2GWGA

Crystal structure of 4-oxalomesaconate hydratase, ligj, from rhodopseudomonas palustris, northeast structural genomics target rpr66.
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
345
structure length
329
Chain Sequence
MIIDIHGHYTTAPKALEDWRNRQIAGIKDPSVMPKVSELKISDDELQASIIENQLKKMQERGSDLTVFSPRAGDFNVSSTWAAICNELCYRVSQLFPDNFIGAAMLPQSPGVDPKTCIPELEKCVKEYGFVAINLNPDPSGGHWTSPPLTDRIWYPIYEKMVELEIPAMIHVSTGAHYLNADTTAFMQCVAGDLFKDFPELKFVIPHGGGAVPYHWGRFRGLAQEMKKPLLEDHVLNNIFFDTCVYHQPGIDLLNTVIPVDNVLFASEMIGAVRGIDPRTGFYYDDTKRYIEASTILTPEEKQQIYEGNARRVYPRLDAALKAKGKLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-oxalomesaconate hydratase
publication title Crystal Structure of 4-Oxalomesaconate Hydratase, LigJ, from Rhodopseudomonas palustris, Northeast Structural Genomics Target RpR66
rcsb
source organism Rhodopseudomonas palustris
molecule tags Structural genomics, unknown function
total genus 110
structure length 329
sequence length 345
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 2gwgA00
2PAJA 3UPMA 3GTXA 3R0DA 2GOKA 4UB9A 3WYZA 3LSCA 5AKQA 1BF6A 2BGNE 1FWBC 3ITCA 1EJXC 1V79A 4H9UA 2HPMA 1YNYA 3GTHA 1FWEC 2OOFA 1A5LC 2ADAA 3F2DA 2GWNA 4RE0A 4CEUC 4XD3A 4LCQA 1I0BA 3MSRA 2F6KA 1FWAC 1K70A 1P1MA 2FVMA 4Z42C 2Z28A 3S2NA 4QSFA 4PE8A 4DNMA 1GKRA 4GX9A 4B3ZA 2QT3A 4C6JA 5FSDC 2QPXA 4GOAA 3D6NA 3UBPC 4EPDC 2R1PA 1O5RA 4XAYA 1UBPC 3CAKA 2WJDA 4IF2A 1PTAA 4GXWA 2E25A 4PCPA 4B92A 4XAGA 3V7PA 3ORWA 4DO7A 4CQCA 1XGEA 3S2JA 3DC8A 3FDKA 3GG7A 1IE7C 2YB1A 3B40A 3MDUA 2I5GA 3NQBA 2Z25A 4I6VA 2RAGA 4YIWA 4P5UA 1V4YA 2VHLA 4GK8A 2OB3A 2Z2AA 3EWDA 2Z4GA 3IRSA 1EJUC 3TN6A 3F2CA 1FWJC 1NDWA 4RZBA 2Z26A 3OVGA 4C5ZA 4C6CA 3BE7A 3TN3A 4QS5A 3DUGA 3GTIA 3HPAA 3F4DA 3K5XA 3HM7A 3LNPA 3LSBA 2ICSA 4EPKA 2E1WA 3IACA 4GC3A 1M65A 4R85A 1RAKA 1V77A 4V1YA 2Z27A 3IARA 3GUWA 1R9YA 4G2DA 2HPIA 3TN5A 3S4TA 1R9ZA 1RJPA 2FTYA 4G7EA 4C6DA 2R1KA 4HK6A 4IH3A 1XWYA 4C6IA 1KRCC 4NI8A 3OU8A 4KQNA 2HBVA 1YBQB 5HMEA 3IPWA 4KESA 1EJSC 2EG7A 1M68A 2VC5A 2YXOA 3JZEA 4I6KA 4H01A 3T1GA 1S3TC 3O7UA 1RK5A 4KIRA 2IMRA 4PCNA 3S2LA 3F2BA 4ZSUA 4HJWA 2P53A 1NDZA 2Z7GA 3MPGA 2PGRA 3GIPA 4QRNA 3OODA 4F0SA 1POKA 2EG8A 4IFKB 4C6NA 1P6CA 1ADDA 1UIPA 2QS8A 3E0FA 2GZXA 2R1NA 3URAA 4KEZA 3PAOA 3DCPA 4C6LA 2VC7A 4GBDA 4J2MA 2OODA 1K1DA 4GY1A 2GWGA 4H00A 3LU2A 2BB0A 1PSCA 3CS2A 1RK6A 1NDYA 1K6WA 4NP7A 2O4MA 1FKXA 3A3XA 4GY0A 2UBPC 4CQDA 3AUOA 1FWGC 1WXYA 3TN4A 1VFLA 3E38A 4H9XA 3MTWA 1EJTC 4F0RA 1FWFC 4WVXA 2DVUA 2VR2A 4ICMA 3OOQA 4H9TA 4CQBA 2HNHA 3MKVA 4M51A 5CH9A 1DPMA 1ITUA 4H9YA 4LFYA 1KRMA 4AC7C 3HTWA 1O12A 4NG3A 4C60A 4H9MA 4PBFA 3GU9A 3UR5A 5A6TC 3ID7A 3GTFA 4ERIA 1R9XA 2D2JA 1RA0A 1WXZA 1A5MC 1GKPA 2Z00A 4H9ZA 3LA4A 2YZ5A 2HQAA 3ICJA 1POJA 5HMDA 4DI9A 4LALA 1PO9A 4IG2B 2XIOA 2OQLA 4GX8A 3RYSA 2AQVA 4PBEA 4C65A 1J6OA 2D2GA 4J35A 1QXLA 2R1MA 4ERAA 1ZZMA 4CNTA 3CJPA 4HK5A 3T81A 4KF1A 4G7EB 1EF2A 4RDYA 2Y1HA 2PLMA 3RHGA 1EJWC 1YRRA 3K2GA 5E5CA 4QTGA 2ZC1A 3URNA 3QY6A 2R1LA 3UR2A 4LAMA 3RCMA 4R7WA 3QGAC 1M7JA 3E74A 4E3TA 2FVKA 1EYWA 4IGMA 1V7AA 2G3FA 3FEQA 2FFIA 2Z29A 3K4WA 4F0LA 3N2CA 3NURA 3NEHA 3IV8A 4LCSA 1UMLA 4QS6A 1KRAC 4DLMA 1J5SA 3A4JA 1NDVA 1ITQA 1NFGA 3LS9A 4MUPA 2AMXA 4IGNA 3QY8A 2PUZA 3MDWA 4LCRA 2Z2BA 4TQTA 3O0FA 3PNUA 1A5KC 2EG6A 3QGKC 4R88A 4KEUA 1FWHC 4GYFA 4AQLA 1J6PA 1E9ZB 3SFWA 3AU2A 4LAOA 4BY3A 3FDGA 3PBMA 2Q09A 2QVNA 3C86A 4WGXA 3MJMA 4DYKA 3GU1A 4IFKA 2AQOA 4CNUA 1ONXA 2ANUA 3B0XA 3EGJA 4EPBC 1FKWA 4B91A 4C6KA 2I9UA 4XAZA 4C6MA 1GKQA 3T8LA 1RJRA 3GRIA 3KM8A 2UZ9A 3GU2A 2GSEA 5LXXA 2YB4A 3AU6A 3RN6A 3LGDA 4LH8A 2HBXA 4XD4A 3S2MA 2A3LA 4C6EA 3UF9A 2KAUC 4L6DA 3URQA 1RA5A 3ISIX 4RDWA 4C6OA 4J5NA 1FWCC 1ONWA 4WHBA 2Z24A 1XRTA 5FSEC 1EZ2A 4UBPC 4EPEC 2VUNA 4ZSTA 2P50A 3E3HA 4XD6A 1A4MA 4C6FA 2OGJA 4ERGA 4BKNA 1P6BA 2D2HA 1EJVC 4C6QA 1YMYA 4INFA 4XAFA 3OJGA 4C6BA 4LAKA 2WJFA 3IJ6A 1J79A 4HK7A 4HA0A 3IGHX 4IFOA 4KERA 3E2VA 3GIQA 1YIXA 4GZ7A 4RDZA 3WZ0E 2CZVA 2WM1A 3E0LA 2VM8A 4IQJA 3WMLA 2WJEA 3EWCA 3F4CA 4OFCA 1EJRC 1I0DA 3TNBA 1FWIC 2DVXA 3SO7A 1A4LA 4EP8C 1FWDC 1QW7A 4KEVA 4L9XA 1HZYA 4IG2A 4IFRA 1A5OC 2FTWA 3LY0A 1XRFA 4LEFA 4QROA 1KCXA 1E9YB 4CEXC 1V51A 1KRBC 4B90A 1A5NC 4DLFA 2DVTA 2O4QA 1W1IE 1JGMA 1UIOA 4DI8A 1RJQA 4BJHA 4CNSA 5G4HC 3B0YA 4DZHA 3A3WA 5HMFA 4KETA 4XD5A 3URBA 1YBQA 4H9VA 4JOMA 4D8LA 3PNZA 4GY7A 4DZIA 4C5YA 3MVTA 2Q01A 1PB0A 2W9MA 3MVIA 4V1XA 3OQEA 4DIAA 3QY7A 3PANA 3G77A 2PGFA 3LGGA 4C6PA 4RDVA 4LANA
chains in the Genus database with same CATH superfamily
3GFYA 4MAVA 1IV8A 3LSCA 1UR3M 3VOFA 5D02A 1BF6A 1EJXC 4ALDA 3C61A 4DJEA 3GUGA 3D3AA 3T0TA 1FWEC 4QLJA 1E40A 4P8XA 4ZQRA 1RD6A 5EA9A 1WDSA 4RE4A 3ANUA 5LKYA 5AC7A 2CZDA 3AXKA 4CNOA 5DY3A 2AGKA 4GUIA 3KLKA 4PTDA 4J3XA 1GVQA 4H8UA 4M6VA 2CFFA 1CB7B 4JIRA 3CV1A 3KP0A 3QFWA 2E67A 1CB2A 3T2OA 5IHSA 3W88A 3TE9A 4DO7A 4ATWA 5DELA 4ZTXA 1CDGA 2E8YA 3VAVA 4O19A 2OLHA 3V4BA 1H51A 4I6VA 2ZA1A 3VNKA 3BC9A 1ONEA 3FKRA 2YIHA 3EWDA 3GR7A 3FSTA 3TN6A 5DCEA 2XH2A 3Q67A 1PKMA 4Z1BA 3U4AA 3BMXA 3HB9A 3F5LA 3VC6A 5CPSA 4R3UA 1CZ1A 2Z1WA 1LRTA 3NVDA 3IACA 3GD6A 3MO4A 1HL9A 3W2KA 3WH9A 4PUWA 3B8UA 2Q71A 5A6SA 3LV5A 3TLLA 1VCFA 1UPMB 3W1PA 2H8XA 3I6RA 1R38A 1JVNA 4C6DA 1M7OA 3AXHA 1KRCC 1WZAA 3G1DA 1Q6CA 5C2GA 4O8AA 1SR0A 2XU2A 3R0KA 5AC4A 1OEPA 3EXSA 2CERA 3UVIA 1H0IA 1ISVA 2PDGA 2XVNA 4ES4A 5EYWA 3IGSA 1XIBA 5G2WA 1JPMA 3ZZ1A 4ZQCA 3NZGA 1POKA 2BP1A 2ISDA 1OT1A 2DPEA 1PZ3A 2POZA 3E5BA 3IUHA 3NAVA 1F6PA 5C54A 2BFGA 5HK4A 3EB2A 2XH7A 1LQ0A 2NQJA 3P2VA 1FOBA 4K37A 1MW1A 1KFBA 2AAMA 3BLLA 4UFKA 3RM9A 1F6YA 3A3XA 3IIXA 1Z69A 5D03A 1XKJA 4J3UA 1QW9A 1TWWA 3KHDA 2NV2A 2RJGA 5IM51 2EHHA 2NLYA 3N9KA 4WUIA 5LA1A 3FK4A 2WM0A 1Z44A 4B4HA 1CCWB 3G5EA 4A22A 3CUHA 4REQA 3E9AA 2C16A 3TLQA 1D3CA 3W1MA 5ABFA 5TNVA 3C0SA 3M5VA 4MB5A 1UH2A 1I45A 4O10A 4NYUA 3OBKA 4F0HA 3GFZA 1OK6A 2EPKX 2HQAA 4LALA 3OA5A 1R86A 2I16A 3RYSA 2EPLX 4Q4MA 2ISVA 4FPSA 4IIFA 3BWWA 3UQNA 3GDLA 1Q8AA 1O4UA 3P3BA 4KCTA 1QMLA 1C29A 5I24A 2P8CA 4GFSA 1KTBA 1YRRA 3WQFA 1Y5WA 4FALA 1FHVA 4NJHA 3UW6A 3WK3A 1SW7A 3CZKA 1A5UA 2YW4A 1UA3A 4JPGA 4U2YA 5FACA 1S5TA 4LY4A 5E1QA 4TR9A 1YX1A 1HIZA 4S3BA 3HG4A 3NIYA 2E28A 3B8IA 3QY8A 5E6YA 1C9DA 3JR2A 2XSAA 1PBGA 3AZRA 3WH5A 1CW2A 4UR9A 1VFUA 3GNNA 1K9EA 1US0A 3WBXA 4MLJA 1CENA 4JQAA 2Y8KA 2DZWA 2V68A 4JTHA 3WH7A 4LB3A 5AZ1A 4S2BA 2I9UA 1W1YA 1W6TA 3NQ7A 3FVMA 3CYVA 3AO0A 3NL5A 4EF9A 1XLJA 3OG3A 1V0MA 3S5SA 4C6EA 4L6DA 1LP6A 2VRQA 4XZNX 3T08A 5T9CE 1IEWA 1TJPA 1LBFA 1T40A 1N8FA 1W2PA 4WHBA 2XHYA 4QLKA 1ECEA 1B4EA 5CLWA 4OTKA 1J96A 3M1ZA 1DJGA 3CTTA 3P0WA 1X6LA 4IT1A 5JBEA 2QUUA 1TPUA 1ONRA 1FWWA 5H8PA 3AFBA 3IVTA 3E2VA 2ACSA 4V2XA 4RV8A 2VX5A 3APTA 2ZTJA 4OUEA 1L6WA 3P61A 1CYGA 4IQJA 2ZUUA 2AOSA 2XIQA 7REQA 5HJYA 3W6MA 1OX6A 4IOTA 5JQ9A 3B9OA 1LOSA 4CEXC 4FLRA 3AUJA 2NX1A 2CLKA 2ZX5A 1IT7A 1PTDA 2H6RA 1JULA 3B0YA 3V36A 4BHYA 4DZIA 3L7RA 3O15A 1W9UA 4QJ1A 2OPJA 3WF1A 1UC5A 4NZ1A 4WSJA 3G24A 3PBGA 3SECA 1SZFA 6CGTA 4Z17A 3TP4A 3RR4A 3CWNA 1O95A 1XRSA 3M44A 4RE2A 3R0DA 1S3HA 2JIEA 1AODA 4ZXOA 1XYZA 4FHAA 4WKHA 1VR6A 2A7RA 2P3ZA 1DXFA 3K8LA 2C18A 4NAFB 2VC6A 4BK9A 5AHMA 3MMUA 3LPGA 2PDJA 3TYZA 3OEXA 1TWDA 3CV2A 5CLTA 2ZXAA 3HGSA 1TTPA 1TKKA 2YDSA 5T91A 4LB4A 2LLEA 3BL3A 3UY8A 4E4UA 3PZGA 7XIMA 3GC5A 1EHAA 2FZDA 1O5RA 4XAYA 1KO0A 1UR9A 3WQCA 1GCYA 1Z3NA 1EXBA 1OWQA 2P1FA 3WQOA 3G1HA 4JTDA 1HUVA 3ZWSA 4ZEPA 3T4WA 3DC8A 3P5YA 3EKLA 4EF8A 3WQWA 3N4AA 1S2WA 3SRFA 1XG3A 3BLDA 5C8BB 2YL9A 3QYSA 3KCJA 4A29A 2QUNA 3BE7A 1KBKA 3MHUA 3W02A 1LBMA 3WLMA 7A3HA 4GO9A 3JU2A 3K5XA 4HT3A 1UASA 2E1WA 2OT0A 4GC3A 1EJ7L 4Q7BA 3TYEA 2XUCA 3D5HA 1DJXA 3TC7A 4Q8MA 2BGSA 1UMYA 2E4TA 4DWDA 3QW4B 4F4RA 3T07A 1ODUA 4GE8A 4M3PA 2WMGA 4M24A 4JIQA 3VKCA 3AWNA 1TB3A 4Q22A 4UQCA 1UJPA 3GLCA 2HBVA 4LSBA 4JN8A 1BVWA 4C91A 1WDWA 5I3GA 3PPGA 3BSMA 4NXSA 3KBWA 1BD0A 1KGXA 4RNJA 3S2LA 2R24A 1OGSA 4PUNA 1MYRA 2P3EA 4YPJA 3PM6A 3OODA 4Z2HA 2HSAA 4U33A 2QV5A 1X7FA 3N2TA 4LVDA 3KTCA 4U3CA 3EYPA 5AECA 2WZIA 3URAA 1REQA 3MHFA 3AYTA 3KRBA 4WKFA 4UQDA 4US5A 3AIQA 4ZB0A 4HCHA 1AH4A 3KZPA 5CAKA 2Y89A 4DBWA 2A6NA 3RNDA 4M80A 4UNKA 5TD4A 3PZVA 4X9YA 3KWSA 5DMLA 3RU6A 1EEXA 2PDLA 4WOQA 1OCJA 4ZOBA 4PUUA 3V0SA 1Z42A 1FH7A 1TA3B 4V15A 3MTWA 3F5KA 2DORA 2RKXA 3NDYA 1WYIA 1PPIA 3QR3A 2D22A 2ABBA 3BCFA 3W7JA 1KBLA 4CQBA 2E5BA 4ZB2A 1O5KA 4U28A 2OKTA 2PA6A 2ZZ1A 1Q2SA 1CXEA 1OC5A 3SY1A 1XV8A 5LSMA 5D09A 1O12A 4O8RA 3NQGA 3WQGA 4OV9A 2RHGA 4LW7A 3SUTA 3UZZA 1ZBWA 2FHBA 4P7NA 1E6PA 3VX0A 3CZ8A 3ZSTA 3WLKX 2VOTA 2WQPA 3WQEA 2ZZ2A 1CGUA 1KXHA 3BJTA 3EWUA 4IIHA 1DXIA 3JUGA 1YPIA 3W2LA 4AHPA 2Y62A 2YJQA 3K8KA 3VNJA 3R13A 4XG1A 1PS9A 1V0KA 4XSMA 2PDXA 2FZ8A 4AMAA 3IIVA 2O7SA 4IJRA 4QDMA 5BW6A 2FKPA 3BARA 5CCZA 3QGAC 3W7IA 2ALDA 3EKZA 3N9RA 1R3TA 3K1DA 3UPBA 4HYRA 3PVFA 1MXDA 1KRAC 4XZIA 1AZ2A 2WHMA 2ZUNA 3WUBA 4LCRA 3UEQA 2EG6A 1ITXA 2QAPA 1MNSA 3CQJA 2A3CA 4R88A 5IBXC 2OU4A 3AHYA 3SFWA 2VEPA 4N2YA 3NDOA 4JTEA 4RZ6A 3PBMA 3RU8X 2WVUA 1E15A 2YR1A 3GFXA 3WNMA 5CGTA 2F61A 2ANUA 2V3FA 3O6AA 2OX4A 5AN7A 5AYYA 5H8UA 4LGXA 5CPQA 3VKBA 4DJFD 3IJIA 1P0KA 1EBHA 2UZ9A 3W7GA 3QQWA 4LH8A 4F3HA 2RDUA 4EWND 3BZGA 1TX0A 1ZU8A 4ZQNA 1MQPA 3ATZA 1DQXA 4HHLA 8A3HA 3UG5A 4UBPC 1E6ZA 2P50A 2VEIA 4QGCA 2YOCA 1BWKA 4PB5A 4M7TA 2QMJA 1UB3A 4KIEA 4POCA 1V5XA 1VP5A 3WLRA 2WBKA 5I7GA 3WLJA 4ZQPA 2JK2A 3CK5A 1F6KA 3CO8A 2NW0A 4DBSA 3SRDA 3W7EA 3KOZA 4GI8A 2DZPA 3DG7A 2QJJA 1O1ZA 1K6AA 1KM1A 2ZX7A 3VMPA 4AG0A 4MB4A 1GZJA 2DVXA 5HDRA 3EX6A 3KVLA 1US3A 1XUUA 1BSIA 4UOQA 2IQ0A 5H2ZA 1R3VA 1GGOA 4MTVA 4D9PA 1PDYA 3EWBX 1V51A 1XINA 4ZE5A 2DVTA 4O0KA 1JGMA 1JDCA 3HIJA 3CB3A 3P8JA 3SSJA 3BVJA 3QH2A 4GNVA 2FFCA 2YA1A 3URBA 5A1AA 4LTSA 1P0DA 4JCMA 3PJWA 1NY1A 3LGEA 1LUCB 1C92A 3W73A 4R7JA 5AFDA 2A85A 2GSHA 2PAJA 1GG0A 3WYZA 1C8QA 1FWBC 5C70A 2Q02A 2F38A 5PTDA 3O1NA 4JN7A 4P8VA 4BFAA 3CHEA 1PL9A 4QCFA 1F61A 4QDPA 4DUVA 1NEYA 3T09A 4NIRA 5FIPA 3XISA 2R1PA 3KUMA 4Z1YA 4XBKA 5M03A 1XLFA 4B5WA 3GYEA 1X6NA 1WP6A 4HPHA 4CQ8A 2VKZG 3KDNA 3M0XA 2YXGA 1FQ0A 1MZHA 1UWUA 4XBSA 4AXNA 1H7WA 3QLDA 4FI4A 3NXLA 3H2NA 1C8VA 4PA8A 3O8AA 2OG9A 2WMIB 3L5MA 2PWEA 4JAWA 4AIBA 2Z2AA 1YHTA 4D8AA 4PMXA 1KLYA 3SQLA 3EZ4A 1EWDA 1ZPTA 3SCOA 3HPFA 3ZVHA 3R94A 1KM5A 3P93A 2QUVA 3TYUA 3LNPA 1IXPA 3F5JA 4DWSC 1CGTA 4R85A 2ZDSA 4U3AA 3VU2A 3GVQA 1V77A 3GIYA 2CZ5A 1VS1A 1AH0A 4HYVA 1XLLA 5DRIA 3TN5A 4DUOA 5EKYA 2DSWA 5JIPA 4BEQA 2JF7A 2Y70A 1LL7A 4L7ZA 5LIUX 1WCGA 3W84A 4M6UA 2FZ9A 1CXIA 2HVOA 1SZRA 1SR9A 1LTDA 4FNUA 5HMEA 3STGA 4MDOA 3CBWA 5A6BD 2QLYA 1IEVA 3IK4A 1M68A 1XIFA 3THDA 4AZ7A 4H01A 3WQ4A 4LYQA 2PCEA 4UTJA 3IGUA 5DXXA 3A4WA 1Q7QA 3M07A 3TCEA 2CC0A 2YCLA 4ZOAA 3TCSA 4B5NA 5JUVA 3F7JA 4D6DA 3KZSA 1ZB5A 3LDVA 2GZXA 1JNEA 4FR6A 3B8SA 4PTMA 2GWGA 1OABA 2XVGA 2Y4SA 2ZUMA 3EB4A 4Q3MA 2L5HA 1QNQA 1E0XA 1AG1O 4NP7A 3B9AA 1X8CA 5BWAA 1UZDA 2CLIA 4B15A 1HX0A 2OSWA 1KXTA 3WUEA 1HP5A 3KLLA 2GDVA 5CGMA 2IXVA 1EH9A 2EF9A 4L61A 3T4CA 2E6AA 4R5EA 1SO6A 1LG2A 3NNTA 2WQDA 1ZGDA 3ABXA 4PUMA 5C9WA 1FWSA 4IJBA 3KL5A 7CGTA 3LRKA 1U5JA 3MSGA 2Q6ZA 2CYGA 5CZJA 1E3ZA 4BZYA 3REQA 2QF7A 4DWSD 3O3RA 2E1DA 4RUBA 4KWWA 3R89A 1I60A 2PD9A 1H7OA 3W4RA 1XSKA 3TXVA 4UOZA 3FHAA 1VPYA 1J10A 5D9PA 4FX6M 3L4UA 3FXYA 4XISA 3W71A 3K46A 1BG9A 2A0NA 2JGQA 3SGUA 1LRNA 1GQKA 2J62A 4DF1A 3E0IA 1WDPA 4QDWA 3TSDA 3UETA 1VIZA 2ZC8A 4WX2A 3ABSA 4BEUA 3VOJA 1YQ2A 3VKDA 3R79A 4Q8VA 2QULA 2O7QA 4I8DA 1K3UA 4FA3A 3MJYA 1OSEA 4G1NA 3N2CA 2ZXBA 4MUPA 4EIVA 4IGNA 3N17A 2QR6A 2VX4A 1L6FA 4RL3A 3SM0A 1SFJA 1A5KC 2BVDA 3LYEA 4MB1A 3VD3A 4J4KA 1R87A 3BLOA 4LEQA 4XUYA 3RMJA 3COTA 4EXAA 5I78A 2G3MA 3W01A 2VMFA 1GJUA 2SFPA 3SZ8A 1RVKA 4BWLA 4EE9A 4M19A 3IJ8A 3WNPA 3MC5A 4TU1A 4LU0A 1RJRA 5LIKX 2WHJA 3PFRA 5E09A 3GNRA 1SW3A 4E5TA 3ARUA 2GQ3A 2JEQA 1GW9A 3L23A 4RDWA 1J0IA 3UYIA 1V3MA 1V3IA 2Y2WA 4LUSB 4HKPA 1JQVA 1J8VA 4H7CA 3RPMA 3WDHA 4YS1A 4TIMA 5DF0A 3VD9A 1KM3A 4P7QA 3VE9A 2PDWA 4ZMGA 3O6DA 2CLHA 2ISFA 3SN1A 3U9IA 1XD0A 1YMYA 4FB7A 4C6BA 5D2YA 1J79A 4W4QA 1PIGA 4IFOA 4KERA 1MXSA 1TRIA 4GZ7A 2VP8A 4B9ZA 4IP5A 4J27A 1M3UA 2VDHA 4D6IA 2VVNA 3F4CA 3CYJA 5BROA 4EP8C 1AQFA 3QN3A 2HZGA 2VZSA 5I3KA 1I75A 3KTSA 4LUYA 5I3FA 3GHTA 5GJNA 4ML4A 2XH0A 2XVLA 3O05A 1F3WA 4DRSA 3WENA 1WBJA 3T9PA 1AJ0A 2FQIA 1P0EA 1JZ2A 9XIAA 3CNYA 5HINA 4M8UA 2XM1A 2I7GA 2ACUA 2GJXB 3HPXA 2B31A 1KNWA 3RCYA 4JOMA 2J7GA 4L80A 1OFPA 5CSUA 5HNNA 4JD4A 1BYCA 1E43A 3GE7A 1P7TA 1ODZA 4JDBA 4ML9A 3B0PA 1W1A1 1D8WA 2Y24A 4GH3A 5LIYX 1VCGA 4UQBA 3GXDA 3NPXA 4UB9A 5I23A 3N73A 3PJXA 5D38A 2IUZA 3ZQ9A 3TYBA 4XAPA 4JNMA 2DSUA 3CV6A 3EWYA 3GAKA 1N7KA 4GISA 4CU7A 4A3YA 4DX3A 2G96A 2HS8A 3WKZA 2IQDA 1FWAC 4H41A 4I9TA 4JIIX 3ZT6A 2ZZ4A 3IIOA 4KEMA 1OX4B 3VMNA 1H41A 4WEVX 2OTDA 4GX9A 1DQWA 3R6IA 2BOGX 3P5ZA 5LIWX 5DQPA 3Q45A 1SJBA 1JR1A 4PMZA 5AC5A 3CZEA 3N6JA 3LUTA 2PDCA 3KBJA 2CITA 3GHUA 3PPCA 1EHNA 3FDKA 5SWUA 4V27A 2X0SA 3MDUA 3CZJA 1OM0A 3U8GA 6XIMA 3UZJA 4RNIA 3IS4A 1V4YA 5F1VA 2X1UA 2EPNA 5JH2A 1WO2A 1DWHM 1U30A 3AMLA 3Q2DA 3GG1A 3RM4A 3QSTA 3DUGA 3S1VA 3FNDA 1SO5A 3G0XA 3JVAA 4JTAA 4DJEC 4HIBA 2BX7A 2O55A 3BCJA 1UH3A 6TIMA 2ZXDA 1KCZA 3R10A 3M0IA 4XKYA 3VD7A 1JZ3A 4TUFA 3CTLA 1SFLA 3S4TA 4BQ3A 2HCVA 2HEJA 3CUXA 3HPSA 3TROA 2H90A 4PYSA 5CSYA 3M0KA 5HWJA 3V5FA 2A2IA 5REQB 2W61A 3ARWA 3CHCA 3TJXA 2AL2B 3IPWA 2PU1A 2QDDA 1RQBA 3TNOA 3EOEA 5ABHA 1XBVA 2YKKA 3SIZA 4O4VA 3SCRA 3R1ZA 4UFLA 2DY3A 4YVPA 4WZHA 1OADA 1LL4A 4FP1A 3LEPA 1MUMA 2W66A 4H2HA 3WFZA 4Q8PA 3RM8A 2V3EA 2QUTA 2QVHA 2CLLA 4NZCA 3NOEA 4MAZA 6A3HA 5HNRA 3KE0A 1NDYA 4W87A 2V9DA 1J0JA 2X7WA 3DOPA 3OBEA 5TIMA 3HZ3A 6REQA 3MUCA 5M5DA 3E38A 1QPKA 2QCHA 2WK2A 2NQ5A 1A0DA 1TV8A 1H62A 3M6DA 5JH1A 1KM0A 1S2UA 1JYVA 4I7VA 4PODA 1A5BA 1TWSA 1U1HA 4DF0A 2CBUA 5I5RA 3CIVA 1KWKA 1ITUA 4US6A 3HTWA 2DUZA 3WLQA 3PBUA 3UR5A 5LNSA 4QEHA 1S5NA 3OYZA 1B0IA 3AMKA 3GTFA 2FH6A 4IMAA 1MEHA 1GVOA 4LYKA 2BTMA 5DXYA 4RKAA 2ZFAA 4DJED 3KBVA 3VDCA 3NPVA 2Z00A 2PTYA 4ZCWA 3WDJA 4TXEA 1W17A 3WNLA 1KV5A 3QOMA 1FHDA 1J6OA 3SGGA 2QQ6A 3GZ3A 4Q4OA 1HJSA 2VJXA 3SCPA 3BV4A 4S3GA 3MYOA 1I2RA 2IKGA 1GHRA 1B2YA 3OIHA 2YFNA 5CSSA 4GQQA 3AJ7A 1NVMA 3R58A 4AVOA 1Q6GA 4I5UA 2W92A 4YTQA 4C1NA 3W1AA 2WZMA 1K8XA 3IV8A 1IGWA 3VFLA 4YXGA 1GW1A 1NF7A 1NP2A 1TE6A 4JTQA 1WZMA 4JFTA 4S3CA 3RR1A 2VCBA 3OLGA 3LBCA 1XIDA 2PUZA 1UCWA 2X42A 1FWHC 4GYFA 4KFOA 2QV4A 3P74A 4I90A 4H6QA 5L6UA 3FDGA 4UTWA 4PH6A 1E1CB 2J74A 1ONXA 1UQYA 2XTKA 3EGJA 2DW7A 2FGBA 1CXLA 1JPIA 2YLLA 1Y5XA 1XLMA 2VEKA 3OGRA 1H7NA 1Z41A 4EWJA 1E4MM 4LS0A 2KAUC 2CLFA 4PMVA 3M46A 4S3KA 5E6ZA 4E8GA 3EX1A 1Q6OA 5E93A 1R2TA 3RMEA 3UXDA 2QEZA 1G6CA 4RJEA 1F4HA 3TTYA 4O4WA 1N2VA 3TC6A 4AMCA 5LNRA 2O9TA 3DU0A 4LYPA 3MCNA 2QUMA 1JXKA 1EPVA 5FJIA 3SJ3A 4RDZA 1H09A 1W32A 2CZVA 3E0LA 3NEVA 1FHUA 3DYMA 5BRBA 4GZEA 5A6LA 4DY1A 3TNBA 2X1TA 3WNNA 9CGTA 5C2XA 2ZRYA 3QF0A 1VRDA 4JNYA 1ALDA 3MS8A 4IG2A 4XZBA 3RX3A 3IVUA 2CHOA 2ZTKA 3UR7A 4C1LA 1AUSL 1E6NA 4AEFA 4M1BA 2VWTA 3NQAA 2WMJA 3UG4A 4RNHA 1PIIA 1DXEA 4DI8A 4ATDA 3N13A 1XDJA 4WLCA 2PBGA 1X98A 4MZ1A 4MNJA 2Z6JA 2W4XA 4GUHA 2Q01A 2CIPA 3W24A 1EGVA 3EPOA 4YTUA 1TFVA 4G8TA 1K4HA 4UUIA 2J75A 1F2JA 3L4XA 1IWPA 4E3VA 3PB0A 3EWZA 3VK5A 2VNCA 3L21A 3BZJA 3FA3A 4PULA 4AY7A 2G8ZA 4RE0A 3U2EA 4CEUC 3STCA 4JTLA 1E56A 3AIRA 4EOUA 1J9YA 3T0DA 4WY0B 1UOZA 3T0CA 1IZKA 3QHMA 1RHCA 3VFCA 3NR0A 1E0WA 4GOAA 2VZTA 4JYDA 3L4YA 1RR2A 1PTGA 4HPGA 5MKGB 5JBFA 8CGTA 4DHGA 2VO5A 5AYZA 2RJHA 2H9AB 4LX4A 1H61A 3U3HA 3QMTA 4P5UA 3LHZA 5FCZA 1RXOB 1VC4A 1VLIA 1ZJAA 1PXGA 3EPNA 4M82A 2I14A 3CEUA 1DTNA 1H0GA 1TVLA 3ELFA 1G7UA 4GPNA 3GTIA 4K3ZA 3GDTA 1ZRQA 2YCEA 3MZ2A 2DSVA 3VZZA 1CLXA 1XYLA 2WZHA 4FNPA 1EO5A 3QV7A 1PKYA 3K13A 4J1OA 4V1YA 3T05A 3WK1A 3WBYA 4PBGA 1ECQA 1JPKA 3EMZA 2X16A 5C71A 1W9VA 2QJIA 3G3DA 2PLKA 1XW8A 1YW1A 1EX1A 3T55A 3R2GA 4A8NA 4O13A 4P8WA 1SYTA 3PZOA 3NO3A 3W7KA 3CEPA 3DC0A 1XLHA 1WOBA 1SFTA 4A3QA 3A3HA 3PZUA 3OB8A 4M29A 3H23A 1TPEA 1WNOA 1GTHA 1NELA 2OT1A 3MHGA 1Q63A 1DIKA 5I03A 1TTQA 2VFHA 3AALA 4CD8A 3BSGA 4OWGA 3H2AA 4IFKB 5IDZA 3UG8A 3P7YA 3PUDA 3HMCA 4NY2A 1P4CA 5LZLA 3LCFA 1US2A 3RITA 1QASA 1SSGA 3G1AA 1SSDA 1V6WA 2BNJA 1K1DA 1OFAA 2VCCA 4UCGA 4HBKA 4RK8A 2A6LA 4AY1A 4J3SA 5CBIA 1OG0A 2FHCA 1XYBA 3SURA 2PTXA 1AMYA 1MRQA 4GUJA 1QWGA 4UFHA 5F4SA 3T7VA 1XLKA 5HWNA 1XBXA 2GGHA 4AEEA 1Q45A 2ZE3A 1L6SA 4H9TA 1VHNA 3MKVA 4M51A 2VZOA 2YCJA 5AY7A 4AC7C 5DLCA 4V33A 1HQTA 4DNHA 3ID7A 4ERIA 1MNZA 3S9ZA 1SJDA 4E6MA 1KKOA 1B3ZA 3GVRA 5IRPA 3KL0A 3M5XA 2WHLA 1BWVA 3SGZA 2JKAA 4D6FA 2JKPA 3GY1A 4AY8A 1EP2A 4AFYA 4I3GA 4R27A 3OW1A 4UOJA 9XIMA 1VBRA 1VPQA 3C2YA 1XH0A 1HKWA 2J6XA 1CLVA 3AS3A 2DT0A 3UR2A 4PRRA 1BGGA 5CXPA 2IQTA 3LBOA 2QYGA 2D20A 3A24A 4IGMA 3WLLA 3TIMA 2G3FA 3VDAA 1E1FA 3K4WA 5A8NA 2Y63A 5I00A 2PU0A 1NFGA 1SU5A 2BVWA 4DXKA 5CKSA 4Y96A 3UWZA 1R0MA 3MDWA 3EA1A 1VJIA 2IPWA 4KEUA 3LRLA 2RFGA 4IMDA 3RAOA 3OTRA 4Q8OA 3FY1A 2WYSA 1DHKA 3PBYA 1VKFA 4LUTA 3R11A 3GQYA 4XIMA 1QBBA 5AOUA 4NAFA 4C6MA 4ZQMA 3ARZA 3ZWTA 1KFKA 4GYPA 5KZMA 5E70A 3GU2A 1XSJA 2YB4A 3GC4A 2YDRA 3B9EA 3W7OA 1DE6A 3OVRA 2FGLA 3TC3A 3FCPA 4FLSA 1T8XA 3WK2A 3TV8A 1G7VA 5I0DA 2ZUWA 3N04A 1W3TA 2Z24A 4I5XA 1XRTA 1V02E 3WJYA 3PUGA 4W5ZA 3NVTA 1ME7A 1A4MA 1B3WA 5F2IA 4K1WA 3LI1A 3K4DA 1WA3A 3W7MA 5CPOA 4QIUA 3W9ZA 4HNVA 4IQLA 2D2HA 2DUXA 1R8LA 4LV9A 1X1NA 2E9BA 5E0CA 2VXNA 4M1RA 4KBXA 5B7ZA 3L2IA 3B9NA 4US5D 3QM3A 5AHEA 2ZZ7A 2R9RA 4HVXA 3L2LA 5ABGA 4B3KA 3EWCA 5AVNA 4RZ5A 1F7BA 3MMDA 1FWDC 3M0YA 3AIWA 1H4PA 3VIGA 1H2JA 3PPFA 4PMDA 4NJJA 2QJMA 1EUAA 4LEFA 4EACA 4Z2LA 2V63A 3D3FA 4K2SA 1N8IA 1OT2A 2WSPA 5T26A 3VNZA 1LCOA 3C2FA 3HU7A 2FZNA 3W38A 2GK1B 1QHZA 5D8WA 4AZIA 5G4HC 1XPGA 1YPXA 4LAZA 1OFEA 1TWZA 2D3LA 1MW3A 3NTYA 1PDZA 3OHIA 2C91A 2QKFA 3ES8A 1AJZA 2QCCA 5KZDA 1LL6A 2PGFA 1SZNA 4RDVA 4LANA 2JALA 3WJSA 3VGGA 4MWAA 3SI9A 3AYRA 1K8YA 4O1DA 4QQ3A 3RRXA 1BYDA 4WQ6A 2E68A 2EPMX 3LBMA 4IP4A 4OUIA 4XD3A 5K3VA 3VGFA 4O1EA 1MW2A 3SCWA 2CLEA 2B4GA 3LENA 2DH3A 1EKOA 1A80A 5FF7A 2RH9A 1FDJA 1YYAA 1XPYA 1JUBA 3ERPA 5XIAA 2VEFA 1ADSA 3MSDA 4EPDC 4YWIA 4ZOEA 1A50A 5ECUA 2GGGA 3AYVA 1L6YA 4H19A 2PZNA 3LQLA 4NL1A 2DZTA 1TPVA 2BXYA 1LWIA 1GVRA 4HU0A 2REQA 1LOQA 4ZO9A 3SN0A 3MBDA 1GVEA 3SY5A 4PB4A 2ZE0A 1LWJA 1FWJC 5K7JA 2A3AA 4C5ZA 3TN3A 5CBBA 1CIUA 3HPAA 4FLQA 3H7UA 3BAYA 3W53A 4EPKA 4HZ7A 4PTNA 1BXNA 1MQQA 2AMGA 4HJFA 4LVGA 1HGWA 1R30A 3AISA 3VINA 4FXJA 1F73A 5EY5A 1LLWA 2XYLA 3TTSA 4IZGA 1JDAA 1U5VA 3OHMB 4RV3A 2R1KA 4XZLX 4NSBA 1X96A 2H3BA 3A9IA 1XIHA 1XCXA 4IMFA 4NI8A 4B5TA 1X38A 5FL1A 2ZRVA 3BAWA 2YSWA 3WQ8A 4AD2A 1KFCA 4HMCA 3R4IA 4UMCA 2PDQA 4PCNA 4JHMA 4JX6A 2Y8VA 5KMYA 1E6SM 5C9XA 4QRNA 1GTEA 4F0SA 4Q8QA 2WHKA 4DBUA 1BSLA 1HJXA 1KGUA 3OO2A 5AC6A 3E0FA 4YU1A 3DHPA 3LHTA 3WLSA 1HKMA 3ZSSA 3N2MA 1E6XM 5MF5A 4XVEA 1K6WA 1X8FA 5BWFA 1MW0A 2CZFA 2PS2A 3HJZA 3F4WA 3W1QA 4O12A 5DT7A 3NSNA 3R25A 4Z1DA 4Q4PA 3RX2A 2J7BA 4ACYA 1I2QA 3WDIA 4CVUA 3AMDA 1BRLA 5DMMA 3FIGA 2DU2A 4KWVA 4ZTYA 2WZTA 3KVKA 1QFEA 2EJ1A 4CCDA 1FCUA 4H9YA 3FKKA 5IOBA 2EPHA 4Y2WA 1EIXA 1S2AA 1BYBA 2C7FA 3ANVA 1OF6A 4DO4A 3ECQA 1LT8A 4MWAE 5A5WA 3QR1A 4Q8NA 1WXZA 3EB3A 1RQEA 4IISA 3UR8A 1YTDA 3GHSA 4W8AA 1DKWA 3VI2A 3UZWA 3U7VA 1KWGA 4DXXA 1QPQA 3VOCA 1PYFA 4D1IA 1W5OA 1AL7A 1R2SA 3R7MA 1CXHA 2G97A 3H8AA 1JZ7A 4X60A 4KCVA 4E2VA 4G7EB 1XFCA 3BSHA 1KR0A 4QTGA 2NWRA 1SO3A 4I8YA 2UY5A 1QHOA 4MNMA 2R1LA 2YFOA 4Y6GA 2YXXA 3CPUA 4TMBA 2I57A 3OGSA 1V8EA 4A4AA 1M7JA 1YE6A 4PMJA 3KRSA 3L67A 4AHQA 2P76A 5EMYA 3TX9A 5FJPA 1JD9A 3V1PA 3KDOA 1BEUA 4LCSA 3L4VA 4UTFA 2Q8ZA 4MUZA 1K02A 1NFBA 4IX2A 2C0HA 3RILA 4YJ5A 5FEWA 3QPEA 1E4IA 1HXJA 1ICSA 3EOOA 1IEIA 4ZL1A 5CBJA 4DM1A 1PZ1A 1VBHA 2EXOA 1VFHA 3WD0A 2J8GA 1RCXB 5CC5A 2VZVA 2ZVRA 3C86A 2A3BA 3GYCA 4ADUA 4EPBC 3BURA 2X1IA 3FOKA 5AHLA 3MI3A 1OB0A 3H4XA 2C13A 1VPXA 3OLDA 1KXQA 4K36A 3LCHA 3AI0A 3PJTA 2DSKA 3W85A 4GGHA 3AIUA 5C2CA 4GBUA 3LD5A 2XN0A 1L2UA 4PUJA 1EOKA 4O11A 1PYMA 2PDKA 3WNKA 2Z0IA 1W0MA 4FX8A 3THCA 1QNOA 3RPDA 4LAKA 5I3DA 1U33A 3F03K 2J9ZA 1WBHA 1UKOA 2GPTA 1UROA 3FA4A 3AHZA 1OC6A 2GUYA 3B8WA 1M03A 7PTDA 5BMXA 3O07A 3LPFA 4ZO7A 3C0LA 2JIWA 1FWIC 1A4LA 1KFEA 1F8MA 3GR4A 2WLYA 4QISA 3QZEA 2ON3A 5HULA 4O0QA 4BWLC 4AZCA 1DIEA 1JD7A 4QROA 7ENLA 3LCWA 4Z1CA 4NYYA 3KBNA 1ENUA 2Y8UA 1RJQA 4Z2GA 1TELA 2POTA 4DZHA 4NAEB 4XD5A 3ZJ7A 2YCIX 4D8LA 4RXFA 1FUYA 3W87A 5BXSA 3A23A 3FSUA 5FJRA 1JDFA 4IXHA 1L2QA 3PANA 4ZODA 3TQ0A 4G6CA 2YYTA 3IAPA 3ZIZA 1A5AA 2ZRWA 3M16A 3U0HA 4UTIA 5AKQA 2FMNA 2WC4A 1V79A 2HPMA 3FJ4A 1A5SA 3EKGA 3PUEA 3GTHA 1QI0A 4L65A 1XI3A 4B2DA 4E2DA 1SPQA 1BF2A 1XS2A 2INFA 2B7NA 8TIMA 4PEEA 1P1MA 1IYXA 1LJYA 5FESA 3EEZA 5CJNA 1LRQA 3GG0A 1YDYA 3DAQA 1XC6A 1KM6A 3NQ8A 4UTMA 4REQB 3BG3A 2OYLA 4MKSA 2AL1A 2HISA 5D37A 1NAL1 4K39A 3TYAA 3S2JA 1VZWA 1UKPA 3DFQA 1WUEA 4HA1A 3DX5A 3BQ6A 1BGAA 2WVTA 3QHNA 1JRCA 1H1NA 1E51A 1XLGA 4XZMX 3CQKA 2PPGA 4EKJA 3A4AA 3MQTA 1W9BM 2PGEA 1WZKA 5CZ0A 3ABOA 2WLZA 1J11A 1FCVA 1ZL1A 2VR4A 1FP8A 3NDZA 2QW5A 3P14A 2MNRA 4DVOA 3VIJA 5M17A 4FS9A 1X6UA 1H7RA 3I65A 3TEVA 4LJ3A 3HV9A 1L8PA 4MMWA 4AIOA 2GUBA 4AISA 1G67A 3KOWA 4HZ8A 4GVHA 2YBVA 3TWBA 1DVJA 3W75A 3WQPA 2CW6A 1KA9F 2C15A 1PWLA 1A3XA 1OZMA 1JZ4A 4HK6A 3WQVA 1H1ZA 3ITLA 3VIHA 1WUFA 3TSBA 1LWHA 1O68A 2WMKA 5JMUA 4MLRA 2OCZA 1FY6A 3FN9A 3RO8A 3M0VA 2IPGA 2I9EA 4KRUA 2XGZA 1XH2A 4J9JA 5D05A 2DZSA 1F07A 4X9SA 3STPA 4H7ZA 4ZSUA 1WPCA 5HAOA 2P53A 3W7RA 3S83A 2Y5SA 4GGBA 1F3TA 4ECLA 2A3EA 3SCUA 1EUNA 2XIJA 3LLXA 4DN1A 2VR5A 3RLVA 5XINA 4Z0SA 1P6CA 3AHTA 1ADDA 3UA3A 3DI1A 4QSHA 2XSXA 2QF8A 3ZJKA 4FR1A 2B7QA 1GG1A 4GY1A 3VPLA 1DJNA 1HKIA 1UG6A 1W1TA 4NZ4A 2CXGA 3NL6A 3UG3A 2C3ZA 4B4FA 4P7OA 3W1RA 4S1FA 1HT6A 2NSOA 1UBSA 1VD6A 3RIKA 1SVDA 3NWRA 2F2HA 3TZNA 4Y9AA 3H26A 3C3UA 4I7UA 3KS6A 4PTXA 1RBAA 4FXSA 2X8RA 2OXNA 3W76A 3TTOA 3I7SA 2WXDM 4LUSA 4HU8A 3A6OA 4J3ZA 1Q4NX 2C1HA 3CZGA 2QGHA 3NG3A 2YBTA 4G7FA 2PI6A 3DFOA 4NF7A 3NO5A 4LUJA 1OFBA 1LF1A 1MI3A 7REQB 8XIAA 4PEKA 3AXIA 2HWGA 4DBDA 3ICJA 1V6VA 2FZMA 4GX8A 2G3NA 4F9DA 1PE1A 3DGRA 2HXTA 4AAJA 4JTTA 2YYUA 1QRQA 1P6WA 3W74A 4DPPA 1W9XA 1R3RA 4I9AA 4W84A 1HVXA 1VEMA 4RDYA 2PLMA 1T6MA 2VELA 3FHQA 2QPUA 1J0YA 3RJYA 3GBDA 2ZQ0A 2J25A 3M5ZA 4NT0A 1MUCA 2J7DA 4E3TA 4WDUA 2TYSA 2FVKA 5CZTA 2JKEA 5ABTA 4OGZA 2Z29A 3ZR5A 3QXBA 4O1FA 4YCPA 1W9PA 5KETA 1J0KA 3UCQA 3LS9A 3MWAA 3LPPA 3FX4A 1D7KA 3GDRA 3BW4A 4P61A 2EPOA 4HCDA 2BZNA 3O0FA 1R3WA 3BLFA 4ENLA 1ITCA 2FGZA 5B80A 4JIEA 2QJNA 4QE4A 3ENLA 5DN1A 3NQCA 2VT0A 5FEPA 3W72A 2RUSA 1DE5A 4DYKA 3GU1A 3AS1A 4S3EA 1FP9A 4GINA 4IP7A 2FPTA 3LXCA 4B91A 4H7VA 4FK9A 4ROPA 4ORIA 3GRIA 3KRUA 4HA3A 3A5VA 3GAYA 4WK9A 3VCCA 4MPKA 1OX4A 4HOWA 3ISIX 2RDWA 4TMCA 3PP7A 2J7CA 3LLFA 3V75A 3CLWA 2VUNA 1V6TA 2J47A 4TTGA 3JRKA 1EZWA 1P6BA 3W82A 1RSCA 3QZ6A 4L1GA 1Q66A 1ZBVA 1YIXA 3F1QA 5J04A 2HNEA 1PUDA 1V08A 1AZ1A 1DJHA 4WSKA 1V3LA 4GUGA 3BOFA 3PF3A 3ARYA 3S0CA 1C3FA 4UTWC 2PEVA 2CKSA 5LXEA 4WXZA 4PUEA 1M5WA 1KCXA 5CQ1A 1TJ2A 4MF4A 1FX6A 2D0HA 1JCYA 3HBLA 3G6LA 3FA5A 3NGFA 2BHYA 2ZZ6A 1KKRA 3TTQA 3WD3A 1ZENA 3NQEA 4GVFA 5HMFA 5REQA 2AL2A 4RCXA 4H9VA 4KS0A 4GY7A 4WIWA 1BYAA 4YYFA 1CT5A 3VMOA 1GYNA 4CGTA 3MVIA 3HJEA 4UFMA 2FDSA 4Z1AA 1S5VA 1TG7A 2DQXA 1C9WA 1B3OA 3WH8A 3LZ5A 1L6GA 3CUJA 3V0UA 4H9UA 1WKEA 3ARVA 1QI4A 4UTLA 3WQ5A 1UKTA 1DWAM 3NXFA 3F2DA 1XCFA 3HGRA 4GHRA 1VHCA 1Z8AA 1YNPA 3T8QA 1W1PA 2QDEA 3VZYA 3CU2A 3EEGA 3PG9A 3SUWA 2QCDB 4S39A 1SM9A 4L56A 4B3ZA 1Q4WA 3TFXA 5FSDC 1V3HA 3UBPC 2EKCA 3M64A 3UA4A 5C9ZA 3P8IA 1U83A 2BVYA 1RALA 2BHZA 3OZPA 1DWIM 1DJQA 3OVQA 4ZFMA 5CG7A 3VNIA 1QOXA 2Z25A 4QEEA 5DBTA 3PTKA 4UWMA 3IRSA 3BLIA 1TQJA 1H50A 3R12A 4IPLA 1OG6A 3LSBA 3FVDA 3BAIA 3KOFA 4JX5A 1ZSXA 1LROA 2J6VA 3DI0A 1KCKA 3QTPA 6ENLA 2XN2A 2HTMA 3GUWA 2ZOXA 1Q6RA 2ZUSA 3O0KA 2DIKA 2O9OA 1T0OA 1CPUA 3NQMA 4IPIA 1BWLA 1VB9A 3RO6A 2XZ9A 3WQDA 2E09A 1JFHA 2CLPA 2VDIA 2BY3A 4XK2A 1E0UA 1EOMA 3ONCA 2BDQA 4W7WA 3T44A 3E96A 4KWUA 3IUIA 2FTPA 5D8ZA 1RK5A 1FWNA 2GDUA 3GM8A 4K8EA 1ME9A 3LTYA 3DHDA 4EXQA 1HG3A 1G9HA 3PTQA 3MCMA 5A8QA 2DFAA 4C6LA 1FHLA 7TIMA 4H6RA 2FHFA 3LU2A 3NQFA 3IK2A 5ECVA 4LNCA 4RE3A 2HE8A 3SCNA 3P0XA 3ARRA 2WV8A 3FS2A 1JCJA 2OYMA 1GYMA 4CQDA 1WXYA 3H54A 4JTGA 6ALDA 3BK0A 4CD6A 2G4JA 4NKCA 4OOUA 1W3KA 2WPGA 1WE5A 4CD5A 1S2VA 2CPUA 1EIBA 1JZ5A 5K9DA 1TUFA 5K2ZA 1VCVA 3Q37A 1L0PA 3QSRA 3R5EA 3VX1A 4NRRA 1EF3A 4GNKB 3L5LA 4K8GA 3ITYA 1KFLA 4QAWA 4OVXA 3VXGA 1W1VA 2GQ9A 5EB8A 3OBAA 3M7WA 3PG8A 5DT5A 3ATYA 1KTCA 1M04A 3BUVA 5CJMA 2UWFA 1GPWA 3GZAA 1L9WA 3C4UA 3CUGA 4LT9A 1AK5A 4HSNA 1NIUA 1TVNA 4MOZA 2YA2A 3G8EA 3T81A 3VIPA 5C6MA 5LNWA 1IIGA 4NU7A 4FAMA 4GYKA 1WDQA 3P81A 3IUDA 1E3XA 3PTMA 3BGGA 5E5CA 1IWAA 3MP4A 2D23A 3QY6A 3MW7A 4BF7A 2PDPA 1LOLA 4LVBA 4RNFA 5IXEA 3W07A 3QW3A 5GPRA 1QDSA 4K7YA 3H4WA 3SADA 3NURA 3UJEA 3UFYA 2QPSA 3K4AA 1UPPA 1J5SA 1I2OA 4IMGA 1TUXA 4IXXA 5KZ6A 3UZYA 4L1XA 4Q7NA 5G2HA 2OMAA 3BXWA 3VIMA 3PNUA 1QT1A 4AW7A 2NVDA 4H1ZA 2F6XA 2Z7KA 1AQ0A 3G1SA 3ZVIA 5CPNA 3EDDA 1VRXA 4WY0F 2AQWA 5GNYA 2ONEA 1UWSA 3LN3A 4HPJA 4Y9MA 2PDFA 3ABRA 3A22A 3I7QA 3UNDA 2BV9A 1KGWA 2X2YA 4WXYA 3OZOA 4MY8A 5LXXA 4UQAA 3RN6A 4WY0A 3W3OA 4HMNA 2PDUA 5M2FX 4IX0A 1BKHA 3STFA 4DEFA 1OINA 2PWUA 4DZ5A 5B7YA 1ONWA 2BSLA 3ZO9A 2XVPA 3CASA 2ZADA 3PBVA 5MKGA 1ME8A 2OGJA 4MFEA 2IKJA 1WAUA 1U1JA 2H9AA 3ABZA 4J2PA 3S46A 4INFA 3N4EA 5HNUA 2Y0FA 1SW0A 4BS0A 4HB7A 4IJCA 5AYIA 3UWVA 1ISXA 4WD0A 1LYXA 3LTPA 2IXUA 2WJEA 2F8QA 1EJRC 3CGTA 3AHVA 4IQDA 1Z9AA 5AHNA 1H11A 1K77A 1XD1A 4L9XA 1H7XA 2VWSA 1HKVA 2ACRA 3WO8A 1KRBC 4GYPC 1N82A 4Q7IA 3BTNA 2G3JA 3DYPA 2Y5JA 4Q8UA 4KGJA 3N6QA 2J79A 2VFFA 1UIOA 4GI6A 5AVHA 1UJQA 5G1TA 4YVVA 4QG6A 4LS2A 3B05A 4N7QA 3GW3A 2W3ZA 4AWUA 3GVGA 4C5YA 4FOKA 4KMQA 3FYOA 1PB0A 3GX9A 4Z0JA 4EANA 3OZYA 3QY7A 2BY1A 3LGGA 2GLKA 3AS2A 4MVAA 3TFCA 5C0QA 3GTXA 4QAIA 3SB0A 2PF0A 2VQTA 4DF2A 2INEA 4ZO6A 1LQAA 3TK7A 3EMQA 1QI2A 2GGEA 4E8CA 3ZLFA 3MSRA 2BVTA 4IUOA 1B57A 1E70M 3UVAA 4FNRA 4G5DA 4QP0A 7TAAA 4XB3A 4GVGA 5AYBA 2W6RA 5G5IA 1I9CB 3NQVA 1DHPA 4ZO8A 3CLMA 2DJLA 1JUKA 3CHVA 3CAWA 3CAKA 4JTIA 2ZIDA 4DO6A 1V03A 4YTSA 4PCPA 1OFDA 3D47A 3O2LA 3REQB 4DJFC 3HGOA 4KKXA 1IE7C 2I5GA 4WGHA 3N12A 2OWXA 3VNLA 3FW6A 3I7RA 3KCOA 1T96A 4W7UA 2VHLA 2VDGA 1ZY9A 2ZWZA 1OGGA 4RZBA 3BO9A 3I3BA 4QFUA 4KRTA 4D72A 1K7FA 5CC3A 4MWAC 1QO5A 3GNOA 4DM2A 1UD4A 1G01A 5DBUA 2D2OA 3CH9A 5D2VA 3FYYA 4Z2KA 2EBNA 3U48A 4PL1A 1UP0A 2HK0A 1IT8A 1GYLA 2PP3A 1QPNA 4IH3A 3NCOA 1O66A 1W2VA 3A12A 5E0KA 5J5DA 4JQ4A 1R7OA 3GG8A 1QPRA 2F7FA 4KESA 1CX9A 1BVZA 4HQVA 1CXFA 3UWUA 1AQMA 3PPHA 2ALRA 4ZZ9A 1MDLA 3GXIA 1NDZA 5A6JA 2FVLA 3Q94A 3L65A 2PGRA 3KX6A 1QR7A 3GIPA 1H7PA 3G1RA 2EG8A 3TH6A 4PCSA 5HJLA 2GJNA 3PSWA 3HN3A 1B4KA 1OX5A 3PAOA 3L4ZA 3GHRA 4AUBA 1N8WA 4MYXA 1PSCA 3M5YA 4AHOA 4PMUA 2Z1SA 5J8LA 4J3TA 2O4MA 1A3HA 3ARPA 3ZLHA 2IPJA 1FWGC 1QWKA 3KBMA 3BJFA 1GONA 4DAFA 2PDNA 3C3NA 5D9MA 5C7VA 3HMJG 1A3WA 1JAKA 3WLPA 5E9XA 4GQ0A 1UUQA 5F4XA 3DFNA 4H8HA 1P5BA 3VDGA 2WANA 4GC4A 2PP0A 3GH4A 4MWAD 3MCOA 4F8XA 3QHOA 2W27A 3V5CA 1RZMA 2WCGA 3C52A 1CGYA 1Z89A 1POJA 4CNPA 3LM7A 1OFOA 2C1GA 4PCTA 1DWGM 3N4FA 3KP1A 2D2GA 3OYXA 5BNKA 2OZ8A 3GNDA 4HNOA 5DY2A 1ZZMA 3SDOA 2PTWA 5DANA 4N9EA 1V6UA 1B9BA 1WOAA 4KF1A 4GACA 3N2OA 5KTLA 5M3WA 4GA8A 1TJ0A 2NV9A 5BCAA 1TX2A 3W70A 1X97A 2Y1HA 3WF4A 3W1LA 1K7EA 1UKSA 2H8ZA 1IR2A 1FWRA 2ZCGA 4L9ZA 4OIFA 2E6DA 1XX1A 1TV5A 3HOJA 3EBVA 1EYWA 3WMCA 4R34A 2DGAA 3ARSA 4JEQA 2O56A 1ZAIA 1KQYA 3UZXA 6TAAA 1UR0A 1C93A 2AMXA 1XBZA 1RH9A 1VFMA 3G18A 3WBAA 3VIIA 2Z2BA 3BOLA 3Q58A 4GUFA 3OP2A 1AFSA 3WEMA 4EK7A 3N29A 1KXVA 4GQBA 4UC5A 1JXJA 4YL2A 2NWSA 1WKFA 4GQRA 4LAOA 3LB0A 4BY3A 2WPBA 1OF8A 1ML1A 2HS6A 2NUYA 1VYSX 4L6HA 4K38A 3KS5A 4OE7A 3QV8A 1GKQA 3M6YA 2VQUA 5GJMA 1P43A 2CXEA 3TONA 1M01A 1A0EA 4JZ5A 4WSHA 5TQLA 1E0VA 3TYDA 1EGZA 1GOQA 4U31A 1D2KA 4B16A 1W3LA 1W1ZA 1FH9A 1FBAA 1FFRA 1EZ2A 4Q8TA 2XWEA 3GSMA 3NJ3A 4NX0A 3JS3A 5A6AA 1G1YA 3SCTA 1OQFA 4BKNA 3W6YA 3W29A 3AQUA 3DYOA 4OOZA 2AAAA 2WSQA 1QATA 4XAFA 1E4NA 3BGAA 3OJGA 2YDQA 3CHDA 1UW9A 3VYLA 1TQXA 3MO7A 1J18A 1MWOA 3TXZA 2DZVA 3EAUA 3BAKA 2D1ZA 1W3HA 4GJ1A 3TSMA 3BLEA 4HHMA 4MJ2A 3FLUA 4S2CA 4QQUA 2V3GA 1OIMA 2PDMA 4H04A 4U2ZA 4OFCA 2HVNA 3MANA 1TV7A 3NZQA 3F4VA 1Y7VA 4CCCA 1WQ5A 1UYQA 3LY0A 3L2MA 1QOQA 1TR9A 3NQDA 3RLGA 2NXIA 4YNGA 4AEOA 4B90A 4JS3A 4PMRA 3WFLA 4AYGA 1KV8A 4GG9A 1H60A 4BQ5A 2RGLA 3VVGA 2C8NA 3NPWA 3TW9A 1XL9A 1RPXA 3CL6A 2P0OA 1WV2A 4UTHA 4N9DA 4URIA 1FWTA 5F7UA 2D0GA 3WBEA 4F2BA 1WXJA 1YDVA 1WAWA 5DFAA 1CXKA 5CJ5A 1DQUA 3JZUA 3MI2A 4K68A 2QJHA 2XFFA 3SSZA 1HTIA 3T0AA 1TPH1 5JXQA 1EP3A 2DIEA 2GJLA 3DFPA 3LMYA 5EFFA 4UXDA 5I3JA 3NM3A 3ME3A 2J77A 2WMHA 3IRDA 2PTZA 4LAUA 1QK2A 4PMOA 1I0BA 1XQKA 4PFMA 1GVSA 1MSSA 2PC8A 4Z42C 3E2QA 2HDJA 3ANYA 2C14A 3IJLA 1MXGA 4RX0A 4MDPA 5CEWA 4JTSA 1D7FA 3QFEA 2OVLA 3VGBA 2WJZA 4PRWA 2VFEA 1JIBA 1UBPC 4H6KA 1JCMP 3N2BA 1PTAA 2V0TA 3DESA 4FX7A 5I2UA 3NO1A 4MY9A 4PC8A 5GNZA 3NZRA 2WCSA 3V7PA 1DJWA 4XVDA 1DBTA 1TIWA 2X40A 3N3TA 1VYRA 1UD3A 2F2KA 4TV6A 2VVSA 3QTGA 1WKDA 1W8SA 4FLOA 3OGVA 1JQXA 1ISYA 4GK8A 3S5OA 4F66A 1OFQA 1W3NA 2BODX 4Q4RA 3SBFA 3HM7A 3VILA 2NXGA 4WF7A 3E2RA 2VD8A 2WW5A 2P10A 3RJXA 4QR6A 1K9TA 1QNPA 1XYAA 3MV01 5CGQA 2OZ0A 2OO0A 1VIWA 1KTNA 3WLIA 4DAIA 3VGDA 5AC8A 2B81A 1HO4A 3C2EA 4PB3A 3WDQA 5DO8A 3HFTA 3NYDA 1R9ZA 4FIRA 3CAQA 3TQKA 4G7EA 4NRSA 3ZMRA 2BHUA 1IF2A 2Y61A 2J9YA 4L4LA 2PWDA 3GDKA 3MB9A 4HTBA 2DJXA 2Z6IA 2V2CA 2MANA 1EJSC 3IWPA 3T1GA 2XH4A 4ZBCA 4KW2A 3OLEA 3O7UA 4IIEA 3LTSA 2Q8XA 4JEJA 5GNXA 1AJ2A 4A35A 3VM7A 4B5VA 4OZOA 5BZAA 5D2WA 3JW7A 3OPSA 4F9JA 2GYIA 4XZHA 3L12A 3V0TA 1E9LA 2V5BA 3AOFA 2V5LA 3QR0A 3LCIA 1XIMA 3DCPA 5DX7A 3G1FA 4GZIA 5E9AA 1IXOA 1XJBA 2JQXA 3WUGA 3UCCA 2BB0A 4NNBA 3MYPA 3LNMA 3FJNA 2PF8A 3P6LA 3LCLA 3GNPA 1CNVA 1AH3A 1TMLA 4S3JA 4YWSA 1KCLA 2QCMA 3WD4A 1XLCA 1XYMA 3BAJA 4F0RA 1K9FA 2VRJA 2R6OA 3QOKA 4NASA 3DHFA 4MKNA 2YLAA 5A8PA 4HZ6A 4R9XA 3QPYA 5CC7A 3FAWA 4DQWA 4AF0B 4ACZB 3LG3A 3WJWA 4FXRA 4HZMA 4IGHA 4L64A 4YCOA 3LZ3A 1ZCCA 4GKTA 4JL2A 1ZS2A 2YZ5A 4B2DD 2DEPA 5A2CA 4IG2B 3DBPA 4E38A 3VKKA 4PBEA 5EGRA 3A64A 1BXCA 5BRQA 1GQIA 1EL3A 3QV9A 4HOXA 1XGZA 4JL1A 5KEZA 1OD8A 4PSRA 4CD4A 2HRWA 1ZUAX 4IMCA 1KBIA 2HJPA 2J27A 1YEYA 1XLIA 1S2CA 2E0PA 3NA8A 1OHLA 4GXPA 3C5QA 3H24A 4QNWA 4QXIA 2ZZ3A 3I6TA 1KD0A 1LM1A 3GH7A 3U2CA 2V8ZA 1FDYA 2XFRA 3NSMA 4GD0A 2G41A 1YDOA 1E73M 1E1EA 3HURA 1M7XA 5EPDA 2XFYA 1G4EA 4C7FA 4NAEA 1VBGA 4LOCA 4UNLA 4DLMA 3CUIA 3TOPA 3VD4A 3KCLA 3U57A 4K7VA 1YLVA 4NZFA 3QC0A 1WZLA 3SAZA 5BOFA 3TQPA 3VKJA 1O6IA 1E9ZB 4HNUA 3GDBA 4U4MA 3A13A 2AQOA 1RPKA 1LZOA 3ALGA 2Y85A 1QU4A 3T2PA 4QHRA 4QNEA 3SFKA 2HBXA 2A3LA 1V93A 2D69A 4O18A 3HG3A 2W5FA 3CIWA 3NOYA 5BOOA 3WLTA 1PX3A 4PN2A 2NSXA 5CPTA 2OEMA 3OVPA 1CGXA 4JYFA 2ZRZA 1XQLA 1ZP4A 3I3DA 5D04C 3FGCA 4ZSTA 5LA2A 1JYWA 3CH0A 4NVTA 5HOSA 1EJVC 4WDXA 3A47A 1UWQA 4JY9A 1H3GA 1XHGA 4FOUA 1K7XA 1HW6A 4PRTA 2WC7A 1YE4A 4TO8A 1TPC1 4F2TA 2WM1A 4TVDA 2JBMA 1NQ6A 3GKAA 4MHBA 4N4PA 4GCXA 1LBLA 3SO7A 2V81A 3VIFA 4XWUA 1QW7A 4DXVA 4QE1A 1HZYA 3F4NA 3G1VA 3PWGA 2YW3A 3BLPX 4ICCX 2OLSA 2OWWA 4ZVJA 3UU0A 3WJXA 4AD1A 3UZ5A 3WDRA 4DLFA 5C9RA 3B06A 3IIPA 1CECA 5F4WA 1A0CA 3DDMA 2DZAA 3TR9A 4JKKA 4TVCA 2ZX8A 3WLNA 3R8GA 3DKJA 1NFPA 4H8NA 3BOXA 4G1KA 3U6WA 3PNZA 2X05A 3L5AA 1U5HA 3BAXA 1VFSA 2J88A 2PC4A 2VGFA 2WWDA 4V1XA 3USZA 3MUZ1 4DIAA 2ISWA 4IMEA 2A4AA 4NUWA 3UPMA 2Q8LA 4TX9A 3LHUA 4I9MA 2BGNE 4IGSA 3RRAA 4AVFA 3W22A 4X61A 2Y6ZA 3SRKA 3VCNA 4KFNA 1JF5A 1UZ4A 4GIEA 1JL8A 2F6KA 2OZTA 2D0FA 1SFSA 3N9SA 5FEZA 5F2GA 3MMWA 4RPQA 4XX6A 3GS6A 5AB3A 3CT2A 1NM9A 3D0CA 4IL2A 4IUGA 4HCLA 1AD1A 4GNJA 4R53A 2WJDA 3GK0A 3PFMA 2PDHA 4AD0A 2C1IA 1R3YA 3E2SA 4CQCA 1TZ9A 3LRMA 3GG7A 1Y8BA 4GI9A 4LXFA 1IT0A 3N18A 4LNYA 3C2RA 1ZP3A 4XO7A 1ZFJA 3S5ZA 5EL1A 3I4KA 3HA1A 1ZJIA 1BQGA 1EJUC 4NI3A 2Z26A 2E5DA 4AIEA 3QMSA 3WN6A 3PS7A 1XIEA 3B8VA 1JYXA 5EMMA 3M43A 3KOYA 1XFBA 4Y8FA 1M65A 1ZALA 4N6FA 1RAKA 5T9BG 4HPNA 2FB2A 3CQHA 3KOXA 1EP1A 3VNMA 4JKMA 5D9OA 4G2DA 4CU8A 2I5QA 4R7OA 2VZUA 1NARA 3DGBA 4EX4A 3T6CA 4O0ZA 4LC6A 1DV7A 4YTRA 5HANA 1UD8A 3AMGA 1IEQA 1VJSA 2TODA 1CGWA 3LMZA 3HG2A 2YXOA 2ZX6A 1EQCA 2UY3A 4LVAA 2PLCA 1TTIA 2IMRA 3F2BA 2MUCA 4IICA 1UWIA 4UR8A 1JAEA 3LPOA 4LUTB 2B7PA 1J5TA 3W2MA 1D3GA 1P0BA 3DHUA 1G4SA 3HO8A 1U22A 5BU6A 5C9UA 4AWTA 1TPWA 2VC7A 4WJXA 3R43A 4ZGYA 5D33A 2Y7EA 1MRAA 1RVGA 2INZA 1F05A 3ZM8A 1ZQ5A 1I6NA 1MVYA 3UNTA 2OJPA 1B3YA 5G4WA 5GQBA 4GY0A 2V38A 1UD5A 3UJFA 1Y0EA 3DG3A 3OLIA 1H63A 4W8BA 1KQZA 3DFHA 3DH7A 1FWFC 4EXBA 2E6YA 3TAOA 3VNYA 1LLOA 3OOQA 2WVVB 5I6SA 3WQ6A 1FXPA 3CAVA 2HNHA 1DPMA 1OD0A 1VFOA 3SUSA 1FFQA 4CN1A 3GU9A 5ENLA 5A6KA 1XLAA 3SUUA 2X09A 2WBGA 3MMTA 2C71A 4AZGA 1HKJA 1XYFA 5IDIA 2WMFA 1H49A 2NX3A 2GVEA 2OZ3A 4UCFA 4XZ9A 4C65A 1GEQA 5D30A 4QE5A 1JPHA 4AIUA 4KCUA 2VRKA 4CNTA 1VH7A 1GOIA 4MM1A 5I02A 2ASHA 4J3VA 2J8TA 3HQOA 3NZPA 1HJWA 3SCQA 2GVJA 3UXKA 3W1UA 4XIAA 1KBBA 1GQNA 1BKSA 3URNA 1TMQA 1OVDA 5HXMA 1MQRA 2IKHA 2CHNA 1V7AA 1XIJA 4NZJA 4WR3A 2AGTA 5EMKA 1QI3A 4QS6A 1D9EA 2I1OA 1EA0A 1TRDA 5FF0A 1C7TA 4HA4A 1NDVA 4MWAB 1TJRA 4QBXA 2C6QA 4LBUA 2VFGA 3KTXA 1WDDA 3LXAA 4I5RA 3UWWA 5F2LA 3QGKC 1Z48A 2DZUA 1GOMA 1MEWA 1K4GA 3G2GA 3AMCA 2XDFA 1X1ZA 3THAA 4D6GA 4JICA 1V3JA 1O5QA 1EQPA 4U5IA 2GGIA 1RP9A 3EDKA 2ZRXA 3TU9A 1JCLA 1FKWA 1HL2A 3WBWA 1PAMA 3FV9A 3TQVA 2BOEX 3PZMA 5BU9A 5FA5A 1VENA 1NQKA 4DB7A 3BDKA 1MFUA 3BMVA 5BRPA 3A5FA 3AU6A 4GYJA 2FPYA 4RXGA 1JI2A 4EAYA 1IZCA 3GW0A 2QCDA 3H21A 1DIOA 1JG9A 4C6OA 2GOUA 2REQB 2O92A 4EPEC 4MGGA 3WF0A 1IQ8A 2X0HA 3VE7A 3W25A 4ERGA 3RF9A 3WDPP 4Q4SA 1H5YA 3W26A 3ITOA 4F40A 3T42A 1PCKA 4QG8A 4HA0A 2ESCA 4HPXA 1CI1A 4L9YA 1B31A 4Q4KA 1NF0A 4JGDA 3R0UA 3TYCA 4CU6A 3VO0A 3AC0A 3W2NA 4CUCA 1NOWA 4A2RA 4K1GA 4IIBA 4QJ3B 1JF6A 4DYJA 4ICNA 5D32A 4OHQA 2E3ZA 1A5OC 2FTWA 3AXXA 3EWXA 5H6HA 3IANA 3EPMA 2BMBA 5AHIA 3VOIA 2V67A 4FNTA 4W85A 4WJEA 1A49A 4ZR8A 2FLIA 1HF6A 2DQWA 3GXPA 1OFRA 1HP4A 1O1HA 2XM2A 1BLIA 4A8IA 5I09A 1VEOA 3THQA 1SZGA 4DYEA 3N34A 3MVTA 3NSXA 1R3SA 1MZRA 4Y9PA 1JRBA 3I4EA 4NHVA 1MUWA 2A21A 1MO0A 2VX7A 3XINA 2E7FA 1EPXA 1HJQA 1B30A 4GQGA 4MPQA 5FF3A 1I2NA 4BI6A 3DG6A 3SW6A 2GOKA 1SMAA 3ITCA 3R8RA 2OEJA 2YPIA 1WB0A 4DUWA 3UT0A 2VENA 3O6CA 3RCNA 3ZS4A 1GPFA 2GWNA 1S1PA 3WMBA 4NX5A 1W37A 3O9NA 4LY8A 5BXPA 3GC2A 2NT1A 1RV8A 2H3DA 2FVMA 1CLKA 2V2DA 2EJAA 1PX8A 2Z28A 3CHFA 1W3IA 1BRLB 4N02A 1E4LA 4C6JA 2A1YA 2WAGA 2YCKX 3D6NA 2ZZ5A 2HE5A 1DJYA 1GHSA 1J93A 3V16A 2E25A 5HR6A 1IWBA 4LRSA 1FA2A 2DH2A 1JZ8A 3TWAA 3ITVA 3QEZA 2PDIA 1PIFA 2CBIA 4JCLA 3C56A 4J28A 1W5MA 4N9BA 4UR7A 3KFTA 1YXCA 3IJ7A 4Z2JA 2VD9A 2ODOA 3HFYA 3BG5A 3U5UA 3MSYA 3WD1A 5HUPA 3BCDA 1UKQA 2W67A 3ZXWA 2B7OA 1V0LA 2BASA 2W79A 3WFAA 5FKYA 1OYCA 3STEA 2E6FA 1F8IA 4OBTA 5I77A 2FMOA 2E40A 2X7VA 2QCEA 1CEOA 4A05A 2V5JA 5HQMA 2XJ7A 3LERA 1YTEA 1ELSA 4LF1A 4MB3A 3VCRA 4HMDA 4HSOA 4C90A 3H22A 4AU0A 4MNLA 2PMQA 1Q6DA 3W7CA 1Y65A 3SJNA 4N4QA 4HD5A 4ILSA 2GSJA 2DT3A 2QIIA 2ZXQA 3H4GA 4XV0A 3DFSA 4ADTA 4DWSB 3A21A 1YPFA 1FRBA 1F4AA 3CT7A 3KW3A 1NWSA 2G5WA 1ICPA 4UZSA 1MEIA 4KEZA 1XUZA 2CESA 1TCMA 3ZFHA 4OV4A 2V30A 3K30A 4GFIA 1B1YA 2A5HA 4FMVA 1OC7A 1FKXA 4ZOCA 2UBPC 2GJPA 2QXWA 6PTDA 3S1WA 2DVUA 2GFTA 4NJKA 3EOUA 2OQYA 4ICMA 4XUGA 4CN6A 3N25A 4RLIA 3PUOA 1UR2A 5CH9A 1TPDA 1G94A 1KRMA 1E5JA 4E0CA 3OIXA 4X2PA 1QNVA 1IEXA 4CKQA 5C55A 3M0JA 2BS9A 2QJGA 5A8MA 3W7HA 1KR1A 5I3HA 3IJDA 1RA0A 1EFZA 3ITXA 4PSPA 4AZ6A 2YL8A 1ZJHA 2PTDA 3VIKA 2OQLA 4AZCB 3A4XA 3MUIA 4JXCA 4ASTA 4NJGA 3TR2A 3AIEA 1IXQA 4J35A 4OBSA 1Q13A 3QYQA 4UTTA 1U2YA 3I3EA 3BGJA 3QQ1A 3QKEA 2YL6A 3QC3A 5HA7A 3GR8A 4S23A 3S1GA 4M6QA 4OJYA 5D9NA 1BTMA 2DZXA 3D46A 2XIIA 4GJJA 3P62A 4F0LA 4H4IA 2O9PA 2J9XA 2OEKA 4MYAA 2VEGA 3TJLA 1S1RA 2QAFA 1QHPA 2GUUA 3A4JA 4QM1A 1ITQA 3LCXA 2EEXA 4JQ3A 3PWIA 3VD5A 3WEZA 4DJDA 5KITA 1C90A 5KZEA 5U4NA 4WDWA 4HYWA 5DEZA 5E0FA 1I8JA 3TA6A 3AU2A 5CC6A 2I5IA 1U1UA 2DZBA 3MY9A 2QVNA 3HV8A 1S38A 1EXPA 4Q6XA 4HN4A 1R3QA 4XAZA 4CCEA 3POCA 1UR1A 4J7RA 3W86A 5I3IA 3UP8A 5HR7A 5FEXA 2GSEA 5A8OA 4WOZA 4XD4A 3UF9A 3SY8A 2P5NA 3E0WA 3G22A 1NU5A 3NM1A 3PZTA 5FSEC 1IGSA 3GO2A 2PDYA 1V6XA 1ZCOA 1TA3A 3C0QA 4D6EA 1L8NA 2ZKMX 4PGLA 3LHVA 2NQZA 3M0LA 1PZ0A 5J5RA 4ZQOA 5LHFA 4C6QA 1V6YA 2PBOA 3CM4A 3KAOA 1OCBA 5LA0A 3GIQA 2DDXA 1QBAA 4OU1A 3HGJA 5GVJA 3Q65A 2JEPA 3QVQA 3N15A 2VOMA 3S5NA 3UXAA 3UY7A 3H7RA 1TV2A 1QI5A 3V18A 2A3HA 4PTVA 1Q65A 2A7PA 1DTUA 1E9YB 4FZIA 1QOPA 1Q8JA 1YXDA 4JDYA 3RPTA 1A5NC 1UP2A 1RD5A 2BBFA 4WJ8A 3GH5A 3H2FA 1PKNA 4LPCA 3VOGA 3A3WA 2DT1A 1DEDA 4KETA 3BW3A 2CBVA 2R8WA 2Z2UA 3DN5A 4JTKA 1ADOA 2P88A 4ZE4A 2TAAA 4KRZA 3B03A 3L68A 2XG9A 1WX0A 3CZLA 2QDHA 1KW1A 3MV11 2ISSA 1K8CA 2J7HA 2IS7A 5FD0A 4O50A 3B9DA 3LI0A 1R2RA 1UWAA 4CQAA 4OBRA 3B0VC 1OIFA 1LDCA 2CU0A 1UWTA 3MP3A 2VYOA 2WNZA 1W56A 3LLDA 2C0AA 3PZNA 1RLCL 5FOOA 4H8VA 4YN5A 3NUKA 3TJIA 3S2NA 1HJUA 2UY2A 2VCAA 4DNMA 1KC7A 3VC5A 3RDKA 4J40A 4O15A 1W9DM 2R14A 2QGYA 4H2CA 4LC8A 3B3DA 4MY1A 1VJZA 2X1RA 5LGZA 1NOUA 1E0TA 4X0NA 3DFYA 3ARTA 4B92A 4HOZA 4TV5A 4XAGA 4F0MA 3BLKA 3LK6A 4NNCA 3HQNA 1TTJA 1JPDX 2RAGA 3QZAA 1GOWA 1TZ7A 3CO4A 3TVAA 2OB3A 4W7VA 2Z4GA 4AZBA 1RQHA 3OVGA 4C6CA 1EDTA 4DO5A 4QS5A 3O6YX 2W0UA 4F2UA 3NFUA 4ZB5A 3TMQA 1EA9C 5BYWA 2QCGA 1UH4A 1TV4A 2AKMA 1OCQA 1FDZA 4IPJA 3POHA 4FEZA 2XVKA 2D24A 4BQ2A 1PWMA 4ZFCA 5EMLA 1VAHA 1RBOB 3ZYZA 4GABA 1HNYA 1ESWA 4C6IA 1B54A 2AKZA 3M9YA 2FJKA 5BXTA 3WSUA 1EDQA 2ZA2A 3N1AA 2F6UA 1RCQA 1YBQB 1GQLA 3KEHA 1R46A 3GXNA 2EG7A 4W8LA 3MKCA 4V28A 2V6AA 1GNXA 1XC4A 2R94A 4HJWA 4CQ9A 2OOGA 5G1MA 4CCZA 1LUCA 4DZAA 5C7HA 4HU4A 1OYAA 2QS8A 1DIDA 2NQLA 3FJLA 2W91A 3LM3A 4HGXA 4HTYA 3WF2A 1QK0A 4QJ4B 2VEMA 4WRHA 3CS2A 1RK6A 3W1NA 1VBUA 3WNOA 4D71A 2PRLA 2ZWYA 4GCAA 3HF3A 2DUAA 3HG5A 4H9XA 2E8ZA 3ZR6A 4F48A 2KZHA 4IIGA 4X22A 3W7NA 4UIOA 4ONVA 1GZ1A 4O1CA 2VGBA 3SIMA 2IPFA 3EA3A 1FH8A 3L66A 2CKRA 4JX4A 1J2WA 2CBJA 5D4YA 1SJAA 4C60A 1NWUA 5A6TC 4JQ1A 1RP8A 1A5MC 5FJOA 3UJRA 2WMIA 4FIQA 4NZ3A 4O54A 2J13A 1PO9A 2VX6A 3H7VA 2AQVA 4BF9A 2BLEA 4C7DA 2CLMA 4I9JA 4AH7A 4PCFA 3MKKA 1RY8A 2Q3OA 2Z1XA 3I68A 3MZNA 1EX5A 4LRTA 1CTNA 2QMKA 3RHGA 4AWEA 2PP1A 3APYA 1EJWC 3K2GA 1PKLA 3WD2A 3PC0A 4QLLA 3E1F1 1TMHA 5A3HA 3KL3A 4OKDA 4B9YA 4R9OA 4W5UA 3GNXA 3NPUA 4WCJA 2VUYA 3SCSA 1R85A 2PRMA 2WKGA 4G9PA 1M6JA 3NZ1A 2GJRA 3ABQA 1LG1A 3C2OA 1AW1A 4OQVA 3THUA 1F3XA 1RBLA 1JCXA 4JFUA 1UHVA 2X41A 1SUXA 2ZVIA 3MUXA 1HVQA 4MZ8A 1CWYA 3MJMA 4DBEA 4KWOA 3GKFA 4KFPA 3S3GA 1XIGA 4W86A 4C6KA 1OY0A 3DECA 2FB3A 4S3FA 3KM8A 5RUBA 2OELA 1NP0A 4P8UA 2OFJA 2WWCA 1FCBA 3KWXA 5JVLA 4CNNA 2G50A 1VEPA 3URQA 5D2TA 3S1XA 4O14A 4YMZA 2VI0A 1GK8A 2DW6A 4W93A 2YBUA 4NQ1A 3U4FA 1S2TA 4YVXA 2V3DA 1Q2RA 4L5ZA 4UFJA 4BCEA 4XD6A 4HHPA 5ABFB 3MUY1 2KX9A 2NVCA 3TDFA 3AXMA 1PV8A 1E6QM 1HL8A 1XSIA 4G56A 4UMBA 3P67A 1TPFA 3I6EA 3H55A 1I4NA 3SCVA 3PB2A 4U10A 5DRCA 1G0CA 4Q6JA 2QHAA 3PSVA 1LLZA 1E9IA 3CWHA 3BMWA 4LYRA 3WMLA 3VABA 3WY1A 3G0SA 2F84A 1XF0A 3W28A 4L1WA 3N6HA 3CV7A 2CCRA 2XIMA 2GDQA 1A53A 3S47A 3C2VA 4GIRA 1GOXA 2HMCA 1DWFM 2TMDA 2YZRA 1G4PA 3H6OA 1W5QA 3EOSA 2TPSA 2Z1KA 1IZJA 1W1IE 3UJ2A 3WELA 1GQJA 4MG4A 2YA0A 2IKIA 3B4YA 1VGAA 1JNDA 2CWXA 4CNSA 5A94A 2BY2A 3PJUA 3L4WA 1Q6FA 3H12A 3AS0A 1ZAHA 1S5MA 3C8FA 1VFFA 4X0VA 3CUZA 3EOLA 4C6PA 1ZNNA 4PTWA 3H2EA 1TR1A 5LNUA 4JFWA 3CQ0A 3H2OA 4JN6A 1SGJA 1YNYA 4AX6A 1A5LC 2Y5EA 4NZ5A 5FI8A 3FYPA 3RK8A 5LIXX 1IXNA 3DEQA 1FTXA 1JDDA 3WMSA 1GT8A 4A6GA 4XTIA 3ZT7A 4PE8A 2IW0A 4IM4A 3GVWA 4HHHA 4M0XA 2FZBA 4I7WA 3EXTA 3LV6A 4AD5A 5A69A 1DORA 4W88A 3BANA 4IF2A 1C7SA 1W5NA 1XGDA 4LF2A 3FJ6A 4FSAA 3FXGA 2YL5A 3C8NA 3EDFA 4GWEA 3PR2A 1GEHA 2GVLA 4NXKA 1NH6A 5FF4A 2ZUVA 2GQ8A 3LXBA 1UD2A 1K9DA 4D8ZA 1ZAJA 2FH8A 1R5YA 3SQSA 4E8DA 4AF0A 4JFSA 4ACZA 3EWWA 3VNDA 2G95A 3UYCA 3NQ6A 3CC1A 3TJ4A 1LT7A 3MWCA 4IIDA 4IL0A 1Z6KA 2G0WA 2Z27A 3RX4A 1JUEA 3M41A 4N0RA 1BPLB 3VKAA 3W0KA 3UGRA 1XWYA 1VYPX 4TX8A 5F2MA 1M9HA 4E2OA 1IHIA 2XWDA 3UXLA 4Y90A 3PZ9A 2XPKA 2HVMA 1DOSA 3RXZA 1XBYA 1J4EA 2VC5A 4MKVA 4I6KA 3VIOA 3CMJA 4MNKA 2GJXA 1V3KA 1TJ1A 5AZ0A 2WNNA 4W89A 3WIJA 3CPGA 2TRSA 2X2GA 3PN8A 2J7EA 4N6EA 5JU6A 1YNQA 3VUPA 4XQ6A 1HN1A 4XO6A 4C1KA 1I1XA 4JTFA 5K4XA 1GVYA 1XCWA 4B5SA 1PJ9A 3ZLGA 3V3WA 3MA8A 3PBWA 5EBUA 4CN4A 3P60A 3W37A 2OX1A 2HK1A 2X0YA 1E71M 1XLEA 3LCGA 1HKKA 2ZYFA 3QKZA 3TN4A 4YLWA 1F9CA 3WK0A 1G4TA 1EJTC 1XRVA 2P0IA 4NJIA 2VR2A 5K4ZA 2DIJA 3VZXA 1RY0A 2OLAA 4GI4A 1IR1A 4LS1A 2R91A 2PB1A 4JTCA 4ROQA 2FYMA 1UUMA 4H9MA 3QLLA 1TWIA 2XGBA 2X30A 3AHXA 5G4EA 6XIAA 4Y9OA 1R9XA 4UQEA 2OR2A 1XDMA 1B5TA 2BWGA 1R6WA 1AW5A 3WUFA 5HMDA 4DI9A 5FAJA 1GOOA 3PAJA 4Y7EA 5HWMA 4JTJA 4K6AA 4D6CA 2ZA3A 1O5XA 2WSKA 4L4OA 1Y5VA 3VUSA 4O28A 3IGXA 4HP5A 2NQ9A 1GZGA 4RR4A 4ERAA 3CPRA 4NILA 2QDGA 4IHCA 5HPCA 1EGMA 2V5DA 3O63A 1A5CA 1EF2A 1UA7A 1J12A 4LWWA 2X1SA 2E9LA 2ZC1A 3G1XA 2XISA 1NTHA 1BTCA 3B0UX 3AZTA 4R7WA 4D1JA 5LNVA 1GVFA 1V02A 3M0MA 2WSYA 4HSHA 2QCNA 1O94A 2WO5A 5A2BA 3FEQA 2GVGA 1G5AA 2YDAA 2PD5A 2NVAA 2YGYA 5F1UA 2PODA 1UMLA 4MADA 1TYGA 4R33A 3VGHA 3W23A 1P1XA 2CETA 3MBFA 5ABEA 3QPZA 1PZ2A 3CMFA 5IFPA 1HO1A 1REQB 3QGVA 3M0HA 4M6PA 3K8MA 4O53A 1UR8A 3AWOA 5MHBA 2QZRA 4GH1A 3HQPA 2VURA 2VL4A 2ZBTA 3KVMA 3LX9A 4Q32A 3E6EA 4QJ5B 5A95A 1Z7AA 4MJ4A 5CG0A 3GTNA 5HATA