1B30A

Xylanase from penicillium simplicissimum, complex with 1,2-(4-deoxy-beta-l-threo-hex-4-enopyranosyluronic acid)-beta-1,4-xylotriose)
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
302
structure length
302
Chain Sequence
EASVSIDAKFKAHGKKYLGTIGDQYTLTKNTKNPAIIKADFGQLTPENSMKWDATEPNRGQFTFSGSDYLVNFAQSNGKLIRGHTLVWHSQLPGWVSSITDKNTLISVLKNHITTVMTRYKGKIYAWDVLNEIFNEDGSLRNSVFYNVIGEDYVRIAFETARSVDPNAKLYINDYNLDSAGYSKVNGMVSHVKKWLAAGIPIDGIGSQTHLGAGAGSAVAGALNALASAGTKEIAITELDIAGASSTDYVNVVNACLNQAKCVGITVWGVADPDSWRSSSSPLLFDGNYNPKAAYNAIANAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (XYLANASE)
publication title Xylan binding subsite mapping in the xylanase from Penicillium simplicissimum using xylooligosaccharides as cryo-protectant.
pubmed doi rcsb
molecule tags Family 10 xylanase
total genus 129
structure length 302
sequence length 302
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 1998-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1b30A00
4JKMA 3W27A 4LYQA 1GQJA 1PX3A 2WMHA 1QI2A 1B30A 4YPJA 2VZTA 4XV0A 2BY1A 1CDGA 1HXJA 1EOKA 1I1WA 6TAAA 4TUFA 5FCZA 1DHKA 4W93A 1BVZA 4GKLA 3WDPP 4ACZB 2ZUUA 1J18A 3AROA 5FL0A 1WAWA 1UR1A 3ZJ8A 4D71A 3EMCA 1NOWA 4J27A 2C8NA 3BLKA 4P7LA 1PPIA 5I23A 1ISWA 1UR0A 4U5IA 4UFLA 2WWCA 5DMYA 2WVVA 1XCWA 2OSWA 1ZU8A 3VGBA 5A8QA 2F61A 2WMKA 5I77A 3ALFA 4BQ4A 3VU2A 3WH5A 2YBUA 1R85A 1R86A 2ZXBA 4LXFA 4UZUA 3VIIA 4PMDA 4MB5A 3SCNA 1KBBA 1BGAA 2WC3A 1C90A 4PUDA 4NF7A 3WUFA 3GM8A 1B90A 1ZB5A 2HVMA 2OYLA 3WF0A 4DWSA 2DSVA 5A3HA 4RL3A 3WUGA 4AZ7A 2VZUA 3OB8A 4E2OA 2QPSA 3W38A 1K9DA 2XWDA 3ARSA 4D6CA 1TFVA 2YL6A 5LA0A 2CBVA 4W5ZA 3OLDA 5ABEA 1SR0A 2CIPA 2WMIB 4P8VA 1UR8A 5KEZA 1H49A 2WSPA 1V08A 1FP9A 3GH4A 3PZGA 5EBAA 1PBGA 2CHNA 1E1EA 3AI0A 4NRRA 4AZCB 2V38A 4H8VA 4MAZA 5I3DA 2V3EA 2WZEA 3AIWA 4HP5A 4DWSD 1HJQA 2VX5A 3VO0A 2WMFA 4B15A 2ZUNA 5DT5A 3WY1A 4KH2A 3MU7A 4CD8A 4V28A 2W62A 1D3CA 3WMSA 1BFNA 1BLIA 5CZKA 4E4PA 1K6AA 1XSKA 3FHAA 1Z32X 1EH9A 2D3LA 4GIAA 2VX7A 3TTSA 2JEQA 1VJSA 1CENA 2PBOA 4J3SA 4PEEA 3FAWA 4UFHA 4W84A 2JE8A 1J10A 1KQYA 1E56A 4GZEA 3WN6A 3SUSA 1HJXA 4P7NA 2Y4SA 2WHMA 5AYIA 5CGTA 3W37A 2DH3A 3NSXA 1W9DM 5BXRA 1W3KA 2ESCA 1V6WA 3BGAA 1VF8A 4X0VA 1B3VA 2DQXA 2OLHA 2XFYA 4HA4A 3QHOA 2ZWYA 2W4XA 5F7UA 1DWIM 3WDIA 5A6AA 3K46A 4ZXOA 2VVSA 2D20A 1GW1A 1KXHA 3VKKA 4N0RA 3NYDA 3AS0A 1J01A 1SYTA 3WD0A 4H04A 4ZEPA 4HMEA 3OGVA 2WKGA 2EBNA 2YBTA 4P7OA 5BXPA 3N18A 4UQEA 1DWAM 1NWRA 2VVNA 2GJXB 2JF7A 3GYCA 2VI0A 4ZE4A 4HMDA 1JDCA 1ITCA 1E4NA 4UQCA 5IHSA 5I2UA 2V3GA 1CGTA 1QVBA 3S2CA 1W9PA 1OCQA 1PX8A 1VFMA 2ZUTA 5DO8A 5I0DA 5ABHA 2PI6A 3LMYA 4WIWA 2RGMA 1DP0A 3AZSA 3MMDA 3VMOA 1U30A 2NW0A 5A6MA 1US2A 4Q7NA 2C7FA 5I6SA 2J75A 3CPUA 4YN5A 3CMGA 3CUFA 1EQCA 3MSDA 1CXIA 5BCAA 2ZIDA 2WBGA 1HKJA 2W5FA 2WK2A 4W8BA 4FLSA 3WFLA 1W1YA 3J7HA 1IV8A 3BAJA 3ZT5A 3AXIA 3WNOA 3ZJKA 4D6EA 4DUVA 3UR7A 1GOIA 4HOXA 1KFWA 3SIMA 3WENA 3W6MA 4CKQA 1JDAA 4RE4A 1ZBVA 4IM4A 1XC6A 4U2YA 4W8AA 4RE3A 3WF2A 3O9NA 3ZSSA 5C8BB 1GORA 3SCWA 4CVUA 2VO5A 1UOKA 3MSGA 4P8UA 1R7OA 2FHBA 1W1PA 1G5AA 2TAAA 3PZNA 4M8UA 4LQ1A 2VCAA 4WKAA 4KWUA 4JL2A 5A1AA 2Y8VA 3WUEA 3L4UA 1HP4A 3AYSA 1QHOA 2YOCA 2IXUA 5BXTA 2WHJA 3WH7A 2GJPA 4AYSA 1RPKA 2DEPA 1UD8A 2GDUA 4W86A 2ZX6A 2XYLA 5GNZA 1XH2A 3G6MA 4U2ZA 2CBIA 4W7VA 3OG2A 1J0JA 1I1XA 3PZ9A 1MW0A 2JIWA 1ITXA 1MVYA 2VCBA 6CGTA 4TTUA 3K8KA 3SCUA 3VUPA 3RO8A 2J62A 5I78A 1JZ6A 3SEPA 1VFUA 4CN4A 5FL1A 5HBFA 3UEQA 1VAHA 1XSJA 3APGA 4MTVA 2D1ZA 4OBSA 2UY4A 2CERA 3E1F1 4MB4A 5C70A 2CCRA 5D8ZA 3WL1A 3RM4A 1I75A 1JD7A 4H8HA 3D5HA 1M04A 1SFSA 2J25A 2RGLA 4Z2LA 4QCFA 7A3HA 2VL4A 1KB3A 1HF6A 1CYGA 4AY1A 2GSJA 1Q6CA 1MFVA 3WH6A 3QOMA 3GZAA 2XSAA 1BQCA 2FGLA 3FNDA 1LJYA 3A4XA 5A95A 1JF5A 1TA3A 1V0NA 4CUCA 5DT7A 3MKKA 3T09A 3RCNA 1E73M 2J79A 4X9YA 2YIHA 1VB9A 2WMJA 1LWJA 2OWWA 4F66A 2D24A 1E15A 3AMCA 3TA9A 1ZS2A 2VRQA 4MDPA 2GJRA 4AWEA 1D7FA 4NSBA 4CD4A 2W66A 1F4AA 3QGVA 1AQMA 3RILA 4J3VA 2EPNA 2CYGA 2WZHA 3AS1A 2A3EA 2YA2A 1RP8A 1QNRA 3W81A 2WAGA 3UG5A 4W87A 3GBEA 3T0BA 1G0CA 1O6IA 4EE9A 4JFSA 5E6YA 4MNKA 3U57A 4A3HA 3EMQA 4JKKA 1US3A 4U31A 2DH2A 1ZBKA 3AQUA 1XHGA 1UWIA 1XD0A 3DYPA 1JD9A 1WZKA 4R27A 2BXZA 4FK9A 3SCTA 2J7BA 2YL9A 3NCOA 2E3ZA 3W82A 4S3JA 2ZXAA 3TTQA 1HJWA 5D8WA 3L4YA 2BY0A 4W88A 3ZR5A 3NDYA 3WQ6A 2PB1A 3AXXA 2A3HA 3UESA 3AISA 2MANA 4JKLA 3D3AA 1HJVA 1NM9A 5IHRA 1IZKA 3MUAA 5GNYA 4HPGA 1GOMA 2J7GA 3DECA 3W0KA 3WL0A 3I3EA 3W53A 3RMEA 3ZOAA 2CESA 4DUWA 3WSUA 1BAGA 3BAKA 1OT1A 1MXDA 1Q6FA 2EPOA 2BVYA 3RM9A 2VOTA 2V3DA 2EEXA 4GXPA 1XYFA 4OZOA 1E72M 4MDOA 4QDMA 1CXFA 1B9ZA 2BFGA 5TD4A 2DSWA 4UTFA 3AIBA 4MNJA 3VILA 5BYWA 2C0HA 3BAIA 1GOWA 3KL5A 2G4FA 1MYRA 1GQLA 3CUIA 4IISA 2YDSA 1GCYA 3AIEA 4DUXA 5GNXA 2PWHA 3EMZA 3GNPA 4LYRA 4UR9A 3AMKA 4AMCA 5JBFA 3N9KA 1VJZA 4PTXA 4PMNA 9CGTA 3VGGA 4CU7A 2D22A 4AIUA 3POCA 1J12A 3AFBA 4DM2A 1NARA 2VX6A 2VR4A 4OOZA 1GHSA 4D6JA 1EOMA 1OWQA 4UCFA 4AXNA 1QBBA 1PJ9A 4J3XA 4CD6A 1H0IA 1HVQA 1J0HA 2X05A 2O9RA 1BYDA 2QMKA 2FDMA 1EGZA 1PEZA 3SUWA 3ZJ6A 1OGBA 2JFEX 1EDGA 4TVCA 1G01A 2VZOA 1QBAA 5CGMA 1GHRA 5KZ6A 1OD0A 1JNEA 5CPTA 1ZJAA 4XZWA 1GUVA 4YHGA 1GNXA 4FF5A 3F5JA 4W85A 4HU0A 2WNWA 4R5EA 1UKTA 1HJSA 4P7RA 1GPFA 3VIPA 1FA2A 3N04A 1W32A 4AZIA 2DT1A 3AHZA 3VX1A 2XG9A 3BAWA 5IXEA 1M03A 2D3NA 2PC8A 1W9VA 3AMGA 2OYMA 2DSUA 3QR3A 2WHKA 3KL0A 4PMRA 1VIWA 1E0VA 1CGUA 1H09A 1LF1A 3PZQA 4ACZA 1WDSA 1FHDA 2VC9A 3IAQA 2BHZA 3NSMA 2Z1KA 1L8NA 3WNKA 4MPKA 4KGLA 3AHVA 4D1IA 2BY2A 4AD3A 3BLPX 1GJUA 2XUCA 5FOOA 4PYSA 3W28A 2QF8A 2D0GA 1B3ZA 1EDTA 2XVLA 1NOUA 1TVNA 1WKYA 4PSPA 3TTOA 5E09A 5I5RA 1KGWA 4J28A 2BXYA 1E55A 2PWFA 1E4MM 4CCCA 4Q22A 1LLOA 4BQ5A 3UG3A 1DWHM 1QNPA 1E3ZA 1JG9A 2AMGA 1RH9A 1GZJA 1V02A 3VTRA 1JYWA 1WZAA 5A8MA 4AIEA 2J4GA 1E43A 5E9AA 4JHOA 4JHZA 4UOJA 5GQBA 1H5VA 2YL5A 1FH7A 5LA2A 2X1IA 3RM8A 1LL6A 4E8CA 3A4AA 2WB5A 2YL8A 1U33A 1E6NA 1LWHA 1V03A 4XZBA 1CTNA 4W7UA 3BSGA 3L4VA 1JGIA 4CN1A 4CCDA 3EDKA 4LGXA 4AZCA 1JZ2A 2VUYA 3B9AA 1JL8A 1BHGA 3S6TA 2GUYA 5IFTA 2J7FA 2DPEA 1OD8A 5CXPA 3CLWA 1OIMA 1ISVA 3CBWA 3WIJA 3ZT6A 1CECA 2DIJA 3AIVA 1GOQA 3VX0A 5M03A 3BMWA 3SCRA 3TP4A 3VIKA 3B9EA 5CPSA 3A3HA 4UNIA 1EHNA 4TX8A 1WPCA 4EAMA 4M82A 3OZOA 3K8MA 4IPLA 4QP0A 4GZIA 1HVXA 4RE2A 1ODUA 1CLXA 3EYPA 1JYNA 3SCQA 2G3JA 3U7BA 3RJYA 4MAVA 1H11A 2J74A 1EQPA 3IJ9A 1TZ7A 3VM5A 5LYRA 5A8NA 1XH0A 4MADA 3ZO9A 4GINA 1C91A 1OIFA 5ABGA 3VDHA 5EFDA 1C7SA 3ZMRA 3WEOA 1J0ZA 1WDQA 1LG2A 3VGHA 2E0PA 1ZL1A 5A6LA 1WCGA 1DWJM 2VRJA 2B31A 3SURA 5E6ZA 2CETA 3QHMA 1UR4A 2XVNA 2XVKA 4L4PA 1GVIA 2XVGA 4MJ4A 4ACYA 1UKOA 3CZ8A 5CPQA 5HPOA 1DWGM 2WANA 3IJ8A 3SUTA 1V6XA 1CGWA 2FHFA 2GJXA 2J7DA 3F4VA 4MB3A 3WEZA 1C92A 3CGTA 5D9NA 1CNVA 2WZIA 3ARQA 1AQHA 3WQVA 4PTWA 4WKHA 1JI1A 2CHOA 3VD7A 1BPLB 3GH7A 5CJ5A 1UH2A 3WBAA 1AVAA 1FFRA 2D2OA 2J7EA 1M01A 1KXTA 3N12A 5ABFB 4UOQA 1V6VA 4AZGA 3TONA 2A3CA 2J78A 3RDKA 1JZ4A 3WNPA 2ZE0A 3CUGA 1UZ4A 3VIFA 1E40A 1QI3A 2Z1SA 5CSUA 3LPGA 1ISXA 2J8FA 4JAWA 1HJUA 3DHUA 4LPCA 3WD2A 5A8PA 1MW2A 3CZEA 2DGAA 3VVGA 1E6ZA 2X0YA 1Q6EA 1UKPA 1JXJA 4UFIA 1WNOA 1OB0A 5E0CA 3DHPA 3VDCA 4AC1X 1VEMA 1E4LA 1E5JA 1BVNP 2NT1A 5AYBA 3A47A 1VFFA 2PWEA 2YLLA 4V2XA 4S3KA 4BF7A 1HKKA 1E6SM 4L4OA 5BROA 2Y24A 3CZLA 5A94A 1P6WA 4PMZA 1VFOA 2NSXA 3ARVA 3WF4A 4BCEA 1PZ2A 4HZ7A 1X6NA 1UHVA 4HA1A 4Z2IA 1E71M 2W61A 2EPLX 3THCA 4XX6A 4Z2JA 2ZUMA 4Z2HA 4KMQA 2DT2A 4P8XA 1QHZA 4Y7EA 1CXEA 3PZMA 1CXKA 3AICA 1UWRA 2WLZA 3PBGA 1H2JA 1HKMA 2WSKA 2XWEA 2WCAA 3L4WA 2E4TA 3B8SA 1Q4NX 3VGDA 5CLWA 2WLYA 3T2QA 3SCPA 4J3TA 3NIYA 5DEZA 4J3WA 1WO2A 4LYPA 2BVTA 1E0XA 1KBKA 3PZTA 1V0MA 1JZ7A 1VEPA 1XCXA 2A3BA 3ZJ7A 1C8YA 5CG0A 1GVYA 1CXLA 1U2YA 1UWQA 5EMYA 4HTYA 3ARUA 4D6FA 2XIBA 3VPLA 3MUZ1 4CD5A 1YQ2A 1NWTA 2YDQA 1E6RA 4E8DA 3WDHA 2XFRA 2PBGA 1ESWA 3PTQA 3K4AA 4PMXA 4GI6A 4LX4A 1LG1A 1Q6DA 2PWDA 4K68A 3AYRA 2E9MA 2J7HA 3DC0A 3NUKA 4QFUA 3N17A 1DTUA 3U7VA 4WJXA 3T2OA 4WLCA 3WD3A 3CHFA 3DYOA 4D6DA 4UFKA 5A6KA 3VIGA 7TAAA 4UQAA 4MB1A 2G41A 2XHYA 1ZBCA 5A69A 5I79A 5JIWA 1FHLA 2CEQA 3VINA 3NJ3A 4CGTA 4PTMA 1M53A 1RP9A 3CHCA 2XM1A 3ARZA 2CNCA 3TTYA 1HL9A 1UD5A 1CWYA 3OGSA 1E5NA 1V3IA 4WSKA 4FLOA 6A3HA 4QAWA 2J47A 4OOUA 5D4YA 4GQRA 3MANA 3FN9A 1UH3A 4MNMA 3CO4A 3VIHA 2DT0A 2GK1B 3NSNA 1G94A 3AS2A 2QPUA 2FH6A 3IJ7A 5AC4A 1VENA 3OLEA 4D6HA 2D0HA 3WMCA 3ZM8A 1BG9A 4CU8A 3ZT7A 3A4WA 4H41A 1QI0A 1W91A 2CKSA 4UQBA 4MJ2A 4DM1A 1CEOA 3F5KA 1GOOA 5A6SA 3UR8A 1R7AA 1FH8A 3K4DA 2OYKA 1C8QA 5JBEA 1K9TA 1OM0A 1NH6A 1JAEA 3WD4A 1HKIA 5GPRA 3L4TA 1WDPA 4KGJA 2XM2A 5ECUA 4AEEA 4QLLA 1UKSA 1B2YA 2X8RA 1TE1A 5D9OA 2WCGA 3T08A 1EXPA 3M7SA 4C7FA 3T2PA 4P8WA 4U3CA 2G8ZA 2W91A 2O92A 1W2PA 3ARTA 5A6JA 4AZBA 4UQDA 1ECEA 3EDFA 4D1JA 2WC4A 4CU6A 4JCMA 1HX0A 3GNOA 3F5LA 1KR0A 4OUEA 1FP8A 2OSYA 2W63A 3O2LA 1KWKA 2VJXA 5A2CA 1E6QM 1JXKA 1UWSA 3B9DA 3CUHA 4PMYA 2FGZA 1J0KA 2JF6A 3RIKA 4TX6A 1TMQA 3CTTA 3WNMA 3ARWA 3K1DA 1MFUA 1XRVA 1QNQA 2FHCA 3UETA 1PX4A 3HJEA 1H4PA 4KRTA 4UFMA 3NDZA 5HOSA 3VGFA 1KGXA 4UOZA 1KGUA 4NRSA 1C8XA 4XUYA 1HL8A 4Z2GA 4AZ5A 4TXEA 1AQ0A 1XD1A 1UQZA 2VTFA 1FOBA 1V0KA 1OGGA 3ARYA 2VRKA 2JALA 2DDXA 2ZX5A 4AEFA 3FHQA 1SMDA 1W9BM 2VMFA 4HU8A 1A3HA 3FW6A 4H2CA 4UZSA 1C7TA 2WC7A 4JFUA 2VQUA 2O9TA 3GXIA 4A3YA 2OSXA 3KZSA 2IUZA 3LPPA 4D6GA 1SMAA 4JZ5A 2CITA 3QOKA 1UUQA 1LQ0A 4WSJA 2JEPA 2BV9A 4AW7A 1BYBA 3CZKA 1UD6A 3JUGA 5D9PA 1GQKA 2GFTA 1VBRA 3U5YA 4HMCA 4JIEA 1E4IA 4D72A 1CXHA 5IDIA 1MW3A 4QLKA 4KRUA 3RJXA 4B3KA 4URIA 4IUGA 3GDBA 3ARPA 4AD5A 3MMUA 4YHEA 3KE0A 1EDQA 3VD5A 3IANA 3N15A 4B3LA 2UY3A 4JL1A 1V6YA 3BAYA 4GPNA 1J9YA 3THDA 2ZXQA 1PIGA 2ZX8A 4PBGA 3UCQA 1NP2A 3WDQA 4GO8A 4A4AA 3W25A 3WH8A 5E0FA 2OWCA 1KR1A 3WQWA 4IPNB 4AIOA 3VMPA 4GI8A 1K9FA 3L4XA 1NP0A 2J8GA 4BQ3A 2WVVB 3OA5A 3BCDA 4QLJA 5AY7A 2ZUSA 1JNDA 2AOSA 3POHA 3EDJA 1X1NA 5IFPA 1CGVA 2WVSA 4J3UA 3GH5A 5DFAA 3VMNA 1OT2A 2J7CA 4ZFMA 1TG7A 4WF7A 1QHPA 4B9ZA 4BA0A 1CZ1A 4WK9A 4DWSB 3AXHA 5M17A 1J0YA 2PWGA 1B31A 3EDDA 4GZJA 1JZ3A 1UWTA 5I24A 1JFXA 3WELA 3CMJA 4N42A 3W6LA 4HPHA 1WB0A 5M5DA 2Q8XA 4M24A 2WW5A 5A2AA 3BMVA 3AIUA 2WMIA 3GNRA 2CXGA 1QW8A 4ZXLA 3GXMA 4ML4A 3W24A 4WKFA 1CGXA 5HDRA 2V5CA 3ECQA 3M6DA 2ZWZA 2PF0A 2V5DA 5A8OA 3U5UA 2VX4A 3SCOA 2VZSA 1NOFA 3SCVA 5A6BA 1KCLA 1G9HA 3WQ8A 1JZ5A 3GBDA 1B0IA 4PCSA 2NT0A 4BZYA 2VURA 1EA9C 2YA1A 4ZENA 1CGYA 1GQIA 4BQ2A 4TOQA 2QV4A 1JAKA 3KEHA 2VQTA 3T0AA 2D23A 1V3MA 4PRWA 3WDRA 1E70M 3PZOA 2V3FA 5D9MA 4PMUA 3ZIZA 4EKJA 1V02E 2WVUA 3AMDA 2UY5A 1IZJA 4AD4A 3WH9A 1PIFA 3IK2A 5A6BD 1PAMA 3VDAA 3L4ZA 1L0PA 2O9OA 1CLVA 1UD4A 3MS8A 2VCCA 1H0GA 3I3DA 4D6IA 1BTCA 4TTGA 3LPFA 4M56A 1V0LA 2GDVA 1EO7A 1Y7VA 2CKRA 2EXOA 1JYVA 1W3JA 2X09A 3SUUA 2QLYA 1V3KA 4OJYA 1VBUA 1QNSA 2UWFA 5BRQA 3WKZA 1TCMA 2W92A 5HNNA 1W1VA 1E1FA 2XGIA 1UA7A 3MO4A 3AS3A 5JBDA 3AHTA 2ZX9A 1E9LA 4HOZA 4W89A 3W26A 1QI5A 3PZUA 3PN8A 1KXVA 3II1A 4GI9A 2VZVA 4U3AA 2VR5A 2IXVA 2XSBA 5CSYA 3VDBA 3VIJA 5BWFA 7CGTA 1WE5A 4OBRA 4BS0A 2X0HA 4DWSC 1R87A 1HP5A 4GO9A 4UQ9A 2E8ZA 1HNYA 5ABFA 3CIVA 4AD0A 4P7QA 3CZGA 3OIHA 4C7GA 1D2KA 2CBJA 1MQRA 4CCEA 1XH1A 1UA3A 1KWGA 5DF0A 3GTNA 2EJ1A 3CHEA 4U33A 1BYAA 1E6XM 3MMWA 2WBKA 3AJ7A 1QPKA 3WNNA 1F4HA 1ZBWA 4F79A 2EQDA 1EHAA 2CPUA 3WNLA 2DIEA 2X2YA 4W8LA 1VRXA 2E9BA 4W5UA 2EO7A 4ATLA 4JFVA 1UQYA 2YA0A 3WF3A 4AISA 1MQQA 3T0DA 3AIQA 3PTMA 2GVYA 2EPMX 1HN1A 2YKKA 3M07A 3LPOA 4JFWA 4ATWA 4H8UA 1JIBA 3GXFA 4U5KA 4AZHA 1C93A 3BH4A 1E3XA 1X6LA 4B9YA 4HOWA 1S46A 4CD7A 2ZUWA 3OZPA 3FAXA 4FMVA 3CH9A 1UG6A 3HU7A 5LA1A 3CZJA 1M7XA 1KCKA 2DT3A 1V3HA 2BHUA 3OLGA 1GJWA 3L2LA 2QHAA 3DYMA 3WMBA 4PSRA 3BAXA 2ZOXA 1WP6A 3WBEA 2XTKA 1O7AA 1V3JA 3A6OA 1EO5A 2F2HA 1JFHA 4HZ6A 2AAAA 1OBAA 1UYQA 3GXDA 3W4RA 1QW9A 2BS9A 2WMGA 3ALGA 3UERA 2BHYA 4HZ8A 1MWOA 2ZUVA 1B1YA 1JDDA 4F9JA 3OLIA 2UY2A 3VD3A 5FKYA 2BNJA 3HN3A 1B3XA 1UR9A 2A3AA 1C3FA 5CQ1A 1ZJBA 3PZIA 1W3LA 3WD1A 3BXWA 4M1RA 4CN6A 5BXSA 3WUBA 1G1YA 3RPMA 1UWUA 3K8LA 3HMCA 4OKDA 5BRPA 5JUVA 3MUIA 2JIEA 1XYZA 2WPGA 1DEDA 1JI2A 2EPKX 1NWSA 4W7WA 2WKLA 3EBVA 1UZ1A 4F8XA 3N13A 3VNYA 4XB3A 1TR1A 1MXGA 2D0FA 2HISA 1JF6A 3W29A 1ISZA 2YDRA 1H3GA 3ZR6A 1TA3B 1OINA 2G3IA 1GOKA 2DSZA 4J7RA 4F9DA 1HT6A 1AMYA 3AMLA 3O6AA 3FXYA 1FH9A 5M3WA 3N1AA 2CBUA 2G3NA 4PMVA 1CIUA 3L2MA 5CLTA 4AZ6A 1CBGA 3OBAA 4UFJA 1R8LA 3WFZA 3VD4A 3CHDA 1DWFM 1E0WA 1MW1A 1K9EA 2VT0A 1UD3A 2GK1A 2ZICA 3N11A 4X0NA 3BC9A 1Q6GA 1UD2A 4PMQA 3AIRA 1BYCA 2G3MA 3KWXA 4NI3A 1N82A 3ARXA 3ZQ9A 2WHLA 4OIFA 3SUVA 3VD9A 2XJ7A 3AHYA 3SCSA 1OSEA 3MV11 4H7VA 1RD6A 2BVDA 4M29A 1ODZA 2YJQA 1MQPA 3AZTA 4FLQA 3OGRA 2XIIA 5EB8A 2E40A 3AHXA 3CUJA 2W67A 1J0IA 4QCEA 4JCLA 4AD1A 1VEOA 2J77A 2Y5EA 1QI4A 4FLRA 1W1TA 1NQ6A 3PTKA 1OGSA 2WYSA 3IAPA 1QOXA 5JIPA 2F8QA 1IT0A 1KQZA 2FH8A 1H1NA 3VGEA 1A47A 1LL7A 3ZSTA 4PN2A 2XGBA 3VM7A 2E8YA 1ISYA 5E70A 3WQ4A 1J11A 1H41A 8CGTA 1JZ8A 1GONA 2DSKA 1E6PA 4TVDA 5AC5A 3UG4A 3G6LA 1BGGA 1BSIA 1XV8A 5A2BA 3BSHA 1W9XA 3I3BA 4AD2A 3WEMA 3M46A 1UR2A 2VNCA 1W3HA 2XPKA 3KL3A 5HXMA 1FFQA 1KXQA 3AZRA 1TUXA 2BY3A 1V3LA 2OWXA 1TVPA 4PTVA 5C71A 3PZVA 1PZ3A 1V6UA 2O9PA 2ZXDA 3VOCA 1XGZA 4PMOA 4PCTA 1XSIA 3VIMA 3EDEA 2QMJA 4ATDA 2XVPA 1WZMA 3QHNA 1QNOA 4JFTA 1LL4A 5HPCA 2WXDM 5FIPA 4C7DA 3FY1A 4M80A 1UKQA 2Y8KA 2YLAA 3ARRA 3PHAA 1BG4A 2XFFA 4Z2KA 3VNZA 4M81A 4V27A 1NWUA 1WDRA 3BCFA 2Y2WA 2ZX7A 4PUEA 1W9UA 3AOFA 4MNLA 2WVTA 5FD0A 1HIZA 2E9LA 3MV01 5EFFA 4B16A 3WF1A 4GQQA 4HA3A 4TVUA 3VIOA 1B3WA 4EANA 1B3YA 4NZCA 1CPUA 4ZE5A 1JYXA 2WWDA 3TOPA 1YHTA 1WZLA 3WQ5A 1UH4A 1W2VA 2WCSA 2WM0A 1BF2A 3MUY1 4EK7A 8A3HA 3WDJA 1EIBA 4CVWA
chains in the Genus database with same CATH superfamily
4Y6GA 4HU4A 1Y5VA 4LYQA 1FUYA 3AUOA 3TQKA 1P0DA 2WMHA 1QI2A 3BMXA 1YXYA 1B30A 4YPJA 2VZTA 3BPWA 4NXSA 5LNRA 2G4JA 1I1WA 3IIZA 1ADSA 4Q33A 4FIQA 6TAAA 4Y2WA 4MZ1A 3G22A 3A4JA 4YYFA 3HM7A 1XG3A 5FJRA 3WDPP 4ACZB 1JVNA 1J18A 1UR1A 3H2EA 3NZ1A 4GUGA 3ZJ8A 3MWAA 3DG6A 4D71A 2I57A 1GVOA 3EMCA 1D3HA 3AXMA 4IGSA 3SY5A 1V8EA 2C14A 2DZXA 1XCWA 1ZU8A 1S2WA 3RGTA 1Y5WA 3VU2A 1TO3A 1FQ0A 2A2IA 3WH5A 2ZXBA 2FFIA 4UZUA 2E6DA 1RQHA 3SCNA 1H7WA 2WC3A 3GU9A 3WUFA 3GM8A 3WF0A 4OUIA 3B8UA 4L80A 5A3HA 1XLGA 4LY8A 3IUHA 2VZUA 1TMHA 3L9CA 1R2RA 5FSEC 3TJ4A 5LHFA 2YXOA 1V08A 1VC4A 4FNUA 4WGHA 1PBGA 1SW3A 4M6PA 1L6WA 1OY0A 3IARA 4H8VA 3WLTA 3RRAA 5E1QA 5I3DA 2V3EA 3P8IA 2J8TA 3SRHA 1HJQA 4Z0SA 3NZQA 2WMFA 3EAUA 3HA1A 1TWSA 3S6DA 3S8HA 4DBWA 1D3CA 5AHMA 5JH1A 5IM51 1BLIA 1FCUA 2OB3A 2J6VA 1XSKA 2INFA 3FHAA 3K13A 1R38A 1Z32X 1XLLA 3FGCB 3C0JA 1TMLA 4GIAA 1W17A 3TTSA 2PBOA 4PEEA 3JZUA 2PDPA 1XUZA 1E9YB 2XH0A 4GC4A 1KM4A 4GZEA 3WN6A 3SUSA 1HJXA 2CZDA 2WHMA 2Y4SA 5AYIA 5CGTA 3CMFA 1UJQA 2DH3A 3MP5A 3NSXA 1W9DM 1LWIA 1ZP4A 1W3KA 3OVPA 3QFEA 1B3VA 2DQXA 3N2BA 3QHOA 3C2VA 4I7UA 3UWQA 2I5QA 1B9BA 1GOXA 3F1QA 2EPHA 4LNYA 4H04A 3GR4A 3OGVA 4NX0A 2WKGA 1IWBA 2YBTA 4JEJA 1DWAM 1OF8A 2VDHA 3B8DA 3LGGA 4G8TA 4DI8A 4KPLA 4E38A 4HMDA 2OELA 4MVAA 2V5KA 3IV3A 2W9MA 1YE4A 4A21A 1CGTA 3S2CA 5MKGB 1LQAA 2ZRVA 3U3HA 3GO2A 3W88A 2PI6A 3JZEA 1OZQA 2RGMA 3MMDA 3NNTA 4NYUA 4YVXA 4Q7NA 2PDXA 2J75A 1M41A 1X1OA 1IQ8A 2BTMA 1XBXA 3BE7A 1CXIA 5BCAA 3N9RA 3MC5A 4PH6A 3B04A 4TX9A 4B5XA 4RDZA 1FXPA 2GPTA 4PUMA 4QE1A 4XZ9A 2W5FA 4W8BA 4QJ4B 1G4PA 1UC5A 4B90A 4PCNA 3UWUA 1XDLA 3W7QA 2AL2B 4HOXA 2BMBA 3H2OA 3WENA 4Q8MA 4HJFA 4U28A 4FNSA 1RCOB 4W8AA 1HO1A 3WLLA 1YBQA 3RAOA 3M0YA 2I16A 3SCWA 4CVUA 2L5HA 4N02A 3ANYA 4MY1A 5C2CA 3UGVA 4DLFA 2FHBA 4I9JA 2V2CA 1OK6A 1W1PA 4LW7A 5AC6A 1XLBA 3W9ZA 2Y8VA 2FIQA 1ICPA 1HP4A 3AYSA 5HWNA 4Y8FA 1XFCA 3C0SA 2WHJA 4LV4A 2DEPA 2E6YA 5TNVA 1LUCA 1UD8A 4LVDA 3KLLA 2XYLA 5GNZA 4GA8A 1DBTA 4W7VA 2ZQ0A 2ABAA 3PZ9A 2JIWA 1MVYA 4IX2A 2VCBA 5KZMA 1QW7A 5EPDA 3SCUA 1W3IA 2GDQA 3KS6A 1JZ6A 2DVUA 4UNKA 6ALDA 1VFUA 4CN4A 3A5FA 3EB2A 1TWWA 1VAHA 1XSJA 3APGA 1VFSA 2GVLA 4PL1A 4Q32A 2UY4A 5K3VA 3C3NA 5C70A 1VCVA 4I8YA 1Q2RA 1CLKA 4E8GA 2ZRUA 1Q8AA 1BKSA 4FS9A 4WDWA 1M7PA 1CW2A 2RDUA 3VXGA 3B40A 2J25A 2RGLA 3TAOA 4Z2LA 1PTAA 5J5RA 1RV8A 4AY1A 3UR5A 3WH6A 5DELA 3A9BA 5C7HA 3GZAA 3IIXA 4G5DA 5C55A 1O66A 3KDNA 1BQCA 3A4XA 4DZIA 1JF5A 1NFBA 2AGKA 3KFTA 5CZSA 4KCVA 3RCNA 2J79A 3VZZA 2YIHA 1W54A 2ZZ3A 4J3ZA 2EG6A 2OWWA 1UMLA 4D8AA 4LEQA 3AMCA 3FXGA 1ZS2A 2GJRA 2WZTA 4NSBA 3UWEA 3ES8A 1AQMA 3KOWA 3RILA 3DKJA 4LAOA 2WZHA 1YW1A 3W2UA 1UOZA 3AS1A 1LOSA 3W81A 1SM9A 1EX1A 3DFSA 4GQ0A 4YIWA 3T0BA 2G50A 4MIMA 4LJ3A 1J5SA 4A3HA 4B91A 3EMQA 5HUOA 2ANUA 1DIOA 1VBGA 2DH2A 2DZBA 1PDZA 3DYPA 4GOAA 5H1WA 4R27A 1LRQA 1I2OA 2J7BA 2HBVA 2YL9A 1UJPA 3M5YA 1ZGDA 5D8WA 3IIOA 3PF3A 2BY0A 3SAZA 1QUMA 3ZR5A 3AXXA 1YDYA 3WLQA 3GC4A 3UESA 2MANA 4ZOCA 4WY0B 2HE8A 1NM9A 3M4HA 3MUAA 3T42A 4GQBA 3DECA 1BAGA 2P3ZA 1K03A 3ITLA 4GVGA 4IIEA 3C5QA 1IEIA 3RM9A 2VOTA 2V3DA 4NQ1A 1R5YA 3TXZA 2BGQA 1UCWA 4QDMA 2PAJA 4MYXA 1B9ZA 5TD4A 1WKFA 2NUWA 3LCFA 4RDVA 1U5JA 5EMMA 3DFOA 1I2RA 2V8ZA 1POJA 4NZ4A 1DYSA 1GQLA 3CUIA 4IISA 5G4HC 4ROPA 1N8WA 4MYAA 3R58A 3GNPA 3U9IA 4UR9A 4ZMGA 1KRBC 4HVXA 3N9KA 3O8AA 4PMNA 1GZ1A 3GHSA 4AIUA 4X2PA 3RLVA 1A5NC 1QK2A 2BWGA 1NARA 2VX6A 2VR4A 1HQTA 4OOZA 1IHIA 1XBVA 1OABA 1EOMA 4QS6A 4S1FA 4G1KA 2O9RA 1BYDA 4QG6A 2TSYA 2QMKA 2FDSA 3URAA 5HNTA 2JGQA 4TVCA 1G01A 3LCGA 1QPRA 3G1SA 3GUGA 5HNUA 1WBHA 1QBAA 1KTNA 3GNNA 5CGMA 4ZB2A 3NQEA 1JNEA 2X2GA 5CPTA 1JUBA 1GNXA 1TV2A 2E5BA 3F5JA 4B5SA 4HU0A 3M0LA 2QCEA 3W1MA 1QO2A 1HJSA 3O16A 4YJ5A 5B80A 2GQ9A 2Z00A 4HN4A 4GFIA 1A3WA 2V9DA 3BV4A 5IXEA 1BWVA 4GYKA 3M7WA 2D3NA 4Q6JA 1R47A 2PC8A 3AMGA 2DSUA 3BSMA 2I5IA 1E0VA 4QR6A 1FHDA 4RX0A 3K4WA 2P10A 4V1YA 1TPDA 3FJNA 4H9ZA 4R9XA 1L8NA 5U7SA 1WKDA 2NWRA 2XIJA 3NOYA 4YCPA 4O52A 4AD3A 1S2UA 1G4SA 4DAIA 2QJJA 5FOOA 4QIUA 4PYSA 2QF8A 3BTNA 1B3ZA 1EDTA 2BOEX 1TVNA 4PSPA 3TSBA 5E09A 2BXYA 1E4MM 3LCIA 4Q22A 1V7AA 4BQ5A 1E3ZA 2SFPA 4NU7A 3N2MA 4AIEA 2OVLA 3N14A 3EOLA 4JHZA 1A50A 1WA3A 3VUSA 2YL5A 2RKXA 2EKGA 1LORA 1FDYA 1K70A 4PUUA 3TMLA 2PRHA 3W7HA 4IH3A 1DL3A 4UB9A 1U33A 1J79A 3ELFA 1CTNA 2GUUA 3ES7A 1JGIA 4FXJA 4NG3A 4AZCA 4F40A 4I6VA 3WBXA 4GNJA 1JGMA 2V82A 1LLZA 4MUPA 4O1FA 2GUYA 5IFTA 4LAZA 2GUBA 3GWQA 4GKTA 1JDEA 3MY9A 3NPVA 1OIMA 3ZT6A 1CECA 1HUVA 1W5PA 5CZ0A 3P67A 3SY8A 3VX0A 3W02A 1I2QA 3G1HA 4Y8EA 4BF9A 3A3HA 1EHNA 4TV6A 1WPCA 3W84A 4N2YA 4F0RA 2G3JA 3Q67A 3RJYA 3W22A 3FV9A 3EX6A 4MAVA 4ZOEA 2F7FA 1TZ7A 4C1KA 1K77A 1NJJA 3GW3A 3ZO9A 3PM6A 3RF9A 1AJ0A 2NV2A 1TPFA 3SI9A 3NO3A 1LG2A 3BZGA 3MTWA 3HGRA 4BR1A 1ZL1A 1IGWA 3IJ6A 2BBFA 1UR4A 2XVKA 4L4PA 1GVIA 2XVGA 1DWGM 3IJ8A 3SUTA 1V6XA 3G8EA 3F4VA 2FMNA 4JBRA 2FPYA 3TW9A 1U1HA 1AQHA 4RE0A 4PTWA 1V93A 3RLGA 3OZMA 3VD7A 1VBJA 1NEYA 3QYQA 1AVAA 1FFRA 2D2OA 1Q2SA 3F4DA 2ZADA 3P93A 1KXTA 1E9IA 3N12A 4Y9PA 3C2EA 4AZGA 4MWAB 3VCRA 2ZE0A 4HHHA 1GZGA 3TV8A 5D37A 2DUAA 3M5VA 5A8PA 1OYBA 2DGAA 3HPSA 4ZO6A 4DJFA 1P6BA 3LCXA 3JVAA 3NZPA 3VDCA 3B03A 2NT1A 1XC4A 1B3OA 3EOSA 3UPMA 4HK5A 4CNPA 4BF7A 5C2GA 4H8NA 3TROA 1E6SM 2OX4A 4L4OA 5BROA 2ACSA 4C6LA 4C6BA 1W37A 2GSEA 2NSXA 3ARVA 4IMGA 4ERGA 1NQKA 2HV5A 1ZSXA 4O16A 3QV7A 4XX6A 5D2XA 4Z2HA 1A5UA 5EMLA 4DF1A 1GKPA 3TYCA 3NL3A 5I3KA 4Y7EA 2NSOA 4GY1A 3V36A 4FXRA 4E5TA 4Y9MA 2WCAA 3APTA 4JY9A 3GS6A 3T2QA 3HFYA 1Q7MA 1P5BA 2BVTA 3AXKA 1Q7ZA 4GX8A 4L9YA 1V0MA 2VEGA 4WDXA 4D8ZA 3SQLA 5K7JA 3O06A 2YBVA 2RUSA 4C1NB 1JCLA 4UIOA 1DIEA 4JOMA 3LXBA 4AB4A 1X39A 2V2DA 3MUZ1 1YQ2A 4EXBA 2YDQA 3UVIA 4H9MA 1H61A 2XFRA 2PBGA 2OX1A 3PTQA 4LUJA 2A7PA 3U4AA 2NLYA 2PWDA 4K68A 2E9MA 3BJTA 3MI6A 4QFUA 1UZDA 1DTUA 4YYCA 4Z42C 3U7VA 1TV4A 2I9EA 3W76A 4AUBA 2C71A 4TV5A 2XHYA 1I4NA 4MWAC 5A69A 5I79A 2F6KA 1FHLA 4C6CA 2Y0FA 4C60A 4PTMA 4PULA 1CWYA 1V3IA 3NQDA 4K7VA 1VHNA 3N2CA 4OOUA 5D4YA 4GQRA 1H5YA 3BICA 4YNGA 1KRAC 1YDVA 2OOGA 4MG4A 2E1DA 3MI2A 1GWJA 3NSNA 5HR6A 3AS2A 1VENA 1J93A 3RN6A 4RUBA 3ZM8A 3ZT7A 3W72A 4H41A 1AJZA 1B57A 1QI0A 4AX6A 4FNQA 1ZENA 2HMCA 2CU0A 4DM1A 1ELSA 2PLMA 1FWCC 3QC3A 2OGJA 2XZ7A 3NYZA 3T4CA 5A6SA 4HSNA 4IIHA 3I6EA 3ZXWA 1R7AA 1K8YA 3CS2A 1C8QA 4WY0F 5D38A 3RHGA 5GPRA 3DGBA 1WDPA 1VS1A 3T0TA 3GKAA 5ECUA 4AEEA 1PO9A 3QV8A 5HUPA 2Y7GA 4C7FA 4AMAA 2VENA 1HO4A 3ME3A 1OCNA 4KIRA 4DO4A 3V5OA 5DCBA 1W2PA 3QY8A 3ARTA 5A6JA 1OQFA 1FHVA 3TW6A 4GG9A 2WC4A 4JX5A 2XIMA 2Z24A 3F5LA 3N9SA 4US5D 3S1GA 3GFXA 1XX1A 2NX3A 1E6QM 1VFHA 1DPMA 3RIKA 3CLMA 1XW8A 1XPGA 3V3WA 1P7TA 4QG9A 3W85A 2QUVA 1MFUA 1PX4A 1D3GA 1F5ZA 2ISSA 4UFMA 4UMBA 2DVTA 4UBPC 4DJDA 4WR3A 5TQLA 4MMWA 6XIMA 1BWKA 4FB7A 1HL8A 3KCJA 4Z2GA 4XAGA 2X1TA 1UQZA 3ARYA 3GIYA 3WJYA 1LT7A 1DJNA 3LRKA 4S2CA 2NXHA 3G1XA 3GXIA 3UWWA 4A3YA 1ONXA 1EPVA 2IUZA 4JN7A 4XAPA 4M51A 4D6GA 3KOXA 1JPHA 1LQ0A 4WSJA 3QEZA 1YTEA 1HW6A 1BYBA 2QVHA 5D9PA 4D2JA 4Z1CA 3U5YA 1CXHA 4JIRA 2DZVA 3GDBA 2QCDA 4XAZA 1DQUA 4O14A 3W87A 1EDQA 3CPGA 1BRLA 3VYLA 4B3LA 3KCLA 2UY3A 1I9CB 2J66A 5CPLA 3TH6A 1YKWA 2ZXQA 1F76A 3UG8A 1U5HA 1JR1A 2BX7A 3H12A 1NP2A 3WDQA 4CNNA 2C19A 2EG7A 4WX2A 3WH8A 4J40A 3G18A 1IT7A 3CYVA 1FY6A 4K38A 1XRTA 4AIOA 1FWHC 3GVGA 4BQ3A 2XH4A 1O60A 3TN5A 1JNDA 2AOSA 4HNUA 4H6QA 1X1NA 5D04C 4YTUA 5AZ1A 4DAFA 1PTGA 4S23A 4GHRA 3VOFA 3GH5A 5DFAA 3VMNA 4C6NA 4DQWA 2TPSA 4Z1BA 3LLFA 3CIWA 4B9ZA 1CZ1A 4DWSB 3W3OA 2GZXA 1J0YA 4LUSA 5D2WA 3FKKA 1CB2A 3EWCA 4L56A 1I2NA 5T91A 2QPXA 4M24A 3AIUA 2V6AA 3GNRA 3PAJA 2H8XA 4ZXLA 3MCNA 2X7WA 2FLIA 4V15A 1J6OA 3CH0A 3W24A 3MCMA 1EF3A 4PC8A 3OHIA 3BK0A 1BF6A 2V5CA 3ECQA 1T6MA 3QR1A 2PF0A 5A8OA 4N9DA 3NTYA 3ANUA 3SCOA 2VZSA 2O56A 4N6EA 2PEVA 4EWJA 3PR2A 4HHLA 2GGJA 2GVGA 2A6NA 1EYWA 4B5NA 3LZ5A 2EJAA 1SJBA 2NT0A 4OT7A 2VURA 2PC4A 1EA9C 4PBEA 2YA1A 1K8CA 2ZZ4A 4ZENA 1CGYA 1DHPA 4QRNA 3ERPA 4I5UA 2D23A 1G4TA 1GVRA 7PTDA 1A4MA 1CT5A 3PZOA 1C8VA 3PPGA 1K8XA 2ODOA 3IVTA 3CHVA 3ZIZA 1IYXA 1V02E 1E0TA 4ZQMA 1OC7A 3WH9A 3R1ZA 4DVOA 4GBUA 4K8GA 5PTDA 4WVXA 2VCCA 5LGXA 2HPIA 3OBKA 4PRRA 4TTGA 2Y85A 3RXZA 2GDVA 4JGDA 3V0TA 1Y7VA 3QPZA 1W3JA 3TYAA 1VBHA 1V3KA 1W8SA 4KKXA 3E5PA 4BI6A 3ENLA 2W92A 1T99A 3NG3A 5LIUX 1E1FA 2YB4A 3MO4A 3AHTA 4F2BA 2YCLB 1SZNA 2PLCA 3SN1A 2BSLA 2Z4GA 4FIRA 1L6YA 5U4NA 2VZVA 4X61A 2VR5A 2XSBA 5EU9A 1ZLPA 2QUMA 5BWFA 7CGTA 4XSLA 4JTKA 4DWSC 3B0VC 1X8FA 4GNKB 2CZ5A 4UQ9A 1KBJA 4C6OA 1HNYA 1Q13A 1XCFA 3HURA 3CIVA 2IQ0A 3NEHA 3DC8A 4P7QA 2PTYA 3CZGA 2YPIA 4E4UA 1D2KA 5G4EA 3UR2A 3KCOA 4LS1A 4GI4A 5DF0A 1BSLA 3LHYA 3MB9A 3MW7A 1UUOA 1E6XM 1TV5A 1XBZA 4BEQA 2EQDA 2J24A 2CPUA 4LUTB 2X2YA 4W8LA 1M9HA 1XRSA 3IVSA 1R3YA 4HNVA 5DMLA 1UQYA 2YA0A 3WLSA 1E9ZB 4G56A 4LT9A 3AIQA 1XYBA 2YKKA 4JFWA 1R3WA 4H8UA 4MWAD 3YPIA 1C9WA 2XH2A 4FSAA 1OFBA 4XZIA 4B9YA 4HOWA 1TJPA 1IT8A 1Z44A 1U22A 2IKGA 4O8RA 1UC4A 3L21A 3OZPA 2FTWA 3STEA 3KRZA 5LA1A 1M7XA 4XIMA 4HYWA 1V6TA 5REQA 4NAFA 1GJWA 3E96A 4PSRA 3PVFA 4WQ6A 5RUBA 2A4AA 5HQEA 3EA1A 3WK1A 3USBA 3GG8A 3MSYA 2V69A 1TRDA 4S3DA 2AAAA 1UYQA 3M5XA 1QW9A 4MPQA 1R0MA 1IR1A 2NUXA 1ZCOA 3ALGA 4K6AA 1TQXA 3G3MA 1MWOA 4GABA 2ZUVA 1TIMA 1JDDA 3RFAA 1EGVA 5E0KA 2Z27A 4N4QA 5FKYA 3ABQA 4ICCX 1UR9A 1MDLA 2A3AA 3ABOA 1C3FA 5CQ1A 1ZJBA 3F7JA 1S3TC 3OEXA 4Q8PA 1W3LA 3AALA 3PS7A 3U6WA 3GHUA 1UWUA 5BRPA 5JUVA 3MUIA 1RK5A 2CLOA 3LTPA 3MCOA 2WM1A 2EPKX 1NIUA 1XLFA 2WKLA 4F8XA 3N13A 4NUWA 3VNYA 2QJNA 3QF0A 2D0FA 5I03A 2OT0A 3DG7A 2YDRA 1KM2A 4XO6A 3TW7A 4HTBA 4KF1A 4PE8A 5DCEA 3AMLA 4JX4A 3UWVA 4ZFCA 4FALA 3H55A 3FXYA 2A5HA 3WYZA 3TEVA 5M3WA 3N1AA 1BVWA 1L2UA 1IXOA 1CIUA 3OBAA 1EUNA 3WFZA 3VD4A 1DWFM 3AO0A 5CGQA 2IPGA 1K9EA 2VT0A 2Q8LA 3IIPA 4QQ3A 1FDZA 2HNHA 3PWAA 4IPIA 3WQPA 3ARXA 4GX9A 4OIFA 5AHNA 3SUVA 1XIBA 3MSRA 1GVFA 4KQNA 3LXCA 5I3HA 3T05A 2YJQA 1MQPA 1XKJA 3AZTA 3OGRA 3LHWA 3B9OA 2E40A 3V0SA 2W67A 3NL5A 3MHFA 1A5SA 1XF0A 2J77A 2ISDA 1QI4A 3BG5A 3ZVIA 2O55A 3P61A 4OQVA 2WYSA 1MEHA 3BLDA 1QOXA 5JIPA 2FZDA 2F8QA 1VP5A 1IT0A 2RAGA 1KQZA 2ALRA 3WLHA 1LL7A 4HPXA 4PN2A 2XGBA 1ISYA 1H41A 1JZ8A 1GONA 1E6PA 1SJCA 3UG4A 1S38A 3PJTA 4NVTA 2OEMA 1GYMA 1XV8A 4LCRA 2YXXA 4JTGA 3RR4A 5DRCA 5HXMA 3KL3A 3JRKA 2J88A 6REQB 1HGYA 4N9EA 4NNAA 4I9MA 1TUXA 1DQXA 1V3LA 1EF2A 3UCCA 1V6UA 2O9PA 1W5OA 1AW5A 3RUBL 4C5ZA 3EDEA 2QMJA 3AC0A 1ECQA 3TWBA 2F2KA 4JFTA 1D8WA 3EXSA 3F2DA 1TTPA 1OCBA 4LAUA 4M80A 2Q01A 2Y8KA 1BG4A 1NSJA 3L0KA 4JYEA 4NY2A 1UB3A 1MSSA 1FWDC 1ZAHA 1W9UA 3OVQA 7REQB 5KETA 2E9LA 3L67A 5EFFA 5K9CA 4GNVA 4LVFA 1EWEA 3DOPA 5FF0A 1WXJA 4CNTA 1UP3A 2E7FA 4EANA 1IWPA 1FCBA 1B3YA 3U8GA 1PE1A 3HGSA 1RHCA 1YHTA 2XZ9A 3CU2A 5I02A 4EVZA 2WCSA 2WM0A 4UTTC 4EK7A 3KTXA 4QG8A 2E67A 4B2DD 1ZCCA 3W27A 3W73A 3F2BA 3K1GA 1DJQA 1SFJA 1EFZA 2DW6A 4GVFA 1EOKA 3SN4A 1X96A 1DHKA 4JQ1A 4N4PA 1H63A 1EXBA 4ERIA 4W93A 3I68A 4I3GA 4H9VA 3R0DA 3AROA 1WAWA 2GWNA 3PBUA 5B7ZA 4LVAA 4QE5A 2C8NA 3BLKA 1PPIA 4C6KA 1ISWA 5I23A 1UR0A 4UFLA 3M0ZA 3BOLA 1RY0A 4K39A 1GW9A 2OSWA 2ZFAA 4O0ZA 1PHQA 3VGBA 2Y8UA 5I77A 1TUFA 1DJYA 3P0XA 3NQ7A 3WJSA 4H3DA 4PMDA 4QDWA 1KBBA 1CX9A 2YX0A 3DFHA 2OYLA 4S3EA 3SECA 4A8LA 3OPSA 4RL3A 5FF3A 1AL8A 4LU0A 4AZ7A 3L66A 3W38A 2CBVA 4GQGA 5J5DA 5BU9A 4W5ZA 3N2OA 2XIQA 2W3ZA 1UR8A 1EJXC 4G2DA 1N8FA 2WSPA 3TFCA 2WNQA 3DHFA 1KKOA 4MAZA 1Q85A 4F0LA 3QW4B 4HP5A 3NFUA 2R91A 4DWSD 1QOPA 4OBTA 2FTPA 4EXAA 3VO0A 1RK6A 2PA6A 4B15A 4X9SA 3O05A 1VYRA 1GG0A 3MU7A 4V28A 1TPWA 2XIOA 4RW5A 1ALDA 3WMSA 4MJZA 3D3FA 3TWAA 4E4PA 1LT8A 1K6AA 5KTLA 1XIIA 2CLKA 4KCWA 2PDHA 1EH9A 3USZA 1W3TA 2VX7A 1SZFA 4J3SA 1Y5XA 3DAQA 1KFEA 1KLYA 4P7NA 2P3EA 1R30A 4HU3A 3R43A 2VEFA 3M43A 5J04A 4L6DA 4YTRA 1DJWA 2ISWA 3TA6A 2OLHA 2W4XA 2DUZA 4O0KA 2WPBA 1RALA 1VR6A 2VVSA 4REQB 1ONRA 3TCSA 4LRTA 5FACA 4C1LA 4MLJA 3VKKA 4N0RA 3AS0A 1J01A 4AWSA 3WD0A 3TR2A 4HMEA 3N3MA 2EBNA 5BXPA 3N18A 5KSWA 3MKCA 2I56A 4ZE4A 1ITCA 1E4NA 4NZFA 1H60A 1W56A 3LTYA 3CV7A 2QZRA 5FEWA 4RNJA 3AJXA 3WBWA 1W9PA 1PX8A 1DJXA 1VFMA 2ZUTA 2QDGA 2PDIA 4IQDA 3ONCA 4WRHA 2PUZA 2E28A 3AZSA 5JU6A 2VUNA 1US2A 2PDLA 4KWWA 1T8XA 3CPUA 4YN5A 3Q4DA 4D8LA 4H6KA 3CUFA 3MSDA 4RJEA 2HEJA 1AH4A 1JUKA 3SW6A 3ZWTA 1HKJA 2WK2A 2JK2A 2ZRZA 3B05A 3LBOA 3FVDA 3RG6A 3H23A 3CL7A 2P5NA 4HCLA 1YNPA 1HL2A 2DFAA 4BK9A 4DUVA 1KFWA 3DFNA 3CUXA 3Q94A 3W6MA 3P62A 3W74A 1L8PA 4IM4A 1FWGC 3STGA 4AVFA 2Y88A 2OZTA 3O9NA 3GK0A 2Y63A 1UOKA 2IQTA 4P8UA 1R7OA 3MYOA 3PZNA 4GH1A 4MY8A 3HIJA 2ICSA 3CWNA 4JL2A 2HTMA 2BXVA 3VNKA 2UZ9A 5K2ZA 3L4UA 3IACA 1JPKA 1K6WA 2QUTA 1KFJA 3NM1A 3THAA 3BZJA 3EPOA 4N7QA 5CBIA 2O0TA 3KVKA 2GDUA 4W86A 2W79A 3M0MA 4C6FA 1QTWA 4HT3A 3G6MA 5XIMA 2CBIA 2ZTJA 3OG2A 4L5ZA 1MW0A 1ONEA 4TTUA 3K8KA 3RO8A 2J62A 5BMXA 3SEPA 1B4EA 5HBFA 4UMCA 2R1KA 4MFDA 2CCRA 3LV5A 3THUA 5D33A 4YTQA 3RM4A 4TQTA 3BUVA 3B97A 1VPXA 1KC7A 1JD7A 4CEUC 3VOJA 3FDGA 3KOYA 7A3HA 2BGNE 3I6RA 2VL4A 1CYGA 3BWWA 1OC6A 1MFVA 4ZQCA 2KX9A 4O0QA 3N6JA 2XSAA 3NPUA 5A95A 1TA3A 1V0NA 1P0KA 2XFWA 4BF5A 3CIXA 3HPFA 2WMJA 2PSNA 3EXRA 2YGYA 5DBUA 1E15A 1Q8JA 2F9RA 1SUXA 4H7CA 1KD0A 4AWEA 2C0AA 3G1FA 4CD4A 1O94A 3S1UA 4YXGA 1UW9A 2EPNA 2CYGA 4HSHA 3EB3A 3P3BA 1J2BA 1J6PA 3U48A 2ZZ2A 3UG5A 3GBEA 2H9AA 3WLNA 3IUDA 3M9YA 5EMJA 4MNKA 1NF7A 3U57A 4G7EA 1W1ZA 4INFA 4ZSTA 1AG1O 1PKMA 5HNRA 3ITYA 3WLMA 3FEMA 4RW3A 1TPC1 1ITUA 1WZKA 4QROA 2BXZA 1EGMA 4XZLX 3PBVA 3SCTA 5EA9A 2E3ZA 1CI1A 3TZNA 3UT0A 1TYGA 3DI1A 4YWSA 3CAQA 1ZHAA 3MUCA 2A3HA 4TR9A 3D3AA 1HJVA 1IZKA 3VCNA 1RD5A 1W31A 1F3TA 3I3EA 2CESA 3WSUA 3BAKA 1REQA 3SGZA 1GTHA 2IKHA 2BVYA 3ZLGA 2HPMA 4GXPA 3DGRA 3PAOA 1E72M 4IHCA 4MDOA 1XLKA 1YPFA 4ZA0A 1O1HA 3CQKA 2X1SA 2PDFA 5CCZA 1RCQA 1W6TA 3GG7A 4AYGA 3AIBA 3W1PA 4MNJA 3PANA 3CNYA 1VQTA 3P60A 2GQ8A 5AVHA 2I14A 3PNUA 2FB2A 2ZKMX 1TWIA 3QFWA 1BXNA 5GNXA 4FNPA 1O1ZA 2PWHA 2PS2A 3LENA 4LYRA 1F3WA 4AVOA 3GW0A 1A80A 4MLRA 1FDJA 3UQNA 1XIEA 4AMCA 4RCXA 1VJZA 4PTXA 9CGTA 2XSXA 1C9DA 3VGGA 4U10A 3PPCA 2D22A 4CU7A 1VFLA 1J12A 4IQLA 2VR2A 1LROA 3E49A 3URNA 3O63A 2PDQA 4L1XA 4JTDA 2WSQA 4NP7A 3K5XA 3LZ3A 3UZWA 1GHSA 1OWQA 4AXNA 5J8LA 1PJ9A 4J3XA 1HVQA 4M19A 9XIMA 2X05A 4H9TA 1YXCA 5I3FA 1VRDA 3TXVA 1PEZA 3SUWA 1QPOA 3ZJ6A 4QEEA 1DVJA 1DKWA 2XDFA 3I4EA 4KWSA 4XZWA 1GUVA 1PZ0A 2GL5A 1OEPA 3G2GA 1ZP3A 2OO6A 3PFMA 2CZVA 2OQYA 1ZJIA 4C91A 3R8RA 3BW4A 1FWTA 4WDUA 4AZIA 3U2ZA 4FP1A 3VX1A 2XG9A 3LCLA 4IP5A 1W9VA 3GZ3A 3QR3A 3G1DA 1H09A 1LF1A 4ACZA 5K9DA 4JTTA 4ORMA 5DXYA 1TPB1 3IJDA 3IAQA 1R2TA 2Z1KA 3WNKA 3ATZA 1XS2A 4JTCA 4MPKA 1OF6A 3VFLA 4WGXA 2RJHA 2Z2BA 1TZ9A 3EWDA 4EXQA 2DZSA 3BLPX 1GJUA 4Q3MA 3GXNA 3UZZA 2FB3A 3OHMB 2XVLA 1GG1A 3TTOA 4J28A 1E55A 2PWFA 1PZ1A 3PWGA 1YLVA 1DWHM 1QNPA 2PDBA 2AMGA 4V1XA 2OQLA 3W7OA 1GZJA 1V02A 1DIDA 1E43A 2J4GA 3NQ8A 5H8UA 4UOJA 3O07A 3BQ6A 5GQBA 2NVAA 1QPQA 3PUDA 5LA2A 2X1IA 1KCXA 3RM8A 3V0UA 1LL6A 3TFXA 3GDTA 2WZMA 3KLKA 2WJZA 3OZYA 3BGJA 1LWHA 2Z1WA 1BXBA 1V03A 4XZBA 3C0LA 4CN1A 2RDWA 3PBYA 4CCDA 4Q8WA 3QKEA 1G7UA 4R88A 1BHGA 3S6TA 4M6UA 4HZMA 5FJTA 3EKLA 3EWYA 3CLWA 1JEZA 1GPWA 3CBWA 1KRMA 1I60A 4XD5A 3CYJA 4AEOA 2ZA1A 3N19B 4GACA 5M03A 3BMWA 1JQVA 3TP4A 3VIKA 3B9EA 3N4AA 3G1VA 4H01A 3QBUA 1KM3A 3FGCA 4NILA 3OZOA 3K8MA 2P53A 4GZIA 3L65A 4RE2A 3VNIA 3STCA 1R3QA 3BOXA 3G1YA 1H11A 1Z48A 1X98A 3H2NA 3M44A 1Q66A 3QV6A 3WFAA 3LUTA 1RXOB 2CZFA 3UWZA 4DXKA 1HKVA 1C91A 3KVMA 3EWUA 9RUBA 1C7SA 3ZMRA 4DX3A 2HBXA 2HROA 2PRLA 2KAUC 1WCGA 2IS7A 1PHWA 2B31A 3G1AA 2W6RA 5E6ZA 3QHMA 2OTDA 3I6TA 4O4VA 1PCWA 4ZSUA 2R6OA 1S5VA 4M3PA 1UKOA 3CZ8A 3FA3A 3MKVA 2FHFA 3LRLA 3RLHA 1CNVA 3ARQA 3EXTA 3WQVA 3NQGA 4OE7A 1JI1A 3FKRA 2CHOA 5CJ5A 1UH2A 4AHOA 2PZ0A 4HK7A 1X6UA 1EWDA 1VCFA 3BLOA 5MKGA 1YRRA 3NVTA 3HQ1A 3TONA 3KVLA 5LNWA 1JZ4A 3HQNA 4HNCA 3CUGA 1DE5A 3PUGA 2OKOA 1MUMA 3LPGA 1AW1A 1ISXA 4WOQA 2J8FA 2XINA 3DHUA 1SQ7A 4IGMA 4LPCA 1MZRA 1QJWA 2EG8A 1MW2A 2QIWA 2X0YA 4ORIA 3PWIA 3CV1A 2FZ8A 3QW3A 3W7MA 3DHPA 4A3RA 5JH2A 5AYBA 3T44A 1QASA 3A47A 1K02A 2YLLA 4N6FA 2QCCA 1TQJA 4V2XA 2P8CA 4JTJA 3SFKA 4PB3A 1FXQA 2AL2A 3A24A 3CZLA 3GLCA 2CLMA 4GRSA 5A94A 1Q6QA 1L2QA 2VFEA 3WF4A 4BCEA 1KM5A 4MY9A 5C0QA 1UHVA 3GD6A 3PBWA 4HA1A 4C5YA 4Z2IA 4FPSA 1R3RA 2EPLX 4RZ5A 3IGXA 4B5TA 2WSRA 4WOZA 3DFQA 3W75A 3UP8A 1QHZA 1WYIA 2QGHA 3GU2A 3PZMA 1MO0A 3PBGA 1SO4A 1DIKA 2XWEA 4YLWA 1RSCA 1Q4NX 3VGDA 4FA3A 5CLWA 5FF2A 3SCPA 1MRAA 3C8NA 3NIYA 5DEZA 1WO2A 1E0XA 3PZTA 4DBEA 5D02A 3CO8A 2D73A 2Z29A 1C8YA 5CG0A 1GVYA 1CXLA 1ICQA 3OJGA 4R3UA 3U2EA 2XIBA 4AFYA 1NWTA 4EIVA 1ESWA 1TPEA 4PMXA 2QDEA 3DXIA 2F38A 7ENLA 5CAKA 1Q6DA 3A22A 2Z1VA 3AYRA 1TJ2A 2J7HA 4MM1A 5BRBA 3NUKA 3LTSA 2IKIA 1FCQA 1XQKA 1DQWA 5JMUA 4YVPA 4FZIA 1RLDA 4WJXA 3HTWA 3JU2A 4GGBA 3CHFA 3GVQA 1QATA 4C6MA 2G41A 4L6HA 5AC7A 2BOGX 4S3AA 5D03A 1TX2A 2NVDA 3SRKA 2ZVIA 1RP9A 3CHCA 2XM1A 3ARZA 4Q4OA 2CNCA 3TTYA 3EPMA 1OYCA 4HGXA 2CFFA 3OGSA 2CLEA 6A3HA 3HG5A 1EZ2A 2J47A 2Q3OA 2C1GA 1EJVC 1KFBA 7XIMA 2DT0A 2GK1B 2OO0A 2REQB 4Z1YA 4A2RA 1RJRA 1S1PA 2FH6A 2QPUA 3C3UA 5K9XA 5LNUA 1W91A 3GTIA 3TC6A 1R9XA 4AXKA 4GUHA 2VFHA 4Y9OA 3WK3A 1K8ZA 3TLLA 3K4DA 4UTWC 2OYKA 3E6EA 4US5A 3OTRA 1ZAIA 4I9TA 1K9TA 1NH6A 3UCDA 3WD4A 3ITVA 3WMLA 4GVHA 4JNZA 1YTKA 3RRXA 4IF2A 5K4XA 5HA7A 1XI3A 4DNHA 1UKSA 4RNFA 2EHHA 3UBPC 5CJNA 5D9OA 2WCGA 4XBSA 3T08A 1EXPA 3GVRA 4P8WA 2G8ZA 4HPJA 3GVWA 3OG3A 4WY0A 2OR2A 3W7LA 2O92A 2OCZA 4O15A 4HB7A 3U2CA 1TWZA 4D1JA 3CC1A 4JNYA 4PCFA 4JCMA 5LIKX 4DY1A 1KR0A 3D6NA 4GYJA 3KRSA 5LXEA 1FP8A 4L65A 2OSYA 3PPFA 2C91A 1UWSA 1QO5A 2FGZA 4XAYA 2CZEA 1K7EA 3ARWA 4JTAA 3D46A 3K1DA 1TPUA 1PKNA 4KEVA 2QNEA 1QNQA 2FHCA 3UETA 3HJEA 4KRTA 3VI2A 3FIGA 4DO5A 2OOFA 4WDTA 2DU2A 5HOSA 4K37A 2GGGA 2R82A 4NRSA 5FAGA 4XUYA 3KUMA 5AB3A 1ZJHA 3ABRA 1FOBA 2WQPA 3HG3A 3WLKX 1NAL1 3N4FA 1CCWB 2ZX5A 5D2VA 1W9BM 4PB4A 1JJKA 4HU8A 1A3HA 1GKRA 3FFSA 3TR9A 4QISA 4O13A 4ZVJA 3H54A 4IIDA 3HV8A 4JFUA 2ZZ5A 1XIMA 3LPPA 1A53A 1SMAA 4JZ5A 2CITA 3QOKA 1UUQA 5SWUA 1AFSA 3DESA 2JEPA 2BV9A 4AW7A 1W5NA 3TSDA 3CZKA 4E6MA 3JUGA 1VBRA 3AYVA 1S1RA 1XYLA 1PL9A 4JIEA 2Y61A 5IDIA 1KNWA 2Z1BA 1MW3A 4HHMA 1AK5A 3RJXA 5EYWA 4IUGA 1FHUA 2AKZA 4C65A 4AD5A 1XJBA 2PE4A 3QGAC 3IANA 1YPXA 4IFKA 3ITXA 4GPNA 1LYXA 3WX7A 1J9YA 4OWGA 4GD0A 4DNMA 2A6LA 1PIGA 2ZX8A 3NZRA 1SSGA 5A5WA 2GGHA 1S2TA 1TPH1 5CAHA 3A13A 1BEUA 3SBFA 1KRCC 4GE8A 3QY7A 1K9FA 1NP0A 2WVVB 3LMZA 3BCDA 4XIAA 3P8JA 5F2MA 5AY7A 2ZUSA 3SGGA 3EDJA 1IR2A 2B7OA 5IFPA 4J3UA 3M47A 2VGFA 3FOKA 2J7CA 4ZFMA 3UYCA 2PDMA 4NHVA 3H7UA 5AVNA 3W86A 3TVAA 1ICSA 1IIHA 1JZ3A 2WSYA 4PGLA 1JFXA 3LCHA 4N42A 2Q6ZA 2DZWA 4GY7A 5A2AA 4XKMA 1GT8A 2Y7EA 1QW8A 4O1BA 2ZYFA 3E9AA 3DFTA 3GXMA 2PDYA 2V67A 3W1NA 4WKFA 3VZXA 4QNEA 3EOEA 1W1IE 3TC3A 2OZ3A 2QUNA 3LI1A 1Y8BA 2VX4A 2NX1A 1NOFA 3UGRA 4W4QA 3W83A 1TVLA 1E0UA 1KCLA 1ZRQA 2QCFA 1JZ5A 1B54A 3GBDA 1FWEC 4K7YA 5CEWA 1RJQA 2QV4A 3NGJA 3O1NA 1SU5A 1TKKA 4ES4A 2VQTA 3MO7A 4IG2B 3T0AA 1FWJC 3NQVA 3WDRA 5D9MA 3DBPA 4PMUA 4EKJA 2WVUA 4HNNA 3S1WA 2UY5A 1AZ1A 1PIFA 3IK2A 3PSVA 3KTSA 3L4ZA 1L0PA 3EX1A 1JDFA 2VKZG 4U4MA 1UD4A 3W7JA 3LNPA 2PURA 3LLDA 2H90A 2W0UA 2CKRA 1Q6LA 5HMDA 3UXIA 2X09A 1IEWA 3H4XA 2UWFA 5HNNA 5GVJA 1UA7A 3AS3A 5JBDA 4LRSA 3W01A 1QI5A 5ABTA 3KXQA 3LS9A 3C2OA 1N7KA 4JQ2A 3PN8A 4IXXA 5TAOA 2IMRA 3NR0A 3VIJA 4OBRA 4BS0A 1EL3A 5FESA 3T78A 4GO9A 4S3FA 2E68A 2R9RA 4XO7A 4EPDC 2YR1A 4MWAA 5DMMA 4NAEB 1MQRA 3OYZA 2G37A 1XH1A 4GYFA 2D2GA 2VDIA 4B5WA 5CKSA 5HULA 3CHEA 2QS8A 1BYAA 4E2BA 3W7CA 4LEFA 1Z89A 3BLEA 1ZBWA 3GY1A 4L7ZA 1VRXA 1OZMA 4W5UA 2G0WA 4UTHA 1MQQA 4CQAA 3PTMA 2NV9A 4I90A 1ADOA 1BTMA 1JIBA 4DN1A 4TO8A 4XWUA 1C93A 3S42A 1X97A 3RPDA 1D9EA 2OXNA 3FAXA 4PRTA 2FFCA 3R0KA 1TX0A 3HU7A 1T40A 3CZJA 3AUJA 3CQIA 7ODCA 3KHJA 3S3GA 5CSRA 3C56A 4EPEC 2BOFX 4PR4A 1A0EA 1JRBA 4F2UA 3IRDA 3UVAA 2ZOXA 3C2YA 3PJWA 1P1MA 1Q45A 1P43A 2P1FA 1JFHA 2QQ6A 3GXDA 3UW6A 3W7PA 3URBA 4GUFA 3PPHA 4B3ZA 4BI5A 3M1ZA 2NQLA 4C1NA 2UY2A 3VD3A 4M7SA 1TJ1A 1VLIA 1RQEA 3I7RA 2O4QA 2V5JA 4KT2A 1PYFA 1T41A 3WD1A 4M1RA 1IGSA 4O1DA 4CN6A 3T7VA 3WUBA 4UUIA 3HMCA 4OKDA 1FWAC 2JIEA 4GUIA 2WPGA 1DEDA 3NXFA 2O7QA 5CZTA 1PKLA 1MXGA 1XIGA 2HISA 1ISZA 5GJNA 5HMFA 1EYEA 3BLIA 3ZR6A 3P84A 4MGGA 1OINA 4NNCA 4J7RA 4IIBA 4F9DA 2ZRWA 5D2TA 2V30A 5BOOA 1FH9A 4F0MA 4J1OA 3SRFA 3T1GA 1R46A 4XD6A 2PPGA 1QMLA 3IVUA 4EP8C 4UFJA 1R8LA 5L6UA 3A9IA 3E0IA 2C15A 3HBLA 1MW1A 1BWLA 3N11A 4X0NA 4PA8A 1Q6GA 1FCVA 4DXVA 1UD2A 2CLFA 3AIRA 3KWXA 3W2MA 4X2RA 3M0VA 4RDWA 1OX4B 3PULA 2WHLA 3FK4A 3ZVHB 3VC5A 2H3BA 5HJYA 1RAKA 2HE5A 4H7VA 5FEXA 1RD6A 2BVDA 4M29A 1KFCA 1VCGA 4GYPC 1G4EA 5T9CE 1EJ7L 3KP1A 3DH7A 4AF0B 1Y65A 3DENA 3DHDA 3L68A 3N73A 4MHBA 4AIBA 3GAKA 1VEOA 2Y5EA 3LHZA 4FLRA 1AD4A 1W1TA 1M6JA 3UNTA 4OGZA 5ECVA 3MWCA 1AL7A 3V16A 4CLMA 1ML1A 3LM3A 2FH8A 5C9UA 5H2ZA 3VGEA 1A47A 3G0UA 2FZ9A 3S5YA 3UXLA 3CEUA 2ZA3A 2DSKA 2GJNA 5LKYA 2FJUB 4TVDA 5AC5A 2TODA 1FWWA 1BSIA 3CQHA 5A2BA 1W9XA 3I3BA 2CLHA 3PUOA 1UWAA 2C1IA 3M46A 2VNCA 1SSDA 3QMRA 2PGEA 1KXQA 3AZRA 1Z69A 3PG9A 1M1BA 2XISA 3LRMA 1GEQA 3SO7A 3G0SA 3KBSA 5C71A 2GGIA 3VOCA 1XGZA 1NDWA 2NVCA 3WQDA 4PCTA 3EKZA 1XSIA 3CWOX 4JQ4A 3VIMA 2A3LA 2HWGA 2DUXA 4HCHA 1WZMA 3QHNA 1F2JA 2G5WA 5HPCA 2YFNA 3L5MA 1RUSA 4C6EA 1EKOA 3FY1A 4RDYA 1BD0A 3HGJA 4B2DA 4GK8A 3PFRA 4HYVA 2XFFA 4Z2KA 1GEHA 4M81A 1NWUA 4Q8QA 1P4CA 4CNOA 2MNRA 3IS4A 2Y2WA 2ZX7A 3UWYA 3AOFA 3OP2A 4MNLA 4TIMA 1FX6A 4QSFA 4FOJA 1F6YA 3EWXA 3IUIA 1H50A 1MEWA 1YADA 4KEMA 4ZO7A 1CPUA 1S2VA 2VD9A 4ZE5A 2WWDA 3QLLA 3TKFA 3LOTA 4RNHA 1UASA 1JUEA 4FNTA 1BF2A 1OK4A 3MUY1 8A3HA 3WDJA 2R1PA 4Q7BA 2H8ZA 5BOEA 3A64A 4JKMA 1PX3A 4GZ7A 3DKLA 3G5EA 4E3VA 5BU6A 4XV0A 3TX9A 2J9XA 3W2LA 4K3ZA 1ME7A 1HXJA 4R7JA 3WCZA 4YVVA 1P48A 2V0TA 4TUFA 5FCZA 2VGBA 2ZE3A 2C13A 2QJGA 2Y70A 4IFKB 1BVZA 3QC0A 1J96A 2X16A 4Y9AA 2ZUUA 1G6CA 3RX4A 5CC6A 1LOQA 3UXAA 4DJEC 3FS2A 2RJGA 4JNMA 2PZNA 4DF2A 1NOWA 4J27A 4QHRA 4QJ1A 1F8MA 4P7LA 2HVOA 3KBWA 5DMYA 3OW1A 5D30A 1SFLA 2C6QA 5A8QA 2WMKA 3KZPA 3PUEA 3BJSA 3ALFA 3EA2A 4BQ4A 2GVEA 4JICA 1RPXA 2E6FA 4FR6A 1R86A 3HPXA 1OFOA 4OFCA 3VIIA 3F4NA 3OIXA 3S2JA 4MB5A 1IWAA 3EWZA 3EOUA 4E3TA 1BGAA 1C90A 3UFYA 4NF7A 2DW7A 5FA5A 1UP0A 3DBNA 1B90A 1ZB5A 4DWSA 4GIEA 1SJDA 3OQEA 2DSVA 3G77A 3S9YA 2B7PA 3OB8A 4GY0A 2QPSA 3ANVA 1K9DA 2XWDA 3B8TA 4D6CA 5LA0A 4J9JA 3OLDA 4PL2A 3P14A 5KEZA 4IFOA 3I65A 1FP9A 1AMKA 3GH4A 5EBAA 2QKFA 4E2VA 1R9ZA 3D47A 1XLIA 2UBPC 4NNBA 1RY8A 1E1EA 4NRRA 2V38A 3SIZA 3UJEA 3P74A 1K4GA 4J5NA 4PBFA 3R13A 4ZBCA 5FJPA 2VX5A 2ZUNA 1G67A 3WY1A 4NZJA 4CD8A 4O1EA 3N2XA 5CZKA 4AAJA 2QGYA 3FJ6A 4I7WA 4ECLA 1M65A 1R3VA 3ZS4A 3O6YX 4IL2A 1CENA 3FAWA 4W84A 4LV9A 3N29A 4MSSA 3EWWA 3W37A 3NXLA 4MOZA 4O1CA 4ONVA 5BXRA 1V6WA 4X0VA 1YMYA 5LZLA 2ZWYA 3KWSA 1AZ2A 1DWIM 5A6AA 2Z28A 3K46A 4ZXOA 1GQNA 1XDMA 3BVJA 2D20A 1GW1A 4C6IA 1O5RA 2VM8A 3LSBA 3NYDA 5F4WA 3INPA 1SYTA 4ZEPA 1ZNNA 1XKYA 1S5NA 4IQEA 4M1BA 4P7OA 4UQEA 5KMYA 2VVNA 2GJXB 2YCLA 2ZZ7A 2VI0A 3GYCA 3S2MA 1JCTA 4C90A 4UTUA 3LHUA 4UQCA 3IV8A 2NX9A 2V3GA 1QVBA 2YCJA 4WCJA 4RV3A 1IZCA 3N2TA 5I0DA 5ABHA 3LMYA 4LF2A 3KOFA 3CB3A 3NURA 1DV7A 2GSHA 4WIWA 1XIJA 2NW0A 4GFSA 3KBMA 2QCGA 1J8VA 1ZY9A 3T8QA 3ZFHA 4AHPA 3MQTA 2CC0A 4JQ3A 4YWIA 1FKWA 2WBGA 2OZ8A 1W1YA 5HMSA 5XIAA 4LUTA 1H51A 5AECA 3BAJA 4G9PA 3R8GA 2R1LA 5LNVA 5CPMA 3G3DA 1UMYA 2WOQA 3QZAA 4V33A 1Q63A 2NQ9A 2E25A 2ZA2A 2YB1A 1XC6A 4Q4SA 3WF2A 2PGRA 3WO8A 3H24A 4NX5A 5LXXA 2VO5A 4J35A 5AHIA 2PU0A 4M0XA 2A7NA 4LQ1A 2VCAA 2PDNA 4QTGA 5EBUA 5A1AA 3W1RA 3VE9A 1TV7A 1QHOA 2YOCA 2IXUA 5BXTA 3CT7A 2Y5SA 1P6CA 3NEVA 5HWJA 3VABA 3W7NA 5HINA 4XZMX 3R10A 1M7JA 2ZC8A 1J0JA 1IXNA 1PS9A 4KWOA 6CGTA 2ISFA 3S1XA 1XDJA 1TREA 3LEPA 1EJTC 1EBHA 3VNLA 5I78A 5K4ZA 3TTEA 3L2IA 3VKBA 5FL1A 1J5TA 4NXKA 4MTVA 2D1ZA 3E2VA 2J6XA 4OBSA 4FX7A 4L1WA 4NASA 1TWDA 3HFTA 5D8ZA 3WL1A 1I75A 1YE6A 3EB4A 5C5YA 4H8HA 1IXQA 3D5HA 2FGBA 3HPAA 1SFSA 3Q58A 4A6GA 5M1TA 4QCFA 2CWXA 2WJEA 2QAFA 1KB3A 1HF6A 1LZOA 1FWSA 3UD6A 4GISA 3R25A 4DB7A 4J2MA 4HNTA 2FGLA 4XBJA 3FNDA 1LJYA 1Q5MA 2VFDA 4Q8NA 4CUCA 5DT7A 5TF0A 3S47A 4MJMA 2OQHA 4X9YA 3W1LA 1WUFA 1VB9A 2HS8A 3AU6A 2WKJA 4LFYA 1LWJA 4O11A 1U5VA 1A49A 3SSJA 2YSWA 2VRQA 3AU2A 5BZAA 1S2AA 4C6PA 3PB2A 1JCXA 1F4AA 3QGVA 1QR7A 2A3EA 2YA2A 5CJMA 2NWSA 2WAGA 3WJXA 4W87A 3IPWA 4QSHA 1G0CA 4YU1A 4UTTA 1O6IA 4EE9A 1R3TA 1NFGA 1W5MA 4JFSA 1W1A1 1VPYA 3NO5A 6PTDA 1OVDA 1US3A 3RU6A 5CBJA 1A5AA 1ZBKA 4UR8A 1XHGA 1UWIA 4ZQNA 1JD9A 3GXPA 4QNWA 4FK9A 3W1AA 1AH0A 3W82A 2ZXAA 4GXMA 1HJWA 1F9CA 2FTYA 3S9ZA 2VWTA 1Y0EA 3L4YA 3T0CA 2Z26A 4W88A 3FLUA 3FYOA 3WQ6A 2PB1A 3AISA 3DI0A 2HRWA 4JYFA 4Z1DA 3ORWA 5GNYA 4AHQA 1L6SA 3UZXA 2J7GA 3W53A 3ZOAA 1MXDA 3HGOA 2VGIA 3KBNA 2Z25A 4OZOA 3W7RA 1DXIA 1HKWA 1EA0A 3HV9A 4GWEA 1CXFA 2DSWA 2NLIA 2RHGA 6REQA 3VILA 5BYWA 1JCYA 5FEZA 3BAIA 1GOWA 2PDWA 4DJED 3R7MA 1JCJA 3AIEA 3QYSA 4DUXA 3TQVA 4DF0A 3EMZA 2CW6A 1M3UA 3AMKA 4UXDA 1GYNA 2OU4A 3NM3A 3OYXA 3TQ0A 3AFBA 5H6HA 4JEQA 4UTJA 4IPJA 3CL8A 4D6JA 2VFIA 4UCFA 3TYDA 1QBBA 2GJLA 5I7GA 4CD6A 7REQA 1H0IA 1J0HA 3BOFA 1N55A 2QULA 3A5VA 3PSWA 3IIVA 4UTIA 1EGZA 1OGBA 1XGDA 5F1UA 4KWVA 2GWGA 4ZL1A 5FJUA 1GHRA 2V2HA 1OD0A 1OG0A 3S5NA 4IIGA 3FA4A 4ENLA 3GR8A 4HNOA 4WHBA 4FF5A 4C6DA 3P7YA 2VEIA 3Q37A 1WKEA 1ME8A 5AHFA 3U2OA 1CB7B 4R5EA 1UKTA 2ONEA 4ILSA 3VIPA 1GPFA 3DX5A 1FA2A 1O5QA 1DORA 5I07A 3BAWA 1O95A 2AQOA 3CK5A 2OYMA 2OLSA 3FSUA 2VEKA 4R85A 5EY5A 3IWPA 1LOLA 1RA0A 2OJPA 2BHZA 4PZVA 2DZAA 2W27A 4ICNA 4GMEA 1SW0A 3FDKA 4JD4A 1PKYA 3GDMA 3CV2A 1WOAA 3L12A 3QSRA 2D69A 4L4LA 1OYAA 3G24A 4MUZA 2XUCA 3GDRA 2D0GA 1NOUA 2I5GA 3QN3A 4JDBA 3EA3A 1SO6A 4S2BA 2CLLA 1H1ZA 4JTRA 2DY3A 1E1CB 1LLOA 3SFWA 3UG3A 1GGOA 4WXZA 2IW0A 3DU0A 1A5OC 4X60A 5E9AA 3CAKA 2QDHA 1H5VA 2E5DA 4Y9NA 5BWAA 4H1ZA 2VXNA 5CH9A 4RR4A 2RDTA 4E8CA 3A4AA 3OO2A 2WB5A 2GVJA 1WXYA 2V5BA 3UNDA 2VGGA 5XINA 3L4VA 5A8GA 2Z0IA 4LGXA 1NTHA 1XISA 1ZALA 2Z1XA 2VUYA 3UXKA 3B9AA 3W1QA 1QAPA 3R11A 2J7FA 1OD8A 1D8CA 5HATA 5H8MA 1ISVA 3WIJA 3A12A 3BV7A 1KM0A 3AIVA 5C6MA 3H21A 1GOQA 2ACQA 2Y7DA 4BWLC 2ZC1A 3SCRA 1OCJA 2E77A 3GX9A 5CPSA 1A5KC 3T81A 1K7XA 4TX8A 1EJSC 4M82A 1DE6A 5T9BG 1HVXA 1ODUA 1CLXA 3R4IA 3SCQA 2Z7KA 3U7BA 5T8GA 2R94A 5F1VA 5CSSA 2J74A 5F4XA 4QS5A 3W2NA 1JPDX 5LYRA 5LGZA 2E5CA 4MADA 5DY3A 2PP1A 1OIFA 4ML9A 3ICJA 4NJGA 1OFQA 1GVQA 5EFDA 3WEOA 1J0ZA 1WDQA 1A5BA 2NQHA 1A4LA 2G97A 4REQA 5A6LA 3C86A 3LG3A 1DWJM 3GB6A 3SURA 1S39A 2CETA 1KA9F 5HQLA 1XPYA 4MJ4A 2OPJA 5DX7A 5G2WA 5HPOA 3TN6A 3VNJA 2CLPA 1SGJA 1CGWA 2J7DA 4MB3A 1KFKA 4ZQPA 3CGTA 1MNSA 1VPQA 1BPLB 5D05A 5G1TA 1X1ZA 1RVGA 1M01A 5ABFB 1V6VA 3TYUA 3BG3A 1IE7C 2V68A 7TIMA 3RDKA 8XIMA 3GUWA 1UZ4A 3VIFA 1E40A 2ISVA 1QI3A 2Z1SA 1RBLA 5CSUA 3L0NA 3TQPA 3VKJA 3WD2A 3CZEA 5BNKA 3VVGA 1E6ZA 4QAIA 3MT1A 1EIXA 1Q6EA 1UKPA 3KRBA 3HMJG 1JXJA 1R9YA 1RQBA 2XN1A 1WNOA 1MI3A 1OB0A 4PFHA 4P61A 3RLUA 1VEMA 1E4LA 1Z41A 1BVNP 4B4HA 1SPQA 5FAJA 2PLKA 2FZNA 3C8FA 4LYKA 3CT2A 4FXSA 2R24A 3LI0A 1P6WA 3LBCA 4KEUA 2DV0A 1K3UA 1PZ2A 3SR7A 1E71M 3THCA 1AW2A 3P81A 3GU1A 4Z2JA 2C79A 2ZUMA 3VZYA 1VH7A 4I5XA 3PP7A 1FBAA 2DT2A 3U4FA 4IUOA 2Q09A 4O4WA 1CXEA 1CXKA 3V7PA 1UWRA 3Q65A 1H2JA 2Y89A 1HKMA 2JBMA 2WSKA 4D9PA 3L4WA 2E4TA 3B8SA 1RZMA 4B4FA 4J3TA 4J3WA 3BDKA 1ITQA 4LYPA 4O19A 3PB0A 1KBKA 3QMTA 1JZ7A 1VEPA 4YCOA 8TIMA 1UWQA 5EMYA 1U1UA 2P76A 2WNZA 5KITA 2QCHA 1XLAA 3NGFA 1E6RA 3WDHA 3OVRA 1JULA 3K4AA 1LG1A 2D2JA 3DC0A 4IMAA 5C54A 3ZLFA 4OVXA 3N25A 3T2OA 4WLCA 4KW2A 3WD3A 5HQMA 4D6DA 5A6KA 3VIGA 7TAAA 2E6AA 4UQAA 3SADA 1ZBCA 2WV8A 3VK5A 4O53A 5JIWA 2CEQA 3VINA 1M53A 4P2VA 3KM8A 3STPA 3RK8A 3LX9A 3IJIA 2A21A 4LTSA 4WSKA 3NQMA 1OHLA 1XIDA 3WQOA 1LM1A 4BY3A 3E2SA 3FN9A 3KS5A 1XLMA 4MNMA 4ZQRA 3VIHA 5EL1A</