4ATLA

Crystal structure of raucaffricine glucosidase in complex with glucose
Total Genus 183
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
183
sequence length
501
structure length
470
Chain Sequence
NDATRISRSDFPADFIMGTGSSAYQIEGGARDGGRGPSIWDTFTHRRPDMIRGGTNGDVAVDSYHLYKEDVNILKNLGLDAYRFSISWSRVLPGGRLSGGVNKEGINYYNNLIDGLLANGIKPFVTLFHWDVPQALEDEYGGFLSPRIVDDFCEYAELCFWEFGDRVKHWMTLNEPWTFSVHGYATGLYAPGRGRSTGNPGTEPYWVTHHLLLAHAAAVELYKNKFQRGQEGQIGISHATQWMEPWDENSASDVEAAARALDFMLGWFMEPITSGDYPKSMKKFVGSRLPKFSPEQSKMLKGSYDFVGLNYYTASYVTNASNFSYNTDIHVTYETDRNGVPIGPQSGSDWLLIYPEGIRKILVYTKKTYNVPLIYVTENGVDDVKNTNLTLSEARKDSMRLKYLQDHIFNVRQAMNDGVNVKGYFAWSLLDNFEWGEGYGVRFGIIHIDYNDNFARYPKDSAVWLMNSFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords RAUCAFFRICINE-O-BETA-D-GLUCOSIDASE
publication title High Speed X-Ray Analysis of Plant Enzymes at Room Temperature
pubmed doi rcsb
source organism Rauvolfia serpentina
total genus 183
structure length 470
sequence length 501
chains with identical sequence B
ec nomenclature ec 2.4.1.219: Vomilenine glucosyltransferase.
pdb deposition date 2012-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4atlA00
4M1RA 1OB0A 2C0HA 3NDZA 1OWQA 4MJ4A 5JBDA 2WC3A 4MNLA 3IK2A 1R7AA 3VIOA 4XZWA 1D7FA 1KR1A 1UR0A 5FIPA 4CCDA 2GUYA 2XM2A 2VRJA 3CUGA 4FK9A 3K1DA 4UQDA 4UTFA 2F61A 1LG1A 1CXIA 2NT1A 2XWEA 2XVLA 1B2YA 1GOOA 1U2YA 4PUDA 1JXKA 1BLIA 3BC9A 2WNWA 1EDGA 4P8WA 4FLQA 5GPRA 3WN6A 4GZJA 1G01A 5JBEA 1W1TA 3ARRA 2WANA 5D4YA 1J01A 3W0KA 4LX4A 3WUFA 1G9HA 2ZWZA 4UZSA 2GJRA 3VGHA 2F8QA 1M53A 3CUJA 3L4YA 3GXDA 2QPSA 4J3TA 2J47A 3VD3A 4D6IA 2CERA 1DHKA 1VEOA 1GJWA 1NOWA 4F9DA 5CZKA 4PMOA 3F4VA 1H41A 2BHZA 3O6AA 2VZTA 3NYDA 3A4XA 4IPNB 1UR9A 4LPCA 4LQ1A 3QR3A 5IXEA 5FCZA 1CXEA 4W5UA 3WSUA 4AZHA 2WSPA 4CN6A 4Q7NA 1E4NA 4WLCA 5A8QA 2VCAA 4JIEA 1E72M 1W9XA 1R87A 1Y7VA 1V3KA 3APGA 2GJPA 1PPIA 1V08A 4JHZA 2XTKA 1WCGA 2CBVA 4N42A 4AY1A 1KGXA 1EDTA 3MUAA 1C3FA 5JIWA 4R27A 1KQZA 3ALGA 4EAMA 5BYWA 2XIIA 1E6XM 4UQ9A 1IZKA 1ZL1A 1UR2A 4HTYA 4B3KA 3OBAA 3AS0A 1VBRA 3AMKA 1YHTA 3SCSA 4F79A 4OKDA 2CHNA 2J7FA 2C8NA 1UKOA 3S2CA 1Q6DA 4AD4A 3T08A 2XSAA 5FL0A 2G41A 5I24A 3ECQA 2A3CA 1U33A 2QLYA 5A6JA 4W89A 1NQ6A 1BTCA 2HISA 3WUGA 2WC4A 1I75A 5DT7A 4KMQA 1QBBA 1E0XA 1VEMA 3GZAA 3L4UA 2JEQA 1E56A 3N18A 3RDKA 4PMRA 1DWJM 3AHXA 3ARXA 5EFFA 2G3MA 1WDSA 2WKLA 1EA9C 4W84A 1GOKA 4GI8A 2J62A 3WF2A 1HX0A 2G4FA 2QPUA 2AMGA 3CUHA 2IXVA 2X8RA 2VVNA 3A4AA 5BXSA 1VFUA 5TD4A 7A3HA 4FLOA 4JFWA 4OOZA 1EQCA 4HPGA 4RL3A 1CGYA 2VT0A 2JE8A 4M80A 3WFLA 3PZNA 4QLKA 2BNJA 4DM2A 4HZ6A 2ZXQA 3VO0A 1KXQA 3VIFA 1HJUA 1X6LA 3HN3A 1JD9A 1E55A 3DC0A 4DWSA 3VPLA 3OLDA 2Y5EA 1MWOA 3CTTA 1H0GA 3TTOA 4UQAA 1ODUA 2GJXB 4ACZB 2J7BA 5C70A 4KRUA 4P7QA 1E5JA 2A3AA 1HN1A 1JYNA 1ZU8A 3BLPX 2DT3A 2E8YA 1KGWA 2YIHA 1JGIA 2VCBA 4UOZA 3VINA 3AZTA 2OWXA 3MV11 1FHDA 1B3VA 1CLVA 3RM8A 1MFUA 3EMQA 1HJVA 1UH3A 1JDAA 3FAXA 3WDIA 1GQLA 2Y24A 3DYMA 2J25A 1KBKA 5E6YA 3TP4A 2D2OA 3K4AA 1GCYA 5GQBA 4AD0A 2D3NA 1J18A 2BY3A 1VJZA 3A6OA 4HZ8A 4B15A 1UR1A 3OZOA 3VOCA 3VMPA 3VIPA 2CKRA 3VUPA 4CCEA 2E9MA 2WVUA 1GQJA 4W7VA 1GOIA 3OGRA 1C8YA 2DSWA 1BYCA 1NOFA 3EDJA 3BLKA 3AXHA 4D6FA 2ZUTA 2HVMA 4UOQA 4MNJA 1CXLA 1GHRA 4U3CA 3WF0A 1JF6A 3ZO9A 4Z2KA 3WY1A 1KFWA 2DDXA 1L0PA 2X0HA 5JUVA 1R85A 5A8PA 3S6TA 1MQQA 2WMKA 1KQYA 4GO9A 3WD0A 3OG2A 4QLJA 3VGBA 2VL4A 1LWHA 4GZEA 4GIAA 3MUY1 2DH2A 3WQWA 4NF7A 2TAAA 4MB4A 3U57A 4AIOA 4ATDA 4W87A 4MDPA 2OSWA 5BXPA 4AZCA 4D72A 1WB0A 1ISWA 1R8LA 1Z32X 1N82A 3AI0A 3AXIA 3VDBA 3WQ4A 4CVUA 3WQ6A 1PX4A 4M8UA 4E2OA 1RP8A 3SCOA 1PAMA 2BFGA 2JEPA 2ZIDA 1GPFA 5E6ZA 1V3JA 4PRWA 1BVNP 1DWGM 4D6JA 4KGLA 3VDHA 1VBUA 1OT2A 1OSEA 3U5UA 1WPCA 3EDDA 4J27A 3AYRA 4PCSA 2V3GA 2YA1A 1TFVA 2CHOA 5M5DA 4ATWA 3LPFA 3VGEA 1C92A 3OA5A 3KL3A 2A3HA 4QLLA 4Q22A 1E71M 3BCDA 1Q6GA 4RE4A 2OWWA 4PSRA 3VD5A 3W6LA 2BHYA 1SYTA 2QMJA 4HZ7A 2YL6A 1UWRA 4HP5A 4MTVA 4YHEA 3PZGA 1SMAA 2GFTA 1XH1A 3IAPA 4A3YA 4F66A 4X9YA 1V0KA 5E9AA 4MB1A 4QDMA 1W3LA 4X0NA 2CBJA 4W8BA 3CZJA 4TVDA 2PWGA 3T0DA 1HKMA 2W91A 1CXKA 2PWEA 2PWDA 3PZUA 1DEDA 1UKPA 2XUCA 3GYCA 4OOUA 2J79A 3ZT5A 2O92A 2ZX9A 3ZT7A 3GNOA 1MXGA 3AZSA 1CEOA 3RJXA 2OWCA 3U5YA 4HMDA 2WBGA 4QCFA 3POHA 2WHJA 3SIMA 1Q6FA 1EGZA 1V0MA 2DSKA 3NSXA 1KGUA 1WKYA 2V5DA 3AIUA 1XCXA 1K9TA 2GSJA 5GNYA 4PMUA 1CGWA 1UWTA 2VZSA 3VKKA 1UZ1A 1ITXA 1C8QA 2IUZA 2YDQA 1E4IA 1HIZA 2J78A 2EPKX 1OD8A 1QHZA 3EYPA 2JF7A 3UG3A 3I3DA 1ITCA 3DHUA 1LF1A 3WNNA 1G5AA 1JDCA 1BVZA 2DSUA 3K8KA 5LA0A 3QHMA 3T2PA 5A8MA 1ODZA 1QW8A 1JYXA 3NIYA 4B3LA 3W37A 1PEZA 2PWFA 2ZUWA 2BVTA 3ZJKA 1E6PA 4CU6A 2VTFA 5A6AA 1MW0A 4V28A 1CGXA 3SCPA 1W1YA 1XSKA 2V3EA 2WWCA 3VDCA 3CIVA 4AZ7A 2Y4SA 3WNKA 5I78A 2EBNA 3AHZA 2VRQA 4CD6A 2NW0A 3SCTA 3ZJ8A 5HDRA 5A3HA 4B9YA 2DT1A 2J7HA 4F8XA 3N1AA 2ZXDA 2X0YA 3G6MA 4H2CA 3ZSSA 3VGGA 1GNXA 3BGAA 1QHOA 3AROA 3AHYA 2XVNA 2X05A 1E70M 5BRQA 1W3JA 1IZJA 4NRRA 1US2A 4Z2HA 4QCEA 2WW5A 1UWIA 1WZMA 1XV8A 1J0ZA 1JF5A 4UFKA 3GBEA 2ZX6A 1UQYA 2DPEA 5D9NA 1Q6CA 2VR4A 4UFMA 4U5IA 5DEZA 2WMFA 1MQPA 3W53A 5A69A 1FP8A 1BG4A 8CGTA 1D2KA 1CYGA 4CD5A 3TTYA 5DO8A 1G1YA 2DEPA 4BQ2A 3FY1A 4NSBA 4LYQA 1NWUA 3ARUA 5IFTA 1KBBA 4J3UA 1JL8A 1E6QM 4LYRA 2W61A 3NJ3A 1BQCA 3O9NA 5CPQA 5DT5A 3ZMRA 1EHNA 1NH6A 1AMYA 2FHBA 3A4WA 3GXMA 4D6HA 2D23A 3AIQA 4BA0A 1FH9A 4DWSB 3W4RA 1GOMA 5A2BA 1WZAA 2O9TA 3WUBA 4D1JA 4AZ6A 3GNRA 1QHPA 5D8WA 2DH3A 3EBVA 4P8XA 3WFZA 3K46A 1HJWA 4E8DA 2GDVA 3N04A 2BVDA 2A3BA 2CETA 1UKQA 3ZR6A 4PN2A 3SUVA 1JFXA 1J10A 1QNOA 1FP9A 2EXOA 4WKFA 2A3EA 3ZT6A 4PMNA 1G94A 1CECA 3WQ8A 1OINA 1WDRA 3W38A 4AZIA 6CGTA 4UQBA 4BQ3A 1G0CA 4WF7A 4TVCA 3E1F1 5FOOA 2VZUA 4A3HA 2WHLA 3OGVA 3ZJ6A 4JAWA 4XB3A 1E5NA 5EB8A 3I3BA 1VENA 1O6IA 3GXFA 1BG9A 1FA2A 3AISA 1PBGA 1GOWA 3MANA 3CHDA 1W2VA 2PBOA 2XVKA 3QOKA 3L4WA 4JZ5A 1TE1A 1WE5A 1JZ4A 2WKGA 3EMZA 1E9LA 3WMBA 3AIWA 4PBGA 2E40A 2ZUMA 3WEMA 1DWFM 5KZ6A 2FGZA 4OUEA 3WBEA 4UOJA 3VX1A 1NP0A 2YA2A 3W82A 3CZEA 1QVBA 1XD1A 4GZIA 3ARSA 5D9MA 3SCQA 3AIVA 3WH6A 1XC6A 2VNCA 3WMSA 3W81A 4J3VA 2EQDA 4PMXA 3WH5A 3MMWA 3WUEA 2VQTA 3CO4A 1UD6A 1TG7A 4HA4A 4PSPA 3T09A 3W27A 1UWSA 4U3AA 2XFYA 1UWQA 4PTVA 2CCRA 4ZE5A 4J3XA 4AZCB 3MU7A 1E3ZA 1RD6A 1XHGA 2EPNA 4HOWA 4AC1X 2CIPA 1TA3A 2PWHA 5I23A 1ZB5A 3OIHA 4URIA 4ZXOA 2VURA 1CGTA 2EJ1A 1ZBKA 1P6WA 4TTGA 3NSNA 1QI2A 3F5LA 5A6BD 4XZBA 3WBAA 3VIGA 1R86A 4FLRA 1E6RA 1QW9A 5D8ZA 2WK2A 1CNVA 1IV8A 3VD4A 2D0FA 1OCQA 3PZIA 4JKMA 3SUTA 1A47A 1JYVA 4OBSA 1VJSA 5IHSA 1E0VA 1EOKA 3L4ZA 3BAWA 2YL9A 5E09A 3DYOA 4KH2A 5I77A 3L4VA 4HMCA 1HF6A 1UZ4A 3WL0A 4CD4A 3RIKA 1CGUA 1JXJA 3BMWA 5A6MA 1FH7A 3KWXA 1LLOA 5A1AA 5LYRA 2CNCA 2WBKA 1V6XA 3GXIA 4PTWA 1JD7A 2BVYA 1KCKA 3VTRA 2Y8KA 1E1FA 2DT0A 3GH4A 3WNOA 1YQ2A 3CUIA 2YJQA 2JFEX 1S46A 3PTKA 3SURA 5A8NA 1UUQA 3GBDA 3K4DA 3RMEA 1UD2A 1C7SA 2WZHA 3AYSA 5AY7A 4D1IA 4B16A 3PN8A 1GJUA 1RP9A 2YLAA 4HPHA 3EDEA 3WELA 2W4XA 1HJQA 4WKAA 1UKTA 1L8NA 2UY2A 4HOZA 3AHVA 3PZQA 1BYAA 4RE3A 2PB1A 2XFRA 4R5EA 2XPKA 5BXTA 2PI6A 2V5CA 3UETA 2V3FA 3WH8A 4ZE4A 2FH8A 3N13A 3WH9A 4MB3A 4CKQA 2J7DA 1NM9A 3VILA 3LMYA 3WENA 3WF3A 4C7FA 3SCVA 1B0IA 3B9EA 4L4OA 1Q4NX 3VDAA 1ZJBA 2OYLA 1ISXA 1JZ7A 3WD4A 4P7RA 1KCLA 4Z2LA 1V6YA 4C7DA 3DECA 3VD9A 4WJXA 3VD7A 1E4MM 2XG9A 4MNKA 2JALA 3AZRA 5D9PA 3VIIA 3VIMA 3GH7A 1JFHA 2W63A 5EMYA 4GQQA 2ZUUA 5E70A 3UEQA 1TVNA 5E0FA 3CZLA 4YN5A 1JNEA 1W32A 1JZ2A 3M07A 1DWIM 2WC7A 1ZBCA 1W3HA 1NWSA 2DT2A 4W8LA 1XH0A 1BGAA 1I1XA 3M46A 2IXUA 2GK1A 4U2ZA 2BV9A 1V0LA 3VX0A 1UOKA 3TTSA 4M81A 4H8HA 2JIWA 1J0IA 2VC9A 3PZOA 1UH2A 2UY4A 2J75A 3WD3A 3BSGA 1B1YA 2WCSA 2ZOXA 6TAAA 1EHAA 3MUZ1 1X1NA 2XGBA 2XVGA 2ZX7A 1X6NA 4AZGA 4W93A 3MMUA 1V3LA 3AMCA 2PBGA 2WZIA 2WMJA 4AEFA 2W62A 4D6CA 3THCA 2CYGA 4OIFA 2BXYA 3VGDA 3WNPA 3D3AA 3WKZA 3WEZA 4EK7A 4H8VA 4QFUA 5BCAA 2E4TA 3ARZA 4K68A 1OBAA 1XYZA 1JZ6A 2QF8A 2XJ7A 5HBFA 2NSXA 1Q6EA 3KL5A 1GQKA 3T0BA 3PZVA 1J12A 1E6NA 4W7WA 3MSDA 4BQ5A 5I3DA 1XCWA 2C7FA 2ZX8A 4HA1A 1CENA 3WIJA 1CPUA 3QGVA 3M7SA 1W91A 2XWDA 2XFFA 4AD1A 1K6AA 1UD4A 1OIFA 3ZIZA 4CD7A 3MV01 4JL1A 4HMEA 4H8UA 5C71A 4U31A 1QNRA 4F9JA 2VX6A 4PMVA 1GQIA 3NCOA 1MW2A 4MDOA 3AIEA 4CCCA 4M82A 1OT1A 1W9PA 3K8MA 1M7XA 5LA2A 3IJ8A 4M24A 5FL1A 1FFQA 1LQ0A 4PTXA 2D0GA 1WDPA 1UD5A 4IM4A 4HU0A 3IANA 1H1NA 4MPKA 1A3HA 4YPJA 9CGTA 2WVSA 1W2PA 5HOSA 5I5RA 1JG9A 2EPOA 3DYPA 1MFVA 1JI2A 4LXFA 4WIWA 3WD2A 2VOTA 1KWKA 1TVPA 1MQRA 4AISA 1QI4A 4Z2IA 4PUEA 1BYBA 4BQ4A 3ALFA 4D6DA 2VO5A 2CBUA 4DUXA 1W9VA 5A6BA 3AJ7A 5A2CA 3FW6A 4RE2A 5CGTA 1B3XA 3KEHA 5HNNA 1B30A 4S3JA 1VF8A 3ARWA 2FGLA 4FF5A 3MSGA 2WZEA 3MS8A 1V02A 4AIUA 2Y2WA 3CMJA 3ZR5A 1XSIA 5I6SA 4BF7A 1CXFA 3N12A 3PTMA 2G3JA 2OYKA 1CDGA 1VIWA 1WZLA 5FKYA 4JCLA 4WKHA 2DQXA 3FHAA 4D71A 1TMQA 1EO7A 1QOXA 1BHGA 1PIFA 5I79A 1CIUA 1D3CA 1K9EA 3NSMA 3CMGA 1W9UA 5AC5A 4PCTA 1QI3A 1OGBA 1UG6A 1TA3B 1H5VA 2D20A 1GONA 2CKSA 3T2OA 4OJYA 5CLWA 1XRVA 2D0HA 3BSHA 2ZICA 1VEPA 5CSUA 2NT0A 3WF4A 4V2XA 3TA9A 2J7GA 2YDRA 1QNPA 2QHAA 2QV4A 2VZVA 3CPUA 4CVWA 3KZSA 2W5FA 5DFAA 1LL4A 2YA0A 3UERA 3KE0A 3ZSTA 1QPKA 4CU8A 1JZ5A 2VMFA 3EMCA 1RH9A 4AD3A 4M29A 5A6KA 3THDA 4JKLA 4GO8A 3WH7A 1V0NA 4CU7A 2QMKA 1FHLA 3B8SA 4MNMA 2D3LA 3W29A 1H2JA 4X0VA 3LPPA 1FH8A 2VQUA 4JL2A 3JUGA 4IISA 1J0HA 4W8AA 2Y8VA 1M04A 3QHOA 3K8LA 1E43A 3WDPP 4PMYA 1PIGA 3CZGA 4DM1A 1ZJAA 1IT0A 3B9AA 2G3NA 1HJXA 4AW7A 3W28A 4CD8A 3AFBA 4PMZA 2CXGA 1B90A 1M03A 4J7RA 4UCFA 3HU7A 4HOXA 1VFOA 2X1IA 3MUIA 2F2HA 1ISZA 1OM0A 1KR0A 5BXRA 2BHUA 4XUYA 3AOFA 5JIPA 4D6GA 2W92A 2VCCA 4EKJA 1DWAM 4MAVA 3N9KA 5A8OA 4H7VA 3UR8A 1KB3A 1GVIA 1HKJA 5LA1A 3EDKA 1UYQA 3VNZA 2DSZA 4N0RA 4AD5A 4OZOA 1HL9A 1FOBA 3BAXA 2ZX5A 3IJ7A 3VIHA 3RJYA 3CLWA 1JIBA 4CN1A 4W88A 1UD8A 4JCMA 1FFRA 1WZKA 1LJYA 2WVTA 1LWJA 1LG2A 3WDRA 1HVQA 1V3HA 4Y7EA 5AYIA 1H0IA 4TXEA 1VAHA 3WNMA 1TR1A 3OGSA 5JBFA 3BAYA 4U33A 5HXMA 3AMGA 1V6VA 3CHFA 3ZQ9A 1NWTA 4ZENA 2YOCA 4D6EA 4W86A 3N11A 2WAGA 1JAKA 2CITA 1XD0A 2D1ZA 2FDMA 1JZ8A 5GNZA 2UY5A 1GW1A 1C7TA 5ABHA 2WLYA 2YLLA 1ZS2A 1CLXA 1VFFA 5C8BB 1XSJA 4KRTA 1PX8A 1SMDA 2XHYA 1EQPA 2EPMX 3L2LA 3POCA 4GXPA 5CQ1A 3PZ9A 1HNYA 3F5KA 3BAJA 3WQ5A 1WO2A 1R7OA 2GK1B 3L4TA 1CXHA 1E0WA 1JDDA 4MADA 3VIJA 1MYRA 5ECUA 1WP6A 4DUWA 2PC8A 1EOMA 2WCAA 1HP4A 3AMLA 2FHCA 3KL0A 2CESA 3HMCA 5ABFA 3FAWA 2EPLX 3EDFA 1UHVA 3WL1A 1BSIA 2YL5A 3MO4A 3WDJA 1BGGA 4UFIA 2WSKA 3TOPA 3WDHA 5HPCA 1V6UA 3ARQA 1C91A 4GI9A 2WWDA 4AMCA 4GKLA 3PZMA 3OB8A 4U5KA 4C7GA 2ZE0A 1WNOA 1OD0A 3AIBA 1HJSA 4Z2GA 2BY0A 3T2QA 1EH9A 1OGGA 1J0JA 1NARA 1KXHA 3CHCA 1E73M 4AXNA 3G6LA 1QI0A 3HJEA 1U30A 3SUSA 3VIKA 4UQEA 3RM4A 4H04A 1UA3A 3CZKA 3AICA 3W25A 5M17A 1TUXA 1JNDA 1F4AA 2CEQA 1RPKA 1W3KA 2UWFA 5E0CA 4UNIA 3VNYA 3MMDA 1AQMA 3RCNA 3L4XA 1MW1A 1W1PA 4PMDA 2WB5A 4GI6A 2J7CA 4KGJA 2Z1KA 1PZ2A 2ZWYA 2WVVA 5A2AA 4OBRA 1V3IA 4BS0A 2BS9A 4UFLA 2O9PA 1M01A 1V3MA 8A3HA 4FLSA 4NRSA 3AS3A 4TTUA 2B31A 3I3EA 3OLGA 4QP0A 3AQUA 2WM0A 4E8CA 3ARTA 1H49A 1V03A 4WK9A 3ARVA 3VM7A 4MB5A 5A94A 2V38A 1WAWA 1J9YA 2DGAA 3D5HA 2ZUNA 3IJ9A 2O9RA 2GDUA 1MW3A 2WMIA 1BF2A 3BMVA 1CGVA 4DUVA 2EO7A 4GINA 2WMGA 2VX4A 1SR0A 1QBAA 1OGSA 3VU2A 1GUVA 3II1A 5AYBA 4ZFMA 2X09A 4E4PA 2VZOA 1GZJA 2CPUA 1OIMA 1B31A 4M56A 5IHRA 3FN9A 2BXZA 3ARYA 2W66A 4KWUA 4HA3A 5M3WA 2UY3A 2E3ZA 3CGTA 3AHTA 5DMYA 3ZM8A 4P8UA 3VVGA 3ARPA 1NOUA 4J3SA 1CTNA 4B9ZA 3AS1A 5CJ5A 2J8GA 4W85A 3IAQA 4LGXA 3WNLA 4XV0A 4AIEA 3VGFA 1UR8A 4P7NA 2XIBA 1WDQA 1E1EA 4ZXLA 1XGZA 3AXXA 3W6MA 2FHFA 4BZYA 3WD1A 1HVXA 2J74A 3GDBA 2ESCA 2YDSA 4J3WA 5I2UA 1EXPA 1UKSA 2OSXA 4MAZA 5CLTA 1E4LA 6A3HA 1C90A 5A95A 2X2YA 3BH4A 4AWEA 1EO5A 5BROA 1DWHM 3NDYA 3UG4A 1W1VA 1BFNA 2XYLA 2E9BA 5CPTA 4ML4A 1JAEA 1UWUA 3UESA 5A6LA 5CG0A 4JFSA 3AS2A 4LYPA 4PEEA 1AQHA 4CUCA 3U7VA 1VRXA 4EE9A 2G8ZA 7TAAA 4UFJA 3WDQA 4AEEA 2W67A 3FNDA 4PMQA 1CBGA 3VMOA 3T0AA 1QNSA 5HPOA 4CN4A 4FMVA 2XM1A 4H41A 1ISYA 1ZBWA 1J11A 2YKKA 1TCMA 2WXDM 2WLZA 3FXYA 4TOQA 4J28A 3B9DA 1CWYA 3PHAA 3LPGA 4P7OA 2YBTA 2O9OA 1UQZA 1PJ9A 4P8VA 3RM9A 2WPGA 1GOQA 3WEOA 5CGMA 4EANA 2EEXA 4JFUA 2VVSA 2ZUSA 3WMCA 4UR9A 4YHGA 1E6ZA 1HXJA 5A6SA 4CGTA 2ZXBA 1I1WA 3W26A 2OYMA 1HT6A 2J77A 2Z1SA 1DP0A 4ZEPA 1MVYA 5CSYA 3CHEA 4L4PA 3U7BA 3CBWA 2WHMA 4WSKA 1J0KA 1DTUA 1UR4A 2E0PA 3QOMA 1MXDA 5FD0A 4JKKA 3CH9A 4PYSA 1H4PA 1E3XA 2ZXAA 4U2YA 1K9DA 1B9ZA 2BY2A 1B3YA 4S3KA 3SCRA 1JI1A 3BXWA 2AOSA 1LL7A 2E9LA 4A4AA 4GPNA 4AZ5A 1UH4A 1UD3A 3SCWA 1V02E 2ZUVA 3WQVA 1E6SM 2OSYA 1KWGA 3UG5A 3F5JA 4PTMA 2CBIA 4UQCA 2YBUA 1BAGA 2WMHA 3A47A 4P7LA 4GQRA 3GTNA 3SUUA 1KXTA 4V27A 3LPOA 3TTQA 4TX6A 3TONA 5I0DA 1EIBA 3QHNA 1TZ7A 5ABGA 4AZBA 4IPLA 3ZOAA 4BCEA 2RGLA 1CZ1A 1C8XA 1HKKA 4TX8A 4QAWA 1B3ZA 1W9DM 5AC4A 2E8ZA 3W24A 4W7UA 4AD2A 1AVAA 1ESWA 3A3HA 5ABEA 4TUFA 1XYFA 2J8FA 3UR7A 1EDQA 3OZPA 5ABFB 2MANA 3PBGA 2AAAA 5EFDA 4HU8A 2PF0A 2VJXA 3SEPA 1NP2A 5CPSA 2D22A 4NI3A 3L2MA 5EBAA 4JFVA 3N15A 2RGMA 5IFPA 2DIJA 1US3A 2GJXA 4ACZA 3UCQA 3RPMA 2FH6A 1E15A 1B3WA 4WSJA 4DWSC 2Q8XA 5GNXA 3SCNA 2OLHA 2DIEA 2WYSA 3CUFA 1GHSA 3GH5A 5D9OA 2G3IA 3J7HA 3SCUA 4JHOA 1LL6A 2WCGA 3PZTA 5KEZA 3AMDA 1ISVA 2YL8A 3GM8A 2XVPA 1H11A 4UZUA 1K9FA 3GNPA 1JZ3A 3RILA 3OLEA 5BRPA 1VFMA 5BWFA 1HL8A 2VR5A 3DHPA 3O2LA 1W9BM 3NUKA 2DSVA 4JFTA 4NZCA 4DWSD 2WHKA 1SFSA 2VX5A 1JYWA 3VM5A 2WVVB 4IUGA 2XSBA 1O7AA 4MJ2A 1J0YA 2J4GA 1VB9A 7CGTA 2JF6A 1XH2A 1NWRA 3ZJ7A 4Z2JA 3VMNA 1HKIA 3BAKA 3SUWA 4UFHA 1UA7A 3BAIA 3PTQA 1H09A 2VI0A 2V3DA 1QI5A 1ECEA 2VRKA 2D24A 1GVYA 5CXPA 5DF0A 1PZ3A 4TVUA 4W5ZA 1C93A 4ACYA 1F4HA 3FHQA 1BYDA 1KXVA 1H3GA 5M03A 3OLIA 2WMIB 5IDIA 1QNQA 3AIRA 2XGIA 2BY1A 1E40A 1AQ0A 2VX7A 1ZBVA 2GVYA 4XX6A 3MKKA 5F7UA 3BCFA 3M6DA 3RO8A 1GORA 4ATLA 1PX3A 1HP5A 4AYSA 2VUYA 3CZ8A 3N17A 3WF1A 2JIEA 1BPLB 1V6WA 2J7EA
chains in the Genus database with same CATH superfamily
4ZZ9A 5FACA 1OB0A 2C0HA 4EVZA 1K7FA 1R7AA 2J88A 1D7FA 4O8AA 1UR0A 3AWOA 3F4NA 3EX2A 3B9NA 2XM2A 3K1DA 4RZ5A 3G0UA 4GG9A 4UTFA 1LG1A 2NT1A 1GOOA 1H63A 1JXKA 1BLIA 3KVMA 4UMCA 2HZGA 4A8IA 5I07A 4N9CA 2NV9A 4P8WA 3WN6A 4GZJA 5JBEA 3N2BA 5DN1A 4A8NA 1E1CB 4PA8A 4DF1A 3LXBA 1G9HA 4YJ5A 3PSVA 3PTDA 3N6HA 3NO3A 1MDRA 1M53A 3B9OA 1M65A 3EZ4A 2CW6A 2XU2A 2X40A 4QS5A 4J3TA 3MW7A 4D6IA 3OOQA 1DHKA 3NVTA 4PMOA 4JXCA 5FJIA 4B5NA 1BKSA 4JD4A 3RUBL 4JTTA 1PZ1A 1UR9A 4IPNB 1O94A 3QR3A 2CZDA 1YTKA 3W73A 1CXEA 1VFTA 1HG3A 3S6OA 5FESA 2WSPA 3NQAA 4XISA 2VCAA 3WLNA 3O7UA 3ZZ1A 3TFXA 3S3GA 1C9DA 3IRSA 2PFHA 4L1WA 3LCHA 3UPWA 4C65A 1V08A 4DB7A 2R1MA 4JHZA 1ZFJA 1WCGA 4N42A 3G22A 1KGXA 2ATSA 1PYFA 4EAMA 5BYWA 4NNAA 3TR2A 1TPH1 1ZL1A 3URNA 1L6FA 2Y7GA 2Z6IA 4IG2B 3OBAA 1RVKA 1CB2A 2PAJA 4F79A 3UXDA 4G7EA 4H01A 2J7FA 4GCAA 4IP4A 5F4XA 5BRBA 3S2CA 1Q6DA 3LERA 3T08A 3VAVA 1TJRA 1IR2A 1VYSX 1PL9A 2OZ8A 4O10A 4DBSA 1YKWA 4FALA 3Q2DA 1W17A 3ELFA 5BU6A 3N18A 4I6VA 4KFOA 1DWJM 1S3TC 5EFFA 2WKLA 1X6UA 1EUNA 4A22A 3M0XA 5D03A 3R79A 2YCLA 2ACUA 2PDBA 1FHUA 2W79A 3VXGA 2X8RA 2I7GA 3MP4A 1MRAA 5TD4A 2Z6JA 1OJXA 4NYYA 4OOZA 5LHFA 3IS4A 4HNNA 2WJEA 1Z41A 4D2JA 4H2HA 5HR7A 4ZBCA 3PZNA 4WSHA 2BNJA 1PZ0A 3BGJA 3R0KA 4GHRA 4ZOAA 1IQ8A 3VO0A 1KXQA 3VIFA 3TV8A 3HN3A 2R1NA 3DC0A 2D73A 3FYYA 3D3FA 1MWOA 1WKFA 1H0GA 2FTWA 1DTNA 1ODUA 4A3RA 3RX2A 4UXDA 5AHMA 3CL7A 3HA1A 4RDVA 3IUHA 4N9DA 1E5JA 3Q37A 4LEQA 1ZU8A 4S3GA 4V1YA 2E8YA 2YIHA 4XZHA 2SFPA 4KEMA 4EPEC 3GDRA 3QPZA 1X96A 3MV11 1FHDA 2FPTA 1L2QA 2ISWA 2AKMA 3EMQA 3GHTA 3R1ZA 1JDAA 1CW2A 3WDIA 2Y24A 3BLOA 1VRDA 4U28A 4ZR8A 3S5NA 1SU5A 4HQVA 2O0TA 2PDKA 1GW9A 2D2OA 3RNDA 4L64A 4YYFA 1KFLA 5D33A 1AMKA 1J18A 1ZALA 4O1CA 3RN6A 2OOFA 1XIJA 4TIMA 5I00A 3VMPA 2I5QA 3VIPA 2CKRA 2V5BA 1GQJA 2WJZA 1S5NA 1C8YA 4I7UA 1XDMA 3Q45A 3BLKA 4LAZA 4UMBA 2HVMA 5LSMA 2WO5A 5XINA 3T8LA 1GHRA 4U3CA 3ZO9A 1TYGA 3FJ4A 2GL5A 4KRZA 1KQYA 4M51A 3WD0A 4C1KA 1VCFA 2VL4A 2Y5SA 4GZEA 4GIAA 4GE8A 2DH2A 3WQWA 3QV9A 3WO8A 2TAAA 4JQ2A 2G4JA 3PBYA 4AZCA 4D72A 3QR0A 3VDBA 1PX4A 2R9RA 4WCJA 2AQOA 4E2OA 1N8IA 1DXEA 3CV1A 2BFGA 4YU1A 4PRWA 1XYMA 3M47A 5KTLA 3ABSA 1OSEA 3EDDA 3MYOA 4YS1A 2V3GA 3VCRA 1IGSA 1SPQA 1YTDA 5I3HA 2A3HA 3FJNA 3QZ6A 3IV8A 2OWWA 4NHVA 3F03K 4PSRA 4G5DA 4B5WA 1UP3A 3AC0A 3W2UA 3EXSA 1JCYA 2BHYA 1SYTA 1K3UA 1RQEA 1SZRA 2KZHA 3HG3A 1UWRA 5H2ZA 1IEWA 2QF7A 3M43A 3NPUA 4A3YA 4F66A 3VNLA 3KHJA 3B8WA 4X0NA 5JMUA 4TVDA 2PWGA 4QE1A 3T0DA 3TKFA 2Z7KA 3AU2A 3TYZA 3IVUA 3SQSA 2A3LA 1UKPA 2VGGA 4OOUA 1REQB 1A0EA 2O92A 4NZJA 2ZX9A 1EP3A 4MZ1A 3R6IA 4BK9A 3U5YA 4QCFA 5FJOA 3W74A 3POHA 1EZ2A 1EBGA 3O16A 3S4TA 1EGZA 3B03A 3IACA 4FX8A 1QASA 4IWWA 2V5DA 1F74A 4GVIA 3AIUA 2GSJA 5C6MA 2VZSA 2QQ6A 3VKKA 2IUZA 3PG8A 4WGXA 2YDQA 2PSNA 1E4IA 1XG3A 4QIUA 2OLAA 2QR6A 4IIEA 3TLQA 2VGBA 3UG3A 1ITCA 3DHUA 3WNNA 1G5AA 1YXCA 2VGIA 3QBUA 5A8MA 3R8RA 3WJZA 4PB5A 4B3LA 1CI1A 1A4LA 3CUXA 2ICSA 1PEZA 3CIXA 4M6QA 2BVTA 5U4NA 3NQMA 4ZB0A 1OYBA 5A6AA 1T8QA 1CGXA 3CASA 3SCPA 3CK5A 2V3EA 3UVAA 3VDCA 1EJ7L 4DI9A 3GUWA 4NI8A 4JN7A 3SCTA 2IPJA 5A3HA 1TV7A 2DT1A 2J7HA 4RPPA 1A5BA 2ZXDA 1PKMA 1JPMA 5ABTA 1J2WA 4PH6A 3AROA 4F40A 4DBEA 4R7OA 2X05A 2P0OA 3NQ6A 4QCEA 2WW5A 3RG6A 5AB3A 2IKJA 4QG6A 3GBEA 3RU6A 3VABA 2DPEA 1XI3A 1S2UA 3SY5A 3Q4DA 1Q6CA 2VR4A 4UFMA 4U5IA 3WQPA 1TZ9A 1H7PA 3UJFA 3ZR4A 2X1RA 5LXEA 1NDYA 2WSQA 5AECA 4UB9A 2AQVA 4BQ2A 1MEIA 3C52A 1YW1A 3GR7A 4LYQA 1H62A 5C9XA 3WBWA 2EJAA 4TR9A 5HJYA 5FF0A 1JL8A 4LYRA 1O5RA 2ISDA 3KOWA 3TK7A 3E2VA 7TIMA 4M19A 5T9CE 3UQNA 2Y8UA 4M6VA 1AMYA 3UWQA 3KVJA 2PMQA 3OPSA 2BGQA 3CWNA 2FKPA 3IUIA 4RDYA 4R33A 3GNRA 3EBVA 2H3BA 3A64A 4P8XA 3WFZA 2B7QA 1OFDA 3EWBX 1UKQA 2QVHA 3ZR6A 3M41A 4FF7A 3SUVA 2J6VA 2EXOA 2A3EA 3DBNA 3WQ8A 1OINA 4R85A 1J93A 1XLBA 4UQBA 3QKZA 1LQ2A 2ZZ7A 2VZUA 1RQHA 2PDMA 1T99A 4UR7A 1FHVA 4HJFA 1IGWA 4JAWA 4XB3A 1E5NA 5EB8A 3GXFA 1O6IA 2GDQA 3HG4A 1BG9A 3AISA 2AL2A 3CHDA 5HWMA 4NJKA 3KRZA 4I9JA 4DXXA 2XVKA 3CL6A 3L4WA 3UY7A 1TE1A 4QQ3A 3ZVIA 4NNCA 3WMBA 3AIWA 2E40A 4OUIA 3T0TA 4I8DA 4IFRA 3WEMA 3PB2A 4ES4A 2YA2A 3VE9A 2AAMA 3CZEA 2HBVA 1G6CA 4DJEA 4LTSA 1XC6A 2VNCA 4ZSUA 4J3VA 2EQDA 4Z08A 4LJ3A 3C0JA 1IF2A 3MMWA 2GQ3A 4U3AA 5HWNA 5E5CA 3LCLA 2CCRA 3RRXA 3MU7A 1VLIA 1RD6A 4HOWA 3ERPA 1K8CA 1TRIA 1TA3A 4H9YA 2EJ1A 3SBFA 5EA9A 1V4YA 3I68A 4D8ZA 3TQ0A 3TU9A 4N4QA 3VC5A 3WBAA 3K30A 1SZGA 1QW9A 5D8ZA 1IV8A 3EOUA 2QEZA 1A47A 3L66A 4CNNA 4OBSA 1EOKA 1JPKA 2OMAA 4CQ8A 3VFCA 4KH2A 5J5RA 2NV2A 4Q8QA 5D2XA 5A1AA 5JU6A 5LYRA 5AC6A 3UXLA 1V6XA 2JKPA 3GTIA 1FWWA 3R13A 7REQB 1PO9A 4H9UA 3TWAA 1QJWA 2Y8KA 1OX4B 3GH4A 2E5CA 1OC6A 1Q7ZA 3TYAA 4YLWA 4ZTXA 4MHBA 4C60A 2YJQA 4AFYA 1RBAA 2AGTA 2NVDA 3MHGA 5A8NA 4MFEA 3RMEA 4QRNA 1C7SA 2WZHA 4IQEA 1BRLA 4D1IA 4B16A 4IPPA 1RP9A 2YLAA 4HTBA 3NQDA 3SFWA 1LOQA 1LT7A 3T9PA 4UTMA 4DO6A 4WOZA 2NQ9A 3C0LA 1EC8A 3PP7A 2DVUA 3AUOA 3FYOA 3N13A 5I3JA 4CKQA 2J7DA 4ZOCA 5I06A 3WENA 3N2OA 2OVLA 3H4GA 3GW3A 3SCVA 1XW8A 3C5QA 4ZO7A 3LEPA 2VDHA 3PBWA 5H8PA 3WD4A 3F4WA 1UOZA 2NVCA 4C7DA 3VD9A 4WJXA 2BXVA 5CC7A 4MY9A 2I56A 3VIIA 3VIMA 3GH7A 1A5LC 1TO3A 3CQHA 5EMYA 2ZUUA 3UEQA 3IJDA 5E0FA 1MZHA 2NV1A 4CQCA 3W76A 2I1OA 2Y63A 1JZ2A 2Y1HA 1ZBCA 3MZNA 1KFJA 3W2MA 2PTWA 1BGAA 4PL2A 1SZFA 2GK1A 4GLEA 1VCGA 4EPKA 3TTSA 2A4AA 3WLIA 2VC9A 5MF5A 3VI2A 3BSGA 1B1YA 3UA3A 1PDZA 4Y2WA 4D8LA 1L6WA 3VKJA 2XGBA 2ZX7A 3OJGA 1SZEA 3IK4A 3MMUA 1V3LA 2ATMA 2WZIA 4AEFA 2W62A 1XBVA 4NJIA 3VGDA 4UC5A 3W00A 3T0CA 4XD5A 4MSSA 2VFEA 2A79A 4QFUA 4I7VA 3MKCA 3TW7A 4IPIA 1EC9A 3KVLA 3WX7A 3KOXA 5HBFA 1Q6EA 1IEIA 1Z69A 3T0BA 4L7ZA 5BMXA 4NL1A 4BQ5A 3MY9A 5JVLA 1XLFA 2V67A 2C7FA 5J8LA 1YPFA 3M7SA 3IIVA 4IT1A 3TC6A 2XWDA 4IZGA 2HJPA 2P50A 4Q4QA 3JZEA 3EWDA 4C6IA 1OIFA 1F3XA 3MCMA 4HMEA 4H8UA 5C71A 1W1A1 2VX6A 4IL2A 1R3WA 3SN1A 3IIOA 3NL3A 3M4HA 3GHUA 2W0UA 4IP5A 3HMJG 1W9PA 5K4ZA 3W2NA 4FNTA 3I6EA 3LU2A 2GWGA 3IJ8A 3WBXA 1FWIC 4M24A 1FFQA 1LQ0A 3R58A 4AIBA 2D0GA 4CCZA 2VEMA 4HU0A 1N2VA 2WVSA 4WXZA 1XIEA 1E9ZB 2VUNA 2VEIA 3ITCA 2QUMA 4JY9A 5HOSA 5TAOA 4O1AA 1MFVA 4LANA 4WXYA 4DJFC 1KWKA 4K7YA 3H55A 5EMKA 3F2DA 3HF3A 2FMOA 1EWEA 2YW3A 4UBPC 2CBUA 2QCEA 1W9VA 4UTIA 5HNNA 4EXBA 4S3JA 4H1ZA 1Q3NA 1SM9A 2WZEA 3I7QA 3MS8A 1LROA 2ZADA 2Y2WA 5F2MA 1EJWC 2CLEA 4J1OA 4LW7A 3HQ1A 1AW5A 3PAOA 1DIEA 1FKXA 3P93A 5G2HA 4D71A 1TMQA 1PIFA 3A5VA 4WOQA 1F61A 2NX9A 1W9UA 4PCTA 4RXGA 1P0BA 4IL0A 4DO4A 2D20A 2P8BA 4BI7A 3BZGA 3HPSA 2QYGA 4AVNA 4O16A 3UGVA 4MFDA 4HK6A 1QOPA 1XRVA 2D0HA 3KWSA 3BSHA 4E6MA 3WJWA 5DELA 2NT0A 2HPMA 3PUEA 2VZVA 3CPUA 3TW9A 2W5FA 1W5PA 4H9ZA 2QUTA 3ZSTA 4AF0B 1JZ5A 4MMWA 3IJQA 5AYZA 1Y5WA 1UW9A 2G0WA 4M29A 3QW3A 1TIWA 1LRTA 3WH7A 5LKYA 2ZZ6A 2QMKA 4Y9OA 4MNMA 4O12A 2PEVA 4X0VA 3VNJA 4IISA 4BWLC 4HNTA 2Y8VA 1Z6KA 5D2WA 1S39A 3TXZA 3IIPA 1PIGA 2L5HA 4RV3A 3B9AA 4AW7A 4CD8A 3CO8A 5G1YA 1B90A 4PUWA 4GQBA 2O55A 2HS6A 2QZRA 2ZTKA 1W8GA 3K4WA 1L6SA 3ZWTA 3FVDA 3JS3A 3KRUA 3HU7A 1AJ2A 2X1IA 2F2HA 2FB2A 3BURA 2BHUA 3BV4A 4Z0SA 4YMZA 5JIPA 1XRSA 2E7FA 2VCCA 3S47A 3GTFA 2NUWA 1OQFA 4IMAA 1FWHC 4FNUA 4JN8A 3VCCA 4MUPA 3FIGA 1KB3A 3VZXA 2P1FA 3W1UA 3VNZA 2DSZA 4UCGA 1HL9A 2ZA3A 2WZMA 4LY8A 1RY8A 4ADTA 1V7YA 2NLYA 4JCMA 1V79A 3H23A 1JRBA 1LG2A 1KD0A 3W7MA 4XSLA 1HVQA 2WNNA 3SJNA 1TR1A 2Z28A 3OGSA 3I7RA 1Q2SA 3IIZA 3AMGA 2P5NA 3GE7A 1I8JA 3O3RA 1HO1A 3CHFA 4IXXA 2YOCA 3RITA 1V5XA 1X1OA 2WAGA 1JAKA 2RAGA 2YLLA 5MKGA 1OFRA 3LGEA 2JGQA 1EQPA 3L2LA 1DJGA 3POCA 1UWAA 4GXPA 3LCGA 3BAJA 2R1KA 1WO2A 3JR2A 3SSJA 3BL3A 3R12A 5C5YA 5CCZA 3AWNA 3VIJA 4HNOA 4DUWA 4H4IA 3GKFA 3W1XA 1VHNA 2PU1A 3KTSA 3KL0A 4G9PA 5LNVA 3NQ2A 4A05A 3HG2A 3FAWA 4MJMA 4AMAA 3WL1A 2YL5A 1BGGA 4B4HA 1V6UA 3DESA 3QYSA 4AX7A 4US5D 4C7GA 2ZE0A 3L2IA 1OD0A 1OGGA 1XL9A 1W31A 1KXHA 4PULA 4JTLA 3VIKA 3SUSA 4UQEA 3DFNA 2ISVA 1GEHA 2CEQA 1RPKA 1K70A 3B40A 1W3KA 3VNYA 4UNIA 3C2FA 2TYSA 1W1PA 3UJEA 1W56A 2GUBA 6XIAA 3H53A 1KBLA 4KGJA 2Z1KA 4BS0A 1UPPA 1O95A 3KBNA 2OKOA 3JVAA 2GLKA 3H7VA 4PZVA 3TJ4A 1H49A 1RK5A 4WK9A 3R8HA 4HNUA 1QO5A 1WAWA 2EG8A 3PBUA 2NXGA 1KM6A 3QMTA 2DGAA 1ZTVA 2ZUNA 3IJ9A 1IXPA 4ZVJA 4MKVA 3B04A 3G1SA 5GJNA 4DUVA 2BGNE 4GINA 2ZA1A 4W9TA 1GUVA 2V2HA 5AYBA 4ZFMA 2AKZA 2REQA 5D38A 4E4PA 4K36A 3S0CA 5CBJA 1K03A 1OIMA 1CLKA 7XIMA 1L2UA 5CEWA 4KT2A 1S5WA 1B31A 7ENLA 1UROA 2EGZA 4M56A 4BEUA 5IHRA 4KWUA 1TPDA 4HA3A 1JCJA 4QNEA 1Q13A 2PLMA 3GSMA 3VVGA 1NOUA 1XYBA 1KRBC 4B9ZA 3AS1A 2J8GA 2VEFA 3MA8A 4W85A 3IAQA 3XIMA 1XPGA 3WNLA 3ITGA 4L6HA 1DE6A 2IPWA 2ZRWA 2OT0A 1RJPA 1LOSA 2BP1A 1F8IA 4C1NA 1W1B1 3AXXA 4JIPA 1IWAA 1KTCA 3A21A 5CZJA 3Q58A 3WD1A 3VOHA 4GH1A 3L67A 1XBXA 5AYYA 5HUPA 3CT2A 2E28A 2YDSA 2QDGA 3EX3A 1EXPA 3BG5A 2GZXA 4REQA 5A95A 5K9DA 1R0MA 1GYMA 2Y70A 1VP5A 1EO5A 1N7KA 4FP1A 3NDYA 2R6OA 3EOEA 1UZHA 3C86A 1OHLA 1QXLA 5CG0A 1PCKA 3HPZA 4L5ZA 4JDBA 5GJPA 1VRXA 3S6DA 3ZXWA 4EE9A 2G8ZA 4HN4A 4UFJA 2W67A 4WJ8A 1IEQA 1FWNA 3LQLA 1YXDA 1Q45A 1ZBWA 3TH6A 1NAL1 3E0WA 4X60A 4MKNA 4Z0JA 1EFZA 4FS9A 5AZ1A 3B9DA 3HV8A 2OQYA 4P7OA 2YBTA 1UQZA 4P8VA 2PGWA 2ON3A 2ZRYA 3N29A 1P6BA 1UP0A 2IQDA 5CGMA 1NVMA 4Q32A 3PC0A 1DJHA 1VGAA 4EANA 3CQIA 4JFUA 1TELA 3LMZA 4ERIA 3DAQA 1E6ZA 2G97A 1BQGA 1I1WA 1ZQ5A 4LNCA 2F6XA 1JUEA 3QQ1A 1HT6A 3NL6A 2H3DA 1L9WA 1WDDA 5EGRA 3P80A 3FKKA 4L4PA 2WHMA 1Q6QA 2G50A 1J0KA 2GOKA 3ONCA 2E0PA 1GKPA 2ZRVA 3CH9A 3LDVA 2XN2A 2ZXAA 4E4FA 3OW1A 4XZNX 1K9DA 4JPGA 4S3KA 3W3OA 1LL7A 2PE4A 1U5HA 2E9LA 4EF8A 4GPNA 3EKLA 3GIQA 4GC3A 4G1KA 1T41A 4DELA 1P48A 1KWGA 1FKWA 4UQCA 1BAGA 2WMHA 4GQRA 3TTQA 4JYFA 3TC7A 3IGXA 1EIBA 4QHRA 3NL5A 3EEGA 4AZBA 3N4AA 1XRTA 3ZOAA 3SB0A 4M6UA 1H50A 3KM8A 1EP1A 3C2RA 3V7PA 1JDFA 1W9DM 2E8ZA 3RRAA 1XM3A 3LBMA 2JK2A 4Y6GA 5ABEA 1T0OA 2AQWA 5ABFB 3MI2A 3H7UA 2VJXA 3SEPA 5I7GA 1OFQA 2D22A 5EBAA 4O1FA 1GWJA 1UJQA 4FR6A 2DIJA 3F2BA 2GJXA 1S5TA 5LGXA 2HWGA 1A4MA 1GKRA 1JVNA 4O15A 5DXYA 5FJRA 3N2MA 5TQLA 2PDIA 3SCNA 4X22A 1GHSA 5D9OA 3EA1A 1AZ2A 2V63A 1LUCA 5ECVA 1DIKA 5KEZA 3MB9A 4A6GA 3CMFA 2YL8A 3GM8A 1UP2A 1Y0EA 3C0QA 3RO6A 2Z25A 1IIGA 3ZVHA 2XIMA 2FZBA 1TREA 3GNPA 3SZ8A 5G2IA 3MHUA 1FWJC 1W9BM 3CAVA 2DSVA 1V77A 4NZCA 4PUJA 4C6LA 2QJHA 1F7BA 2WVVB 4ZOEA 3P14A 3VKDA 1J0YA 2V0TA 4QX4A 5AHFA 4KWOA 4Q4OA 1ZZMA 3W2LA 3AALA 3DIPA 2ODOA 4K8HA 3GQYA 4L56A 1EA0A 1HKIA 3O06A 3PTQA 4F0LA 1H09A 1JRCA 2OTDA 4O1BA 4QG9A 2ACQA 4J2PA 1HGWA 1G4EA 5CXPA 3GAKA 5DF0A 3EWZA 4FX6M 1GGOA 3QC0A 4ACYA 1F4HA 5CC6A 3NDOA 4X9SA 4AX6A 2PURA 2XGIA 1AQ0A 1XS2A 3AXMA 1QR7A 4QJ4B 5F7UA 3BCFA 3M6DA 3RO8A 4O1DA 3O0KA 1PX3A 1GEQA 3CZ8A 4IGNA 3N17A 4CNSA 4A2RA 3WF1A 1BPLB 4DYKA 2BOGX 4DLMA 4LSBA 5JBDA 3N6QA 3VIOA 4XZWA 3MVTA 4KKXA 1JPDX 1KR1A 4LRTA 5G2WA 1Q7QA 1QCWA 3VZYA 3UWWA 2P3ZA 2GQ9A 1YYAA 2Z00A 2Z4GA 3B4UA 4K38A 2VRJA 4I9AA 4FK9A 3TJIA 3NPWA 2XVLA 1B2YA 2CZ5A 2XN1A 3QTPA 1VJIA 3BC9A 2ZFAA 5REQB 4E2VA 1SSGA 4IIDA 1QK0A 1A3WA 5TBOA 6PTDA 3EKZA 3LHWA 1EYWA 1W5QA 3U48A 5D4YA 4JYDA 4XAZA 4LX4A 2ZWZA 1YLVA 1XYLA 4UZSA 3VGHA 3H4WA 1TWWA 3L4YA 4EWJA 1BWVA 3GXDA 4H3DA 2QPSA 2X7VA 1FDYA 4PCNA 1NOWA 5CZKA 1YNYA 1D3HA 2W3ZA 4O19A 3VKBA 3KTCA 2VZTA 3NYDA 1ME9A 4FEZA 3A4XA 3VOJA 3NOYA 3MBDA 4LPCA 1MSSA 4NY2A 4JTDA 6ENLA 5IXEA 4DEFA 2HVNA 3WSUA 4NVTA 5B7ZA 4WLCA 4GUFA 5A8QA 1WAUA 3QZEA 3LM7A 4JIEA 2FMNA 4GZ7A 4LYKA 1SR9A 4Y8FA 5IM51 1GTEA 3APGA 4FNQA 2GJPA 4GQ0A 5EYWA 1IR1A 1PPIA 3M16A 2ISSA 2FGBA 5I3KA 1EDTA 1C3FA 1UPMB 5JH1A 2XIIA 4UQ9A 1IZKA 1ZNNA 5DMNA 1UR2A 1A5OC 3Q94A 2VC6A 1YHTA 4XD4A 1O12A 4GYPA 2C8NA 2PDPA 4G6CA 1T8XA 2O4MA 2WM1A 3PSWA 5F1UA 3HG5A 5FL0A 4GC4A 3GAYA 3ECQA 1P4CA 1U33A 3DHDA 5EBUA 3BZJA 1IXOA 2QLYA 2B4GA 3E49A 4JR5A 5A6JA 1BTCA 1ZAIA 1R30A 2Q02A 4RX0A 3WUGA 4GA8A 2E09A 2O7SA 3U0HA 3FLUA 4KMQA 2RJHA 1QBBA 3I6TA 5DCBA 1VEMA 4XAFA 3GZAA 4X61A 1JPIA 1A50A 3L4UA 1F9CA 1X7FA 5CH9A 4PMRA 2NQHA 5AKQA 2QVNA 4DXVA 3WJXA 1FWRA 3N6JA 1PTGA 4JIQA 3LV6A 1C8VA 3MUXA 4WHBA 3WF2A 2PTXA 3C56A 3CM4A 3G24A 2QPUA 2ZYFA 1PB0A 1TQXA 2VVNA 5BXSA 1VFUA 4GUIA 2FYMA 4GGHA 7A3HA 4AYGA 4NAEA 4JN6A 1SJCA 2YCEA 3LRKA 1EQCA 4HPGA 1NY1A 2PP0A 4NG3A 2VT0A 1Z48A 2JE8A 4KEUA 4KW2A 5BW6A 3WFLA 4IHCA 4DZAA 5D02A 4EXQA 3DENA 4C91A 4RW5A 2FB3A 2TODA 1X6LA 2NSOA 3ME3A 1E55A 2OEKA 2VKZG 2C13A 1SQ7A 3VPLA 1TTPA 2Y5EA 3CTTA 3OZMA 3TTOA 3LZ5A 2E6YA 1VZWA 3I7SA 2QAPA 2JKAA 1IZCA 3R25A 4P7QA 4ZO8A 1JYNA 2GYIA 2DT3A 3ZS4A 1Y8BA 1KGWA 2O4QA 1JGIA 2VCBA 2OWXA 4B5VA 3L7RA 1CLVA 5C9UA 1HJVA 4L80A 3EB4A 4NU7A 4AHPA 3PNZA 5E6YA 5F2IA 1DKWA 3E2SA 1OFAA 2OEMA 4JICA 3UY8A 4AD0A 3FSUA 3BW2A 4TMBA 3YPIA 1IHIA 4HZ8A 3GVQA 2NUYA 3VA8A 4DXKA 2G37A 5A5WA 1BXBA 1GOIA 2DSWA 2TSYA 1NOFA 1A5KC 1TB3A 3EDJA 3AXHA 5DRCA 3W22A 4D6FA 4INFA 5FJUA 3WF0A 1JF6A 1KFWA 1L0PA 1JJKA 1I45A 1R85A 5A8PA 5LIKX 2WMKA 3R8GA 3OG2A 5HNTA 1M7JA 2P8CA 3QC3A 4QLJA 2GSEA 1QPQA 1LWHA 3BW4A 4XIMA 1EJTC 4ZB5A 4Q4RA 3DX5A 4NF7A 4MLJA 4HHMA 3U57A 4ATDA 8TIMA 3TN5A 4MDPA 2OSWA 5BXPA 1WB0A 5HINA 4N7QA 1R8LA 3AI0A 1Z32X 1N82A 3AXIA 4CVUA 1AH0A 2VFFA 1XLLA 4M8UA 1XJBA 4HSHA 3P7YA 1PAMA 1E9YB 1A3XA 3M9YA 1GPFA 4JEJA 4ZGYA 3UNTA 4IJCA 5E6ZA 5CPMA 1POKA 4B90A 4D6JA 3VDHA 1UC4A 2BGSA 3FSTA 1TSIA 5C7VA 4PCSA 4ORMA 4A29A 1B5TA 3LPFA 3M0YA 4DJED 4Q7BA 3KL3A 1VFSA 3NM1A 3GG0A 1Q6GA 4Z1DA 4RE4A 3CIWA 1YADA 4XG1A 3W6LA 2QMJA 4O1EA 1IEXA 3A22A 4S3AA 2YL6A 1TWIA 3MUCA 1JCNA 3DI1A 4M6PA 3SSZA 3SGUA 4YVXA 3TC3A 1OYCA 1DE5A 2VD9A 3TMQA 1E0TA 4MB1A 4GKTA 1W3LA 4XO6A 4QXIA 3WK3A 3CQJA 4RKAA 1KC7A 3EA2A 3CU2A 5JQ9A 3KUMA 3PZUA 1XINA 2OXNA 1BF6A 3B0VC 4IGMA 2XUCA 3A4JA 4S1FA 3ZT7A 1GPWA 1SO3A 1ME8A 3NZ1A 5ENLA 4HMDA 1J8VA 4ZQCA 1DQWA 2WHJA 1T6MA 4ICMA 2RJGA 3THAA 2A85A 1V0MA 1ONRA 1XCXA 5G4EA 5D09A 1UZ1A 3D0CA 4O0ZA 2TPSA 1KM2A 1C8QA 3BO9A 4DUOA 3W83A 4HGXA 1UCWA 2J78A 2EPKX 3U2EA 1Q85A 1A5SA 3GDLA 1W54A 2OO0A 3I3DA 4XAGA 4PBFA 4O14A 5IBXC 1JDCA 2A1YA 3VNMA 3K8KA 5LA0A 4JNYA 4KEVA 1DQXA 4JQ1A 4F48A 2PRLA 1KRMA 4G7EB 2PWFA 2RDWA 2ZUWA 2NQ5A 1XIBA 3ZJKA 3TMLA 4CU6A 1AW1A 4DWDA 1OC5A 1MW0A 4K8GA 3M5XA 3WNKA 3AHZA 3KBJA 3ZJ8A 1GYLA 2F6UA 3PPFA 1MUWA 4FNPA 4ZO6A 1WDWA 3R10A 3BGAA 1QHOA 2PCQA 3AHYA 5HANA 3VOFA 1E70M 3GG8A 1IZJA 1CX9A 4NRRA 4Z2HA 1XIHA 3W7IA 2OCZA 1XV8A 3M0LA 1JF5A 5D9NA 2YCLB 4L9YA 1XLCA 2WMFA 1DXFA 2OQLA 5KMYA 5E93A 3W53A 1OCJA 1Z89A 1D2KA 1CYGA 4CD5A 4C5ZA 5DO8A 4L9XA 4M0XA 1G1YA 1K7XA 2ZVIA 3STCA 4ROPA 1X97A 4OQVA 2C1HA 2QCNA 3PFMA 4PB4A 5IFTA 2W61A 4Q8WA 2G5WA 2IPGA 2PRMA 2PDLA 1QNVA 1S2CA 4Q4SA 3BLLA 1EHNA 3MCNA 1P0KA 2FHBA 3GXNA 3AIQA 3KS5A 3NM3A 1B4KA 4KIEA 1WZAA 2O9TA 4D1JA 4U10A 4MUZA 3TXVA 4J5NA 2DJLA 5D8WA 3UYIA 2DH3A 1GJPA 3TZFA 4FX7A 4E8DA 2Q3RA 1O1ZA 4JS3A 4TO8A 4RDWA 2QNEA 1QMLA 1TTIA 3LHYA 1K8ZA 5A6TC 2CHRA 1JFXA 1J10A 1QNOA 1FP9A 3TSBA 3HZ3A 1G94A 1WDRA 4C6JA 4YWIA 4AZIA 4WF7A 3S9ZA 5FOOA 2WHLA 4IIFA 1Y65A 2X1SA 3I3BA 3P3BA 1PBGA 2OZTA 2Z2UA 3LCWA 4B5UA 4RZ4A 4QDPA 3MYPA 2DZVA 2DW6A 3QOKA 4JZ5A 3R94A 1Y5VA 1WE5A 3L68A 4ALDA 2VFDA 4KF1A 3IWPA 4LB3A 4PBGA 4ML9A 2PDUA 4R53A 3I6RA 3QGAC 2ZUMA 2FGZA 3UJRA 3G1XA 5DRIA 4JYEA 2VFIA 1QVBA 1K4GA 3ARSA 3AIVA 2X30A 5M1TA 1DOSA 1PVNA 3QXBA 3WUEA 3CO4A 4HA4A 1TG7A 3TYDA 3W27A 4WD0A 1QUMA 4DF2A 2GQ8A 4J3XA 4AZCB 1TX0A 3UFYA 5BOOA 3B0PA 2IKHA 4AC1X 2CIPA 5I23A 4URIA 3PBMA 1CGTA 4TTGA 3NSNA 5KSWA 1SO6A 3LHVA 4XZBA 3VIGA 1WA3A 1E6RA 4FLRA 1KFKA 2WK2A 3GR8A 2D0FA 1OCQA 3PZIA 4JKMA 4DBWA 1JYVA 3ATYA 1FWAC 1E0VA 1WKEA 1W3NA 3A24A 3W70A 1XPYA 2A7RA 5E09A 4GIYA 4E8GA 1XYAA 5I77A 2X2GA 3PUGA 5T26A 3WL0A 2C15A 3RIKA 1GKQA 3LM3A 1R9ZA 1W5NA 2CNCA 1BWLA 4O54A 3TYBA 3AUJA 2DV0A 3UZ5A 3N4EA 4O8RA 2Z2BA 1KCKA 4PFHA 4I5XA 5D30A 3C2OA 4OBTA 3OU8A 5H91A 3VTRA 3EXRA 4Q6JA 2DT0A 4QDWA 4LV4A 3DGRA 4NKCA 3E9AA 4NJJA 3CUIA 3R4IA 1P6CA 4H9MA 3E3HA 2QJGA 3G18A 5AY7A 3BQ5A 4RR4A 4IMDA 3V5FA 1GJUA 2YDAA 1HJQA 2VWTA 1RCQA 1VYPX 2UY2A 3AHVA 4RE3A 4AVFA 4R5EA 2V3FA 5D37A 2FH8A 2POTA 3WH9A 4MB3A 4A35A 5CAHA 1NM9A 3WBYA 1B0IA 3LNPA 1J4EA 4DPQA 4KCTA 1JZ7A 1ADDA 1TV4A 2FVKA 1V6YA 3F7JA 1UUOA 1E4MM 4MNKA 4WRHA 3ANVA 3AZRA 5D9PA 2ZC8A 3GB6A 3R89A 1TVNA 4QGCA 4LUSB 3CZLA 3GNDA 2CLOA 2RH9A 2INFA 1SUXA 1W3HA 2DT2A 3DG7A 4UTTC 4RV8A 4W8LA 1XH0A 2IQ0A 4OECA 4U2ZA 2E1WA 1ZLPA 2BV9A 4GNKB 4HYVA 3VX0A 2P88A 5HAOA 5AFDA 1WOAA 1SFJA 2JIWA 3EAUA 4QISA 4EP8C 1XIDA 2UY4A 2J75A 4S3CA 3D46A 2WCSA 4Q4MA 2HPIA 7PTDA 2D2HA 1EHAA 3PK7A 1DXIA 1X1NA 3V0TA 1KA9F 1TWZA 4I5UA 3GTHA 2AGKA 1K8XA 5F4WA 3L65A 3FDKA 4LUTA 4S23A 4OIFA 3W87A 4GUGA 2BXYA 3I4EA 3D3AA 3WKZA 1Z44A 3MSRA 4AHOA 4EK7A 3ARZA 4K68A 2VDGA 3DOPA 3M64A 5LHEA 3A13A 1JZ6A 3Q67A 1OG0A 2IS7A 2OEJA 2GQAA 3KL5A 4K2SA 4WVXA 3TQVA 1E6NA 1ZRQA 3MSDA 1OC7A 2GVLA 3NFUA 2I5IA 2ZX8A 1W6TA 4HA1A 3SAZA 3U4AA 1CENA 3WIJA 1Z42A 3GVGA 4FHAA 4Q6XA 3HPFA 4QE5A 3WLOA 1K6AA 4JTJA 2DUZA 2H9AA 1FWCC 4BR1A 5I09A 3ZIZA 2FZ8A 4U31A 3D47A 1GG0A 1KNWA 3M5YA 4IMGA 3NCOA 1MW2A 5FJPA 3AIEA 4KBXA 4CCCA 1SJBA 2VWSA 2WNZA 6REQA 3S2JA 4S2CA 1OT1A 3K8MA 3H70A 3MC5A 3HOJA 5C2CA 5FL1A 3HBLA 4K8EA 4V15A 1AD1A 4ERGA 1TQJA 3KX6A 1H1NA 1UBPC 1A3HA 4YPJA 1MEWA 3TVAA 5I5RA 3MI6A 3DYPA 3E0LA 1GVSA 2PTDA 2YX0A 3AYVA 3WD2A 2AL2B 1TVPA 1MQRA 3M5ZA 4Z2IA 3ITTA 4BQ4A 2OU4A 1ZAHA 4AVOA 2X7WA 3BPWA 4CLMA 3FW6A 4QITA 3N25A 1VF8A 3ARWA 3PWAA 1RSCA 4FF5A 3A3XA 3MSGA 3WLMA 5LXXA 3V5OA 3PUDA 3CMJA 1TPFA 3INPA 3PTMA 2G3JA 5LGZA 3MWAA 2OYKA 4QR6A 4JQ4A 3W1NA 4JCLA 1QW7A 4Q33A 1Q2RA 3H2MA 4AHQA 1D3CA 4KCVA 1K9EA 3NSMA 3PJTA 1YE4A 3A3WA 4JBRA 3PM6A 3ZWSA 3FGCA 5AC5A 1IYXA 1QI3A 1OGBA 2QDDA 1UG6A 3PR2A 4I90A 1TA3B 3L23A 1XXXA 2CKSA 3T2OA 3T05A 2ZICA 4XAPA 3WF4A 1EGVA 2J7GA 2YDRA 1QNPA 2QHAA 5DMLA 2QV4A 2G95A 2INZA 3PPHA 1LL4A 2Y88A 3UERA 1QPKA 4CU8A 2OODA 4RNJA 3CV6A 1QAPA 4G2DA 3SRFA 1RH9A 4AD3A 5F4SA 3LYEA 1EX5A 3BE7A 4GO8A 4TX9A 3QYQA 4IMEA 3DFTA 3UP8A 3M7WA 1FHLA 4I6KA 3B8SA 4EXAA 3FEMA 3TZNA 4KQNA 2Z2AA 3JUGA 4WZHA 5DANA 4W8AA 3QHOA 1OZQA 1S38A 3CZGA 1I4NA 4DM1A 1ZJAA 1HW6A 4A8RA 2G3NA 2QCMA 3TA6A 3T7VA 3W28A 4FNSA 2PTYA 1EEXA 4PMZA 4XWUA 1GT8A 2J9YA 4ECLA 2GVEA 2CLMA 3E0IA 4UCFA 1Z8AA 3MP3A 3U4FA 3NGJA 1TV5A 1ISZA 1OM0A 4LUJA 4XUYA 3AOFA 1M68A 3W72A 2W92A 4NJHA 1BRLB 1TTQA 4A21A 4MAVA 1LLWA 1UMLA 3N9KA 3UPBA 3SRKA 3W2JA 3UT0A 5LA1A 1OFPA 1UYQA 3W07A 3E12A 4AD5A 3G5EA 1HQTA 4H9VA 1FOBA 3NNTA 4CEXC 3BAXA 4UTKA 4PR4A 2QCDA 4DBUA 1TV8A 3I65A 3GU2A 2KX9A 4IMCA 3EOSA 4OT7A 1H5YA 4Y7EA 5AYIA 1J96A 3H2CA 3WNMA 4GFSA 4JTEA 3BAYA 4NXSA 5HXMA 3LHUA 2XDFA 1V6VA 5DXXA 4IMFA 3ZQ9A 2ZQ0A 4IQDA 4TQTA 2DZWA 5LIXX 3GG1A 4WY0A 3N11A 3CEUA 3ABQA 1Q6LA 3W1AA 1EYEA 2UY5A 1GW1A 3FFSA 1F8MA 1C7TA 3S9YA 2WLYA 4ENLA 3U8GA 1M7PA 3OTRA 5C8BB 1PX8A 3MDUA 1OABA 2IKGA 1FY6A 3ICJA 2EAWA 1PXGA 5CQ1A 2HRWA 1HNYA 1ADSA 3LS9A 8RUCA 2GK1B 3L0GA 3L4TA 2F2KA 3RHGA 4XAYA 1E0WA 1JDDA 4MADA 1DIOA 1MYRA 5ECUA 1OY0A 1V93A 1WP6A 1XLIA 4Z1YA 2PC8A 1HP4A 4PMJA 1S2TA 3C4UA 2ZA2A 2CESA 3QKEA 3MO4A 2FTYA 3TOPA 3WDHA 3PB0A 4WDWA 4GI9A 1VH7A 3LTSA 3PZMA 3H7RA 3H22A 1ZPTA 2FVLA 5D2YA 1HJSA 3T2QA 3G6LA 2DZSA 3HJEA 1U30A 5G5IA 3IVTA 4H04A 1UA3A 5I3IA 3CZKA 3OIXA 3W25A 4NUWA 1OZMA 2Q09A 3KOFA 4HJWA 2XIOA 2UWFA 4N6EA 3R2GA 3MMDA 1RCOB 3RCNA 3L4XA 1MW1A 3U2ZA 1EUAA 5DY2A 2V30A 2WB5A 4GI6A 4LS0A 3URQA 3BWWA 4GVHA 2H90A 1PZ2A 3S2LA 5A2AA 2YB1A 1V3IA 3M0IA 3UXAA 4NRSA 2ASHA 1M41A 2WQPA 3IGUA 3OLGA 4B92A 1ZGDA 2WM0A 4DZ5A 5M2FX 1ADOA 4WY0F 3VM7A 4MB5A 5A94A 2PDHA 3D5HA 2RDUA 3LSBA 4OVXA 3MZ2A 1R3TA 1VPQA 2EO7A 2VX4A 4JGDA 1JCMP 1N55A 1SR0A 4PCPA 3VU2A 1IEVA 3BARA 4YCOA 2CLFA 3SFKA 1R47A 3F4CA 3TAOA 4ZMGA 2BXZA 1GK8A 3ARYA 3WG6A 3EGJA 4CNTA 2UY3A 4QROA 2VDIA 4GISA 2E3ZA 3DERA 3EWUA 3CGTA 3ZM8A 4OE7A 3RAOA 3ARPA 4J3SA 2VR2A 3AJXA 1OEPA 1NJJA 1RUSA 2R14A 1O66A 3IJLA 4US6A 4PFMA 3WFAA 2YB4A 1J6PA 4XV0A 2DZXA 4IGSA 4MPQA 1UR8A 4XSMA 1H61A 2XIBA 2FJKA 1WDQA 3OP2A 1XGZA 3W6MA 4F3HA 2ZTJA 5AYXA 1HVXA 3CWOX 2PDJA 3KAOA 3W1LA 3PVFA 4ZQRA 1DJZA 3S1VA 2ALRA 1UB3A 1UKSA 3CT7A 5CLTA 1E4LA 3FS2A 1F6KA 3SW6A 4JIRA 4JTRA 3WZ0E 4DYJA 2XYLA 4GCXA 2E9BA 4DO5A 5CPTA 3IV3A 4ML4A 1JAEA 2BLEA 1O5KA 3S1GA 4PEEA 4CUCA 4QSHA 2Q8LA 2A6NA 4AEEA 1ZJHA 2ANUA 3DI0A 3EA3A 5FJTA 4CN4A 1OADA 4FOKA 1XR2A 1IWBA 1A53A 2XM1A 1ISYA 4UNLA 5HQEA 2P53A 2XH0A 4MWAA 4TOQA 4FOUA 5I02A 2BASA 4FIQA 4HPJA 1R46A 3LPGA 2Z27A 2H8XA 2PDFA 3OZYA 3S5OA 2WPGA 1GOQA 4P2VA 3APTA 1AUSL 1X98A 2VC7A 2XIJA 3USZA 4B91A 2OO6A 3BOXA 2V5LA 2ZUSA 3BK0A 5KZMA 3NAVA 4ADSA 5A6SA 4H19A 5I3FA 4CNUA 3STPA 3CV7A 1DP0A 2PGEA 1WBHA 2YSWA 3CHEA 4ADUA 2DVTA 3R7MA 2OPJA 4WSKA 3H2OA 3VDGA 5FD0A 3TCSA 4JKKA 3GRIA 1AA1B 1BSLA 3P8IA 3CH0A 3S1UA 5TNVA 4MZYA 3WLPA 1B9ZA 1B3YA 3BXWA 4HK5A 1L8PA 1H1ZA 2HEJA 4UTLA 4RNIA 3N14A 4A3QA 2I9EA 3UG5A 1A49A 4D8AA 3A47A 1OK4A 3SUUA 1KXTA 3LPOA 1EL3A 5MKGB 1U1JA 5I0DA 3QHNA 3FA3A 4NZ5A 5ABGA 3NG3A 2HBXA 3BMXA 2RGLA 1CZ1A 1A5CA 3KCJA 1HKKA 3P81A 4TX8A 5CBBA 3G1FA 4UTJA 2PUZA 1RVGA 3GR4A 4TV5A 1ESWA 3A3HA 3WCZA 2RUSA 1E9IA 1XYFA 2J8FA 3T6CA 4YXGA 2NLIA 2AAAA 3T07A 3SI9A 4HU8A 2IKIA 3L2MA 4JFVA 3GC5A 1US3A 4ACZA 3UCQA 3T42A 3RPMA 4C6NA 3GVWA 3QLLA 1QWKA 5FF3A 1OG6A 3PBVA 5GNXA 3NQVA 4B5TA 3HQNA 2ZZ3A 1VPYA 3CWHA 2X0SA 4I3GA 4DAIA 5AHNA 4QAIA 1QOQA 1ZCCA 2KAUC 2OB3A 1TPEA 1XLDA 3UCDA 1JZ3A 1VFMA 3O2LA 2YFNA 4K3ZA 4LBUA 1R3QA 3TAKA 1LBLA 3ITXA 3U9IA 1QPOA 3IUDA 2J8TA 4LVAA 4MJ2A 3PUOA 2J4GA 5HJXA 3GHRA 4R7JA 4EOUA 5C2XA 3QRHA 4JX5A 3ZJ7A 3TSDA 3KDOA 3B8VA 4O4WA 3NGFA 4DAFA 1AJ0A 5FSDC 1TZZA 2VI0A 4LAKA 5KINA 3H12A 3BVJA 1KLZA 1ECEA 4ZB2A 2YCJA 5BMWA 1VHCA 4W5ZA 3KLKA 1C93A 3LTPA 5TF0A 1Q8AA 5M03A 4XZLX 5IDIA 2IMRA 4KWVA 1LBMA 3KVKA 2BY1A 2F38A 1D8CA 1ZBVA 3V18A 3UF9A 3UU0A 1GORA 1W5MA 4ATLA 2REQB 1XUZA 1I2NA 4AYSA 1EKOA 3B97A 1VKFA 4GD0A 1V6WA 3QW4B 3FDGA 2D2GA 4YTUA 2F7FA 2QJJA 4DNHA 1TMLA 1JGMA 4LAOA 1OWQA 4MNLA 3IK2A 2O56A 3HQOA 2R1PA 1TJ2A 4Y9AA 4CCDA 4JX4A 4DJDA 1DVJA 4N9BA 3CUGA 1R3YA 4N9EA 2F61A 2WOQA 3A9BA 3XINA 5PTDA 2WNWA 4KS0A 1EDGA 4XBKA 1EF3A 4FLQA 3KW3A 4C1NB 4X63A 1OCBA 3GU9A 1P0NA 4JHMA 1G01A 1W1TA 4LOCA 4Q8PA 4WQ6A 1J01A 2FQIA 3LSCA 1J5TA 1FWFC 2PDXA 3CUJA 4REQB 4J4KA 2OR2A 4F9DA 1VEOA 1W5OA 3F4VA 1H41A 3GK0A 3QFEA 3CPGA 4LQ1A 1R9XA 4HT3A 1DJNA 1YNQA 3R43A 4FIRA 1QATA 4Q7NA 5AC7A 2EPHA 3BCJA 4DPPA 1VPXA 1MRQA 1E72M 1KM1A 1YX1A 1AODA 5CSRA 1V3KA 2QJMA 1ML1A 1WUFA 4EIVA 1PTDA 3EX4A 1I6NA 3T81A 4GY0A 2XTKA 4LALA 4AY1A 4J9JA 1I60A 4R27A 5JIWA 3ORWA 3ALGA 2PWUA 5C0QA 4HTYA 3VC6A 4ZSTA 4B3KA 1A0CA 4IUOA 3AS0A 1VBRA 4Z42C 2EHHA 1AL8A 4GYKA 3TJLA 3CEPA 2OT1A 1G4SA 4G8TA 1FXPA 4AD4A 2DVXA 1UIPA 3LI0A 4LVDA 2A3CA 3W75A 2HISA 1MDLA 2NQJA 4YWSA 5C55A 2WC4A 3BLEA 4R9OA 3TIMA 3ANYA 3TR9A 1E0XA 3RDKA 4XUGA 5K9CA 3L12A 2EKCA 2V5KA 3AHXA 3ARXA 4JIIX 2Y89A 1WDSA 3LD5A 1HL2A 1EA9C 4W84A 1GOKA 3MP5A 4PUKA 4GWEA 4GI8A 4XKMA 4AB4A 2NVAA 2AMGA 3CUHA 4U4MA 2GSHA 4S3BA 5GVJA 3WK1A 4LCRA 5CPOA 3A4AA 5T9BG 5K9XA 1DYSA 4JFWA 3M5VA 2YBVA 3L0NA 5DBTA 3QV7A 4RL3A 1CGYA 3C0SA 2VC5A 4UR8A 4PRRA 4HZ6A 3GIYA 2FLIA 1Z9AA 4LF2A 3KBVA 5DY3A 1HJUA 1MO0A 1JD9A 3LLXA 4DRSA 1JEZA 4DWSA 2R8WA 3OLDA 3UNDA 2EKGA 4MY8A 1SSDA 4B3ZA 1SJAA 4UQAA 1OF6A 4GX9A 2GJXB 3C2VA 2J7BA 1VYRA 1TKKA 5C70A 4UTWA 4KRUA 3NZRA 3SRHA 3BLPX 3IARA 3WLQA 2C1GA 4UOZA 2AL1A 3BICA 4HHPA 1YDNA 3VKAA 3G1HA 3UWUA 1LUCB 3LQGA 3NQGA 3P82A 4C6FA 1AJZA 2IW0A 1G4TA 2NQLA 1QFEA 1B3VA 3KRSA 2W27A 3RM8A 2VXNA 4MZ8A 1FX6A 3FAXA 3ZVHB 1GQLA 3DYMA 2J25A 3LXAA 4JTSA 1KBKA 3L21A 3LV5A 3K4AA 4LC6A 5AVNA 5GQBA 1FWSA 2D3NA 2BY3A 1ICQA 5DBUA 4B15A 4L6OA 5LZLA 3OZOA 3EWYA 3EKGA 1SFTA 3VOCA 1TE6A 4MWAE 3VUPA 5K2ZA 2E9MA 4QBXA 4W7VA 3TQPA 3P60A 3LN3A 1XRFA 4XKYA 5C9ZA 1PSCA 3G1AA 3H2EA 3LG3A 1P7TA 3O6DA 2ZUTA 1TJ0A 4MNJA 1Q66A 2YYUA 3MWCA 1LBFA 3V1HA 2DDXA 4AQLA 3B05A 1BEUA 5JUVA 3V0UA 2A7PA 3S6TA 3C3NA 3OO2A 4B2DD 3DKLA 3VGBA 4YVVA 3MUY1 1ITQA 3E0VA 1BXNA 2VEGA 4DJEC 3UZZA 4RCXA 1PS9A 4XVEA 4W87A 1ISWA 3GUGA 1EX1A 3WQ4A 2H6RA 4IQLA 3VNIA 1RP8A 3WK0A 2E5BA 3CPRA 4GNVA 2HE8A 1BVNP 3CQ0A 1DWGM 4KGLA 1K7EA 1OT2A 1WPCA 3PFRA 3KFTA 4J27A 1FRBA 2YA1A 1TFVA 4UUIA 2QDHA 5M5DA 4ATWA 3VGEA 3GYEA 3OA5A 4XK2A 4QLLA 3B8DA 3S9IA 1XLJA 5F1VA 4QG8A 2HROA 2VOMA 4HP5A 4MTVA 3GZ3A 3PZGA 1NTHA 1SMAA 2GFTA 4IFKA 3UJSA 4X9YA 1G7UA 1PKNA 1V0KA 5E9AA 2NQZA 3OEXA 3W71A 2CBJA 3OVPA 1NDVA 2PWDA 2PLJA 3O05A 2QW5A 3ZT5A 2J79A 3N3MA 4IJBA 3GNOA 1MXGA 1YDOA 1VLWA 4HMNA 2OWCA 5L6UA 4NQ1A 1OYAA 3SIMA 1Q6FA 4PRTA 1A5UA 1TVLA 3FOKA 3NSXA 5CZSA 3UBPC 1TWSA 3P61A 4RDZA 3P5ZA 1WBJA 1K9TA 4MGGA 1YPIA 1CGWA 4Q8OA 1I0DA 3FVMA 4O4VA 1UUMA 3DG3A 3UWVA 3W1RA 3EYPA 2JF7A 2PWVA 3HTWA 2VEPA 3KRBA 1G4PA 1LF1A 2PDYA 1DORA 4LNYA 2Z26A 1M6JA 3SGGA 4KPLA 3LGGA 3CL8A 2I14A 2C71A 4DLFA 1E6PA 2P0IA 1BD0A 2VTFA 1F6YA 4O13A 3ZYZA 1W1YA 1RCXB 2ZDSA 4AZ7A 5I78A 2EBNA 2R82A 2VRQA 2NW0A 1H7WA 4IH3A 5HDRA 2QIWA 4YTQA 4F8XA 2UBPC 4GJJA 2X0YA 1I2RA 4H2CA 3ZSSA 2WPBA 3VGGA 3T4CA 2BG5A 2HMCA 2XVNA 5BRQA 3GVVA 1S2AA 4AUBA 1US2A 1UWIA 1WZMA 2BOEX 2ZX6A 4HYWA 5CPNA 5CZ0A 4MOZA 4EAYA 3EWCA 1TTJA 2VYOA 1MQPA 3CS2A 1FP8A 1BG4A 1X38A 3TTYA 4NAEB 4NSBA 2V68A 4RXFA 4XD6A 1QRQA 3QV8A 2DIKA 5DT5A 3ZMRA 2PZ0A 3TWBA 1JULA 2WNQA 1NH6A 3RYSA 1JCXA 3W88A 1R6WA 3GXMA 4D6HA 1ICSA 2D23A 4BA0A 1FH9A 3S42A 3W4RA 5A2BA 2OLSA 3V3WA 4RPQA 3WUBA 4PTNA 4AZ6A 3BJFA 1QHPA 3K46A 1HJWA 1VC4A 3FEQA 4RLIA 2A3BA 2OFJA 2Z1VA 1SJDA 5HK4A 3V0SA 4PN2A 1GZ1A 5LIYX 2J27A 1ZCOA 3ZLFA 1CECA 3W38A 6CGTA 2XIQA 1G0CA 4TVCA 5C2GA 9RUBA 4RNHA 3E1F1 4GXMA 3RPDA 4A3HA 2OQHA 3OGVA 4HHHA 3ZJ6A 5KITA 3MKVA 3NL2A 4CQDA 2J9XA 3A5FA 4Q4KA 5D2VA 5CGQA 3W7HA 1VENA 1OCNA 1KV5A 4NZFA 1B4EA 1SZNA 1GOWA 1W2VA 2OJPA 2PBOA 1XFBA 4IIGA 1KBJA 2B7PA 4FXSA 1JZ4A 2WKGA 3EMZA 2D69A 4NZ1A 3TW6A 4Z1AA 1DWFM 3QSTA 3OVRA 3BG3A 3CB8A 4OUEA 5HUOA 3W82A 3N2XA 3WQGA 5MHBA 1C9WA 1OFOA 3BLFA 5D9MA 2OX1A 3WH6A 3W81A 2ACSA 4NP7A 5E0KA 1ZY9A 3W7QA 3T09A 3UR5A 1UWSA 3HV9A 2XFYA 5CZTA 5CKSA 4PTVA 1IIHA 4ZE5A 1X7IA 3C8NA 1XHGA 3V4BA 1AD4A 4UIOA 2PWHA 1ZB5A 3OIHA 1ONXA 2FDSA 1RJRA 2W9MA 2Z29A 4HNLA 1DQUA 4FOJA 4GX8A 4O57A 2QXWA 3JW7A 1R86A 3FA5A 3GDTA 1QTWA 4HPXA 1CNVA 2XFWA 3SUTA 4PEKA 5XIMA 4S3DA 3L4ZA 3BAWA 2YL9A 4UTUA 1PTAA 1KKOA 5FSEC 1HF6A 1F3EA 3E0FA 3NYZA 1KM5A 1CGUA 1JXJA 1FH7A 3KWXA 2PDGA 4WDTA 2WBKA 3GXIA 3VYLA 5CAKA 5HMFA 4M5PA 4PTWA 4OU1A 1JD7A 2BVYA 2YZRA 2XZ7A 1KO0A 3MBFA 2F6KA 2ZRUA 1SFLA 4I9TA 2Z24A 1XKYA 4F0SA 1E1FA 3ZLHA 3WQFA 2QULA 2XSXA 2DQWA 4DX3A 3WNOA 1YQ2A 2JFEX 2FVMA 5L9FA 3SGZA 3SURA 4Z1BA 3LNMA 3GBDA 3K4DA 4BF5A 1UD2A 3AYSA 2X16A 4Q8NA 5FA5A 3MJMA 4HPHA 3WELA 4WKAA 1L8NA 4HOZA 1QU4A 4S3FA 1BYAA 3VFLA 3SRDA 2XFRA 2UV8G 5BXTA 1M7OA 2V5CA 5FF7A 3UETA 3WH8A 3M1ZA 1FWTA 1PYMA 1R3SA 4C7FA 2GGGA 2CLPA 1W1IE 3V75A 3VDAA 3KP1A 1ZJBA 2OYLA 3W7EA 3HGSA 4Z2LA 3DECA 2Z1WA 1IWPA 4F2UA 1JUKA 3VD7A 1AG1O 4ERAA 3LGDA 3EPOA 3LUTA 1T40A 4LS1A 1LP6A 4ILSA 2WKJA 1IT8A 3CNYA 2W63A 3G1DA 5D2TA 1SW7A 1DJXA 4YN5A 4QJ5B 1WXYA 1YE6A 3LI1A 3CAQA 3FCPA 1I2QA 3G3MA 1ZP3A 1I1XA 3RX4A 4Y9PA 2IXUA 3V35A 5CBIA 3RLGA 3FKRA 2QIIA 2WQDA 3WD3A 4LAUA 1TUFA 4IIHA 1DJWA 3WLSA 2ZOXA 3MO7A 2DORA 3TNOA 1YBQA 1RA0A 2XVGA 1X6NA 3SY8A 4KCWA 4W93A 3F1QA 3AMCA 1RZMA 2PBGA 3DFYA 4D6CA 3THCA 2CYGA 3WNPA 1F5ZA 4DVOA 4LCSA 3REQB 4GXWA 3WEZA 3UZXA 3WMLA 1MI3A 1OBAA 5EMUA 4LWWA 1XYZA 4KERA 2V69A 2DW7A 4C6KA 3UPMA 6TIMA 1GQKA 3GFXA 1GTHA 4W7WA 1RA5A 1XCWA 3APYA 2DZPA 1NF0A 4H8NA 1YNPA 3C61A 4R88A 4NX0A 1XCFA 2YGYA 4XZ9A 3O07A 3B8TA 3A12A 2XFFA 3UYCA 3O6CA 3MV01 5DLCA 1QNRA 2Q3OA 4ZCWA 2HE5A 4Q4PA 4MDOA 3H6OA 1CCWB 2FZ9A 3ZLGA 3BTNA 3O8AA 5AHLA 1B3OA 4H6QA 3T78A 4LB4A 1XLEA 2TMDA 1LOLA 1TR9A 4PTXA 5CG7A 3PS7A 1UD5A 1I0BA 2CC0A 4K6AA 3BJSA 3I4KA 1W2PA 4JQ3A 1MUCA 5IDZA 4GUJA 3IEBA 5RUBA 2NWRA 2EPOA 1K77A 4MIMA 1XICA 4N4PA 1JI2A 4LXFA 1XQKA 4AISA 3M0JA 2G3FA 4GVGA 4O11A 4PUEA 1GQNA 4N02A 1M9HA 2O7QA 5D04C