1B30A

Xylanase from penicillium simplicissimum, complex with 1,2-(4-deoxy-beta-l-threo-hex-4-enopyranosyluronic acid)-beta-1,4-xylotriose)
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
302
structure length
302
Chain Sequence
EASVSIDAKFKAHGKKYLGTIGDQYTLTKNTKNPAIIKADFGQLTPENSMKWDATEPNRGQFTFSGSDYLVNFAQSNGKLIRGHTLVWHSQLPGWVSSITDKNTLISVLKNHITTVMTRYKGKIYAWDVLNEIFNEDGSLRNSVFYNVIGEDYVRIAFETARSVDPNAKLYINDYNLDSAGYSKVNGMVSHVKKWLAAGIPIDGIGSQTHLGAGAGSAVAGALNALASAGTKEIAITELDIAGASSTDYVNVVNACLNQAKCVGITVWGVADPDSWRSSSSPLLFDGNYNPKAAYNAIANAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Family 10 xylanase
molecule keywords PROTEIN (XYLANASE)
publication title Xylan binding subsite mapping in the xylanase from Penicillium simplicissimum using xylooligosaccharides as cryo-protectant.
pubmed doi rcsb
total genus 129
structure length 302
sequence length 302
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 1998-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1b30A00
1FH9A 1CXIA 2WNWA 1K9DA 4PMDA 1KXHA 4MAVA 2D24A 3WENA 3QHNA 1WDSA 4OOZA 2QPSA 1GNXA 3WNKA 1E6RA 3T0BA 4YN5A 2VC9A 3UESA 4MDPA 2YDQA 3GNPA 2OSWA 1MW0A 1V0NA 1V3LA 1E4IA 1UKTA 4C7DA 3KE0A 1HJSA 1OIFA 2VJXA 2WZHA 3T2PA 4J7RA 5A8OA 2RGLA 1XH1A 4DM1A 1GOQA 1JDDA 1TVNA 5IDIA 3WF3A 4D72A 1QHOA 1GW1A 2ZUWA 1JZ7A 4M29A 3UEQA 1JYWA 2PWGA 2WKLA 3K1DA 4CGTA 5EMYA 2C7FA 2WBGA 3M6DA 1QNSA 1CGTA 4TX8A 4F8XA 1W1PA 1QNPA 4WK9A 5GNXA 3AJ7A 3QR3A 3VGGA 4K68A 4S3KA 4DWSC 4HP5A 2WCAA 1OGBA 2ZWYA 1J0ZA 3NUKA 2WZIA 4AWEA 4CVWA 1EHNA 4UZSA 1HP4A 3VIGA 1V6VA 2UY2A 5BXRA 3IJ8A 4M56A 3NJ3A 4AD3A 3CUIA 1H0GA 4EE9A 1KCKA 1NARA 4S3JA 4WSKA 2ESCA 1E6SM 1OGGA 4KH2A 2W67A 5HBFA 4D6DA 2GDVA 5AYBA 1OGSA 1E0VA 1CTNA 3GH7A 2CBUA 1UWQA 2OSYA 3L4ZA 5JIPA 1GQLA 2W62A 3GXMA 4JFSA 1B2YA 3S2CA 1KWKA 2ZUSA 1QI4A 2X2YA 4P8WA 1ZBWA 4NZCA 3RM4A 4TVCA 3OBAA 2BVTA 4HPHA 3L4WA 1WDPA 2G3NA 4J3UA 1E6XM 2CPUA 2CHNA 1TFVA 1TR1A 1E3ZA 3VD5A 5CGMA 3PZMA 1W2PA 2BHYA 2YL6A 1WAWA 2WMHA 1U33A 5I6SA 3L4XA 1H2JA 4DWSB 4J28A 4CN4A 3WDJA 2GVYA 3ZQ9A 2XFYA 1JFXA 4U3AA 5E0CA 5A6KA 3NSNA 2WANA 4KWUA 2V3DA 1W9DM 3GH4A 3T2OA 1HL8A 2XTKA 5A6AA 6CGTA 2J25A 4B3KA 1HIZA 3ZT5A 4CD5A 1V08A 2XVNA 2Z1SA 1B90A 4JHOA 3MMDA 5FOOA 3MUZ1 1W3LA 4IPLA 5CGTA 3MV11 3PZGA 1UH2A 1ISYA 4N0RA 3SCUA 1BF2A 1UD4A 1E72M 4MAZA 3ZJ8A 1OD0A 2F8QA 1QHZA 2O9TA 2G4FA 4MNMA 5LA1A 1M7XA 3SCNA 3BAJA 4WF7A 1V0MA 3SCTA 3W38A 1RP8A 1QI5A 4EK7A 3WD2A 1FH7A 2J7BA 2VR4A 3GNRA 4R27A 3ALGA 4M1RA 4H41A 4DUVA 1G1YA 5C71A 5I79A 1ISZA 1C7SA 1GONA 2E8YA 1B3ZA 2JALA 4OJYA 1XH2A 3MUIA 5M03A 3VNYA 4ML4A 1FFRA 3AMLA 3VDAA 1SR0A 3I3DA 1J11A 2YDSA 2OYLA 5AC5A 4GQQA 4CKQA 1DWIM 1DWHM 4CCEA 3A4WA 1TZ7A 1CNVA 1M04A 4QLKA 3EMQA 3PTKA 1DP0A 4FK9A 1VF8A 1G5AA 2VR5A 4AZCB 5DMYA 2OSXA 2ZX7A 3IJ7A 3I3BA 3SUTA 1M01A 4UOQA 1ITCA 4M8UA 1NWSA 4W8LA 1RH9A 3VGEA 4GQRA 4JFWA 5I2UA 4W89A 2QHAA 2BHUA 5CPTA 4WSJA 1CXHA 1JDCA 2OLHA 2DSVA 2XVPA 4AD4A 3THDA 4UOZA 2EJ1A 2CYGA 4YHEA 1CXLA 4V28A 5GNZA 2VX7A 3MMWA 3NCOA 1WZKA 4CD4A 3RDKA 4EANA 3UERA 3WDRA 4HU8A 2V3GA 5TD4A 2F2HA 1LG1A 3TP4A 1BG9A 5HPOA 2ZXDA 3WF2A 3CUGA 2VX4A 3WBAA 3EDJA 2CCRA 2XHYA 3RPMA 4AEFA 2ZX9A 3T08A 4AD2A 2DPEA 4FLQA 4B15A 3GBDA 2Y8VA 2WHLA 1E3XA 5DT7A 1B3VA 3ZR5A 1QNOA 4BA0A 1XYZA 3WEZA 4YPJA 3RCNA 1MFUA 2W63A 3VIPA 5A6BD 1GOWA 1CGUA 2Y8KA 4D6IA 3T09A 2WCGA 3UETA 1JG9A 1G94A 3DECA 3VIOA 3GXFA 1V3KA 3O2LA 1HKMA 3OGVA 1E6NA 2W61A 5FL0A 2IXVA 1CGYA 3F5LA 1HJUA 2EPLX 3WDIA 1JXKA 3B9AA 3M07A 1AMYA 4DUWA 3W37A 2YL9A 3U5YA 4ACZA 5JIWA 4W8BA 4E8CA 2WVVB 1JF5A 5A6BA 4J3WA 2UWFA 2FGLA 3CIVA 2VT0A 3W27A 2ZUUA 2JF6A 1DWJM 3W26A 4JCMA 2F61A 3QGVA 5CXPA 1VBRA 1W3JA 2ZUTA 4MB5A 3TOPA 3L4VA 3ZJKA 4D6HA 1UQZA 4M82A 3N17A 4PCSA 5A6SA 2WSPA 5D9OA 3MO4A 5EFFA 4RE3A 4J3XA 2GK1B 4PMZA 3RILA 3SCPA 4OOUA 1BYBA 1WO2A 3J7HA 4JKMA 4GO9A 1BYCA 4XB3A 4B16A 1EDQA 2WWCA 1HJVA 1R86A 2WB5A 4JIEA 3GM8A 1QHPA 2XUCA 1QW8A 4Z2IA 1J10A 1GHSA 5I24A 3NSXA 2WSKA 4PTWA 1H4PA 1C3FA 3MMUA 2BFGA 4HOXA 2UY5A 4PMUA 1XCWA 4X0NA 2WM0A 1OIMA 1H3GA 1UKOA 3WEOA 1FHDA 2G8ZA 1CIUA 2XWDA 3WL0A 4X0VA 3VUPA 2G41A 2XFRA 1AQ0A 5CG0A 1R85A 1HKIA 1X1NA 4HOWA 3GBEA 1M53A 4MPKA 1E1EA 4J3SA 2D3LA 2E9BA 4PMYA 3BSHA 2AAAA 3WD0A 3L4TA 3PHAA 1E43A 1VEMA 4LYPA 4KMQA 4QDMA 2WVUA 1J0HA 2WZEA 3WH8A 2X09A 1AQMA 2UY3A 3SIMA 5JBFA 3KL5A 4U33A 1US2A 2XSBA 3CZGA 2BVYA 3MS8A 3GDBA 1UD3A 2J7DA 3CZJA 4PTVA 3IAPA 1EOMA 1G9HA 2X8RA 4AYSA 1UR2A 4XZWA 3WMBA 5E09A 3ZJ7A 1V0KA 1R8LA 5CPQA 3W81A 1X6NA 5A8NA 1DWAM 1LLOA 2X0HA 3AHZA 5EB8A 3RIKA 2FHFA 3RM9A 5CQ1A 3AYRA 2JIWA 1GPFA 1RD6A 4DM2A 3A47A 5HXMA 2FDMA 5HOSA 4U2ZA 4XV0A 1QBBA 4NRSA 5A8PA 2PWEA 1VFUA 2A3EA 1HKKA 2VQTA 4H2CA 1XYFA 1C92A 1PJ9A 1MQPA 5CZKA 4CCDA 1H11A 2O9RA 4RE2A 2WMIB 4U5KA 4H04A 2WHJA 1A3HA 1EH9A 5GPRA 1EDTA 3OLGA 3BSGA 1Q4NX 1WZLA 3CHDA 1VBUA 1KXVA 4HZ7A 5BRQA 3RJYA 4AZBA 2J7HA 1WB0A 3O6AA 2XM1A 1B9ZA 1D3CA 1OBAA 2GFTA 3AMCA 3A4AA 1B3WA 1A47A 5I5RA 2J47A 4ATLA 2DGAA 3WUGA 1FFQA 2YKKA 1C7TA 3N13A 4AZ6A 1UWUA 4BQ4A 2WC4A 2FHBA 1KB3A 5A94A 1DWFM 3WH5A 5D8ZA 3VX0A 4AZHA 3ZSTA 2E9MA 2QMJA 2PWHA 1W32A 2PF0A 1V02E 3VIIA 4PMVA 3AIWA 4HMCA 3K46A 1NWUA 2ZXBA 3UG4A 2CKRA 4V2XA 2NSXA 5FL1A 5AC4A 1IZJA 4M24A 4PUEA 1FP8A 2JF7A 4CD6A 3WNMA 3VVGA 1H49A 1JXJA 2O9OA 3ARSA 3PZTA 4Z2JA 1LL7A 3LPFA 3TTOA 1LL6A 3SCOA 3W6LA 1KWGA 4OUEA 2AOSA 3ARQA 1O7AA 1QNQA 4AC1X 3VD3A 2Y2WA 4TOQA 1CYGA 1HJWA 3VU2A 1B0IA 4WKHA 4CN1A 3WDQA 3OGRA 1UA7A 1J0KA 4ATDA 1EO7A 4ZXLA 2WC7A 3N18A 1BVZA 4LYQA 1QW9A 2E0PA 1PZ3A 6A3HA 2EPMX 4GI6A 5ABFA 2YJQA 4PN2A 1W2VA 3E1F1 1WZMA 3OIHA 4Q22A 1C8YA 1HL9A 2G3MA 3APGA 2PC8A 4W93A 1UQYA 5A95A 3BAYA 3WFLA 2EPNA 3AOFA 5D9NA 2D3NA 2PWFA 1JD7A 1MXDA 2EBNA 4P7LA 3AHVA 4HA3A 4AMCA 2JE8A 1BAGA 2J77A 5CLWA 1NWTA 3THCA 1Q6CA 3N9KA 4JHZA 4AZ5A 3VMOA 3VIKA 2EEXA 2FH8A 2DT2A 4GINA 4JKLA 1PZ2A 2J4GA 1E1FA 3WDPP 1HX0A 3WD3A 2OYMA 1XSIA 1EXPA 4KRUA 1FHLA 1B1YA 1QI0A 3FW6A 2V3FA 5FKYA 1SYTA 4FMVA 1EQCA 2XPKA 1JAKA 2NT0A 4GZJA 3WUBA 1ITXA 2OYKA 8CGTA 1ZS2A 3AXXA 4KGLA 3AZRA 4E8DA 1VFOA 3VIHA 1JDAA 4MB4A 4M81A 4TUFA 3AQUA 2VCAA 5ABEA 3VNZA 1B31A 1SMDA 2BVDA 3FAXA 4E4PA 5LYRA 2XG9A 3VM7A 5A8QA 3PN8A 4HMEA 4RE4A 1RP9A 4EKJA 1ZL1A 3SCWA 3UCQA 3WDHA 3K8LA 1WKYA 3AMDA 2D0GA 4AZ7A 4CD8A 5EFDA 1W9VA 4UFHA 1E4NA 3KWXA 4FLRA 4HPGA 1UR9A 4LYRA 2J78A 3AHTA 4BF7A 3WNOA 3K4DA 1HP5A 5D4YA 1TCMA 1FOBA 2EXOA 4BZYA 4P7RA 3DHPA 3G6LA 5BXTA 4MNJA 1XH0A 1GHRA 3AYSA 1EGZA 3BXWA 4U5IA 3DYMA 5CLTA 3CUJA 4GPNA 4P7NA 3ARRA 4UNIA 1I75A 3WNNA 2WMIA 1FP9A 1QI3A 2J7EA 3BCFA 1E70M 2WHKA 5I78A 3LPOA 3ALFA 1N82A 2WVSA 3VO0A 3MANA 4MB3A 1XHGA 1BYAA 2FHCA 4TTUA 2JFEX 4LGXA 1TA3A 4QCEA 4Z2HA 1XSJA 1TUXA 1J01A 1GOKA 3RMEA 3OLDA 5DT5A 1CXFA 2JEPA 2WMFA 2DT3A 1KQYA 4XZBA 2VRKA 5A6LA 3A4XA 4TXEA 3HMCA 1OM0A 4U31A 3WUEA 2YLAA 2GJRA 3B9EA 4CN6A 1LL4A 3SCQA 2JIEA 1IV8A 1JZ8A 1SMAA 3ZJ6A 1E0XA 5M5DA 4WIWA 3SCRA 1SFSA 2J75A 1PBGA 1DEDA 1XV8A 2WBKA 3RO8A 4H8HA 4D6JA 3POHA 3AS0A 4C7FA 3AMKA 1IT0A 4Q7NA 3OLEA 2HVMA 1UHVA 2YA2A 3JUGA 3WIJA 2DH3A 3WH7A 3OZOA 1E0WA 5F7UA 3BC9A 1BFNA 4TX6A 1Q6FA 3PTQA 1V3IA 1EQPA 2WMGA 3ARUA 5I0DA 1MW1A 4OBRA 2DSKA 3CHEA 1KXTA 4AISA 3KZSA 2VX6A 4JFVA 2Z1KA 1XGZA 4OZOA 2XFFA 1HJQA 2A3BA 5DF0A 1W9XA 1JL8A 4D1JA 3BAWA 4PMXA 1FH8A 4N42A 2YBUA 2OWXA 3OLIA 1JYVA 4URIA 4HZ8A 3B9DA 3VD9A 1MQQA 2ZUMA 8A3HA 5E6ZA 3L2MA 3ZM8A 1TVPA 2X1IA 4FLOA 5E70A 3B8SA 3IJ9A 1ZJBA 3VMPA 2MANA 4CD7A 2CXGA 4UFIA 1JZ6A 4CVUA 2V5CA 1V03A 5E6YA 1CLVA 4RL3A 2WMKA 2DQXA 3PZOA 1JD9A 3KL3A 3BMVA 2BV9A 3L4UA 1WCGA 3AZSA 1ISVA 1JI1A 4CUCA 1UUQA 5KZ6A 1JZ4A 4UQBA 1V0LA 2C8NA 2ZXAA 1F4AA 4DWSD 2DH2A 4KGJA 3SURA 1Z32X 1KGUA 1V6YA 1BLIA 2G3IA 1W3HA 1YHTA 5A6JA 1PX8A 1Q6EA 9CGTA 1VIWA 1JAEA 1LQ0A 2HISA 1GOOA 2XVGA 5CSYA 1FA2A 5IXEA 3WL1A 1KR0A 4PMNA 1PEZA 4EAMA 4MDOA 3WQVA 1R7AA 4HOZA 1OCQA 2CHOA 1GJWA 1CGXA 3CHCA 4DWSA 3U7BA 4UQAA 1ZU8A 1W91A 4JFUA 1GQJA 3DC0A 4GZEA 3A6OA 5CPSA 2O9PA 4D6CA 2NT1A 1J12A 3CBWA 2BXZA 5HNNA 3VILA 2CBIA 3NYDA 1V6WA 3CUFA 1JI2A 4D6FA 3EDDA 4TVUA 3MSDA 2O92A 1K6AA 1E71M 4W88A 1MYRA 3FHQA 3SEPA 2ZICA 4UFKA 4OKDA 1BGGA 2GDUA 2YLLA 1OT2A 3VD4A 3HJEA 1E6ZA 1LWJA 2UY4A 5BYWA 1EA9C 2D0FA 3BCDA 2VOTA 5ABGA 3MV01 5FD0A 3VTRA 4NF7A 1LG2A 2WLZA 2X0YA 3WN6A 1QPKA 1U2YA 4F79A 1KQZA 2A3HA 5JUVA 3OGSA 5GQBA 6TAAA 1HVXA 3AIUA 2AMGA 1P6WA 5D9PA 4IISA 1OB0A 1UZ4A 3WD1A 5BRPA 5D9MA 4P8UA 3IK2A 1UH3A 1TE1A 3AIQA 5I3DA 2YBTA 3FN9A 2J74A 1WPCA 3DYOA 4IM4A 4PRWA 2VVSA 4ZE5A 3W28A 2YL5A 3WQ8A 4AIUA 3VX1A 4GZIA 3VIFA 1MFVA 1R7OA 1E15A 4AZCA 1GVYA 4W7VA 3TTSA 1ISXA 4QLLA 4BQ5A 2WVTA 1ESWA 3VDBA 4KRTA 3VMNA 1H5VA 1K9TA 1W1TA 1VENA 4QCFA 4QLJA 4WKFA 3WFZA 1UA3A 1C8XA 1XD0A 2CEQA 4PUDA 2VQUA 2DDXA 1GORA 4XUYA 2EO7A 4ACYA 4TTGA 5A3HA 3MKKA 2J7FA 3VGFA 4AD5A 4PMOA 2WPGA 4W5UA 3PZUA 3VGHA 2ZE0A 4GXPA 3WQWA 4IPNB 3SUVA 1GJUA 3AFBA 2J7CA 3W82A 4W7UA 3M7SA 2YL8A 2J8FA 2D1ZA 1BYDA 3UG3A 3AXIA 3CZ8A 2C0HA 3F5JA 2VI0A 2V5DA 1ISWA 1QNRA 3KL0A 1YQ2A 3ARVA 1PAMA 3BAXA 3WKZA 4QFUA 3WH9A 2D0HA 2Y24A 1CGWA 1V3JA 2V38A 2WHMA 3ECQA 1C90A 2CBJA 2DT0A 2ZWZA 3VOCA 2IUZA 3BAIA 4FF5A 2VRQA 1CECA 4H7VA 2NW0A 4UCFA 2XVLA 2XVKA 1V3HA 7TAAA 2CITA 2J8GA 3AIEA 1XC6A 3M46A 3EDKA 3BLKA 1KXQA 1Q6DA 3AMGA 3QHMA 2VZUA 3N11A 3FHAA 3WQ5A 1NP0A 3T0DA 3T2QA 2WW5A 1L8NA 5E9AA 2X05A 1J18A 3T0AA 2V3EA 4L4PA 1D7FA 2WVVA 3WF0A 4HMDA 5ABHA 1TG7A 1K9FA 3F5KA 1V02A 3LPGA 1TMQA 3U57A 1UD6A 3CZKA 1NM9A 1WP6A 3VPLA 4H8UA 4ZEPA 3EMCA 4QAWA 3SUWA 5FIPA 3ARYA 1VRXA 1GZJA 4UTFA 3ZIZA 2QF8A 2OWCA 2GK1A 1HVQA 3ARXA 5IFTA 5IHSA 3W6MA 1E4LA 1VJZA 3W24A 4MJ4A 1BQCA 2ZUNA 3VGDA 3POCA 3CLWA 3W4RA 2A3AA 3WF4A 4HTYA 4WJXA 1EHAA 4MTVA 3NDZA 3WELA 3AISA 4GO8A 1BSIA 5D8WA 5A2CA 1HT6A 4F9JA 4E2OA 1WE5A 4AD0A 3WY1A 1CXEA 3DHUA 3ARWA 4B9ZA 4W85A 2VZTA 2W5FA 3CHFA 1JYNA 1Y7VA 3CPUA 2WAGA 2PI6A 1WZAA 1VJSA 4MADA 1C8QA 3SUUA 3BMWA 2VO5A 1XCXA 4FLSA 2XWEA 4B3LA 1UKQA 3FNDA 1ZB5A 2WK2A 1EO5A 3AIVA 3GXIA 3WEMA 2VVNA 2ZX5A 1HN1A 4D6EA 3BAKA 4HA1A 4JKKA 4D1IA 5BXPA 1MW3A 1K9EA 1VEPA 4PCTA 4AIEA 3PBGA 3WF1A 1WDRA 1CDGA 3WQ4A 1NH6A 4LX4A 1PPIA 3WMCA 1UR1A 3ZT6A 1UKPA 4P8VA 4P7QA 1HKJA 3VDHA 2VCBA 4ACZB 4UQCA 4UOJA 1G01A 3WBEA 5BROA 4X9YA 1L0PA 2E8ZA 2CIPA 4UFMA 3ARTA 1JGIA 2DT1A 2ZX6A 3BLPX 3CZLA 2VRJA 1GVIA 1ZBCA 1E40A 4PSRA 1E6QM 5I23A 2YDRA 4GKLA 3VINA 1V6XA 1PIGA 1WNOA 3AICA 4UFLA 3U7VA 2QPUA 1EOKA 4J27A 4AXNA 1UYQA 2VZVA 1VFFA 1BG4A 3NDYA 1W9PA 1UD2A 2QV4A 4H8VA 7A3HA 4F9DA 4P7OA 1CBGA 1UD8A 5LA2A 4PMRA 3DYPA 4PEEA 4MNLA 3N04A 4J3TA 7CGTA 2A3CA 3VD7A 4BS0A 1JNDA 2CETA 3ZT7A 2QLYA 1IZKA 3F4VA 3G6MA 4PSPA 1H41A 1V3MA 3WH6A 5DFAA 1J0IA 5AYIA 5A2BA 2BY2A 4U3CA 1CLXA 1KGWA 2CESA 4D71A 1UWSA 4UZUA 1MW2A 4W87A 1D2KA 3K8KA 1LJYA 3EBVA 1KGXA 3II1A 3LMYA 1EIBA 3RJXA 4UR9A 3CUHA 3AXHA 1ODZA 1WDQA 3OB8A 1UWTA 4U2YA 5AY7A 2GSJA 2IXUA 1DWGM 4J3VA 5BCAA 2E40A 2E3ZA 4HA4A 2WWDA 5M17A 2WCSA 1CPUA 1JNEA 3QOMA 3PZNA 4OIFA 1UOKA 3BH4A 2D2OA 2EQDA 3ZR6A 3PZIA 1MVYA 2CKSA 4A3YA 1X6LA 3QHOA 4GI9A 1ZJAA 1C91A 2Q8XA 2XGBA 1PX4A 1QOXA 3I3EA 1KBBA 3HN3A 2VNCA 1ODUA 1UZ1A 4PBGA 3VKKA 3WNLA 1AVAA 1V6UA 4PTMA 1VEOA 1JIBA 1E4MM 4WKAA 1HXJA 1ECEA 1HF6A 1HNYA 1CENA 2WLYA 3FXYA 2XGIA 3VDCA 2XIBA 4MNKA 1H0IA 2PBOA 4JZ5A 1E56A 3BGAA 5FCZA 2CERA 5A8MA 4A3HA 2ZX8A 4W7WA 2BXYA 1J0JA 1GOIA 2BNJA 2DIEA 1MQRA 3D3AA 3FY1A 3AIBA 1UR0A 1CWYA 1DTUA 1S46A 1E6PA 4BQ2A 2Y4SA 3ZOAA 1CEOA 3GZAA 1PX3A 4AD1A 3UR7A 4OBSA 4TVDA 3O9NA 4BQ3A 1EDGA 3L4YA 2VZOA 3AIRA 3CMGA 5C8BB 2CNCA 2FH6A 1JF6A 4UQ9A 5C70A 1J9YA 4Z2GA 1DHKA 2ZUVA 5CJ5A 3QOKA 3N15A 3MU7A 1UWRA 1GUVA 4L4OA 5A69A 1G0CA 2BS9A 2DSUA 2GJXB 2VMFA 1W9BM 2VZSA 4R5EA 2W4XA 3ARZA 3TTQA 3GH5A 1RPKA 1B3YA 4B9YA 1GOMA 1JZ3A 1NOWA 2WKGA 2YA1A 1M03A 3W53A 3CZEA 1R87A 2XIIA 3MSGA 4ZENA 1NOUA 2DSZA 4Y7EA 2BHZA 1GCYA 4ZFMA 4LPCA 1BGAA 1Q6GA 1F4HA 1VFMA 4CCCA 4UQDA 1QI2A 2RGMA 3PZQA 5A6MA 1I1WA 1H09A 1UKSA 4AIOA 5HDRA 1E5JA 5BXSA 3WMSA 1JYXA 2D22A 3CH9A 1HJXA 3FAWA 1OWQA 5IHRA 1GQIA 1E5NA 3ZMRA 1UH4A 3CMJA 1I1XA 3IANA 4ZXOA 3OG2A 4W86A 5I77A 2GJPA 4PMQA 4MJ2A 2VL4A 3PZVA 4LXFA 5E0FA 2W66A 2WXDM 4HZ6A 2TAAA 3VM5A 4W5ZA 1ZBVA 5A2AA 3D5HA 5ABFB 1UR4A 1W9UA 2XJ7A 3VGBA 2VTFA 1XD1A 1U30A 4AEEA 5ECUA 4Z2KA 2VX5A 1NQ6A 3N12A 1CXKA 1KR1A 2DEPA 3L2LA 4XX6A 2D20A 2FGZA 4LQ1A 3AI0A 2QMKA 1B30A 1OSEA 3GTNA 1W1VA 1E55A 1O6IA 4NRRA 1B3XA 4YHGA 1LWHA 2PWDA 1LF1A 2J7GA 4QP0A 1VB9A 1H1NA 2EPKX 2VURA 3MUY1 4V27A 3GXDA 5JBEA 2W92A 3OZPA 1KCLA 3AZTA 2E9LA 1UR8A 3KEHA 2OWWA 2CBVA 4F66A 3K4AA 3MUAA 2PB1A 2BY3A 2BY0A 1OT1A 4A4AA 1BHGA 4AW7A 3UR8A 1W3KA 4CU8A 4JL1A 1BVNP 1OINA 4ATWA 3U5UA 5GNYA 1QBAA 3AS3A 3SUSA 3OA5A 3TTYA 1JZ2A 1PIFA 5DO8A 3WQ6A 1VAHA 1NP2A 1J0YA 1UD5A 2J79A 1XRVA 4P8XA 1GQKA 2BY1A 2XSAA 1BPLB 4Z2LA 3TONA 1XSKA 5BWFA 2B31A 2GUYA 5JBDA 3WNPA 5KEZA 5EBAA 1UWIA 1OD8A 3ZO9A 4JAWA 2XM2A 4AZIA 3SCSA 4HU0A 1CZ1A 5M3WA 2ZXQA 3GYCA 2W91A 2ZIDA 5A1AA 2E4TA 3WSUA 3HU7A 2Y5EA 1JFHA 3WUFA 4CU6A 1C93A 2XYLA 2YIHA 2WMJA 3PTMA 4MB1A 2D23A 4CU7A 1US3A 2DSWA 2J62A 4M80A 1KBKA 3NIYA 3CGTA 3AS1A 1MWOA 3LPPA 1KFWA 2VCCA 3AHXA 3SCVA 2YA0A 4D6GA 4PTXA 2PBGA 4JCLA 4UFJA 3ARPA 5CSUA 4ZE4A 4W84A 2YOCA 3WD4A 5LA0A 1UG6A 3EMZA 1E9LA 4DUXA 2ZOXA 2VUYA 3IAQA 4UQEA 3GNOA 4AY1A 4BCEA 2WYSA 4C7GA 3CO4A 2DIJA 3W0KA 3AS2A 4JFTA 4W8AA 1ZBKA 3TA9A 1AQHA 1JZ5A 3W29A 1TA3B 1QVBA 2GJXA 1W1YA 2WC3A 4WLCA 3ZSSA 3NSMA 4GIAA 3AHYA 3W25A 4NSBA 4JL2A 4NI3A 1BTCA 2JEQA 4PYSA 5IFPA 3RM8A 3PZ9A 3EDFA 5DEZA 3AROA 3CTTA 4AZGA 1MXGA 3UG5A 3VIMA 4IUGA 2G3JA 3VIJA 3N1AA 3K8MA 2EPOA 1NWRA 3EYPA 3S6TA 1E73M 1NOFA 5HPCA 3A3HA 4GI8A 3EDEA 1CGVA
chains in the Genus database with same CATH superfamily
1K9DA 3GHTA 1FDZA 3FA3A 1E0UA 3W86A 2D24A 3CV7A 4GVHA 3TQVA 1FWAC 3WK2A 3WZ0E 1MDLA 1T6MA 1GNXA 3OQ8A 1AD1A 1E6RA 4Y9NA 2VC9A 4WOZA 3HV8A 4L5ZA 4TX9A 2YDQA 1V0NA 3EKLA 2R94A 3B97A 4INFA 4NUWA 4ZQCA 5CAHA 2VWSA 2WZHA 1L6SA 1EJVC 3OVPA 2QVNA 5A8OA 2PDGA 2PGFA 1GOQA 1JDDA 5IDIA 3M0XA 4D72A 3BQ5A 4QE1A 1G67A 4MUPA 3DU0A 4DHGA 1XRSA 3GU1A 4M29A 3UEQA 2PWGA 3EXTA 4JDBA 2FZDA 4NJKA 3K1DA 3GO2A 4DB7A 2QCDA 2WBGA 4B92A 3IJQA 3IWPA 3I6TA 1CGTA 4EPBC 1MDRA 3TMQA 4F8XA 1W1PA 1PV8A 1F74A 1S2TA 4JN8A 2Z28A 3MTWA 4FXSA 1XBZA 4H9YA 4S3KA 2WCAA 3NNTA 3RYSA 2ZWYA 4KQNA 4LEFA 5HJYA 3W76A 1EHNA 4DLMA 3UXIA 3O15A 2H8ZA 3RG6A 4ICMA 3B8TA 4WJ8A 3E74A 3DFYA 1KCKA 4A21A 4QTGA 2ESCA 1E6SM 1OGGA 4MUZA 1IYXA 4CCZA 2GDVA 5AYBA 2H9AB 5K3VA 3M5YA 2OSYA 5JIPA 1GQLA 2GSHA 4JX4A 3QV6A 2GQ3A 1WKDA 3GXMA 4FPSA 1A5LC 1PKLA 1UMYA 4US6A 1JEZA 3R5EA 1ITUA 4IXXA 3MCNA 4M7SA 3OBAA 1MEHA 5JMUA 2CPUA 4ECLA 1W2PA 2Y61A 3I10A 4O8AA 2WMHA 2VEMA 1U33A 2I9EA 4DF2A 2PP3A 2I5QA 4J28A 1BKHA 1JFXA 4LOCA 4U3AA 3N73A 4FHAA 3TTEA 1TWIA 2QCMA 5DMMA 1K70A 4IQLA 3HB9A 1TPDA 1DJHA 3RPTA 3SRKA 1WX0A 1V93A 1B90A 4JHOA 2FKPA 5CGTA 3MV11 2QIIA 4QDWA 1UD4A 2ZRYA 4MAZA 1JGMA 3ZJ8A 3TYAA 3WJWA 1OD0A 1N8WA 4WXYA 4C1NA 4ERIA 4EOUA 2C79A 5FAJA 3ITOA 3SCTA 2YCLB 1RP8A 1H62A 1LWIA 1QI5A 2VR4A 4RDZA 4ZOCA 4DUVA 2FTYA 3IACA 3IRSA 2Q02A 3AMLA 4K7YA 3CPRA 3NPXA 4Z1AA 5H1WA 1J11A 2YDSA 2OYLA 3ANUA 4GQQA 1FKXA 4CCEA 2QCCA 3LA4A 2VDIA 1RJRA 2C71A 2QJJA 4MFDA 4HSOA 3PTKA 1DP0A 2ACQA 1VF8A 1WBJA 1G5AA 4GD0A 1MEIA 5DMYA 2OSXA 3GFXA 3SUTA 2AQVA 3DG6A 4W8LA 3MKVA 3N3MA 1KTCA 1EXBA 1VR6A 4JFWA 2QHAA 2BHUA 3HGRA 4WSJA 3CWNA 5GNZA 3FKKA 2QYGA 1WZKA 3CYVA 4CD4A 2OKOA 3UERA 3SR7A 4HU8A 3NQ6A 4PUUA 3TP4A 5HPOA 1A4MA 3EDJA 2GWNA 5E93A 3RPMA 3C2VA 2VGGA 4IJBA 4AEFA 5CBJA 4D8LA 3GBDA 5I3KA 1KCZA 3CASA 3TFCA 5DT7A 1QNOA 1XYZA 3DHFA 3WEZA 4A05A 3ZS4A 5TNVA 4ROQA 1SO4A 2XH2A 1FX6A 2Y8KA 4KERA 4IFKB 3L67A 1G94A 1I45A 3DUGA 3VIOA 3GXFA 3EZ4A 3O2LA 1HKMA 2YBVA 3IV3A 3D6NA 3UW6A 4GZ7A 3F5LA 2EPLX 1GEQA 3JU2A 2ACRA 3M0HA 5MKGA 3NG3A 4NZ3A 3CJPA 1FBAA 4E8CA 2DQWA 1GT8A 3CB8A 5A6BA 3CIVA 1XX1A 2ZUUA 4GXMA 4JCMA 4YTUA 3ICJA 1X1ZA 1KTBA 2NX1A 7REQB 1W3JA 3H8AA 2V2DA 3O16A 3BCJA 5C7HA 1UQZA 4M82A 3N17A 2ISDA 3UCDA 4E0CA 3HJZA 5A6SA 2GJLA 2R9RA 1S2CA 5J04A 2X40A 4PMZA 4H3DA 3VDGA 1BYBA 1W5OA 3HPSA 3LGDA 1TIWA 1EDQA 3AWNA 1Z42A 3KZPA 3UWQA 5JH2A 1KCXA 2WB5A 1R86A 3BOFA 4JIEA 4B90A 4YU1A 1Q4WA 5KZDA 3C2OA 5AHLA 3RK8A 1R9YA 1S3HA 2PD5A 2WSKA 3PUGA 1T96A 1C3FA 2IQDA 1RQBA 3TSBA 4X0NA 4Z1BA 1QAPA 2BP1A 2WM0A 4IIBA 4NX0A 2FVLA 1OIMA 3HG3A 5I00A 2HPMA 2PLCA 3TJLA 2ZA1A 4X0VA 3VUPA 4I7VA 3CUZA 4Q8QA 1WDWA 3W83A 1R85A 1X1NA 1ITQA 4C6CA 4NYYA 3UBPC 2E25A 3D0CA 4KWSA 3GBEA 4ZGYA 2YB4A 4L1WA 2IMRA 4PMYA 3BSHA 3M0IA 2AAAA 3W7LA 3L4TA 3PHAA 2BOEX 1DOSA 4YYFA 4QDMA 2WVUA 3QFWA 2WZEA 4OQVA 3TDFA 1AQMA 2GVJA 4U33A 5T9BG 3MSYA 2XSBA 2BVYA 3N6HA 4PTVA 3IAPA 1UR2A 5E09A 4DJFD 4GH3A 1R8LA 1PXGA 1TWDA 3MDUA 4RXGA 1F9CA 3W81A 3RGTA 3C3UA 3G8RA 1LLOA 3AHZA 3RM9A 3UZXA 4GUIA 3AYRA 1YRRA 1EA0A 3JZEA 4JIQA 1ELSA 1GPFA 1XLDA 3A47A 3N4AA 1U1HA 5HXMA 2FDMA 5HOSA 2HCVA 1JCTA 5BZAA 1H51A 3TSDA 4V33A 3RNDA 4ERAA 2PWEA 5I3JA 1H50A 4CCDA 1MQPA 4HPXA 2O9RA 3MDWA 3W75A 1TPVA 4H04A 1A3HA 1EH9A 3STCA 4GX9A 4KFOA 3UQNA 1I0BA 3G1SA 1IWAA 1VBUA 1KXVA 4HZ7A 4PUMA 1WB0A 3O6AA 1J2WA 1EJTC 4MF4A 1A47A 2A7PA 5BNKA 5I5RA 4DWDA 2YSWA 3N13A 3WLKX 1UWUA 2WC4A 1KB3A 3N6QA 3CAQA 1A80A 3LENA 3ZSTA 3WLTA 1GYNA 2J9ZA 4ADSA 1XLFA 1US0A 1G7UA 1YDVA 3AIWA 4IJCA 4HMCA 3LHTA 3M7WA 4IIFA 3UG4A 3WLPA 3CYJA 1K4HA 4QITA 3SN0A 1IZJA 4LT9A 4M24A 4N02A 3GDTA 1FP8A 2DZWA 3C3NA 4NJJA 1XFBA 1IEXA 3VVGA 1CI1A 1JXJA 3CMFA 3ARSA 3A12A 1VFSA 1LL7A 3N3TA 1J79A 3TTOA 4DI9A 2CWXA 3NZRA 4ZOAA 4X2RA 1KFCA 2I5IA 4UTLA 4Q4RA 4PB3A 1O7AA 4TOQA 1HJWA 3VU2A 3BQ6A 2IPFA 4ICCX 3HM7A 7REQA 3AAMA 7TIMA 3NQFA 3WDQA 1X8FA 3LI0A 1J0KA 2X7VA 5FSDC 2J13A 3N18A 5LGXA 2DZAA 2YJQA 3APTA 4MWAB 3OIHA 3H4XA 3DGRA 1C8YA 1ICPA 3NQ7A 4LVAA 1IQ8A 2HPIA 2XSXA 4ZFCA 4PUJA 3WLQA 5A95A 1K03A 2AGKA 3OOQA 3NQ2A 4ASTA 2X2GA 4GRSA 4P7LA 3AHVA 2QGYA 4AMCA 3TYBA 3RLGA 3UA4A 3W07A 3RPDA 4L61A 1IR2A 4NAEB 4JHZA 1M7JA 4LJ3A 3PJTA 7ENLA 2J4GA 1RA5A 3LCXA 3UWEA 2OYMA 3E0VA 5AYYA 4AY8A 3IVUA 1D7KA 3N25A 4AB4A 3SQMA 3S5SA 5HUOA 2VENA 5C9RA 4GJ1A 2OYKA 3G3MA 4E4FA 8CGTA 1AJZA 4GC4A 4E8DA 3VIHA 3TR2A 1P43A 3W84A 2VCAA 5ABEA 2Y88A 3HGJA 1B31A 4OFCA 4M5PA 2E09A 2XG9A 3PM6A 3TYZA 3VM7A 4HMEA 4KCVA 2TSYA 4FNRA 4ES4A 3UCQA 5KTLA 1WKYA 4RZ6A 3AMDA 2D0GA 4PBFA 4GIRA 4CD8A 3C6CA 5EFDA 3UXLA 1JUKA 1IEQA 4HPGA 3VKJA 4UUIA 2CXEA 2TYSA 4UTIA 4S3CA 1E9IA 3IPWA 4PBEA 4LYRA 2J78A 2AMXA 3GX9A 1TQJA 3WNOA 3K4DA 3MPGA 3LM3A 2GVEA 3SM0A 1TCMA 3C0LA 5HJLA 4OBTA 2OOFA 3GXTA 3BXWA 3PWGA 3VAVA 5CLTA 3OQEA 1F5ZA 4P7NA 3M16A 4HNTA 3ONCA 3ARRA 2OZ8A 1REQA 1I75A 2QAPA 1QI3A 2J7EA 4X61A 2NLYA 2WHKA 5K4ZA 3NQMA 9XIAA 3V75A 1XHGA 2JFEX 3RU6A 4XZMX 3DBNA 4QCEA 4ROPA 4Z2HA 4FP1A 1RAKA 1SW0A 3E49A 4IGHA 3OLDA 5DT5A 1OVDA 3W23A 3UPWA 5A6LA 3A4XA 4RNIA 3WUEA 2YLAA 4GQGA 2CWNA 1CX9A 3SCQA 2JIEA 1E0XA 5LSMA 1VYSX 1XV8A 3RO8A 5MHBA 4QEEA 4IQEA 1QWKA 1XLBA 4O8RA 4C7FA 5CJMA 4BF5A 3AMKA 4HCLA 4LEQA 3OBEA 2DH3A 4KWOA 4BK9A 3W73A 5HULA 1BFNA 1Q6FA 1S2VA 1V3IA 4LFYA 4DO5A 4MWAE 2O7SA 5F4WA 5I0DA 4A22A 4OBRA 1NVMA 3KTCA 3KZSA 4NAFA 3O7UA 1XGZA 2A7RA 4OZOA 2GLKA 2P8BA 2VC6A 4US5A 1W9XA 1NJJA 3KX6A 1FH8A 4LC8A 5K9XA 5AECA 3PTDA 4HZ8A 3B9DA 2ISVA 3UJRA 3W85A 1JCNA 1PCWA 3LHVA 3RN6A 4LAKA 5CC5A 3S2JA 2X1IA 4DBEA 4FLOA 3SJNA 5FJRA 2G4JA 3RRAA 2MANA 3LYEA 1A5AA 2CXGA 4JEQA 4UFIA 1XYLA 2V5CA 2FFCA 4R9XA 1V03A 1ENUA 1SFTA 4RL3A 3R94A 2DQXA 3U2EA 3DFNA 1WCGA 2YGYA 1HZYA 3UJEA 4CUCA 4Y2WA 2HVNA 2BZNA 3IIVA 4ZQOA 4CQBA 4UQBA 8TIMA 2ZXAA 4DWSD 1QPNA 2DH2A 1XM3A 3IIPA 4KCWA 1A49A 3LCLA 1KGUA 1V6YA 2G50A 3ITCA 2HK0A 3E38A 1UP0A 5A6JA 4QSFA 1JRCA 3LM7A 1VIWA 1GOOA 1TTIA 1K8YA 3GVVA 3S5YA 3FJ6A 2NX3A 2GVGA 4MPQA 5DQPA 2IKHA 1KV8A 2DORA 1O5XA 4LY8A 1PEZA 2HNEA 3WQVA 1R7AA 2DY3A 1YDOA 3GTFA 2IKIA 1OCNA 3U7BA 1ZU8A 2FGBA 3DC0A 4GZEA 4FALA 3ZFHA 4D6CA 1UPPA 1WV2A 2BXZA 3VILA 4LWWA 4D6FA 5EMJA 2ZRVA 3EDDA 3WLRA 3MSDA 1YKWA 2TMDA 3C2RA 1K6AA 3R6IA 5AHFA 2X1RA 4IMDA 4LVFA 2FPVA 3SEPA 4P5UA 3KAOA 4Q8UA 1ICQA 1OT2A 3HJEA 2UY4A 2OGJA 5BYWA 2FB3A 1GVQA 3VTRA 2J6VA 1QPKA 1WA3A 4HNNA 2QF7A 1KQZA 4DAIA 1KRAC 3FGCA 2HQAA 4DVOA 2EF9A 2AMGA 5D9PA 4ZBCA 4IISA 3LOTA 1OK4A 3OEXA 5BRPA 1O5QA 3OYXA 5HAOA 3PJXA 1UH3A 3I6EA 5G4WA 2J74A 4LVGA 3NWRA 4LV9A 1RD5A 3A21A 1MZRA 5HQEA 3N4FA 4FNSA 1GTHA 3I4EA 1PYFA 1ONEA 3W28A 1GKPA 1UWAA 1KM0A 3N19B 4LH8A 5CPNA 5LNVA 4AZCA 2AQWA 1GVYA 4W7VA 3C86A 4QLLA 1QFEA 4WDUA 4DBDA 2WVTA 1ESWA 4G1NA 4QCFA 1VIZA 4WKFA 1KM2A 1A0DA 4HK7A 1C8XA 2VQUA 4LAOA 2EO7A 5A3HA 2OQLA 3MKKA 2J7FA 5G1TA 4KETA 2D2HA 3HO8A 3PZUA 2PODA 3SUVA 3IV8A 1GJUA 5BOOA 1FWGC 3M7SA 2YL8A 3MHGA 3CZ8A 2C0HA 3VK5A 2VI0A 1B5TA 5G2HA 3TQKA 3C4UA 3KL0A 3WKZA 3M47A 3GUGA 4LY4A 2F6XA 4GNKB 2ZWZA 2IUZA 4U4MA 5ECVA 1CECA 1SZNA 4H7VA 1K02A 3G1HA 2XVLA 2XVKA 3CAVA 1V3HA 1XC6A 3M46A 1VRDA 2Z1WA 3EDKA 1Q6DA 2OT0A 3BZJA 3SFWA 5FSEC 1NP0A 2G96A 3PAJA 2B7QA 3T2QA 2WW5A 1L8NA 5E9AA 4MZYA 1R0MA 1J18A 2BOFX 4N9BA 4IGMA 4OU1A 5HMDA 1YW1A 1D7FA 3BL3A 3LXAA 3UJSA 3WF0A 3KOXA 2YCIX 7PTDA 1V02A 4JPGA 1TMQA 2ATSA 2LLEA 3NL6A 4E5TA 8XIAA 1DJYA 3G1XA 3MVTA 3NO5A 4IQJA 1NM9A 1WP6A 3E0IA 3VPLA 4JIHA 4L65A 1FWDC 3VOFA 3SUWA 1TKKA 5FIPA 1M65A 3ARYA 3S46A 1Z9AA 4ZQNA 1NFGA 2GK1A 5IFTA 3UXDA 3UGRA 4JTFA 5AHMA 2TODA 3ZLHA 5DBTA 4Y9PA 3CLWA 2VELA 3LCIA 3N14A 3O0FA 3K1GA 2XIQA 1L9WA 3WK3A 2OX1A 4Q32A 3ARWA 4W85A 2W5FA 3U4FA 3TW6A 3CPUA 2UV8G 2W79A 1OFDA 4QISA 3COTA 2XZ9A 2YFOA 2VO5A 1DE5A 2FYMA 4NXSA 4Z1YA 1ZB5A 3V5CA 3WEMA 1HN1A 5E1QA 2GQ8A 1W1ZA 4JKKA 5KINA 1FWWA 4PCTA 3PBGA 3WF1A 1WDRA 1VFLA 3WMCA 1PPIA 3TKFA 3ZT6A 4RDVA 4P7QA 3PY2A 4LBRA 1MO0A 2VCBA 3VDHA 2R8WA 4GJIA 4KS0A 4UOJA 1G01A 3WBEA 4Q7BA 4X9YA 1SFLA 1QW7A 2QVHA 3RLHA 2DT1A 2ZX6A 3CZLA 2EKCA 2VRJA 3WQCA 3A22A 5I23A 2YDRA 2OZ0A 1G69A 1MUWA 4GKLA 3VINA 1FVPA 4UFLA 5DX7A 3U7VA 1XIBA 5C7VA 1UP3A 1VKFA 3NDYA 3QJAA 1UD2A 4JN7A 3TW7A 4G8TA 3BG5A 4NJIA 4IIEA 5LA2A 1T8QA 3DYPA 2BTMA 3N04A 4LUJA 1JPDX 1TCDA 7CGTA 2A3CA 3VD7A 4BS0A 3FA5A 1S5WA 1K7EA 1JNDA 3ZT7A 2QLYA 3W71A 4PSPA 1H41A 1YXDA 3SAZA 3WH6A 5I3FA 5CZJA 4JTHA 5A2BA 4U3CA 3NO3A 1UWSA 3VOIA 4J2MA 2XN2A 1S2UA 3K8KA 2EAWA 4H4IA 3II1A 1KGXA 2HS8A 1RCOB 3UWYA 2VD9A 1EIBA 3DXIA 3QLLA 2DIKA 3CUHA 3AXHA 2HV5A 3S5ZA 4Q4SA 4BEQA 3O63A 2HROA 2IXUA 4HPNA 3PF3A 5HQLA 4J3VA 2QUUA 3R11A 4RW3A 5C9XA 2GWGA 2VEIA 2WCSA 1CPUA 1KM4A 1AUSL 3NQCA 1SO6A 1VQTA 4S3DA 3GNNA 4GVFA 2V2HA 3BH4A 2D2OA 1O68A 3ZR6A 3PZIA 1MVYA 4N9CA 1THFD 1T41A 4FOUA 3B4UA 4EACA 1ZJAA 2NV2A 1C91A 3M43A 2VC5A 3N29A 4PC8A 1KBBA 5JH1A 6TIMA 2VNCA 1ODUA 2YXGA 4FS9A 1JIBA 1D9EA 1ZAJA 5REQA 3S9IA 2XGIA 3VDCA 3BGAA 4A3HA 2ZX8A 1P1XA 4KESA 1J0JA 3T8QA 4UTHA 2BNJA 1XXXA 3B8VA 1DYSA 3NXFA 2YR1A 4L9YA 3E2SA 3AIBA 1S46A 3GW3A 2PCEA 3GZAA 1PX3A 4AD1A 2R1PA 3W7KA 3L4YA 3VCNA 1EF2A 3SBFA 1EF3A 4EWJA 3Q45A 1JF6A 4O10A 4Z2GA 1DHKA 2Q3OA 3QRHA 5CJ5A 3N15A 3AUOA 1UWRA 2CLIA 1OFPA 1GUVA 4L4OA 5A69A 1G0CA 2QDDA 2VMFA 3LSBA 1F76A 3HPZA 3GG8A 5DANA 2ONEA 3GKAA 1YMYA 4NI8A 2A3LA 1F3XA 4DZ5A 2WNNA 1NOWA 2YA1A 3PPFA 1O1ZA 3W53A 1R87A 3CAKA 2NX9A 2XIIA 1F2JA 1XRFA 3ERPA 2ZRXA 3MUXA 2BHZA 4EF9A 1GCYA 3FEQA 2PAJA 3HGSA 4LPCA 3Q67A 2E67A 4BI7A 5A6MA 5H8UA 2WM1A 1XW8A 5DXYA 4AIOA 4AX7A 3M0JA 5D2XA 3CH9A 1HJXA 3F4DA 4PCFA 3B0VC 2Q8ZA 1I1XA 4MKNA 1DHPA 4CLMA 4B5TA 4AYGA 2CLLA 1HW6A 3INPA 1PHWA 1RPXA 2WJZA 2Z2AA 4X63A 2DU2A 4LXFA 4JDYA 6REQB 4I9AA 2Z24A 3MUCA 4PRTA 4W5ZA 5ABFB 4IP7A 4IP5A 1U30A 3T7VA 2OEJA 4ERGA 3PC0A 1JDEA 2FZBA 1CXKA 2Z00A 2V8ZA 3B8WA 4XX6A 3KOFA 3L5LA 4HU3A 4EXQA 1DJZA 2Y7GA 3AI0A 1OSEA 4GUFA 3GTNA 3OU8A 3H54A 1LRQA 3CPGA 1W17A 4LSBA 1B3XA 4YHGA 4JYFA 1LWHA 2PWDA 2ICSA 1SZRA 5EPDA 4O11A 4QP0A 1VB9A 1H1NA 2VGBA 4JY9A 4QR6A 3W1AA 3MUY1 2B7NA 4AU0A 2W92A 3OZPA 1G4SA 3EOLA 3TH6A 1UR8A 2OWWA 1LUCA 1OY0A 3MUAA 2PB1A 3GXPA 1OT1A 1U5VA 3C52A 3GVQA 1UJQA 4ATWA 3RRXA 3K2GA 4MKVA 1BXBA 3K30A 4AFYA 4MY9A 4A8RA 4LF2A 1ALDA 4AH7A 3CQHA 4S2CA 3CL6A 3NR0A 2BY1A 3NM3A 3BE7A 3H2OA 3RITA 2B31A 5JBDA 3LBCA 5EBAA 3ZO9A 4H7CA 3FKRA 3SCSA 4GCAA 2W91A 6XIAA 1SR9A 1XDMA 3WUFA 3P0WA 1VS1A 4KT2A 4CU6A 4DF0A 3TU9A 2C6QA 3BJFA 2D23A 2RJGA 4N6EA 1XLLA 3TCSA 1KBKA 3LHUA 3B0UX 4O4VA 1UBSA 4QSHA 2VCCA 3BG9A 3SSZA 2FZ8A 2BB0A 3GD6A 4K8EA 1AZ2A 4QJ3B 5GJMA 4GBDA 2PBGA 4JCLA 3ARPA 1GK8A 3SADA 3VCRA 3PULA 3H53A 9RUBA 4JTAA 1OK6A 4AY1A 2WYSA 4WQ6A 4K39A 3B03A 4GJJA 1ZAHA 2DIJA 2VM8A 4XAPA 5I02A 4W8AA 2WJFA 3W29A 3FSUA 1W1YA 1W56A 4YIWA 2WC3A 4WLCA 5F4XA 1Q63A 4WHBA 5D38A 4PYSA 4ZODA 3NURA 2CLFA 3VIMA 2QCLA 1S38A 4LAMA 1F3EA 3NEVA 1UR3M 2J9YA 1UW9A 1Q2SA 2P0IA 3LK6A 3WENA 5HR7A 2PDUA 3QHNA 1WDSA 2QPSA 3T0BA 4YN5A 4YTRA 3P67A 4DZAA 4JIPA 3VC6A 1QPRA 2OSWA 1JCJA 1MW0A 1E4IA 5AC8A 4C7DA 5BRBA 1FY6A 3KE0A 5TQLA 1AW5A 1OIFA 3MCOA 1EJRC 1TJPA 3UWZA 3G8EA 4BR1A 3T1GA 1XH1A 4DM1A 4PE8A 1TVNA 1RQEA 5GVJA 1H7PA 1XI3A 3E12A 4M6VA 1OFQA 1WUEA 2O0TA 3IVTA 3GS6A 3VNJA 1JZ7A 2R1NA 4F0KA 2WKLA 4RPPA 3MWCA 4MY8A 4HYRA 4HD5A 5EMYA 2C7FA 3CS2A 2E6YA 1TSIA 4C5YA 1U5JA 3RU8X 1WXYA 4WK9A 1S3TC 1Q7ZA 3AJ7A 3VGGA 4K68A 4IF2A 4HP5A 1OGBA 2E5BA 2FJKA 5J5DA 3R0DA 1J0ZA 2WZIA 4AWEA 4RLIA 4CVWA 1N55A 4UZSA 4QS6A 4FX7A 3VIGA 4M56A 4AD3A 2PS2A 3R10A 1H0GA 5FF3A 3CV2A 4XZ9A 3WBXA 1VCVA 4WSKA 2W67A 4YWIA 1MNSA 1VJIA 3KCOA 1CTNA 1E1CA 3UNTA 3IGUA 4NNAA 1A3WA 1HO1A 1GPWA 2C19A 4UTUA 3MP5A 4JFSA 2ZUSA 1QI4A 2FQIA 3F2DA 1ZBWA 3G1YA 4NZCA 4DJEC 2BVTA 3PANA 1S1RA 1LCOA 1WDPA 2G3NA 3GAKA 2V5BA 3CO8A 4J3UA 3L4WA 1PTGA 3PWIA 3M0KA 4IX0A 5CJNA 3SRFA 4H83A 4KEZA 1L2UA 1MUCA 5I6SA 2ZZ6A 4Y8FA 4DWSB 3THAA 1M9HA 3WDJA 3KVLA 1C29A 5A6KA 3BV7A 2WANA 2V3DA 3KBVA 4I6VA 1LBMA 2F38A 1W5NA 1V4YA 1A3XA 3W7IA 2XVNA 4LS0A 2Z1SA 3MMDA 4H9ZA 5CEWA 4TMCA 4LS1A 4GK8A 4UMBA 4N0RA 3ZVHB 3QY7A 3LHWA 4WJEA 1TTJA 4F0LA 1QHZA 2O9TA 4L4LA 4AF0A 1M7XA 3SCNA 3BAJA 1XIEA 3MY9A 3G77A 3RCYA 3LNMA 4DUOA 3CWHA 4PUWA 3V7PA 1EJ7L 2J7BA 4M1RA 4H41A 1ZCOA 5CSSA 4TMBA 3QY8A 3S2NA 1VYPX 5C9ZA 3IS4A 1GONA 2ISFA 2ZRUA 3KBNA 5M03A 4JQ4A 4ML4A 1FFRA 5D2YA 3W7JA 1SR0A 3I3DA 4P61A 5KETA 1B9BA 1OFRA 4Q8TA 1QMLA 2CZEA 4AXKA 3JW7A 9XIMA 1TZ7A 1CNVA 1J5SA 2PTXA 2D73A 3BZGA 1HFBA 4QLKA 4LAZA 3EMQA 1PTAA 1IXQA 1JQXA 3SY8A 2OGYA 5G4HC 4YXGA 1TV2A 1XPGA 4REQB 1SJDA 1M01A 1RXOB 1ITCA 1W1B1 4M8UA 3NL5A 2ZRWA 4E8GA 5I2UA 4W89A 1EWEA 3T78A 3DG3A 3PJUA 5CPTA 1CXHA 1JDCA 2QUTA 2OLHA 4UOZA 2EJ1A 2CYGA 5AHNA 1ADSA 2PZ0A 3QKZA 1J6OA 3GDKA 4L6DA 5TD4A 3UXKA 5CC3A 2EKGA 1Q66A 1BG9A 4F0RA 4FI4A 2ZXDA 1HTIA 5F2MA 2QCFA 2JKEA 1IT7A 4NIRA 3T08A 3TYUA 3MHUA 4JNMA 1ME8A 3OZMA 5FEWA 4B15A 3Q37A 1CLKA 4TU1A 4GGHA 2IPGA 1EPXA 5HANA 3FXGA 1AL8A 1UZHA 2W63A 3QY6A 3GFZA 5H2ZA 5A6BD 3P80A 2VR2A 2ZQ0A 4D6IA 4KW2A 2WCGA 2NXHA 4RR4A 3DECA 4HNOA 1V3KA 3DZ1A 1E6NA 2IXVA 2ZCGA 1BRLA 2INZA 3CXOA 3LZ5A 1NEYA 4UTJA 1PIIA 3VNDA 2E1WA 4HJWA 3P0XA 5LXXA 2MUCA 2YL9A 3W3OA 5FJJA 4NZ4A 4AUBA 4D8AA 5JIWA 4W8BA 2H3DA 1XUUA 2WKJA 3W1PA 3UWWA 2W6RA 4XIMA 2W9MA 4WDXA 4O57A 3W27A 1KFEA 1LBLA 3W26A 1M7PA 5GJPA 2Y7EA 1O60A 1GW9A 1VBRA 4PEKA 2NQ9A 3L4VA 5KZEA 3M9YA 3I65A 3WBYA 3TJIA 3CAWA 5EFFA 4J3XA 3UJFA 3RILA 5FJIA 1B57A 1ECQA 1ONRA 5FF7A 1ZUAX 4JKMA 1OZQA 4FNTA 1BYCA 4IG2A 5U7SA 4Y90A 5B7YA 4CNNA 1P48A 2A0NA 3GUWA 3LCHA 1KRCC 4F0HA 2VEPA 3GM8A 1QHPA 4X9SA 4Z2IA 1JVNA 3VKDA 1RQHA 1GHSA 4MZ8A 1FWNA 3PWAA 1H4PA 4D8ZA 2HE5A 4JQAA 5BU6A 3ZLGA 2NVDA 1QT1A 1TPB1 1H3GA 3BJTA 1UKOA 3MW7A 5I3IA 1FHDA 4Y6GA 3HGOA 2OJPA 4IMCA 2BWGA 2XFRA 1PO9A 1AQ0A 1HKIA 1W5QA 5HWJA 4JX5A 1S2AA 1M53A 3KS5A 5H8PA 4J3SA 1OHLA 2D3LA 2E9BA 2V5JA 4NNCA 5I09A 4H6RA 1A50A 3PP7A 4LYPA 3C2FA 2X09A 1YX1A 4H9TA 3CZGA 2J7DA 1EOMA 2PUZA 1G9HA 4XZWA 4JQ2A 3USZA 1IF2A 5CPQA 4Q8WA 3R8HA 1HGYA 1DWAM 1A5NC 2X0HA 1YNPA 3MHFA 3W7CA 3RIKA 4DNHA 2FHFA 4QIUA 1I2NA 1AH3A 4DM2A 3FVDA 3R43A 2JKAA 4U2ZA 4S3AA 2A3EA 1HKKA 2VQTA 1XYFA 1C92A 4BI6A 2ASHA 1PB0A 4QEHA 5AKQA 1RUSA 2WHJA 3GNXA 5GPRA 1EDTA 3OLGA 2OU4A 3H24A 3BSGA 5BRQA 3KDNA 5EKYA 2J7HA 1Z44A 1NDVA 4E4UA 4A29A 2QJGA 3AMCA 3W7EA 1B3WA 1QU4A 1QXLA 2J47A 4ATLA 3SZ8A 3TCEA 1RZMA 3M6YA 4BQ4A 2PZNA 2PDCA 4KCUA 4DY1A 4RNJA 3E3HA 3VX0A 4OGZA 4IPJA 3U3HA 1ZFJA 1W32A 3NPWA 3QEZA 4MMWA 4PMVA 3B40A 4FSAA 1F07A 1S5MA 3NZPA 3BVJA 1NWUA 4WY0B 4V2XA 2NSXA 5FL1A 1FWJC 4GNVA 4PUEA 2JF7A 3ZZ1A 1P0DA 3BLFA 1ZP4A 3F7JA 3PBYA 4O28A 4Z2JA 4KIRA 2PDYA 1LL6A 3GDLA 2P1FA 1KWGA 4OUEA 2QCNA 4G7FA 3WCZA 4AC1X 1LQ2A 2H90A 3UFYA 1B0IA 2F7FA 5EU9A 4JTJA 5TF0A 3OGRA 3U2ZA 1UA7A 5KITA 4O16A 4XVEA 2OEKA 4P2VA 4O4WA 4ZXLA 5E9XA 3PNUA 1BVZA 4JN6A 1QW9A 3W1RA 1PZ3A 1FWBC 4LUTB 4GI6A 1MNZA 1W2VA 4Q22A 3WYZA 4W93A 4O1EA 1PS9A 5DLCA 3QTPA 4GFSA 1E51A 4JICA 3L23A 4RNHA 3ATYA 2D3NA 1MXDA 3FX4A 4ZOEA 4HA3A 1EGMA 1J2BA 3ID7A 1BAGA 4ZL1A 3IEBA 5CLWA 1NWTA 3OPSA 3THCA 2OO0A 1VYRA 5C54A 2PD9A 5D2VA 4FO4A 3IIXA 2NXIA 4QX4A 1PZ2A 4PCNA 3WDPP 1HX0A 1X39A 3K5XA 3G1FA 1EXPA 4WEVX 1FWFC 4FNUA 1KNWA 3QN3A 4ZB2A 5IBXC 1PKNA 1FHLA 4XKMA 1QI0A 5C5YA 4UWMA 3ZVIA 2V3FA 1EQCA 2XPKA 1ITXA 2PGRA 4Q6JA 4GX8A 1X6UA 3FJNA 3LV5A 1JDAA 4TUFA 4M81A 4DO4A 3KBMA 3EA2A 3VNZA 1SMDA 4RCXA 1TJRA 3GIQA 3FAXA 5LYRA 1TREA 1PZ1A 2PU0A 3PN8A 4LS2A 1P4CA 2OTDA 5H6HA 4W9TA 3SIZA 3WDHA 3EPOA 3K8LA 4IICA 1XKJA 4HHHA 3R89A 1FHVA 4UFHA 3KWXA 4FLRA 3V1PA 1TTPA 4AWSA 3CM4A 1YTEA 5RUBA 2I57A 5D4YA 3WJZA 1FOBA 3G6LA 1ZLPA 1XH0A 1BXCA 4U5IA 3DYMA 3DDMA 1H63A 4GVGA 4AWUA 1EYWA 4ZB5A 3LRKA 4XO6A 3W1UA 2HEJA 5FA5A 4LAUA 1CB2A 2HMCA 3D46A 5I78A 1OX6A 4KCTA 1M68A 4AHPA 3GYEA 3ALFA 3LPOA 5DCBA 1N82A 1C9WA 3VO0A 4HZMA 3UZJA 3MANA 1FXPA 1TR9A 4I90A 1Q7QA 1POJA 1TWSA 4LGXA 4XD5A 5HINA 4GOAA 5F4SA 1VFHA 3OO2A 3LQGA 4LRTA 3RMEA 1O95A 2JEPA 2WMFA 2NV9A 1KQYA 3P14A 4XZBA 3WG6A 4TXEA 4PR4A 3G0SA 2GUBA 1RALA 3GZ3A 1OFEA 2GJRA 3B9EA 2ZTJA 4JIRA 3NXLA 3B8DA 1NAL1 2Z26A 3LGEA 1SMAA 3ZJ6A 5M5DA 3W7GA 3HFTA 1PBGA 3PB2A 4B5NA 4DXKA 2WBKA 4YTTA 3P5ZA 3AS0A 2PTWA 3DH7A 3W02A 4Q7NA 3OLEA 2HVMA 3EEZA 3JUGA 3CUXA 1KO0A 1E0WA 4ADUA 2PWVA 4DZIA 4HKPA 1EKOA 4QG9A 4E38A 1S1PA 1KXTA 1EC7A 2VGIA 4N7QA 1NTHA 1VH7A 1WXJA 2OKTA 4NZFA 3T4CA 1OX5A 2XFFA 3QYQA 3L5AA 1EEXA 1HJQA 2A3BA 5DF0A 3VKBA 1JCLA 4GA8A 3BAWA 1EBHA 1XF0A 4E6MA 1UIOA 3TJXA 4XWUA 2RDUA 2ZUMA 2OFJA 2ATMA 3NQDA 3ZM8A 3M64A 3LV6A 5FEXA 4GISA 4C91A 1ME7A 4GABA 3VMPA 3NM1A 1GYLA 3HTWA 1RLCL 5E6YA 2C18A 4GG9A 5C2CA 4CEUC 1YIXA 4BY3A 1KKOA 3KL3A 4IL0A 1NY1A 2BV9A 5D05A 1OC7A 3Q58A 4GBUA 3W2LA 1ISVA 3SRHA 1OQFA 3HQ1A 1WAUA 3URQA 1JZ4A 1MRQA 1V0LA 2CZFA 1F4AA 3B04A 2OODA 4C6QA 1YBQB 4LUSA 4F2BA 1ME9A 2ZADA 3HPAA 3SURA 3TA6A 4J9JA 4AEOA 2HJPA 1EEPA 2CZ5A 1O5KA 3A4JA 3H2FA 5AYXA 4DO7A 1IWPA 1RV8A 4H01A 1JAEA 1F3WA 2Q6ZA 2HISA 3I7QA 2QS8A 4J4KA 3NQ8A 4G5DA 2HBVA 4PUNA 4Z1CA 1QWGA 5AFDA 4DBWA 3BSMA 4TO8A 4EAMA 4MDOA 2DUXA 4HOZA 3FCPA 4C6PA 3CHCA 4DN1A 4UQAA 1W91A 4JFUA 1KFKA 3BLLA 5CPSA 2O9PA 4IUOA 1KRMA 3HOJA 3CUFA 1JI2A 3UNDA 1T8XA 1FRBA 4TVUA 3DCPA 2O92A 3LBMA 4WVXA 1E71M 1MYRA 3QV9A 3LB0A 4HHMA 4S38A 4LVBA 2ZICA 1XIGA 3VD4A 1Z41A 3CIWA 3SFKA 1LWJA 2NSOA 2ZVRA 1EA9C 4KFNA 4UR8A 1AH0A 4XG1A 3KVMA 2A1YA 3MV01 4TV6A 3EX3A 1IZCA 1LG2A 1VHNA 2BGQA 3S1VA 4DJEA 1U2YA 4F79A 2A3HA 5JUVA 1N8FA 3ANYA 5LHEA 5U4NA 1HVXA 3AIUA 4ONVA 4IJRA 3H23A 2OXNA 3M5VA 1JR1A 3KS6A 5D9MA 1FWTA 4RNFA 4P8UA 3IK2A 3AIQA 5I3DA 2YBTA 1RVGA 1OYBA 1Z69A 2NUXA 4XVDA 4NJGA 2E6DA 3DYOA 1IXNA 2E28A 1F6KA 3IJIA 3TNOA 1WXZA 2YL5A 4FR1A 4QG8A 3IIOA 4GZIA 5L9FA 2A2IA 1ISXA 4BQ5A 1BWVA 4KRTA 1H5VA 1K9TA 1W1TA 4QLJA 2HXTA 3WFZA 2CEQA 2DDXA 3LHZA 2RJHA 1SO3A 3CL7A 4TTGA 3LD5A 3AU2A 3TX9A 2AL2A 1TVLA 4L80A 4KRZA 3VGHA 4GXPA 4IPNB 4LCRA 5BOFA 3AFBA 2J7CA 2J8FA 3KBSA 4FXJA 3QKEA 3KRUA 3UG3A 1RBOB 3AXIA 3MVIA 3VABA 3F5JA 3C8FA 1DBTA 4C60A 2DVTA 1XLCA 1H7OA 3EPNA 1YQ2A 1PAMA 1RY8A 1XLGA 2QDGA 3VOJA 4QFUA 4C1NB 1I9CB 2D0HA 3ITGA 2Y24A 5C9WA 3LERA 1CGWA 4XBKA 2WHMA 3N4EA 2CBJA 1EC9A 4ZO6A 2WPBA 3ABRA 4CNUA 3H12A 4UCFA 2CITA 1EJWC 2UZ9A 1DPMA 4WGXA 1KXQA 3AMGA 3QHMA 2VZUA 1TV8A 4LVDA 3VI2A 3OVRA 4MFEA 3WQ5A 1DL3A 1IEWA 1VHCA 2X05A 3T0AA 1YBQA 3YPIA 2WVVA 4LUYA 4HMDA 4JIIX 4MY1A 2ZRZA 4BFAA 2ALRA 4R34A 1K7XA 4H8UA 3EMCA 4QAWA 4EX4A 2P88A 3H70A 3CTLA 4N4QA 3BDKA 2XH0A 4H6KA 1HVQA 4Q8VA 4AY7A 5IHSA 3UY8A 2F9RA 4MJ4A 1BQCA 3VGDA 4LYKA 2A3AA 3W4RA 4HTYA 3NDZA 2VYOA 3UPMA 3PSWA 4ZSUA 4QQ3A 1T40A 4B5UA 3P8IA 3QR0A 3H2CA 4LBUA 1CXEA 4B9ZA 2VZTA 2BDQA 1FCBA 4HYWA 3APYA 3B8IA 4MADA 3SUUA 2QUNA 5LZLA 3BGJA 3EWDA 3Q65A 2XWEA 4B3LA 2ZC1A 4AVFA 2WQDA 3W7PA 1EP1A 1EO5A 2WK2A 3AIVA 3GXIA 3MMTA 2ZX5A 1K9EA 3UCCA 1VEPA 4AIEA 1CDGA 5MKGB 3EWXA 3WQ4A 1DKWA 1UKPA 2X30A 2E6FA 4P8VA 1R3RA 1IIHA 1Q65A 2QJIA 3MI2A 3G22A 3WQEA 1UROA 2DZTA 3BLPX 3B0PA 4PFHA 1E6QM 1KLYA 1TTQA 2PDLA 3S47A 2ZYFA 5A8GA 3QTGA 1WNOA 1XCFA 1OF8A 1TYGA 4WSHA 1EOKA 4YCPA 3REQA 3BWWA 3TC3A 4YMZA 3EWWA 1VFFA 5FF0A 1BG4A 2QV4A 1XYMA 4H8VA 3QMTA 3SN4A 4JTRA 5HNRA 1CBGA 2ZDSA 4DYJA 1UD8A 4NX5A 2R82A 4YTSA 4PEEA 1HQTA 4MNLA 2GQ9A 4BJHA 4Y9OA 4IL2A 4JTIA 3IJDA 1IZKA 3LTSA 4U10A 3F4VA 4GMEA 3VA8A 1V3MA 2PCQA 1J0IA 2CFFA 4O13A 3TFXA 1CLXA 1WQ5A 3F2CA 4D71A 3R58A 4DI8A 1KTNA 2DW6A 3RR1A 1D2KA 3OJGA 1LJYA 1AJ0A 4HA0A 3VKCA 1GG1A 3RJXA 3BMXA 4AAJA 1TWZA 1OFOA 1WDQA 3OB8A 4Q3MA 1X7IA 1EP3A 3R1ZA 2R1LA 1TELA 2E3ZA 2CU0A 4ZQRA 2WWDA 3TN5A 3PZNA 3JS3A 3R0KA 1X6LA 1J6PA 1QOXA 4IMFA 5A5WA 1WBHA 3HN3A 1WKFA 1UZ1A 4IGSA 2VFGA 2J6XA 4PTMA 1GKQA 4AIBA 1L6FA 3TLQA 2WSYA 1DE6A 5CPLA 1HF6A 4K38A 3NVDA 2WLYA 3FXYA 1FCQA 1P5BA 1Q8AA 1NSJA 3KP1A 3LTPA 2FMNA 2BXYA 5DXXA 3IGSA 2DIEA 1FKWA 5FF2A 1MQRA 4GUGA 3D3AA 3FY1A 1IIGA 4WGHA 4YVVA 1CWYA 1VBGA 3O1NA 1E6PA 4BQ2A 3ZOAA 3UR7A 4OBSA 4BQ3A 3O9NA 5JU6A 3AIRA 5DMNA 3L66A 4IGNA 1XLMA 1HO4A 5C8BB 5HA7A 4UQ9A 3EB3A 2ZUVA 1X38A 1X98A 1MEWA 3MU7A 1IT8A 4JNZA 2BS9A 4PMJA 2GJXB 1PDYA 4FIQA 1W9BM 4DJDA 4MLJA 2FPYA 3GHUA 1U1JA 1MXSA 3V16A 2PLKA 1TX0A 3O6CA 4OV9A 1B3YA 1UMLA 5LHFA 1VZWA 1JZ3A 1H7RA 1M03A 4MYAA 1Z8AA 4XUGA 3P8JA 3CZEA 4HMNA 3MSGA 5AB3A 4ZENA 2EGZA 2DSZA 3R12A 4LANA 4AQLA 1R2RA 4GC3A 4DPQA 5KSWA 1FQ0A 1QO2A 3H7UA 5TIMA 3MBFA 1F4HA 1VFMA 3OZYA 5M2FX 1GVEA 2RGMA 2AGTA 1AA1B 1XL9A 5HDRA 3UYCA 3V36A 5BXSA 2YYTA 4RW5A 4G56A 4H9MA 1Q6RA 2BMBA 3FAWA 4C6NA 2ADAA 3GC5A 1GQIA 4PB4A 1UH4A 2CLOA 4Q8PA 2YCKX 5M1TA 4W86A 3W7HA 5I77A 1TJ0A 4MJ2A 5ENLA 3PZVA 1XBVA 4HZ6A 4GKTA 5I3GA 3TUUA 2TAAA 4I8DA 2REQA 3TEVA 3DN5A 1I0DA 1W9UA 3NPVA 3VGBA 2PDHA 2Z2UA 1H1YA 7ODCA 2PGEA 3BJSA 3N12A 1KR1A 1UBPC 2DEPA 4XK2A 3L2LA 5IBXA 4C6DA 1HG3A 2D20A 3VE9A 2QMKA 1Z3NA 2PDMA 4JTGA 1Q5MA 2QEZA 1GVSA 1TZ9A 2VURA 4RXFA 3LG3A 4V27A 3GXDA 5JBEA 1Q6QA 1KBLA 3VNMA 1KCLA 4TIMA 2E9LA 3ES8A 4V1XA 3FV9A 3K4AA 4GNJA 3SECA 3AWOA 4A4AA 1BHGA 2WQPA 4EVZA 5FEPA 3S5NA 1K8CA 2DVUA 1OINA 3NOYA 4O1FA 2Y5SA 4Q4KA 1R47A 1R9ZA 4IOTA 5IM51 2OCZA 1QBAA 3AS3A 4U28A 3VNLA 4NXKA 1KBJA 2D2JA 3TTYA 1GQNA 2NWRA 3GW0A 1J0YA 3E96A 2J79A 2INEA 3RLUA 1IEVA 1HUVA 2V5LA 3IJ6A 2VFFA 2Y7DA 3CV6A 5BWFA 2GUYA 4C5ZA 3WNPA 5KEZA 1OD8A 1Q8JA 4JAWA 4HU0A 3NGFA 5M3WA 2ZXQA 4AWTA 2ZA3A 5A1AA 2PDXA 1QR7A 2Y5EA 3DKJA 4C1KA 3ME3A 2QCEA 4J5NA 2IS7A 4M6PA 5DCEA 4MB1A 2X16A 1DXFA 1BQGA 4UXDA 4ZQPA 1OC5A 2E5DA 1MWOA 1RCQA 4JTLA 3P60A 4CNPA 3G5EA 4MIMA 4UCGA 2FB2A 2QAFA 2GGJA 2YA0A 1F6PA 3ITVA 3OVGA 3HF3A 3LMZA 1VLIA 1MI3A 1REQB 3CL8A 5CSUA 5D32A 2YOCA 2A85A 1TJ1A 4M6QA 2XZ7A 2OLAA 3T55A 1A5BA 1E9LA 8XIMA 3IAQA 1SSGA 3XIMA 4C7GA 2SFPA 2A4AA 1PVNA 4DX3A 2BOGX 1ZBKA 3TA9A 3W1XA 2GJXA 3DI0A 1GVOA 2DZXA 3NSMA 4GIAA 3OYZA 2J27A 3AHYA 3H21A 5F2IA 4WDWA 2ANUA 3ZWSA 1WYIA 2VGFA 4UMCA 5I06A 4QJ1A 3GC4A 4PULA 3EOUA 3W01A 5G1YA 5IFPA 1PWMA 3LUTA 3EDFA 5DEZA 3CTTA 1MXGA 3MWAA 2OQHA 3BW3A 5E5CA 4IUGA 2G3JA 3N1AA 3K8MA 3C0SA 4QGCA 1NWRA 3EYPA 4I8YA 3S6TA 1E73M 1NOFA 5HPCA 3A3HA 4BWLC 4XBSA 1FH9A 1CXIA 2WNWA 3MP4A 4RV8A 4PMDA 4MAVA 4A8NA 1A5SA 4OOZA 1F6YA 3WNKA 1A4LA 3LDVA 3NQAA 1WOBA 1DJWA 3QYSA 3UESA 5K7JA 4MDPA 4NAFB 1W5MA 3HV9A 4XQ6A 3BW4A 2D2GA 4XIAA 3IUIA 1AW2A 3WF3A 4JXCA 4J1OA 2FTWA 3W7QA 1XG3A 4AHOA 3LGGA 1MSSA 1NIUA 4QS5A 1JYWA 3W22A 3NAVA 2HDJA 3CQ0A 1K6WA 1QNSA 2OVLA 4TX8A 4G9PA 2ZVIA 1ZTVA 3KVKA 1UIPA 3QR3A 2ZDRA 1VLWA 2BVWA 3TYEA 1QK2A 2Y8UA 4N9EA 2BGNE 1V6VA 1A5OC 2UY2A 5BXRA 3IJ8A 4JS3A 4G2DA 4EE9A 4UTMA 3N9SA 3S6OA 3W6YA 4KH2A 3RLVA 3UY7A 4D6DA 1XPYA 3IVSA 1E0VA 1ZY9A 2CBUA 3L4ZA 2W62A 4GQ0A 2WV8A 1EJSC 4EXAA 4DF1A 3BANA 1BEUA 2ACUA 1B2YA 2RFGA 3S2CA 5LGZA 4P8WA 4LNYA 4O19A 5AVHA 2VFHA 3RCMA 1E6XM 1O1HA 3VD5A 5CGMA 3PZMA 2BHYA 4A8LA 1TPH1 2YL6A 4PH6A 3TE9A 2F6KA 1ADDA 4LUIA 3SY1A 1H2JA 2OZ3A 1EBGA 3BV4A 1KV5A 1NELA 2GVYA 3ZQ9A 5E0CA 3NSNA 4HSHA 4KWUA 1JJKA 1IGSA 4MZ1A 4XISA 1C9DA 4XTIA 2QCGA 4M51A 3T2OA 1HL8A 5A6AA 4B3KA 1HIZA 4CD5A 1NF7A 2VD8A 1FTXA 2ZZ4A 1JQVA 5F1VA 1Y5VA 5HWNA 4GACA 5FOOA 5C2XA 3ITLA 3PZGA 1LOLA 2C91A 4UTTA 4LW7A 3L65A 2NZLA 1E72M 3ITYA 4G7EA 5AC7A 3H6OA 4ZB0A 4MNMA 5LA1A 2PU1A 5CZ0A 3O0KA 4GLEA 4S23A 1Z7AA 3U8GA 3FGCB 3L0KA 4R7WA 2WNZA 3WD2A 5C71A 2ZZ5A 2WJDA 4GY7A 2E8YA 2JALA 1Y0EA 1XH2A 3MUIA 2VEFA 3QPZA 3VDAA 1YE4A 1KM5A 1N2VA 3R13A 4CKQA 2HRWA 1DQXA 1DWIM 4QDPA 2YZRA 4KBXA 3VC5A 3GNDA 4UR7A 1EL3A 1M04A 3I4KA 5CG7A 4FK9A 4OHQA 5C2GA 2WOQA 2Y62A 3QLDA 1O66A 3N2TA 5FACA 4AZCB 3IJ7A 4UOQA 3S2MA 3EX4A 1RH9A 3VGEA 3L0GA 5GJNA 1XJBA 3PS7A 2CLKA 1A5UA 2BX7A 3ITXA 2FVKA 3CB3A 2XVPA 2DSVA 3FVMA 3THDA 3KHDA 4YHEA 1CXLA 4V28A 3MMWA 3LLDA 5DY2A 3FJ4A 4EANA 3WDRA 4OUIA 2V3GA 4K8GA 2F2HA 1EGVA 3AXMA 4RV3A 3R8RA 4PB5A 3VZZA 4BHYA 3WBAA 2XHYA 4UMAA 4K37A 1I2OA 4L4MA 2ZX9A 4AD2A 1O12A 2DPEA 2EG7A 4HT3A 1B4EA 2Z6JA 2Y8VA 2IKGA 5HNTA 2WHLA 1E3XA 1VD6A 3QM3A 1B3VA 3ZR5A 3B05A 4BA0A 2BG5A 3S9ZA 3S2LA 4YPJA 3UR2A 5B7ZA 3G1DA 4XBJA 4MHBA 2PDBA 4B5WA 3BW2A 3PNZA 5CC6A 2WZTA 3VIPA 1DV7A 4EAYA 4KF1A 1YTDA 4E2VA 2A21A 3T09A 4XAYA 1E0TA 1JG9A 2POZA 3E0LA 5FL0A 3WDIA 1JXKA 4BI5A 3N2BA 1I2PA 3M07A 1N7KA 1L2QA 3W37A 4XAFA 4XKYA 2QR6A 3W87A 1DVJA 5A6TC 2PDIA 4ACZA 3DEQA 3LXCA 1JF5A 4J3WA 2UWFA 2VT0A 3NZQA 2PTDA 3LNPA 1X96A 2YDAA 3QGVA 3VZXA 3KXQA 4WDTA 3V5FA 3E5PA 4LU0A 2AL1A 2ZUTA 4MB5A 4F4RA 3ZJKA 2GGHA 4D6HA 2WSPA 4PL2A 3MJMA 4RE3A 2JGQA 2GK1B 3SCPA 4JTQA 1BD0A 1WO2A 3J7HA 3QZ6A 4GO9A 4H9UA 3DHDA 4XB3A 3NEHA 1P0EA 4LCSA 2O55A 4HNVA 1HJVA 2F6UA 4JTKA 4OE7A 5I07A 2VC7A 1PYMA 3NSXA 3WQGA 3MMUA 2I14A 4HOXA 1QASA 3H55A 4PMUA 1KD0A 1W5PA 1XCWA 3VNIA 1TB3A 3E5BA 2PDPA 3HG5A 4F3HA 3BG3A 3DFHA 3ABXA 4CNTA 3LN3A 4TV5A 3WEOA 3S1WA 3KLLA 3OG3A 2G8ZA 1V51A 1RJQA 2G41A 3P84A 4HOWA 2NWSA 4F40A 2NQ5A 2KZHA 4MPKA 1E1EA 2NQHA 1QUMA 3WD0A 3ABOA 4HNCA 4ENLA 2PTZA 5I7GA 1J0HA 4F0MA 2UY3A 3SIMA 2Y1HA 3MS8A 3GDBA 2O4MA 1UD3A 3DGBA 3CZJA 4Q4PA 3S8HA 4DZHA 2P0OA 2Z25A 2X8RA 4AYSA 3ZR4A 5LNWA 3TN3A 3ZJ7A 3PFMA 5XIMA 1XRTA 4LB3A 1JPMA 1TV5A 4NZ5A 3MBDA 1Z89A 2OEMA 3P74A 1XIDA 1P6BA 2J8TA 2JIWA 3TMLA 1RD6A 2FIQA 3JVAA 1K4GA 4XV0A 1QBBA 4NRSA 3F4CA 4Q8OA 1KC7A 4H2CA 2HWGA 5CZKA 1PJ9A 4HHPA 2RKXA 4O15A 4JX6A 1Y5WA 1ZGDA 2R1KA 3SW6A 5G5IA 1EX5A 3H2MA 1WZLA 4GYJA 4AZBA 2G97A 3RJYA 3GG1A 1EZ2A 5HMSA 2XM1A 4CEXC 1B9ZA 1W0MA 1VBHA 1D3CA 2GFTA 3C56A 2CC0A 1K77A 1NF0A 2DGAA 3P62A 1FFQA 3PPHA 1C7TA 4K1WA 3WLNA 4AZ6A 1LDCA 2FHBA 1TPUA 5A94A 1J5TA 4ORMA 3WH5A 1V5XA 1OF6A 4AZHA 4I3GA 2E9MA 2PWHA 2CLMA 2PF0A 1V02E 3VIIA 3T81A 1V6TA 2JK2A 3QW3A 1RCXB 2XDFA 4JBRA 2GUUA 3K46A 2ZXBA 1T99A 3TZNA 2CKRA 4DYKA 2QV5A 2HNHA 3RAOA 5AC4A 3H4WA 3TC7A 1H1ZA 1H49A 1R2SA 2QJNA 3S9YA 3SCOA 3W6LA 4HN8A 3QQ0A 3ARQA 3VOHA 1T7LA 3VD3A 5REQB 2Y2WA 4C6BA 1CYGA 1WOAA 3HQOA 1A53A 2C3ZA 2Z1XA 4WKHA 3M44A 3UXAA 3E2VA 4OTKA 2GSEA 4PZVA 1EO7A 2CW6A 1YPFA 2WC7A 4LYQA 4XAZA 3R7MA 2B4GA 3TOYA 2EPMX 4MYXA 3VZYA 4PN2A 2IPWA 3C5QA 4IPIA 5T26A 2ABBA 2G3MA 4HVXA 3M41A 3APGA 4IIHA 5C6MA 1R9XA 1SZGA 3U2CA 2QJHA 3T40A 3W7OA 2ZBTA 3MJYA 4IMGA 3BAYA 4KWVA 2EPNA 1OYCA 3AOFA 1LYXA 4I5UA 1JD7A 3C0QA 4B5XA 5ABTA 2NQZA 4HJFA 4QQUA 3WJXA 5IOBA 1H7WA 1N8IA 1H61A 1HKWA 2J77A 3RR4A 3G2GA 3B8UA 1AG1O 3Q4DA 1Q6CA 3BLOA 3N9KA 2E68A 3VMOA 3RFAA 5K2ZA 3VIKA 2EEXA 2ZZ2A 4A2SA 1TUFA 1GEHA 1E1FA 1FWRA 3WD3A 4EPKA 1XSIA 4B5SA 5K9DA 4KRUA 1XGEA 3M5ZA 3FW6A 4ZR8A 2WZMA 3KRSA 4K36A 1SYTA 4XTDA 4GZJA 2R1MA 3WUBA 3A5FA 1GYMA 1LTDA 1B3OA 3AXXA 4KGLA 3AZRA 2DZVA 4MB4A 4CQAA 1XLHA 2BVDA 4E4PA 2E7FA 5A8QA 4RE4A 4HTBA 4EKJA 3NA8A 1ZL1A 1QPQA 3SCWA 3W2MA 4AZ7A 2PP1A 4QE5A 1E4NA 2HSAA 3V0SA 2Z7GA 4GIYA 3GIPA 1UR9A 4H9VA 3USBA 5PTDA 2DV0A 3VXGA 1FHUA 2ON3A 4BF7A 3MQTA 3QGAC 1HP5A 2EXOA 3NOEA 3DHPA 1YDYA 3W2JA 5D2WA 5DN1A 1GHRA 2Q01A 3AYSA 1O4UA 1EGZA 3HQPA 3S0CA 2WSQA 5AOUA 4UNIA 2HZGA 3QMSA 1FP9A 1KBIA 4GUHA 1DIEA 1FWCC 4GWEA 3DX5A 4HCHA 3BCFA 2B7PA 4DNMA 4GYKA 3GG0A 4YYCA 4Q4QA 2FFIA 2WSRA 3GU9A 4MB3A 2QDHA 4H6QA 3LY0A 1BYAA 4TTUA 1W1IE 1TA3A 3BURA 1TUXA 1GOKA 3U6WA 1LUCB 1U22A 1OX4A 4AC7C 5EMMA 3SGUA 2DT3A 3ITTA 2VRKA 3BGGA 3BK0A 4NU7A 1OM0A 3EWUA 4A35A 4CN6A 3A9BA 1LL4A 1XINA 1IV8A 1JZ8A 1EJXC 4WIWA 1SFSA 3RUBL 2J75A 3KOZA 3P82A 5AZ1A 1IT0A 1DJNA 3GLCA 4XD4A 4PCPA 3TC6A 1UHVA 2BGSA 2YA2A 2ZFAA 3WH7A 5F7UA 1C8VA 4TX6A 5C9UA 1KM3A 1EQPA 3QF0A 3ARUA 1MW1A 2Z1VA 4AISA 1P0KA 1FWSA 2Q3RA 3L5MA 2Z1KA 2G37A 5LNUA 5D04C 3THQA 4Y96A 1JCXA 2DP3A 4MGGA 3M4HA 2OWXA 3FA4A 1JYVA 3SGGA 3SQLA 1YE6A 1CB7B 3V0UA 2ZA2A 1ZNNA 1MQQA 4S3BA 4B4FA 8A3HA 1QOPA 3T8LA 1IHIA 2GQAA 1TVPA 3LHYA 3B8SA 3LRMA 3IJ9A 3WMLA 1IEIA 1RHCA 1EUAA 4CD7A 1CCWB 3LBOA 1SVDA 4BWLA 4L1GA 5D03A 1YPXA 4E2BA 3N6JA 3GK0A 2WMKA 3EOOA 3PZOA 2NQJA 3L4UA 1XKYA 3R25A 1R6WA 2J66A 3IGHX 1UUQA 1FWEC 4B2DA 2BLEA 2C8NA 4GI4A 4OVXA 4ZZ9A 4Z0SA 3OHMB 4KGJA </