2GWGA

Crystal structure of 4-oxalomesaconate hydratase, ligj, from rhodopseudomonas palustris, northeast structural genomics target rpr66.
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
345
structure length
329
Chain Sequence
MIIDIHGHYTTAPKALEDWRNRQIAGIKDPSVMPKVSELKISDDELQASIIENQLKKMQERGSDLTVFSPRAGDFNVSSTWAAICNELCYRVSQLFPDNFIGAAMLPQSPGVDPKTCIPELEKCVKEYGFVAINLNPDPSGGHWTSPPLTDRIWYPIYEKMVELEIPAMIHVSTGAHYLNADTTAFMQCVAGDLFKDFPELKFVIPHGGGAVPYHWGRFRGLAQEMKKPLLEDHVLNNIFFDTCVYHQPGIDLLNTVIPVDNVLFASEMIGAVRGIDPRTGFYYDDTKRYIEASTILTPEEKQQIYEGNARRVYPRLDAALKAKGKLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords 4-oxalomesaconate hydratase
publication title Crystal Structure of 4-Oxalomesaconate Hydratase, LigJ, from Rhodopseudomonas palustris, Northeast Structural Genomics Target RpR66
rcsb
source organism Rhodopseudomonas palustris
total genus 110
structure length 329
sequence length 345
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 2gwgA00
4IG2B 3S2NA 3ISIX 1V77A 3N2CA 3EGJA 4J5NA 4R85A 1VFLA 4ERIA 4D8LA 3PNUA 1DPMA 3TN4A 4WVXA 4XAYA 3IJ6A 4KEUA 3B0XA 4ZSUA 1RJRA 3WMLA 3B0YA 3F4CA 2HNHA 2HPIA 1EJXC 4C65A 4GYFA 4GOAA 4V1XA 4LCRA 4UBPC 3UPMA 3GG7A 1YNYA 4ICMA 4RDVA 4IG2A 1A5NC 5FSEC 4ERGA 4KEZA 4R7WA 4C6BA 1RJQA 4B90A 3GIPA 4H9TA 2ZC1A 3MVIA 2Z2AA 2OOFA 1A5LC 1GKRA 3IPWA 3AU6A 3MVTA 3LU2A 3TN3A 2QPXA 1V4YA 1FKWA 3E74A 3F2CA 2GWNA 1ONWA 3OOQA 3GU1A 4XAFA 4BY3A 3LY0A 3CJPA 1YMYA 2QVNA 4B91A 4CQBA 1BF6A 1P6CA 4LAMA 2GWGA 3EWDA 1ADDA 1M68A 4C6EA 4CQCA 2FFIA 3HTWA 2Q01A 4XD5A 4C6OA 3IV8A 3NQBA 1EF2A 3GIQA 1NDZA 4QS6A 1ITQA 3ORWA 2Z27A 3GRIA 4DZIA 3LSBA 2WJFA 1FWCC 2XIOA 1XGEA 4OFCA 3O0FA 4LH8A 4PBFA 4EPBC 4LAOA 4E3TA 1YBQB 4RDYA 3F2DA 4GC3A 2PGFA 2Z2BA 3D6NA 2I9UA 2OB3A 4PCNA 4RE0A 5A6TC 2Z4GA 3TN6A 3SO7A 3OODA 4H9UA 1XWYA 2RAGA 2OGJA 1FWBC 1J6OA 2YXOA 3MTWA 4KERA 2P53A 1XRFA 3ID7A 1QXLA 4C5YA 3UF9A 1JGMA 4GY1A 2A3LA 1POKA 3URNA 1RK6A 3IACA 1J79A 3ICJA 4PCPA 3HPAA 1K70A 4GK8A 2FVKA 4C6NA 3GTFA 1J6PA 2D2GA 1I0BA 1R9ZA 1FWIC 1NFGA 2Z29A 1YBQA 4DNMA 4KETA 3KM8A 2UBPC 3PAOA 4XAZA 1KRMA 1R9YA 2Z24A 3O7UA 4XD3A 2AMXA 5G4HC 1P1MA 5E5CA 1FWEC 2HBVA 3GTXA 4LCSA 2GZXA 3URAA 2UZ9A 3G77A 3MPGA 3FEQA 3DC8A 4DO7A 4F0SA 3EWCA 1EJRC 1EJWC 4IF2A 1QW7A 3OU8A 1KRCC 3JZEA 2R1LA 4KQNA 5HMEA 4CEXC 4LALA 4AQLA 4IFRA 4I6VA 2PGRA 3BE7A 4GZ7A 3UR5A 5HMFA 1PB0A 4HJWA 4RDZA 4GX9A 2WJEA 4L6DA 1S3TC 1XRTA 2Z28A 3QY7A 1A4MA 1PTAA 4DI9A 4XAGA 4QRNA 5HMDA 2E1WA 2AQVA 3IRSA 3UR2A 3GTHA 4IGMA 4DYKA 2ADAA 4H9VA 4XD6A 4CEUC 1EJVC 4IFOA 4WHBA 3RN6A 3PANA 2R1KA 2HQAA 1UIPA 2IMRA 1EZ2A 2VUNA 1KCXA 4LEFA 1PO9A 2BB0A 3LA4A 2P50A 2R1NA 4HA0A 1RA0A 2I5GA 4BKNA 1UMLA 3HM7A 4H00A 2Z26A 2GOKA 3RHGA 3MDWA 2ANUA 1NDYA 3S2LA 2PLMA 3S2MA 1V7AA 4JOMA 3E3HA 4QSFA 4AC7C 4DLFA 4C60A 1FWFC 4DIAA 2Z7GA 1FWAC 4C6KA 1A4LA 4UB9A 1NDVA 2DVTA 2YZ5A 3DUGA 3LGDA 2QT3A 4PE8A 1KRBC 2Z00A 4TQTA 3E38A 3ITCA 4Z42C 1R9XA 2WM1A 3GU9A 4QROA 3RYSA 4LCQA 4I6KA 2G3FA 2VM8A 2DVUA 4F0RA 4G7EB 4ZSTA 2E25A 1EJSC 2ICSA 4C6LA 3LSCA 3PBMA 4GBDA 3F4DA 1GKQA 1ONXA 3S2JA 4DZHA 2Y1HA 2EG7A 4CNUA 4EPDC 1IE7C 1WXZA 3E2VA 2CZVA 4GXWA 3MKVA 4LFYA 4C6IA 4YIWA 4QTGA 4BJHA 1RJPA 3OJGA 4NG3A 4EPKA 3GUWA 2VHLA 3LGGA 4H01A 4B92A 3PNZA 4C6QA 4HK5A 4C6JA 3DCPA 4G7EA 4LAKA 3K5XA 2F6KA 3LNPA 4KEVA 3UBPC 1J5SA 3LS9A 1WXYA 1I0DA 3A4JA 1UIOA 3T81A 1V51A 1A5OC 1GKPA 2BGNE 1FWGC 4RZBA 3MJMA 1RAKA 4M51A 2Z25A 4H9MA 4IFKB 2HPMA 4L9XA 1EJTC 3T8LA 3QGAC 4GY7A 2D2JA 3WYZA 4C5ZA 3NURA 4NP7A 3MDUA 4ERAA 3FDKA 2WJDA 3CAKA 1EJUC 1P6BA 2OODA 3MSRA 3GTIA 1E9ZB 4EP8C 3SFWA 3CS2A 3URQA 2R1PA 4CQDA 2O4MA 3GU2A 2PAJA 1M65A 2FTYA 4IGNA 5CH9A 3IGHX 3K4WA 4G2DA 1W1IE 4H9XA 3TNBA 3C86A 2DVXA 4HK6A 1RK5A 1FKXA 1FWJC 4C6PA 3F2BA 2OQLA 1HZYA 1A5MC 4IFKA 1KRAC 1M7JA 3E0LA 1K1DA 2EG8A 1K6WA 4RDWA 3QY6A 4GY0A 3A3XA 1ZZMA 4CNTA 3OQEA 2FVMA 3FDGA 5FSDC 2KAUC 3AU2A 4HK7A 4QS5A 1EYWA 1ITUA 2R1MA 1E9YB 2W9MA 5LXXA 3B40A 1V79A 4KF1A 4J2MA 1RA5A 4KESA 4XD4A 2HBXA 3OVGA 4F0LA 2EG6A 4R88A 3AUOA 3QY8A 5AKQA 2VR2A 3URBA 3A3WA 3E0FA 1PSCA 4PBEA 4V1YA 2YB4A 2D2HA 1A5KC 2GSEA 3T1GA 2VC5A 2FTWA 4WGXA 2AQOA 4INFA 4IQJA 1YIXA 4J35A 1UBPC 3IARA 3RCMA 2PUZA 2YB1A 2VC7A 1NDWA 3R0DA 4C6FA 4C6CA 4KIRA 3K2GA 3S4TA 1YRRA 1FWHC 3TN5A 4DLMA 3V7PA 4EPEC 1FWDC 4H9ZA 1O5RA 4B3ZA 4LANA 4C6DA 3QGKC 2QS8A 1POJA 4C6MA 2O4QA 4DI8A 4GX8A 3WZ0E 4H9YA 1O12A 4NI8A 2Q09A 4P5UA 4CNSA 4IH3A 3NEHA 4MUPA
chains in the Genus database with same CATH superfamily
5JVLA 2Z1WA 3L7RA 4O10A 3SY5A 1NQ6A 4U5IA 2V5KA 2PLJA 2G3JA 1JCNA 1B30A 1YPXA 3PWIA 1OX4B 4Q7BA 2JF6A 1B9ZA 1DPMA 4RXFA 4DQWA 3AWNA 3A9IA 4BF5A 2QDHA 1UPPA 4NJKA 1Q65A 4LF2A 2NQZA 3FJ4A 4JNYA 3TQKA 3WMSA 2NX9A 1TWWA 1BXBA 2XFFA 1R2TA 4KEZA 1XYCA 2PWDA 5JBDA 2EKGA 3NQGA 4M7TA 2RHGA 4QE5A 5REQA 1EUNA 3VD4A 3PPCA 1P5BA 4IX2A 4WF7A 1FH9A 4H19A 3MU7A 4R53A 4US5A 3OOQA 3A6OA 4BY3A 2HWGA 3PBUA 3BICA 3FXYA 3VILA 1XH0A 2YL5A 5CEWA 3ARPA 2E9BA 3IK4A 5C0QA 2GWGA 1B4KA 1P0BA 2ZXAA 2WWDA 1XHGA 1VIWA 4B9ZA 1KKRA 3NQBA 1EF2A 1GTEA 4JIEA 1TMLA 3CL7A 1B3WA 5FCZA 3T0DA 4LVGA 1W9DM 1ZB5A 4O0ZA 1JDDA 1LBLA 1PWMA 1UH4A 1AQHA 3E0VA 2QIIA 4WXYA 3H4WA 3UJEA 4LRSA 2WANA 1FWBC 2YXOA 4U2ZA 3LXCA 3TTSA 4A8IA 1E9LA 3C0JA 3GXMA 2YXGA 3OB8A 3GZAA 1TJ0A 4UQCA 1GPFA 3ZT5A 9XIMA 1RP8A 3NCOA 1K9EA 1VFMA 2AL1A 1WV2A 2FIQA 1J6PA 3A5FA 3GHSA 4GD0A 5DXYA 4S3EA 3IIZA 3ME3A 1W31A 4S38A 5I06A 2AAMA 4RNHA 4NXKA 1H7XA 3M0VA 3H8AA 2JE8A 4FLQA 4LU0A 1BG9A 1P1MA 2NXHA 3ZFHA 4LCSA 3ZIZA 3BDKA 1RCQA 1KBJA 3OYZA 4ONVA 4HJWA 2WJEA 1G67A 1S3TC 2PDWA 5AVNA 4XSLA 1SUXA 4UMAA 1XLCA 5CSYA 1AMKA 4QLKA 4GH1A 3TSMA 1WKDA 3CYVA 4IFOA 5J8LA 2VEGA 3SY8A 4FS9A 1UIPA 1DV7A 3IRDA 1XUZA 5JXQA 1W5MA 3GYEA 1LBMA 3CT7A 2ZE3A 3VC6A 1PYMA 3P60A 4MG4A 3BLOA 3W87A 4LPCA 3LHWA 1FWFC 3KUMA 4AZBA 3VX1A 3A64A 2WHKA 1R0MA 3EEGA 3ZYZA 4PE8A 5FF2A 1KV8A 4H8NA 1UC5A 3SECA 1KGXA 3N2BA 3W26A 1SFTA 2DV0A 3Q2DA 4KWWA 3VAVA 3CQ0A 1BWKA 4H04A 3JRKA 1W5QA 1UR8A 2DSZA 2VRKA 3ZJ6A 1W9PA 4JY9A 4CVUA 1ONEA 2ISDA 1GKQA 3GO2A 1QI3A 5E9AA 3QMRA 2WMHA 4K1GA 3L68A 4W89A 2AKZA 5FJOA 1EHNA 1W1YA 3MCNA 3BMWA 5I03A 3KOXA 4ZTYA 1X8FA 3WLMA 1JRCA 1W8GA 2X1RA 4ORMA 3ALFA 3O3RA 4S39A 5LZLA 2GFTA 2ISFA 1PHWA 4UTTA 2WVTA 1J5SA 1WZMA 3L4UA 1I0DA 3FN9A 1UIOA 4KFPA 3FAWA 1OYBA 4YYCA 4REQB 1FCBA 4PSPA 2D1ZA 4YTTA 1T96A 3QXBA 1AH4A 1CT5A 3TJ4A 5HWMA 1UD8A 5HATA 3KBWA 1EGMA 4WKAA 3UWWA 3EZ4A 1LUCA 3C2RA 3SGGA 4YVVA 3I6EA 3XIMA 3AYTA 4OUIA 5U7SA 3B0PA 4J27A 5BU6A 1H4PA 4H9XA 2E67A 4LTSA 2V5BA 1S5VA 2X42A 3W81A 3AUJA 1UR3M 2C8NA 4XUGA 4MGGA 3LHYA 3DESA 3LQGA 1J5TA 2QUNA 3QBUA 1WAUA 2PCQA 1TZZA 4CNTA 1HVQA 4GNVA 3N19B 2PFHA 2XFWA 1TR1A 3G8EA 1E4LA 1QOXA 3T44A 3W70A 1Q5MA 3UR7A 1NOWA 3G2GA 4CNOA 2YR1A 3CUIA 3LV6A 3N29A 3L23A 4R88A 3TTYA 1G4EA 2X0SA 3N1AA 3WH9A 2OZTA 5F2LA 2PMQA 3AWOA 3GVQA 4V28A 3UG3A 1NOFA 2D2HA 4IQEA 4WGXA 3WK1A 3P0XA 4QGCA 1B31A 4YN5A 2XUCA 5I3GA 1HJVA 2F2KA 4US5D 1QBAA 3U7VA 1JZ4A 5G1YA 4KIRA 1LRNA 4KRTA 5G5IA 2QGHA 1F76A 3UG4A 2WOQA 4AZHA 3WFLA 3HGRA 3LTPA 4UTWA 3BOLA 4ZQRA 1PWLA 3KCJA 5M17A 1MDRA 4JEJA 4P5UA 4K3ZA 1TJRA 3S6DA 4LVAA 1VFSA 3W7HA 4TVCA 3RRXA 1CYGA 2V8ZA 2PF0A 4JYEA 3QZ6A 4LXFA 3AMLA 3E49A 4NNAA 3OYXA 3M0MA 2ZCGA 1Z32X 4H7CA 1HVXA 3ZVHB 1PAMA 3WMLA 2OCZA 4AEEA 1MW1A 2C14A 1F7BA 2ABBA 1W1TA 4UBPC 1YNYA 4J4KA 4J3ZA 4N6EA 1NELA 3B9EA 4R7WA 2V63A 1K7FA 2E7FA 5DBTA 2JIEA 3MP4A 2C19A 3EOEA 2BFGA 2JIWA 3PP7A 2Z2AA 1KR0A 3M44A 1RVKA 4AD1A 2EAWA 2WMFA 2OVLA 3C0LA 4X3ZA 1C29A 1XYAA 2QUUA 2CBIA 3SUWA 3UWVA 1ISXA 1E1FA 2RH9A 3WQEA 1W32A 1P7TA 2IQTA 5J5DA 2XN2A 3UETA 2FFIA 2VNCA 3EOSA 2Q01A 4XD5A 1MXDA 4GQBA 2X1TA 1BYAA 2J27A 4GRSA 5CQ1A 1DWJM 3GAKA 1VH7A 4MZ1A 4PBGA 3LSBA 4IMAA 1B54A 3O0FA 3QZEA 4E3VA 1O4UA 5LNUA 1IQ8A 4PTXA 1WB0A 1TE6A 3I65A 3PZNA 5FIPA 3QW3A 3TC7A 3FJLA 4PUMA 2Z2BA 1BVZA 1DIKA 4DO4A 1C8QA 1EDTA 1AFSA 1XM3A 1QWKA 1TJPA 4H2CA 1J0HA 5KEZA 2VEFA 3W1RA 4RZ5A 3BAXA 3RMJA 3GK0A 4TU1A 4LRTA 1UWIA 2PWUA 3LI0A 1I8JA 5GJPA 3NZGA 1EGVA 2QW5A 1QMLA 3QM3A 1W9VA 4HZ7A 4KH2A 1P6WA 3H2NA 4TVDA 1SW0A 1R9ZA 1S5NA 3AIQA 4MTVA 5F7UA 3RR1A 1XCFA 3VOFA 3EB4A 1RALA 1D3CA 1UKTA 1UA7A 4QG8A 4LC6A 2XU2A 3I6RA 1OT1A 4JHZA 2WNNA 3H4XA 2GUUA 1KB3A 2R1LA 3BJTA 2PRHA 5AYBA 3CZGA 1PB0A 1Z3NA 3EYPA 3POCA 1TWIA 1XDLA 3H7VA 1EH9A 3UR2A 2RUSA 1V3KA 2CESA 3WY1A 3BXWA 3UP8A 1JZ5A 1GHSA 1L6WA 3ARSA 2PLCA 4CCEA 3BJFA 1JUEA 5AB3A 2GJXA 3IVUA 4Q6XA 3E2RA 5FL1A 4O50A 3I10A 1SJCA 2D69A 2Z26A 2HEJA 2OELA 4ZFCA 4M81A 3LMYA 2Q3OA 2ZRVA 1S2WA 1TIMA 2C0AA 4JEQA 4IJBA 1J96A 4BFAA 2QT3A 4YTRA 2PWVA 1CGWA 1PKMA 1KRBC 3B8DA 5D9PA 1PIFA 3GU9A 3PAJA 5I3IA 4QX4A 2DVUA 3OG3A 3N73A 2X09A 4F0RA 1VYSX 3SJNA 3SCUA 1FHLA 1KCLA 2FTPA 1Q4WA 3H2FA 4GBDA 1TV3A 2DIJA 4P7QA 1OSEA 3LG3A 3GR4A 2E9LA 4F0HA 4F9DA 4DZHA 2GJNA 3TP4A 1CENA 3UA4A 1JD7A 4GHRA 4LFYA 4UR8A 1DWAM 3VUPA 4J7RA 2HS8A 3W75A 3SCVA 4C6QA 2W79A 4XO7A 3SQMA 3IJIA 3M0LA 1BF2A 4HU3A 5FJPA 3BCFA 3W85A 1UYQA 2RJHA 4MFDA 3SGZA 2YFNA 2F6KA 1XYFA 1QPKA 2IKJA 4Y7EA 4QQ3A 1F2JA 3THCA 2BGNE 5F1VA 3MT1A 4PCFA 1R5YA 3S1GA 3TA6A 5CCZA 3UWYA 2VD8A 3FCPA 3SCRA 1GUVA 3W2UA 3PTDA 4DXVA 1NVMA 2FPVA 5DQPA 1K7XA 4P7OA 2XWDA 1PZ2A 4KCVA 4H41A 3W1XA 5DELA 1TX2A 1DHKA 4BWLC 2OO6A 4JTCA 1LRTA 4IUOA 4MWAA 2VCCA 1P7TB 3L21A 3G1VA 3DENA 3UVAA 3FVDA 3HV8A 5CZTA 2NQJA 2D2OA 1H7WA 4ZOEA 1ONRA 3RM4A 1I45A 2YA1A 4PUDA 3OQEA 3DKLA 1H2JA 2OJPA 2WZHA 3SJ3A 4X22A 5HAOA 3LZ3A 1F74A 1BYDA 3B9NA 1KO0A 2A3HA 3L2IA 3LLXA 1VHCA 2H8ZA 3WLJA 3GVGA 3OW1A 3GNRA 4ZB0A 3BLIA 1B2YA 3M7WA 3CIWA 2DZAA 2G3MA 2FMOA 4Z2GA 5DBUA 2HXTA 3CHEA 3TOYA 1A5KC 4ORIA 2FZ9A 1IT0A 4GFIA 5H8PA 1CPUA 1V0MA 5LIXX 4IIGA 4P8UA 3BW2A 3S83A 2BBFA 4FAMA 3L67A 3SUVA 3W53A 1W54A 1ZENA 3I3DA 3W7IA 4IWWA 4IP4A 6TIMA 3HG3A 4AIEA 4N9EA 4RZ6A 2PDGA 3TSBA 4JFWA 5AECA 2GDUA 5HNUA 4DF2A 1WO2A 3RCYA 1JPIA 4DEFA 4RE3A 5EU9A 2E8ZA 2BXVA 3K8LA 1GZJA 1PKNA 3O6YX 3QPYA 1R38A 4JCLA 4L4OA 1P4CA 3G0SA 1OD8A 3EDDA 1W2PA 4HBKA 3GB6A 2IPWA 2DSUA 3FNDA 1P0KA 1XDJA 2VEMA 4W7WA 5FL0A 2GJXB 4M8UA 4LB4A 4LAUA 3UZWA 3H2OA 5AZ1A 1TB3A 2HK0A 1YE6A 4L80A 2XHYA 1VD6A 3RRAA 3WQGA 3DKJA 1I2PA 4G7FA 3WNMA 4F48A 1H1NA 4WX2A 3GW0A 1OFEA 2Y7DA 2WHMA 1UR2A 3GVVA 3TQVA 4H9TA 1OIFA 1PZ3A 1GVQA 4H7VA 4RE2A 2OOFA 5I5RA 3IVSA 2ALDA 3KLKA 5LKYA 2Z0IA 3QEZA 4DAIA 4H4IA 3NQAA 4JHMA 4HYVA 2Y7GA 2QCNA 4MYAA 2Z6JA 1JZ2A 3I7SA 4L1GA 1M68A 4QDPA 3H6OA 3L4VA 2CLEA 1TTJA 2QF8A 1GWJA 1AQFA 3W7CA 2EPOA 2WO5A 2Z27A 2C1GA 3SB0A 4WKFA 4A29A 3GY1A 3GAYA 4D6EA 3U7BA 2NQHA 1R2RA 1XIMA 5F4SA 3OHIA 1A53A 1T8QA 4MKVA 5KZEA 3DEQA 1DJXA 3WJWA 4O19A 3VIJA 4YTUA 4F9JA 2RAGA 1WDDA 4IPLA 1YPIA 2HVMA 1KM1A 2EKCA 2CXEA 1DIDA 3Q45A 1BHGA 4YLWA 1VKFA 3KHDA 3GFZA 1H61A 5F4WA 3KRUA 4JCMA 3N25A 1W9XA 1OX5A 2YYTA 5FEZA 4K7VA 4NJHA 4GCAA 1TPVA 2WYSA 2OPJA 4W85A 5DANA 2FDMA 2MUCA 1N82A 4XAZA 3PM6A 4MWAB 4Q4RA 3Q94A 2GZXA 5BROA 3BMXA 4NX5A 4DO7A 5IDZA 3DU0A 2WZEA 4PMXA 4CEXC 1LP6A 2J75A 2XINA 4EAMA 2J78A 1VRDA 4UTTC 4GX9A 3TZFA 4AU0A 4AMCA 4DJEA 3GE7A 3MQTA 4GKLA 1MXGA 1VCVA 1W3HA 2J4GA 3GNPA 3MANA 4UXDA 4LY4A 2NQ5A 4ADSA 4DYKA 4ACYA 3HJZA 4NZJA 1YTEA 1UASA 4HMDA 4MF4A 3QOKA 3UA3A 4O1AA 1HXJA 5FEPA 3RN6A 3UWZA 1J0IA 1XX1A 4H8VA 2E5BA 3STFA 5TNVA 5I24A 2IMRA 1PO9A 4P7NA 3PY2A 4HA0A 3TJXA 1K3UA 4GACA 2PDJA 4S3DA 4H00A 3NTYA 5FACA 5T8GA 1UR4A 3L5AA 3L4XA 1E6ZA 3W23A 4BQ4A 4XX6A 3BL3A 3EX2A 1A4LA 1FWTA 4XZIA 1NDVA 3LLFA 1G9HA 5C5YA 4PMNA 2QUVA 3RG6A 5KITA 4PCSA 4LV4A 3BLEA 4JL1A 4TQTA 3H55A 4JGDA 3E38A 1J18A 3LENA 1HL9A 1XSKA 2VVSA 2FGZA 1E1EA 4FK9A 4MSSA 4CN1A 2VEKA 2ISWA 5I3KA 4DJFD 4ATWA 4D8ZA 2E1DA 3KS6A 4PB4A 3MWAA 2PDLA 5FKYA 4V27A 3VGDA 1PS9A 5D2WA 4E8GA 1PUDA 4R3UA 2WVUA 3UZ5A 3N3MA 3M46A 4WQ6A 1WXZA 4C90A 1US2A 2CZVA 3MKVA 1F3XA 1XV8A 1A0CA 2X0HA 4J3UA 1RJPA 3OJGA 2DH2A 2CLLA 2HXUA 3AHTA 3G6LA 4ALDA 4B92A 2P0IA 2GLKA 3W25A 1B4EA 4XG1A 2DUAA 4GABA 5AYZA 8A3HA 1MSSA 3GM8A 4AZ7A 4KEVA 2DQWA 3MMUA 4P2VA 4PSRA 2INEA 4MNLA 1DWFM 1V51A 4JKKA 3MKCA 1DXIA 1XJBA 3CAQA 3VIFA 5XIMA 5CBBA 1EJTC 2TAAA 4DN1A 3GTNA 3GBDA 3FDKA 5HDRA 4UTWC 3M9YA 5IRPA 5A69A 1U1JA 3GH7A 3TA9A 3PWGA 1BTMA 3GTIA 4ZB2A 5EFDA 4CNPA 3VD9A 5RUBA 1WZKA 3MJYA 7REQB 3GUGA 4HMCA 3WH8A 1V0KA 3WMBA 3TNBA 2BOGX 1GVEA 5E70A 3EDKA 2OLHA 2ZX7A 1IWAA 3EDEA 2BOFX 4Z1CA 2PBGA 1EXBA 3IUIA 2Y7FA 3E0LA 2DZVA 3E5BA 1XBVA 2E6FA 5FJJA 2FHCA 1XLIA 1O5XA 2IPFA 5LA2A 1U5JA 1ZQ5A 1ALDA 1XBXA 3UGVA 4JDYA 5FSDC 3AU2A 4TTUA 4Q8UA 4AMAA 4MIMA 4FA3A 2WV8A 4E0CA 3KL5A 5I3DA 3LN3A 4O4VA 2ZUTA 3KLLA 4F0KA 4HVXA 1AH3A 4RKAA 1EUAA 3PZQA 3FXGA 2VR2A 2GGEA 3C8FA 3E0FA 4ZBCA 2O9TA 1CXHA 2ZDSA 1Q6RA 3QR3A 5HA7A 5BRPA 3RXZA 2FTWA 1OVDA 4A8LA 3LRKA 1O66A 4IQJA 3L0NA 1YIXA 3IARA 2HDJA 4KRUA 1LL4A 2P10A 2XH2A 3LBOA 3JS3A 1UZDA 4KCWA 4W93A 3EMQA 1TYGA 3O2LA 3BGJA 2F6XA 3OG2A 2ISSA 2XN1A 4UQAA 1GONA 1S5WA 1A3WA 1N7KA 5A6KA 2YDRA 1J93A 5LHEA 1W5OA 4IMGA 1DQUA 2NV2A 5LNSA 2PDHA 4HIBA 3IGSA 1J9YA 4UTUA 7PTDA 2IKIA 1XC6A 3LB0A 4AD3A 3GBEA 4O4WA 4XAPA 3QVQA 3U4AA 1HIZA 3LHUA 4R34A 8TIMA 4WXZA 2VRQA 4MUPA 4GVIA 2V5JA 3UXDA 3WDHA 3GNDA 1WDWA 2PWHA 2YL6A 3NVDA 4FSAA 4H6RA 4ERIA 2BMBA 4WVXA 3AHZA 1NEYA 4ZCWA 2V9DA 4JX5A 1O1ZA 4WUIA 3ITTA 3PTMA 5FOOA 4ZA0A 3VGGA 3WH6A 1ISYA 4XBJA 2UY4A 1NQKA 4HNUA 4RDVA 3PUGA 1EWDA 1LCOA 3VGHA 3VCRA 3B8UA 5D32A 4FMVA 1AZ2A 2V0TA 4ACZB 4FOUA 1VLIA 1M6JA 3VGBA 1IV8A 1QVBA 4JDBA 1F5ZA 4KS0A 2C1HA 3R8HA 1FWWA 1BYBA 5JBFA 1KFBA 2X8RA 1JCYA 3E74A 4Z1DA 3E0IA 3QTGA 2ZUUA 5AHIA 4DJED 2VVNA 5HULA 3G6MA 4JR5A 1VAHA 3C0QA 5CZSA 3KWSA 2DZPA 4C6OA 9CGTA 5K9DA 1G7UA 1KBIA 2OSWA 3RMEA 3R6IA 3E2QA 6CGTA 2IQ0A 4GQQA 3PJTA 3QQ0A 5CSSA 3CL8A 3EWUA 3FA3A 1GJWA 2ZTKA 1YDVA 1DWGM 1BXCA 1LORA 4IT1A 1DORA 1PV8A 2WMIA 1IZCA 2NXGA 3TNOA 3B8SA 4WD0A 4XKYB 4I8DA 2OGJA 3GX9A 1ZTVA 2P53A 3H23A 4A8RA 1I2NA 3CV1A 2Y4SA 1LWIA 4IMEA 3FAXA 2HS6A 2NQ9A 4HMEA 3IACA 1D3GA 3O07A 4MUZA 1AH0A 3R79A 3HPAA 3ZJ8A 4W9TA 2QZRA 3N2MA 1BD0A 4DNMA 1UJPA 3IJ7A 1KR1A 3CQJA 5ABGA 4YJ5A 3VDBA 4I8YA 3KM8A 1E51A 1R3RA 2A3CA 2VTFA 3HFTA 2REQA 1F3WA 1EPVA 3MPGA 1QPQA 4IZGA 5GQBA 1EJWC 4IF2A 4E2VA 3JZEA 1LJYA 3S1VA 3CWNA 1XBYA 1J8VA 5IFPA 1RD6A 4DZAA 4FZIA 5D04C 3W76A 3KDNA 3AXIA 1XRTA 1A4MA 3P74A 3GTHA 2ADAA 4R9XA 4XD6A 2BY3A 1UD2A 4MJZA 1KFCA 1RY8A 3WNNA 3QSTA 2BB0A 3VOIA 1ZL1A 2P50A 1TVNA 1HTIA 3HM7A 3RHGA 1EC8A 1UD6A 4Y96A 2ZA1A 2NV1A 4H1ZA 3TU9A 3O8AA 4JTAA 3CC1A 4C6KA 5LGZA 3QZAA 2QCGA 4AVNA 4BA0A 4HSNA 3RM9A 4J1OA 3I68A 4BEQA 3WQPA 3RPMA 5C7VA 3AQUA 1GW9A 4BF9A 3VFLA 2OEMA 3HPZA 2A6NA 2QXWA 3TKFA 1MDLA 4CNUA 1IE7C 1U5VA 1ZSXA 3M5VA 2C18A 3F4VA 2YW3A 4JTGA 4W5UA 3FHQA 3GUWA 2ZQ0A 2VFFA 1TVPA 1XLGA 2A3BA 3N2TA 5EFFA 3NUKA 2Y2WA 5LA1A 3NJ3A 3G1YA 1XUUA 1XICA 4D2JA 4LAKA 3EPOA 3ANUA 3ZQ9A 4WZHA 1S2UA 3KOZA 3BG9A 3BG5A 4K6AA 4QHRA 4KFNA 4U28A 1IT8A 3NO3A 4O16A 1YADA 1QNSA 1WAWA 5IFTA 2WJDA 3ZSSA 3TROA 1S2CA 1CW2A 5KMYA 1TPDA 2YL8A 4MPQA 1FHUA 2JGQA 2PAJA 2VD9A 1Z7AA 3P0WA 1JI1A 5CH9A 2G95A 3IGHX 4AZ5A 1MRQA 4BQ5A 2OQYA 1I2RA 2XH0A 4JIHA 2E6AA 4G9PA 4C6PA 2R6OA 1XL9A 1E0XA 1X7IA 1SZEA 5JU6A 1M7JA 3A24A 3RX2A 2PP0A 2CBVA 3WK2A 5C2GA 1N55A 4KEMA 2V3EA 3VA8A 5CGQA 4PMZA 3WFZA 4JTTA 4TV6A 3AFBA 5A3HA 1FWSA 3LHZA 1A80A 3RAOA 1P1XA 3IGXA 1TQJA 3LTYA 1N8IA 3TYZA 1RQBA 4JTHA 2WSQA 5I09A 3MY9A 4J35A 3P61A 2RDUA 2NVDA 5ENLA 5LNRA 1OJXA 1BQGA 5EY5A 3LBCA 4IUGA 3W6YA 1SM9A 3VOCA 5K9CA 1GQLA 3GIYA 2DZSA 1H63A 3EKGA 2CHRA 1MFUA 4M6VA 4Q22A 3AI0A 4TIMA 4L1XA 2NUXA 3IAPA 4B3ZA 2QS8A 3WNPA 4EIVA 2DH3A 3RPTA 4N9DA 3ARXA 2Q09A 5BXPA 4IH3A 1R3WA 3LCLA 3S2NA 1V77A 3UD6A 4DAFA 4N4PA 3SEPA 4ZENA 3G1FA 1CXFA 1DJHA 4B16A 1W3KA 2G4JA 3TN4A 3BQ6A 4OBTA 4XAYA 3KBSA 1XXXA 1SZRA 4IPNB 3ARWA 3FJ6A 3H7UA 2XM1A 1EIXA 1UP0A 1JPHA 2HNHA 3MUAA 3PN8A 3VD5A 3CWOX 1AA1B 1DJNA 4GOAA 4YTQA 4GC4A 1JPMA 2E77A 2JKPA 6XIMA 4X9YA 3C2FA 2Q8ZA 1Z9AA 2OMAA 3GIPA 1E6QM 3OGVA 4UQ9A 2P3ZA 4CN6A 2QJGA 3LCGA 2WSRA 3TAOA 3PR2A 2DEPA 3FSTA 4JN6A 4DJEC 3OTRA 2X2GA 3W6MA 4XAFA 4PUKA 3R8RA 1ADSA 1WOBA 4NAFA 5DEZA 4GYKA 3KVMA 4LAMA 2MANA 3BC9A 3NZPA 4BI6A 2EPHA 3B04A 1NDZA 3I7RA 3SW6A 4ZOBA 1ITQA 4BS0A 5C54A 3DBNA 1VF8A 3COTA 4NZ5A 1AZ1A 2WJFA 1FWCC 3R10A 1J10A 5CPQA 4YCPA 3E0WA 3SRKA 5JQ9A 3PFRA 2DSKA 3VNLA 1QO5A 1ZNNA 4GC3A 4BI5A 4UQDA 1PZ0A 2BGQA 1TMHA 2E6DA 2B0MA 1TRDA 3NOYA 3ANYA 2RGMA 4ZFMA 2V30A 4IHCA 3MSDA 2XSXA 5SWUA 4M7SA 1XRFA 1G0CA 5I23A 1TTQA 3IJQA 1ZJBA 3UERA 2GPTA 2OFJA 1XYBA 2OGYA 4KWSA 1GYLA 3B0VC 3UPBA 3SQLA 1QASA 2WXDM 2TYSA 3UXKA 1LOLA 1F07A 1YBQA 1VB9A 2UBPC 1LQ2A 3AZRA 3O7UA 4UNIA 1BEUA 3S1UA 1C93A 3VX0A 1FWEC 1SZGA 1Y7VA 3SN0A 2UZ9A 2XIQA 1XRSA 2QAPA 3ZWTA 4GXPA 4QNWA 3EDFA 2P76A 5I02A 1V03A 3FHAA 5LNWA 3SCQA 1C8VA 2E1WA 4BK9A 2VFHA 3R8GA 2DZBA 1RP9A 4GYJA 4H9VA 1IEWA 3CB8A 3H70A 1UCWA 3GQYA 2BVTA 3CV6A 4WHBA 4LWWA 5ECUA 1VIZA 1VBRA 4AZCB 2DORA 2PCEA 3WQ4A 3M0XA 3L4ZA 3LOTA 4RL3A 3MCOA 3EB3A 2ZZ1A 5I3HA 3S6TA 4BEUA 4QBXA 3CEPA 1CTNA 1TPEA 4RCXA 4UQBA 4AFYA 2WNQA 2DVTA 1LDCA 1REQA 1C3FA 3IIVA 2QV5A 2XJ7A 1BQCA 1CXIA 2PDPA 4PB3A 4YWIA 3SCNA 4ZZ9A 3HURA 4WSHA 4QROA 3QN3A 4LCQA 2CWXA 2EGZA 3EAUA 5H2ZA 2ZX8A 3H2AA 3TAKA 4UCGA 5AHEA 1XW8A 3SIZA 4C6LA 1U22A 5LSMA 1E0UA 4Q8OA 1ZBCA 4Q33A 3CWHA 1GQJA 3M64A 1JYWA 1YXYA 3FX4A 1HKWA 4MLJA 1S5MA 4GO9A 2WK2A 3KCLA 5I6SA 1F4HA 2GJLA 2J66A 3CLWA 3BTNA 3CQKA 2J79A 1Q7ZA 1XYZA 1AL7A 3HQOA 4HK5A 2YDAA 2WWCA 1V93A 4BQ3A 1ODUA 3LS9A 4RUBA 2NSOA 2HK1A 5C9RA 2ON3A 1L6FA 4M6UA 3ENLA 3AC0A 4S3CA 1ICQA 3A21A 5CLWA 3WYZA 4C5ZA 2D73A 3WNKA 4E8CA 1TX0A 5F1UA 3VIPA 4JX4A 2EO7A 3MSRA 2NZLA 4LNYA 1I9CB 3FA4A 3THUA 4OECA 3UCCA 4RW5A 4CD7A 5TBOA 1Q6CA 4M1RA 3K4WA 4O17A 3WH7A 5B7ZA 3C86A 1DXFA 3T78A 3M07A 2XN0A 2WBKA 3THAA 4QAWA 4FX6M 4JFUA 3NQDA 3V75A 3DGRA 1K1DA 4MZ8A 3EXRA 1KFJA 3DAQA 4GY0A 4ZR8A 1DIOA 3E5PA 2FVMA 3N14A 2FLIA 2FFCA 3M7SA 3T2QA 1KXHA 3T0TA 4CU8A 1V3IA 2W27A 4KF1A 3TCSA 1MQQA 4QJ5B 4XD4A 2EJAA 3LX9A 1ZY9A 5HMSA 1SO6A 3GFYA 1CGUA 3A3WA 3URBA 3PG9A 4FALA 4Z17A 3L0GA 2PD5A 3M1ZA 3NL3A 3TV8A 1E72M 2YSWA 1ZP3A 2DJXA 4O0QA 1M01A 3V18A 3V3WA 3DI1A 1HL2A 1WDRA 3TZNA 1VP5A 2OT1A 5HJXA 1VHNA 1FTXA 4MB3A 5EGRA 1Q7QA 5K4XA 2OQHA 3RLHA 1NFBA 3CH0A 4JY8A 2GDVA 3EX1A 4OQVA 3WDRA 1GVFA 2WKGA 3WELA 3NVTA 4C6MA 4HD5A 1GOWA 1RZMA 3M41A 1PTGA 2YW4A 4CNSA 5D4YA 2ZXBA 4JTJA 1Q45A 2PGEA 3DHDA 4XZWA 3I6TA 1WOAA 2CETA 3IUDA 4O1BA 3S9YA 4AY1A 3DZ1A 4LUTA 2DP3A 4DHGA 2NT0A 2H8XA 2DUXA 2WLZA 1OQFA 4D8LA 3BW3A 3SADA 1NM9A 1XR2A 2GUYA 3OA3A 4A21A 2A4AA 4JL2A 1J2WA 3LUTA 1OGSA 2CLPA 2YGYA 5H8MA 2QIWA 3ZLGA 3B0YA 2QJMA 1GOOA 2XVNA 2I5IA 3B8WA 1O95A 5IBXA 2OSYA 1TJ1A 3VM7A 3ZS4A 4IG2A 5XINA 3V1PA 1JZ8A 1AL8A 4B90A 1QHZA 1HG3A 2BWGA 3LCXA 4M56A 1TV7A 5DFAA 3KTCA 5F2IA 2VGBA 2H3BA 3IPWA 2ZWYA 1OCBA 3MVTA 1GORA 1VJIA 3CL6A 3EA2A 4A2SA 3M16A 4LYKA 1QPOA 1WYIA 4MHBA 2Z1SA 1M7PA 1ADDA 1SQ7A 4FPSA 3F1QA 3G1DA 3N13A 3C2VA 2PURA 2ZRZA 4NI3A 1GT8A 4AXNA 4IMFA 2VZOA 3UW6A 4KPLA 5E09A 1XFBA 3F5JA 4IICA 3OPSA 4N9BA 4ASTA 4E3TA 1PBGA 1SFSA 3KRBA 1K77A 2D24A 2ZDRA 5A6TC 2C1IA 3OODA 1FUYA 4ML4A 5GVJA 3W7MA 1DWHM 5EMUA 5EMYA 4L6OA 3P93A 1IR1A 4I9JA 2OU4A 3B4UA 3WD1A 4OJYA 3QW4B 2VWTA 2CKRA 3PJWA 3CV7A 2Y5JA 2J8FA 1H62A 5BWFA 4ZB5A 3WBYA 1YYAA 2BX7A 3QMTA 1LRQA 4NJIA 2OWCA 3LD5A 2NWRA 1K9FA 3CUHA 1HO4A 1UKQA 1E6XM 1WA3A 1IXNA 3EWCA 1V3MA 3N4EA 4S3AA 1PHQA 3B4YA 3W00A 2VR5A 3WJZA 3CIVA 4S3JA 4TXEA 3N04A 1PTAA 3LPPA 1QI0A 3RLUA 3DHUA 2ZE0A 3T09A 5FA5A 4HCHA 1EDGA 1TVLA 5AVHA 1FXQA 3QC3A 4GMEA 1J0ZA 4W87A 3B03A 2QULA 2CITA 4KWVA 3GYCA 2WSKA 2NW0A 4NVTA 3QR1A 1JEZA 3S2MA 3HA1A 3K1GA 3KBMA 4JOMA 2PDNA 4IISA 4S2BA 1B3XA 1FWAC 3BVJA 2QEZA 3RPDA 3NO5A 3PWAA 7CGTA 1D2KA 3GG8A 4LV9A 3ZR5A 2VM8A 3WF0A 2V68A 4UIOA 3O16A 2J25A 2G0WA 4LUJA 4C1KA 4LVFA 2ICSA 4MWAE 4WSJA 3DFNA 2A85A 1HJSA 3JU2A 4X0NA 3WF2A 5G2HA 4J40A 2NX3A 1ZAHA 4HN8A 1CX9A 4O1CA 4LUTB 4PMYA 1BXNA 2Q02A 2BZNA 2PTYA 1Q66A 3B06A 1IWPA 2OEKA 4QTGA 4EPKA 1F4AA 1R3QA 4KMQA 3ELFA 4TX8A 1SMAA 3PNZA 3VINA 3MHUA 1PJ9A 2PDYA 3NYZA 4IIFA 4CCCA 3GNOA 2QCCA 4PEKA 1RXOB 4ZE5A 3KHJA 5I07A 3MJMA 1OFQA 4IFKB 2XM2A 4JQ3A 4M6PA 1W3TA 3K8MA 4AWEA 2QKFA 1JZ6A 4ERAA 1R7AA 1P6BA 2OODA 1KWKA 2RDWA 3N12A 5DY2A 3VC5A 1JFHA 3BOXA 3BOFA 4K7YA 1CGVA 3KTXA 3WLNA 3VDCA 3UYCA 3TYDA 3TCEA 4W8BA 1C90A 2FTYA 3GG0A 1J0JA 3M0ZA 3OIHA 1HL8A 2INZA 3WDQA 5DN1A 3S2CA 3KDOA 3GDMA 5F2MA 3KL3A 1LL7A 2G4FA 1KM3A 4ENLA 4BHYA 1JCTA 2AL2B 5KZDA 3CBWA 4F2UA 3QY6A 3S3GA 1J2BA 1O6IA 2ZYFA 3WMCA 4M5PA 3QQ1A 5BRQA 3QV6A 4GQRA 3GVWA 1DOSA 4JIPA 4UNKA 3MV01 4HK7A 1T5AA 3NZRA 2J7FA 2Y7EA 3VCCA 4RX0A 1JYXA 4ZQOA 3EPMA 2CW6A 4RLIA 5JIWA 1GOIA 3NQEA 3QPZA 4Z1YA 4MLRA 4LT9A 4AD4A 4AVOA 5DY3A 4RNJA 3SGUA 3DHPA 1Q2RA 4PC8A 2CLFA 1A5UA 2O0TA 2NVCA 1L6GA 1OF8A 3R0KA 1YE4A 1GQNA 4OKDA 3P8JA 1M7XA 3W6LA 4NAEA 1VYPX 4EF9A 1XLMA 4B4FA 3WSUA 3RGTA 2I16A 3QV7A 3MWCA 1FWHC 1AJ0A 4JQ1A 5AYYA 3UU0A 2POTA 4J28A 2NQLA 3TK7A 4MOZA 3CB3A 1W3NA 2C16A 1Z42A 2BNJA 1XSIA 2D0HA 1SZFA 5DF0A 1E0WA 3BLPX 1HNYA 3DERA 4RNFA 4S3BA 1EB3A 1OM0A 1KTNA 3VFCA 1X6LA 4HU0A 3I4EA 1K4GA 2OR2A 2Z1BA 3EX6A 4J5NA 1GCYA 3TYUA 1E73M 3DFSA 2JFEX 3II1A 1H09A 4AX6A 3MUZ1 1HGWA 3LMZA 3FFSA 3SZ8A 1MQRA 3QGVA 3B97A 3RU8X 2ACUA 4KIEA 3MI6A 2B31A 3LEPA 3F4CA 2YX0A 1DE6A 1UWQA 3DFYA 4M82A 1T0OA 1GG1A 3TQ0A 2PDIA 3R1ZA 2FYMA 1HP5A 5EKYA 3OZYA 5A8NA 5HJYA 4OE7A 3CPGA 5HANA 3O0KA 5HWJA 3SDOA 1OX4A 2Q8LA 4Q8NA 1K8YA 1A5LC 1TJ2A 2VOTA 5PTDA 5DXXA 3ABOA 3QTPA 3CZLA 1V4YA 4IXXA 1MW3A 4ZVJA 2CZFA 3N15A 3NSMA 3SRFA 3DX5A 5G1MA 3SBFA 2WNWA 1MVYA 2W66A 4MB1A 4RK8A 1NF7A 5D33A 3TE9A 1RHCA 1MUMA 4FLOA 4A2RA 2OLAA 4TR9A 1ZALA 5BOOA 1LLWA 4HOWA 2MNRA 5M5DA 3AHVA 1EL3A 1GHRA 4A4AA 4L6HA 4XB3A 1ME7A 3LV5A 3NA8A 4YNGA 1JQXA 4EPBC 4NQ1A 1KC7A 4RDYA 1TWDA 1MUCA 4PCNA 2WMJA 4RE0A 3ITGA 1DHPA 3Q58A 4XZHA 3EOLA 1UD4A 2UWFA 5AY7A 3AYRA 4DUWA 3U6WA 4ADUA 2DW6A 1DEDA 4C6NA 1OIMA 4TTGA 5CPNA 2ZA2A 1TQXA 3P62A 2WHJA 4DUVA 3AS0A 3G3MA 1UA3A 4WSKA 1WBJA 3MI2A 1KXQA 5CSRA 3CM4A 2OKTA 3Q37A 2NUWA 2VEPA 2O55A 3F4NA 2ZA3A 1CLXA 4W88A 1OWQA 4LX4A 3OU8A 4NIRA 4AZGA 5D9NA 4AQLA 3RLVA 2VMFA 4OBRA 3QF0A 4L6DA 4N2YA 4MB5A 4J2PA 4W8LA 2YXXA 4EANA 4K36A 3ABSA 1O7AA 2V6AA 3SN1A 4P8VA 4OT7A 5TIMA 3VE7A 3WFAA 3NQ2A 3HB9A 1FX6A 2XDFA 1KM5A 4O1DA 2VUNA 3PVFA 1TTPA 1LT8A 1NP0A 1OG0A 2R1NA 2GQ9A 1DQXA 1RA0A 4QSHA 2HE8A 1E5JA 1VLWA 2J8GA 1IWBA 3ABQA 1SO5A 3T08A 4NXSA 3LCIA 4GFSA 3VMPA 2V5DA 1UJQA 3W02A 4IQDA 1A5SA 3RU6A 4JNZA 4PODA 3TW7A 3L2MA 1FDJA 5LIKX 5H91A 5TD4A 3W7KA 2R91A 3RFAA 5DX7A 1JIBA 3MYOA 4QG9A 3QMSA 2IQDA 3V36A 3TUUA 1EJSC 1SR9A 2VFIA 4G8TA 2YCLA 3S1WA 3GDBA 2NX1A 2V2CA 3KL0A 4P61A 3S9ZA 1UH3A 2C7FA 3V0TA 1BWVA 1GVYA 1ODZA 2CLMA 2VGGA 4NILA 2ATMA 3UJ2A 3WG6A 1M53A 1FP8A 2A79A 1QAPA 3GKAA 4AF0A 3ARQA 1NP2A 1DYSA 4H01A 4EX4A 1EXPA 3WJYA 1V6WA 3VZYA 3AOFA 1PVNA 4FNQA 1MEWA 1XLFA 4TVUA 3AIWA 4DM2A 1MZRA 1KXTA 5H8UA 4IP7A 1GNXA 4IX0A 1A5OC 4QCEA 1E9IA 4FIQA 3WBXA 1EKOA 5CLTA 2W62A 1DTUA 4PYSA 3T8LA 2GQ3A 3W9ZA 1B0IA 4OUEA 3NURA 3S42A 2B7QA 4JTIA 1O60A 2Y5SA 3TDFA 4LBUA 3IVTA 3BLKA 3NFUA 5AOUA 2BXZA 3CMJA 3SFWA 8XIAA 5D37A 2C3ZA 3UJSA 3V35A 4JTEA 3CUZA 1VJZA 1XIEA 3VNDA 1XBZA 2F8QA 4IGNA 3S5OA 1W1IE 4UR9A 3GG1A 3PBVA 1EFZA 3BAYA 2FJKA 3W1QA 3TMLA 3F2BA 3W72A 4LS2A 4EAYA 2WCGA 4REQA 3W82A 3TYAA 3STEA 5DCDA 5GJMA 1K9DA 3SIMA 3ONCA 2ZXDA 2J6XA 1KM4A 3ARTA 2B4GA 3V5OA 1L9WA 3PBWA 1NWSA 3WLPA 2Y0FA 1OG6A 1PXGA 3B40A 2JBMA 1C9DA 2HBXA 5AHLA 2PRLA 4Y9MA 2VX5A 4WKHA 2CWNA 9XIAA 5A6BA 5D2TA 4Z1AA 2XVLA 4FXRA 3I7QA 5CZJA 1JUBA 4J9JA 1R3VA 1T6MA 1U5HA 5CJNA 3A4WA 1LROA 4K2SA 3AIRA 3RCMA 1OCJA 2BV9A 2XZ7A 3MMTA 4S1FA 3VIGA 4O1FA 4I3GA 4HKPA 5BMXA 2BP1A 4C6CA 3S8HA 1ITXA 2GVJA 2YBTA 3SUSA 3W2KA 1I2QA 3CTLA 2VC9A 1MO0A 1K8ZA 1O5RA 1OYCA 1DWIM 1RSCA 4EXQA 3HQNA 1VBGA 1W37A 4DI8A 2NLIA 1O5QA 5AC8A 2OT0A 2OZ8A 1CCWB 1HW6A 1ESWA 4I5XA 1H7NA 3UQNA 3S6OA 3O63A 3N2CA 2X0YA 3VZZA 2ZZ6A 4Q4QA 1VR6A 4IL0A 1LQ0A 3DXIA 3RNDA 4PRRA 3OVPA 3TJLA 2CLHA 4PMUA 4HU4A 3B0XA 2C13A 1RJRA 1R8LA 2HPIA 1SU5A 3ZM8A 4V1XA 1F61A 1BLIA 3DG6A 5A6SA 2H3DA 3B0UX 1SR0A 3BQ5A 5FSEC 1E1CA 1RV8A 1XKYA 2ZVIA 4GO8A 2GVYA 4JN7A 1K8CA 1YHTA 4LUIA 3FS2A 1FXPA 1Q3NA 1DJGA 3EXTA 1E55A 1GKRA 3EXSA 4YHGA 1QTWA 1F05A 3NZQA 3TN3A 2HRWA 3ZJ7A 4LVBA 1AMYA 3LY0A 3ZVHA 2YCLB 3K4DA 4ZEPA 5D38A 3TQPA 1QO2A 3FK4A 3PPFA 4DWSA 2NV9A 1I2OA 1YKWA 5ECVA 4QNEA 2BY0A 5HWNA 3TWAA 2BVYA 3KBNA 4LUSA 4B4HA 3MUIA 5A5WA 2F6UA 3ORWA 2W4XA 3ECQA 3IJDA 4RPPA 4DZIA 1TWSA 1Y5WA 4AF0B 1UB3A 2J9XA 2XIBA 3Q65A 4LH8A 4MAVA 1HT6A 5I78A 2E8YA 2FVLA 5LIYX 2ZICA 5FF7A 2CIPA 2IKGA 2BG5A 3W7JA 3VKJA 1AVAA 3IIXA 1SGJA 3KOFA 4B2DA 4KCUA 3V1HA 4I5UA 3S5ZA 3JUGA 1W0MA 3PUDA 4GVGA 4Q4PA 4FB7A 4HSOA 4AUBA 1V3LA 1TTIA 4TOQA 1J79A 3SCWA 1WPCA 2Y85A 2R24A 1UD5A 5C9ZA 2PDKA 4KWOA 5A2BA 4AY7A 1F73A 2ZIDA 1HKMA 4ZGYA 3GS6A 1XIGA 1YTKA 1HP4A 1NWUA 4W86A 3VMNA 2Y62A 4HOZA 1R3SA 2AKMA 1JNEA 5HMEA 4B5UA 1VPXA 5LIWX 1DBTA 2DSWA 3KRZA 4IL2A 5C2XA 2WVVB 1LWHA 3KVJA 2Z28A 3OA5A 3EEZA 3M6DA 3WN6A 2QUTA 2FPTA 1XISA 2GK1B 1V08A 3C6CA 1X6NA 3TMQA 5DMNA 1EJVC 3R5EA 1TPWA 2AGKA 3B9OA 4KCTA 4FOJA 3VIIA 5HNRA 1WP6A 4GINA 2VX6A 2PC4A 3VUSA 3F7JA 4MY9A 3E3HA 5MKGB 4XVEA 3WJXA 1OZQA 5JH2A 2GVEA 3BK0A 3H26A 2BLEA 1O1HA 3N6JA 4XTDA 4Z2KA 4GI8A 4ZTXA 4HTYA 5HPCA 5FEWA 2J74A 1CWYA 1IEIA 3GNNA 4LF1A 2X1IA 1NF0A 1VYRA 4ZQCA 1WUFA 1JCXA 5DT5A 3L9CA 1DQWA 1IEVA 3C52A 5FEXA 3F4DA 3R11A 2NUYA 4L56A 1VBUA 4JIIX 4L9YA 2Y1HA 1W91A 3U48A 3QFWA 3M5ZA 1B90A 1BPLB 5D2XA 2D0GA 3AJXA 8CGTA 3PZ9A 3LHTA 1V6YA 4EACA 4NG3A 1C7SA 1IIHA 1X38A 2VHLA 4HPGA 4C1NA 2CLKA 2ZUWA 4IPPA 3VD3A 1LT7A 1QW8A 3C3NA 3G1HA 1F6YA 2ZKMX 5AHMA 4XO6A 4BZYA 5ABTA 4JTUA 3M0JA 1VEMA 3VDHA 4U33A 1FWGC 3MSYA 3QFEA 2FZ8A 1E1CB 2VDGA 3NL6A 4S3FA 4A6GA 3QGAC 2EPMX 4NP7A 1J0YA 1SO3A 3CAKA 3P5YA 4FO4A 1JDEA 1DJZA 3ZO9A 4EWJA 4L4PA 3BSHA 2HVNA 4AWUA 4B15A 3HGJA 2RDXA 2NWSA 4QFUA 4QCFA 4IMCA 3WD4A 2BDQA 4QISA 1GW1A 4WDWA 3ES7A 1UQYA 1H11A 3MCMA 2W91A 4DWSB 1IEQA 4FEZA 5CBIA 4PTDA 1HZYA 5GPRA 1A5MC 5HR7A 4LUSB 2PDFA 3EKZA 4L4LA 2XGIA 1TA3A 1K6WA 4WJEA 2WKJA 3ZMRA 2TMDA 1V0LA 1UG6A 4IIHA 4ZODA 2FZMA 3WLRA 4AD0A 1WZLA 3R25A 5BXSA 2XFRA 2ZRYA 2X1UA 2R1MA 3QYQA 4NJJA 2DQXA 3THQA 5FJRA 3MO7A 4J2MA 1VC4A 2EG6A 1HGYA 1OYAA 5AKQA 5BU9A 3A4XA 1PSCA 4V1YA 3ZWSA 4XWUA 1VZWA 3MKKA 2ACQA 1G5AA 2EPKX 2VC5A 2XIJA 4ZQNA 3T42A 2B81A 3RX3A 3G1SA 3D3AA 5CPLA 2XG9A 1V8EA 1BAGA 2VURA 1EEXA 3NPWA 2XSAA 5BOFA 3IS4A 3MI3A 5KSWA 4EPEC 5CC5A 1FH7A 1LG1A 2ZADA 4LANA 1S46A 4ZE4A 1Q6QA 4M6QA 2F9RA 3ALGA 2J7HA 3BURA 1V02A 5IXEA 2DUZA 3VNZA 3E1F1 5FJUA 3EWYA 3MP3A 5FI8A 2D3NA 1CIUA 3PZUA 5BZAA 4D1IA 2PD9A 1WUEA 4RZ4A 4CQ9A 3PUOA 3QLDA 3U4FA 2QGYA 4U10A 3ATZA 2R9RA 4CCZA 4BQ2A 1MXSA 2F84A 3MZNA 4GYPA 2OZ0A 3N4AA 2UY2A 1LQAA 2Y8UA 4WR3A 1EJ7L 1UKSA 4ES4A 5EMLA 3PB2A 4I7UA 1UR0A 3NNTA 1ECQA 5C55A 2H6RA 4XISA 5F4XA 5C7HA 1XC4A 1FWRA 4M1BA 2YCIX 3NIYA 1FFRA 1FY6A 3CIXA 1J12A 4OZOA 3AU6A 3AICA 1E0TA 1N2VA 3CYJA 1W2VA 2PBOA 1ONWA 4Q4SA 1SJAA 4Q7IA 1PL9A 1KGUA 4CQBA 2C6QA 4JKLA 3PJUA 1P6CA 2NVAA 4AAJA 5BRBA 3FIGA 1C9WA 3GR7A 5K9XA 4AHPA 3AISA 3V0SA 2CBJA 2WBGA 1E5NA 1A47A 4F4RA 1ZCCA 5BXRA 4OV9A 1UP2A 4C1NB 4OOZA 4PBFA 1E56A 3MA8A 4LJ3A 4CQAA 4O13A 1W3IA 4FXFA 2PGFA 1EA0A 1SJDA 2I9UA 2ZWZA 4L9ZA 2V81A 4I90A 4DNHA 1BWLA 4CNNA 1XWYA 4ROPA 4S23A 3MTWA 4MKSA 3RITA 1XLLA 2TSYA 5DRIA 2RKXA 1OBAA 3HIJA 1JCMP 2ABAA 3APTA 3RIKA 2XFYA 3B8TA 4LNCA 1OINA 2QCMA 2OKOA 3QHNA 4KETA 3WQOA 4IIDA 3KFTA 2VZTA 2VENA 1G6CA 3QPEA 1EA9C 3T4CA 2AMXA 2J77A 1GGOA 3UR8A 2BGSA 1P48A 1NSJA 3ZLFA 1QW7A 1DE5A 1FA2A 4IFRA 4I6VA 1TA3B 4UTKA 2G5WA 1IGWA 3L5LA 4JQ2A 2IUZA 3W37A 4LYRA 1MFVA 3DYMA 4WK9A 2C91A 2D20A 2J6VA 3C56A 3WIJA 1QNPA 5M3WA 3W2NA 1WE5A 3AIUA 1QPRA 3YPIA 3PZVA 3OO2A 3EOUA 3WBWA 1UWAA 1CI1A 4H7ZA 1KCXA 3WLHA 1THFD 1WQ5A 1XYMA 2Z1VA 4HNNA 1H5YA 3KZPA 2I5GA 2YA0A 2VDHA 2GSJA 4HN4A 2Z6IA 4HNTA 3MDWA 4HHMA 3WQWA 3C2OA 3W74A 1V7AA 3BSMA 4D6HA 2YCKX 3CZ8A 4Y6GA 2GL5A 1VFUA 4FXSA 5C8BB 4LBRA 5C9UA 2VZSA 4JYDA 5A6AA 3UXLA 1MZHA 4Z42C 1UZ4A 3QV8A 2CHNA 4DRSA 5HUOA 1W9UA 4KW2A 5E0CA 2I14A 1CXLA 4HZ8A 3OP2A 4G7EB 4QITA 1UP3A 3VTRA 1U1HA 3G18A 3LI1A 3KE0A 2WMKA 4EKJA 3DFPA 3H12A 3IJ8A 3WEZA 1C91A 3U9IA 3DIPA 1OK4A 3HFYA 2B7OA 4EPDC 3WK0A 3B9AA 3E2VA 3OLGA 4AIBA 3UESA 2Z1XA 1YNQA 4DO5A 1JR1A 4F66A 1VFHA 2YBUA 4UFHA 9RUBA 4KBXA 3MHGA 2DZXA 4RW3A 1BGAA 4LYPA 2FHBA 2P88A 3RJXA 3VNYA 4TO8A 4JIQA 4JS3A 4LEQA 5FD0A 1BRLB 4QQUA 3CNYA 4UC5A 4L1WA 5HK4A 3RJYA 4D8AA 1PX8A 2R82A 3U5YA 4E5TA 2CC0A 1U30A 4D6DA 4JQ4A 3A5VA 3UY7A 3GH4A 3N9RA 3K13A 3JVAA 2FDSA 3TWBA 2A2IA 3MMWA 3WK3A 4TX6A 1S1PA 4PH6A 3H2EA 4WY0A 3PHAA 3DFOA 4UZUA 1JFXA 1GQIA 2WW5A 5HOSA 1BKSA 1WXJA 5C9XA 5ABEA 5JMUA 1IXPA 4HNOA 5BYWA 3PPHA 5FF0A 7REQA 3H7RA 1PZ1A 1RA5A 3FA5A 2WPGA 3AUOA 1M5WA 4DYJA 1C92A 3I3BA 3NM1A 4PRWA 5AHNA 1EPXA 2X7WA 4KKXA 4ZO6A 4GUIA 5T26A 1X7FA 1QBBA 4YTSA 2EF9A 1TUFA 2CERA 3DOPA 3T1GA 3ZZ1A 1TR9A 2E0PA 1EC9A 1GVSA 2YB1A 2VC7A 3W2LA 3AXHA 5HQEA 2FQIA 4ZO8A 1HFBA 3AMGA 1XLHA 3EMZA 2OWXA 5CJ5A 4PMRA 5LA0A 4FX8A 3PF3A 1BGGA 4ZXLA 4GUHA 3UJFA 3QGKC 3SI9A 4PTNA 2D22A 2VWSA 2CHOA 4NHVA 2R14A 3GVRA 1KBLA 4XZLX 3F5KA 3M0YA 6ALDA 2YA2A 1JXKA 5K4ZA 1ZGDA 1Q2SA 2VKZG 4JTKA 1KM2A 2ZXQA 4OV4A 1EDQA 4JYFA 1FOBA 1XD1A 5D8WA 1EO7A 1JDCA 2HMCA 1I1WA 1HUVA 3W83A 3E9AA 4PULA 4DWDA 1Z48A 3KBJA 3UPMA 1GYNA 1A5NC 1TSIA 1XSJA 2V69A 5AC4A 3NL5A 1O5KA 1F8IA 1LOSA 3WCZA 1ZAIA 2PTDA 1JDAA 1K4HA 5L9FA 3G22A 3MVIA 1A49A 4E38A 1QNQA 4ZL1A 7A3HA 2GQ8A 1UWUA 1H7OA 2G3NA 4QG6A 1UUMA 3F4WA 1ITCA 3OZMA 4O14A 3CJPA 1CNVA 2CZ5A 2HTMA 2J47A 2G3IA 1E4MM 3N34A 3AZTA 3W7EA 3NPXA 2W63A 3TJIA 2PDUA 1CXKA 3DYOA 3QLLA 4ACZA 1RPKA 3G3DA 2NSXA 5ABHA 3BCJA 4MWAD 3OBKA 3VDAA 1DJQA 1J11A 2EBNA 3DECA 5AYIA 3FY1A 3CXOA 1XQLA 5A8OA 4H6KA 2PWGA 3BZGA 2XGBA 3W1MA 5GNZA 5A6MA 3CO4A 4POCA 4DBUA 1UMYA 2PA6A 5K7JA 1IGSA 1B3OA 2VOMA 1GJPA 1NU5A 4WIWA 1H0IA 4J3VA 3KX6A 4C5YA 3FV9A 1JGMA 4XZNX 3XINA 4RPQA 4GY1A 5DO8A 1W1VA 4PCPA 3ICJA 4AWTA 2A21A 4BWLA 3GTFA 1NFPA 4C1LA 3GC5A 4C91A 4E2DA 3OLEA 3B8IA 2VELA 3H24A 3PAOA 3CMFA 4O52A 3QHMA 3QV9A 3D0CA 5DMYA 4XKYA 4O18A 3URAA 3B3DA 3FEQA 2Y61A 3GDTA 3UWEA 2WSPA 4PA8A 4WY0B 2H9AA 3ANVA 3R13A 1C8YA 2PGRA 3CH9A 1G69A 3U3HA 4IGSA 2WMGA 1OC5A 1H7PA 4QRNA 5HMDA 2AQVA 1CB7B 4JFTA 3CTTA 4OIFA 3U2OA 3LQLA 1BYCA 3FGCA 1M1BA 4MY8A 3FVMA 2P3EA 1WZAA 3MC5A 2R1KA 1ENUA 2VC6A 5KETA 3WQVA 4HHHA 2ZZ4A 3JR2A 3HQ1A 2SFPA 2YLAA 4TX9A 5GNYA 6PTDA 2W67A 3OGSA 3O06A 2ATSA 5TF0A 4S3KA 3ITOA 5IHRA 3W0KA 1NDYA 1CLKA 4AC7C 4DBDA 3N4FA 4C60A 4H83A 4L7ZA 1JG9A 1T40A 4GQ0A 1KQZA 4NNBA 1I1XA 3M43A 3LGDA 3CGTA 3M6YA 1ISZA 1EP1A 3D5HA 1PPIA 4Z08A 2FGBA 3V0UA 3EWXA 1XLDA 4XKMA 3AMDA 4NZ1A 3LSCA 1JJKA 1IR2A 1NTHA 1GZ1A 4RE4A 4X2RA 4ZOCA 1S3HA 2V3DA 4GXMA 3W7NA 2X16A 1YTDA 2PLKA 1ICPA 4GXWA 2G96A 4XK2A 2PDBA 1XS2A 3TEVA 3UCDA 4WRHA 4R27A 4L5ZA 3TTEA 3QRHA 4O11A 2WB5A 2WCSA 4I7WA 3EX4A 4UOJA 4UMCA 1V3HA 1XLKA 4PL1A 4NX0A 5CJMA 3KRSA 2X7VA 5BWAA 3STCA 1DXEA 4B5SA 1ZU8A 4QJ4B 4U3AA 3URQA 5EBAA 1ICSA 1Z89A 7TIMA 4Z2IA 1M65A 1LWJA 1X1OA 1SFLA 2FH6A 5L6UA 2VT0A 4NU7A 3G24A 1DIEA 4HK6A 3G1XA 2ZRWA 1HO1A 3WQCA 2P8BA 3UNTA 1F9CA 2O9OA 4HMNA 1QOQA 3QKEA 1VQTA 4GYPC 3TW9A 1JF6A 3A3XA 3PBGA 1RY0A 1RPXA 3VKCA 1B3ZA 3KWXA 1NOUA 3AMKA 3BAWA 3KP1A 2J62A 3O6AA 2E40A 4JIRA 4EK7A 1E9YB 3LK6A 3CQIA 3LRLA 3OBAA 4FHAA 4DVOA 3OVGA 1FRBA 2PDMA 3DFHA 2ZOXA 1WCGA 5A6JA 2VGFA 1QNOA 2I56A 2XVGA 2Z2UA 1Q8AA 2BHYA 1XIJA 4LB3A 4RV8A 4E4UA 4NRSA 5CGMA 2VQUA 3EBVA 4KWUA 3TC6A 1AD1A 2A6LA 3DH7A 2GGHA 2A7NA 4CD8A 2V82A 4QAIA 3E6EA 1X1NA 4Q4MA 2GVGA 1GJUA 3HV9A 4D9PA 3APGA 4XIAA 1SW3A 2YLLA 3GDKA 1L8NA 4AW7A 3WZ0E 2H9AB 3ZSTA 1P0DA 2WHLA 3MHFA 3PS7A 3RO6A 4BCEA 2PF8A 3T0CA 2PDCA 4IGHA 2QUMA 5EYWA 1AD4A 2GVLA 4GLEA 3FGCB 1TKKA 3WL1A 1EOMA 5REQB 1PE1A 3T0BA 1X8CA 2QJHA 4PUWA 1EBHA 1SVDA 4O53A 4PRTA 4JTSA 2VFGA 3CAVA 1AK5A 5IHSA 3IAQA 1Q4NX 4CN4A 1R86A 3L2LA 4NASA 2PTXA 4L61A 2F7FA 4FF5A 3F03K 3UGRA 3DG3A 3GXNA 2WC4A 4KGLA 3REQA 2VDIA 3BCDA 1A50A 2WNZA 3P3BA 2EPNA 5A2CA 2Q6ZA 1ZJAA 3NPVA 2ZC1A 4PMDA 2DY3A 5TQLA 1OFAA 4W7VA 3IIPA 1RBOB 3ITLA 1IXOA 3CUGA 4K39A 2DT1A 3GXDA 4X61A 3RO8A 4HZ6A 1FWNA 3UJRA 5FF4A 3GKFA 3WLOA 2FB3A 3UG8A 3LM3A 1OFPA 4PTMA 1JI2A 4RV3A 4B91A 3EWZA 5C70A 3R4IA 4UWMA 3K30A 4MWAC 4OBSA 5FF3A 3THDA 3EWBX 6REQA 3N2XA 4UFIA 1AJ2A 3GIQA 4HHPA 4QS6A 1A5AA 4UTIA 4DX3A 1JVNA 2OYKA 4NY2A 2UY3A 5CXPA 4AHQA 3UEQA 4FIRA 4W84A 2TPSA 5D09A 5GJNA 5TAOA 3W7PA 5D05A 4QP0A 1ZFJA 4L4MA 2G50A 3UZJA 4OOUA 1EQCA 2PTZA 3P67A 3SO7A 3ZR4A 4D6FA 1XPYA 4R7OA 2QYGA 2DIEA 4MADA 4IP5A 1TV2A 3UG5A 1R30A 2BHUA 1KTBA 1R87A 3AO0A 4DY1A 1OFRA 2AGTA 4Q8QA 5CPOA 1AW5A 3BSGA 4CKQA 1E15A 1KFEA 3ATYA 2D2GA 2RJGA 1OGGA 1V3JA 1E70M 1E3ZA 1D8WA 3N17A 1MWOA 3CPUA 4L65A 2HSAA 1ME8A 3SSZA 1KRMA 1JQVA 3EOOA 2Z24A 3KZSA 1XCXA 3MUCA 1EC7A 4N42A 1ISVA 5C71A 3OIXA 4F0SA 2PODA 1YQ2A 5EL1A 4JFSA 2A5HA 4XZ9A 3PUEA 2QCFA 1UWSA 4MDOA 3VIMA 1F6KA 4Q8WA 4LS1A 2QPUA 5HMFA 5E6YA 4CD4A 4URIA 5EMKA 1XLAA 4RDZA 2QAFA 5AC5A 3GD6A 4DI9A 3IRSA 1D3HA 2DPEA 2ACSA 4IGMA 1XPGA 3CMGA 1RVGA 3AIEA 5IDIA 3T4WA 1KGWA 5BW6A 1OY0A 3HU7A 1XDMA 2V5LA 4YPJA 4UR7A 3D46A 1TRIA 2C79A 2EEXA 5CC7A 4PTVA 1WBHA 1H51A 4AYSA 4HPJA 3E96A 2QV4A 3N2OA 1Z6KA 6ENLA 2YDQA 2BY2A 1A0DA 1KTCA 2IXUA 4S2CA 3PZIA 3CHFA 4IJCA 3G0UA 3OZOA 3FLUA 3IUHA 4FI4A 3S5SA 3L4YA 3SRDA 3TLQA 4AZCA 5DMMA 4ROQA 4US6A 3MS8A 3R0UA 1PIGA 2PTWA 2YZRA 2DT2A 4GGBA 4HYWA 2EHHA 2XTKA 2EG7A 1CGXA 1K8XA 1U83A 3OZPA 3ZVIA 3H53A 2CFFA 1U2YA 3HQPA 3WD2A 2QCDA 4C6IA 3W4RA 1YX1A 1EHAA 5K2ZA 3W88A 1H3GA 1LUCB 5J5RA 1LOQA 4HPXA 3STGA 3R43A 3S46A 1OFBA 1OGBA 3TVAA 1EX1A 4I9TA 3UBPC 1AQMA 3EA3A 3O6DA 4PTWA 2E3ZA 5HR6A 3REQB 4X0VA 5BMWA 2HPMA 3HO8A 2WPBA 1R47A 1KFKA 4JICA 5B80A 3QKZA 2YCEA 3NDYA 1WKFA 5H6HA 1RCXB 5KZMA 1FQ0A 4MY1A 2R1PA 2XWEA 5D30A 2VX7A 4JKMA 1XIHA 3AYSA 3W1TA 1WKYA 4NYUA 1Q6GA 2AQWA 4PN2A 3TTOA 2UY5A 1ZJIA 1RK5A 1EEPA 2QPSA 4XVDA 6REQB 2YL9A 3TR2A 4XZBA 1LM1A 3BH4A 2EG8A 5E0FA 3MMDA 3WNOA 1ZZMA 1TREA 1EYEA 3S5YA 3VKBA 5EPDA 3VKDA 2V67A 3UZZA 1TWZA 3AHYA 2I5QA 2XZ9A 4NL1A 1VPYA 4CCDA 1SYTA 5LXEA 1JXJA 4JN8A 1V79A 1E0VA 3WF4A 4PUEA 3HOJA 2IPGA 4QLLA 1CGTA 1LLOA 1B9BA 2QVHA 3LCFA 5DMLA 1OCQA 2YB4A 4UOQA 3SURA 4G1NA 2R94A 3SY1A 5B7YA 5HPOA 2ZUVA 2OZ3A 3WBEA 1O68A 1P0NA 3LCWA 1KWGA 1XG3A 2WAGA 3AXXA 1XP3A 3WD0A 3RK8A 1OB0A 3GW3A 1HJXA 4DLMA 3W7QA 1E6PA 3MP5A 1RQHA 2C71A 3GLCA 4KRZA 4C6DA 1QK2A 2I7GA 5A94A 1BSIA 4P8XA 2O4QA 2Y8KA 2ACRA 4J3SA 2CZEA 1KCZA 1D9EA 1W3LA 2P1FA 2HNEA 3WL0A 4ICCX 7ENLA 5J04A 1FHVA 1UBSA 1EIBA 1SPQA 2VL4A 2VQTA 1J4EA 1GOQA 4LGXA 4KFOA 2ZFAA 2A0NA 3SUTA 4A3UA 2FHFA 1QU4A 1AJZA 1DVJA 1OFOA 3LPOA 1VFLA 3WEOA 1PX4A 3M0KA 3NQMA 3IK2A 1W8SA 2PB1A 1SSDA 4KEUA 2A1YA 3WEMA 3MUY1 2O9PA 2J9YA 1EJXC 4QJ3B 3TLLA 4AWSA 3BAKA 2DGAA 3TFXA 3WLIA 1PCKA 3G8RA 3GSMA 5CSUA 1A5CA 4C6BA 1KQYA 1NWRA 3WKZA 1K6AA 1X6UA 1SMDA 1N8WA 4O8RA 4DJFA 1H60A 1GYMA 1NARA 1G01A 3WLSA 1IEXA 1KV5A 3LGEA 4JTRA 1GOKA 3TTQA 3L4WA 1FHDA 4M29A 1G4TA 3BZJA 1QNVA 1X97A 4Q3MA 4GISA 3H22A 2ZUSA 1L8PA 2VGIA 2BASA 2ZZ5A 3EWDA 3EDJA 2E4TA 3QJAA 5IOBA 1DJWA 4HZMA 1ZBVA 3W7RA 2QCDB 4GQGA 2X30A 2GJPA 3FW6A 4IXHA 1R6WA 5I2UA 1EX5A 4D6GA 2XVKA 1GOXA 4ADTA 1RBAA 4E2BA 1DP0A 1XH1A 4OFCA 2IW0A 4O1EA 5HNNA 4LAOA 5LHFA 1VBHA 2EXOA 4QM1A 1AQ0A 4DM1A 1Y8BA 2OB3A 2Z4GA 1YXDA 4Q4KA 1TIWA 3T0AA 4NUWA 1HQTA 1YDNA 4C7GA 1JL8A 4E8DA 1QOPA 4EVZA 4ZOAA 1QXLA 1IXQA 1MMFA 1W1B1 2J13A 4PEEA 3MV11 2CZDA 4LC8A 4UOZA 2B7NA 5A8MA 2OEJA 1LL6A 5AC6A 4YU1A 1UWTA 4A3YA 2DSVA 3WO8A 1N8FA 3K46A 4MNKA 1ECEA 3HPSA 3RILA 1OZMA 3P5ZA 1W56A 3T6CA 3GTXA 4AX7A 3N3TA 3WUGA 1KXVA 4EOUA 2FB2A 1S39A 2GOUA 4DXXA 4K37A 1MEIA 4GNJA 4GZ7A 1BVNP 3KOYA 4ATDA 1B5TA 2PS2A 3BAJA 1EBGA 5G2WA 2V2DA 3P82A 4IMDA 4O28A 1H1YA 4OVXA 4HU8A 4H8UA 4NZFA 8XIMA 3PZTA 1NAL1 4JNMA 5EA9A 2ZX5A 2BVWA 4DBEA 2D0FA 1HN1A 3W38A 3IJLA 1TCMA 4HNLA 1EO5A 4LEFA 1YEYA 1F3EA 2PZNA 3CU2A 4JFVA 3TYEA 2GOKA 3SCPA 4HHLA 4NZ3A 1GVRA 4LBSA 2V5CA 4CU6A 2A3EA 1ZRQA 3M0HA 1K7EA 2PEVA 3LHVA 4C7FA 4DIAA 1GEHA 1KBBA 4UB9A 4AY8A 2D23A 3ZLHA 5HXMA 4AZIA 2E5DA 1JGIA 3LRMA 2WKLA 3ITCA 2VCBA 1RR2A 4R9OA 5CZKA 3BV7A 4UFKA 5E93A 2PC8A 3AAMA 4FNSA 4JX6A 1BG4A 3WDPP 3U57A 3VIKA 3C61A 3D3FA 3A13A 3BW4A 1QFEA 3W2MA 3INPA 3KTSA 4TMCA 4AEOA 4BJHA 2GYIA 1YNPA 3W1LA 1SSGA 2ASHA 1ZAJA 1U1UA 3C0SA 5D02A 4K8HA 4RNIA 2QDEA 1TELA 4HPNA 3LNPA 4PMJA 3S47A 4HPHA 4QE4A 4HYRA 4OHQA 3W84A 4HP5A 3R89A 4GPNA 3CASA 3SM0A 3W86A 4U4MA 4NZ4A 1B3YA 2HV5A 3MDUA 3USBA 2DZUA 3VE9A 4FLSA 1QI5A 4P7RA 3T55A 3UNDA 4ECLA 3VCNA 5HQLA 4CQDA 4H6QA 4MM1A 4NJGA 3S0CA 1G7VA 5JBEA 1KW1A 3TONA 3NQFA 2JF7A 3ARRA 3QOMA 2DVXA 1RQEA 1L6SA 2O92A 3ARUA 1FWJC 3UY8A 3ARVA 2DZTA 2INFA 5D9OA 2OG9A 4IFKA 4GCXA 1V02E 1LLZA 2J24A 1KCKA 2CLIA 3CO8A 4HA1A 5MHBA 3FDGA 4KGJA 4GUGA 3NG3A 2KX9A 2KAUC 2QR6A 2TODA 4XQ6A 2J7DA 1ITUA 1IHIA 4H8HA 5I77A 2J88A 1X39A 1F3TA 1G4PA 4AIUA 5G4WA 1Q6EA 4KESA 4JTQA 3ITXA 1VBJA 2W3ZA 4UFMA 4PR4A 4D1JA 1GEQA 3PG8A 1IT7A 4HCLA 2XH7A 4WJXA 1US3A 2G41A 4PL2A 1S5TA 2AL2A 3CUFA 2YCJA 1OX6A 3O1NA 1IIGA 3W7DA 2X41A 2RGLA 4GBUA 3W27A 1BVWA 2JEPA 2PUZA 3PPGA 5EBUA 3DBPA 4MPKA 3TW6A 1NDWA 1QRQA 3A9BA 2PP1A 2PP3A 2XYLA 3AIBA 1OK6A 3U2CA 1QJWA 3L0KA 4YL2A 3VKAA 6TAAA 5AFDA 3MBFA 1YW1A 1UKPA 3A4AA 3V7PA 3A23A 3NXFA 4E6MA 1Q13A 4Y9OA 2Z1KA 2WZIA 2J8TA 1EOKA 3FSUA 3NXLA 2IKHA 2OYMA 2YFOA 1OD0A 4WDXA 4ZMGA 1Q8JA 3ARYA 1T7LA 3P6LA 1XLEA 1TCDA 1XGDA 5DRCA 1GG0A 2PGWA 4QIUA 2X2YA 2OOGA 1Q6DA 4U3CA 4U5KA 4OTKA 4N6FA 3LBMA 4O12A 2PWFA 3WDJA 3TXZA 5U4NA 1W1ZA 1UQZA 3H2CA 1E6NA 4BI7A 3EPNA 2XGZA 1S1RA 3ABZA 1M3UA 2QCHA 4HQVA 2GUBA 2YDSA 4LS0A 2BTMA 1TFVA 3KVKA 3WD3A 4ERGA 5BCAA 4JXCA 4GIAA 4UTLA 4X63A 3H54A 3KCOA 1XIFA 3GWQA 3RDKA 1J01A 4GUJA 2QCEA 1L6YA 4XIMA 4GIRA 5G2IA 5FESA 1CZ1A 1FCUA 2O9RA 2GWNA 3GNXA 1BTCA 4B5VA 3EX3A 1AODA 1UZ1A 1JAEA 3AHXA 3ERPA 1TPFA 3BPWA 4C6EA 4Q8PA 4LVDA 3B9DA 4N7QA 1XIBA 3UCQA 3TFCA 2GSHA 2OXNA 2WLYA 1RUSA 1XGEA 1D7KA 4MFEA 1WNOA 2WC3A 3WQDA 3E12A 1E4NA 5CC6A 3D6NA 2VR4A 3FEMA 4H9UA 3PK7A 1VENA 4KERA 1KM6A 1YDOA 2G8ZA 4I9MA 3UYIA 3NM3A 1T41A 4UMBA 1LYXA 2OX4A 3KW3A 3URNA 3IJ9A 3WNLA 1K70A 5M03A 4B5TA 2FVKA 5M1TA 1I0BA 1QATA 3IWPA 1V6TA 1VFTA 2Z29A 1NWTA 1PX3A 2IPJA 2OSXA 4DYEA 1B57A 3MBDA 4PFHA 1FDZA 3FYYA 3TXVA 5E5CA 4JD4A 4O8AA 1UROA 3FKKA 1KLZA 1QDSA 4B5NA 1XG4A 4KQNA 3WLTA 1VRXA 3T8QA 4H3DA 4A35A 3RX4A 1W1PA 3KEHA 3WENA 4YS1A 3S9IA 1E71M 4DPQA 2ZX6A 3FYOA 2OTDA 4QE1A 3VNMA 2VRJA 3R2GA 3PANA 1W9BM 3VNKA 3AYVA 4AXKA 3ZXWA 3LA4A 5T9CE 3O9NA 4C7DA 1D8CA 1UWRA 4MNMA 1OADA 1K03A 3E2SA 4ZQPA 3M0IA 1GVOA 4WJ8A 4WCJA 1ME9A 1HJUA 4N0RA 3GXTA 3AROA 1UOZA 4GI6A 1H0GA 3U0HA 1QNRA 2VFDA 2YZ5A 5ABFA 1LF1A 4ILSA 5XIAA 2WM1A 2FPYA 1PCWA 3RYSA 2G3FA 1Z41A 1XIIA 2WJZA 4GZIA 2E25A 4HTBA 1P0EA 2A7PA 1LTDA 4DB7A 3UZXA 4GKTA 4Q6JA 3ZT7A 2VX4A 3U5UA 2BHZA 1OEPA 1AW1A 3CPRA 3FYPA 4AH7A 1QWGA 2FKPA 5FJIA 3UZYA 4Y9NA 3WJSA 5DT7A 3W1AA 3CUXA 1PDZA 5EMMA 4DJDA 2HISA 4PMQA 2X05A 3V5FA 3MW7A 5H1WA 3BANA 4FX7A 5FJTA 1YLVA 5E0KA 3BMVA 3N9SA 3P14A 2OO0A 4RZBA 1RAKA 3OLDA 2QJIA 1KFWA 2RDTA 5T9BG 3CHCA 3VGEA 2XSBA 1EJUC 1PKYA 1YPFA 3W7LA 1C8XA 2AAAA 4CLMA 3DN5A 2VXNA 5A1AA 3KAOA 4JQAA 1GTHA 4RXGA 4YHEA 5BNKA 2FZBA 4PZVA 4UNLA 4D6CA 4GZJA 1Y0EA 4CD6A 3QQWA 4F8XA 3OGRA 3PZOA 5KZ6A 2PZ0A 3LXBA 4QLJA 3KP0A 3GC4A 4R7JA 5AC7A 3DYPA 4QEEA 1FH8A 1X96A 4HT3A 2YKKA 4QS5A 1E3XA 1EYWA 4BF7A 3AXKA 3KS5A 3T07A 1EWEA 1T99A 3GHUA 3BJSA 2W9MA 1E40A 4CGTA 3VABA 4F0LA 3LZ5A 3VNJA 1OC7A 2E68A 4DJFC 3HPXA 3OVQA 1HKVA 4WEVX 1U33A 3H21A 4PBEA 2PPGA 3HMCA 1Y5XA 4NNCA 4B3KA 4D72A 4TV5A 5D03A 4D71A 2EJ1A 1G94A 1FDYA 1UBPC 1I60A 5EB8A 3W29A 3EMCA 4R33A 5FAGA 4C6FA 4CVWA 2E6YA 3TOPA 3NQCA 3AJ7A 3AIVA 1VEPA 3L5MA 1MW2A 4YWSA 2BSLA 3TN5A 3MZ2A 4CU7A 3C2EA 4LY8A 2EQDA 1ZJHA 3D47A 1CB2A 4M24A 3XISA 3GFXA 4GX8A 3HG4A 1WDQA 3T2OA 2WZTA 2DJLA 1D7FA 3LPGA 5CGTA 5LIUX 4P7LA 2BOEX 3ISIX 4D6IA 3LDVA 2XIMA 3EGJA 2Y88A 4QR6A 2PWEA 2O7QA 1R85A 3L4TA 2QF7A 2ZZ7A 7ODCA 1TZ7A 4K38A 2JGYA 2QDGA 2E28A 1JRBA 3VOJA 4ZSUA 4W4QA 3OHMB 4MJ2A 3WQ5A 1ZBKA 2DT0A 2LLEA 3ES8A 3GG7A 1TV4A 3RM8A 4FNTA 4GWEA 1UR1A 1EP3A 4IQLA 5ABFB 3K8KA 3T2PA 2VCAA 4HSHA 4O57A 4PCTA 1HKKA 1QPNA 3N9KA 3NYDA 1LZOA 1TUXA 1I4NA 2PDQA 1FKWA 3NQVA 1H41A 3GU1A 3NWRA 2PRMA 2QVNA 2WMIB 1PDYA 5E6ZA 4G5DA 4NRRA 1GZGA 1BKHA 5FAJA 1AG1O 2C15A 5CKSA 1XLBA 4CQCA 1XI3A 3HTWA 2J7BA 3T40A 1OABA 1Z8AA 2Y8VA 1DJYA 2DW7A 3BV4A 2XIOA 1R7OA 4FXJA 4E4FA 7XIMA 3FJNA 3I3EA 1TG7A 5AYXA 3TC3A 4ML9A 2REQB 2W0UA 1SFJA 3NR0A 3ID7A 5BOEA 4UTMA 4PGLA 2ZTJA 4TUFA 1W17A 2CCRA 2A7RA 4AIOA 4P8WA 2HZGA 4LYQA 1POKA 2ISVA 3HF3A 4RJEA 1OCNA 2FZNA 2VP8A 4PFMA 3A22A 3Q67A 1NFGA 2POZA 1QHOA 4JBRA 4QDMA 1B1YA 2RFGA 3M47A 4H2HA 4ICNA 4ZO9A 1R9YA 4XD3A 3AS1A 2L5HA 3BGAA 2OYLA 4NF7A 1KM0A 5A2AA 4O54A 3VDGA 3VD7A 1EJRC 3LCHA 1RLDA 3W3OA 3GC2A 3CV2A 3C2YA 3ZJKA 1VFOA 2I17A 1PTDA 3TYCA 5G4EA 3UR5A 2E5CA 3RLGA 1Y5VA 3WQFA 1HJWA 4DJDD 3A3HA 2ZZ3A 3QY7A 5D9MA 3W2JA 4XAGA 3IGUA 4Z0JA 2NLYA 1SW7A 1OHLA 3LTSA 1W3JA 3DFQA 3W1UA 2QJNA 3VM5A 3BWWA 2J9ZA 1RH9A 3W22A 1EZ2A 3NSXA 1TZ9A 5D2VA 5K3VA 4HB7A 4AD5A 4WOZA 1UMLA 4EXBA 1XCWA 3VXGA 3W01A 4PUNA 2I57A 2WVVA 5I3FA 2QCLA 3V4BA 5IBXC 2FMNA 2OWWA 1CBGA 1KA9F 4WDTA 3DUGA 3G1AA 2GK1A 1W5NA 1KKOA 2Z00A 3CT2A 1R9XA 3W28A 5M2FX 3E02A 2GGJA