1KGWA

Three dimensional structure analysis of the r337q variant of human pancreatic alpha-mylase
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTQVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Probing the role of the chloride ion in the mechanism of human pancreatic alpha-amylase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords ALPHA-AMYLASE, PANCREATIC
total genus 167
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2001-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1kgwA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1kgwA01
3VSTA 3A4AA 2ZX6A 1JF6A 4V27A 1BG4A 1BYDA 3EDKA 3W6MA 2UY3A 1Q6CA 4FF5A 4UZSA 1WZAA 3WEZA 1W2PA 2X0HA 4PSRA 1OGBA 1P6WA 2XN0A 1MQQA 3OG2A 3EMZA 4H04A 1OCQA 2V38A 1KGUA 1SZNA 1IZKA 1EQCA 1EHAA 1TG7A 1UASA 2WNWA 1UR2A 5M3WA 3VD9A 4H41A 3CIVA 1XSIA 4UOQA 3ZJKA 3HMCA 5GQBA 2D0GA 3WH7A 3F5LA 1E3ZA 1OD0A 3ARQA 1DWAM 4JFUA 2DSWA 4M56A 2FHFA 3BVUA 4UZUA 3PZIA 1CENA 4MTVA 4MAZA 1XYFA 2D0HA 3CTTA 1H0IA 4M24A 1KFWA 1VEMA 2DEPA 1NM9A 3DX0A 2WKLA 3UR8A 5I0DA 3ZT7A 3NDYA 3GTNA 1NOWA 4FLOA 2A3HA 1GOKA 2VX5A 3CGTA 1R47A 3VSVA 5DF0A 3WD2A 2BHUA 2E8ZA 1K9EA 3MUY1 1HKMA 1JIBA 3IAQA 3SUVA 1WDPA 1EGZA 2EBNA 1UA3A 3VD7A 3DC0A 2XSAA 3AYSA 5GNZA 4JZ5A 3BAXA 3WQ5A 1R33A 1B30A 2XM2A 3VDBA 4W88A 2DSZA 4TTUA 4CN4A 5KZ6A 1L8NA 5HNNA 3GYCA 3PTKA 3VGHA 3A21A 1DEDA 3LPPA 5I77A 1E5JA 3VIHA 2YA1A 1GNXA 4JFTA 4P8XA 3DX2A 4JKKA 3MS8A 1WNOA 1YHTA 3RM8A 1K9TA 5I79A 3WN6A 2V3FA 4B3KA 1B3VA 1XCXA 4MDPA 2O92A 4AZCB 2JALA 3A5VA 1ISXA 2Y24A 2F2HA 4FK9A 4WSKA 4AIOA 1GPFA 3L4TA 2OSXA 3W0KA 3T0BA 1C7SA 4QCEA 5DT7A 4KMQA 1UH4A 3BVWA 4CU6A 3BVXA 1V08A 2WZHA 4GIAA 4MJ4A 1UQYA 3WUEA 2VR4A 3AMGA 1I1WA 3SCVA 1ISVA 3MSDA 4ZENA 1PAMA 3N9KA 3W38A 4CD4A 3WDJA 1RD6A 3WD1A 1JZ8A 3AMDA 4GI9A 3HJEA 3NYDA 2WB5A 2VZSA 1J10A 4GKLA 4U3AA 1J18A 1CXEA 3EMQA 2WKGA 2W62A 3LMYA 2VL4A 3SCWA 1FP9A 4PMNA 1KQZA 1D2KA 2XG9A 3AIUA 5IFTA 4U33A 2EPLX 1R46A 1OGSA 1QX1A 5E0CA 1W1PA 4PMQA 1ITCA 5I2UA 4DO6A 1HN1A 1G5AA 3VIIA 2EQDA 5LA2A 5A8OA 3CZSA 1HJWA 4PUDA 4GQRA 4NZCA 3G6MA 4BS0A 5EMYA 3TTSA 4PTVA 1Z32X 2CYGA 4R5EA 4A3HA 5CGMA 5KEZA 4FNTA 5E1QA 4OGZA 1M01A 1W9DM 1MW2A 2G3NA 4U31A 2YL9A 3S2CA 1E6ZA 1H1NA 5ABHA 1H11A 1R7OA 3QOKA 1BGGA 1NQ6A 4A4AA 2X2JA 3VIPA 4PTWA 8A3HA 4CKQA 2D1ZA 3ARVA 3H53A 2VI0A 4W84A 4XV0A 1E73M 2FHBA 1UG6A 3WDPP 1CTNA 1C93A 1BGAA 1W9XA 2VOTA 5HPCA 3WNLA 4DWSC 3N11A 1XD1A 3VD4A 2J7CA 1VFOA 4AIEA 3GNRA 5DMYA 1JDDA 1HXKA 3DDGA 5A8NA 3IJ8A 1E0WA 2WSPA 1XC6A 2VMFA 1QNOA 1OWQA 4DWSD 3M6DA 4U5KA 2Z1SA 2W66A 3PTMA 4TUFA 3ECQA 3FN9A 5ABFB 1B90A 2GDVA 2EACA 1GQJA 1E4NA 1E70M 1HJXA 2WLYA 5JIWA 1GUVA 3A4WA 2ZUSA 1J11A 1WDRA 3WY3A 3CZKA 2F7RA 3BVVA 1JFHA 1NWTA 2RGLA 8CGTA 3VIMA 1D7FA 1TQWA 2DSUA 5AC5A 1E0XA 4B15A 4AD2A 2VNCA 2E40A 1BYBA 3D4ZA 2HISA 3GXMA 3HG5A 1DHKA 2CKSA 4YHEA 2GDUA 4BQ5A 5JIPA 2C7FA 3BUBA 1BPLB 2VRKA 1WZKA 2PWGA 4W8AA 1PEZA 3VM7A 3RMEA 1GQIA 3WFLA 1QWUA 1TUXA 1GOOA 1H09A 3OB8A 4M1RA 5JUVA 4PMZA 5LA1A 3MMDA 4GPNA 2G4FA 4H8UA 3VD5A 3VM5A 2ZOXA 2FE0A 3MI6A 2QMJA 1MWOA 2OWXA 1X6NA 3VDAA 2XIIA 3IJ9A 4PEEA 1HJQA 4MB5A 4DM2A 1E1EA 3KE0A 3ZO9A 1K9FA 3E1F1 1LL4A 1RP8A 1QW8A 4IISA 1PZ3A 3PHAA 4W86A 4LX4A 2D3LA 3PZ9A 2DDXA 3IANA 1JF5A 1GJWA 2WVVA 3WFZA 2FDMA 1LWJA 2VX4A 5ECUA 1EH9A 1E0VA 2UWFA 4HZ7A 3L2MA 3ZT5A 1WDSA 5A2AA 5D9NA 1XH0A 2X0YA 3A4XA 3O9NA 4W5UA 5A6JA 3ZMRA 1AVAA 1KXHA 1GOIA 2VJXA 3CHEA 2BVTA 2XM1A 1TA3B 1W1YA 4PMDA 1CNVA 3SURA 3MUZ1 4QLJA 3WMBA 1R7AA 3L4VA 1JZ7A 1BFNA 1V0NA 1UQZA 1WP6A 1B1YA 2YLLA 4J3TA 2ZWYA 4NZJA 3D4YA 2WVSA 1W3JA 3AZSA 4EKJA 1OD8A 1J9YA 1ODUA 1QBBA 2ZWZA 4CVUA 1CGTA 3DHUA 3KLLA 4P8VA 3RJYA 1JAEA 1QW9A 3GXDA 3MMUA 2CKRA 1KGXA 5A2CA 3ALGA 3GBDA 2IUZA 4FMVA 4CGTA 1LL7A 1OIFA 2JEQA 3WQ4A 3OGRA 1M7XA 3FAXA 4E8CA 2ZUMA 5A3HA 2F61A 4D6JA 4AC1X 3VO0A 4JHZA 4J3WA 1ZBKA 1QOXA 2G3IA 2AMGA 5A6MA 2E9BA 2GK1B 2XVPA 4AEFA 2XUCA 2WMKA 4PMOA 4OOUA 2OWCA 1C8QA 4GI6A 3AIWA 2FH8A 1GHSA 1ISYA 1UKOA 4X0VA 3AS0A 1XGZA 1VRXA 1UKSA 1EXPA 3I3DA 2CXGA 1HVXA 1QPKA 1LG2A 1V6XA 4N42A 3THCA 3VGBA 2J7HA 3DX3A 5AYBA 2J7GA 2PBOA 2CETA 1JXKA 3OA5A 1FA2A 4V28A 4AW7A 3EDDA 4W85A 3GXFA 5ABFA 3ARPA 2F1BA 4BQ2A 4J3UA 3BAYA 1GQKA 2VZUA 3K4DA 1KCLA 4F9DA 1C90A 1M04A 3UERA 3QHNA 2YIHA 3LPOA 3CBWA 3EJUA 2YDSA 3NCOA 1PPIA 3WBAA 3GH7A 5AY7A 4OUEA 2GFTA 1EO7A 1F4HA 3GBEA 1CZ1A 4HA4A 4HZ6A 1BSIA 1TVNA 1JZ5A 1MVYA 1E6RA 3TTOA 1FOBA 5E09A 3A3HA 2V3GA 3W6LA 4UQCA 2TAAA 3CUGA 4F9JA 3L4UA 1WE5A 3WY4A 5FD0A 1EOMA 1HP4A 4TTGA 2PI6A 1E43A 2OYKA 4TVCA 1VEOA 1KQYA 1JGIA 1HJVA 4ML4A 3RM9A 2G8ZA 4ACYA 1PX4A 3CZJA 3CLWA 1XHGA 4AD5A 1QI4A 1V3KA 4W7VA 4Q7NA 3CZNA 1LQ0A 1CIUA 3EDFA 4MPKA 1CBGA 3VVGA 2DSKA 3AHYA 3SUUA 3CMGA 5D4YA 4F8XA 4K68A 1NWRA 3LXCA 1UR9A 1UR1A 3HG4A 2VVNA 3T09A 1TQTA 1XH2A 3AS2A 3W25A 4D6GA 5CSUA 1W3KA 3WNKA 5D9OA 3AXHA 1HX0A 5A8MA 4XZBA 1V6WA 2EADA 2GSJA 3BXWA 1NARA 2EPNA 5A6AA 1VIWA 3WF4A 2DH3A 2J47A 5A6KA 1OT1A 4UQBA 1ZB5A 3T0AA 4DUXA 3CV5A 3GXNA 4P7RA 2YL5A 1GCYA 1EDTA 3N15A 1JI1A 3IAPA 2VRJA 1JYNA 1BF2A 1Q6FA 4GI8A 1C8YA 2WMFA 1LJYA 4WIWA 1Q6DA 2D20A 2OW6A 2VQTA 4DUWA 3LRLA 1UR0A 2EPOA 1V0LA 4CD6A 2RGMA 3TA9A 5C8BB 4PYSA 1E6NA 5A6BD 3OLDA 4OJYA 4D72A 4AISA 1XYZA 3EDJA 1PX8A 2CNCA 2ZXAA 1FHLA 1VJSA 3WEMA 3ARYA 1PIGA 5HBFA 2O9OA 3IGUA 1BHGA 3F4VA 2EO7A 3S5ZA 2WZEA 2XGIA 3II1A 2W4XA 3ZM8A 4PSPA 5GNXA 4HZ8A 4ZXLA 1R85A 1CXLA 1H4PA 4J27A 3J7HA 1FH8A 3EDEA 1US3A 4P8UA 3NSNA 3POHA 3PTQA 3SCRA 3BGAA 2VURA 4QFUA 4D1JA 5I6SA 2ZE0A 1HT6A 4JL1A 1UWQA 1CGVA 5CGTA 4NF7A 4E8DA 1GJUA 1J01A 4CD5A 3PN8A 1UH3A 2AAAA 1T0OA 2VCAA 1UKTA 3BMVA 2BV9A 4HMDA 1GOWA 3VGEA 4MNKA 2YL6A 4KRUA 1Y7VA 2X2YA 5BXSA 1JYXA 4P7OA 1E56A 2W91A 4OKDA 2XPKA 2VO5A 4CU7A 2J4GA 1CXIA 1EO5A 1OT2A 2DT2A 2J79A 1V02E 4J3VA 2PWFA 3WD4A 3KWXA 2CBVA 4BCEA 2CEQA 1A47A 2WPGA 1EHNA 3CO4A 1VFFA 4BF7A 3ZT6A 2DH2A 4FNRA 2W63A 1ZBVA 3QOMA 3WNMA 4D71A 1HL8A 4J3SA 3T08A 3AROA 3MSGA 2J74A 5BWFA 1OBAA 4B3LA 5I23A 3D5HA 1CECA 5BYWA 3QHOA 4UFIA 1K9DA 3WH6A 4EAMA 3KLKA 3O2LA 4U2ZA 3I3EA 2W92A 1LLOA 3GH5A 3HG3A 1W32A 1V3MA 3EJQA 1M53A 4HU0A 1E3XA 3OGVA 4MB3A 4TVUA 2A3EA 4HMCA 5E6YA 2ZXBA 1L0PA 2WCAA 1XD0A 1V6UA 1JZ2A 2BHYA 1VBRA 2WMIB 2VCBA 4PCTA 1R75A 1JXJA 3QR3A 2BXZA 5IHRA 1V0KA 2EXOA 3UEQA 3MO4A 4FLSA 4NXSA 1B9ZA 4AZHA 1B3WA 6A3HA 4JFSA 5D8ZA 4D6HA 2EAEA 4AYGA 2VQUA 1UD4A 3IJ7A 4GINA 3CUJA 1KWKA 4D6FA 2XFYA 4NZFA 3AFBA 3EMCA 4GQQA 2BFGA 3TTQA 1WPCA 4F79A 3GM8A 2EJ1A 2WCGA 3EJTA 1C7TA 2J7BA 5EFFA 2JE8A 1E15A 4KWUA 2BXYA 4UFHA 5FIPA 4DUVA 1MFUA 1QHOA 2GJXB 4NXKA 3PZGA 1TZ7A 4FLRA 3SCQA 4U5IA 1UD5A 1E4MM 1J12A 4L4PA 3DECA 1VB9A 3SUSA 1XCWA 2WC4A 3WUBA 2G3JA 1ISWA 3FHAA 1B3ZA 2F1AA 3VX0A 2J25A 3KL3A 2F7QA 1OINA 1JD9A 3U5UA 1E9LA 5CLTA 1TVPA 1DTUA 4HP5A 3VPLA 5A8PA 1WB0A 3M7SA 4JCMA 2MANA 2J7FA 6CGTA 2J77A 1UR8A 1FH9A 1WZLA 4C7GA 3FHQA 1R34A 2JIWA 2OLHA 3W28A 5IXEA 2D73A 4B16A 3OLEA 4Z2LA 3RILA 1KBKA 2PWEA 3BAWA 4AY1A 1LG1A 2WC3A 1ISZA 3SUTA 3WD0A 1V03A 4Z2GA 3AMKA 2V3EA 3WELA 1VFMA 3WF2A 1UA7A 1QWNA 4TX8A 2CITA 1MW3A 2CBJA 3WDHA 3BAKA 4WSJA 1JD7A 2XHYA 4H8HA 2WZIA 4PMVA 1CPUA 4FNSA 3T2QA 1MXGA 1K6AA 2ZUVA 3PZVA 1ZS2A 5BXRA 1PJ9A 3RCNA 1W1VA 3WMSA 3N17A 3PZTA 1RP9A 3GDBA 2VCCA 1EDQA 3AYRA 3ARTA 3NJ3A 1ZL1A 2CHNA 2X2IA 1V3JA 3A47A 2GVYA 5I3DA 1J0IA 3AIEA 3EBVA 2D0FA 2X8RA 4JHOA 4CCCA 2DGAA 4Z2HA 3SCSA 5M5DA 3ZJ7A 2CCRA 2F8QA 1B31A 3PZNA 2J75A 3UG4A 1UWSA 1BTCA 3RJXA 3WUGA 2B31A 4CD8A 4FNPA 2YBTA 1WZMA 1IZJA 3D50A 4FLQA 1HNYA 1V0MA 2JEPA 2XVGA 1HL9A 1X6LA 5ABGA 4AD1A 4H2CA 1D3CA 4LYQA 1HJUA 1VAHA 1WDQA 5GNYA 1BYAA 3HG2A 1JI2A 1MW1A 4WKFA 2VUYA 3TTYA 2XN2A 1HKIA 3OZPA 4HOWA 1JG9A 3TP4A 2XVNA 1R86A 1ECEA 1Q6EA 3CHCA 3AHZA 4RE2A 1I1XA 3WH8A 2X09A 2WMIA 5I5RA 3IK2A 5TD4A 4P8WA 1CGYA 4LGXA 3O6AA 2E8YA 2FGZA 1QHZA 2ZUUA 4JL2A 1CLVA 3KEHA 2ZUTA 3W81A 2PB1A 3GNOA 4KRTA 1G1YA 1C8XA 2IXUA 3MUIA 4CD7A 5M17A 3EJPA 1R8LA 4UCFA 3ZOAA 2V5CA 1H5VA 2WBGA 1PIFA 1PBGA 4TOQA 1EA9C 3DYOA 3M07A 3CUIA 1TA3A 4ACZB 2DT0A 2YFOA 2J62A 1NP2A 3EYPA 4MAVA 5CXPA 2PC8A 3CC1A 1Q4NX 2CIPA 3ZSTA 4QLKA 1BQCA 3TV8A 3FAWA 1G01A 1BVZA 1A3HA 3VNZA 4PRWA 1US2A 1V6YA 3WUFA 4AMWA 2XVKA 1BAGA 2ESCA 2ZXDA 1WKYA 2UY4A 4C7DA 1FP8A 2OYLA 2XYLA 2WMJA 4GZEA 4LYRA 4LPCA 2E9MA 1I75A 1YQ2A 1CGXA 4AZBA 3ZSSA 5CZKA 1FFRA 5I78A 2XVLA 4H8VA 5A1AA 7A3HA 1KR0A 5LA0A 4Q22A 3RO8A 1OGGA 2YA0A 3A22A 3LX9A 3VIGA 2PBGA 4MJ2A 3BUDA 3BLPX 5BRQA 3L4WA 1UUQA 3WD3A 3FY1A 3VU2A 3SCTA 5BXTA 4W7WA 2Y5EA 1W9UA 3DX1A 3N13A 2GK1A 1UKPA 3SCNA 3WH9A 1GHRA 5M03A 3VOCA 3CZEA 4IPNB 3SCPA 3OBAA 2WVUA 1KBBA 4HOXA 1RH9A 3T0DA 4MNLA 1E6XM 1E4LA 1AQ0A 3BSGA 4IM4A 4Z2JA 3BMWA 2UY5A 1IT0A 4GZJA 5E0FA 5FL0A 2D23A 4ACZA 2YA2A 2BY0A 4DWSB 3D52A 1CXFA 1CWYA 3MANA 1QI5A 2PWDA 2ZX7A 3U7BA 4AD0A 3AICA 5HOSA 1MXDA 2WAGA 1KCKA 4W93A 3DYPA 4OIFA 4ZE4A 4RE3A 4E2OA 3OIHA 2XGBA 1JZ4A 4GO8A 2YBUA 3WSUA 1VENA 4BQ3A 3AHXA 2JF6A 1E6QM 4AZ6A 3B8SA 2DQXA 1U33A 3GZAA 3ZJ6A 3OZOA 2XWEA 3EJRA 4TXEA 1CXKA 1IV8A 3TONA 4PN2A 1KGWA 1CGWA 4W8BA 5HDRA 2NT1A 3BLKA 1B3YA 3K1DA 3DDFA 1BG9A 4FNUA 3UG5A 4DO5A 5CG0A 4X9YA 1ZU8A 4AZ7A 3GH4A 1FHDA 1LL6A 3WQWA 1UHVA 4UQ9A 2ZUNA 3F5JA 2QF8A 2DT1A 1QBAA 3WY2A 3KZSA 3I3BA 4N0RA 1CGUA 3WDRA 4D6IA 3FNDA 1SMDA 2QMKA 4QAWA 4UFLA 4AMXA 2UY2A 3UESA 1NP0A 2BVDA 3CPUA 3LPGA 2W61A 3WH5A 3VMOA 3CHFA 2ZX9A 3ZR5A 2WHMA 3ZR6A 2XTKA 1V3IA 3VGFA 4CN1A 2A3BA 4A3YA 3G6LA 1SFSA 4MB4A 3K8LA 3HZ3A 5DEZA 5JBDA 2FGLA 4AZGA 2YFNA 1CEOA 5FCZA 3AQUA 1GZJA 1EOKA 4GZIA 3ARSA 4ZE5A 4J7RA 1VF8A 1JDCA 1OM0A 3CZLA 1DWHM 1UOKA 1JFXA 4EK7A 3JUGA 2YDQA 1J0YA 1E55A 4S3JA 5A94A 4NI3A 2V3DA 5D9MA 1W9VA 1W2VA 2YJQA 4EE9A 4W5ZA 3RM4A 4FNQA 4NSBA 4M8UA 2GUYA 3DX4A 2PWHA 4MB1A 2YLAA 1V02A 5JBFA 2G3MA 1OIMA 2YL8A 2WMHA 5A6BA 1GOQA 5I24A 3AS3A 4WJXA 4JCLA 2BHZA 1G94A 2QLYA 1WAWA 4AIUA 2X05A 2VX7A 4P7QA 2IGTA 3MKKA 2BY2A 3NSXA 2WHJA 3NSMA 3A6OA 1V3HA 3AISA 4CUCA 4AYSA 1PZ2A 7TAAA 3K8MA 3ARZA 3B9DA 1JZ3A 2Y8VA 1E1FA 1OB0A 4V2XA 2EABA 3M46A 3MUAA 4D6DA 3AXXA 4OOZA 1DWFM 1FH7A 2XIBA 1G0CA 2O9PA 4UFJA 3W26A 2VZOA 3LPFA 3NIYA 1AMYA 2G41A 2JF7A 4CCDA 3KL5A 1OSEA 2BVYA 4W8LA 5BXPA 3CH9A 3VINA 2WWCA 3WDIA 3RPMA 1DWGM 4OZOA 9CGTA 3BAJA 2JIEA 1ESWA 3AHTA 1JL8A 4CVWA 5A2BA 4ZFMA 1LF1A 5BRPA 1NH6A 3N18A 2J7EA 1GVYA 5DT5A 4CN6A 3CMJA 3PZOA 3GXPA 2O9RA 4HA1A 3NUKA 4MADA 4UQEA 3AMLA 1J0KA 1GQLA 1BYCA 1E72M 5F7UA 4UQDA 4LQ1A 4ATLA 3ARXA 3B9EA 3RDKA 2WWDA 1JDAA 1E4IA 3VX1A 3H55A 3T2OA 1JYWA 1DWJM 4HU8A 3L4YA 2VR5A 4C7FA 1XH1A 5DFAA 1MYRA 1W3LA 3K4AA 2YOCA 2OSYA 3CHDA 4W89A 2WSKA 3VDHA 3BCFA 2CBUA 3APGA 1TQUA 1M03A 3FXYA 3MMWA 4WLCA 2EPKX 3W24A 3K8KA 1ZBCA 5IDIA 4AZIA 4IUGA 5C71A 4D6CA 3LXBA 2PF0A 1WO2A 1QNQA 4ATDA 3PBGA 4AMCA 4XUYA 3VMPA 4PCSA 4JIEA 4Y7EA 1W3HA 3BH4A 1ZJBA 4JKLA 4XX6A 5A6LA 5JBEA 1QNSA 2WVVB 5CPQA 2WBKA 3ZQ9A 3VILA 3BUIA 2ZX8A 1XSKA 1RPKA 5IFPA 1ITXA 2BY1A 2AOSA 2CPUA 1S46A 3D51A 1VJZA 4KGLA 5D9PA 4GXPA 2OSWA 1XRVA 2QPUA 4DM1A 2QPSA 3QHMA 4WKHA 5A8QA 4Z2KA 2WK2A 2O9TA 2OYMA 3WKZA 2OW7A 4MDOA 3VKKA 2CERA 4OBRA 2WW5A 2J8GA 1KTCA 1C91A 5C70A 2Z1KA 2VTFA 1QVBA 3UG3A 3MU7A 2FHCA 3LRMA 4BZYA 1GONA 4AXNA 3MV01 4UFMA 3SCUA 2CBIA 5A69A 4QDMA 3WNNA 3KL0A 4AZCA 3WQ8A 4WK9A 4AZ5A 3UETA 4JKMA 4PMRA 5DO8A 4PMUA 1Q6GA 1H2JA 4LYPA 1QI3A 2GJXA 2YDRA 3VGDA 3W29A 1GW1A 2E9LA 3A23A 4UFKA 1UD3A 1MFVA 3AIVA 1PX3A 4HPHA 1N82A 2WXDM 1ODZA 1R87A 4HTYA 1GOMA 2ZICA 3W82A 2X2HA 3WQ6A 3UCQA 3DYMA 3BSHA 1SR0A 1G9HA 3AOFA 1BLIA 4UOZA 4P7LA 4B9YA 3AXIA 3PZMA 1HIZA 2Y2WA 2BY3A 1LWHA 1E40A 4UQAA 2NSXA 1QI2A 3OGSA 3VTRA 2XWDA 5CSYA 1TMQA 2WYSA 2XN1A 2DIJA 4NRSA 2E0PA 1TFVA 1C92A 4DO4A 2D22A 2DT3A 4QCFA 1JAKA 3T2PA 4IPLA 2VC9A 3TOPA 3WEOA 4PMYA 1TQVA 1BVNP 2W67A 2XJ7A 2J78A 2E4TA 1KR1A 3L4ZA 2CESA 1HXJA 3CUHA 5EFDA 1TQSA 4ATWA 1UWTA 4L4OA 4LXFA 3AIBA 1U2YA 2ZXQA 4UNIA 1KXQA 1CXHA 2ZX5A 3BC9A 1JNEA 1DWIM 1QHPA 4M80A 2XFRA 2BS9A 1UD2A 3ZJ8A 3A24A 2C0HA 3N12A 2NW0A 5CPTA 3BUPA 4HA3A 5FL1A 2VVSA 3VGGA 3S6TA 5CLWA 3WQVA 2ZUWA 3WENA 1DP0A 3AHVA 3CZGA 1E71M 5FOOA 3WL0A 3D3AA 4U2YA 5AYIA 3AS1A 1B2YA 4UTFA 2Q8XA 2WC7A 4F66A 2XSBA 1PS3A 2WHKA 2NT0A 1H49A 4H7VA 1HWWA 2C8NA 1UH2A 4GO9A 3FW6A 1UD8A 4YHGA 1O7DC 1JZ6A 2X1IA 3VIFA 2VX6A 2WLZA 1C3FA 4EANA 4JFVA 4KGJA 2OWWA 1MW0A 1NOFA 3LXAA 5E70A 1W1TA 2A3AA 2HVMA 1CLXA 3VD3A 1NOUA 3UR7A 2D3NA 1U30A 3EJSA 4KH2A 4P7NA 4ZXOA 5EB8A 4TVDA 5ABEA 3WBEA 4MNMA 4HMEA 3S5YA 4J28A 3HN3A 3SUWA 3U7VA 3W27A 1NWUA 1TE1A 3W53A 2DSVA 4J3XA 2IXVA 4S3KA 5EBAA 3N1AA 2D2OA 3AJ7A 4WKAA 2J7DA 4AEEA 4M81A 3WF0A 3AI0A 1ZBWA 1EIBA 4PMXA 1XSJA 2V5DA 3SCOA 1CYGA 2F7PA 3OLIA 1MQPA 1SYTA 4Z2IA 3THDA 3BCDA 5FKYA 5A6SA 1XV8A 4PTMA 3GNPA 4AD4A 3F5KA 1QI0A 1QNRA 2GJPA 3K46A 1X1NA 2VRQA 2JFEX 2W5FA 5HXMA 5CJ5A 3WDQA 3GXTA 3VIKA 3W4RA 2WANA 4YPJA 1UWRA 3BAIA 3AZTA 3WNPA 2WMGA 3SIMA 2DPEA 4CU8A 2QV4A 3U57A 3CZ8A 4XZWA 1CDGA 1MQRA 1EQPA 3AZRA 2EEXA 1B3XA 3AIQA 3DHPA 4URIA 3B9AA 4M82A 2DIEA 2J8FA 2CHOA 1KWGA 3LRKA 3GXIA 2A3CA 3MV11 3PZUA 3WL1A 4CCEA 2Y4SA 1UZ4A 4D1IA 4UR9A 1O6IA 1HJSA 1H41A 3AIRA 2D24A 2FH6A 4W87A 1HKKA 1UWIA 2E3ZA 1UWUA 3PZQA 4AD3A 1ZJAA 2WCSA 3RIKA 3ARWA 3VMNA 2ALWA 1FFQA 1VBUA 1HP5A 3ARRA 5E6ZA 2VZTA 3W37A 3BLBA 1V3LA 1E5NA 1KXVA 3SEPA 4X0NA 1E6SM 4HPGA 3VDCA 3VIOA 4XB3A 1B0IA 2GJRA 4HOZA 1F4AA 1W91A 1HTYA 2QHAA 4RE4A 1TR1A 1W9PA 4PBGA 1UYQA 3VSUA 1E6PA 4MNJA 1KB3A 1AQHA 4JFWA 3ZIZA 4U3CA 4PTXA 4W7UA 3WY1A 4NRRA 3L4XA 4QP0A 2WHLA 3VUPA 1UZ1A 5BROA 4BA0A 2BNJA 1HF6A 1VFUA 4DWSA 3HU7A 1J0JA 4WF7A 3WMCA 2VZVA 1W9BM 3WF1A 3WIJA 5CPSA 5HPOA 1GVIA 1JYVA 1H0GA 4OBSA 2YKKA 7CGTA 1NWSA 4QLLA 4BQ4A 5GPRA 3BUQA 1H3GA 1QNPA 4RL3A 5CQ1A 5E9AA 1HKJA 6TAAA 2EPMX 5IHSA 1WCGA 2F7OA 4PUEA 2VT0A 4AWEA 4ZEPA 3U5YA 1J0ZA 3L2LA 2FYVA 1HVQA 1UR4A 2F18A 3OLGA 3AMCA 3WF3A 3ARUA 1AQMA 5AC4A 1VEPA 1SMAA 3BVTA 5LYRA 3QGVA 4M29A 1J0HA 1O7AA 3VNYA 4E4PA 2ZIDA 2XFFA 2WM0A 3ALFA 4D6EA 3WNOA 5D8WA 3N04A 5BCAA 1KTBA 3VIJA 1JNDA 4NX0A 1UD6A 3H54A 1V6VA 4UOJA 4JAWA 4YN5A 3NDZA 1EDGA 1GORA 4TX6A 2Y8KA 4B9ZA 1KXTA 1UKQA 2WVTA 3CUFA 3POCA 4R27A 1TCMA 5A95A
chains in the Genus database with same CATH superfamily
1FCUA 2FZBA 1XQLA 2XIJA 2IALB 4PUBH 5CPOA 1U2CA 1ZA3B 1MHPL 1BF8A 1BJMA 3PG8A 3GMRA 1KT2B 4JFFD 1VFLA 2OTUB 2HFEA 1JF6A 2NLJA 3HR5B 4QCIA 5C07E 1S7QA 1PE1A 5I1HH 4ODHL 1VHNA 4V27A 3A4JA 5MHBA 1XLKA 5E6UB 1G9MH 1IWBA 2Q8BH 1XLHA 3ENLA 1X38A 4ZOCA 4PUNA 1T0MA 4AW4A 2GZXA 4OQ1A 3CLEL 1HCFX 4ISVA 4PJ9C 2X7LA 3C2RA 4BUHA 2B0MA 2DM3A 2EIEA 3DTUB 1LBMA 1NC2B 1E67A 4GKZB 4H1ZA 1U5JA 5HI3D 5FPIA 15C8L 2D2GA 2X0HA 1CLZH 4IGSA 4WOQA 1PFCA 5I16A 5H35A 2E6AA 2QHRH 3L9EA 5HYJA 1XCTA 4JHAH 3ZQXA 1P6WA 1MQQA 3OG2A 4J4PD 4PJCB 4C4KO 3UPBA 3OGCB 1X9LA 3CU1A 2OMZA 2O61A 3T8LA 2VL5B 2ZYIA 4HC1L 3SDAB 4DBEA 2VSCA 2DZEA 1XW8A 5L2KA 3TLQA 1QVOA 1BCIA 2Z92B 3TFBA 1EHAA 2X5PA 1KBPA 3M0HA 4NFDA 4B5WA 3SBQA 2Q6WB 2ACRA 3GHPA 3M45A 4E41E 4LHUB 4J8RB 4H41A 2I9LA 1GGBH 1XSIA 3B34A 2V2XB 2ZXEB 5I5MA 2DQTH 5GQBA 2APWA 2VYOA 3NQIA 3LNMA 1JPSL 4PV9B 4XPTH 1E3ZA 2B3RA 2R9HC 3QUZB 4Z7WA 2Y7FA 1OAYL 3ARQA 3FSUA 5XINA 3H2WA 4RGNC 1GIGH 2DSWA 2EXWD 1ZCRA 4DYJA 4M56A 3N50A 3MA9L 3BVUA 4PCYA 5E8DL 3X13B 3ITVA 4GISA 1ZVHA 2REQB 4GRSA 3EO9L 4KKLD 4NC1C 2Y62A 4RMBA 4POUB 3U36A 2APTA 1EYEA 1VEMA 1PY9A 2FUTA 1ZXKA 5ABAA 2FWOB 1B3OA 1EJTC 3I6LD 3GTNA 3LTVA 4GT7A 1YDVA 1RUPL 1N6QL 1YKWA 3FO9A 4YHKH 1NOWA 4FLOA 1RK6A 3KBSA 4GVFA 1JHKL 35C8L 4KTYA 5I03A 1EJSC 3CGTA 3I74A 5DMIH 3VSVA 2X70A 1RIHH 1L7TH 3DTDA 3MBDA 3QWQB 1FAIL 2BHUA 2GEQA 3R6IA 3F2BA 3CX2A 3S35H 1EO8L 3WE6A 3O3RA 4MMZA 3FDWA 1QFPA 2CO2A 5ETUB 4IIEA 4WVXA 3RZCD 4W4OC 1WBYB 4APXB 4IKLA 3PFMA 1JPST 1RV8A 4TO8A 1ZLEA 2QYGA 5KVFH 1CZ8L 4GQ9L 1UA3A 1CG9B 3RVUD 1WLHA 3BFWA 3VD7A 2H2PC 3DC0A 3T81A 3AYSA 5GGSB 3G24A 4JMXA 4EIUA 2R59A 3IJSB 3U4AA 3WMPA 1A0QL 3O9WA 1RJQA 2XM2A 4HIBA 3HA1A 1QTYT 1FNSH 4F8QA 3BGJA 3S8HA 2HFEB 5IQMA 3R1ZA 5BPPA 3C2EA 4Z77A 4Z7QE 4LWWA 2X0UA 3VI2A 3OIXA 1D5MA 3NCWA 1DEDA 1RZFH 1S9WA 1F9CA 3GUGA 3L68A 4KEUA 4R27A 3LPPA 4K4KA 3DLQR 4TLUA 3N2JA 1INQB 1QTSA 1SXCA 1GMIA 1HHJA 3KW7A 4R97C 1E5JA 1YNYA 4PL2A 3Q1SL 4M03A 3NPZB 1M6OB 3S96A 1TPB1 4Z7NB 5CSZB 1UYWH 3BWUF 4QRUB 3FRPA 3QO1A 4Q0XH 1GNXA 3EXSA 3LU2A 3MS8A 4C60A 1WNOA 3BZJA 3DBSA 4RQQA 3QNZB 3FJNA 1JNHB 3KYMA 3A6BL 4LOFA 2F54B 3DXAB 2FLRT 5E2JA 1G5GA 4G9DA 1Z3GH 4O17A 2DWEB 3LB6C 4B3KA 1B3VA 4FQQB 3WHXA 4FCAA 1XCXA 4AZCB 3GSXA 4WW2A 1KIPA 1HGWA 2EDMA 3T2LA 2D2JA 2JALA 4XHQA 5C9UA 3A5VA 4IPIA 4PUMA 2Y24A 3ARFA 4X6DF 3EEZA 2F2HA 4ZS6C 1JGLH 1F1DA 4WSKA 1GPFA 2OSXA 3WKPA 4M61A 3RDTB 3T0BA 1PTDA 5AAMA 4XO8A 2K7PA 2NXIA 2C18A 4L8CA 4QCEA 3CX5J 2R4SL 5DJCB 2X4RA 1PDKB 1FL6A 1BJ8A 4CU6A 4K7PL 1VLWA 1SFDA 3LSCA 4GMTH 2HMID 1X5MA 1A7OH 3EO0B 2KLSA 2ZSWB 4HIEA 5LHDA 1UQYA 4M8QB 1Y5VA 2YCEA 5EPDA 3ESOA 4DTGL 3TFXA 4LKXB 4X99B 4XP9H 2XETA 2D03H 3GS0A 2CAKA 1L5GB 3TAOA 2IGLA 3I9PA 1EJOH 1PKLA 2ILLA 1PAMA 4XVJH 1QQDA 1YMMB 4JRWA 1U8IB 4EI0A 1YPIA 3N9KA 1BGXL 5CZXC 3CV1A 1JUFB 2JCCB 5J9PB 1JZJA 2PODA 3STEA 3UJSA 7REQA 1RIVH 3KDPB 1RPXA 2NUPA 5C7HA 5J3HC 2VDML 3BJ91 3ZJAA 5IV2A 1DQJA 4OCRH 5DHMC 1J18A 1XYCA 2ZDSA 3FYOA 4IF2A 4EUPG 2J24A 4DGVH 2A6IB 1AXTH 2VL4A 3IDGA 4PRPB 2EAWA 1OPGH 1HKLH 1DL7L 1DBTA 1M65A 3T0VA 4G8GB 3N9GH 4V1DA 4X5QA 3V4VA 3GMMB 4F1ZA 1R38A 2AQ1A 2UYLA 2VWEE 2F1EA 4JN8A 1KCSH 4NUJB 2B16A 3K2KA 1W1PA 3TROA 3B9KB 3CPLA 1R3KA 4NQEA 3US9A 1G6RA 3AC0A 4PLJD 3AUWB 1G5AA 4WI0A 4DKFL 5MEPA 1KJ3L 3AU6A 3WCYA 1XBXA 4NIYE 4JICA 4M6NH 1XGRB 4NRZB 4WKZA 1DJZA 2AXGB 1ED3B 5FYJD 4G83A 1TRIA 4XBKA 5FO8A 4TUJA 4NNYB 4IBYA 4R4FH 3VXSE 4R7DA 1E9ZB 1XYAA 2XWBA 4MXQC 4NZCA 3QMRA 2QL1A 4BS0A 4W9HC 4MLJA 4JE4B 5EMYA 3TTSA 1Z32X 4B50A 5GRJL 4X98A 4U7MA 2POTA 4U1GB 4FI4A 4JS7A 5KEZA 3DHFA 1M6OA 5XIAA 4JBSA 1TKWB 3PUCA 5EY5A 2A6JA 2CKBH 4FNTA 1IAKA 5JXAH 3GB7A 1LE5A 1LYXA 3UWWA 1M01A 3TVAA 3TJHC 3BUYB 4HGKC 5JW4N 3R8HA 3BP6A 4ZTOH 4LCCC 4LK4A 1E6ZA 1H1NA 3KYOA 4C56E 2P0IA 1R7OA 5IBTH 2DVUA 4Q4KA 4KHTH 1BD2D 4MD5A 1B0RB 1BGGA 1ELSA 4RGOH 1NQ6A 2D69A 4A4AA 5FESA 3NFNA 5FW8A 2JGYA 3UPRA 3TIEA 1J2BA 4BRJA 2EH7L 1LMIA 4Z7VB 4R5TA 3VD2A 2KQMA 3BZDA 4GVHA 2V5SA 4KZEL 4XAYA 8A3HA 4QHUB 1O9VA 3KBJA 3H53A 4W84A 1P43A 4XV0A 1D5XB 3M4HA 4X22A 4IGNA 4TLKA 4EI6A 1M7DB 2E3VA 2ZWKA 4YSQA 3WDPP 2VDRH 1NANI 4P2QB 1BGAA 3NQCA 3CUPB 4JIIX 1YPZB 2IMMA 4G6KH 4UTWC 5HPCA 4HN4A 1SDDA 3GJFB 2RDTA 1P7KB 4B4HA 4CCZA 4AIEA 2DWXA 4QT5A 3WJSA 4L9YA 4E5XA 4XH2B 4Y1SA 3DDGA 3CIAA 5IK3A 3VFRB 4JK0D 1ZLDA 5A8NA 1J8HB 5E94A 1PCSA 4KO5A 3FA5A 2NUTA 1B2WL 2VMFA 4HJ0D 5DHDA 5AW7B 3O2DA 4HIJB 2REQA 1OAUL 3ZKMD 4OF0A 3WTYA 5FEPA 4EKXA 3GPSA 1AZCA 1CL7L 2JF1A 4NKIH 4CNUA 3GIYA 2G9HB 2R15A 3HLKA 5L2KE 3PJUA 4H83A 3NPSB 3QUGA 3TF7C 4M4RA 1MRCH 1DQQB 5E2WL 2YPLB 3L9YA 2XZZA 1R0AL 3MUXA 1HJXA 1Y1UA 2WLYA 3FXGA 1GUVA 2FVKA 1AXIB 3T2NH 1TVHA 2UZPA 2QUUA 3N25A 4ONVA 1HCZA 3COTA 2NY0C 3RAOA 2YRZA 2OP4L 1KZQA 1INEH 2CZFA 1WDRA 3FTGB 4M4PA 3ZIMA 4O51B 3C5SB 4H20H 4MZ3A 5EZPA 1RERA 5CJQH 4RWHA 4UV4L 3VFGH 4F5CE 2Q7NA 4NQSB 1GKRA 1G7LB 4CNTA 1OCJA 3CQQA 2YBGA 2BSSA 2UY7A 3D08A 1KN2H 3IDXL 4JTGA 3SY0B 1HHGB 3X12B 3GW3A 3EAKA 3FU7B 3ZUCA 1T5XB 4GEJA 1IGIH 8CGTA 1F45A 3VIMA 1D7FA 5AVNA 4MJ5A 4HLZH 4XRCB 2XZ9A 2A4ZA 3DO7A 1SNRA 4X98B 3K4ZA 2YN3A 1E0XA 5AC5A 2CLHA 4AD2A 4Z1CA 5HVWA 3L4CA 1B0GA 1GK8A 2CKSA 1DHKA 2QULA 2JB6A 5AVVB 2GDUA 5DBTA 2A9AA 2OG9A 2PTTA 4ZFZB 1TO4A 1BPLB 4E36A 2VGLM 5I1KL 2QGHA 3DKJA 4UTLA 5C9XA 1A25A 4TQEL 2BLEA 2A9NL 3FYIB 2E7HA 4LP4A 4MWAE 4AF0B 4DERA 2KT6A 1XFPA 4HHAB 4HJGB 1X4XA 2C9UA 5DU7A 1GQIA 4JR5A 4N9GB 1GOOA 1ICTA 3QS2A 5DT1H 1TZOA 4ZB2A 4BFNA 3QCTL 4IFKB 5JUVA 2R0WH 1BW8A 3VI3F 3JS3A 5IBXC 3MGOA 3LY6A 4N2NA 1FSKB 4WU7B 3HAEA 1XUUA 1C5BH 3EBAA 3W9DB 3L1EA 5F1NB 2G4FA 3EYSH 1KMGA 4B4FA 2CUHA 2VLLA 4H8UA 1BBJB 4TS6A 2HKFH 3CMFA 5E0KA 1YYML 2B39A 3GNML 1MN4A 3MI6A 2P8LB 2BP1A 4WGWB 1EWDA 2OWXA 1FRGH 3CK0L 2N4IA 5FHBL 1X6NA 4R53A 4XAKE 5IJCC 1BEUA 4MAUH 1IC1A 3SDYH 3VDAA 2XIIA 3KXFD 1QP1A 4MB5A 4AUUA 1UC6A 2VIRB 3UROR 4RBPH 3VWKA 5HYQA 3EG9B 1KF9B 5DVLA 1AHKA 1FXPA 2PZNA 1F4YL 3E1F1 1OP5H 2JIXD 5EBLB 5CD5C 1PZ3A 4I8YA 3OZ9L 4G7YH 2K45A 4LVNC 3PZ9A 4POCA 4JFEB 4NNXA 2B4CH 3IANA 2EDBA 4ZFOA 1LQAA 4JTFA 2VDNH 2WVVA 4DLFA 3WFZA 3CASA 3TH6A 5DRNA 1G7MA 3LAFA 2TSAA 3CXDH 1EH9A 3BAEH 1I8LA 3MRLA 2VDQL 3UZQB 1QOQA 2I07A 3TBTA 1ADQA 4KXCA 4UTJA 2ASHA 1A1MB 4IGBD 3IRSA 4LF2A 1E8WA 5GRYA 5A2AA 3UTTD 4M3HA 5CLYA 5D9NA 2X0YA 3ARBB 4G8GA 2IOMA 4V1DB 4DPQA 4HIQA 3GMMA 2X4RB 2ZPKL 2PGFA 2I26N 3L9RB 3NM1A 5FM5M 5LGXA 3SCMD 2L5HA 4ZZ9A 1QASA 5C1MB 1M68A 2CZDA 1AVAA 1KXHA 1S78D 2HWZL 3MLYL 3W11D 3RR1A 1M9WA 1J93A 1U3JA 3BK0A 1FZJB 4U4IA 1DVXA 5HAOA 3TLLA 2Y7SA 5F6IB 3KDOA 3TN5A 3UNDA 1TA3B 2JCCA 5J9PA 2CGZA 1GYVA 2PXYC 2X1PA 2VM3A 2XHNA 5ERWB 5D9SB 4ZA0A 4RK8A 3SURA 8XIMA 3DFOA 5SWZA 4EDXA 3WMBA 3FUKA 1R7AA 3F4CA 5K9JH 4OBTA 4JG0H 4RW3A 5DRWB 4CW1A 2HLAB 3WQCA 5IQNA 1UQZA 1HKLL 4E9TA 1XGYL 1Z48A 1FUNA 3FU6A 2L4OA 1JULA 2WXGA 4HC1H 3NMEA 1BEXA 1EEPA 3CL6A 4B7IA 1BX2A 1OF6A 3F6LA 4V1YA 5J8OA 3GRIA 1Q72L 2YD9A 4NZJA 4O0QA 3AZSA 1T21B 2GYSA 2OFQA 2WXFA 3AAZA 2VLME 3L5WB 3MLTB 4W70A 1KRAC 5DC9B 4YVUA 3GD6A 5FJJA 4NZ4A 1QBBA 1RMFL 2ZWZA 5E8NA 1CGTA 4EO5A 5HYSA 4UTIA 3UGXA 2AKZA 4Q89A 4H9MA 8FABA 4XN5A 3QHZH 3MJ8A 3EYOA 4M8VA 1XF4A 5L8JB 4GXWA 4ZO6A 4GQGA 1CLCA 3U0PA 2VDLH 5K9QG 1U22A 1OB1A 1P0SE 4RNRA 5FW7A 4DPRA 3QQ9C 1TO3A 1AGCA 1Y6KR 4XD6A 1RZ7L 2P5PA 3RIFK 3MMUA 5FXCH 3L08A 2FD6H 4JX0A 5GGTL 3CWNA 1DE4A 4Z78B 5JOFB 1FZMB 2RUSA 2FB4H 3GBDA 5JLZB 1YG9A 1XLAA 2AEQL 2IUZA 3WLQA 1H60A 4WZ9A 1NY1A 4I2XB 4BFAA 5GSRA 2VXSL 2DQWA 5BMFL 5H94B 2JEQA 3W02A 5D37A 4WFFE 3WQPA 1DZBA 3DUHA 5EDSA 1WDAA 4TSBL 2MCMA 4JO4H 3KTCA 2WCPA 2VGGA 2ZUMA 3TNNB 4PRPD 1NCDL 4TQ8A 4GW4B 3REWB 3VO0A 1UB3A 1YX1A 5J8LA 4H9VA 3MXVH 3O3AA 3IE4A 1N5YH 3JWOC 5HA7A 4DEWA 3ASNB 3KM2A 3ZFHA 2GK1B 2D4DA 1IEQA 2DTSA 25C8L 3INUH 3PP3K 4G3YH 1LHZA 1SEQH 3N1FC 4GYPA 2XUCA 2XQBH 3UTSE 2PPDA 4JM2C 2VXVL 2NRDA 2GAZB 1KPVA 2ZG3A 1CR9L 3S8WA 4Y5VB 1LO0H 5K1NA 3HCVB 4XCFH 1QFWL 5F9AC 3VXTA 1AJ0A 5KJ4A 2BSEA 4GFXA 3B2VL 4YDVA 2AKMA 3AS0A 4O54A 1XGZA 4QY8A 4AHOA 1VRXA 1ZTXH 2OLDA 3I3DA 3U6RA 3T71A 1HVXA 2N1KA 3HMWL 1UZHA 1S5TA 3THCA 2R0KH 4QG6A 2YSSB 3ES7A 1NWPA 1GGUA 4ZAKB 1VBJA 2MTAA 2QJIA 3LLDA 3U4FA 2J7GA 2Y88A 3FT0A 4W4NA 3S34L 4LVHB 1XEUA 4ZMAT 12E8L 2M26A 1CW2A 2FZNA 4B0MM 1SQ7A 2PBOA 1IF2A 1FN4B 2CO6A 2V7HB 3OA5A 2W27A 3BPWA 4PJHE 5SV3A 4F8OA 3ZU8A 4QJ4B 5HHXH 4V28A 1MFEL 3WLJA 2BNRB 1XL4A 3ARPA 4LLYB 3ZL4H 1FWNA 3BAYA 5GGQH 2NR6A 3PE9A 4ERIA 4M3JA 3GSNH 3ITOA 1OYCA 2N01B 5BO1H 3NJNA 5GJMA 4KXAA 1JGDA 3VOGA 3BLDA 2I27N 2VZUA 1ZSXA 2X4OB 2GSEA 5ECJE 2VMEA 3DSNB 3DO4A 5L4IA 1IEIA 4LRTA 2QHLA 4MHHI 3DBXB 3E38A 2VZ3A 2OP4H 4Y2DD 5J5EA 1C90A 4K8RC 1YN7B 1IGSA 2FJGA 2YIHA 4FFVD 4JDTL 4WK0B 1EZVX 3DG7A 5D1XB 4FXKB 5DD3H 1O5KA 1ONRA 3MA7B 4IHOB 4N9GA 3U0WH 4N22A 3MVSA 1C12B 3WQGA 4GMTL 3WBDA 1KYDA 2ENYA 5TGBB 3S1GA 5GRUL 1BLNB 4AUYA 3A5FA 4NNPH 1ZIBA 4TV5A 1PPIA 2ZOLB 3BH8A 3QG6A 4UMSA 3GH7A 3I6KA 2YKLH 3GC3A 1U1HA 2LT9A 2BSBA 3GBEA 4LE8A 1F5ZA 3KHJA 2VLLB 5IMOA 3IN2A 1A4CA 4Y88A 4V15A 5JPMC 3NQ7A 2EDQA 1CDYA 1JVOA 3JZEA 5I28A 4Z95H 2WO5A 3QULA 4KWSA 3R4DA 1BQLL 4QHMA 4AVJA 4GCXA 3TTOA 1H3TA 4N1HB 5JIIA 2V3GA 2ZCKL 4FQJL 3GW0A 2TAAA 3BQUB 4KDWA 2HVKB 4I0PA 4QTHB 5HGDA 4XAGA 4A29A 3LQAC 2WLLB 1XBDA 3P9LB 4BKLB 3QEHA 4GSDH 1EOMA 1Q5MA 2QVHA 4NZRH 5D7JC 3U9UB 1A5NC 5TAOA 3S4TA 3VW3H 4RFOL 3S2AA 4ZMVA 5TIMA 4O1FA 3RX4A 2FX8H 5CMAA 2F0CA 1AC0A 3O45B 3UAJC 5FDWA 1XT5A 2PUZA 4MNJA 2PCQA 3FX4A 4IBQA 3PAUA 4QO1A 5TK2A 1HZKA 3O2WH 3OAZH 2R29A 1F6FB 1DANT 2V68A 3BJSA 2DTMH 1WA1X 3G3MA 4OM0H 4UINH 3H2FA 2R82A 3CXFA 1HJVA 4FI6A 4WW1A 7PAZA 1BV8A 1JWUA 1K70A 1AHWA 1W5NA 3CL7A 4Z0JA 4EJ1C 3CZJA 5D1QA 4F58L 1WFUA 3CVHL 4QRQB 3K5SA 1WC7A 1A3RL 1VADA 3NJLA 4UIKH 1XHGA 2P53A 5DQ9B 2VW6A 1NCNA 1FAKT 1QI4A 1EPFA 3V0EA 5ITFA 1AO7E 4L9LC 1XLCA 4HGXA 2RQEA 4Q7NA 4IEFB 3TA3A 3TJXA 4E41B 4KRLB 1Q8JA 1CIUA 2ZF9A 3B43A 4NENA 1G1KA 4HNVA 4G9PA 1T4WA 5DUPH 4HISA 3IARA 5C0CA 2FLIA 4K68A 2EUZA 3LVTA 4JG1H 1VFTA 2ZDRA 3W76A 2AQRA 3HI1B 2BFVL 1KCUL 4KKPA 3NQMA 3N1MC 3QDJA 2VDNL 1MDLA 1YY8A 3QAQA 3P82A 4IZGA 4LVOB 5D71H 1BQUA 4WUUD 2PGWA 1JCVA 5I07A 2QADB 3T6QC 1TYGA 3NPVA 3FFSA 3W25A 4W9IC 2VWTA 2EXYC 3LNGA 5MP6H 1T0NB 2PAJA 3G3DA 3BP7B 1OL0A 3E6FA 3AXHA 1XH3B 2J1ZA 1RUMH 3O2DH 4PBXA 3BXWA 7ODCA 3GEFA 4XX1G 2EPNA 3S3SA 2RD0A 5A16A 3PNRB 2V5KA 1XGEA 2VR9A 2GTZB 3QPXH 3C5ZC 4KDVA 2IEPA 1G7JA 5GS0L 4PUJA 4Q8TA 5A6KA 1WH0A 1OT1A 1C12A 2EDNA 3EGDB 3RTQD 4M8RA 3UDWC 4J1UB 4UQBA 2HWZH 2G60L 5LIXX 3QIBD 4OZHE 4Y19A 4Q8UA 1TG8A 5FJUA 2R2BB 2HTLD 4YXHL 1EDTA 4MJHA 4TQHA 2G9KA 1SFTA 2DFAA 4XB7A 3UTPE 4ZG1A 3QO0B 3N15A 4DAGL 4QR7A 4JBRA 2BIPA 3PPCA 3KNBB 1UM6H 3BLEA 2PA6A 3T8XB 4KWWA 4JY4A 1C8YA 3RVVC 3V4PA 3FT9A 3AXMA 1YMHA 5LXVA 4N20A 1AQ8A 4GNKB 1Q6DA 1AR2A 4C6CA 3QDJD 2OK0L 2QBWA 4V1DD 4AIZA 1W72H 4NKOA 2YCLA 1ADQH 2OR9H 1I9IH 2ZUXA 3BVNA 3N06B 3GIZL 3SCMA 1BBDL 3WIHA 5EZJA 2E7LA 4PTNA 2OW6A 3DO3A 3FEMA 4QXUH 1EZUA 1FVDA 1J79A 1UR0A 2LQRA 3FMGL 1CK0H 4WWKD 5INDA 4YGVA 5FGBA 4HMNA 2BNUA 1KCUH 3MLVL 5AG9A 1EP3A 5C55A 3COOA 2H32B 3APYA 3OLDA 1BEYL 3Q8CA 3AXLB 4OFYD 3OAUH 4NN7C 5I18H 3D47A 1NAL1 3GDKA 4JN2A 3G3LA 4X4YB 1CF8L 2JKTM 3LZPA 3W57A 4CD4A 5D93C 4XKYA 2YWZA 1FHLA 2H26A 1EHXA 5JPMA 2X4PA 3CPGA 3EZ4A 1H9DA 4IKKA 4HQQL 2VMJA 4GSXA 1YEJL 3M5VA 5HJLA 1FI8C 1QLRA 4KTDL 4LSQH 1IGCH 4UB0H 3H56A 4C54A 3L0KA 5AYUL 3IGUA 3M0KA 4AYFA 2DKMA 3QUZA 2WZEA 3ALWA 3BYYA 2K1MA 4CJ0A 3ZM8A 4EF8A 5FO7A 2PGRA 4RA3A 1PLAA 4HZ8A 1YECH 4WR3A 4JZJB 4N2DA 2ATSA 3KWUA 1Z44A 5CN2A 3LXUX 4XN9A 3T1GA 4Z76B 4QCIB 2ZVRA 4JQIL 2BZDA 1GY2A 3ECBA 3SJVA 1KOAA 3EDEA 1KCBA 1RZIA 4XPGH 1UACL 5D2NA 2XIMA 2Z0IA 3KBEA 3NXFA 3LH2L 3PGFH 3AO0A 3NSNA 2NCEA 4F7PA 3P77A 5EO0A 3OHMB 1FWEC 1Y8BA 2MKLC 2F9BT 1XF5A 4DQAA 1UADC 3I75A 4ODUA 2J8OA 2ZE0A 4PTTB 3WGVB 2DZTA 2ZTKA 4US5A 4C83B 3S46A 4HNLA 3K6FA 5F9OH 1AI1L 1Q3NA 3RPIA 2BNQA 2HKFL 4LLDB 1WBXA 4FX7A 2RH9A 3RWFA 1NM4A 1FWBC 3CN4A 2A0NA 1J01A 3IEAA 4H8WC 1KENH 3KGRA 3QUXC 4DCQB 5F7FA 3IMRA 1ICSA 5IW1A 1VFHA 3BO8B 4L1GA 3MSRA 1DQMH 4AQ1A 1OFAA 2I57A 1EEZA 2J73A 2EYSB 1Y7VA 3C8DA 1QO5A 5KJRH 1OAZH 4NZ3A 4I1RA 2VC2L 3NEHA 1FWHC 3HN5A 2XPKA 2QZQA 2VO5A 4B97A 4Z7UA 5BQ7A 3THUA 2JCCF 2EC9T 2IF7A 4FQCH 3ZE2B 3IXTA 3ZK0A 1ZWIB 1D3HA 1TTJA 4IGMA 4OHQA 3W75A 1LOQA 3SQOL 3APDA 3BKMH 4TL4A 3WD4A 1ZAGA 3KWXA 3D0VB 3IMTA 5IB3B 3ULUH 2CIIB 2WJ7A 1IR1A 4LANA 4BWTA 1DJGA 4WJKB 4GUQA 3UTQB 2CGRH 3PFQA 3ZDYE 1A47A 4HKZB 2WPGA 3FQUB 1AC6A 4ZK8A 4K3EL 1R2RA 2WNGA 2Z4GA 3HNTH 1VFFA 1MJJB 3FO0H 2VELA 2ORBL 1VKXA 1BVWA 4WO4C 5T1LB 5IGXL 3E1ZA 5BOFA 1F1GA 1NGZA 4I48B 1G4TA 2MQCA 2DIBA 2GY7B 2IIJA 1XB3A 4IMEA 5C2UB 3OGOE 2QDGA 3WNMA 3ZRCC 4Y4KA 1MLCB 1HL8A 1LUCB 2P8MA 1D5IL 4B3EA 3SZKC 4H9UA 1RFDL 3TE9A 4UTBA 4ZTPH 1N67A 3SE9H 1MCWW 4GMSL 1MFDH 2DZUA 3FO2A 3RI5K 5I23A 1RJRA 3EWZA 4RPPA 5KJ7E 4GSQA 5GGSA 3FT3A 4U6XA 5KOVC 3FF7A 4B5SA 4M1DL 3WH6A 1OGAE 1GVOA 1TJHL 3KLKA 3GVVA 3O2LA 3WS3A 3PR2A 3QH3A 3CFBA 5CHNB 2IAMD 3UO8B 1VC4A 3M0XA 2WQ8A 1GR7A 4F0RA 3W1MA 2BRQA 1W32A 3WX7A 4TL5A 3BN3B 1GC1C 1JZGA 4DKAA 4N4YB 3BH9A 4U3XA 3EJQA 3FNKA 4OFDA 1M53A 4XXCA 5CR8A 4HU0A 4ZTXA 1UEYA 2KERA 5ICZA 4HMCA 2A3EA 1OX5A 4Q4MA 3KXQA 3BW3A 4GG6A 2PTTB 1X5GA 1XD0A 2X44D 2FT6A 2ICEA 3FRPB 3QO1B 4HWBH 3RWEB 5IESL 2X1UA 1VBRA 3H42L 2VQ4A 4ICWA 2HX8A 1JR1A 2WMIB 5KN5B 4YYCA 5KTLA 3UC0H 2WUBL 3LKRA 3DGDA 1TSIA 2FZMA 4HALA 2HUHA 4PRIB 4BK5C 3FB7A 1VYPX 2VCBA 4FJ6A 3U3HA 1JWSA 1A6TA 3DFNA 4PCTA 2Y6SD 3Q48A 4IU2B 1JXJA 1G6VK 3QCVL 3TS8A 1JQXA 3KYNB 3HKZA 4XVOA 1X5KA 4ZPTA 1A7OL 1AGEB 4M43L 1M05A 1MCHA 4P2OC 4Z5RB 5CD3B 3EXTA 3I4EA 1K7FA 2BSSB 2UY7B 4CNIB 3MO4A 4KWVA 2B3IA 4PJ7F 2GTZA 5C54A 1YUKB 1HWGB 2X1RA 4YQXH 2NUYA 4IRJB 5E23A 4GFIA 3LD8B 1JK8B 4LSUL 2DJXA 3TYBA 1I8IA 4L4JA 6A3HA 3QUMB 1JPMA 3VXRB 1WWBX 3DI0A 4URTB 4NYYA 5EH1A 2QEZA 1A7PH 5D8ZA 1RA5A 4B41A 4R84A 5IQ9A 1FP5A 3FBKA 3I6GA 2CLFA 2V2DA 4LSVH 2VQUA 1MFDL 1ME8A 1BMZA 3RIAK 1PAZA 1UD4A 3O4OB 5DO2C 4PP1C 5F88A 3QQ4B 5EEWA 1NCDH 3MROB 3CSBA 5C0JA 4J2PA 4D6FA 1MWAL 2CRIA 3AFBA 2MQ3A 5CJBA 5E5UB 1HNFA 5JPNB 1GOHA 3M47A 2PLMA 4DF0A 1CFVL 3GBML 4FA7B 3E9AA 1GC1L 4F79A 3TVMC 2GHZA 2WCGA 1C7TA 1SDYA 3QXDB 1PYFA 4JTJA 4M1GH 4MD5B 2GC7C 4NCC2 2JE8A 4K8RH 5B8CC 1ADDA 5C2GA 2Z0UA 4KWUA 1JZFA 2YPVA 4UFHA 3ILDA 5IQ7H 3L5XH 1I7RB 2XQYK 2K8QA 5FAAA 2E28A 4YNGA 4EI5D 2KX9A 1MIEL 2XV3A 4O14A 4RAVB 4X6CA 3QR1A 3TQKA 3B8DA 5EZOL 4PREA 4NXKA 4PMZA 1QFWM 1DFBL 3GRWH 4J8RA 4PWIA 1SZEA 3E5PA 3JSSA 1B4RA 3LS9A 5IG7B 3RG1C 1XIWC 4FLRA 2FTYA 2UZXA 1E4MM 2Q71A 4JFQB 1J12A 4Q6IA 1UP3A 1PB0A 2XG5B 3DECA 4GO6B 1ED3A 3WEXA 1VB9A 1W8EA 1NBZA 4Q6XA 1XCWA 5A8GA 4DXKA 4GB9A 2H41A 2UZYB 3BLIA 3ZL4L 5IB1A 1B3ZA 4C6KA 2F1AA 3GHBH 3VX0A 3V0IA 2NUTB 4JFDE 1DN2A 4I9JA 1OINA 1QNIA 1X5HA 2IO5A 4ZXBD 3S36L 1T03H 5FA3A 3PQYE 4KROD 4HYWA 4HP5A 3GHEL 4G6AC 1IAKB 3QFJB 4JZNA 4DQOH 2WGNB 1FFNA 1PU0A 2D7QA 4X5XA 5KN5A 1HXMA 3B8YA 1KB9J 3Q5OA 1FX6A 1WB0A 4IT1A 3U1SL 1LEGA 5BOPA 4PRIA 5K7JA 5IVXB 1N2RB 4PJ8C 4LU5H 1TR9A 5D05A 2J7FA 4PV1C 3MUGB 4IOSD 4ZX5A 1TQCB 4K8RD 3PDDA 1Q90A 3W86A 4H6KA 4HK3N 1WZLA 1EHKB 4AKOA 2VMCA 3ERXA 3FHQA 2Z4QA 5ILTH 3EH4B 2CC0A 2QCEA 3NZ8B 5F1IA 2CLIA 2WWOA 3W3BA 5FF2A 1OO2A 3SKNB 5K5YA 5DI8A 5EEZA 3ESVF 5IXEA 2D73A 1S9VB 2F53A 1U95B 3JTTA 5F3FA 1TU2A 3OLEA 1D8CA 5EU6A 1SO3A 3S37L 3VCLA 5DD5L 5ISZE 3W1TA 3IAGC 2DLFL 1KBKA 4PJCF 2NX5B 4R2GC 5DD6A 3BAWA 3OR6A 5DFVD 3SJVB 5G1YA 1E9OB 1N4XL 2PPEA 3SBWC 1ISZA 3WD0A 1RPUA 1N55A 2R8SH 1P84J 4C4UA 2YMXH 1G1OA 1O9ZA 5FV1L 4Z2GA 2V3EA 2LU7A 1VFMA 1UA7A 3O6FA 3WKYA 3QPQC 5F97E 3HQNA 3KM8A 2CNZA 4TX8A 1KN4L 3MKGA 1MW3A 3SKOB 4AQ1C 2NXHA 3IV3A 4KEZA 3CS2A 2DWEA 2J8TA 4HCRA 2P5WD 3WHXB 3ITLA 3BAKA 4PYGA 5AFAA 1JD7A 5CC5A 2CK0H 4ZAKD 3RRXA 1AK5A 1UJ3B 4HUXB 2CM5A 5CGYC 5AB2A 4N9CA 1CPUA 4U1JA 3T2QA 3WXWH 1LP6A 4S1QH 3HQ1A 5FJTA 2ZUVA 1C16B 3T65A 1QO2A 1ZS2A 4KUZL 4OU1A 1F58L 3ITYA 2RACA 4M5PA 4F8TA 1T66C 1RJPA 1KPVB 3C6LA 3UBXG 4LU5L 3WMSA 5LDSA 1WA3A 3PZTA 2C34A 1MLBB 3ATFA 5CSRA 1V51A 2X4TA 5D6CB 3EWCA 4UILL 4YDJB 4HCGA 4WFHE 1EJ6A 5A2FA 2BZCA 2DQJL 3GDBA 4JFQA 4WV1B 3UL4A 4P5UA 4LCSA 4G5AA 3TQPA 2XY1A 3B3IB 2X2IA 3OKLA 4Y9EA 4DN3L 1ZL1A 4AIXA 1UWXH 3KVLA 2DVXA 1DBJH 1WKFA 1MEXH 4G7SB 3A12A 3EBVA 2YAOA 4UOW1 1AKJD 2Q8BL 1DBML 4QXVA 2X8RA 4ZMYA 1MFNA 2ZG1A 4X6EA 1VKFA 2BP8A 1SN0A 4HKJB 4ANKA 4AZ8A 1TWSA 5AYXA 3RITA 5CC6A 2A83A 5GJNA 4PRTA 1WWWX 4J5VA 4XTDA 2MOVA 2OQLA 4TRPH 3VI3B 1Z9SA 4AB4A 1QTPA 2HLEB 4NP9A 4YDKH 1UWSA 1JGDB 3ZDZE 2YEZA 1GTEA 1VRDA 3REQA 3RJXA 3ZDZF 2ATKB 3CC5A 2LU4A 4J3OC 5A2IH 4QRFA 4JQAA 3WLTA 4PJXB 4NWUH 3HCVA 1ENUA 4CD8A 3EW3B 3DI3B 3V1PA 2JKWA 3QJAA 3BQUD 4RETB 4BXSV 1JRBA 2VGFA 3UWVA 4NQED 2PCPA 3QUMH 3G6JA 3CK0H 5FHBH 5GIRB 3CFDA 2PYFB 4AZUA 2JEPA 1C9SA 5F9DC 2HKHL 1UP0A 4XO5A 5E2UL 3HRPA 5DSCB 3FFDB 2YSSA 4PWGA 1CG9A 4PJDF 2INEA 4I9TA 1G6RH 1F2JA 1D3CA 2FQEA 1HJUA 3MRPB 2XU9A 1WIPA 3VKJA 2XNAA 3BUTA 5L4JA 3MNVA 1DJIA 1T1ZA 1T2XA 2Y7QB 3HG2A 4ENED 2X38A 5DD1L 5HPMA 3CXHK 4F2ME 2C71A 2QCMA 2VUYA 4P5MB 4PHZA 2FYYA 1KJ2L 5FECA 5MI0C 2B1HL 5EN2B 1HKIA 3P80A 4HOWA 1PZBA 1ZSDA 4YJ5A 3RK8A 4OV4A 4YO0A 3WKMH 3RAJL 3OR7A 1ZPLA 3NYKA 5JQHC 4S3GA 3MYZA 4NB7A 3Q43A 3CEPA 4O8RA 4DF1A 4MNGB 1DANU 1LO3L 4RE2A 5DEFB 3SD2A 1P7HL 3QQ4A 2WMIA 2GJLA 3CDZB 3ZTDC 1P7QB 2RALA 4B9PA 1HEJC 3LHVA 4WNSA 1QTWA 4GK8A 4HPOL 4I77H 2F6UA 3RR4A 3OYXA 4OSUL 4P8WA 4AVOA 4LGXA 3BOVA 3VNDA 1R4XA 3UDWA 2V2WB 3NSCA 1K4HA 2G3FA 1BOYA 2Y7MA 1WS7A 4OCLC 1QHZA 3C3NA 3TZNA 1JXGA 4EEEA 2GSMB 4QHUA 2VXUL 2ZUTA 5IEKB 4WTZG 2EECA 4AEHL 2PB1A 3E0VA 3GNOA 1NBCA 2FPVA 1CD1B 1HE7A 1X5ZA 2DD8H 3HPJA 4GXUM 4IRJA 3DERA 4P46C 1C8XA 3B4UA 3SGDH 3IKCB 5DS8A 2IXUA 5DJ0B 4AM0Q 3LGEA 3QUYA 1R8LA 3O4OC 3MUHL 3U0PB 4TX9A 4LH8A 1G7QA 3UMTA 1XLIA 1WFJA 2JTYA 1RD5A 1H62A 4YL2A 1XR9B 1PIFA 3P0GB 1PVNA 3DIFA 2BOLA 1FE8H 3QUHA 4UTAA 4L6HA 4XBPA 5I1GL 1TA3A 1E4HA 3V7AG 2DWDA 3EGSB 2EZ0C 2DZWA 2EEAA 5D2TA 2E6QA 3LD8C 4RGND 1JTPA 2VM9A 4EOWL 2J62A 3NZQA 4QNEA 4GSDL 4YJZL 1MY5A 2VXQH 2HH0H 1WXYA 3L5LA 4YCPA 3A3XA 2HTLC 3LQAL 2WLIB 4PM1A 3BP5B 5LDUA 3VSQA 1NFDB 3IU3B 5EMKA 1E51A 2VR3A 4K8RL 4JFXB 3VRIA 5CXPA 1OAUH 1RMFH 3FT2B 4N8VA 5FO9A 4DT2A 2YXWA 2YMTA 3D3FA 4WX2A 1MCQA 5L6UA 2NY4B 3FRUA 4FNLH 2NV1A 4WW1B 4AK2A 2ZP8A 2Y70A 3L81A 3LHWA 4YBLB 1JK9A 5F7BA 1BA9A 3R58A 5KYUB 3NGFA 4CC0A 1S5HA 4Y90A 4GP4B 3H2PA 4JRLA 2BIOA 3I9GL 3OKYA 4XP4H 2GB2A 4FQXC 1RQEA 4PRWA 4MDRA 4NUJA 4PN6A 5FF4A 2W38A 5LIWX 1QWHA 1Y6NR 1OHLA 3S8GB 3EOBB 5TDOA 1ONEA 4UIKL 2XVKA 5BZWB 1JCLA 4NN6B 4DTGH 1M7OA 3Q58A 2ZXDA 1WKYA 2XG5A 2OGYA 3FSTA 2AEQH 3OAWA 1KB5B 4MBOA 3MV7A 2QJHA 1DQLL 2OYLA 3R0UA 4K8EA 4I0CC 1LE9B 1NEZA 1I75A 1BQGA 4MA7L 4IIQC 4OF3A 3NABL 5I78A 5M7QA 1KR0A 4PD4J 2A6DB 2A7BA 5F7MC 1L6YA 3QI9A 2W3ZA 4QM1A 2AAVA 3A22A 2QFRA 4R26L 4PJFE 1EJ8A 4JFDA 4MJ2A 2NX1A 3BLPX 2WYTA 3CFCL 3UXIA 4MCYB 3DDMA 3L4WA 3MRBB 1SOXA 4LRNL 3SGZA 1TJIL 3CFQA 5IMMA 1EP1A 3IIZA 1AXTL 3E3HA 4FA8A 2O6DA 2VEGA 1SU5A 2WNZA 3JWNC 5JHLA 2Z8SA 2PP8A 1FKXA 4JGDA 1TTPA 3FFOA 5B1JA 4W6WB 3DX1A 4PJHA 1GT8A 1TPVA 2FB2A 1YN7A 2CDGA 5EKYA 2XWCA 4IGBA 1SR9A 4RMWA 1H51A 1H8NA 3LN9A 3WH9A 2ZA3A 4Q6JA 5E2VH 1BXAA 3NZ8A 4U1JB 1MNNA 4MY8A 2E7DA 3IDIB 1IC4L 1KKRA 3KFTA 2UV3A 2Z7GA 1PZCA 2V5TA 2GBUA 4NEHB 3MRDB 4HOXA 5A7BA 3JV6B 1RH9A 3T0DA 4QHKJ 3H2NA 4MNLA 3V2AR 1E1CB 4AY7A 2RFXB 5AW5B 1E6XM 2YD1A 4Q8BA 1EMTL 3MV9D 5I71B 2LABA 3BSGA 5IHLB 1MRFH 3MLUL 1F13A 4XVUC 3FTZA 6TIMA 5H2ZA 2UY5A 5FUZH 5CZVL 4QTGA 4GZJA 1NZRA 2DYPD 2XVBA 5E0FA 3QI9D 3E0IA 1LO4H 2TSBA 3FL7A 5EF2A 4HJWA 1W72L 2XI9A 1MFEH 3L16A 5GZOD 2YA2A 4GUPB 2YGPA 1CXFA 2SEBA 4PGCB 3OKNB 1N7MH 1V6TA 3U7BA 4F7CB 4AD0A 1MEHA 5CSSA 4PRRA 3ECBB 3AICA 3DROA 3ULUD 3QUXB 3DX9A 4MIMA 2WAGA 2W6RA 4Z23A 4L3CA 1I2PA 1H5BB 3WFBL 4ZE4A 2B2XL 4GKNB 4D8OA 2OODA 3WXWL 2A74A 3O4LA 2BERA 1WCQA 1SVDA 1OCCB 3M16A 1OW0A 4XUGA 1U3YA 2IMNA 3H6AA 3QNXB 4HSCX 4GO8A 2A74C 2YBUA 1DVJA 3RVTD 2NY7L 3BARA 2H9GB 4X9GA 2ZZ7A 4OZGF 2H9AB 3U4KA 1CFQA 2DL2A 2OS7A 4NZDA 2VDKB 4GG6F 4TR9A 1X5FA 2HN7A 3VXOA 2WQPA 1SJXA 3CFDB 4DJFA 1TVDA 1BWVA 3GKFA 1KM1A 1F6AA 1S8DB 4WY0F 2XWEA 2B8OT 5E94B 1MQKL 1MREL 4QHLA 4BEUA 2NXZB 1MEXL 4HAKA 5JR1H 3LBCA 1ES0A 4LGSB 3R13A 2VJ0A 2FJSA 2KHAA 2PWVA 1CGWA 1QACA 4MA3B 5HDRA 1OHZA 4OZFH 4PN2A 1P4LB 5T3ZH 1B3YA 3B03A 3P2DA 5K4XA 2HDJA 4XWGL 4MXQD 2FZ3A 2YW4A 1KJ2B 1UJPA 3RFZB 2XFWA 2JSFA 3A6CH 1MPAH 2FYYB 4MLSA 4RX4A 4MQ7B 1ZU8A 1AS6A 1BAFH 2CLVB 3CVIH 5K9JL 1S3TC 4NC0B 1XIGA 1CLOL 4M02A 4ZS7L 1KJVB 3GH4A 5AKQA 3UA3A 3VCRA 4ODXA 1D7DA 1SXAA 3EO1A 4OFPA 3U9PL 1RCXB 3MLXH 2ZYHA 4DGYH 5MERA 1LL6A 2ZRWA 1UHVA 3HB3D 4HEPG 1DDHB 4MKMA 4Y2DC 1O4UA 5DCEA 5CGBA 2Z91B 3L5MA 4NM8L 1A49A 1W5QA 2DT1A 3BW4A 5C0GB 5EIIG 1G4RA 1B4JH 3CLFH 2YO3A 1N0LB 2IPTL 1LROA 2GITA 2NNFA 5DSCA 2X0WA 5FEBA 2PP7A 4OFKA 2OTWB 2R2BA 3RVXD 2EDLA 1SMDA 1ZRQA 5CJQL 2UY2A 3EWUA 1Q9KA 5DZLA 2VISB 4X7TB 5HHNA 1EL3A 1BXUA 3PP4H 1AGCB 4XAPA 1WFNA 3GHBL 1RHHB 2O5ZL 3MV8B 1HU8A 3QI9C 5FWQA 4ALAC 1EHLL 7XIMA 4LNVA 4O9HL 3KXFA 3OTRA 4FEMA 5D4QA 5IVXE 4IIQA 3KPRD 3QY8A 4BWWA 1E3FA 1NC2A 3ZR6A 1I0DA 1W3NA 4XAZA 3QRGH 2Z2UA 3NNTA 2LOEA 5JMUA 1DYSA 4XP6H 4XVSH 1DKWA 2VM4A 1MREH 3K81A 3K8LA 4HJUA 2YPKB 3HZ3A 5JBDA 3PB0A 4AZGA 3WCZA 1XB8A 2N59A 3UTPD 3SN0A 3TSDA 5FCZA 2Q3RA 4GRLC 3LQGA 4GY0A 1VFAA 5SWSB 3UABA 4XBGB 4GZIA 2EGZA 4KBXA 4E4FA 4KCVA 1OM0A 3MTRA 3BVDB 5DQDH 4PWJA 1TSHA 1SXNA 3N1GC 3RY5A 1JFXA 4ZDHA 3G18A 3JUGA 3TGXA 1PIIA 5A94A 3TJEH 2YZ8A 25C8H 3MU3A 3FO2B 3R18A 4G3YL 4E2VA 4TUKL 1MEWA 4L3FA 1W2VA 2YJQA 5C9RA 3EYSL 4U1IA 2E7BA 2D4FA 2QJJA 2OI9C 4GY1A 1FYTA 2JELH 1GZHA 5TPWL 2VITA 4FNQA 4XMXA 2ZP9A 3ZYZA 4DN4L 1C9WA 4UTTC 5T26A 4A2DA 1KFAH 3I7RA 4NAMA 4JX5A 1FL5B 4U3SA 2ENJA 1OIMA 2YL8A 4S0TD 3JWOH 4LKCB 2BGNE 3TBYB 5I1JL 5A3IC 5J6GA 5F1OB 5A6BA 1Z0MA 3FB6B 1AE6H 4HXAL 5ACLA 4XD4A 1EDYA 2IBGA 3VWKC 1C08B 3PABA 3FC8A 4JB9H 2JB5H 3L3IB 2KLTA 3QB7C 2O6FA 4NLAA 2WINB 3DTXB 1OCWL 4RNIA 4HKXA 3GSVA 4EE2A 2ZOOA 5I1DB 1XIMA 1K02A 1X5LA 3GSNB 2ZA2A 4AIUA 3DG3A 3ISYA 2X05A 4MRCA 1CK0L 5D2NB 5C9ZA 2IGTA 5I3GA 3NCXA 4ZW6A 3PPEA 4MCZB 4WD0A 3WXVH 3V18A 4FFTA 2JWYA 4UT6L 2PR4L 3A6OA 1V3HA 3H7UA 4N5ED 2F74B 4CUCA 4O13A 3QZPA 5E9DD 3PAZA 4DHGA 5B3JF 3STBA 4Y7OC 2OMNA 2Y8VA 1H6FA 1E1FA 3SZ6A 4WEMB 5LAXB 4V2XA 5LNRA 4Y16C 3T1WA 1U8CA 2EABA 1KTJA 3QEUB 4RMSA 4NQXA 3TJPA 1A4JB 4A68A 4BE5A 2AQPA 5I19H 1URZA 3MUAA 3W7MA 4K5NA 2BDNH 1WD9A 1F05A 2XIBA 2FBOJ 5CC7A 1KFKA 1SJVA 3GSWB 5T5FH 1AODA 2G41A 2A7PA 4XMUA 5AVQB 1K3IA 4CCDA 3NA9L 2J9ZA 3MBXH 4JDYA 3MV8A 5F71A 4PJ6A 3HE6A 3G1AA 4NPJA 4F2FA 3KXFB 1XIHA 4A8NA 1BFTA 2OV0A 3MLRH 43C9B 1IT8A 3FB5B 9CGTA 3QV8A 3QW3A 4K6AA 4WXZA 3BAJA 3Q5YA 1MFAL 4WY0A 4DJEC 5KSAC 2RIKA 1T99A 2ISSA 3STPA 1CL7H 4NKIL 3WLOA 1U92A 5A2BA 3U2CA 1Z5HA 5AWNL 2FEEI 4ALDA 3FU9A 2PDQA 1G87A 1NH6A 2LAAA 1JGEB 1N59B 3D9AL 3GSXB 5DGRA 4EQ3A 5J13B 1KV8A 1IC5H 1EGMA 3T04D 3GDMA 1IFGA 2D2CC 1QUPA 3RY6A 3UADA 1NCWH 2LVCA 3D4CA 3VW3L 4KKZA 4FMKA 3T5WA 4FXKC 4N9BA 3AREC 4M1GL 3U83A 4AJ0A 1CFNB 3CMJA 3F58H 3CYVA 1WBYA 3VZXA 1USZA 3O0LA 4PG9B 3UQNA 5IQ7L 3NUKA 2HTMA 4KETA 5DJ2B 1XF5B 5CCJA 2A1WL 1NTDA 1TEFA 5FM5O 5I09A 1ICPA 1UWXK 1KN2L 2XPGA 4HIXH 1Y5WA 1I0BA 3EAUA 3AMLA 3U2OA 1NLDH 4U1IB 5CEZE 4GXVH 4IQEA 2RMNA 3AVEA 3M1OA 5FF7A 3HEIB 4H0HB 4IBTA 1NOAA 5I19L 4E41A 2NVDA 1OM3H 1E9QA 4DPCX 2TODA 1BZDA 1G4MA 2QTVA 3VOJA 1F00I 5KUKA 1E4IA 3JVAA 3VX1A 4AQ8C 1HC1A 2HN7B 4K7PH 4KKNA 2VHLA 2QUVA 5AZ1A 3V5OA 1S8DA 5CBAB 1GXEA 1TNNA 5FA4A 1DWJM 2OXHA 2AGTA 2VLKE 2I5QA 5GZNC 3E8UH 2UZIL 3ZTCC 4YU1A 1EVUA 3TR2A 4MQXC 1K7XA 1ET7A 4OB5L 4QRTB 4FL4C 1IHIA 3TEWA 4N2LA 2ADFL 3KPSE 2FZ3B 3JBG7 4FQHA 3N1PC 1CQYA 5D71L 3FSZA 3INUL 3BPNB 2BNQD 4H4IA 3MCNA 2Y07L 2J88L 1VLIA 1D5IH 3L3DB 1UB5B 3SJNA 1ZEAH 4P9HH 1NKOA 2EXSA 4G7QB 3VB8A 1OABA 2F7IA 5LNEA 5IZ7A 4PJCA 3P3TA 3Q2VA 4Z7WF 3O06A 3PWIA 4PJGE 4PV8B 4D8PA 3APGA 5CD3A 2OSLB 5EG6C 1ZDSA 4F9LA 1PQZB 5FGCB 3M6YA 4AJYV 1L8PA 1R9YA 3WS6C 3SRHA 1YNTB 1R3IH 4OZIF 4NSKB 4YXLH 1F6AB 3FXYA 2V6AA 2VLRD 1KV7A 4M1BA 1JGMA 4WHBA 3RWJA 5CN1A 3DX8A 5AG8A 4F93B 2VR2A 4M1DH 1ASPA 2V2XA 5ES4B 5KBKA 1KO0A 1YMHB 1KYAA 43C9A 5CPMA 2CBQA 1ZLWK 4WXYA 5JUEH 2OA9A 2UX7A 3M43A 1I3UA 3M8OL 2NY3C 4FJYA 4ISVB 3VWJD 5JOEA 2JCWA 2IW0A 3PBGA 5DJ8B 2X28A 4XUYA 2BB0A 1YMME 4YDZA 3S0PA 5DWUH 5A2KH 1LDPH 3RGTA 4MZ2A 2LGNA 1XG3A 1HHHB 1BYOA 1R3JA 4XMPL 4AQZA 1JN6A 5JBEA 2E6FA 4O12A 3TIEB 3D30A 1ZCCA 3OGCA 4NBYB 5KZDA 3HNSL 4DBWA 4N2MA 3BUIA 3E2SA 3L21A 2E09A 1C16A 3IMBA 3QJFB 5C0AE 3SDAA 4G1EA 4AG4L 1KGCD 4JM0A 4CAGA 1KG0A 3EHBC 4YK4B 3PC0A 4EXQA 4GP8B 4O4WA 1I4FA 1IBHA 3N6QA 4GXPA 2OTDA 4QS5A 2EC9U 3P81A 4DM1A 1JWSB 4QXGH 4GX9A 3TASA 2WTRA 2PZ0A 3QHMA 3K30A 3IT8D 5D7KD 1O75A 1LOLA 5FD0A 3KUMA 3B3IA 3PP4L 1VHPA 4XVTH 1AHWB 3UFIA 2GBVA 2NY6C 2CU0A 4MWAD 2ICSA 1DIDA 3HTWA 2EYTB 4WHDA 2XWBB 1C1EH 5HHOD 2HEJA 4NBZB 2GDQA 3OKEA 4HYVA 2CERA 1R9FA 2EH8H 1KTCA 1FNFA 2OJEA 2PXYB 3BIKA 1C91A 4X50A 2Z1KA 2VTFA 4KNUA 3DJRA 3P9LA 3UG3A 4HLEA 2FHCA 4ZSTA 4NQCB 5LXGL 4AXNA 1P48A 4UFMA 3SCUA 1GGCH 1T6BX 4JKWA 4QDMA 3WG6A 2FWSA 2V17L 4AENA 4L1DA 3U30C 1R5WA 2HA1A 1XIWA 4HZLA 1DUYA 4OVUA 5EEVA 5FIEA 4YVNA 3GSVB 1O0VA 3GSRA 3EA2A 1JUEA 3P62A 3X1FA 1A3WA 1W3IA 4WK9A 3CHOA 5JVLA 4ICMA 2GIXA 3UETA 2PF6A 5ECVA 1IBYA 2NQJA 5DO8A 1KYFA 1LT8A 1NPUA 1O6TA 1QI3A 5DXXA 5HHPA 3D46A 1P5UA 2CUMA 2YDRA 3LNDA 3RWGA 1AGFB 5E08L 2HRWA 1T1XB 3S48A 5IEKA 2JBMA 4PB0H 4QPEA 1K3UA 1HS6A 1FYTB 4XX1E 3A23A 2YBRA 1FG2A 3RHWF 3PQYD 4MJ5B 3TVMA 1AUSL 1TELA 3AIVA 2DORA 2ZA1A 1PX3A 2H8XA 1S9YA 4HPHA 3QAZC 3V9CA 3VXUE 1N82A 3QEQD 3CCHA 4MJIB 3LHAA 4AJWA 3DJSA 4X6DB 1EGJA 3KPMA 5KBNC 3NDYA 5DUPL 5EN2A 4FG0A 1AE6L 1GOMA 4TIMA 1HHJB 3VOIA 2PE4A 3L8QA 5EZLB 1VJIA 2X2HA 1IEAA 1NIFA 1VGEL 4LEEA 3WQ6A 2C5DC 1M2OA 2Z31B 3QG7H 3QRHA 4XISA 1ZS8B 4POYA 2DWSA 4UDTA 5DUML 1G9HA 1SR0A 5EU3B 1TIWA 3A0OA 4LAUA 3F12A 4FGMA 3B2PA 1DVFA 4XIAA 2R1NA 3FFCD 1AW1A 3RYSA 3ABMB 1I9JH 1KLFB 1R5IB 1U3ZA 2BVPA 4JO1H 4ZQKB 5BJTA 5HD8C 1Q4WA 4CQBA 3WIFB 4WWKB 4Z7NF 1HIZA 4HBKA 2V2WA 1FPTL 3H9SE 3QMTA 1KIPB 3RWCB 3TK7A 4X8JA 5DC2A 3OKOA 5DYFA 1NFDA 3IU3A 4BZ1L 1ERNA 2AL2B 2KQNA 3OJ2C 1I6NA 4XVDA 4NAEA 6XIAA 4A2LA 1WT5A 2P43B 4GNVA 1QI2A 1EXUB 3BPOC 3HE6D 3N42B 4HK0B 4I5BA 4N5EC 6PAZA 4AC4A 3QCTH 1NC4A 2NX9A 3W83A 2D22A 3QY7A 1T20B 3PVFA 4XO3A 5I6OA 3WV0A 1GJPA 4PIBA 4X80H 4L0YA 3T2PA 2FJFB 2V9TA 3TBCA 3A9BA 4JGMA 4OY9A 4XKYB 5G5DB 2VB5A 6REQA 5JNYA 3RWDB 3V5FA 3CN0A 5J4MA 1TQVA 4XNYL 2HVOA 1XRSA 2J78A 1KR1A 4GG9A 3GX9A 2OK0H 1XISA 4W9CC 5C0AA 5BOEA 3LIZL 3L4ZA 1HXJA 3P84A 2DEYX 3CAWA 3CUHA 1VRSA 4QRRB 2AS5M 4EXAA 1IM9A 4ZO8A 4A8LA 2CKBL 1UZ8A 1WK0A 4OT1L 1SQ2N 1DJYA 3QIWC 4L3EB 2CA4A 4D9PA 4OUIA 1ZA6A 2I24N 4LLQB 4ZUWB 2VXQL 4H9XA 1T6WA 1SJAA 2QADD