1B30A

Xylanase from penicillium simplicissimum, complex with 1,2-(4-deoxy-beta-l-threo-hex-4-enopyranosyluronic acid)-beta-1,4-xylotriose)
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
302
structure length
302
Chain Sequence
EASVSIDAKFKAHGKKYLGTIGDQYTLTKNTKNPAIIKADFGQLTPENSMKWDATEPNRGQFTFSGSDYLVNFAQSNGKLIRGHTLVWHSQLPGWVSSITDKNTLISVLKNHITTVMTRYKGKIYAWDVLNEIFNEDGSLRNSVFYNVIGEDYVRIAFETARSVDPNAKLYINDYNLDSAGYSKVNGMVSHVKKWLAAGIPIDGIGSQTHLGAGAGSAVAGALNALASAGTKEIAITELDIAGASSTDYVNVVNACLNQAKCVGITVWGVADPDSWRSSSSPLLFDGNYNPKAAYNAIANAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (XYLANASE)
publication title Xylan binding subsite mapping in the xylanase from Penicillium simplicissimum using xylooligosaccharides as cryo-protectant.
pubmed doi rcsb
molecule tags Family 10 xylanase
total genus 129
structure length 302
sequence length 302
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 1998-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1b30A00
5GQBA 3WUEA 2QPUA 4GXPA 4D6JA 1CXHA 4M82A 1R7OA 1U33A 3G6MA 4AZ5A 1CYGA 2CNCA 3AZRA 3A47A 2X0HA 5JBDA 3SUTA 3OA5A 4AD0A 3EDKA 1Q6GA 3WH6A 1QHOA 4HA4A 2A3AA 1JNDA 4D72A 2FGZA 3ARXA 3CHFA 4U31A 3CHEA 1HP4A 1LWJA 1QHPA 3N11A 1DP0A 4U3AA 4PMYA 3WNKA 1KQYA 1XH1A 3EBVA 3AJ7A 2XGBA 3ARUA 3PZIA 2VUYA 3APGA 5HDRA 1JI1A 1SR0A 3TTOA 5M5DA 3T2OA 1JZ8A 1GZJA 3KEHA 4PRWA 4D1JA 1S46A 2FHBA 4P8VA 5A3HA 3UETA 5LA2A 2CHOA 1XCWA 1V0NA 3WUBA 2ZUVA 3VIMA 3WD1A 1N82A 3QOKA 2YL6A 1VF8A 1V02E 2VVSA 1ECEA 2ZUUA 1HJQA 4PMUA 3WMBA 1UR8A 4MDOA 4FF5A 3WF0A 1NWTA 2VRKA 2BHYA 1KR1A 4GI8A 3EMCA 3PZTA 1JL8A 4AZCB 4J3UA 1DWJM 3D5HA 1KR0A 2PWDA 1W9DM 3CUIA 1UH3A 1GHSA 4CU8A 3GXMA 3GXFA 1W3LA 4TX8A 3W6LA 3IAPA 2DQXA 3MKKA 4PMXA 1OSEA 1BFNA 2WCGA 4BF7A 4FK9A 1PEZA 1UD6A 3AIEA 1HF6A 1OD8A 1VEPA 3WMSA 3MANA 4LX4A 1UYQA 1B1YA 1CGUA 1WZLA 1YHTA 1E6RA 1ESWA 3QOMA 4P8XA 4D71A 4F9JA 1US2A 2A3EA 2GJXA 3I3BA 1OB0A 3WENA 1V3HA 3OIHA 3ZT6A 1FP8A 2VX4A 4CD5A 1KB3A 1EOKA 5D9OA 5ABHA 1V6YA 1VEOA 3SUWA 1NQ6A 4MAZA 4XB3A 1CGYA 1PBGA 1E56A 4Z2KA 3BCFA 1NM9A 4JHZA 1LJYA 1OT1A 5GNZA 2F61A 2EPOA 2CESA 1JYXA 5FL1A 1JI2A 5E0CA 1CDGA 1V3IA 4JL2A 5HXMA 3OZPA 1X1NA 4OZOA 2CPUA 5CSUA 1HVQA 1JYNA 1W3HA 1BQCA 4V28A 3VPLA 1PZ3A 3L4YA 2J75A 5AC4A 3VOCA 4XZBA 3WFZA 2JIWA 3NDYA 1O7AA 1ZS2A 5D9PA 3WDHA 1JG9A 1U2YA 1DHKA 2ZXQA 2VJXA 3IK2A 3DC0A 2WMJA 1UD4A 4E2OA 2WVVA 1E6PA 2WKGA 1GJUA 3MV01 1M53A 3BAXA 2WVTA 1JZ4A 3GTNA 2Z1SA 3ZJ8A 2O9TA 3RJYA 1V0KA 4UR9A 5EFFA 3RIKA 3GDBA 3O9NA 4CKQA 2DPEA 2J77A 1NH6A 3EDFA 5EFDA 3F5LA 3RCNA 3AXIA 2WCAA 4E8CA 5M03A 1E5NA 2YL8A 5CLWA 3S2CA 4PUDA 1PX8A 2CBUA 2Y2WA 2DIEA 1M03A 4ZXOA 3CIVA 4HOWA 1V03A 2QV4A 1PZ2A 2FH6A 2YA2A 4X9YA 3OBAA 3ZO9A 1GOIA 2XYLA 1P6WA 4Y7EA 2VRJA 4TTGA 3VNZA 6TAAA 5CGMA 3AFBA 4Z2GA 3MUY1 2FH8A 3HN3A 4Q7NA 1KWGA 1OGGA 5GPRA 2J7CA 3MUAA 2ZUMA 3TTQA 3ARWA 2XHYA 2CKRA 1E40A 1UD5A 3RMEA 3U7BA 2VC9A 2VZUA 3K1DA 5I79A 1FA2A 1US3A 2BY3A 1EHNA 4IM4A 3NIYA 4UCFA 2OYMA 2Y24A 2VCBA 3IJ7A 1WDRA 3SCQA 2YDSA 3VD4A 2BY1A 5CPQA 3WNLA 1JZ2A 1EH9A 2FDMA 3T0AA 4D6IA 1V3JA 1K6AA 3M46A 5DFAA 2BHZA 3T08A 4DWSA 1V3MA 1JZ5A 3GNRA 3WF4A 2OWWA 1E4MM 4RE2A 1K9TA 2OSXA 2V3FA 3NJ3A 1ITCA 4JFTA 2XG9A 5I24A 4GI9A 2WZEA 2IXUA 4MJ4A 4W5ZA 4TUFA 4Q22A 1E3ZA 1B3YA 2YBUA 3CZGA 4D6HA 4OBSA 2ZUWA 4W5UA 3CZEA 3MV11 1EXPA 4U33A 3ZM8A 4UOJA 3SURA 2WYSA 4WKAA 1B3VA 3LPPA 1BVNP 1RP9A 4JZ5A 1L8NA 3W29A 5FCZA 3K4AA 4JFUA 3VINA 5C8BB 1IT0A 3NDZA 4MADA 4QP0A 1UQZA 4ATLA 1CGVA 1E4NA 1RP8A 1UR9A 2VCCA 1NARA 2V5DA 1GQKA 5JBEA 1R86A 4QAWA 2VRQA 4W8AA 3B9DA 5EBAA 2YA1A 5CXPA 4FMVA 4UQ9A 1W1VA 2AMGA 2GFTA 4PN2A 3WEZA 1ZU8A 1UG6A 3WQVA 2XSBA 2E40A 5A6JA 5IFPA 1UWUA 1H11A 1OD0A 1M7XA 1TVPA 4BCEA 5BRPA 2EPKX 3K8MA 2PC8A 1J01A 1EDGA 1Q6DA 1E6NA 1VFUA 5HNNA 2WMFA 3A4XA 2J78A 3UG3A 1HN1A 3AROA 1JAEA 1HL9A 3CHCA 1GVIA 2QPSA 1XYZA 4KRTA 2W61A 3AS0A 3K4DA 4FLOA 2WHLA 2XGIA 3LPFA 1E9LA 4GQQA 3MMWA 1XD0A 1H4PA 4HZ6A 2WLYA 3VIIA 4B3LA 2VTFA 4AZCA 2JF7A 2WNWA 4JHOA 2X05A 2E9MA 3LMYA 4HU8A 4OOZA 4C7GA 1C7TA 1JYWA 3WNOA 4XV0A 5A94A 2C8NA 1UWTA 3AMGA 2E8YA 5FIPA 3MMDA 2ZXAA 5DMYA 3FHQA 3DYOA 2WC7A 3IAQA 4GZJA 4UZUA 1KXQA 3AZSA 3L2MA 5C71A 4P8UA 1V3KA 1BVZA 1B9ZA 4AY1A 2G8ZA 2VQTA 3SUUA 2VCAA 3SCTA 1RH9A 4EAMA 1OIFA 3TTSA 1G1YA 3WQWA 3OLEA 1NP2A 3GYCA 2X09A 4AEFA 1JYVA 4W86A 3F4VA 1MW1A 4DM1A 1TE1A 4AD5A 1FOBA 1QW9A 5BXTA 2UY3A 4OJYA 3AMDA 1OWQA 1G94A 4MPKA 4M81A 1CXEA 1QBAA 5CGTA 2Z1KA 2VMFA 2XJ7A 1HJXA 1QVBA 2X1IA 2BFGA 4AW7A 3CMGA 1UD2A 4R5EA 3VGBA 1I1XA 2E9BA 4DM2A 1UH4A 1UKOA 4KWUA 4JKMA 1KCLA 1JNEA 4HOXA 4OUEA 5BROA 4E8DA 3BLPX 1CPUA 3ZJKA 4PMZA 3HMCA 3W4RA 1VRXA 1M01A 3POCA 2D23A 2X0YA 2YL9A 4AZIA 1HNYA 3AZTA 4MNMA 3VIGA 3PZMA 3WDPP 3WF3A 1HJVA 3IJ8A 1QI2A 5EB8A 2XSAA 1E3XA 4HMEA 3MUZ1 4KRUA 4NRRA 3WF2A 2V5CA 4UNIA 1UZ4A 2D20A 5I2UA 5FOOA 5E9AA 1U30A 3KE0A 1D3CA 3U57A 4GZIA 4J27A 2BXYA 5I6SA 2G41A 5M3WA 2DH2A 5A8MA 2CETA 2FHCA 3VGFA 1C92A 2DT2A 3WY1A 3AIVA 3SIMA 3AIWA 3UERA 2WKLA 4J3SA 4DWSB 4UQDA 2XUCA 4X0NA 3UR7A 1OM0A 2WC3A 3OGVA 2WBKA 4JKKA 3VD7A 3RDKA 3VGHA 1DWFM 1G9HA 3PZVA 3UEQA 4U3CA 1ZL1A 2XTKA 4KH2A 3OZOA 1E0VA 4N42A 4D6EA 2J4GA 2CHNA 3FY1A 3WD4A 3BAKA 3VIHA 1KWKA 1UD8A 5FKYA 1YQ2A 3SCSA 3WNMA 3AIBA 4C7FA 3MSGA 2CBIA 1LLOA 1B3XA 2PWHA 3PTQA 1QI0A 3PZGA 4W89A 1UWSA 2EXOA 3L4TA 2W4XA 2W63A 4JFVA 2VNCA 3PBGA 4CN6A 1VJZA 1BTCA 3OLDA 1AQMA 1W3KA 5TD4A 3WKZA 5JBFA 3MS8A 3PZNA 1KCKA 2YJQA 4HU0A 1ODUA 4ZENA 5ABGA 4A4AA 4YPJA 1EO7A 2TAAA 3A4WA 4QLLA 2DEPA 4PBGA 3ARVA 4HMCA 4ZFMA 3AYRA 3WD0A 2BHUA 1CTNA 3VVGA 3A6OA 1MW3A 3ZMRA 2GVYA 2ZIDA 1TA3B 1L0PA 3VMOA 1GQJA 1K9DA 4UOQA 3VU2A 1EDQA 5IXEA 3FAWA 2GDVA 4BQ5A 2DGAA 1QW8A 1C90A 1PX3A 4PTXA 4JCMA 4AZGA 2VZVA 5I5RA 2IUZA 1W2VA 1W9PA 4P7QA 1E43A 3NYDA 3BH4A 1ODZA 1PIGA 3AMKA 3GNOA 3VD3A 1I75A 1MQQA 3AQUA 3T2PA 1MQRA 3VMPA 8A3HA 2WMHA 5D9MA 1BLIA 2CERA 4UFKA 2WSPA 1HKIA 1AQ0A 4DUXA 3PZOA 1JZ3A 4W93A 5CPTA 5EMYA 4HA3A 3TA9A 3ZR6A 1EA9C 2PBOA 2XPKA 4H8HA 3ZSSA 3OG2A 1OT2A 2CCRA 4WK9A 4Z2JA 3EMQA 4W8LA 1VIWA 1IZKA 3W6MA 1Q6EA 1E6ZA 2WAGA 5LA1A 3TONA 3AXXA 1V02A 3L4ZA 1CIUA 2BXZA 1OIMA 1C8YA 5IHRA 1PIFA 2VURA 2J7GA 4EKJA 1ITXA 3OGSA 2J8GA 3SEPA 2EJ1A 4U5IA 3GH4A 2VO5A 2OYLA 3PTMA 3L4WA 1PPIA 4GKLA 1DWGM 5A69A 1UWRA 1BGGA 1R8LA 1DEDA 4AZ6A 1DWHM 2J7BA 1NOUA 4F79A 4MNJA 2UY4A 1ISYA 1QHZA 4RE4A 1UZ1A 5ABFB 3AMLA 4AD4A 1B0IA 3VD9A 1KQZA 1W9VA 3AHZA 4LYRA 4TXEA 4N0RA 4OKDA 3W0KA 3KL3A 1W2PA 4L4OA 1MXDA 2ZWYA 3WH5A 4UFHA 3VD5A 4AXNA 3B9EA 1QBBA 3CUHA 1UWIA 2YIHA 3QGVA 2W92A 1W32A 1VENA 2A3HA 4P7NA 1CXKA 1SYTA 2IXVA 3CZ8A 5DT7A 2F8QA 1XC6A 4IUGA 2XM1A 3UCQA 2J47A 5BCAA 1GOWA 4HPGA 2BVDA 2Y5EA 3II1A 4PMQA 1AMYA 1CENA 5LYRA 3N1AA 4HZ7A 1UR0A 3WN6A 4PMRA 3WQ8A 3WD3A 1KBKA 3NSXA 1LG2A 3FXYA 5IDIA 1BYCA 1B31A 4CGTA 4D1IA 3GZAA 4UQCA 4HP5A 4JL1A 1EGZA 1CLVA 4FLSA 4GO8A 4MB5A 5LA0A 1V6VA 1HXJA 2WM0A 4LYPA 1BGAA 1Y7VA 1HKMA 4HZ8A 3VM7A 1AVAA 2VT0A 1GNXA 1CXIA 1JDCA 3AS3A 5JIPA 1TUXA 4J3WA 3W82A 3ALFA 3WELA 4W8BA 1RD6A 1V0MA 4P8WA 2XVNA 1AQHA 3PZ9A 1ZBCA 2OLHA 2VZTA 3CUJA 1NP0A 1GHRA 1X6NA 5A95A 3HJEA 1LL4A 1E71M 3WDJA 4H8UA 9CGTA 1H2JA 3SUVA 1OINA 3N17A 1WZMA 5BXPA 3WQ4A 2BNJA 3DHUA 4YHGA 1TR1A 2D24A 4AD3A 4EANA 1J0IA 2GK1B 4CN1A 1GOMA 4V27A 3LPGA 1W9UA 5BXRA 4MNKA 3BSHA 3SCOA 4HPHA 5A6KA 2WVSA 4QLJA 4AD1A 3VDBA 3THCA 3ARSA 3VX1A 1GONA 1WPCA 4AZHA 3VM5A 4D6DA 3AOFA 2WB5A 1VB9A 3AHYA 3M07A 3VUPA 5IFTA 1WZAA 1ZJAA 5DT5A 1LQ0A 1E6SM 4M56A 4CD4A 4BQ4A 5I0DA 1VFMA 1NWRA 5JUVA 2ZX7A 2WWCA 3FHAA 3M6DA 4X0VA 2NT1A 3BXWA 5CG0A 3KL0A 3N13A 1GCYA 4IISA 4WLCA 4WF7A 2FHFA 2PWFA 3UESA 1G5AA 2BVYA 2DSZA 2CBVA 2OWXA 3RM8A 1R85A 2J7EA 4DUVA 1A47A 3L2LA 1E72M 3EDDA 4CU7A 3ARQA 4ACZB 1J11A 3CZLA 4P7RA 4AYSA 4PTWA 2G3MA 1XGZA 4Z2LA 1B90A 1DTUA 3VGGA 1B3ZA 2V3EA 1J0HA 2AAAA 3D3AA 1BG9A 5DO8A 2XVGA 3MU7A 3CUGA 2G4FA 4R27A 4MTVA 1UQYA 5AY7A 3VDAA 2YLAA 2G3JA 1JFHA 2BY0A 1KBBA 1VJSA 4H2CA 1UKQA 4ZE5A 3EDEA 4NI3A 2YA0A 3CHDA 1BYAA 1LF1A 1EIBA 2ZXBA 1XH2A 3THDA 2O92A 1TA3A 3TOPA 1SMDA 1EDTA 1IV8A 1E15A 4V2XA 4NF7A 4CN4A 1UWQA 2QLYA 4UFLA 3WBEA 1MYRA 3KZSA 4TOQA 1M04A 5A8PA 4M1RA 2E3ZA 1XH0A 1E73M 2ZWZA 4YHEA 1PJ9A 3SCVA 4M29A 3CTTA 4AWEA 3K46A 2PF0A 2EBNA 2VVNA 5CZKA 2F2HA 3WH9A 1V6WA 4HMDA 1KXTA 5AYBA 3AHTA 2Y4SA 2YL5A 1UOKA 5BXSA 1UR2A 1HIZA 1MXGA 2WBGA 1E6XM 4WJXA 1XRVA 1XSIA 1F4HA 2ZUSA 1C8QA 4NSBA 1FHLA 1E70M 4NZCA 3PTKA 1BG4A 1UKTA 1SFSA 1H0IA 4PEEA 4GQRA 2D22A 5HBFA 2ZICA 3ZJ7A 2VZOA 1F4AA 3N18A 3W28A 3FN9A 3ZJ6A 5GNXA 2UWFA 1W3JA 4J7RA 4UFJA 3AHXA 2GUYA 2NW0A 5CQ1A 3M7SA 2FGLA 1WDPA 3WDRA 1JD7A 4BZYA 6A3HA 1KGWA 5CPSA 1G01A 2QMJA 2EO7A 3U7VA 1LL7A 2YOCA 3BSGA 4ATWA 1TMQA 2VX6A 3PZQA 1BPLB 1TVNA 2DSKA 4HOZA 2OWCA 2RGLA 4CCCA 2OSYA 3NUKA 1GQIA 1FH9A 1HVXA 2Y8VA 4BQ3A 5ABFA 3DYMA 1JZ7A 3BGAA 1WCGA 1MWOA 3VO0A 4HA1A 2Y8KA 4TTUA 1FFQA 1OBAA 1CEOA 2GSJA 2EPNA 2ZX9A 1HKJA 4WKFA 4B9YA 2YBTA 1ZBWA 2VZSA 5D4YA 4S3JA 3RJXA 1WAWA 1CWYA 2EPMX 1B2YA 2W5FA 3GH5A 4UFMA 2O9PA 3WQ5A 4UQBA 1H09A 3CH9A 3JUGA 4KGJA 4A3YA 3TP4A 2J7FA 2D0FA 3WNNA 3UR8A 1H1NA 1KXVA 3GBDA 1UR1A 3PN8A 2W91A 2WMIB 3SCWA 3CGTA 4CCDA 1V3LA 1ZJBA 1EO5A 5M17A 4DWSD 5A2CA 2WC4A 3K8KA 1C7SA 2J74A 1KGXA 4LGXA 1E55A 1UKSA 1MW0A 5I3DA 3AMCA 1XV8A 3AI0A 4W7UA 1VFFA 2CIPA 2O9RA 4ZE4A 1C91A 3WH8A 5BWFA 2PI6A 1J0JA 3I3EA 3VDHA 3IJ9A 1NWUA 3BAIA 2A3BA 2XIIA 3VIPA 3BAYA 1BYBA 5I78A 5FL0A 2G3NA 1JAKA 4PUEA 3UG4A 4URIA 5A2AA 1V6XA 4GI6A 5KZ6A 2D0HA 1R7AA 3VGDA 4WSKA 1GVYA 2HISA 2CKSA 4AEEA 3G6LA 3GM8A 3F5KA 1NOWA 2GJRA 3GBEA 2JEQA 4PMVA 4F66A 1DWIM 3OLIA 3WQ6A 2VR4A 4L4PA 1MFUA 3L4XA 3BLKA 4GPNA 2JALA 1QOXA 2RGMA 4W7WA 1LG1A 3J7HA 2GK1A 4JCLA 2WCSA 4AIEA 1HP5A 3NSMA 3WD2A 2VR5A 4OIFA 5I23A 1E4IA 3LPOA 3OB8A 4LPCA 4MJ2A 2YLLA 3WDQA 1GPFA 3L4UA 3RO8A 1ZBKA 5A8NA 2E9LA 5A6AA 2ZX8A 1NOFA 5F7UA 3B8SA 3WL0A 4AIUA 3U5YA 1Q6FA 2WMGA 1WO2A 3KL5A 5I77A 1GOQA 1IZJA 2WSKA 1K9FA 5D8ZA 3EDJA 4AISA 3BMVA 2XVLA 3QHMA 1E5JA 2QHAA 3WEMA 4RL3A 5ABEA 3KWXA 2NSXA 3MMUA 4M8UA 4MB4A 1VBUA 2DT1A 4EK7A 2YDRA 4UQEA 2DSUA 1QNSA 3DHPA 3L4VA 4PMNA 1E0XA 1JD9A 3W26A 2YKKA 4ACZA 1QNQA 2J7DA 3AS1A 3BMWA 1GORA 4BA0A 5A6MA 1H5VA 2DDXA 4B9ZA 1D2KA 4DUWA 1KXHA 3VIKA 1W91A 3OGRA 2JEPA 1I1WA 1VFOA 7A3HA 5IHSA 2UY5A 4LQ1A 1JFXA 2WK2A 5E6ZA 1HJWA 1A3HA 2WZIA 5A1AA 3T09A 4UFIA 3W24A 2G3IA 1UA7A 1ZBVA 2GJPA 3ZIZA 2ESCA 1BSIA 3ZSTA 4U5KA 3BC9A 4JFWA 4B15A 1EQPA 1XSKA 3GH7A 5A6BA 2Q8XA 2WZHA 2XWEA 2PWEA 3WNPA 7CGTA 3TTYA 3DYPA 1CZ1A 3WDIA 4MB1A 1V6UA 4ATDA 4CUCA 1QI5A 2ZE0A 2W67A 3RPMA 2X2YA 1CECA 4HTYA 4OBRA 1PX4A 1B30A 1VBRA 2WWDA 1PAMA 3N12A 1FHDA 2V3DA 2W66A 4MAVA 4J3TA 2V3GA 1WDSA 1E1EA 1V0LA 4AC1X 1XCXA 3ARPA 4B16A 4J3XA 2D3NA 5JIWA 1J9YA 2ZUNA 3ALGA 3AIRA 2XIBA 1B3WA 5CLTA 3CO4A 4JIEA 3AXHA 1QPKA 1HJUA 4S3KA 2BY2A 1O6IA 1OGSA 1HT6A 1E0WA 2A3CA 2CXGA 5A2BA 3K8LA 1WNOA 1E4LA 3AISA 4IPLA 1V08A 4CVUA 5D8WA 4YN5A 2V38A 2CBJA 2J8FA 5FD0A 1EOMA 3W25A 2XM2A 2VX7A 4UZSA 3WL1A 3AYSA 1ISXA 1WDQA 3N04A 1GOOA 4C7DA 1H0GA 1MW2A 4W87A 3EMZA 3ECQA 4CD8A 4CCEA 1D7FA 3T2QA 4DWSC 1FP9A 5A6LA 3WUFA 3W53A 4TVUA 2QF8A 1X6LA 1ISVA 8CGTA 2ZX5A 1C93A 3VDCA 4XUYA 4ACYA 3CLWA 3N15A 5CSYA 3FW6A 4H8VA 3E1F1 4KMQA 3FNDA 1TFVA 1JDDA 4D6CA 2XFRA 5A6SA 3POHA 2J7HA 3WBAA 2DT0A 2WHMA 5DEZA 1K9EA 1KGUA 2CYGA 3GXIA 2WW5A 1HJSA 1Q4NX 2OYKA 3VIFA 3GNPA 4H04A 4AZ7A 2WMIA 4CD7A 3EYPA 1XHGA 2VOTA 1UD3A 4PTVA 1J0YA 2ZOXA 4GO9A 2D3LA 2DH3A 1GW1A 1LL6A 4W7VA 2PWGA 3CBWA 3U5UA 2ZXDA 1JF5A 2ZX6A 4FLRA 3CMJA 1BAGA 1CXLA 4W85A 4E4PA 1BYDA 1XD1A 3VIOA 3NSNA 3N9KA 1BF2A 4NRSA 4W84A 1H3GA 1JXJA 3RM4A 2BVTA 1JIBA 1JDAA 4AD2A 1J10A 1OGBA 2WHKA 4WSJA 1QI3A 1QI4A 3UG5A 4UTFA 3S6TA 2JF6A 1R87A 1GQLA 4MDPA 2GDUA 3MSDA 1GOKA 2VL4A 2EEXA 2WMKA 4FLQA 1ISWA 4H41A 3ARYA 3O6AA 3AS2A 2WXDM 4TX6A 3CUFA 3BAJA 2OSWA 1LWHA 4Z2IA 3FAXA 4PYSA 4QCEA 2D1ZA 3T0BA 2MANA 1H49A 1CNVA 4JKLA 1UH2A 1WZKA 5E6YA 2EQDA 4W88A 5C70A 2ZUTA 3IANA 3W38A 1HL8A 1MVYA 3CZJA 1C3FA 4ZEPA 1WKYA 5A6BD 3F5JA 1W1TA 1WB0A 1CXFA 3SCRA 1QNOA 3PHAA 4P7OA 5BRQA 4CVWA 4WIWA 3HU7A 2DIJA 5ECUA 4GZEA 4MB3A 4WKHA 2VX5A 4XZWA 5E70A 4TVDA 3DECA 3AICA 1JXKA 2GJXB 4OOUA 5DF0A 5A8QA 1H41A 1HX0A 2VI0A 3WH7A 3SUSA 3ARTA 5HPCA 4J3VA 2WPGA 1CGTA 1XYFA 5E09A 4TVCA 1HKKA 4U2YA 1JF6A 3VIJA 4B3KA 2VQUA 4F8XA 3VILA 2WVUA 4GINA 4IPNB 1CGWA 3CZKA 4UQAA 3ZOAA 2O9OA 1EHAA 2CEQA 3BCDA 5AYIA 1FH8A 2WANA 3AIUA 2PBGA 4JAWA 5KEZA 4MNLA 3ZT5A 2DSWA 4PSPA 1MQPA 1JGIA 3MUIA 2D0GA 4XX6A 1TG7A 1ZB5A 2E8ZA 4GIAA 4BS0A 2E4TA 5GNYA 1E6QM 2XVPA 3QR3A 4LXFA 3VGEA 1DWAM 2J25A 2B31A 2AOSA 2CITA 3VNYA 4CD6A 4RE3A 1W1YA 3WMCA 3BAWA 3W27A 3CPUA 2BS9A 2WVVB 4PCSA 4CU6A 1FH7A 5BYWA 3O2LA 5HOSA 4PCTA 7TAAA 3NCOA 2JFEX 1UHVA 3QHOA 1JZ6A 1XSJA 4H7VA 4KGLA 5E0FA 1J0ZA 2QMKA 3WUGA 3ARRA 4D6FA 1SMAA 3I3DA 4QLKA 3AHVA 1TZ7A 3WIJA 4PSRA 1Q6CA 3GXDA 4JFSA 4LYQA 3AIQA 4PMDA 3W37A 4ZXLA 4D6GA 2XVKA 3ARZA 4AZBA 1UA3A 2C0HA 3VMNA 2WLZA 5D9NA 4K68A 1W9XA 5AC5A 3A4AA 1WE5A 2JE8A 1W9BM 4P7LA 1UUQA 4QDMA 1QNRA 3OLGA 3WF1A 1NWSA 2HVMA 1VAHA 2XFFA 2WHJA 4ML4A 2X8RA 3MO4A 3SCUA 6CGTA 3RM9A 4PTMA 1RPKA 3ZQ9A 2EPLX 1C8XA 2DT3A 4U2ZA 1J12A 1CLXA 4M24A 3A3HA 4PMOA 4UOZA 3WEOA 4BQ2A 3WSUA 2J79A 4Z2HA 3W81A 1EQCA 5HPOA 4AIOA 1OCQA 1TCMA 4AMCA 2DSVA 4EE9A 2UY2A 1ISZA 3SCPA 1W1PA 4M80A 1FFRA 2E0PA 3QHNA 2PB1A 2W62A 5A8OA 3ZT7A 2YDQA 1UKPA 3VKKA 2JIEA 4J28A 4QFUA 4F9DA 3ZR5A 3B9AA 4A3HA 1CBGA 4QCFA 1KFWA 1GUVA 2XWDA 1Z32X 1WP6A 1UR4A 1G0CA 3WFLA 1VEMA 2J62A 3SCNA 2D2OA 1J18A 1MFVA 3VTRA 2C7FA 5CJ5A 1QNPA 3VX0A 3RILA 2BV9A 2XFYA 3PZUA 1GJWA 1J0KA 1CGXA 3T0DA 1E1FA 2NT0A 1BHGA
chains in the Genus database with same CATH superfamily
3KVLA 1XBXA 2DZAA 3WUEA 2QPUA 4D6JA 3QR0A 1XIMA 4QS5A 3UW6A 4NAEA 4QR6A 2A1YA 4US6A 1U33A 3G6MA 5BOEA 1FWHC 2CNCA 1UZHA 4C6BA 2FZ9A 4HZMA 3SUTA 4AF0B 1Q6GA 1YXCA 1JNDA 1PKLA 1BXCA 4HHMA 1OFBA 3QC3A 3CHFA 4WGHA 4PB5A 1Z3NA 1HP4A 3STGA 4FNPA 1DP0A 4U3AA 1XH1A 2OX1A 4BI6A 4QJ5B 5HDRA 1XDJA 3VNIA 3W7IA 1GZJA 1Q66A 2CLKA 3KEHA 3FKRA 4D1JA 3S9IA 3DFHA 2FHBA 4P8VA 3USZA 5A3HA 1FKXA 3O15A 4RKAA 4GX9A 3IRSA 4XSLA 2QEZA 2Z29A 1H7PA 4G7EA 3D46A 2NQ5A 1N82A 3QOKA 1OF8A 2D2JA 1ECEA 3PM6A 4PMUA 3TN3A 1AW2A 2VFFA 4B92A 4FF5A 1E9ZB 3ITVA 4MLJA 2BHYA 1KR1A 1W31A 3EMCA 3REQA 3MPGA 5F1UA 3N9RA 1GHSA 4ZR8A 5CAHA 4FNQA 5K3VA 3NGFA 2IPGA 2YR1A 1LT8A 1OSEA 1BFNA 4WOQA 2I5QA 3TJLA 4FK9A 1PEZA 2TPSA 3AIEA 3MANA 4LX4A 3ABXA 2R1MA 1CGUA 1WZLA 1CW2A 1YPIA 1TE6A 4F9JA 3EA3A 3R43A 1OB0A 3WENA 3WBWA 2NV1A 3BW2A 2ZQ0A 4KF1A 1VEOA 1X96A 2YSWA 3SUWA 3WQCA 3T05A 1RA5A 4QNEA 1FWBC 3QF0A 4HMNA 1REQB 3OG3A 4M6QA 1NM9A 4JHZA 5GNZA 3LZ3A 1VQTA 5E0CA 4JL2A 1X1NA 1JYNA 2HQAA 4NU7A 4UTJA 3N2XA 3TLLA 1FDYA 3FYPA 4V28A 3VPLA 1MRAA 4PRRA 3L4YA 1F3WA 4QDWA 2Z6JA 1U2YA 1DHKA 4GK8A 2DZUA 3M47A 1SFTA 4CNOA 4MFDA 2QUNA 2EG6A 3WLTA 2QCLA 2WKGA 1GJUA 1EL3A 5C2XA 1FCQA 1EPVA 1M53A 3LDVA 1TPVA 3GTNA 4DBUA 3ZJ8A 3BANA 4HCHA 4UR9A 5CSRA 2P8BA 3TNOA 2OO6A 4CEXC 2RDTA 2H9AB 5CZ0A 5EFDA 4E6MA 3V0TA 3NNTA 5HATA 4R53A 3SW6A 1KRMA 2E28A 2WCAA 4E8CA 3PBUA 5CLWA 5K9XA 3S2CA 1VD6A 4YYFA 4ZXOA 1F5ZA 3GNDA 3S83A 3S9ZA 1Z44A 5T9BG 2ZRUA 2FH6A 2YA2A 2ISVA 3IIZA 1ICQA 5LNSA 4BI7A 3ZO9A 4Y7EA 4L7ZA 1EJWC 3AFBA 4A3RA 1FQ0A 3MUY1 3TFXA 3UA4A 3PJWA 2R8WA 3QV8A 3MUAA 2ZUMA 5FJJA 4IJBA 1FCUA 2CKRA 3CEPA 3VFCA 3RMEA 1YKWA 3FA4A 2VC9A 5T91A 2VZUA 1US3A 1L6SA 2FB3A 1EHNA 3HPAA 1W3IA 1E0UA 2VCBA 3IJ7A 3WMLA 1N2VA 4HT3A 4EWJA 1RJPA 4S23A 5I02A 1QFEA 2B7QA 4DYEA 2E6FA 3AC0A 1JZ2A 1FKWA 4GH1A 4D6IA 1XIBA 2X16A 1FWAC 2EHHA 2X1RA 1K6AA 4DWSA 4F48A 1M7OA 1R9YA 2OG9A 3GNRA 4HKPA 2G4JA 4YTUA 3G1VA 2V3FA 4L9YA 1W1IE 2FVKA 2XG9A 1S1RA 2QGHA 2WZEA 2IXUA 3CWNA 1E3ZA 3Q94A 1B3YA 3WLRA 3PPGA 1XINA 3CZGA 4OBSA 4W5UA 3GZ3A 1EXPA 3ZM8A 3ZWSA 1TQJA 1B3VA 3NYZA 2ISWA 3CPGA 4JTAA 3A23A 1BVNP 3MA8A 1L8NA 4UTWA 3W29A 4DPQA 3K4AA 4JFUA 1PHQA 3IGXA 3NDZA 4MADA 4QP0A 3LG3A 1E4NA 3DKLA 3NQCA 4QNWA 1GQKA 1PZ0A 2QIIA 4W8AA 4FS9A 4H2HA 2YA1A 1ZCCA 4FMVA 1R2TA 2FTPA 1XXXA 2AMGA 3M5YA 4MM1A 1EYEA 4PN2A 3WEZA 4Y6GA 4GQBA 3WQVA 2XSBA 5AOUA 1EEPA 4BCEA 5BRPA 2ANUA 2VC6A 2PF8A 4JXCA 1Q6DA 1E6NA 2CWXA 3C2YA 4J9JA 4KIEA 1VFUA 2FQIA 3AROA 1JAEA 3VC6A 1HL9A 1B4EA 4JX4A 4HA0A 5AYXA 1YLVA 4FLOA 1TTQA 3S1UA 1GT8A 4GQQA 2GUBA 3MMWA 1JULA 3VIIA 1LOQA 3TOYA 4AZCA 2PTZA 4JHOA 2E9MA 4B5VA 1RALA 4C7GA 3C52A 1JYWA 2J6XA 4GABA 3H8AA 4XV0A 5A94A 4JTQA 3RR4A 1XQLA 3KTXA 2E8YA 1PHWA 2ZXAA 2WC7A 1RXOB 1U83A 1AJ0A 4JTIA 1G7VA 1B9ZA 3SR7A 2VDGA 1RH9A 1JGMA 1OIFA 3U2CA 3GWQA 4AEFA 1JYVA 4W86A 3F4VA 4GQ0A 4NASA 4XUGA 4NJHA 5BMWA 1F3EA 3EWCA 2INZA 4OJYA 3KRBA 5E1QA 1LUCB 1G94A 4MPKA 1R3TA 5KSWA 4KEZA 4QEHA 1OC5A 1WA3A 1EBHA 2MUCA 1QVBA 4B90A 3E0LA 2RH9A 3HMJG 1UD2A 1R38A 3AUJA 1VZWA 3UT0A 3W02A 2QV5A 4FXFA 5EPDA 2E9BA 2OGYA 5U7SA 1KCLA 3M43A 3C5QA 5G5IA 4L80A 3VNLA 4MZ8A 3HMCA 3W4RA 3LM7A 1IE7C 4GUHA 2D23A 2ALDA 3LRMA 4DF0A 2QVHA 4HU3A 2WJFA 3ABRA 3WDPP 3UBPC 4MVAA 3WF3A 3TIMA 3SFKA 1B3OA 3G24A 5EB8A 1E3XA 3H2MA 4HMEA 3MUZ1 4N9BA 1J6PA 2XIJA 5E9AA 1A0EA 2FIQA 3KE0A 1S5NA 1XLAA 2G41A 5DELA 3ONCA 4ADSA 4ENLA 2FHCA 3VGFA 1KLYA 1KO0A 2PP3A 3WY1A 3NA8A 4R88A 3UERA 2WKLA 4J3SA 1KM3A 4DWSB 1SQ7A 2A6LA 4X0NA 3UWVA 2PA6A 2WC3A 2YPIA 3OGVA 4HNNA 4J4KA 1DWFM 1RVGA 4C6CA 4R7WA 3S1XA 2IKIA 4Z1CA 4U3CA 4KH2A 4N42A 4JTKA 4C6MA 4D6EA 5I07A 3MWAA 3FY1A 3G1XA 3UJRA 4B91A 4D8AA 1KWKA 4INFA 3EKGA 5FKYA 3EGJA 3SCSA 4GFSA 3WNMA 3AIBA 4C6DA 5D32A 1BD0A 1KC7A 2C15A 2CBIA 1LLOA 4H9VA 5HR7A 1V7YA 3PTQA 1QI0A 1EZWA 3HQ1A 4W89A 4QROA 4RNFA 1FXQA 2ZRYA 4PB3A 2W63A 3PBGA 1GVEA 1BTCA 1AQMA 3H2OA 3H6OA 2YJQA 1RA0A 4A4AA 4YPJA 1XIHA 5G2HA 2DEPA 2GVGA 5A8GA 2C1GA 4OGZA 1XYCA 4DNHA 1CTNA 3VVGA 5KTLA 4JIQA 1F07A 3IVSA 2HMCA 1IEXA 1JCTA 1P0DA 5DLCA 1XIFA 2FMNA 2F2KA 3IIXA 3FAWA 4JN7A 4BQ5A 1W1A1 3SJ3A 4JCMA 1H7WA 3A64A 2IUZA 1Y5VA 1EJXC 3BH4A 2EG8A 2IKJA 3AMKA 1PDYA 2HBVA 1KD0A 3BL3A 3SIZA 1QU4A 1MQQA 1BLIA 4QGCA 4GX8A 4UFKA 5KMYA 2Y5SA 3STFA 1HKIA 4LH8A 3WJWA 2WNZA 4UMCA 1R3QA 2V30A 3B8VA 4IFKA 4HA3A 4LVGA 3KP0A 3TA9A 1SZRA 1HKWA 3ZSSA 3OG2A 4E38A 3LM3A 5D30A 3W6MA 1Q6EA 4XBJA 1DVJA 3L4ZA 1CIUA 5CBIA 1EP3A 2YW4A 4K7VA 1FCVA 1LROA 2J8GA 2AL2B 2OYLA 5CZJA 2QDEA 4MWAC 3U48A 5FEZA 3PTMA 3FGCA 4L64A 1XC4A 4XIMA 1R8LA 1S3TC 1DWHM 3N6HA 2J7BA 1NOUA 3KVKA 5J8LA 1ISYA 3QSTA 1UZ1A 2G95A 1VIZA 3RXZA 4GA8A 2P88A 1KQZA 3AHZA 1UCWA 3BK0A 3JW7A 4N0RA 4OKDA 3WH5A 4UFHA 2HE5A 4AXNA 3B9EA 1PIIA 3CUHA 3LI1A 1UWIA 4H6EA 1I45A 4RW3A 4XSMA 1VENA 1WKDA 1CXKA 4FAMA 2OCZA 1HTIA 5IDZA 2OX4A 5DT7A 3QJAA 4DO6A 4O0KA 1XC6A 2YZ5A 1XPYA 2Y5EA 3CH0A 4HBKA 3II1A 1CENA 3WN6A 4UC5A 4ZB2A 3IIVA 3WD3A 3E38A 5KZMA 1B31A 3B0XA 4D1IA 3GZAA 3TZNA 2AMXA 5LNUA 3BVJA 1EJTC 4AX6A 3WQEA 5EL1A 3KLKA 5I00A 1QPQA 3VM7A 2VT0A 5DX7A 3AS3A 5JIPA 1G4EA 3ALFA 1EP1A 3A3WA 1V0MA 3BLIA 4IJRA 4IT1A 1QMLA 3PZ9A 3BLFA 4C6KA 2FB2A 3CUJA 4RDYA 3M1ZA 1WUFA 2OQYA 3M6YA 4X63A 3HJEA 4J2PA 1LL4A 1WXYA 2JKAA 3WDJA 3NDOA 1V51A 1F8IA 2VKZG 1OINA 1TJ0A 1GYMA 1VH7A 5SWUA 4GYFA 3URQA 2GK1B 3LPGA 1S5MA 1W9UA 4MNKA 1GG1A 4Q8NA 4N2YA 3FA3A 2VEPA 3CQKA 4H9XA 3G3DA 4QLJA 1W5QA 1S2WA 1BEUA 4IIDA 1VFSA 3W1TA 4DVOA 2V6AA 3VM5A 3AOFA 1YDOA 3QYSA 1YTDA 2FLIA 1ZJAA 2NLIA 2W0UA 4N6FA 1RVKA 2IPWA 1MRQA 1VFMA 3CASA 1NWRA 4XAFA 1X38A 2QR6A 4Q6JA 5CG0A 3TCEA 1GCYA 2PC4A 4WLCA 2FHFA 1G5AA 1A53A 3EOSA 4LC8A 5CCZA 2CBVA 4GJJA 2OWXA 2YCJA 4DUVA 1A47A 1TTPA 3RRAA 3W73A 1J11A 1MXSA 4AYSA 2G3MA 2PLJA 1XGZA 3BLEA 2OFJA 1VJIA 1B57A 5LIUX 4IP5A 1BWVA 4GKTA 2ASHA 3CUGA 5BRBA 4N4PA 3QC0A 4MTVA 5AY7A 2G3JA 4AHPA 1JFHA 3GVQA 3WYZA 1F3XA 3BZJA 4H2CA 1UKQA 3UXAA 3EDEA 5H2ZA 4JY8A 4NI3A 4HPNA 1S1PA 2XN2A 2ZXBA 3CK5A 5MHBA 2O92A 1YTKA 3IARA 4NQ1A 3DOPA 2KAUC 1E15A 2JQXA 4V2XA 4NF7A 1UWQA 3WQOA 4UFLA 1MYRA 4TOQA 1TX2A 3E0WA 4M1RA 2E3ZA 1E73M 2QJGA 3AU2A 2PGWA 3SCVA 1DIEA 3BG9A 4IL2A 3HIJA 1O60A 3SFWA 2O4QA 2VVNA 1MUCA 5CZKA 2VGIA 1V6WA 5DN1A 3OHIA 4LUTB 3G22A 4HMDA 3O1NA 3W7RA 1C9WA 3AHTA 3OVRA 2YL5A 2X1TA 4XISA 1XSIA 5DBTA 1XUZA 3NL6A 1C8QA 1BG4A 3H2AA 2DZVA 4PUWA 4ZTXA 5IBXA 1XFBA 2QUVA 1JUKA 4PBEA 3UPBA 4KFPA 3TA6A 2LLEA 1W3JA 2GUYA 2I9UA 3PVFA 2NW0A 3M7SA 2FGLA 1P7TA 2IQ0A 3C2VA 4LCSA 1JD7A 2PU1A 6A3HA 3EKLA 1YPFA 3CO8A 3O06A 1F76A 1TTJA 1LP6A 2YOCA 4MLRA 1KRCC 2PWVA 2NZLA 3SI9A 4CLMA 4MWAB 5FJUA 2PDXA 4PH6A 4US5A 1BPLB 3P0XA 1TWZA 5REQA 4HOZA 2OSYA 2DUZA 1GQIA 1HFBA 1FH9A 1HVXA 2Y8VA 4Z1DA 2Y85A 1OFEA 3H2CA 3RFAA 3VO0A 3V5CA 1CEOA 4GRSA 3WBYA 3ZYZA 3MUXA 3PNUA 2EPNA 4FNTA 2ZX9A 2C91A 1TR9A 4S3JA 3SADA 3RJXA 1WAWA 3GH5A 1B2YA 2PSNA 1LORA 4GIYA 4XD6A 2FTWA 3FDKA 1J2WA 3JUGA 1O1ZA 3TP4A 3TLQA 1X98A 3B0VC 3DG6A 4WXYA 4O17A 2IQTA 1UR1A 2VWTA 3TKFA 4GIRA 1ZJBA 1QDSA 3TYAA 4CNTA 5A2CA 3L21A 3A12A 1RAKA 3TAOA 1UKSA 4LUSA 1XV8A 4FXSA 4W7UA 3HGOA 4Q8TA 2CIPA 2O9RA 3H53A 1C91A 5BWFA 1I4NA 4O0QA 3UVIA 1J0JA 3P3BA 3IJ9A 3BAIA 2A3BA 5A5WA 3RX4A 1Q8AA 5HNRA 2HPIA 3HJZA 5FL0A 3BTNA 3GHTA 2ISFA 4I7UA 4URIA 5HNTA 3UVAA 3VGDA 1ALDA 3OJGA 3F5KA 2J24A 4OBTA 1XISA 2GJRA 5DRIA 1A4MA 1YIXA 1XLEA 1PYMA 4PL1A 4ZQCA 1Q7MA 3CYJA 4DF1A 1P1XA 1VYRA 1SJAA 3V5FA 2Q71A 4CQDA 3W7NA 4XQ6A 1LG1A 2Q6ZA 2QGYA 3LK6A 2DFAA 1ADDA 2GOUA 3AAMA 2FZMA 2WCSA 3P62A 2FTYA 3DENA 1FHVA 2HVNA 5DRCA 1AD4A 3LPOA 1DJGA 3OB8A 4LPCA 4GE8A 5DMLA 1ZBKA 5A8NA 2PURA 1EC8A 1GGOA 2YCKX 5A6AA 1SW3A 4RNJA 5H8MA 2VDHA 3B8IA 2HS8A 3QTGA 5M2FX 5F7UA 4QTGA 1WO2A 3VKCA 5I77A 2WSKA 1ME8A 1DJHA 2PDGA 4IIEA 4XKMA 4AISA 5HK4A 3BMVA 2WPBA 4Q8PA 2NWSA 4RL3A 3FJLA 3T9PA 4XTDA 3W1RA 4M8UA 3QV6A 1VBUA 2BX7A 2V2HA 4EK7A 4LWWA 3MJYA 4L1XA 1X6UA 2OZ0A 1M7JA 3QZ6A 1GG0A 5AHEA 1SW0A 1T5AA 1DXIA 3AS1A 3DN5A 4GUGA 1MNSA 3ZR4A 4QG8A 3GC4A 1D2KA 1GQNA 4RDVA 3WJYA 2CU0A 5BMXA 3WJXA 3OGRA 2W27A 4YWSA 1JFXA 2R1PA 3UJSA 1A3HA 3CU2A 4AWUA 3RUBL 4K8HA 1ZBVA 3O6CA 3VKAA 3ZIZA 1BSIA 4IX2A 1AW1A 4GWEA 2CZEA 2GGHA 4JFWA 3RLHA 4B15A 2JGYA 4K1WA 5EMUA 1QXLA 5A6BA 5C5YA 1PV8A 2DJXA 5G1TA 4JBRA 3H24A 2XDFA 4ATDA 4IIBA 3IGHX 3MI6A 4CUCA 1QI5A 4HK5A 3P67A 4GC4A 2BOEX 2X2YA 3NXLA 4IFOA 1CECA 4HTYA 4CEUC 1VBRA 1FHDA 5HWJA 4MAVA 2W66A 3UY8A 2DVTA 4LUYA 1K8CA 3RCMA 2VEFA 1YNQA 1V0LA 4DBSA 4AC1X 4C6IA 4AWSA 1XBVA 2O55A 3CIXA 4DQWA 1VYPX 4N6EA 2ZUNA 1ME9A 3KBVA 1ZJIA 2NSOA 5CLTA 3PUOA 1C9DA 1OADA 6XIAA 1TV4A 1O6IA 3XIMA 3HGRA 1E0WA 1M68A 2A3CA 5I3HA 1W0MA 5MKGB 1KCZA 3AISA 4IPLA 1V08A 3BLLA 5D8WA 1EC7A 4A8RA 4K6AA 1SZNA 5FD0A 5C55A 4HN8A 1EOMA 3AYTA 1OFPA 4AY8A 2CHRA 2VX7A 3PJXA 3M0YA 1RLDA 1ISXA 4E0CA 3E12A 4Q4QA 4C7DA 1K7XA 2CZVA 2A0NA 3EMZA 4CD8A 4CCEA 1D7FA 3T2QA 4ZB0A 4ZOCA 3WUFA 4TVUA 2QF8A 1PWMA 1ISVA 2INEA 3E3HA 4I8DA 5H8UA 2ZX5A 5XIAA 4YTQA 4XUYA 1BRLA 4XD5A 4JIPA 3FNDA 4FSAA 4D6CA 3PANA 3UPWA 3MMTA 3WBAA 2I7GA 4I5RA 1HO4A 2P5NA 4OTKA 5DEZA 2V5BA 2CYGA 3M0IA 1Q4NX 5AVNA 4JOMA 3PC0A 3EYPA 1LOLA 1XCFA 3W23A 2A21A 2AQWA 3RLUA 3W7PA 2VOTA 3P80A 1UD3A 4PTVA 1FWIC 3KHJA 4NIRA 1RCOB 2ZOXA 1OK4A 1POKA 3W3OA 4E3TA 3NM3A 3I7RA 1VCGA 4FLRA 2E1WA 1LLWA 3V1PA 4P61A 3OTRA 1OABA 2KZHA 1CB7B 1H3GA 1JXJA 5KINA 2AGTA 1K3UA 1J10A 2DORA 3KDOA 1F2JA 3UG5A 3R10A 4QRNA 4PR4A 3F4CA 3S6TA 2GDUA 4CNSA 1T7LA 4FLQA 4R34A 3ARYA 3AS2A 3ZZ1A 1ZLPA 1V8EA 2D1ZA 4M7SA 3T0BA 3UZ5A 4Q8QA 1UH2A 4N7QA 2C0AA 2EQDA 3TQKA 1ONRA 5C70A 2ZUTA 3IANA 3W38A 4DB7A 4Y96A 3H54A 1OG0A 1TB3A 3GUGA 3E5PA 3P61A 1WB0A 3ONBA 1CXFA 4D9PA 1QNOA 4P7OA 5BRQA 4H9YA 4WIWA 3MCMA 2DIJA 4MB3A 1JRBA 1QJWA 4XZWA 3AICA 1JXKA 3GHRA 2AKZA 3I7QA 2EJAA 1CGTA 1XYFA 5G4EA 3VIJA 4B3KA 4F8XA 3VILA 2R14A 4GINA 3NAVA 4JYFA 4O53A 5HQMA 3PUGA 3CAWA 2CEQA 1FBAA 3ENLA 3IIOA 2VGFA 3Q45A 4PSPA 1MQPA 3FEQA 3MUIA 4GJIA 1DJIA 3S5NA 4JR5A 4RV3A 2QCFA 4GIAA 5JXQA 3LS9A 2JBMA 4JX6A 3T81A 5GNYA 1LQ2A 3LV5A 4H7ZA 3GU9A 3QR3A 2AOSA 3QW4B 1DJYA 2Q02A 1U1UA 4ILSA 1XLBA 2BS9A 5B80A 4PCSA 1FH7A 5BYWA 4YCPA 4O54A 5HOSA 1D7KA 5HUPA 1WYIA 3NCOA 3Q67A 1UHVA 1GEQA 1H1ZA 5XIMA 2XZ9A 4ZO7A 4D6FA 3AHVA 3YPIA 3O0FA 1VGAA 2R6OA 4O8RA 4LYQA 3AIQA 3ORWA 3W37A 1ZAHA 2VR2A 3L0GA 2PLCA 4AZBA 1LTDA 3WG6A 4CNPA 2RFGA 4FB7A 2J9XA 2WLZA 4X61A 4GXMA 2FVLA 2HBXA 1W9BM 2V5JA 3UU0A 4WRHA 1UZDA 3BQ6A 2XFFA 3UFYA 2P8CA 2NX3A 1IR2A 2EPLX 3MO7A 1CLXA 4DJFD 2YCIX 1TZZA 4HNOA 3R8HA 4UOZA 3IUHA 3WEOA 4IG2A 4BQ2A 1OYAA 4Z2HA 3W81A 2P10A 1IWAA 3DG3A 2I9EA 3HQOA 4AIOA 1OCQA 1OG6A 3QFEA 2DSVA 4JNYA 4QG6A 3TN4A 3H70A 3G8EA 4A05A 1W1PA 4M80A 1FFRA 5AN7A 5J5DA 4L56A 3D0CA 5A8OA 1BKSA 1UKPA 4XVDA 2Z00A 2JIEA 4NNCA 4F9DA 3HURA 4MKSA 1CBGA 1KFWA 3LU2A 4KFOA 1GUVA 1Z32X 3T0CA 2Y6ZA 5D09A 4IQJA 3WK1A 3CAQA 2CZ5A 4E4FA 3GNNA 3TSBA 2C7FA 2NWRA 1QNPA 1OF6A 2BV9A 1CGXA 2ABAA 4JTTA 2NT0A 1TVLA 1BHGA 2BZNA 4GXPA 5AC8A 5CKSA 4M82A 4FX6M 1KM0A 4A2SA 1CYGA 3AZRA 4B3ZA 3A47A 5BNKA 5K4ZA 1MUMA 1NY1A 4GYJA 2BDQA 4AD0A 5ENLA 3WH6A 4LT9A 5F1VA 1NF7A 2A3AA 3NOYA 1W1ZA 4D72A 2FGZA 1Q45A 4U31A 5AVHA 3VZZA 2VEKA 3N11A 4GYPC 1QASA 5G1MA 1A49A 1J2BA 5T8GA 4LBRA 3URAA 3IPWA 3TTOA 5M5DA 4FO4A 1JZ8A 5AHNA 4F0KA 1S46A 1L6YA 3UETA 4WJ8A 3V3WA 3F4NA 3S6DA 2QZRA 3W1XA 3WUBA 2IW0A 4FR1A 1ZY9A 3N25A 2FFIA 1A80A 1VF8A 1V02E 2ZUUA 3MI3A 4BY3A 1YX1A 1ZUAX 2VRKA 3P8JA 2HCVA 4OWGA 1B9BA 1O5XA 4CQ8A 3PZTA 4JTFA 3D5HA 3IUIA 2PWDA 1W9DM 4N02A 1UH3A 3R8GA 1W3LA 1H63A 2Z4GA 4H1ZA 2FZDA 3MKKA 2ZZ5A 4PMXA 2OODA 4Q4MA 1OD8A 3WMSA 4P5UA 1YHTA 1E6RA 1ESWA 4D71A 4L9XA 2A3EA 3KS5A 2GJXA 4Q8WA 3UGVA 1R3VA 3NO1A 1V3HA 3BV4A 2ABBA 4Z1YA 2VX4A 1EOKA 2VFDA 5D9OA 1SSGA 2PP1A 2QCNA 4MAZA 4XB3A 3MT1A 4RNHA 3NEVA 2ZC8A 4LS2A 3BCFA 4QE5A 2QCDB 2F61A 2D2HA 4JHMA 4O18A 4Q7BA 1TPH1 4R9OA 1Q6LA 3NQ6A 3OZPA 4OZOA 2CPUA 1HVQA 1W3HA 4E3VA 1O12A 3QPZA 2GGEA 3C86A 1FDZA 4B2DD 2HE8A 1PZ3A 3GLCA 1RR2A 3W84A 2DY3A 3SY5A 2PAJA 3WDHA 1VHNA 1RBAA 2V5LA 4MKVA 4IGSA 2HRWA 1X1ZA 1XG4A 3DZ1A 1A50A 2WVVA 4JPGA 3MHFA 3KHDA 1AL8A 2GQAA 3BAXA 2WVTA 1LLZA 3NZGA 4M7TA 3OODA 5EFFA 4GNJA 4FF7A 1SJDA 6ENLA 4ONVA 3L5LA 3N2OA 4DJFC 2J77A 3IJQA 4LUJA 5LIKX 2Z26A 3G1SA 2RUSA 2PZ0A 4IWWA 3UZXA 5M03A 1Y8BA 1E5NA 2YL8A 4PUDA 1M03A 3PF3A 3CIVA 4HOWA 4EIVA 1IEIA 3QPYA 5HQLA 4DJDA 2PDFA 4X9YA 1UUOA 4R33A 1V79A 4QJ4B 2NUWA 1GOIA 4GH3A 4ZFCA 2VRJA 1XF0A 5CGMA 4Z2GA 1J96A 2FH8A 3APYA 3QRHA 4OVXA 1K7EA 3VNDA 4Q7NA 5GPRA 5CPOA 5F4XA 3E0VA 4HCDA 2FPTA 4JTRA 3K1DA 4Q4KA 4AEOA 1XLMA 2BY3A 2GLKA 1WDRA 5XINA 3VD4A 3LRLA 3T0AA 2BGQA 1IXOA 5F2GA 3BW3A 1TUFA 4Q3MA 4UTLA 5LXXA 5DFAA 1SU5A 3T08A 1SUXA 4RE2A 1K9TA 1ITCA 3BURA 3TWBA 4A6GA 4MJ4A 4W5ZA 4Q8OA 1CI1A 1Q4WA 4Q22A 5JH1A 3O8AA 1TSIA 2PDWA 3GDMA 2YBUA 3HM7A 4GOAA 1A4LA 3VZYA 2ZUWA 3G1HA 3W7MA 3CZEA 3MV11 3SURA 1E9IA 3HGJA 3LPPA 4JZ5A 2BBFA 4ADUA 3VINA 5C8BB 3OVGA 4NY2A 1IT0A 4NX0A 2OKOA 3L0NA 2P53A 1UR9A 2VCCA 2V5DA 1UIOA 3D47A 3BOLA 3B9DA 3M7WA 5CXPA 1D3GA 1H62A 1W1VA 2GFTA 4UMBA 1Z48A 4XO7A 5AHIA 3VK5A 4REQB 5IFPA 1S5WA 1M7XA 3M5VA 3MJMA 3FK4A 3OZMA 3CXOA 3R8RA 1EDGA 2PODA 1S39A 3BLDA 3VDGA 4RJEA 2WMFA 3P6LA 2BOFX 2J78A 5IOBA 3OZYA 4AUBA 2BMBA 2CLOA 1T0OA 1FHUA 4XIAA 3EX4A 1FCBA 2XGIA 4I9AA 3BDKA 5HJYA 3EWDA 3UYIA 3H7UA 1YTEA 4YTSA 2OOFA 4GCXA 3E49A 4ICCX 3GW3A 1UPMB 3R11A 1BWKA 4O4WA 2X30A 1DXEA 4KWSA 2X05A 1LRQA 1C7TA 3T44A 4BHYA 2GUUA 1TELA 4B5UA 4Y2WA 3DFQA 4DELA 4KWOA 4OFCA 3DYOA 5BW6A 4QITA 4MKNA 3IAQA 1KXQA 3HG5A 5C71A 1TREA 3UP8A 2VEMA 3LBMA 4AY1A 2G8ZA 3SUUA 2VCAA 3NTYA 2PTWA 3TTSA 3EKZA 1GK8A 3TYDA 4EPKA 1ME7A 1WDDA 1EX5A 1DTNA 4W4QA 4IXHA 1Q2SA 4DWDA 4AD5A 1FOBA 4GACA 2QNEA 2UY3A 2WQPA 3S5OA 4GNVA 4HB7A 1H7RA 1ZZMA 1CXEA 3PSWA 7TIMA 5CGTA 3NPUA 2O7QA 1HJXA 1QAPA 2ACRA 2X1IA 3U0HA 2YFOA 3IS4A 4DXKA 1X7IA 4DM2A 1UKOA 2BXVA 3LRKA 3SO7A 1YDYA 4HOXA 4DO7A 3W1NA 4AQLA 1CPUA 3ZJKA 4PMZA 1O66A 1BXBA 4KQNA 3T40A 1M01A 3POCA 3KBJA 2X0YA 4AZIA 3GG0A 3EWBX 1HNYA 3AZTA 3E02A 3VIGA 2ADAA 4EF8A 1X1OA 4GY0A 1QI2A 4WY0B 2XSAA 3GDLA 4KRUA 5I2UA 2V5CA 3GDTA 1UZ4A 2D20A 4UNIA 2VP8A 5FOOA 3RX2A 3C3NA 1U30A 1D3CA 4Z08A 2DH2A 5A8MA 2CETA 1C92A 1WDWA 5CC7A 3A22A 5G4WA 4UQDA 1RY0A 1FWTA 2WBKA 4JQAA 3LCXA 5G2IA 3RDKA 3GDKA 3ATYA 1M5WA 1ZL1A 2XTKA 4QQUA 3NL5A 1K7FA 5DCDA 3FS2A 1MI3A 1UD8A 1UIPA 4KERA 4O16A 2G97A 3EOLA 3GHUA 3EA1A 1B3XA 3M16A 3PWAA 3W1AA 3COTA 3JRKA 1JQXA 2EXOA 3S1GA 1VJZA 1MNZA 3W71A 1XX1A 3QZAA 5EY5A 3WKZA 3MS8A 3IUDA 1EJSC 1ODUA 3ABQA 3L65A 3GXNA 3IIPA 5C9UA 4QLLA 4KKXA 4NZJA 4PBGA 5FAGA 4HMCA 1A3XA 4DXXA 2BHUA 4XWUA 4GXWA 3CQIA 1RD5A 3DX5A 3ZMRA 2GVYA 2R9RA 3GW0A 3MDUA 1L0PA 1U1HA 3ANVA 3R79A 1GYLA 1R2RA 1TWWA 2AKMA 3KVMA 1GKPA 5IXEA 4C90A 4DLMA 4MYAA 2PMQA 3P14A 1QW8A 4ZO6A 2E1DA 3IK4A 4PTXA 1S2VA 3L12A 2WQDA 2VZVA 1W2VA 1W9PA 4P7QA 4AVNA 2OQHA 5AFDA 3QXBA 3N14A 1ODZA 3VD3A 3W1PA 3T2PA 8A3HA 1FWGC 1E51A 3JR2A 4DJED 5CG7A 2CERA 2Y7GA 7REQB 2GQ9A 1LYXA 2C19A 3A21A 1AQFA 4KCUA 4W93A 5CPTA 1GOXA 1HG3A 4JEJA 4M0XA 4YTRA 1CB2A 5G4HC 4H8HA 4BWLC 2WM1A 4I5XA 1VCVA 4Z2JA 3G1AA 3EMQA 1E6ZA 3TONA 4YTTA 4ZOEA 2BXZA 1R30A 1TIMA 4WDTA 2VC5A 4R9XA 3W86A 3CT2A 2VFHA 4FIRA 3T55A 2PDNA 1KTCA 2VO5A 3O6DA 1HKVA 3L4WA 4GKLA 1OC6A 4JD4A 1BGGA 1WXZA 3QLDA 1TQXA 4YIWA 3IJLA 1W54A 4FP1A 1NU5A 2HEJA 4XG1A 1QO2A 2UY4A 1VBHA 3BICA 3ITGA 3AMLA 2PEVA 4TO8A 4C1NA 1MO0A 1W9VA 2VFGA 5G2WA 5T9CE 3G1YA 2ZZ2A 4L4OA 1MXDA 3VD5A 4S3BA 1VBGA 2YIHA 1OFAA 3QGVA 3OOQA 2A3LA 4P7NA 2XIOA 1SYTA 2H6RA 2ODOA 3N3MA 3TR2A 3GRIA 2F8QA 4PUUA 5EBUA 4RZ4A 4LEQA 2XM1A 3UCQA 1GOWA 2VGGA 4IJCA 5FJIA 1IEVA 2J6VA 4NXSA 3AO0A 1UR0A 1WOBA 4FOJA 4WDXA 3WQ8A 2HXUA 3NSXA 5AHLA 2OEJA 4NT0A 3I65A 2P50A 3F03K 3GVVA 3KWSA 2OMAA 2RDXA 4ICNA 4JL1A 4GO8A 4X60A 4DZ5A 1IXQA 1HXJA 1BGAA 1QNVA 1UBPC 1Y7VA 4HZ8A 1JDCA 2DQWA 3SQSA 3M41A 3DIPA 1TUXA 3BQ5A 5HINA 1ZBCA 2OLHA 1YE4A 1NP0A 2ZVIA 4M6VA 4CQCA 2ZDRA 1GHRA 4OU1A 4GVIA 5D03A 3UJ2A 3QMRA 1E71M 4GLEA 1QO5A 2ZE3A 1F6PA 1K4HA 2I17A 3N17A 1WZMA 3A3XA 4YHGA 2D24A 3O6YX 4EANA 1J0IA 3HV9A 4V27A 4E2BA 1F7BA 3OQEA 1OX4A 4ROPA 3SCOA 3ME3A 2F6KA 3AUOA 1G4PA 4NAFB 3S4TA 4H83A 3N3TA 2GWGA 3TNBA 3RLVA 2J9ZA 3ARSA 3VX1A 1GONA 1WPCA 4D6DA 3BE7A 2WB5A 3V1HA 1VB9A 3VUPA 4UTUA 5IFTA 1HQTA 5DT5A 1E1CB 3E2RA 1LQ0A 4M56A 1ICPA 5BU6A 4CD4A 3ES8A 1NFPA 2QCEA 1SO3A 2Q3RA 3FHAA 4X0VA 1GVQA 3EWZA 2NT1A 4OE7A 2NLYA 2BGNE 4IISA 3S1VA 1N8WA 2GYIA 4UB9A 3OYXA 2BVYA 3RM8A 1R85A 3LMZA 1E72M 5ABTA 2WSQA 4CU7A 1TPFA 3ARQA 4ACZB 3RGTA 3UZWA 5EMJA 3DH7A 4PTWA 4K39A 1B90A 1UP0A 3VGGA 1XR2A 1T8QA 2V3EA 2DUXA 4XD4A 3D3AA 4QAIA 1BG9A 2XVGA 3MU7A 1UQYA 3VDAA 2YLAA 1VFLA 3P93A 1VJSA 4NZ3A 2YA0A 4Z0JA 4DJEC 4FALA 3THDA 1TA3A 3RPTA 1O68A 3ZLGA 4O12A 1IV8A 3KDNA 4G7FA 1R9XA 3LHWA 3DFPA 4TMCA 3WBEA 1M04A 3LXCA 1XH0A 1IF2A 4F0SA 4YHEA 3WLLA 3DHFA 4M29A 1A0DA 2EBNA 2B81A 4QIUA 3WLSA 3NPVA 4EXQA 1KXTA 3E74A 4LS0A 3SN4A 5LHEA 2E09A 3LGEA 1LZOA 1PE1A 3XINA 1MXGA 2ZKMX 5IM51 2OPJA 1KV8A 1XRVA 3QMTA 2ZUSA 4NSBA 1VCFA 3B0PA 2H3BA 1FHLA 1S5TA 3PTKA 1HUVA 1X7FA 1EA0A 1UKTA 1H0IA 2G3FA 4UXDA 2VZOA 4Q33A 3UJFA 3LXBA 4IIFA 1TX0A 4UFJA 5CQ1A 1S38A 1WDPA 3JVAA 3NQVA 3WDRA 3W87A 4ZGYA 3CUZA 3B8TA 1Y5WA 3W7CA 1WXJA 1T96A 3F2DA 2PDQA 3U7VA 1LL7A 4F0RA 1TMQA 3PZQA 1I9CB 3KOXA 2FMOA 3NQEA 4IHCA 4F2BA 2OWCA 1MSSA 1X8CA 4CCCA 3I6EA 3EX6A 2QXWA 2C13A 3RU8X 5ABFA 2GJNA 3DYMA 3BGAA 3F2BA 4IGMA 1WCGA 2ZA3A 2JGQA 2NX1A 2ZVRA 3ZVHB 1R0MA 3V75A 2PRLA 2HWGA 1FY6A 1ZBWA 2CLMA 3S42A 1ZALA 4HNCA 4J35A 4CCZA 4G8TA 4UQBA 4QISA 3CH9A 3MSYA 2QCGA 3UWWA 2GSEA 4A3YA 2J7FA 2D0FA 1KXVA 1OYCA 3SCWA 3CGTA 1EO5A 3N6JA 3W74A 4DWSD 2NUXA 5GJMA 3W7LA 1IQ8A 2P76A 1LRTA 1C7SA 1EJ7L 4B5WA 1E55A 3AMCA 3AI0A 1EF3A 1VFFA 2P1FA 1BWLA 3P8IA 4Z0SA 4H4IA 5D2VA 1XFCA 3FYYA 4PFHA 1OCJA 3NG3A 3NEHA 3I3EA 2XIIA 4CQ9A 4RX0A 2G3NA 1JAKA 3TJXA 3MYPA 3NL3A 5A2AA 3NO5A 4GI6A 2D0HA 1Z7AA 4WSKA 4FA3A 4AEEA 4L1WA 5EKYA 3P82A 1MZRA 3VA8A 1TMLA 3QGKC 1ICSA 3CQ0A 4AAJA 4GPNA 3E0IA 2JALA 4W7WA 3V16A 4QXIA 1X8FA 2PDPA 2XIMA 2I5GA 3TMLA 3J7HA 2Z1XA 4J1OA 4XZHA 1NFBA 2F6UA 1E4IA 1WV2A 2YW3A 4GVHA 2GVLA 2JKPA 4Q8MA 1IR1A 3TSDA 2OGJA 3V18A 4V1XA 1SO5A 5RUBA 4L9ZA 2A6NA 2ZX8A 2OXNA 3GC5A 1NOFA 4JIIX 2TYSA 3NQ2A 5K7JA 5DCEA 3WL0A 4DO4A 3RU6A 1F8MA 4O15A 3WCZA 1XI3A 3KCOA 8XIAA 3H12A 1Z9AA 3HOJA 5D8ZA 3EDJA 2OEMA 3ERPA 3KRZA 3QHMA 5I06A 2NQJA 1OEPA 2QHAA 3H7RA 1TWDA 3Q4DA 3BMXA 1JCYA 1O1HA 3UNTA 3DESA 2DSUA 4NL1A 3L4VA 4PMNA 3FKKA 4FPSA 3HA1A 5H91A 2ISDA 3QN3A 3VOIA 3T4CA 1QNQA 3BMWA 1XDLA 1TPWA 1H5VA 4B9ZA 4CNUA 1JPIA 1R47A 4DN1A 4AWTA 1KXHA 4GIEA 1XLKA 3L5AA 1W91A 2W6RA 1VFOA 2Z1WA 5CC5A 4UTMA 2WK2A 2NXGA 2WZIA 5A1AA 3T09A 3W24A 2G3IA 2GJPA 2ESCA 3GR4A 3BC9A 4LBSA 1XSKA 2BP1A 3NVDA 2Q8XA 3C0LA 2XWEA 2PWEA 1KLZA 3TTYA 3ZFHA 3DYPA 3H4WA 3I10A 2XH0A 3WDIA 1TO3A 2QULA 4MB1A 4QBXA 1V6UA 2XSXA 2HPMA 4J3ZA 2HJPA 3RPMA 3ZS4A 1DIDA 2I14A 1PX4A 1PAMA 3EPOA 2C1IA 5CJNA 3UF9A 2ZTKA 1ONWA 1WDSA 4I8YA 2ZZ3A 3MTWA 3ARPA 3UYCA 3DBNA 3BJTA 2ZA1A 3KBNA 1RBLA 4F0MA 1YBQB 4MPQA 4AC7C 1JQVA 3GG1A 1JDEA 3CO4A 4JIEA 1HJUA 4S3KA 2C18A 1OGSA 4S3GA 1US0A 3B06A 3KUMA 3UZYA 3FX4A 5A2BA 5FEWA 4NJJA 4ZZ9A 3GSMA 2XZ7A 4LNYA 3D3FA 2PDUA 2V2DA 4YN5A 2CBJA 2J8FA 4ECLA 3SSZA 1B4KA 3GFYA 3W2UA 1QK0A 2EKGA 1W3TA 4MY1A 2V8ZA 4GISA 3T42A 4PRTA 4JTDA 1MW2A 4RNIA 4ALDA 1IT7A 3CAKA 4DWSC 1M3UA 2ZZ4A 5EA9A 3W53A 4L65A 4PULA 1X6LA 1JCJA 8CGTA 4QDPA 2B7NA 1C93A 3CV1A 1WKEA 3KBWA 3CLWA 4IPIA 3N15A 5CSYA 3E1F1 4ZVJA 1JDDA 2XFRA 4ZO9A 1IWBA 3BW4A 2ATSA 2WHMA 3R58A 4DAFA 1K9EA 3ITCA 4NZ5A 3GXIA 4NAEB 1HJSA 1DKWA 3M0LA 4UTWC 2F9RA 1JUEA 2WMIA 4CD7A 3W83A 1A5MC 4RLIA 3IGSA 3WLHA 3FFSA 3H2EA 5JQ9A 1KW1A 1UJQA 3AYVA 1DXFA 3R7MA 4MG4A 2VEGA 3NQGA 3TV8A 4S3AA 4GO9A 4RR4A 4OQVA 1GW1A 4W7VA 3OIXA 4HGXA 2PWGA 3U5UA 1RSCA 2ZXDA 2YCEA 2ZX6A 4QE4A 4WXZA 1YADA 3CMJA 4ROQA 1F61A 1CXLA 2HTMA 4E4PA 3URBA 1OC7A 4LCQA 1PUDA 1JCNA 4W84A 1A5UA 3LQGA 4K36A 1W5PA 3TVAA 1JIBA 3ZXWA 1OK6A 4RK8A 1QI4A 2XFWA 3NQAA 1AJ2A 4OV4A 4R7JA 4G7EB 3CQHA 4MDPA 3O05A 2VL4A 2EEXA 1SM9A 3PFMA 4HQVA 3O6AA 4JQ4A 1O5QA 1QT1A 3W22A 1K8XA 4GD0A 3FAXA 2J66A 1BQGA 3CM4A 3RX3A 1IXPA 1JUBA 4IF2A 3W1QA 3S46A 4YVVA 3REQB 1CNVA 5E6YA 1HL8A 3FSUA 1MVYA 1GJPA 1C3FA 3CZJA 4ZEPA 1WKYA 4G2DA 3CV6A 1OFDA 1WQ5A 1W1TA 3SBFA 3WLQA 3DC8A 4RZBA 1A5SA 3NO3A 4MJZA 1NIUA 4S1FA 3PHAA 4ZB5A 3MB9A 3W1LA 2ZYFA 4GZEA 4OECA 2VX5A 5E70A 1TJPA 2HDJA 2QYGA 3FDGA 4OOUA 5DF0A 3L2IA 3WH7A 4LAOA 3RCYA 3DFSA 4PCNA 1GW9A 5HPCA 4J3VA 2WPGA 4RXFA 5J5RA 3C0SA 1A3WA 1TV2A 4TVCA 1HKKA 5AYZA 3VOFA 1IIGA 4NYUA 2GPTA 3H23A 1F3TA 1O95A 4O4VA 1NDYA 3SAZA 3WK3A 4JTLA 3ZOAA 3RITA 1EHAA 3BCDA 3CMFA 3UR5A 1FH8A 2UBPC 3GY1A 2WANA 3AALA 3CUXA 1YW1A 2PBGA 3S5ZA 3K13A 2D0GA 2YBVA 5GVJA 1TG7A 1ZB5A 2E8ZA 3M0KA 1G69A 4L4LA 3GAYA 3LHYA 2XVPA 4MWAD 3H55A 4AG0A 2J25A 3BJSA 2B31A 2CITA 3VNYA 3K2GA 4CD6A 2J13A 4RE3A 1YXDA 3RO6A 4R3UA 2IMRA 2ZZ6A 4CU6A 1GKRA 3O2LA 4PCTA 4LANA 7TAAA 2JFEX 4LBUA 1A5AA 3CB8A 7ODCA 2GQ8A 3TR9A 4A3UA 1J0ZA 3B8DA 3LHUA 3WUGA 1SMAA 3I3DA 4QLKA 3QQ0A 1Q6CA 4JFSA 3Q65A 1FUYA 4PMDA 1XQKA 4ZXLA 2XVKA 4HHPA 3W75A 5JMUA 4MYXA 3INPA 2C0HA 3W7QA 5D9NA 3DKJA 2PDJA 1W9XA 3A4AA 1WE5A 4L6HA 4A2RA 2JE8A 3RPDA 4P7LA 4YJ5A 5LXEA 4QDMA 2HVMA 1VAHA 4FNUA 4ML4A 3H22A 3MO4A 4PTMA 1RPKA 1V7AA 3ZQ9A 2L5HA 1EB3A 1C8XA 1UR3M 5HJXA 3W6YA 1J12A 4UIOA 2E25A 4M24A 3BG5A 4NXKA 1UUMA 2J79A 5F4WA 4JTGA 1AH3A 4J2MA 4PFMA 4ZBCA 1TCMA 4B2DA 3Q58A 3SSJA 4XBSA 3ISIX 5FA5A 3UJEA 3QHNA 3UQNA 3MKCA 2YDQA 1T8XA 1O5KA 2BLEA 3PULA 4F2TA 3O63A 3SZ8A 5AECA 1PYFA 4BR1A 2DJLA 1AL7A 2ON3A 2J62A 2BASA 2D2OA 1TMHA 4K2SA 3SQLA 4ES4A 2PLKA 2YXXA 5CJ5A 2CW6A 1XLIA 3RILA 3VX0A 1ZTVA 3DBPA 1J0KA 6REQA 3T0DA 1E1FA 3S47A 3IJ6A 1JPMA 3U2ZA 1S2AA 1CXHA 3ID7A 4O19A 4I6VA 4I9JA 2X0HA 5DY2A 5C9WA 5JBDA 1PL9A 3OA5A 3EDKA 3C2EA 4JQ1A 2H8XA 4BFAA 3EOOA 3B04A 4ADTA 4IXXA 3HTWA 4ZTYA 1N8IA 4BK9A 3AWOA 4KEMA 2C1HA 1OX6A 3QBUA 4TU1A 2W3ZA 3WNKA 1KQYA 3AJ7A 2XGBA 3PZIA 2VUYA 3APGA 4DLFA 1JI1A 2CLFA 3W1MA 3T2OA 3HPZA 4PRWA 5T26A 1XRSA 2OB3A 1QK2A 3LCLA 5LA2A 1W1B1 1WBHA 2CHOA 1V0NA 4DPPA 1IYXA 3A4JA 4ICMA 5DCBA 3WD1A 3GE7A 4BI5A 1ZPTA 5DQPA 3HPSA 3IRDA 4AY7A 2VVSA 5BWAA 2OTDA 3O16A 3WMBA 3HG4A 1KFEA 4PUJA 2TODA 4DX3A 2IKGA 1YMYA 4QM1A 2Z1VA 4WHBA 2GSHA 5I3JA 4DBEA 1VR6A 4AZCB 4J3UA 1Q6RA 2E5BA 1KR0A 3U3HA 2XN0A 3CIWA 3THQA 1QPOA 1XKYA 3PUEA 4KCVA 4A3QA 4TX8A 1GZGA 1JPHA 2DQXA 1I2RA 4F4RA 3A24A 3N4AA 5KZEA 1JEZA 3NQMA 3E9AA 5TAOA 3L0KA 1B1YA 3MQTA 4ORMA 1Z89A 1I6NA 1XL9A 3QOMA 4WD0A 1QWKA 1ZAJA 4YYCA 4KCWA 3R4IA 3MHGA 3I3BA 5EMLA 3WQPA 3TC3A 3ZT6A 2WKJA 4Z17A 3LLDA 1FP8A 4CD5A 4RPPA 5AHFA 1KB3A 2QIWA 5ABHA 4GUIA 1V6YA 3FLUA 4NVTA 3B8UA 1NQ6A 4KW2A 1CGYA 3R6IA 4JN8A 5FESA 3CAVA 1PCKA 3VOGA 3JS3A 3NURA 1E56A 1LJYA 3FXGA 2HK1A 5FACA 1XBYA 1R3WA 2Y1HA 1CDGA 1V3IA 1R5YA 5HXMA 5CSUA 3IJIA 4C6PA 2PGFA 1NF0A 1TV3A 1V6TA 4OUIA 4MHBA 3PY2A 4K8GA 5AC4A 5AHMA 1O7AA 1ZS2A 5D9PA 1EYWA 1JG9A 3FA5A 4LAMA 2VJXA 3URNA 4HHLA 2WMJA 3V7PA 1UD4A 3EA2A 4UNKA 1E6PA 3OEXA 3MV01 1RY8A 4PEKA 4OHQA 2Z1SA 3GK0A 2O9TA 4A21A 4JYEA 3W85A 3TQVA 1PB0A 3RIKA 4GGHA 2DPEA 4EAYA 4EF9A 1NH6A 1FWRA 3F5LA 1GTHA 1XIIA 2V67A 2PGRA 4EXAA 2BG5A 4X22A 2O7SA 1VLIA 1UC4A 1PX8A 2CBUA 2Y2WA 4LF1A 2DIEA 1V03A 5JH2A 2Y7FA 2X40A 1PZ2A 3EPMA 3OBAA 2A2IA 4GUFA 3HV8A 4LRSA 2XYLA 1P6WA 2AQVA 2B7OA 3NZ1A 4FXJA 3W00A 3NVTA 3AJXA 1OCNA 4BEUA 2J7CA 3STPA 2FPVA 3TTQA 5EMKA 5LIXX 2XHYA 1P5BA 1UD5A 1E0TA 3U7BA 2VDIA 3ANYA 1FA2A 4H19A 4IM4A 3NIYA 2OYMA 2Y24A 2QVNA 3KRSA 3RMJA 3H7VA 2BY1A 3GXTA 5FJPA 4HYWA 5CPQA 2FDMA 2VELA 4UR8A 3M46A 2BHZA 4JNZA 1V3MA 3WF4A 2OWWA 1E4MM 3QQWA 1UROA 3EXRA 3LHZA 4NZFA 3I6TA 5I24A 4UWMA 3GTFA 4TUFA 3OYZA 1L2QA 5KETA 3MY9A 5LNWA 3ITXA 2F6XA 2CLLA 2IPJA 3CTLA 3DU0A 4UOJA 4WKAA 4L4MA 2PD9A 1OFQA 3WK2A 3TQPA 3QV7A 4AF0A 1NJJA 3A5VA 4Q8UA 4IMCA 1FWFC 1CGVA 1RP8A 1IEQA 3GDRA 4IFKB 5CAKA 4QAWA 2ICSA 5IBXC 5EBAA 3VYLA 7XIMA 2QUMA 3P5ZA 2PE4A 1ZU8A 1UG6A 2UZ9A 1W17A 1ELSA 2E40A 3THUA 3PP7A 3FCPA 3E2VA 3KXQA 4B5SA 1CX9A 1J01A 4KT2A 2ALRA 3B8WA 1K77A 4ERAA 2A5HA 3FGCB 1EUNA 3VOJA 4I3GA 3CHCA 3CC1A 4S3DA 1GVIA 2QPSA 1SFLA 4KRTA 2W61A 4O10A 3K4DA 2WHLA 3EXSA 2Y62A 3LPFA 3DFYA 1E9LA 4DYKA 3OW1A 1XD0A 2FFCA 3C0JA 2C3ZA 2ZADA 4HZ6A 2WLYA 4B3LA 4NX5A 4RE0A 3B3DA 2JF7A 2PWUA 2WNWA 1DJNA 3LMYA 2Z24A 4HU8A 3EB2A 4LY4A 3L66A 1XLCA 3WNOA 4JTCA 3IEBA 1Q3NA 4GY1A 1UWTA 5FIPA 3FHQA 1L6WA 2YFNA 3AZSA 3L2MA 1Q13A 3H2NA 1V3KA 2V9DA 3SDOA 1FWJC 2VQTA 1K8ZA 1NTHA 4ZODA 3HG3A 2J88A 5PTDA 3OLEA 1UWAA 3GYCA 3HPXA 4F40A 1TE1A 5D37A 4R85A 3GQYA 3AMDA 1OWQA 4JEQA 4DYJA 1U5JA 3BCJA 1YDNA 1QBAA 3GO2A 2OLSA 1P43A 1Z8AA 1REQA 4IMEA 4ZMGA 3CMGA 4V33A 3OVQA 4QHRA 3S6OA 3VGBA 1I1XA 2RDUA 1K70A 3N2BA 4KWUA 1RK5A 3W7GA 1SPQA 1VFTA 2Z25A 1JNEA 4JKMA 3KP1A 4OUEA 3KOYA 4E8DA 4EACA 1TJRA 4UR7A 2DW6A 2YYTA 2H3DA 2YL9A 2BGSA 3LD5A 1UOZA 5H6HA 4DY1A 3PZMA 4FIQA 1RUSA 1LWIA 1J6OA 1HJVA 1XP3A 1WAUA 1P6BA 2NQZA 3DEQA 3P5YA 2VUNA 4FR6A 5TIMA 4GZIA 4J27A 4I9TA 2BXYA 5I6SA 5M3WA 2F84A 2WO5A 3ITYA 4RCXA 3M0ZA 4MMWA 4HNVA 2DT2A 2H9AA 4YVXA 3AIVA 3SIMA 3AIWA 1I0DA 2YXGA 2P3EA 4JKKA 3QV9A 4WDUA 4TV5A 3L7RA 3VD7A 3VGHA 3QPEA 1XUUA 1WX0A 4N9EA 1E0VA 3TAKA 2CZDA 1J4EA 4JS3A 4LEFA 2J4GA 4O1BA 3WD4A 3MP4A 3BAKA 1UB3A 3GU1A 3VIHA 3M0MA 3H2FA 4UTTA 4GI4A 3MSGA 1PCWA 4MOZA 4C6FA 3TEVA 2PWHA 3THAA 3NZQA 1OFOA 2VD9A 2XISA 1I8JA 1UWSA 3M0XA 2W4XA 4JFVA 2VNCA 2XINA 2GWNA 2F38A 1M6JA 4H00A 4NNBA 1M65A 1W3KA 3EEZA 2CWNA 5JBFA 1Z6KA 4ZENA 3ABSA 4AFYA 1AZ1A 1D8WA 4KIRA 2QJNA 4Q4RA 5F2IA 4ZFMA 4JGDA 3AYRA 4XKYA 3SB0A 2FZ8A 5AB3A 1XM3A 1MW3A 2E5DA 2ZIDA 2D73A 3P81A 1GQJA 1K9DA 3QM3A 3M0VA 4XZIA 4TMBA 1FWEC 3VU2A 5HA7A 3U8GA 2DGAA 4RZ5A 3TYEA 1PX3A 1FWCC 2A4AA 4AZGA 2VFEA 5I5RA 1E43A 4EXBA 3NYDA 1PIGA 1WOAA 1KFBA 4HD5A 4PA8A 4MY9A 1MQRA 3UPMA 3HFYA 2J9YA 2PPGA 2Q8ZA 3V4BA 4MF4A 3BV7A 2WMHA 1SVDA 1PKMA 3PR2A 2WSPA 4PGLA 1AQ0A 5LSMA 3GIYA 1JZ3A 2ZFAA 4G6CA 5EMYA 4JX5A 1MDLA 5FSEC 3ZR6A 3WQGA 1EA9C 2PBOA 2XPKA 3GVGA 1OT2A 3PNZA 2CCRA 4KRZA 1ONXA 2QDHA 4W8LA 1XIEA 5LA1A 2WAGA 2O0TA 3AXXA 4RUBA 1V02A 4UTIA 1OIMA 1P7TB 1VRDA 5IHRA 3LHTA 4M19A 4EKJA 1ITXA 3OGSA 4TV6A 3SEPA 3B4YA 3W2LA 2QJHA 1SZFA 2QCCA 2EJ1A 1XDMA 5H8PA 2SFPA 5A69A 5I3GA 1UWRA 2GGGA 1DEDA 1KTNA 3DHDA 5REQB 1XBZA 4MNJA 5DMNA 4N4QA 4RE4A 3RK8A 4HSHA 2X7VA 5LIWX 4IPPA 1B0IA 2P3ZA 3MZNA 5DXXA 3HGSA 3LN3A 3N2CA 3W0KA 1R6WA 2QT3A 4B5XA 2HZGA 2ZWYA 2DU2A 1QBBA 1KBIA 2G37A 1AG1O 3VOHA 4M3PA 2W92A 1W32A 2GVJA 3KX6A 4JQ2A 2IXVA 2Q09A 2R1NA 1LBFA 4LB3A 1ECQA 1Q2RA 4HPGA 1H7NA 3B9NA 1DJQA 1M7PA 2PDBA 5LYRA 4HZ7A 2FVMA 2OT0A 2R94A 3EB4A 4Y8FA 3WO8A 5DXYA 5K2ZA 4H9UA 3FXYA 1EJRC 4PBFA 3ABZA 4LUSB 4RPQA 4UQCA 1YRRA 1EGZA 1CLVA 2HK0A 4FLSA 4MB5A 3W72A 1H50A 2EPHA 2C71A 1LUCA 2X1UA 4S2BA 3RRXA 4KWVA 2CLHA 2PGEA 2CLIA 1S2CA 1GNXA 1I60A 3PBWA 3WELA 1RD6A 1AQHA 2XVNA 4JIRA 1IT8A 2QS8A 3FIGA 2VZTA 1PVNA 2Q8LA 3EZ4A 3UXKA 1VP5A 5A95A 4MZYA 3WLIA 4PL2A 4JTSA 3KZPA 4NYYA 1SSDA 1I2OA 1QPNA 1H2JA 3JU2A 1QATA 5FF2A 1TYGA 4FX8A 3G77A 4GJ1A 1EX1A 3WQ4A 4U4MA 1J8VA 1QOPA 3KTSA 4KETA 4ASTA 3FOKA 4I9MA 2Y89A 1GOMA 3R1ZA 4IZGA 3TW7A 5MF5A 5BXRA 4GNKB 2A7NA 3BSHA 3U4FA 1O5RA 1OZQA 2WVSA 2E7FA 4AD1A 4XKYB 5E0KA 4ZQRA 3M07A 1WZAA 2ACUA 4AYGA 3B9OA 3ZWTA 1ZSXA 4LNCA 1UMYA 2VFIA 4NNAA 1RCXB 4C60A 8RUCA 3KVJA 3CYVA 2WWCA 3LV6A 5KZDA 1UJPA 1M41A 3WX7A 1KNWA 1RQBA 3KL0A 3N13A 4GBUA 2XIQA 3O07A 4WF7A 3UESA 4YMZA 2WV8A 4LAZA 5ECVA 2RHGA 1SJBA 1KM2A 1SFJA 4GY7A 3EDDA 4O1FA 4P7RA 3CLMA 4GVFA 3QKEA 1EJUC 4Z2LA 3KOZA 2IS7A 1DTUA 5FJTA 1B3ZA 3C56A 2AAAA 1DJZA 5DO8A 1VHCA 4XZ9A 2G4FA 4ORIA 4MSSA 3LGGA 3QGAC 3TXZA 6ALDA 3PBYA 1Z41A 4KWWA 3U2OA 1VKFA 1KBBA 1KM5A 2Z1BA 4ZE5A 3TCSA</