4ATLA

Crystal structure of raucaffricine glucosidase in complex with glucose
Total Genus 183
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
183
sequence length
501
structure length
470
Chain Sequence
NDATRISRSDFPADFIMGTGSSAYQIEGGARDGGRGPSIWDTFTHRRPDMIRGGTNGDVAVDSYHLYKEDVNILKNLGLDAYRFSISWSRVLPGGRLSGGVNKEGINYYNNLIDGLLANGIKPFVTLFHWDVPQALEDEYGGFLSPRIVDDFCEYAELCFWEFGDRVKHWMTLNEPWTFSVHGYATGLYAPGRGRSTGNPGTEPYWVTHHLLLAHAAAVELYKNKFQRGQEGQIGISHATQWMEPWDENSASDVEAAARALDFMLGWFMEPITSGDYPKSMKKFVGSRLPKFSPEQSKMLKGSYDFVGLNYYTASYVTNASNFSYNTDIHVTYETDRNGVPIGPQSGSDWLLIYPEGIRKILVYTKKTYNVPLIYVTENGVDDVKNTNLTLSEARKDSMRLKYLQDHIFNVRQAMNDGVNVKGYFAWSLLDNFEWGEGYGVRFGIIHIDYNDNFARYPKDSAVWLMNSFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAUCAFFRICINE-O-BETA-D-GLUCOSIDASE
publication title High Speed X-Ray Analysis of Plant Enzymes at Room Temperature
pubmed doi rcsb
source organism Rauvolfia serpentina
molecule tags Hydrolase
total genus 183
structure length 470
sequence length 501
chains with identical sequence B
ec nomenclature ec 2.4.1.219: Vomilenine glucosyltransferase.
pdb deposition date 2012-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4atlA00
3FAWA 3JUGA 4OBRA 1UD5A 4AD2A 2BY0A 3BAJA 4PN2A 4NSBA 1DHKA 2YIHA 3CUHA 3ARWA 3WDRA 1E43A 2VR4A 5FKYA 3BH4A 1WO2A 3MSGA 3HJEA 4L4PA 3WF1A 1JZ5A 2AAAA 4H8UA 1BLIA 1E4IA 1GNXA 2WK2A 4P7RA 4QLKA 5LA2A 4CKQA 4AZGA 4F8XA 2VZUA 1KWGA 1LF1A 1XCXA 2WCAA 3AXXA 3WFZA 5DT7A 2EPKX 1OGSA 1NWTA 3PBGA 1ZS2A 3GTNA 1AMYA 1X1NA 2DEPA 3UG5A 2CHOA 3N12A 4AY1A 5GQBA 2PF0A 1OSEA 5FD0A 5HXMA 2E9MA 1PZ2A 5HDRA 1B3XA 2XM1A 4BA0A 3OGRA 4D6EA 2D23A 4QAWA 4M24A 4IPLA 3BC9A 2DSKA 4W7UA 1H49A 1KB3A 4D6FA 1CXKA 3WF4A 4GZJA 3GBDA 4JL1A 5IXEA 1V3IA 4N0RA 1JAEA 4UOQA 1NOFA 2DH2A 1CXIA 5IFPA 3WDQA 3W4RA 1JXJA 5I79A 4UQEA 1H41A 1PAMA 4UOJA 1ZJAA 1QOXA 2WC7A 3OA5A 2FHCA 2YLLA 2FH6A 4J27A 3K8KA 1W9BM 2A3BA 3POHA 4QDMA 5BWFA 3VM7A 1WDPA 4Z2GA 3BMVA 7TAAA 1CGYA 3POCA 5A2CA 3MV11 2VR5A 1I75A 2WZHA 1UA7A 1CDGA 4RE4A 1J18A 3UERA 3RDKA 3AMGA 5DT5A 4Z2LA 4D6DA 2AOSA 4CVWA 5CGMA 2VX7A 4WSKA 1QVBA 2ZWYA 4V2XA 1XV8A 1LWJA 3OG2A 1UZ4A 2VZOA 4P7QA 2VC9A 4PMDA 3THCA 4JFUA 3WF3A 3B9EA 3U57A 1VEPA 5JIWA 2G3MA 4HA3A 2D0FA 3NIYA 3IK2A 1C90A 1K9EA 4QCEA 3K8LA 4W5ZA 1R86A 4ACZB 1MQPA 5I23A 2ZOXA 3WIJA 4LGXA 3EMZA 4U33A 2W62A 4DWSC 2CXGA 2PWDA 2EO7A 3AIBA 5LA0A 1BGAA 4JIEA 3CUGA 2J7CA 2BVTA 1H3GA 2QPSA 4CCCA 2CETA 1CGUA 4WK9A 3I3BA 4M81A 1QW9A 4ACYA 5FL0A 1FA2A 3II1A 3B9AA 2JIEA 2FGLA 3PTQA 5EB8A 1UD3A 2O9OA 3GBEA 2UWFA 1BG4A 4YPJA 2WSPA 3W38A 2C7FA 1V3MA 2GVYA 4MNLA 4JKMA 3LPPA 4UCFA 1E55A 2CESA 3L4UA 1CLVA 4CU7A 3K4DA 5JIPA 1WNOA 4U31A 1B31A 3MU7A 4CVUA 4GQQA 4W84A 1ISXA 1JFHA 4JHZA 4LX4A 1GOMA 1KXVA 4BCEA 3VIPA 1HIZA 1W9PA 1W9DM 3WNNA 4AZ6A 1ITXA 1OT1A 4J7RA 3DHPA 2DT3A 4AZ7A 3CHFA 2WLZA 1VFOA 1KBBA 2VOTA 1UR4A 1J0ZA 4W5UA 3WSUA 3WDHA 4P8UA 4ATDA 1HKIA 1PX4A 2WHMA 2WC4A 3KEHA 3ARZA 4CD8A 1CXLA 2G4FA 3VGBA 2QF8A 4UQDA 3N13A 1V3HA 4MAVA 1J0KA 4PTVA 1EXPA 2XSBA 1TFVA 3CUIA 1ECEA 1G1YA 1FHDA 3UEQA 5EMYA 3VMOA 1B3WA 5I2UA 1PPIA 2CBUA 4MDOA 3PZMA 5M03A 2VRKA 3VGHA 2WZEA 4KGJA 4AIOA 2VUYA 4B15A 1HL8A 3PHAA 4HZ6A 4D6GA 1AVAA 5AYIA 1BTCA 4KRTA 1J11A 2BHYA 2ZIDA 4GI8A 4AD0A 1HT6A 3WFLA 1BSIA 5FCZA 4F9JA 5D9MA 1R85A 3KWXA 5AY7A 1E4MM 1US3A 3BCFA 3VNYA 3ALFA 1CXFA 1C3FA 1Y7VA 3ZOAA 4WKHA 3F5JA 3VIOA 1V3JA 1E9LA 3SUVA 3WL0A 4ML4A 4JAWA 1OIFA 1E6RA 1UWUA 1YQ2A 2E8ZA 4UOZA 2ZX5A 2EPMX 3A47A 1QPKA 4AD1A 3AXIA 4PUEA 1AQ0A 4U2YA 3UCQA 1KGWA 3RM9A 1JD9A 1VB9A 3MMDA 4URIA 4GZEA 1CYGA 4ZE5A 1XCWA 4P7LA 2PI6A 4W89A 5JUVA 2VZSA 5AYBA 5CPTA 4PEEA 4CU6A 1C92A 5EFFA 1O7AA 1WZAA 3I3DA 4BQ3A 1OD8A 2YBTA 1WZLA 1NWRA 3D5HA 4D6CA 4AIUA 1WPCA 2XVNA 4CD4A 4UQ9A 5I77A 4PCTA 3VVGA 5BYWA 3AROA 2FDMA 3SUSA 1CEOA 4W86A 2GJXB 1FP8A 2EEXA 3OLDA 1HNYA 1G0CA 1OT2A 1EOMA 1W9XA 3DECA 2J74A 4R27A 1NM9A 3IANA 4FLSA 2BVYA 2DDXA 4DUXA 1E6SM 4FMVA 1XSJA 1K9TA 4MAZA 1TUXA 3CUJA 4WIWA 5ABGA 3MUY1 5CLTA 4N42A 1E3XA 4MNKA 5GNXA 2GSJA 2G3JA 2XGIA 5GNYA 4NRSA 3BAIA 2E8YA 4J3XA 2BVDA 2ZX8A 1UR0A 3AMKA 3T2OA 1HP4A 2BFGA 3UETA 3RJXA 2J62A 4MDPA 3MUIA 4D1IA 1GOWA 3VIKA 3NDYA 3AICA 2D22A 1V02A 4EK7A 4HMEA 2WW5A 3SCNA 4A4AA 5A2BA 4PTWA 3A4WA 3MMWA 4P8XA 1KQYA 2E3ZA 1QI0A 4J3VA 2VZTA 3B9DA 1KWKA 1HKMA 3APGA 1MXDA 1ZU8A 4JFTA 1E15A 3VIHA 1RPKA 3WL1A 1FH7A 2WPGA 1CIUA 4D1JA 2XTKA 4NF7A 1B3ZA 2E4TA 2XM2A 3WQWA 2QLYA 2XVLA 1JDDA 3UG4A 1D3CA 1E0VA 5A6BD 3ARUA 5EFDA 2CHNA 5I24A 4P7OA 4CU8A 3GNRA 1JDAA 4AWEA 4IM4A 3VIJA 2XHYA 2GDUA 5M5DA 3VOCA 1ODUA 5E6ZA 2DH3A 2ZUTA 1BPLB 1OWQA 1JF5A 1M7XA 2WANA 3WMSA 2X2YA 4E4PA 2DSUA 2V3GA 3K4AA 3EDJA 4M8UA 4DUWA 1VEOA 3EYPA 4KRUA 2WMJA 3WKZA 5E0CA 3LMYA 1BVNP 1F4AA 1QHZA 2YL6A 3BAYA 3AZRA 2OWCA 2WLYA 2DGAA 3A3HA 1E6ZA 1C91A 5CQ1A 4P8WA 5IHSA 2YBUA 1ESWA 1UKQA 4OIFA 1RD6A 1V6YA 1NH6A 4TOQA 1V6UA 1OBAA 4UFKA 3PTMA 4Q7NA 3WEZA 3VX0A 4GIAA 3AHXA 2D3NA 3TTOA 2B31A 5A69A 1GUVA 2XUCA 2J8FA 2DSVA 2XVPA 3ZIZA 2WCGA 1C8QA 2PWEA 1Q4NX 2WHLA 1VFFA 1KGXA 3KL3A 1C7SA 4DWSA 1DEDA 1H4PA 2NW0A 1DWHM 4PMVA 4A3HA 1ZBWA 3NCOA 3MO4A 3BAXA 4W8AA 4XV0A 3WH6A 1JG9A 3GDBA 4AW7A 3VPLA 1PIGA 4HA1A 1V08A 1H09A 4HMDA 1UQZA 1EQPA 3T0DA 4OOUA 1B3VA 2FH8A 3W6LA 5ECUA 1XC6A 2NSXA 4S3KA 1W1YA 3MSDA 2BXYA 3QHNA 4H41A 4B3LA 2YA2A 2W4XA 2J8GA 1B9ZA 3MUAA 4OBSA 2DSWA 3ZT5A 3BXWA 1VBUA 1C7TA 1SYTA 4DUVA 3RIKA 2VNCA 4Z2IA 2FGZA 1F4HA 1E56A 3W82A 2CPUA 1E6PA 3UESA 5CZKA 4DM2A 5BRPA 4ZXOA 2EBNA 3T0AA 4GXPA 1TVPA 1QI4A 1W3KA 1UR2A 2W92A 3PN8A 1GCYA 1JDCA 2CYGA 3WQ4A 5AC5A 3WF0A 4UZUA 2YDRA 3VKKA 3N15A 1GQIA 1PZ3A 4J3WA 1ZL1A 1MVYA 2GUYA 3ZJ7A 3LPGA 2DIEA 3RILA 5CGTA 3FHQA 2FHFA 3CH9A 3T08A 3O9NA 2YJQA 1LL4A 4MB5A 1PJ9A 4GI6A 3BLKA 1IV8A 4XZWA 5I0DA 1E6XM 5JBDA 1V0NA 4EKJA 3U7BA 3WNMA 4E8CA 1QBAA 1GQLA 3EDFA 4FLQA 3K1DA 1TVNA 4NZCA 4C7DA 2D20A 2J7GA 1JAKA 2PB1A 3ARYA 3EDEA 2G41A 4M29A 2WSKA 4J3TA 1E6QM 4M56A 4MB4A 4LQ1A 4B9YA 3ARTA 1KR1A 3WUBA 1CGVA 1JI2A 3AJ7A 3WD2A 1J0JA 3KZSA 1B90A 4RL3A 1KQZA 2X0YA 4PMXA 4PYSA 2JEQA 2OWWA 2WMFA 4PTMA 1GOOA 3O6AA 1E70M 2WKLA 5HNNA 3ARRA 5DF0A 2DSZA 1ISVA 1RH9A 2W5FA 4V28A 3L2LA 5DO8A 2OSWA 3IAQA 1FP9A 4FLRA 1XSIA 2Y4SA 1WB0A 1JNEA 1GONA 1HKJA 3B8SA 3DC0A 4U3CA 4BF7A 3ARQA 5LA1A 1MW1A 3L4ZA 5A8PA 2OYMA 3A4AA 3PZIA 4WKAA 3WH8A 1BYDA 2OSYA 1K9DA 4RE2A 1ISWA 1H11A 2EQDA 4DWSB 5C71A 1UD2A 1EGZA 2ZUUA 3ARPA 3VTRA 4UZSA 4UNIA 4F66A 1UG6A 2WXDM 4Z2KA 1FH9A 7A3HA 3WNKA 1A47A 1JYXA 2JF6A 3NUKA 3VO0A 5C8BB 2F61A 6CGTA 2AMGA 2E9BA 1CWYA 4D6IA 4F9DA 3PTKA 3VGFA 3U5YA 3AS1A 3IAPA 3HU7A 2UY4A 1H1NA 2TAAA 4X0NA 8A3HA 5F7UA 2J7FA 2ZX6A 3ALGA 4H8HA 2XPKA 2UY2A 1QNRA 3FN9A 1KCLA 3RM4A 1TA3A 1ISYA 3CUFA 1NOWA 1EHAA 1CGXA 5DEZA 1Q6EA 3DYPA 1JZ4A 3QR3A 4YHGA 5BXPA 2ZX7A 4QLLA 5A6LA 3PZOA 3DYMA 4IUGA 2XYLA 4JHOA 4BQ5A 4AIEA 4W8BA 5D4YA 3VD4A 1LL6A 4U3AA 2D2OA 5E0FA 3W27A 3CZGA 4H04A 2YA1A 2YL5A 1EO5A 1MFUA 2J78A 3OBAA 1I1XA 3AHVA 4LYRA 2V38A 3AFBA 3WDJA 3WH5A 5E70A 4BS0A 1GQJA 1UA3A 3IJ7A 2VT0A 3CLWA 5I3DA 1LJYA 2J77A 5GPRA 4IISA 1CGTA 5BROA 2QMKA 4XB3A 4HOXA 3GH4A 1VIWA 1C93A 7CGTA 1DWJM 4BQ4A 3GM8A 2X05A 3VDCA 3NSNA 3VMNA 4PMZA 1L8NA 2ZE0A 1LQ0A 1UHVA 3BLPX 2J4GA 4HP5A 3W81A 2WB5A 1B3YA 1OIMA 4MNJA 1BYCA 3ZJ6A 1E4NA 2BV9A 2WNWA 4CCEA 3GXFA 1DWGM 1L0PA 2VQUA 1JZ6A 2EPNA 2WBKA 4FLOA 1GW1A 3VD3A 1Q6DA 1TE1A 1DTUA 3U7VA 4AZIA 4M80A 3SCTA 5A8QA 3L4YA 3CIVA 1EO7A 4OZOA 1GVYA 3J7HA 4AEEA 1LG1A 3NJ3A 2X09A 3CZLA 1UUQA 3WUEA 3WY1A 2ZUVA 4X0VA 3QOKA 1VEMA 2VRJA 2ZUWA 3RO8A 1JGIA 3ZSSA 5CPSA 4B9ZA 1R87A 3DYOA 4C7FA 3WNOA 1VBRA 3TONA 2WZIA 5CPQA 4JFVA 2WYSA 3PZTA 1BG9A 2VX5A 3FY1A 2V5CA 5A2AA 3W28A 3AHYA 8CGTA 2GJPA 2YA0A 3WN6A 1UD8A 4ATLA 3CHDA 2WMKA 2DT0A 1V6VA 4PTXA 4B16A 5E09A 1GZJA 4PCSA 2BY3A 1K6AA 3FNDA 4AISA 3OB8A 3OZPA 2G3NA 2XSAA 3L4XA 1ISZA 1EOKA 1V6WA 5KEZA 2XVGA 2J7EA 3L4VA 1TA3B 3BCDA 1E1EA 2W91A 1SMAA 2OLHA 2XJ7A 4MB3A 5CJ5A 3T2QA 3THDA 2XG9A 1GHSA 2PC8A 4TX6A 2X0HA 3WQ5A 4CCDA 2V3FA 4HMCA 1DWAM 1FFQA 5GNZA 4U5KA 2WM0A 1E1FA 2VVNA 1AQMA 1MW0A 3BSHA 1G94A 4YN5A 1D2KA 4NI3A 4RE3A 1B1YA 4ZXLA 1NOUA 1W1PA 1ITCA 1UH3A 2D3LA 6TAAA 4GQRA 3GNOA 2E40A 3CGTA 1DWFM 2YL9A 2CBVA 1H5VA 3ZT6A 5A6SA 4UFHA 1VAHA 1GQKA 4JCLA 5E6YA 4PMQA 4TUFA 5A8NA 4UR9A 3TP4A 1EH9A 1GHRA 4HPHA 2VURA 1MWOA 3K46A 1A3HA 2WHJA 3WUGA 1GOKA 1WKYA 2CBIA 5AC4A 4QLJA 1C8YA 5M3WA 5I78A 3WNPA 1KXHA 3SCRA 5A6BA 3VIFA 3W37A 4GPNA 1WZKA 1H2JA 2VVSA 3W53A 5ABHA 2VCAA 3ZT7A 1NQ6A 4W88A 3F4VA 2D1ZA 3OIHA 2A3HA 1BAGA 1NARA 5FIPA 4YHEA 1VFMA 1GVIA 1V3KA 3IJ8A 1MW2A 2ZICA 2ZXAA 2VO5A 3WF2A 4AD3A 5ABFA 3AQUA 3N1AA 4AZBA 5IFTA 1R7AA 2V5DA 3FW6A 2A3EA 3F5LA 1HJSA 3MS8A 4BQ2A 1FH8A 2XFFA 2XWEA 1DP0A 5JBEA 2JFEX 2XWDA 3TOPA 1QNSA 3A4XA 5KZ6A 4XZBA 4D6JA 3ZSTA 1W3JA 4AZHA 3EDDA 3LPFA 2X8RA 1OINA 3ZR6A 5A6KA 4IPNB 3N11A 3OLIA 4OUEA 3SCVA 1D7FA 3TTYA 4WSJA 1LG2A 1WCGA 3ZMRA 3BSGA 2FHBA 2W66A 4W8LA 2ZXDA 4ZENA 3WNLA 3OLEA 1R7OA 1UKPA 1V0KA 3FHAA 1B2YA 3GZAA 2ZWZA 1PX3A 3D3AA 4P7NA 4CN6A 1EQCA 1VFUA 1W3HA 3VDHA 5EBAA 4MNMA 4PMRA 4PMNA 2WMIA 1VF8A 1MFVA 1CTNA 1PIFA 4PMYA 1BYAA 5E9AA 1XHGA 3IJ9A 5CLWA 4HTYA 1PX8A 1RP8A 1WDQA 2WHKA 1OGGA 3AISA 2OYLA 2CNCA 4LYPA 4JZ5A 3WQVA 3GXMA 4CN1A 4TX8A 5D8ZA 2QHAA 1XYFA 2NT1A 1SMDA 3VGEA 4M1RA 2GFTA 1P6WA 1OCQA 2XGBA 4AD4A 1U2YA 4PUDA 3PZNA 4JFSA 2BS9A 4WJXA 3M07A 3WENA 1R8LA 4S3JA 2IXUA 3ARXA 1UWSA 2WVTA 3L2MA 2BY2A 4PBGA 1CLXA 1UQYA 3VDAA 4ATWA 3MV01 1XD0A 1UWIA 3M7SA 5CXPA 2WCSA 1G01A 3AYRA 3RJYA 3CO4A 4OOZA 9CGTA 1EHNA 1E72M 1PEZA 3CMJA 3EDKA 1UYQA 4WKFA 3GXIA 1J0HA 1OD0A 1JF6A 2BNJA 3O2LA 2J75A 4CD6A 4HA4A 1IZKA 1HX0A 3AIEA 2ZX9A 2CCRA 4H8VA 1TCMA 1E71M 1J12A 1JZ8A 3T0BA 4C7GA 3A6OA 3WMCA 2X1IA 4W87A 5D9NA 2VI0A 4ACZA 3AYSA 3AHTA 3QHOA 1KR0A 2JALA 5CSUA 4KH2A 3VM5A 2EXOA 5IHRA 5A6MA 1BGGA 3OLGA 1JIBA 3SURA 3M6DA 1VJSA 3AMCA 3OGVA 2D0HA 2A3CA 1SR0A 4FF5A 3KL5A 4W85A 3WBAA 2JE8A 3EMCA 2ZUSA 3AS2A 3LPOA 2UY5A 1WZMA 5ABFB 2WMHA 2G8ZA 4MJ2A 4UTFA 1QNOA 3AZTA 4TVDA 1ZBVA 4PSPA 4MTVA 4H7VA 3GNPA 1MQQA 5D8WA 1UZ1A 2DT2A 4GO8A 1HXJA 1TG7A 3WUFA 1JNDA 2F8QA 4HZ8A 4AZCA 3FXYA 1QBBA 1VENA 3WQ8A 1M01A 4PMUA 4GINA 3WD0A 4UFIA 1W3LA 3GH7A 4V27A 4AC1X 1N82A 5BXSA 3N17A 3OZOA 3MKKA 2WVUA 4MADA 2WAGA 1E4LA 1V3LA 3WEMA 1UOKA 4WF7A 3PZ9A 2QV4A 3OGSA 2WMIB 4ZFMA 4TTUA 4TVCA 3SUUA 3CZKA 2CERA 1W2VA 3QHMA 3CBWA 1HJUA 5BXTA 1M04A 1Q6GA 3CHEA 1JZ7A 1KBKA 3BAKA 2WVVA 1V6XA 2XFRA 3WQ6A 1UR8A 4D6HA 1TR1A 4W7WA 3BAWA 2ZXQA 1GOIA 1CPUA 1K9FA 5A95A 5C70A 1HVQA 1CBGA 4JL2A 1HL9A 1QNPA 4TVUA 2ZUMA 4HZ7A 4UQBA 5BCAA 1BYBA 3TTSA 3PZUA 4NRRA 2C8NA 2BXZA 1XH1A 2VJXA 4AXNA 1KGUA 2VRQA 1UWRA 1UKOA 2C0HA 2DT1A 3VIMA 2GK1A 2NT0A 3ZQ9A 2JEPA 4UFJA 1SFSA 2WC3A 3RCNA 2O9RA 5D9OA 4AMCA 3E1F1 4JKKA 2XFYA 2WMGA 2MANA 1NP0A 1GORA 1UD6A 3PZVA 1FOBA 1W1VA 3ZM8A 1US2A 5A6AA 4E8DA 1VRXA 5HOSA 3WD3A 2D24A 3VMPA 3VU2A 1JI1A 1EDGA 4AD5A 3W26A 3AS0A 3AMDA 5CG0A 3ECQA 3N18A 4XX6A 4QP0A 1E0WA 3RPMA 4UFLA 3F5KA 3AI0A 3ZR5A 1XGZA 2PWHA 1XD1A 1BF2A 4U5IA 3ARVA 4W93A 4EE9A 2XIIA 1LLOA 4Z2HA 4HOWA 3EBVA 2VMFA 1XYZA 3MANA 1VJZA 3VD9A 4GI9A 4HOZA 3T09A 1V0LA 2GJXA 2O92A 1QI2A 2PBGA 1WE5A 1WDSA 4DM1A 1CECA 1MW3A 3AXHA 2OSXA 3QGVA 1U30A 3SUWA 4U2ZA 3GYCA 3CMGA 2XVKA 2ZXBA 2QMJA 2A3AA 1IZJA 4AZCB 1HVXA 3I3EA 2RGLA 1EA9C 3AIUA 2YLAA 2V3EA 2JIWA 3T2PA 1E3ZA 1UWQA 1J9YA 1W32A 3VILA 2RGMA 4BZYA 2Y5EA 6A3HA 3VDBA 1LL7A 1M53A 3G6MA 5TD4A 1E73M 1HF6A 2EPLX 3SCUA 4R5EA 3AIQA 4LYQA 3RM8A 4TTGA 3ZO9A 1WP6A 4KWUA 3VD7A 3TTQA 1UD4A 2W67A 1JD7A 3G6LA 3WEOA 4CUCA 3NYDA 4PMOA 3MMUA 1OGBA 3VGDA 2G3IA 2WVVB 3M46A 2VX4A 3BMWA 4F79A 3U5UA 4FK9A 1W9UA 4UQAA 5HPOA 3NSMA 3WH9A 5D9PA 1E0XA 3AHZA 1GJUA 1O6IA 1GPFA 3VGGA 5LYRA 1BVZA 4HPGA 5HBFA 2Y24A 2CKRA 4J28A 3VUPA 1B30A 1W91A 1ZJBA 1HP5A 5M17A 1IT0A 1NP2A 1EDQA 2BHZA 4GZIA 2QPUA 2WWDA 5FL1A 3AIVA 1WDRA 1CZ1A 2VZVA 2DQXA 2GK1B 1GOQA 2Y8KA 1H0GA 3UG3A 1U33A 5BRQA 2W63A 4A3YA 4KGLA 1ODZA 1UWTA 2VCBA 3BGAA 3SCQA 1HN1A 3CZEA 4X9YA 1XSKA 3WBEA 1B0IA 1J01A 1Q6FA 2Z1KA 5A6JA 3N04A 1QHOA 1UKSA 3PZQA 1X6NA 1FFRA 1XRVA 2DIJA 1E6NA 4OKDA 1EIBA 4D71A 4JCMA 1G5AA 1I1WA 3SCSA 1UKTA 3K8MA 4W7VA 3WD1A 3EMQA 2PBOA 2VL4A 3DHUA 5BXRA 2E9LA 3FAXA 1RP9A 3MUZ1 1J0YA 5A8OA 1UH4A 1KXTA 4P8VA 2GDVA 3WD4A 2CKSA 2CEQA 4L4OA 2HISA 3NSXA 4M82A 4GO9A 2W61A 1HJWA 1X6LA 3W6MA 5A1AA 2WWCA 3UR7A 1NWUA 4PSRA 2D0GA 2WKGA 1QNQA 1S46A 1MQRA 1TMQA 2DPEA 1V02E 2VX6A 2WVSA 1V0MA 4D72A 1CXEA 4LPCA 1TZ7A 3GH5A 1JYNA 1J10A 1HJVA 1ZBKA 1E5JA 3AMLA 1CNVA 4E2OA 1JXKA 2Z1SA 3CTTA 2WBGA 1CENA 4TXEA 5FOOA 5DFAA 4CGTA 4Q22A 2CITA 4MB1A 2IUZA 2VCCA 2O9TA 4HU8A 3AOFA 2J7HA 2Y2WA 4UFMA 1ZBCA 1G9HA 2J7DA 4J3UA 2F2HA 3WDIA 3VNZA 5DMYA 2O9PA 5ABEA 3PZGA 2V3DA 2Q8XA 1C8XA 1CGWA 4B3KA 1XH0A 2GJRA 1FHLA 4JKLA 1UR1A 1BFNA 4KMQA 4QCFA 3QOMA 3SCWA 4AZ5A 2ZUNA 3W29A 1M03A 5IDIA 3AZSA 3VD5A 3W0KA 3KE0A 2PWFA 4XUYA 3CPUA 3SEPA 1QW8A 2YOCA 2VTFA 2HVMA 3TA9A 4GKLA 1QI3A 3HMCA 3WDPP 3WH7A 4K68A 4Y7EA 1KFWA 4CD5A 5A3HA 3N9KA 5HPCA 1JZ2A 1EDTA 1LWHA 2YKKA 1HJQA 1QI5A 4OJYA 3VIGA 2IXVA 5A94A 1AQHA 1ZB5A 3AIRA 4QFUA 3SCOA 1Q6CA 1HJXA 4EAMA 1JYWA 1KXQA 3AS3A 2Y8VA 2YDQA 3CZJA 3ZJ8A 4H2CA 4J3SA 3L4TA 1OB0A 1JL8A 2CBJA 2BHUA 1YHTA 3S6TA 2BY1A 3HN3A 5CSYA 1E5NA 5I6SA 2YDSA 3NDZA 4AYSA 3GXDA 3CHCA 3S2CA 3SIMA 1JFXA 1W9VA 1HKKA 4HU0A 2OYKA 4WLCA 3L4WA 3SUTA 1H0IA 1BHGA 2EPOA 2J47A 2J7BA 2JF7A 1MXGA 5JBFA 2J25A 4UQCA 3VX1A 4ZE4A 2OWXA 2CIPA 4MPKA 1E40A 3VIIA 4ZEPA 3SCPA 4EANA 3WMBA 3RMEA 1PBGA 2ESCA 1V03A 2XIBA 3CZ8A 1QHPA 3VINA 4CN4A 2EJ1A 4AEFA 1UR9A 2VQTA 2UY3A 1DWIM 1Z32X 4MJ4A 3ARSA 1JZ3A 4DWSD 1W1TA 3W24A 2E0PA 3KL0A 1OM0A 1JYVA 5A8MA 1J0IA 1GJWA 1KCKA 5I5RA 3AIWA 3WELA 1NWSA 3UR8A 1BQCA 2J79A 3ZJKA 2YL8A 2PWGA 1MYRA 1W2PA 1UH2A 3W25A 4JFWA 4Z2JA 4PRWA 1WAWA 4LXFA 4CD7A 1XH2A 1CXHA
chains in the Genus database with same CATH superfamily
3FAWA 4Z17A 2BY0A 4O8AA 3BAJA 1DHKA 3L2IA 4IF2A 4PFMA 1UBPC 3CUHA 3ARWA 3LCLA 3GRIA 1E43A 2VR4A 4LCQA 5FEXA 3G8RA 1FTXA 4L4PA 1JZ5A 3VZXA 1GNXA 4XBJA 3FYOA 2OQHA 4QG9A 4AZGA 5HMFA 1XCXA 1NY1A 3WFZA 5DT7A 3LMZA 1H62A 1KO0A 4WQ6A 1NWTA 2QJIA 3PBGA 1ZS2A 1AMYA 1X1NA 3GTNA 3EA1A 3MMTA 3LBCA 3UG5A 2CHOA 3N12A 3T81A 1RR2A 2PF0A 2WNZA 4A8RA 2G5WA 5K2ZA 5HXMA 2E9MA 4IQEA 5HDRA 4BA0A 4LUSA 2Z1WA 4K37A 2GSEA 4IPLA 4RPPA 1H49A 4XG1A 4D6FA 2ZCGA 1P43A 3QC3A 4AHOA 4HPJA 1EJ7L 4QSFA 3NZPA 1W56A 1VKFA 3UZWA 5CC7A 3MJYA 3NM1A 1NOFA 3EPNA 3TSDA 3KOWA 1FWEC 3W73A 3P60A 4G9PA 4UQEA 5AHIA 1PAMA 3OA5A 1FXQA 3BG9A 3K8KA 3CH0A 3ZVIA 5BWFA 3M0VA 1NJJA 3V36A 3BPWA 3Q67A 2YBVA 5AKQA 1WXZA 3D6NA 3POCA 3EOUA 1Q7ZA 3MV11 4EIVA 5U7SA 1I75A 2WZHA 2KX9A 2YCLB 1CDGA 4K8GA 3SN4A 3LYEA 4Z2LA 3WLQA 4NP7A 3TW9A 4IIHA 4XO7A 3AYTA 3LGDA 2NV9A 4NI8A 2Y62A 4WSKA 3TVAA 1LWJA 1CI1A 3KRZA 3TYDA 1ZTVA 2OZTA 2F6KA 4DJDD 3WF3A 1M6JA 1I2QA 1EUAA 3A9BA 1C90A 3LEPA 1VYSX 1GYLA 3S1XA 3K8LA 1MQPA 4LNYA 2ZOXA 3ISIX 3WIJA 3EMZA 5DRCA 3AIBA 3QQWA 2R1LA 3UBPC 3NQ2A 3EB2A 2ISFA 4C5YA 1H3GA 3OHIA 5FF3A 1KBJA 3S1GA 1YYAA 4IMAA 4M81A 3RMJA 1F2JA 1FA2A 1PVNA 5H8MA 4LC6A 2UWFA 3G3DA 1F6YA 1B57A 5G4EA 4YPJA 3LI1A 3TCEA 5JXQA 1FWTA 3B4UA 4YTUA 1V3MA 3KHDA 3VC6A 3C0QA 3MUXA 4JKMA 5I02A 8XIAA 1CLVA 3K4DA 5JIPA 4UR7A 2YFOA 3GFYA 1R6WA 2YB1A 4I9JA 4JHZA 2ISWA 1OF6A 2PFHA 4H3DA 3IJ6A 1PE1A 1EF3A 3H2MA 1GOMA 1KXVA 3CS2A 1Q6OA 3DG3A 4DF2A 1TPVA 3HBLA 4AZ6A 6TIMA 1ITXA 1ZY9A 3TDFA 1A3XA 4PZVA 3DHPA 4ICMA 2DT3A 1R30A 2DVUA 5F4XA 1KBBA 3OZMA 4H9XA 1SJCA 3N2CA 4XAGA 1PKNA 3UWZA 3KEHA 5TQLA 4GIYA 1S2WA 2R94A 3SY8A 1V3HA 1J0KA 1E0TA 4Q6JA 3H26A 4AQLA 2E1WA 2B7OA 4C6LA 3CUIA 3VZZA 3CASA 3CMFA 3ITCA 5EMYA 3VMOA 1X1ZA 4GI4A 5I7GA 2EJAA 3PZMA 5D09A 3W84A 1IR2A 1HL8A 3O1NA 1MDRA 4HZ6A 3LXAA 2IMRA 1OHLA 5HWJA 3FJNA 1GKQA 4KRTA 1J11A 2BHYA 1HT6A 3WFLA 4EF8A 1K6WA 3TXZA 3UJEA 5CGQA 1KNWA 4YU1A 5AY7A 1ZAHA 3BCFA 4DBWA 1CXFA 1E9LA 3RO6A 3U4FA 2PU0A 1SFJA 3WLMA 1E6RA 4XWUA 1YQ2A 2E8ZA 4UOZA 3A47A 1UIOA 5I3JA 4XKYA 3M5ZA 1KTCA 5CBBA 3ABOA 1S3HA 2P3ZA 3R89A 4U2YA 3UCQA 1JD9A 2CLIA 2ZRUA 4HQVA 3MMDA 1XC4A 1NELA 2PI6A 2VZSA 3EWDA 1A5UA 4O52A 5EFFA 1XW8A 2QGYA 4GVGA 5EMKA 1NDZA 4LF2A 3R94A 4A35A 1Q3NA 3I3DA 2HMCA 1OD8A 2YBTA 3DC8A 4IPPA 4S3AA 4DO6A 4JIQA 3PP7A 3CEUA 4KF1A 1S2CA 3D5HA 1WPCA 5C9ZA 2PU1A 3LU2A 5LIUX 4LT9A 1IIGA 3VVGA 5BYWA 2FDMA 3SUSA 4W86A 1G0CA 4QNWA 1JDFA 2J74A 4R27A 1DIEA 4FMVA 1XSJA 3CUJA 3MUY1 4N42A 4MNKA 2XGIA 5GNYA 3TFXA 3BAIA 4OGZA 3T2OA 5LIYX 4G56A 1TIMA 4MDPA 1SSDA 2FTYA 3LLFA 4D1IA 2ASHA 3N3TA 1FHUA 3NDYA 1LWIA 1QFEA 2OEKA 4E4UA 1G7VA 1TPDA 3WFAA 4HMEA 2ZQ0A 4KKXA 3OQ8A 1XWYA 5A2BA 4PTWA 3GUWA 3A4WA 4R53A 4XVEA 2DZSA 4KERA 4ZODA 1G67A 1HKMA 3RNDA 1ZU8A 2Y89A 3NOEA 5AHMA 3QMTA 2ISSA 5EL1A 3EXSA 4NF7A 3F4CA 1YE6A 7REQB 3DEQA 5KMYA 2QLYA 2CC0A 1JDDA 3WK3A 5J5RA 3L0NA 3ARUA 5EFDA 1DORA 3PC0A 2XN0A 2DJXA 5I24A 4Y9MA 2REQA 3VIJA 1K7FA 2GDUA 3BGJA 8TIMA 4OWGA 3I6EA 4PULA 1XQLA 1Z42A 2DH3A 3P5ZA 3DXIA 3QMSA 2I1OA 4IMDA 1P6CA 1KM3A 2X2YA 4FNTA 3M1ZA 4XO6A 2V3GA 1KFCA 2NUWA 4YTRA 1VEOA 5BU6A 3KVMA 1F4AA 3HG2A 3PG9A 3W75A 3REQB 1XP3A 1LQAA 4HPNA 3O7UA 3VDGA 5FSDC 1E6ZA 5CEWA 2NX9A 5CQ1A 4ECLA 5IHSA 3JRKA 2PTXA 4WSHA 1OX5A 1ESWA 3G24A 1PWMA 1BKHA 1RD6A 1NH6A 3DHDA 5LNUA 4UTLA 1EJRC 3W7NA 3ENLA 3WEZA 3S2NA 3LZ3A 3AHXA 1FCBA 2B31A 2J8FA 3ZIZA 4QJ5B 3G77A 5AHNA 3BLEA 3LRLA 1A0CA 1PCKA 1DEDA 3Q58A 1FCVA 1KKRA 2X1TA 2NW0A 1E1CA 1RA5A 1IGWA 1ZBWA 3MO4A 3R58A 2H9AB 4AW7A 3VPLA 3GHRA 3WQGA 1A4MA 1OG0A 1EQPA 3T0DA 3SN1A 4YNGA 2FH8A 1HTIA 1PO9A 3VFCA 3MC5A 1HUVA 3H54A 2ZZ2A 3BK0A 3QHNA 4H41A 3JVAA 4IQLA 1WDDA 2YA2A 3TUUA 2W4XA 1ENUA 1H61A 4OBSA 2DSWA 3ZT5A 3TWAA 1SYTA 3NGJA 2R14A 4Z2IA 4RZ5A 4Y8EA 3BARA 2I7GA 2EBNA 2WSYA 3T0AA 1QO2A 1W3KA 1N8WA 2BWGA 3IPWA 1VJIA 1EKOA 1YDYA 2EKGA 3G3MA 4JN7A 3IRDA 3SECA 3GTFA 3WF0A 3RRXA 2YDRA 2HQAA 3EA2A 5CGTA 3RUBL 3T08A 2YJQA 1LL4A 2ZC1A 2X0SA 4RUBA 3WLNA 3RF9A 3WQCA 4GOAA 1IV8A 5I0DA 3IK4A 2TPSA 4E8CA 1I0BA 1GQLA 4RK8A 1QW7A 5CJMA 4KEZA 1JQVA 5I3GA 4Y8FA 1F3WA 1EWDA 2OT0A 4A2RA 3GC5A 3IIPA 4C7DA 2D20A 3BOFA 1XKJA 3EDEA 4M29A 3M0YA 2E68A 2VHLA 1E6QM 3TE9A 4M56A 4NAFA 4WGHA 3WD2A 1J0JA 4A3RA 4HNVA 3KZSA 4YLWA 4CNSA 2PTYA 2X0YA 4QE4A 3P8IA 4X2PA 3O6AA 1E70M 2WQDA 2HDJA 3TOYA 3V7PA 1AK5A 2CZFA 5CPNA 1FP9A 3C8NA 3FYYA 2D2GA 2GPTA 1JNEA 1M1BA 4JIPA 2BVWA 3T4WA 1HKJA 3B8SA 1XJBA 3ARQA 5LA1A 3A4AA 3W2UA 3NYZA 1AW2A 3WH8A 1RBAA 1UCWA 1BWKA 4DBEA 2TMDA 3KLKA 4NJIA 3MA8A 4UZSA 4LUTB 4GK8A 4Z2KA 1FH9A 3A5VA 2CZVA 2NVAA 1A47A 2ZZ7A 4FPSA 4B5XA 2JF6A 3W74A 3VO0A 2INEA 5C8BB 1Q7MA 2E9BA 2GDQA 4D6IA 4I6VA 1OFOA 1MUMA 4IXXA 4ES4A 1IEQA 2FVLA 2POTA 3T78A 3WG6A 3G1XA 4WJEA 5F7UA 2V5JA 4GCAA 4LWWA 3STEA 4H8HA 2XPKA 4LH8A 4KPLA 3MVIA 3FN9A 1TRDA 1P0EA 1XYCA 3RM4A 2IPWA 4Q6XA 4XZHA 3DYPA 3PUEA 3HQOA 4YHGA 3VE7A 3PJXA 4QLLA 3PZOA 4YVXA 1KKOA 1XDMA 4MZ1A 4E2DA 4J5NA 2FQIA 5D02A 4IWWA 4I9MA 3VD4A 4AVNA 4LCSA 2P3EA 3M0HA 3DFSA 3QTPA 1I1XA 4LYRA 2V38A 3AFBA 1RCQA 3WH5A 2AKZA 1GQJA 1UA3A 3H2OA 4LOCA 2YYUA 3W7MA 4F0KA 2VT0A 4TMBA 3BOXA 4C5ZA 5CBJA 4IISA 1CGTA 4KBXA 2QMKA 1ZALA 2Z2BA 1VIWA 3K2GA 3GM8A 2X05A 1KM2A 4S2CA 2NXGA 2VDHA 3UVIA 1LUCB 4FIRA 1JQXA 5G5IA 2NQ9A 2Y63A 5LIWX 3GAYA 2ALRA 4TIMA 4K3ZA 4WCJA 5TIMA 2YFNA 1B3YA 1J5TA 4JD4A 4AWSA 1JDEA 3QN3A 3W2KA 2BV9A 1S1RA 1DWGM 4Q3MA 3UYIA 2WBKA 4J2PA 1GW1A 3P0WA 4IPJA 2OZ0A 1FWDC 1TE1A 4AHQA 4OECA 4Q8NA 1JPHA 4JTTA 4M80A 1IWAA 3L4YA 3CIVA 1CT5A 3ANYA 4HHHA 3FSTA 3NJ3A 4J4KA 3QOKA 3ZSSA 2ZDSA 5CPSA 3W7RA 3PS7A 3GIQA 4C7FA 3PF3A 1VBRA 2QJGA 5HINA 1OYBA 5CPQA 3K1GA 3UWEA 2WYSA 1BTMA 4C90A 3UU0A 3FY1A 3LS9A 2V5CA 4XD4A 2DQWA 2GJPA 1YPXA 3DFOA 1W5QA 1W3NA 3LSBA 3CHDA 4Z1AA 1K6AA 3OB8A 2Q09A 1NDYA 2G3NA 3PSVA 1YMYA 3G1SA 1ISZA 3LGGA 3XISA 2J9ZA 3Q94A 3L4VA 3T8LA 2DV0A 1E1EA 2W91A 3THQA 4IMFA 2OLHA 3T2QA 1WKDA 2PC8A 2VEFA 3URBA 4IIGA 3WQ5A 1DWAM 3NQBA 2QVHA 2OTDA 4DAFA 3T8QA 1DOSA 3S8HA 3W88A 4ZB2A 1D2KA 2QQ6A 5H91A 5DMNA 4BEQA 1B1YA 1UH3A 2D3LA 3NWRA 3I7SA 2NV1A 5K9XA 3RPDA 4GQRA 2A4AA 1F07A 3H7RA 2VFGA 2C16A 4PRRA 4UFHA 1VAHA 5IBXA 2XIQA 4C6QA 1GQKA 1K8ZA 1VHCA 4JCLA 1ZP4A 4Y9NA 4TUFA 5A8NA 1ONEA 2RAGA 3TP4A 1EH9A 3GC4A 4B4FA 3K46A 3KOYA 2PDIA 1A3HA 2PP1A 3TYUA 1WKYA 6REQB 2CBIA 5AC4A 4QLJA 5M3WA 5I78A 3WNPA 3VCRA 5A6BA 4GPNA 3ZT7A 3NAVA 3OIHA 3C5QA 2A3HA 3S6DA 1SO4A 2W6RA 1VFMA 5D2WA 2FGBA 1VFTA 4Q8OA 4E3VA 3I4EA 3B0VC 2BZNA 3GK0A 4DJFC 4F0HA 2ZXAA 1YNYA 5ABFA 1YXDA 4RE0A 3TJLA 1RVKA 3U2OA 3RYSA 4AZBA 1OCBA 3H4GA 4GZ7A 1EP1A 1ZP3A 1HJSA 4BQ2A 4G2DA 1TE6A 3TAKA 1DP0A 3LHTA 6PTDA 4IJCA 4D6JA 1QRQA 1XLKA 3TR2A 1W3JA 3IGSA 3EDDA 4LVFA 5REQA 4ZFCA 4HKPA 1SJBA 5A6KA 4IPNB 1GTEA 3N11A 4PUKA 3SCVA 3TTYA 2QVNA 1QAPA 3ZMRA 4OU1A 3O3RA 4HSHA 3LCXA 3SJ3A 4JDBA 3OLEA 1POKA 2VOMA 3PNZA 5XIAA 1UW9A 1EQCA 1VFUA 2E25A 4XKYB 4N9BA 3KFTA 5EBAA 4JTFA 2WMIA 4UIOA 1BXBA 1CTNA 3WO8A 2YSWA 3QXBA 3UZJA 5E9AA 1XHGA 4ZR8A 2QS8A 3PTDA 1U5VA 1OGGA 3WQVA 4M7SA 3H7UA 4CN1A 4AXKA 4ZCWA 4XQ6A 1XYFA 1LRTA 2W27A 1QDSA 4D2JA 3SRFA 4M1RA 5LKYA 2XGBA 1OCQA 4PUDA 4I9AA 2V81A 4LY4A 3PWIA 2BS9A 3M07A 2IXUA 1YLVA 2PDHA 4FOUA 1CLXA 3VDAA 3MV01 1XD0A 2EKCA 1OK6A 3AYRA 3BW2A 5LNWA 9CGTA 1EHNA 1E72M 1PEZA 4XZLX 1JF6A 1SZEA 5HUPA 2Y7EA 2ZX9A 4O0KA 3E2RA 3WX7A 2R1PA 1J12A 3QEZA 4GUJA 3T0BA 3M5VA 3SN0A 2DIKA 3P14A 4ACZA 3AYSA 4IGNA 1XISA 3ZLHA 3AHTA 1YTEA 3CPRA 5EMUA 4BI6A 4XBSA 2PGEA 2PDNA 1I0DA 1O5RA 2EXOA 1Q2RA 3UYCA 4H6RA 4KEMA 5A6MA 4I7VA 1L8PA 2OEMA 3OGVA 4LRSA 1WKEA 1SR0A 4DELA 1P6BA 3EMCA 5CJNA 4NAEB 4IMCA 3LPOA 1HZYA 4QIUA 3C2OA 3E02A 4UTFA 2QUUA 3QV6A 1ZRQA 3AZTA 3IJLA 4TVDA 4O28A 4H7VA 3GU9A 3W1TA 5D8WA 1UZ1A 1HXJA 3MWCA 3ABQA 3KXQA 3W2LA 2B4GA 1QBBA 4AF0A 4REQB 1JCNA 1ZCOA 2GQ3A 3OYXA 4HYVA 1OX6A 3GH7A 5BXSA 5JU6A 3N17A 3OZOA 3NQ7A 2GWNA 3P62A 2TSYA 1R9XA 2WVUA 4MADA 2WAGA 5KZMA 3RFAA 1E4LA 3CL7A 1ADDA 1UOKA 3ONCA 3PZ9A 5I3HA 4B5VA 3W70A 3SUUA 1YADA 3FGCA 4OUIA 5LIXX 2QNEA 1TR1A 1DIOA 3DFPA 4FX6M 4W7WA 4GYPA 4HCHA 2ZXQA 3S5NA 3CWOX 4Z42C 1CBGA 1A5BA 5A8GA 3TW7A 1R3QA 3WLHA 4NRRA 1UP2A 2BXZA 3CV6A 2GJLA 1RJRA 3GG1A 4YCOA 2FIQA 3NQVA 2FZ9A 1KGUA 1XIIA 5DLCA 2DT1A 3GYEA 2NT0A 2JEPA 2WC3A 1S3TC 4MWAA 2V30A 4ERIA 3BZGA 3E1F1 3IVSA 1FXPA 1I2PA 5GVJA 2RDWA 3KHJA 2OKTA 4DBDA 1ITQA 5HOSA 1V6TA 1RAKA 4EACA 4TX9A 4NU7A 2UV8G 2MNRA 3ECQA 3Q4DA 1E0WA 3RPMA 3QYSA 3ZR5A 4DI9A 1XGZA 1REQB 1QK0A 1XIDA 3A21A 5I3KA 1VBHA 3CQKA 4EE9A 4QBXA 3WZ0E 3SQSA 4HOWA 3MANA 1Q7QA 4WY0A 4DVOA 4PUWA 3EEZA 5CZTA 2Y85A 5I09A 1I4NA 4P61A 4JQ3A 2E1DA 3LTPA 1F8IA 2QF7A 7ODCA 3PNUA 3QGVA 1U30A 1KRAC 4U2ZA 2WJFA 1DQWA 1UMLA 4S3CA 1GVFA 1RA0A 3E2QA 1MNSA 3AIUA 2YLAA 2YZ5A 2V3EA 3UG8A 1UWQA 2W9MA 3AALA 5FEZA 3QW3A 1YXYA 2RGMA 2Y5EA 3KBVA 2Z2AA 4LVBA 1WBHA 1LLWA 1E73M 2EPLX 3SCUA 4LYQA 4PMJA 3H55A 1QMLA 3QJAA 2Y8UA 5CAKA 1UD4A 1YKWA 3OYZA 3G1YA 5LHFA 3SGUA 4M5PA 3FK4A 1EGVA 3FA4A 1OGBA 3VGDA 1P7TA 3M46A 2H3DA 2CLOA 3NGFA 1W9UA 3NSMA 3UJ2A 4H9TA 5DXYA 4GUIA 1BRLA 5D9PA 1X6UA 6ENLA 2INFA 3T6CA 3O6YX 4IGHA 1GPFA 5LYRA 1BVZA 2Y24A 2JQXA 4JTEA 5HNRA 3VNIA 4UTWA 2FTWA 1HP5A 1IT0A 2QCFA 3DFQA 1V93A 3KVJA 2OU4A 4RZ6A 1UUMA 3W7KA 5FL1A 4X9SA 4KCTA 3GFXA 4K6AA 1GOQA 3CAWA 3AWOA 3RHGA 1XG3A 5BRQA 5U4NA 3NEHA 4L56A 4A3YA 2A0NA 2NX3A 1I45A 1XLEA 3GDMA 1XSKA 1R0MA 2J6XA 2Y7FA 3F4NA 3PR2A 5HATA 5C54A 2ZZ4A 3NQDA 4ZQPA 1Q6FA 3TR9A 3I65A 1UKSA 2DIJA 1XRVA 2I57A 3PAOA 1E6NA 3NDOA 1T40A 3DI1A 1EIBA 3RU8X 2P76A 4JCMA 4L9YA 3N9SA 1UKTA 1DVJA 3SFKA 4IX2A 4B2DD 4B5SA 3DHUA 1RP9A 1UH4A 4Z0JA 3QPYA 1OC6A 5HJYA 1B54A 2CEQA 2HISA 1KA9F 4G5DA 4M82A 2YCKX 1X6LA 1C29A 3W6MA 4LF1A 2QCLA 4FXSA 2ZVIA 4L61A 3G1DA 1S46A 1TMQA 2DPEA 3G18A 2FLIA 1B3OA 1TPUA 2XIJA 2Z2UA 2FYMA 1SW3A 1TZ7A 4TV5A 1J10A 3CO8A 3KBMA 1ZBKA 4H00A 3RR4A 2PSNA 4YJ5A 4D9PA 1RK5A 3LRKA 3PPCA 4C1LA 3R0DA 3HQNA 5DFAA 4CGTA 3QGAC 2E5CA 2IUZA 2Z28A 2VCCA 1AH4A 4Q4PA 3IIXA 4X61A 1IXQA 2OO0A 3HFTA 3VOHA 1JUKA 3A64A 5F1VA 3WDIA 3GNXA 4R85A 5DMYA 3B3DA 2I9EA 3E0LA 4B3KA 2JKEA 1W0MA 3CLMA 4QCFA 4AVFA 2VKZG 1K02A 1IHIA 1XPYA 1M03A 5IDIA 3VD5A 2VXNA 2Y1HA 1EC7A 3UWWA 4DZHA 4XUYA 3O16A 5A3HA 4GQBA 1EDTA 1LWHA 3CUZA 4FXFA 2YKKA 3OU8A 1J2WA 3GAKA 5AOUA 4F0RA 1S2UA 3FYPA 4QJ1A 3LOTA 4A8IA 3B40A 3BW3A 1HJXA 3TAOA 1R3TA 1D3GA 1KXQA 4X63A 2X16A 2YDQA 3U9IA 2Z4GA 5J8LA 1OB0A 1P0BA 2CBJA 1TR9A 1IE7C 4NILA 4O4VA 3KWSA 5F2GA 3ATYA 5DBUA 1FKXA 4N4QA 1MSSA 1E5NA 3P7YA 3E5BA 3TJXA 3NDZA 4MFEA 1RVGA 3CHCA 3S2CA 3SIMA 4OVXA 1W5MA 5FJTA 3IIOA 5F2LA 3SUTA 5J5DA 2ZRWA 2EPOA 3PUOA 4N9DA 4M6UA 2H90A 5G2HA 3TFCA 4J35A 5JBFA 2J25A 5FEWA 4ORMA 1C9DA 5E9XA 3MI2A 5JMUA 1E40A 4ZEPA 3FSUA 3NQ8A 1FWHC 1BQGA 3RMEA 1PBGA 3IGHX 2ESCA 3M43A 3CZ8A 3S1WA 1QHPA 2HTMA 3O6DA 4GG9A 2EJ1A 3V5FA 4LC8A 2PDQA 3BWWA 1WUFA 3TYBA 7PTDA 3CV1A 1DIKA 2E0PA 5F1UA 3MHFA 1JYVA 3AO0A 1D8CA 3ABZA 3W1XA 1LLZA 4UCGA 3UR8A 3OG3A 4A3QA 4US6A 2J79A 4GQGA 2DZWA 2YL8A 3PUDA 1OX4A 5AVHA 3UVAA 2J13A 4CD7A 1XH2A 3HPXA 1EJXC 3JUGA 4AEOA 1KLYA 2D2HA 2PLMA 3DKJA 1A5AA 3WDRA 4AB4A 5FKYA 1WO2A 5C2XA 3TLLA 3UR5A 1SGJA 1E4IA 2WK2A 3KCOA 4WGXA 5LA2A 4IXHA 3EWZA 4HB7A 4F8XA 3A9IA 2WCAA 1QK2A 4C91A 1KV8A 1OFDA 4OFCA 1XLDA 1RK6A 5REQB 1U1HA 2A6LA 3JZUA 3E0IA 1FWBC 1OSEA 5EY5A 1N8FA 4FNQA 5CH9A 3OGRA 4D6EA 2D23A 3THAA 4QAWA 3TC3A 2DSKA 3RCYA 4W7UA 1KB3A 1CXKA 3IIVA 4JL1A 1VC4A 5DCEA 2GOKA 3EKGA 2XIOA 3WDQA 2NZLA 3O63A 3W4RA 3FA3A 2A5HA 4X22A 1F8MA 4ZO6A 1H41A 5BU9A 1NVMA 3MI6A 4J27A 2FH6A 2A3BA 4QDMA 2ISDA 3VM7A 4ZB5A 1ALDA 5IOBA 2Q01A 1ITUA 3HJZA 1VLWA 1TMHA 2CWNA 5CKSA 3BMXA 3G0SA 2ZVRA 2BP1A 4LFYA 4RE4A 1J18A 1X96A 3UERA 3RDKA 4O17A 1P1XA 4D6DA 3VXGA 4WDTA 4MWAE 4INFA 2DZBA 3IRSA 2X30A 1XKYA 3FXGA 4M6PA 4TV6A 1KFBA 1QVBA 1NDWA 3OG2A 4P7QA 1TJ2A 3THCA 3IS4A 3U8GA 4BFAA 3E49A 3B9EA 1SUXA 2ATMA 3T42A 4HA3A 3S5SA 3NIYA 1T8QA 4JNYA 4LB3A 4ACZB 1R86A 4L9ZA 2W62A 4U33A 2CXGA 2PWDA 2EO7A 3HGRA 5LA0A 1BGAA 3ID7A 3TJ4A 3CUGA 5KETA 1LROA 2AL2B 3F2DA 5F2IA 2QPSA 3URNA 2CETA 1CGUA 3LTSA 3CXOA 1QW9A 3CV7A 2JIEA 2FGLA 1X7IA 1UD3A 1MDLA 5CC5A 3B9NA 3RLUA 3UJRA 4HTBA 1L9WA 3CK5A 4UNLA 2WZMA 2FPTA 3H21A 4NASA 1I9CB 1O94A 3L4UA 4CU7A 4AY7A 2OMAA 1WNOA 3L5LA 4U31A 4LEQA 2RJGA 4K8HA 2ZA1A 3E3HA 4L6DA 4W84A 1ISXA 2Q3OA 4LX4A 3PANA 3KZPA 3QQ1A 4FZIA 5CZJA 1TB3A 4EWJA 3WNNA 2CXEA 3U0HA 3TYEA 4FSAA 4J7RA 3CHFA 1VFOA 1UR4A 3WDHA 5AFDA 3V16A 1HKIA 3LCIA 3ZR4A 4CD8A 3TWBA 3N4FA 7ENLA 2R91A 3ME3A 4XD6A 3DH7A 2DU2A 3NXLA 2QF8A 2JGQA 2Y70A 4PTVA 2VWSA 4HHMA 1EXPA 1JPKA 4LAOA 3KDNA 3UEQA 3MP3A 3QSRA 1OABA 4ZGYA 2VRKA 3GVRA 2WZEA 3RLGA 2VUYA 4B15A 3B0YA 3R2GA 4XIMA 4D6GA 1RCOB 5CAHA 1BTCA 3UJFA 4RDVA 1OC5A 4DNMA 2ZIDA 4CNTA 1BSIA 3L5AA 4X2RA 1GPWA 3VNYA 4O0QA 4K7VA 1C3FA 1Y7VA 3S1VA 1RQHA 3F5JA 3VIOA 3PBMA 3W6YA 3SUVA 3E0FA 1XBVA 1RUSA 1ZCCA 2H8XA 2ZX5A 2EPMX 2NQ5A 1HGWA 4J3ZA 1UC4A 1QPKA 4YXGA 3AXIA 3SRHA 1O66A 3KS6A 4PUEA 4Q8QA 1KGWA 3RM9A 1VB9A 3TN4A 4URIA 4GZEA 4ZE5A 1EP3A 4DWDA 4O16A 5AYBA 4QAIA 4PEEA 4JGDA 4CU6A 3NQAA 3NM3A 3WYZA 3I68A 3GDKA 2PDKA 4AIUA 4CD4A 1EFZA 3U6WA 1YW1A 3W76A 4DPPA 2QT3A 4WY0B 3AROA 2AQVA 2GL5A 1FP8A 2FFCA 4JX6A 1MI3A 1EOMA 2FZNA 3DECA 5I07A 4LS2A 1Q6QA 2V67A 2DDXA 4FHAA 2F6XA 3UZXA 1K9TA 1TUXA 4GIEA 1E3XA 3QV7A 5GNXA 3SRKA 2G3JA 4RV3A 3R7MA 2PUZA 1F76A 2BFGA 3RJXA 2J62A 3PAJA 5XINA 2WZTA 4EXAA 3MUIA 2NVDA 4O53A 3VIKA 4PCPA 4F2BA 2D22A 1V02A 4EK7A 2WW5A 5AHFA 1YBQB 4A4AA 4FNSA 4HCDA 5DMMA 4IHCA 5EPDA 3A5FA 4NZ3A 3NO5A 3TN3A 2GJNA 3B9DA 3DBNA 3BZJA 4GYJA 4JFTA 3T4CA 1E15A 3VIHA 2X2GA 3ITVA 1FH7A 2WPGA 2XTKA 4QEEA 3NQEA 4N7QA 2E4TA 3U2EA 3WQWA 3R0KA 2PCQA 2XVLA 3ZLGA 1E0VA 4JTKA 5A6BD 4C1NA 2CHNA 1O5XA 2BASA 4RNFA 2WM1A 1XM3A 5MKGB 1JDAA 1SVDA 1TVLA 1S1PA 4A6GA 3VOCA 2OZ8A 5KITA 5E6ZA 3STGA 4FXJA 2ZUTA 1BPLB 2QDDA 2WANA 2IKIA 3K4AA 4CNUA 2WMJA 4EF9A 3WKZA 1BVNP 1QHZA 1X1OA 1XQKA 2DGAA 3A3HA 5D32A 2PLCA 4IPIA 4KCWA 4I5RA 4QS6A 4M0XA 1GYNA 1UR3M 4LCRA 4OIFA 1SW0A 3ZVHB 5BOOA 3UZ5A 1KFKA 2Y61A 3TTOA 2HXUA 1GUVA 2I56A 3NZGA 4G7EA 2QXWA 2WCGA 4C6DA 1ZJHA 4I90A 1VFFA 3W9ZA 2ONEA 1WXYA 1H4PA 4PMVA 3NCOA 3GHUA 4W8AA 4XV0A 3WH6A 1JG9A 4MG4A 1MNZA 3SBFA 4AAJA 1PIGA 3BLOA 3TYCA 4F0MA 2EGZA 1XRTA 2QIWA 1HO4A 4OOUA 3CUXA 4ZOCA 5HMDA 3NOYA 3OODA 3W1RA 1ZPTA 5E1QA 2QUMA 2NSXA 1W1YA 5L6UA 1R3WA 1HFBA 4W4QA 3STPA 5C9XA 1KRMA 1VBUA 1B4EA 1OEPA 4F4RA 1AG1O 1GVSA 4DM2A 3ZWTA 4GXPA 4RKAA 3ITYA 4DQWA 1UR2A 3G0XA 3PN8A 2E5BA 3QC0A 3W7QA 2QCDA 4WDWA 3WQ4A 1QTWA 4E6MA 4XAFA 3W02A 4YYFA 3C2RA 3VKKA 3N15A 2C1GA 1GQIA 4Q8UA 1MVYA 3LPGA 1QWGA 3FHQA 4JIIX 3QQ0A 3KRSA 3LHWA 4MB5A 4UUIA 1PJ9A 3R12A 1XICA 3N73A 4XZWA 3MTWA 4S1FA 1GK8A 5I03A 4RZBA 5TAOA 3QH2A 1LDCA 1XG4A 1TJ0A 3LZ5A 4LUIA 3R79A 4NZCA 1J8VA 1VP5A 4I8DA 2G41A 3FA5A 4FB7A 2WSKA 3P93A 3UNDA 3AUJA 4LQ1A 1UPMB 2J6VA 2R24A 2KAUC 3V18A 2A21A 1UBSA 1KQZA 4JTDA 4NX0A 1TWWA 4QG8A 3KBSA 1R47A 4GY7A 2OWWA 1W6TA 2WKLA 5HNNA 2DSZA 4GVFA 4V28A 2G95A 3L2LA 5DO8A 2Y5SA 3E38A 2R1KA 5EMMA 4LV9A 1TV7A 1XSIA 1Z48A 3V1PA 1A5CA 1X39A 4QROA 4R88A 1GOXA 1F7BA 1GONA 3BG5A 2OT1A 1LBMA 4M6QA 2MUCA 2ODOA 3EOEA 4I9TA 1J6OA 3L4ZA 3CT2A 2CLLA 3PJWA 2BB0A 4WKAA 4LW7A 2HBXA 2QJMA 3HV9A 4WDUA 4RE2A 1ISWA 8XIMA 4DWSB 5F4WA 3HQPA 3C3NA 4JIRA 4U10A 2ZUUA 3ELFA 1PDYA 4K1WA 4UR8A 4WD0A 3D0CA 3DZ1A 3H2FA 2WPBA 3WNKA 4FR1A 3UXAA 3NUKA 4O1EA 2VGIA 6CGTA 2AMGA 1FQ0A 1CWYA 4MY1A 1XGDA 4F9DA 2BGNE 2O56A 1EJWC 5GJPA 1Z69A 1XIJA 2GSHA 1VH7A 1B5TA 1XLBA 1FVPA 4MFDA 2TAAA 1ZHAA 8A3HA 3TN6A 2NXHA 4UMBA 1DXFA 4MKNA 1OX4B 3OQEA 1A4LA 3NFUA 2BODX 2UY2A 3H12A 1QNRA 2OQYA 4L7ZA 5HQMA 1TPEA 3WJZA 3ATZA 4GA8A 2B7QA 5E5CA 4HJFA 1JZ4A 1W17A 4MWAD 3QR3A 1XRFA 2QIIA 1DJQA 3DYMA 3LCFA 4IUGA 2XYLA 4GCXA 1S5NA 4JHOA 5D4YA 4NY2A 2ZBTA 1KRCC 2Y7GA 4U3AA 2D2OA 5E0FA 1TV4A 1UWAA 4IP4A 4L6OA 3G5EA 1MFUA 1V7YA 4HYRA 3BO9A 4M19A 2B7NA 5HJXA 2AGTA 1RQBA 3CLWA 1TV5A 2ZDRA 5I3DA 4YS1A 3TMQA 3QR0A 1BF6A 4XB3A 2GQ9A 4HOXA 1YX1A 3TC6A 2HVOA 4BQ4A 4MSSA 1GQNA 1XLIA 1MMFA 2EG7A 3E2SA 4MYXA 4MHBA 2R8WA 3P61A 4B90A 4D8LA 1ZUAX 2ZE0A 3BLPX 1Y65A 2PF8A 1OF8A 5D2TA 1EBGA 2CLHA 3VNDA 3TLQA 3NPWA 4DRSA 3H24A 1X97A 1OIMA 4AWUA 1BYCA 2PURA 3GXFA 1DE6A 4J1OA 2VQUA 2XZ9A 1JZ6A 3AYVA 3FKKA 4NNBA 4JX5A 4FLOA 1WUEA 4HNLA 1OC7A 3VD3A 1Q6DA 1Q6LA 2XH2A 2V5LA 1DTUA 3TJIA 5A8QA 4XD5A 1OADA 1A80A 4BJHA 1EO7A 4OZOA 4IQJA 3WUEA 4GGBA 2OOGA 3TIMA 1JGIA 3RK8A 1R87A 3B0XA 2WQPA 3TH6A 3KTXA 3GVQA 1Z41A 1IXNA 4JFVA 4DO4A 2VWTA 4BKNA 1CCWB 2VX5A 5DN1A 5A2AA 3R5EA 2RDTA 8CGTA 2YA0A 4ATLA 4IIDA 5HMEA 2WMKA 5IDZA 2DT0A 1V6VA 4PTXA 5E09A 3FNDA 4HNCA 1VFLA 2V2DA 2XSAA 2YX0A 3L4XA 3B03A 4MMWA 4KESA 2XVGA 1PTDA 2J7EA 3GU2A 1TA3B 1XLFA 2GYIA 1U83A 2GVJA 4MB3A 5CJ5A 4IFKA 1JCTA 3THDA 2XG9A 4C6BA 4HMCA 3C2YA 3Q37A 4XZMX 1XBZA 3G0UA 2VVNA 3TX9A 1MW0A 2DORA 3BSHA 4RDZA 4KW2A 3HG4A 2F2KA 3SY1A 4NI3A 4ZXLA 4TMCA 4ROPA 3GNOA 2E40A 2XH4A 5AVNA 1H5VA 5A6SA 1DJNA 3S5ZA 4UR9A 1ZLPA 3IUHA 1WXJA 4C6EA 1TX2A 3FOKA 1C8YA 1T99A 3WCZA 3N19B 3O0FA 4FXRA 3VIFA 3W37A 1H2JA 2VVSA 3BANA 5FESA 2VCAA 2QJJA 4AU0A 4W88A 3RPTA 2D1ZA 4HHLA 1Q65A 4YHEA 2CZEA 1V3KA 3PB2A 3R43A 2Z7KA 4B5NA 1NF7A 3AQUA 1YNQA 3N1AA 3HO8A 1UZHA 1R7AA 5C7VA 2HXTA 5G1YA 2C6QA 3MS8A 5LNVA 4DB7A 4AVOA 2JFEX 3V1HA 3A4XA 5KZ6A 3HOJA 4UTUA 4JHMA 2XDFA 1OINA 3ZR6A 1O68A 4FX8A 4OUEA 3KOXA 1L6YA 1LG2A 1J93A 4A8LA 5LGXA 1FWNA 4W8LA 4HBKA 4XKMA 2ZXDA 4P5UA 5JQ9A 4F48A 1R7OA 5C5YA 4P7NA 2ACQA 5JH1A 3VDHA 4MNMA 1DKWA 4PMNA 1VF8A 2BTMA 4J40A 1MFVA 1PIFA 2NVCA 1LTDA 1BYAA 2E77A 4DUOA 1XBXA 3ANUA 2Z27A 1PX8A 2WHKA 3LCHA 4L1XA 2ZZ1A 2OYLA 4JZ5A 5IM51 1BSLA 2VD8A 1YDVA 1EJUC 2NSOA 2GFTA 1P6WA 5DCBA 3FVMA 4AD4A 3PZNA 3AWNA 3E74A 4YCPA 4BF5A 3GNDA 4S3JA 4XAPA 5K4ZA 1O5QA 4JQAA 3GLCA 5LXEA 2BY2A 4I7UA 4PBGA 1GW9A 1XLLA 3M7SA 4XTDA 5CXPA 4HHPA 1DPMA 1C9WA 2FDSA 3DG6A 2BLEA 3CMJA 1UYQA 4ZVJA 4M7TA 4WKFA 3GXIA 3L0GA 1OD0A 2BNJA 3AIEA 4R9XA 2FZMA 4H8VA 1TCMA 1E71M 3W85A 1JZ8A 1DJWA 4F3HA 1AW5A 3WMCA 1GVEA 1U5HA 2X1IA 1UIPA 2BOFX 1HW6A 4W87A 2VI0A 2VC6A 1SPQA 2JALA 1EWEA 1OZMA 2ZFAA 4KH2A 3SW6A 3VM5A 2ZA3A 1MEWA 1OFQA 3VKCA 3EA3A 3MCMA 5IHRA 3NEVA 1SQ7A 3N2BA 1L6GA 2OFJA 4RW3A 3HV8A 3IJDA 3D3FA 5FJOA 3M6DA 3EWCA 2A3CA 2QV5A 1QXLA 1E9ZB 4R3UA 2ZUSA 4JTUA 2UY5A 1WZMA 3ICJA 4MJ2A 4OT7A 4JTRA 3GD6A 4PSPA 4NXSA 4C1NB 4LUJA 1T5AA 4GUFA 1DJYA 4IIBA 2F8QA 4HZ8A 2INZA 3WQ8A 4PMUA 1W1B1 3C56A 4GINA 4CQ8A 3W00A 3IACA 1S5MA 1BXCA 4XSMA 4GISA 4IG2A 1W3LA 4I5UA 2ACRA 3AXKA 4S3EA 2RJHA 3NPVA 3NO3A 2W3ZA 3H23A 3IEBA 5G2IA 1V3LA 1E9IA 2V6AA 1AUSL 1FKWA 3QSTA 4AX7A 3LX9A 3CIWA 2VYOA 1IWPA 3LTYA 4ZFMA 4TVCA 3TROA 1PZ0A 2CERA 2VFDA 3FJ4A 4GXWA 4S3BA 3CBWA 3IARA 1M04A 3CHEA 1KBKA 3BAKA 1V6XA 4NG3A 4G8TA 1UR8A 4G7EB 4HN4A 3N25A 1GGOA 5M2FX 2J9YA 1K9FA 2IPGA 4CEUC 2OVLA 4GC3A 4UTMA 1A5SA 4HSOA 1QNPA 2EG6A 2ZUMA 4UQBA 5BCAA 1QOQA 3LQGA 3QLDA 3DUGA 1F61A 3QY8A 3GVGA 3TV8A 1CW2A 2Z7GA 2VRQA 1UWRA 1UKOA 5G1MA 3VIMA 2GK1A 1EBHA 2E67A 4UFJA 3RCNA 1J4EA 1SU5A 2ADAA 4H83A 4QE1A 3N4EA 2IPJA 2OELA 2XFYA 4CQCA 4L6HA 2RFGA 1NP0A 1UD6A 1V8EA 3PZVA 3OOQA 5DQPA 5T9CE 1W1VA 4OV4A 1US2A 4ZQRA 2ZKMX 3BGGA 4EPKA 4Y90A 3WD3A 2DFAA 4IL2A 3VU2A 1JI1A 4HPXA 3N6HA 3QMRA 2PGRA 3N18A 4XK2A 2WSRA 4QP0A 4DZAA 3F5KA 3KDOA 3ABRA 3UGRA 3CQIA 1NQKA 3F4WA 3EKLA 2PWHA 3COTA 3GC2A 1TWDA 1QNVA 4W93A 1TPC1 4LU0A 1W5PA 4Z2HA 3EBVA 4NZ1A 4DJEC 1VJZA 4HOZA 2FMNA 1WDSA 2D2JA 4DM1A 1CECA 2NLYA 1MW3A 3LDVA 4GH1A 3FCPA 2OSXA 4E2BA 4UTTC 3TU9A 4GX8A 3RN6A 3C0SA 4TU1A 4A29A 2ZXBA 3K30A 4AZCB 1IIHA 3LB0A 3LHUA 3HPFA 2HZGA 1J9YA 4ZBCA 1EX5A 1Q45A 3F7JA 3NVDA 4QJ4B 3LHYA 6A3HA 5K9CA 3F1QA 1LL7A 4KFOA 3SGZA 1A5OC 3NQ6A 1M53A 3FKRA 3USZA 1HF6A 1GEHA 4O8RA 3VE9A 2IW0A 4MLJA 4R5EA 4NJHA 3AIQA 4TTGA 3ZO9A 3OBKA 1XGEA 1D8WA 4DXVA 3CYVA 1JD7A 4H9MA 2VGFA 4FNPA 5FJUA 2WVVB 3R6IA 2YYTA 5C55A 2AQWA 3BMWA 3U5UA 4FK9A 2VGBA 3EOSA 1OG6A 4R9OA 3DFNA 1SO3A 4G1NA 1XIFA 4NYUA 2PS2A 3VGGA 4QHRA 5HBFA 3VUPA 3GDLA 1VPXA 3U2ZA 1UMYA 4ZL1A 1NP2A 1LCOA 4I7WA 1XDJA 2DZAA 4PTDA 3LV6A 1R3YA 4DLFA 3AIVA 2VFFA 2VZVA 4NKCA 2Y8KA 4IUOA 4JN6A 3UG3A 3EXTA 1EL3A 3IJIA 2OGJA 1U33A 5CZ0A 4KGLA 1ODZA 1UWTA 1TPWA 2VCBA 3SCQA 3UWYA 5HK4A 4YWIA 4X9YA 3RX3A 3WBEA 4B2DA 3QTGA 2Z1KA 5A6JA 3A24A 3N04A 1T96A 3SAZA 3OVGA 1JEZA 1EJSC 3TEVA 4OKDA 5HA7A 3S6OA 2I5QA 2HNEA 4D71A 5RUBA 3T07A 2X1UA 2RDXA 2PBOA 2VL4A 1P1MA 3L21A 4NZ5A 5BOFA 3MUZ1 1EC9A 1IQ8A 1J0YA 2VUNA 4JOMA 2HJPA 4P8VA 1KM6A 3WD4A 4L4OA 3TNBA 1PWLA 1KC7A 3NSXA 2I16A 2PLKA 1KBLA 3CAVA 5KINA 3U2CA 3MZNA 5A1AA 2WWCA 3UR7A 1NWUA 2Y88A 2WKGA 3GIYA 1AZ2A 2VX6A 1V0MA 4D72A 1CXEA 1IEWA 1WOBA 3FLUA 4KS0A 4E2OA 4ROQA 4PBFA 4TXEA 4Y9OA 2OODA 3IVUA 1AJ0A 1ECQA 1I8JA 2CITA 4MB1A 3W7OA 3GB6A 2DZXA 3AOFA 1AH3A 2J7DA 2O9PA 5ABEA 3PZGA 2V3DA 3OZYA 1HO1A 2ALDA 1CGWA 4R33A 1O1ZA 1A49A 1FHLA 4JKLA 1UR1A 4EVZA 1BFNA 3SCWA 2ZUNA 5EKYA 2QCMA 3W29A 4RPQA 2PWFA 3NQCA 3CPUA 1DIDA 1T8XA 3OTRA 4LVGA 2VTFA 4BY3A 3HG5A 3W3OA 3WH7A 1K4HA 1KFWA 3KCLA 3N9KA 1OZQA 5HWNA 3VKJA 3MI3A 3V0UA 3FIGA 4E2VA 2C1HA 2IXVA 2NLIA 3LHZA 2ABAA 1ZB5A 3AIRA 3UPBA 1Q66A 2YDAA 1X7FA 1P0NA 3TQKA 1G4EA 2PA6A 2IQDA 4DO5A 1PHQA 2XZ7A 3EOOA 1TIWA 3BJFA 3S6TA 4F40A 2P8BA 3QZ6A 3RX4A 3HN3A 2GZXA 3M0MA 3O05A 3SGGA 1JPIA 5I6SA 2JKPA 1Z3NA 3GXDA 4O14A 3KM8A 4QE5A 4FNRA 3SADA 2QR6A 1OCNA 5DY2A 4HU0A 1JCJA 3TSBA 3L4WA 5H8UA 3GR4A 6XIAA 1SZGA 2J7BA 4PL2A 2WJEA 1TWSA 1MXGA 4ZE4A 1AODA 2YCLA 1R2TA 3MSRA 1VZWA 3SCPA 1UROA 3WMBA 4RDYA 1AJ2A 3CL6A 2QUVA 3P8JA 1Q2SA 1AL8A 2CLEA 3R0UA 1UR9A 2VQTA 3UNTA 1K7EA 1LQ2A 4MJ4A 3LSCA 3ARSA 1W1TA 4IT1A 1YXCA 3W24A 4V33A 3KL0A 3ONBA 3SY5A 1J0IA 2PD9A 5I5RA 3AIWA 5DCDA 3WELA 1NWSA 1TUFA 2B81A 3DIPA 2VP8A 3ZJKA 3KCJA 3GUGA 1JUEA 2YXXA 4F0SA 4JFWA 5CPLA 4PRWA 4UC5A 4LANA 4B92A 1CXHA 2Z6JA 3RITA 4A3UA 4OBRA 3N2XA 2V8ZA 1UD5A 4IJBA 2TRSA 4PGLA 3W7JA 2NUYA 4PN2A 3T44A 2B0MA 3B8DA 1E0UA 3WLSA 4O1CA 1MRQA 3HJEA 2AAAA 2ATSA 1BLIA 2B7PA 4QLKA 2ZTJA 3UJSA 2VZUA 4LY8A 1KWGA 1LF1A 4WOQA 3VNLA 3AXXA 2OEJA 1OGSA 1SO5A 4ZOAA 2YW4A 2DEPA 2XN2A 2PDJA 2W79A 1EGMA 4K7YA 4AY1A 1MZRA 3N9RA 1S39A 1EYWA 1F3XA 5FD0A 3VUSA 4S3DA 1PZ2A 3OP2A 3EOLA 4RNHA 2XM1A 4IIEA 1I2OA 2AQOA 1F73A 4LALA 4ZMGA 4S23A 4GZJA 3GBDA 2F9RA 5IXEA 3CC1A 5A5WA 1RBOB 4UOQA 2Z1VA 2O4QA 2DH2A 5IFPA 3NZ1A 2IQTA 2HE8A 1LP6A 4Q33A 4H9VA 1Q5MA 4IFRA 1QOXA 4I6KA 2RKXA 2YLLA 1W9BM 4WEVX 2FZDA 1WDPA 3QV8A 2PD5A 2PDLA 1CGYA 3HGOA 3T05A 4JS3A 5A2CA 2VR5A 3CT7A 5E93A 3R1ZA 3W1NA 3DFTA 3LBMA 3CWNA 3AMGA 3OA3A 2YW3A 4QX4A 2AOSA 3LXBA 5CGMA 3QGKC 2VX7A 4O1FA 4V2XA 3G1AA 3ANVA 3WLRA 2VZOA 9RUBA 4PMDA 4ERGA 4FO4A 2A7PA 4ADTA 5JIWA 2G3MA 4L64A 3O0KA 3VOFA 1K9EA 4C6MA 2VGGA 3KTSA 4W5ZA 4DF0A 5I06A 5I23A 2R1NA 4NNCA 4LGXA 3DERA 4DWSC 3A3WA 3CPGA 3B8WA 4JIEA 3ZLFA 1UP0A 2Q6ZA 1SSGA 4ALDA 5CPOA 2BVTA 3R4IA 1XLMA 4WK9A 2VEPA 3H2EA 2ZZ5A 3SR7A 4ACYA 1JCXA 1EZWA 1OK4A 3II1A 3KVKA 5FL0A 1HL2A 3L9CA 5EB8A 2O9OA 3B4YA 3GXPA 4C60A 2YGYA 1WV2A 1BG4A 4GMEA 4QGCA 5KZDA 1TTPA 3W38A 1JRCA 4K39A 4ZA0A 1EX1A 3QV9A 3H7VA 4POCA 1QWKA 2FFIA 4WHBA 4BR1A 4DF1A 4MNLA 2E6AA 3LPPA 1E55A 2QYGA 1GWJA 3MPGA 4HYWA 1GVOA 2YB4A 3UWQA 3U3HA 2ZRVA 3LCGA 1B31A 4CVUA 1VFSA 4XZNX 2C79A 3K5XA 3OIXA 4N2YA 4L1WA 4LUSB 5MHBA 1HIZA 1W37A 1W9DM 3W7HA 1LRQA 4S38A 3MJMA 2IPFA 4LAZA 4AZ7A 5H1WA 4EX4A 1S2AA 1NFBA 1J0ZA 1SM9A 2JK2A 1N7KA 3WSUA 3THUA 4QTGA 4ATDA 4O1AA 2WHMA 5K4XA 3VGBA 2G4FA 3PSWA 4IZGA 3WLIA 4UQDA 4ZTXA 3N13A 4MAVA 3UA3A 1U5JA 3W23A 3ZXWA 3CWHA 3B8VA 3LI0A 2HWGA 3I6TA 7REQA 1TFVA 1ECEA 1TSIA 3HTWA 3R8HA 1B3WA 2WNNA 5M03A 3VGHA 4KGJA 2BXVA 3G22A 2FPYA 4KWOA 1R9YA 2DZPA 5AYIA 4N9CA 2H3BA 4AD0A 3QKZA 2CLPA 4F9JA 3R11A 5D9MA 3C86A 1CX9A 1R85A 3KWXA 1E4MM 1US3A 3ALFA 4WKHA 3MQTA 3REQA 1V3JA 3SJNA 3IGUA 3F2CA 1H7RA 2OCZA 1KFLA 1XL9A 1KM4A 4ML4A 4N6EA 3V5OA 7TIMA 1OIFA 1J2BA 1UWUA 3E5PA 1W3IA 1XINA 4H6KA 4AD1A 4BI5A 3AC0A 4MF4A 4L4MA 1JJKA 2PDBA 1XUUA 1F3EA 3GTIA 4WUIA 4DJDC 4P7LA 3LXCA 4W89A 5JUVA 3VYLA 4QSHA 1GEQA 2AL1A 1O7AA 1WZAA 4BQ3A 4LS1A 4Z1CA 1AH0A 1WZLA 2PDCA 3MKVA 3LNPA 1G6CA 5FF2A 4PUUA 3LLDA 1WYIA 2H9AA 5I77A 3B05A 4PCTA 2NX1A 4RR4A 4FAMA 3ITLA 2EEXA 1HNYA 1LM1A 1W9XA 2QDEA 4O0ZA 4FLSA 3WLPA 4DUXA 5DANA 3H2NA 1E6SM 4GRSA 4WIWA 1M7OA 4RZ4A 1UJPA 4HVXA 3PPHA 2GSJA 1LOQA 3SQMA 3WK0A 4M51A 3FEMA 4UXDA 2E8YA 2BVDA 1UR0A 3HURA 1HP4A 3D47A 4FOJA 3PJTA 4GFIA 3LRMA 5K7JA 3NR0A 1AMKA 1GOWA 3WQEA 4FI4A 1LYXA 4ZQNA 4PA8A 3QZEA 3GZ3A 2OGYA 2VZTA 1VHNA 1KWKA 4W9TA 3GO2A 3APGA 1VCVA 1XIHA 1U1JA 3WL1A 3KRBA 1XXXA 2CW6A 1D3CA 4BWLA 4PB4A 3EWBX 3HGJA 4NVTA 4P7OA 4CU8A 3PBVA 3SB0A 1K8CA 1TTQA 1NFPA 2XGZA 4PUJA 1J96A 4LVDA 3M44A 4Y9PA 1WQ5A 1ODUA 1H7OA 5DMLA 1PUDA 1OWQA 1JF5A 4S3GA 1M7XA 3WMSA 1VCGA 2DSUA 1K77A 1RQEA 4DUWA 1ZENA 3EYPA 4KRUA 4MKSA 1H1YA 3AZRA 1T41A 5BZAA 3MUCA 1V77A 3PJUA 1C91A 2QULA 2YBUA 4GNVA 3UXIA 4CQBA 1G4TA 1XFCA 4GY0A 1XRSA 1V6YA 1KFEA 3CNYA 4TOQA 1V6UA 1OBAA 4UFKA 3PTMA 1QJWA 1XPGA 4GIAA 2D3NA 2XUCA 4R34A 2QUTA 4PEKA 1C8QA 3MO7A 2PWEA 1Q4NX 3RLVA 1C7SA 1OVDA 1V7AA 1OFEA 4A3HA 3BAXA 4LUTA 3BLIA 2J24A 2XISA 4HA1A 2CZDA 3QZAA 3NA8A 1H09A 3EX6A 4IMGA 5HAOA 2X40A 3N29A 1KM0A 3W6LA 4ZO9A 5ECUA 1RY0A 3CQJA 5AC6A 4S3KA 1H5YA 3MWAA 2BXYA 1A0EA 2Y6ZA 1NFGA 4H1ZA 1GZ1A 1H1ZA 1B9ZA 4A22A 3WK1A 3BXWA 1W31A 2HS8A 4DUVA 3RIKA 1Y5VA 2FGZA 3WQFA 1E56A 3W82A 5CBIA 3UESA 5CZKA 1ELSA 2J88A 2QJHA 5AHLA 3M41A 1S5WA 3P2VA 5FJJA 4MGGA 3BV7A 3H53A 3S1UA 3CQ0A 3V0TA 2CYGA 4GVHA 5AC5A 3VOGA 6ALDA 4OV9A 1PSCA 4IICA 1XLJA 1GZGA 4J3WA 2ZADA 1AD1A 1ZL1A 4MKVA 2DIEA 4DZ5A 3HM7A 5FF4A 3EX4A 3L67A 2WO5A 3O9NA 4EWND 4AMAA 4GI6A 4GYKA 1GG1A 1E6XM 1V0NA 1EA0A 3GKFA 4EKJA 3U7BA 3WNMA 1HKWA 3O15A 4GJ1A 1QBAA 2G37A 2DW6A 4FLQA 3C61A 1HG3A 5AN7A 3HB9A 4IOTA 1HGYA 3DHFA 3K1DA 1TVNA 2J7GA 1JAKA 1IEIA 2PB1A 4LUYA 3ARYA 4UTJA 2REQB 4LS0A 4DZIA 4J3TA 4YTSA 1NAL1 5G1TA 4B9YA 3ARTA 4QJ3B 1KR1A 1LUCA 5AYZA 1CGVA 4RCXA 5AECA 4RL3A 4LAUA 4Q7BA 4PMXA 4PYSA 4E0CA 4JXCA 2V63A 4PTMA 2P88A 1GOOA 2P10A 1H7PA 4FALA 1KM5A 1SFTA 5DF0A 2W5FA 2QCGA 3IAQA 4JNZA 2FB2A 1R2RA 2Y4SA 1WB0A 3C4UA 4KIEA 4RJEA 4C1KA 2R82A 4O15A 4UTKA 5PTDA 4U3CA 4C6OA 2YPIA 3LUTA 1GVRA 3HZ3A 1VLIA 3KRUA 3DFHA 4V1YA 1H7WA 3NTYA 4H6QA 1BYDA 2OSYA 3GTHA 3BJTA 2EQDA 3I6RA 1EGZA 1E1CB 2QCEA 3SRDA 1JGMA 2A85A 3ARPA 3VTRA 1NTHA 4UNIA 4BF9A 1FX6A 2WXDM 1K8XA 7A3HA 4EPBC 5C2GA 3Q2DA 1JYXA 4GLEA 1X8CA 4MIMA 5A6TC 8RUCA 3SZ8A 3N4AA 5CC3A 1O95A 3PTKA 3VGFA 3AS1A 1G4SA 2R1MA 3HU7A 2UY4A 1GTHA 4X0NA 1DJZA 2PWVA 2J7FA 4MY9A 3ABXA 3IVTA 1DQUA 3MSYA 3W1UA 2EG8A 4L65A 5JVLA 3CIXA 3B9OA 4AYGA 1RBLA 4U28A 1ISYA 3CUFA 1EHAA 3OBEA 1CGXA 2PE4A 1FWJC 1W1A1 3WBXA 3LD5A 3TQVA 5A6LA 5DX7A 2CLFA 5BRBA 3SI9A 1IYXA 1LBLA 4BQ5A 1RLCL 3A3XA 1EIXA 3JZEA 3VCNA 3KLLA 3O8AA 3CZGA 5D38A 2YA1A 2OB3A 3EWWA 4QXIA 2YL5A 2BG5A 3OBAA 3TQPA 3AHVA 1ONWA 1XLCA 1DJHA 3WDJA 1BEUA 4Q8TA 5E70A 3IJ7A 1QOPA 5BMWA 3FJ6A 1LJYA 2J77A 5GPRA 4Q7IA 4Y6GA 5BROA 4ORIA 2Z0IA 3H70A 3GH4A 4U4MA 1C93A 1DWJM 1I60A 3MHGA 3V4BA 4NAFB 3VMNA 4HJWA 2GGHA 2OX4A 6REQA 3TC7A 4HP5A 3W81A 3MYOA 2WB5A 4DN1A 4DJFD 1K8YA 3M0IA 5ABTA 2FZBA 4MNJA 4JEQA 3ZJ6A 3I4KA 1PYFA 1E4NA 2WNWA 4QR6A 2EPNA 4WVXA 3CB3A 3NO1A 4XAZA 3AUOA 1OYCA 1YPFA 2AKMA 3SCTA 1PXGA 1Q8AA 3UY8A 1QR7A 1EC8A 1GVYA 3PFMA 1LG1A 2X09A 3CZLA 1UUQA 1XYAA 3WY1A 4L9XA 2ZUVA 2VRJA 2ZUWA 3RO8A 1FWCC 4B9ZA 4Q8VA 4AC7C 3C6CA 3DENA 3DYOA 2Q71A 2GWGA 3QR1A 3TONA 4JPGA 2A79A 1BG9A 2J8TA 3ITOA 4L1GA 3CTLA 4Q4OA 4HNTA 1EJVC 3WN6A 1LORA 5I00A 4PB5A 3MVTA 1GZJA 1FDJA 4AISA 3PUGA 1KLZA 3P67A 3OZPA 4IL0A 5I3FA 2F38A 1V6WA 1PTGA 3NNTA 4O19A 1TYGA 1XLHA 1SMAA 3ZFHA 1P4CA 2XJ7A 2WJZA 2C91A 2XH0A 3LCWA 4FR6A 2X0HA 4JIHA 3MYPA 4U5KA 1E1FA 3WJWA 4ZZ9A 2EAWA 1IEVA 3R13A 4YN5A 1X38A 4H9ZA 3GHSA 3MB9