2GWGA

Crystal structure of 4-oxalomesaconate hydratase, ligj, from rhodopseudomonas palustris, northeast structural genomics target rpr66.
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
345
structure length
329
Chain Sequence
MIIDIHGHYTTAPKALEDWRNRQIAGIKDPSVMPKVSELKISDDELQASIIENQLKKMQERGSDLTVFSPRAGDFNVSSTWAAICNELCYRVSQLFPDNFIGAAMLPQSPGVDPKTCIPELEKCVKEYGFVAINLNPDPSGGHWTSPPLTDRIWYPIYEKMVELEIPAMIHVSTGAHYLNADTTAFMQCVAGDLFKDFPELKFVIPHGGGAVPYHWGRFRGLAQEMKKPLLEDHVLNNIFFDTCVYHQPGIDLLNTVIPVDNVLFASEMIGAVRGIDPRTGFYYDDTKRYIEASTILTPEEKQQIYEGNARRVYPRLDAALKAKGKLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-oxalomesaconate hydratase
publication title Crystal Structure of 4-Oxalomesaconate Hydratase, LigJ, from Rhodopseudomonas palustris, Northeast Structural Genomics Target RpR66
rcsb
source organism Rhodopseudomonas palustris
molecule tags Structural genomics, unknown function
total genus 110
structure length 329
sequence length 345
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 2gwgA00
3OU8A 4QTGA 1FWBC 4KEZA 5AKQA 1PB0A 3ICJA 3NEHA 3NQBA 2HBVA 4C6FA 4C6CA 3DCPA 4CNSA 4KESA 1EYWA 3MVTA 3TN5A 4H01A 3KM8A 1FWGC 1R9XA 2ADAA 1EZ2A 2OB3A 3PAOA 1I0DA 4LFYA 1FWDC 2Z24A 3LA4A 4LAMA 4ERGA 4H9VA 4IG2B 1ONWA 4GXWA 3D6NA 3TN4A 4LCSA 4H9UA 3B0XA 3GU9A 2BB0A 5CH9A 4EPKA 1QXLA 4IFKA 3S2JA 2FVKA 2GZXA 4C6NA 3QGKC 2PLMA 1YNYA 3GRIA 4DI8A 4C6MA 2XIOA 2Z26A 3HM7A 3LY0A 4RZBA 4B3ZA 1KRBC 4GOAA 4KETA 1YBQB 3GG7A 1WXYA 5HMFA 3MSRA 4I6VA 1NDZA 1UIOA 1UIPA 2WJEA 2QS8A 3WZ0E 3EWCA 3A4JA 4L6DA 4LANA 3GUWA 1RA5A 1ADDA 2Z28A 2QVNA 1A5OC 2AMXA 4KF1A 2Q09A 3N2CA 1XGEA 2WJFA 1A5LC 1A4LA 1EJUC 1FWCC 3LNPA 1V4YA 4CEXC 4Z42C 1E9YB 2UZ9A 3RN6A 2VM8A 1VFLA 2GWGA 4INFA 2VC7A 1P1MA 3E0LA 1EJWC 3K5XA 4DIAA 4GBDA 3LS9A 3CS2A 2WJDA 3SFWA 1J6PA 1PSCA 4BY3A 2DVUA 1PO9A 4R85A 4DLMA 3T81A 4J35A 4ERAA 3UR2A 4PBFA 1J79A 1PTAA 4G7EA 4WGXA 4QROA 4XAFA 3F4CA 4DI9A 1NDYA 2P50A 1EJXC 3TN3A 2R1NA 4KERA 1FWJC 1KRMA 2PGRA 4EPEC 1P6CA 2YZ5A 5E5CA 3E2VA 4GX9A 1QW7A 1K1DA 3E38A 2F6KA 4LALA 3LSCA 1A5MC 5LXXA 2O4QA 1I0BA 1FWEC 4UBPC 1R9YA 2PUZA 4ZSUA 4CQBA 1KRCC 1M68A 2Q01A 4C6LA 4GC3A 1M65A 4DZHA 4QRNA 2PGFA 4RDZA 4F0RA 1NDWA 2VR2A 4LAKA 3EGJA 3FDKA 3MJMA 2VC5A 4DYKA 4CQDA 4C65A 2DVXA 2R1LA 1E9ZB 1RK6A 4DLFA 1O12A 2Z2AA 3MVIA 3K2GA 5FSDC 4QS6A 4C5YA 1K70A 1DPMA 4GZ7A 4LCRA 3QY7A 2HNHA 4IGNA 4HK5A 3IACA 1YBQA 3S4TA 3F2BA 3IARA 4PBEA 3LGGA 4PCPA 4CNUA 1V7AA 1FWIC 1NFGA 3GTXA 3IPWA 4EPBC 2FVMA 2WM1A 1RA0A 3B40A 1A4MA 2W9MA 1M7JA 4H9TA 4XD5A 3QY8A 4J5NA 3GU2A 3UR5A 4XAZA 3CAKA 3GIQA 1EJSC 1V77A 2CZVA 4BJHA 3AUOA 2IMRA 4UB9A 3PNZA 2Z7GA 4H9ZA 4C6EA 4WHBA 1FWAC 1XWYA 3UPMA 3ORWA 4CEUC 4G2DA 5FSEC 1GKRA 4IF2A 4EPDC 2VHLA 3MDWA 4HA0A 4CQCA 3RYSA 1YIXA 1FKWA 4GK8A 3WMLA 3K4WA 3F2DA 2AQOA 4E3TA 4GX8A 2EG8A 4M51A 2G3FA 4H00A 2OGJA 3MKVA 4XAGA 4IFOA 3DC8A 2EG6A 1GKPA 2YXOA 4R88A 1W1IE 1O5RA 4C6IA 4GY1A 1UBPC 1A5KC 4ICMA 2AQVA 3TN6A 1WXZA 4IFKB 3RHGA 1ITQA 4P5UA 2O4MA 3ID7A 3OODA 3TNBA 2Y1HA 3GTHA 4KEVA 4B90A 1YMYA 3GTFA 4L9XA 4H9XA 3ISIX 4ZSTA 2P53A 2HPIA 4KIRA 2HBXA 4IH3A 3RCMA 1S3TC 4HK7A 4GYFA 1A5NC 3URBA 4CNTA 2GWNA 3QGAC 3IJ6A 3O0FA 1BF6A 2R1MA 2I5GA 2GSEA 1P6BA 4IG2A 2ICSA 3R0DA 4C6KA 1NDVA 1EJTC 2E1WA 4C5ZA 2RAGA 4XD3A 3AU6A 2R1KA 4H9MA 3T1GA 1EJVC 1KCXA 1YRRA 4G7EB 4LAOA 4NP7A 2Z29A 3IGHX 3NURA 4MUPA 3E74A 4HK6A 4C6PA 2GOKA 1J6OA 2A3LA 1IE7C 3JZEA 3F4DA 3MPGA 3URQA 1RJPA 4DO7A 2DVTA 1ZZMA 1RJRA 3OVGA 2D2HA 4KQNA 1V79A 4PE8A 4C6OA 3A3WA 1POKA 1ONXA 3URNA 2Z4GA 3SO7A 4NI8A 3FDGA 4BKNA 4TQTA 4IGMA 4C6DA 4H9YA 4J2MA 4GY7A 1POJA 1RJQA 2HQAA 1EF2A 3IV8A 4HJWA 4RE0A 5G4HC 2OQLA 2OOFA 3GU1A 2Z27A 4C60A 4C6JA 4LEFA 1ITUA 1RAKA 3ITCA 4D8LA 4ERIA 4V1XA 2FFIA 4KEUA 4LH8A 2YB4A 2D2JA 2ANUA 3DUGA 5A6TC 4B92A 5HMEA 3IRSA 2KAUC 1FWFC 2OODA 3GIPA 3URAA 2PAJA 3HTWA 1K6WA 3MTWA 5HMDA 3QY6A 4PCNA 1XRFA 3C86A 1R9ZA 4QS5A 2HPMA 4RDWA 3AU2A 3CJPA 1FWHC 3T8LA 2R1PA 2Z2BA 4LCQA 3F2CA 3UF9A 1XRTA 3B0YA 4RDYA 4F0LA 3HPAA 3OQEA 4F0SA 3S2NA 1FKXA 3E0FA 3LU2A 3WYZA 1KRAC 3A3XA 3PANA 4OFCA 2E25A 4XD6A 2VUNA 4YIWA 1EJRC 4GY0A 4RDVA 1V51A 2D2GA 1GKQA 4NG3A 1JGMA 4AQLA 3LGDA 3BE7A 4IFRA 2UBPC 3EWDA 2Z25A 1J5SA 2FTYA 2FTWA 4XD4A 4DNMA 3UBPC 4IQJA 4QSFA 3LSBA 3GTIA 2QT3A 1RK5A 4B91A 3S2MA 2Z00A 3O7UA 3G77A 3MDUA 4WVXA 3OJGA 3E3HA 4C6QA 2EG7A 4AC7C 2YB1A 2QPXA 3FEQA 4R7WA 4C6BA 2BGNE 2I9UA 3V7PA 1HZYA 3PNUA 2ZC1A 4EP8C 4DZIA 3S2LA 4V1YA 3PBMA 1UMLA 4I6KA 4JOMA 4XAYA 3OOQA
chains in the Genus database with same CATH superfamily
5I3FA 2XVLA 4LTSA 1OY0A 3ZZ1A 3TTSA 1WZKA 3NDOA 1DJZA 3TQPA 4Y7EA 1UR9A 3C52A 1CTNA 2MANA 1VFMA 2G0WA 3A47A 1NQKA 1MQQA 1XD0A 4CNOA 3POCA 1R9XA 5L9FA 1RHCA 4LW7A 5AVNA 3DFYA 4IPJA 3M0HA 4HPGA 3H12A 4Y8FA 2VX5A 2XH2A 4GABA 3BPWA 4IG2B 3TMLA 2QXWA 2NT0A 1SFLA 3B0XA 1KWGA 3WQFA 1T8XA 1BG4A 1GOKA 1OGBA 1E4MM 3P8JA 2VZUA 3AMDA 3BW2A 2PLMA 1FWWA 3R25A 3L21A 3E5PA 3GG7A 3NUKA 4PZVA 4OE7A 3VZXA 2D24A 1UIPA 2OELA 4X0NA 1S1RA 3R2GA 5I06A 2BVYA 3M64A 1JNDA 1XGEA 2E8ZA 3WENA 5KSWA 4BQ5A 2YPIA 3WD2A 1HGWA 4BFAA 4IT1A 1PWMA 2VGIA 3TU9A 2BGQA 3THAA 1G4PA 1UD2A 3UZYA 4XO7A 2DVUA 1TPUA 5HR6A 1FDJA 1VBUA 2PP3A 5A5WA 2ZUUA 3EA1A 1VYSX 1QI3A 4FIRA 2IXUA 3FHAA 1EP2A 3NR0A 1H7XA 1EDGA 1P6CA 2YZ5A 1XLLA 3BJSA 5LYRA 1UWRA 2F6KA 3IUDA 1VFTA 2HISA 2WPGA 3LSCA 2O4QA 3PFMA 5E93A 5LXXA 3VZYA 4ZQPA 1VFSA 5LIWX 4NRRA 1EO5A 1GJUA 4O4VA 4JQ3A 2EPKX 3M9YA 3H53A 1M9HA 2VR2A 2GDQA 1UWUA 2P8CA 3AC0A 2WVSA 3N12A 3APYA 2BHUA 1N2VA 4K37A 1DP0A 3IS4A 4A29A 3NL3A 3KCOA 3SN4A 1QPNA 5I03A 2PWHA 4H8VA 3W82A 3CASA 4MDPA 2W66A 2CCRA 4AYGA 4XG1A 3M5XA 1GG1A 3IWPA 4S39A 1XYBA 1HXJA 6TAAA 4NVTA 2CU0A 1EGVA 1QU4A 3IARA 1G4EA 3SSZA 3ZVHB 1DIKA 1QOQA 1CGTA 3WFAA 4Q4OA 4PTWA 1GONA 3ZS4A 5C70A 3W76A 4HA1A 5FJTA 3ARVA 2QUMA 1W5OA 4UTUA 1HO4A 3GU2A 4GH1A 1UKSA 4JICA 4XAZA 3BAIA 2JKEA 3EPOA 1J93A 1E15A 1KC7A 4K6AA 4C6EA 2V0TA 1PXGA 4OWGA 1GOQA 2CYGA 3NSXA 1QWKA 1R5YA 1XLEA 5EBUA 4E8CA 1IEIA 1GVEA 4U10A 4ES4A 3F03K 3VC6A 4S3BA 4K39A 1WUEA 2ZRXA 3GXNA 1ZP3A 3WMCA 4PH6A 4LY4A 5D9PA 4XO6A 2OGJA 3LCWA 4BI6A 1JUBA 5AECA 4AD3A 4ICMA 1I2RA 4V15A 4RNHA 2L5HA 4P5UA 2PDXA 3W1XA 1XH0A 3TNBA 4UQEA 4KEVA 2ZVRA 5CGMA 3QQ0A 1Q6CA 4R7OA 1YTDA 1XC4A 1ZL1A 3WEMA 4NL1A 1TQXA 3N29A 3CHDA 2YDSA 2WJZA 4JTEA 4IH3A 2RJGA 3RCMA 3QV7A 1B4KA 1V7YA 3ZQ9A 2G97A 1WOAA 4PRWA 1QI2A 4D1IA 3REQA 1UD8A 4V2XA 5I79A 1Q3NA 3DXIA 1PKYA 3GG8A 1MUWA 2GSEA 4IG2A 1R0MA 1OGGA 1D8WA 5A6KA 2R1KA 5HNNA 3OO2A 4M6UA 5CZKA 4KFOA 2FYMA 1MW0A 2Z29A 1UR2A 1XH2A 4M56A 3JZEA 1THFD 5G5IA 4X3ZA 3CV1A 1TKKA 1OYAA 1QHPA 2PDFA 4L5ZA 3UCCA 1YQ2A 3STCA 3T2PA 3KE0A 4PRTA 4DN1A 1RBOB 1V03A 4JZ5A 4LNCA 2CBUA 2VRQA 3IV8A 3VIGA 3B03A 2A3HA 2DT3A 4HJWA 1U5HA 1GOWA 4JIQA 1UJQA 1R8LA 7ODCA 3SURA 1QNSA 5AYXA 3GKFA 4B5TA 5AHMA 3W37A 4PMZA 3I6TA 3UZWA 4D6DA 7PTDA 1F4AA 5D03A 4H83A 2DSWA 2PLJA 2XGZA 5C9ZA 3EWWA 4S3AA 4NYYA 1EWEA 1C7SA 2VDIA 4AZHA 2DEPA 1JUKA 4RDWA 3KBWA 3W02A 2OU4A 3SCRA 3H2OA 1XRTA 1UC4A 4HZMA 1DWHM 2Z1WA 1FKXA 2CESA 1NWUA 2WCGA 2GJXB 1KRAC 1XIBA 4NAFB 1J2BA 4E3VA 3G1AA 1VPYA 3NGFA 4ZVJA 1NOUA 3S1UA 2OOGA 4LC6A 4IJBA 5AVHA 1VFHA 2YA1A 1F3WA 2NXIA 3TYBA 3VM7A 3WQVA 4Q4SA 2OO6A 3GTIA 3QVQA 2A3CA 1EDQA 5A1AA 3ZVHA 1E5NA 1Q63A 2FGZA 3SZ8A 4IXXA 2WMFA 4C6QA 1B90A 4ZOAA 4JIEA 1E56A 4GIYA 2YB1A 1REQB 2QPXA 4JFTA 4NT0A 3O63A 4TX9A 4J2PA 3A13A 3A22A 3FEMA 3FY1A 1JZ4A 2VGBA 4DWSC 1L8NA 3MQTA 4JOMA 5FEZA 3O16A 3UA4A 2GJPA 3GDTA 3OW1A 3RM8A 1KQZA 1EC9A 1PWLA 3GXMA 4JR5A 1H41A 4MB4A 3BCFA 2INZA 1EF3A 4C7FA 3UXIA 1US0A 2H8XA 4DAFA 2JEQA 4IQDA 2FHBA 1JIBA 3TDFA 3R1ZA 1ADSA 3G8RA 3LBMA 2ADAA 4FB7A 3ZR6A 1NELA 4O1CA 3M1ZA 4Q8TA 3LA4A 4NZJA 2H3DA 1JCLA 4PUDA 3B9DA 3TV8A 4REQB 3UETA 1UWTA 2PWGA 3RLVA 3ZJKA 2XUCA 5H8UA 3BZGA 5AZ0A 3A9IA 1GT8A 2J24A 3DBNA 1WOBA 4FK9A 4NZFA 1EL3A 3ZJ8A 5A6BD 1KA9F 3MBDA 4ACZB 3W7QA 3SN1A 2ALRA 1XD1A 2ZE3A 2JIEA 2Z28A 2QVNA 4AWUA 1YXCA 1PL9A 1XGZA 2OXNA 1XR2A 4Z42C 3CHEA 2NX3A 3UD6A 2UZ9A 4FSAA 4P7RA 2BMBA 2JQXA 2VZOA 4LBRA 1EJWC 2NUXA 1O5KA 3P61A 2D0HA 4J40A 4UQDA 4BY3A 4HT3A 1DJXA 2J27A 2NUYA 3OQ8A 4L9ZA 1D2KA 3VKKA 3IAPA 1PTAA 4WR3A 3WJYA 5I3KA 1OC6A 3WIJA 3SGGA 4DM2A 4NYUA 1XUZA 5DEZA 4DI9A 3MKCA 3ARPA 2DP3A 3PAJA 5C7HA 2DZBA 4KERA 1FWJC 2QF7A 4ZTYA 5JUVA 4M7TA 4ALDA 4OV4A 3S5YA 4NHVA 4PMVA 4J1OA 2FH6A 4GC3A 3RGTA 1XLHA 4AF0A 2A21A 3GVVA 3AZRA 1UD5A 3SEPA 3WL0A 1BHGA 3H24A 4M19A 1UKPA 1EGMA 4ZXLA 1JR1A 1EBGA 3TC7A 3VYLA 1XLFA 1SSGA 2QAFA 2FGBA 1RQHA 2C1GA 4GZ7A 1JG9A 3T40A 1C9DA 4KEMA 4WLCA 1F8MA 2OKOA 1YBQA 3QF0A 1XLCA 4S23A 1LBMA 3VX1A 4HNUA 2VXNA 2PTYA 1WNOA 1HG3A 5A2AA 4A22A 4LXFA 4MJZA 3WBAA 4OBTA 4ZB0A 1JCNA 3M46A 1T0OA 4UOZA 4D1JA 3MYOA 1W5QA 1UH2A 2QIWA 2IMRA 4S2CA 4D9PA 2Y6ZA 3LQGA 3VU2A 4D6IA 3QXBA 2QKFA 3GR8A 1XWYA 2J7DA 5CAKA 3G2GA 1GQJA 3CZEA 3STGA 3RYSA 1GJWA 2WANA 1CI1A 2ZZ5A 4D6GA 4RNFA 2E5CA 1GVRA 4M51A 2G3JA 3DC8A 1J12A 5MKGB 4DX3A 1ALDA 2YXOA 3GX9A 2XSAA 1REQA 4TVUA 4EXAA 1IGSA 3ATYA 3DFNA 3THCA 1O60A 2PDUA 2BOEX 5CZSA 1PHQA 1V3KA 3ID7A 4WZHA 1SJDA 4IIEA 2V2DA 3NM1A 4ZE4A 3P74A 4HOWA 2XN2A 2O9TA 4GRSA 1C8VA 4W4QA 5HK4A 2P53A 5J5RA 4JFWA 3EWXA 2VEPA 4KIRA 4LC8A 2X1RA 3ITGA 2BOGX 2ZX5A 1DJQA 2YBVA 1DKWA 4DZAA 2X1IA 2X2GA 1Q2RA 2WZIA 5FAGA 3HIJA 3BARA 3OA3A 3MKKA 4W93A 5XIAA 3KOYA 1VB9A 4JIIX 2HXTA 3NAVA 3WQCA 2FGLA 3M0XA 4ROPA 4REQA 6ENLA 1E55A 1QATA 1O95A 2NQJA 1M1BA 3EWZA 4JX6A 3FA4A 1EP1A 4O8RA 5FJRA 3O6DA 3WDHA 1Z6KA 4PUMA 3ZJ7A 1AJZA 3CUJA 3I4EA 2ZX8A 3W38A 1BQGA 3A21A 4DQWA 3KL3A 4LGXA 4X2RA 3OVGA 5CJNA 2J7GA 5GNZA 4YS1A 3S1GA 3GC2A 2MNRA 5I23A 2XH0A 1LT8A 4N6EA 2PWUA 3LUTA 4MYXA 4C6DA 1L2QA 4AVOA 1CGVA 4PUNA 3S1XA 4XVEA 4A8RA 3PSVA 3WD4A 3HG5A 3L9CA 4HCLA 1ECEA 3HQNA 3GH5A 1PDYA 3QHMA 1Q8JA 3TWBA 1MO0A 1PZ0A 5CQ1A 3N2OA 4PC8A 2VL4A 5I3GA 3W7MA 4FF5A 5JIWA 4NSBA 3SCVA 1XDMA 3B4YA 3DYPA 3AIBA 3G0UA 3VMNA 3AYTA 2R1PA 1KLYA 2Z2UA 5DANA 3C2FA 2VUYA 4F0LA 3N4EA 4UTWC 1VIZA 3AXIA 1JFHA 3VNKA 5D2XA 3GWQA 3WUBA 4UOJA 1D7KA 4BF9A 3W72A 5E0CA 3WUEA 1FXPA 1Q4WA 3VNZA 3IGSA 2PP1A 1R3SA 1W0MA 2PTZA 3PZVA 4G56A 5A6LA 2D2GA 5EY5A 4AQLA 5LSMA 8XIAA 2ZIDA 5IDZA 3T4WA 3M07A 2C18A 1G0CA 4MADA 2OSWA 4JX5A 4IQJA 4QSFA 1ZCOA 1T6MA 4Z2LA 3IANA 3K30A 4RPPA 4GKTA 4F9DA 5LNWA 1ZJBA 2HE8A 1VR6A 5D2VA 4ZENA 1C8QA 2E9MA 3WH8A 1SO3A 1JQVA 1U2YA 4WJEA 4W84A 3OU8A 4IQEA 2VD9A 1SZEA 3UVAA 2WQPA 3MMTA 2C0HA 3UYCA 2WHJA 1DJYA 3AIUA 1LT7A 3MYPA 3V1HA 1TJ0A 3R7MA 1ZGDA 4CU8A 2YJQA 5HANA 3M6DA 1V0KA 4DO5A 3LM3A 2PC8A 3SY8A 4WDTA 3OBAA 2YCLB 1SPQA 3ATZA 1L6YA 1IZJA 2HZGA 4RV3A 4GVHA 3AO0A 3VNJA 1PBGA 4CN1A 1JDFA 5LGZA 3TNOA 4C6NA 2REQB 4C1NB 1XUUA 3EOSA 3HM7A 1OFEA 3ZWTA 2PU0A 4W9TA 2OX4A 4MLJA 2E68A 4Y96A 1WB0A 4IIBA 2BY3A 4Y9NA 2GK1A 1UYQA 1YLVA 3BGGA 5CBJA 3LNPA 3GVWA 2CKSA 2OFJA 3TVAA 2FVLA 2VC7A 2V3GA 4AEEA 1XLIA 3W26A 3H2MA 3OGSA 1CYGA 4ZBCA 4ZFCA 2GGEA 3W00A 4YYFA 3DFOA 4WQ6A 3BK0A 2DU2A 3RMJA 1PHWA 3TZNA 3WLNA 4YWIA 3FNDA 2EJAA 3BQ6A 4GNJA 1I8JA 4O57A 1IEVA 2WV8A 1Q6RA 3D3AA 3U2OA 1M68A 4W7UA 4YCOA 3MS8A 1B57A 2PRMA 3R10A 3TAKA 2QJMA 4E8GA 3MC5A 5ECVA 4GMEA 1OEPA 5FF3A 1UUOA 2QF8A 3I7QA 2CNCA 3OA5A 3E0IA 2CLPA 4Q7BA 4IZGA 2VOTA 4LCRA 2HNHA 3G0XA 3BH4A 4C91A 3TW6A 3EKZA 3W71A 3LBOA 3NZ1A 3IUHA 3LGGA 4PCPA 2SFPA 4RX0A 3M0IA 3ZWSA 4M1BA 2YL6A 4PUKA 4X9YA 3SBFA 1TV2A 3H7VA 2F61A 4IPPA 3NQMA 3WL1A 2H6RA 2PDYA 2VCBA 5T8GA 1L9WA 3C0QA 1XICA 2PZNA 1SUXA 3NQCA 3UG3A 4BJHA 3VO0A 1KFLA 3AIEA 4US6A 1C3FA 5LIUX 4WHBA 2PI6A 1X97A 4HSNA 1V08A 4IF2A 3UP8A 3HPFA 3L23A 3PJTA 1TUFA 4OVXA 3FXYA 4H2HA 1C8YA 1TJPA 3IIPA 3I6RA 1JD9A 5HDRA 3SCNA 3WDIA 4HTBA 4TV6A 3W1PA 4HNCA 3SM0A 1LQ0A 1V6UA 3EX6A 3DAQA 2HEJA 2VDGA 2BLEA 3VGHA 3O07A 4GCAA 4O1FA 1WZLA 2YXXA 3THUA 3UXKA 4NNAA 3QQWA 4QITA 3MW7A 3STPA 1WBJA 2OLHA 5H6HA 4L9XA 3GK0A 5DLCA 3FW6A 2XTKA 3AZTA 2G37A 2OKTA 5TAOA 3CMGA 4K8HA 2Y2WA 2C16A 1QWGA 3KOZA 1HQTA 5AHIA 1NIUA 2YYTA 2OR2A 1EKOA 4GVFA 7TIMA 5E0KA 2DZVA 4HA4A 4JYDA 2BASA 3KCJA 1UD6A 3QGAC 1IF2A 4QDMA 4NJHA 1RP8A 1HNYA 1ZSXA 2I5GA 3QRHA 1DTNA 1J9YA 2EPHA 4PFHA 1XBYA 5BZAA 4GQBA 8RUCA 2IQDA 2X41A 5CZTA 3IJDA 3T09A 4YLWA 1K7XA 5D30A 4DO4A 2REQA 1I2NA 1DHPA 3PY2A 4MJ2A 4U5KA 2QR6A 4EF8A 1J6OA 2D0GA 2A3LA 1LL6A 2QDDA 2ZYFA 5CSRA 2DVTA 4OQVA 1CDGA 3HB9A 4E6MA 4HD5A 4NNCA 1VD6A 3AHVA 3AAMA 2GGIA 4NZ3A 2CHOA 4UTTC 3LYEA 2ZRVA 4GY7A 1TELA 4IP4A 2PB1A 3GU1A 2NX9A 5KINA 1JRCA 3NDZA 4ONVA 1TMLA 4QJ4B 4LRSA 5HOSA 1UP2A 2W92A 1P0BA 3QYQA 1W5NA 3OGVA 3M0KA 2FB2A 5HMEA 1KXTA 4B5NA 3GR7A 1GK8A 1WV2A 2J7CA 3N1AA 1T99A 1ICSA 3B06A 1K6WA 5DT5A 3QY6A 1R9ZA 4R33A 4EWND 3VK5A 3UWEA 2I57A 3CJPA 4DHGA 2ZUTA 3W1LA 2YBTA 3TYEA 5G1TA 4D2JA 3OG2A 2CZFA 1JEZA 1OABA 4CD8A 3S2NA 5CC6A 5MF5A 2Y63A 4JTJA 2X1UA 1PZ3A 2BOFX 1K8CA 1YNQA 1Q6EA 2FJKA 3LHUA 2ZZ1A 3TSDA 3H8AA 2IXVA 3ES7A 3RR1A 2WVVB 1OIFA 1XLDA 3NQVA 1UUMA 2WZTA 3HJEA 1J10A 3MI3A 1KBLA 1MZRA 3BW3A 4QCFA 1Z8AA 1KFEA 2FB3A 3KOFA 5D8WA 2BS9A 1GW1A 6ALDA 1I6NA 5TQLA 2ABAA 4NJGA 2GLKA 4I9AA 2VURA 4PB3A 3T05A 1LDCA 4JD4A 1TWDA 4DWDA 4Z17A 3SQMA 3L4VA 1K9DA 2RDXA 1V5XA 4NI3A 3OOQA 5LA0A 2GGHA 2X1SA 5JH1A 1KV8A 1FWBC 4KEZA 3ICJA 3VNIA 4A05A 5CLWA 4FI4A 3BMXA 5JIPA 1FDYA 1LBFA 1KWKA 1GVYA 4RJEA 4XZHA 1TWIA 4Y90A 1NWTA 1LP6A 1OFAA 4MFDA 2TRSA 4Z08A 1GPFA 5H8PA 2OQHA 4PEKA 4Y9MA 4DRSA 4GO8A 2ON3A 1YTKA 4C1KA 1H0GA 1BFNA 4IPIA 3WBYA 4HA3A 1XBXA 2P5NA 5D09A 1KNWA 4WKAA 4CN4A 1XH1A 1TWZA 3P5ZA 4AHOA 2PBGA 4GIEA 5CH9A 1QRQA 1LCOA 3MUIA 1KFCA 3DECA 4MB1A 2FVKA 5EMYA 3TA9A 1UA7A 2GZXA 1B5TA 4LAUA 3IJ9A 4W87A 3LPOA 3U57A 4X22A 1IHIA 3VZZA 4P7NA 1QI4A 3ARRA 3QKEA 4CN6A 3HQ1A 1OX4A 1DQXA 1YKWA 4A3HA 3NXFA 3RCNA 3ITXA 2ZC8A 3N2CA 1LLOA 2VT0A 4MJ4A 3HQOA 3O6YX 2PBOA 1AW1A 1GZJA 3NM3A 2GWGA 2JEPA 4INFA 1TIWA 3QMRA 4Q8MA 4M80A 4ADUA 4FX8A 1PSCA 3ZFHA 2R9RA 3QR3A 3O6AA 3KDNA 2Q3RA 2WNQA 2W63A 3T81A 1UC5A 1M03A 3UPWA 5T91A 5D32A 4XIAA 3EWBX 5HQEA 3IJLA 4XZNX 4JPGA 1HT6A 2J8FA 4HU0A 4YTUA 4GNKB 3ZSSA 3EDFA 2J13A 3SCUA 1LLWA 1LWHA 1KGUA 4FX6M 4LVFA 4L6HA 4IUOA 3UG8A 4C6LA 4FNTA 2I14A 3TUUA 4X61A 3LHTA 3M47A 5ABFB 4JQAA 2I7GA 3FDKA 1ZHAA 4CQDA 2DVXA 3WMSA 4IMFA 5CC5A 1H2JA 3WCZA 1T40A 1E9ZB 4DBWA 4DLFA 3BGAA 1M53A 1OGSA 3WLTA 2WWCA 3VIKA 4QS6A 3IJQA 3FVDA 3UCDA 1DPMA 4BF5A 4GA8A 1XIMA 3RCYA 1XG3A 2F2HA 1LRTA 3DEQA 3CH9A 3CPGA 3W7EA 4FPSA 2XH7A 2XIMA 4CNUA 2W0UA 4OOUA 3LPGA 4NJKA 3VDCA 2BVTA 1RA0A 3BG3A 4H9TA 1GORA 3ARTA 3RRAA 4PODA 1W1YA 3WD1A 4O13A 4QJ3B 2WC7A 1S2VA 2VJXA 5AZ1A 3FS2A 4HHMA 1FWSA 4CEUC 2J7FA 2I9EA 2WVVA 1SU5A 2J9ZA 1SZNA 3U7VA 4EPDC 1WBHA 2QQ6A 3W6LA 1FKWA 4JKKA 4XBJA 1YPXA 3O1NA 5LNVA 2QPUA 4Q8UA 3NPUA 4BQ4A 1GWJA 3H2NA 1IV8A 3V5CA 3QJAA 1K9FA 2PWVA 3SY1A 1J0IA 3TN6A 1TV8A 1AL7A 1AH0A 1AD1A 4B90A 2V5CA 1MVYA 3UXAA 1BSLA 2OEMA 2ABBA 3AJXA 4NAEB 3WG6A 3CLWA 3WF4A 3CC1A 6CGTA 2ZX7A 5BXPA 2Q8LA 1Y5VA 3EKGA 3WELA 4F2UA 3ALFA 3CB3A 5F4SA 3GYCA 4CNTA 3EWUA 4GG9A 3S9ZA 2ZRWA 1BF6A 2R1MA 1YE4A 2V5LA 1P6BA 5GNXA 2DDXA 5KZEA 2V3FA 1EJTC 5E0FA 1RD5A 4QAIA 3HPSA 4W89A 3GSMA 1WYIA 4CVWA 4IMCA 2GUBA 1G7UA 1A50A 3SGZA 2WMIB 1BWVA 4GINA 3AMKA 3TJLA 7ENLA 2CLKA 1X38A 3CQIA 2FKPA 1XYLA 4XQ6A 2Y7FA 1ZZMA 3MUXA 3SQLA 2QVHA 3EDDA 4PE8A 3TAOA 1CENA 1RALA 3QLDA 4LVAA 2X30A 5SWUA 1P48A 1XBVA 3HURA 1D7FA 3Q2DA 1XIEA 4Y9PA 3PN8A 2HQAA 4O1BA 4MAVA 2V69A 4DUVA 3BAKA 5G2IA 1TRDA 4WX2A 3P82A 4H41A 4IL0A 2G3NA 1CGWA 1W31A 2EJ1A 1LOQA 4LT9A 4I7WA 3RJXA 4ZEPA 3A6OA 2E8YA 1KD0A 1XIGA 2NVCA 2Y5SA 4XAPA 5AC6A 1W6TA 4UFJA 4YTQA 4E2DA 1YW1A 4JIHA 1YDNA 4QS5A 2GVEA 1SJCA 1FH7A 3H4GA 1YPFA 1G69A 3HPAA 1BWKA 3VI2A 2GQAA 3E0FA 1QT1A 1CGYA 2PRHA 2W79A 3WYZA 4LUJA 4AMAA 3W7NA 4UZSA 4H1ZA 1AFSA 4QFUA 2VTFA 1VFOA 4WSHA 1H51A 3KTSA 3FK4A 5IHRA 1I60A 3EWDA 2WHKA 5A8MA 1IGWA 2VZTA 1X7FA 2Y7GA 4KW2A 4GXMA 3ZOAA 2YFOA 1OD0A 4B91A 3VE9A 4L7ZA 3H2AA 2E28A 1KXVA 3PUDA 3R4IA 3SR7A 1OIMA 2VC6A 3NEVA 4P7LA 1ELSA 4LUSA 1HZYA 2QCCA 2TYSA 2ZC1A 4QEEA 1EX5A 3PC0A 1ISXA 2PLKA 2OG9A 4LAZA 1F8IA 3N34A 3M0ZA 3VFCA 1E1CB 4B9YA 3NEHA 4Z1YA 1FHVA 1EEPA 4CNSA 1PKLA 2INFA 3EWYA 3H4XA 3QPYA 5E6YA 1HKIA 3GBEA 2CLMA 3KM8A 5FI8A 1O7AA 4BEQA 1K4GA 1Q7QA 1E5JA 1I1XA 4UNLA 3KEHA 1IZKA 4HQVA 4DXVA 3N2TA 1OINA 3FJLA 1KCLA 3WLSA 4I5XA 4JQ2A 4XVDA 5D38A 5AYBA 1KV5A 3GHUA 4GH3A 3RU8X 1N55A 1QXLA 3C2OA 5A8NA 2RGLA 3TZFA 3QGKC 4KFPA 4RK8A 4U31A 2A1YA 1CPUA 3UERA 4PUWA 3WQPA 1FCVA 3L68A 1R85A 3DERA 5DRIA 1A5AA 3KRBA 2V68A 4I6VA 1W2PA 5AC8A 5C9XA 2PDBA 3NG3A 4D6HA 3FSUA 2FZNA 1H5YA 5DQPA 5G4EA 1O1HA 4Z2IA 2D3LA 2WHMA 1A4LA 1RXOB 3WQ8A 3SIMA 3G3MA 1QBAA 1I45A 3M5VA 3VD5A 1PZ2A 1F3EA 4S3FA 4TVDA 3K5XA 3OTRA 3LS9A 4EANA 4HTYA 3G22A 3BV4A 2H90A 2WMIA 1BRLB 1AL8A 4HCHA 4AD4A 3TN3A 1HGYA 1V02A 4J28A 2E9BA 3CAQA 2PGRA 1EB3A 2QCGA 4XUYA 5E5CA 4GX9A 1O6IA 3DHPA 2ACUA 1NAL1 1NOWA 3R43A 4ZSUA 2NZLA 3AMLA 1J2WA 3NWRA 1UJPA 3SCPA 3M0MA 4LY8A 5ABGA 2J75A 3NNTA 3BOFA 1OBAA 5I5RA 5U7SA 4D8ZA 4NASA 2YDAA 1IT0A 4AZ5A 1RV8A 4HCDA 1AODA 2TMDA 2DSZA 3WK1A 2TAAA 4XZBA 2ESCA 4AX7A 4AZ6A 2ONEA 2VWTA 2DW7A 5F2LA 4IGNA 1KR1A 3UXDA 1IR1A 3WQWA 4ZL1A 2V3DA 3WH6A 2X42A 1XIFA 1GVIA 4FNUA 2JKAA 3A64A 3W28A 2DIEA 2ZDRA 3S47A 1B2YA 1LQ2A 1JZ2A 1MYRA 1U30A 2O9RA 3B4UA 1XFCA 3PBVA 1OYBA 2O9PA 1WDWA 4NXKA 3V36A 4PCFA 5DELA 2CPUA 3HV8A 3OGRA 1FBAA 1OFOA 3HF3A 5I07A 5GPRA 3MP4A 1J96A 3UVIA 2WNNA 1SSDA 3DFQA 3GZAA 2TSYA 2EG8A 1RVKA 4PTDA 4LYPA 4MJMA 1GKPA 2DSKA 4FX7A 4OU1A 5HPCA 5JXQA 3HGSA 1UBPC 3EA2A 2BWGA 4WSJA 3FOKA 2ZADA 1GOMA 1RY0A 1Y5WA 4K36A 1R3VA 2B81A 3W7HA 4O14A 4K3ZA 3WQ5A 2PURA 3ISIX 3PZGA 3GXDA 3SUVA 3CK5A 1XPGA 3RJYA 2V67A 2FHCA 4HK7A 1CLVA 3TCEA 4NXSA 2X7VA 4LEQA 2ISVA 5A69A 4Z1AA 1GQIA 4U28A 3VNLA 3HBLA 5I78A 2V2HA 1G67A 1EWDA 3WLLA 2E1WA 3B9AA 1LF1A 2ZA1A 4LWWA 1JPMA 1UW9A 1AZ2A 9CGTA 1EDTA 1QPOA 5FCZA 1K9EA 1HJWA 4IIGA 4HZ8A 5PTDA 3DN5A 4G5DA 4Z0JA 3OLIA 4FNSA 2W5FA 3RM4A 3GLCA 1RJRA 5AC5A 3TYZA 3S5SA 3MY9A 1MXGA 2C91A 3AWOA 2V6AA 1H63A 1POKA 1JZ5A 4UFMA 2ZRYA 2TODA 1FA2A 2NWSA 1ODUA 3L4UA 3KCLA 3M0LA 4GYPC 1W3KA 4XV0A 4RE0A 2ZE0A 1KM4A 4F2BA 5CPOA 4LUIA 3WNOA 1F74A 3ZR4A 1R46A 2VD8A 4PBGA 3PPHA 3NXLA 1WA3A 6A3HA 1OC5A 4O15A 5K4ZA 2A4AA 4L1XA 5C2GA 1FDZA 3T9PA 1AQFA 2PAJA 3EDKA 3G1YA 3DKJA 1JCYA 4LS0A 1XV8A 3FXGA 3TLQA 4UTWA 5DXXA 1GTEA 1JGIA 1CXIA 2YKKA 2BY1A 9XIMA 4A35A 3F2CA 4IIHA 3PB0A 2WSQA 3N17A 4UZUA 4F0SA 3VFLA 2YYUA 4CCEA 3W7LA 1BYDA 2AL2B 3A9BA 1LOLA 3G6MA 4XTDA 1EJRC 4GQGA 4R34A 2IPWA 3VDBA 1Y5XA 4KPLA 5EA9A 4MAZA 3TFXA 1E4NA 5CPTA 4KWOA 1WXJA 4XBSA 3CQKA 1W9VA 1V93A 2GDVA 3CZJA 1P0NA 3NQAA 2J9YA 1PVNA 2Y88A 1JCTA 3DFTA 1YXYA 5I09A 1TV7A 4MKVA 1IT7A 3RPDA 1Q45A 3P93A 2XVPA 5IFPA 4L6DA 4G8TA 1OX6A 2HBVA 1V0MA 4WDUA 4GNVA 3KRSA 5FESA 1AQMA 4L61A 4KESA 2PTDA 3MVTA 5BRQA 1SMDA 2HV5A 2VELA 1H3GA 1GPWA 3RIKA 2R6OA 1PTGA 4E2VA 5D9NA 4Q4RA 1BGGA 4WJXA 2P8BA 5AC4A 1TVPA 2IKHA 4ADTA 4H9UA 5C0QA 2H8ZA 1XSIA 1ZU8A 2XDFA 1DWGM 3W7CA 4UFHA 4WOZA 3W74A 4Q8QA 4KETA 4XZIA 3VOIA 1FQ0A 1IXOA 5LXEA 3H70A 3VIFA 1B3YA 2XZ9A 2Y8VA 4NJJA 2VQTA 4LUTB 3KHDA 3DFSA 5BWFA 2J7EA 5BNKA 5I02A 2EAWA 1V4YA 3HG4A 3D5HA 1DTUA 1P7TB 1Q6OA 4KRTA 2VM8A 3LOTA 3GAKA 4QNEA 2OSYA 1YYAA 1JZ3A 5LA2A 1J6PA 1XIHA 2B31A 2DZAA 3IEBA 3N9RA 3AXHA 2QJIA 3DYOA 1AJ2A 1NTHA 1J79A 3LLFA 4H6QA 2VOMA 5M03A 2EXOA 2CBVA 2XIQA 1EJXC 2ZVIA 5AYIA 2R1NA 1M41A 3USZA 1FOBA 3SFKA 4LS2A 4EVZA 3VUSA 2W3ZA 2ZQ0A 2DUXA 3IIXA 1DV7A 1JCJA 4FALA 5D4YA 4DZHA 4F0RA 2ZDSA 1XLJA 3R13A 3WH5A 5CPNA 1CT5A 4ASTA 2C14A 3WQOA 3WLKX 3R89A 3W27A 4ZGYA 1MEHA 2JE8A 2VFDA 4EACA 1UOKA 1KFJA 3VD4A 4M0XA 3DHFA 3C4UA 3CHCA 3RXZA 3IACA 1TREA 3V1PA 4JHZA 4KWVA 2YLAA 4PBEA 4KRZA 3M7SA 2VEMA 3MP5A 1EH9A 4W8LA 1M6JA 1UPPA 2HS8A 2FVMA 3UA3A 2C1HA 2DSVA 5D9MA 2O55A 1QO2A 4ENLA 1Z42A 4DJFA 5C2CA 1TVLA 4ORIA 1JZ7A 4M24A 3YPIA 3ZMRA 1LL7A 4J3ZA 3E9AA 1NF7A 3WNPA 3W01A 4WGHA 3JRKA 1BTCA 3IIZA 1Z3NA 1PCKA 1VIWA 2DT1A 4MZ8A 4HVXA 4KWWA 2CC0A 4POCA 1OCQA 4X9SA 1CWYA 1TPWA 1ME8A 3ZR5A 5DF0A 2QULA 1G4SA 3CXOA 1DJGA 3GTFA 5LZLA 1XRSA 1GQNA 2DFAA 5I24A 5HNUA 1QO5A 2V5KA 4ZZ9A 2RGMA 4XWUA 1LBLA 3TR9A 1V6YA 3QPEA 2QJHA 3S1VA 3T4CA 3WF1A 4AB4A 2CXEA 1L2UA 3U3HA 3FA5A 3GYEA 1TVNA 1JDCA 5F4XA 5L6UA 4W7VA 1SVDA 1QNRA 4UR8A 5HJXA 1Q7MA 1NEYA 5G4WA 2VENA 4XSLA 2DY3A 1PV8A 4IMAA 4LAOA 5CZ0A 2BP1A 3IGHX 3UYIA 4CVUA 3W2LA 3ZYZA 4ADSA 4MUPA 2GOKA 2CEQA 4URIA 3B8UA 2QUUA 2P0IA 2BXZA 4C7GA 3CMFA 1B9ZA 1J0ZA 1TPVA 4W5ZA 4AWSA 1ZJHA 3M5YA 5IBXA 4O1EA 1U22A 2OGYA 4AD2A 2PDGA 4E2OA 3QPZA 3PK7A 1OCNA 1OT2A 4TR9A 2ZUMA 4ERIA 3TOYA 1I75A 2VYOA 4B92A 3FAXA 2ATSA 1MFVA 4B4FA 2DUZA 3ZJ6A 2AOSA 3URAA 3C8NA 5U4NA 1UR1A 5I6SA 2LLEA 4JFSA 4ORMA 1SFJA 1ZQ5A 5HMDA 3W73A 3PR2A 2YGYA 3GVQA 4PCNA 4Q33A 1ISWA 3BMVA 2E77A 2QV5A 2HPMA 4I9MA 3TA6A 3HGOA 3UJSA 3T8LA 1TYGA 1R30A 5CJ5A 1TA3A 2Q71A 3KW3A 3WBWA 2PWDA 3H22A 4Y9OA 3FJNA 2B4GA 1XHGA 4J3SA 4XD6A 3TJXA 2VNCA 4O0KA 4UNKA 3O2LA 2V81A 1G7VA 3GQYA 4E4UA 1KBKA 3K8MA 4GY0A 1WDQA 4BWLA 4FF7A 1CIUA 1JGMA 2F7FA 1E0TA 2FTYA 1R3RA 4U5IA 1O1ZA 2TPSA 1IXPA 1H60A 4GPNA 4FZIA 1IEQA 5A6SA 3I10A 2PA6A 1SFSA 1GVFA 4DJDC 1SZRA 3GD6A 1GUVA 4JBRA 1EFZA 1WZAA 4OTKA 1UMLA 1Z69A 2X05A 4LQ1A 1RZMA 5ABTA 1W56A 3NZGA 3O6CA 3NQBA 4RLIA 2J9XA 1RR2A 3LRMA 4QQUA 4DBEA 4TX8A 3B8TA 4EXQA 3DZ1A 4IGHA 3PTDA 2CXGA 4JY9A 3ZLFA 3S0CA 2Z6JA 2GL5A 2DZTA 4QISA 4LFYA 1TUXA 3AYRA 2HK0A 4ZO9A 3B0UX 4H9VA 1TQJA 1ZPTA 1XIIA 3BXWA 3OVRA 3RDKA 2J88A 3B04A 2PMQA 3S5NA 3KBSA 1GGOA 3GDKA 2CBJA 1W37A 4NX5A 1X8FA 3U0HA 3BGJA 1GOOA 3N14A 3S2JA 5JBEA 1LG2A 1Q66A 3LHVA 1LUCB 1KRBC 3O3RA 1X39A 2BDQA 2WVUA 3WQGA 3L4WA 3TEVA 1XJBA 1LWIA 4LOCA 3QMSA 3GUWA 3AXMA 2Y61A 5IM51 1E4IA 4EOUA 4JTDA 1TCMA 3EXTA 2WC3A 3PB2A 1VRDA 3UT0A 3W1NA 5HMSA 2POZA 3KXQA 3J7HA 1H1NA 3DENA 3MU7A 1Z44A 3E0LA 3IIOA 4GBDA 2ZX6A 3MSDA 3APTA 2CZDA 1ZJIA 3FHQA 2FDSA 4RNIA 4V33A 3S42A 3P0WA 4QLKA 1Q6QA 2QUTA 3TTEA 3Q45A 2B7QA 2ZTKA 1V3MA 4AX6A 3COTA 1CXHA 1OG0A 2ZXQA 5AYYA 3E2VA 3PPGA 4O0QA 3NQ7A 3LNMA 1MUCA 4U33A 4KCTA 3OZPA 3IVSA 5TF0A 3QOMA 2BX7A 3KBJA 1XF0A 3HMJG 1YNPA 3W53A 3T08A 2XPKA 1J0JA 4LRTA 1DL3A 5D2WA 2EQDA 1JQXA 1H4PA 4N9DA 3LTYA 3AZSA 1V3IA 3QY7A 4S3GA 3VKDA 1EIXA 3VOHA 1XCXA 4P61A 3F2BA 2WLYA 1DIDA 5K9XA 5CC3A 1E40A 1FWNA 1TR1A 3CUFA 3UJFA 3ARZA 1QOXA 4GI6A 1NFGA 1EXPA 3VC5A 5K3VA 3IPWA 4OBRA 1B3VA 1YDOA 5TIMA 4I7UA 1ZB5A 5BU6A 3W83A 5BRBA 3CV2A 2A3AA 1XIJA 1US2A 1B3OA 2PDNA 4UB9A 4FMVA 1HKWA 4KWUA 1O5XA 3NO3A 2BXYA 2PDCA 3S8HA 4N9BA 5FSEC 1B3WA 2XH4A 1GKRA 1MXSA 3W7KA 1NP2A 3EKLA 1RBLA 3B9OA 3S2CA 1OHLA 4S3EA 4ACYA 2V82A 1XLGA 2RKXA 1EXBA 1FP8A 1OFQA 4QG9A 1O5RA 3LG3A 1A5KC 3KTCA 3E2SA 1NARA 2QHAA 1LRNA 2JF7A 1DBTA 5C55A 5FJJA 1J01A 2BHYA 3BVJA 4A6GA 1RY8A 2FMNA 3JU2A 2UV8G 1HKJA 4UTIA 4HNLA 3U8GA 4UFLA 2DW6A 4AZBA 4HYWA 2XM1A 1VBJA 3CUXA 3C6CA 9XIAA 1OYCA 4NZ1A 3WJXA 3ITTA 3JUGA 1AQHA 3QV9A 3AWNA 4QQ3A 1Z48A 3FGCB 3I3EA 3R0DA 5K2ZA 4Z2JA 2FIQA 1KCXA 2ZA2A 3WK2A 3AICA 1FWRA 2VC9A 4ZODA 3VAVA 4NNBA 2XVGA 1G1YA 3EX1A 2BXVA 1LLZA 3TQVA 5F1VA 4YU1A 3TH6A 3V18A 4MWAB 3EOLA 3QLLA 1W1VA 5DCEA 1QK0A 5CSUA 3L0NA 1A0EA 4JHMA 5BXTA 4F8XA 4PMYA 1DWFM 4J2MA 2WWDA 4US5D 1CXEA 2D0FA 3LHZA 1L6FA 3I68A 1P0KA 3B8DA 2PD5A 1RCOB 4FIQA 3BO9A 1XL9A 1BYCA 3KTXA 2X09A 1H7RA 5B7YA 2D2JA 1Q8AA 3VNDA 4UOQA 3XISA 1G94A 2Z1VA 4DPPA 1AW2A 3NL2A 2D23A 1GZGA 3LI1A 1E9IA 1OK4A 5E1QA 5HR7A 3DESA 2QUNA 1FCUA 1LOSA 1F3XA 3QKZA 1CXLA 3QEZA 1HKVA 3GHTA 3EB4A 1NF0A 1WAWA 4LBSA 4QEHA 3WNLA 4LYRA 5CC7A 3P14A 1JXKA 1NJJA 2PEVA 4OFCA 1JZ6A 3DKLA 1JF5A 4GJ1A 4RDVA 3WNMA 3KHJA 3TCSA 3GHSA 2OYLA 1BXCA 3SAZA 2D1ZA 2ISWA 1E6QM 1UD3A 1G4TA 4ZQCA 2WSPA 4ICCX 3E3HA 3UZZA 1MRQA 2C7FA 1FY6A 2XFRA 3KRUA 3L4ZA 1M7PA 3WLQA 4C6BA 5CBIA 3TWAA 1S1PA 5FF2A 5CEWA 3OBEA 2DZXA 4V1YA 4AVFA 1A0CA 4LJ3A 3BQ5A 1PB0A 5REQB 3DCPA 4AG0A 1VYRA 1TJRA 5CXPA 3T2OA 3TC6A 4JYEA 3ES8A 2JGYA 1TIMA 2WCAA 4AD5A 3U4AA 3UNTA 3UFYA 3P7YA 1E6SM 3PAOA 1AUSL 1ZBVA 4LAMA 4JNMA 3CPUA 1W9BM 4FLOA 5E9AA 5HULA 2BV9A 3TN4A 3GU9A 1Q13A 1S5VA 4BQ3A 1Y65A 3KWSA 3CIWA 4JKLA 3IUIA 4RZBA 2VR5A 3B8SA 3UXLA 4F2TA 5HQMA 1VJZA 1M3UA 4ZQMA 5K4XA 4GI4A 2X0SA 3CZ8A 2XN1A 3R94A 1XXXA 3GZ3A 2NXGA 3A4JA 5D2TA 4KGLA 4YWSA 4MG4A 3L67A 4K8EA 2BY0A 3TJ4A 3FYOA 3DOPA 1UQYA 1C29A 2CLOA 3M41A 4I3GA 2DJXA 1KM6A 3SFWA 2WMJA 3WQ4A 5C7VA 1W17A 1AG1O 1RCQA 1SZGA 3DYMA 3MSGA 1NDYA 4UTFA 3MUY1 3NA8A 3M6YA 4AZCB 5D04C 1V8EA 3NO1A 4MWAA 3CGTA 3KVMA 4LALA 1A5MC 1XYAA 2D20A 4K2SA 3L0KA 3THQA 5LNUA 4J3WA 3O0KA 1W3JA 4W86A 3RLHA 4CU7A 4XUGA 4M81A 2RDUA 3A12A 4JXCA 1UROA 4WDXA 1V3HA 2Z1SA 3HG2A 2BVWA 3M0JA 2QGHA 2VR4A 4ROQA 3M7WA 3VIOA 5ENLA 5KMYA 3ABOA 3W2MA 3PTQA 4BA0A 1VZWA 3EPMA 3ZLGA 1WUFA 1MXDA 1P5BA 1R3YA 1UZHA 1H1YA 1WDPA 1LROA 4I9JA 1J0KA 4Q8OA 2DSUA 1X6NA 1IXQA 2XSXA 1UG6A 1ZS2A 1VHNA 1VCGA 4FLRA 2V9DA 1OFRA 3MI2A 1TE6A 3NZQA 4XD5A 4RZ4A 4UWMA 3S46A 2ZUWA 3RX4A 1XRVA 4LYKA 2YW3A 4JDYA 1KFKA 1VLWA 3KS5A 3UCQA 3HFTA 2AAMA 1QOPA 1UKQA 4JHOA 4TTUA 1EQCA 3MZNA 1VQTA 1UH3A 5D8ZA 2V5JA 3LTPA 4CQCA 3BLLA 5AHLA 3TONA 1GCYA 5A6MA 3BLPX 1PYFA 3T6CA 2ODOA 1V6VA 2PDLA 3SJ3A 4HKPA 3UG4A 2DJLA 2HCVA 3CUZA 3DFPA 4MF4A 4JTFA 1DJIA 3RR4A 3U7BA 3GNDA 5HBFA 3BICA 1JI2A 1H50A 2WW5A 4QG6A 1GHRA 4IFKB 4Q3MA 1XLMA 4K38A 2XYLA 2A6LA 1ZRQA 1XP3A 4UTJA 3GTHA 1E73M 2YA2A 4X63A 3T0DA 4UFIA 1EHAA 3W7PA 5REQA 3ZLHA 3G0SA 4EIVA 3H26A 5FF7A 3PWIA 1SMAA 3W84A 3L2MA 4RCXA 2AGKA 5FEWA 3M16A 4F48A 3DBPA 3EPNA 2VEGA 4S2BA 5BWAA 3ENLA 3AROA 2DQXA 4WEVX 5FIPA 2FDMA 1VEPA 1TTJA 1KTBA 2X16A 4C5ZA 1IIGA 4XD3A 3L4TA 1ICQA 1B3ZA 1EJVC 1VC4A 3TYAA 2HSAA 2HRWA 3MHGA 3TK7A 3KLLA 3QFWA 2QUVA 3NURA 3W24A 1UA3A 3E74A 1JPDX 3WK0A 1J18A 3PWGA 2ISDA 4Y9AA 1D3HA 2WO5A 1YTEA 1TV4A 2IQTA 1QNPA 4D72A 1I2OA 3C0JA 2G96A 2G50A 3L0GA 4I5UA 2Y4SA 4MNJA 3SO7A 3OG3A 1OFPA 3TLLA 3U5UA 1S39A 3LB0A 4MVAA 4FHAA 1POJA 3NDYA 1XM3A 1ZBCA 2O9OA 3M0VA 1MWOA 3VCCA 4LEFA 3GO2A 1HFBA 4KEUA 4LS1A 1SO5A 3VDAA 4JQ4A 3GNPA 1W1A1 1E0XA 3DIPA 3HTWA 3DDMA 4AZCA 2NWRA 3BWWA 1FH8A 3MTWA 3G1SA 1X7IA 3STFA 2ZZ4A 5C54A 3GVRA 4L4MA 5M5DA 3V0TA 1Y7VA 1UWIA 3UG5A 4LCQA 2PDKA 2ISFA 4JTIA 5FJOA 3TMQA 3GW3A 2X40A 3W23A 1VBGA 1LL4A 2YOCA 1JDDA 4GUGA 4ZFMA 1W9XA 4L4PA 1O68A 1IR2A 4DF2A 2CERA 4XD4A 1J4EA 3OEXA 1K4HA 4ZOCA 5LIXX 1TPC1 1YXDA 4NQ1A 1LZOA 4L1WA 4Z0SA 2YDQA 4WVXA 6REQB 3JW7A 1A47A 3QH2A 3H4WA 3MV11 1TO3A 1JJKA 4TXEA 2JIWA 3QTGA 3TYCA 3W3OA 8CGTA 1DXIA 5EBAA 4DUXA 3PBMA 2JGQA 4IX2A 3EEGA 4PSPA 5C9WA 5A2BA 1ITCA 3WFZA 3MJYA 1MDRA 4B15A 3Q65A 4H01A 3R0KA 1SW0A 3FJ6A 3LZ5A 3DGRA 4O10A 1EZ2A 5BU9A 1JDAA 1I0DA 4QE1A 4WDWA 2Z24A 3VGBA 2YSWA 2VGFA 2QMKA 4Q4QA 3W7DA 2BB0A 1I4NA 3CAVA 4H8UA 4IFKA 1KM1A 3U6WA 2XGIA 4DI8A 2Z7KA 2W27A 2ZXDA 2DORA 2GJXA 3VIMA 3KBNA 2EKCA 2QJJA 3W7JA 5HWMA 1UKTA 2PFHA 6XIMA 4NAFA 5HMFA 4IICA 1MSSA 4A4AA 4NKCA 2DUAA 3WZ0E 4RPQA 1TJ1A 1ADDA 3ONCA 4HN8A 2AMXA 3MUZ1 4AEOA 2C19A 1FWCC 3ITYA 3UJRA 1OWQA 3GXFA 1WP6A 3DG6A 2GQ8A 2OCZA 4O53A 4DJFD 2NXHA 7REQB 4KS0A 4LSBA 4J35A 2FPVA 3UR2A 2E1DA 4UQBA 3EEZA 1TWSA 4P8XA 3LPFA 1F76A 3S3GA 2GFTA 4N6FA 3VIIA 1V6TA 3ME3A 3GS6A 3TQ0A 1S2UA 5FA5A 5F1UA 4EPEC 4PGLA 2PDMA 5GJPA 1W9UA 2I56A 1DYSA 1K1DA 1UR0A 1I0BA 3NCOA 1DXEA 2E40A 2OQYA 3WH9A 3HN3A 5GJMA 4GVIA 4I8YA 4B5XA 2J77A 1V6WA 3LV5A 3LHWA 3WUGA 3UWUA 2R1LA 2ZX9A 3WH7A 3NL5A 2HVOA 4GACA 1TJ2A 1TPEA 2DZWA 5FOOA 3BW4A 5IRPA 2Z2AA 4OHQA 1VYPX 4B9ZA 3E49A 1MNSA 1D9EA 2J6XA 4S1FA 3LMYA 1QR7A 4KWSA 3KS6A 4WKFA 4L64A 4IL2A 2WMHA 1DEDA 2WM0A 3MBFA 1KM3A 2P76A 4ACZA 1FWIC 5FEXA 4MKSA 3PZMA 1TTPA 4HNVA 1DE5A 4A3QA 2A3EA 5KZDA 3CT7A 5JQ9A 4JTQA 4J5NA 2JF6A 5I00A 4HPJA 1U1JA 2ATMA 6PTDA 5BW6A 3QR0A 5FJUA 1UKOA 1KFWA 1GYMA 1QCWA 3BZJA 4A8LA 4H9ZA 2PRLA 1Q4NX 4EAMA 3NYZA 1FWAC 1FHDA 1P43A 4G2DA 1VF8A 4B5WA 2PF8A 1UB3A 3I65A 5TD4A 5CCZA 1FUYA 3EMZA 5FAJA 1UWSA 3MSYA 3P3BA 2QW5A 2AQWA 3P84A 1FWTA 2YA0A 2AQOA 1MZHA 5F2GA 1MDLA 2GQ3A 2ZRUA 1XLBA 1A3HA 2PDQA 4RXFA 4GX8A 3UNDA 3GTNA 6REQA 2PWFA 3SRKA 4DYJA 3I4KA 3LENA 4DF1A 1V02E 4GGBA 3PBWA 4HB7A 1I1WA 3O8AA 3PTMA 1WDDA 4AMCA 1RVGA 4G1KA 2V3EA 1DE6A 1VEOA 3AHTA 3OODA 1TX2A 1K02A 2NVAA 3SN0A 4DJEA 1NFBA 5AYZA 2ZBTA 5LIKX 4O19A 3UGVA 2PU1A 3Q58A 3BLOA 4IMGA 1BF2A 2BHZA 2G95A 4AVNA 4S3JA 4DELA 2AMGA 4TVCA 3R11A 3UWVA 1PEZA 1QASA 2GWNA 1KTCA 2ZUNA 4M29A 3CYVA 3U9IA 1BKSA 2J4GA 2ICSA 1VAHA 4GHRA 3EX2A 3FIGA 1NH6A 1TFVA 1QDSA 4HP5A 4XK2A 3ZT6A 4E8DA 4G7EB 3WLIA 1W8GA 4Q22A 4DUWA 1EIBA 1LRQA 4CLMA 2E9LA 4I9TA 1E1EA 2IPGA 4ZMGA 3JR2A 1HL9A 1X8CA 3LLDA 2J47A 3BOXA 1G01A 5F2IA 1G5AA 4JNYA 4H9YA 4XBKA 2X7WA 3QSRA 3ZXWA 2Y8KA 2NQHA 3AXXA 5MKGA 3MO7A 1HL2A 4CQAA 5KZMA 1RAKA 3IIVA 3N6JA 4TTGA 3LTSA 4PMQA 3CU2A 3M4HA 1KBJA 2YB4A 3WJWA 1X96A 3RO6A 3N4FA 3IRSA 4FLQA 4XB3A 1IWBA 2KAUC 4HJFA 2OODA 4NF7A 4HMEA 1CW2A 4TO8A 4P8WA 2HVMA 3WBEA 2H3BA 3N6HA 2Y5JA 1JAKA 1GZ1A 3TTQA 3AUJA 1FWHC 3T0CA 1E6XM 2DIJA 3VKAA 4RDYA 3QC0A 4Q4KA 3RLUA 1UZDA 3LEPA 1KXHA 3PANA 4GO9A 5IOBA 1N82A 1IEWA 1UZ4A 4NG3A 2CZ5A 1D8CA 5HPOA 4AIUA 4IFRA 3MA8A 3MWCA 3BG5A 5JU6A 3GXTA 3VDGA 1TV3A 1U1UA 3ZIZA 1OM0A 2OWWA 1RK5A 3PZIA 3FKRA 2BG5A 4JKMA 3N2MA 3WD3A 1TB3A 2YDRA 4BS0A 5DCBA 4U2YA 2O0TA 5F2MA 1CGXA 3I6EA 4DZIA 1Y8BA 3CTLA 3LQLA 1W2VA 1QFEA 3CZLA 4QTGA 4FNPA 5AKQA 2E0PA 1WKDA 1C8XA 3F5KA 2Z1KA 3LCFA 4UR7A 1IWPA 1TMHA 5DY3A 3FVMA 5IDIA 1HJUA 4QDWA 2ZZ3A 2DPEA 5EFFA 1OZMA 4G7FA 2CETA 1X6UA 4DO6A 1QW9A 1BYBA 2C79A 4F0KA 3AIRA 4F79A 4ZE5A 1H5VA 4EPKA 4TX6A 4AWEA 5FF0A 4LNYA 3G1HA 1EBHA 2WSKA 3LK6A 3BCDA 1IXNA 4L4OA 5DCDA 3LY0A 3KVKA 3W0KA 3WBXA 2EPLX 2RJHA 3H21A 3HQPA 2NQLA 4GCXA 3MSRA 3RPTA 3RPMA 4J3TA 1NDZA 3MO4A 1RA5A 3OP2A 4KF1A 1A5OC 4Q8WA 3E96A 2QCFA 3SW6A 1X6LA 1S2WA 3HPXA 3WMBA 1W1B1 1PE1A 3LM7A 3NSNA 3DHDA 2YCJA 1C92A 1ZALA 3ARQA 2IKIA 5KEZA 5G2WA 3HG3A 3S6OA 2P1FA 4GUFA 3ZT7A 2VDHA 4B2DA 4DIAA 3CS2A 2A5HA 2ZTJA 3K1DA 4NJIA 4PTMA 4BCEA 3VKCA 4C7DA 4DLMA 1G9HA 5HUPA 4G7EA 2NQZA 2VKZG 4QCEA 3WDJA 1PKMA 3SQSA 3GM8A 4O0ZA 4MY1A 3BLIA 3BOLA 1JVNA 4R9XA 2DH2A 2X1TA 1R9YA 4YMZA 1QPQA 1TPDA 1EYEA 3DFHA 3NVDA 2G8ZA 5I3JA 4RDZA 1GVOA 4D71A 2C3ZA 4LB3A 3ARSA 1RLDA 3EGJA 2VC5A 4O11A 4QSHA 4AZGA 5XINA 2YCLA 2WLZA 3F4WA 5J5DA 1VGAA 1GEHA 2B7NA 2EEXA 5DBUA 2HXUA 1GOXA 3SRFA 2V38A 4IM4A 4PUUA 4C1NA 2QZRA 3REQB 3V0SA 1PKNA 1L6WA 1B30A 1HJSA 2YFNA 3KBVA 4JN7A 3V35A 1F4HA 3BV7A 2ZUVA 4C90A 4XSMA 4X0VA 4AY1A 4O28A 4EPBC 3PTKA 4RUBA 2HWGA 3W75A 1B54A 3II1A 4PFMA 3PUGA 2F8QA 1XYCA 1XQKA 4IP7A 2A7NA 4S3CA 4HNOA 1ME9A 1R2TA 3DI1A 2FZ8A 2F6XA 4OJYA 3PNZA 3QHNA 1TTQA 4YPJA 3P8IA 3AYSA 3DC0A 2NT1A 1GG0A 2OZ0A 4HSHA 1TCDA 4U3AA 3T8QA 3OYZA 5BOOA 1XCWA 1TWWA 1VBRA 5M3WA 2HJPA 4PEEA 4IFOA 3UEQA 2XFFA 3ABRA 1LTDA 5DMNA 4BK9A 2NW0A 4GQ0A 4UCGA 3RK8A 5LNSA 2O4MA 4P7OA 2Y1HA 1QNQA 1MRAA 3AQUA 2NVDA 3T07A 1UWQA 2J7BA 2GPTA 4GE8A 4ZB5A 2HPIA 1HN1A 4YJ5A 2G5WA 4IMEA 2NLIA 5A3HA 4H7VA 1XC6A 1XDJA 1SO4A 1C93A 3PG9A 1UH4A 4XKMA 5EU9A 4QE5A 4AEFA 4YL2A 3MP3A 3SRHA 2O7SA 1S2TA 1BKHA 2QCEA 2E09A 4PTXA 1EZWA 1NDVA 2QJNA 3W70A 5H8MA 3G1VA 4GISA 5C5YA 3OPSA 1ZAHA 1J0HA 1F7BA 3FJ4A 4QIUA 2UWFA 4NP7A 5G2HA 2ZRZA 3CO8A 1WPCA 2R94A 4ZQOA 4FS9A 3G8EA 3T42A 3URQA 3MCOA 2ZKMX 3TFCA 3K8KA 1V79A 2MUCA 1TPFA 4TMBA 3A3WA 1EEXA 3URNA 4XZLX 1MW3A 3FFSA 4IXHA 4IGMA 1OB0A 1D3GA 3A23A 3W87A 3BLDA 4N4QA 4P8UA 2Z27A 3P80A 4P2VA 3QV6A 8TIMA 4HBKA 2J6VA 5EMUA 1Z32X 4ZO7A 4Q4PA 2HROA 3KP1A 1PIFA 3DG3A 4Q8PA 4JNZA 1FWFC 3PS7A 3GBDA 2WQDA 3TYDA 3FX4A 3QN3A 2WNWA 3H2EA 1CNVA 3N73A 1B3XA 2QDGA 3B97A 1WZMA 3PZ9A 4U3CA 1KBIA 3HZ3A 3CT2A 3UF9A 4HHLA 2X0HA 1I2PA 3ITVA 3QHOA 4J4KA 4RZ5A 1N7KA 5GQBA 1T41A 4PMOA 1YE6A 4XTIA 2ISSA 2EHHA 4QAWA 1JPHA 2GUYA 3MCMA 2Q8ZA 3BE7A 3QMTA 4LVGA 1T7LA 4D8AA 3KWXA 4WXZA 2NSOA 2FTWA 2YXGA 4ATWA 3ECQA 3UBPC 3MI6A 4LBUA 3KVJA 3WJSA 2GVGA 3H7RA 5CAHA 2UY2A 2JBMA 2HMCA 3W2JA 4MSSA 2IPFA 4BQ2A 3O06A 3L65A 2WHLA 3AHXA 2PSNA 1N8WA 3SUWA 5AHEA 4MLRA 5K9DA 4Q4MA 5CKSA 4LPCA 5FD0A 5DRCA 3MMWA 3CUHA 3VOFA 2X2YA 1XX1A 2Z0IA 3NO5A 1AQ0A 3UWYA 1H7NA 3W2UA 3AS1A 4MWAD 2QIIA 4GI8A 1M7OA 4AF0B 4QXIA 1O4UA 4YN5A 1FWDC 1VLIA 3NQEA 4ERGA 5D2YA 2C15A 3BL3A 1ZNNA 4DWSB 2Y5EA 1VEMA 2J66A 3WDRA 1W3IA 3VD9A 4M82A 1M01A 1DWAM 4O1DA 4C6MA 2XIOA 1KM2A 3FA3A 4M6QA 1YHTA 1YBQB 2QCDB 3G1DA 1NSJA 3W1RA 3OVPA 3E5BA 4JTTA 2B7PA 2DZPA 1Y0EA 4AISA 1H11A 2QS8A 4JTLA 3CBWA 4FA3A 4MGGA 1ICPA 4H8NA 4OZOA 4UTKA 1NM9A 1K7EA 1FFQA 4ATDA 4B4HA 4EWJA 1ML1A 2IUZA 1OK6A 4FOUA 1MI3A 2VFGA 1E0VA 4O17A 4PBFA 4PB5A 1PYMA 5CBBA 3OBKA 2FZMA 4QROA 4AC1X 1OX5A 2NLYA 2WKGA 3L5MA 3CH0A 2X0YA 3SCOA 1WKEA 5DXYA 3F1QA 2BGSA 3AMCA 4HOXA 3VCRA 1QW7A 2BFGA 4UQ9A 1LYXA 1BPLB 1XIDA 3N18A 4RV8A 1M65A 3RMEA 3U2ZA 1PCWA 4JAWA 2CW6A 3CQHA 3NJ3A 5M17A 1S3HA 5HAOA 3MJMA 1L6SA 4MOZA 3ITLA 1CB2A 2Y85A 3CIXA 5MHBA 6XIAA 2OTDA 4ZOEA 4ATLA 4N0RA 1B9BA 2VZSA 1E3ZA 4ZA0A 1UMYA 1K70A 2ACQA 5D9OA 3B8WA 4QP0A 5CSYA 1GYNA 2PDIA 4HMCA 5BXRA 4FNQA 3R58A 3EOOA 3KUMA 3UR7A 1J11A 2FQIA 1XLAA 1GQLA 1ISVA 2WM1A 4HGXA 3B40A 5I2UA 1JYNA 5T26A 2W9MA 1HL8A 4ILSA 1SQ7A 3E2RA 4O50A 3QY8A 4HPHA 3UR5A 3EMQA 2CZVA 1LQAA 3AUOA 1UOZA 3LV6A 1BVZA 1VPQA 2XU2A 3KFTA 5C6MA 2CLLA 4HA0A 1YIXA 1S2AA 2C71A 3MMUA 3TROA 4R9OA 1ESWA 4F4RA 4EK7A 4F9JA 2OYKA 1UWAA 2OVLA 2XM2A 4QNWA 2BY2A 2EPOA 1BG9A 3PBUA 3GNNA 5FEPA 1JD7A 1WAUA 4ML9A 3WEZA 1VS1A 1ZP4A 5ABFA 4AY8A 4CD5A 1WKYA 4N9EA 3NFUA 2AGTA 5K9CA 1M04A 4OIFA 2HBXA 3B0VC 3C3UA 2E4TA 1ZY9A 1F61A 1PPIA 4YCPA 1ITXA 1IEXA 3GB6A 4JTHA 3S9IA 3QYSA 3JVAA 2E5DA 3OIXA 4DWSA 2VX6A 2GVYA 4MY8A 2YL9A 4EKJA 3N13A 4PL2A 2VZVA 3QM3A 1QI5A 2NV1A 4US5A 4J27A 5H2ZA 2J7HA 2A2IA 3NPXA 4WOQA 3BC9A 1BD0A 1Q7ZA 2PP0A 1S46A 4ZB2A 1K8ZA 4LV9A 2QCDA 4C6PA 1KGWA 3V16A 1W9DM 3U5YA 4UFKA 4A3UA 1EUNA 3QZEA 5AB3A 3V3WA 5KZ6A 2E3ZA 4A8IA 3AYVA 4TQTA 1SR9A 4GYJA 4PTNA 2EO7A 3T78A 1RJQA 1EF2A 4JTAA 5G4HC 1JNEA 3E12A 4C60A 1CLXA 1VHCA 2W91A 1VRXA 1WX0A 4HHPA 5LA1A 4DPQA 4LH8A 4RW3A 4YXGA 3N2XA 4GQRA 4MUZA 3VMOA 1DQWA 3OZOA 2BTMA 2P10A 3GIYA 3KOWA 4NAEA 3DI0A 4MHBA 3TE9A 3VGFA 4WD0A 3FKKA 1CGUA 4UMAA 4GIRA 1YDVA 3F5LA 4AZ7A 3TX9A 1O66A 4ICNA 4O16A 1MUMA 1XDLA 1OVDA 3OHMB 4TOQA 5LNRA 3MUCA 5CPLA 2VUNA 5J8LA 4XX6A 4YIWA 3TSBA 1LORA 3CO4A 4HMDA 4RE2A 1UR3M 2WSYA 3LGDA 1W1ZA 4O18A 2GK1B 2A85A 1ONRA 3QBUA 4LV4A 3OZYA 3V4BA 2D22A 1JPKA 3UW6A 3CUGA 4BEUA 1EX1A 2YIHA 3O7UA 3NPWA 4LYQA 5CG7A 3PZOA 1SZFA 3TTOA 2XHYA 4LB4A 3ABZA 4W5UA 3PZUA 3AS0A 3WSUA 3FAWA 3S2LA 1XG4A 3THDA 1X1NA 4ZTXA 1A53A 3C2VA 1T5AA 4QX4A 1W91A 3CZGA 1BEUA 4C6FA 1ZJAA 4GUHA 2NQ5A 4C6CA 4PYSA 4RR4A 3XIMA 2VQUA 4O1AA 3R8RA 3ARUA 1C90A 2OSXA 3UWZA 4QDPA 3RITA 4ECLA 1TG7A 1W1TA 3EX4A 4L80A 3W25A 1S38A 1UR4A 2IPJA 1ADOA 3CWHA 4CU6A 3D6NA 4LCSA 4KCWA 3VINA 2A7PA 1W3LA 3CLMA 3G5EA 1IZCA 3GRIA 2Z26A 1HW6A 2ACRA 4UC5A 4QJ5B 4GJIA 4WY0F 4CD6A 4GWEA 1VCFA 5EMLA 2EKGA 4DVOA 4S3DA 4LANA 2BNJA 4BR1A 4GFIA 2QYGA 1MFUA 1E9YB 2OPJA 3RX2A 1EP3A 4OGZA 1US3A 3CL8A 1W3TA 1GNXA 3T55A 4JCLA 5LHEA 4WGXA 1FCBA 3UGRA 1Z89A 4HSOA 1EJ7L 1S5TA 4Q6XA 2P50A 1WO2A 3PSWA 1E1CA 3WNKA 1KRMA 1A80A 1QJWA 3E38A 4QHRA 3GW0A 3ONBA 5AFDA 1FHLA 2Q01A 2VI0A 1MQRA 1V0LA 1DHKA 3IJ8A 5LKYA 3MV01 3QTPA 4LAKA 4IMDA 4H2CA 4TV5A 4JQ1A 4DJED 1GOIA 4A8NA 3OZMA 1E0UA 3BUVA 4S3KA 1AW5A 3T44A 3IAQA 5D02A 1VPXA 1K7FA 3N4AA 3QGVA 4HPNA 3NQFA 4ZR8A 4EXBA 4Z1DA 2WZHA 1BXNA 2XFYA 4NIRA 2C13A 4E0CA 3SY5A 2O92A 1PX3A 3G1XA 4GLEA 4U4MA 2I16A 4LF1A 3GTXA 1FCQA 2DV0A 1RQBA 3PF3A 4YTTA 4DEFA 3T0AA 1V77A 3TXZA 1HJXA 3LXAA 2P88A 5EKYA 3SJNA 3QR1A 3H55A 2J8GA 4DUOA 1P0EA 4NZCA 1TRIA 2VHLA 1BRLA 3MB9A 3C0SA 3P2VA 4GK8A 4L1GA 2OX1A 3VPLA 1OADA 4E3TA 4F0HA 3F4NA 3AISA 1MMFA 3KLKA 4AU0A 3RUBL 3E2QA 4AHQA 4K7VA 4R88A 3GFYA 1ME7A 3CHFA 1E51A 3RHGA 2VEIA 4MWAE 4G9PA 1GTHA 3WF3A 4GZEA 4JEQA 1K8YA 1GVSA 2E5BA 3C2EA 5FL0A 3F5JA 2PODA 5E70A 4GYFA 3KZSA 2FLIA 4JS3A 3V5OA 3WUFA 3URBA 2DGAA 3D3FA 3PJXA 2PZ0A 5T9BG 4H3DA 1M7XA 1ZCCA 3LCXA 3GXPA 5HNTA 3BJFA 3W29A 1W54A 5KETA 2IS7A 4JDBA 5CJMA 1TR9A 1BYAA 4MB5A 1ENUA 3MMDA 2GJRA 4FR1A 2NX1A 5IFTA 1JFXA 4HK6A 1AD4A 1H0IA 4RXGA 2DZSA 3F4DA 3ZM8A 3W1TA 2G3IA 2ZA3A 4G6CA 4DJDD 2D2HA 1E6RA 1ONEA 3EB2A 4M6VA 1OJXA 4YHGA 2QGYA 4NI8A 4IPNB 1JYVA 2PTXA 2WMKA 3LRLA 3QW3A 3W85A 1DJNA 1AVAA 1VJSA 4AY7A 3SADA 2OQLA 3PZTA 3PWAA 4O8AA 5HJYA 4C6JA 3L66A 2ZCGA 4W8AA 3C56A 4DJFC 3N04A 3N3MA 1VENA 3LXCA 5A6TC 1P1XA 2IKGA 3KBMA 3S5OA 5F7UA 3UY7A 2V63A 4MTVA 4PA8A 1UCWA 1WE5A 1XKYA 1SR0A 1DWJM 2D3NA 1BVWA 1HIZA 2PCEA 4FR6A 1ZBKA 3C86A 3C3NA 3LGEA 4DBDA 4AXNA 4YYCA 1LM1A 4LU0A 3Q4DA 1BQCA 4XZWA 4KH2A 2J25A 3JS3A 3AI0A 1DVJA 3KAOA 2G4JA 2HK1A 2WYSA 2A3BA 3LU2A 4AAJA 3A3XA 2E25A 3KP0A 3NZPA 2NV2A 1IQ8A 5BMXA 2VO5A 4NZ5A 1CBGA 3CV7A 3EXSA 4Q8VA 1OX4B 1V51A 1R47A 4QLJA 2RDTA 4QJ1A 5BOFA 4DF0A 1O5QA 2Z25A 4M5PA 2WBKA 2VRJA 4DNMA 3LERA 1YPIA 5JBDA 3H2CA 2YR1A 3RFAA 2Z00A 3R12A 1VCVA 2BSLA 3C2YA 4W7WA 5HXMA 4B3LA 1A3XA 4E38A 2I9UA 4B2DD 3ABQA 3GXIA 3HA1A 4M8UA 3BSHA 4Z2HA 4EP8C 1EGZA 1Q2SA 3ZO9A 3BLFA 4B16A 5GVJA 1C9WA 2Z1BA 4U2ZA 3MUAA 3NL6A 4WY0B 3TN5A 3HJZA 5E09A 2RH9A 4FAMA 4OOZA 5TBOA 2PGWA 3WLMA 1JAEA 1X1ZA 1T8QA 1HVQA 1U33A 5DO8A 3AXKA 3EB3A 5DMMA 1L0PA 5LHFA 5IBXC 1ONWA 3LD5A 4GXWA 4Z1BA 5A94A 1CB7B 2XGBA 5CGQA 1KKOA 2RDWA 1FFRA 1K3UA 3VE7A 2VFEA 4HPXA 4H6RA 4K8GA 4GUJA 4O4WA 1EO7A 1YNYA 2A6NA 4HNTA 2E6FA 3R8HA 3N19B 2DH3A 3WKZA 2VP8A 2FZBA 2AL2A 2C6QA 2E67A 4IPLA 4GUIA 1JYWA 3VTRA 4A3YA 3QQ1A 3W9ZA 3L5AA 1K03A 1EOMA 2BBFA 2DIKA 4NZ4A 3QZAA 1EC8A 3AIWA 4X2PA 1B31A 1EJUC 4HMNA 4DXXA 2WNZA 5CLTA 5BXSA 3B9EA 1FXQA 1TPB1 3A3HA 4JEJA 3QOKA 3B8IA 1P1MA 4OV9A 3CIVA 1S5MA 2PWEA 3TC3A 2RHGA 3BCJA 2WJDA 1A5SA 3CPRA 5E6ZA 3VILA 4UTMA 1PO9A 4R85A 4AD1A 5EMJA 1H49A 5CPMA 2GJNA 3F4CA 4BWLC 1EA0A 1KQYA 3GNOA 1H61A 2GVJA 1C91A 2YCKX 4GI9A 1UZ1A 3ABXA 3FSTA 3WDPP 3ZVIA 1FWEC 1ZUAX 4UBPC 4MPKA 3QSTA 2F6UA 3K8LA 2QMJA 3PZQA 3CL7A 2PGFA 4LUYA 5LIYX 3VA8A 4B5VA 3WNNA 4A21A 4DYKA 3G24A 3RX3A 2ZOXA 1HKMA 1ECQA 1OFBA 1UUQA 5JVLA 1O12A 1R87A 3MZ2A 2C8NA 3CB8A 3USBA 4IP5A 4CD7A 5FSDC 3FN9A 2VRKA 4CNPA 3IJ7A 3VCNA 3IK2A 1UBSA 3RAOA 1NU5A 1BSIA 2B7OA 2CITA 2XFWA 4GQQA 4GBUA 4JFVA 5BMWA 1QAPA 3FYPA 4UTTA 2XWEA 3O15A 1V7AA 1A5UA 3M44A 3W2NA 4LUTA 3LBCA 3CZKA 4JTRA 1L8PA 2XINA 4O52A 3DGBA 4UQCA 4IX0A 1P7TA 3BURA 4IUGA 2KX9A 1EJSC 3CEUA 1HKKA 3HV9A 2WBGA 2EBNA 4BZYA 1QHZA 2CHRA 4C1LA 1GQKA 4UXDA 3ORWA 3ANYA 1QMLA 4JL1A 1NP0A 1TE1A 3VOGA 4OECA 1PIIA 3WMLA 4JL2A 1OQFA 4TIMA 4AWTA 4PCSA 3INPA 1FX6A 3TJIA 3BG9A 2HVNA 5LGXA 2G3FA 1MQPA 3QFEA 2EG6A 2PS2A 1W1IE 2PCQA 4KCVA 2XVNA 1F07A 3NQGA 4GY1A 1UPMB 4X60A 1SGJA 4WRHA 4JGDA 4W8BA 4HNNA 1AH4A 1DOSA 3G6LA 1VBHA 1F05A 1JUEA 3B9NA 3SCWA 1AA1B 1YMYA 3N11A 2PTWA 4R27A 1BTMA 1TMQA 1ZAJA 3N25A 3AS3A 1PJ9A 3DX5A 2VEFA 2HTMA 1OSEA 4FXRA 2FFCA 4WF7A 1GYLA 3AJ7A 4EX4A 4WY0A 3SDOA 4W88A 1R3TA 1ZAIA 5EL1A 1R3QA 1R2SA 3MCNA 4UMCA 3ANUA 3O0FA 5A8OA 3ARWA 1E0WA 4D6FA 1W1PA 3EBVA 2V2CA 1HUVA 1RBAA 4YVXA 4RW5A 3BLEA 2FH8A 4QG8A 3T1GA 3BAXA 2P3ZA 2B0MA 4WKHA 4HU4A 1H7WA 4QR6A 4GKLA 3NYDA 1KM5A 5FJPA 4MM1A 3T0TA 1RJPA 2GQ9A 5AN7A 4ZO8A 2D2OA 4MNKA 4B5SA 3BAWA 4KFNA 4LUSB 3CUIA 3GG0A 1CX9A 3EA3A 3I7SA 2E6AA 2OOFA 3W7GA 4LVBA 4TMCA 1BVNP 3SI9A 1E4LA 2G3MA 2VFIA 4ZO6A 3VNMA 4M6PA 1B4EA 3LI0A 3GIPA 4AFYA 2CBIA 3IGUA 3GDLA 2QDHA 3GAYA 3VD7A 1EHNA 2V5BA 1V0NA 2W4XA 1XRFA 3DH7A 3HGRA 1UASA 3N6QA 2QCLA 1DQUA 1OD8A 3NTYA 4YNGA 1TPH1 5I3HA 3WD0A 3E1F1 3GUGA 4G1NA 2QV4A 2X8RA 3B0YA 3UU0A 2QDEA 1PZ1A 5ECUA 4H6EA 4S38A 1U83A 1A5BA 3W6MA 4CUCA 3GG1A 1Z41A 1TX0A 1XYFA 4I8DA 1GKQA 1PX8A 1EUAA 3W2KA 1W32A 1TTIA 4FEZA 4JX4A 3TXVA 1DJHA 3PUOA 2XIIA 5BRPA 5CZJA 2PDHA 3P67A 3IV3A 3NQ8A 3RO8A 2FMOA 1HX0A 2G4FA 4FP1A 1SJBA 1F3TA 2F9RA 3KL0A 4AC7C 2OMAA 4PMUA 4PMNA 4Z1CA 3RRXA 1KLZA 4E4PA 1MW1A 1PX4A 4Y2WA 3W81A 1TZZA 1U5VA 4FOJA 1MEWA 3GNXA 3K1GA 1XQLA 3OLDA 2ZFAA 4CCCA 4XAYA 4NU7A 2QPSA 1L6GA 4R7JA 3SB0A 1JPIA 1YADA 1MNZA 4N4PA 3W1AA 3VM5A 4FXSA 2PF0A 4JTSA 3RG6A 2ZXAA 4CNNA 1R86A 1X1OA 3P6LA 4RL3A 2CIPA 1TV5A 3MT1A 4OT7A 1PIGA 2DT2A 2YW4A 1RH9A 1E70M 4BI7A 3SCQA 4CGTA 3VX0A 3GH4A 4KIEA 4DB7A 4PMDA 1F6KA 5A6AA 2GUUA 3RM9A 2YZRA 3UY8A 3PHAA 3HFYA 3VD3A 4L9YA 2GDUA 4AIBA 4J9JA 1E72M 4UUIA 4JY8A 4K1WA 1NWSA 2HS6A 3NQ2A 2F38A 3EYPA 4XKYB 3A5FA 3EWCA 1QPKA 3PJUA 4WCJA 2WJFA 3GDRA 1DIEA 3LXBA 4PL1A 2J62A 3ELFA 1HO1A 1CCWB 2XJ7A 5HWJA 3RILA 1RLCL 1WKFA 3PZNA 4MDOA 4AXKA 3ANVA 3IK4A 5HA7A 3RU6A 3UWQA 1F6YA 3AMGA 4XAFA 2J79A 3HOJA 1HP4A 2QEZA 2UY3A 4AH7A 4PMRA 4DNHA 2HDJA 4UNIA 4H7CA 4M1RA 3AIVA 4YVVA 2ASHA 4CQBA 9RUBA 1Q5MA 2RUSA 5KITA 3KOXA 4H7ZA 2CLHA 1H09A 2XN0A 7TAAA 3K46A 4ZQNA 1JYXA 2NSXA 3HPZA 4C65A 3GY1A 3E02A 2W62A 3TW7A 2YCIX 7XIMA 3MVIA 2XZ7A 3H7UA 3VUPA 1S2CA 4GC4A 4C5YA 1FH9A 4FXJA 4DAIA 4V28A 3P81A 3EDEA 1LUCA 4H04A 1HTIA 3NQDA 1F6PA 3ABSA 4HIBA 1S5WA 4IJCA 5DBTA 3W1UA 5H1WA 3VMPA 3QC3A 4MZYA 5HINA 2F84A 4LVDA 1K8XA 2FTPA 2WMGA 1A4MA 4DWSD 1M7JA 1W3HA 3CAKA 2FPTA 1A3WA 3GVGA 4KRUA 4O54A 2OT1A 3VNYA 2V8ZA 2QLYA 1RD6A 1SJAA 2QJGA 4ZCWA 1HP5A 3K4DA 5HQLA 1J0YA 1EOKA 4IIDA 3WY1A 2CHNA 1IIHA 3F2DA 3GE7A 1H62A 3VGDA 5G1MA 4IOTA 1KM0A 4JCMA 3F7JA 3KRZA 4CQ9A 3K4AA 4HZ6A 1DWIM 1ZLPA 2QAPA 5C2XA 4B5UA 1E6PA 4MPQA 2AQVA 1WXZA 1TZ7A 1XYMA 3S5ZA 2VFHA 2ZZ7A 3EAUA 3L4XA 5A8PA 1U5JA 2WSRA 4M7SA 3AHYA 3LHYA 2CFFA 3R5EA 1E6NA 4A2RA 5HJLA 3GH7A 3EDJA 3WK3A 1ZFJA 4V27A 3Q94A 5M2FX 3T0BA 2AKMA 3UPBA 3R79A 2V30A 3BAJA 3TKFA 2C1IA 2OZTA 1A5NC 3PPFA 4MWAC 3VGEA 1LG1A 4ML4A 4L65A 2J74A 3CMJA 4PR4A 3EMCA 4C6KA 3L7RA 4P7QA 4PRRA 2WB5A 2PGEA 4UQAA 3TTYA 3W7IA