1KGWA

Three dimensional structure analysis of the r337q variant of human pancreatic alpha-mylase
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
496
structure length
496
Chain Sequence
b'EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTQVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALPHA-AMYLASE, PANCREATIC
publication title Probing the role of the chloride ion in the mechanism of human pancreatic alpha-amylase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 167
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2001-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1kgwA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1kgwA01
2VX7A 3L4VA 4BA0A 1VBUA 3OGRA 1FHDA 1SZNA 3FHAA 3FXYA 2WVTA 3WUEA 4UOQA 3OZPA 1V0NA 1NWRA 1PPIA 4AZCA 5I77A 1EO5A 1QWUA 5CGTA 1J0KA 4HPGA 2D3NA 3SCNA 3ALFA 2F7QA 1SMDA 2X09A 5ABFB 4IUGA 1HL8A 3BAJA 2DPEA 2WKGA 3EMZA 4PUEA 5LA2A 1Q6CA 4H41A 2BVDA 4HA3A 3WUGA 3VSTA 4S3KA 2A3AA 5BXSA 3EDFA 3UG5A 3EDKA 2VURA 4GO9A 1E0XA 3HMCA 1WO2A 2XGIA 1QHPA 1X1NA 4MNLA 1WZAA 1CGVA 2V3FA 2JE8A 2VZSA 3BMWA 3VDBA 3BLKA 4PYSA 2ZOXA 5A6SA 1E6SM 2F7RA 2E40A 4W5UA 5E6ZA 2YDRA 5M03A 1W9XA 1Q6DA 2IXUA 3WQ5A 5A69A 4D71A 4AD2A 4HU0A 1MW3A 3BVWA 2XGBA 1TQUA 4H7VA 1J0HA 4LXFA 4J3XA 4PSRA 5A6AA 3VIIA 2CYGA 4H8HA 4D1IA 3CZKA 1DWGM 3KL5A 3AIQA 3AXHA 3HG2A 1GOQA 2O9OA 4U3CA 1ISXA 1K9FA 2XSAA 5I5RA 2EADA 2GK1A 2EO7A 2D20A 3CMJA 2GJPA 2F7OA 1UKTA 2DDXA 1R7AA 2C7FA 3ZMRA 4MTVA 2CBIA 2WVUA 2WXDM 3VIMA 4FNQA 3ALGA 3D50A 4W8LA 4MNMA 3NIYA 1OD0A 3QOMA 1GZJA 3WFZA 2W4XA 1AVAA 1JZ4A 4MDOA 4PCSA 1HN1A 4HOXA 2XWDA 1E70M 2EAEA 5A6MA 1CYGA 1D7FA 3ZJ8A 2J79A 4WKHA 2YA1A 3OLEA 3CZEA 1GORA 3EBVA 3N12A 2JF6A 2PI6A 4FLRA 1B3ZA 3WEMA 1QBAA 2E9BA 8CGTA 3WKZA 1JNDA 4MB1A 1VB9A 4RL3A 2GK1B 1W32A 4WSKA 2WZHA 1UKQA 2J7BA 3D4ZA 2CBVA 1ZS2A 2JIEA 3L4WA 4QLJA 4V28A 2BS9A 3H55A 6A3HA 1TQWA 2ESCA 2OYMA 3IAQA 4J3SA 4U2YA 3FHQA 1BYBA 2V5CA 4GZIA 3EJRA 3LRLA 1GJUA 5FL1A 5A8PA 1UASA 1B90A 3MUZ1 1JZ8A 8A3HA 2EPLX 3GH7A 4QFUA 4GQQA 2YBUA 4FLSA 5A2BA 4HMCA 1GVIA 3A3HA 4NF7A 3WY2A 1V0MA 3CH9A 5HDRA 4UQEA 3F4VA 4P8WA 5BRQA 1JD7A 3WDHA 1UR8A 4UZSA 2OW7A 3A47A 3WQ8A 4GXPA 1E6RA 1KBKA 4GPNA 1V6XA 3VNZA 4ATWA 3ZR5A 1QI5A 3GBDA 2DT0A 4QAWA 3OBAA 1Q6GA 3WF3A 4TTUA 1LF1A 3BCDA 5DF0A 2VI0A 3KEHA 4AMWA 1HJUA 3GXDA 4GZEA 5M3WA 3IJ7A 4HZ7A 2OSYA 1CXIA 4AW7A 2XVNA 5E0CA 1Z32X 1UWUA 3II1A 1E6XM 1BVNP 1US3A 2YBTA 1GONA 3ARZA 1E56A 4L4OA 3T2OA 4TTGA 1E9LA 1V3LA 3UEQA 3ARUA 5I79A 5CPQA 1BYCA 4F8XA 5FCZA 3BLPX 4FNUA 5A8QA 2WSPA 2IGTA 3TOPA 3WF0A 1BFNA 3THDA 1TA3A 1GNXA 2GUYA 1KGXA 2PWDA 1W3HA 3UCQA 3OB8A 1W9VA 4D6DA 3FY1A 3GH5A 2CCRA 3G6MA 3LXBA 1RP8A 2PC8A 4W7VA 4MADA 1EQCA 1WDQA 4KH2A 3IGUA 1WDPA 2YIHA 1JZ5A 5DMYA 3VPLA 1B3VA 3NDYA 3DC0A 1OB0A 3N11A 3WNOA 1UH4A 3BVTA 2G4FA 3M6DA 1V3HA 1QI3A 1B30A 4NZFA 2D0FA 2CHNA 4OOUA 3AIEA 4UFJA 3AHYA 2WYSA 4KGLA 3BMVA 1R47A 1ITCA 1G94A 1V3KA 1JZ3A 1KCLA 5F7UA 5C70A 4DWSA 1TA3B 4AEFA 2YOCA 2VR5A 1C7SA 4QDMA 4UQCA 2OWXA 2XFRA 4BCEA 4H8VA 1E4LA 3TTSA 1M04A 1BTCA 2VZTA 1F4AA 2RGMA 3DDFA 2XVGA 3DDGA 1UH2A 3DHPA 1CXFA 3FAWA 3J7HA 4BS0A 4Q7NA 5A8MA 4CD4A 3FN9A 3UESA 4CN4A 2EPNA 4Z2JA 1V0LA 1GJWA 2GVYA 3L2LA 2VZVA 4XX6A 4W93A 3VM5A 4EK7A 1CDGA 2BXYA 3BXWA 4UOJA 3T2PA 4XZBA 4AYGA 2DIJA 4QLKA 3ARWA 1J01A 3DYPA 1DWAM 4PBGA 4PMNA 4BQ4A 5I3DA 1WNOA 1BYAA 2F1AA 3B9AA 5D8WA 5LA0A 3PZIA 4P7QA 1KQYA 2PF0A 4RE2A 3WMBA 1M03A 3TTYA 3ARXA 5DO8A 2CESA 2DH3A 4J3TA 1R75A 1NOUA 1HJSA 3G6LA 2VC9A 4P8VA 4D6CA 5IFTA 1OWQA 3RDKA 2ZUSA 2EEXA 2J7HA 3MUY1 2BHYA 2JEPA 1OGSA 4DO5A 3A21A 1B3XA 1SFSA 3FAXA 4Z2HA 5CJ5A 4CUCA 3VGGA 1JG9A 1G5AA 2WMGA 1W1PA 3CO4A 4NXKA 4QCEA 3WF4A 1KFWA 2QMJA 4WJXA 2Y2WA 2X05A 4YHEA 4EKJA 1VEMA 1VFMA 4KWUA 5D9OA 2BHUA 4OGZA 4CCEA 1QNOA 3VIFA 3GXNA 3BAIA 3GXPA 2WW5A 1OT2A 4BQ3A 3F5LA 1U2YA 3MMDA 1XV8A 3OLDA 2JEQA 3RJYA 3A6OA 2ZXBA 3RM4A 3I3BA 4PMYA 3ZJKA 3AMLA 5HBFA 1E73M 1D2KA 1XGZA 1OIMA 5GNYA 3VNYA 3SUTA 4WSJA 3PN8A 2HISA 4AWEA 1GW1A 1VENA 2XIIA 1XSKA 1GHSA 4HTYA 4W7UA 4ACZA 1W1VA 3PZQA 5E70A 4D72A 1JAEA 3QHNA 4MB3A 5EB8A 4UTFA 5GNXA 3APGA 3WY4A 1H11A 4WK9A 2EABA 2AAAA 2DT2A 3VD7A 3UETA 5ABHA 4IPNB 4LYQA 1UH3A 3KL0A 1EDQA 1FOBA 2ZUTA 1E40A 1IZJA 1VRXA 1UA7A 2E8YA 2VX5A 3F5KA 3ARQA 3L4XA 4EE9A 1G0CA 3ZJ7A 4UZUA 3ZIZA 3OGSA 5ABGA 1TR1A 3AROA 4P8UA 2RGLA 1V03A 1NOWA 1HF6A 4JAWA 3A5VA 1H1NA 3AYRA 3WH9A 1B31A 3WUBA 3LPFA 2ZIDA 3MMWA 1UWIA 2TAAA 1ISWA 1NP2A 2V3DA 1HJXA 2VR4A 3ARSA 1YHTA 1LQ0A 2FYVA 2PBGA 2CKRA 3NDZA 1QNQA 3GNPA 3A4AA 1PX8A 1M7XA 2WVVA 2J75A 5CLTA 5D4YA 9CGTA 4A3YA 2XYLA 1HJWA 2WMIA 3NJ3A 4B15A 2BVYA 1UWQA 3WF1A 3K4AA 4D6FA 2FDMA 2D24A 3VDHA 5IHSA 1KXHA 5FOOA 3K8MA 1GPFA 2O9TA 3VD3A 3CZLA 1ODZA 1JYWA 3SCOA 3TONA 1JFXA 4D6GA 3HJEA 3AJ7A 2UY3A 3PBGA 1TQVA 3WH8A 3CPUA 1KWKA 4NZCA 3SUVA 3VOCA 4UFLA 2BV9A 2WK2A 3ZSSA 2WBGA 1LJYA 4D6IA 1C7TA 1EXPA 2DT1A 1C92A 1V6VA 1JNEA 3PZMA 1ZBCA 4P8XA 4PMZA 3RMEA 1W91A 2CETA 1UUQA 4JCMA 1X6LA 2WVVB 1KXQA 1IT0A 1JZ7A 3L4ZA 4HMEA 4CD8A 3SCPA 4W84A 2VNCA 1G9HA 3DX0A 1XYZA 3WDRA 1NM9A 2XSBA 4MNJA 5C8BB 3VD4A 1CXEA 3L4YA 1C8YA 5A8OA 5HPOA 3WQ4A 5JBDA 4F66A 1T0OA 3PZVA 1UA3A 1AMYA 1XSIA 1AQHA 3SEPA 1I1WA 2EPMX 3UG4A 1E6PA 3VINA 3IJ8A 3T0DA 3GNRA 1WAWA 1UKOA 4R27A 1V6WA 1LLOA 4KRUA 3DECA 2QPUA 1WB0A 1JAKA 1E3ZA 2Y8KA 1CNVA 4M81A 1MFVA 1J10A 4RE3A 1B9ZA 1XH2A 3BUBA 1NWTA 5A6LA 1DTUA 5GNZA 1ISZA 6TAAA 4YHGA 2AMGA 5A6JA 3ZR6A 3GYCA 2D3LA 3OZOA 1MXDA 1TMQA 2PWEA 3WBAA 3VDCA 1GOIA 3OLIA 4Z2GA 1ESWA 4MAZA 2WAGA 3WD4A 2XN0A 2VZOA 3BVUA 3SIMA 4AZCB 3ZT6A 1H5VA 4DUXA 1JI1A 1FH8A 1E3XA 4JL1A 1I1XA 1W3LA 3RJXA 3VD5A 3AQUA 4Z2IA 4U31A 1XD0A 3IANA 2J7FA 2J62A 2EJ1A 2ZUUA 1Q6EA 1VF8A 2F2HA 5JIPA 4Q22A 3LPPA 2ZX7A 2UY2A 3AIWA 1MXGA 1JDAA 4AXNA 2WCAA 3U57A 3KE0A 3OIHA 2WMKA 3EDJA 5E1QA 2ZX5A 1CXHA 1JI2A 4F79A 2CITA 4H2CA 4YN5A 4MAVA 1BHGA 1TQSA 5D9PA 2CBUA 5IXEA 2E3ZA 4UR9A 2E8ZA 3SCWA 2VCCA 1MW1A 1H4PA 4GI6A 3OG2A 2WC7A 1JF6A 2WMHA 3WDJA 3SCQA 1K9TA 5BRPA 3LXCA 4OKDA 2XPKA 1V3JA 1WDRA 1I75A 1KGWA 1E1FA 1GOWA 4PMQA 1C90A 4W7WA 4PTVA 4AMXA 1M01A 2VRQA 2BVTA 1MWOA 4JZ5A 4AEEA 3VIOA 3CUIA 5BCAA 3W6MA 4E4PA 1XH1A 3JUGA 3NCOA 5HNNA 4GIAA 1Q6FA 5EFFA 3BAKA 1TQTA 5E09A 1JD9A 4QP0A 1EGZA 5EBAA 4DWSC 4M24A 1EDTA 3IK2A 2WZIA 1Y7VA 2ZUVA 4M1RA 2W92A 4E2OA 1BGGA 1V08A 3U7BA 1UD2A 2YLAA 1J12A 2WLZA 3VX0A 4DM1A 1GQKA 1C3FA 4JHOA 5A1AA 2Y5EA 2V3GA 3TA9A 2VRKA 2OWWA 4ATDA 1QI2A 3IJ9A 1H41A 2VVSA 4JFVA 2FE0A 3AS3A 3TTOA 4CD6A 2VO5A 3UG3A 1E15A 2G41A 4ZEPA 1SMAA 1R46A 1H0IA 1TG7A 3HG3A 1EDGA 1WCGA 4OZOA 4H04A 1R86A 3GM8A 2X0HA 1PIFA 3ARYA 4MB5A 1JYVA 3O6AA 1UR0A 1BSIA 3ARPA 1CGYA 1L0PA 1GOKA 3AMDA 3IAPA 4KRTA 4PMOA 1H0GA 4AD5A 1CGXA 3CZGA 3RCNA 1C8QA 3KLKA 4HOWA 4AD3A 3T2QA 5I2UA 4K68A 2QPSA 1E71M 5A3HA 1O7DC 1WZLA 2GJXA 2QMKA 3CHFA 1C91A 3OA5A 3M7SA 1RP9A 2BY3A 3MUIA 4ACYA 3VVGA 4X9YA 4JFUA 2VUYA 5BXTA 4PTMA 2CXGA 3H54A 3VSVA 3WELA 4AISA 1GOOA 1KBBA 2DSKA 5D8ZA 3GXFA 7CGTA 4JKMA 4GQRA 3BUIA 1GQLA 3CHEA 2O9PA 5E0FA 4NX0A 2J8FA 3S5YA 1BAGA 4MB4A 2NT0A 4CCDA 1G1YA 4NRSA 5DFAA 3B9EA 2CKSA 2FHCA 1CGTA 1DWJM 3PTKA 2VVNA 4B9YA 6CGTA 3CTTA 3RM8A 1DWHM 3FW6A 2D22A 1U30A 3A4XA 1E6QM 1MQRA 2WHLA 5CSYA 3MSGA 1KTBA 5CLWA 1GUVA 2E0PA 4U3AA 3EJTA 3AZRA 4AZ6A 4OBRA 4OOZA 2WWCA 3RPMA 2FHFA 3AS2A 1WPCA 5HXMA 1UZ1A 2VCBA 1OCQA 3NSMA 1GQIA 2F1BA 5HOSA 3CBWA 4IM4A 1CXLA 5BROA 5JUVA 3W24A 4EAMA 2VX6A 1EA9C 2BY0A 4TX8A 1NP0A 4LGXA 1VFOA 3D4YA 4KGJA 2B31A 1B1YA 3WD2A 2CPUA 3N04A 3W4RA 3W28A 2PBOA 2XUCA 1DWFM 5BXPA 5EFDA 1FFRA 2GSJA 1B3YA 2VOTA 1BQCA 1HVQA 2NT1A 2X0YA 3GXTA 4P7LA 3W25A 2YA0A 5IDIA 3ARRA 5KZ6A 3WBEA 4CGTA 2EPKX 2EBNA 5JBFA 3A22A 3MANA 2ZUNA 1DWIM 2J7CA 3PZGA 1BG9A 2E9MA 3ZO9A 2D73A 3DX1A 1G01A 3VIKA 2W91A 3DYOA 4FNPA 1C8XA 2OLHA 1PAMA 1HX0A 4UNIA 4JFTA 1QBBA 4DWSB 3ZJ6A 1ECEA 2IUZA 1KB3A 3WMSA 4CVWA 2JF7A 3ZT7A 2G8ZA 4UFKA 1R87A 2DQXA 3VD9A 2DT3A 3VIGA 1A47A 1PX4A 1QWNA 2IXVA 3BLBA 5AYBA 2WBKA 4TOQA 1UR9A 3PTQA 3PZUA 5GPRA 2ZWZA 4WKFA 4GO8A 4ZFMA 2HVMA 3QGVA 1VBRA 1E4IA 1QVBA 3AIRA 1GQJA 4JKLA 4FF5A 4RE4A 2GJRA 5D9MA 1FH9A 4S3JA 3ZSTA 2ZX6A 1CPUA 3BSGA 3EMQA 2ALWA 1KQZA 1OBAA 4LPCA 3GTNA 1JXJA 1EOMA 1ISVA 1OGGA 1NH6A 3AIBA 1PS3A 2DSUA 5IFPA 2VMFA 2V3EA 3ZM8A 2A3CA 2WWDA 1W2PA 3LRMA 1V02E 3KL3A 3HG4A 3AHVA 4U5KA 3VGFA 1J11A 1V02A 1CIUA 5I0DA 1E43A 4U33A 1E6ZA 2OW6A 1HIZA 2JFEX 1B2YA 1OIFA 1WE5A 3GZAA 1CZ1A 2EQDA 1MW0A 3WY3A 2JALA 4AD4A 5BYWA 3LX9A 3VMNA 2BHZA 3MKKA 3UR8A 2WLYA 1QI0A 1VFUA 1CGWA 5A6BD 4MNKA 3AXXA 2YL6A 1UD3A 1HT6A 2VX4A 2XN2A 1GOMA 3L4TA 1JZ2A 1OM0A 3S5ZA 2QLYA 3WFLA 1BPLB 4UQ9A 2YL9A 3S2CA 3MU7A 1UR4A 4XV0A 4HMDA 4F9JA 3WENA 4UQAA 2WCSA 3BUPA 2PB1A 3WY1A 4AZIA 3N15A 2X1IA 5DEZA 2BNJA 1EOKA 2YDQA 3W27A 2ZE0A 4ACZB 3BAWA 3SCRA 5CG0A 3WNLA 1KXVA 1ZJBA 1R8LA 4ZENA 3AFBA 1FH7A 4W87A 1W9DM 3WNNA 2XVPA 2Q8XA 1KCKA 1HTYA 1KR0A 1IV8A 4NZJA 4HZ6A 5CZKA 2ZXQA 3I3EA 2WMJA 1UQZA 1EQPA 3AS0A 1MVYA 1L8NA 3QOKA 5ABEA 4GZJA 4DUVA 3CMGA 3AIVA 3GBEA 1AQ0A 1OSEA 2ZUMA 2NW0A 2QF8A 3HN3A 1ISYA 3W6LA 4BQ5A 1QX1A 1UWRA 4D6JA 4WKAA 3W38A 1XRVA 1GHRA 4AZ5A 4ZXOA 4F9DA 1N82A 1WP6A 3VGEA 1O7AA 2YLLA 3O2LA 1BVZA 2W66A 1CLVA 1WZMA 1E5JA 3EJPA 4PSPA 3A4WA 1QW9A 3LXAA 1W3JA 1NQ6A 4HZ8A 3NYDA 5I6SA 3W53A 4EANA 1JL8A 3AOFA 4M80A 2PWGA 4R5EA 1W9PA 3KLLA 1VJZA 1ITXA 5CQ1A 4M82A 1QI4A 4FLQA 2PWFA 2CERA 2VJXA 5A2AA 3WF2A 2DGAA 4HA1A 2YFNA 4AIEA 2BXZA 4MPKA 4HA4A 3QR3A 2WM0A 2X8RA 4GI9A 5KEZA 1OGBA 3D52A 2WMIB 3QHMA 3BUDA 1DEDA 2WHJA 1LWJA 3EDEA 5TD4A 4URIA 5E9AA 1E6NA 3BCFA 5A95A 2G3IA 1F4HA 2G3MA 2OWCA 1R7OA 3VGDA 4PTXA 4ATLA 3WQ6A 3RILA 3MSDA 3CGTA 2UWFA 7A3HA 1PBGA 1JYNA 1UG6A 3EMCA 4W88A 3TTQA 4B3LA 3SCUA 2CBJA 1UR1A 3VM7A 4JFWA 5JBEA 1CGUA 5EMYA 3AXIA 4XB3A 4NXSA 3KWXA 3AMKA 1ZU8A 3SCVA 2D0HA 5AC4A 2UY5A 2ZXAA 4PMRA 1BYDA 3B8SA 2WPGA 4CU7A 2W61A 3CLWA 2YL8A 3MUAA 4C7FA 1S46A 1MW2A 4FMVA 3AISA 1FHLA 3M46A 1WKYA 1W1YA 1K9EA 1US2A 2XHYA 3MV11 3WNKA 1J0YA 4XZWA 4J3UA 5HPCA 5I24A 1B0IA 4LX4A 4OJYA 2CHOA 3F5JA 4AYSA 3K8KA 1VJSA 1CEOA 2E9LA 1CXKA 1XD1A 1JFHA 4PRWA 3CUFA 1YQ2A 2WVSA 3CIVA 3PZ9A 3CZSA 4DO6A 1J0JA 3W81A 3AZSA 3GH4A 3VKKA 3CUJA 1SR0A 1BGAA 3A24A 3WL0A 2DH2A 1QHZA 4P7OA 2QV4A 2XWEA 5CPTA 3N18A 1O6IA 1GVYA 3I3DA 5E6YA 3PTMA 1W1TA 4QCFA 2WB5A 3AHZA 5D9NA 3TV8A 1SYTA 1JDCA 1MQPA 3K46A 1WDSA 2J74A 1QOXA 4GI8A 2FGLA 2W67A 3CHDA 4TVDA 2Y24A 1B3WA 2NSXA 2FH8A 1CENA 1M53A 5BXRA 2XTKA 3EJQA 3POCA 3VTRA 3DX2A 3VU2A 1LL7A 4TVCA 1VFFA 4JHZA 1E0WA 1UQYA 1BG4A 1W9BM 2XFFA 3B9DA 4CU6A 5CXPA 2X2YA 1TFVA 5LA1A 1VEOA 1MQQA 2W5FA 2WANA 4TVUA 3GDBA 1VEPA 3VDAA 3RIKA 1H49A 2YA2A 2C0HA 2QHAA 4LYPA 1HJVA 1V0KA 1UWTA 2BY1A 3BGAA 3D5HA 3NSXA 1UD8A 3CUGA 4CU8A 2GDVA 4PTWA 3GNOA 3VIJA 4CCCA 4A3HA 3WIJA 1MYRA 2X2IA 4IISA 3NSNA 4TUFA 1P6WA 4ZE4A 4MJ4A 4OUEA 1CTNA 4PMXA 2ZX8A 2J77A 2XFYA 1HXJA 3ECQA 1CLXA 1QHOA 3AYSA 2CIPA 2EPOA 5GQBA 1HL9A 1XYFA 3LRKA 4AZHA 2W62A 3E1F1 3AMGA 3K4DA 4AY1A 1OD8A 7TAAA 2J4GA 4CN1A 3CZJA 4OBSA 4HP5A 2XIBA 4GINA 3W26A 3DX4A 1LL4A 1UD5A 1QPKA 3POHA 2VRJA 4AD1A 2UY4A 1JGIA 1QNPA 4C7DA 4CD7A 5AYIA 3WQWA 5BWFA 1Q4NX 2YDSA 3CC1A 3GXIA 2C8NA 5FIPA 4ML4A 1ODUA 1J18A 2ZXDA 3WDIA 2Y8VA 3WNPA 2W63A 4J28A 4DM2A 2F8QA 1HJQA 4W86A 3MMUA 4MDPA 4N0RA 4CD5A 2CEQA 4LYRA 4J7RA 2Z1SA 2J7DA 3WMCA 1JIBA 1PIGA 3WD1A 1E5NA 2D2OA 2Y4SA 3L2MA 5DT7A 3WQVA 5LYRA 3EDDA 1FFQA 3VILA 1W2VA 3BUQA 4PN2A 2Z1KA 2WNWA 1J0IA 2WKLA 4GKLA 1RD6A 1UR2A 2OYKA 3FNDA 2VT0A 2XG9A 3MO4A 1WZKA 3OGVA 1H09A 4WIWA 4W8AA 4HU8A 1ZBKA 3LPOA 4UOZA 1H2JA 3HG5A 3S6TA 2GDUA 4OIFA 3LMYA 2GJXB 2PWHA 3L4UA 1RH9A 2AOSA 4ZXLA 4NI3A 3VO0A 5A6KA 1EIBA 2XN1A 2X2JA 4FK9A 3SCSA 3VMOA 2WCGA 1UD4A 3AZTA 3AICA 1QW8A 3K8LA 4WF7A 1HKIA 1ZB5A 4AZ7A 2ZICA 1HVXA 2YFOA 4AZGA 3CHCA 4J27A 1NARA 4W85A 2DSWA 4J3VA 2OSWA 2XJ7A 4XUYA 1E4MM 2OSXA 4D6EA 2WZEA 5A6BA 3D3AA 1HNYA 1OINA 3NUKA 1UKSA 4JIEA 5I78A 2J8GA 4Z2LA 3BVVA 1TVNA 2YKKA 5A8NA 1DHKA 3AS1A 4U2ZA 1LG2A 2YJQA 2MANA 4LQ1A 4L4PA 4UQDA 1TCMA 2XVLA 2E4TA 2A3HA 2CNCA 1ZBVA 4NRRA 3CUHA 3BC9A 3SURA 2A3EA 4FNRA 3BAYA 3UERA 5M17A 3T08A 1BF2A 3AI0A 3QHOA 2J7GA 4UFMA 1ZL1A 2DIEA 3O9NA 3BAXA 3WH5A 3A23A 1HP5A 1W3KA 3EJUA 3MV01 3U5UA 1V6UA 4N42A 5AY7A 4UQBA 2JIWA 3VGHA 5FKYA 3K1DA 2XM1A 1QNRA 1CECA 1JDDA 2VL4A 4IPLA 2O92A 4PMDA 5FL0A 1A3HA 2EXOA 1TE1A 3WL1A 4FNSA 2VQUA 1JF5A 4PCTA 3LPGA 4E8DA 4PEEA 3ZQ9A 3PZTA 4YPJA 1V6YA 3D51A 3WH6A 4Z2KA 4HOZA 3MS8A 3VMPA 1KWGA 3KZSA 1NWSA 1FA2A 4JFSA 1W9UA 1H3GA 4BQ2A 1RPKA 1KR1A 1R33A 3DHUA 3SUUA 2J7EA 2D0GA 1CBGA 3MI6A 1UKPA 4D1JA 3WNMA 1C93A 4V2XA 3DX3A 4E8CA 4TX6A 3WD0A 5ECUA 2F18A 3N17A 3WD3A 4FNTA 3PZOA 2WC3A 1EO7A 2XVKA 1K6AA 1VIWA 4JKKA 4CN6A 4X0NA 2XM2A 1HXKA 5DT5A 2WSKA 1TZ7A 1KTCA 4B9ZA 3WH7A 1EH9A 1D3CA 1MFUA 2FHBA 1FP8A 3U5YA 3BVXA 4PMUA 3CZNA 1HKMA 3THCA 4WLCA 3VGBA 5M5DA 4UCFA 2GFTA 1PX3A 1KGUA 2DEPA 4PMVA 3HZ3A 1BLIA 3AHXA 1XCWA 2D1ZA 1FP9A 4X0VA 2F7PA 3VX1A 2J47A 1HWWA 3ZOAA 2O9RA 5CSUA 4JCLA 1NWUA 1QNSA 4CVUA 2ZWYA 2DSZA 3W29A 1ZBWA 4UFHA 4DO4A 1PEZA 4KMQA 3N9KA 4AC1X 3EYPA 1UYQA 4C7GA 4DUWA 3BH4A 2G3NA 1EHNA 1PZ3A 2F61A 3H53A 3T0BA 3N13A 1JZ6A 2V5DA 1LG1A 1LWHA 5CPSA 4HPHA 1HP4A 2G3JA 1E72M 4B3KA 4U5IA 1V3IA 2WHKA 3GXMA 2D23A 4BZYA 3AHTA 5C71A 1JXKA 4FLOA 4DWSD 4P7RA 2J25A 3RO8A 1UHVA 1PZ2A 4M56A 3EJSA 1CWYA 2ZUWA 2BY2A 3WEZA 5JIWA 4UFIA 1U33A 4A4AA 1UWSA 4B16A 1E55A 4P7NA 5FD0A 3UR7A 4AIUA 3DYMA 3RM9A 2VTFA 4Y7EA 3SCTA 3VIPA 1R34A 4D6HA 1IZKA 5A2CA 2V38A 1XSJA 5A94A 4J3WA 3U7VA 3BSHA 2YL5A 1ZJAA 1XCXA 2WC4A 4NSBA 5IHRA 5AC5A 3TP4A 2OYLA 1J0ZA 1VAHA 3WUFA 1DP0A 2X2HA 2VQTA 1K9DA 1V3MA 1X6NA 3ARTA 1JYXA 1XH0A 3CZ8A 1PJ9A 4W5ZA 3ARVA 4QLLA 4M29A 3W0KA 2FGZA 3WSUA 2EACA 1E4NA 4MJ2A 3CV5A 2A3BA 1XC6A 1XHGA 4BF7A 4AD0A 1TVPA 1NOFA 3VSUA 4CKQA 3T09A 1E0VA 2ZX9A 3WDPP 3OLGA 3T0AA 4V27A 2FH6A 3W82A 1J9YA 1EHAA 3PZNA 3SUWA 3HU7A 1AQMA 1E1EA 3WDQA 1KXTA 1UOKA 4AIOA 5CGMA 4W89A 3W37A 1GCYA 4W8BA 1UD6A 3VUPA 3VIHA 3WEOA 5ABFA 1OT1A 3N1AA 2WHMA 3ZT5A 4M8UA 3PHAA 4AZBA 5I23A 2VCAA 3AMCA 3WN6A 3AIUA 3SUSA 4ZE5A 1R85A 1HKKA 2VZUA 4JL2A 2DSVA 4H8UA 2BFGA 1TUXA 1UZ4A 2J78A 1HKJA 2WMFA 4PUDA 4TXEA 4AMCA 1LL6A 3M07A
chains in the Genus database with same CATH superfamily
1IC4H 3L4VA 1PXGA 2UY6B 3SDCA 1OWRM 1JPDX 3PG2A 1NIEA 2D9QB 2FEDC 4U6XA 2ZCGA 1KXTB 1M1XA 5I6MA 2CRZA 5LJYH 3HG1A 4H40A 1DSFL 4QYOB 1N2VA 3TJPA 2OZ4A 2PODA 4ORIA 1XIWD 1KKOA 1J2BA 5HQMA 2BVDA 3ISRA 5EV7A 5F96H 3MNWB 5I6OA 1WA0X 2IADB 3HMCA 3G5WA 3V6FB 3B7SA 1TO3A 3SE8L 1A6VH 4XD6A 4GJIA 3B8VA 3O8XC 4I0PC 4TLKA 3LHYA 5MF5A 1VH7A 2OL3A 1H3PH 1MCSA 3D39B 4DLFA 2AGJL 4M03A 3RG6A 1QUNB 1MW3A 1CFMA 2J6EL 1N64L 3S8FB 5LHDA 4H8HA 4XMLL 1CDHA 3TT3L 4DAGL 4A39A 2O9OA 4DKEH 5TQ2L 1P1MA 3K2UH 4D0CA 5DK0A 3VFMA 4RMQA 2EO7A 1INEL 3CMJA 4PJEE 5DK3A 4E41E 1VIZA 3ZMRA 2R2CA 2Y22A 2NTFA 4KI5C 1XGQB 1C16A 3MRCA 2FIQA 3CFKA 4UTJA 1JPFB 3DX8B 2AL2A 4N20A 2VXTH 4CKVX 1V4YA 1IC7L 5EO0B 3S37X 3DRTA 1DQDL 4F3FB 3AREC 2J66A 3WJLA 4XODA 1F00I 3UWEA 5BS0A 5I8EA 1ONQA 4Y4KC 5E93A 1EC9A 5KBDA 1FAIL 3Q7JA 1B3ZA 3CNYA 2EC9U 5CIPH 4X4ME 2FTAA 3FUIA 2L7EA 4MS8D 2WZHA 4KZCA 4QLJA 2AV1A 3RWJA 3HUJA 1G7IB 1R3WA 5ERWB 1HCFX 4PJXE 5LCVH 2ZOTA 1WAAE 4YXKH 1A5KC 4Y5YA 3B05A 1VDGA 1Q1JH 4QFUA 3NQMA 1ZSXA 4NF7A 3CUPB 3FC8A 5KSBA 1KD0A 3V4PA 3VXMD 2C3VA 5BRQA 1UR8A 3I85A 3DBPA 2OW7A 5ANME 4ABWA 1EXUA 1Q2SA 3BW3A 1EEXA 2O93L 3GBDA 3G6DH 1LF1A 2X4UA 3QYNA 2OR2A 1NA8A 2CLVA 4C59B 2P8LB 1D9KA 5FYLD 1V55B 1HU8A 2YAPA 1YNKL 1GXEA 5EBWB 2B2XH 3QJZA 3LHPH 4LY4A 1FX6A 4PG9B 3GU1A 2XSXA 3SAZA 4OZHF 4HK3J 4IQJA 4A55A 4FFVD 4DPCX 1FQ0A 2QCGA 5HGAB 4JZNB 2DQHL 1PFCA 3FBKA 25C8H 1JZDC 4NHCL 1RSCA 4PB0H 4UUJA 1IFHL 4P23B 4NAQA 2IFFL 1HQRB 5BOZG 4BKLA 2YGYA 4CDGC 5CKSA 1UJPA 2VXQL 4LRTA 3OKLA 3RBGA 2P1YA 3HGRA 4ACPA 2BP5M 2AMXA 3L5XL 1M04A 5C3IA 3NO1A 5HDBB 4ANWA 4WVRA 1PDKB 2PZNA 3TJHD 2EYRA 3SDAA 4XX6A 5F1IA 2MQ3A 4X4KA 4UOJA 3Q9PA 4XZBA 4LFHG 3QQWA 4PLJC 1HK6A 3KPPA 1P1ZA 5I18L 4OIIL 1Z66A 5KOVC 2PDGA 1FWSA 3R1ZA 1JWSA 4Z7WA 4GW1A 4IRJC 3G6AA 5DO8A 2CESA 3UTZB 3MN8A 3ANUA 1QLFB 4GISA 2VC9A 1YNLH 3RA7L 5LXVA 4IRSC 5I16B 3U7YL 43C9A 3A21A 4DSYA 4P2RD 4NKMA 1IBBA 1PV8A 3PWVB 3ISWA 2PXYC 2A79A 1ZVHA 3L12A 3B2UD 3MRHA 4FE9A 3OO2A 2BW5A 3L1OH 3KPSD 3MRIB 3IS4A 1Z9NA 4MWAC 1NQKA 2G9HA 3MXVH 3RX7A 3W9EB 3U2OA 1U2YA 3H2PA 3MMDA 2JEQA 1DLFH 1JEZA 4Z77B 3LLFA 3FV9A 1BZ8A 1S78C 2VCOA 1G4MA 4J4PC 1BJ1J 4GKNA 3QHNA 4JFHD 4NQXB 3DLQR 5JXQA 3ANYA 4D8PB 2R0LH 3R4IA 1PSKH 1HHIB 2QGCA 1JHKH 4PCYA 2ATAA 4F1SA 1VZIA 5AWNL 4HCHA 4CMHB 1KTLA 4M1GL 1IZJA 5LXXA 4HSCX 1F7BA 3L4XA 4D7PA 2DZSA 1MUJB 3OGSA 4A29A 1A5LC 1XF4B 1ZOXA 2UXFA 3E6HB 2XH0A 2HJPA 1U4EA 3LPFA 5IF0B 4LANA 4KVCH 3BWUC 1EJUC 3VABA 3UPWA 4IX2A 2FYVA 3SIZA 3FCBA 1WYIA 5DJCB 4W9DC 4R8WH 1JK8B 2EE9A 1ONXA 2J75A 4GH1A 5C0IA 1TU2B 5GRUL 1TKWA 4WEEA 4LIQE 2JVUA 3TU6A 3TONA 1QFHA 4AYEC 3AJ7A 2OXHB 4PJ5D 4EMZA 1D2PA 3FYOA 1HINH 4PFEA 3REWB 2QHRH 2JV6A 4HIHB 4K8RC 2REQB 2FGBA 4P4RA 4IOSA 5TDOA 1W91A 1YCSA 3FQWA 2CETA 4FRWA 5CMAA 1H8OA 4Z6AT 1CLZH 1SYVA 4CD8A 4V2CB 3DX0A 2IKIA 1IKFH 4L8SC 5A2IH 4AEIL 4NAFB 1AQHA 4P3DA 4G11A 3FFCB 3G08A 3O9WB 1UKOA 3IRZA 1P48A 4DKFH 1T7ZA 3DECA 1UT9A 3QA3B 1G69A 1XEUA 1NC4D 1KMGA 3MUHL 1B9ZA 1XH2A 3QZ6A 4GGBA 4B41A 3LQMA 7PAZA 4JZJC 1HI6B 2Y61A 4LVOC 2I57A 4YS1A 3I02A 4DUXA 3GIPA 2JKWA 1FH8A 1I1AD 4WDUA 4QG9A 5FLUA 4C47A 3AQUA 3LS4L 4RFNB 4RESB 4YO0B 5F2MA 2WXGA 4B9PA 5JIHA 2UY2A 4H4NA 4FFZA 4GGHA 3R19A 3KH4A 5EF0A 1RFDL 4MQ7A 1EZVY 1FVDB 4MAVA 4Z3TA 2VITB 3TYZA 4PJEA 4E41A 3T40A 3MX0B 1OADA 1H7WA 1CLKA 4H6KA 4XN2A 5TF1L 4IJ3B 5BRZE 1GOWA 4W7WA 1DIEA 4O1EA 1LK3L 5BMFL 3LEXA 4NFDA 4PRPD 3JUGA 1TFHA 2JKEA 3TFCA 3BAKA 1TQTA 3RVVD 3MLXH 1YKWA 1ZLWH 3BZ4B 4ZX5A 4HU3A 4DN3L 4IU3B 3IB4A 2WTPA 4WI4A 4LBSA 4ZS6C 4B4HA 1QI2A 1KJVB 4NZ3A 4BSWA 3DG3A 4CRPA 3BH9B 3ZR4A 3RLUA 3QS2A 2X0HA 3ZKXB 2FWUA 4HB7A 3VE9A 1Z3RA 1AGEB 3O6AA 3N3MA 4UT9L 2Y6ZA 4JTFA 1GOXA 4KRTA 4C4BA 3S97C 1KV5A 1R2SA 4HNTA 2YC1B 1JQVA 3IGAA 3FK4A 7REQB 3UTPE 1BPVA 3NSDA 1QW7A 3A9IA 3MUIA 3WHXB 2A7BA 4G7EA 1H3TA 3TAOA 1RZJH 3G6JA 3O6FB 4JDVA 1PZAA 1XCQB 1F86A 3KPNA 4KZ0A 1NCTA 1LO2L 6CGTA 3CO8A 3CTTA 3KLHD 4YZFF 3H9HB 2WGNB 5I15H 4PGCB 3GTIA 4WFHE 4OBRA 4EZKA 4C4KT 1WWCA 5HXMA 4LKCA 5HR6A 5DLMH 1J2WA 4QRSA 4P46C 2NY2C 1R3KA 3U6RB 3ZFHA 1J6OA 4QKXB 3IMUA 4XVUD 4X8JA 1S8DA 4XNBA 1IEIA 1I2QA 5E08H 3V0GA 1MI5E 2VLLA 3VQ2C 4AY7A 5JW3H 4FXSA 2EBNA 3BPOC 4X5LA 5E8PA 2FEDD 2PYEB 3BT2L 3CLMA 3QFDA 2ZRZA 2EXWC 4HQQH 4Y89A 1QKZL 4GG8A 5F2LA 1SFHA 1EHLH 3LEVH 1S2AA 4UFKA 1UB5B 1MFDL 1T0NA 2FSDA 2OULB 4TOQA 3UBXI 2HVMA 4XPFH 4B2DA 2J7LA 5AYTA 1DBJH 1A9BB 4LJ3A 3SECA 4ADIA 2QQNH 3RG1C 3VCNA 4JRYD 3O8XD 4I0PD 4JKLA 4PRDA 3RDTC 5D9MA 4KJWC 3MOBL 1EEUA 4OCMC 1M9SA 2EDTA 2ZX6A 3T6XA 1EOMA 1QO5A 4FG6C 3QXTA 2P80D 3PSWA 2A9DA 5DFTA 2GYSA 1V02A 5CR8A 2W65B 5TH2B 1VADB 3WLMA 5EULV 3TZNA 5HJYA 5FCUH 3VFGL 5KVFH 4KTDH 4PJBA 4KI5D 4KQ0A 4I8DA 3RIAK 3KYMA 4W4NA 1E4WL 1VFUA 4XO3A 1AGBB 4MNKA 3ARED 3TO4B 4LKXA 3CXDL 1JZ2A 4Y4KD 4M8QA 1S9XA 1VFBA 3VWKC 1VGEH 3QDJB 5IVOA 4F9JA 3L08A 1OGAA 2YGOA 2I25N 5B1JA 1ML0A 4WY0A 1B4TA 4M7JH 3QDMA 3TLQA 5C07A 3H4XA 1FZMA 3GFXA 3HE7A 1AG0A 1F3DH 4TMBA 3QUZB 3I6EA 1W9DM 3UTSD 3O2DA 1W5NA 1HTYA 4RNHA 1O9WA 2HQAA 3I3EA 4EI6B 1XGDA 4PJCB 1CYXA 3H7UA 3FTGB 1XIWB 1E4KC 1TB3A 2C79A 1DUZA 3SBWA 1E8XA 1QR7A 1LORA 2K7QA 1ZXKA 3R13A 1GHRA 4Q4QA 3DOSB 1K4CB 4ZO7A 2W66A 3W7HA 4MBRA 2J9ZA 4MDIB 4TUOA 4MRCA 1OSZA 1JL8A 2G5WA 4M80A 3SY5A 3KLLA 3AT9A 5CPNA 4GXUN 4B5VA 4OZGF 1KIPB 6PCYA 4LF3B 1E6NA 2OWCA 2OP4H 1NCNA 3VA8A 3MSDA 3GFUA 4ABVA 2IC2A 5CN1A 4Y7OC 4NZRL 2DW5A 5JQIB 4FXFA 3FKKA 3IIZA 2YAHA 3FU8A 3RL2B 3GJFB 4NP4H 3AXIA 1NVMA 2DYPA 1ETZA 2KQNA 2W60B 1BYDA 4E9YA 1K6QH 5EN2B 5AAPA 2K9FB 1Z9AA 3TNNB 2QPDB 4GRWF 4FMVA 4BZ2L 2R56H 1Z2KA 3RZCA 1J0YA 1T1XB 4NJJA 1U3HB 3NO5A 5JZ7C 4G80A 2C9QA 1TJ0A 3GK8H 4DGIH 3NPSB 1A49A 3BKJL 1K77A 1CXKA 1O0VA 3RLGA 2VAAB 1QACA 3W2KA 4BH8A 4NQED 4PLJD 3HNTH 3WL0A 4TULL 4HS8L 4LCWE 1TPUA 1NIFA 3NMEA 3FQUB 1G9ML 2N56A 3JWOH 4IRJD 3KTCA 3DBXA 1WDSA 3EJCA 3HPLA 4AIZA 5BNXD 3VU1A 4YFEA 4IRSD 4PBFA 5L9DL 5BRZA 3U9PH 2VMCA 4RAVB 4K7VA 1WFTA 2O6PA 2OQLA 1FNEA 2O5YH 3LDBB 2PXYD 2QHAA 5EEWA 1WTGT 5D7KD 2V17H 3NCJL 3S36H 1I8IA 3ITXA 2WV3A 5I6XB 4R4BA 4BE6A 3FA3A 3VIJA 4MWAD 3ZS4A 4DBSA 3WUWG 2TRYA 3LM7A 4AGOA 2AVFA 3STBA 1MHHB 4QG8A 1MFBL 2CIPA 4MAUL 5PAZA 3GTVA 3E1F1 1S78D 3R8RA 1ETB1 4J4PD 4AH2B 2RD0A 4HKZA 6FABH 1OQOA 1ILUA 3EYQD 1W3IA 1P5VB 3VRLF 5F7DB 2HAZA 5IB1B 4N1CA 3T77B 2H8ZA 5D93B 4DM2A 1AC0A 1MI3A 3LTSA 2DL9A 3H56A 4IF2A 4LYRA 4G6ML 4J7RA 4QNWA 4HZ1A 3SPJA 3QEUA 4Z76B 1JNLL 4M93C 2FJHB 2Y4SA 5IB5B 3AABA 3MA9H 2WTRB 5CUSH 4PN6A 3X13B 2VT0A 1H09A 4EP8C 4KJQC 2IQDA 2O6EA 3OIXA 2FJGB 4AGLA 2PCFB 4M1BA 1R38A 1BYPA 3OJDA 1RHHA 2FBOJ 4P2RB 4E42A 1A3QA 5IOPA 1TPH1 2X4SB 4NNBA 2LU3A 2UUDK 1AQDB 4K8RD 3UC0H 4U1GC 3CHCA 4P4KC 3E9TA 2JJWA 5LBGA 5GGVL 3T42A 4G82A 4C6MA 4JIEA 2DEWX 2NY5H 4RDBA 2AABL 2DZTA 4QLRA 2YLKA 2D4FA 2MANA 3GTHA 3NIFB 4XPTL 2NXYB 4ZPTA 2F7IA 3U4BL 1S9VB 5JW5A 2EDKA 2C3HA 2BNQD 4X9BA 5GJNA 3MV01 4WU7A 5AY7A 4PGZA 2OR9L 2X7LB 5T3XE 1JDDA 3NGBB 1A3HA 1OAXL 2A9MH 4UIKH 5JH2A 2RH0A 4PR4A 3WH6A 3KHQA 4Z2KA 5FO7B 3VMPA 1KWGA 3QI9A 3EO1A 1DIOA 4PFHA 2Z25A 3UZXA 3V95A 3ATBA 5EIQA 1U8KA 2ALDA 5M2FX 1F4WL 3CG8A 1AK5A 1C93A 4V2XA 4MA3A 2BIPA 4NQDE 2X4NB 2IMNA 3MVIA 2WSKA 4WI0A 3FQRA 1E9ZB 1W8EA 3W7DA 4ZMZA 3WH7A 5CJOH 2WBWB 4PBEA 3SQMA 4XN8A 3GSUB 5ACZB 4IBYA 5C0DA 3KCPB 1TFPA 1HGYA 4X0VA 3CN3A 3AACA 3QYQA 1QNSA 1UZHA 3W29A 1G7LB 1GAFH 1R3HB 4PJ5B 4YFDB 4DZBA 2R1YB 1N12A 3EYPA 2HFEA 4LCQA 4LQFH 3EZ4A 2WGXA 3D25B 3KAAA 5GRXG 1E72M 4BZYA 5C71A 4OFCA 4OZIB 2XN9E 2VZ1A 2YAMA 1DUYB 3RYMA 2NYYC 2NUTB 2JKTM 4AYFB 4ZS6D 4K94H 3A6BL 2HJLA 1SDAB 3CE1A 2M26A 4HIJA 2PDYA 1DDHA 3DFNA 1TETL 3L3OA 3IN0A 4L80A 4B16A 3HBQA 4L8DA 4YZWA 4AIUA 1WOAA 3FTXA 4TSCL 2Z7KA 5FB8A 2EC9T 4MNGB 3LHUA 2XNAB 4DP7X 4G5ZL 5AC5A 1M3UA 3TP4A 5ITFB 5HHOE 4HPNA 1N2RA 1X6NA 5EF1A 1QFWH 3LQZB 3OVGA 3E38A 4M1DH 4NZ1A 1N8OE 5H8MA 1MCDA 1JGLH 3VWJA 1YN7A 4TU1A 1EAOA 4WHYH 3NABL 1I1AB 4FYSA 1NGZB 4AD0A 2V8MA 4XPGL 1S2UA 1JCTA 7ODCA 2APVA 5HHPA 2Q3AA 3QO0A 4W9GC 4MCYB 2WOYA 5CBAA 3PQYD 1XGRB 3DGDA 4Q6IA 2VCAA 4AF0A 1GHFL 4E0CA 4R97C 1HKJA 4TXEA 1HILB 4J6RH 3N14A 1FFPA 5C9WA 2UYLA 2NNRA 3F58H 2HPMA 4WVXA 1PPIA 4X6DE 2CMRH 4R83A 1G7HA 4Z7AA 4XZ9A 3U79A 3S0CA 4PUJA 2X09A 3KPLB 4YZFE 4NUJA 4P46D 2NY2D 5CZSA 5DJXB 4U7MA 5EU4A 3VFWB 3S2JA 2HCVA 3DENA 3B0YA 1XXDC 5DT1L 4B7IA 3PVFA 2XGIA 3PB0A 3GJFH 3GKWH 3ZTNL 2FEEL 1RJPA 4ZZ9A 3VFNB 1A3LL 1JHTB 1U92B 3D4GA 2ISWA 2ACSA 4FX6M 4PYSA 5HYEA 1IO4C 2ATMA 2WHVA 1AIFA 1SDYA 3HZYA 3GG8A 4LSVL 2EXWD 2XIQA 4L3EA 3L5WB 4XTRC 1E8WA 5GRYA 3BVJA 3AXHA 1IEAA 1GOQA 4N68A 5GGSB 3H7LA 2CBOA 1WAPA 1C8VA 2ZVIA 4FIRA 4S1DC 1Q4WA 4HU4A 5BZWA 4NJKA 4PS3A 4MTVA 1YIXA 3X11B 2FB2A 2Y1AA 1IQWH 4FNQA 4MNMA 4LSSH 3RDTD 4KJWD 1GZJA 1GQNA 3RUGF 3FT3A 5A6MA 1I4FB 4NO5B 4FG6D 4W9LC 1A5FH 4G6FD 2X4TA 4FLRA 1XCTA 3E2VA 1F18A 3N41F 3D4ZA 3ME0B 3RNQB 1MO0A 5JO5B 4F7EA 2Y25A 2E6YA 4FX7A 5FYLH 3FJNA 5SWSE 3IMBA 1OC6A 3NSCA 2JCWA 4XAKD 2VISB 2XISA 2PURA 1TRIA 3HTLX 15C8L 5D72H 1PFOA 3VXGA 1ADQA 2Q3RA 5LNUA 5FFOA 4QRNA 1GZHA 4GXPA 5AHNA 3GNDA 5ALBH 2JK5B 1A4AA 2BMBA 3USZA 3NQDA 2HVKB 1EANA 3MUUA 4XNUH 3IJQA 1QZNA 3GHBH 5DUMH 3GXDA 5FHBH 3V7MA 3QKZA 2WBXA 4G42A 3JRKA 2PPEA 5PCYA 3HKZA 2XVNA 1NUGA 2YPKB 8TIMA 2ZP8A 1QD0A 1R9ZA 1LP9B 3JWNC 3UWYA 1AKJA 4GP8B 3M7WA 1MFEL 2XPYA 1U91A 6ALDA 2R2BB 3IVKB 2ZPKL 1TZHB 1BZ9B 1SO3A 1K8CA 1CT8B 1FNGB 5L88H 1M7JA 1AMKA 4JRYB 2AQ2A 1YSOA 3Q6GL 4AUYA 1HH9A 4I0PB 3G0SA 1WDPA 3FBQA 4YWIA 3W00A 3B2VH 1DBBH 5HHME 4V1XA 2CHNA 3ULVL 4OD1H 3W23A 1EX0A 4TL5A 3L9RB 1OLZA 3FO9B 3DV6B 1TA3B 2DTML 1KB5B 4KTEL 4AC4A 3M4HA 1GTFA 1XGYH 1T20B 3GI9L 1W72A 2GJLA 3DERA 2AXFB 5DCEA 1T5WB 4Y2OA 2W95A 5I19H 3PP4L 4ZSOA 3AREB 2V9UA 1XZ0A 1UIPA 2QVMA 3MGOB 1JR1A 5K9QG 1NBVL 2YAFA 2BOLA 2AK4D 5DJ2A 4HUUA 4GSDH 4XZUA 3RDKA 4GKTA 5JH1A 5JZ7D 1Q9LB 1B6UA 1EZLA 4FQPA 1V8HA 3FAXA 3NYZA 5L2KA 2PZ0A 2GBAA 4EIBA 1G5AA 2D31B 3NZQA 4YPGB 1O75A 1X9UA 1XR8A 1EXBA 4M5YH 3U4AA 1XIEA 4WFEE 3M0KA 1FNFA 4J8RB 4KAQH 2BG5A 2FCBA 1R3VA 3VIFA 4JPKH 3FCSB 1Q0EA 5HDWA 5D71L 3KXFE 3VFTB 4NC1E 3TYBA 1KGIA 2QLVB 5KMYA 1DQUA 1WBZB 4IK6A 3UT0A 2K70A 3A6OA 3WUWA 4FF7A 1UC6A 3FQ2A 1KNWA 1YEEH 2ZVRA 5EB8A 4WI5A 2NUWA 2ED7A 5DMLA 3F1QA 3H24A 1M9WA 1H11A 4NQVA 3HLAB 3VD7A 2R6OA 1R5IB 4LYQA 1UH3A 2R69H 1PZBA 1FYTE 1F05A 1TNMA 3F5KA 1IJ9A 5I7GA 2EICA 3ASWA 5I03A 1RZIA 1AQKH 3T9PA 1NOWA 4JAWA 4A8NA 4UDUB 2ZE3A 1I7UB 3MMWA 4R7DA 4N28A 3W07A 5ACLA 5I1DA 4FDWA 1NP2A 1U8NA 3SIKA 3QW3A 1GVQA 4O16A 4Q2ZA 4CA4A 1HQTA 2BDQA 4DO7A 1A14H 3A4AA 3PAJA 2V2DA 1OP3H 4Q6JA 4XBPA 3NJ3A 5D70L 3CC5B 4NRXB 5KN5B 1R17A 2C1GA 3TJLA 1OTUC 2EIBA 2VDLB 4FFVC 4NC2B 2JH2A 4A37A 3PBGA 4YC2C 5DS8A 1CCZA 3WKNA 4HUWB 1FRGH 1MCNA 1XKYA 1OZUA 1LJYA 5DD5L 2YMXL 2ZJSL 2CJTA 3ATAA 4K8EA 3SCMA 4H6EA 4QRTB 5IFJA 2ZKXA 5MEOB 4X7TA 3W3BA 4KJQD 3IM1A 3H6OA 4HD5A 2ZONA 3FEMA 1UA3A 3BUYA 3LD8B 4GAJL 3MV8B 3QARA 4RX4A 2PXYB 5D4HA 4P4KD 3JWDL 4OCNC 3NZPA 2CZNA 4OLEA 1A7OH 4JN2B 5E1AB 1DTUA 5GNZA 3QEHA 4DYKA 3T3MB 3OZOA 1KTNA 1OCWH 3WBAA 3D0LB 3VXSE 3NL5A 3T4AC 1TPFA 2FFIA 2ZKHH 1HEZB 2IANE 5ENWA 1F58L 5IFAH 4NZTH 4ZA0A 3NEHA 1XD0A 2G75A 3N25A 2CC0A 1BD2D 5EZOH 4OGYL 4LAUA 1Q6EA 1VF8A 5JIPA 5HR7A 3IMVA 2J5LC 3MRNA 4HQVA 4R4FL 4NWUH 1C1EH 2CA4A 4N2CA 4F20A 4S1FA 3W7NA 3HMXL 2JJTA 2JCCB 2VERA 2YD3A 3ESUF 4RMWA 5CIPB 4JM4H 1SXSA 1S6NA 5CFHA 1E1FA 4KF1A 4JZ5A 4LUIA 4F58H 4U1JA 3E9UA 3HOGA 4MWFB 4H2HA 2OAAA 2K4AA 1JF1B 2NNXA 4XMVA 4K9EH 4Z08A 4DM1A 1Z6KA 1WD9A 1N3NA 2V3GA 1PDZA 1QWHA 3T8XB 1D6VL 1C9DA 2J1WA 3UTQA 4KWSA 1EFXD 4K3JH 2R29L 3ARYA 1MREL 4MKNA 1OAKH 3RO6A 1JK9A 1L0PA 3O6DA 4XTIA 5F1VA 4GJTB 3EBGA 2NYYD 1FDLL 4JX0A 3HJZA 2QPSA 1A50A 4U1IA 1XI3A 2BNQB 4A68A 1BXUA 1H60A 4Z1AA 5JIQA 2RA1A 3QIBC 4FEMA 3VSVA 1WFUA 3TT1L 1QWKA 4DF9A 5KBLA 1LDSA 2HBVA 2GT9A 1H7XA 3VDGA 5TDPB 5CP7A 5I8CA 1NIAA 2ATKB 3S5YA 2Z27A 2IH3B 4JZJB 1T5KA 4K5OA 1DVFC 4LVOB 4X98B 1FKWA 3IJ6A 4O57A 4A8LA 3R1GH 1AGCA 2UBPC 3HZKA 5EMJA 4NZUL 3T8VA 1MQRA 3FDGA 4WWPA 4MNHB 3AS2A 1H1ZA 4JQVC 1J5CA 3H9YA 5AB1A 4HXBH 1EPFA 1O95A 2FLBT 5BRBA 4X9FA 1TJMA 1T7XA 2X3CA 2CPUA 1TDQA 4ZQKB 3HFFA 1KLYA 2YD2A 1Q9WB 2XQYG 2Z4GA 2IDUA 1YMMD 1XGPA 3H22A 5IB3B 4RLIA 2OV0A 2YA0A 5HWNA 5CEZD 5C0RL 2J88L 3FQNB 1D7BA 4PRAA 4C91A 2P5WD 4GPVA 2J7CA 1M9HA 1EJ7L 4PJFE 2P24B 2W91A 1MOEA 4QKTA 5C09E 4FCHA 1FIGL 2G0KA 2FEEI 4HYTB 1KB5H 5MEQA 3FU7B 3ZTJG 4KQ3H 3VIGA 1PX4A 2HFFA 4ZD3L 5DJ8A 4Z3GA 2BC4A 3PABA 4GO8A 3BP4B 1F76A 1HXYB 1DJZA 5FAAA 4KTYA 5BU6A 3IDYB 1O7VA 2I1OA 4NENB 1OM9A 1OAZH 2Z4QB 5D7LB 4UTIA 3T1GA 1KY7A 3VG0H 2ADJA 2XXGA 3BE1H 3UJRA 2H1PH 1JUFB 2R1XA 3LH2L 5AEAA 3RVVC 2I9TA 4XTRD 4OT1H 2Z93A 3TS8A 3EWWA 3HGOA 4QTHB 2ICWI 3VI3B 1L6YA 4S1DD 1CZ8H 3WIHA 2AGTA 4NNXB 1A0CA 4BK4A 1JN6A 3KLDA 1PG7H 3MRDB 4PUUA 2VELA 3FKRA 3XINA 5D05A 3KD4A 3EYFB 1MQKH 1BX2B 2AJVH 2HX9A 5DEGB 4AG4H 4ZXBB 3WFLA 5HGBB 3SDXE 3DROB 1VGAA 3DHFA 4XWUA 1FYTA 4OD3L 3HZMA 2YD0A 4JY5L 4YDZA 5I09A 3WENA 2YPLE 3CFIC 3AY4A 4WUKH 4MZIA 1OOWA 2X1IA 3C86A 3H21A 4PUMA 2XTSA 1KXVA 4W87A 4F4RA 5HANA 2ARWA 3WFDH 4HZ6A 5F9AC 5C0BD 5GGTA 4P46B 3QNXA 2NY2B 3FOLB 4D9RE 3KLAA 1CI5A 1NGPH 2CZ5A 3QDGA 1O66A 2UVFA 3U7AA 1EXGA 3DBSA 4AZ5A 1WP6A 4RZCB 2ICSA 4W81A 3AG3B 1BVZA 2ITEA 3SKNA 4E0RA 4HZ8A 3ZLHA 4F7MA 1W9PA 4LDCA 3WF2A 4LLYA 2CJSA 4OJFL 3MJ6A 4HA4A 3U8GA 2X8RA 1A1MB 4IUOA 4PODA 1NMBL 3VGDA 3CFJA 2ITDA 4LL1A 1T7WA 3DPDA 1JYNA 5J5DA 2HP4A 5D30A 5EMKA 2OCZA 5FESA 3RDTB 4XB3A 1XPGA 2NVAA 5GGQH 1ZU8A 3RLHA 1K4HA 1SQ7A 3AU2A 1Z8AA 3P9LB 3L66A 1QSED 1KFBA 5E6IA 3OZYA 4CBPA 4LCYA 3B9NA 5FECA 1K2DB 3WO3B 4PLKD 3L65A 1IAMA 3NGFA 2NUXA 3DVNA 3J07A 1LOSA 1Q0YL 3GY1A 1KJ2B 5HY9B 5TPWL 2XHYA 1IBZA 1Q6OA 3D85B 2BSSA 2NVDA 3W2LA 3HFML 1L7TH 5F0PB 2DQGL 4MRBA 1WT5A 1YQ2A 3UZJA 5E2VH 4ZODA 3VOGA 3CIQA 3CZSA 1T04B 4M3JA 3SY0A 3KYKL 3VWKB 1N5AA 1W1TA 3TWCH 2WB5A 4TL4A 1NFAA 2AEOA 3K46A 4HA0A 1WWBX 5D2WA 4C1NB 3LZOA 4NO3B 3UYOD 3OGOE 1FFOA 3EJQA 1U8IA 4QGCA 1KA9F 3PNUA 3Q65A 2D7MA 4UR8A 5IG7B 3P30L 3B9DA 3IN2A 3NZRA 5DS2A 1LHZA 5I1CH 5TBOA 4I3SL 1YQVL 1JNNL 4HJGB 2EH8L 2XCMC 4HF5L 1UD8A 4XN1A 3TV3H 1L9TA 1AFVL 1U8OA 1F3TA 2Q6WA 2ISVA 2BWIA 3H42H 3CSFA 5DMIL 4FOKA 1CTNA 4JQ4A 3QQ4B 4U6YA 4GQ9L 1MCWM 2EUVA 1MRDL 1XF5B 1EDHA 2CK0H 1D3GA 4Y2NA 4QBXA 1E4JA 4Z3IA 4RDZA 2AKMA 1OD8A 3GQFA 3PNRB 3VXQA 3F2BA 4A1RA 4BM7A 1LL4A 4MJ5B 2BP8A 4PUWA 4BK9A 4K23L 4BH7A 2BNUA 1KBPA 4Y5XA 5ESVA 3GS0A 4RLDA 3MLYL 2Y8VA 4IBUA 3UXAA 5FAJA 4ONOA 4ZBJA 1OEZW 2Z35A 1ZKAA 3Q1EA 1RLCL 3MJ8A 3I6LE 1A4KB 3NQKA 3UACA 4K8RH 2CEQA 5C0CD 1HL4A 5HHNA 2YJLA 1PIGA 2DY2A 3VFSA 1RKRA 4OV6F 2I5QA 1Z9MA 4NUQA 1XX9C 1FFQA 4NRYA 5DD6A 5L4MA 5JMRA 4ICXA 1IM9D 3JYBA 4LSUH 1KACB 4DP0X 2AK4B 1T6MA 4JQIH 1GEHA 3EX6A 3C5JA 3L16A 3S6TA 2ESVA 1SEBB 7ENLA 6XIAA 3VFUB 4EI5A 3CYVA 5F7EL 1XQ4A 4H4IA 3IMSA 4ZXLA 2Q02A 1OTUD 2QFPA 3KMDA 5GS0L 1GZPB 4QHPA 4DN4H 4GUOA 3QORD 1ZB5A 2HKFL 3VCLA 5C0GB 5F1OB 1E4MM 3CQFA 3RWGA 2O6DA 2CZFA 3WAJA 1E9OA 4KCUA 5IHLB 5IHZB 5A8NA 3LS5L 4Z7NE 4F8TA 2A77L 4M48H 1VZHA 1TITA 1FPTH 2XVLA 2CNCA 1JBJA 3CUHA 4YSDA 5L2JB 4UFMA 1TJGL 4TQ8A 3BW4A 4FHAA 4ELKB 1CECA 3FDKA 4PJFA 4UILH 2O92A 1JHLL 3NG3A 4FNSA 2A6IB 3X12B 4NC0B 5C09A 4O50A 5F4XA 2W07A 5BOOA 5IBTL 4MFHA 4Q8WA 4CCZA 3PRZA 3IVTA 2Q2EB 4PJGF 2P8MA 1BVNT 4UXDA 4ZMTA 3PC0A 1UWAA 1LWRA 4TX6A 3WD0A 4FO4A 1BSLA 2ZZ2A 3T0EC 4JKKA 2JXMA 4YTTA 2XIDA 1ECQA 4EBQL 1SGJA 3NG5A 2UWEE 1GS6X 1G6RL 1AJ7H 4OQTL 3V6ZA 2V5JA 3BPWA 3QV8A 1KGUA 4ZAKB 1LEGB 4NGHH 2DWSA 1XIJA 5RUBA 2X0UA 3KPOA 4ZFZB 2BASA 3R7RA 4DP9X 3ARGC 5ID0A 4QG6A 3FJTA 2OMUA 4G8EA 3QSTA 5I71B 3US9A 3GUGA 3V1PA 5C97A 1CIDA 3GBLA 3WQDA 3QSRA 4M93B 3DIDA 1ZCRA 1KC5H 4CQ8A 3ZRFC 5EO1B 5FJUA 1BWMA 4B3KA 3FU3A 5CJXC 1E1CA 2W9DH 2FPYA 3SDXA 3GSRA 3WFHA 2GSMB 3NVTA 3EYQC 4WU5A 2GTQA 3DPBA 4QCIA 3PWPD 1BECA 4OTKA 3GZKA 4WSGA 4GNKB 2J55A 3DXAA 2V67A 3H7VA 4ODWB 1Y1DA 5IUSA 1S3KH 4QEHA 3TLLA 4P7NA 2QHLA 1FZOB 3AZUA 4P4KB 4D6HA 3QJRB 4NSBA 3VRIA 1PWMA 2OYLA 4Z0BH 4KBPA 3B43A 3TIDA 4PB9H 1V3MA 3RX5A 4W5ZA 1NCAH 3DX5A 4XC1H 5IMLB 4DELA 3HOJA 1YY8B 5E2TH 3CV5A 4CILA 2P10A 1XHGA 4ZFFA 3QYCA 3G5VA 2QADC 1T83C 4DVRH 5J1AB 2GTWB 5DANA 4EDWH 3B5TA 1NOFA 3TBSB 3GMRB 2CK2A 3M0XA 3QIBD 2BNRE 2M8XA 3SUWA 2VE6B 3CQIA 2GIXA 4ODBD 1GCYA 3VUPA 4HBCL 1Z0MA 3ESMA 3DV4B 3AMCA 3UIYA 4FF9A 3QJQB 1DVFD 1AHWC 1A5OC 1GTHA 4HEME 4U7SA 1ZANL 3W9ZA 3JV6B 4GRSA 3PV7A 4A2FA 2XQYA 4JKNA 1OABA 4P5TA 5I8OH 5HDQL 1PKLA 1D9EA 4HPGA 2D3NA 5HVGB 1LVEA 4O0QA 2VGIA 3V4BA 5INCA 1HL8A 3NZUA 5ID1A 1B4JL 1KIRB 3MREA 3N2BA 4KX8A 2D2JA 12E8H 3TBYB 3LU2A 4MNLA 1CGVA 1S7XB 1EFXB 2Z8RA 4ZI8A 3WX7A 1QXLA 1X7FA 2Y5QA 3UJTH 2HRPH 3QXWA 4PGLA 4DEFA 3FUJA 5ABTA 5C0FA 3P4NA 1KJ2H 1FBIH 1FVCA 2FDBP 5IFHL 1NBQA 3IDGB 4NKCA 2BCKB 8XIMA 4G7QB 1UA6H 5KW9L 4N0UB 1R7AA 5XIAA 2V2TA 4LCUB 1YYLL 3VIMA 1BFTA 1ORQB 5EUKA 5EWIL 2C1PB 5CPLA 4RMVA 5AVTB 4XP9L 5AVZB 1ZT7A 1UEYA 4PJ7B 3TCTA 1SW3A 5DX7A 3SADA 1D7FA 1D5MA 4X7EC 4AX3A 3GFZA 2E7BA 5AD0A 4X4MA 5AOZA 4FFYH 4CVXB 3OKDA 4M61A 2XINA 1D7KA 1RY7B 4YOKA 2EVGA 2DJUA 4PJXA 3UJJH 4J3SA 2P26A 1TPEA 4X6EA 4XCEA 4AOFA 1WAAA 4NUMA 2J43A 5A8PA 2QPFA 3TSDA 1NCBH 1T1ZA 1IAIH 1VERA 3FK3A 4W6YB 5CZXC 1PZDA 1E5BA 2R1KA 1ETA1 3MSPA 3S2MA 5ANMA 3N1PC 3BQ6A 1KBKA 3VNZA 4TXVB 1EJWC 3PDDA 4TTUA 2X9ZA 3BCDA 5DF0A 2JI1A 5IREA 4HCIA 1RIHH 1P0BA 4FTVE 3BJFA 2Y07L 4X5PA 2P5WB 3OB0K 5FR3A 2K7PA 1PGRB 2QR6A 2BOBA 4WI6A 3A5FA 1V3LA 5DD0H 2R4SL 3ARUA 4DAIA 1ZHKA 1DTNA 1NTDA 1ZLEA 3O4OC 1FO0A 4I18A 5FKAA 4KZEH 4BEIA 1MEWA 5BW6A 3QFJE 3FY1A 1K3IA 3G6MA 5LDSA 1JZIA 2YGQA 4QJ3B 3UNDA 2H6PB 4LPTA 3NFSH 3EHBC 4DW2L 1A4CA 5CILL 5FEBA 4FQLL 1AH3A 5D7EA 1O6SA 2A74C 2E9JA 4DB7A 1ITCA 1R47A 1KCLA 3MHFA 5REQB 3BLFA 5ECGA 3TL5A 4YHNB 1SYSA 3TTSA 3TQKA 3NAVA 2PTYA 4DHGA 3R89A 4ZCWA 4ECNA 4FIQA 5H8UA 4E3TA 4K15A 5IHWA 3CN4A 3UZZA 4JLRB 2XZ9A 2CIKA 4Z2JA 1V0LA 4A63A 4PBXA 5IGXL 1PVNA 3L3HA 1CDGA 1OAUH 4ADUA 3IETA 3G5ZA 3DYPA 4LP4A 4PMNA 4Y4FA 4IIGA 1CDJA 1DO5A 5IY5B 3PZIA 5F88B 2APWA 3BW9A 3THMH 1S38A 3TTYA 2IH1A 5C6WH 3GIVA 1SZRA 2O61A 3SYOA 1N7KA 3T8QA 1OWQA 3QMRA 1VPOL 2J7HA 3O6CA 4I48A 4LLMB 3QMTA 1SFSA 2IAMC 2VEGA 1EJXC 3B0PA 4UT6A 4JHAH 5T33H 5C0BB 1WYJA 1ZGLB 2UWEA 3BFOA 5C6TL 1KFWA 5C2UB 2DJXA 4MD4B 3D6NA 3IRPX 2GIYA 1KF9B 3VXUD 1FJ1A 4QJ5B 3JR2A 1PKQB 3PDOB 3MP5A 3GXPA 4KKAC 3WJWA 3I50H 3IDJA 1TVHB 1N8ZA 1VSCA 3BLIA 3RJYA 1PZ5A 2ORBH 5GNYA 5JPMA 1MVUB 2HISA 3W02A 4NM8H 2R14A 5DA0B 2YBRA 4B90A 1PYWA 4WJ5A 4S2BA 1SBSH 3ES6B 3APGA 4FI6A 3QZPA 3P0VL 3DG6A 3O2VH 2W5PA 4AG0A 1WXJA 4YL4A 3ZLQC 5ADPH 4EE2A 3A6CH 3QZMA 4M6ML 1ITUA 3CV2A 3ZJ7A 2ADIA 1OQFA 2EUZA 3U4EA 1QYGH 4S3DA 2AV7B 2YSSB 1XR9A 2EDJA 1LQ0A 4RUBA 1IBHA 2PD9A 4EWJA 1FL3B 2IXQB 1IE4A 1PZ0A 3L17A 3BQVA 3C6EA 1RZ7H 1HJWA 3QR0A 1FHVA 2VAJA 3WF1A 3K4AA 4J4KA 3GBML 1KM5A 1G4PA 3BDXA 1ODZA 5DQDL 1K8IA 5H1WA 3SFKA 1TQVA 1MAMH 5EPMB 4RNFA 1VYRA 2LFEA 1JNEA 1TPDA 1OX5A 2WXHA 2CHXA 3WK0A 4RMTA 1X6LA 1C08A 3PL6C 3VKDA 1F90H 4S3GA 1UJQA 1FZJA 3UMNA 1DJWA 1XF2A 2ZOLB 4MBOA 5H35A 4G8IB 3ABMB 5FHAH 3T65A 2DQUH 3NEXA 4Q4RA 1ELSA 1IGIL 3QHTC 4QF1A 2BRRH 4C6JA 1ZV2A 3ASNB 3FS2A 1WBXB 2Z6IA 1U93A 4OZHE 4JB9L 1OK8A 1HHKB 3V8OA 5HJ3B 4BZ1A 3CT7A 4JG5A 3KDMA 6TAAA 4S3FA 2ZCKL 4MD5B 1US0A 2XJLA 3VDCA 1NGWB 1OLLA 3FH5A 3NN8A 4N0CC 4K2SA 4MY1A 4GVHA 1W8OA 2CA3A 5J6GA 2EG8A 2KPNA 2FAUA 1X5LA 4DCQB 3WOVA 3IANA 3PGFL 4M7LT 1OARL 4I88A 2YD8A 4ORGB 2RFXB 2NY7L 4ZB5A 3ZTEA 4DP1X 3GVGA 1NFIB 4ZFQA 1OCCB 5DVOA 3VXMB 3OKOB 2E3ZA 1PCWA 2OK0L 3FTZA 1DVXA 3Q06A 4A6GA 2WC7A 5AW7B 3JTSB 4U1LB 3BWZA 3ZE2B 5GRZA 6PAZA 3T0ED 3IJHB 4PJGE 3SYQA 4AV0A 1GSKA 1XH1A 4JHUA 4XG1A 5F6HI 1A4JA 1IQDB 1A53A 3IWPA 2I26N 4WW1A 3BH8B 3DWTA 3N9GL 4WWKC 3EYSL 1WIOA 2CDFB 3CHSA 4M24A 1I8KB 3LEYL 5DRZA 4YHPA 3HJ0A 5HINA 4BHUA 3ARGD 1A2YA 1KFGA 4JG0L 3WLBA 3ARFC 3IARA 2CFFA 5KG9A 4WHBA 3O81A 3CN1A 1WCGA 4NQCD 4DWDA 1CI1A 1E9QA 1BV8A 3LZFH 1LO4H 2BX7A 1UWEH 1DJHA 2V5SA 1SM3H 3BRGC 2PWUA 3HI1B 4HWBL 3ARPA 4MNQE 3Q2DA 3US0A 1YJDC 1R3QA 5HI5D 3V0HA 1K7XA 4D0DB 3OYZA 4L4VD 3BISA 4AT6A 3VFVA 3O3EB 2E59A 1PWLA 3F05A 3SPGA 1CFTA 2VDLL 2HWGA 3WMQA 4ERSH 5IJVB 2EUXA 3DGGB 1IC4L 1GC1C 5CEZH 1VBJA 4B9YA 4HNNA 1DWHM 2MPAH 5MHBA 2WLNA 2QADD 5DEJA 2MKLC 1GUVA 4U3AA 1DL7H 2I24N 5J9PA 3WFEH 1IAKB 1NBYA 4RFEA 1DXEA 2DJ4A 3F7YB 2J5LB 3APTA 2XHNA 1BRLB 3FYIB 3NPVA 3PUEA 4DQOL 1NP0A 5F96L 1BFOB 2B31A 3FMGH 2PBOA 3KPSB 5DEFB 2ICEC 4KXDA 5EMUA 3KNBB 3IBOA 4U3SB 2NT1A 4G1KA 2KMWA 1IGTB 1HNFA 2O6CA 3PWAA 5KZ6A 3OQ3B 1WCQA 1JZEA 3CQQA 1JRBA 3OG4B 1MI5A 5JOPE 3PF3A 5I8KH 4FI4A 4IGSA 2JI2A 3S1XA 4DFHA 2IUZA 4DKEL 2V33A 3K2UL 1ZRUA 2YS4A 5DMNA 2QZ5A 4L1DA 1DEEB 3L9EA 3WFCH 1EJ8A 3O41A 3PTQA 3R12A 4P9HC 5LNDA 2ZKMX 2VXTL 5EZJA 4PCPA 1MCLA 3B0VC 4B53A 3AIRA 3W1MA 2GQ3A 4HC1A 4K3HA 1HIMH 1KQZA 2VDGA 1MWAH 1CB4A 2G3XA 4NM4H 4P04A 2DSUA 5D2LB 3H2MA 2NXHA 1T66C 4NLHA 4N2GA 3LRHA 2QGEA 5I6PA 4REQB 1TIWA 3AUOA 5G2HA 2JFEX 4YXKL 2IDCA 5HVHC 5B39B 2NZ1A 3QIBB 3GSQA 5IIEB 1JGDB 4HWZB 1Q1JL 4NWTH 4NNCA 5K9KA 4MMZA 4IOIB 4A6YH 3GVQA 1YDVA 2XN2A 2PRLA 4NJAH 1W3TA 1DVFB 4UQ9A 3QC3A 1XMEB 3TYAA 3G6DL 4IRZA 4PJ9C 2WCSA 1RBLA 2E7FA 3CAQA 5FA3B 4GXVH 1FH7A 3M0MA 3JWNH 2E9IA 3LHPL 3SY8A 3APFA 5FK9A 1NC4B 5CZXD 2BP0A 5HHQB 2QF8A 2QEZA 5KYWB 5I3IA 2J1XA 3W1RA 1OALA 2CJUH 2DLIA 1VKXA 2WB1A 4LUSA 25C8L 3FF8A 4M7ZC 4PB0L 1R30A 4O2CB 1T0MA 4RMBA 5H4YA 3PAYA 1VKFA 1TVDA 3VTMA 4QR6A 5A16A 1ED3B 2WHJA 5TD4A 1VESA 1P84K 4H3DA 4JFDD 2XH7A 1R7OA 4ATLA 2CLFA 2UWFA 1T6BX 1EUUA 3KUMA 1IQ8A 1WBYA 4E9TA 3PGDB 4EPDC 3RWIA 5K1NA 4LVEA 3EJJX 5F93C 5JPNC 4OZHA 3EHBD 5B8CC 2E68A 3MGTA 3IYLW 1S3RA 4PRPB 3B8SA 4M7KL 2YL8A 2YX0A 2K8QA 4MAYA 1I82A 3VJ6A 1S5WA 4KEMA 4X5WB 1TTRA 1YNLL 3L3IA 4NFBA 3WQGA 3VRJB 5DS1A 1W1YA 3NIGF 4MX7B 3N4AA 4ZNCD 2N01B 5CEXA 5I17B 3CDZB 1KV8A 1RZMA 2HVNA 4LZKA 1JRHH 4UV7H 4KRLB 2H6OA 5KS9B 5CO1A 4ZFGH 1U41A 1XH3B 1IEVA 1YMHB 5BZAA 3HA0A 2AHIA 1UVQA 1BMZA 3B8YA 4QMEA 1JGMA 3L1OL 3KS5A 4RIRB 4OJCA 4LCWA 3WFBL 2NV2A 1SYTA 4B5EA 1DLFL 1REIA 2FATL 2NNFA 2MOQA 1XYMA 2FH8A 1IM3A 4FKEA 5HI3C 1F6YA 1BG4A 2FRGP 2IAMD 5LA1A 2R0LL 1W17A 1PSKL 1QSFD 5EH1A 4LMQE 1JHKL 2C0HA 1UGKA 4OM0H 1KCRH 2CWNA 5BVJA 3NIDB 4DEPC 5DBTA 1RPXA 4LLUA 4PS7A 4XNQB 4OH2A 2BMKB 5CEWA 1JGEA 4A3HA 5D7SH 1DN2A 2J8OA 4DK6A 4KKAD 1K8DA 3C09B 1OV8A 4CNPA 4QEEA 5FA5A 4XP1L 3AYSA 2EPOA 1FVPA 2BPBA 2H9GB 3Q3GA 1AZVA 2W62A 2JJUA 4NT6A 2NYZA 1FC1A 1XISA 2HVJA 4R8WL 4HH8A 3ULVF 3QIWA 4JTHA 1NTHA 4OBSA 4XNDA 4HT3A 2XIBA 4MHHI 2OT1A 1KNOB 1UD5A 3D2UA 2EDXA 1QPKA 3POHA 4W9JC 3QQ3B 4GBDA 2YDSA 1F42A 4UTAA 2F8VA 3QK0A 3N6YA 2QVTA 2C8NA 2EPHA 4JEGB 5GS1B 2F8QA 2Z29A 3PTDA 1HINL 2QHRL 2PP8A 4ODSH 3K4WA 4UMGA 3UBGA 5IR1A 5IEKA 1W6TA 4D8LA 2VN7A 3QUMB 4F9PC 4M5ZL 2WNWA 4TIMA 2Q0ZX 5G5IA 1R0AH 3HPJA 4W8AA 4UOZA 3EWYA 3DIFA 5IW3A 3QUXA 1LE9B 5I3GA 2EDYA 1DL3A 2I9LA 4AYBA 4RDWA 5DUJA 2AOSA 3FJ4A 2ADGA 2CIIB 4NI3A 3LKQA 4K9JA 3UR5A 2WQ8A 4DKFL 3AZTA 1MKFA 1VZGA 5GJTH 2PU0A 1E28B 4JNZA 1HVXA 3O8XB 5ICZB 1ZUAX 1J5IA 5EIVA 4OLWH 2XWCA 2FEJA 3RWFA 2XJKA 2FT7A 4C65A 3VXUB 2XZCH 2FBJH 2QZQA 2BIQA 1FUNA 3PL6D 4RQQA 3AS1A 3RGTA 4U2ZA 1MJUH 4PLKC 3ZJAA 5HSFA 3PULA 1AZUA 1F8IA 4IDLA 3QH3B 4F7CA 3SURA 4PWHA 4O4YH 3ALPA 2KT6A 2OR7A 4OZGE 1U8QB 3C0SA 2E25A 4QE1A 1HP5A 3F7KA 4I0CC 5E8DH 3BLDA 1P4LA 3K1DA 3F7VA 2VL4A 2ZT9C 1RJYB 4ELMF 4C6FA 1EP1A 3QPZA 1WUZA 2Q7YA 3D51A 3MS8A 4Y4KB 3HVDA 3B2MA 5DO2C 4S3CA 3SUUA 4NNPL 1O94A 4N0CD 5DYOB 2J7EA 3SODB 3TASA 1N18A 2D0GA 2E76C 5EG6C 3U36B 3JTTB 4E8CA 1FDJA 5LUMA 2CU9A 3WD3A 2WC3A 5LKYA 1X1ZA 4GRWE 3UROR 1BQHB 4NQDA 3UTSB 3RAJH 3B0UX 2DIKA 3MLXL 5EA0H 4S0TD 4L18A 5CEYB 1IKOP 4P3CH 5E7BA 2FWOB 1HKMA 1N70A 3GS7A 5J6HB 4PW9A 3MDWA 4IIEA 1FP9A 3ZOAA 1MCPH 1UWXK 2DY3A 5K1VA 3MYJB 4IGBA 1EPVA 1EBGA 3QNYA 2J9XA 3FNKA 4C7GA 1ES0B 4J2QA 4ZMVA 3ZK0A 1TQBC 2G3JA 3GXMA 2GJNA 4WWKD 4KQ4H 2ZOKB 3L3GA 1KCVH 2XN9A 3K2KA 4PRBA 3U9IA 3S8HA 5C8JA 5TF0A 2QKSA 1CG9A 3ARFD 1RZJL 3VZXA 3UR7A 4O12A 5IKCB 3SCTA 3VIPA 4AE1A 3R0UA 1XCXA 2SODB 5K9JH 4OV5B 4Q74A 1VPYA 5HHOA 2AJXH 1PJ9A 2XTJE 1GEQA 4JM2A 5I15L 1OSPH 2K3HA 4ZUUB 4BWLA 1XC6A 4A38A 4LVNC 3VRLE 1XLCA 5DLML 2FVKA 3QORC 4KX9A 2OMVB 4NQEB 1H6TA 3QUGA 3ABLB 4HK0B 4WW2A 1A1OA 1UXSA 5HYQB 4HIEA 2D2GA 4JL2A 1TZZA 4NUWA 3QPKA 2XETA 4IRJB 4PV9A 1MFCH 5E08L 3MNZB 1YDPA 4M0XA 3QULA 4BA0A 3EOBA 1SVZA 5JW3L 4IRSB 3UCDA 3EGSB 3DUUB 3D47A 3T0EB 4P0DA 1V0NA 5ICXB 3BIAX 2VQ1A 2ZKWA 4HQQL 2E28A 3PP7A 4X6DA 5DZ9A 4G8GD 1EHLL 3GRIA 3LEVL 4KKZA 4PRTA 1IGYA 3BAJA 4ZX3A 4DVBB 4M7TA 2EKGA 4XPFL 2XY2A 1ZPUA 1ZHNB 4PY8I 1DBJL 3U82B 1SO5A 5BXSA 4MWAB 3TCSA 1VLIA 2QQNL 3EDKA 4FQCL 2NCMA 3ARGB 2XC8A 4OF6A 1QHPA 2DQCL 1BXXA 5DN1A 1AXTH 2XPGB 3VQ1C 3K74B 3CJPA 1BQSA 3BV4A 5M03A 3WQ5A 3PXLA 2EIEA 1MN4A 4PWGA 3OEXA 4H7VA 4LLQA 3VIIA 2GBUA 1T7VA 1SJAA 1G7JB 2AEIT 5FCUL 1SU5A 5KVFL 5I5RA 4KTDL 5D32A 4ZPVB 2BX5A 3P4LA 4MVAA 4C6OA 3U2IA 1FFNB 1OKEA 4L4VB 3ZHLA 1T41A 1FY6A 3ZVHB 3ZY7A 2CBIA 4TQIA 3KBWA 3NIYA 1XDTT 1YN6A 4PYGA 1S7TA 5MP6H 5TK4A 3O2WL 3CHPA 1W0WA 4G7FA 1VR6A 3RY6C 1HN1A 1I85C 3HRPA 1M2OA 2GTZB 2PU1A 4YCOA 4ZDHA 3OJ2C 3GJEA 4JFFD 4M7JL 1T66D 2OSLA 2CBVA 5HP5A 2QADB 5DRNA 2FQDA 3RN6A 2WSQA 2PP3A 4N3TA 5HVFB 4I5XA 1BYBA 5J04A 5EU7C 3T1FA 5SWSA 4KXBA 3HI6H 4JG9A 4JTEA 2DORA 1VHNA 4PJDB 2Y6TE 4ZQCA 4I13B 4S2CA 2DWDA 1JWMA 3CFUA 1FNSH 4L8SB 4PJ9D 4FERA 1YO4A 3QNZA 4FZEH 2ZXCA 2VI0A 1TNNA 4E9VA 3FUKA 3R8QA 2K6ZA 2WNNA 2AKZA 1YC7A 5F7AA 5D5MF 3FUFA 2GITB 4P2QD 2OP4L 4F8XA 3UZQA 1KCZA 2X1RA 3TOPA 1AH1A 5AW9B 3THDA 1GNXA 2PABA 2CLKA 1O6TA 1KB9K 1FWTA 2HLAB 3B1UA 4FQJH 1B9BA 4H0IA 5CCHE 1CFNA 4QRBA 5EBGA 3BO8A 1SZFA 2PRMA 4KUCD 2WXRA 3QUMH 2QVKA 1K6QL 2G4FA 2GJ6E 2X1TA 5ISZE 1RZKC 2KL6A 2R56L 4BCYA 4S39A 4EUPH 1S7UB 2Q01A 3S98A 1XYBA 4K5MA 3GVWA 3RWCA 3S9ZA 3GK8L 4DGIL 3MJ9L 3KYOA 4YQXH 3R10A 2RGMA 5TJWK 1FWEC 4LB3A 1GYMA 4NJIA 1Q65A 3W7MA 2V69A 2NLIA 1UUSA 3MYZA 3HNTL 3IJYB 2BXYA 3QDHA 5SWQA 3AXKA 4JIIX 1UM6H 4FNLH 1CF8H 1A0DA 3LZ5A 5L7XH 2BZNA 5I0WA 4UTTC 2R2HA 5JHBA 2AQOA 1WXZA 2Y7EA 3MUY1 3HA1A 3ITOA 1MY7A 1OGSA 1KYOJ 1F5WA 2O5YL 4KWWA 2QVFB 4A7GF 4W6XB 2BODX 2V17L 3V75A 32C2B 1JCXA 3LEPA 1WHPA 4MHBA 3S35H 2ZA2A 3KOWA 4K7FA 1U8HB 3S1VA 4DP2X 5D9OA 2APSA 2BHUA 4MJ6A 4HKXB 1YECH 1G1KA 4K7PH 1JJKA 3KXFA 2QCNA 4X7SH 4XD4A 1XYAA 3AMLA 5KWYC 2ISSA 5HI3D 5E00A 3VNYA 4AQOA 1ZP4A 1IAIM 2WSDA 2RACA 2BGSA 1FL6A 1U8JB 2FO1A 4I9AA 2CH8A 1RUKH 3PQYB 4KKRA 4Q0XH 3M47A 3CCHB 2C91A 1AIZA 4TVSa 1E40A 4OU1A 1VRXA 4KWVA 5CJ8A 2YD4A 6ENLA 1G0XA 1MCQA 3RUGE 4MJHA 2DWEA 4ZT1A 1ULVA 1TR1A 4P8UA 4IBWA 1EERB 4HZAA 4DT2A 2VABA 5FSDC 3MA9L 3EHBB 5CUSL 5B7MA 2BIMA 1UC5A 4K3DH 1H8LA 1P4BH 3ARSA 4MJID 3MYPA 2A74B 3REVB 2JELH 1DFXA 4FULA 4G5AA 3MU3A 1QLRA 3WQFA 5DJ0B 4UTBA 7TIMA 2WMIA 3VI4F 3KX6A 5I1LB 2HG5B 5EDXA 4GC4A 4LU5H 3GSOA 3CZLA