4JL2A

Crystal structure of a bacterial fucosidase with a monovalent iminocyclitol inhibitor
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
438
structure length
438
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEKMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords alpha-L-fucosidase
publication title Exploring a Multivalent Approach to alpha-L-Fucosidase Inhibition
doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase/hydrolase inhibitor
total genus 164
structure length 438
sequence length 438
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4jl2A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4jl2A01
1V3MA 2PF0A 4CU6A 4W87A 3EJTA 3AI0A 1JYNA 3WEOA 2PBOA 2DT3A 1E6ZA 1QI4A 3VINA 2WVSA 2X09A 3KL3A 1X6NA 2GVYA 3THCA 1PJ9A 3D4ZA 3WBEA 3TTSA 3BSHA 4MNMA 3HG5A 2WCAA 4GKLA 1BGGA 2OLHA 2FHFA 2W66A 4MAZA 1UD3A 4XZBA 5CJ5A 2J8FA 1KXVA 2GK1A 2OWCA 3A47A 2J8GA 1TUXA 2ZXBA 3BVWA 3AFBA 1EQPA 1UKPA 4FNTA 4UCFA 1LF1A 3LXBA 1K6AA 2XVLA 5LYRA 3AISA 2GDUA 5JBDA 2WBGA 1QI5A 4JHOA 5CQ1A 5I79A 1PIGA 3CO4A 3BAWA 1NARA 3CH9A 2E9BA 1LLOA 3K8MA 4B3KA 3GXDA 2C0HA 2VZOA 3SURA 3WMBA 1UD6A 1UQYA 4QLJA 1E9LA 3WNKA 2CHOA 2DSWA 1W3KA 4PMZA 2J7DA 2CITA 4PMRA 4U3AA 1LL6A 1XH2A 2F1AA 4AXNA 1VFOA 3HMCA 4ATWA 1EHNA 3NJ3A 1NM9A 4NF7A 1QHPA 5E9AA 4BCEA 1MYRA 1XSIA 1J0HA 9CGTA 4OBSA 1E56A 1ITXA 3UG3A 2FHBA 2XG9A 1EDGA 2DIJA 4LYRA 3ECQA 3AHTA 3AS2A 1EO7A 4LGXA 2D3NA 4AD1A 2VNCA 3CLWA 3AROA 2W4XA 2YJQA 4LPCA 1J01A 3KL5A 3AMCA 3GYCA 4OGZA 4W84A 3RMEA 2D0HA 1D2KA 4J3TA 2EPOA 4ZENA 3BLBA 1DHKA 1UKSA 1V0MA 3PTQA 5LA0A 1V02E 4W89A 1HKIA 4IISA 1JZ3A 2W63A 3WL1A 5I23A 2Y8VA 1W1TA 2E9MA 3G6LA 1CXIA 2VRQA 5A8PA 3L2MA 4CU8A 1C3FA 2FGLA 4PEEA 1RPKA 1U2YA 3VMPA 2XGIA 1VBRA 6A3HA 1QHOA 4A4AA 5F7UA 1DWHM 3PBGA 1CGVA 1UH3A 2FYVA 4WKHA 2J4GA 5DO8A 4IPLA 1NOUA 3M46A 1MQQA 3AHVA 3ARPA 1WPCA 5HDRA 4MJ4A 1NWUA 4AD0A 3VDBA 3MKKA 1AQ0A 1UWUA 3HZ3A 5CPTA 1B90A 2GJRA 3LRMA 3WNPA 3WH6A 1CDGA 4C7FA 2QLYA 1EXPA 3AHYA 5M03A 1C93A 2WHJA 1BVZA 1H11A 1IZKA 3ARTA 2VZVA 4HA1A 3ZSSA 1H0IA 4AMCA 1BYDA 5C70A 4C7GA 1E6RA 1Y7VA 2PWEA 1V3LA 5BXRA 4UFMA 3BUPA 2OYMA 3TONA 4D6HA 4AIEA 3LPFA 1E6NA 3GM8A 2DSUA 2PC8A 1ITCA 4TXEA 4UQEA 4PTVA 1RD6A 2CBUA 4OOUA 4QCEA 3T2PA 4AD5A 1VEPA 3D51A 5AYBA 3AXIA 3AOFA 1GHSA 4NI3A 1ZJBA 4W85A 4D6DA 2G3IA 1WDSA 1V03A 5BXPA 3D50A 4ZXOA 2CERA 1Q6DA 4U2ZA 2DSZA 4XV0A 1E0WA 3VMOA 2XFYA 4W86A 1BPLB 5LA1A 4AEEA 3L4ZA 1WDRA 2WCSA 4AYGA 3OBAA 4ATDA 3CPUA 5HNNA 1B0IA 2VURA 3IAPA 4ATLA 3WUFA 4AZBA 2OSYA 4L4PA 1LG1A 1I1XA 3PHAA 2FH8A 2VTFA 1W91A 3PZVA 4HZ8A 2DSKA 7CGTA 5KZ6A 5GNXA 3N15A 5FD0A 1PEZA 2WMIB 4Z2HA 3AMDA 5A2AA 1EDTA 4PSRA 3CZLA 3VPLA 1W9PA 4YN5A 4AZGA 1G1YA 2CETA 2YDQA 3AMKA 2W92A 3MMUA 1JI2A 3ZOAA 4DUWA 3A5VA 2IUZA 1V6YA 4J3SA 1H3GA 5CGTA 3N12A 3L4VA 5E6YA 2J78A 5E0CA 1W9XA 3D5HA 1UZ1A 1KBBA 1PS3A 3J7HA 5GPRA 1QWNA 5ABGA 4PUDA 5A6SA 1J0JA 2OWXA 3BUQA 1C8YA 2CKRA 5I6SA 2EEXA 2UY2A 3ARVA 5C8BB 2BXZA 3VIGA 1CGXA 1M01A 3FAWA 4JFVA 3WH7A 3IJ9A 3W6LA 1JZ4A 1BG4A 1QNSA 4MB4A 2EPNA 2O9TA 2DGAA 4FLSA 3OZPA 3WD4A 5TD4A 2XHYA 1KQYA 3WL0A 3VIMA 3S2CA 1JDDA 4TOQA 3ZT6A 4Z2JA 2W5FA 3K46A 1JZ8A 1AQMA 4B3LA 3LPGA 1R7OA 3VD9A 3DX1A 1BF2A 4MB1A 4MADA 2WMIA 3WDPP 5BROA 2OW7A 1UOKA 3ARSA 2EPMX 3WD0A 3OLDA 1S46A 2VR5A 5A94A 1US2A 3EJRA 2BNJA 1HL8A 4GQRA 2WC7A 1CLVA 1E1FA 3CUJA 3I3BA 1K9FA 2DIEA 2YFOA 3KLKA 3RO8A 3AIRA 4P8WA 2Z1SA 2BY0A 4W8BA 4DUVA 4WSJA 4NRRA 1MW0A 4D1IA 3VVGA 4MAVA 4GO9A 4WKAA 3W37A 4M81A 5EB8A 2WANA 1GCYA 3ZT5A 4QFUA 4AW7A 4XUYA 1DWAM 4BZYA 5IHSA 4MNLA 2G41A 2YBUA 4BS0A 1B3ZA 1VB9A 1VIWA 1F4AA 1UR0A 2WHMA 2J7HA 5I24A 1CXFA 3F5KA 1ZBCA 2MANA 3SUSA 1HL9A 4W7VA 1Z32X 1L0PA 1CLXA 3CUHA 3L4XA 1JF6A 3FHAA 1CEOA 1BQCA 1JXKA 3B9EA 3H53A 4PMYA 2WSPA 5IHRA 2PI6A 5A95A 4UQBA 2IXUA 2JF7A 4J7RA 3SUUA 3WEMA 3ARUA 4NXSA 2JIEA 1M04A 2DT0A 1HIZA 3WBAA 3WNNA 2XGBA 3VGGA 5CZKA 3SCSA 3OIHA 3MO4A 4AYSA 3LPOA 1CNVA 3B9DA 1GUVA 5BCAA 1M7XA 3ZT7A 3VM5A 4BQ4A 3SCNA 2QPUA 3VX1A 3BAYA 1GVYA 2EPLX 2ZX5A 1W9VA 2OW6A 2ZXDA 4GI6A 4D6IA 4UQAA 3RCNA 4F79A 4UNIA 4TVDA 4AEFA 3AIUA 1KXHA 3VSTA 2V5CA 3RM4A 2JFEX 4OIFA 1NWRA 3WN6A 4JZ5A 1MW2A 3N17A 1Q6CA 2OWWA 4WSKA 1QI2A 4HMCA 1E5NA 3W28A 3NSMA 1TQWA 3A4AA 2QF8A 1DWJM 4AISA 3O9NA 1JYWA 3WSUA 2PB1A 4GINA 3T08A 4AZ7A 4NZJA 4HOZA 1FHLA 3CZKA 3MI6A 1YQ2A 2X8RA 3B9AA 4D6JA 4TVCA 3JUGA 1UD5A 3ZJKA 5CG0A 7A3HA 1JNEA 2GJXB 2XM1A 3M07A 2Z1KA 1HJUA 3WMCA 2D0FA 3SCVA 3CZSA 1JI1A 2XIBA 1QBAA 3WH9A 3MMDA 2Y24A 3EDFA 3KLLA 1J18A 4GZIA 1X1NA 2WPGA 3G6MA 4XX6A 3ARWA 2E3ZA 1H41A 1V0LA 2V3GA 1NH6A 5EBAA 2WWDA 3K4AA 1CGTA 1VEMA 3SCOA 1PZ2A 2WKGA 3DDGA 1HP4A 5BYWA 2YL6A 1H49A 3BLPX 3MUZ1 2XN0A 3UEQA 1UR8A 2PWGA 4DO6A 1UWTA 4CD7A 2ZUSA 4UFLA 2JEPA 1V0NA 2XN2A 5IFPA 5HBFA 4FLOA 2IXVA 1XD0A 2F7PA 2XPKA 1LWHA 3OB8A 4PRWA 1EIBA 8CGTA 1CGUA 1UD8A 1WE5A 3BUIA 3DDFA 3H54A 1ODUA 2WNWA 1OSEA 3DX2A 5E6ZA 5A6MA 4F9DA 2W91A 5LA2A 2WLYA 2XYLA 1ZU8A 3CZ8A 5I77A 8A3HA 3WQVA 1XSKA 4KH2A 5I5RA 2BVYA 4M80A 4RE4A 4U3CA 2GJXA 5GNYA 3IK2A 1BG9A 1WZMA 4U5IA 1J0YA 2F2HA 2F7RA 2XTKA 2G3NA 2OSXA 3VIIA 4PMQA 4HP5A 1TFVA 1CGWA 3CZGA 1WKYA 3T0BA 3RJXA 3ARQA 4AD3A 4TX8A 3N9KA 1QPKA 1XH0A 2GUYA 3II1A 2J77A 2XWEA 2VCCA 4RL3A 2DQXA 3VIKA 1XCWA 1JD9A 2AMGA 3WF3A 4V2XA 4Z2GA 4JFTA 2JEQA 3VGBA 4QAWA 1KWGA 3OGRA 2HISA 2JF6A 4HOWA 3UCQA 1BHGA 2CNCA 1CWYA 4PN2A 1JL8A 4FNRA 1CECA 5ECUA 1JNDA 2BY3A 3VNYA 1JD7A 3RIKA 1BGAA 1HKJA 1HJWA 3WENA 4F66A 1VJZA 3WQWA 1TE1A 1BYAA 1H4PA 2WZIA 3UETA 5A8OA 3W82A 1UG6A 3GNRA 5HPCA 1EH9A 1O7DC 3SEPA 5D9NA 1OGSA 3WF1A 3W53A 4QDMA 4TVUA 2V38A 4UQCA 3DYPA 4PMNA 2V5DA 4OOZA 1YHTA 1WO2A 3FW6A 3CTTA 3DHUA 3K1DA 2ZX9A 3L4UA 1N82A 2VR4A 1GHRA 2WBKA 2WHLA 4JCLA 4TTUA 3VSVA 1E3ZA 1UASA 1B31A 1UZ4A 2V3DA 3EMQA 3MUIA 3VDHA 3L4TA 2UY4A 3GNOA 1E72M 2G3JA 1MFVA 1V02A 1CGYA 3FAXA 4TX6A 4HMDA 4A3YA 3QHOA 4D6EA 4IUGA 4W7WA 3GH7A 3AIVA 2ALWA 2NT1A 3LX9A 1ZBKA 5FKYA 1OD8A 4DUXA 4PMXA 1JZ5A 1CZ1A 3A23A 2XWDA 3WF2A 1GQIA 4J3UA 5HOSA 4EKJA 4JFSA 1R86A 3BCFA 1RP8A 4GZEA 4FK9A 2W62A 3PZQA 4JL2A 1DWFM 4MB3A 1VFUA 1GZJA 5M17A 2ZXAA 1JF5A 3IJ8A 1HTYA 3N13A 1UKQA 1VRXA 2YIHA 4CN4A 1HXJA 4CD5A 1HVXA 3A4WA 3H55A 3O2LA 4FMVA 3MUAA 2WZHA 3FY1A 1C90A 1HNYA 3HG3A 2YKKA 5FIPA 1LL7A 3N11A 4OKDA 4OBRA 3EDKA 1R34A 3FXYA 1CENA 1E1EA 4AZ5A 1SMDA 2WSKA 1OBAA 2E0PA 3EJPA 1ZL1A 1W3LA 5HXMA 4YHEA 4WK9A 2GSJA 4NXKA 3VUPA 2QV4A 4HZ7A 1UD4A 1NWSA 1V3HA 3OG2A 4WJXA 1JYVA 4AZIA 3HG2A 2WC3A 2D73A 1W2PA 3WD1A 1HP5A 2DSVA 2WVUA 1J0ZA 1GONA 4MNKA 4V27A 3VD4A 1GQLA 4CCCA 1O7AA 1IV8A 1WCGA 3U57A 1V08A 5D9PA 4J3WA 2RGMA 4J3VA 3VILA 2ZXQA 3SUTA 1NOFA 3OLIA 3VIPA 4A3HA 2XIIA 3EDEA 3SCRA 4CU7A 1KXQA 4CCDA 3EMCA 4KRUA 1V3KA 4GPNA 1GVIA 4W5ZA 2WC4A 2YOCA 1E0XA 1NP0A 3GNPA 4CKQA 2EABA 1XYZA 4D6GA 5A2BA 1OWQA 1GJUA 2VZSA 2V3EA 4DM2A 1AMYA 3S6TA 4CD8A 3APGA 3A6OA 1G5AA 1JZ2A 3W38A 3KZSA 1QW8A 4H2CA 1W3HA 1QNQA 3W81A 4KWUA 1QOXA 1MQRA 3ZIZA 1VAHA 4D71A 3ARRA 1GOQA 5CPQA 1MXGA 1FOBA 1R7AA 3BGAA 4HPHA 1OGBA 2QMJA 2AAAA 1XYFA 2EQDA 4PTXA 5A1AA 2EADA 2VX5A 1KB3A 3POHA 1UQZA 1EA9C 2ZICA 2YDSA 1QVBA 4H8HA 3IAQA 2EJ1A 2VX6A 1M53A 4P7OA 4PMDA 1ISWA 3NDZA 4MPKA 3VMNA 2DT1A 2X2YA 3VM7A 4P7NA 4QLKA 3AJ7A 3WDHA 1JG9A 3K8LA 4AMWA 5JBEA 1WAWA 3A4XA 4J3XA 3PN8A 2Y8KA 2CHNA 3DC0A 4LXFA 4W7UA 3BLKA 1OGGA 5JUVA 2YA2A 3LRLA 3PZNA 3WF4A 3WNMA 1UA3A 1TR1A 3D3AA 3I3EA 1HVQA 1ESWA 1X6LA 2VVSA 3VTRA 1C7TA 1W1YA 2ZUTA 5ABHA 1W32A 1HT6A 2A3BA 1J0KA 4W93A 3QGVA 2W67A 1PX3A 2J7EA 2WMHA 3BC9A 3T09A 1J11A 1GOMA 2BHYA 5ABEA 3AS0A 1FHDA 1XRVA 4CVUA 4BF7A 1IZJA 1QI0A 3U5YA 1OIFA 3PZMA 3WDJA 4YHGA 4PTWA 3WUEA 3VD5A 1E73M 5AC5A 4HOXA 5A6AA 3VIFA 2ZE0A 3GXTA 1LG2A 5FCZA 3SCWA 1UWIA 2D1ZA 1DTUA 4DWSC 1K9TA 2O92A 1FA2A 1BFNA 3GDBA 1UWRA 1FH7A 3DHPA 3SCQA 3HN3A 3L4YA 1DWGM 1ISZA 1KWKA 5IDIA 1C7SA 3E1F1 4PBGA 1T0OA 4KRTA 1EDQA 2EACA 4CN1A 2FGZA 2HVMA 4JAWA 1O6IA 4B9YA 3OLEA 3WDRA 4PMUA 2VCBA 5I78A 2YL9A 3UERA 2BY2A 5DFAA 5E0FA 1JFHA 1K9DA 1RH9A 3EJUA 2CESA 2UY5A 1UYQA 1G9HA 3GBDA 3CZNA 2JALA 3AXXA 2GJPA 3PTKA 2NW0A 1E6QM 3ALGA 5E09A 3PZOA 1JZ7A 4K68A 3AZSA 4ACZB 1QWUA 3AMGA 1ISYA 2W61A 3BSGA 2VO5A 3VD7A 3UG4A 2DT2A 1E6PA 4E8CA 2DEPA 1W2VA 3DECA 2F7QA 2WK2A 2ZX6A 1CPUA 1W9BM 2WAGA 1JYXA 1CYGA 3OZOA 1QBBA 1HXKA 2YA0A 3W6MA 2VOTA 5BXSA 4GI8A 1E4NA 1ZB5A 3LRKA 5BWFA 1DWIM 1TVNA 4LYQA 3CGTA 3W4RA 2V3FA 3ZO9A 3NIYA 2VRKA 3CIVA 4N42A 3W24A 3EJSA 1R87A 1E6SM 2QMKA 1XCXA 3EDJA 3QHMA 3DX3A 4FNSA 1XSJA 5A6BA 1XHGA 1WZLA 4BQ5A 4B9ZA 1VFMA 1VF8A 3RJYA 4MTVA 4S3KA 1HJXA 4M1RA 3BMVA 3AIQA 1EHAA 3IANA 2F1BA 4IM4A 3U7BA 3PZTA 4Z2IA 3BAIA 4C7DA 2WVVB 4CVWA 4U33A 4XB3A 2F7OA 4JFWA 1E70M 3QOKA 5I3DA 3UR8A 4NX0A 2XVNA 1MFUA 3U5UA 4AZHA 4JHZA 4AMXA 3WUBA 2PWHA 3LPPA 2VVNA 1V6UA 3GXPA 1ZJAA 4ACZA 5AC4A 5CSUA 2F8QA 2XVPA 1FP8A 3NSNA 1W1VA 1GOWA 5GQBA 1BSIA 2BFGA 1MQPA 1GW1A 1E0VA 1KQZA 2CKSA 1U33A 4RE2A 4UFKA 4CD4A 2BV9A 3WH5A 4HZ6A 3RDKA 5I2UA 3BUBA 1UWSA 3CMGA 1Q6GA 3S5ZA 1D7FA 3VU2A 1GQKA 4H8VA 4MJ2A 3OGVA 4J28A 4P7LA 4HU8A 1XH1A 4AY1A 3WQ4A 2XSAA 3ZR5A 1E5JA 5DF0A 1HN1A 2X0YA 4QP0A 1KCKA 3RM8A 5FL0A 3WELA 1WZKA 4XZWA 3W27A 3WIJA 3A24A 6CGTA 1HJVA 4MNJA 5DEZA 5M3WA 4EANA 2WMFA 1UKTA 2X1IA 5DT5A 1R8LA 3ARXA 5CGMA 4PMVA 3TA9A 5EMYA 4JFUA 3RILA 3CMJA 2JIWA 3VOCA 4P7RA 3M6DA 1EO5A 3OGSA 1I75A 1QW9A 2WVVA 1CXLA 1BLIA 1B9ZA 3UR7A 1SZNA 3NCOA 1E43A 1B3YA 3L2LA 4DO5A 2YLLA 4E8DA 1J0IA 3CUFA 1NOWA 1HJSA 1PZ3A 4JL1A 3EMZA 1CTNA 3WKZA 7TAAA 3LXAA 2PWDA 1UR1A 2YFNA 5D8ZA 1OCQA 4F9JA 1XGZA 1B30A 2Q8XA 1QHZA 3WQ8A 3FN9A 2ZUNA 1MW3A 2GFTA 4AC1X 2XVKA 5BRPA 2GDVA 3TOPA 3WY3A 3HJEA 2J74A 3F5JA 3I3DA 5BRQA 1B2YA 4MB5A 2VC9A 1PX4A 4IPNB 5E1QA 3RPMA 2XSBA 4X9YA 3F5LA 4BQ2A 5M5DA 3GBEA 2BVDA 3BAXA 1OT2A 2C7FA 1BYCA 4DO4A 1LQ0A 4KMQA 3AYSA 1UH2A 3DYMA 3BAKA 4BQ3A 2CYGA 1EQCA 1SMAA 5A6KA 1AQHA 3WY2A 1HKMA 1WP6A 2YDRA 3VSUA 2CIPA 2BS9A 1QNRA 1V6WA 5A3HA 3WFZA 3VIOA 3CBWA 1KGUA 1JGIA 1MVYA 1KGXA 1B3VA 4Z2LA 3UESA 5KEZA 2X2HA 2D24A 4JIEA 4U5KA 4JCMA 1GOIA 5CLWA 2G3MA 2EAEA 1WNOA 4W88A 1Q6FA 2D2OA 1UUQA 3W25A 2Y2WA 1UR2A 1OD0A 4CD6A 1HWWA 1M03A 2BY1A 1HJQA 2FE0A 2CBIA 2OSWA 4AIUA 3W29A 2OYKA 1UH4A 2DH3A 5D4YA 3N18A 3BH4A 3EYPA 3CUGA 3WQ6A 2WYSA 3CHFA 2CCRA 3MMWA 1TQVA 1H0GA 1ODZA 4CUCA 3THDA 1WB0A 3WNLA 4WF7A 3ZJ7A 1GNXA 3CZJA 1B3XA 3BUDA 2RGLA 4UOJA 3DX0A 1FP9A 1UA7A 1E4MM 1UR9A 5BXTA 2BHUA 3VD3A 3BAJA 2J7CA 1ZBWA 4B16A 4H8UA 3BVXA 4CN6A 3TTYA 3SCPA 4UOQA 3VGHA 3GH4A 5ABFB 1SYTA 2WCGA 1A3HA 4URIA 2G8ZA 4B15A 3FNDA 3EJQA 3PZ9A 3VX0A 4D6CA 1E6XM 3AXHA 1R46A 2TAAA 4AZ6A 3DYOA 2WKLA 4H41A 3PZUA 4TTGA 4R27A 2VI0A 3VGFA 3CC1A 2ZX8A 2X2JA 3POCA 5A8QA 1BTCA 1H5VA 4CGTA 3GXNA 3AZRA 1GOKA 4HPGA 5A8MA 3N1AA 4D72A 1VFFA 4UR9A 4LQ1A 3BVTA 2G4FA 3A3HA 2E9LA 4ZE5A 4QLLA 3LMYA 1PIFA 1JZ6A 1BVNP 4EAMA 2FH6A 2ZIDA 2VJXA 4PUEA 4X0VA 3MU7A 3WFLA 4M8UA 2WHKA 2ZOXA 3ARZA 2WVTA 3MANA 4UOZA 4HU0A 5A6BD 4WLCA 1ISVA 2YA1A 1XC6A 1ZBVA 2E8ZA 1CIUA 2E4TA 1EGZA 3NYDA 1PBGA 3PZGA 2J62A 1NWTA 3T0AA 2O9PA 3S5YA 2A3EA 3CHEA 3ZQ9A 5ABFA 1LWJA 2WB5A 4U31A 1CXKA 4U2YA 1Q6EA 4M56A 3VGEA 2YL8A 3ARYA 3WH8A 1OIMA 4OJYA 3DX4A 4GQQA 3WNOA 2VZTA 2EXOA 5CSYA 3WDIA 1F4HA 1JAEA 3W0KA 2J47A 2UWFA 3VDAA 4P7QA 2J7FA 4DWSD 2F61A 1UD2A 3TP4A 2A3AA 3ZM8A 2ZUWA 3QR3A 4NSBA 1VENA 2Y5EA 2XVGA 4ZXLA 2J7BA 3BXWA 3HU7A 4UFJA 3WUGA 4X0NA 2VZUA 2O9OA 1MXDA 1GPFA 5I0DA 4W8AA 3MSGA 4M24A 3BMWA 1DEDA 1K9EA 2VQTA 2JE8A 3VKKA 3A22A 2WMGA 5DMYA 4N0RA 1US3A 4GI9A 4RE3A 1VBUA 2WMKA 4Y7EA 1E71M 4CCEA 3VO0A 3TTOA 1GORA 1TVPA 2XJ7A 1NQ6A 4AIOA 3WY1A 1TQUA 3PZIA 4Q7NA 2D0GA 2E8YA 1FH9A 4PTMA 1TA3B 2YBTA 4AZCB 4D1JA 4UQ9A 1BYBA 1VJSA 4UZUA 2IGTA 4UQDA 4E2OA 1V6VA 2CBVA 3ZR6A 4WKFA 2ZWYA 1BAGA 1JDAA 4FNPA 4PMOA 3IGUA 1B3WA 2E40A 1GJWA 3AICA 3GH5A 1VEOA 2XN1A 1OB0A 1E3XA 4FLQA 1LL4A 3PTMA 2D23A 3MUY1 2VT0A 3B8SA 5IFTA 3WQ5A 3T2QA 2VCAA 1JFXA 2CBJA 2EBNA 1R47A 1TCMA 1CBGA 2FHCA 1E4IA 1TQSA 3GXFA 4PSPA 3AIWA 4ML4A 5GNZA 3BVUA 5AY7A 4NZFA 2WZEA 4R5EA 4UFHA 1KR0A 2EPKX 3ZSTA 1KBKA 2J7GA 2X2IA 4MDOA 1WZAA 1V6XA 3IJ7A 3VIHA 4GIAA 3A21A 3NUKA 2WLZA 1PPIA 3AIBA 5D9OA 1PX8A 2FDMA 3NSXA 3SUVA 2J79A 5JIPA 1JXJA 2X0HA 1EOKA 1HX0A 3TV8A 4MDPA 3QOMA 1C91A 3AS1A 5FL1A 3AIEA 2ZUVA 1FFQA 2CXGA 1TA3A 3KEHA 5DT7A 2D22A 4AZCA 1DP0A 3GZAA 4JKKA 4UZSA 3AYRA 2A3HA 2BVTA 1W9UA 4F8XA 3L4WA 3GXIA 5A6LA 4ZE4A 3HG4A 2ZWZA 3RM9A 3VIJA 1OT1A 1ZS2A 3VNZA 5JBFA 1W9DM 4PCTA 1V3JA 3GXMA 3QHNA 1KTBA 3MV11 1U30A 2XFRA 4EE9A 3SCTA 4ZFMA 1OM0A 3WMSA 3AS3A 3WEZA 4FLRA 3OA5A 2DH2A 4DM1A 2VRJA 3CHDA 2VQUA 5CPSA 2YLAA 2O9RA 2XUCA 1ECEA 1I1WA 1TG7A 4HA4A 1KCLA 2VX7A 4PYSA 4H7VA 1JAKA 1AVAA 3FHQA 1UHVA 2PBGA 2VMFA 2EO7A 1H1NA 2QHAA 3WDQA 4HTYA 3AHZA 2DPEA 4HMEA 3WY4A 4M82A 1FFRA 1GOOA 1A47A 3SCUA 3WF0A 4H04A 1C92A 1SFSA 3ZJ8A 3KWXA 1HKKA 4FNUA 3AHXA 1OINA 4Z2KA 3CHCA 2C8NA 1WDQA 2B31A 1C8XA 1J9YA 1R85A 1CXHA 4GO8A 4UTFA 4DWSB 2OYLA 1KTCA 2WWCA 3TTQA 3N04A 2A3CA 1E40A 4KGLA 5CXPA 1IT0A 4BA0A 2PWFA 1UKOA 1E15A 1KGWA 2D20A 2VUYA 1B1YA 2AOSA 5C71A 1KR1A 4JKLA 4D6FA 1TZ7A 2WMJA 3ZMRA 1LJYA 4GZJA 5FOOA 5D8WA 2XFFA 2YL5A 1L8NA 5A69A 1D3CA 2NSXA 1V0KA 4L4OA 1W1PA 2WW5A 2BXYA 1UWQA 4OZOA 4E4PA 1G94A 1E55A 1NP2A 3OLGA 1E4LA 1Q4NX 3KE0A 4WIWA 1FH8A 2X05A 3WD2A 3ALFA 2QPSA 1UR4A 4KGJA 4QCFA 6TAAA 4V28A 4LX4A 4Q22A 3K8KA 3D4YA 4AD4A 4ACYA 3BVVA 1V3IA 2F18A 1R33A 3AQUA 4NRSA 1XD1A 3AZTA 3CZEA 5JIWA 1HF6A 4LYPA 4FF5A 1H2JA 1WDPA 5AYIA 1G01A 2J75A 1C8QA 2J25A 4ZEPA 3ZJ6A 3WD3A 4TUFA 3NDYA 4P8UA 3AMLA 4FNQA 4P8VA 3T0DA 2UY3A 4NZCA 4OUEA 2NT0A 2ZUMA 4DWSA 3SUWA 5IXEA 5A6JA 1RP9A 2BHZA 1J12A 1KFWA 1J10A 2XM2A 4M29A 1ISXA 5EFFA 1H09A 3W26A 2WXDM 2VX4A 3MV01 4S3JA 5A8NA 2ZX7A 2CEQA 3D52A 3T2OA 1JIBA 1EOMA 3CUIA 5E70A 2DDXA 3CV5A 4UFIA 4HA3A 3O6AA 5D9MA 1MWOA 4GXPA 3LXCA 2CPUA 5A2CA 1R75A 2WM0A 1MW1A 5HPOA 1W3JA 1JDCA 2ESCA 2GK1B 1PAMA 1QX1A 2VL4A 2Y4SA 1XV8A 4AD2A 4EK7A 1QNPA 4P8XA 3KL0A 3F4VA 3BCDA 1SR0A 1TQTA 1GQJA 1KXTA 3SIMA 1QI3A 4YPJA 3K4DA 3M7SA 4W8LA 1QNOA 3U7VA 4PCSA 3GTNA 4J27A 3EBVA 2ZUUA 5EFDA 3MSDA 1CXEA 4W5UA 3VDCA 4JKMA 3UG5A 1P6WA 1G0CA 3EDDA 2D3LA 1TMQA 5CLTA 3MS8A 4AWEA 3VGDA
chains in the Genus database with same CATH superfamily
3QORB 4UTBL 5JYMA 1KLGB 4GYJA 3W1LA 2A6JA 3AI0A 5DDHA 3HHSB 4MBOA 1LO2L 3SQLA 4HK3J 5AW8B 2UZYA 3L17A 2E47A 4ESKA 1LDCA 4M3KB 5FYKE 5E9XA 2ROYA 5IHWA 1ZY9A 4QLRA 3MDJA 1VFSA 3HPJB 1LF1A 5I74C 2AANA 2YZ1A 3CTLA 2EVIA 5KBLA 3LTSA 3CWGA 4CLMA 4HV8A 3FCGA 1UWGH 3FO0H 1UWFA 4QBXA 1XF4B 3RI5K 3D33A 3WNKA 4LE8A 4PMZA 2ZRVA 1M1XA 3TO4D 1YXDA 3CVHH 2F1AA 4EAEA 1G6RL 1KTLB 1TDQA 4LF3B 2REQB 4FI6A 4ZSOE 5I3GA 3GBLA 1P5VB 5DZLA 3LVTA 2DKUA 3FQRB 1GOFA 5F7DB 3VXUE 1WV2A 1YYCA 5I00A 3T3MF 3X11B 2A4ZA 2XDHA 3TYUA 4LCUA 2BIMA 3F12B 3MLUL 2O1AA 4XP1L 1V0MA 3B56A 5G5DB 4M7JL 4OQTA 3ARDB 2KHAA 2VFIA 2BGSA 1MI5E 5AKQA 4MUPA 3L7FB 4Y5YA 4I77H 6A3HA 2TODA 3FGCA 3UPRA 1DXIA 3ARFC 1DLFL 1IBBA 3DESA 4XMKH 4XPBH 1ZT1B 3RWGA 3NFSL 3ABOA 3WH6A 4QWWC 3ECVA 4GSXA 4F7CB 4K8EA 3EYSH 2X89D 4Q8BA 4IGBA 3ZSSA 5A8GA 4R97B 4U4BA 4JHAH 3EJJX 1E2VA 3I9PA 2R29H 3BTNA 4G72B 5BXRA 2YCLA 4JY5H 3QNFA 2WXHA 3VZZA 4Y2LA 4XBKA 4TXEA 3MLSH 5BV7L 3V4PB 1RD6A 3D51A 1XUUA 5IDZA 2L4OA 2GBUA 3T6WA 1GHSA 2EXSA 3MGOA 4D6DA 2G3IA 4Z7WE 5I0YA 1A0DA 2Q8BH 1OGPA 2XFYA 4W86A 1TYEB 3AG4B 3V4VA 5CGQA 3L4ZA 2WCSA 5KVEH 2AJXL 4L4PA 3T65B 4JN2B 4DEPC 3TFBA 2VTFA 4HIHA 1FO0B 3UPBA 4KPHH 4PJDE 2Y3NA 4XO6A 1UFGA 4FYTA 4LT7A 2BP1A 3CZLA 3TT3H 1Q9WA 4MQTB 4YSSA 3LHTA 4LAZA 4PV8A 3HMXL 4MKSA 3GIVB 1P4BL 3MMUA 4XCYA 2WXIA 1Q6RA 2WZAA 3L4VA 4JDVB 4M7SA 3TMLA 3D5HA 3HM7A 4DSYA 3J7HA 2PGWA 4XPGL 4MMZC 4TUOA 2CKRA 4I7VA 2DUZA 4DETA 3N2MA 3W6LA 2JVUA 1EEQA 4QDWA 4EN3A 1NSNL 2J44A 3NJHA 4N0UB 3T77B 4WDTA 3VIMA 3BKCL 4ONHA 3DUUB 2VC6A 5DRNB 4PC8A 5EZLB 2GQ3A 3GJEA 1T1WB 4XP6L 2XY1A 3WD0A 2VR5A 1DVQA 2WC7A 4HBQA 3RRQA 2HROA 4B41A 5HK4A 4W8BA 5G4NA 4P2QE 4MAVA 2W8CA 4UQ2A 4ZCWA 1CU4H 3APNA 1CFTA 4BCYA 4AKOA 3UGXA 3RXZA 2R7EB 3HR5A 3LQZB 1O1HA 2VFHA 3EFDH 5J3HD 2F6XA 3SUSA 4XD5A 1PO9A 1D2OA 4NDMA 1R3YA 4NP9A 3B9EA 1HZYA 4YTUA 4R90L 4HCIA 4NUGL 5BPPA 4J6IA 4EZLA 3GS0A 2GJ6A 1BOGA 3SUUA 3QCUL 1JZFA 1K8CA 1A1MB 4FQQA 4OLYH 1EK3A 2K78A 3ZT7A 1N0XH 4MJIB 5DYFA 3LN5A 3WMPA 5F9JB 1HW6A 3MLPA 4C6JA 2MTAA 3A4EA 1WGOA 3B8VA 4M1GL 1CL7I 5LXVA 5IVXB 1ZTXH 1E6JL 1TQWA 5D6CA 5L0QC 4X6FA 1RU9H 3K5RA 2QCFA 5JO5B 1NMCC 1JNEA 1S3HA 1MFCH 3D6GA 3L3JB 4UAHA 2W38A 5AQ0A 1P5UA 5FO9A 4J8RB 5I1GL 4YWGH 4TULL 3TJXA 4P06A 4XX6A 2PF8A 3SDDC 3MQIA 3JW7A 3KM2A 1RUKL 5KETA 2NQZA 1L6PA 4LEOB 1HP4A 3C0SA 2FECI 2EKSB 3EOLA 3SDXB 3H26A 2BOBB 3KHDA 1KA9F 1RD5A 1TZGH 1TJHL 4FOUA 2F7PA 3QFJD 4OD3L 4ZFFA 2FUQA 1JGEA 1W1IE 1I8MA 3WQVA 4KRZA 2ADYA 1NKGA 4FP8H 1P0NA 5DK3A 1BXCA 3DGCR 3HS9A 4CVXB 1CGWA 3STZB 2R9RA 1PY9A 1RZKC 2VSCA 1MPAL 2MCPL 1GGYA 2A74B 2XX0A 2PO6C 2W79A 1AD9B 2K70A 2G2NA 3L5JA 2IAMC 2HRWA 3K91A 3GSMA 3SY8A 3VJ6A 4K36A 5IUSA 5F2LA 4OF3A 2QSVA 4B5NA 1UUOA 1QNIA 3WJWA 3UR5A 5CCZA 4Z8FL 3W53A 4Y4HA 4CC0A 3DYPA 5EMUA 1JPEA 1BFSA 3AJXA 3UT0A 4KKLD 4JX6A 3VKBA 3LCLA 4M6NL 4MA3A 5HDQH 4XN5A 4E4FA 3ML9A 3FFCA 3L4TA 3OGCA 4YLQT 3MODH 1FJ1B 4IUGA 1KIQA 3DIVA 5T3XE 3MVTA 4PMFA 4QF1A 1E7UA 2ZT9C 4XSMA 5H4YA 1GMEA 5FHBL 2W62A 2CJUH 2ZA1A 3K74B 4KTDL 1T2XA 1A02N 2Y1AA 3FY1A 2IBZX 1YEGH 1CCZA 4BFRA 3V16A 3V5HA 1LL7A 3GO2A 3ZDZE 4OKDA 3TCTA 4YBQD 1R34A 2ZRUA 3DIFB 3V6OA 1ZL1A 2DZAA 4JFXB 2R23B 3FFSA 5GS1B 2Z8WC 3R4IA 2ANUA 3VYNA 4PLJC 1T1YA 3HG2A 3GDMA 3QFJB 4PUUA 1J0ZA 1GONA 3INUH 3NTCH 4WHCA 6XIAA 2ZXQA 1NOFA 2DQGH 4LDCA 1LP9A 2IQDA 2KLSA 2PD9A 4FQHA 4RDQG 4QTFA 1LP6A 2VMDA 5IVNA 4LSPH 1KPUA 4WDIA 3G5WA 4CD8A 3T8VA 1HQRB 3RJDA 3PANA 4EZJA 5D1XE 4DKAA 4DZ8B 4FAAB 4WXZA 1QOXA 1MQRA 4KRPC 5AKSA 5EU7E 3S4SB 2BO0A 4MLSA 5FYLD 5CPMA 1OF6A 5AC6A 4JFDD 4Y4FA 1DE5A 2XKNB 4NPJA 4XN2A 2I1OA 3FMGH 2RKXA 3ALPA 1NAKH 2IPUK 1X39A 1B0WA 4FRWA 3CK5A 4XE0A 1C5DA 2AQSA 3DC0A 4AJWA 2XWRA 1WUNT 2K6ZA 2IV8A 1V7MH 2GC7C 5I3KA 1NDMA 1UC4A 1CLCA 1C5CH 4BWUA 1ORQA 2FGWH 1XIDA 5F2GA 1DN0A 3CMFA 5ABEA 3ZE1F 3EIFA 4HFUH 1OQXA 1MRDH 2OFJA 3KWWA 4FHKA 3VD5A 3HVNA 4AYEC 1EC8A 1RQ5A 4C6LA 5D38A 1M6OA 2O92A 3GDBA 4MJZA 1DE4B 4OM0H 1A5FH 5J8LA 5FJPA 1DWGM 1ISZA 3GRWL 5A5WA 5IOPA 2VW6A 3MRCB 4JRXD 4TM9A 4HK0B 1FRGH 2VDQH 1J93A 4A6GA 4JQIH 5I1AA 3G18A 5IROA 2FR4A 3GLAA 3VI4E 2X1UA 3QUMA 1IT7A 1L9SA 2DM2A 4ONGH 2P10A 2JALA 2A6KA 1JRBA 3ALGA 7PAZA 2H1PL 3GI8L 4GG6A 3SE8L 4CQCA 4JGDA 4F1ZA 2WK2A 3IDIB 1U8IB 5AZUA 1MEXL 4OLVH 1XRSA 5H35A 4WKZA 4JEGB 3U6RA 3ERPA 3X13A 5DMMA 4HETA 3HI6H 3FRPB 4A04A 2P5WA 2Z31B 4JJ5A 4P3CL 2C4XA 3W24A 2BSSA 3LTYA 2E7CA 3GIPA 4BFNA 2G2RB 1AG0A 2OA9A 1MJUH 4UTAA 5GGRB 3DJ9A 4I0PB 1F86A 4JFDB 2I60L 4Z2IA 4QAMB 2ZZ4A 4GHRA 2WSQA 2F7OA 4FMFA 1JPDX 4MA1B 2DVXA 3QXAA 1MFUA 2JKPA 5GIRB 1BVKB 3JWOH 1KKRA 5E9DE 5B8CC 2V81A 3O63A 3WXVH 4ABVA 3UZJA 1HNGA 1KQZA 1EP2A 2IPKB 2JSFA 5FJOA 5EH1A 2ALAA 4ZFOA 1UWSA 3LG3A 2DQHH 4EF9A 3BPOC 4WCYH 1FNLA 1S78D 1WA3A 1HI6A 4DO7A 3WO3B 2GI7A 2ZONA 3RVVD 3ITVA 4DN3H 1IZCA 2ZCHH 2C4FU 3L5IA 2G50A 3SYAA 1VD6A 5KYUA 2OJEB 3S48A 1QR1A 1MUMA 2OZTA 1FDLH 3W02A 3EO1B 3WLWC 4NEHB 1WDDA 1HJSA 2R4SH 4WWOA 4ZSTA 2CDFA 1MWAA 5IV2A 1Z44A 1I9JH 1QHZA 3BSMA 5GGSY 5E8PA 2NW2A 2X3AA 4ONFL 3DKHA 3VFTA 2P43B 1DUZA 4A7QA 1PJWA 1JGDA 1VRDA 2IH3A 4M48H 1RJZA 5E1QA 3QUGA 4X9YA 3Q01A 3BAXA 4KMQA 4DKEH 1SMAA 4Z7OF 4KK5C 2BVQB 2PTXA 2J66A 4LV4A 4ZSOA 1LLWA 3BKYL 3SPVA 1F4XH 4EI5B 2BY1A 1Y5WA 2FE0A 1UH4A 1Z9PA 2E59A 1GZGA 3VXUA 3UAFA 1OSZA 3MOBH 4NKCA 3IDYC 1WB0A 4XH2B 1GNXA 2A7NA 3VC5A 1R3TA 4QG6A 3IU4L 4HNUA 1DIOA 5FLUA 2P52A 3OHXC 3FZUD 3TK7A 4A6YA 4TQIA 1MI5A 5JHDD 3LIUA 1BD2D 4U7KA 3O2DL 2IDTA 3CLFH 1MZRA 1SO3A 4LO9A 3WLLA 4TTGA 4IGHA 5A8QA 1H8OA 4ZOBA 1NCOA 4OZGE 3UP8A 4N5EC 4O14A 4ZE5A 3OJDA 4ASTA 4PRPD 2MJWA 5T1DH 3WGVB 2FIQA 2XBDA 2C6QA 1BAFH 4M8UA 2WHKA 1MCPH 4KK6D 2NMSA 4WLCA 1ISVA 2VEFA 3SPIA 4NO2A 3VXSB 2QPXA 4XC1H 3Q37A 1S9YA 4H9ZA 5BW6A 4ZQPA 1B54A 3WLHA 4G1EB 2VLJE 4RDBA 3CDFA 5AC7A 4GAYB 1X7TA 3DX4A 3WNOA 4PJ9A 3IMWA 4NO5A 2DWTA 1BXVA 1BPVA 5E95B 1Q66A 2O56A 2J47A 4FX6M 4Z7WA 4DWSD 3BLEA 4NNYA 4PGZA 1L5GB 4POCA 4Y2DD 3P61A 4FFZA 1U42A 3HAEA 3QZAA 5TF0A 1FFNA 2FJFA 1IX2A 1MXDA 2XIMA 4PJDA 2XH2A 2O5XL 3VKKA 4JTKA 1ZLVH 4N0RA 3QJZA 3HG0A 3QRFM 1ZTMA 1NQ6A 4ETQA 2FUTA 1I7ZB 5DU7A 1FH9A 3UZZA 5REQB 4K15A 1UB3A 2PDUA 4B96A 5C5YA 3GVQA 3VYPA 2ATKA 4E2VA 4RWHA 3IGUA 3CFKA 3C61A 2X28A 1VGKB 2VDNL 1WYIA 2GITB 1AGCB 3MUY1 2LAGB 3RX5A 1TIUA 3DENA 1H9VA 3DV4A 1PHWA 3ZE0F 3RA7H 1Q1JH 3LVEA 3W70A 3EGXB 3AIWA 4NLAA 4NZFA 2RFXB 2NLIA 4ZO9A 3ZSTA 1EZVX 3FBKA 2OQYA 3IJ7A 5JHDB 4LLYA 4X8CA 4Q74A 1BD2B 2PDYA 2UYLA 2GWNA 4ELME 4P2QA 2NRDA 4J5NA 1FFQA 5DVOA 5ELIA 3BH8A 4C54A 3MRQB 4UZSA 8XIMA 5EWIH 5JXEA 3UAEA 3RM9A 1I7UB 3GXMA 4AVOA 3PFQA 1KTBA 1U30A 3O16A 4FGMA 3F8UB 4OF7A 1LHZA 4ZB2A 1FWXA 1IGCH 1Z0NA 2F54D 3FHQA 4YYFA 1T7LA 2Z3FA 1MCKA 1MCJA 2AGTA 4D8OA 1FUNA 1UPMB 5AOMA 4PYGA 4DVBA 1OP4A 2AEPH 2BRRH 1LO5A 3FTUA 2I5YH 2K9FB 3FCSB 3TBTB 2PA6A 4DWSB 3RX3A 2VXSH 2XZAH 2I9TA 1CK0L 3FTGA 1M4KA 4DF1A 1Q0EA 3OPZL 4KKAC 3BN3B 5ID0A 4QQUA 4NQCE 1DIKA 4LEBA 4L6HA 3GU9A 1W0WB 1OP5K 4HX1A 4P5TA 1DZ0A 1QBLH 2WQAA 4K8RC 3MKCA 4E5XA 3HS0B 5BZDB 5TDNA 5IQ7L 1DQDL 1FFOB 4DW2H 1G94A 4UAOB 4I5RA 1HCZA 4ZQNA 2VEPA 3QP3A 5ACLA 1MFAH 1SF3A 4UINH 3A13A 2PPEA 3ARBA 3SPGA 3ZN6A 3MJ7B 1RSYA 2FEDC 4FF5A 4Z7NF 2VW4A 3MCKB 4F7PA 3HKZA 2Q7AA 5TQ2L 3XINA 4CKVX 5K9JL 5IXEA 4KHTL 1RP9A 1Z9MA 1YPZB 1LO3L 3NZGA 5JHMA 1RZIA 2VX4A 3MV01 1FWSA 2C16A 1KTRL 3PWPD 4NUWA 1W3JA 1JUFB 1JDCA 3SJ3A 3CCHA 5LN4A 5C0DA 2YXFA 5TDPB 3U9PL 4JAMB 3F4CA 2R1MA 1XICA 2W65B 4MCYB 5HHNB 4Z3FA 1L3WA 3DKLA 1W8GA 4R26H 3FQXB 5LVEA 3LS4L 2OMAA 2P53A 5I6PA 4PUWA 1G0CA 3X1FA 4KXDA 4NQQA 4JPSA 5J5RA 3FU8A 4OZFA 2YXOA 4GUIA 3EJTA 5J57B 1EF2A 4OD1L 1N8ZA 2D3JA 4XMPH 4CADB 4J3OG 1F1GA 2F54B 3WBEA 2OTUA 3IDGB 1BGGA 1ZQ5A 2FHFA 1P48A 1ADSA 4LASH 2J8GA 4QYOB 3MSYA 2ITCB 4WUIA 1VYPX 4XWOC 3Q8AA 2E27L 4D0CB 4FR6A 2W95A 4RDVA 1W72B 3G6JE 3D7PA 4O0ZA 3BAWA 3V7MA 2ADFH 4K2UH 3QQ4B 2EXYD 4N8PA 4BFIB 4BQ9A 4P59L 5E6IA 3U8GA 2EDDA 3NQ8A 3U9UB 4P2RA 4HN8A 2GSIA 2WY3B 4Q6IB 2Z7GA 2DSWA 5FUCC 4G6KL 4R96A 5FYJU 2FQDA 3BEVB 2KUTA 1JXGA 3SB0A 4JB9H 2JTDA 4NS0A 2Z35B 4YFLI 2Z91A 3FT2B 4LDLB 2QR0A 1E51A 2DWSA 2WM1A 1VR6A 1NUDA 3F7QA 2V5MA 5GVJA 4PP1C 2D3NA 2WYTA 4HKPA 3G5ZB 1YNKL 1WBZA 3KL5A 1GW6A 4U1KA 1XXDC 3QE5A 4J3TA 3ABQA 1XZWA 4XO8A 4W89A 2W63A 1EXUA 3CX5J 2QUNA 1OB1A 3PWPB 3WQGA 3O7UA 2VIRB 5MHBA 1ZOXA 5K1VA 1XIBA 4CU8A 4MLJA 1U2YA 5BU9A 4IRSC 1BX2A 5TE4H 2CM6A 4NHUA 4ZYKA 1BQSA 1CN4A 4UNVA 5K93A 3WG6A 1LE9A 5SWZD 2WGNB 3O0FA 2QF7A 4IPLA 2Y1YA 1ZIBA 4DQAA 3X2QB 5EA0L 3VDBA 4L8SA 1B90A 3MJYA 5HYJB 4K38A 4H26A 1EXPA 1M9WA 3R5EA 4NAFA 5D1XA 4EPSA 2VABA 5MEQA 1TCRA 2VC2B 2QKIA 1DO6A 3AG1B 3K4WA 3RG6A 4IG2B 1E6NA 3GM8A 2CGZA 4FABH 3ICJA 3EH4B 4EWND 3T2PA 1CE6A 3I10A 5JXQA 2E7DA 3NQKA 2PDWA 4V33A 3D2UD 4ZMAT 4OFIA 1RZJH 5H2BB 2AL2A 4XZMX 3ZL4L 3TDFA 2YRPA 1NCUA 5DSCA 2A85A 3OBAA 4NPKA 2AERT 4XIAA 2VURA 2P3YA 4OV4A 3WUFA 5IK3B 1I1XA 4R84A 3AY4A 3NEHA 3LHUA 4IRZH 1DSWA 4LCYA 4HZ8A 2APBA 1PEZA 1NCJA 2W27A 3DFNA 1SHWA 3DXAD 2E6DA 3E12A 4M7KH 4AENB 3UYPA 1XLEA 4P57B 2E9GA 1D5BA 4MHHG 1FL5B 4N0YL 1F6LL 2B1OA 2VWSA 2OCJA 4QOKD 3E6HB 1PS3A 4K5OA 1QWNA 3KBPA 4RX0A 3UJRA 5CC6A 4JEJA 1PKYA 2A9CA 1C8YA 5HSFA 1QNSA 3MXVH 2Z28A 3BZFB 2WN2A 3OZMA 5E94A 1MFBL 1OX4B 1MELA 4V11A 3ZT6A 4LRIC 1AD0B 3VI4A 4B3LA 1F73A 4A22A 2V6HA 1S4IA 3QAZC 3WDPP 4P8QA 1EJUC 4BKLB 1VRSA 4S10A 1A9EB 3WE6B 2K4AA 1WAUA 1WITA 1S9WA 2Z1SA 4K7PY 2E7MA 1KLFB 1CFQA 2B2XL 3FOKA 1OCJA 2WANA 3NL6A 5I1EH 5ESQB 5IM7A 2G41A 2Y5JA 4BS0A 1F4AA 1D3GA 3B40A 2F8IA 3OHMB 5KJRL 2IPFA 3VOJA 4CAGA 1BEYL 1OARH 2W81C 1FNSL 1A6VL 5AYYA 5ISZD 3FKRA 1XXFC 4PCPA 4Y89A 4QX4A 3O3UN 3JUZA 3FT1A 5A95A 5D7JD 4M8RA 4M93B 2QADC 4DNMA 4G43A 1EWDA 1ZHAA 5TH2B 5IB1B 3DGGB 2DT0A 1N7MH 3PBMA 1ZSDA 3UAJC 4JKWA 3OVRA 1CNVA 5HHVH 3B9DA 5DHYB 1M7XA 3WUWG 5LGJB 4GO6B 3D2UB 4OTXL 3UY7A 5E9DA 1GVYA 5CEZE 5T1MA 4N1HB 3WFDL 1SJDA 4PJCE 3U46B 1T6MA 4LVNC 4HNNA 3WLBB 3RWHB 4Z7VB 1AR1C 1N5YL 5E2WL 4JZ5A 2B4CL 4PVBA 1ZCOA 4OUOA 4E0CA 5DJ8A 3PAOA 1RZMA 2PB1A 3BISA 3HEIB 3DXAB 1YQ2A 4QRRD 1G6VK 4IJ3C 5AZEL 1ZSXA 3WZ0E 3EBGA 4E5XG 1HJUA 3FTVA 1INQB 2D0FA 3E7JA 2V5BA 1I1AA 4QHUA 4APQA 2FJHA 1J18A 5EC1B 2Z1PA 4JX0A 2B81A 5TNVA 1Z69A 3PAYA 3BZ5A 1XINA 5DCCA 3JWDH 4NNXA 2E56A 3OVGA 3JTSB 2P5EE 3LBCA 4J23A 2F8VA 3VUSA 4GRLA 3SR7A 3SCOA 2YPLD 2QJIA 4A35A 3E6FA 3P4MA 3UEQA 5T1JA 4R7XA 2J8UE 4G7VL 1WEJL 1XIWA 3G9AB 5EEVA 1AYRA 4ZUSB 5DMIL 3F58H 4PRWA 5CUSL 8CGTA 3NQFA 5I16B 3UBPC 4WFFD 3H0TA 4HBCL 1WLHA 8A3HA 1E5BA 1XSKA 3VFCA 3HIZA 1WZMA 3RWJB 3QA3B 5EN2B 2C9PA 4LU5H 3F6IA 3QZWA 2OXGA 4PJHE 4GUJA 3W39A 5T1LA 2J8OA 2X4PB 1BXBA 1OQOA 5F4WA 4V2XA 1P0BA 4DCQB 2H90A 4QAWA 5ISZB 4J1UB 3S9DB 2MPVA 3BP6A 2Q1EA 1TZZA 2DQJL 5ECUA 1PD6A 1NVMA 2WLJA 4JR9L 2IQAA 4N2AA 5D7JB 3T2NH 2CKBL 4UOW1 4F66A 1BF5A 2VWEE 2VITB 2WZIA 4XHQA 3IDMA 1UP0A 1OW0C 4Y9CA 1M5WA 4G8GE 4YC2B 3CTTA 1YECL 4X4XA 1RZPA 3MKVA 2VR4A 2WBKA 1U3HC 5JTWA 2PC4A 1A4KB 4OZGA 5FEBA 2G3JA 4JTFA 3HPSA 1Z66A 1TSRA 2VFGA 4JDBA 2NT1A 1V6TA 4A67A 3B9NA 4C6CA 3Q06A 2DVTA 3GMQA 1JZ5A 4QRRB 1CZ1A 2X4SA 4CNOA 2WV8A 4JDTH 1RP8A 2YRLA 1ERNA 3G1RA 3L9BA 3N2OA 2AABL 4GIEA 2VLJA 3RU8H 5IB4A 1U93B 2YIHA 3DJSA 2V5YA 1W3TA 1OE2A 2WZHA 1KBGL 2MOQA 1T80A 1MFMA 5AFAA 1I85C 1TEYA 3GQFA 2NUXA 4L3ED 1E1EA 3HUJB 5SX5K 1II4E 5A3IC 4EI6B 1PYFA 5EUOF 1PZSA 1U36A 2GSGA 4NAQA 3VD4A 3FL7A 2YGPA 4I48B 4RZ4A 2BSRB 4DWDA 1KLZA 2GVEA 4ZS6C 4M02A 4O18A 4MMXA 1B0GA 3OXRB 4K1WA 2P46B 4W5ZA 1BCIA 2CSPA 4KX9A 1GJUA 4JO5A 3C9NB 1KN2L 1H3PH 3HJ0A 2UWEE 1S5HA 3HOJA 4KTEH 4NRYB 2JJSA 4QR7A 3VWKD 3HRZB 3GWQA 1PMYA 1MXGA 5E4OA 3BOVA 1DJWA 4Q4PA 2QMJA 5BQ7B 5EPMA 2BB0A 2AAAA 2OMTA 2G5BB 3Q8CA 4AC4A 5GZNA 4E0RA 1J8HB 2QKFA 1R24B 2WZTA 3EYUL 2E67A 4GIPD 2OCCB 4GE8A 4IDLA 2J21A 4I2XE 3LNFA 3VMNA 2FVMA 1U95B 4X98B 2NUWA 5HNTA 1G4RA 2H9GB 5JBEA 5KAQF 4NN7C 4ELMA 3I2CH 2Y8KA 2O61A 4BDVA 3UBXG 1XIIA 5EUKB 2XU2A 2OQLA 2OR9H 4YDJA 4HEPA 1OWWA 1YY9C 3F7PC 5FWRA 2JCCB 4EIZC 1ESWA 4UV7L 2ORBL 1W1YA 1IXPA 5CZ0A 3S34H 3BW9A 4TN9A 2VYOA 4W93A 4NGHH 3H2AA 3GMRA 2HBXA 2OMZA 3VAVA 1AHWA 3KLAB 3GSNL 4L29B 3PZMA 3MRPA 4B9JA 2UY7A 3CXHJ 5MP6L 3FK4A 1XPYA 5CPOA 4FQPA 1VZWA 5KZEA 4K6AA 2OKOA 3MO7A 1WTLA 5LZLA 1XLFA 4IBLT 2WLIB 4KRTA 4LSTH 5IJDC 4L3EB 2FGZA 1XC4A 4JAWA 3MRLA 2DZSA 3VB9A 4D94A 1L7IH 1RH9A 2XQYK 5DJCA 2Y2YA 1JR1A 5LG1A 3W2DL 1AZVA 1LEGB 1WH0A 2YXVA 1KNWA 4JREB 1QMUA 1TSHA 3UG4A 4JDYA 2DEPA 2R69H 4Z7QB 4AVIA 3Q7JA 3K71A 5GZOD 1JVOA 4FQXB 1JYXA 1QBBA 4S1QL 5BU6A 2DZWA 2AJSL 2E5CA 1LOQA 4YDZA 4LRNL 3LNGA 4G7YL 2V3FA 3CIVA 3ZO0A 1KTNA 3ZDYF 1SOQA 1JV5B 4ZX4A 2N4IA 1P0KA 5C2GA 1FP5A 3SQBB 5ADOH 4JDZA 3VA2C 5D93B 2D3VA 3ZPDA 1M56B 3KX6A 4IM4A 3IM1A 3SDCA 3BAIA 4U33A 3P14A 3BQUC 1BWLA 4YBHA 3LZFH 3U5UA 1SZFA 1F8TH 5LIYX 5EU5A 4Z0SA 3KPMA 2PWHA 3QQ9D 3RLGA 3VFWB 4D9QE 1KCSL 3ASNB 1FP8A 5H8MA 4HVBA 1PG7W 4WDUA 5TE7H 1U33A 1SJEB 5EIVA 2HJFA 4JBSA 3WH5A 4XE5B 4PY8I 4H8VA 4Z0XB 4GH1A 5HYSG 3W1UA 1E6OH 5J6HA 2DQWA 3P73A 1MHHB 1UA6L 4DK6A 4U1MB 3OZYA 3DX5A 2X0YA 1D6VL 2WB1A 4KCUA 3QG7L 4EANA 2CR6A 3G6AA 2CU9A 3QHZH 1F2QA 4WHDA 3WJJA 4RFNB 1NGYA 4N2MA 4JANA 4W6XB 4QHNA 1RPUA 3KCPA 4YGVA 1XF5A 1FUYA 3MB9A 4O4VA 5G4OA 2QDVA 4N0CD 1NBYB 3LXAA 4XNQB 5IW3A 5IBLC 2ZAGA 3TN3A 3G6JA 1FGNH 1UXSA 2BNQD 2HCZX 2NQLA 2PDCA 4QTIL 3GLCA 1VS1A 1NDZA 3I3DA 1XB6A 4X8GA 4A8IA 4BEUA 3AITA 3GSUA 1RJYA 2OL3H 2C7FA 5EZPA 4BQ3A 3BJTA 1GZHC 1AQHA 3WY2A 1H0DA 4H20L 5C0JA 2O4EA 5ESVB 5I8OL 1J48A 2QUTA 1EVUA 3UYRL 1EHKB 1A4AA 1KRCC 1UVQA 1CDIA 2CZ5A 1OY0A 4PJGF 2QQ6A 5I06A 3D18B 2Y6SD 4CNSA 4MOZA 3W25A 4CD6A 1JNHA 4NHVA 1KENL 3L5WB 3PUEA 3UZQA 1Q63A 3WQ6A 3V5CA 3DVFA 1ODZA 3OF6A 3S35H 3THDA 4QYAA 3NGJA 4GKSB 3B6SB 1JCMP 2XX1A 3HE6C 4XVTH 3RY5A 2HS8A 5IR1A 1P7QD 1ZRQA 5ABFB 3RVWD 5F96L 4ZAKC 2WTRA 4NQVA 3RWFB 4HWZA 1Q1PA 4B15A 2HVJA 5KVDH 2EDKA 5DCDA 5HYEA 1NEZA 3LYEA 1VBGA 1EJOH 5GGTL 3UTOA 5IMMB 2TRYA 1V93A 3FH5A 4R27A 1LUCA 3AZRA 4D72A 3SDAD 4HOMA 2WXKA 4JDEA 4ZX6A 3MHGA 4ZVJA 3BIBX 3MANA 2Z1WA 3W2MA 2VDLH 4Q8VA 4DYKA 3OPSA 4AUUA 3NYDA 1JV2A 1PKOA 2NNAA 2VSDA 3TYFA 1HEZA 2UXGA 1CB2A 5CN3A 3H2CA 4N8CL 1IGIH 3EH1A 4O00A 1LMIA 2H1XA 3BKJH 1J5DA 3TO2A 2UWFA 4DVOA 2Y88A 1J5OH 2JI1A 4P5RA 4BF5A 2VJ0A 4AHOA 4A05A 5EKYA 1E4XI 1WBXB 5KYWA 4FA3A 2YD6A 3KOXA 3IJYB 4QHLA 4L8CA 4HHLA 4D9RE 3NK3A 1XX9C 1UCTA 2VM4A 4P2OD 5CINH 4KKPA 4ROQA 4L3CA 5L8KB 2OEMA 1PZ0A 3TLLA 1UWGL 3DCPA 3FO0L 4GI9A 1T89A 3VO0A 3U3HA 5DI8A 2CLKA 4C4KO 3ORWA 4AIOA 3WY1A 3WEXB 1WXJA 2QNEA 3IV8A 4PJ7B 1VJSA 4RH4A 3DBXB 5F93C 1JDAA 1OGTA 5DXXA 4DJED 3NMEA 4POYA 1JSYA 5TF1H 5L9DH 2OEJA 3PTMA 3LZLA 2D23A 5IFTA 2CBJA 3EOBA 2RA1A 1TCMA 4FHAA 4AUYA 3TO4B 2WLLA 1T83C 1Y18A 2WZEA 1Y65A 5BOFA 4WUUE 3VFMB 2N3JA 3FO1B 1YG9A 5FO8A 2A5HA 1IKNC 2J79A 3B2DC 3D85D 5CEWA 1DQWA 2OMWB 4I77L 3BGGA 4BQBA 5I3FA 4HJGB 4IT1A 1YEEH 4K9EH 1GL4B 4YHYC 4G71B 1KV7A 3IDJB 4Y8DC 5JHBA 3QDMA 4XPBL 2GOUA 2J4WL 3MLZL 1RVFH 4PJFB 5AAPA 4KJPD 1OM0A 3AS3A 3EYSL 2PABA 2VX7A 1NLDH 1TTJA 1XBVA 1KCZA 4PODA 4QRPD 1ADWA 2B1HH 4JY5L 5CC7A 3TEVA 1GK8A 4GG9A 3GPSA 3ZJ8A 3AHXA 3MLSL 3T8QA 1RY7B 5HPMA 3V0GA 4WHTB 3PXHA 1RALA 3TIEA 2GQHA 1TJGL 4PJCA 1E40A 3QUZC 3BQVA 3RZCD 1RZGB 2OS7A 1R5VB 2Q8BL 2AOSA 2VGLM 4D6FA 3ZMRA 1E28A 3G5YA 1H50A 4P2OB 3IJIA 1OF0A 3KBEA 4WJKB 4O28A 1V0KA 3JWNG 3CSTA 3I6KB 5EU6D 3HLAB 3ILPA 5KYYA 2RACA 5AC8A 3TT3L 4PJIB 1OSPH 4L1TA 3BWAA 4GXWA 4ACYA 3EO0A 2V9UA 1FXQA 2FZ9A 2XU9A 4LYPA 2OKTA 3BRFA 4RISH 2X6CA 2OEKA 3L5AA 3DMMC 4KIEA 4IW4C 5LBGA 2NT0A 3NPWA 1DN2A 2WQUA 4R5TA 4X7DC 3TIMA 2GY5A 2YZ8A 4IIQA 2J8UA 2QJHA 5MEND 5E70A 1I2OA 5ERWA 1MWOA 4HALA 3L3IA 4HCLA 3SE3C 5DZAA 4C91A 4MMYB 3JVAA 2XN9E 1JWSA 1JVNA 2OO6A 2CLZA 1N5AB 3QEZA 3D85B 2PLMA 4X80H 4P5KA 2NPLX 4WW2C 1X7QA 4D0DA 3HQ1A 3BPNC 1AY1H 2JF1A 4PJHA 2YCJA 2I5GA 1CU4L 4UTBA 5FWQA 5L8LB 4S1SH 4I90A 2H3XC 3EFDL 3GR8A 1JYNA 3CFEB 3ETBF 3OYZA 5I9QC 2DT3A 1T7XA 2WVSA 1TYRA 3D07A 5B38A 4QRPB 2ZYHA 3HG5A 1SPQA 1PKQE 4TSBH 1UD3A 1Z9SA 1KXVA 4CNIA 4FX5A 3H2NA 2NY7H 2ZXBA 1V27A 5IB3B 1QBMH 3RN6A 4FNTA 4UCFA 1WFTA 3SIZA 4G8GA 4P46C 4OLYL 5FA5A 1TPWA 2HPMA 4XISA 2GDUA 1QI5A 3BGFC 4IM8A 1FL3B 2WSRA 3RZCB 1HKVA 4GSDH 4PRIE 3COOA 4JZJC 2O6DA 4A7GA 1ROCA 1A8JH 5LBSL 4XTIA 3SHSA 5MHSD 4JN6A 2DV0A 1ZTXL 3SAZA 1UWEH 1KNOA 1G6RA 2CITA 1HH6A 3FUHA 1O95A 2H41A 3TFKC 2XACC 3P4OB 3G1DA 1KGYE 4RSYA 5K39A 2WBJD 3V0VA 4CILA 4WEBH 1XGPA 4Y16D 2YB1A 3LS5H 1MFCL 3SKNA 1ZJHA 1UXWB 1K7EA 1J0HA 1LWIA 3B3IA 4YWGL 1KN4H 2DIJA 2QT3A 3QTPA 1XQ4A 3LNPA 1H60A 1CT8B 2QHLA 1RJLA 3GMLA 3L2IA 1J01A 2YMOA 4NNBA 2X9XA 4M4RB 2H9AA 1LEKB 4Y9OA 4LFHD 5JQ6H 5HYFA 3QNZB 4HWBL 1TZGL 5AALA 2B15A 2XZQH 3G5VB 3BSZH 4FYQA 3KCWA 4ORIA 1AGEA 2J12B 3MGAA 1HSBB 4WWKA 3DVNA 4FP8L 1D5IH 5JHAA 3SW6A 4UCGA 4I87A 3NIFE 2UWEA 1IE7C 1NF7A 3ARTA 3C75A 2EDEA 5GRYA 3DU0A 4DT2A 4A39A 1JEZA 1OTSD 1A49A 3RE0A 1RK7A 3RL2A 4UFMA 2NR6C 2OYMA 5IIEA 2MSPA 3UJTH 3FQTA 2GQAA 3MBWB 1VIZA 4I2XA 3USBA 3PL6A 1FWIC 4NI3A 2TRSA 3PGCB 3B34A 3C5ZA 1P7TB 4LPYA 3RX2A 1TLMA 4YHPB 5F7WC 4FFVC 3DOSA 1B0IA 1MO0A 2OSYA 4KESA 5I5MA 3CQ0A 3P69A 4M51A 2XFXB 5IHZB 2QQQA 3R10A 2VUKA 5HY9A 2ZAHA 4LPUA 1VFTA 1LK2B 3M88A 3HMXA 3MODL 2OTWB 2W9EH 3AWOA 3KRSA 4YN5A 4G6JH 1G1YA 5KSAD 1XLKA 4X42A 1JI2A 2YGYA 3GB7B 2AFNA 3D05A 4QXGH 3UNDA 5C3TA 4Y8EA 2ETWA 1R3IH 3GF8A 4Y16B 3LAFA 5G2IA 2VUNA 4YSDA 3M45A 2CJUL 3DGDA 4B5ZA 2CDEB 4QNPF 4NQSB 2IEPA 2VR2A 3CJJA 3NIDF 2E86A 2YOAA 1WWCA 2O9TA 1MVUB 3W1PA 5HNRA 1YEGL 2XHYA 5DYOB 3IFPB 3BG9A 5C08E 3DX1A 5BROA 4D9PA 3NJIA 2ZXGA 2BNJA 5KANG 5CBAA 3I3BA 3OWRA 1NFIB 5EEXA 3INUL 3RUBL 5EB8A 2AJ3B 2VL5A 3VVWA 2DQGL 8PAZA 1AL8A 3AO0A 3RYSA 3VH8B 1CXFA 3FT9A 4PJBB 5LXGL 3SKOA 3ABXA 3R0UA 4LSPL 1Q6OA 3CUHA 3L4XA 2DQEL 4PMJA 2X7LB 3QLLA 1KIPB 4CVZB 2B39A 2W07B 1IM3A 2C1OA 4UQ3A 3N41B 2IPGA 1Z7JA 4O2EA 3GNNA 2O5ZH 3KPSE 4NXSA 2J5LC 3UTPD 3EAUA 2PP1A 4MJ6B 5CD3B 3WNNA 1M7PA 4OLXH 4J6RH 4K3HA 1HCFX 5AVXB 1U91B 3BG5A 1GUVA 1KDIA 4YQXL 2PDIA 3NZPA 4E41E 2NQJA 4KO5A 1DQMH 2ZX5A 1PKLA 3FMGL 1F42A 2DQFA 2YD0A 4G1MB 1NAKL 1OAYH 4TVDA 2B1AH 5DVLA 4QNWA 3T6QC 2YSSB 5GGRY 4QY8B 3GW0A 4HMCA 1MCWM 4F2BA 4L56A 5E8NA 1V7ML 3A4AA 1EYEA 4AISA 1GRWA 3KHJA 5C0IA 1K8IB 2JKRM 4XMTA 3IGSA 1TQCC 1KV8A 1C5CL 5G4MA 5KSAB 2FGWL 2GIYA 5E03A 3RNDA 3PVFA 2CZNA 1TTPA 4HFUL 4LBUA 3ZR4A 2R9HC 1MRDL 4PWGA 3FBQA 3G6MA 3GS7A 5FECB 2V3GA 1NKRA 3K4AA 1IC1A 1U9KA 5AVRB 3CAVA 3RFZC 1A1OB 3Q5YA 1V4YA 4OM0L 4TL5A 2DEYX 1EAOA 3HC0A 4JIIX 5EOQL 5FUOH 5CFHA 5DUBA 4LCVA 4FLOA 1FRGL 4FXGB 4JG0L 2CO1A 3SODB 2M26A 4JQIL 4TIMA 1KBWA 4ZW3A 2WLYA 4XAPA 2NZ1A 3LDVA 4ONGL 4U3CA 3QFDA 3S8GB 4WOQA 3RGVC 5IBXC 5C0FA 4KDWA 4OM1H 2XGZA 1D3HA 4JRXB 3G1YA 2Q8ZA 3ARFD 5J13C 1PNDA 2ERJB 5FDWA 2YBRA 3PY2A 2JV6A 2AEQL 4KWWA 3UF9A 4B3ZA 4UM8A 3XIMA 3EAKA 3O4LD 3AU1A 4HOWA 1E4XH 1XGQB 4O13A 3HI6L 4JTSA 3IUIA 3F04A 3N3TA 4PV9A 1EUNA 3H9SD 1Q9LB 2AK4D 1JXFA 4YK4C 1ICPA 2Q8AH 1MJUL 3CEUA 5D37A 2GGIA 2V38A 3MWAA 2Y62A 1ZV9A 4OOZA 1U8CA 4PG2C 2ZF9A 3GDRA 3L4UA 3JWOL 4G8EB 5HGGS 1W54A 4HFWB 4JCLA 2V3DA 5H2ZA 3EMQA 1PD0A 4FFWC 1ETJA 3BIKA 3E6EA 1RR2A 1NCCH 2EUXA 4O17A 5D09A 1ETB1 1TG8A 3LX9A 2Q02A 5J5EA 4WCYL 3W2UA 5FKYA 4H0GA 4P9HC 3MC0A 4O12A 2BIQA 5LWYH 3B5HA 4DN3L 3U1QA 5BS0D 1BFOB 1WIPA 2ZCHL 2N1KA 2R1WB 2ZXAA 3AU0A 5T9BG 3DK2A 5K59E 2CLRA 3EXJA 3A4WA 2BASA 5BMFH 1FDLL 4NZ3A 2EDJA 1AH4A 1SEBB 4QLWA 1AH3A 4ADJA 3OAYK 2R4SL 1FFPA 2ENSA 1NCDH 1BVNT 1SMDA 4JRYE 3EJPA 1XKJA 3H6JA 2E9JA 1GA2A 3TU6A 1JQXA 1YJDC 1U4FA 1GQLA 2IH1B 4M48L 4G6AC 2GK0A 4AXWB 1AKJD 4O50A 1XZ0A 3P40A 5FO7B 1GVIA 3LTPA 1X97A 1R0MA 5CO1A 1C9SA 5TDOA 2DDQH 3ARFB 1KCXA 2QAFA 3A9IA 1GC1C 3ES8A 5EZJB 3NG5A 1GZ1A 4E2BA 3O4LB 1GOQA 4HCGA 2DLIA 3N9RA 3N42F 3X3GH 2ZKXA 3MOBL 5A1AA 5GHWL 4HJEA 3W7QA 4U1HB 3H9SB 5LKYA 2AK4B 5LDUA 5BRZD 2AQRA 4WUUA 5IHBA 3HNTH 4GA8A 4LNYA 4FP1A 5ECVA 2VLME 4YDVB 5AW6B 4IKLA 3CDGA 2NWSA 3AXLA 1DQKA 3THUA 3W7RA 2BP0B 2RQEA 4OI7A 5DJYA 2XPYA 3BH9A 1T8XA 1AGFB 3CLFL 3ZE2F 4X6CF 3CV6A 4E9TA 3KGSA 4OF5A 4RGMC 1J0KA 1YMMD 1ECZA 4HTBA 2GJLA 2YWZA 5T1DL 4A2GA 3PDOB 4EMZA 1MCPL 3WUEA 5BS0B 4GIYA 4BXVA 2OMBA 2ZE0A 1ZANH 4BFEA 3IXAB 3H4WA 3W87A 3GRWA 1U1UA 2HRPH 5ENWA 2R0LH 3KGRA 1TWDA 2ZXWB 4GFXA 4MMZB 4FI8A 4PRPB 1QOKA 3SDDD 4IP4A 1F6YA 1PDYA 4QT5A 3TQPA 5AENA 4GY7A 4CL7A 1NDYA 1A8ZA 3KBNA 4U6HB 3X14B 2PMZA 2FB2A 4YHNA 4NKOA 2JKLA 3WKYA 2HK0A 3PTKA 2DYRB 4TLSA 4H9TA 3L3KB 2VO5A 1AKJB 3P2DA 3GVVA 4MLIA 1YYMH 4Y2DB 4TLUA 3QI9C 1A5AA 3KVPA 1K7FA 5HI3C 3KD4A 1TJIH 4FAMA 2AAVA 4S2SA 4LY4A 4AL8C 1SLXA 3LRKA 5HDBB 1IKOP 3CGTA 3NABH 3P3BA 3R8QA 3T07A 4HPOL 5JW4Q 3S6CA 4AFYA 1R3HA 2PO6D 2QMKA 2Z93A 1FV1B 1LOLA 2IAMD 1VBHA 1CL7L 1SDDA 5BRZB 3RA7L 1Q1JL 2DBJA 3KYOA 4OGYH 5KS9F 4P9MH 2VVNA 2XN9A 2MFNA 5DK2B 1DJXA 3RLSA 4JHUA 2ZZ1A 2A3TA 4LL4A 2A9BA 5C7HA 2XG4B 4NKQB 1U4EA 3HPLB 3FSOA 1QWGA 3VU2A 5K9XA 3FQWB 3L9EA 2BOGX 3OGVA 1XIGA 4J28A 1H7WA 4PJ8A 4F0SA 2Q86B 1SM3L 1E2WA 2FATH 5EWIL 5LHFA 1YMMB 4YOKA 4U0RC 1MXSA 4BR1A 3O3EB 4NNAA 1NMCB 1DJNA 2GQ8A 4HU4A 3JYCA 1I4FB 1B9ZA 3T3PE 4A21A 1PKQA 3ZKNC 6PAZA 1IGCL 4LUJA 5EV7A 3L8QA 1VERA 3L1OL 3B8DA 3SDDB 2AEPL 1YO4A 4LKXB 2I5YL 4DEUA 1R3WA 3W7EA 3PGFH 3SE9H 2VXSL 2YGNA 2XZAL 2XFWA 4PRIA 3ABZA 2VLKD 1L0QA 2H3BA 2OFQA 4KK8C 1ZDSA 3BP5A 4JO1H 3TA3C 2P8CA 4H1LH 1XAKA 4PLJD 1EEYB 1QBLL 2OI9B 3EFFB 1MVYA 1SYVB 4H40A 1HEHC 3KG5A 1HHGB 3W29A 1MFAL 2OXHA 2YJLA 4UINL 2V82A 2ZOLA 3EYPA 3WHE0 3NEVA 4LOUC 4MZIA 2VDGA 3DPBB 4U6XA 2PO6B 1UA7A 4KRPD 2CNZA 3BAJA 3UPAA 1PYMA 1M9SA 2EE9A 3O2DA 3FNDA 3IYLW 4EPBC 3QQDB 1I7RB 5L2JB 2EEBA 5D5ME 4YSRA 3V4PH 2QUUA 3PZUA 2PTTA 4N2OA 3F7JA 4OF0A 4PLOB 1G7QA 1NC4A 3OZLA 4HPGA 4XN1A 4R83A 1AS6A 5D4IA 4ILSA 3DOPA 3VK5A 1ENUA 2WWMC 4R26L 5J1AA 1IAII 1T6WA 1E5ZA 1YZZA 4K8GA 1S7XA 4HU0A 2PW2A 2YA1A 1AC6A 4PRHD 1SJCA 5DJXB 1FO0H 1XWYA 3BEWB 4C6NA 1NWTA 3MP3A 1F1DA 4Q8WA 3IJSA 4LRSA 4Q32A 4JTRA 3UBGA 1TENA 3EG9A 1IEWA 1WSST 3NPSC 1IXQA 2ZZ5A 4XMPL 1OX5A 4GG8B 4AY0A 2VZTA 5FYJD 43C9A 5CSYA 2KYIA 3T7VA 2VAAA 4P7QA 3W3OA 1S7UA 4LASL 4LUSA 2D8KA 3T3MB 5FGSA 2ATAA 5HHPA 3RCMA 4O51A 3R06A 2Y5EA 4G9FE 1MH5A 5AAWA 3H7UA 1ICSA 2ADFL 1W5NA 2VLKB 4ONVA 5JPMA 4KO6A 3CIQA 2R0KH 4GD0A 5FJTA 3QPXH 3WD5H 4QHKI 4Y9AA 2LOEA 1MJ7L 2EINB 4Z23A 4V1DD 4KV5F 4APXA 1KPRA 4D1JA 3DX7B 3C8NA 4ZPVA 1V6VA 4MNQD 4WOZA 4WTZA 5HULA 2HRLA 1P0DA 4PMOA 5TAOA 1YXCA 3HAEG 4X4YA 1QKZH 8FABB 5IVOA 2WIIA 3IV3A 1JPHA 4TMBA 5LNVA 3OX8A 3FU7B 3QDGD 3IWPA 4G8TA 4GQ0A 3AUWB 3T6XA 4JYDA 4LHUA 4KRPB 2DJLA 1M7IB 5IT2H 1YEFH 5C08A 2X2UA 5HHOD 5CJOH 1BKHA 1V6XA 4X9SA 1PWLA 5D9OA 1PPIA 1B3JA 4NQXA 3MCNA 1PX8A 2APVA 2BSDA 2LHAA 3SUVA 2WNXA 1C91A 3AIEA 5TE4L 4JFYB 4YVXA 1MG3C 3IU3A 4ZPTA 2C19A 5GRXG 5CC3A 4JN7A 1F6AB 4WFHD 2XWXA 2Y7FA 2ESVE 4E2DA 2XTJE 4XXWC 1UUMA 5T5NG 4IIDA 4AM0A 1MRQA 4O02B 4PRHB 2YCEA 4LZKA 1TG7A 4PYSA 4S3GA 3ELFA 4J4PC 3KPSA 4F1SA 1A65A 2ZD0A 2YPKB 5SWZB 2QHAA 3QIUC 3CQIA 1F4WH 1GOOA 2EDLA 2X6BA 3SGEI 4H04A 4OZ4A 4FNUA 4E41A 3BK0A 2VDOH 2EE0A 1ET7A 3WLWD 5EEUA 3H70A 3WJSA 3N04A 1PVHA 4HUXB 1DKWA 1JHLH 1AZ2A 4AITA 3NYZA 3U82B 1I8JA 3E0VA 4LLQA 4GK8A 5G5IA 1K4GA 3SN1A 5D8WA 5D2TA 4C56D 3TV3H 2PS2A 2JWYA 4IRZL 4QRQA 1ZEAH 4YAQA 4LHJB 3IRSA 4KK5D 3NZ8A 4M7KL 6TAAA 3K8KA 3I9AA 5DD1H 3IVKA 4QGCA 3N1PC 3MR9B 4H8WC 4MNQB 2R2EA 4JIPA 5AYIA 5CD5C 4Y5VA 4AV5A 1HJBC 4HGMA 4P8VA 3T0DA 5EU3B 4OUEA 5CEXB 2IOMA 4G8FB 3SBPA 3DRQB 4I9WE 5EC2A 1G9ML 2X3BA 1JIBA 1FPTL 3MXVL 3QQ0A 5GS0L 4GXPA 1E4KA 1OYBA 5HHOB 4QOKB 3STBA 4LSSH 1KFJA 4EK7A 1Q94A 3KL0A 3GMNA 3FT3B 4RMBA 4DP2X 2PETA 4J3ZA 3DFQA 4W8LA 5B8CB 4IX0A 1XCQA 1YA5A 4J2XA 3EBVA 2CO7A 2ZUUA 4QQ3A 1LEIA 2BVOB 2A83A 4WU5B 5I1EL 3VGDA 4N5ED 5DWUH 3BPOB 5EIIA 3TN0C 3S97C 5AZ2H 4Z5RB 5KSBF 3MACH 1QSFE 3EOAA 3QXDB 1HIMH 2A6DA 4R4BA 1XRTA 3HZVB 3CFDA 1O75A 1OARL 2PBOA 1MCOH 3R79A 1EHXA 2QIWA 3ZIYA 1YN7A 1BRLB 5I76B 5I3IA 4JPKL 2GK1A 1X9RA 4L1SA 4E9WA 4JVPA 5HHVL 3KS5A 1X5HA 4JLRB 4DEWA 4JQ4A 3CO4A 1SUHA 1F3TA 4OZFG 4WI0A 3QG6A 3SRFA 4C56B 1NEYA 3G3MA 2PPGA 3ZZLA 4YSUA 2IIJA 1H19A 2IXQA 3NJ3A 3F7RA 1ORSB 2DZUA 4U1SB 4NN5C 5KZCD 3U30B 4CSPA 3PAJA 4LYRA 2PYED 3HBGA 3PPHA 3VRLF 4XN8A 2FZ8A 2V8LA 4AH2A 4W84A 5ICXB 2GOKA 2X1OA 2F9BT 1I9IH 3MCG1 5BMWA 1P6AB 4JRYA 3PWNA 4X6EA 3RWEB 5LA0A 3IDYB 5JDSB 4DKFH 4K3ZA 2VFFA 2I56A 4I88A 2E9MA 4EAYA 2XV3A 2YXXA 4WUKL 1RLCL 2NZ9C 1D6EB 4DF0A 2JB6A 2EGZA 4L4MA 5IJKA 3VMPA 5IM51 2PYFB 3K13A 4WKHA 3PUUA 4AQZA 3CN4A 2YPLB 4Y8FA 3VXQB 3F2DA 4MJ4A 3HZ3A 4NSKA 4IMKA 1HDMA 1IFHH 4ZGYA 4LU5L 4B5UA 3AAZA 2QDGA 2ICEC 4BFOA 1BVZA 2P7TA 4X63A 3OG6B 4L0PB 4Q3MA 1NIDA 4MWAC 1BYDA 4DQWA 4BCZA 4QGYA 1V3LA 5HJ3A 4TQ8A 2ADJB 3HQNA 5I66A 3H2OA 5IF0A 3BOLA 3MRHA 3VXTB 1FQ0A 4RZCA 1XR2A 4GT0A 4MD4B 3T2NL 3GDTA 2DSZA 1DYZA 2OQJB 4AQ1C 1BPLB 1FKXA 1T1XB 4NFBA 5LA1A 2L04A 4PM1A 2G5RA 4R7WA 2BS71 4ATLA 1XRFA 1QVOB 4PJAF 3UD6A 4RIRB 3HZKA 4CC1A 1KGJA 4G59C 3MKGA 4PSRA 5DA4A 4XNDA 2LW3A 9XIMA 2FBRA 2HB0A 1BQGA 4MKMA 2YDQA 1FG9C 4K8RD 4Q6KA 4HULB 1GKQA 4BWLC 2A5UA 2PDFA 1UZ1A 4MZ3A 5FJRA 1QABA 1HL2A 2E68A 1G7MB 4PUDA 1JFQH 2DBLH 4DP9X 1G43A 4TLKA 2NV9A 3FPYA 1T2JA 5DVNA 3SQSA 2P26A 5DK0B 2FEDD 4ALAH 4O1DA 5B22A 3KBJA 4OVVA 1D5ZB 1Y6MR 4NT6B 2ACSA 1SHXA 1GZPB 3SOBL 3LIZH 4MB1A 2IDCA 2I07A 1JRHL 4GUGA 3P8JA 1HXYA 4NWTH 2D7TH 3WLJA 3W1RA 4ZMNA 1AW2A 1E1FA 3UBHA 2EDMA 3RO8A 3V0HA 3BFOA 1LBMA 4L61A 3HQOA 4DI8A 5HHQB 2KS0A 1BZ8A 4BZYA 3E3QC 4NQCA 2Q3RA 3SE4C 4MCNA 4OH2A 5H4ZA 4XPHL 3PJNA 1UJ3C 1JVLA 1H3PL 1BJ1J 1BQCA 1LE5A 4ZZKA 1OVDA 4PMYA 4KTEL 2CGRH 3OAWA 2J57A 1JRCA 1GGIH 2O6PA 3ZE1B 3DG7A 3NQ2A 4Y19D 4FE9A 1N6QH 3ZKQD 5JXAH 3BV7A 2J1YA 3FS9A 5CZKA 4MIMA 3WLQA 1S3RA 3EZ4A 4BQ4A 3GNXA 3GJFH 3VX1A 4IBSA 1TTBA 1W9VA 1BZDA 4YVPA 2Q5BA 4F79A 3VWKB 4XWOD 1LRTA 6ENLA 1SJVA 4OIFA 4RV3A 3I2CL 4TPRL 4RCAA 3GGWB 4OCWL 2IANE 2OR9L 4JQVC 1ZNNA 2QF8A 3L67A 4XBGA 5HWJA 3W7JA 4DJMA 5I15H 5IMLB 4KFNA 3I65A 1WJ3A 4ACTA 1J2BA 3WMCA 4MSWA 4NGHL 2YB4A 1ZLSH 3FTSA 4AK2A 2BNRD 3ZW3A 3ARWA 3T0EE 2HH0L 2YK1L 2YXMA 3VXNB 1VEMA 3F7VB 4GGHA 2DEXX 3LXUX 4PP1D 3SYCA 4LPTA 4RX4D 1XIMA 4PRDA 2ED9A 2J8TA 4JKPL 3BVNB 5CKGA 4OB5H 3HS8A 1BOYA 1RZ8B 1IAIH 4WSHA 1L7IL 4F9DA 5I26A 3CN2A 4F7TA 3DX8A 5I5RA 4ZQRA 2Z7KA 4XWGL 4KIRA 4X2UA 4IRSD 4XBJA 4YS4A 4N2BA 1PTZA 3FCTA 4GCXA 4P5SA 3HI1B 1MRAA 4EEEA 3B8WA 2OT1A 4QS5A 4YE0A 1VFLA 3R2GA 2I9UA 3DI3B 3WQFA 2R69L 3II1A 4RL3A 2DU2A 3PY9A 5LB1A 2UZIH 3SBWA 5K9QG 3RFAA 2ZCZA 3CFJA 4N6RB 5DUPL 5EIIG 1R5YA 4BSWB 1QU4A 1HHKA 3KPQB 2CKBA 3FUNA 4D0BA 1SVDA 4FOJA 2DWYA 3VKDA 1JTPA 2WOYA 5JIHA 1Q9KA 1OD7A 4M8QA 5IESH 5DMKB 1EH9A 1OP9A 1OGSA 3QZWG 3FUFA 1TPB1 3PNRB 3BVJA 1BWKA 2P76A 5D5MA 5IOBA 3LERA 4F7MA 2H6PB 1F8TL 1MF2H 5BVJB 4KNQA 5IP4A 3RPTA 1B31A 4M6AA 1N6UA 3P0YH 3GNOA 3O06A 1MFVA 1GW0A 1L9WA 5TE7L 3O41A 4F27A 1U8LB 3PGDB 1A80A 4GFSA 4L2YA 1OK4A 3K5XA 1A4JA 2FWSA 1OXYA 4L4VE 1KV5A 2BGQA 4L0ZA 4BGDA 1E6OL 4Z7OB 1KYAA 1EX5A 1Q0XH 3BP4B