU5A 3I6GA 5CJOH 2XHNA 3MMTA 5AW4B 3CWGA 1AQMA 3MX0A 5SV3A 1MZHA 3V5HA 4BFFA 1GZJA 3MC5A 1NFDA 1AMKA 3VXNA 4MCZA 4I0PB 4QKXB 1IXOA 2DSZA 1QOXA 5F4XA 3N9KA 4CVXB 2BVOB 1JAKA 4JYEA 1SGJA 4OZHF 3N42F 3TO2A 4HMCA 4WDWA 1I53A 3VC5A 3E0LA 1EA9C 1T2QH 3IFLL 2X7VA 3MNMA 3W37A 3V35A 3RVWD 3C6LB 4EQ3A 3RWHA 4AVFA 2YAOA 1R30A 1XH3B 2AFNA 2YA0A 3WFBH 3REVB 3G6JA 3S37X 3ALXA 4PJDF 4GACA 1O12A 2L7JA 4MRCA 1EEYB 5LO7A 4EBQL 2XWBA 4WO4C 3NO3A 1MUCA 5KJ7E 3MUXA 1WCQA 3D85B 2WXRA 2WZMA 1F4XH 1HCFX 2APTA 4J6IA 4TSCL 3ZKSD 1R0AH 2XSAA 3SKMB 2JIXA 1J48A 3MRKA 4Y2DC 1X8FA 4DP4X 3GFXA 1U8QA 5FO2A 3ULUC 2P8LB 4QEEA 2XG4B 2FZMA 3G04A 3HFML 4OCXH 1SM9A 2BVWA 4JN2A 3SHSA 3SDDD 5FGRA 2UZYB 1B30A 4QAIA 2BH0A 3OKOA 5EO9B 4PJ7F 1W6LA 4FN0A 2FQEA 4QS5A 4IEFB 5I0VA 3R19A 3LKOB 4GO9A 4N4YB 4YFLI 3FHEA 4MF4A 2ZWYA 4YDLB 2JLLA 3N2BA 4NO3A 2YPVA 3F5WA 3MA7A 5F9OH 1W2PA 4QIUA 3M0JA 2JQXA 1AE6L 2EIDA 4AE0A 4X4XB 1TELA 2ZX7A 1S39A 3LHVA 4M6OH 3BV7A 1OC5A 4OQVA 1FGVL 2V2WB 1JZJA 3D25B 3R8HA 2DQIL 2QADB 3B8WA 4O57A 2DMKA 3K8MA 5C09D 4MGXA 4UQ2A 1PZDA 1ADQA 3KYKL 3PWUB 4Z7AA 4GW1B 5AEAA 5KZCB 1HU8A 3CZFB 4NQCE 1A80A 4GOSA 4L4TB 2GHZA 3GSRB 3MJWA 3OKDA 1YA5A 4WFHE 2CYGA 3PUCA 1DVFA 2WNQA 4K8GA 1QVBA 4JO3L 5IB1B 4A8LA 1HNFA 1A5BA 4F2ME 1B4JL 1E67A 5JW4Q 3IUHA 1U30A 2WLNA 2X6CA 2XX1A 1EDHA 1Z6JT 4PJCF 1K8YA 1W5NA 3SRHA 4XOBA 2BOFX 3B37A 3F6IA 3HG1B 4RFEB 3S0PA 4B27A 4BE6A 1TWSA 2OXGB 3PGDB 3DDMA 3W24A 4IRJD 1QSFE 4MA3B 5KJRH 4IQLA 3BGMA 3TWAA 5A1AA 2XV2A 2VDPH 1RD5A 1TJXA 1KJVA 4DXKA 3T3MF 4FERA 4C91A 1ETJA 1PMYA 1Z0MA 2P8PA 1XMWA 2X40A 2CZEA 3DVIA 5C0CE 4K3HA 4XPTH 1JVNA 2AQVA 4FOKA 4YQXH 4OUUA 4UMGA 1SSGA 5HULA 4BFBD 1BFOB 1WD9A 2Q3OA 2Z1SA 3REWA 3EWWA 4QCEA 4NT0A 4EQ2A 4Z2KA 4QTIL 4ZTOH 3LDBB 4RIRB 2HISA 4PGCB 4PUNA 1JF1A 3F7KA 3S2NA 2CWRA 3L3JA 1QRNA 4PRPB 4I7WA 1MCFA 2NT1A 3FT0A 4N4PA 1FQ9C 4FXFA 3QQ3A 1UR2A 5D55A 2H6UA 2EDXA 3P0VH 4ICWA 3D0LA 1AZ2A 4TTDD 3FYOA 3QTPA 4WEEA 1BBJB 3O4LB 5C0CA 3V0WH 4EDWL 2BOGX 3ILQC 4GQZA 4U1JA 4B9KC 3TIEA 5FOBB 3KL0A 4CD8A 5CBBA 4XCYA 3ZZLA 1MUWA 5IBUB 4BH8A 3MOBL 3D7PA 4RGOL 1MMFA 3KUMA 3UO1L 2BSRA 3OC5A 2IV8A 3ZTJG 3N73A 1UD3A 5LA2A 2WO5A 2AGKA 2P5EA 3IPEA 5SWSA 2VM8A 2O7SA 5AQ0A 7TAAA 2P8LA 5B8CC 3C5ZC 5HATA 3FTGB 3H2PA 1TZGH 2YJLA 1LYXA 3PPEA 2B16A 1I9JL 1NZRA 3O8XB 3QW9A 2PP7A 4Z7WE 1K3IA 1MFAH 4HK3J 2DLHA 4AVIA 1IXPA 2EEXA 3SIMA 1CG9A 4XMXA 4U6TA 1HN1A 1MAML 2YK1H 3QORD 4KHXH 5DHDA 2J5WA 2DQWA 3PUGA 4JFQA 4ZW3A 2TRSA 3RYSA 1HVXA 3DIDA 1DVFC 1NLDH 5IF0B 1BMZA 3CBJB 1OIMA 3VYLA 4LF1A 4BF5A 2OSLB 1WS8A 2GQHA 4D6IA 1W31A 3GI8H 1VF5C 4HH8A 1NFKA 4BSWB 3LN4A 4ONGH 1CK0H 5BZDB 2GAZB 1CXIA 3BD5A 4WI4A 4PFEA 4ERAA 3MLTB 2J56A 4ZMVA 9XIAA 4UV7L 3WL9A 2G30A 1II4E 3M7WA 4U1MB 2GJXA 1E3FA 3K6FA 5D2WA 4OU1A 5KBDA 1LYQA 3RDTA 1TR9A 4IU3A 5IQLA 2BLEA 2VDMB 3F7YB 1R3JA 3EWBX 1J12A 4S3DA 4OZIA 1FP8A 5TGBB 1RIVL 4Y7EA 3B8YA 3H4XA 3DMMC 3MPCA 4GUOA 3SN0A 4X6DF 1F02I 1YSOA 5JHDD 3L66A 3X3GH 2AERT 3T4AA 3MJ7A 5FW6A 1SBSL 3NEXA 4J1UB 4CD6A 1S2UA 4O2FB 3WNPA 2X44D 2EICA 4CDGC 4MB3A 3EO0A 3FFCE 1Y5XA 4FKEA 1Q9KA 3UCRA 1ZLSL 1OQOA 1LWHA 4UC5A 4P4RA 4GG6E 2C1GA 1LG2A 1DBTA 3CE1A 3W22A 1H6UA 3WUFA 3CFDB 4MA7L 3ARQA 1A21A 4L9LC 3ZGHA 3WEMA 2SEBA 2A1YA 3MXWL 4FZEL 4LHUD 4UTJA 2NQ5A 2FLMA 4PGEA 1PLCA 2MCMA 3TX9A 3P73B 2AJ3B 3CUXA 3NQMA 1HQRA 5GGSY 5IVZA 3TV8A 2VXQH 4RIRA 3QNXB 5C6WH 2HG5B 3G6DL 1TV7A 3EH3B 4R6UA 3S37L 3ZDXF 3BZJA 5JVLA 1W8SA 5E08L 4IG2B 3ESPA 2DUZA 4NNCA 2XPGB 4ONFL 4HNOA 1MRFH 1OCNA 4X83A 1EMTH 2WPGA 3NFPA 4BSJA 2GK1B 2XZ7A 1NGQL 2PCYA 3BVWA 1KY6A 1QW7A 2WZIA 3GSMA 1D7FA 1P4UA 3RWJB 4OJYA 3G7TA 3WNIA 3CLEL 4MD5A 3ELFA 3SDXF 1QFUH 4HJ0D 2A79A 3QCVH 3STZB 4PMDA 3IJHA 4HW6A 4AWUA 4M80A 3RFZB 5KS9B 4PR4A 4JZOB 5HDQH 3CXDL 4DNLA 4ZB0A 3NJNA 5IKCB 1HHGA 3THCA 3GDRA 1F90L 4O52A 4ZG1A 5CJXA 1E6SM 3L5MA 5AW1B 1X7FA 3A6BH 1E5AA 2HA1A 3QISA 3USBA 4GNVA 4G6ML 2IH3B 3LQAC 35C8L 1DVZA 1ZD6A 2J8UB 3BQUB 3BVNB 4LLWA 5E5MB 1W3KA 5DRCA 2DORA