4JL2A

Crystal structure of a bacterial fucosidase with a monovalent iminocyclitol inhibitor
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
438
structure length
438
Chain Sequence
b'EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEKMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords alpha-L-fucosidase
molecule tags Hydrolase/hydrolase inhibitor
source organism Bacteroides thetaiotaomicron
publication title Exploring a Multivalent Approach to alpha-L-Fucosidase Inhibition
doi rcsb
total genus 164
structure length 438
sequence length 438
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4jl2A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4jl2A01
2J7FA 4EE9A 3SCVA 3WQ6A 4TVDA 3U5YA 4J27A 1O6IA 3WQ4A 1V08A 4B3LA 5IHRA 5AC5A 5CPQA 5DEZA 1UH4A 4IPLA 3EDFA 3ZT5A 1QNRA 5FKYA 2WZHA 4P7LA 2VZVA 1E73M 1V6UA 4HMCA 3SCQA 2G3MA 2ZUUA 3ARRA 1DWJM 3VKKA 4YHGA 4XX6A 4Y7EA 2VTFA 3A22A 4MJ4A 5LYRA 3SUWA 1B1YA 3F5KA 1GOKA 2YA0A 1E3XA 1VEMA 1SMAA 1YQ2A 1X6LA 3RPMA 3N1AA 4WLCA 1JF5A 4HA1A 4TVUA 1NP2A 4GQQA 2PBGA 4JFWA 1CTNA 3U7VA 3GDBA 5F7UA 2PBOA 1UD6A 3VD9A 2W66A 4D6HA 5CLWA 5E0CA 1CDGA 4JCLA 4FNTA 1WAWA 3VD4A 4AC1X 1E1EA 2WWCA 2VL4A 1UWTA 1PZ2A 3BC9A 1BQCA 4P7RA 1E0XA 2WCSA 5GQBA 4UOZA 4CCDA 1R7AA 4FLRA 2A3CA 2X2HA 1XRVA 3ZT7A 5ECUA 1ODUA 3L4XA 2GJXB 3WBEA 1PX4A 1W9BM 2QMJA 3BMVA 3AZTA 2BY3A 1X1NA 1KGUA 3WD1A 3S5YA 1CGUA 4UQ9A 3BH4A 4H8UA 2A3AA 1K9EA 2WC4A 1B2YA 3BUIA 4P8UA 3T0AA 2XN0A 2X2JA 8CGTA 3QHOA 5FIPA 2J7CA 3TP4A 2D24A 3KWXA 3ZSSA 3MANA 3AMCA 1NM9A 4GKLA 5CLTA 2BVYA 4QFUA 1UD3A 3VNYA 2XTKA 4DWSD 2XIBA 4PMYA 1O7AA 1KTBA 3QOMA 4OJYA 2BHUA 2VRKA 3ZSTA 3WEOA 1DTUA 1TQVA 1W9XA 2FHBA 4ZENA 4AD1A 5HPCA 1GW1A 4HPHA 1QI3A 2OYKA 1QHZA 1UA3A 4NX0A 2VX4A 1B3YA 1UD2A 2F2HA 2F7QA 3RIKA 4KGJA 4D1IA 2BVTA 1E6ZA 3IJ7A 4D6EA 4CGTA 3MSGA 2YDQA 3WDRA 1HJQA 1NOUA 4X9YA 3OLIA 5I24A 1E4NA 4PSRA 4OIFA 5CPTA 2WZIA 1EQPA 2E40A 1R34A 1E4IA 5M5DA 3T0BA 1HTYA 4PMUA 1VFMA 3AMKA 2PWHA 2DDXA 4MTVA 1B9ZA 3WF4A 3PHAA 1V6YA 2J78A 5A2AA 3UG4A 3NYDA 4V27A 1XH0A 3THDA 1Q6GA 2XFYA 2WHJA 3AFBA 2PWGA 4NZFA 4E4PA 2ZUWA 2WXDM 4ZE4A 5HBFA 1WP6A 1HKMA 3MSDA 2DSWA 1TZ7A 4IPNB 4OKDA 1TQTA 2FYVA 4JHZA 3IAPA 4AZ6A 2WCGA 3PZIA 3BCDA 3CPUA 4CN4A 5CZKA 1ZU8A 5DT5A 3BUDA 1FH7A 1QNSA 2XVLA 4AIEA 1UR4A 4JIEA 4BS0A 4CVUA 2RGLA 3VM5A 1KR1A 3EMZA 3CUFA 3WQVA 4WKFA 3WH5A 2BS9A 1QWNA 3VNZA 1FH8A 3VX0A 1E15A 4P8WA 3NJ3A 2XVNA 3DHUA 1ZS2A 3ZJ7A 3CBWA 4LYRA 1GQIA 1B30A 3WH6A 2VRQA 3IK2A 1KBBA 4MB3A 4FF5A 2XWDA 2PWEA 1MFVA 2CXGA 4MAVA 4ATLA 4Z2GA 5I6SA 3EDEA 3CV5A 1ISWA 3ARWA 1JDAA 3K1DA 1DWFM 1EHNA 5AYBA 3A5VA 2VR5A 1DWIM 1QI0A 3N18A 3WMBA 4D6JA 3PTMA 3PZTA 3LMYA 2VVNA 1KXQA 4U5IA 4M29A 3MUY1 3W0KA 3CZGA 2VRJA 2VI0A 2Y5EA 5I77A 6A3HA 5GNYA 2F61A 3VIFA 1MVYA 1QBAA 1E56A 2GJRA 4XZWA 5BRPA 3CUIA 3N11A 2V5DA 4UCFA 3WDPP 1C7TA 1B0IA 4HZ8A 1VB9A 4W85A 4AISA 3KLKA 3EDJA 2WKLA 1IZJA 3DDGA 3PZQA 3ZT6A 3G6LA 4UZUA 1H41A 3EDDA 3NIYA 2WMIA 1E4MM 4JKKA 2O9RA 3PZNA 4CD5A 3NSMA 5ABFA 3ZOAA 3ZO9A 3MUIA 1CNVA 1M7XA 4J7RA 3MI6A 4P7QA 3OZOA 4A3YA 1QWUA 3IGUA 2G3JA 2WMIB 4AEFA 2VX7A 1LWJA 3WQ5A 5A6SA 3VMNA 1GCYA 1V6XA 2EPOA 3EJRA 1HT6A 3VIPA 3FHQA 3BAYA 1NOFA 2OW7A 3VIMA 3W28A 1PIFA 2GK1A 1E6PA 3WMSA 1UG6A 4PUDA 2DSUA 2GJPA 1JDCA 1V6WA 1KQZA 3SCNA 3M46A 1ZB5A 4PTVA 4F79A 2A3EA 2Y2WA 5A2BA 2PF0A 1QI2A 1MW2A 2WVVB 3AYSA 4B9ZA 3OLEA 3GXTA 4A4AA 3ZJ8A 4HZ6A 3OGVA 3MMUA 1NH6A 3K8MA 1XD1A 4HU0A 1GUVA 4WK9A 3G6MA 3TTSA 1LF1A 5FL1A 5JBFA 3VSVA 1EDTA 3ARYA 2V3GA 3CHDA 4URIA 2JF7A 2V3FA 3POHA 1CGYA 2FE0A 4ZXOA 3W25A 3AXHA 4HP5A 3SCTA 3WF2A 4QLJA 2JIWA 2D20A 2QMKA 2D0HA 1MQQA 2WMFA 1JDDA 3K4AA 1UR8A 1DWHM 2V5CA 4J3UA 1E6RA 5BWFA 5A6BD 5AC4A 1J0YA 1W3KA 1ZBKA 1G01A 3BMWA 4EK7A 3EYPA 4PTWA 2A3HA 4PUEA 2OSXA 1EXPA 2WHKA 2X8RA 3VTRA 3AHVA 2CBVA 1UUQA 5CSUA 2WSKA 1QBBA 3WY2A 1UASA 3JUGA 2E9BA 3PTKA 1JD9A 3AMLA 1VEOA 3LPGA 1R46A 4PMQA 3W4RA 5A6JA 4ZEPA 3AIRA 3FNDA 3LXCA 4AZCB 2VURA 3VSUA 1M04A 4UQDA 3QGVA 4DO6A 4TX8A 2YL5A 7A3HA 4IISA 2XFRA 1J0KA 2Y24A 4BQ2A 1E6QM 2TAAA 3DDFA 4KH2A 2OSYA 2QV4A 2Y8VA 3SUVA 4OUEA 1FP8A 3U5UA 1VAHA 1QNPA 2QF8A 1E70M 2E9MA 1CWYA 3PZGA 3N12A 4GI9A 2W63A 4D72A 2JE8A 3D52A 2JFEX 1V6VA 4HOWA 3VDBA 1QOXA 1E6XM 4MB1A 2JALA 4A3HA 1EO7A 4LYQA 1HN1A 5E09A 3A4XA 1XH1A 5ABEA 3DC0A 3UR7A 4M80A 5D9MA 4W7WA 4DWSC 2WB5A 2Q8XA 3OZPA 2B31A 4AZCA 3W27A 1JZ5A 1U30A 1ITCA 3VU2A 1ESWA 1V3LA 4PTMA 4PBGA 2WBKA 2VR4A 1TUXA 3EDKA 3MO4A 3WH9A 4GPNA 4Z2JA 4BZYA 3VMOA 1E6NA 2WVUA 1JYXA 1EO5A 3QHMA 4HA4A 3WNNA 1GHRA 2D1ZA 1QHOA 1IZKA 1HWWA 4MAZA 2EXOA 4ACYA 3WFZA 1V0KA 2CCRA 3MS8A 2XWEA 4J3VA 3L2LA 1G5AA 1WDRA 2AOSA 2YLAA 4AZ5A 1MQRA 3FN9A 3NDYA 1TA3B 2W4XA 1MYRA 2BFGA 3NSNA 1EA9C 1JI1A 1HXKA 3KZSA 1OGGA 1TQWA 1UD5A 3ARQA 4LYPA 2NW0A 2EAEA 4GZIA 2OSWA 1D3CA 2F7RA 1IV8A 3WQWA 2D0GA 3UETA 4E2OA 2OWCA 5TD4A 5A6MA 2ZX7A 1QVBA 3HG4A 3CTTA 3VDAA 5I2UA 1KGXA 4XUYA 2G3NA 3LPOA 4W87A 5JBEA 3ZJKA 1CEOA 1WO2A 1UKOA 3B8SA 1JXJA 2O92A 4HPGA 5A1AA 1JZ4A 2DSKA 3D4ZA 5C71A 4F9DA 3M07A 4Q7NA 3BLBA 2JIEA 2ZX8A 6TAAA 5D8ZA 1DHKA 2G41A 4QCEA 2J77A 4GO8A 4D6IA 3IJ9A 5I3DA 1JZ6A 4P8VA 3BAJA 3FXYA 4WSKA 3ZM8A 2FGZA 1GQKA 3W26A 1E40A 1UR1A 1TFVA 4UFLA 5EBAA 4WSJA 2NSXA 3W37A 7CGTA 3W53A 3WENA 1E5NA 3WIJA 3TTYA 2VX5A 1VRXA 3CH9A 2DEPA 1OT2A 3RJXA 1UR0A 3N17A 4FNPA 4CCCA 1US3A 1JI2A 4D6GA 3WSUA 3KEHA 2WBGA 4H04A 3K46A 3LPPA 2BY1A 4FNSA 5BXSA 1MXGA 3CMJA 5LA1A 3VIIA 1UWQA 3VSTA 3WUBA 1W3HA 4CU6A 5JIPA 3BVVA 5CGMA 2WHMA 1D2KA 4PMXA 1PX3A 3VD5A 4AD5A 2E9LA 3CO4A 1UD4A 3UCQA 1GQJA 4J3WA 2C7FA 1TCMA 2CHNA 5A3HA 4MNMA 3A3HA 3KE0A 3U57A 1CGXA 3CHEA 5HOSA 2JF6A 2BNJA 4W84A 2J7HA 4ZFMA 1KB3A 2XM1A 2DH2A 3AQUA 3VD3A 1HKKA 3NSXA 4AZGA 2BV9A 3CUJA 4U2YA 4JFTA 1CXFA 4GI8A 3VDCA 1XGZA 5CPSA 4EANA 3L4TA 1A3HA 5JIWA 3SEPA 3LXAA 3VGEA 6CGTA 1KBKA 3FW6A 2DT3A 2XN2A 2PC8A 1ISXA 3PZMA 2OW6A 2CERA 4ATDA 3BCFA 1UWSA 5A2CA 1CLVA 3IANA 1JXKA 4H7VA 1TVPA 5E1QA 4PRWA 5HNNA 1JYNA 3DX3A 1VJZA 3QOKA 1Q4NX 3WD2A 4AD4A 2J7EA 3W82A 1YHTA 2WVSA 3F4VA 2ZE0A 3DX2A 4DWSA 1ZJAA 2UWFA 2WYSA 2EQDA 1ITXA 2WCAA 4W5UA 3W38A 4AYGA 5CQ1A 4OBRA 2E4TA 5DFAA 4YPJA 1EHAA 4MNJA 4JCMA 4AXNA 1J9YA 4JFSA 1N82A 1R47A 2X2YA 3AIUA 4CD7A 3S2CA 3SUTA 3AIQA 1UKPA 3BLPX 3GBEA 3W29A 5ABGA 4AD3A 1R87A 2DT1A 2XM2A 1PBGA 1VFUA 3OGRA 1TMQA 1XSKA 3BXWA 4FMVA 4H8HA 3WN6A 3VINA 3KL5A 1ZJBA 2WLZA 1OGBA 1C92A 4AIOA 2IGTA 3L4VA 3HN3A 4UQAA 1NOWA 2XHYA 1BYDA 1G9HA 1CZ1A 3RM8A 1JNDA 4OGZA 1GQLA 1UR2A 3ALGA 1TG7A 4Z2LA 5BXPA 1C93A 4CUCA 1X6NA 3WY3A 1UQZA 4PMOA 5LA0A 2DH3A 3OLGA 3AS1A 3WNMA 3BVWA 4MADA 4IUGA 1B90A 3T0DA 2F8QA 3MUZ1 3BAWA 3EBVA 1GORA 1MFUA 2ZX9A 3VVGA 4MJ2A 4LQ1A 5FCZA 1LWHA 1BPLB 1JZ2A 2WMJA 1I75A 3B9AA 2GK1B 4UFHA 4D6CA 3RMEA 4LGXA 3T08A 2XIIA 1E4LA 1XSIA 2XSBA 3AIWA 3MKKA 1OD0A 4ACZB 4L4PA 1V3JA 1QW9A 3WMCA 4PSPA 1GONA 1NWTA 1V02A 4K68A 1UZ1A 4BQ3A 4FNRA 1GPFA 3W24A 1C8XA 4ACZA 2ZXDA 3VIHA 2V38A 5CSYA 1NWSA 2J79A 3LRKA 2V3EA 1WZAA 4CKQA 3HG3A 4RE3A 2GSJA 1PAMA 2DQXA 5A94A 5IHSA 2J8FA 4PEEA 4AW7A 2VUYA 4W5ZA 1NQ6A 4C7GA 2XVGA 1TE1A 4DUXA 1DWGM 4CU7A 5KEZA 3WL1A 1J11A 2YJQA 4S3KA 3CZKA 1L8NA 4AMCA 2Z1KA 1HL9A 3PZVA 3SCOA 1BAGA 4OZOA 4JAWA 1G1YA 4W7UA 4DUVA 1T0OA 1UKSA 1GZJA 3L4WA 3GM8A 2CKSA 4B16A 3SCWA 4ATWA 1R33A 2D3NA 1ISZA 2WPGA 1JYWA 4TTUA 2GVYA 5A8QA 3QHNA 2GJXA 3WKZA 4IM4A 1CXHA 4OBSA 2YA1A 1JIBA 2F1AA 1KWGA 1V0MA 2RGMA 3H54A 3EMCA 1MW3A 2JEPA 5I79A 4C7DA 4MNLA 1UHVA 2DSZA 3WNLA 3AS2A 1WE5A 2YFNA 1LG1A 1RP9A 1LG2A 1ZBCA 3K8KA 3RM4A 4B3KA 3U7BA 4BQ5A 5ABHA 1BYCA 3T2QA 4R27A 2UY3A 1Y7VA 3S6TA 1CGWA 3UESA 1H1NA 1OIFA 2DGAA 2XFFA 1W9VA 3GTNA 1BLIA 3VIOA 1CXEA 1UD8A 1HL8A 4F9JA 1HJSA 1HJWA 2ZWZA 2IUZA 5E70A 2D0FA 3VIKA 4F8XA 4J3XA 1K9FA 4NSBA 4PMDA 3IAQA 4RL3A 3SCSA 4BF7A 3AHXA 4CN1A 4AY1A 3SCPA 4AIUA 2X0YA 1WDQA 4N42A 2G4FA 4XZBA 2X0HA 3TV8A 2J25A 3MUAA 4W88A 3VGDA 3KL3A 2VCCA 1M01A 3HMCA 1GNXA 1HJUA 4UR9A 1B31A 4AZIA 4QCFA 1V0NA 1J01A 1W9DM 3M7SA 4U3CA 4CD6A 1BF2A 2J47A 3T2OA 4AZBA 3VIGA 3CZSA 2F7PA 2Y4SA 3TONA 2VMFA 4PMZA 1XH2A 3CLWA 4C7FA 1EQCA 1ODZA 3OIHA 1B3XA 3GNOA 3WF1A 2YKKA 1C90A 1PIGA 1CXLA 1QI4A 1J0ZA 5EFFA 1KFWA 1TA3A 2WC7A 2VT0A 3RILA 3SCUA 1O7DC 2ZXBA 2ALWA 3DYPA 2VVSA 1TQUA 1AQMA 3POCA 5FD0A 3CIVA 4AEEA 4TVCA 5AY7A 1W2PA 1ISYA 3ARVA 2C0HA 3SIMA 5C70A 1FA2A 4MPKA 1XV8A 2J62A 3WELA 2YLLA 4QP0A 2CBUA 1RP8A 4W93A 1W3LA 3BVXA 4JKMA 1SFSA 4GZJA 1OT1A 4AWEA 3AHYA 2ZX6A 1XCXA 1E71M 2AAAA 1H4PA 2ZUMA 2EPKX 1B3WA 4GXPA 5A8MA 2W92A 2E8YA 3WUEA 1FOBA 3VM7A 1E0WA 1JZ8A 2DSVA 2PI6A 3CZLA 1UZ4A 2CYGA 3F5LA 1BVZA 1JAEA 1U33A 1OBAA 3WUFA 3LRMA 3PN8A 2CITA 2WMHA 3ARSA 1PX8A 1LL6A 2HVMA 2YBUA 1WDPA 3AISA 3CMGA 1F4HA 2VNCA 3GNPA 4N0RA 3BUQA 4BQ4A 2YBTA 5M03A 5EMYA 2CEQA 2XPKA 5E6ZA 1K9DA 1SZNA 4DM2A 4UQCA 1WKYA 5FOOA 5D4YA 4AZHA 2UY4A 4B15A 3TTQA 4UFIA 1WPCA 3VX1A 1HJVA 3GH4A 1VFOA 2W61A 1VJSA 3CZJA 1ZBWA 1EOMA 4DO5A 2WVVA 3H53A 1OD8A 4ML4A 1KXVA 3CZNA 1VENA 3PZ9A 1E43A 1SMDA 1H5VA 1JG9A 2F7OA 4S3JA 4HOXA 4ZE5A 2VO5A 3MMWA 1Q6DA 3LX9A 3CUHA 3DHPA 1B3VA 2ZICA 1D7FA 1EDGA 3OG2A 2FHFA 2QLYA 1VIWA 4HU8A 3VUPA 3AIEA 3CC1A 3THCA 1BG4A 3HG2A 1W1VA 1IT0A 5HPOA 2XUCA 4GIAA 1WDSA 5BXRA 4JFUA 4E8DA 4U33A 4MB4A 2J75A 5ABFB 3SURA 4M81A 1E5JA 3VGGA 4Z2HA 2AMGA 1CECA 4U5KA 2OYMA 4JL2A 1I1WA 2XSAA 2BVDA 2E0PA 3L2MA 5A6AA 2CBJA 4W89A 3EMQA 1W9PA 2CESA 4NI3A 1QNOA 2XN1A 1NP0A 1XSJA 4H8VA 3I3EA 3WDQA 3WF0A 4E8CA 2VCAA 1DEDA 3AS3A 2ZUSA 5M17A 5A8NA 4FLSA 2J74A 4M1RA 3OA5A 4F66A 4DUWA 2WNWA 1ZL1A 4JL1A 1QNQA 1GVYA 3RCNA 4GINA 4PN2A 1GOWA 3BAIA 4NZJA 2W62A 3DYMA 5JUVA 1CGVA 1SR0A 3RO8A 1CXIA 1G94A 2D73A 1K6AA 1UH2A 1A47A 1LL7A 2NT1A 4M82A 3BUBA 1LQ0A 2XG9A 3T2PA 3OB8A 4HA3A 3AOFA 2E8ZA 5BXTA 1CIUA 1TR1A 1C91A 1GVIA 1JAKA 4QLLA 1US2A 4HTYA 5DT7A 3VIJA 3AMGA 3K4DA 5A8OA 3DX1A 4TXEA 1R86A 3CHCA 1XCWA 2F18A 1Q6EA 2XGBA 2EPMX 1BG9A 1KGWA 3SCRA 5BROA 3AZSA 1W1PA 3AROA 1V03A 2X1IA 2WZEA 3J7HA 2EBNA 3D5HA 1UKTA 1FP9A 3LRLA 1WB0A 7TAAA 5A95A 3WY1A 1NARA 4UTFA 1WCGA 2GUYA 3WQ8A 5CJ5A 3APGA 3GXFA 4CD8A 2UY2A 4YHEA 4CVWA 5LA2A 2WSPA 1NWUA 1LJYA 5I23A 1HXJA 3N9KA 1UWIA 3T09A 5E9AA 1GOMA 2C8NA 1PS3A 4TTGA 1UYQA 2YL8A 5A6KA 1RD6A 2OWXA 4KGLA 1FH9A 1TVNA 1JFXA 1HP5A 4M56A 2VZSA 1V02E 3DYOA 4NXKA 2NT0A 5DF0A 1J0JA 2IXUA 4KRTA 4X0NA 1G0CA 2EEXA 3GXNA 3L4UA 4J3SA 5EB8A 3WY4A 5HXMA 3ZMRA 3OLDA 3I3BA 5CGTA 5D9NA 4V28A 4FLOA 4AMXA 1UQYA 3WNKA 4RE2A 3VGBA 3D51A 3UG5A 1KCLA 1EGZA 1HP4A 1I1XA 1Z32X 3WD3A 1Q6FA 2VX6A 3VDHA 4ZXLA 3AXXA 4D71A 3H55A 3W6MA 4PCSA 2VZUA 3ZIZA 3GXIA 2WW5A 1E3ZA 1PJ9A 2FDMA 2CHOA 4GZEA 3LXBA 4BA0A 5M3WA 3I3DA 1E6SM 4TX6A 1E72M 2WMGA 3FHAA 4UQEA 1V3KA 3BVUA 1UKQA 3HG5A 3WH8A 3WD4A 1M53A 3A23A 2WVTA 3ECQA 3MV01 4WJXA 2EPNA 4W86A 1E1FA 4XV0A 2D22A 1UA7A 2DIJA 5I5RA 2X2IA 2Y8KA 3GNRA 2ZUTA 2HISA 1HNYA 2ZIDA 1HF6A 4UOJA 1H11A 2XVKA 4PCTA 1R8LA 3MMDA 1P6WA 1XC6A 5AYIA 3EJSA 3BAXA 3ARPA 1OWQA 4UNIA 4UFJA 4WIWA 3WNOA 1ZBVA 1CYGA 3BSHA 1HX0A 3WFLA 2FHCA 3ARXA 3S5ZA 3VILA 2FH8A 5HDRA 2YIHA 4U2ZA 3A4WA 5FL0A 5GNXA 1PEZA 2ZX5A 2YA2A 3AIVA 1XYFA 3NCOA 1BYAA 5IFPA 4CCEA 3O2LA 2J7DA 3PZOA 3AMDA 5JBDA 2W67A 3AIBA 3DECA 2WAGA 2BY0A 2VOTA 4U3AA 2UY5A 4NZCA 4L4OA 2WLYA 3RM9A 1EIBA 3CHFA 3FY1A 1C7SA 1HKJA 1J10A 1HKIA 1JZ7A 1BVNP 4QDMA 4H41A 3AI0A 4V2XA 1KCKA 1KXHA 2CIPA 2ZOXA 2O9TA 4U31A 5DMYA 2D2OA 2YOCA 3W81A 2IXVA 3WNPA 1FHDA 2FH6A 1OSEA 1RH9A 1W91A 4RE4A 2CBIA 5DO8A 5I0DA 2CPUA 5I78A 1WZMA 1EH9A 4MDOA 3OGSA 3AYRA 3GH5A 1FHLA 3VGHA 4BCEA 5EFDA 3HU7A 4WKAA 3D50A 2CETA 1HIZA 1LLOA 1KXTA 4TOQA 1OINA 5KZ6A 4MB5A 1UR9A 3WH7A 3WDJA 1W1TA 2XYLA 1RPKA 2XJ7A 3UG3A 5C8BB 4R5EA 4FNUA 3UR8A 3KL0A 1MXDA 4GI6A 5BRQA 3II1A 3OBAA 1W32A 3F5JA 5E6YA 1FFRA 2EO7A 2DIEA 2EJ1A 4NRSA 1CENA 2DT2A 1QI5A 2WK2A 1V3IA 1KQYA 3DX4A 2ZUNA 3ARUA 3EJTA 1JF6A 1XYZA 1SYTA 2PWFA 4TUFA 2PB1A 4GO9A 2Z1SA 1H0GA 3BGAA 3W6LA 3CUGA 5E0FA 4AD2A 1BSIA 5BYWA 2EADA 4UZSA 1BGAA 3MU7A 1GOOA 4UFMA 3VD7A 3B9DA 2YDRA 2V3DA 1CBGA 1BYBA 2D3LA 3B9EA 4LPCA 3WBAA 3N13A 1JNEA 2WHLA 1VFFA 2ESCA 1JYVA 4EAMA 4DM1A 2F1BA 5D8WA 1W2VA 4WKHA 5A8PA 4FK9A 4D6FA 3ZQ9A 3L4ZA 2BXYA 2YL6A 2OLHA 1JD7A 3BAKA 3BUPA 4Q22A 4KMQA 1QPKA 4KRUA 2BY2A 1R85A 2JEQA 4Z2KA 4W8LA 3GBDA 4DWSB 4H2CA 1C8YA 3UERA 1R75A 1DP0A 1JGIA 3BLKA 3SUUA 3K8LA 1OGSA 3KLLA 4P7OA 4PTXA 3QR3A 1HVQA 5D9PA 1GJUA 4AZ7A 3A21A 2J7GA 3WD0A 1WZLA 3A6OA 4PYSA 2VCBA 2CKRA 3AS0A 3PZUA 3AICA 4CD4A 5IFTA 2A3BA 2EABA 4NXSA 4MNKA 4PMNA 2ZWYA 3EJUA 4HOZA 1K9TA 1FFQA 1LL4A 1VBRA 2O9PA 4Z2IA 2OYLA 3D3AA 1B3ZA 3TA9A 4GQRA 3GXMA 1U2YA 3ZR5A 1H0IA 1QX1A 1UH3A 1ECEA 1EOKA 4D6DA 2YL9A 3WL0A 4UQBA 1PPIA 1HJXA 3A4AA 3LPFA 3EJPA 3O6AA 2GDUA 2X09A 1EDQA 3N15A 1CGTA 1UWUA 2VJXA 2WMKA 5A69A 4KWUA 4EKJA 1NWRA 5A6BA 1PZ3A 2GFTA 2DT0A 1V3HA 1BHGA 1W1YA 1E0VA 1J12A 3FAWA 3TOPA 3CZEA 2YFOA 1UWRA 3D4YA 1CXKA 2VC9A 1ISVA 1F4AA 4HZ7A 1AQ0A 1V0LA 5BCAA 3CGTA 2BXZA 1AQHA 4UOQA 1MQPA 1W3JA 2J8GA 1XHGA 3NDZA 3N04A 4HMDA 4LX4A 1W9UA 2MANA 1C8QA 4HMEA 3VGFA 3GYCA 1CPUA 1JL8A 2X05A 4QLKA 8A3HA 1MW0A 3GXPA 3BSGA 1OM0A 1TQSA 2XVPA 2XGIA 3ARTA 4AD0A 4FNQA 3E1F1 3VO0A 2GDVA 3A24A 1HVXA 2WKGA 1C3FA 1H2JA 1WNOA 2QHAA 2QPUA 3IJ8A 3WUGA 4OOUA 1BTCA 4JKLA 4CN6A 1BGGA 3WF3A 4W8BA 3HJEA 5CXPA 2VZTA 1OB0A 1Q6CA 4P7NA 2OWWA 4OOZA 3HZ3A 3M6DA 2O9OA 4J3TA 3MV11 2DPEA 2EPLX 1OIMA 3L4YA 2PWDA 3VPLA 1QW8A 4J28A 4QAWA 4D1JA 1GHSA 3FAXA 4DO4A 5GPRA 2ZXQA 2QPSA 1OCQA 1XD0A 3AXIA 1KTCA 1KR0A 2J7BA 2ZUVA 2ZXAA 1GOQA 1KWKA 1JZ3A 1R7OA 2J4GA 3CZ8A 1E55A 3ZR6A 4MDPA 1H09A 1MWOA 1H49A 3RDKA 5A6LA 3GH7A 2BHZA 3ZJ6A 1J0IA 4LXFA 1V3MA 3RJYA 1L0PA 3O9NA 5IDIA 3ARZA 1QHPA 1VEPA 2G3IA 1J0HA 1BFNA 1WZKA 4W8AA 3DX0A 4WF7A 4CU8A 2WM0A 3WEZA 1UOKA 4JZ5A 4B9YA 4M24A 2WC3A 4XB3A 2WWDA 3WDIA 1H3GA 1VBUA 4YN5A 1MW1A 5CG0A 1E9LA 4JHOA 3AJ7A 4W7VA 1M03A 1GOIA 4X0VA 1AMYA 1J18A 3VMPA 2VQUA 4NRRA 2YDSA 3AHTA 2FGLA 1S46A 4AYSA 1GJWA 1DWAM 5D9OA 2W91A 3NUKA 2BHYA 3GZAA 1CLXA 3WDHA 2D23A 2G8ZA 3WEMA 1VF8A 5GNZA 2W5FA 3SUSA 3PBGA 2E3ZA 5IXEA 3ALFA 3VOCA 4P8XA 2EACA 3PTQA 4UFKA 9CGTA 1AVAA 3AZRA 3EJQA 4PMRA 3UEQA 3GXDA 1JFHA 4FLQA 2WANA 3TTOA 4NF7A 2VQTA 2CNCA 4PMVA 4AMWA 3BVTA 4JFVA 2VZOA 4M8UA 3AHZA 3A47A
chains in the Genus database with same CATH superfamily
3N4AA 4OVUA 4MBOA 1YLVA 3FUJA 2VFGA 1RY8A 1U8CB 3DG6A 1A0DA 3LHZA 2Z91B 4TO8A 3RLHA 2PURA 2J8UA 1V08A 3ABLB 2W5PA 4AX6A 3B97A 5HHQA 5EUOE 4AXKA 1KT2B 5IHRA 2WXGA 5CPQA 1LXMA 3ZY7A 1TWSA 4IG2A 2CAKA 4IPLA 1S5HB 4WJEA 4EOUA 3I9PA 3VSQA 3ML8A 5D4QA 3FQ1A 3SCQA 1I8MB 3O8XB 2IKHA 3TE9A 2P28B 5DD0L 4YSCA 1AIFA 3OKLA 3O2VL 1N68A 2W1NA 4WUKL 4H9TA 1NCBH 2ZUUA 2HS6A 1R24A 3LKNA 4K07A 5E6UB 1DWJM 2VFDA 4GKZB 3OPSA 4G2DA 5I1GL 4OZGE 4XX6A 1RZJH 1I8JA 4CQBA 4PBEA 1S5MA 1NDZA 1HYSC 2P88A 2WGXA 4MJ4A 5EN2A 5KZMA 4P2RB 1B1YA 3KGUA 5KN5A 4HSNA 1KLYA 1AHWB 2YA0A 1BOGB 5MEND 3KS6A 1JWSB 5LXGH 4TNWF 3UNDA 1OAUH 1YQ2A 2Y06L 4G6JH 1IMHC 1M2VA 4FABH 1MFAH 2NY6D 3QDHA 3RPMA 1SZGA 3B8DA 1JF5A 4FQ2L 1S6NA 3Q6GH 3ESVF 4TVUA 4Q8WA 3LB6D 2R4RH 4GQQA 5JHBA 1EJRC 3H8AA 1DUYB 2NY1D 2OMVA 4KZEL 3NPVA 4EUPH 4JFDE 1MCPL 2H6OA 2MH4A 2Y7QA 3D12B 3GDBA 4KU1A 4POZD 3RY5A 3BQUB 2AQ2A 2AV7A 3D85A 2PBOA 4D6HA 4KKXA 1AQKL 4GP5B 3U57A 4IRSA 1CDGA 2FT6A 1NPUA 1R3TA 2PF6A 2OX5B 3B2UC 3RHWF 1LOSA 3KS0H 3PHQB 3DVIA 3KW8A 4KBPA 5DS2A 1UWTA 3AFLA 1FRGL 3B56A 4F9LA 3EEZA 5D2XA 5IF0B 5GQBA 4LHUB 1DBAH 1V93A 3KTXA 2A3CA 1HEZA 2PXYB 2X2HA 3DUHA 1D5XA 3K7UA 4JFDD 5C09A 2EDXA 4RFOH 1E42A 1PD6A 3QFDB 4AEHH 4BFFA 3VD1A 3GC2A 5DQ9B 1POJA 4TMBA 3C5XA 2INFA 1SHSA 4ENLA 3F4DA 5HYJB 3RRXA 4OD3L 4FALA 1XYAA 2BY3A 4XCYB 4M6QA 2GGGA 3HMWH 5IW3A 4QXGH 4DGVH 4JQXC 4OJAA 3RWIA 1ZVNA 3CM4A 1KLFA 4JFHE 1CG9B 4K0OA 3UYRH 1F18A 2X40A 3IE4A 3S5YA 4CBZA 4UQ9A 1AD1A 1Q0XH 4F2UA 1TV3A 4H8UA 3S3JA 3W7PA 1K9EA 4XX1G 1VPYA 3CZFA 4YU1A 3T0AA 3V4PA 2DZAA 1P5UA 3WXVH 4HT3A 2NY3B 3VQ2C 4I1PA 3HI6H 3NJFA 1RAMA 1FWIC 1KRCC 3RG6A 2D3JA 3TVMB 3WFHA 2IANA 1P4LB 1YY8B 4XWOD 2P4AB 3F7VA 5E93A 4AC2A 3KWXA 3P2BA 4OFYD 4FD0A 1I2NA 4YO0A 2BMKB 4GKLA 3WTWA 2DUZA 2CPCA 2MHAA 5AEAA 3D0VB 3N9GL 1D9EA 3KX6A 5E08H 2UZYA 5ECVA 2F19H 4E41D 1HHGB 1UD3A 5LQBH 4QFUA 1M71A 2F53B 3NIDF 4LF1A 4ONGL 2XZZA 1IM9D 3VE0B 4M6MH 2CLZA 1FBIL 4DBEA 2BHUA 1OCRB 3L48A 4NIKB 5DHVB 5MEPB 3EB4A 4FIRA 5IIEB 2FLIA 2OQYA 4GC4A 4WWPA 2FHBA 2GGJA 3REVA 4M6VA 3MRBB 1KYFA 2H8PA 3TQPA 4LAZA 4DQWA 3BQ5A 3VFPA 1YNLL 2OMUB 5D55A 3WV0A 1THFD 1O5RA 4QBXA 4NX0A 5T5FH 4PGJA 2KT6A 3S4SB 2CGRL 1NM4A 4F2MB 1UD2A 3BPLB 2F7QA 3PHOB 3WS6C 2YSWA 1A6WL 4ZFZB 3WX7A 1P7BA 2JKWA 1ZTXH 4KOCA 1M1BA 3TA6A 2I60H 3QPXH 5C07B 1H8SA 3G6AB 4AQOA 4KI5F 2R1MA 1BZQK 3NH7L 1SDYA 4ZMYA 3ARED 3DKJA 3MSGA 4KJPD 2COVD 3EO9H 1BGXH 3HNTL 4N22A 4KX9A 5K1NA 1HJQA 1NOUA 4R4FL 1TZGL 4MUPA 4JN2B 3MU7A 5KG9A 5JW4M 4XPBH 4X9YA 3P3YA 4WNQB 4E9XA 3QNXB 4RNFA 2EE6A 4P2AA 1HU8A 4JGDA 2MQCA 4IRSC 4A2EA 5GHWL 5MEQB 2X6VA 2VDIA 4X9SA 2P24A 4US6A 4KDTA 3DFSA 5CPTA 1K4DA 2E40A 4UT6L 1SDAB 4X5QA 5B39G 3M5ZA 2DZXA 2R69A 2ZFAA 1FL6A 2NCEA 3T0BA 4GUHA 4FEIA 4PGLA 4MD0B 1MELA 3D06A 1HTYA 5RUBA 2Q3AA 3HNSL 3IGAA 1RK6A 2JCWA 4QHLB 2K8QA 1KIRB 2DQGH 1OFDA 1EP1A 4MTVA 1NF7A 3QG6B 1E6OH 2BP0B 5LSMA 2GITB 1VCGA 4DZ8A 2ROXA 2KKQA 3QXUA 4XMTA 4X98B 3ZHLA 5HDWA 3PHAA 2E7HA 4ZMNA 5I19H 1J5OH 1XLJA 3VKDA 4HJWA 3EHBD 5HYSB 1F5WA 2ERJB 4GQZA 2WY3B 4YC2C 3VXUB 3ZHFA 4DWHA 1K72A 3B03A 3D2UB 3THDA 2VLKE 4XMLL 5GS0D 1AH0A 2OJEA 3BP4A 4LMQE 4OZHA 4DOHB 1RVKA 3BWUF 2WHJA 2XFYA 4G56A 5C2CA 4I3SH 4C6LA 2HEJA 3DK0A 3GSOA 4Z7WE 1AYRA 2V30A 1S2VA 1RZIB 5K93A 3KBNA 4DBDA 3OR7A 2AK4D 2WSYA 1E5AA 3EYVB 3ZK0A 4AJWA 3UD6A 4BEQA 3V79C 4U6TA 3V52L 4X5XA 4O54A 3L08A 4NAFA 4R7OA 2OJEB 3BP4B 3K5XA 3ELAT 4CEXC 2F8OA 1QSFB 4FP8L 5KJ4A 3MSDA 3RLGA 4WHYH 2PDMA 4B5TA 1I60A 2XA8L 1XGRA 1A3LH 3AZUA 4FQIH 1X8FA 4IPNB 2WYHA 3PCYA 3U2IA 2EG8A 4Z1CA 3UJTL 1KUMA 2ZF9A 3IAPA 1TJ1A 4KRMB 4AZ6A 3UWWA 3BCDA 3DRTB 3BAEH 5CUSL 4O02B 2DQWA 5DT5A 3BUDA 1FH7A 1SPDA 4YWIA 4AIEA 3C60B 3F85A 4H0LC 4D0CB 4XOCA 3P9LB 2JKJA 1F90L 5JO5A 3EWZA 3VRIA 4JS3A 3IJSA 3SZ8A 1H6EA 2WV8A 1KMGA 3LGEA 3VB9A 1SSDA 3W84A 3F84A 2Q71A 2J4WL 2XG4A 1B4KA 3WQVA 3QIWB 5CC3A 2XOTA 1FZJB 2NR6A 4IYKA 1FGVH 4ZFOA 1KEGH 1SXCA 1RZ8A 2ODIA 2ADAA 5DBTA 3TWYA 2WKOF 1XLGA 1F4YL 3L5JA 1RV6X 2GJ6E 3NJ3A 4MX7A 2AL2B 3GUTA 4HS6A 2DI9A 1U8MA 1HCZA 2QFPA 5AOUA 2ZKYA 4U1MA 1B30A 3HJ0A 4L1HA 3L7RA 3PFUA 4K23L 1KBBA 4JFFB 1U36A 4BDVA 5F1IB 3NOEA 5T3ZD 3T8MA 1U91A 2VEPA 4G70B 2Y7QB 1V7NL 4REQA 5GS1C 3L0NA 3LYRA 3T77B 3RN6A 4EUPA 4LUSB 1IBZA 2IPKB 3FYPA 2VGLM 5LNUA 3FA5A 3I9IA 1EPVA 1X7IA 4QG8A 3ISRA 4DTGL 1OP5H 4JDYA 4LVNC 4FQJH 4KKLD 3EDEA 2RH0A 1DBBL 3HVNA 3HCVA 3IFPB 4PY8J 4MXQC 3ARDC 5TFSH 5KSBB 1KCWA 1DWFM 5FKPA 1ML1A 1RMFH 1AE6L 4FXRA 4GD0A 4PCYA 3IU4H 4K2SA 4XPAL 2VR5A 3P9LA 5F9WB 3DO4A 3Q05A 4QRFA 4DUOA 4K8RL 1JV5A 3BQ6A 2J56A 4GQ9H 4TN9A 3T42A 2XIDA 2R39A 5DFVD 3ZDZE 4Q7NA 3UJSA 3SY0B 2GDQA 3O4OC 3W73A 4A7VA 1Z3RA 2VLLB 4WO4D 3ABMB 2R0LH 1KOAA 1PCSA 3JXAA 1ZLVH 1B4EA 2CXEA 1ILUA 3ZRFC 3UXFA 3GRIA 3V0SA 1NDYA 1KXQA 3FMGL 4QDPA 3KWTA 4LSTL 2OZ4H 2ZT9C 3W57A 3ZDYE 4G1KA 1QATA 4GJ1A 3GRGA 1JPIA 3NZQA 1BQHA 3RX9A 3NCFB 4JRFA 1RI8A 3SDCD 4ZXBA 3A9IA 1J6OA 2ZG2A 3SGDI 1IRAY 4ZFOL 3GMRB 3GTFA 4QHNB 3ZDYF 1ACXA 5G4NA 1OY0A 4G6AD 2FGBA 5IGXL 1LLAA 3N25A 4QRBA 4C54A 5IB1B 2XQBL 2DM7A 5FESA 5BOZG 2RIKA 3LVEA 2DQHH 2DMGA 3TA3B 5C9JA 3VIFA 3RWGB 4B92A 1A22B 3VQMA 2GJRA 1AXSB 4NQCD 5BRPA 3U9IA 4BFEA 4EDXB 3QFJE 1KN4L 4M7ZB 4X9HA 4CMMA 1BXCA 4J4KA 4RMQA 4UCFA 4XN8A 2ZZ2A 1QW7A 3FA4A 1AMXA 4HHHA 3AXLB 3P61A 3APTA 1P4IH 5BV7L 2FMNA 4K3ZA 1WC7B 2FBRA 3HBZA 3QJRB 4L5FE 1XAKA 5HI5D 4F8NA 1IR1A 1N55A 4ES4A 5H94A 5B38G 3KLKA 3D46A 1Q9KA 2L7JA 3EDJA 4AIBA 5MP6H 3VXUE 4ZMAT 3LMJL 5FHBH 2WKLA 3JUYA 4HWBA 3PZQA 3DDGA 5DQPA 6PTDA 4CMMB 1IQ8A 1DJWA 3VXNA 1H50A 1H41A 3EDDA 1VLIA 2WMIA 1JFQH 2JIXD 3CFDB 3INOA 4MKSA 3W2UA 1RVGA 5EA0H 3G5ZB 5ABFA 2XWBB 3IE9A 4PY7A 4MWAD 1FNEB 4G7EA 5C0DB 2XKNA 1HYSD 3ZGHA 1G67A 3MUIA 4RFNC 1TZ8A 1BMWA 4Z95L 4P7QA 1OY3B 2XV3A 3FRPG 3L7FA 4PWKA 2EAWA 1U92A 2V5TA 2XG5B 4H8PA 1IVTA 2F8IA 3IGUA 1C1EL 1S39A 4S3CA 2UXGA 4XMKH 3RWJA 3UR2A 2F6AA 2VX7A 3SYPA 3VXME 3FT4A 3R58A 2WWKT 1JRHH 2IQ0A 1BXUA 2I57A 3BQUA 3D85B 3CXDH 3KJ6L 5I6PA 2WYIA 3G1FA 4P04A 3H26A 4O02L 2CMRL 3EJRA 1VCBC 3VNJA 1KZYA 1FVDA 5HVGB 3RGVD 2QKIB 3BAYA 1DZ0A 3L9RB 3P54A 1P7TA 1D7DA 3W28A 3S9ZA 1DQLH 5LVEA 2NY2B 4XX1E 3LCWA 2HLAA 1NL0H 2YPVL 3QQ1A 3ESOA 2Y6SD 3FFDB 4TL5A 2EXTA 3MVIA 1EEUA 3ZTNL 4JQ3A 2B59B 4UR7A 1C8PA 2GJPA 4OGAD 2SEBB 3ABSA 2VR6A 2R0KH 3KAAA 5EBGA 4ZTPL 1KQZA 3DRQA 3LCXA 2M83A 5HHOD 3M46A 5J5EA 3UTQA 2CO2A 4PTVA 2VDRH 35C8H 2ZRWA 1U8PA 4ICMA 4U1JA 4LOVA 1G7QB 5L9DH 2Y2WA 5A2BA 4KRLB 2IAAC 2YCKX 3R79A 3TF4A 4RV8A 2PYEA 1XG4A 4O58H 2E6AA 3ZJ8A 3Q1SH 3MMUA 4QR7A 2D2JA 2E74C 1EJFA 1LBMA 4JTCA 3PWUA 4FXKC 4QRAA 4GISA 4UOW0 5E2WH 3ATBA 4KY2A 4HQQL 5GRXG 2VFHA 4Y8AA 2BJML 2VAJA 1I4NA 3GR4A 4HHMA 1I8AA 4ZAKB 3WJMA 2IPTL 2Y7OA 1NLBL 3AADB 1WVZA 2I14A 3VSVA 1U42A 1IE4A 5GZNA 2BCKA 2NY5L 4GABA 1E50A 4QJ3B 3E8UH 5DJZB 1YPZE 3UBFA 4PEKA 1OSYA 1R3YA 4XO3A 4M00A 3LAFA 1TJPA 1X5XA 3POHA 4BGDA 1JCKA 2PDLA 3VFOA 4ZXOA 4GOSA 3AXHA 5D1QB 3G24A 3Q1EA 4OD2B 1EEPA 3W1PA 2AJYL 3P73A 3CH0A 4L4LA 4WY0F 1EEQA 2D20A 2JIWA 3CQJA 1H9VA 1G4RA 4GKSB 3GO1H 3UWZA 2WMFA 3UPBA 2ADGA 3HI5L 1CVSC 1XISA 4LSPH 4RISL 3WO4C 1ZLDA 4G6FB 3NQAA 2GEQA 1Q5MA 2GJ6A 2OQHA 2Z7KA 2V5CA 2F74B 3MGAA 4HWBH 5M7QA 3VXGA 4S2SB 2CE6A 4POUB 1DFBH 3F83A 5G4HC 4I9WE 4QTIH 1T20B 4GBXD 1J0YA 4XP5H 1RUKL 1L5GA 1G01A 1S2AA 3B8TA 2XH2A 4O1CA 1S7UA 5TQ0H 3KWSA 3GMMA 4EK7A 5JYMA 3IIXA 2WYTA 3C08H 3EYPA 2NY4B 2QCHA 2WTOA 4YBQC 3NZSA 4QD2E 5BS0B 3CEPA 3EX1A 4PUEA 3TQVA 2NQHA 1AH1A 1EXPA 3QQNA 1JPTH 3P0VL 2G9HB 5DRZB 1QK0A 3AHVA 2CBVA 1C08B 5DJ6B 2J55A 3CH1A 3WY2A 2ZOLA 2BSCA 3EGDB 3HI1A 2RHEA 1E6JH 3UBHA 1Z9AA 4O13A 2A9AA 4YLCA 3GNNA 1M7UA 1XBDA 4Q7IA 3RLSA 4HH8A 4ISVB 5E9DB 1KBJA 3QQWA 2V33A 2GOKA 4P23B 2A3TA 2PW1B 4G8GB 4OI8A 1TQBC 1N0LB 1NCNA 3QUYA 2CO6A 4UTIA 3AQDA 4XVOA 3GB6A 3EO1B 1A9BA 2VN6A 2PTTA 3DVGB 3QGVA 4DO6A 5G55A 4Q2ZA 4K7PX 2WQXA 3TSDA 4CJ0A 4HB7A 4IISA 4GKTA 2VDOL 5I0YA 4O5LH 5AW3B 4Q6XA 1F73A 5HD8C 1QK2A 2EDFA 2TAAA 3UC0H 4IXXA 5KVFE 4DVOA 3DDFA 4KH2A 2Y8VA 3NIGF 5EIQA 1IBDA 1L9TA 4NENA 4OUEA 1T2QL 4IBVA 1QNPA 3BWAA 3INUH 4IKLA 2EKGA 1XX1A 3TEUA 3MV9D 2WOBA 3ROOA 2GYSA 4AKOA 4XPHL 4X6CF 2CIIB 1LE9A 1UUOA 3EA2A 2W63A 4LU5H 3KRZA 4FFYL 3R6IA 2BGSA 4PGDA 3OG6B 3WN5A 1FO0H 1OQXA 1OVDA 1P0KA 2IXQB 3LM7A 4JHWL 1C5DB 3QIUC 1QOXA 4DN3L 3LSCA 3BLOA 3W2NA 4JTFA 2EDQA 5FYJU 4AYID 2YSSB 4K71C 2X4TA 4A3HA 1IM9A 1JCVA 4RCXA 4QQUA 2BP5M 3GIPA 4XHJD 3PTDA 1XS2A 2NQ3A 1XH1A 1JDEA 3R8BB 2AQTA 2XV0A 3MZNA 4QRPB 3B4NA 1HG3A 1IWAA 1Z89A 4WKZA 4GKNB 2Q8XA 4PTNA 5KZDA 4MAYC 4R0LC 1NGZB 2EZ0D 4KUZL 1N2RA 5CJ8A 3MRGB 4UTWA 3C6SA 4KMLB 4LBEB 3V9EA 4HUUA 3G5VA 3OX8B 5I74B 4ZK8A 4A66A 1J5IA 4O2CA 4OZHB 3MUGA 4ZXBC 2OG9A 2CLFA 1U8OB 4U3XA 3W1RA 3WH9A 3QY8A 4LARL 4XWUA 5CGQA 1FVEB 3V7MA 4IUOA 3EA1A 4XNZC 2I9TA 4YSTA 4A2MA 4BZYA 4Z2JA 8RUCA 1YUHA 1JF1B 2EZ0C 3WFEL 1T1ZA 1THCA 4N86A 4MQXD 4WW2B 4PI0A 4AIZB 1OYBA 4HA4A 3VKCA 1WGOA 3FTYA 2ATPA 1TTGA 3C56A 1UATA 1WAPA 5DA4A 3FX4A 5FA4A 4B90A 3TF7C 1I8MA 4LVNB 3S88L 3C12A 4AQAB 1MCHA 2MQGA 3NURA 1V0KA 2A77H 3E0IA 2CDEA 1F2JA 2CW6A 4QEHA 2EIKB 1P2CA 2XWEA 3BGGA 3W75A 2OTUB 1WDRA 2AOSA 1HNFA 5EU6A 3LU2A 3KPSD 2E1WA 4Q7DA 5HNRA 2PODA 3RWJB 4I18A 3PWGA 3OVGA 3NDYA 5C0JA 3BPLC 5KUMA 3TVMA 4I4WB 4NC1C 2QTEA 3MKGA 3WFHB 4Y9EA 4PBDA 4YXGA 1G4MA 2AJUH 2QJHA 4C65A 9XIMA 1HXKA 3KZSA 4PRPA 3SADA 1D5BA 3QG7L 5DT1H 2NX9A 2CBPA 2EAEA 3MCOA 1INEL 5E00B 1MFMA 2OSWA 1K5WA 2CHRA 3CQIA 2BNRB 1WCBA 4FA7B 1IC7L 1RUQL 4TQPA 2FTYA 3FFSA 1WT5A 1S5NA 1LO4H 3DPDA 3W0WA 5L0QB 4PUBH 5I5JA 5IMMA 3G1VA 1TQCB 2D0GA 4K71B 4KEMA 2R83A 4LL9A 2YAQA 2VR9A 4DVRL 5F71A 5FFGA 5A6MA 5ITBL 1AFSA 1FFOA 5LGHL 3K2IA 1AR1C 3CTTA 3CSPA 3PWVA 3HA0A 1EF2A 1SHXA 1REIA 2G3NA 2R4SL 4JDBA 3W86A 3SZ6A 3VI4E 1RZMA 3WLIA 5JBEA 1GJIA 3ZJKA 2YBVA 1BJ8A 5EOQH 4ERIA 2PRLA 3B8SA 1JXJA 2HWZL 3DSFH 1SY6H 1H5BC 4HWEH 4NQQA 1KC7A 2HRPL 4P9MH 2G5RA 4F9DA 2AEQH 3FOLA 1TJIL 4KCWA 4DLFA 2JIEA 2Q8AH 5I1JL 1GKPA 3HQNA 4IGSA 1RUPH 1R9XA 1AGCA 5G2NA 3TWBA 4PJHE 1EXBA 4HTBA 5D8ZA 3RPDA 4J4PD 2W27A 4HPNA 4G5DA 1AZZC 1JWUA 1S7WB 1IBYA 1OYCA 4QNWA 1YEHL 1B4JL 2CDGB 4D6IA 2YB4A 1VFBB 1AP2B 2NY0D 2VDGA 5I3DA 3BE7A 1VZWA 5EH1A 1O9VA 3DXAE 1KB5L 4N28A 3N42F 1G7QA 4MYAA 2XWRA 4JTTA 5HMEA 1COBA 3LKSB 2JCCF 5IHBA 1PF3A 4Y2LA 3ZM8A 2PLTA 3MRLA 1RLBA 1CLOL 4WDUA 1WFUA 2AK4E 4HUXA 4JZOB 1E40A 4DXKA 1ME8A 4GRLD 5GGTH 2XQ0A 5FKAA 1GZPA 1O5XA 2F5BH 2W07A 1CLZH 3OQ3B 3UA4A 3T05A 5C0BD 2WM1A 3W53A 3KYNA 3NSYA 2GBVA 2BDQA 3SE6A 3CCHA 4WCYL 3LHPH 5BV7C 2AI0L 4LFHD 4FTDA 2BIPA 1FSKC 5KSUA 1VRXA 1WAAA 1FWNA 4OE7A 1VBHA 3IJYA 1LUCA 1OPGL 2R69L 1BQKA 1FZMA 2AKRA 2QNEA 1UM4L 1X5GA 3N17A 3UW6A 1US3A 5DEGA 3VNIA 1J1XH 1A0QL 2G75A 3BG5A 2QADC 1DPMA 3GC5A 4H04A 1AGCB 5AECA 4UTBL 5AYUL 1DQML 4IIHA 1E9QA 3CMJA 3DI0A 1R3JA 5BXFA 1YEEL 4L3FA 5BXSA 1G7MB 1FCGA 2G3FA 5HA7A 3VSTA 4FA8A 4MSSA 4K36A 4PJ9B 1ZWIA 4N2IA 1NC2B 3ILQC 4OF8A 4OSUH 4R53A 2Z31D 4OJDH 1H3PH 5HGGS 4L1TA 3GU9A 3UZJA 3IFOA 5C8JB 4UTCA 2K78A 5D70H 3ULVC 1WAEA 4AL8C 4I9MA 4IBZA 2CJUH 3HMXL 4XAGA 4AD5A 2G4GA 5F9OL 3HC3H 3M0KA 1RU9L 2CRIA 3PPCA 4C8XA 3CLMA 3WIHH 3VYLA 5ELIA 4RR4A 5IROD 5JO5B 4IOTA 1TCMA 3BWUC 2CHNA 4XNDA 4Z23A 3KCOA 4JDTL 5D6DC 2Z31C 2CKBA 3V4UH 6PAZA 3A3HA 4ALDA 1JZFA 3KE0A 5D6DA 2DWXA 3FSVA 2LU4A 4NX5A 2BZ7A 3UG8A 4PRNB 5BQ7B 1PY4A 2BNJA 1B0RB 4W84A 2DUAA 4M6OL 4ZBJA 4ZFMA 1KB3A 2LLNA 3SKNB 2Y1HA 2UZIH 2BDNL 3VCNA 4HS8L 1A02N 5FF0A 5I02A 4KKQA 1GH7A 2AKRB 3NSXA 3H2EA 2KLTA 1UENA 3LSBA 2J12B 1O94A 4ZTYA 3VNMA 5FYJE 3CUJA 1KM6A 1U5VA 4GRWB 4G9DB 3ZKMC 2VABB 1UT1A 1YDYA 2XTJD 4DJDD 3REWB 1GGBL 5DC2A 2WXRA 1AL7A 2C15A 4FE9A 2GUBA 3OAWA 1S78D 3D3VA 1XGZA 4GI8A 4PJ8D 5CPSA 3DUUB 4MXQD 1KIUB 4XAYA 4FKEA 3LQAC 5DDHA 3RCMA 3UYIA 5AZ2L 2BNRE 1FC2D 1Q72H 4WI7A 5DLML 1A3HA 3LXAA 5B8CB 3MVTA 4X4XB 2QSQA 4NKIH 4C6KA 2OMUA 4P4KB 3L9CA 3EZ8A 4ZTXA 3V4VL 3FW6A 2DT3A 2KHAA 2VN7A 2NTFB 3IN2A 4K8RD 1NIAA 1AG0A 2BSLA 1DUZA 2XQYG 5B3JF 5JVLA 2VN3A 4JDVB 3BIKB 4V2CB 1X98A 5K39B 4LLVA 5A2CA 3I75A 4P5TC 1U8LA 3B7TA 4H7VA 4BXVA 2OT0A 2QT6A 5DUJA 3RM9A 3G0XA 5CC6A 1JYNA 2Q7YB 2PP8A 4LCVA 3BQUD 4MQ7B 4OF6A 4X50A 5AAWC 3SN6N 4AEHL 1L9WA 3QOKA 3W83A 4Z0XA 1LLZA 3QORA 1J8HE 2SODB 4CNPA 3RI5K 1GVSA 1U8CA 5CM1A 5DELA 2VDOB 3T77A 2ZCGA 3IM1A 3DI3B 3GIZH 5F8RC 3V4PH 4YS4A 2WVSA 1RA5A 3GMNB 1YHTA 3DX2A 3HMWL 2WZPA 4DWSA 1OP9A 2JXMB 5IQNA 3SFWA 3LEXB 1ZJAA 4BFAA 4JREB 1FN4A 1OE1A 1S9VA 1T2XA 2Y7LA 5GGTA 3UYRL 3KPRB 1Y5WA 4A2HA 3GR8A 4MLRA 2BOCB 2O5XH 2YQ2A 4WO0A 5CCKH 4W5UA 1RFDL 5ALBH 1HXYA 3W38A 4X9FA 5LGYA 2EINB 3QCTL 3BLLA 5LKNA 4PR5A 5CQ1A 5B1BB 4NYLA 4GAFB 1NCTA 3H56A 3Q6FA 4HZLA 2NCMA 1SDDB 4H25B 5J11C 3ULUC 2ZYRA 4GCAA 4PJ7A 2QDWA 3F62A 2ADIA 5AYTA 3HI6L 1H51A 4S1FA 1SM3H 3F7LA 3LD8C 4WY0B 4YVVA 3FO1A 3Q9PA 1NBYA 4IF2A 1WDDA 1JSYA 2HVKA 5EBLB 3USBA 4UDUA 4KPHH 4X6CB 4X7TB 5E9DD 1KM5A 3S1UA 5HJGA 3S2CA 2VGFA 1UUSA 3WLKX 4FNLL 4LLMA 3AIQA 3QVQA 1DEEA 3BLPX 3UTSD 1X5LA 2HKAA 4KXCA 2DOCA 3WE6A 3IN0A 4CAGA 1N4XH 3MYPA 3RPTA 3GNMH 3DV6A 5E4EB 5TPWL 5M2FX 1I9JH 2ADJA 4GYFA 1XZ0A 4M7JH 4PUJA 5AVQB 3KOWA 2JB6A 3RUGB 1BJ1J 1A4JB 2IDCA 1PBGA 4WV1A 4YIQA 2C79A 3LNIA 3KTCA 1RPUA 2OO6A 1JZHA 3VXRD 3HPZA 1TMQA 3HOGA 4YE4L 2Z28A 4ISVA 1P7KA 2I5GA 1ZJBA 2NUWA 4UTWC 2WLZA 1DBJH 4HD9A 4BUHA 3UWEA 3UX9B 1T8QA 2K4WA 4MA1B 3ZMNA 2BGQA 3E2QA 3U4AA 2XZCH 1LORA 3W7KA 4P5TB 1H6TA 4KC3B 3T2NH 4AKPA 3ECUA 1WITA 2CRYA 4DGIH 1I9IH 2NUTA 4JFYA 2O93L 2FD6L 4A37A 3NQ8A 1CZ1A 2XU2A 1JNDA 2ASHA 2FBJL 3ECVA 1JWSA 5FUOL 4N9DA 1YMMA 2H26B 15C8H 3WTSA 1CE1L 3DDMA 2MSPA 4KW2A 3EGSA 4BXSV 1XMWA 4DPCX 4R9HA 3SDDB 2PU0A 5EUKA 3ALGA 2DN7A 4XO4A 4Z2LA 4OUIA 1MNNA 2ZCLL 4KKZA 4O8AA 5HQEA 3FDWA 2VMDA 1GPOL 3EXTA 2NXIA 4Z08A 3DEQA 3QJQB 3F4CA 3L1OH 5KTEL 3NCMA 5ANMA 2BNQA 3V2AR 3MCKB 4Y5VB 4XO8A 4J5NA 4X6DE 4X0VA 4YL2A 3U2SA 5C6TL 3HAEH 4F2BA 3BVWA 3SKMB 2WAHA 4L4MA 3RL2A 4OM0H 3T0DA 1OF2A 2VDMB 1XF2A 3F6IA 1DL3A 3GZQA 1H15A 1T0NA 1ZA3B 4YVNA 2DQGL 5DC9B 4NL1A 3FC8A 3QHFH 2ZX9A 3L6FA 3O6FB 32C2B 3OXSB 4IDJH 3WJJC 3GBLA 4LQ1A 1LQAA 1LWHA 3URQA 4DP4X 5J06A 1BPLB 4QTGA 2WMJA 1Q9LA 4KKCC 3B9AA 2ZA3A 4UFHA 4WDXA 2GY7B 1GW0A 3BEWB 4LGXA 1F1AA 2V8ZA 2F54D 2G95A 1PD0A 2XIIA 3PU7A 4FXKB 5DS8A 4U6XB 5DD1L 5AW5B 1XSIA 2XSBA 1NCBL 1GL4B 3P2VA 3QPYA 3R0DA 1YPIA 4DJEA 3MKKA 2GK0A 1I85C 3EHBC 4BH7B 5HBBA 3VRJA 1RJYA 1ZK9A 5DC4B 1QW9A 2Q3RA 1FH5L 2OMTB 4CADA 1NLDL 4PSPA 5EN2B 2FQDA 5BZZA 5T1DL 5I9QC 1G7UA 2VXTL 1GONA 3KBPA 4UANA 1F6FB 1HDMB 1Z9SA 4UINL 2R29A 4F7TB 4Z3TA 4ZI8A 1JPDX 2P5NA 4H8WC 2AL1A 4I87A 2YHGA 1ZLSH 3TCLB 1Q94B 2Y36L 3BZGA 4JM4H 1TZOA 4HN4A 4MKNA 5IMOA 3W24A 3BAEL 2ZCHH 4ZD3L 1E9IA 3Q6GL 2PRHA 3AJXA 2DWTA 1BWVA 4R84A 2I7OA 4P2YA 3LRKA 1HHGA 2AQ3A 2BVPB 3MRJA 1M7IB 3UAJA 1TNNA 4Y5XB 5C0JB 4ENEC 1XUZA 1ZGDA 4IS6B 3TXAA 3V0WH 2VM8A 4H7ZA 4ONFH 3HG3A 5GRVL 1KV8A 1EZVX 1AC6A 4ZA0A 4RE3A 3VFNB 1F11B 1PSKL 1PAMA 1L7TL 1ZTXE 3DX8A 2A79A 3RX8A 3KVMA 4N4QA 4L3EE 5IHSA 3BEVA 4PJCA 4AW7A 3PE9A 1BYNA 4FAMA 5GVJA 1CICC 5DRIA 1YPZB 2OR8A 3KLSA 1TE1A 1DBAL 2EYTA 5DR5L 4CU7A 4G72B 5KEZA 4EE2A 3QWRD 3PK7A 2FEEL 4EACA 4LP5A 4NPJA 3RNKA 4CL7A 3PWIA 4LF2A 4OR1A 3KLAB 1L8NA 4G9FB 4OZIE 1YYCA 2C1IA 5AAPA 5HD8D 3RNDA 5ADPH 1BREA 2PYFB 1X5MA 2A83B 3SGKA 4K3HA 4Y9BA 3S2MA 4H88L 1GZJA 3FSTA 4A6YA 4FQJL 2NPLX 2R94A 4M62H 4XCEA 1Q0XL 4U6HA 2NXZB 2QPFA 1GAFH 4ELMF 5MEQA 1BRLA 1A1NB 3FCSB 3HPJB 4LK4A 2ZONA 3FOLB 5ESQB 3JWOL 4Y2OA 5SWZA 2DMHA 1ZE3H 2LABA 4R7LA 3MC5A 2QGHA 2J2ZA 4YHIB 4HKBB 1D5ZA 1DVYA 1HZKA 1NSNL 2Y25A 1FL6B 4PTTB 4NERA 2X4OA 2D3NA 4ZMGA 3DBXB 4X4ZA 5DRXB 1JRBA 2CBTA 3U9UB 1JYWA 5BS0E 4TTUA 4PAZA 4J2MA 4GVFA 4J6RL 2VDLL 4A2LA 2YD8A 1F3XA 1PKYA 2HVNA 3PG8A 4KX7A 5ES4B 4XODA 1IKOP 4FQQB 4A55A 3QHNA 3WKZA 1M2OA 5DEGB 4ADSA 2WO4A 4YTUA 3CN3A 4LOUC 1HOEA 5CD5C 1R3QA 5EZIH 2HT2C 1C16A 4F92B 2WBWB 5KG9B 2F54E 3F00A 3AXMA 4YTTA 2R2CA 2VDNL 4C7DA 1M57B 2DEXX 4KFMA 1KRMA 2DSZA 5JXEA 1EBAA 5L88L 1PB0A 2E09A 3WHXA 4HUNB 5LNGA 4EN3C 1WE5A 2YFNA 4MYPA 1F61A 2ARJA 3P30H 4XOBA 3TBSA 1ZBCA 3HS0A 2P5WA 1GZPB 1KB9K 1JP5A 1T83C 3SDXA 1AW2A 4LLVB 4LSDA 1IR2A 3WEAA 1BYCA 4AD0A 3K30A 1Y7VA 5EOTB 4TUOB 2DGAA 1E28A 5D1ZB 3GTNA 3C75A 1BLIA 4A38A 1KIQB 3EGXB 1V5XA 4LCQA 3PGFH 4HPYH 3CHQA 3I84A 2ZE3A 5E9DA 2W94A 1DIDA 1A2YA 5E2VL 2ZBTA 3BPCB 3BE1L 3T40A 1DBMH 3BPNC 5F4XA 5AKQA 4PRAB 4HJEA 4P2OD 5JHLH 3DUSA 3QI9A 2C9VA 2RAMA 2B14A 1GGCH 1UB6A 4NSBA 3CFEB 2VLKA 4A7QA 1XF3A 3IAQA 4PJ8B 3A4DA 1G7PB 5FA4B 1K77A 3CL8A 4RL3A 2CLOA 4CN1A 4BF7A 3Q2VA 2YXFA 2WWOA 5T8GA 1FYTE 5I3JA 4TLUA 1DSWA 1S4IA 4MZIA 4H9UA 4NWTH 1RJCA 3AWFA 1Q8MA 2V5LA 3P4MB 1Q8AA 3VXPA 1R5VB 5GXBB 3VRLE 3LKPA 2FQFA 3GSNB 5JHLA 3VWKC 3NRFA 3SQBB 2AKZA 5INDB 1OCNA 2CXKA 5EU7C 4MXWL 1KCBA 4O2CB 2A9ML 3QDJA 1F0LA 2AQPA 5E56A 4XMKL 2HTLD 3X17A 3DJ9A 1M01A 3MBWB 5CJMA 2XWJB 4LCYA 3VQLA 2AZAA 4JHAL 3V9CA 3GUTB 1OXYA 2CBMA 3MLSH 1T4WA 4MASA 3M7SA 3RPIB 1W9DM 2CMRH 3WJLC 2WN3A 3B1TA 1V8EA 3OSVA 1BF2A 3P2TA 3A5FA 4FYQA 3T2OA 1RHHB 4C4BA 2R2EA 1YDNA 3W0WB 2PO6D 3FT9A 2WV3A 1G9NC 4QXUH 1QSFD 3CLWA 1ERNA 3SCMC 3WS3B 1EQCA 3DJTA 3MTWA 2DF3A 2PMQA 4JNZA 2EC8A 4I0CC 3WAKA 1LEIB 3P5YA 3OIHA 3TLLA 2Z64C 2YXMA 3GNOA 4HIBA 4BFGA 2IFFL 1FTXA 2H6UA 2NV1A 4LCWD 3WFCL 3OHXB 4PUWA 5CSGA 1CXLA 3BZDA 4ZUTA 3WNJA 1GZ1A 1UXWB 3MSYA 2PW2A 4N5ED 3V10A 3ZIYA 4ZMQA 3ARFA 1SUJA 2CIIA 2KC0A 1UB5A 2AABL 4ZNCD 5GGQL 1Y8BA 5TQLA 5CMAB 1I9CB 4JFED 4QYAA 2CA3A 4MNQA 3IDXL 2BSTA 2A4AA 2Z1XA 3GB7A 2VJ0A 4JMXA 3GLCA 4NJGA 2AAVA 2ZSVA 2ZXBA 4PC8A 4M8QB 4W9IC 3VH8A 4M1GH 3B0XA 2QGDA 1ROCA 2C14A 2RDTA 3IUHA 3JTTB 3OPZL 5AW0B 3RU8H 3S96B 1PW3A 2DZSA 2YYUA 2YAHA 2BRQA 4XWOC 3DENA 2EDMA 4TVCA 5D1QE 1DUZB 4NG3A 1F90H 2B7OA 1W2PA 3P77A 3WEXA 5AY7A 5TAOA 3FF8A 5JMUA 4LCYB 1IXOA 2G5WA 2HVOA 2FQGA 4E9WA 4I6KA 2IFGA 2ANUA 2NV2A 2YRBA 1FVCB 4YJZL 1RP8A 1CU4L 3TPKA 1RBAA 1UW9A 5AHNA 4UTJA 2H2SC 1YEKH 2ICCA 5CEXB 4KZEH 4P23C 1JGLH 2PZ0A 3OKKA 1TTUA 2Y7GA 4BE5A 3GTHA 4N5EC 3AHYA 3LN3A 2EPKX 2F84A 1CI5A 3U0HA 5KOVC 2FZMA 1SOSA 4GXPA 1P9MC 1PD1A 1KFEA 2W92A 3B9KC 1XGPA 2V7HA 2PDCA 3W07A 4XMUA 5ETUB 2E8YA 2REQA 3LTYA 4IOIA 4JNYA 3UC2A 2NW3A 1ECQA 4FL4B 4J3OG 1A5SA 4O2FB 4RMRA 5TE6H 3HI5H 3DU0A 5LGJB 3GW0A 3LHVA 4W9CC 1JGUH 1YY9D 5IY5B 1LO5A 3CZLA 1GG1A 2CYGA 4PR5B 3LZOA 4YDIL 1BVZA 1U33A 3T3PB 1P69B 1F05A 2OR9L 4MMWA 3ARSA 4MWAE 4MMYA 3W56A 2F54B 1K8YA 4DTGH 3ZLFA 5KSWA 5I1LA 3VI4A 1F4HA 4FTVB 5I1KH 4Y4HA 2P8PA 3FSUA 3OZMA 2JELL 1Y0LB 1VSCA 2XY1A 1E9OB 2Z29A 4D3CH 4LSVH 2IAMA 3HHMA 2FO1A 2AEOA 4BQ4A 2CALA 3FB6A 2D7TL 3IU4L 4E3TA 3N6QA 4LUTB 4N8CH 2XTJE 5ID1A 1PVHA 1U8OA 4H6KA 2X9ZA 2APBA 1HQTA 5FOOA 4OLXH 1KV7A 4OGXH 4Y16D 1VACB 4NPYA 5I30L 1JPFB 5C97A 1ZGLM 1T8XA 2UY4A 5REQA 5HMSA 2VIRB 1QFOA 3PWNA 1XQLA 2NX5D 3VX1A 1SFJA 4L8CB 1YC8A 2X10A 3FEMA 3TFKD 5EYWA 2W61A 2X70B 1KGCE 1TO5A 4IGBA 3FBQA 3HZYA 5LN4A 5BUGA 1NCIA 4LRIC 3SYAA 4GSRA 1EOMA 4LIQE 4DO5A 2WVVA 2NY2D 2OXHB 2Q6ZA 4IPPA 3BV4A 3JYBA 3PZ9A 2OZ4L 2EIBA 3MLRL 1UROA 2QCFA 3OV6A 1SMDA 4FQXC 4K73A 1SXZA 1JG9A 2OL3H 4KMTL 4HOXA 2VO5A 3C5JA 4ZE5A 5JIMA 1QLFB 3UWYA 2G60H 2X12A 4IQDA 3DGBA 2WBXA 3ZRCC 5DXYA 3L2NA 2F53A 1KBIA 4ONGH 4EMZA 1EEZB 1H62A 1OSPL 2PDWA 1IFHH 3DUGA 1B3VA 3JZ7A 4OCWH 1T04A 2E28A 4MMYB 3CVHA 1Y6MR 1N18A 3X11B 2ESVE 2GUUA 2R7EB 4HU8A 2WINB 3D6GA 1UTDA 3AIEA 5KYXB 4MF4A 3VUPA 4GG8B 3HMXA 1PCWA 3U2EA 3HG2A 4G43A 3TBBA 3C0LA 3UA3A 1IT0A 3AQXA 5KYWB 2BO0A 2FYYB 5I16A 5XINA 2G5UA 2PYFA 3RLUA 2GAZB 3UP8A 3NL2A 1P4IL 2DJSA 5BV7H 1WDSA 4JANB 5ILTH 1SVZA 1PKOA 2WTPA 4L3CA 4ZUSA 3MRQA 4QAIA 3O11B 1Z9PA 4JFUA 3UTSA 2CGZA 4IJTA 1O66A 3AWOA 3I74A 4FYRA 4MB4A 4UV4L 4PI2A 4TRPL 1ZKAA 4IRZH 4ERSL 1KXQE 1ZHKA 3D39B 3NIGE 1BGXL 3CFTA 3HNTH 2V81A 4PJAA 2FBOJ 3OJGA 1V27A 1ZTMA 3TESA 3W9ZA 2TMDA 4JMNA 4XPBL 3VRLF 3LY0A 1NUFA 3KXFA 3QR2A 4OGQC 3ZZSA 3LK6A 4WW1B 3O6CA 4I1NB 3LMZA 2ESVB 3K1GA 1PZ5B 3EYSL 1UGKA 1TIMA 5AOIA 2ISFA 2A74B 1I2RA 1RY7B 3TEXA 4I7WA 1ND0B 1JERA 2EDJA 5XIMA 2YPVA 4EIBA 2VDPB 1DQKA 1M7IA 3NEOA 4YDJA 2BVDA 2XSAA 2PP7A 1EEZA 3P3TA 4PW4A 1BJ1H 2DRUA 4KJQC 5HYJE 5K9JH 4Y5XC 3HFML 4HK0A 3Q8CA 2NQ9A 4NI3A 4EBQH 1WUZA 4QE1A 3SCWA 2X6AA 3WLPA 4APXA 1NP0A 4NO5A 1XSJA 4TSBH 1T7YA 3FN0L 4WVXA 3C09C 1KLGB 3I3EA 1FWAC 4I0PA 3BDXA 2UBPC 2VXVH 2X1XR 3EG9A 4ZX6A 1MY7A 4F7TA 4K94H 4A04A 1Z9MA 4A7SA 4Q4KA 5GS3A 4PY7B 3X1FA 1JK8A 4OUOA 1TJHL 3FZUC 2WNNA 4H1LH 2XIQA 4YIWA 3AS3A 1MCFA 4N4PA 1P5UC 3GJEA 4OD1L 2KDGA 5M17A 4GSQA 4TSCL 3REVB 5A8NA 2R8SH 3C9NA 2HBXA 2J74A 4R9XA 4S0TD 2ITEA 4K7FA 2UUDK 4WSGA 4KERA 2IQ9H 4DUWA 1E8YA 4KK5D 4LGPB 4Q0XL 3M1CA 1GVYA 4ZQKA 3RCNA 5FGBA 1US0A 2VUKA 3B9OA 1R3HB 1FFPB 4CGUB 5GRJH 3M5YA 4E4UA 1CQKA 1HKLH 4OCYL 3FSAA 5CHNB 2X4UA 4TV3A 2A9NH 4BFIB 1BMGA 4HX1B 4ZQTA 3LS9A 4J35A 3B40A 2UWEB 5DD3H 4OVXA 1SR0A 2B7NA 4XZNX 3RHGA 1WNOA 4A35A 4B9KC 1G94A 1FNHA 3SQOL 5HJYA 4X4KA 1TTJA 4ZW8A 2IPFA 2DQDH 1WBZB 1U8JB 1UH2A 5AKTA 3AUVA 2YD3A 1MCSA 2W0FA 4XX5A 3X13B 4BHUA 1K3UA 3TC7A 4M82A 2Y5TB 3TXVA 1LQ0A 4Q8OA 3OAYH 2XG9A 1GGIH 3T2PA 2YGOA 2BSTB 3D48R 1BVKB 4OIIH 2XI9A 4U6YA 4ZO9A 3W39B 1LRNA 2GVGA 1VS1A 3GSOB 2KI6A 4U1JB 4XD5A 1K4GA 3KBSA 4O0ZA 2Y0SA 3DI2B 4ZPTB 4ZUVB 1JNHA 3MRKA 4F93B 5GS1B 1CZ8L 5HHXL 2UXVA 3OP2A 3BTNA 4R7WA 1TPXC 1HH9A 3LVTA 3CAWA 4EPBC 3VIJA 4Z0BL 3GO1L 3E2RA 4NKDA 2A2QT 5LIYX 4HCHA 4Y5YC 1GTEA 4TXEA 2YRZA 4LLMB 3CHCA 1OGAE 1YMMB 2H26A 3QVAA 4KRNA 5EN3A 1DVFD 4KITB 2IQAA 3QIUD 2F74A 3U6RA 2CCVA 1YUHB 1IEQA 2Z7GA 4FKKA 1QA9A 1BG9A 3KWVA 1RUKH 4M1CC 3KP1A 2AK1L 2VGGA 2HPOA 3DI1A 2VYRE 1YEHH 4JAMA 1XB8A 4RMSA 3HJZA 2EF9A 3MMEA 3TIMA 4MG4A 2X89A 3MROB 3R4DA 4R97C 1T3FB 4M7LL 5CJQL 3BL3A 1F4WL 2CM5A 4NYLB 4EQ3A 2YR1A 1FZKA 4U7MA 2XWTA 4G8GE 3R7QA 4HW6A 4Y4KC 1NMCB 3VFOB 1NEPA 1XYMA 1ZPLA 2WZEA 3MHUA 4RE0A 4GNVA 1CLOH 1QVOB 5F1KC 1WB0A 2Z31B 4X60A 3DWTA 4N2YA 3ZWTA 2VCOA 4XPAH 5IB3B 3QUZD 1NARA 3EB2A 1CLZL 1A1OB 4U0RC 5FLVA 3VA6A 3M7WA 4BRJA 3APGA 3MXWL 2NNFA 4ZDHA 2UY2A 3Q2WA 1U8MB 2ICWB 2J6VA 2Q5BA 4XPGH 2XN9E 3TEZA 3T4CA 2CBQA 1KD0A 3SPJA 4JM2C 2JI3A 4D8AA 3SSGA 3PWPD 1GQNA 3MNVB 3SIKA 1CDHA 1MFCH 3KM1A 3H7LA 5ITFB 2DZPA 1UWIA 1MO0A 3NJMA 3LJ3A 4EAEA 5IMLA 5EMMA 2RCSH 3S9DB 2C8NA 2FX8L 2MNUA 3INPA 4XTRD 1YDOA 1KIQA 3EGXA 3RI5F 1MIEH 4GG6F 1JCXA 1RD6A 2YL8A 2JI1A 3ABGA 3U6RB 3UXIA 1YEEH 3E3QC 1FDZA 2DQUH 1MUJA 1FH9A 2A6DA 1TVNA 1FYHB 3RVVD 4EF8A 1EBPA 1HP5A 5DEFA 1L4IA 3K2MC 3DYOA 5AZ0A 1Z5LB 3GZKA 2QQLL 4BSVA 4ZMTA 2J1ZA 4LLWA 4E6MA 2NX5A 2OULB 2PCFB 5IB1A 1Q0EA 1P6FA 1AO7A 1G0CA 1EC9A 1Q9OB 3WJXA 4C6JA 5DUMH 3GY1A 3LNPA 3WY4A 5D96B 5F9OH 1DVJA 3QUYB 3W76A 2LVCA 4GW4B 1A7RH 3OLDA 3HE6B 3IVKB 4Q6JA 4YLWA 4FLOA 2BVPA 3MBXH 1QWKA 2OB3A 1TQJA 5JPNC 4NS0A 3USZA 3ZTJH 5F1OB 3DXAA 5GZOA 3D51A 4ONHB 2CK0H 3CVBA 2OZ3A 5E2TL 4KWSA 1EGZA 1HP4A 4R5XA 2YRPA 2QVIA 4NAJA 1VFSA 4ADJA 3KOZA 2BIIA 5DHYB 4HYWA 3WD3A 4NFBA 3ZE1B 2VX6A 3I6GB 1Y18A 5C0FB 2DW7A 6ALDA 2K6WA 1MAJA 3KDMB 5FA3A 1JV2A 3LCYA 3D9AL 4XMXA 1V77A 4PCSA 2PDFA 1N5YL 3QFJB 5EKYA 3MO1A 4XBPA 1HDMA 1DE4B 4N1CA 3BO9A 1AODA 2XWBA 4JFXB 1KCXA 4UQ3B 3BLIA 1DORA 3WE6B 5PCYA 3L67A 1TJGH 1LEIA 4E4PA 3MGOB 1AW1A 1T5WA 2Y7MA 4UQEA 3TJHC 1V3KA 2X53A 4GXMA 3O4OB 3LZRA 2V67A 1ZLEA 3NQGA 1CBJA 3F12B 3ZJ6A 4P48A 1UA6L 3HG5A 3RQ3A 4PLJC 5LCVL 2A83A 1JRHL 4L05A 1GOFA 3WZ0E 3TIEB 1MJ8H 1KTDA 1UZHA 1QYGH 4TUKH 1EX0A 3A23A 4L0YA 2BSRB 1JVOA 4IIZA 1A5UA 3E9AA 1LP9A 3L0KA 1NIFA 2OA9A 1E4XL 3VD0A 1GYUA 1ZSDA 4V27A 2ZOOA 5KVMC 1UPMB 1XR8B 1OD9A 1FORH 3UTTD 4HLJA 4X3ZA 3T2LA 2D22A 2X2IA 1S7TA 2G75B 3U0WH 2HISA 4MZRA 1HNYA 4OLUL 3TJEL 1IEVA 1PLGL 4UOJA 3M0ZA 2D7QA 1TKWA 5I15H 5ICUA 1AR2A 1KJ2L 2FWSA 2M8XA 1R8LA 3NZRA 1KCVH 2AJUL 4HDIA 2WOQA 3SR7A 1TPEA 3SYQA 1XC6A 5CINH 2V17L 4AF0B 3BAXA 4IQJA 3MR9A 4QEEA 5F7MC 5FFLA 4QSHA 2ICEB 3TIDB 1U8PB 4NQDB 3N91A 4S1SH 5AOLA 4N0UE 3IACA 1AFVL 1LO4L 5DJ0A 2F38A 4LU0A 5HWMA 2ITCA 4Q6IB 3AWEA 4F2MA 3PGCA 1J9CT 3HIZA 3UYPB 2J9XA 3F03K 5FC9A 4WWNA 2JLLA 4HISA 3T0VA 3ZKMD 3WFLA 3ARXA 1KM3A 5CKAA 4PRHE 2L3BA 1K8ZA 1W8GA 2YIHA 4ELMA 3COOA 2BJMH 1IIIA 4UU9A 2ORBL 4WHDA 2GSMB 1TCDA 2C1OA 3NCOA 1XT5A 1S2WA 4P57A 4Y1AB 5EOQL 1XRSA 3VE0A 3B8WA 3E3HA 4CCEA 5IJKC 3O2LA 3EBIA 1IT9L 1SY6L 1G6RL 3SN1A 3LLFA 4YN3A 2R0ZH 1CFBA 3PAZA 5AOZA 4HCIA 3AMDA 2H1PH 3CZFB 4MKTA 3VXTB 4X80H 3EYQC 4JO4H 3S34L 4Z8FH 3SQMA 3O9WA 3ZL2A 3ZIMA 5FYKE 2Z1PA 3CCHB 1EJ7L 2FMOA 2UY5A 4HNUA 5BOFA 1AL8A 4WO4B 3CUXA 2XFGB 4G59C 4L4OA 2BW5A 4L9XA 3NSDA 3MUJA 5F4SA 5IROC 1M65A 4F3FB 1C7SA 3ULSA 1J10A 1XP3A 3VFSA 3MV7A 1YBQA 5D2WA 1R3LA 3MOAL 2XXMB 1X5JA 4M7JL 4ZSOB 1KXHA 4H0IA 4S1DD 1KJ2B 4ZMLA 3OWEA 1GYLA 1OCWH 3LV5A 1L8PA 1W72B 3CB3A 3FOMB 4X98A 5DO2C 3X12B 5C9UA 1T80A 3AM8C 1W5PA 5T1LB 2BFVH 5D03A 1IHIA 4HH9B 5AG9A 2O61A 2D2OA 2H0PA 4FXGC 1QFWH 5DFWH 5HHME 5HTSA 3K74B 1PXGA 4P2QB 5JOPD 3G6DL 4HNTA 1I4FA 3W81A 3OAUH 3WNPA 2Z65C 1FHDA 2A73B 2AJ3B 3LKOB 1BM3L 2XA3A 2XPGA 3U79A 2C3XA 1H7XA 1RH9A 3BOLA 3AABA 3U0TA 4QJ1A 4V2BA 4H00A 1W91A 4RE4A 3V0UA 2YAFA 5DQDL 1ADQH 4F3HA 5DO8A 3CFCH 3QRGL 4K2UH 3V1HA 3WUWG 1KRBC 5I78A 2AJZB 4JG1L 2IBGA 4H01A 4QLRA 3H6AA 3QIUA 3PJXA 4B95C 4C91A 1U3JA 3PPFA 2GOUA 3NO1A 4F7PA 3U4EB 1Y07A 3N2CA 3Q5YA 3VGHA 4Z7UB 3W6LA 5C7VA 5EFDA 3HU7A 4ZAKA 3ARGB 1SYVA 4WRLA 3S3DB 4UTBH 3QH3B 5AYUH 4W9DC 1K7XA 4GY0A 3ROLB 4ZMZA 4EI5D 3LV3A 1OINA 2A6KB 4ADGA 1MJ7L 2XZ7A 3NYZA 3AY4A 2YKLL 3O6ML 4B3VA 5LDSA 2CZEA 3CASA 3M5VA 1RPKA 3DVNA 5T8IA 4AEIL 3KRSA 3V3WA 4P8QA 1CLKA 3EBAA 4GXVH 4ZFGL 2XJ7A 3EWDA 3PFMA 3GI9H 4YEFA 4S1DC 1X1OA 4FNUA 1HZYA 2E7FA 5CZXD 2XDFA 3LHWA 4OECA 4UUJB 3UR8A 4O1DA 4OW6A 4Y4FD 1MJJA 2AKMA 2QSTA 5IJBC 2HK1A 1DO6A 5HJXA 2DQ6A 1FYTD 2NNAB 3V0DA 3H22A 4AY7A 3WIHL 5J57B 2I5YL 1LNUA 2ZG3A 3FF7A 1DEEB 5IW6B 4LNYA 2J8OA 3HE7D 1QI5A 2D7PA 4W9KC 4A29A 4MGGA 1V3IA 4UQIM 4XXCC 1KQYA 3S5SA 4WKXA 1WBXA 4JQIL 3ARUA 5IK3A 1O5KA 2V0TA 1JF6A 1OP4A 4Q6IC 3KBEA 1FHUA 2E5DA 2G2PA 1NLDH 3N4EA 4GO9A 1U21A 4O51B 5FUCC 1LO2H 3BGAA 5LBSA 1H0GA 1SDDA 4MS6A 4UYQA 5EWIH 1POKA 2Z1SA 3M5XA 4UQ2A 1PTDA 1LWIA 3TZVD 4C6PA 3P4LA 3PJLA 3RUGE 4JM4L 4QRUB 5FO8A 2OBGA 2J6XA 4NJIA 1I3RA 1NBZB 2HX9A 3SGUA 4AD2A 4QRQB 4E5TA 1FWJC 5HYQB 1G1KA 2HA1A 4XP9L 5BOEA 1LOQA 4UFMA 1AHKA 1P43A 1EA0A 3L1FA 4LARH 1IGMH 9PCYA 1XLFA 3B9EA 1UPPA 4G8EB 1XCQB 4PMFA 3WBAA 4NKIL 3N13A 3KUMA 1JNEA 3PBMA 5JXEC 2XYBA 2P76A 5DJ2A 5E8DL 3WK3A 3MRCB 3DTXB 2ISVA 1AHWA 4TULL 5IRPA 5GZNC 2VH5L 3CJJA 2Y7FA 1DSFL 3V95A 1YNQA 3JS3A 4KI5C 2C9RA 1TOXA 3OO2A 4UI2A 3RX5A 1IIHA 2NXGA 2H8XA 5A8PA 1F86A 3L4ZA 4NQEB 5E23A 3RL1A 2YL6A 5JH2A 1XSOA 1HZHH 4JN6A 3TR9A 3NCYS 1K7FA 5IBLC 5A8OA 1RZGB 5CS7A 1OW0A 1X7SA 3VFRB 1QPKA 1JPKA 1F07A 1LEKB 4OKVB 1M68A 5KVFL 5AL0A 3O8XA 3W9EB 3WLWC 3PP3K 4ODVL 1EJUC 2DVUA 4FA6A 2FIRT 4KRUA 1TTQA 4AVOA 4RAHA 1T89A 3E3QE 2B2XL 4UB0L 2WCPA 4DWSB 1ASQA 4H2CA 2CLIA 4L8SC 1T89C 4KTDH 4JGNA 3CUPB 2N1TE 1VC4A 3W2KA 2UY7B 3ARBB 4NP9A 4HF5H