1KGWA

Three dimensional structure analysis of the r337q variant of human pancreatic alpha-mylase
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTQVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords ALPHA-AMYLASE, PANCREATIC
publication title Probing the role of the chloride ion in the mechanism of human pancreatic alpha-amylase.
pubmed doi rcsb
source organism Homo sapiens
total genus 167
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2001-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1kgwA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1kgwA01
1OM0A 5JBEA 1IV8A 5CSUA 3WELA 4BZYA 3FHAA 1XC6A 2O9OA 3FAWA 4P7OA 5IHSA 4U3AA 1KWGA 1XH0A 1TVNA 1UH3A 2AOSA 4AMWA 3ZJ8A 3DYOA 3N9KA 3LXAA 1XSIA 1B0IA 2VVSA 2FHCA 1WO2A 1BYBA 1JIBA 2JFEX 4PMZA 3PTKA 3EJQA 2WMHA 5A95A 1E5NA 4QCEA 1BTCA 3PZOA 1O7DC 3LPFA 1KFWA 3PZMA 1Y7VA 3GNOA 1LL4A 1OT1A 5BCAA 4JFUA 1AQ0A 1KXVA 2NT0A 1WP6A 3VDHA 3EJSA 3UG5A 3HMCA 1PZ3A 3WH8A 1UH4A 3CZEA 4LYRA 3ARRA 3K8KA 1B2YA 1WZMA 4B3KA 4U31A 2PB1A 1R8LA 1E56A 4CU8A 1UWIA 2FHBA 2JALA 1EOMA 3SCRA 2UY2A 2OYMA 2GJXA 2XSBA 2IGTA 1AMYA 3J7HA 3OB8A 2G4FA 4B9ZA 1UASA 1OD0A 1HXKA 2DSUA 3LXBA 1E3XA 5BYWA 1UG6A 4NRRA 2D24A 4MB1A 1TQWA 2ALWA 4D6DA 3BAKA 4AZGA 3CUHA 1JNEA 3CHFA 5I23A 4H2CA 1US2A 2VVNA 3CMJA 1WPCA 1J0HA 5A94A 4PCTA 1JYNA 5D4YA 5JIPA 4JKMA 4EANA 2CESA 1UH2A 3ZQ9A 3A5VA 2WCGA 1V6XA 2XWDA 1UUQA 2EAEA 1J18A 1QNQA 4R27A 3ARZA 3WIJA 3SUSA 2VQTA 4ML4A 5A69A 4FLSA 1N82A 4DUXA 2EO7A 1GJWA 1H1NA 1M03A 1ZJBA 3OZPA 3W29A 4AD1A 2FDMA 1E1EA 2WK2A 3M07A 2YFNA 2BY0A 3K46A 1JZ2A 1OGBA 8A3HA 2ZX7A 4YN5A 2F7PA 3VTRA 1EHNA 4WLCA 1J01A 5A8NA 1GNXA 2ZX8A 4HZ8A 4ZENA 1V3HA 4D6JA 3K8MA 3UEQA 3MS8A 1BGGA 3U7BA 1TQSA 3ZM8A 2WPGA 3CHEA 3B9AA 2DGAA 1XD1A 2DEPA 4GI6A 2D20A 1EO7A 4PYSA 4CCCA 4DO6A 1OCQA 4NZCA 4D1JA 3T09A 2WMGA 5EFFA 3LX9A 1K9TA 1QW8A 3VD3A 3AMDA 4HMDA 1AQHA 1V3LA 1ISWA 1NOFA 3BAWA 2B31A 4AD0A 1Q6GA 2WHLA 1JXJA 1E15A 3TTQA 3VGFA 1ZBVA 2J7FA 1U2YA 1VBUA 4GINA 1CWYA 1VFOA 2IXVA 5FCZA 2WAGA 1JI1A 3GXNA 3O2LA 4HOXA 5GNZA 2NT1A 3WDQA 3VPLA 2YIHA 1W2VA 3WEMA 4IUGA 2WVUA 1QWUA 4AC1X 2OWXA 4MNKA 3VIPA 4HOZA 3WMSA 3NDZA 1JZ7A 1KGUA 3AHZA 3HG2A 4KWUA 1K9FA 4TOQA 3OGRA 3VUPA 2VRQA 1FP9A 4UFLA 1PJ9A 3B9EA 1HJWA 1LJYA 3FHQA 3W25A 2Y5EA 4PSPA 2XM1A 2EJ1A 1XH2A 4MAVA 2WB5A 3VX0A 3T0AA 4NX0A 1LWJA 3PN8A 4NRSA 1H0GA 1SYTA 1BVZA 1UOKA 3TOPA 5C70A 1W3HA 3WFZA 1ODUA 4M8UA 1PBGA 2WANA 5AYBA 1EQPA 3CMGA 3WL1A 2OSXA 1BHGA 1NOUA 3G6MA 2X2IA 4PUEA 1H4PA 1JD7A 3K4AA 4M29A 4PBGA 1XSJA 3BUDA 1WDQA 1XV8A 3OIHA 5CPTA 1FHLA 4P7LA 1QNOA 2F1AA 4E2OA 1MW3A 1JZ4A 1VEPA 1JAEA 1W32A 1JZ3A 1NWTA 4UFHA 3H54A 3LPPA 1RD6A 3MU7A 4ZXOA 1XD0A 3LXCA 1C7SA 1XCWA 2ZE0A 3M7SA 5A8QA 1C90A 2VNCA 4MNMA 3BCFA 1CBGA 3WF1A 4OOZA 2IUZA 3CHDA 5FKYA 1PIGA 2VX7A 2D0FA 2DT3A 4AISA 3IAPA 1UWUA 5M5DA 1GUVA 2OLHA 4DWSC 4TXEA 1DWIM 3U5UA 2YOCA 1KXHA 4IISA 2J47A 1JD9A 3AMLA 3WQ8A 2J77A 1ISVA 4YHGA 2VL4A 1B31A 2CNCA 3AIWA 2VOTA 1H41A 1E6NA 2HVMA 2E0PA 3VIKA 1QNPA 4OKDA 2W91A 2VJXA 3VVGA 1V3KA 3UETA 1NP2A 3BAIA 2DT1A 3KL0A 1WKYA 3N13A 1LL6A 2QLYA 2G3IA 4F79A 3ECQA 3AMKA 3ARQA 1QI2A 4FMVA 3THCA 3GXTA 1HF6A 1JZ8A 4MNJA 3VGEA 4W5ZA 4QFUA 1TMQA 4GQQA 1UD4A 3UR7A 2J7EA 5FL0A 2XUCA 4MADA 5E0FA 4M24A 5D8ZA 2JF7A 2CHNA 4L4PA 1WAWA 1YQ2A 2WHMA 1W1PA 2BXZA 1UZ1A 1ITXA 2V5CA 2WC3A 2W4XA 1R86A 3DDFA 2VX5A 5GNXA 3GH5A 5LYRA 3L4ZA 2Y8VA 3NIYA 5BXPA 4TVUA 1QW9A 4ZE4A 1C91A 2J7GA 3AXXA 3CHCA 2ZWZA 4CN4A 1E70M 1LF1A 3N17A 1VAHA 3S2CA 1IZJA 2VZSA 2OW7A 1VENA 1CXKA 3WFLA 4KMQA 4KGLA 5A2AA 3VIFA 2PWEA 2VMFA 2WLYA 2WZIA 1H5VA 1I1WA 1BSIA 4BA0A 1GOWA 2WVTA 4FNQA 3AZTA 4RE4A 4AIOA 3I3DA 4A3YA 4PN2A 1WDPA 1R75A 1CLXA 4LGXA 1ISZA 2Y8KA 5F7UA 2FH6A 2AAAA 4FLQA 2VC9A 1J11A 1EDGA 3WF0A 4BQ5A 4UR9A 1TFVA 4TX8A 2E40A 3EDDA 2YDQA 2DT2A 1GVYA 1C93A 3GXFA 4HMEA 3OLDA 3UERA 1UWQA 3WNNA 4D6EA 4PMNA 4GIAA 4W84A 5CJ5A 3TTSA 4PEEA 4W86A 1G9HA 4W89A 3BUPA 3VIMA 3VD7A 4GKLA 3SCUA 3F5LA 2ZXDA 1V02A 5KEZA 3NCOA 4UFJA 1BAGA 4H8UA 3BMWA 3IAQA 5DEZA 2GJPA 5BRQA 3WBAA 4TVDA 1ZB5A 2FHFA 3A4WA 4S3KA 1GQLA 1HX0A 4FF5A 3KL3A 4FNPA 1SMDA 2QMKA 3FN9A 2WKLA 3OG2A 4M82A 1M04A 1V0MA 3W81A 3AROA 5I79A 3SEPA 1UR9A 1TQUA 3DECA 3WH7A 1PX4A 3HZ3A 3N11A 2YLAA 2UY5A 3GNPA 4GXPA 5IFTA 1SMAA 1HVXA 5E0CA 1MXDA 3D4ZA 1V6UA 1JYVA 3M6DA 2F1BA 4H8HA 4CN1A 1E3ZA 4CU6A 5DO8A 5EFDA 4QLJA 1D3CA 2XVKA 3VIOA 4UNIA 3L4YA 3D3AA 3GXMA 4OIFA 4P7NA 1H0IA 3WDIA 2VURA 3M46A 1H11A 4XZWA 2CKRA 4WJXA 2XPKA 4PUDA 1E72M 4HA1A 3W53A 3CZKA 3N18A 1G1YA 1KCKA 2WVVB 5IXEA 4D6FA 2EQDA 3BLBA 2PWDA 1JFXA 4OOUA 1HKJA 4AIUA 1V08A 3GDBA 2VRKA 4JZ5A 4CD4A 1GONA 3OLIA 3O9NA 1GOIA 4UZUA 2W66A 4PMYA 1KB3A 3GBDA 3DX0A 3IK2A 3GZAA 4UFMA 3TP4A 4U5KA 3KZSA 2BY1A 3EBVA 2VZVA 1QI3A 1EDTA 3NDYA 3OGVA 3FY1A 2ESCA 4W7WA 4PRWA 4J3XA 2BFGA 1UA7A 1R85A 1KGXA 4U5IA 3CZSA 2WC4A 4D6GA 3WNPA 5CGMA 3BGAA 3KWXA 4BF7A 1L8NA 4HPGA 1CGWA 3UG3A 1UD6A 3KLKA 3F5JA 2YLLA 1Q6FA 3L4UA 3MMDA 4M81A 1H3GA 1KQZA 1W3LA 4AZ6A 4JHOA 2D1ZA 4AD5A 3SCOA 4B3LA 1J0IA 4LYQA 1E5JA 4HU0A 4OBRA 1EOKA 3RDKA 4QLLA 1ZL1A 3A23A 2CKSA 1WDRA 2YKKA 3BVWA 3ARYA 1FHDA 1LWHA 1E6RA 3AMCA 3TTOA 1HT6A 1L0PA 3AICA 2D0GA 2VUYA 1HJQA 3OLGA 2XTKA 3DX4A 1QPKA 5I5RA 1EH9A 4NXSA 3VD9A 3BUIA 5HPOA 2VCCA 2XSAA 2F7RA 1KQYA 1CGYA 1UD2A 1HVQA 2XFRA 1CXLA 4H04A 4HA3A 7CGTA 1QHOA 3LMYA 1XCXA 1BG9A 3GM8A 3SCSA 1FFQA 4ATWA 2ZUTA 1B3YA 4Z2IA 1B30A 1TA3B 2E8ZA 3MUIA 1UA3A 4HZ6A 3SCVA 4P8WA 3WQ4A 1BLIA 1V6WA 2VZOA 3W26A 1OB0A 1MW2A 2OYKA 1OSEA 5AYIA 1DWJM 2VO5A 1MXGA 3ARVA 2WVVA 1HJSA 1MW1A 3PBGA 1KXQA 2WMJA 2DQXA 2VR5A 2VZUA 2YL8A 1F4HA 2PI6A 4NF7A 4P8UA 1E6QM 3LPGA 3N15A 1NWUA 2WSPA 4C7FA 4KGJA 1J12A 4UCFA 4HP5A 1U30A 2ZICA 4AMXA 3G6LA 4MB4A 2YFOA 3D4YA 2VTFA 3SUUA 2WCAA 1GOOA 1QWNA 1B3WA 5BROA 3VIGA 4B9YA 3HG5A 2RGMA 3CZGA 4TVCA 1B9ZA 3JUGA 3CZNA 3ARWA 1GQIA 4F8XA 4DO5A 2ZXQA 1W91A 1NQ6A 1CNVA 3QR3A 5A6AA 4AEEA 1ODZA 3SIMA 1O7AA 4U2YA 3VIJA 4A4AA 1XGZA 3EJRA 1HP5A 2BV9A 1WZKA 2G3JA 3VD4A 2X1IA 2W62A 3EDKA 1V0LA 1J9YA 3WDHA 3AFBA 1UKOA 2V3EA 4LPCA 2BHUA 4AWEA 1J0ZA 3KLLA 3WUBA 4Z2HA 4QCFA 1JDDA 2D0HA 2J7HA 5GQBA 5A6SA 2X2HA 1OGSA 2WBKA 2D3NA 3NJ3A 2FYVA 1CZ1A 2G41A 2CYGA 1SZNA 5I24A 1JZ6A 1SR0A 2XN0A 4CVWA 4XV0A 1GJUA 2DSVA 3BUBA 4NZJA 1NP0A 4PMVA 5I78A 5A3HA 1CYGA 4UQEA 2XIIA 4Z2JA 1VJZA 3D5HA 3WY1A 1BYCA 1NWRA 3QOMA 3PZIA 3VNYA 4RE2A 1G01A 3WNOA 1UR0A 1UKQA 1TA3A 3AOFA 3HU7A 2Z1SA 3D51A 2X8RA 1NOWA 1CGTA 2W63A 1CENA 4Q22A 3MUZ1 1LG1A 3VDCA 2QF8A 4L4OA 1TUXA 5A8MA 4TTGA 1ZBKA 4CKQA 2X05A 1FP8A 1DHKA 4N0RA 3KEHA 1BFNA 1GPFA 5I77A 1R34A 2J75A 3NUKA 1BYDA 2VT0A 1R47A 2WWCA 2BHZA 3K1DA 4TX6A 3VX1A 1D2KA 4PMUA 1TQVA 1OINA 5CSYA 2OWCA 4Z2GA 1JAKA 3NYDA 1HN1A 1DWAM 2J62A 2CBUA 1PX8A 5E9AA 3ZT7A 3HN3A 3BAYA 4J3VA 3VD5A 4S3JA 2WNWA 3VGDA 1TR1A 3ZOAA 3MMWA 3VU2A 1FOBA 3BVVA 3A22A 3VO0A 3LRKA 3MMUA 2FGZA 2F8QA 3APGA 1GCYA 4AYSA 5HPCA 3U5YA 5LA0A 2J79A 2XN2A 3VSUA 1Q6CA 1ISXA 2X09A 3QHNA 4F9DA 2A3BA 5E6ZA 2NSXA 3DYPA 2BS9A 3RIKA 3UCQA 3W28A 2EXOA 3CBWA 1G0CA 2XFYA 4CD8A 4J3WA 2V3FA 3AHYA 4Y7EA 4OBSA 2BNJA 4D72A 1UD5A 1M7XA 2AMGA 5HXMA 1BF2A 5IHRA 1K9DA 2PBGA 3K4DA 1R33A 1JF6A 4W87A 1W1VA 1HXJA 1XRVA 5I2UA 4FNRA 1XH1A 4H41A 3L4VA 1XHGA 5I3DA 3I3BA 4W7UA 1E6SM 4WSJA 3CPUA 5A2BA 1PX3A 5ECUA 2WSKA 1CGUA 1V02E 2BY2A 5I0DA 1MQRA 3WEOA 2BVTA 2WZHA 3B9DA 5CZKA 3ZO9A 4V27A 2A3AA 2OSYA 1RH9A 4PTMA 4WKFA 4EK7A 3AHVA 2YJQA 1UYQA 3MUAA 3A47A 1A3HA 1QHPA 4KRUA 2W92A 1GOQA 4XX6A 3L4XA 4J7RA 3WD0A 2HISA 3N1AA 3T0DA 3W0KA 1J0JA 4ACZB 1QNSA 1V0KA 1RP9A 3FXYA 3O6AA 3VDAA 4LQ1A 1E4NA 1UZ4A 4JHZA 4NSBA 3W37A 2W67A 3OLEA 4F9JA 4UTFA 4V2XA 1OGGA 5DMYA 4GZIA 3WUFA 3ARXA 4RE3A 5JBFA 1K6AA 3BLKA 1FFRA 1MQQA 2Q8XA 3ARUA 3VIHA 3F4VA 3W6MA 3WQWA 2ZUUA 5EB8A 2D2OA 4GI9A 1YHTA 4OGZA 2DH2A 2XIBA 2A3CA 3WN6A 4JKLA 1NH6A 3WY2A 1HNYA 4IM4A 3AQUA 3NSXA 2GDVA 2EEXA 2DSKA 5D9OA 2O9PA 3BCDA 5CXPA 1E4IA 1VBRA 1PZ2A 4AXNA 2C7FA 1US3A 2PC8A 3WL0A 4JIEA 4J3TA 4NXKA 3S5YA 3A4XA 2EPMX 3PZQA 3DHPA 4QAWA 3RPMA 4HU8A 1E55A 3AYSA 5A1AA 3WNKA 1WZLA 1JI2A 3AIRA 4PMQA 4TUFA 4ATDA 2QMJA 1HWWA 1ITCA 4BQ3A 1TG7A 1KGWA 3SURA 2CXGA 3IJ8A 3BUQA 3AXIA 2CBVA 1RP8A 4MDPA 3W27A 3QGVA 3ALGA 3VDBA 4PCSA 4CD6A 4HA4A 3POCA 3SUVA 3DX3A 5CG0A 3DX2A 2F7OA 5GPRA 1I1XA 1W1YA 1CXIA 5A6LA 1B3ZA 1PS3A 2TAAA 4JKKA 3WD2A 4X9YA 3WH5A 1WZAA 1MFVA 4EE9A 4YPJA 3PZTA 3SCWA 2PF0A 3VSVA 3MV01 1WB0A 1U33A 3GH4A 2CBJA 3THDA 2PWHA 1ZBCA 2BXYA 1IZKA 4U2ZA 5CLTA 4D6HA 3WNLA 1JNDA 4W8BA 1HJVA 3D50A 1JG9A 1TCMA 3VNZA 4UFIA 3DC0A 4ACZA 4A3HA 2VCBA 1B1YA 1CLVA 3CC1A 3ARTA 1CXEA 1HL9A 1V3MA 5E6YA 1X1NA 4EAMA 1ZS2A 5IDIA 3VMNA 2CITA 1R87A 3SCPA 5FOOA 4URIA 4FNUA 4AZ5A 3AHXA 3CH9A 4AD3A 3BC9A 2ZX9A 1E0WA 1DWHM 3A3HA 3RMEA 3SUTA 2E8YA 3ARSA 4J28A 5C8BB 4FLOA 1W9VA 5D9PA 2WC7A 3WMBA 1HP4A 5CLWA 1W9BM 4CD5A 1GW1A 4GO8A 1E9LA 3AI0A 3AS3A 3PZGA 3RCNA 5BWFA 2YBTA 4JL1A 2WWDA 1XYFA 1ISYA 4PTVA 3VOCA 4JFWA 2VR4A 2ZOXA 2WMFA 3AZSA 3GTNA 3ZT5A 1OIMA 9CGTA 3OGSA 3CTTA 3NSNA 1A47A 1MQPA 2VZTA 4NI3A 1NARA 2J8FA 3BVTA 2EACA 3SCQA 1OD8A 1V3JA 1H2JA 3WUGA 1UD3A 4P8VA 4X0VA 4U33A 2XVLA 3TONA 4R5EA 4W93A 1EGZA 4LXFA 1V03A 3WMCA 4KRTA 4UOJA 3ZSTA 4CD7A 3ZJ7A 3QHOA 1M53A 1QNRA 5FIPA 2OW6A 3FW6A 1Z32X 2BVYA 1B90A 4FK9A 1UWSA 3TV8A 2VCAA 1C7TA 2XG9A 3CZ8A 3PZVA 4DM2A 3L4TA 4D6CA 1VEMA 1D7FA 1V0NA 2VX6A 3WQVA 3EMZA 1OIFA 1DTUA 3GXIA 1DP0A 1UKSA 3HJEA 1KR0A 2GDUA 1GHRA 3ZIZA 2EPOA 1MVYA 3U7VA 2UY3A 5JIWA 8CGTA 4W5UA 3BLPX 3H55A 2VI0A 2QPUA 1WE5A 1KBBA 3BVXA 2ZUNA 1E73M 2ZUSA 3ZR6A 3GXDA 1E0VA 4QP0A 2YDSA 3VIIA 5KZ6A 3ZT6A 2FE0A 1DWFM 3CLWA 4D71A 2CBIA 2F61A 2G3NA 3WY4A 5DT5A 1GOMA 4BQ2A 4QDMA 1OWQA 2GJRA 4H8VA 2DT0A 1KXTA 3WDJA 2UWFA 1JDAA 4DWSD 4NZFA 3KL5A 2ZIDA 5GNYA 1KR1A 1R7OA 2WYSA 4EKJA 3B8SA 1JDCA 5EBAA 1B3VA 5A2CA 4GPNA 5LA2A 3WDPP 4B16A 1CTNA 1HKMA 4PMOA 1FH9A 1GORA 1BYAA 1E6PA 3FNDA 2ZUWA 2XHYA 5BXSA 3LPOA 2UY4A 4C7GA 3MO4A 3GH7A 1QI5A 1X6NA 5DT7A 2XVPA 2XN1A 2J4GA 1S46A 4PSRA 2X0YA 4IPNB 4HMCA 4AZCA 2O9TA 2FGLA 2A3EA 4CU7A 2X0HA 3CGTA 1UR2A 3UG4A 4FNTA 3H53A 2D23A 4JCLA 4OJYA 2J7DA 1VFUA 2J7BA 2D22A 1UKPA 5FD0A 2ZXBA 3F5KA 4AD4A 3ZSSA 1W1TA 4AMCA 1C8YA 4WSKA 2WMIA 3IJ9A 1E6XM 4CUCA 1VIWA 1X6LA 3SCNA 5A8OA 5M03A 4TTUA 4XZBA 1LLOA 1E1FA 3CO4A 3AMGA 2ZXAA 2YL5A 1Q4NX 1QX1A 3BVUA 3BXWA 3TTYA 3CV5A 2C8NA 4E4PA 2V5DA 3IGUA 2CIPA 1K9EA 5CPSA 1UR4A 3DDGA 2O92A 3WQ6A 3T0BA 4W8AA 3AS2A 3EDFA 1WNOA 3WD3A 2YA2A 2J74A 5DF0A 3RM4A 1OT2A 4OUEA 3GBEA 5BXRA 4AEFA 5HOSA 1G5AA 3FAXA 3ALFA 5AC5A 1LQ0A 2E9MA 2XGBA 4MAZA 1GOKA 1HJXA 3PZNA 4H7VA 3BAXA 3QOKA 1RPKA 3AIVA 5E1QA 3PTQA 4AZIA 4UOQA 1SFSA 2C0HA 1QI0A 2WHJA 1JL8A 4W85A 3T2QA 3L2MA 1JF5A 1BGAA 4M56A 2WBGA 2JEQA 4M80A 2VX4A 3L2LA 4MDOA 1EIBA 4GQRA 5ABHA 1W2PA 2XM2A 2V3DA 1VFFA 2PBOA 4CN6A 1XYZA 3EMQA 1KTCA 4AD2A 1DEDA 3BSGA 4MTVA 3EDEA 4WF7A 1E0XA 3HG4A 1LG2A 1E71M 2J78A 1JZ5A 1V3IA 2Y2WA 2CHOA 1WDSA 1J0KA 3AJ7A 3WNMA 1CPUA 1G94A 3CUFA 2DH3A 4M1RA 3TA9A 4AY1A 2CETA 3WBEA 3DX1A 4XB3A 1AVAA 2DSZA 3W4RA 1KCLA 4K68A 5BXTA 3ZJKA 1BPLB 3WY3A 2CEQA 3QHMA 3WEZA 4LX4A 2E3ZA 3WSUA 1EXPA 4D6IA 1V6VA 1EA9C 1MWOA 2WVSA 1VFMA 3CUGA 1ZU8A 3AXHA 4YHEA 3RJYA 4LYPA 3EJTA 3W82A 3WD4A 3UR8A 3ZR5A 3VGBA 3D52A 1E4MM 3T2PA 2PWFA 5D8WA 2G3MA 2X2YA 1W9PA 5A6BD 2OYLA 3LRLA 3GNRA 1O6IA 4D1IA 4DWSB 5CPQA 1ZJAA 1TVPA 4MNLA 4E8DA 4JFSA 2VQUA 4ZEPA 2ZX6A 4PTXA 3A4AA 4MPKA 1QHZA 2F2HA 1JYWA 1F4AA 2O9RA 4MB3A 5JUVA 3E1F1 4E8CA 4FLRA 2XYLA 3WF3A 4CVUA 5HDRA 2GSJA 2WMKA 3AIEA 2CCRA 3CZJA 1QBAA 2JIEA 2W5FA 3GXPA 2XJ7A 4DUWA 4J3SA 1J0YA 1TQTA 3BSHA 3WF4A 2BVDA 2E9LA 1KBKA 4WIWA 1HL8A 1TE1A 2DPEA 2XFFA 4XUYA 2E4TA 3PZ9A 5M17A 1UWTA 2EPNA 1DWGM 1IT0A 1CGXA 4J3UA 3N04A 1EHAA 2CPUA 1HKKA 3EMCA 4JFTA 3EJPA 2DIJA 3KE0A 3VGGA 1CECA 1PIFA 3A6OA 5CGTA 3EYPA 4WKAA 7A3HA 3EJUA 2EPLX 3IJ7A 2G8ZA 1KWKA 1W9UA 2WM0A 2WLZA 4BCEA 3MI6A 4MB5A 4P7QA 1W3JA 1NM9A 4DM1A 3W24A 4HOWA 4C7DA 3W6LA 2X2JA 1M01A 1HIZA 1QI4A 4Z2LA 3WH9A 2DSWA 4U3CA 2EADA 1QVBA 4ZXLA 7TAAA 2WZEA 5I6SA 4GZEA 2XGIA 4CGTA 4ACYA 4F66A 1T0OA 3W38A 4P8XA 1UQYA 3ARPA 5JBDA 3POHA 4HPHA 1TZ7A 1PAMA 3VM5A 5EMYA 2OSWA 2VRJA 1ESWA 2YA1A 2XVGA 4P7RA 2QHAA 3T08A 3RO8A 2DIEA 4X0NA 4BQ4A 2JE8A 1Q6EA 1HKIA 5ABFB 5CQ1A 4J27A 3K8LA 3RILA 2YA0A 6A3HA 1UR8A 4DWSA 3OZOA 3VKKA 4HTYA 3U57A 2QPSA 1GQKA 3VMOA 4UZSA 1VB9A 2YL9A 4B15A 1VF8A 3WD1A 4UFKA 1CGVA 1EDQA 1MFUA 3AISA 5D9NA 3NSMA 3CZLA 4PTWA 2J25A 2RGLA 3DYMA 4V28A 1QOXA 5A6JA 1CXHA 3I3EA 1NWSA 3ZMRA 3AZRA 4W7VA 4DUVA 3MUY1 1CXFA 1LL7A 1JFHA 3PZUA 1VJSA 4UQCA 3MSGA 4ZFMA 1CIUA 3II1A 5HNNA 1CDGA 2J7CA 3PHAA 4HZ7A 3CIVA 5D9MA 3WENA 3VGHA 4BS0A 1BG4A 3A21A 1AQMA 4AYGA 2XVNA 3AIQA 1I75A 4ZE5A 4W88A 1UKTA 1ECEA 3IANA 3OA5A 3RM9A 4PMXA 1KTBA 1OBAA 1MW0A 4AZ7A 4OZOA 1JXKA 1XSKA 4UQ9A 3WDRA 4MJ4A 3BAJA 3DHUA 5TD4A 2OWWA 3N12A 3AS0A 3RM8A 4CCEA 3EDJA 2WKGA 4N42A 2EABA 2GK1B 1E40A 2EPKX 3T2OA 1R46A 3AYRA 1C92A 2Y4SA 2V3GA 3LRMA 2JF6A 5AC4A 5HBFA 2GVYA 1PPIA 2QV4A 1WCGA 2YL6A 4FNSA 2A3HA 2GFTA 3S6TA 2ZX5A 2PWGA 3SUWA 4JAWA 4WKHA 4GZJA 1GVIA 1R7AA 2DDXA 5FL1A 2WCSA 1P6WA 1CEOA 2MANA 4JL2A 2FH8A 3PTMA 3VINA 4JFVA 1GZJA 4Z2KA 4MJ2A 5ABFA 4AZBA 4UOZA 2V38A 5ABEA 2D73A 2JEPA 4GI8A 2XWEA 3UESA 4RL3A 1VRXA 1PEZA 2ZWYA 1UQZA 2YBUA 5E70A 5A6KA 3L4WA 3WF2A 1E4LA 2BHYA 4DO4A 3MANA 1HTYA 3A24A 1W9XA 4GO9A 3AIBA 3WH6A 4UQAA 2NW0A 1W9DM 3WKZA 5A6MA 1Q6DA 2F7QA 2GUYA 4QLKA 2F18A 2ZUVA 1EO5A 3MV11 3OBAA 4AZCB 3VSTA 2Z1KA 3VM7A 1B3XA 1EQCA 3AHTA 3BH4A 5IFPA 4JCMA 5ABGA 1UD8A 3HG3A 1V6YA 5DFAA 3S5ZA 1ZBWA 5AY7A 3MKKA 5E09A 5BRPA 2GJXB 2WMIB 3AS1A 3CUJA 1UR1A 4WK9A 5C71A 5M3WA 3SCTA 3ZJ6A 2JIWA 2WHKA 4Q7NA 2D3LA 1VEOA 1C8XA 4UQDA 1UWRA 1C8QA 1HJUA 2EBNA 1W3KA 4IPLA 1BVNP 2WW5A 2W61A 4PMDA 1FH8A 2WXDM 1FH7A 1GQJA 3WUEA 1UHVA 4CCDA 4KH2A 2BY3A 1J10A 2J8GA 5A6BA 1QBBA 5LA1A 3VILA 6TAAA 4UQBA 1E6ZA 4AIEA 2GK1A 1JYXA 2CERA 4PMRA 2ZUMA 1C3FA 2E9BA 3CUIA 4AZHA 3WQ5A 5A8PA 3GYCA 1H09A 1FA2A 3BMVA 2Y24A 3MSDA 6CGTA 4W8LA 2IXUA 1BQCA 1GHSA 3VMPA 1JGIA 1H49A 3AIUA 4AW7A 4ATLA 2YDRA 3RJXA 1E43A 1MYRA
chains in the Genus database with same CATH superfamily
4JS7A 1DJIA 4P4KB 2AOSA 1IKFH 2OCZA 5ID0A 4H25B 1HL2A 3EX2A 5AOZA 4FOJA 3N9KA 4UMSA 1A4KA 2OZ4A 2WMHA 3VXRA 4DYJA 3GNOA 4K3DL 1K1DA 2G9HB 1UADC 3HMCA 2DQTL 5DD5L 5JMOC 1NFBA 3RRXA 5E1AB 3CL6A 3P6LA 5AWNH 3J7HA 5IGXH 5JNYB 3RI5F 4V1DD 4Q7DA 4E4FA 2X5PA 1E3XA 2MQCA 3LDBC 4YHYC 1MIEH 1MEIA 2HH0L 1JNEA 3S2NA 4A6YA 2VVNA 3UIZA 3WD5H 4B3ZA 4WI0B 1KYDA 1ZAGA 3S3DB 3TN3A 1UUQA 3SHSA 3WIJA 4IU3A 1Z41A 4U6YA 3TYGL 3QUYA 2IQAB 4PC8A 1GJWA 3VFTB 5F4XA 1ZJBA 3VFOA 4Q4PA 1JXDA 4ERIA 3UR2A 4K73A 5F88B 5KTEH 2NXYB 4ONFL 4QXUL 4OCSH 5E1IA 1NANI 3QZOA 3AB0C 5F1IB 2ZE3A 5A8NA 5J5EA 2Y0SA 4HVXA 2POZA 4NO3B 5EOCJ 2G60H 3ZM8A 2BMBA 2PDLA 2WWKO 5DJ0B 4PRAB 2D20A 1ZP4A 3R06B 1JDFA 2IMMA 1I1AA 4OGXH 2FWSA 1K9TA 4MQXD 4F7TA 5JOFA 1AACA 3L67A 2W81C 3RYMA 1ISWA 3BAWA 2A1WL 3K5XA 3N2BA 3EO9L 5EBGA 1F7BA 3VGFA 4M4RB 2AQOA 2EXTA 2Y88A 4YXHL 2IXVA 1NCJA 1Z9OA 2QEJA 1MWAL 2Z8SA 2AEIT 2H2SC 3UIYA 3O2DL 3H9SE 5FAAA 3MNVB 3P5YA 3RL2B 3QH3B 4QE5A 5FW7A 3SJVB 3B9EA 4NBZB 4IHOA 4Z5RA 4CC4C 2BWQA 2G4EA 1ACYH 3SKMB 3MCNA 3UZVA 3KXFB 5JDJA 1SYTA 5D72H 1RLWA 3K2GA 4K0OA 1YRKA 2OSXA 4ZQMA 4Z7QF 3G6MA 4F7MB 1AFVH 4R7LA 5AW6B 1UM4L 1UIOA 3F6JA 3QPXL 1AD1A 3SZKC 3H4FA 5DZ9A 1DBTA 5D2LB 4N87A 5AVVB 3SIZA 2MOQA 4XMKL 3O3RA 5LDSA 4U3XA 3IAPA 1X3DA 4HFUL 4GUHA 4XO8A 2B3IA 1KXHA 3NJKA 2A7RA 2H1XA 3LXUX 3U4EA 4PGCA 1W5OA 5HYFA 4LDCA 4KQNA 3R18A 3NJJA 1ZK5A 4E2VA 1I9RL 2E0PA 3VIKA 5J6GA 5L0QB 1SPDA 5AOLA 2GK0B 3VGEA 2BNUA 1TMQA 2VN7A 2HT2D 4GRSA 5FUZL 1RERA 4X7TA 1WAWA 4XGZB 3PNZA 2W4XA 4ADTA 4EBQH 4PD4J 1OP3H 2QIIA 3S96B 2HWZL 3RWEB 3HC2A 2OW7A 1SJVA 2PWEA 2WZIA 4EXAA 3PE9A 4PN2A 1T5XB 3FT2B 1J8HB 3DX6A 2ESVA 2VC9A 1DKWA 1EDGA 3QFDA 2HUHA 2NNRA 1YEGH 4HDIA 4PBDA 1C93A 4RFNC 3GTFA 5LBSL 4MZIA 5EUOB 2QR0B 2NLJA 2Q9OA 4GKLA 4U1MA 4L3ED 1GRWA 3DBXA 3MBEA 1PY0A 3L95A 3ZX1A 4PJBB 1JQXA 1D5ZB 5EY5A 4X5PA 2JI1A 4FQCH 1F6KA 1AOHA 4FF5A 1SJDA 4GAJL 3FN9A 4HJWA 4WK4B 2QGHA 1M04A 1S7XA 1V0MA 3R0DA 1VFTA 2AJSL 3BOFA 3BHBA 3P8JA 3GT6A 4PJFE 1LP9E 2ZP9A 2XVKA 1A7RH 4GH3A 3Q2DA 1H0IA 3WDIA 1ASPA 1UOWA 3CZKA 2QQ6A 5C55A 1G5GA 4Y2DA 4FG6D 2ACQA 3HZVB 3WEAA 5DQDH 3FV9A 2E6PA 2LVEA 2WKOF 2HVJB 4KKZA 4JZ5A 4CD4A 1HL5A 4X4ME 1ZSHA 4EF8A 3APNA 5K9JL 3OR7A 2BY1A 2NLYA 3N19B 4BQ6A 3ROLA 4GYPA 5FI8A 4I18C 4NJ9H 4KCVA 3K3QA 1MG2C 2QDWA 2BP0B 4DO7A 5LHFA 4HNVA 4JYEA 2YQBA 2HSAA 1UA7A 2NX1A 3MCG1 2A7PA 3TE9A 3FFCA 1EEZB 4NO0B 2KZWA 4U1LA 3FU7A 1OGAE 4IMAA 1UYWL 1OZQA 1YLBB 1A3RL 3NRPA 1NEZA 1SQ7A 1UD6A 1R24A 3QIBD 2WNZA 3HPSA 2HB0A 4AQAB 1ACXA 2J8HA 4R26H 4YK4C 4PJAE 5LQBH 3Q06A 4XCNB 1NMCB 2VIRA 3GYEA 4QRNA 1MCHA 1N0LA 3FKKA 1P0DA 3H9HA 1I7ZA 2BNRE 4AGMA 5I5RA 5KJRH 3GLZA 3LD5A 3SGDI 3SPHA 1KQYA 3CASA 1PLBA 1D5IH 1CGYA 4Z9KB 4UTTC 4FKHA 1XCXA 3WL9A 3VCCA 5FWRA 4O1EA 2DY2A 4NZ5A 2M8XA 3CCHA 1XIJA 5DRNB 4I7UA 2OYKA 3FO1B 2ABAA 4M6UA 5IB4B 1HJSA 2HT2C 2R1WA 2J9YA 1A5FL 1F4HA 5DS8B 2BWIA 4C56E 1SM3H 5ICZA 4GYKA 4UTKA 4FFYL 1MY5A 1VFAB 2O4QA 2QAFA 5FO9A 3UC0L 4CMHC 4HPYL 3W87A 5DLLA 1KGIA 3QPKA 3D18A 2LTQC 3QG7L 2Z2UA 4LBEB 3DX9B 3QBTB 2P5EB 1KNOA 5CIPB 5J9PB 5MHSD 1TTCA 4K7VA 3E6FB 4LVNB 5HGGS 5D30A 5B1CA 1X9QA 2FVNA 4ESKA 1RHHB 1Y18B 3FFOA 2NV9A 5B39G 2B1HH 4Q4KA 4YIQB 3EB3A 1V4YA 3ULVL 1Q8JA 1SR0A 3ESNA 4K2SA 1TZHA 3P4OA 4L4TA 1LDPL 4AK2A 1S5HB 3MBFA 1OAKH 1HGWA 4B50A 5T3ZE 3D5HA 1DIOA 3AAZB 4EPSA 1IJNA 3ZL4L 3HN5A 4IH3A 3RZWA 2VWTA 3PNRB 2QHRL 4E3VA 2ZNXA 4L4VB 4YYFA 1AD9A 5I77A 1U21A 3NJGA 3B8TA 4DW2L 6TIMA 3GX9A 1A66A 3FYOA 1XIEA 4GG8A 3CN1A 3EEGA 2A6KB 2LLGA 4FG6C 5TQ0L 3NG3A 4MKVA 3PWNA 3ZOAA 3BVVA 2OOFA 3RWFB 2DWSA 1EZSA 2IPUK 1IR2A 1USZA 2COQA 2X4QA 3QDMD 2R1XA 5E6ZA 3AY2A 5EIIG 2OMYB 3OF6A 4RUBA 3W28A 2Z2BA 3W6YA 1QO3B 3TNOA 4J3WA 2WXMA 1XQKA 1JJUA 5IHRA 3K4DA 4HCGA 4Q74A 3G18A 2AEOA 3QIBC 4UMGA 2QGDA 1XHGA 1HG3A 1C12A 2R0ZH 1PX3A 3PWPD 1CGUA 2D7NA 4Z0BH 5I0DA 3HLKA 4JYDA 5CZKA 2ZRXA 4FNLH 2W9DL 5EU5B 3UFYA 3VYLA 4KQ4L 1QHPA 5CSGA 3ZK0A 4KRUA 4LVBA 3KLQA 4Q4QA 5EU6E 4QRAA 2KQMA 3K6DA 1R3HB 1IGJA 3VTAA 3I7RA 2FZ3A 4IIQB 1EGJH 2JXMA 1XIWB 1MQQA 2Q8XA 2E3VA 4W9TA 1ELSA 5EOQH 4OGZA 4UTJA 1VCVA 2HG0A 4ZX3A 3FB5B 3L5HA 2XWCA 3MRBA 2LU3A 2X41A 3T6XA 1OW0C 3VG0L 3GK8H 2DEXX 4XPGH 1NDYA 3LS9A 3PZQA 1K8DB 3W2DL 4QAWA 5BVJA 2BX7A 5TGBB 2WHVA 4WD0A 3WBYA 3UTZB 5E2WL 1PTDA 3TN4A 1TQBB 2GSIA 1E2WA 2OTPA 2C7UB 2C9AA 4HX1A 1HE8A 1YY9D 5I8KH 5FOBA 1KA9F 3KTSA 3B05A 5IQOA 1KYOJ 1UWGL 3MR9B 3QFJA 3G5XA 3U36A 4X9YA 3ABGA 1DE4B 3MUUA 4IOSD 2V8ZA 4OIIL 2PWHA 5CLTA 5CEWA 3KVKA 1KLFB 3VNZA 4ACZA 1EWHA 5CM1A 1HL9A 1V3MA 1A7NH 4NUMA 4WWKB 1AH3A 3TURA 3RMEA 4GRWH 3GDRA 5C8BB 3GYRA 2YXMA 3SBQA 5CLWA 3OYZA 4GO8A 1MI5A 2F53D 2BP8B 4JNMA 5HANA 2DKUA 3IDJA 3H4HA 4LT7A 2R1YB 5F7LB 1ZHAA 2EYTB 5F2FA 1ISYA 3O2VH 3GTNA 2NMSA 4Q4IA 2OL3B 2YD3A 3O9WB 4AY7A 1NARA 3LB0A 2DICA 5I1CL 3QA3A 4X7DC 2YCLA 3WHXA 2W8CA 5BO0D 4TQIA 1U3YA 5A5WA 3RG6A 2LFEA 2WJDA 1FNAA 1QPNA 1U8OA 4U1GC 4FK9A 1NGYA 1JNNL 3JQOB 3L4TA 3X1NA 3LQAC 1YTKA 4N0CD 2XY1A 1ONQB 3G3LA 5J06A 2CKBA 3C6LC 4JTDA 3V16A 4JY4B 2I60L 3VXMD 3ABZA 2GZXA 2CBIA 4GNJA 3BDKA 3HQ1A 4XNZB 2CZDA 1UATA 3I2CL 1GGBL 2J3SA 2OEKA 2Q7YB 3LKQA 3B9KD 3RTQC 43C9A 3VOFA 5TNVA 5PTDA 5AKVA 3TSBA 1LO4L 1T22A 3EYQD 3EH4B 3U4FA 5GZOD 4EI5C 4H6EA 4N25A 2LU5A 1ZHBB 2Y06L 2XJLA 1UMYA 4J2QA 3F8UB 3FFDB 5FD0A 4Y2OA 4KKPA 3I7SA 5BXFA 2C15A 3APYA 1TV5A 1W3NA 1KZQA 1SYSB 2XU9A 1JE6A 4LCWD 3S35H 4K4KA 3QF0A 3LCXA 3AMGA 5HQMA 2GBTA 2GK2A 1QRQA 4A8LA 3G3MA 5D7KE 3V4PL 1E5UI 5FA3A 5MP6H 3KRSA 3FUFA 1QKZL 2V9RA 4OFYA 2XY2A 4IXHA 5A7EA 2B2XL 5CP3H 3D8MA 3DU0A 3LQMA 2V7NA 1MFBH 2FJFB 5D7LA 2PDFA 4FA7B 2XWXA 3BAXA 1G9NC 4LCCB 4F80A 4PB0H 4NIKB 2OKMA 3Q7JA 2EIKB 3KYMA 3OJ2C 2ZG1A 1AKPA 2XM2A 1VFFA 2ZF9A 4E4UA 3TK7A 1OK0A 3P9MA 2CUAA 3QRHA 3C5ZD 2VABA 3EDEA 4KIRA 1RUKL 4WOZA 4BK5A 1V27A 1AGCA 4QITA 2QPEB 1IEQA 2IG2H 3C09B 5HHOE 5ABAA 3NPZB 3ETBJ 4M7SA 3OR6A 2ARJB 1NCGA 1U8QA 2E3ZA 1C5BH 1MNZA 3WSUA 1Q38A 2LOEA 2D31B 3GEWB 3ZZSA 3BISA 2OP4H 3EJTA 2OYLA 1Z9MA 3R58A 3EJYD 1TVPA 1CZ8H 1NUFA 2DLHA 1S78D 2EE9A 1FTXA 5I5MA 2BH0A 5DMIL 3K80A 3VCLA 5TF1L 2XISA 3DTDA 2XRAL 4CVUA 1A6TB 3U9IA 4F8QA 2AJUH 1WCBA 3LNIA 3V52H 1R9YA 3GTVA 5I15L 4R97C 1PLGH 1BECA 2I32A 2WMPB 2B15A 4XUYA 4N02A 2R82A 4P3DA 4J3UA 4AGOA 4HUMB 3FUEA 4OUUA 1SFHA 2HK1A 4CSSA 1QLEL 4FYRA 4AQEB 1ZRQA 4CC4A 1UCWA 1GKOA 2LU4A 4BYHA 4DPAX 3WG7B 5E7BA 3GVWA 1FV1B 3ULSB 5I16A 4Y5VB 1MOEA 2DSWA 1ZSXA 3B9KC 3MLWL 3VI2A 4ACYA 2MOVA 2C1OB 4WW2B 2FIKB 5B7ZA 2V68A 2XETA 3PHQB 3ZR4A 5GZOC 4NKDA 1BD2B 4P7RA 3GHBH 1Y07A 1Q6EA 3RPBA 4HIPA 2XBZA 4PL1A 5IHWA 4HJJH 4XO9A 2ZPKL 3KVJA 1IM9A 3OAZK 3O1NA 1MFUA 4G59C 2V5JA 3PLYA 2X6UA 3I3EA 4TPRL 2Q8AL 4DUVA 2GOKA 4JN2A 3CH1B 3B5TA 3WXWH 3SM0A 4O8AA 4NAMA 1CDGA 3G0XA 3CBRA 2E5EA 1PYWA 2Z92B 3CPLB 3I9IA 4HT3A 1RUMH 4CQBA 5ALCH 1DBJL 1K8CA 3QZPA 2Z4GA 3QNXB 4KHTL 2DDQH 1I1AD 3GDMA 1PG7W 2V8MA 3MUHL 5FGBC 1I8KA 4JN1H 3NTYA 2E76C 2YMOA 3LKRB 3IGKA 1JPFA 2DWYA 1C5DA 1ZIAA 3KHJA 2OMUA 2DI8A 3GSWA 4ZMWA 2GBVA 5GGQL 3UY7A 3ZKXC 5CSZB 3R7MA 5FL1A 2V37A 1HH9B 2F5BL 4QF1B 2MANA 2FR4A 4OSUH 1FHGA 1FDLH 1H7NA 4XCCH 1EZ2A 5CGBA 4HJ1A 4AITA 2BOFX 1PEZA 4M7ZB 5DTFA 1GGIL 1E4LA 1HTYA 1SJXA 3I6LD 2FPVA 3ZDZB 3FULA 3OBAA 5IVNA 4NHUA 1B3XA 3B3IB 3T3ME 3EWDA 3EJYC 1CC3A 5IQ7L 4HPXA 1Q94B 2PCXA 3AS1A 3FN0L 1IEXA 3VXNA 4HSQA 4Y1SA 4MDJB 3BJSA 2LV4A 4RETB 5HGHB 2W61A 4NZTL 3ZQXA 2BY3A 1YDNA 1EX1A 1WUFA 4QRRE 2J66A 2QIWA 4AIEA 3ME0A 3GIQA 2ITFA 4IMLB 4GIPD 3T0EE 3AXLA 3GDTA 1YNLL 4KX7A 3MCLH 1JCKA 4S2CA 4YL2A 5F21B 4ATLA 5HYJD 3GMNB 3C2VA 4H00A 2Z6JA 5EZLA 2QVMA 5JBEA 3RJQB 3FAWA 1GYMA 5MI0B 1A6WH 2EPHA 4APXB 1UH3A 4GRMB 4AMWA 4IRSB 3LXAA 4JPWL 1BYBA 1ZPTA 4C6CA 2JFEX 4PMZA 4YHPA 4U28A 3UPWA 3LV6A 2IBBA 1CURA 1MSSA 4GMTH 3IKCB 5FGSA 2R4RH 3KYAA 3KJ6L 1GZGA 1WIOA 1E4XI 4ZMPA 5I8EA 3TXZA 1YW1A 4BH8B 4DN3L 3IRZA 2ESVD 5D7IF 3DETD 1W17A 3NSYA 2X38A 2X1XR 1T21B 5C0DA 4GW5A 1KDJA 4B9ZA 2JCCE 5CEXA 4IQLA 2FAUA 3EF4A 4NQCE 3F7YA 1S6NA 4UTTA 3LMZA 2X88A 4L6DA 5FYKU 4NQCB 3L3IA 2R2BA 5HHVH 2DTMH 3MBED 2NUPA 4R27A 3ECBB 4X2PA 3WUWG 2Q6ZA 3Q2CA 3A3XA 1TJ2A 2DMCA 5I19H 2P88A 4H7CA 1I1AC 3MODH 1ZS8A 3B7RL 3I6TA 5CCGE 1MFDH 4LUIA 5CKGA 1AKJA 4QOKA 5HTSA 2VYOA 5HVWA 3W7OA 5BW6A 3JVFC 4ZENA 1P7KA 1FFNB 4YDMA 2KH2B 2UV3A 3BSZA 1M2VA 1RULL 4QXTB 1IIGA 5IHUL 4NZCA 1F4WL 4X98B 3GHUA 2FSEA 1QW8A 3NO5A 4ZMVA 4YDJA 5HD8C 1AQHA 2W1NA 1IAIH 2B31A 5FF6B 1RY7B 4O2CB 4EO5A 3WZ0E 5AB9A 3ZFHA 2NCEA 5KW9H 3SI9A 1VFOA 3ABKB 4KRLB 3RWDB 3ELQA 1L2UA 1TZ8A 4LF2A 1W2VA 4PRNB 4IDLA 1FYTE 5I6KA 1TJMA 1TLKA 3S6CA 4HC1H 5BZXA 3NJVA 5D2TA 3FFCD 1NCWH 4TOQA 4YWGL 1YJDL 4GJJA 4DOHE 2Y2YA 1RUAH 5KSBA 4HCIA 2EJ1A 4NX0A 4IPJA 4NO2B 1IGTA 2WJZA 3I50H 5C70A 1TVBB 4A7GF 4GAFB 2DMGA 1LO3L 1BHGA 2YWYA 3AUVA 3STCA 4TQHA 2NY1B 3IFPB 5FM4A 3OAUH 1W32A 1AFSA 1RD6A 5TK2A 3FUKA 5ECJE 3NGBC 4F58H 5I6PA 3FJ4A 1VADA 2MJWA 2HLFD 2VISB 3HNTL 3E9TA 2YSTA 2RA1A 2E27H 5HHMB 2VW4A 1XF1A 2HX9A 1HXYA 3T3PF 5CBAA 4P5MA 4GAGL 2Y9RT 2XA8L 3STGA 4NNPL 3SY6A 5K3VA 3SD5A 3GWQA 3F7VA 4RWYH 3N1FC 3B0PA 3IJYA 4JFFE 5C9JB 2ZZ5A 4B3VA 4ZW8A 4BFGA 2GQ3A 4LLVB 1XINA 5D7JB 4YVVA 1CFTA 3TSDA 1K3ZA 3TNBA 3AMKA 1TZGL 1KY6A 2UYLB 3QCTL 1CU4L 4F2FA 3S8FB 2Q76B 4XAPA 3DETC 4ZSOE 3NJFA 2VC2B 4LDLB 1FWAC 1MUCA 5EEZA 3VXTB 1ZCOA 1S7UA 4ASTA 2ZWZA 4XC1L 5HHNB 4LGRB 4N0FB 4PJ8C 3ZUCA 3HMXA 1AH1A 5A2AA 3M43A 2P8MA 1L6XA 1SJMA 3EX1A 3TJPA 3HZKA 3WO8A 2DMKA 4L4TD 2FH6A 2ZXWB 2A6DA 4BQ5A 1YUKB 4LBAA 4LB3A 3LTVA 4M3JA 1HC1A 3G5YB 3TWCL 4UFJA 1KTKE 5TPWL 4YVNA 1JXGA 3JXAA 4PP1D 4XVTH 3MZTA 2OO0A 4G9FA 1ACZA 3U9UB 5J4MA 3H2MA 3DXIA 3JYCA 3OG2A 4LLUA 5HJ3A 3AACA 4HCDA 4ZTXA 2C1PB 5FYLE 3TQ0A 4GXPA 2AK4B 5FF0A 4P2RA 3HPXA 2IPUG 4KKAC 3BP6A 1BJMA 1H6TA 4Z1YA 4KESA 4GW4A 4FQ2H 3PQYA 4GP8B 1UVQA 4FB7A 4WJXA 1W1A1 1B3IA 3OF6D 3OPUA 1U8PB 1MCSA 5TQLA 2R8SL 4FQLH 4MWAA 2VRKA 1SW0A 1DVFB 3SDCB 4LH8A 4GXUN 5ILTL 3O11A 3VXPB 1RPUA 3P4LA 3EBVA 3VFSA 2VZVA 1CYWA 3WFHB 3U6RA 3O3DB 4ALAL 1IBGH 3PBWA 3FB8A 4KIEA 8XIAA 1GTFA 4HT1H 5AW9B 3NZGA 5J12C 4ZO8A 4PJGB 5A2IH 4N9BA 4DKTA 5GGSA 1AZRA 1SEQL 5CJOH 4AZ6A 2HLFC 2D1ZA 4LYQA 3QYSA 3CX5K 4LVAA 2R59A 3UJSA 4UIKH 1R17A 1NDVA 3JWNE 3STLA 1IC4L 2QV2A 1E9OB 5H8UA 4Y88A 3UXKA 4HSNA 3C6LA 3FJTA 4KOCA 4TQTA 1G7HA 1KYUA 3RWIA 1S9WB 1O6SB 3GJFB 3NQDA 4W4QA 4HZ6A 1JRHI 3WQ4A 3DRTB 4NVTA 3OAYH 1B4TA 2JKJA 4LPUA 4JDBA 1A6UL 2X70A 2BSDA 2Q3AA 3JWOL 2GPTA 1YEJL 2G5WA 4UCFA 3M47A 1L9RA 2ZICA 3QFJD 3BOXA 3RTQA 3VFPA 1U91A 2WCAA 4IX2A 2CHRA 4GY4A 4NDMA 3UGUA 2BSRB 3HG5A 1MRFH 3VAEA 1GQIA 1QRKA 4ZFQA 2ZXQA 2V82A 2EDWA 5A6AA 4EI5A 4YHZH 1S2CA 3APFA 4NNYB 1XGZA 2WSYA 2X1IA 2IS7A 4N2MA 3AFBA 5TDPA 4HQQH 1X5YA 2BJML 5B38A 4ZJ9A 1KLGB 5DVPA 1CZ1A 1U83A 2HJFA 3DI0A 3COTA 3TAKA 4H13C 4PP1C 1MI5D 2NPLX 3K6SA 3MHFA 3MRRA 3USBA 3N4FA 5I1EH 2VXUL 5EU7E 4HUWA 1D9KB 1JHTA 4Z2JA 5CC3A 3D3FA 4M00A 3BRGC 2EHHA 3SOBL 5LG6A 3ZDXF 4LIQL 3MDWA 4KCWA 2OFJA 1IB5A 1BQHA 5DCEA 3LSOB 2DQIH 4MAYB 3BEVB 3HQPA 5F3HA 4IIBA 3CPRA 5G4EA 4N0RA 1T1XA 3BAEH 1GPFA 1SQMA 3NUKA 4MFHA 2HVBA 4QT5B 4GEJA 3FTYA 4Z2GA 2I14A 1WYIA 4OM1H 3BAYA 3DXAB 2WNWA 3VGDA 3STFA 1FOBA 4JY8A 2AK1H 1MH5A 5HPCA 1Z9SA 1A21A 4G7EB 4GKNA 4L8DB 5E00B 2CGRH 5T3XH 1YEFL 4O19A 3NVDA 2V17L 5DHYB 2V3FA 3ZYZA 1YTDA 5HXMA 1K9DA 2A9NH 1ZK9A 2DEYX 4OAWB 2MKWA 2VFHA 4GRWE 3MBXL 3BW2A 3MLSH 4NRYB 3TBSB 3WTVA 1QU4A 3LHPL 4N2BA 3B2UD 5FOJA 2X4RA 5IJKC 1QUMA 3MREB 2F7FA 2XIJA 2W92A 3WD0A 1YDPB 1O4UA 3W0KA 1AMKA 4YVUA 4HULB 1OFPA 1SO4A 1RP9A 1MJJB 4X7SL 4RZ4A 2RFXB 3VI3F 5IVXA 3GBML 1GYAA 2KZ1B 4EI6A 3CH0A 4JFHD 3D3VD 4IFOA 2VN6A 1FFRA 3ULAB 3U2CA 3M5XA 5C97A 3WXVL 1QSEB 2LVCA 3DFPA 1R1CA 2KLTA 5D9OA 5FYJL 1A5NC 4NAFA 3WK0A 1YN6B 1R3IL 2PC8A 4X4XB 2XWBA 1HZKA 4BXSV 3A4XA 4OFYD 5J0BA 5I18H 5AYYA 5JHDB 4G8GB 3LNMA 5D7LD 2OR7A 2TMDA 4TUFA 4JR9L 2KZBA 3KS0H 2CBVA 3TBBA 1L9MA 1BM3L 3FJNA 1TIMA 3DX3A 1I1RA 3BKMH 3ITTA 2BIOA 2ROXA 3U9PH 1VRDA 1J9RA 5DT1L 1G9MH 1N6UA 4W6WB 3MX0A 3PZTA 3BL3A 3BQ5A 4IOTA 3V4VB 2EECA 1KJVA 1JHKH 4X7CC 2PU0A 5DUBB 1ZBCA 5T5FA 2ENPA 1HJVA 2BOBB 4N2FA 4K3HA 4RRPG 3O3EA 4IOFD 1I3GH 4L29A 4A3HA 2AGKA 2F19L 1O5DT 4UZGA 3SCPA 3VKJA 3GLEA 3O6YX 4HJGB 3KR3H 3N2OA 2FEEL 1E0WA 4U1KB 5LCVA 1EEPA 2OULB 3TYFB 1W9VA 1S3KL 3DO7B 5C6TH 5KAQF 3RG1C 1GW1A 2E77A 3AS3A 1RQBA 3RUGF 5I1IL 2BP1A 3CTTA 1I8AA 6FABH 2G0WA 2ICES 4Q8BA 2F5AH 2I5YH 2WZTA 2Y7EA 4GUOA 2CUHA 5FIEA 4P59H 3VFVA 2ZUQC 2F2KA 1EBAA 3S4SA 1T7VA 4P5KB 3ZJ7A 1M53A 4HF5L 5C0RL 1MLCA 5D1XA 4MMYA 1I60A 1IWPA 1Z32X 1AH0A 3GFUA 4G6JL 2VCAA 2R0WL 2X4NB 4LRNH 4LV4A 1AE6H 1UMLA 5ETUA 3N4AA 4CQDA 5B1KA 2VDMB 1BQGA 3M8OL 1SN5A 3HJEA 4N2AA 1QPRA 2J4WH 2EPOA 3GK0A 3KLAA 4W5UA 3CB8A 4RXGA 1YPXA 1R19A 2E6FA 3HA0A 2HLAB 3CLFH 4Z7AA 3B2UC 1E9QB 1W8NA 4OFQA 2F61A 3CSPA 1DCEA 1QR1A 3ANVA 1XWYA 4JFEA 1DIEA 1YPFA 3EG9B 2D3VA 5E24E 4JZOA 1GYWA 1KB5B 4ZOBA 2CIIA 1XWVA 5DYOA 3OJDB 1QMLA 4JDZA 1AQDA 4Z7NF 5EBAA 1B3VA 1IM9D 5D32A 2FX8L 4QMEA 2ZOLA 3SQBA 1FH9A 1KFLA 4GVFA 2XHYA 1KTDA 4WGXA 1YNTB 3GH7A 3PFQA 5EU3B 1ZALA 2Y36H 5C08E 2J4GA 3M0XA 4GH7B 3VI4F 3SE8H 2GWGA 1P4BH 4BRVA 2Q86A 4CU7A 1Z7JA 3AQYA 3H53A 3FRPG 3A4JA 1VFUA 3MNWA 1KFEA 5DANA 3CMFA 4N8CL 4AMCA 4WSKA 1RZGB 4AE0A 1CD9B 3PUOA 1X6LA 4DAGL 4Z42C 2VUKA 1T7YA 3QPEA 1TEFA 4XZBA 3WK2A 4OHQA 3FL7A 2BP3A 2EDTA 3OPZH 5FLVA 2E9WA 1FZKB 5FKAB 1TV7A 3PWUA 3CXFA 4DGVL 4BSWB 2FK9A 2C1IA 3IGUA 3V0JA 4K8GA 2UUDH 1NAKL 4JO5A 2OMTA 3L9RA 5JHLH 1K77A 3RM4A 4RMTA 4OT1L 2WBWB 5GRVL 4MD0B 4Y90A 4BK5C 3X12A 4J40A 2E9MA 1BBJA 1MNUL 3VABA 1LEGA 4NBYB 2ZKMX 3HVNA 4IOFC 3AIVA 2GIXA 5E1QA 4NQSA 1JL8A 4ZW6A 3O8XB 3L2MA 1IWAA 3LN3A 2DU2A 3V8OA 5B8CB 1E0XA 4XBEL 1INQA 4N8UA 3B8VA 1UJ3C 5LIYX 1I1CA 4F9LA 1AGDB 2MNWA 4AZ8A 2OMXA 3G1VA 3WBEA 2FZMA 2CO7A 3DX1A 4HK5A 4A2LA 5C07A 3UJTL 4GJ1A 1JCXA 3DKLA 5ABTA 4D6IA 3DBPA 2FJSA 2XX0A 3ISWA 4ZTYA 1SDDB 5AZ1A 3KOFA 32C2A 3IV8A 3ITVA 5D8WA 5JUEL 4QRBA 1BRLB 2OPJA 3PAJA 1I1FA 2JIXB 2D9CA 3QUKA 2AEQL 1QHZA 3H9SB 5FF3A 4WDIA 4N26A 1QBLL 3AIEA 3A6CH 2GSMB 1TTFA 4XP5H 1TTQA 1TJGH 1JPIA 5CUSL 4XX5A 1NGPL 3ZWSA 2FNBA 5D55A 1PZ0A 3K2IA 4DCQA 3CDZB 4JFOA 4TVPD 5IKCA 4L5ZA 3S2MA 4NN5B 3UQNA 1CLKA 3SQOH 3CZFA 3LIZA 1RURH 4H8NA 1MZYA 4JMNA 1TIUA 4KVCL 5AB2A 2EPLX 4Y4HA 4TUOA 1FCBA 2A7BA 2R8WA 4P7QA 3I74A 5F7BA 2H90A 2VO8A 1KIQB 2YAMA 5KBMA 4LSSL 3VJ6A 2PXYC 3BFOA 1CK0L 3ZE0E 1UQYA 4L3CA 4NUGL 1FHUA 4OZIE 4JMXA 3BANA 3HV9A 1FCCA 3KZPA 5HYJA 2Z91A 1E27B 3UOAB 4JPVH 4ZFGL 3BPCB 3K8LA 2QDHA 5HYEA 4HTYA 4W70A 3W7RA 3QKEA 2YL9A 2Y7QB 1I7TA 3LERA 2WXNA 2R1NA 5IK3A 1OSPH 4BDVB 3MNZA 3G6JA 1RK0A 3UAJD 5AQ0A 5GRJL 2NY2D 3MJMA 3SR7A 1AKJD 4QOKD 5KBPA 2J7CA 4AYGA 3QKZA 4AWUA 1ED3B 4JIQA 4TSAL 3W7CA 1K8XA 1OBAA 2V2DA 43CAB 5KG9A 3SY5A 4E9VA 25C8L 3BAJA 3E12A 5T1MB 2OWWA 1MEXH 2ENJA 4N42A 2GK1B 1DN0A 5D71L 1V93A 4PJ8A 1IQWL 3BIKB 2AZAA 3JBG7 3TR9A 5ISZA 4JQIH 5EN2B 1OXYA 2DZVA 1A7BA 1XMEB 4DHLA 3K81A 4GX9A 1BWVA 5DEFA 2TRYA 4ODVL 4XWGL 4CEUC 1H7WA 2ZCKL 2OZTA 4KBXA 3W84A 4HISA 4PUNA 4JTJA 3TU9A 4ZOAA 1GZJA 1FLRL 3TH3T 3TN5A 4OFDA 3HVDA 5AD0A 4BZ2L 1WKFA 4HS3A 3TFKD 3QIWA 3DURA 2BVEA 5ENWA 3FB6B 3OM3B 3AXKA 4GCAA 4PJFB 1LP9B 4LLWB 1LMIA 3KOWA 1CLZH 12E8H 1TMLA 4OD1L 1ZPLA 3FC8A 2JKTM 2W88A 1K6QH 5CO1A 2ACSA 2R0KH 2QCLA 1E5YA 4ZTPL 4WK9A 1II4E 1RJLA 3QZBA 2AJVH 4AW4A 5IHBA 4RWHA 4DLMA 4LLYA 1WWBX 2WBXA 5FC9A 3FF8A 1W3KA 3ZDYE 3QCUL 5E8NB 2ATMA 2VQ4A 2OZ8A 1FIGL 3ZDYB 4GXUM 5HNRA 4HN8A 2BFVH 1Z44A 1MF2L 1E6ZA 4JO3H 4FQPA 4UTMA 1W54A 2LLNA 5A8PA 3KPNB 4IQHA 1W1IE 2NLIA 3KTXA 4IIHA 5HK4A 4AYMC 1MEWA 1OGAB 3DVFA 3RJXA 3RO6A 2Q3XA 3T8QA 1ZT4B 4PJAB 3K30A 1VYPX 4Z7WE 2YAOA 4TUKH 4IQJA 5E2VH 5DHVH 2K3TA 2VC7A 2CMRL 1XSIA 3DUUA 3F7QA 1IKOP 4WIQA 1S7SA 1I3RA 1XGRA 3OC5A 2BNRB 5PAZA 1N2RA 3BLLA 3D0VB 2Z65C 2YPVH 4QCEA 3D0LA 4B9JA 3IJLA 1X5GA 2TSAA 3B40A 4DF1A 3EJSA 5F9JB 1PZ3A 1KKOA 3CZEA 3FFSA 4B5XA 3GSNH 1ZUAX 1AR1C 1AYOA 3JT0A 2PB1A 2VUOA 1ZT7A 1TF4A 4AM0A 3TEZA 4OJFL 2FLBT 4D2JA 3SCRA 2JLPA 4DKFH 2DLIA 3DKHA 2JLLA 4WFED 2FB2A 3BZEA 3LZFL 3PDOB 3UAJC 3T77B 2IF7A 4C56B 3BAKA 1EAJA 4X8GA 2BSSB 1HXMB 1WPCA 2NY2C 4JQ3A 2EDKA 1X8CA 4DGYH 1UH2A 1WBXB 5CSRA 2AQ3A 2CLEA 1FN4A 2TSYA 3NYZA 1J18A 4EMZA 2AJZA 4G9FD 4JB9L 3ZJAA 2IQ9H 5GSRB 4TV6A 1M42A 2M26A 2IANA 3VRLF 3H26A 3I9GH 4P2RD 5E8PA 3S6OA 1HAWA 5J8LA 3AWNA 3FTGB 1UPMB 4WI4A 5IM7B 4JM4L 1YPZE 1UWEL 3PQYD 1DEEA 1DSFL 2DGAA 1TWWA 3DSNB 2DLGA 4CCCA 1U8KB 2BZ7A 3ONBA 3W73A 3QDJE 2GC7C 3RLSA 2UY7A 2G0LA 1YECL 1V3LA 1NOFA 4UV7L 1QR7A 4MWAD 1TO5A 1QVOA 4ODXA 4C4BA 1IM3B 3TFKC 2GTWB 1KEGH 1MQ8A 2BZCA 3I02A 1HESA 1XAKA 1AI1H 3V0DA 2VERN 1JI1A 3GXNA 1WAAE 4IUGA 5DR5H 5KVGH 3E0IA 4HOZA 1L5GA 4IBSA 3UYIA 1JZ7A 1QFUL 4IBQA 1R0MA 1J9CT 3GUTA 3PGDA 2PDMA 4S23A 2VEMA 1LO5A 4PSPA 4NZRL 1D6EA 3OKEB 4YJ5A 5GGSY 1VJIA 3QORA 4LK4A 2IH9A 1QLRB 4CADB 2ZCLL 4U6HB 2J7LA 3H54A 3LPPA 1A4MA 5DRIA 4ABWA 1XQ4A 2EE6A 2E9JA 4ANWA 1XD0A 3LXCA 3C6LD 1JUFB 1ZVYA 1S5VA 2QSCH 3E1ZA 4NJKA 3QQ4B 1UXWB 1U8CB 2OGYA 3B5HA 1FC2D 4KQ3H 4PRPA 1M7IA 1JWSA 4I9TA 2YPKA 1WBZA 5XINA 3TPKA 4O14A 1T8QA 4CMMB 1VACA 3M0JA 1ZLWH 2QQKH 3RTQD 5EU6B 2VJXA 4IFKB 3Q2WA 4B41A 4HZLB 1Y5VA 4XZIA 4F79A 2PGFA 3QY6A 3QYQA 4Q9BA 1LEKA 3VFGL 5B1AB 1JZ8A 3BXNB 3FCBA 4AEIH 3NPXA 5IJKA 4EI5D 2CHNA 4JRYD 3IDNB 3QG6A 3FCSB 4X6DE 4X6EA 2Q7NA 1QW9A 5AEAA 3RMJA 3AXXA 4K8RD 2ZBTA 1VAHA 1KF9B 3L7FB 1Q63A 2ZC1A 3FUDA 1LT8A 4OGYH 5JMRA 2K4WA 3W57A 2HXAA 3K74B 4G42A 4YH6A 4Q6JA 1HHJB 2DQEL 1GPOH 4RSYA 3TYZA 2NX3A 3OPSA 5DYFA 3TLLA 2ZUXA 4HMNA 4ODWB 3WCYA 1WUEA 4WKZA 2YUWA 3IDIA 1UWXK 3SQRA 3LGDA 1R30A 3L3DA 4WU7B 4OFPA 3C2SA 2PGWA 4ZODA 1NLBH 4KKXA 1QBMH 2R2HB 5FA4A 3KL3A 3RAJL 1JVLA 1BVOA 1MAJA 3B7UX 1PX4A 1SO3A 4BEQA 4E3TA 3UMNA 4N2NA 1DBMH 4MWAC 1D7KA 2YARA 4BXVA 2ID5A 1YEEH 1VKFA 2YGVA 4UTHA 3H3BC 3LKOB 5LVEA 1NJJA 4L1LA 2H8PA 4QLWA 2OMAA 4R7DA 3O4OC 1SOKA 1NEUA 4ONOA 3HRPA 4GQ9L 5I73B 1GW9A 4NENB 3NESA 4XBKA 4BZ1H 4JNZA 3EXSA 5FKPB 1B0RA 4ELKA 1AXSA 4U5KA 3DJTA 1DQML 5IB3A 1FFPB 1CCZA 2ZRYA 4W7WA 4FQJL 5DK0B 1INEL 2IFFH 4DP0X 3QZAA 3MO7A 3V2AR 1F61A 1FORH 3KCLA 2NY7L 4EIGB 1R85A 3GU9A 5AAPA 4D6GA 4KV5E 2VDOB 2HVKA 5TFSL 3P11L 4AVNA 2YQ2A 1VLWA 2A4ZA 1KQZA 4PJ7A 5FDYA 3S3SA 2H9AB 1TB3A 5K9OA 3WE1A 5C0JA 3A23A 1A5CA 1CQYA 1IWBA 2Q3RA 4P9HH 3NZ8A 4C6QA 2OODA 3ARFA 5F96H 4C6PA 4Z7UA 3ILQD 1Q3NA 1HT6A 1OARL 2VUYA 1AS6A 3MRDA 4I5UA 3IE9A 3RYSA 2ON3A 4KROD 5D6CA 1MIML 1VPXA 3GNXA 2XFRA 3RB7A 1QHOA 3WLNA 5DUML 3T2NH 1G84A 5IMOB 3N1MC 4F2UA 2FSDA 2E8ZA 4MZ1A 3MUIA 1GGYA 2H6PB 2OMVB 3GVQA 2NX9A 3GMMA 2CZ5A 3W39A 4QUOA 3V55A 1E90A 3MN8A 3HIJA 3W86A 5E8DL 2WMJA 2VEPA 1QEXA 2Y6ZA 1T1WB 1RIVL 3NDZE 1KYOK 4X6CA 4O02A 4K8RC 3RY6C 4WFFE 3FT4B 2OT1A 3D3VA 3CVDA 4NKOB 4B9YA 1KT2B 4LSQL 3OZMA 1H5BB 3NK4A 2HRGA 5KAQG 4GKSB 3UTQB 3L3KA 2WOQA 1IEBA 4B5TA 1WTGT 5EHFA 4LF3A 4HFWA 3BIBX 3PS6A 2PYFA 4QCFA 2HVOA 4YL4A 1CLOL 3ZKNC 1NLDL 4HS8L 1TZIB 3MRJA 4QR7A 2BIQA 2I7GA 3P0VL 1CYGA 4UQEA 4NGHL 3H7LA 4UUJB 4W9HC 3QMTA 5E4OA 1ESOA 3U8GA 2RDUA 1QK2A 1NL0L 3CSGA 4O0QA 1TA3A 4LV9A 4OE7A 1MJ8H 1CE1H 1D8CA 3ELAT 1E1CA 2IH1A 3EYOB 4NZDA 4CKQA 3QUMA 2V8LA 2WLIA 4M48H 2A6IB 4NZ4A 2WXPA 2QDVA 5D1XD 3UTSE 4B5WA 5HHOB 2HBVA 2E9IA 4PBXA 3FUJA 4WY7L 2J62A 4Y19A 1N6QL 2XV3A 1UJ3A 3C12A 3KGTA 3MMUA 1A14H 4J2XA 4C6BA 3AQZA 5D7SH 1QT1A 3FQXB 3QQ9D 4ZX5A 2VE6B 4EF9A 3D34A 5JORA 4D7BA 5LNWA 4JFED 5GS3A 5DFVD 1BF2A 2IXQB 1VZGA 1XH1A 3I7QA 3KDNA 5DLCA 3EH2A 1MLBA 2PA6A 2PDQA 3VQLA 5DD1H 2D8KA 1VCGA 3ZO9A 2A3AA 2NDFA 1BAFH 1QP1A 3AHVA 3ILQC 1HKWA 1FZMB 1T7XA 2DN7A 3LN4A 4KROC 3HC3H 5F44A 3TBWB 3O6AA 3EO1A 2EDHA 3EFFB 4DVBB 3W37A 2W67A 4F9JA 2VLLB 5GGVY 1Q9LB 4GZIA 4G7YL 1CL7L 3WKYA 4UQ3B 4CVXA 3U0PA 5HGAA 4HKBB 3MRIA 1KZYA 5J1AB 1KN4L 2I7SA 4HCRL 2CO2A 3ZYOA 1S8DA 2ZWLT 1DQJB 1RCQA 1TJHH 2EEXA 2DSKA 3L0KA 5H6HA 2FX9L 4G6MH 1AODA 4AXNA 2C7FA 3ECUA 2ZCGA 4FYSA 4WQOA 2WXKA 4ERGA 5AYQA 4JG9A 4KF1A 2PXYA 4LAKA 3WNKA 3MP4A 4L1GA 1QNZH 1DYSA 3I6SA 3O16A 2QMJA 1ITCA 2J5LB 4IW4C 2JJWA 2HK0A 3IJSB 1R5VA 4MDPA 5H4YA 2W0LA 3SDYH 2F7OA 5B3SB 1I7RA 4H9YA 3FX4A 3WD2A 1H6EA 1AA1B 3WTXA 1AZCA 3VSVA 4LFHD 5GGRB 1XB6A 3GNNA 1CR9L 2FL5A 3D50A 3KBSA 4KW2A 1F5ZA 4OKVB 5C07D 3HOJA 3H3PH 1CXEA 1OQOA 2DQFB 1P0KA 1L6WA 1WQVT 1TG8A 1PTGA 3TZVB 4URIA 3CQFA 2ZX9A 1MRCH 2OYPA 3P0YL 2GJ6E 1TEYA 3L08A 1LE5B 1AGFB 3PHSA 2D7TL 2YD4A 3ETBF 3AI0A 4MNGE 5MEPA 5HD8D 3RCNA 3VWKA 5BWFA 4JL1A 5IJBC 2WMFA 5D1XC 4AX7A 3RDTB 1KXQE 1S7RB 3FTZA 2VW6A 1I8MA 1WV2A 2XIOA 4LNYA 3DUSB 4PJHA 4ROQA 3SCQA 4ML9A 3UXLA 4MQTB 3DGBA 4A68A 4A3RA 3VW3H 1CVSC 4N8VB 4ZW7A 1RXLA 3QZMA 1QLFB 1KLYA 4V33A 3HPJA 3T3MB 3QQ9C 3BW9A 2OW6A 5DWUH 3ANYA 1BVKB 1TVHA 1LEIA 1B90A 3R4IA 4HSHA 3KPPA 4Y4HD 1GOGA 4Z95L 5I1GL 1A0QH 1V0NA 5DFVC 4HGWA 3EJCA 4I3RH 1UKSA 4M93C 3M7OA 1FVEB 4ZNCD 1MVYA 1JV5B 3AITA 4FRWA 2Z1VA 4QRRB 1OM3H 2H32H 2HJKA 2FO4A 3T0EB 1B4EA 4NCC1 4FA6A 4QSFA 1MCEA 3CYJA 1F3WA 3D05A 2W38A 1I4FB 1KM5A 1KBLA 3BP4A 3MCMA 4LOUD 4EKJA 2NXHA 1X7IA 4UTAH 1HH6B 4WTZA 2PF6A 1J1PH 3U46B 3LHUA 4BGDA 5IW1A 4MZ2A 1LRQA 1SFDA 4LS0A 3RFAA 1ICSA 1J1OL 3MXVL 4KTYA 4O52A 4LCRA 4ODHL 1ZQ5A 3EUDA 3HS0C 5FUOH 2ITCB 1UR2A 2J7DA 1RAMA 2E7FA 5LNVA 1IGSA 4IQEA 1W1TA 3FT9A 1KJ2A 2P8PB 2GUOB 3W0WA 4HSOA 4OZGE 2VD9A 2JCCB 3TCTA 2ZXAA 1SZEA 4B5UA 3BG5A 1QX1A 4GNVA 4PJ8D 3QYMA 2EYRA 4KVNL 1P1XA 5ISZD 2CIPA 1K9EA 1F11B 2Z64C 2W79A 3UBXI 4DEPC 3S47A 2F8XC 3NCJL 1LUCA 4FEMA 2GJZB 4FKKA 2Y89A 2PPFA 1TPB1 3BUVA 4QG6A 2H4EA 4MNHB 3UAJA 4L8SB 4F9LC 1XYLA 3RNKA 1IL1A 1V7NL 3IDMB 3PTQA 1Y5WA 2C0HA 1DQVA 3LG3A 1NCUA 3QIWD 3LGGA 4W4OC 1LO0L 1JULA 4FF9A 2BGNE 4O4VA 3EOLA 1YBQA 4NP4L 3BP5A 5C9ZA 1V3IA 4KJWD 2W59A 3U7WL 4EIVA 5GRYA 2CK0L 4DJDA 2SEBA 2CO6B 4AY1A 2Y22A 4J4KA 3NIGE 3MB9A 2CLMA 4KKAD 5GJNA 4UDUA 3FS9A 1MWOA 3NVQA 4B3EA 2PDBA 5L2KA 5AW0B 3HRZA 4AXWA 1E4MM 2A74B 3ITOA 2XVBA 2NQ3A 1JTTA 1KIRB 4U1SA 1UPPA 2BC4B 2DQCH 3A9IA 1NJ9A 1FYTB 4ZEPA 4PTXA 3MSYA 5E6SB 3L3OB 1KM1A 3U3HA 3WUZA 2ZRWA 4MJIA 4DOHB 3PUCA 1E28A 3OO2A 4Y4HC 2OR2A 3CVHL 4OV9A 1TQTA 2E46A 1MREH 5IG7A 3PFRA 1TQXA 4ZQKB 1RVGA 3FOLA 3HNSL 3APMA 1MQKL 2CLHA 1AHWA 3VGGA 2H45A 5CGTA 5AVNA 5BQ7B 2AQWA 2GSGB 1RJRA 5DJYB 3W24A 4TLTA 4BQCA 1XRTA 4H9TA 1DPMA 8FABA 4WEEA 1MRAA 4LOUC 3EHBB 3VYPA 4G83A 1F3JA 5FESA 4KMTL 2BRRH 1IFRA 3W38A 1WAPA 4ICCX 3TR2A 1ZAJA 3QUXB 4MUPA 4PW3A 4FO4A 4JFFB 4KXZH 1EC8A 5U7SA 2YA1A 3H7BA 3GO1L 1ZHKB 4PYGA 5JXEA 4EN3A 5IW3A 4M4PA 4UFKA 2J9XA 4XP4L 1TNNA 3AISA 2JSFA 5C92A 5JPNC 3CZLA 5IMKA 5B3NA 4GAAA 4ZSOB 1JPKA 3SE4A 1ZWIA 3HOGA 1JK8A 4N20A 2IAND 2VDLH 4UQCA 3RU8L 3II1A 3FRUB 2ZCHH 4QHUB 2I9TA 4D0BB 2X4OB 4LCUA 3V5FA 1MN4A 9XIMA 3QDAA 4IPPA 1KEMH 1LT7A 2E7MA 5C09E 1XSKA 5CBIA 4MJ4A 4ZBJA 5CILH 4B9CA 5C09B 4A2RA 3N12A 3ORWA 1XGYH 2WKGA 1PZSA 3ARDA 2EABA 3C87A 1A3LH 2C0AA 2F6UA 4JG5A 5HYSB 1MCWW 3EA3A 1EANA 3QIWC 3VFNA 1M6OA 2YL6A 1EXHA 3X3FH 1B57A 1EJRC 2DJ4A 4UNTA 4KKQA 2RHGA 1XBDA 3I68A 5B3JF 3C56A 2CAKA 3L9EA 1OK8A 1NMBH 1P6WA 2AQ1A 5AHIA 3MRNB 1YSOA 4KJWC 2FH8A 2EEAA 2GI7A 2VZ3A 1FWNA 5RUBA 3I9AA 4H26B 3PP3K 2P24B 4YEEA 5CF3A 2CU0A 4UILL 2I17A 1RSCA 3TQVA 2NW0A 3MDJA 3LY0A 2Y69B 3TMQA 2ARJQ 3QORD 1IMHC 5F9WC 2ZUVA 4LVHB 3RFZA 2H3KA 3LEYH 4JKPL 3I4KA 1JN6A 1YEIH 2ATKB 3E49A 3HURA 4ONHA 5IUCA 1W72A 2IH3A 2I24N 4NJJA 2QKIC 4YCOA 1Q7QA 2HKAA 1JBJA 4K3EL 3PV7A 1OPGL 2VQ1B 1XR8B 2OJZH 3FU5A 3N85L 1AJ7L 1AQKL 3F58H 4EZJA 4PRPD 3B2PA 4OBTA 2YKLL 3VKBA 2G5BB 2ACRA 1NCAL 2IDTA 3VH8B 2IQ0A 6CGTA 4NS0A 4W8LA 3VXUA 2PWUA 3QEGH 1BXAA 4LGSB 2NQZA 2NX5E 4NLAA 4ENED 5GZND 5L9DL 3G5EA 5IT2H 1CQKA 2UZPA 1OM0A 3W71A 3ZWTA 5IBXA 3IMBA 2R69L 2Z31C 3K4WA 3VFCA 1XQLA 2YMTA 1MCPH 3LHVA 2V33A 4GS7C 5KVGE 2MNUA 1MJUH 4R7NB 5KYYB 5E08H 1U6AL 2AL1A 4DYEA 5G4WA 1YYML 3NZHL 3HNVH 3ARRA 5HDBE 1O5RA 1JZFA 2NXIA 1KBWA 1EYEA 5D9SA 3UWUA 3FSOA 3GHEL 3FQNB 2ALAA 4XNYL 3TWBA 3JYBA 2R4SL 1UG6A 4MB1A 5IZ7A 3QXTA 1A1MB 4LHUA 5FEPA 2GW5A 4PCTA 1OQFA 1P43A 4TNFA 3P30H 4B92A 3MTRA 4EDWH 1QNQA 4HGXA 1XFCA 1FNGA 1DL7H 2HDJA 1ILUA 4G5ZH 4JRYA 3JV6B 1HHIA 3GSUB 4EIUA 4ZG1A 2FDMA 5I06A 1XLGA 5EDSA 5J56B 3OAZH 1IXPA 3RY6A 1OGBA 8A3HA 3GG7A 1ZTXH 4DZIA 3ETTA 4DNMA 3UEQA 1RZIA 2MNJB 3BO8A 2DIAA 3MV8E 4K94L 4DPPA 1N9PA 4U6VH 4PYSA 1JWUA 2YCEA 3KOXA 4X5QA 5JH1A 4XNDA 3U0WH 1UM5H 4DELA 5EWIL 4XMTA 3GJEA 4KWVA 3TWAA 1DLHB 2PMQA 3RQ3A 2VLRA 3LV5A 2SFPA 1JRCA 2VC5A 4JRFA 5DELA 4JFYA 3MV9E 4HWBL 1AO7E 3QORC 5BV7H 3ZHKA 1ZTMA 3TMLA 1SHWA 3IPWA 3PULA 4H8PA 3QZWA 5DO2D 4MWFB 5JQ6H 3RPIA 1NFDA 1UP2A 1LJYA 3G1HA 3VFUB 4XPBH 2FEDD 2VXQA 2Y5EA 4MKNA 3HHSA 5DGRA 4K15A 2WXOA 2R23B 4MX7B 1W3HA 3SBFA 3WFZA 2DLTA 1UXSB 4M8UA 3DMMB 5EZIH 4N4PA 4X80H 3ARFD 4F0LA 1CO1A 4NRZA 3OIHA 2X0VA 1JZ3A 5E51A 1MHPL 1TU2A 4M6NH 1YX1A 5E8OB 4YJZL 4EN2A 5LHDA 3FT0A 2GFBA 1QTYT 2N7BA 5DD0L 3WFBH 1P84J 2X4UB 3S37L 4ENEC 1CBGA 4MJMA 5GZNC 1BQ5A 1XTLA 5FKYA 1PG7H 1ADQL 4NJAH 3FSZA 4GRWB 4YC2C 3VFMA 3DOSB 1Y5XA 1QEWB 2FQIA 4E9RA 4ZMZA 4ZL1A 1ISVA 1ZA3B 5GS0D 2PP3A 1Z6KA 1YEHL 3GMOA 3I6RA 1QNPA 2HMID 4QEEA 1VPOH 4R7XA 2H8XA 3UL4A 3BURA 1GYNA 3BKCL 1MXSA 1XFBA 5A3ID 4PG9B 2BM3A 4MNJA 5HNUA 4A21A 1QYGL 1IGFH 4HWZA 1OFQA 1UA6H 4LARH 1ITXA 1PKQA 5ICUA 3G5WA 3KWWB 5GNXA 2CLVA 5IBLC 4DBWA 1VBGA 1W8OA 5FL0A 1BX2B 4Z7QE 4HJEA 3FOMA 1N6VA 2ZAIA 1G7JA 1WXZA 2AAAA 3ULUC 1AXTL 4FLQA 5I71C 1JK9A 4BH7B 3SKJH 5TE4L 4UR9A 4NPYB 1LE9B 2OCCB 4J3BA 1BWMA 1DQQB 3ATAA 4F0KA 1U4FA 3MJYA 4PGDB 2ZKWA 5T33H 5FS5A 3G6AA 3NCOA 1C8PA 1QPOA 2YRZA 4IF2A 2VEFA 1XH3B 4WI7A 3C5SA 4S3KA 5DXXA 4ZUTA 3UZYA 4IEFB 4N1HB 2HFEA 3KPMB 4YBQD 1J93A 1MJ7H 4MCMA 5HI3D 4H7ZA 5AVZB 1BLNB 3RIFK 3HZ3A 4PAZA 4Y19D 1KV5A 4NQVB 2YX0A 1NBVH 3OG6B 4Q56A 3M6DA 4JRXE 4CU6A 5EFDA 3ITYA 4I0PB 3U1PA 1RJZB 2XWTB 3QAZC 3SRFA 3QXDA 5CEZL 3PUUA 4XZWA 1W3IA 3C8DA 3CN2A 3B3DA 4WEBH 2PDXA 1JTOA 3JW7A 2CZEA 4WENB 3BLBA 4MBRA 2AEPL 5DO2C 2MIZA 3T81A 2B08A 3V4UL 4O1BA 3PNWB 4ODSH 2OTDA 4L9YA 2FEDC 4QRSB 3ZS4A 4C5YA 3QNZA 4AQ1C 3GSXA 1FL5A 2L8AA 4ZSUA 1NSNH 4AL8H 4GJTB 1D5XB 4PRWA 4PUKA 5KSBF 1UWFA 3ARFC 5KTLA 4NHVA 3TEYA 1Y6NR 4BFBD 3HE7B 4G8EA 5E56A 1KFKA 4XIAA 3B2XA 3BGAA 4I4WA 2ZTJA 1YAIA 3TJEH 7ODCA 3KLKA 3AY4A 1VGKA 5F70A 1J0IA 4NNAA 3CEPA 4ZQRA 4Y4KC 2G2RB 4S39A 5D8JH 5D37A 2YJLA 4OLVL 3EH1A 5DJXB 1J8VA 2CKBH 4RLDA 1TQJA 4BFIA 3CUPB 2J2ZA 5GS0C 1EH9A 4F57H 3BZ4B 1RJYA 2EUXA 1OHQA 2ADIA 1MMFA 2OELA 5DJDA 5FECB 2HMIC 1KIPA 5K59F 1BG9A 3HA1A 1HDMB 4ZFZA 3T4AB 4Z2IA 4JYFA 2PXYD 4S3GA 4CBPA 3KBNA 2R1LA 5A3IC 1WD8A 3UGVA 1OX4A 1E9ZB 3KPRA 3B37A 4WK0B 2EC9U 4LEEA 2DQXA 4YGAB 5REQA 4YR6A 2HRPH 5C08B 3OKNB 4JZJB 2ZZ3A 5SWZE 3HPFA 3D4YA 2VTFA 3SUUA 5SWZB 5GRUH 4C6EA 4DP1X 5CPLA 5FFLA 4JX6A 5IIEA 1WFTA 1GZHC 3BLOA 1IEAA 2XWJB 2PTZA 3L68A 5KYUB 2BV9A 2G3JA 3BH8B 2OI9B 4W9ZA 3HS0A 1SJEA 3RNQB 3ET9F 3QQ3A 1FNSH 3HPAA 2WBKA 4U10A 2PTTA 2DV0A 4UTBA 2EKSB 3C75A 3SPJA 3H56A 1GZ1A 2YXOA