1KGWA

Three dimensional structure analysis of the r337q variant of human pancreatic alpha-mylase
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTQVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALPHA-AMYLASE, PANCREATIC
publication title Probing the role of the chloride ion in the mechanism of human pancreatic alpha-amylase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 167
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2001-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1kgwA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1kgwA01
4BZYA 5BXTA 2YJQA 1GCYA 4V28A 3NSXA 3WQVA 3W26A 2XGBA 4WKHA 4EE9A 3N1AA 4R5EA 4MNJA 1XV8A 3WEZA 3S6TA 1TQVA 3DDGA 3BVWA 1PBGA 1UASA 2VQTA 3VD3A 1PIGA 5ABGA 1HL9A 1KWGA 2CHOA 3BAYA 3AS3A 2EABA 4D6IA 4CCCA 1KR0A 2VCBA 4Z2GA 2O92A 3NSMA 2BY0A 1HJXA 5HPCA 5AC4A 4PTVA 3K4AA 1MXGA 1C7SA 3DYMA 1BSIA 2J7DA 4V27A 2DT2A 4JCLA 3OLIA 2WHKA 2J8FA 2DIEA 1HVXA 1M01A 1HKIA 4JAWA 2OWXA 4W84A 2F7PA 3PZNA 2X0HA 3AYRA 2OW7A 1ZB5A 1TA3B 4AZCB 1CLXA 1JFHA 3SCWA 5E09A 5A95A 2OSWA 2VZVA 1IV8A 5A3HA 3BSGA 3RPMA 4KMQA 1KB3A 1QNOA 2YL5A 4QLJA 4NRRA 4FLQA 3AFBA 3UR8A 4S3KA 3L4TA 1YQ2A 3VOCA 4MNMA 5FL1A 5D9MA 3K1DA 2HVMA 2XTKA 2EEXA 4AIOA 3NJ3A 2F18A 4PMXA 4W87A 1JDCA 3MU7A 2D3NA 1O6IA 1QI4A 3WY4A 2F8QA 3AXXA 4BF7A 1FFQA 3BUBA 1V6YA 1J0KA 2G3MA 4GO8A 2ZUMA 3OGVA 1OSEA 1DTUA 2VI0A 3WDQA 5CGTA 7A3HA 1UKSA 3AHYA 3WNPA 5DT5A 1PX4A 3VUPA 2J7CA 1CECA 1Q6FA 1HKJA 1O7AA 3BXWA 2JEPA 2IXVA 4ATLA 4M24A 1GONA 3TA9A 4CN1A 2ZWYA 1WE5A 3FHQA 1PS3A 4K68A 1DHKA 1GNXA 4W5UA 5CLWA 4DM1A 2YLAA 4D1JA 4J3VA 1V0KA 2VZUA 3VGFA 1WDQA 1LWHA 4AD2A 3W82A 3WY1A 2BXZA 5A6LA 4JZ5A 4MNLA 5IDIA 3AZTA 1TG7A 3HN3A 4HZ7A 2WVUA 1V3HA 1TQWA 4PMYA 1BFNA 2V5CA 3GM8A 1JF6A 3LPGA 3QOKA 3W38A 4HOZA 2YDQA 5FIPA 1GJWA 3KEHA 2MANA 4U3CA 4MB5A 3CUHA 3VIFA 1SR0A 1M53A 2F1BA 1V08A 5D8ZA 1D2KA 3IJ7A 5LA2A 2C8NA 1SFSA 3AHTA 2DT3A 1B3VA 1OD0A 5BROA 2DT1A 4HZ6A 5GQBA 1UR4A 1E6ZA 4MB1A 1HKKA 3U5UA 3TTYA 1MW1A 4NF7A 1B1YA 2V38A 2Y8VA 3WEOA 4CU7A 3U57A 2X2IA 1FH8A 4JCMA 4AC1X 5LYRA 4H8VA 3CMGA 2VX4A 4BA0A 4NRSA 2JF6A 4OBRA 5IFPA 3D4YA 2VZSA 3ZJ6A 5M3WA 1W2PA 2XN0A 3CHFA 1GVIA 2AOSA 2RGMA 2FH8A 1TZ7A 3WD2A 3WDHA 4PBGA 3K4DA 1ESWA 3ZM8A 3L4VA 2BY1A 1UWRA 3ZR6A 3L2MA 1UKOA 1SMAA 2VNCA 3ZR5A 1UD5A 4C7GA 3WNMA 2ZXBA 2WCAA 3WNOA 1D7FA 1E40A 4M8UA 1UH3A 3I3BA 1BYBA 1QWNA 2W92A 1JXJA 2JE8A 1C7TA 2ZXAA 2J8GA 3FW6A 4GI8A 4AY1A 4BS0A 3WH5A 5ABFB 1VFFA 1H3GA 1QWUA 3AHXA 4GIAA 2BVDA 1IZJA 4UR9A 5A8QA 1LWJA 3CIVA 1GORA 4LYPA 3CUGA 4W93A 5M03A 2E0PA 3PTKA 3CTTA 3SCQA 3ALFA 4HMEA 4IUGA 2XVNA 2EAEA 3AMCA 4FNTA 1QNSA 1OD8A 3CLWA 3VM7A 5E6ZA 1P6WA 3UG5A 1JD9A 3LXBA 1JYNA 2VMFA 1KR1A 3THCA 4U5KA 4A4AA 2E9MA 1IZKA 5M17A 4HOWA 3O2LA 3GXIA 4B3LA 2WMIA 4PSPA 3FXYA 1J0ZA 3KWXA 1WZMA 1R8LA 3ZJ8A 4IISA 2J7BA 3PZMA 1TUXA 3MS8A 3BAKA 1H0GA 4OUEA 6A3HA 2XPKA 1PAMA 1UR2A 1KXQA 4W8LA 2VX7A 3PTMA 3RDKA 8CGTA 3CZNA 2VTFA 4OKDA 3S5YA 4PN2A 5E9AA 3VDCA 5JBFA 1DWHM 5E0CA 1VBUA 4JFVA 3G6MA 1QHOA 3JUGA 5FKYA 1I1XA 3NUKA 4CVUA 2WMJA 3AS0A 2ESCA 5CPSA 1RP9A 1ECEA 1UH2A 2GFTA 4PRWA 1B3YA 1BHGA 3QOMA 2J79A 1HF6A 2DDXA 3DX3A 1GQIA 3A24A 3GH7A 2YOCA 3OZOA 2WNWA 4UFLA 4DUWA 5I77A 3AROA 3EJUA 1V0NA 2W4XA 3VIKA 1KBBA 3SCVA 3HZ3A 1W3KA 1M7XA 4KWUA 2ZWZA 4C7DA 2EQDA 1MW2A 5JUVA 1W3HA 2JIEA 4YN5A 2D0GA 3ARTA 2X8RA 1UD3A 3M6DA 1HVQA 3RIKA 1UWTA 2W66A 1VF8A 1V3MA 2WW5A 3DHPA 4FNSA 3WL0A 5DFAA 3H54A 1C8YA 4TUFA 1W9DM 2Q8XA 2V3DA 2VX5A 1PPIA 3ARXA 2J75A 3O9NA 4FNQA 4J3UA 1YHTA 3AYSA 2DSZA 3BVXA 1E9LA 2ZE0A 2WBGA 3K8LA 5EBAA 3VDAA 2IGTA 2X05A 2C7FA 4AXNA 4UQAA 4AZIA 2VC9A 1L0PA 2FHCA 3QGVA 1MFUA 1KQZA 4UFIA 1DP0A 5FOOA 2JIWA 3WD3A 3W29A 1E4IA 4MPKA 2OYKA 4JKKA 1RH9A 3ZSSA 1JG9A 1OBAA 4U2YA 3N15A 4CD7A 1A3HA 1C3FA 2IXUA 2F7OA 4TTGA 3MSDA 4M29A 2CBUA 4L4PA 5CSYA 1KCKA 2CITA 2XFYA 1LJYA 2F2HA 3ARSA 2D3LA 1MQRA 4FLOA 4XZWA 1WB0A 2UWFA 3D51A 3MV11 5IFTA 3N9KA 3WY3A 4TTUA 1UWQA 2A3HA 2DH3A 1V6XA 3VGEA 5BXPA 5BYWA 1UD6A 1NOUA 1CPUA 3ARUA 3KL0A 4XUYA 4HU8A 3RCNA 5A69A 4Q7NA 1NM9A 1UR0A 3A47A 2WVVB 2W5FA 1JAKA 1TVNA 1KGUA 4HA3A 3UR7A 4H04A 4ZXOA 4DWSD 1UR1A 1WPCA 2YDRA 3WUFA 1F4HA 1OCQA 4CD4A 1R87A 3ZOAA 2ZX8A 1E71M 1RPKA 2VX6A 4D1IA 4QP0A 1ZL1A 2V3GA 2X2JA 4BQ3A 2WHLA 4BQ4A 3A4WA 2ZUUA 3DX2A 4HPGA 2YBTA 4BQ5A 1KXTA 1CXIA 1MQPA 3LX9A 3SCSA 1CENA 2V5DA 3UCQA 1TA3A 2PWFA 1HJWA 1V3KA 2E4TA 1FA2A 1CXFA 3WF1A 2OYMA 3O6AA 4FNRA 1E56A 4PMQA 3SUSA 4MADA 1PEZA 1GOQA 1NOFA 4E8DA 1GJUA 1C8XA 3ZSTA 5I24A 3AIUA 4BQ2A 5JBDA 4AIUA 1TQUA 3WDRA 3GDBA 2Y4SA 3SURA 1W9UA 4DO5A 1XYFA 2D1ZA 2XN2A 3MO4A 1MWOA 3M7SA 3MSGA 4F9DA 1GOMA 3MANA 4RL3A 3KLKA 1XD1A 2XM1A 3ZT7A 1VFMA 1CXHA 3ARYA 3WBAA 4NXKA 4UQBA 2YL9A 1OT1A 2W61A 4OIFA 1DWGM 3M46A 4PMOA 4ATDA 4FLRA 3SIMA 1JZ3A 3WL1A 4PMVA 2D0HA 1CXLA 3BLKA 4UZUA 3CO4A 1G0CA 3WDJA 3VIGA 3A22A 1V6WA 1GOKA 4AIEA 3VO0A 5A6KA 3D3AA 3NIYA 2ZICA 3VD7A 3AHVA 1XH0A 2EBNA 3PHAA 4M1RA 1XYZA 1E70M 4KH2A 1DWAM 2CESA 1JNEA 4UFMA 1CXKA 2YA2A 2WLZA 2YA1A 4IM4A 2PI6A 1UUQA 3EMZA 3T2PA 1BQCA 2VR5A 4EANA 2W67A 1G01A 5IHRA 3VINA 2VZOA 3UERA 4AW7A 3MUAA 4N42A 2A3AA 2JALA 5A2BA 2FDMA 5A1AA 3WKZA 2WBKA 5A6SA 3T2OA 5CSUA 1NP0A 2NT0A 3FAXA 1TQTA 1WZAA 4UQ9A 4MAVA 4LGXA 1QI2A 3PZIA 3S5ZA 3W25A 4HU0A 5BWFA 4YHGA 1AMYA 9CGTA 1EDGA 2O9PA 2PBGA 1TMQA 2PWEA 1E6SM 4RE4A 3GXNA 3PZOA 1G1YA 5BXRA 3ARWA 1V3IA 5HPOA 3GYCA 5CGMA 2QLYA 3W53A 2EADA 2YA0A 1AQMA 4AZGA 1W32A 5I23A 3EJRA 4JL2A 1ISVA 4OOUA 4AZBA 3W24A 3I3DA 4ZXLA 1W9XA 4J27A 4S3JA 1CGWA 2CYGA 1GOWA 3BLPX 1R75A 4HMDA 3VD4A 2OSYA 2FHBA 1NWTA 3VGBA 1OGGA 3KL5A 4DUXA 4UZSA 4Q22A 4Z2KA 4FNPA 4AISA 1V02A 4P8VA 2FGLA 4Z2LA 2Y8KA 2F7RA 4JFUA 1G5AA 5EMYA 2J7GA 4QAWA 4HZ8A 1E1FA 1LG1A 3CC1A 5AC5A 3CMJA 1QBBA 3GXPA 1R7OA 3GNPA 1FOBA 4LYQA 1BF2A 1TVPA 3HMCA 1QNQA 1UR9A 5DF0A 2VVNA 4F8XA 1UWIA 1KWKA 5A2AA 3NDZA 1TFVA 1JYWA 3F5JA 3T08A 2JF7A 3ARVA 1CXEA 1J9YA 3BUPA 2WSKA 3AIEA 1D3CA 3DECA 1WCGA 3SCNA 2UY5A 3OIHA 4U2ZA 1E6XM 2WAGA 1UWSA 2ZIDA 1VEPA 2CHNA 1E3ZA 4D6HA 3M07A 2WC7A 3DYPA 4ACZB 4CCEA 1JNDA 1GOIA 1DWFM 1NOWA 3I3EA 1RP8A 4OGZA 1TCMA 3AHZA 1ISXA 3VD9A 1KXHA 4RE2A 3WQ5A 2JFEX 1HL8A 1G94A 1B3ZA 3WMSA 3WY2A 1HXKA 4HMCA 1HXJA 1K6AA 2QPSA 3W37A 2E40A 2BXYA 1W1YA 2OWWA 3POCA 3QHNA 3RILA 3FY1A 4OJYA 3ZT6A 1B31A 1MYRA 2PWHA 2X0YA 5ECUA 2WKGA 3VMPA 4AMXA 1F4AA 1WDSA 1J11A 1QVBA 2QMKA 2ZUWA 3N11A 1AVAA 4M82A 3BUIA 1XSIA 3IGUA 3BCDA 1QI5A 3L4XA 4AD5A 1CIUA 2WMFA 2F1AA 1JIBA 3SUWA 2AMGA 4DWSA 3RM4A 2O9OA 3N18A 2BHUA 2CIPA 1BPLB 1US2A 4P7QA 1E55A 2C0HA 2ALWA 3CUFA 3SCRA 1J0IA 3VU2A 2ZOXA 4H2CA 4EAMA 3T09A 3TP4A 1JZ6A 1JF5A 3K8KA 4HA4A 4W89A 1JXKA 3TTOA 4JFWA 3W28A 4CD5A 4URIA 3IK2A 1JGIA 3W0KA 1FP9A 1ZU8A 3CZ8A 2WPGA 3POHA 5HXMA 3DHUA 1ZJAA 1WZKA 4ZE4A 3AIBA 3N12A 1EH9A 3VDBA 1C90A 5A6BD 2WB5A 4ZFMA 2WYSA 4H8UA 1B3XA 2D23A 4ZEPA 2BFGA 3BCFA 4WSJA 4AZ7A 2VQUA 1E1EA 3ARZA 2BS9A 3WH6A 4AD3A 2ZXQA 2JEQA 1DWJM 3VD5A 1VJZA 2D22A 2D2OA 4EK7A 2BHZA 3AMDA 2DSUA 4ZENA 3W6LA 2G3IA 1PIFA 3DX0A 3L2LA 1CWYA 1TR1A 3OLDA 4CCDA 1B90A 1DWIM 2XHYA 1JZ5A 3BAWA 3EJQA 1KTBA 1E6PA 1VB9A 3TOPA 1E5JA 4U5IA 1JZ4A 3F4VA 3U7BA 1BGGA 1H41A 2VCAA 1PJ9A 1FH9A 5BRQA 3HG2A 2DGAA 5C71A 3AXIA 3LRMA 3AZRA 3L4UA 5LA0A 1WP6A 3ALGA 2FH6A 1CNVA 1UA7A 4IPLA 4D72A 2DSVA 2D20A 5D9PA 4JL1A 1MW3A 1UD4A 1UR8A 1GUVA 4MB4A 1CTNA 3SUUA 1DEDA 4PYSA 2QHAA 2DIJA 5CPQA 4W7UA 5A8NA 1PZ2A 2XM2A 1HT6A 2YIHA 4OZOA 4PMRA 1KQYA 3WH7A 5E0FA 3WNLA 3MUY1 3PZUA 4Z2IA 4CUCA 5GNYA 5A6AA 2W62A 1I1WA 1V0MA 5I78A 1O7DC 4NX0A 2GJXB 3AMLA 2BVTA 2UY3A 4GI6A 4GINA 4AWEA 1PX3A 1EIBA 4J7RA 2DSWA 4DO6A 1U30A 4L4OA 3UEQA 5A94A 1JI2A 2WMKA 4WLCA 1R47A 1J0YA 1JZ7A 3DX1A 3HU7A 3OGSA 1CDGA 3WD0A 2Y5EA 4F9JA 1UZ1A 3OGRA 3WNKA 4AYSA 2F7QA 1Q6DA 3B8SA 3A21A 2IUZA 3WD4A 3BMVA 4W7VA 4HPHA 4QCEA 4MJ4A 1OM0A 2BHYA 4UFJA 1ZS2A 2G3JA 1CYGA 1Y7VA 4J3TA 4JFTA 1W3JA 3GXDA 3GXMA 2RGLA 3ECQA 1HP4A 1E73M 2GK1B 3TONA 3WUBA 4E2OA 4QLLA 1UH4A 1JFXA 3WN6A 1R46A 5DMYA 3WFLA 3OZPA 4PMDA 2ZX9A 3FNDA 1HTYA 6CGTA 4PUEA 5FD0A 3CPUA 1NH6A 4MAZA 1R86A 1KCLA 2BY2A 3EJSA 2X09A 1QW8A 1V6VA 3AI0A 2YFOA 4M80A 1ISWA 4WK9A 5GNXA 4GPNA 1XRVA 1K9FA 2XFRA 5F7UA 1QI3A 3EBVA 1XGZA 1LF1A 2YDSA 4UOQA 3A23A 4NI3A 5I5RA 2CETA 2WM0A 1AQHA 1WNOA 2VURA 1GHSA 1GQLA 3VPLA 3EDJA 3T0BA 5GPRA 3UETA 5D8WA 4PMNA 2XVPA 5D4YA 4FF5A 3OLGA 2XN1A 2XUCA 2WCGA 4UQDA 2WLYA 3VIHA 1E6NA 3QR3A 4OOZA 1U2YA 1KGXA 3BSHA 3LPPA 2J62A 1EQCA 3ZJ7A 1EQPA 2WMHA 1I75A 1XHGA 3WQWA 4WKFA 1CEOA 1UD8A 1CGUA 3CZJA 3OLEA 3SUVA 1R34A 4QFUA 1SZNA 3VIIA 2CPUA 1NQ6A 5E6YA 3H53A 2VO5A 1UOKA 4RE3A 5A8MA 5JIWA 1Q6EA 1VBRA 4CD6A 1CZ1A 5I6SA 1XCXA 4LX4A 4F66A 1EHNA 2WMIB 1E72M 1W1TA 1KTCA 1X1NA 1XSJA 3SCTA 4H7VA 1TQSA 3CZGA 3BH4A 4P7OA 3PZQA 4B9ZA 5BRPA 3W4RA 2J4GA 3LPOA 3G6LA 4QLKA 3TTSA 4DUVA 4CGTA 4D6FA 3T2QA 4TXEA 2XSBA 2BVYA 3AIWA 2X2HA 3EMCA 5A8OA 3L4YA 2WWDA 2WWCA 4E8CA 1L8NA 1J0JA 4C7FA 1LL4A 3VIOA 3CZLA 2OSXA 5A6BA 3WSUA 5AYIA 4AZCA 3TTQA 3DDFA 1XH2A 3VNYA 1E6QM 1QPKA 5CJ5A 2W91A 2CBVA 4XZBA 1GZJA 6TAAA 4D71A 1JZ2A 1FP8A 1BYCA 5E1QA 1GW1A 3WF4A 1W91A 4J3XA 1CGTA 3MV01 3D52A 1LG2A 1W1VA 3GNOA 1JYXA 1C92A 3PZ9A 1CBGA 1HJQA 2G3NA 2WKLA 3AJ7A 3BAIA 3EDEA 3RJYA 3GH4A 3DX4A 4JHOA 4ACZA 1QW9A 5AYBA 4U3AA 5CQ1A 3SCOA 1VEOA 2NSXA 2A3EA 3CUJA 4MB3A 3AQUA 2ZX5A 1E4MM 4UCFA 3AIVA 5A6JA 5EFFA 1WO2A 1JI1A 1OIFA 3VGDA 2QF8A 2ZX6A 3J7HA 1VRXA 2Y2WA 2CERA 2DEPA 4W8AA 3UG4A 3VIJA 4PCTA 3BAJA 1H49A 1UQYA 2NW0A 3VSUA 4PUDA 4UQCA 4NZJA 3AZSA 1IT0A 2GJRA 3VILA 3VVGA 4PTXA 3T0DA 3MUZ1 2XWDA 2WC4A 2CNCA 3ARPA 5A2CA 1E0VA 2J7HA 1OINA 2XFFA 3AISA 4H41A 3EDDA 2A3CA 2J77A 2OWCA 2UY4A 2J78A 1WZLA 3PN8A 4AD0A 1H0IA 3ZT5A 3KZSA 1R33A 3BGAA 3LXCA 2WSPA 1QNPA 4GZIA 2YLLA 1C93A 4AZ5A 1EXPA 4CKQA 1NWRA 4AMCA 4AD4A 3II1A 3APGA 2WANA 1H09A 2EPNA 4ACYA 4Y7EA 4MTVA 2QMJA 1VFUA 1BG9A 2X2YA 3EJTA 4XV0A 1FFRA 2X1IA 3EDFA 2OYLA 4FNUA 3SEPA 3VGHA 2YL6A 2EACA 2E8ZA 4UOZA 3ARQA 1BTCA 4B16A 1XSKA 4MJ2A 5M5DA 2NT1A 1VIWA 1EDQA 1UKQA 4TX8A 1JAEA 2GDUA 3VNZA 1ZBWA 3CUIA 2QV4A 2WXDM 2WZHA 3PZGA 4CU6A 3THDA 1W1PA 2WK2A 3F5KA 1Z32X 1KXVA 2D0FA 1XH1A 1V3JA 1V6UA 3GBEA 3W6MA 2ZUSA 1HX0A 1H2JA 3GTNA 1LL6A 1ODUA 2Y24A 3VGGA 5CPTA 1VJSA 2VRQA 2CBIA 5DT7A 4HP5A 1SYTA 3BLBA 1GOOA 1J18A 1UWUA 1OGSA 3ZIZA 5ABFA 3WELA 1EA9C 3WUGA 4KRUA 5LA1A 3EMQA 1OWQA 4YHEA 5C70A 4W8BA 1QI0A 1E0XA 4P7LA 3CHCA 3AMGA 4MDPA 7CGTA 4UFKA 2VZTA 4D6JA 1S46A 1M03A 5CG0A 2EJ1A 1ZBVA 4W88A 1VAHA 4UFHA 1XC6A 3B9EA 1QNRA 3DYOA 4HTYA 1QHPA 2VL4A 1HKMA 3BUQA 4JKMA 3VMOA 3LMYA 5BCAA 3MUIA 5C8BB 2FHFA 1EOKA 2VRJA 5JIPA 1EO7A 2J7EA 2WCSA 1KFWA 2PF0A 4CU8A 3HG5A 2GUYA 1GPFA 2W63A 1VEMA 3DC0A 1KGWA 4LYRA 1QOXA 1W9VA 3BUDA 3NCOA 2PWGA 1UKPA 1UA3A 5I79A 5FCZA 2CKSA 3NDYA 4ML4A 5EB8A 3CGTA 4UTFA 3A5VA 2ZXDA 3GBDA 3U7VA 3UG3A 1HP5A 3BVTA 1N82A 2DT0A 1BG4A 3BAXA 4P8UA 3AS1A 1V3LA 2DPEA 1UZ4A 3E1F1 2GJXA 4N0RA 2D24A 3K46A 1QHZA 3WDPP 1JZ8A 2DQXA 4PSRA 1BVNP 5CXPA 3ZQ9A 2J25A 2FGZA 5IXEA 2V3EA 1A47A 1CLVA 1MFVA 3LRKA 2FE0A 1RD6A 1B0IA 3WQ4A 1UG6A 2CXGA 1ODZA 3EYPA 3IAPA 4MDOA 2DH2A 1K9DA 3LPFA 5JBEA 2ZUTA 4ATWA 1MW0A 4WSKA 2YFNA 3MI6A 3T0AA 1UYQA 4KGLA 2VJXA 2XSAA 4M81A 4P7RA 5I0DA 3D4ZA 4KGJA 3B9DA 4MNKA 2J47A 3AXHA 3VSTA 2EPMX 3FAWA 2WHJA 2XYLA 4Z2HA 4LQ1A 2YKKA 1WDRA 1HNYA 1EHAA 3RO8A 2V3FA 2GSJA 4CVWA 1W2VA 3RM9A 1XCWA 3EDKA 2OW6A 2GK1A 3CBWA 4XX6A 3WEMA 4D6CA 3GH5A 4QDMA 3FN9A 4TOQA 1M04A 3BMWA 2J74A 3WQ8A 1K9EA 2G4FA 4P7NA 3CH9A 3PBGA 4PTWA 1JDAA 3SUTA 3AICA 1GQJA 1UHVA 1X6LA 1E3XA 4TVDA 1C8QA 3RMEA 1TE1A 3WFZA 1BAGA 2CKRA 1E43A 1MVYA 3WDIA 3VIPA 3U5YA 4BCEA 1R7AA 4XB3A 3QHOA 3ZO9A 2F61A 3WENA 3PZVA 2WC3A 1FHLA 4V2XA 1E4LA 4B9YA 5HDRA 4JKLA 3L4ZA 3S2CA 2BV9A 5D9OA 4WJXA 3AMKA 4PMZA 4Z2JA 4J3SA 3A3HA 4D6DA 1ITCA 5FL0A 1J01A 1E15A 2EPKX 2WMGA 1QBAA 3AOFA 2EPLX 3IAQA 1WAWA 3RJXA 1ITXA 1UD2A 4W7WA 2WZIA 4DO4A 3W27A 1MXDA 3KE0A 1GVYA 4PCSA 1B3WA 5I2UA 1J12A 1WDPA 5A6MA 3CZEA 4NSBA 3A4AA 3OA5A 3MMUA 3N04A 1Q6GA 1LLOA 1NWUA 2Z1SA 4GXPA 1Q6CA 5E70A 2WVVA 4W85A 3MMDA 1EO5A 3F5LA 1VFOA 3FHAA 3WD1A 3AIQA 1FHDA 1ZJBA 4E4PA 2VOTA 2PWDA 2E9LA 3KL3A 4AZHA 1ZBKA 3BC9A 1HJVA 4H8HA 1PX8A 4GZJA 4AMWA 2VVSA 1XD0A 3WH9A 4AYGA 3UESA 2ZX7A 4B3KA 4YPJA 1BYDA 4DWSB 2EXOA 2HISA 5ABEA 4PEEA 4JFSA 3OG2A 2XGIA 3L4WA 2GDVA 4UQEA 1E5NA 3ARRA 1R85A 4WKAA 1OIMA 2QPUA 3WF0A 1W9PA 1CGXA 4R27A 1OT2A 4P8XA 2TAAA 1T0OA 1BLIA 3GNRA 2YBUA 1J0HA 4X9YA 3WMCA 2EPOA 4PMUA 1E4NA 3WUEA 4PTMA 4AD1A 3VX1A 4F79A 2E8YA 5TD4A 1LL7A 3HJEA 4IPNB 5CZKA 1CGVA 2G8ZA 1Q4NX 4A3HA 1BGAA 1B2YA 3CZSA 4GQRA 2CCRA 3WF3A 4J3WA 2G41A 2O9RA 4OBSA 3BVUA 1OGBA 5ABHA 2XIIA 1U33A 3CV5A 3EJPA 4CN4A 4WIWA 3AS2A 2XIBA 3OBAA 3NYDA 2XVKA 2ZUNA 3N13A 4GZEA 2O9TA 5KZ6A 1V0LA 4CN6A 5DEZA 5EFDA 2WVTA 4AZ6A 3A6OA 4HOXA 4WF7A 3SCUA 4LPCA 1B9ZA 4NXSA 1FH7A 1V02E 3VDHA 2E9BA 1UKTA 1JYVA 2XVGA 7TAAA 3TV8A 4GO9A 5HBFA 2GVYA 1E0WA 4DM2A 3IJ8A 1J10A 4FMVA 1SMDA 1H1NA 1WKYA 4W5ZA 1K9TA 5IHSA 1JD7A 3D5HA 2FYVA 5A8PA 1GHRA 1CGYA 5D9NA 1KBKA 4FLSA 1ISZA 3WNNA 2EO7A 2CEQA 2CBJA 1AQ0A 1X6NA 4GKLA 3B9AA 2WHMA 3ZJKA 2B31A 4EKJA 3KLLA 1W3LA 4UNIA 1G9HA 3WH8A 4AEFA 1H4PA 3W81A 2XJ7A 3LXAA 1ZBCA 2VRKA 3HG3A 3WQ6A 1OB0A 4W86A 1US3A 2XVLA 3WIJA 5DO8A 4NZFA 3IJ9A 2YL8A 3VMNA 3K8MA 2A3BA 4NZCA 5CLTA 3MKKA 1GQKA 4GI9A 4KRTA 1QX1A 2BY3A 5I3DA 2D73A 4GQQA 1C91A 3MMWA 4TX6A 3VIMA 4X0NA 3CHDA 2UY2A 3OB8A 4D6GA 5BXSA 2E3ZA 5AY7A 3NSNA 4ZE5A 3ZMRA 1EOMA 4D6EA 2VUYA 2PB1A 4JHZA 2WVSA 2Z1KA 3HG4A 1HJUA 1UQZA 4UOJA 1JDDA 3WMBA 2WZEA 2PBOA 1E6RA 3VKKA 3VX0A 3BVVA 2PC8A 2ZUVA 2VR4A 1NWSA 1BVZA 3AIRA 4M56A 3CZKA 3D50A 5HNNA 8A3HA 3CHEA 1NARA 1PZ3A 3PTQA 1LQ0A 1HN1A 2XWEA 4AEEA 1W9BM 3VM5A 4TVUA 1EGZA 5KEZA 1ISYA 1B30A 2OLHA 4TVCA 1NP2A 1H5VA 3VSVA 4FK9A 3GZAA 4CD8A 3VTRA 3RM8A 1H11A 5GNZA 4U31A 3A4XA 2GJPA 2XG9A 2DSKA 3WBEA 3IANA 1VENA 3LRLA 2VCCA 4B15A 4X0VA 1HWWA 3SCPA 3PZTA 4QCFA 5HOSA 4J28A 3WF2A 3H55A 4HA1A 1BYAA 2AAAA 3QHMA 4U33A 4LXFA 1JL8A 1HJSA 2BNJA 2J7FA 1MQQA 2VT0A 4P8WA 3GXTA 3GXFA 1HIZA 4DWSC 3N17A 4A3YA 1V03A 4JIEA 1EDTA
chains in the Genus database with same CATH superfamily
3UYPB 2A9DA 2BNQB 3MKVA 1TCRB 4OUUA 5L4IA 2YD2A 2WP3O 4TSCH 1UOZA 1OAZH 1I1AD 1PBGA 1KBIA 2FUQA 3CN0A 4C1NA 5D1ZD 4NZTL 5F3HB 3STZA 4D6IA 2XV3A 1ZAIA 1KFAL 4YBQC 1F6FB 1I1FB 3P2TA 3RF9A 4XAYA 1HJXA 4NJIA 5HPCA 3RFZB 2AABH 2ZQKA 3O05A 1MLBA 4UV7H 1A7QH 1M1XB 2V7NB 4K71C 4V27A 4K8RH 4JCLA 3OLIA 3S3DB 2PCEA 5HYIA 2JKPA 1RPUA 2BRRH 5L9DL 2OWXA 3LTPA 1P7TA 2F7PA 1BQLL 2XFWA 2MCMA 3PZNA 3OG3A 4JFOB 4XB7A 2BWIA 1U95A 2L7UA 5GZND 3BK0A 4F8QA 1DLHA 2ZYRA 5JLZA 1JFHA 4JVPA 1VFBB 2J6EL 3T2NL 1XIWA 1HKLH 4KZDL 2OELA 2WQDA 5DRWA 3AFBA 3BZ5A 4MY9A 4Y89A 5A3IC 2QS8A 3QJTB 4AIOA 3IDUA 1O9WA 2ISWA 3WU1A 4K9EL 3T0CA 4BF7A 2WPBA 2IOOA 4RFEB 4BRJA 3RVWC 3QZ6A 1INQB 3FQWB 3GJEB 4M19A 2ZYIA 2QVHA 1IEAA 4G59C 4X9BA 1R2RA 3QEHA 4PRBB 3F12B 1ZA6B 3GUTA 4PJHB 4FX5A 2PO6C 5CLWA 4KXDA 1FJ1B 2YRLA 2NXHA 4D1JA 3B7UX 5G5IA 4R34A 1RLDA 2JKWA 3VUAA 1IWAA 4POZD 2XUWA 2OTDA 3MUXA 4B5ZA 4ZFOB 2YJLA 4AY7A 1RV8A 1EXHA 3H24A 4HZ7A 3E7JA 3KVLA 1BFNA 2V5CA 2YZ8A 2HWZL 2O5XH 4QRUB 1GZQB 3RGVA 4CVZB 1H3TA 2Y22A 1FCQA 2F2KA 3WXWH 4X8CA 3VI3E 1UR4A 1E6ZA 2NX3A 4NO2B 1B1YA 2OCJA 1HXYB 3GAYA 5TQ2L 1XAKA 4JCMA 1P7QD 5CBEA 1Z6JT 3CQIA 1PZ5A 1S9VA 3VTAA 1D3HA 3WQDA 3QC0A 2P10A 2DQ6A 5JW4R 2X1TA 2VZSA 5B1CA 1A4LA 1ONXA 4Z7VF 4X63A 4X98A 3UH8A 1L6WA 4XD5A 5KVDH 1UWRA 3LB6C 3BP7B 5K9OB 1FE8L 2WNXA 3BLOA 5BS0D 2KYIA 2VXTH 4GC3A 3CN4A 1G0XA 1DQWA 1H61A 2BVDA 3LEXB 4GRLD 4IGBC 4LYPA 4Q8WA 4TRPL 5M03A 3S2NA 3PTKA 3N1PC 3MNWA 3UPRB 4Y5VC 5D7IB 1YC7A 3RURA 5H6HA 5G2HA 5CLZA 3IGXA 4ZTXA 2EAEA 5MEQA 3QRLA 4P57B 4JLRA 2L04A 3LXBA 4U5KA 3N40F 4A4AA 2E9MA 1FSKC 1S3KH 2V5YA 4GYJA 5FYKD 3KXFE 2CIIB 3FXYA 4AK1A 3S1VA 2D8KA 3AACA 4ZI8A 1OZQA 1G0YR 4XB8A 2NNFA 4BFEA 1T1ZB 4GW1B 3UZEA 1NLBL 4DCQB 1GEQA 2BLEA 4WWOA 4FQIH 5I19L 1BM3L 4TOYL 3PWVA 3Q43A 4LF1A 1E9ZB 3FC8A 3ZZQA 3JUGA 1S9YA 1ECEA 4YZFF 2O5ZH 2YYUA 3VH8G 2W4XA 1KBBA 1KLFA 1ZPLA 5IW6B 1ZWIB 1M6OB 5KW9L 3HZ3A 1W3KA 5D03A 2ZWZA 4JB9L 2FJUB 4XVSL 2JIEA 4E2DA 3ARTA 4X83A 4O2CA 1M2VB 3DROA 3HRZA 2PWVA 3TEZA 3ARFC 3VC6A 3NQMA 1ADOA 5MEND 2ZOLA 3LQMA 1F5WA 3SDOA 3CYJA 1XZ0B 3CDYA 5EMMA 4CVXA 2IGTA 2TSYA 2X05A 5JOPE 4OCSH 2NLJB 2XTSA 2FHCA 4BZ2A 2L3BA 2A4EA 1A49A 1U93B 4JZNB 4IMKC 2ZCKL 2ZUQC 1UP3A 3ZSSA 3T77A 2FGBA 3MLUL 1LZOA 3L66A 3T0EC 1KCKA 5CBBA 4X2PA 1ZVSA 5I1LA 3HPAA 3PFUA 4GJTB 1UWQA 4QXWA 2ZCLH 1KTDB 2RHEA 4ZW3A 2AS5M 4MJ5B 4XPAH 5BJTA 2QUMA 3RCNA 3D39E 5F9AC 3A47A 4OZGE 4H04A 1MCOL 4DWSD 1OFDA 4EBQL 5AVNA 2K6ZA 1E6OL 5B3JE 4DF0A 2FZ8A 3T3PF 3PULA 1RPKA 4HSOA 1ZL1A 3BDXA 3IDIB 43CAA 4HWBL 4F2EA 3QUKB 3WQGA 1PZCA 1Q8MA 2C3GA 3TASA 3UJIH 3T8LA 1F73A 5LIYX 2PWFA 2DBJA 3S3CB 3GU1A 4K7FB 2OB3A 3G1VA 1JWUA 2E9GA 2BS71 3RWIA 3FTVA 4K37A 1EB3A 3F7LA 1MCSA 3GK8H 3NYKA 3MANA 5I1GH 3ZT7A 4HPJA 1Q1JL 3HZYB 3HBZA 1GKEA 4DJEA 1K1DA 2YL9A 3NJIA 4ZS7L 4MLJA 3TFKC 4FNLH 3W1UA 4OIFA 2OGJA 1WAAE 2YD7A 5IK3B 1P7KA 3KCJA 1CGSL 4AI7A 1RURH 4I88A 4AJ0A 1FZOA 4LCCA 4KZ0A 2WBJA 5AB1A 2VC7A 1X6UA 4H88L 4Y0GA 4DJFA 4UFMA 5ELIA 2WLZA 1UPMB 3QF0A 1PIIA 4N9GA 1UUQA 3KBFA 3R8QA 2VDLB 4O0ZA 3N29A 1B2WH 2W67A 3VINA 3NVDA 4QXIA 2XIDA 3HI1B 1Z89A 4Y8DC 4MNQE 4HQVA 4LGXA 2W59A 9CGTA 5IVZB 3WKYA 1AKJD 4LMQI 5EB9A 2R2EA 4TSAL 3U36B 3FEQA 4L0YA 2PGFA 1TJIL 3G1AA 2QPFA 4Y16C 4UDUB 3K6FA 2ZAGA 5ADOH 4Y6GA 2J44A 4DGVH 2XHNA 3ABRA 4GSDL 4DUXA 2F19H 4XVTL 3BGMA 2PMZA 4XZUA 1JFQL 5B39B 1LBMA 3SQBB 2NWSA 2Y8KA 2F7RA 1LG1A 2A4CA 4JM2F 3CHRA 3MBXL 1D8CA 4HT1H 4FG0A 4WJG3 3L65A 4Z3EA 1HC1A 3T08A 3QN3A 4OZHE 5A6TC 1AY1L 4DLFA 1OQXA 4M0XA 4IJBA 5C09E 3VFMB 4DP5X 3RRAA 4RCAA 3L9BA 2D4DA 4RMBA 2AVGA 1T20A 3HZKB 3U0PB 1ISXA 4W9EC 4RWHA 5F0PB 1TNMA 3K1GA 4XHJD 1B3ZA 3WYZA 4CW1B 5I6XB 4GAYA 2E40A 3B9OA 4HULB 2MPAH 3FH7A 4NRZB 4QHUA 3GWJA 4PS3A 3ITYA 3C86A 4ZO7A 1QVBA 3TJPA 4J2PA 1NAML 3RHGA 2LAAA 1TWDA 5F1UA 2OKOA 3ZDXE 4K5OA 1KPRA 3S9IA 3FN0L 4ZQTA 3R4RA 3W00A 2CIPA 1BPLB 4UMCA 3RVUD 4MJIA 3VFVB 3SCRA 3T4YA 1I3VA 3KX6A 1JGMA 4HH8A 2BSDA 3W74A 2R2HB 2ZZUT 1TXKA 3QJOA 4TQEH 1NGWB 3ZXAC 3IJSB 2CU0A 5T3XH 3O11B 4XNQB 2IANA 4WK2B 3FU5A 4ONGH 1CD0A 3V5KB 3ARZA 1YY9D 4HLJA 1F90H 1KCZA 2X1SA 4IMLB 2DSUA 1AGFB 4ZMAT 1P6AB 2QGYA 3AUVA 1XF3A 3LCLA 2IFFL 1XDLA 2XHYA 4IRJD 5BUGA 4B9PA 4RGMB 4BK8A 2X4QA 1JPTH 4MMXA 3W3OA 1UC4A 3VE0A 4FF7A 1UT1A 3BANA 1SBSH 3CX5J 1WFOA 3KAAA 4JDZB 1T89A 3CHVA 5I6MA 4CMMB 1HZYA 4AEHL 4FG6C 1P4BH 1VLIA 4JFEE 3G5WA 3U0HA 1A1OB 3TKFA 4PYSA 1EJTC 4ODWB 1YN7A 4EN3A 2J8UB 1KQYA 1KENL 1I1WA 1O7DC 4OD2A 5EF0A 5BZWA 2BVTA 1KLUB 5HVHC 1TYGA 4KCTA 5E93A 4IOFD 2C9XA 2HFEB 5FGBC 3GFXA 1MY5A 1NGQH 4MJ4A 3ARGA 2ZZ7A 3BMXA 4ORGA 3IU3B 1O9ZA 4U7KA 3FT4A 1AZVA 1ZP4A 3ECQA 5DSCA 3R4DA 3WUBA 5PTDA 3CJJA 3MZGB 3WN6A 5EZOL 3CZUB 5DJCA 5EWIH 4W70A 1OC5A 3RGTA 3GU2A 3EZ4A 2WXHA 4GNJA 1LEGB 1MFEH 4D9QD 3GDTA 5F7UA 4ZZKA 4AYID 4UOQA 2E6JA 1IRAY 1DQTA 1SQ2N 3MJWA 3TBVA 2YAQA 1GQLA 1PG7H 2PDFA 2QSTA 3LNPA 4FF5A 3OLGA 4HHMA 3D9AL 3D48R 1U5VA 5KSVB 2ZTKA 3JQOB 4BGLA 2HJKB 3VI3A 2VXVH 4ZX6A 1LUCA 3LEYL 5E6IA 4RXGA 4PRIE 1T0NB 1ZAHA 1MJJA 4GZ7A 5EMLA 1CFVH 1AACA 4ZW7A 3EF4A 2WMIB 1TEGA 4KI5C 3EYQC 4B9ZA 3GJFB 1AJ7L 2NY0D 5IW1B 1QTYT 4HUVB 3RX3A 3IEBA 3CZLA 3I75A 4K07A 1R3VA 4MWAC 1XH2A 4U1SB 3VNYA 1GC1C 4AM0A 1IEBA 5MF5A 5AOMA 8PAZA 2XJLA 5AWNL 1SLXA 4GNKB 4ZS6D 4F3FA 3D6NA 3E38A 1MUWA 3KOXA 4PRPD 1ORQA 2OKMA 1X9UA 1TPFA 1S78C 2KZ1B 4Y9BA 2BVUA 5GRZA 1LCOA 5B22A 1BD2E 4ACZA 4US6A 1D6EA 5CQ1A 1BVKA 1X5ZA 3KPMA 2FJGA 3FN3A 1G7HB 3CUJA 3Q6FB 5FECB 4BSWA 1F5ZA 4XP4L 3VOIA 1ML1A 3F85A 3NG5A 4KV5E 4PCTA 1UJQA 1QMLA 2YAMA 4PLKD 3VILA 1MLCA 1DORA 5E9DB 2J88H 5HJGA 5CWSA 4BH7B 1R33A 4GZIA 1OYAA 2DZUA 3WFCL 5JXQA 3FNKA 3LZLA 2VR2A 4AD4A 3M41A 2B2XH 2NQ9A 3WEXB 3P93A 4YVXA 4JPWL 1JZEA 2OYLA 3QR1A 3BQVA 5E23A 4PJFA 1ANUA 1VGEL 5F7NC 1LDSA 1XSKA 4HHAA 1MDTA 1FAIH 1IE4A 1ZS8A 4M1CC 3NYZA 4YH6A 2CKBH 4FQHB 1QNVA 4PY7B 3H6JA 5L0QB 3OKDB 1FO0H 1A50A 1X39A 2CBIA 4HP5A 4PC8A 4ODXB 1XCFA 1D5XB 4N2MA 4QTFA 5I1DA 2AL2A 3X1EA 3QE5A 4ZBCA 1I1AC 3K5RA 4HUUA 4TVSa 2R56H 4I7WA 4R83A 3QIWD 3LRHA 4KK9D 1K6WA 3GMQB 4IU3B 1F76A 3DYOA 5E2VH 4HTYA 5EF3A 2VL4A 4BUQA 2Y6TE 5HYSA 4I2XB 2HG5B 2I27N 4XD4A 4F8TA 4OZGA 2WLKA 2J7EA 5EIIG 2C13A 3WK3A 1FHNA 2HTLD 5IB4A 3VRIA 4PJDF 1HW6A 4S3EA 3TYAA 3P3TA 5EB8A 3SY6A 3MHGA 1NBQA 4JPVH 4Y9CA 3KYMA 2P47B 5GZNC 2CZVA 2HE8A 3V7AG 5GZOA 2YHGA 3ATDA 3C2YA 3BPCA 3AUOA 1DBAL 2J25A 5H2ZA 1ZLPA 5IXEA 4GIOA 5AOZA 4A37A 4GLEA 4IXXA 1A0DA 1XF2A 3SDXF 2FT7A 4O50A 2ZUTA 2YCJA 3NJVA 3UAFA 1A7PH 4KGLA 1S8DB 2XSAA 1V6TA 4KGJA 3FMGH 4KCVA 2YKKA 1EHAA 2WTRA 4LEOA 4F15C 1BQRA 2HRGA 3HS0C 1ORSA 2G9KA 1GR7A 4JDTH 1UCBH 1PCSA 1GC1H 3WEMA 3SE4A 1ZDSA 2ZKHL 4P2RA 1EJUC 1Q85A 3Q58A 3MC5A 3C09B 4DPCX 2IH1A 5H94A 1EMTH 4ZD3H 3RPTA 1OVZA 4POZC 1Q7QA 1UHVA 4IIQA 2HZHA 3RMEA 2OXHB 3L95B 4Y4KA 2ZONA 2X40A 2IAMD 3NZGA 3ETTA 1FHLA 5HQLA 1A9VA 1JHKL 4O19A 5HHMD 3EB2A 4HJ1A 2EPKX 2WMGA 1S7RA 1BZ7A 2IBBA 3L5XH 4Z3FA 1EUNA 1QG3A 3W27A 4OLVH 4BWUA 2ODOA 4LHUB 2I5YH 2YBRB 2V9UA 1BV8A 1KCRH 3LN4B 4UBDD 3IAGC 1DJZA 4NO0A 1I7TA 1ZENA 4M9PA 3MLWL 1D9EA 3ROLA 3MHUA 4Y2OA 3CWNA 1JRHL 3T6QC 3CVIL 1XD0A 3SD2A 4EX4A 2OS7A 2F5AL 2CO6A 3VYPA 4RW3A 3W5NA 2GTZB 1E5NA 4WKAA 4L4VA 4O15A 4OZHA 1O5KA 3LTVA 1QEWA 5MHSD 3S5LA 2UXVA 5C09A 5FWQA 4UINL 3GNRA 4X9YA 3OVQA 1F4YH 3DI2B 4QI3A 3GUWA 2AJ3A 5C3IA 1OX4A 5ESQB 4P07A 1Q0EA 1OGBA 5ABHA 1QSEE 2G97A 3OGOE 1NFDE 3UP6A 2V8LA 1C08B 4WF7A 4H9YA 1CFMA 3SCUA 5KYUB 7TAAA 1V79A 3SDYL 2J12B 4P4RB 1W3IA 1FHVA 3BN3B 3HFFA 4YXGA 4GYKA 3EBAA 3CPLA 1GY2A 5JDSA 3ZL4L 5DJ8B 3QTPA 1KT2A 2FYVA 2EIDA 5IVXF 3TN0A 1DQLH 1EXUA 3PXLA 1ZAGA 2PZ0A 2VW4A 1LD9B 4X80L 4LKXA 4FR1A 4DEFA 2W1NA 2F5BH 4UNIA 2XYCA 2AJZB 1NGYA 3RDJA 2HLAA 3M7WA 5H2BA 3RP1A 1RVGA 5AENA 5J7CC 15C8L 4MUPA 3VZYA 1ZHNA 3IRDA 3WIJA 3NP4A 3PPHA 2QXWA 4GQQA 3UYIA 1A6WL 2VQ1A 5BO1L 3OB8A 1AG1O 4FFYL 3BJ91 4A55A 3MI2A 4MRBA 2PDHA 4XZ9A 1JQXA 4R7LA 4P3WA 4M56A 3ULUL 4V33A 5DWUH 3F7JA 4IGNA 3JZYA 3G5VB 1H5BA 1RMFL 2XWEA 4UTBA 5MKGA 4FXTA 4N87A 1FY6A 5E1IA 3BV4A 3SCMA 2YEQA 2V67A 2YMTA 4Z0XA 1ND0A 3A4XA 2WWNA 3QWRA 1MFNA 4YE0A 2BB0A 3PF2A 3TO2B 1XP3A 4K7VA 2R4RL 1DQDH 3LRLA 4I18C 3NM1A 2B08A 3MMTA 4FXSA 4LEXL 1JMZA 4O4WA 1HIML 1PCKA 4RZ6A 4A3UA 1MZYA 4P8WA 1YAIA 4AH2A 4DWSC 3DOSB 2IADA 4L3FA 2I9LB 1TZ9A 1R17A 1P4IL 5AC7A 1YEWA 5HP5A 3N1AA 4E8GA 3OODA 3PABB 5A3ID 3OB0K 4NQCA 1NEPA 2F58L 1SJBA 1CN4A 5K33A 3NOIA 5J9PB 2CHOA 3BAYA 3GDKA 1TU2B 4INFA 5KYWA 3IPFA 4WU5B 3Q94A 4IJ3B 4I0PA 3EKGA 2OMWA 3UTTD 3FRUB 4G42A 2HPTA 2QUUA 4HDIA 4C58B 1GGIL 1GS7A 3SDCA 5I07A 4FEIA 1BMGA 2WHKA 4NQEE 5HGDA 1DN0A 2X4RB 5TH2B 4P46B 2X6CA 5FO7B 4NNCA 5F1KC 3MRNA 4OCXH 4Z42C 4WEEA 1RI8A 4YBLC 2X0HA 1Q1PA 1ADQA 3NSDA 1J5DA 5TE6L 4YHPA 3IE4A 1CLXA 1N3NA 1AMXA 4EVNB 1P43A 1QNOA 4HTBA 3GD1C 4AF0B 2NY3B 1RD5A 1TETH 1XL6A 1XRSA 2G60H 2V37A 3H2QA 3NZSA 4WEUD 2RUSA 1FIGH 2WLMA 3OGVA 4PRIA 5J5DA 5FYKH 1FTXA 3WDQA 3P30H 4JEJA 2AK4D 4RZCB 3W11D 3HI6H 3B8WA 2E27H 4B53A 4W9GC 3WJXA 3TJEH 5D8JH 2POZA 1WH0A 4ATLA 3BIAX 4P59H 1EFXB 3STCA 4GYBA 4X8XA 2P5EB 1Q0YL 1WE5A 4KBPA 1ML0A 1MXSA 3M7FB 3AYTA 3WO8A 1PNDA 1QR7A 4JO2L 2A73A 3DGGB 1MCFA 3WY1A 2W88A 3URAA 3L0KA 3LB6D 4MNLA 2R23B 1KIUB 3ARDB 3PYCA 1X7TA 1V3HA 3T4AC 1LE5B 2ADAA 5LGHH 4LSBA 4JTDA 2EDHA 1WAAF 3O4LE 2WWOA 5EU3A 3FT9A 2F1BA 1S7QA 1D2KA 3IJ7A 4JN6A 3CFBB 4XP9H 4H2AA 1ZEAL 2DT1A 1J5OH 3ZZ1A 3P4NB 3JYCA 3QJFB 4XOEA 1WT5C 4MYAA 4HZLB 5LVEA 4BA0A 4JY8A 4XHJC 2A5UA 4ETYA 5GGUA 4HIQA 4PB5A 4G1MA 2QCNA 3EWDA 3BKMH 1YJDC 2CCLA 4WRHA 3ZR6A 2QEZA 1NIAA 1YPZF 5K39A 1Y65A 3T4CA 3DGCR 4GEIA 4MYWB 2IPKB 3HI5H 1VFFA 4JTKA 1NQKA 4BHUA 1T4WA 1D5MA 4RDQG 4GP4B 3CUGA 3RVUC 3W7HA 4W93A 3CTTA 5FJPA 4BKSC 3MLTA 4NZRL 2VR7A 1H9VA 5JO5A 5D1QB 3WQCA 4LC8A 1Q5MA 1XDTT 1A14H 2OTUB 4MVBD 3NGJA 4FA3A 4B5WA 3ZXWA 4JGJA 4GBXA 2XIJA 3D1MC 3VDCA 5INCA 4KHTH 1YY9C 3GMPB 3HG1E 5IFJA 2J8OA 5EOCL 1MJUL 5FKYA 3NUKA 1WBZA 1TTRA 3AS0A 5BOJA 2HRLA 1I8LC 3BKYH 1MEHA 1U4FA 4PUBH 1WCQA 1J79A 4PRWA 4M6MH 3A24A 1VGAA 1B6UA 1NGZB 1T0MA 3O3DA 5I77A 3PJSA 1V0NA 4BUHA 1AJ0A 1KG0A 2XWRA 3EPOA 1KTLB 3GKZA 2IOIA 3LZNA 3W0WB 3WUWB 3DBSA 2ITDB 4H26B 1U3JA 4YDKH 1GGTA 2R8SH 4LSTH 3PNZA 3ZDXF 2XZCL 4PJ8A 1WKDA 3SDAA 1TFHA 2DSZA 1X3DA 3BVXA 1QO5A 3T9PA 2XV2A 4IK7A 3SD5A 3V5DA 1O4UA 3EH4B 1KCVL 5F7BA 3D18B 4KUZH 3WD3A 1K2DB 3L3KA 1OBAA 4IOFC 5JH1A 2R0KH 2JCWA 2HFGH 3FT2A 1RH8A 2EUWA 4CMHB 3OD3A 4M5TA 1MSSA 1BRLA 4JDEB 3BD5A 4GT0A 4KPHL 4RPQA 2X2GA 3VGEA 5BXPA 5LXVA 4FC3E 4KKRA 3TFKD 2TRSA 2PDWA 2VP8A 4MDJB 3U2SB 3X1NA 2WVVB 4ABUA 3AT0A 1MOEA 1QBLL 1ASQA 3S37X 2ZNWA 4CGUB 2ZSVA 3TCLA 5LUMA 1M57B 5F9OL 1QK2A 1UXMA 5DHDA 3K13A 1OFOA 4IIGA 1TDQA 1MI5E 1IM9A 2KH2B 4U1LB 1NUGA 4PYGA 1ZD6A 2CO4A 3LYRA 2OL3H 5F8QC 4RZ4A 1G7PA 4TNGA 2Q6WB 1YJDH 5C86A 1SW3A 2FPVA 4PMOA 5M1TA 5AYXA 4AVKA 5D02A 3LZPA 1MHHB 1F6AA 3CO4A 5FO8A 1W17A 2O0TA 3I6LD 3PS6A 2C1PA 2A9NH 4OUOA 3CT2A 3TYGL 3TX9A 3QEUB 5FF3A 3X1BA 1R3JA 4PJGA 4O9HL 4IM4A 5DXWA 4EANA 3MTRA 4P99A 3GSRA 3BO8A 5F2FA 1A3RH 2JALA 4PA8A 2WBKA 1T21B 4BV1A 4UQ9A 3W25A 4F0RA 4X6DE 4POUB 2X3AA 4ZS6C 4FALA 3AG3B 1RUSA 1S5WA 3LHVA 3N2XA 5EIVA 1ACZA 4F37K 4LVAA 2D4FA 5GJTL 1AXTH 4PRHE 3UR5A 3FKKA 4Z7NB 3G6JB 5EU7C 4S3CA 3VGBA 3DFPA 1TTAA 1NFDA 2IWFA 4WDIB 4NKDA 2Y1HA 3LZ5A 1QEXA 1B9KA 1OWWA 1R5IA 4RISH 3NIGB 2O1AA 3RAJH 3GLCA 3D69A 1W0VB 1A7RL 3TEXA 4N0YH 1FWRA 4LASH 2WLJA 5DQJB 3C2VA 4HWBA 3W7IA 4XGZA 4F2BA 1IR2A 2QV2A 4PLKC 4JIQA 4PRDB 1PZUB 3DECA 4ICXA 1TQCB 3E5BA 3GBLA 1A1NA 4H9VA 3ZYZA 4HH9A 1WBYB 4YIWA 1NOWA 1CDBA 4AEIH 2J5LB 3RBGA 3BPWA 2VHLA 2A74B 1AQDB 4DP4X 2CO1A 4JZJC 1NTHA 2K45A 3WY2A 1D2OA 2UVEA 1HFUA 2Z8VC 5EORH 2OZ3A 2J8TA 3DK0A 5ECUA 3DO7B 3OKOA 1CFQB 1HSAB 4NJHA 3IJLA 3QORD 1QOQA 4OTKA 1E42A 4KQ4L 1LK3L 3UZYA 5C1MB 4IKKA 5IJBC 5KAQG 1J0IA 1I9CB 3QK0A 1LMIA 5D4HA 2ZYSA 1VHPA 3AY4C 5IQMA 4KV5F 5EU6E 4Q74A 1T6BX 3LS4L 1JWMB 3HE7A 1KB9J 3QIWC 3KDMA 4ADSA 4KK9C 4GUPA 4XPTL 1GH7A 3PVFA 2SFPA 3K71B 5L4FA 2B39A 3QV8A 4Y19D 2HTLC 3M45A 1H8OA 3SRFA 2FB4L 3VD5A 5INDB 4YHLL 3L2LA 1AZBA 2A6KB 1B90A 3B2VL 2RIKA 2SODB 3WO3B 1HCZA 3NTYA 3VU1A 1XXXA 2ZF9A 3EJQA 3GRIA 5BMFH 1LLWA 1FWSA 3VWJD 4ZUVA 1NELA 1A6AA 4Y4FA 4PRTA 2XBZA 4FFTA 5SWZB 3GRWA 1UA7A 3V79C 2AXFB 2B1HL 2RCSL 3HOGA 2VXQL 1X7SA 1K7FA 2DIJA 1AR1B 4NQEA 4Z78B 2FX9L 1B0RA 4OZIB 4P8QA 4NO5A 2NVDA 2YIHA 2HJPA 4YLQT 3IDMB 2CGRH 2HFFB 3MJ9H 2IH3A 1E5BA 1PX3A 5C0AA 2C9SA 4ES4A 4FA7B 3DFQA 3OXSA 1KJ3L 2VSDA 2DWDA 5JQ6L 5JPNC 4Y7OC 1NAMA 1OP4A 1SJEA 3EOAA 3QUYA 4K3HA 2YUVA 4UTBL 4P9HC 5CILH 4RE0A 1Q6DA 1QUNB 3PF3A 2DQHL 2C3WA 2IAMC 5IHLB 3C5SB 3GZKA 2FPYA 4HS3A 4DETA 3TBCA 3HTLX 4GQGA 3KTSA 1CYGA 4N6RA 5C3LD 1NFKA 4JO1L 2IQ9H 5SX4H 2GK1B 4NUMA 1G7IA 1P69B 1W15A 4MY8A 2W80C 2CO7B 5F7LB 5D2LB 3OKKA 3FUIA 4S2CA 3ZRFC 1KCLA 3UT0A 1NC2A 3HPJB 4QF1A 3FFCD 4N6FA 1I9IL 2VLJD 3T71A 3D0VB 4M02A 5AW3B 2DW5A 1QRQA 1XRVA 3QZEA 3PSVA 4K7YA 2IALA 1RY0A 5J1AB 1FFTB 2V5RA 2XRAL 1Q2RA 3O4LA 1OK6A 1DBML 2F54E 1P5UC 3C5QA 4KMTL 3ULUE 3QNYB 5DRNA 1YMMB 2IPJA 3VXMB 4G9DA 5K9KA 2MOQA 3CZJA 1S78D 4LP8A 2DW7A 4WI9A 5HYEA 3CHPA 2HT2D 4QDGA 1PGRB 2MNUA 2ZKWA 4HPOH 1XCXA 1EHNA 3GYRA 1B4KA 3EOLA 4F0KA 1E72M 3MU3A 3SCTA 1TJPA 3CUPB 1QBML 4NDMB 2NZLA 5MERB 3WLPA 1RBOB 5G4EA 1FL6A 5F9WB 2I17A 2PTUA 4E8CA 2XZ9A 4OGXL 2HVBA 2HNHA 4BM7A 1F74A 3L5WA 5ENLA 4FZEH 2K3TA 4DZ8B 2YXWA 2R1YB 3RDTA 4GW5A 2G5UA 1NEZA 5I0XA 4OLXH 4MJIE 1PDKA 1Q9OA 3PU7A 2WWKT 3EB4A 1C92A 4I8DA 1E0TA 1TJXA 1QWGA 1CJYA 1MEXL 4DVOA 2DEYX 2VEIA 4U3AA 1FVCA 2NSXA 4IBLT 4QMEA 5D6DC 4RGOL 3KWUA 5EULV 2YW4A 2X70A 1KFBA 4LS0A 2B77A 1IT9L 4NL1A 4M7ZB 4OAWA 4PV8B 1KM4A 4AUBA 4R4ND 1DBBL 2YD1A 2Z31D 3N50A 4F33B 3CZFB 4X4YB 3CXOA 5A2CA 3P0YL 4BFJA 1DANU 2O61B 2A3CA 4JRXB 4N9EA 3ZO0A 1YTDA 3L3JA 1QRNB 3NQKA 5HWMA 4P3DB 5DZNA 1T7ZA 2VDOL 4XTDA 5TFSL 4RNJA 1SOSA 2XICA 4F20A 4HHWA 1O5DT 1U8CB 4OLWL 3THML 4C4UA 2KMWA 3LHPH 5JZ7D 4PREB 2VLKD 5C08D 2E8ZA 2KL6A 4U1MA 3K5SA 3MZ2A 2HT3D 4Z7AA 4NRXB 2NVAA 4P9HH 3IFNH 5GGVH 1DQUA 1MCBA 3A5FA 1Z32X 1IEQA 1V3JA 1NCNA 4IS6A 4J39A 2NLYA 3GTNA 3VGGA 1FWTA 5KG9B 3B7RL 1F2XK 3LHTA 1IQWH 1SEBB 5FK9A 4MA3B 4BUGA 1OGSA 2CJUH 5E6RB 3MJGX 1D5IH 3H3PH 1EJFA 4JZOA 4L5FL 3L21A 2VAAA 1NKRA 1QNZL 3LRGA 1RZIA 1BX2B 2C9UA 2AERT 3TH2T 3TA4D 1BF5A 4B4FA 1LEKB 2BMKB 5KVEL 5DHVH 4LCIL 2RFXB 3K2KA 2AQNA 1FORL 3G9VA 4UAOB 2GUYA 4UU9B 1UA3A 3DX9B 3S88H 4EDXA 3C3UA 2FQIA 3B8DA 5HR7A 2XXGA 3HVNA 2CAKA 1ZTVA 1GEHA 1U8MB 1MUJB 2BOCA 3F7YA 3ROOB 3FYYA 3UY7A 2XPYA 3NIDF 2CWNA 4J35A 3AS1A 1UZ4A 4DP9X 3CAQA 4LPVA 1YBQB 4ODUB 2V3EA 1MI5A 2BOGX 1CLVA 4OJFH 3CMOH 3KOZA 4J1UB 3NFPA 4ONFH 2BWDA 1FLRH 3EYPA 2AFNA 2DH2A 1XCQB 2Z1BA 4OCWL 5E5CA 1CVSC 4B96A 3FV9A 1IKFL 2IPGA 3QJUB 1X7QA 3M8OH 2J47A 2EILB 2G5BB 1A3LH 3FAWA 3W11C 3M5VA 1WDRA 5EBUA 1XIGA 4XBEL 3M0IA 1ZLEA 4NIRA 2CJTA 5DEFA 4CADB 2OW6A 3RRQA 3WIFB 4D0DA 1FRGL 1KGCD 4UTWC 4QM1A 5CC5A 1IC5H 2G4FA 4P7NA 4OSUL 4IQJA 3SIKA 4V1XA 1ZSHA 1GQJA 4I7ZC 5J0BA 5L2KD 3I84A 3UCCA 3VD0A 2YRPA 2OMUA 3H56A 1BFVL 3PHOB 1JGUH 3LCFA 4ZXBA 4JY5L 3ISRA 1E4LA 3BXNA 4X6DA 4KITB 4KTEL 4LVBA 5D9OA 4PJEF 4HK6A 5F88B 2H1PH 2ARWA 1TV4A 3PL6B 4AG4L 3ZHLA 4S2BA 2EPLX 2NCMA 3QJVB 3GNXA 4PJAA 5DJYA 2HUHA 4PRHA 3SKMA 4QHNB 3A4AA 2Z2UA 4EIBA 3N04A 5KVGH 1LLOA 3EPNA 3GM0A 3B0PA 2X6MA 1UMYA 2Z29A 1WDWA 4WO4B 3KR3L 1YY8B 1WCBA 4AAJA 4UOW1 3QIBD 3BWAB 1Z66A 2X4SB 1GZPB 3NCWA 4L80A 4U1IA 5EBLB 5ALCH 3DJ9A 1TPH1 3DOHA 4R27A 4HCFA 4DNLA 3O6FD 1R4XA 1BM7A 2Y23A 3GLEA 5B7MA 4WZ9A 3UZVA 1LL7A 3DCPA 2ZZ1A 2MJWA 2A6IB 4I77L 1H9DA 1DDHB 4TUJA 2XIIA 5ICYA 2GQAA 1XGPA 4LLWA 3N13A 4I48A 3OA3A 2Z34A 4PJFE 1AE6H 2J1KA 2PLCA 4HKJB 4MVBC 2QUTA 1JYVA 5AL0A 5DVMA 5GGQL 3O8XD 4CL7A 3ZE0B 1PLBA 1I8KA 1E0WA 1HQTA 2JJTC 4HKZB 5G4OA 4GH7B 4BYHA 3FQTA 3H9HA 1J10A 2VN5A 5CN1A 2Z28A 5ES4B 5J8LA 2W79A 2R2CA 1B0GA 4HX1A 2QKFA 1RK5A 1Y5WA 5I3FA 3PFMA 5GS0L 5EU6A 3C8KB 5CFAA 3CXHK 4N6EA 4J3BA 3FJ6A 4HJWA 4W86A 1A6TA 2DKSA 4W4NA 2VXUL 1FVEB 4R9HA 1MVFA 3LG3A 1A7OL 2D73A 2R7EB 3M0HA 5LG1A 2OMNA 1KELH 5HHOD 1HCYA 1XC4A 2YC1B 2GQ3A 1D6VH 3N1QC 5C0RL 4YVPA 3IDJA 3V0AC 3DVFA 2AQ2A 4WWPA 4NCC1 5AZ2H 2J4WH 2H8PA 5HDBB 2OULB 5T26A 3R89A 3DTDA 5ALBL 2Z4GA 3P4MB 3MGTB 2WXGA 5JA9A 2BCKA 3R12A 3TEVA 1RUMH 3NO5A 5C9XA 3DURA 1KLGA 3OAYK 3OKLB 2MCPH 1BLNB 3W1NA 4MFEA 1ISYA 1B30A 1YX1A 3LOTA 1NP2A 2X38A 5CJOL 4XBMA 5HGGS 2BSTB 1IBGH 3G1XA 4PJBA 5I6OA 2GUOB 3EKCA 3GDCA 3EIFA 2G95A 2F7FA 3BSMA 3I4KA 2LVEA 2DQEH 2DVTA 3H55A 1VJIA 4YU1A 2JCCB 2ZP9A 4CCZA 3UPMA 2MKLC 4GW4B 4YGVA 5TE4H 4XO7A 4P2RE 2BMBA 1OSPH 4BZYA 2V82A 4NN5B 4V28A 4PJIE 4Q8TA 2Q3RA 1E8ZA 2V5BA 1PKYA 1XV8A 4HIBA 3S6TA 3MWCA 2I60H 5E1AA 2VQTA 1T1YB 4ZTEA 5I5JA 1WISA 3UX9B 2FBJH 3HG0A 3OO2A 2J73A 3IVSA 3NSMA 5IMKA 5D4IA 4C56D 2XIQA 1BAFH 1HVXA 3QWNA 3LPWA 2H3NA 4UM9D 1S7VA 1XLBA 1IGWA 1J5IA 1A3QA 2BZCA 3DERA 3L2NA 1TA3B 5C9WA 4FFYA 3SSJA 4G8GD 2G50A 4K36A 1IX2A 4WQ6A 2X42A 3NBNA 1BVLA 5C0CB 3MUHL 5D9MA 2F54A 2MCAA 4TIMA 3ESPA 4O4YH 4A2EA 4W87A 3MU7A 4PB0L 2YD0A 4CJ1A 5DVOA 2EXSA 4L4VE 2A9ML 3KPTA 3ZUNC 4HGMA 3GRWL 3BDBA 2CK0H 5C6WH 5HHNB 1LT7A 4OCMC 4MZRA 1NGXB 4Q9RL 3L1OL 1GGBL 2AXGB 3ZZSA 2CDFB 3B9KB 4DM1A 4F7MB 1N59B 3CU1A 4HIIB 5D2XA 2H7WA 3C8DA 4NAJA 4FXGA 1LHZA 4AD2A 5EYWA 1DHPA 1UZ6E 3K2UL 1PFOA 1ZXKA 4JZ5A 5C92A 5JUEH 1YRKA 2F6UA 1PKQA 1CR9L 2MWCA 3MXVL 1OTSD 1JF6A 2PABA 1JCTA 3PAJA 4HJGA 4MB5A 4LUJA 5C6PB 3Q2CA 3JTSB 2NY6D 3FRPG 2P5PA 4ZFCA 3RITA 5C8JB 5D2NA 3JVFC 4MQTB 4Z0JA 5KUMA 4PH6A 4MASA 1RBAA 1A4KB 3IFLL 4H6EA 3Q3GA 2W9MA 4CU7A 3H2CA 3S6DA 2Y7LA 3JZ7A 2PDUA 4NO3A 3VXUB 5LYRA 5T1KB 3WBYA 4TS6A 5BUPA 4M93B 2RGMA 3QO1A 3WD2A 3SRHA 2W27A 3SRKA 2EJAA 2ACQA 4HGWA 1ZT4A 1GVQA 4MD0A 1BYBA 3R1GH 1U8PA 1NCCH 4DBDA 3FUNA 3QORC 4GOAA 3OAYH 3Q1EA 1SDAB 4EOWH 2WINB 4GHRA 2BJMH 4YDIL 3SYPA 1SHMA 3OIXA 3BWUC 3RWDA 1R0AL 1U58A 3QXWA 1O7VA 2HPOA 1OKEA 3QXUA 3O2WH 4UNLA 3WCZA 1PZDA 4B3LA 1R8LA 5I3JA 2J7BA 3WLMA 3MS8A 6A3HA 4JEGB 2CZ5A 2VTFA 1UXWA 3TYEA 4QS5A 2PPAA 4WGHA 3QZPA 1E4XI 4JFVA 3GHBL 4FQJL 1S1PA 5A16A 4G56A 4P4KB 1JCXA 4GG8B 3URBA 5T3ZL 1BHGA 3QVQA 3R25A 4NQCE 4DUWA 3OZOA 1SUXA 1EAPA 3AROA 3NWRA 3GSVB 3FO2A 2N0KA 3VWJC 1OD9A 5ID0A 3ZPDA 4NQVA 3CEUA 1UD3A 5HYQB 2WXIA 3S1GA 9XIAA 5B1KA 2PF8A 3MOBH 4GAJH 3RRXA 4H19A 4K71B 2DJMA 3WTXA 2EIZA 7ENLA 4NUPA 5IB2A 1JPFA 2BSRA 3G08B 4DN3L 2F53B 5K7JA 3MO7A 3S3JA 3OZLA 1SM9A 2CWRA 3V4VB 4F24A 1MZHA 2N01B 1D5RA 1TRDA 1RH9A 4G6KH 3PWJA 4GUOA 1P4UA 5GRWA 3WBWA 4Q8UA 1DZBA 2FX7L 5GSVA 4S1QH 2IXUA 2FR4A 1OM9A 2CITA 6ALDA 2OSLB 3FCPA 1YKWA 1K7XA 4N3UA 2RMNA 4FX6M 1A0CA 2A3HA 2NY4B 1T03H 5BYWA 2JKRM 5LWYL 3AUWB 2QADD 2JXMB 1LDPH 5LN4A 1Y0LB 4N6QA 2PTTA 4QYAA 3CASA 2XZQL 3PV6B 4HWZA 1Z3RA 1TZHA 4CAGA 2I25N 3W72A 3EYVB 3HFYA 2PO6B 4UBPC 1F13A 3UYRL 4O13A 3RPIB 2KZKA 4KX7A 4ZPTA 3PANA 5IEHA 2PW2A 5KVFL 2MUCA 2YN5A 2W38A 3DX2A 3OR6A 3FX4A 1R3KB 1CENA 3WN5A 4GIRA 3MRKB 1YEKH 3BLFA 2YXGA 1E56A 5LNVA 5MEOA 4QRNA 4IRZA 2NUTA 1KIRA 1YDVA 5JYLA 3HNSH 4N9DA 1VYRA 4BFIB 4F0LA 4M1DL 3M7SA 5DJAA 4PLJD 2FSDA 1NJ9B 3CSYA 1IBFA 4BWLA 1E67A 3T3MB 2HT2C 3P0VH 5DJDB 4U6XB 3MCKB 1SZGA 1I2NA 3W7CA 3PUGA 2B4CC 2R59A 4V15A 3BJSA 3H2FA 3P77A 2D7OA 5ESAB 4LGSB 1QWKA 4DW2L 3KCLA 4H40A 3H6OA 4DXVA 3T2OA 3EWYA 1X98A 4EPEC 1KYAA 1ME8A 3MNZA 5TPWL 4AEOA 2BVEA 2CUAA 3X11A 4IGBB 4L5FE 4HJIA 2B59B 4D0BB 2IV8A 5HANA 5B1JC 4Y5VB 4F7TB 3FQUA 4QTGA 1ISVA 5DUBA 1U92A 9PCYA 4UIMB 1SO3A 3I68A 3FB5B 1S7SA 2Z7KA 2FHBA 1FSKB 2FECI 5D38A 1J9TA 3Q5YA 5KVEE 4W9HC 5G1TA 1D7KA 3GIVB 5AW8B 4HIEA 3IFOA 3O2VH 2EDWA 5AC5A 1TWSA 4YHIB 1JQVA 3GSWA 3F84A 3IPBA 5B8CC 4LS1A 4S3AA 4GVHA 2NNXA 2A6JB 4R4NC 3KDNA 2Z31C 1GIGH 3SCNA 4JQ1A 4NCC2 1E3ZA 3OGCA 3BG9A 1T5XA 3W9EA 4PMEA 3BURA 3KW7A 1WUZA 1WBXB 3I6GA 4QRQB 1EWEA 4NM4H 5DK2B 4HMCA 5EZIL 3VYOA 5JZ7C 1K6AA 3DHMA 2GVGA 2BXYA 4L29B 4K8HA 2DM3A 4YHKH 1M7UA 3FY1A 1IBZA 2HT3C 5C07B 1MYRA 3L9EA 4MCNA 1F4AA 2DZTA 1OADA 4J2MA 4E9YA 2VFFA 3C5JB 2QQKL 3KLAA 2F1AA 4P9MH 4TUOB 4K94L 3HR6A 1US2A 2C0HA 1DYSA 3T0EB 1A6VL 1X8CA 3O6LH 4W89A 3G7TA 1WRFA 3MJ8B 3TA3D 1QATA 1PYFA 4UT6H 1DKWA 4M61B 5CZVH 3M0YA 3FDWA 3ILDA 3VDBA 5ID1B 2WB5A 1JGDA 3B83A 4IP5A 3EGDA 4NM8H 2BOBB 2VIRA 2HTMA 3F7PC 2OO0A 5H8PA 4EZLA 1DWJM 1VJZA 3FSVA 4PJIA 1DWIM 3CV1A 2IQAA 5L88H 5D7HA 3DFYA 1K4DA 3C2FA 1K03A 4OF7A 3MRMB 3R4IA 2BP5M 4JEQA 3ALGA 4U6YA 3WFDH 1R5WA 2HA1A 5I0ZA 3OKEB 2B4CH 3AQDA 1DANT 4MJZA 2QHAA 3L9RA 5CPQA 4NYLB 3ES6B 1PZ2A 3GGWA 3QUXD 2OODA 1NIDA 3UP1A 4AYMC 5IM7B 4AFYA 5EF1A 3RY6C 1UUNA 2W62A 1WUFA 5F0MB 3MV9B 4AVNA 4HN8A 2VFHA 4I6KA 1AYOA 4PJGE 7FABL 4V1DD 4AYBA 1FKXA 4AX7A 1KV5A 1OG0A 4Z95L 3WNKA 1OSYA 5GS2D 4CBZA 5PAZA 3EUDA 4HNVA 2EHHA 4ZQMA 1MDAA 4LUYA 4Q8NA 4PTNA 1CDCA 3GXDA 5CSGA 1FWJC 5E2JA 5DJ2A 5JH2A 1M3IA 4F7KA 4QEGA 1JFXA 1O12A 3R58A 2LLLA 1C12B 5FUOH 2G4JA 1RQHA 1PEWA 1V6VA 2X30A 2Q8BL 3O45A 5F7FA 4KX8A 3UDWA 5GNXA 3QXTA 2PRHA 5GJNA 3FQXA 1AQHA 4OD3H 1XIDA 3VI3F 1GHSA 4NHVA 1RHHA 3IXTB 3RX7A 3QIBC 4QNEA 4AQ1B 4Q0XH 1XR8A 4Y4HA 3V6FB 1IIKA 5IV2B 2CNYA 1P5VB 3GQFA 5CZRA 3V36A 1FKWA 3QMTA 1BFOB 5KSAD 1TVHA 4MWFB 3O6FC 1SY6H 4LLVA 4Y1SA 4HUCA 4ESKA 2VXQA 1H6FA 3ZRCC 1X1NA 3UFIA 3QCUH 4XWUA 3PZQA 1IILE 2AQ1A 3TTSA 1W5QA 3W02A 1FH2A 3N6QA 3MLXH 2X2HA 2GIXA 2QDVA 4IGSA 1P7BA 3MQTA 4UQ3A 3SQOH 4AZCA 3CQPA 3O8XC 1TLKA 2Y2YA 2GITB 4ZAKA 2CGYA 2OBGA 4J3XA 4I1RA 1RZPA 2HTKD 3VFSB 2K70A 2Y89A 3TIEB 2WBWB 3FT3B 1BQHA 4X9IA 1LO4L 1H19A 5M7QA 1PKNA 3CC5B 3NACL 2JQAA 1E30A 3HNTL 1ZE3C 3QV6A 4IIDA 2GJ6B 1AUSL 1O68A 4GG6B 4LCRA 3M0XA 5LAPA 1ID2A 3DG3A 4BEUA 3HB9A 1AGDB 4KAQH 3MCMA 3ERXA 1H49A 1EEUA 2ATPA 3GVWA 4MSSA 2ICEA 2NW2B 1JXDA 5T1MB 1J9CT 2QQNH 3SYAA 43C9A 3KTXA 1KEML 4FTVD 1JK9B 4TV5A 1OINA 4A29A 5CCKL 2UY4A 3Q13A 4JTAA 4NFCA 4YHNA 4PJFF 4YXLL 1QNPA 1HXMA 2WSPA 1GPWA 3RWHB 4HC1L 3WJLC 3DSFH 2Y62A 4UMBA 3SODB 4KUCF 4WI6A 3HUJA 4I89A 3TAKA 1QTPA 3VGHA 5AYTA 2EACA 5FYJL 3M5ZA 2VW6A 3NJLA 4UOZA 3H8NA 3ENEA 3NH7H 3C0SA 5J06A 5G1YA 4U0RC 1CK0L 2GDUA 1ZBWA 2WXDM 4CU6A 4Z7IA 1RXLA 1KGYE 4FTDA 3NPSC 1ODUA 5C0AE 3DXAA 1WOBA 1MCQA 3BLBA 2G3ZA 5LBSL 3P2DA 1E9YB 5HMFA 3W88A 5LA1A 3EMQA 4N2OA 4FYSA 3ABLB 3BZEB 5D1XD 4OZGF 2FQEA 4O1EA 4RWYH 4K5LA 1MRDL 2CKBB 1SFDA 4UFKA 5B3JF 2HKHL 2ZWKA 1XC6A 1YNKL 4BINA 1AHWC 2R51A 3DX7B 3LH2H 4A2LA 1KIPB 2WTPA 5KSBA 1MDRA 1BBDL 1VD6A 4PP2A 3DH7A 2LQRA 3HQOA 3PAOA 1A02N 5HUPA 4P5UA 4FOMA 4NNBA 1MRFH 3IDYC 2OA9A 3QNZA 4IX0A 4HWUA 4K5PA 1W6WA 2ZRUA 2EEBA 4P8UA 2OI9B 4WJ5A 3P2BA 2CDEA 4WHYH 4ZODA 2Z1VA 5JXEA 1YTEA 5J1SC 1Z5LA 3IAPA 3N9GH 4QTIL 4ETQB 4RDYA 1ZLUH 2VJ8A 1L7TL 2P26A 3HHMA 2A1WH 2VD9A 2VKWA 3C6LA 2CHWA 4I0CC 5CEYB 3BIKA 2XN9A 4BH8A 1XCWA 2R15A 5HGAA 1C9SA 3RWGB 3GH5A 1NCIA 5AKRA 3NN8A 1ZHAA 3BMWA 6REQA 3TYZA 1KM3A 1N8OE 1BZ9B 2LR4A 2ITCA 3ATAA 4PG2C 3LQAL 1EHLL 5IR1B 3VW3H 1TE1A 1BAGA 4MWAB 4JDVA 2D31A 4ZK8A 3V52H 2WLIB 1IJNA 1OTSC 2EDBA 1Z0NA 1R3YA 2WC3A 1PZ0A 1ZE3H 4ZTOH 2NY6C 5F96L 5T3ZE 2IGFL 1QFWH 4NHUA 5DD6B 3L08A 1NBZA 4JANB 5DYOA 2YSWA 4E4FA 1G6RL 5FJTA 2WD0A 1ZHBA 4XMXA 4YVUA 1VFOA 5KSUA 2NX5D 4OZHF 3BE1H 2HZGA 2VLME 2BTMA 1JUFA 4H8HA 1IYXA 1SO4A 4XBGA 4AMWA 4IJTA 3VYLA 3F5WA 3NPZB 3MCYA 3C6CA 3L4WA 4UQ2B 4Z8FH 1OIMA 2ADFL 4IRZL 1TITA 4GIYA 3HE6A 1OT2A 3RWEA 5BV7L 1BLIA 3RJOA 4FXKA 3LV3B 1YEGL 35C8H 2QHRL 4S0HA 3LGDA 2OTPA 3FFSA 3MRCB 1RK0B 2CE6A 3AWFA 3WUEA 3TYFA 3EG9B 4XG1A 2ZZ6A 1EC7A 4Y88A 4YXKH 3N91A 4H9XA 1UB5B 1U3HA 1X4ZA 2C34A 3GI9H 3QQ0A 4YLWA 4N2LA 3QKEA 2NTFB 2WYTA 4YWIA 2WVTA 2EDYA 3UJTH 2BWGA 1DJIA 1B9ZA 2M2DA 1V02E 5GGRB 2E9BA 2Q8AL 4L8DB 4U1HB 5E1HB 5EU9A 3F8UB 2WQAA 5KVFE 1KRMA 1V93A 3NA9L 3G8EA 4I13B 5DGQA 4V11A 5H35B 2IV9A 2ESVB 1F4WH 3QULA 5D96B 4X6FB 3ZJKA 1UQSA 1PDYA 3KBNA 1W3LA 3MRIB 5D1ZB 4G1EA 3HIZA 2ALAA 4FJ6A 5L2JB 3UP8A 3RLUA 3PV7A 2YL8A 4PVMA 5DHYB 2BY3A 2J9ZA 2HVJA 1XBXA 5AZEL 2AGTA 2ENSA 2Q20A 3BGJA 1IAOA 3UBPC 2WMPB 4U1GC 1JCMP 2E7FA 3ISIX 4REQA 3VOFA 2WZEA 4C1LA 5K9DA 4I4WB 4HMNA 4G43B 4L1WA 4M4PA 1NARA 1VFSA 2HX8A 3GO2A 3WFEH 1XLJA 3RFAA 1TV2A 3F7VA 4GPVA 5KEZA 1EHXA 2IF7A 3MRDB 1XUZA 3KCWA 3QNXB 4ZUUA 1AQKH 2XG9A 1DBKL 3SFKA 2EKSA 4MZ8A 2IWKA 3V95A 2QADC 5EO9A 4F15B 2HKFL 4FQLL 3W1LA 4K5NA 4IQDA 2VR9A 4HA1A 3PWNA 3QHMA 4OD1L 5C0EA 1AO7A 4HU4A 1XLHA 3B6SA 4M3HA 2IH9A 3F2DA 3AAZA 5DRXA 1DFBH 2XGBA 4LF3A 2DKUA 4NJGA 3CLEL 2G2RA 3CQJA 3AREA 3VXSD 2P5WA 1F8TH 1R3QA 3I6KA 2PP3A 5I00A 4XCCL 1I9RL 3EFDH 2OEMA 1UIOA 1EL3A 4OCRL 4AXKA 3PWLB 4J6RL 2FFCA 4A7UA 3NZ1A 3UTQA 3BH9A 4PLJC 5JTWA 1XIMA 2XQYG 1K6QL 1FFOA 3GSXB 4F57H 4NC2B 1OLLA 1OPGH 1R19A 4PJAE 1RJQA 2Z3FA 1P7QB 1Q13A 4LMQE 3MRJA 3W7DA 3TT1L 1FCBA 3MRRB 3OZKA 5A3HA 3BSGA 4LDOB 3FO9A 2HLEB 4KMQA 1R24A 5FUCE 2PDIA 3KD4A 4L1HA 5D7LE 3P0XA 1B4JH 3O3AB 1CU4L 5EA0L 4RJEA 3DXIA 4XMZA 2XSXA 5BS0B 5IWLC 5IVNA 1JP5A 5E99H 4JG1L 1ECZA 4AGNA 5IGXH 4K3DH 4AGMA 2MMXA 4GRLB 1Q6FA 2VDPH 1HSBB 4QHMB 4OLUL 3VKBA 3FHQA 1S7WB 4PCPA 3QXAA 4LLYA 3RGHA 3OZ9H 3TCEA 2YB4A 4MBRA 4Z6AT 5F7DA 2ZJSL 3FTXA 1PVNA 3OHMB 4NQXB 4HUXB 4AKQA 2Z7ZA 3H3KA 1JZJA 4LUSA 1OHQA 5AFDA 1MHEA 3LPGA 3HC3L 2A77H 1WK0A 3NEOA 3VJ6B 4C6PA 2AAVA 3O3BB 5BROA 2EVGA 5C9UA 1LBLA 1NSNL 2P46B 4FG4A 3UU0A 1CFTA 3PUDA 2BW5A 4LOEA 1S5HB 3CL7A 1EZ2A 1F7BA 1T22B 2A9CA 1EJOH 2VMCA 4XOBA 1LYXA 1NC4A 3SOBL 1X9LA 4IP7A 5F4WA 3W2DH 4LCUB 2WOBA 3QUZD 5MENB 1X5LA 2BY1A 4OT1L 1VP5A 1GZHA 4Q3MA 1DL7H 1RZMA 1C7TA 5K9QG 4GXVL 2PDMA 2I56A 4Q89A 1QWUA 2P0IA 3U2IA 3QA3B 4MG4A 2WLLA 2OP4H 5F7MC 1QNSA 4LUTA 4OBTA 3TA3C 5E6ZA 4PJBE 1IUZA 1E2VA 3IMVA 4X5RA 1AD4A 3O2LA 2ZRZA 4I18B 4XAFA 3PZMA 4K1GA 4J6IA 2BG5A 1B4RA 3M1BB 4W8LA 2Z25A 3C2EA 4ZQPA 3KCPB 2FQDA 5E0CA 3NDOA 2OMTB 1BDYA 2HP4A 3NGFA 3WLBA 5J04A 4U6HA 3DX8B 4OV6F 2IPWA 1RP9A 2A4AA 1YDOA 4YAQB 2I9EA 4JN1H 4AGOA 2OZ0A 4OUIA 2Z92A 5IBTL 1Y1DA 4YN5A 4DI9A 1A5OC 1REQA 3PPSA 4G80A 4FQXD 3W7KA 32C2A 1DJSA 3MV8D 3RK8A 4K3EH 5DZJA 2NYKA 2FJHB 2GEEA 1FWWA 3QUXC 5FEBA 4C5YA 3K8LA 1AP2B 5E08L 3NABL 1F3DJ 4YBLB 3ERPA 2AV1A 4EI5A 3HAEH 4O57A 3DV4A 1JF1B 1U8LB 2JIWA 1SO5A 2IAAC 4Q32A 1ZT1B 4UANA 1DVFB 4JX4A 2ZOKB 3KPRE 5CGYD 2BC4B 1S5IH 1JCYA 3BZFB 1X5GA 3SSZA 5ISZB 2WO4A 4M8QB 4AIBA 4KY1H 3N9KA 2P48B 4AHOA 1L6FA 1U22A 1NOUA 1CPUA 1AKJB 1DVZA 4RQQA 5DD1L 1SN2A 1XO8A 1YPFA 4XUYA 3EJCA 1Z5YD 1NUFA 2AV7A 4N8VA 2QUNA 1E9PB 1KGUA 2X16A 3KOWA 1BJMA 1YE4A 2K3HA 3QI9D 2PAJA 2AEQH 4RGNE 4ZQKA 2YBTA 3LYEA 2W0FA 4H8WL 4BQ5A 3LX9A 3QISA 3T4AB 2DL9A 4WHYG 1PKQE 1CXFA 1JR1A 3VAVA 5GS1B 3SHSA 3RU8H 4GQ0A 5BOPA 4KMLB 5T5NG 3WG6A 5D2NE 2RAGA 5KSAC 3RHWK 5IB1A 1QVOA 3INOA 3B5HA 5CO1A 3MBEA 2W61A 5BRBA 1LO5B 5SWQA 3MA9H 2BNUB 4PJGF 1WA3A 1U3NA 5ANMB 1X9RA 5J57B 2PP8A 2OQJA 3WDJA 3ZKND 3PPCA 5FYJE 5F7EL 1ZGLB 3BD4A 4M1RA 4AMAA 4KRMB 2AQOA 2OL3B 4YE4L 1HESA 4KEVA 1CXKA 3WK2A 2YA1A 1JN6A 1Y6NR 2JI3A 1UWXH 4H3DA 3SYCA 2EDXA 1DXEA 3U46A 4N42A 2V33A 5A1AA 3WKZA 2PTVA 4EP8C 3QEQA