4ATLA

Crystal structure of raucaffricine glucosidase in complex with glucose
Total Genus 183
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
183
sequence length
501
structure length
470
Chain Sequence
NDATRISRSDFPADFIMGTGSSAYQIEGGARDGGRGPSIWDTFTHRRPDMIRGGTNGDVAVDSYHLYKEDVNILKNLGLDAYRFSISWSRVLPGGRLSGGVNKEGINYYNNLIDGLLANGIKPFVTLFHWDVPQALEDEYGGFLSPRIVDDFCEYAELCFWEFGDRVKHWMTLNEPWTFSVHGYATGLYAPGRGRSTGNPGTEPYWVTHHLLLAHAAAVELYKNKFQRGQEGQIGISHATQWMEPWDENSASDVEAAARALDFMLGWFMEPITSGDYPKSMKKFVGSRLPKFSPEQSKMLKGSYDFVGLNYYTASYVTNASNFSYNTDIHVTYETDRNGVPIGPQSGSDWLLIYPEGIRKILVYTKKTYNVPLIYVTENGVDDVKNTNLTLSEARKDSMRLKYLQDHIFNVRQAMNDGVNVKGYFAWSLLDNFEWGEGYGVRFGIIHIDYNDNFARYPKDSAVWLMNSFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAUCAFFRICINE-O-BETA-D-GLUCOSIDASE
publication title High Speed X-Ray Analysis of Plant Enzymes at Room Temperature
pubmed doi rcsb
source organism Rauvolfia serpentina
molecule tags Hydrolase
total genus 183
structure length 470
sequence length 501
chains with identical sequence B
ec nomenclature ec 2.4.1.219: Vomilenine glucosyltransferase.
pdb deposition date 2012-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4atlA00
2WVUA 1ISZA 1E3XA 2IUZA 1TE1A 3N13A 2A3EA 3WMCA 4NRRA 1V3LA 3ZM8A 3IAPA 1UYQA 2J78A 4U2ZA 4AD3A 1WKYA 3WMSA 4JKLA 1UD2A 1MWOA 3AI0A 3CUHA 3WQ6A 1NWRA 5LA1A 3NIYA 3TP4A 1OBAA 4D1IA 5A8NA 3AZTA 4DWSC 3LPPA 4A3HA 3BCFA 2EQDA 7CGTA 1XHGA 2XPKA 2JIEA 3MV01 1JXKA 3N1AA 4JFTA 5ABHA 1O7AA 3L4WA 1DWHM 4D72A 1MXGA 3HJEA 1FP9A 1KGUA 1XYZA 2ZUTA 3NUKA 3BLKA 1KXQA 1HKMA 4EE9A 1FH9A 3CHDA 1VF8A 1UH3A 1K9FA 3RCNA 4PEEA 1Q6EA 1UUQA 3ZT7A 1E4MM 2QF8A 1HJSA 5BXSA 1FOBA 3TTYA 2WMGA 3AISA 3PN8A 3FAXA 1ISWA 2F8QA 2BY3A 4CVUA 1UOKA 2J74A 3OBAA 2ZXAA 3PZMA 3WBAA 4P8UA 1QHZA 1CXHA 3AS0A 2DDXA 2DT3A 1O6IA 4PSPA 4KRTA 2XSBA 4KMQA 1H3GA 1IT0A 3CLWA 4OJYA 1DTUA 5E70A 1UD8A 4AEFA 1V3IA 1SR0A 3KL5A 5CGMA 2Y4SA 1R8LA 2AAAA 3VIIA 1KCKA 4GINA 1PIGA 5E0FA 1J0IA 4WKFA 4BA0A 1UR8A 2VQTA 1BGAA 3QHMA 1JFXA 3PTQA 4PTWA 4Z2JA 3L4ZA 3VM7A 2WLZA 1WCGA 3ZR6A 1MYRA 3MUZ1 2ZWYA 4BQ4A 4U5KA 1CXLA 2Q8XA 4MJ2A 3U7BA 2VX4A 4JCMA 4AZCB 1U2YA 1C8XA 4P7OA 3K4DA 4P8XA 3B9EA 2WMFA 4J3UA 3T08A 2Y2WA 4QCEA 4PMXA 1B3VA 4AYSA 2VMFA 4W89A 3VNZA 1KR1A 4ML4A 5TD4A 3AYSA 3O9NA 1UKPA 2QHAA 2G3JA 4QAWA 1W9DM 1QNRA 1ZBCA 3BAIA 3APGA 4J7RA 1MW1A 2DGAA 2W62A 4FLQA 5M5DA 1J0KA 1E4NA 2XUCA 2F61A 1E1FA 1H49A 1B3YA 3THDA 1V6VA 4UFLA 4BCEA 3WBEA 1MVYA 4W84A 1MQPA 4LYQA 3GH7A 3SUUA 1WAWA 3GTNA 1EQCA 1KGXA 2A3AA 2GUYA 1B90A 3D3AA 2ZX9A 4XV0A 2GFTA 1B1YA 2J75A 2WXDM 2CCRA 1JD9A 4HPGA 2WCSA 1E43A 3OZPA 3ECQA 2PWGA 1PAMA 3MMWA 3PZTA 4RE4A 1J0YA 5JIPA 4H8UA 4P8WA 1KB3A 1E9LA 3VDCA 4AZCA 3SUTA 2CNCA 1BSIA 2E3ZA 4MDPA 3VU2A 3NSXA 4DM2A 4CCDA 1VB9A 2WMHA 5A2BA 1R86A 4CCCA 5CG0A 1UWIA 1UWQA 4W8AA 1OGGA 3A4WA 4H04A 5BXRA 1AQMA 1P6WA 4K68A 3ARRA 3L4XA 3BH4A 3AMGA 4UTFA 1GNXA 3RO8A 3TA9A 3FHQA 4CU8A 1NQ6A 4CD4A 3CZLA 3DHUA 1E6RA 2YA0A 1QNOA 3RM9A 3WF4A 1W3JA 5CLTA 4JHZA 1GQKA 1BG9A 1GJWA 1ITCA 2W92A 5JUVA 3T09A 3DECA 1K6AA 3CZ8A 2DSUA 3VPLA 2X0HA 3BGAA 3EDKA 1E5NA 1G01A 1BLIA 2WKGA 1UA3A 4W93A 1JYVA 3S6TA 4B3KA 2V5CA 1H0IA 1HF6A 4X0VA 2WC4A 2WANA 5I3DA 1QNPA 5CXPA 5BXTA 6A3HA 1LG1A 1UKSA 1W9XA 3VGBA 5D8WA 1US2A 1JI2A 2QLYA 2E8YA 1OCQA 3ZOAA 1H41A 1JZ5A 1J10A 4H8VA 1B30A 4HOWA 4IUGA 2V3GA 3ARTA 3W38A 3BSGA 4W8LA 5HOSA 1LJYA 1BHGA 3WH6A 1VEMA 4YHGA 2DSKA 4U3CA 1GOKA 1ZJAA 2EJ1A 1G1YA 1UKQA 3OG2A 2XWDA 4J3XA 3BC9A 1SFSA 3VD5A 2JEPA 3KZSA 5KZ6A 1OIMA 4UOZA 2A3BA 2DQXA 2XVGA 5FKYA 1XD1A 2DEPA 5HBFA 4PCTA 1J0ZA 2YA2A 5DT7A 1KGWA 2XG9A 3DYPA 1EDQA 1G94A 2VC9A 2VRKA 5AC4A 2O9PA 5A6BD 1JAKA 1CGTA 3CMJA 1H1NA 2OYLA 3ZT5A 5EB8A 5A6LA 4HTYA 5JBDA 3AIRA 3A47A 3POHA 1OSEA 5EBAA 3CO4A 1W2VA 2VVNA 1XSJA 2WZHA 2QMJA 3BAWA 3VDHA 5EFDA 4V2XA 2V3DA 3N12A 1KBKA 4UFKA 5E6YA 3CGTA 2DIEA 1EHNA 2BXZA 4UFIA 3W0KA 5CPTA 3ZSTA 2HISA 4C7FA 1XD0A 2WBGA 4FLSA 2DSVA 2FH8A 4J28A 5ABGA 3N15A 1V6YA 1HKIA 2E9LA 2XIIA 5DFAA 4BZYA 1C92A 3SUVA 4TX6A 3WEOA 1D2KA 3L4YA 4W7VA 1PX3A 3ALFA 4HZ7A 3ALGA 3ZJ7A 4JZ5A 1MFUA 3U7VA 1E55A 3II1A 1UZ4A 2YL5A 3NSMA 3CUFA 4EK7A 4OOUA 3AHXA 3CBWA 2YL8A 5CPQA 4PTXA 2VZTA 5KEZA 1KWGA 4F9DA 1ODUA 3MUIA 4R5EA 5E09A 3WN6A 3WDHA 3EDEA 4PMUA 3EDJA 2XFFA 1QI2A 4OOZA 4AD0A 2FDMA 1NWUA 4TX8A 5CSYA 4ACYA 1QI0A 3NDYA 4PYSA 3MSDA 5A2AA 3GXIA 5C71A 1GUVA 2VUYA 3W24A 3RDKA 3IAQA 3F4VA 4URIA 1V0KA 1JF6A 2RGMA 3ARXA 1E3ZA 3UR8A 1C8QA 2BY1A 5CPSA 2VCCA 1JNDA 1BFNA 3F5KA 3QHNA 1WZLA 1QI5A 3ARPA 5M3WA 1HJVA 1CGUA 3BMWA 3T0DA 1XC6A 1EH9A 1PX8A 1NWTA 4HMCA 1LL6A 1ISVA 1NWSA 2X2YA 2WWDA 1PX4A 2G8ZA 3M6DA 2WVSA 4HU0A 2EXOA 3J7HA 4Z2GA 3WD2A 4QDMA 2XFYA 1WB0A 1QNSA 3VMNA 2XGBA 1C8YA 3VDAA 5BYWA 5EFFA 2BVTA 1I1WA 5BXPA 1V6UA 1CGVA 4W5ZA 3CHEA 2EEXA 5HXMA 1JZ6A 3EMZA 1B3XA 4S3JA 3FAWA 1HL8A 4HU8A 1F4HA 1UQZA 3AMCA 1GOMA 4DUVA 5HPCA 1DWFM 1M01A 3KL3A 3SUSA 5CQ1A 1M53A 5CLWA 4JKMA 4QCFA 4AZGA 4QLLA 4ACZB 1TR1A 1DP0A 2CERA 3MO4A 3GDBA 1ISYA 4UOQA 1WDQA 3CPUA 4AZBA 4L4PA 3GXFA 1Q6FA 4M56A 3RJXA 1VBRA 3MUAA 3WMBA 3SCRA 5IHSA 4RL3A 4AD2A 2WSPA 3K4AA 2V3FA 3CZGA 3CHFA 4IM4A 4LX4A 4OIFA 4WJXA 5E0CA 3O2LA 3WQ4A 1L8NA 3GH5A 1W9VA 3IJ7A 4W8BA 2EPKX 3HN3A 4E8DA 1JD7A 4MJ4A 2G3MA 1PIFA 5A2CA 2YDQA 1C7TA 4PTMA 3VGFA 5BROA 2DT0A 3UG5A 1H4PA 2GJXB 1W1VA 3SCSA 1JF5A 1V03A 3AMLA 1GZJA 4W7UA 3VIOA 1OGSA 2E4TA 4E4PA 3WELA 1MXDA 1E4LA 1JIBA 1Q6GA 3RJYA 1B3WA 4HA1A 3RILA 5D4YA 4RE3A 1H11A 5A69A 3VMPA 1JZ4A 4GXPA 4GKLA 1HVXA 1US3A 3KEHA 3RPMA 1WDRA 3A4AA 4ACZA 1ZL1A 3VIHA 4NRSA 3W37A 9CGTA 1TG7A 3WH7A 4ZFMA 4AD4A 1J01A 3QOKA 4A3YA 4ZEPA 2VCBA 3WUGA 4GZIA 4V27A 1CEOA 1EDTA 3WUEA 2BXYA 3L2LA 1M7XA 1CENA 3RM4A 1RD6A 3BAJA 3VGEA 2DT1A 3WFLA 3WSUA 2VX6A 1NP2A 3M7SA 1NARA 2YDRA 3QR3A 4IISA 2Y5EA 3W6LA 4LQ1A 1GPFA 3PZNA 4MB4A 1XSIA 3PZIA 3GYCA 4E2OA 1VEOA 3VIFA 4ZE5A 1DEDA 4BS0A 4TTUA 3D5HA 5DT5A 2OLHA 1XH2A 3WF1A 4KH2A 2AOSA 1V0NA 2XHYA 2A3CA 4CVWA 2GJXA 2TAAA 3VINA 2J7EA 4PRWA 2ZX7A 2ZIDA 3OIHA 2OSWA 5GNXA 2D20A 2ZUMA 1HP4A 2WW5A 4JFVA 3UCQA 2XYLA 4PCSA 3K46A 1HIZA 3A4XA 2QV4A 4D1JA 5GPRA 5ABEA 3AHTA 4ZXOA 1TMQA 4DWSB 3K1DA 3AHZA 1UR2A 2VCAA 1C3FA 3SCTA 3SCWA 5BRQA 3SCOA 4QP0A 1V6XA 4A4AA 1HXJA 4HZ8A 3A3HA 4CU6A 2PWHA 3PHAA 1MFVA 1OD8A 3W25A 4C7GA 4AC1X 1YHTA 2CITA 1FHLA 3FN9A 4PMRA 4LXFA 1HJUA 1JFHA 4P7RA 2FGZA 2CYGA 3WL0A 3M46A 3N17A 4FMVA 1QW9A 2Y8VA 2ZOXA 3SCQA 5HPOA 3AJ7A 1TUXA 2AMGA 3T2PA 4OKDA 2J7GA 1C93A 3PZ9A 2GDVA 2IXVA 4ZE4A 1VJSA 4Q22A 2VZOA 4MNMA 5EMYA 2YL6A 2FHFA 1B9ZA 3WQ5A 3HMCA 2Y8KA 4CKQA 5JBFA 2UWFA 4PMYA 3RM8A 3W28A 1HKKA 4D6FA 3TONA 1GOQA 4KGLA 1E56A 4DWSA 4AD5A 1CXEA 3ZMRA 4P8VA 2JEQA 2QPUA 5A8PA 1HX0A 1V6WA 2DSZA 4BF7A 4IPLA 1UR9A 3WEZA 2CETA 1UHVA 4CD5A 1E6SM 3WDPP 1W1PA 2C0HA 5ABFB 4B9YA 2W67A 4D71A 1NOWA 1ODZA 2YLLA 1JZ7A 1ESWA 1C90A 2EO7A 1PPIA 4WK9A 5D9NA 1JYXA 2WHKA 2ZUSA 5I79A 3F5LA 2JE8A 4XUYA 4Z2KA 3MANA 3AIBA 1CXIA 1NM9A 3MUY1 4JL1A 1VIWA 3IJ8A 1V08A 1J0JA 2A3HA 5D9PA 5FOOA 3VD9A 1NH6A 2JFEX 2X09A 3L2MA 3JUGA 1OD0A 3K8MA 1KXTA 5FL0A 1GQJA 1VRXA 2PBOA 1WZKA 3PZQA 3WF3A 4S3KA 2D0HA 1EXPA 3WKZA 4LPCA 2PWFA 3WIJA 2G4FA 4V28A 4R27A 1LWJA 5GNZA 1TVPA 3AIQA 3QGVA 3ZR5A 2FHCA 4JKKA 4ZENA 3AZRA 3AS3A 5LA2A 4CN6A 2YL9A 3WH9A 1K9EA 4UQEA 1VEPA 2C8NA 4PMZA 5IDIA 2WMJA 1XH1A 2ESCA 2X8RA 2O92A 3OB8A 1BPLB 3OGSA 1W32A 3NYDA 3M07A 5ABFA 1H5VA 3WNKA 2VX7A 2JF7A 2YBUA 3OLDA 4CN1A 1C91A 3AXXA 3LMYA 3AXHA 1E6XM 2UY3A 3AS1A 1Q6DA 1V0MA 4U31A 2VURA 3WDJA 4PMDA 5IFTA 3FHAA 4KRUA 1NP0A 2IXUA 6TAAA 4Z2HA 1WO2A 7A3HA 2WKLA 3WL1A 1EHAA 4BQ5A 2X0YA 3PTKA 3AROA 1DHKA 2CIPA 4GI8A 4Z2LA 3TTOA 3PZVA 3WFZA 1OWQA 2J7DA 1CGWA 1KBBA 5IHRA 3WY1A 1G9HA 3BSHA 1Q4NX 1E0WA 1W3LA 2WVTA 1XH0A 3AMDA 1E0VA 3AIWA 4JFWA 1CECA 4EAMA 3TTSA 4NSBA 2VZVA 3ZO9A 4UFMA 5ECUA 1NOFA 4X0NA 4B9ZA 1J18A 7TAAA 3QOMA 1W1YA 4GQRA 4LYPA 4MAZA 1IV8A 3DHPA 3U57A 1E6ZA 4OBSA 1ITXA 1Z32X 2ZXQA 5A6KA 3CIVA 4LGXA 4DUXA 3FY1A 2QMKA 3WUFA 4GZEA 4H8HA 1RPKA 3IK2A 4D6HA 1H2JA 1LLOA 4PMNA 1KXVA 2J7FA 1LL7A 4HOXA 2WC7A 3VGGA 4GPNA 1U30A 1VAHA 2XM1A 3AIVA 2OYMA 2W63A 3AQUA 1JAEA 1XRVA 1R85A 2CHOA 2WVVB 1CPUA 4GIAA 1W9UA 3EMQA 3S2CA 3VD3A 3VOCA 3W53A 3UG4A 4JL2A 4D6IA 1MQQA 4CU7A 1CGXA 3BLPX 2PI6A 5FCZA 5AY7A 3L4UA 3OGVA 1GONA 2NT0A 3PZOA 2O9OA 4M29A 3SIMA 3OLGA 3SCVA 2E0PA 4AZIA 3WEMA 1CIUA 2ZE0A 3UR7A 1UWTA 4XZBA 2GSJA 1SMAA 1WDPA 3BCDA 3VIKA 2ZUUA 2HVMA 2RGLA 3MU7A 3O6AA 5I2UA 2DH2A 4KWUA 2CKSA 2J25A 1LWHA 1I1XA 2XJ7A 2J62A 2DIJA 2Z1SA 5A3HA 1BGGA 5DEZA 2VO5A 4UQBA 4MADA 1X6NA 4DM1A 1V0LA 2XFRA 4MAVA 3WUBA 1HP5A 1HVQA 2OWXA 5A8QA 4JFUA 4UQAA 1E15A 2CBIA 3T0BA 1GOOA 1KQZA 1EOKA 1OGBA 4AY1A 2ZXBA 3ZSSA 3VUPA 1V3KA 3PBGA 4AEEA 1DWAM 2WVVA 4H41A 1WPCA 1X1NA 1V02A 1FA2A 4F8XA 1UD5A 3NCOA 1RP8A 4H2CA 4OUEA 3W4RA 2NW0A 1MW2A 1U33A 2D3NA 4ZXLA 1TVNA 4MB3A 2J47A 2XVPA 4UQCA 2NT1A 1E5JA 3PZUA 2XSAA 4AISA 1JGIA 3CUJA 5E6ZA 2EPOA 1ECEA 4PTVA 1MW3A 2YDSA 1UKOA 1BVNP 1AMYA 3L4TA 1JL8A 1OINA 3ARUA 1R87A 2OSXA 1E0XA 1KR0A 2VTFA 3GXDA 3WNMA 1E4IA 2YIHA 4WKAA 1B31A 1K9DA 4D6CA 1YQ2A 4HMEA 3TOPA 1XCWA 2CBJA 3CH9A 2PB1A 1BYCA 2WB5A 1GORA 2YKKA 3UERA 1LF1A 1ZJBA 2G41A 1H0GA 2BVDA 1IZJA 1HJQA 2EBNA 4B16A 1VFOA 2ZXDA 2V5DA 4M82A 3IANA 2DPEA 4QFUA 1XYFA 2CXGA 4W5UA 5A8OA 2ZX5A 3NJ3A 1GQLA 5CJ5A 2O9RA 5A8MA 4CN4A 2VRQA 1SMDA 1JYNA 3MV11 3GBEA 4CCEA 4J3TA 3CUGA 3T2OA 1H09A 4AZ7A 5A6JA 1UWUA 2BY2A 1BYBA 2BHUA 3W81A 2XTKA 3EYPA 1OT1A 4MNLA 2VI0A 1DWIM 3GNRA 4MNJA 2VOTA 2XIBA 2Y24A 2PBGA 1FFQA 2CPUA 2ZUVA 1V02E 2WZIA 3VO0A 3MKKA 4CGTA 1EOMA 4W7WA 3VNYA 1EO7A 2W91A 2EPMX 5A6AA 1PZ3A 2WYSA 4N0RA 3B9AA 2OYKA 4YN5A 3WH8A 2VVSA 2PWEA 1WE5A 2JF6A 3SCUA 4WLCA 5C70A 2CBUA 3ARQA 2QPSA 3NSNA 5I0DA 4HA4A 3ZJ8A 3VVGA 2XVKA 1JG9A 3WENA 4CD6A 1CXKA 2WNWA 3MMUA 3KE0A 1GJUA 1IZKA 2D2OA 4WF7A 1TA3B 2YA1A 4PMVA 4UFHA 4PMOA 4TTGA 5HNNA 3AIUA 3GXMA 3ZQ9A 5I77A 2FH6A 1V3MA 1HT6A 1GHSA 3CZJA 4AW7A 1W3HA 1BG4A 1M03A 3N9KA 2UY5A 1QBAA 2VR5A 1GOWA 4W87A 5CZKA 4W85A 2EPNA 1V3JA 2GK1B 1PBGA 2J8FA 3AFBA 1E73M 1Y7VA 2WMIB 4D6EA 1BAGA 4M8UA 1F4AA 1JDDA 3GZAA 3OZOA 5I23A 3N11A 4MB5A 3BXWA 2OSYA 4JCLA 1QHOA 3I3EA 3WQVA 3WD3A 3ARSA 4AD1A 1CZ1A 1XCXA 1PZ2A 2JIWA 3EDDA 2G3NA 2CKRA 2GVYA 4AIOA 4AZHA 1FH7A 3E1F1 4CD8A 2J7BA 3VGDA 4NZCA 4UR9A 4HOZA 4PMQA 3VX1A 5I6SA 2ZICA 1UKTA 3GNPA 1VJZA 4WSJA 3VX0A 2D1ZA 1FFRA 1VFFA 4HPHA 3SEPA 2ZWZA 1LQ0A 4XZWA 3BMVA 3L4VA 4MB1A 1TA3A 1ZU8A 4QLKA 2XGIA 1BQCA 2CHNA 1JDAA 2VR4A 4C7DA 3WD0A 3OA5A 4ATDA 2WMKA 4UQ9A 4GZJA 1W3KA 5I24A 5D9MA 3W6MA 5A95A 1A3HA 4EKJA 3AIEA 2W4XA 3SCNA 2GK1A 1TCMA 1UWRA 3SCPA 5D8ZA 1VFUA 2WMIA 3NDZA 1CLVA 3BAXA 2WCAA 3W29A 3VTRA 3KL0A 4JAWA 3OLIA 4HZ6A 3DYMA 2F2HA 4QLJA 3AYRA 2WHLA 5HDRA 4B3LA 4P7LA 3CHCA 1FH8A 4FF5A 1UR1A 3U5UA 1GCYA 1WP6A 3MSGA 3U5YA 3ZJ6A 4HMDA 4D6GA 1GQIA 2ZUNA 3B9DA 4OBRA 1TFVA 1DWGM 1AQ0A 3W26A 3DYOA 3K8LA 3BAKA 3WDIA 5A94A 1QW8A 1MQRA 1QVBA 2OWWA 1OM0A 2EPLX 2WBKA 1CNVA 1EDGA 3CZEA 4M80A 1UD6A 4AXNA 3ARZA 4W86A 4LYRA 2PF0A 2XVNA 1RH9A 1UH4A 1L0PA 1C7SA 1ZS2A 4XB3A 3AHYA 3ZT6A 5CSUA 3ARYA 2DH3A 1BF2A 2WAGA 1SYTA 2VL4A 2YBTA 3ARVA 3WF0A 1OB0A 1UQYA 1UZ1A 3MMDA 3PTMA 4J3VA 5LYRA 3TTQA 1E1EA 1G0CA 4YPJA 5BWFA 3OLEA 3WDQA 4UOJA 4Z2IA 2C7FA 2PWDA 2J79A 2WM0A 2E40A 2WHMA 1GHRA 1B3ZA 2VZSA 1GW1A 1JZ8A 3HU7A 2VZUA 2E9MA 4FK9A 1HL9A 3THCA 2D22A 4GQQA 3VMOA 3MS8A 3ZIZA 1JZ3A 1HNYA 2BFGA 1WZAA 2XVLA 1W9PA 4ATWA 4DWSD 3WQ8A 4PUDA 3QHOA 4RE2A 4PBGA 3G6LA 3I3DA 2YJQA 1JNEA 1ZBKA 2VT0A 2D3LA 4F9JA 5AYIA 1JDCA 4UQDA 3WF2A 3OGRA 2MANA 3AHVA 4GI9A 1HKJA 5AC5A 1QPKA 4NI3A 1E72M 1TZ7A 3DC0A 4GI6A 5LA0A 5FL1A 1W91A 3CZKA 3N18A 4WSKA 1XV8A 1ZB5A 3WDRA 1WZMA 3EBVA 2CESA 2VJXA 5JIWA 1EA9C 5BCAA 2ZX8A 5A6BA 8CGTA 2WSKA 1EIBA 4PSRA 1CTNA 2O9TA 2YLAA 5A1AA 1KQYA 5I5RA 2WK2A 5GQBA 1UR4A 3T0AA 3LPGA 3FW6A 5A6MA 8A3HA 1B0IA 3VD7A 3VIMA 3VGHA 1JXJA 1WNOA 2GJPA 3AXIA 4M24A 5D9OA 5F7UA 2BV9A 3ARWA 3AZSA 1OIFA 5I78A 2D0GA 3UETA 1CGYA 2VRJA 4F79A 1EO5A 1PJ9A 2XWEA 4ATLA 2X05A 3AS2A 3VM5A 3T2QA 4D6JA 4TXEA 3LPOA 3WNLA 3N04A 1W9BM 5JBEA 1E6QM 1WDSA 2BNJA 2E9BA 3FNDA 3VILA 3LPFA 4Y7EA 2BS9A 4OZOA 4AZ5A 3GM8A 1B2YA 1V3HA 2DSWA 2G3IA 3VIGA 3CTTA 4TOQA 1CWYA 4UZUA 2J7CA 2WWCA 5DO8A 3CMGA 1W1TA 2FHBA 2W66A 3GH4A 2WZEA 1ZBWA 1ISXA 4FLOA 2J8GA 2D23A 3A6OA 1E40A 4W88A 1R7AA 1DWJM 2BHZA 2VQUA 4U33A 5A6SA 2V38A 1KCLA 1LL4A 3SURA 2BY0A 1W2PA 5C8BB 1BTCA 1UA7A 1PEZA 1HJXA 1RP9A 4AMCA 4JFSA 3F5JA 4F66A 4GO9A 4MNKA 2WHJA 2PC8A 4E8CA 5IXEA 5FD0A 3AICA 4M1RA 2GDUA 1CBGA 2YOCA 1D7FA 1OT2A 2VNCA 1QI3A 1JI1A 4J3SA 3RIKA 2V3EA 4P7NA 3BAYA 4HA3A 4PN2A 3EMCA 4BQ2A 4D6DA 4TVCA 1Q6CA 1VENA 4L4OA 1BVZA 1UWSA 1QHPA 1CDGA 3UESA 3EDFA 4B15A 5DF0A 5AYBA 5GNYA 3WQWA 1QOXA 1S46A 1GVYA 4TUFA 2DT2A 1UD3A 4KGJA 4UFJA 1XSKA 1JZ2A 1AVAA 3AMKA 4P7QA 5M03A 6CGTA 1E70M 3RMEA 2CBVA 1CXFA 3SUWA 2CEQA 3WNNA 4PUEA 3WNOA 3B8SA 4AIUA 4UZSA 3KWXA 4M81A 3VKKA 4WIWA 4CUCA 1KXHA 2NSXA 1I75A 2WC3A 4TVDA 1VFMA 4U2YA 2UY4A 3CUIA 3VD4A 5IFPA 2BVYA 3IJ9A 2WPGA 1X6LA 3K8KA 2XM2A 1R7OA 3W27A 1MW0A 3UEQA 1N82A 4J27A 1J11A 1CLXA 2W5FA 2BHYA 2FGLA 4MDOA 4N42A 5DMYA 1FHDA 4AIEA 1J9YA 3ZJKA 3FXYA 1LG2A 5M17A 4TVUA 4HP5A 2WLYA 3WD1A 1EQPA 4JHOA 1QNQA 4WKHA 3VDBA 4MPKA 1UH2A 3POCA 4AWEA 4FLRA 4NF7A 4UNIA 4IPNB 1KWKA 1K9TA 2ZX6A 2UY2A 1UD4A 2D0FA 2JALA 3WNPA 1BYAA 4J3WA 4BQ3A 1EGZA 1QI4A 4MTVA 1E6NA 1GOIA 5CGTA 1KFWA 2B31A 3PZGA 4Q7NA 3GNOA 1ZBVA 1JYWA 1M04A 3VIJA 1E6PA 2D24A 2GJRA 3I3BA 2WCGA 1XGZA 1QBBA 2J77A 4H7VA 2OWCA 1CYGA 4U5IA 1J0HA 4DUWA 5BRPA 1FP8A 1E71M 4CD7A 3VIPA 3G6MA 2W61A 1A47A 4XX6A 1UG6A 5FIPA 1BYDA 3WH5A 1VBUA 1HJWA 4AZ6A 4UCFA 2Z1KA 4JIEA 2ZUWA 1GVIA 4YHEA 1UR0A 1HN1A 3W82A 2X1IA 4X9YA 4GO8A 3GBDA 1D3CA 2E8ZA 3AOFA 2VX5A 4EANA 2J7HA 1AQHA 1J12A 1G5AA 3UG3A 3WD4A 1NOUA 5E9AA 4U3AA 2J4GA
chains in the Genus database with same CATH superfamily
2MUCA 2WVUA 3EX1A 3QMSA 1E3XA 3LGGA 3N13A 4NRRA 3IAPA 1GPWA 2F84A 2J78A 4AD3A 5JH1A 1EJSC 4F0MA 2EAWA 3WMSA 1MWOA 4IXHA 3CUHA 4C6LA 3NIYA 3G1DA 3QZEA 4EVZA 3CEUA 3AZTA 3W7QA 3W02A 5IM51 3NZQA 2EQDA 1VLWA 3C0JA 3V0TA 1XHGA 2P76A 4FR6A 4IIEA 3MV01 2QS8A 1G6CA 4ECLA 4GBDA 3L4WA 3DBPA 1NDWA 1WOBA 1MXGA 4DVOA 3TR9A 1KGUA 4F2BA 3PUDA 1QCWA 1OADA 2ZUTA 3NUKA 1FH9A 5CJMA 3LCXA 4A8LA 4R7OA 2GPTA 1K9FA 3RCNA 4RZ4A 4E4FA 5EPDA 4NZJA 1FOBA 1UUOA 4ICNA 4UBPC 1ML1A 3I6RA 2QCDB 5C7HA 3KOZA 2Y5JA 4CVUA 1MNZA 1H7NA 4P8UA 3ELFA 2DT3A 5FSEC 2BG5A 2ACUA 2TRSA 3PBUA 1EJWC 4KRTA 3TN5A 2QDHA 4TQTA 1IT0A 4OJYA 1DTUA 5E70A 1UD8A 1CI1A 4AEFA 3FK4A 3C4UA 3NO5A 1G4SA 1SZFA 1ZJIA 4IFKB 1O94A 3G1RA 3HMJG 5E0FA 3E02A 3GX9A 3PANA 4JTFA 3P67A 3PTQA 1VYPX 1PHWA 1WCGA 3NQ2A 1TIMA 2OFJA 5DQPA 4XVEA 1LRNA 4U5KA 3NQFA 3ZZ1A 2Q8XA 2PDJA 2POZA 4P5UA 3WBWA 4MJ2A 3BMXA 3EWDA 4I9AA 1YPFA 4KCTA 1CW2A 4J3UA 2Y2WA 1A5CA 4L1WA 3B05A 1A5LC 4ML4A 1UKPA 3W7EA 4DWDA 3REQA 2PD9A 4ZQPA 3H70A 3LBMA 1HKWA 2FFCA 3P84A 3APGA 4E5TA 5J04A 1E4NA 4ADUA 3V36A 1H49A 3C2VA 3TXVA 2PD5A 4HQVA 1OFBA 1MQPA 3SUUA 3NQ6A 2GUYA 3A3WA 3LXAA 3O05A 4XV0A 3QW3A 3U0HA 1JPHA 2J75A 4XIMA 3NEVA 3UZYA 1UUMA 2PWGA 3MMWA 1WXYA 2GUBA 4H8UA 4R7WA 3W1UA 1M9HA 2X16A 4JTJA 1VB9A 2WMHA 1DXEA 3R6IA 4DJDD 3EKLA 2YXGA 1EZWA 2QQ6A 1MDLA 3NQAA 3MKCA 4IQEA 1NDVA 2HXUA 1P0NA 4W8AA 1OGGA 2XH0A 4OUIA 3G8EA 1P0BA 3ARRA 1X96A 1MRQA 3RO8A 4UNLA 5K3VA 2I57A 4IMDA 4F3HA 2HS8A 3LMZA 3TZNA 3DHUA 3FSUA 1E6RA 3RM9A 3Q2DA 3WF4A 1GVOA 3CPRA 1F2JA 2W92A 4PUMA 4DLMA 5D38A 3HO8A 1WOAA 1LLZA 2OQYA 2YR1A 1LUCB 2QJGA 3EDKA 4Y9OA 1G01A 1B4KA 1JYVA 3H12A 3UWEA 3S6TA 4WJEA 3PPFA 2V2CA 3BV4A 5I07A 4ZQOA 2WC4A 2I5QA 1JQXA 5CXPA 2ABBA 5BXTA 3UWQA 1EC7A 3W1TA 4XZMX 3CT2A 3DFTA 5FEPA 5E93A 4LUYA 1L9WA 1T6MA 1OCQA 4O4VA 4H8VA 1TB3A 4HOWA 2J27A 3I68A 4IUGA 2PUZA 3VNMA 3QH2A 2YZ5A 3W38A 2IMRA 3BSGA 5HOSA 1XLDA 4TMCA 1VLIA 2FIQA 4AIBA 4U3CA 1ZJAA 2EJ1A 1G1YA 4J3XA 2OR2A 3BC9A 4FI4A 2PZNA 3VD5A 5DELA 4BKNA 3S2JA 4HYWA 3GS6A 5FKYA 4K8GA 1KGWA 3C0SA 2PLCA 2ZRUA 2VRKA 2V5JA 4JQ1A 5AC4A 3DG3A 1JAKA 2OCZA 1TPVA 3L12A 5EB8A 1F3EA 4GACA 1JCMP 4HTYA 2X1TA 4M6QA 3TMQA 2OEJA 4JTLA 4PUNA 3OHMB 1KD0A 5EBAA 1GKRA 1W2VA 1V77A 1XIIA 2VVNA 5KETA 2WZHA 3L65A 1YBQA 3BAWA 1I0DA 4B92A 4J2MA 6REQA 2QCGA 3VDHA 1P6BA 5EFDA 4V2XA 2ZZ1A 3TVAA 4BF9A 2H8ZA 3N12A 1TYGA 4GNVA 1KBKA 4MKVA 2VGGA 3BURA 3CGTA 2DIEA 1H7WA 1FVPA 2QDDA 4PZVA 2DQWA 2NWSA 1XD0A 2WBGA 1KC7A 3N15A 7XIMA 3WEOA 6ENLA 2PE4A 4JY9A 3UP8A 5CC6A 1TELA 4JIRA 1MFUA 3II1A 3AHXA 3M0YA 3V0SA 5EBUA 2RKXA 3E74A 1PKNA 1NFGA 1ODUA 4L4LA 4B5UA 5E09A 3WN6A 1O95A 3GVVA 3EDEA 1QI2A 4AD0A 4NZ3A 1KV8A 4PYSA 1CB7B 3QVQA 1GUVA 3OVRA 3B0YA 3W74A 1BF6A 1DHPA 2GJNA 4URIA 1R3QA 1JF6A 3ARXA 4UTWC 3NPXA 1C8QA 2BY1A 2HDJA 3LTPA 5HWNA 2HPIA 4Q8UA 4K39A 1LOQA 2P5NA 1WZLA 5D05A 5M3WA 2WSYA 1HJVA 4IP7A 2HPMA 1PYFA 3BMWA 3T0DA 1XC6A 2O56A 2G37A 3GU9A 3W7KA 2X2YA 2WSQA 1PX4A 1YTKA 4HU0A 3J7HA 4S3EA 5CGQA 4PEKA 2FZ8A 2XFYA 4LWWA 1WB0A 1QNSA 4KFPA 3VMNA 1O5QA 5JH2A 1C8YA 3K2GA 3ATZA 1ZP4A 3G1FA 1IZCA 2P8CA 4W5ZA 1YXYA 4NJGA 2BLEA 4RPPA 3RU8X 3CL6A 1F4HA 1XYBA 3OYZA 3FCPA 2VOMA 5FF4A 3VAVA 4JKMA 2OB3A 3OODA 4Y9NA 5BRBA 3MO4A 3NPUA 3N25A 3TW9A 2ALRA 1QPNA 3CPUA 5EGRA 5AHLA 3ZWTA 4QBXA 4EACA 1ME7A 3TFCA 3WMBA 3SCRA 1JDEA 4P2VA 4AD2A 2WSPA 3CHFA 4OIFA 5FACA 4WJXA 3C8FA 3WQ4A 3EPOA 1W9VA 4UTJA 1XLGA 4BI5A 5BNKA 3SRFA 2Q8LA 1FWCC 4E8DA 4WY0F 1JD7A 1A0DA 4MJ4A 3OBKA 2G3MA 1W8SA 1R30A 5A2CA 1SFJA 1F9CA 2YDQA 2GOUA 3C0LA 2IQDA 3C2OA 4IIBA 3TU9A 2VGIA 1CLKA 4NAEA 4E4PA 3RJYA 1D7KA 4EWND 4UTTA 3RILA 1S1RA 3O6CA 2A3LA 3VMPA 4Z42C 1JCTA 1HVXA 1US3A 4RJEA 4Y8FA 3LRKA 4ACZA 3TYZA 1ZL1A 1IWAA 9CGTA 1TG7A 3B9OA 1VCGA 3DKJA 3R89A 2VCBA 2YCJA 4DJEA 4LVBA 3WUEA 2BXYA 1IGSA 3U3HA 2C6QA 3WSUA 1NP2A 3D3FA 3QR3A 4DPPA 2CLIA 3PZNA 4GH3A 3S1VA 3BTNA 2DY3A 1XSIA 3PZIA 3GYCA 3S1UA 4E2OA 4JEQA 2OGJA 4O1CA 3VIFA 3HQPA 8XIAA 3AAMA 1PWMA 3QMTA 1RUSA 3EB3A 4RXFA 3BLOA 1V8EA 4ZMGA 1IXNA 3WF1A 4KH2A 1OY0A 2PU0A 2RDWA 2NUXA 5JQ9A 2GJXA 3BCJA 3JS3A 3OIHA 3DKLA 3GC2A 2QJNA 5GNXA 2OSWA 3FJ4A 2ZUMA 3E6EA 1TO3A 2XYLA 4RV3A 5AYXA 3PULA 2Z4GA 5TIMA 2RUSA 1HZYA 3DG6A 3OQEA 3IRDA 3KTSA 3MI3A 1UR2A 2VCAA 3I4EA 4ERIA 4Q4MA 2AQOA 3QQWA 3UXDA 2V67A 2QIIA 3OBEA 3SCOA 1R2SA 4QP0A 4A4AA 2ICSA 1OD8A 4C7GA 4YL2A 1YHTA 2CITA 4WDTA 3FN9A 1XBYA 4LXFA 4E3VA 3S8HA 4P7RA 3M46A 4RLIA 2Y8VA 3V18A 2R6OA 4DRSA 1EC8A 2AMGA 4XG1A 1XIFA 3P74A 2GDVA 5FJJA 1QOQA 2QCMA 5U7SA 4YWIA 1LCOA 1DQXA 2FHFA 3LGEA 4GYFA 3WQ5A 4CKQA 3TFXA 4PMYA 3RM8A 5BU9A 4D6FA 3E9AA 4IX2A 2HZGA 2Y7EA 1L2UA 2WQDA 4GI4A 2EG7A 1RBOB 2VD9A 2RDUA 4DWSA 4Q7IA 4P8VA 2QPUA 5G4HC 3ITVA 1YEYA 3TYUA 4BF7A 4IPLA 1UR9A 5A8GA 3IIPA 2CETA 4Q4OA 1TJ0A 1E6SM 5C0QA 1Q3NA 1W1PA 2C0HA 5ABFB 3OVPA 4B9YA 2X41A 3U48A 3W2JA 1KFLA 2W67A 1L6YA 1ODZA 1ESWA 2QEZA 1RJQA 3DH7A 3W7IA 1AG1O 3SSJA 3QY6A 3F5LA 4J4KA 4XUYA 2ZE3A 5H2ZA 1O1HA 3MSRA 1OX5A 3AIBA 5LKYA 5BMWA 2FB2A 4JL1A 4B5SA 3EXSA 1Q63A 2HV5A 3GU1A 3R7MA 5D9PA 4AQLA 1JDFA 1HO4A 2JFEX 3JUGA 2G4JA 1GQJA 1VRXA 1TPH1 3NZPA 3WKZA 2XU2A 2PWFA 1GEQA 2G4FA 1POKA 4R27A 3QGVA 4BY3A 4H9UA 3PAJA 4XUGA 4ZENA 3NA8A 5LA2A 4XZNX 2YL9A 1TWZA 2ZC1A 1VEPA 5MKGA 2E68A 4ALDA 3NYDA 4NI8A 2QVHA 3M07A 3EWZA 3FIGA 1AJ0A 2FVLA 3WNKA 3P5YA 2VX7A 3LU2A 2CLEA 4CN1A 3AXXA 3LMYA 5KZEA 4GG9A 1E6XM 1FWSA 3NPVA 2UY3A 1V0MA 4U31A 4R34A 4GD0A 2D73A 3S2MA 3WDJA 4PMDA 3FHAA 2PRHA 2X0YA 3AROA 1DHKA 5FA5A 4X2PA 1W5OA 8XIMA 3M44A 3QSTA 1GYMA 3GG7A 1X8FA 1OWQA 2J7DA 4JX6A 4E2DA 1KBBA 5IHRA 2YB4A 1HG3A 1F6YA 2P88A 1C8VA 2G96A 1E0WA 3IUHA 1XH0A 2PGWA 1E0VA 3AIWA 3W7LA 1M7JA 4NSBA 3STCA 4C6QA 1ZAJA 3URAA 3CUXA 2OODA 2H90A 1W1YA 2PTWA 4GQRA 4EOUA 5FEWA 4O17A 3C5QA 1RSCA 2OO0A 1ITXA 4AFYA 2QMKA 5TF0A 4GZEA 3CQHA 3IK2A 1LLOA 1W1ZA 3M0KA 3N2CA 3U2OA 4PUUA 1VPXA 4H8NA 3G1AA 1WUFA 3CIXA 2W63A 2EKCA 1FWEC 1JAEA 1XRVA 1AZ2A 4GNKB 2W3ZA 4JIIX 3S42A 3HFYA 2CHOA 1IXOA 2WVVB 1ZCCA 2ABAA 3F03K 5CPNA 3N14A 1GTHA 3UG4A 4PL2A 3HV8A 3KBMA 4D6IA 3T1GA 4I6KA 3KZPA 3U2ZA 4GUGA 5H1WA 3TW6A 3MBDA 4ROQA 2O9OA 3SIMA 3EX3A 3CLMA 3C2EA 4H7CA 3OLGA 4AZIA 3WEMA 1DIEA 2XH4A 1PYMA 4XZBA 3E38A 4PB5A 1SMAA 1WDPA 3IK4A 1HW6A 1QWGA 2A6NA 3RGTA 1OG0A 4KEZA 4F4RA 4IGHA 1N7KA 4JS3A 1U1JA 1RLDA 2J62A 3FA3A 4G7EB 3W88A 4NU7A 2EPHA 2I16A 4UQBA 1X6NA 3JRKA 1V0LA 2I5GA 4OWGA 3ZFHA 3WUBA 3THQA 3KXQA 1JJKA 2NVAA 4UQAA 3FGCB 1XBZA 1KQZA 3PFMA 4UTUA 3MVTA 3WBXA 3KX6A 1RA5A 3LYEA 1GGOA 5T91A 4A05A 2V63A 4EWJA 5I3JA 2DV0A 4F8XA 4FNTA 4YWSA 3NCOA 3E2VA 3UCCA 4H2CA 4JPGA 4GCAA 1K4HA 1VPYA 3TQKA 4DI9A 1MW2A 4WD0A 1TVNA 3MMTA 2J47A 2R1PA 3GVRA 1E5JA 3GHUA 3PP7A 3L66A 3M7WA 3O7UA 4QDWA 4Y9MA 1ECEA 4QSFA 4PTVA 1MW3A 5AZ1A 1KLYA 1UKOA 1BVNP 4FAMA 3L4TA 3Q67A 2OSXA 1PB0A 4GJJA 1KKRA 1KR0A 1I9CB 1NJJA 4IJBA 4DF2A 1SVDA 3EWYA 4E0CA 3WNMA 4LW7A 1TJ1A 1W3IA 4D6CA 4I8YA 4JHMA 2G0WA 4HMEA 4PA8A 4RNFA 1ICSA 3CH9A 3NTYA 4DO5A 3DFQA 1WDWA 2WB5A 4I7WA 4I9JA 1LF1A 1YNPA 2E6AA 1LOLA 1ME9A 1HJQA 4B16A 1IIGA 4FXJA 4DHGA 2V5DA 1A4MA 4M82A 5CBBA 2FKPA 1AL8A 3NGFA 2NSOA 3C86A 2CXGA 3U8GA 5A6TC 3RHGA 4CN4A 3LCGA 4KEMA 3RX2A 4J3TA 4D8ZA 5HQLA 1TTQA 1H09A 3EA2A 3W2LA 3A5VA 5HMDA 1F8MA 3ONBA 1UWUA 2XTKA 3EYPA 1UP0A 3VABA 5BOFA 3P14A 5IRPA 2Y24A 4QSHA 1UC5A 1PS9A 4CGTA 3THUA 1TJPA 4DBWA 1FDYA 5A6AA 4Q4PA 1PZ3A 3B9AA 2OYKA 4YN5A 2PWEA 1WE5A 4JX5A 4H2HA 5C70A 2INEA 2AKMA 2QPSA 2DIKA 1H7PA 4HA4A 1AODA 3NQDA 3ZJ8A 1JG9A 2IKHA 1RVGA 3LS9A 1CXKA 4KESA 1GJUA 1GTEA 5DCBA 4WF7A 4JQ4A 2YA1A 2E5DA 1PWLA 4PMVA 4CQAA 3F7JA 3ITXA 4TTGA 1PKMA 3AIUA 3ZQ9A 4MOZA 3FDKA 2QCFA 4ZFCA 1GHSA 1GVRA 1GZ1A 2OOGA 4LS2A 3AYVA 2Y7GA 4WQ6A 3DC8A 2C14A 1YW1A 4E3TA 2GK1B 3AFBA 3M0XA 1Y7VA 2WMIB 3RLUA 3TZFA 1BAGA 2PWVA 2XIOA 4L1GA 3N11A 4JCLA 3SIZA 1QHOA 3WQVA 4LV4A 4AD1A 2XFWA 4K8EA 5AHFA 4WOQA 5FAJA 4CD8A 2J7BA 5J5DA 3IJLA 4UR9A 4HOZA 1KW1A 4PRTA 2PDPA 3N4AA 1Q4WA 1UKTA 3GC5A 4WSJA 1FFRA 2ZWZA 2FTWA 1LQ0A 1KFKA 4XZWA 3BMVA 5JXQA 3LHVA 3L4VA 4FNUA 3FX4A 3JZUA 3JU2A 4QLKA 1AL7A 2CHNA 3MC5A 1TE6A 4ATDA 3GWQA 4YTUA 5BOOA 3NNTA 2YCLA 2CZVA 4LAKA 3MSYA 3I6TA 2P0IA 3FSTA 3AIEA 4LUTB 4Z1BA 3SCNA 3SCPA 1VFUA 4O0QA 3QKZA 2B4GA 2WCAA 3SI9A 3VTRA 2DZBA 4DJDA 3OLIA 1QU4A 4HZ6A 4I6VA 4QLJA 4XO7A 3QPYA 3EWUA 5HDRA 4UTLA 3W2UA 1CCWB 1UR1A 3ZJ6A 3MSGA 5PTDA 4D6GA 1TVLA 1WX0A 2ZUNA 3CB3A 3MDUA 5LNSA 3DYOA 3K8LA 3BAKA 4Q4KA 2EPLX 2WBKA 1EDGA 4S2CA 4AXNA 3ARZA 1UH4A 5CSUA 4J9JA 3KOWA 3UA4A 1XFBA 2ASHA 2B0MA 1QR7A 4EPBC 1UZ1A 5LYRA 3TTQA 1S38A 5G2HA 1OF6A 4G6CA 4LUIA 3S6OA 3CAWA 2QF7A 4Z2IA 3WZ0E 1Y65A 1WQ5A 2J79A 4XAZA 1CB2A 3VDGA 2VZSA 5U4NA 3HU7A 3THCA 4ZZ9A 3VMOA 1AW2A 3GXNA 4NIRA 1JZ3A 1XJBA 3S0CA 3B8IA 2HSAA 4ATWA 1W9PA 2WO5A 3Q4DA 1VBJA 4LVDA 1EFZA 4LEQA 4RR4A 4ZA0A 2D3LA 1AA1B 3GW3A 3M16A 4HSHA 1LBMA 3GVGA 3KOXA 1HKJA 4BHYA 5AC5A 3DC0A 4S23A 5C2CA 3G1YA 4YTTA 2Z25A 1W91A 4L64A 3CZKA 4LS0A 3K1GA 1ZB5A 1FCUA 4PCPA 3WDRA 1PUDA 2ZA1A 3BQ5A 1JCLA 3NQMA 3OTRA 2O7SA 4C5ZA 2O9TA 2YLAA 4Z17A 5FF7A 4ZCWA 3E5PA 3VZZA 1KQYA 4CQCA 3ERPA 3T0AA 1DJNA 5I7GA 5J8LA 4IMAA 3KRSA 3TW7A 2ZRVA 1EJVC 2HE8A 1OFDA 1FWNA 4JIQA 2PRLA 5IOBA 3BLFA 5HQEA 4JTHA 1LOSA 1Z8AA 3OPSA 1G7UA 4JN8A 1FWGC 5CZJA 3I7SA 1PJ9A 2XWEA 2X05A 3Q65A 1TTPA 3RCMA 4B5WA 1W9BM 1XLJA 3SFWA 3UXKA 2HJPA 4IZGA 1L8PA 3VILA 3WQEA 4HKPA 2DSWA 4NQ1A 5MHBA 3UY8A 3CTTA 4UZUA 2J7CA 2WWCA 4KWVA 1TZZA 2W66A 1OYBA 3GH4A 1E51A 2D23A 3A6OA 1G7VA 1E40A 4BI7A 1BSLA 4YTQA 4AF0B 1KCLA 2FZMA 1LL4A 4IJRA 5C8BB 5LGZA 5DMNA 1UA7A 2ISFA 2PZ0A 4AMCA 3P5ZA 3HG4A 4H9VA 4OVXA 2PC8A 3QC0A 4GCXA 5FD0A 4REQA 2YOCA 1D7FA 3HGJA 3KVJA 1JI1A 1X8CA 3KTCA 4IFRA 4KERA 3UGRA 4P7NA 3BAYA 4GLEA 2AGKA 4G1KA 3EMCA 1Q7ZA 4BQ2A 5FJPA 4D6DA 2OTDA 3GK0A 1VENA 4DY1A 3DFNA 1UWSA 1QHPA 5K9CA 1WBHA 3IJDA 3C8NA 1QOXA 4TUFA 1WYIA 5DY2A 5DANA 3QV6A 3EX6A 3VNDA 2ISVA 5LIKX 4ILSA 1R0MA 4F0KA 3FKRA 1YYAA 1E70M 3RMEA 2DVTA 2FPTA 1E0TA 3B8SA 2VEMA 3FYYA 3GXTA 3KWXA 1MDRA 1OHLA 1OFAA 3PBYA 4WIWA 4CUCA 4C65A 1KXHA 3BW4A 2WC3A 3KBVA 2DFAA 4U10A 2XIJA 3MO7A 1DVJA 4DJEC 1R9ZA 1X6LA 1R7OA 4HZMA 4I9TA 1J11A 1CLXA 2BSLA 2W5FA 3PAOA 2FGLA 3SJ3A 3C3NA 4MDOA 4N42A 1FHDA 2HK1A 1J9YA 4K2SA 3FXYA 3CNYA 1EQPA 2G50A 5BU6A 1TPDA 2GQ8A 3UZXA 1KWKA 4DYEA 2I14A 3R0UA 2Q8ZA 1ZGDA 3ZVHB 2Y62A 3WNPA 3FYOA 4KWWA 2YCEA 2YW3A 4Z1AA 4IIHA 4O50A 2C15A 3PZGA 1ZBVA 4PE8A 1P48A 3MW7A 3VIJA 1E6PA 1GYLA 2D24A 3LCIA 3I3BA 1XGZA 5EMUA 4K7YA 2OWCA 1IXQA 3I4KA 2WQPA 3F1QA 3EEZA 1FP8A 1XUUA 3PJWA 3LX9A 3S47A 1YTDA 2GDQA 4L4MA 5FIPA 4UMAA 7ODCA 1VBUA 1Z3NA 1RY0A 4UCFA 2Z1KA 3PPGA 2ZUWA 4YHEA 1UR0A 4X9YA 3GBDA 6XIMA 2HK0A 2E8ZA 2VX5A 3IJ6A 3W1RA 4Y9AA 4JQ3A 4IIDA 3MUCA 4EANA 1J12A 1G5AA 1SO3A 5E9AA 4LVGA 4QRNA 3CUZA 4CNPA 2CWNA 3SGZA 3B0PA 1LLWA 2J8TA 2PPGA 3U2CA 2PRMA 1UYQA 3VOHA 4U2ZA 2QW5A 4E2BA 1F6PA 4Z0SA 2WOQA 5LA1A 2POTA 1OBAA 3BLIA 4DWSC 2I5IA 3GG8A 4A3HA 4XISA 4DJFD 1H63A 3G0UA 4MZ8A 4LBRA 2OLSA 2XPKA 3EOEA 1JXKA 9XIMA 4C1KA 2QZRA 1EBHA 4HSNA 2NV9A 2Y8UA 4LTSA 3BLKA 1KXQA 2Z1WA 2VELA 2D69A 1TPEA 1T99A 1UUQA 3ZT7A 1H7RA 5MF5A 2E67A 1KLZA 3S5SA 3TTYA 4L1XA 2WMGA 1K70A 1EA0A 3REQB 3BOLA 4Q4RA 2F8QA 2C13A 4ZB5A 1Q5MA 2BY3A 1AQFA 4C1NA 2J74A 3M5XA 4PUWA 3PZMA 3WBAA 2PDNA 3K13A 2XSBA 4KMQA 4NASA 3NO1A 4FR1A 5LZLA 4MWAC 5CGMA 2Y4SA 1LBFA 1R8LA 2A5HA 1I2QA 4ZGYA 2H6RA 2PURA 3VIIA 4MUPA 3G1VA 3V0UA 4LF2A 1PIGA 3TJIA 3VKCA 1FQ0A 3MWAA 1OF8A 2ZRZA 1J0IA 1GT8A 1DJHA 4BA0A 3IGXA 1BGAA 4L6DA 2Z0IA 3B9NA 4ERAA 1A5OC 1KTBA 4IWWA 3L4ZA 3VM7A 1SJBA 2WLZA 3ZR6A 1UWAA 1MYRA 3MUZ1 1CXLA 5CAKA 4I90A 1B9BA 3U7BA 2VX4A 2Y88A 1C8XA 2R1MA 2WMFA 4QCEA 4RNIA 4PMXA 1XKYA 1B3VA 2OQHA 1EJXC 1OYAA 1T7LA 4W89A 3VNZA 7REQA 1KR1A 2X30A 2QHAA 2G3JA 1H1YA 3A5FA 2QT3A 4QG8A 1KTNA 9XIAA 1Y5XA 1NF7A 4JTAA 2DZPA 1RJPA 3HBLA 2FLIA 1MW1A 2DGAA 5M5DA 3CIWA 4QJ5B 4Q32A 2F61A 1RQEA 1V6VA 4BCEA 2PCEA 1R38A 1W5QA 2WSRA 4NNAA 1PKYA 1EQCA 3QRHA 2A3AA 1PDYA 1XL9A 3D3AA 4UTMA 5BMXA 2AQWA 4H00A 1RA0A 3OZPA 1W0MA 4CQBA 2GSEA 3NQ7A 1V51A 1MUCA 3R13A 1KB3A 1E9LA 1VCFA 2VEIA 3SUTA 1N55A 2E3ZA 2VFEA 4MDPA 3NSXA 3TQVA 4CCDA 4D8AA 3E0FA 1UMLA 3DX5A 3N2XA 3LTSA 3BWWA 4PTDA 3UVIA 3PG9A 1UWQA 3A4WA 3CC1A 4HNOA 1AW1A 2X2GA 1AQMA 4GHRA 4K68A 2HROA 4L65A 3BH4A 4MJMA 1SSGA 3W1QA 1GNXA 3RF9A 1W3TA 1MUMA 4JXCA 4N6FA 3UF9A 3CZLA 3NFUA 3LHZA 2VR2A 4XKMA 4KIEA 1S3HA 1VFHA 4JX4A 3EKZA 5JUVA 4GA8A 3T09A 3CYJA 3DECA 1K6AA 2OZTA 3LSBA 2DSUA 1QATA 2ZYFA 1E5NA 1PZ0A 2Q3OA 2XGZA 1QMLA 1BLIA 4GVHA 3T55A 3IGHX 1ZLPA 3UNTA 4W93A 1O5XA 4JY8A 1UPMB 1BRLA 3JVAA 1HF6A 3MP4A 5D2TA 1YPIA 1QNPA 3F2BA 1M7OA 4C6DA 1W9XA 4ML9A 1PCWA 1YBQB 6REQB 3TROA 3LK6A 3OJGA 4M3PA 3W2MA 4IP5A 2OKOA 1B30A 4AX6A 4ZBCA 3WK3A 2E6YA 4FP1A 2GUUA 1WA3A 5DRIA 3T8QA 2YSWA 3YPIA 1UP2A 4AEOA 1KBJA 2NQ5A 1GOKA 5CC3A 2P1FA 1SFSA 4WUIA 3BGGA 4UOZA 2QCLA 1KM1A 2DEPA 4F2UA 5DT7A 2E6DA 2XG9A 1R6WA 2NWRA 2GJLA 2VC9A 4PULA 2O9PA 3LHTA 4E2VA 5A6BD 1ZNNA 1CGTA 3EOLA 5AFDA 3NWRA 4S3DA 2JK2A 4LC6A 3S1GA 1QFEA 3A64A 3POHA 1OSEA 3B8UA 4I9MA 1M6JA 3WJXA 1VZWA 3GD6A 2QMJA 3SW6A 2PEVA 3W7CA 1XW8A 1TQXA 4N9CA 1Y8BA 2CZEA 4Q8QA 4Q33A 3H22A 2IKJA 2V3DA 3KDNA 2BASA 2XN1A 2BXZA 3BJTA 4PR4A 2HISA 4YIWA 4C7FA 4ZB0A 2DSVA 2FH8A 4J28A 5ABGA 2C16A 1V6YA 2E9LA 1I2OA 3BG3A 3ITCA 3SUVA 4HNLA 4TX6A 3STFA 5LHFA 2NXIA 4GVFA 3ALFA 2IKIA 3ALGA 3GXPA 2P50A 2HWGA 4YS1A 3ZVIA 3RXZA 3CYVA 3H4XA 1UZ4A 4OOUA 2ZZ7A 1GG1A 1QO2A 1MNSA 4UXDA 2VZTA 3FLUA 3BARA 4I5UA 3HG2A 1KWGA 2PU1A 1TQJA 3QV9A 4G5DA 3PWGA 3WDHA 3M5YA 4DXKA 3EDJA 2ATMA 2J88A 3F4CA 4OOZA 4C6FA 3VOGA 2QGYA 5CSYA 1QI0A 5CJNA 2VXNA 3NZGA 5A2AA 5C71A 1XRSA 4QG9A 3W76A 3RITA 4M7SA 3W24A 2VM8A 3WLPA 3RDKA 4IHCA 1E1CA 1FKWA 1Q66A 3G22A 2JBMA 3NQEA 1BQGA 3BW2A 3ZR4A 3D47A 3B04A 3UR8A 3BDKA 2ZZ2A 3W84A 2RH9A 1P5BA 3QHNA 3ARPA 4F0SA 3SJNA 1CGUA 1PX8A 1P7TA 3PR2A 3PUEA 3P0WA 3W75A 3QW4B 1HO1A 1A49A 4AVFA 2EG8A 1RAKA 2CU0A 2WWDA 2G8ZA 4FOUA 2WVSA 2X1SA 4Z2GA 3WLNA 4LJ3A 3B06A 3TC6A 4HN4A 3RLGA 2AL1A 5C9WA 5EFFA 4O0KA 5I03A 1DJWA 5BXPA 4DLFA 3HM7A 2QJMA 5HXMA 1JZ6A 4S3JA 2XZ9A 4NAEB 3TYCA 1UQZA 5CCZA 3KL3A 3SUSA 5CQ1A 4QCFA 4ACZB 1TR1A 2CERA 1ISYA 1Q7MA 2B81A 3GXFA 2Z2UA 1R3YA 4UIOA 4CQ9A 1VBRA 3MUAA 4JIHA 3FXGA 2QCEA 4YNGA 4HT3A 2VEKA 2ZRXA 3CZGA 4LX4A 3RFAA 1QOPA 3HZ3A 1L8NA 3H54A 5G5IA 1GW9A 4W8BA 3IJ7A 4XKYA 1Z42A 3XIMA 1RD5A 3GTHA 3V5OA 2EG6A 1JGMA 4WHBA 3R8HA 3NL5A 4XD4A 4PCFA 1PIFA 3N3TA 4UTKA 5F4WA 3Q58A 1C7TA 1EP1A 4PTMA 3UG5A 2GJXB 4PFMA 1EGVA 4W7UA 3VIOA 2E4TA 4UR8A 1E4LA 1SFTA 3KLLA 3W83A 4S3CA 3TNBA 5D4YA 3UWVA 4UR7A 1JZ4A 4GKLA 4CCZA 3RPMA 1N8FA 3NAVA 2OGYA 4GQ0A 3N6QA 4IJCA 4QNWA 4IX0A 4NRSA 3W37A 2IPGA 2YGYA 2QVNA 1X97A 1J01A 2GVJA 4ZEPA 4QISA 1FDZA 4GZIA 4WJ8A 1EKOA 2CZDA 1K6WA 2YYTA 1LT7A 1CEOA 3MCOA 1T0OA 4IP4A 1M7XA 1CENA 5LXEA 1RD6A 1TRIA 3VGEA 3WFLA 4GGBA 2ADAA 3TSMA 1NQKA 3MP3A 4M5PA 4LQ1A 1TWDA 2PP0A 2PDFA 4US5D 4ERGA 3VFCA 4HYRA 1RCQA 4ZE5A 1A3WA 4PB4A 1DEDA 4B4HA 1R9XA 5DT5A 5F2GA 4CVWA 1GJPA 1KBIA 4TV5A 3W07A 3VINA 4K6AA 1QAPA 2J7EA 3TCEA 4CNSA 2ZX7A 5H8PA 7TIMA 1S1PA 2Y7DA 3O07A 1ZTVA 4ZO7A 2D20A 1D3HA 2WW5A 3DERA 1I2NA 4XAGA 4S3GA 4PCSA 4R7JA 9RUBA 3RG6A 3VE9A 4D1JA 5GPRA 1RVKA 4ZXOA 2O55A 4DWSB 2W6RA 4I5XA 3SCWA 3R1ZA 1JRCA 3GR7A 3QTPA 2BGNE 4E8GA 3G0XA 4EF9A 1XIBA 1XQKA 2PWHA 4H9TA 3QQ1A 1P4CA 4RW3A 1FHLA 2FPVA 3KW3A 1HJUA 1W37A 3W2NA 3W1AA 1YDYA 2CYGA 3WL0A 1QW9A 2ZOXA 1GEHA 3SCQA 1OCNA 4A2SA 2PS2A 3AJ7A 3T2PA 4OKDA 1C93A 3D46A 5I3KA 4AAJA 4MSSA 4ZQRA 4MNMA 1BKHA 1CT5A 2QAPA 1IQ8A 3VA8A 2Y85A 3PF3A 4MWAB 1TX0A 2Y8KA 3WX7A 1HKKA 4X3ZA 5C6MA 3GDMA 4FNPA 3TONA 3V1HA 1VBHA 2OJPA 1JUBA 3LI1A 5D33A 5D2YA 1S2CA 2A4AA 1THFD 1IR1A 3S4TA 5MKGB 1SGJA 1DQUA 1TJRA 1V6WA 3LCWA 1XLHA 3SRKA 3WEZA 1UHVA 2YFNA 5AB3A 3GUWA 3C3UA 2REQB 5D30A 3H26A 3APYA 2NX3A 4D71A 2YLLA 3QR0A 1DE6A 3VCNA 4GNJA 3HPZA 3PJUA 2WHKA 5LSMA 1B4EA 1VCVA 1EXBA 1W54A 2PLMA 2VFFA 4JYFA 3NGJA 3LD5A 1UPPA 5AHEA 1V08A 2D2HA 3I10A 3RPDA 3VD9A 2X09A 1OD0A 2HE5A 1KXTA 4ZOCA 3NQ8A 1KCZA 2G95A 4QEHA 3PZQA 4S3KA 4ICMA 5EL1A 4KQNA 4V28A 4IH3A 4CEXC 1LWJA 3AIQA 3ZR5A 4JKKA 1G69A 1K9EA 4R9OA 4UQEA 2C8NA 4IMGA 4RV8A 2Z00A 5IDIA 1XH1A 2GOKA 3PS7A 3UXIA 2X8RA 3T8LA 3WBYA 2VYOA 3OGSA 1W32A 3ICJA 3P60A 3VKBA 3ZS4A 2Z28A 1H5VA 3UZJA 2TMDA 2EGZA 1C91A 3T05A 4X63A 2INZA 2W27A 2BGQA 3W1LA 1Q6DA 4MIMA 1DJXA 2WZMA 3SFKA 2VURA 1OX6A 2CC0A 4X60A 1VFLA 4KRUA 3KVMA 4O0ZA 5D32A 1EHAA 1XGEA 3PC0A 4K38A 4GI8A 5HA7A 4HCDA 4RPQA 4NNBA 1G9HA 3R58A 4K7VA 1F3TA 4OQVA 3WJWA 2DW7A 3T42A 1KRCC 1XIEA 3KS5A 2VZVA 4F0LA 2NLYA 3ZO9A 4UFMA 3T44A 1NOFA 4X0NA 7TAAA 3VNLA 1MMFA 3QOMA 1O66A 1IV8A 2FFIA 3ABQA 4LBUA 3U57A 2VFHA 5CKSA 3PWIA 1Z32X 5D2XA 4LGXA 4DUXA 2V8ZA 3G18A 4YCPA 4AWSA 4IGNA 4GJIA 1XG3A 4GPNA 1U30A 2I7GA 1Y5VA 1GG0A 2BOFX 1ZQ5A 5LNUA 1XLCA 1Q65A 1CPUA 4US6A 3L0NA 3FA5A 4JTQA 3B3DA 2XH7A 3AUJA 3BLPX 1XYAA 1WAUA 5FCZA 3UJFA 3MHUA 1LORA 2PFHA 2FJKA 2YBVA 2J9XA 4ZSTA 4H9MA 1A53A 3ABOA 3HGSA 3O15A 3FEQA 5KZDA 1FHUA 2E0PA 3E96A 1UWTA 4YVXA 4ZVJA 2LLEA 2ISSA 3PUGA 4FXFA 3BCDA 3VIKA 1R3RA 3QBUA 3HGOA 2RGLA 4QIUA 2GGJA 3W9ZA 5I2UA 2PC4A 2OKTA 1I1XA 2XIQA 2XJ7A 2Z1SA 1JPKA 3G8RA 5A3HA 1IT7A 4GKTA 5DEZA 1D8WA 2WKJA 4MAVA 1HP5A 1HVQA 1MZRA 1AH3A 3HIJA 2OWXA 3JZEA 5DBUA 2QJJA 4C6JA 1I45A 2OQLA 2CBIA 2ZXBA 3ZSSA 3VUPA 1V3KA 4AEEA 3WK1A 3UWZA 1O5RA 3BV7A 4H41A 1V02A 4JICA 1UD5A 3EB2A 4LT9A 1W31A 3W4RA 5K7JA 5AHMA 4MB3A 2DVUA 2FDSA 2PGFA 1EUNA 4UQCA 2NT1A 3PZUA 3WQCA 3KLKA 3M43A 1TWWA 2EPOA 2PDIA 3CWOX 4E38A 1DJGA 3MZ2A 2YDSA 3M0JA 3UVAA 5E1QA 1SW0A 1JL8A 4O54A 1OINA 1R87A 3QY8A 4PH6A 4WXYA 4O57A 3RUBL 2CLFA 3B40A 4X2RA 1K02A 1MEHA 4WKAA 3WLTA 4YLWA 1YQ2A 4GH1A 2CBJA 4HK6A 4LFYA 3AUOA 1DBTA 1TCDA 1E9ZB 5FJIA 3BL3A 4O14A 1ZJBA 3S5YA 2PODA 4A21A 2G41A 4AU0A 1A4LA 4ROPA 4Q4QA 4EPDC 2BTMA 3H24A 1ICQA 2DPEA 4JGDA 1YDVA 4QFUA 3SY1A 3IUIA 3ZWSA 2Y0FA 3S2NA 5B7YA 4W5UA 4QITA 4A8IA 1GQLA 5CZTA 3BJFA 3BANA 4JTIA 1JYNA 2Z27A 2WZTA 5BZAA 2Q02A 3CUGA 1KNWA 4UMCA 2FZBA 3SRHA 3PPCA 4FIRA 4AZ7A 3GDLA 1BYBA 1P0DA 3MHGA 1O4UA 3UWWA 3W81A 3ITGA 4MNLA 1O12A 2VI0A 1DWIM 4IMFA 3OP2A 2ACRA 2NLIA 3W1PA 2UZ9A 4H6QA 3UW6A 4XIAA 3THAA 3VO0A 3MKKA 5CC5A 3H4WA 1EOMA 1OCBA 3AO0A 1YKWA 3OG3A 3DIPA 1UJQA 2JKPA 4XBSA 4WLCA 3G77A 3UXLA 5DCEA 1W5MA 2CBUA 2A7RA 1IWBA 1FRBA 5I0DA 5D09A 3BSMA 4PMJA 3MMUA 3N4FA 4BFAA 4LAUA 1NDYA 5AHIA 4NZ4A 3SADA 4B90A 3JR2A 1UBPC 1RALA 1V3MA 4ICCX 1HT6A 2YCLB 2C71A 1SFLA 3CZJA 1BG4A 2V5LA 1M03A 3C0QA 1QBAA 2VR5A 3ANYA 1XQLA 5CZKA 4G2DA 3PG8A 4RZ5A 3E2QA 1E73M 4KCUA 2HQAA 4M8UA 1UROA 1JDDA 3GZAA 4C6OA 3BXWA 1FWJC 2OSYA 4RCXA 2RJHA 3WD3A 3P8JA 3ARSA 1CZ1A 1PZ2A 4NILA 3EDDA 2G3NA 2CKRA 2GVYA 2RAGA 3TN3A 4AZHA 1FH7A 2Q09A 4FSAA 4CNTA 1RLCL 2PDWA 3I7QA 3B0XA 3VGDA 5D37A 4NZCA 5FESA 2FZNA 3URQA 3LN3A 1VJZA 3L68A 1TV8A 2D1ZA 1ITQA 4HPHA 5I3IA 4XD6A 2V68A 3H2MA 4M6PA 2ZC8A 3DFHA 5CSSA 1UZDA 1R2RA 2FPYA 2VR4A 1JDAA 4C7DA 3OA5A 2WMKA 2ISDA 4S3FA 1W3KA 2A7NA 1VKFA 4WX2A 4NJIA 5I00A 1F7BA 1A3HA 1LT8A 1P1MA 3IVUA 4EKJA 4OE7A 4FOKA 3UXAA 3VNJA 5KINA 3CL7A 1UWRA 5D8ZA 2PGEA 3BAXA 3W3OA 3W29A 3TV8A 3KL0A 1T8XA 4JAWA 3GDRA 2WHLA 4P7LA 1FH8A 2EKGA 1GCYA 4NYYA 3U5YA 1GQIA 3O6DA 4IIFA 3CJPA 4OBRA 4R33A 1DORA 5F4SA 3WDIA 5A94A 1MQRA 1R3SA 3MCMA 1OM0A 1CNVA 3TAKA 4NXKA 2OZ0A 1UD6A 2QUUA 2PF0A 1L0PA 1ZS2A 3ARYA 2WJZA 4GABA 2DH3A 3H4GA 1SYTA 1YIXA 4B5XA 1OB0A 4KIRA 3WQGA 3V1PA 3CWNA 3MMDA 3PTMA 3RLVA 1X7IA 4H9YA 4QHRA 5BWFA 3WDQA 4NUWA 3HF3A 2PWDA 4CNNA 3NL3A 2WHMA 3N2TA 1B3ZA 1IEIA 1OFRA 2E9MA 1HL9A 3QFEA 1EJRC 4UCGA 3ZIZA 1X1ZA 3DGRA 4QS6A 1HNYA 2BFGA 1OG6A 4PB3A 1U5VA 4NNCA 4ONVA 2OZ8A 4IT1A 3S83A 2Z6IA 3I3DA 2Z7GA 1JNEA 2J24A 5EYWA 3KOFA 2OPJA 4F9JA 5AYIA 2PP3A 4OGZA 1NDZA 4L6HA 2G5WA 1XIDA 1AFSA 1O60A 3ID7A 3TR2A 4NI3A 1M68A 1E72M 1TZ7A 3WLLA 2XN0A 1FWHC 3GHRA 3MY9A 5LXXA 1C9DA 1F76A 1F61A 1WZMA 2E1WA 3MI2A 1EA9C 5A6BA 1VYSX 1CTNA 4YJ5A 2Q3RA 3N2BA 3PY2A 5I5RA 1U5JA 2WK2A 5GQBA 3H2NA 3SRDA 8A3HA 4DBSA 3MBFA 1JXJA 1WNOA 2GJPA 4RUBA 3FJNA 4FALA 4REQB 3CXOA 3TJXA 2X1UA 1OX4A 2PMQA 3ARWA 3AZSA 2ZRYA 1S5TA 3TC7A 4CNOA 3PBMA 2XISA 2D0GA 2RJGA 1OK4A 2CHRA 1EO5A 3KCJA 3P7YA 4ATLA 4WCJA 2SFPA 3S5ZA 1YE4A 5AOUA 3WNLA 4Q8OA 2F38A 4JD4A 5JBEA 2EF9A 3U4FA 1E6QM 1WDSA 2R1KA 3FNDA 2QNEA 3DXIA 4Y7EA 4DQWA 2BS9A 4OZOA 3GM8A 3DDMA 4FNSA 2G3IA 4GYPA 4LYKA 4HHLA 1F07A 3GB6A 5HWJA 1A5SA 5DO8A 3ZLHA 1ISXA 4FLOA 4U28A 4W88A 1R7AA 1DWJM 2VQUA 4NHVA 4DZIA 1UBSA 4GUHA 5G1TA 1H7OA 3WQFA 2A85A 4MFDA 3AWOA 1OZMA 3B4UA 3HOJA 4JFSA 3F5JA 3LQLA 4F66A 4EPEC 3HG5A 1AUSL 5GJNA 4INFA 2WM1A 4DXVA 1QASA 4M1RA 2GDUA 3TE9A 1CBGA 7PTDA 2VNCA 3UJSA 1QI3A 2O7QA 3RIKA 2V3EA 3R11A 2ATSA 5L6UA 4G9PA 5HWMA 1H60A 3QV8A 3FJ6A 4TVCA 3SSZA 1Q6CA 2UV8G 4L4OA 5FJUA 5DCDA 3UESA 4B15A 3L0GA 4GVIA 2DZUA 4Q8PA 2E5BA 3F4NA 4H7ZA 3LZ5A 4KGJA 3MB9A 1XSKA 1AVAA 1JVNA 6CGTA 3R2GA 4DYKA 2CBVA 4B2DD 4PUEA 1DYSA 1DIKA 3N6JA 4AIUA 3VKKA 3FV9A 5J5RA 4TR9A 1YDOA 4Q8TA 4HK5A 4YVVA 4U2YA 4DEFA 4G56A 2YCIX 4Q4SA 2WPGA 4KFNA 3W27A 2FJUB 4F0RA 3UEQA 1N82A 3VCCA 3EOUA 3MYOA 5AC7A 5C2GA 5REQA 3LLFA 3VOJA 4EP8C 1DIDA 1R47A 1QWKA 1QK2A 2X42A 3WYZA 4ZQMA 4WRHA 5M17A 1IXPA 2DZAA 3SAZA 1B3OA 2C1GA 2WV8A 5TNVA 4TMBA 5FAGA 4UNIA 2UY2A 4DNHA 3TWBA 2CLKA 2D0FA 1ZP3A 3W7OA 4GYJA 4BQ3A 3WLKX 1BWLA 2A1YA 1QI4A 1KFCA 2G97A 1JPDX 4C6CA 2B31A 4QGCA 4Q7NA 1GVQA 1LM1A 5AHNA 2XSXA 1M04A 2X7VA 4X22A 4XTIA 2GVLA 2GJRA 1U1UA 2J77A 3NVDA 1CYGA 1YADA 4MZ1A 4U5IA 1J0HA 3OVGA 4IIGA 1SW3A 4KFOA 5HULA 3VC5A 4CD7A 4LBSA 4BI6A 4KCWA 3RN6A 3GR8A 2AL2A 4JQAA 1UG6A 4GX9A 3WQDA 3WH5A 3A4JA 3GDKA 4AZ6A 2VC5A 3HURA 1FWDC 3N9RA 3E5BA 4UMBA 1HN1A 2J66A 2ZVIA 1JCNA 3A22A 3JW7A 3H7VA 1SU5A 1D3CA 4BEUA 1EIXA 3AOFA 1XPGA 3HJZA 3W85A 4XO6A 3F4WA 4B4FA 3E12A 4DIAA 1TSIA 4US5A 1J2BA 4U3AA 1DJIA 1JULA 4C1NB 2IUZA 3GNXA 2A3EA 1K77A 3NQGA 1X7FA 3WO8A 3WMCA 1YX1A 4N9BA 3UCDA 2QKFA 3ZM8A 1ZFJA 4UUIA 4M7TA 3WFAA 4DAFA 3SY5A 4Y90A 4MLJA 4ZL1A 1BVWA 4GY1A 3AI0A 3GFZA 3WQ6A 3ME3A 1NWRA 3Q37A 3TP4A 4D1IA 4AVNA 3IVSA 4A29A 1QT1A 2Y6ZA 1EX1A 2WPBA 5AC8A 2VHLA 2JIEA 2DZSA 4XD5A 2ZBTA 3HQ1A 3GKAA 4YYCA 1DQWA 4D72A 4KF1A 3FA4A 3HJEA 1XYZA 3QYQA 1B54A 3CHDA 3NXFA 1VF8A 4HJWA 3P62A 1XICA 5C55A 1E4MM 2QJIA 2QF8A 2IQTA 2DUAA 5BXSA 7REQB 2YXXA 3AISA 4BF5A 3PN8A 3ZXWA 3AYTA 4GC3A 4LS1A 2P10A 3RX4A 1Y5WA 3EB4A 3OBAA 4XZHA 4AY7A 1QHZA 1O1ZA 3H55A 1O6IA 3MZNA 3C61A 1POJA 4DPQA 4DJED 2HNEA 1H3GA 4F2TA 2HCVA 3CLWA 3HPXA 3RNDA 3CT7A 1FWTA 1V3IA 1SR0A 5EMMA 1Q2RA 2FYMA 1A0EA 4MYXA 4UWMA 4GINA 1IIHA 2B7NA 2UBPC 2H8XA 2VDHA 1F73A 1BWVA 1RZMA 1UR8A 3V4BA 3QHMA 4PTWA 1MO0A 3IJIA 2PDKA 3SDOA 3IARA 2ZWYA 4BQ4A 4RXGA 3GAYA 2W9MA 1GVFA 1FXQA 3OZMA 1FWAC 1QW7A 3K4DA 5DY3A 4NG3A 3TC3A 4HHPA 2JQXA 1QDSA 4MM1A 5KITA 3S1XA 5TD4A 3AYSA 1H62A 3O9NA 5C7VA 4GUIA 1UB3A 3S9YA 4QAWA 4JTKA 3RO6A 1QNRA 1JPIA 2WJEA 3RX3A 1ZBCA 3BAIA 5HJXA 4NY2A 3CQKA 4FLQA 4Y9PA 3E2SA 1NU5A 4Z1DA 2C3ZA 3D0CA 1WKDA 3DESA 4OECA 3THDA 5BW6A 1B3YA 4C60A 4JTUA 2V5BA 1VFTA 2B7QA 4Q6XA 3NO3A 1AH4A 3GTNA 1AW5A 2OLAA 4ZTYA 1G67A 1KGXA 3M4HA 1QPQA 4LANA 4NJJA 3VOFA 3ABSA 1FCQA 1VGAA 2P3ZA 4HPGA 2ALDA 1E43A 2J9YA 4QE4A 3GO2A 5DLCA 3W86A 4S39A 1PAMA 1BRLB 1XISA 5JIPA 4P8WA 1MI3A 2OU4A 3CS2A 4AZCA 1BSIA 3MWCA 3VU2A 4I7VA 4XZIA 4LU0A 3QGAC 2H9AA 3PUOA 5CG0A 4JTSA 4KETA 4A8NA 4H04A 3M5VA 3W7JA 4ZSUA 1XKJA 3TUUA 1Q6QA 3FHQA 4CU8A 1S2UA 2YX0A 2BB0A 4YVPA 4PBFA 1JUEA 1KM6A 4IICA 1QNOA 1SJDA 2E09A 2VWTA 1W3JA 2YZRA 1GQKA 2ZZ6A 4DBDA 1BG9A 1B5TA 2VP8A 2V82A 4Q8VA 2X0HA 3BGAA 1K7EA 2WKGA 2HXTA 1UA3A 3UYIA 2XDFA 1KBLA 4GVGA 4EPKA 4JIPA 3P2VA 3KUMA 4ZTXA 1BTMA 4HNUA 2F6XA 3O6YX 3R8RA 3SM0A 4C6IA 5I3DA 6A3HA 1LG1A 1UKSA 3VGBA 5D8WA 3V35A 2QLYA 2E8YA 4MWAD 3ZOAA 1EUAA 1H5YA 4KWSA 1J10A 1IF2A 3UG8A 5EMJA 1VBGA 4HCLA 5DRCA 3ARTA 4W8LA 3TYEA 1ECQA 4QEEA 3NPWA 1VIZA 1BHGA 1VEMA 2DSKA 4EF8A 4GJ1A 2XWDA 4L7ZA 2NV1A 1RJRA 3GIYA 1OIMA 4LRTA 4MKSA 2DQXA 5DMMA 2XVGA 3IRSA 3PVFA 5HBFA 1J0ZA 1EL3A 4XK2A 1H61A 5A5WA 1EDQA 1V93A 1G94A 3W7PA 3CMJA 5LHEA 3G24A 3BW3A 1ZHAA 5A6LA 5JBDA 1XIGA 5K4XA 3AIRA 3A47A 3EAUA 4MF4A 4L9XA 4MY8A 1E1CB 5GJPA 3PB2A 2OT0A 3LZ3A 2OX1A 4S1FA 4UFKA 1VRDA 2F2KA 5E6YA 5AKQA 1EHNA 3W0KA 4JEJA 5CPTA 3ZSTA 4A3RA 3KRUA 3TX9A 1P7TB 1HKIA 4BZYA 2EHHA 5DFAA 1C92A 5LNVA 4IPJA 3L4YA 1T40A 4W7VA 4LEFA 2I9UA 3ZJ7A 4JZ5A 1E55A 2YL5A 4EK7A 2I9EA 3VKAA 2YL8A 5CPQA 1YLVA 5KEZA 4R53A 3VNIA 3MUIA 4R5EA 2V6AA 4NX0A 4PMUA 2XFFA 3CHVA 4XVDA 1NWUA 4TX8A 3BGJA 4HK7A 4ACYA 5CEWA 2OG9A 5IBXC 2R1NA 3GXIA 2ISWA 5FJOA 3M9YA 1XINA 3ZLFA 1IEWA 1EJ7L 3F4VA 1QJWA 4HNVA 3U9IA 3USBA 1V0KA 4HU4A 2AKZA 4AWUA 3ATYA 1BFNA 5FEXA 3F5KA 4ZOEA 1J2WA 3WMLA 1QI5A 1X38A 1VQTA 4C1LA 1GOXA 4NX5A 2BMBA 3WLHA 4HMCA 1LL6A 4XKYB 1XLKA 4LRSA 2FZ9A 1TREA 1TX2A 5D2VA 1A80A 5HUOA 3UPMA 3UFYA 2BVTA 3BZJA 3M1ZA 1PTGA 1CGVA 1EEXA 3CHEA 2EEXA 2V69A 2R91A 1ZZMA 4FS9A 3FAWA 3LCHA 1HL8A 4HU8A 1GOMA 3UBPC 1PCKA 3MA8A 1WKFA 5HPCA 4H01A 3TA6A 1M01A 3M5ZA 3MI6A 1M53A 5CLWA 2PWUA 4AZGA 1DIOA 2DUXA 3GDBA 3PSVA 4GBUA 1XX1A 4UOQA 4L4PA 2NQLA 1Q6FA 5DBTA 4M6VA 2FZDA 3BG5A 4LCQA 3RJXA 2CZ5A 1IEVA 3KBNA 3T0CA 3GNDA 1V6TA 1KFJA 2DJXA 3L5AA 1OFPA 1LP6A 4RL3A 5LGXA 5M2FX 1TTIA 2ZFAA 5E0CA 3DZ1A 1ZCOA 1DKWA 2EPKX 3MPGA 4K3ZA 3N3MA 3HN3A 4ZODA 1FWBC 1H7XA 2R24A 3SQSA 4KT2A 2E7FA 1UZHA 1ADDA 4RDWA 3KHJA 3GYEA 3IS4A 3QZAA 3VGFA 2DT0A 1R46A 3W7DA 1V03A 3AMLA 1GZJA 1HQTA 1OGSA 5KTLA 4O11A 1V5XA 3NM3A 3WELA 1MXDA 1JIBA 4NXSA 4AY8A 1B3WA 3GUGA 2QDGA 4XSLA 1H11A 1FWIC 3CH0A 4GXPA 4QJ3B 2PDLA 3A4AA 1YXDA 1IEXA 3VIHA 3P93A 2A0NA 5LNWA 3WH7A 2Z1BA 3CAKA 4A3YA 4H6RA 3WUGA 1NFBA 4V27A 3LRMA 1L6GA 3MKVA 3RM4A 1RK6A 4LNCA 3OO2A 3VNKA 1NARA 4NAFA 3R94A 3W6LA 1EZ2A 3KBWA 1GPFA 1FXPA 5DMLA 3QFWA 3WJYA 2F9RA 4DX3A 2Q01A 1DJQA 3KRBA 6TIMA 4ZOBA 4BS0A 1S3TC 4O10A 4TTUA 3PBWA 3D5HA 4Q8MA 2BVWA 1VC4A 1XH2A 3CQIA 2AOSA 1V0NA 3W00A 2A3CA 1UC4A 3TKFA 4AHOA 1SW7A 1VP5A 2ZIDA 4C6EA 3LUTA 1HP4A 1I60A 1P0KA 3K46A 1HIZA 3A4XA 5CAHA 3AHTA 1PDZA 3RPTA 4AG0A 3LLXA 3RR4A 4AMAA 1PL9A 1FWRA 4MY1A 5BRQA 3ONCA 3SN1A 1K4GA 1V6XA 2BXVA 5I09A 3A3HA 3PHAA 1SO6A 2Y5SA 3W25A 4AC1X 1JEZA 4XD3A 4PMRA 3TN6A 3S2LA 2FGZA 3MQTA 4FMVA 2YXOA 3UZZA 1RHCA 4KRZA 1NEYA 3TSBA 3EWWA 1TUXA 3UJ2A 4GQBA 5ECVA 4O1EA 1M3UA 1A5BA 1GVEA 4L56A 2VZOA 1LQ2A 1AZ1A 3R79A 3AXMA 5EMYA 2YL6A 2GYIA 1Q6LA 1B9ZA 3HMCA 1C9WA 4NJKA 3W7RA 1EBGA 4QG6A 4QTGA 4FXRA 3G3DA 3E0LA 1IE7C 3LSCA 1GKQA 3D6NA 1E56A 3CV2A 1VHCA 3T78A 4AD5A 3ZMRA 3B97A 2Z7KA 2Y1HA 5A8PA 2DSZA 1YPXA 4CD5A 4XBKA 4GYPC 4NYUA 3TYAA 3O16A 1N8IA 1JZ7A 1C90A 1Q6OA 1KTCA 1YTEA 4MUZA 5G2IA 4WK9A 2ZCGA 1UP3A 3CO8A 4F48A 3EXRA 3UNDA 2OOFA 5I79A 3KOYA 4JNMA 5I3HA 2BP1A 1UIPA 2XZ7A 3EKGA 4X9SA 4Z2KA 2F6UA 4DZAA 1XGDA 1WKEA 2EJAA 4OTKA 3ITTA 1VIWA 2VEPA 4UNKA 4JOMA 2A3HA 4MPQA 1UASA 3DI0A 1NH6A 5FOOA 2YDAA 3PJXA 3KCOA 3K8MA 3LG3A 2ONEA 2PBOA 3BLLA 1WZKA 3VC6A 2D0HA 4LPCA 5T8GA 4M19A 1XIMA 5GNZA 4GFSA 3KFTA 3VUSA 2FHCA 4C6KA 4ZQCA 4YCOA 1FDJA 5CSRA 3AZRA 3AS3A 3PSWA 4IQJA 3WLMA 3WH9A 4O13A 3S6DA 4AUBA 2WMJA 2P53A 2ESCA 1GYNA 2VKZG 4RZ6A 3OB8A 1UW9A 3LI0A 3EGJA 3DG7A 4GXWA 4EX4A 2GWNA 1XDLA 2JF7A 3M47A 4XWUA 2Z6JA 3ZVHA 5AYYA 3AXHA 3FFSA 1DXFA 1XS2A 1JPMA 3STEA 1EC9A 4F40A 5IFTA 2IXUA 6TAAA 4Z2HA 1XM3A 3QTGA 7A3HA 2C1HA 2HRWA 4BQ5A 3PTKA 2CIPA 3LM7A 4BR1A 4Z2LA 3TTOA 1PVNA 2PDBA 1CGWA 3TK7A 3KM8A 1SSDA 4FEZA 4TU1A 5FSDC 3BSHA 1W3LA 4H19A 3TYDA 3LLDA 3WJZA 3V5CA 1ZSXA 3L2IA 4JFWA 2BOEX 4JTDA 4MGGA 1EJTC 4B9ZA 1ITUA 3R43A 4MAZA 4Y96A 1E6ZA 4CLMA 3VI2A 4OBSA 2ZXQA 3RMJA 3CPGA 3GDTA 1SM9A 5JMUA 2JKAA 3WUFA 1D3GA 1RPKA 3E2RA 1KKOA 4MWAE 5HR6A 2J7FA 2F6KA 4HOXA 3SQMA 2WC7A 3VGGA 3QPZA 3GHTA 3USZA 4DYJA 3AIVA 2OYMA 3AQUA 3B0UX 3RR1A 2VC6A 4DO6A 1M5WA 1R85A 3UA3