1KGWA

Three dimensional structure analysis of the r337q variant of human pancreatic alpha-mylase
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTQVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Probing the role of the chloride ion in the mechanism of human pancreatic alpha-amylase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords ALPHA-AMYLASE, PANCREATIC
total genus 167
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2001-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1kgwA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1kgwA01
2OW7A 4HU0A 1EOKA 4AY1A 4IUGA 2O92A 1QWUA 4C7GA 3D4YA 2OYKA 2WAGA 4PMXA 4CD5A 3PTMA 1UKOA 3D51A 3W37A 3DDFA 4AD5A 1M01A 2VZVA 1HKIA 3WENA 1W9VA 5JBEA 2XGBA 2G4FA 4PBGA 3VOCA 4A3HA 3WMSA 4XZWA 3GNOA 4FNRA 2PBGA 2GDVA 2WZEA 1QHPA 3MV01 2V3EA 2V5CA 3F5LA 4ZE5A 1UH2A 3HG5A 1GORA 1ZBVA 2OLHA 9CGTA 1JF5A 2ZX8A 2VX6A 5DMYA 2DQXA 1PX3A 1E4LA 4WF7A 4B9YA 3LX9A 1TUXA 3VGEA 3D50A 2VJXA 5LA2A 1W3HA 3TTSA 2PWHA 3DYOA 1E3XA 1UR1A 3N17A 2WKGA 3APGA 2BFGA 2FGLA 3ZSTA 1LWJA 1KB3A 2A3BA 1JL8A 3EJPA 1W91A 5HOSA 5IFPA 1K9FA 1W9PA 5CPSA 4QDMA 1QI4A 2PF0A 3MUZ1 1J0JA 3WNOA 1BG9A 2F8QA 3ZM8A 1TFVA 1TVNA 4AWEA 2Q8XA 1M04A 1HJVA 1OGBA 1UHVA 4A4AA 4PMVA 1J10A 4UQAA 2YL9A 2QLYA 4PUDA 4HPGA 4BS0A 2QV4A 5KZ6A 3ALGA 1CLVA 1Q4NX 3ZJ8A 1X6LA 5IHSA 2CITA 3SCQA 2W4XA 2D0FA 3DX4A 4E8CA 3AS2A 2VQTA 1BGGA 5I2UA 1RH9A 2VL4A 1W9XA 1JYVA 3RM4A 3SUUA 4KGLA 1AMYA 2WVVB 1EXPA 5CSUA 4MB3A 1EQCA 1VENA 4CD7A 4MB5A 3SCTA 3VO0A 1KGUA 4PCSA 3VSTA 1E1EA 3CZEA 1W2VA 4GIAA 3WD1A 3M46A 4P7RA 1HVQA 1W9BM 4DWSC 1MVYA 3F4VA 1BVNP 2PWDA 1CGVA 4M81A 2NW0A 1NWRA 3GXNA 4MNLA 1HIZA 4P8XA 4CCDA 2WCGA 4JL2A 3HU7A 3CC1A 3VD4A 2OWXA 4KWUA 2QMKA 1TQWA 2C8NA 4D6JA 4AIEA 1JGIA 2CXGA 2YIHA 1JXKA 1GONA 4ACZA 1JYWA 5D4YA 1L8NA 4W5ZA 4JAWA 3VM7A 2F1AA 1GQLA 1GOKA 3GH7A 2W61A 1CEOA 3AXHA 1NWTA 2PWFA 2JEQA 3WH5A 3DHUA 3GXTA 3VDCA 1QWNA 1L0PA 4ZXLA 1R8LA 1E55A 5EMYA 3AS0A 1DWJM 2WCSA 2VR5A 3AISA 2VO5A 2OYLA 4MADA 2D20A 4BQ2A 3A4WA 1CXLA 2VT0A 3CZGA 3KWXA 3AOFA 1W2PA 1XD1A 2W92A 3CZKA 3RCNA 3EBVA 2ZX5A 5I3DA 1JIBA 1CLXA 3WD4A 2V3DA 1BTCA 1KTCA 5ABFA 4U3AA 5GNYA 1CPUA 1ZL1A 1D2KA 2WSPA 2OSYA 1QVBA 4UFLA 3CBWA 3NCOA 1MWOA 4GXPA 2E9BA 3VD7A 2F7OA 1JXJA 1V02E 2QF8A 1VF8A 2D22A 4MDPA 1UR0A 4FLRA 2WPGA 1W3KA 4B3LA 1E6QM 2UWFA 4TVCA 1C8QA 1TQTA 4MTVA 2BHZA 1CXHA 3ECQA 3WNNA 1IT0A 4CGTA 4MB4A 6TAAA 3CIVA 4YHEA 4P8UA 1ISVA 4JFWA 1KTBA 2VMFA 2YBUA 4GZJA 1M7XA 1ISXA 2VOTA 3HG2A 3VPLA 4TUFA 4D1JA 3LPOA 1UYQA 5ECUA 5FL1A 3GXPA 3D4ZA 3KLLA 4FNTA 1E1FA 3DX3A 1WZLA 3IGUA 1VRXA 1GOIA 2ZUWA 3LRLA 2PI6A 3BLKA 2F7PA 3T2OA 4RE3A 3A6OA 2YOCA 1X1NA 1TQVA 2WK2A 3EMCA 2CIPA 5LA1A 5GPRA 3AMKA 2EPNA 4WSJA 4YPJA 2J7BA 1OT2A 2DT2A 1ZBWA 1DWFM 4HU8A 4Z2IA 1QX1A 2GFTA 3BLPX 1E71M 4UQ9A 3VMPA 3O2LA 4PUEA 3U7VA 3SUTA 3CZNA 2W63A 1QW9A 1WZMA 3AMLA 3WQVA 1WZAA 4PMYA 1C91A 1PX8A 1R7OA 1GOOA 1V02A 3TTQA 2ZOXA 2XPKA 3CUGA 1ZBKA 4D6HA 5A95A 3SCUA 1U2YA 1G94A 2WHLA 3LXCA 3KE0A 4TTUA 4UFIA 4JCLA 1A47A 4JFUA 5I5RA 1KWKA 4IPNB 3AROA 2EBNA 4CU7A 4H41A 4MDOA 1BVZA 3BSGA 3MUY1 1UWIA 4NRRA 3NSXA 3ZO9A 3AQUA 4K68A 4W5UA 1JDDA 2FHBA 2YDRA 2YFOA 4J3TA 5DO8A 4LYRA 4V27A 4FNSA 3OGVA 1UA7A 3POHA 4W89A 2WHKA 4CCEA 1UZ1A 2F18A 4AD0A 3LRKA 4UOQA 2YDQA 3NSNA 3VVGA 1M03A 3VGFA 2WMIA 3EDJA 1TA3A 4JL1A 3W25A 1E9LA 4F79A 2WMGA 1VJSA 1BG4A 2IXVA 1BFNA 4MPKA 2GK1A 2O9PA 4CN4A 1C8YA 3L4TA 1G01A 4B3KA 4CCCA 3ARZA 3WNPA 4X0VA 1QOXA 4UZUA 3CHCA 4U3CA 1GQJA 3N1AA 1HKMA 3S5ZA 2VZSA 3AYRA 3MV11 1E56A 3AMGA 1GCYA 2BVTA 3OZOA 1CGUA 4HP5A 4WIWA 1MQRA 3SCNA 3BAJA 2XVPA 3DHPA 3AFBA 1CGXA 2XYLA 4PMDA 5A69A 2Y2WA 1LL4A 1R87A 4JFVA 3FN9A 5M03A 4AZHA 1BLIA 3OLEA 5E1QA 3ZSSA 2QPUA 4UFHA 3K4DA 5A6MA 3T0BA 2RGLA 5A2CA 2VCBA 1C7SA 1EH9A 1IZJA 3T0DA 4PCTA 3BAIA 3WUFA 4M82A 1UD5A 4ZE4A 1UASA 3G6LA 1BHGA 1CZ1A 2X1IA 1JZ4A 2OSXA 1OWQA 4AMWA 3EDEA 4DO4A 3O9NA 2WB5A 3VMOA 3D3AA 3OLDA 4GI6A 1V03A 1KGWA 3EYPA 1J0IA 1K6AA 1H49A 3VGBA 3WQ6A 2CBJA 2XVNA 4UFKA 1RD6A 1EA9C 3ALFA 2VVSA 4DWSB 2W67A 3UR8A 1SR0A 3SCWA 3GDBA 4X0NA 1JZ6A 3B9AA 3ZJ6A 1Q6GA 1UKQA 3W38A 3G6MA 5BXSA 4U5IA 1AQHA 2Y24A 5M3WA 1J18A 1KXHA 4QP0A 2MANA 3K4AA 4HMCA 4BF7A 1V0KA 4B15A 1H41A 1E0VA 3PZMA 3VX0A 1UD3A 2DT0A 4JKLA 3VGGA 2WHJA 3W24A 1UWRA 3BMVA 1C90A 2A3EA 4NRSA 2XGIA 3WUEA 3OBAA 3NYDA 4J3UA 3WEZA 1C3FA 3MMWA 3HZ3A 4NZFA 3OA5A 3RO8A 1O6IA 4H8HA 3UERA 3WD2A 1W3JA 1W9UA 3ARYA 1SMAA 3GH4A 4IPLA 4D6EA 1B9ZA 4WSKA 4GZEA 4D6GA 4QLLA 1ZJAA 1HP5A 3OB8A 4HMEA 2BNJA 1CYGA 2WVVA 2O9TA 1XCXA 2J47A 1B30A 1UR4A 2PWEA 5ABEA 1OCQA 2JALA 2WXDM 3MMUA 7TAAA 3SCOA 1ZJBA 2EPKX 4OBRA 4NX0A 2BY2A 4JHZA 1J0ZA 3VU2A 4P7NA 4QCEA 1U30A 1H1NA 1J01A 1QHOA 2WWDA 5I79A 4AEFA 3DX2A 3EDFA 3AIUA 5A94A 3HG4A 3ARSA 2JFEX 4TXEA 4LXFA 3WFZA 2WNWA 4HZ8A 2OSWA 4AD4A 1DTUA 4ZXOA 3CMJA 1FH8A 1VAHA 3BVUA 4W88A 5IDIA 2WW5A 4JIEA 4NSBA 1LLOA 1XH0A 3VIPA 3N12A 3W6MA 2Z1SA 3WFLA 4U5KA 2CYGA 2V38A 2QPSA 3VIJA 3VTRA 1OBAA 4UFJA 3WH7A 3GXMA 2VX5A 3KL0A 2UY2A 4WJXA 1C8XA 3PZUA 4HA1A 2JIWA 2DIEA 1AQ0A 7A3HA 3VKKA 8A3HA 1FA2A 2E3ZA 1HJWA 1GQIA 2WLYA 2WMHA 1GJWA 3W28A 1F4HA 2WVSA 1B3YA 5A8PA 2E4TA 1UH3A 3WDHA 1J0KA 8CGTA 2ZUNA 1JZ7A 2J8FA 4Y7EA 3ARXA 1JNEA 4W7UA 4PMOA 2IGTA 5BXPA 2Y8KA 3PN8A 1UH4A 1R75A 1LWHA 3A5VA 4EK7A 1WZKA 1UQZA 3AHYA 3AZTA 3MSGA 4HZ6A 5ABGA 5E6ZA 3CMGA 4TTGA 3AMDA 5HNNA 3SIMA 1CXKA 1JAEA 4TOQA 4UZSA 4CUCA 1QPKA 1NARA 1V6YA 4W8LA 3UETA 3AIEA 1ZBCA 1EIBA 2EAEA 1O7DC 4R27A 1US2A 1IV8A 3VIHA 1PAMA 5I77A 1GJUA 1HL8A 3NDZA 4D6DA 4AZBA 3AIWA 4OZOA 1HNYA 5BRQA 1HL9A 4HOZA 3QHOA 3WBAA 1ZS2A 5A8NA 2J7FA 3AS1A 3U7BA 4D6CA 1UWTA 3WNKA 4YHGA 4J3XA 4NF7A 2BY1A 3KEHA 4ATWA 5CPTA 1XYFA 2DH2A 3VD3A 3W27A 4NZCA 2ALWA 2XHYA 3ZR6A 5IHRA 3L4UA 2J75A 2Y8VA 1GOMA 2ZWZA 3RIKA 1KQZA 1E5JA 1KXQA 4AZCB 1UKPA 2FYVA 1VB9A 1SMDA 3K8MA 4PMRA 3WF1A 1X6NA 2EEXA 1JNDA 1UD4A 1HXJA 5F7UA 1MW1A 2CPUA 4PSRA 3NUKA 3LXBA 2VCCA 3FXYA 1E6XM 1LL6A 4QAWA 3MMDA 3CHFA 1GW1A 1FH7A 4V28A 4EKJA 1JYNA 3IJ9A 2ZX7A 4AZ7A 3ZJ7A 5A8QA 4PSPA 1W1PA 1XSKA 3OG2A 1GPFA 3VNYA 4V2XA 2BY3A 1WPCA 3SEPA 1EO7A 1CGTA 4RL3A 1CTNA 5BXTA 1E40A 1NM9A 1WDSA 3WEMA 3WQWA 2XFRA 1JDCA 4H8VA 3BVWA 3ARWA 4MNMA 3RM9A 1G5AA 1OINA 1WKYA 5E70A 3HMCA 5A6KA 2XJ7A 1H0IA 2OW6A 4DO5A 2ZXBA 5HPOA 3FHAA 3CUJA 3D5HA 1E72M 4AZIA 2J7CA 2GK1B 4R5EA 4F66A 5I78A 3CZLA 2YA1A 3LPFA 1DWAM 5CGTA 1WDQA 1WNOA 1GOWA 3PZGA 3ZT7A 1E4MM 3S6TA 3K1DA 4WKAA 4GO8A 1JF6A 1BSIA 3GNPA 2E0PA 3VD5A 4M24A 5A8MA 4KRTA 1MFUA 1EGZA 4AISA 2VZUA 1BYDA 4XUYA 3AHZA 1HJQA 2NT1A 1HVXA 1R85A 3TA9A 1CXIA 1BQCA 3PZ9A 4W8BA 4W86A 1CXEA 1VFOA 3OGSA 4OGZA 3AI0A 4W84A 3BC9A 2W66A 5A8OA 2VQUA 1VFMA 2YA2A 2D3LA 3RM8A 1E0WA 2GJXA 4CVWA 4OOZA 2JEPA 3BAWA 2JIEA 2OYMA 1V3KA 1LF1A 3GH5A 2VRJA 3EMQA 1XSJA 3BXWA 1PS3A 2WYSA 2X2HA 1W1YA 4A3YA 2IXUA 4EE9A 3AIRA 3BUIA 3WQ4A 2XVKA 4D6FA 2NT0A 5A6BA 3UG4A 1V3HA 2WC3A 1OIMA 1E43A 2WVUA 3OLGA 5E6YA 3A22A 3AIVA 1R34A 5JIPA 3ZT6A 3VDBA 4S3JA 3A47A 4BCEA 1MW3A 3LRMA 1B2YA 5A2BA 4CD4A 4AIOA 5HDRA 2F7RA 3GBEA 3CUIA 5CZKA 1R46A 1AQMA 1B3ZA 1KXTA 1E15A 4F9JA 3IJ7A 4NXSA 1TCMA 4UCFA 1UA3A 3AHXA 2V3FA 2B31A 2VRQA 1W1VA 2EADA 2A3AA 3UEQA 1JZ2A 3PHAA 1HKKA 2DIJA 3WD3A 4C7FA 4MJ2A 1K9TA 2DSKA 3WELA 3WY2A 2VCAA 4CU6A 5AYBA 3SUSA 5HPCA 5KEZA 4MAVA 5CGMA 1QI5A 4M29A 2QMJA 1WDRA 2G41A 2RGMA 4MNJA 3WN6A 3BUDA 3VILA 1KBKA 3VIMA 2XN1A 2CETA 4B16A 3SCVA 1JI1A 3DYMA 4LYQA 4HOWA 2CBUA 1LQ0A 1ITXA 4IM4A 2CBIA 3WDPP 1WO2A 4GPNA 4JKKA 2YLLA 5BXRA 2ESCA 3A4XA 3L2LA 3VIGA 1QBAA 3WY1A 3IK2A 3BCFA 2ZUMA 3E1F1 2CHNA 4RE2A 1N82A 3VIFA 1CGWA 1EO5A 1QI3A 2W91A 2J74A 4JCMA 3BGAA 2X09A 3DECA 3WUGA 4U33A 1HF6A 3ZT5A 1TVPA 4M80A 4AYGA 3RJYA 4AZCA 1CXFA 2WM0A 2EABA 1O7AA 4OKDA 5DEZA 3CO4A 4HPHA 3CGTA 5FL0A 2F1BA 3DDGA 4LGXA 1K9DA 4JKMA 5JBDA 1Z32X 5EB8A 3RJXA 3OIHA 3F5JA 4DM2A 3VX1A 2W62A 3EJQA 3ARVA 2XTKA 1E0XA 4D1IA 1DWGM 1E4NA 2W5FA 1V6VA 4U31A 2XIBA 4CN1A 1B31A 4H04A 2G3NA 4AD3A 1B3VA 1UD6A 1SFSA 3OGRA 4BQ3A 1V6UA 1JZ3A 3KL3A 1UZ4A 1BYBA 4AEEA 1UR8A 2FGZA 1V0LA 1W1TA 3EMZA 4QLJA 4H7VA 1OSEA 4J3VA 2FH6A 5TD4A 1XHGA 4AZ5A 5C8BB 3H53A 4B9ZA 3CH9A 2XWEA 3WF3A 5AC5A 7CGTA 4W87A 2XG9A 4UNIA 1CDGA 2AMGA 4MB1A 2F2HA 3BAYA 1H2JA 2YL8A 3N13A 5I6SA 3VMNA 2ZIDA 2ZX9A 4GI8A 3AYSA 1MW0A 3CPUA 3AIQA 1FHLA 2BXZA 1JI2A 2BVYA 5E09A 3MSDA 3BVVA 3TTYA 2ZUVA 2XSBA 1KQYA 1TZ7A 5FKYA 5A6JA 1JD7A 4DM1A 1V3LA 5CJ5A 1XCWA 1TE1A 1HJXA 1NOFA 2EACA 3THDA 4NI3A 1FHDA 1HN1A 3W81A 2AOSA 2X8RA 4FNPA 4PTMA 1XC6A 4RE4A 4LPCA 1WCGA 3LXAA 1D7FA 4AW7A 3GM8A 3SCRA 3WNMA 5EBAA 1HX0A 3ARPA 2G8ZA 1NWUA 1LJYA 1YQ2A 1OD8A 3VGHA 4P7OA 3NDYA 1RP9A 1VBRA 1NH6A 4Z2LA 2YFNA 1UR9A 1PJ9A 3EDKA 2A3HA 4F8XA 3WQ5A 5CLTA 3N11A 3ZMRA 3PTQA 2X0HA 1NP2A 3W0KA 1GVYA 5A6AA 5IFTA 2FHFA 4TX6A 3M7SA 3T2QA 3AS3A 2ZX6A 1ZU8A 2WCAA 5CQ1A 3SUVA 3UESA 2HISA 4NZJA 1G9HA 3I3DA 4D71A 1E73M 3J7HA 1I1WA 1VFFA 4DWSA 5A6SA 4ZFMA 3EJUA 5A6BD 1KCLA 1B3WA 2J77A 3AHTA 3T0AA 3CZSA 1QW8A 4W85A 3L4ZA 3LMYA 1I75A 2X2YA 4QLKA 4AC1X 1DP0A 2JE8A 4M1RA 3KL5A 2ZUUA 2DGAA 4KGJA 1TQSA 1M53A 3VIOA 5C70A 4JHOA 1ECEA 4AZ6A 1OGGA 5JUVA 4PMQA 5BRPA 1VJZA 4AYSA 2EXOA 1QI2A 3O6AA 3W29A 3VINA 1H0GA 2UY5A 2D0HA 2J4GA 3OLIA 3W6LA 1CIUA 4UFMA 4FLOA 3SURA 4LX4A 2WMFA 3BH4A 2E8ZA 1HKJA 4OBSA 4PTVA 1HWWA 3FY1A 2D23A 3M6DA 1J9YA 1JYXA 3BAKA 1XGZA 5CLWA 1CWYA 2VZTA 4MJ4A 1UR2A 2ZXDA 4BA0A 3VM5A 2JF7A 3A4AA 4DWSD 5M5DA 4UTFA 3A23A 1EDQA 2G3JA 1ISYA 4LYPA 1KFWA 3WH8A 2VR4A 3NIYA 1NWSA 3H54A 4BZYA 2GDUA 5BCAA 3WD0A 2GJRA 3M07A 5FIPA 4URIA 4AD1A 4XB3A 3HG3A 1US3A 5FCZA 5GNZA 2HVMA 2ZICA 2BHUA 5GNXA 4AIUA 1E70M 2CESA 2E40A 4FLQA 2OWWA 4Q7NA 1BF2A 4QFUA 3UCQA 4N0RA 1R86A 2WWCA 1EDGA 1H3GA 3GBDA 4LQ1A 2X05A 3QGVA 2X2IA 1JG9A 1SZNA 3S2CA 1Q6DA 4OOUA 1V3IA 4J27A 1QNSA 3CZ8A 1HXKA 4FF5A 1V0NA 1BPLB 2ZXQA 4ATLA 5I24A 2EPOA 1OIFA 1UUQA 1E3ZA 1UWQA 4YN5A 5AY7A 1Q6CA 1NQ6A 3VNZA 4OJYA 1KCKA 1EHNA 2BHYA 4H2CA 1Q6EA 3BUQA 3ARQA 4M8UA 1DEDA 3QOMA 3SCPA 3RILA 3AZRA 2YLAA 4P8VA 5I23A 4OIFA 2BV9A 3WH9A 4UQCA 4X9YA 1F4AA 1GHRA 1ODUA 1D3CA 3WMCA 3AMCA 3KZSA 2OWCA 2GJPA 3GXDA 4TVUA 1PEZA 2D0GA 1H5VA 1HJUA 2ZE0A 1JFXA 1PPIA 3VDAA 5JBFA 1W32A 3FAXA 1B90A 3WF2A 5DT7A 2EPLX 2DPEA 1SYTA 3MS8A 2WMIB 3BAXA 2XUCA 2YJQA 2DH3A 3MI6A 3VUPA 4P7LA 3VDHA 2XWDA 3K8KA 5AC4A 1LG1A 2VTFA 2VNCA 2X0YA 3VGDA 5CPQA 1R47A 4DUXA 3GTNA 3CUHA 1FP8A 3I3EA 1CENA 1UD8A 1B3XA 4D72A 2D3NA 1CBGA 3T08A 4BQ4A 1ESWA 2F61A 2Y4SA 4CVUA 1KXVA 3T09A 2IUZA 1OT1A 1NOUA 5ABFB 1H11A 2GSJA 1YHTA 1W9DM 1ODZA 1FOBA 3HN3A 5D9OA 4KRUA 4L4PA 5E0FA 3TP4A 4PEEA 1MQPA 1J0YA 2UY3A 2GVYA 1ITCA 1A3HA 1UKSA 3L4YA 3D52A 1FH9A 2AAAA 2J7DA 3WBEA 1JZ8A 5DT5A 3I3BA 2VRKA 1C7TA 1MW2A 1C92A 1QHZA 5AYIA 1JAKA 2J25A 5CXPA 4JZ5A 4L4OA 3FHQA 1B1YA 4GI9A 1VEOA 4GKLA 4ML4A 1S46A 2DSUA 5CG0A 1BYCA 2GUYA 5A1AA 1KBBA 4AD2A 3AXIA 3RDKA 2E8YA 2EQDA 2VZOA 4F9DA 3WY3A 1GQKA 3NJ3A 3N04A 4N42A 1LG2A 1UG6A 3ZIZA 1H09A 1P6WA 3PTKA 3IANA 5I0DA 1TQUA 3ZQ9A 2WVTA 1JDAA 1RP8A 2XFFA 5A3HA 3L2MA 5EFDA 5D8ZA 2J62A 1JZ5A 1HJSA 1OB0A 4E2OA 3T2PA 5FOOA 3WSUA 2JF6A 3K46A 3QR3A 4S3KA 4UQDA 3SCSA 2E9MA 2ZUTA 1XH2A 3B8SA 4WKHA 3L4XA 4Q22A 1VEMA 3MKKA 3QOKA 1Q6FA 3L4WA 2CBVA 5FD0A 1V3MA 3ZJKA 4WK9A 1EDTA 2CEQA 3WF4A 1CECA 3H55A 1PZ2A 2YKKA 2VI0A 3BUBA 4GQQA 4HTYA 1NP0A 4P7QA 1QI0A 3THCA 1LL7A 2YDSA 4WLCA 3BVTA 1WB0A 5C71A 1V0MA 4AZGA 2WBKA 3RMEA 1BAGA 1UWSA 4QCFA 1DWIM 3BSHA 3RPMA 1DWHM 2E9LA 5GQBA 4W7VA 3DC0A 3MU7A 2CKSA 4DO6A 2WMKA 4PTWA 1E6RA 3ARUA 3PZNA 3U5UA 3DX1A 4EAMA 3A24A 1TG7A 3SUWA 4U2ZA 1PZ3A 3N15A 5M17A 4JFTA 1GOQA 3WF0A 2VURA 2PB1A 3FW6A 1R7AA 2WKLA 4UR9A 4NXKA 3WL0A 3BUPA 4ATDA 3TONA 1FFRA 3PZIA 6CGTA 2C0HA 2YL6A 4IISA 4J7RA 3WIJA 1FP9A 4ACYA 3W4RA 3A21A 2ZUSA 3GYCA 5E9AA 1IZKA 3A3HA 4HZ7A 2UY4A 3U57A 3BLBA 4AXNA 3FAWA 2G3MA 1OD0A 1UKTA 2O9OA 2XM2A 4Z2JA 1E4IA 4MNKA 4BQ5A 5LA0A 1J11A 2CHOA 1QBBA 3NSMA 2XVLA 4ACZB 2ZWYA 4DUVA 1TA3B 2VVNA 5HBFA 3TV8A 1JFHA 2XVGA 1WP6A 1GUVA 2D73A 1XSIA 2A3CA 5D9NA 2BY0A 4UOZA 4JFSA 1VIWA 1PIGA 2FH8A 3AIBA 1VEPA 3WL1A 3AXXA 2XN2A 2PC8A 4FMVA 1KR0A 1XD0A 2J79A 3MO4A 4Z2KA 2WMJA 1Y7VA 2VC9A 4XZBA 3TTOA 2J8GA 2WZHA 3IAPA 2YA0A 3UG3A 3UG5A 4J3WA 2WC4A 2WLZA 1HT6A 4UOJA 2VX4A 2EJ1A 2TAAA 3DYPA 2WBGA 3GXFA 4PRWA 1UOKA 4E4PA 4UQEA 4CKQA 3BCDA 1U33A 1G0CA 1XYZA 5A2AA 1NOWA 3EJSA 3EJTA 1C93A 2VUYA 2Y5EA 4FNUA 1W3LA 5CSYA 1QNRA 3TOPA 4M56A 3UR7A 3EDDA 4GZIA 3CUFA 1V08A 4TX8A 5IXEA 3VIKA 4Z2GA 1AVAA 4W93A 1EQPA 2WHMA 1MFVA 1V6WA 4GINA 1QNPA 3CHDA 2J78A 3S5YA 4EANA 4J28A 2EO7A 5DF0A 4WKFA 1XRVA 4P8WA 3ARTA 2FE0A 2PBOA 3OZPA 3KLKA 1TR1A 4DUWA 1GZJA 4PN2A 3K8LA 1E6ZA 5E0CA 1I1XA 2CKRA 4GQRA 3PZOA 5JIWA 3VIIA 4AMCA 1DHKA 2XSAA 4H8UA 2WC7A 3WEOA 2DSWA 1V3JA 4HA4A 3AJ7A 2XM1A 4CN6A 4TVDA 1MXDA 4J3SA 4D6IA 3WDIA 4CD6A 1WAWA 4C7DA 2DT3A 3W82A 1RPKA 3IAQA 4AMXA 2YL5A 3PBGA 5BROA 1BGAA 1QNQA 2DEPA 2O9RA 4KMQA 3WQ8A 1KGXA 4XV0A 3MANA 2XIIA 1H4PA 4KH2A 1EHAA 4XX6A 1ISWA 1CNVA 1EOMA 4U2YA 1PX4A 1E6PA 3MUIA 3JUGA 5D8WA 1JD9A 2VX7A 3GNRA 3POCA 1XV8A 1HTYA 3WMBA 3F5KA 4PYSA 1G1YA 3L4VA 1WE5A 3WY4A 1MYRA 1R33A 3WDQA 3W53A 1PIFA 1UWUA 2DSZA 4Z2HA 1E6SM 3W26A 2ZXAA 4OUEA 1J12A 2F7QA 1VBUA 1UQYA 4CD8A 5ABHA 4ZENA 3WH6A 2GJXB 4ZEPA 1J0HA 3WKZA 6A3HA 3PZVA 4PMZA 2J7HA 1GNXA 3IJ8A 3AICA 1VFUA 2V3GA 3ARRA 2X2JA 5D9PA 2WZIA 3QHMA 2Z1KA 1CGYA 3LPPA 3CLWA 2V5DA 4W8AA 1ZB5A 5A6LA 2CNCA 2QHAA 3GXIA 2EPMX 1E6NA 1TMQA 5DFAA 1KWGA 3QHNA 3BMWA 5D9MA 4GO9A 3FNDA 3VD9A 2D2OA 3ZR5A 1XH1A 3II1A 5LYRA 4E8DA 3PZTA 3HJEA 2FHCA 3N9KA 4UQBA 4FK9A 3VSVA 3WDJA 2J7GA 3EJRA 1K9EA 3U5YA 1MQQA 5BYWA 1FFQA 4PMNA 4HA3A 2WSKA 1GVIA 4MAZA 1V6XA 1BYAA 2DSVA 3B9DA 3B9EA 5EFFA 4FLSA 1OGSA 1E5NA 1T0OA 3DX0A 2D1ZA 3CTTA 2BVDA 3CZJA 4HMDA 5HXMA 1GHSA 1QNOA 4HOXA 2C7FA 2XFYA 2BXYA 3LPGA 4CU8A 2PWGA 3AHVA 2XN0A 1B0IA 4PMUA 1UD2A 2G3IA 2WANA 2DT1A 4PTXA 3WNLA 3MUAA 3WUBA 4FNQA 3AZSA 2CCRA 2BS9A 1KR1A 2J7EA 4W7WA 3ZOAA 1HP4A 3N18A 2NSXA 3WDRA 2YBTA 3BVXA 2CERA 2FDMA 1OM0A 1WDPA 1ISZA 3CHEA 3VSUA 5BWFA 3PZQA 2D24A 3GZAA 2DDXA 1MXGA 1PBGA 3CV5A
chains in the Genus database with same CATH superfamily
1I1AC 4HSAC 4XBGA 3NFNA 2P44B 5F3BA 1RCYA 1DUZA 1HFUA 2ATKA 3ABMB 2IF7A 2J8TA 4IUGA 5HQLA 3BWWA 3U8GA 2QL1A 4P2RD 1T20A 3HQOA 3R4DA 4KCVA 1QWUA 2ZUQB 2TPSA 4GIOA 4Y5YA 4C7GA 4JRXA 2OYKA 4FO4A 2BS8A 2VDKB 1KYOJ 3G2GA 2IDFA 2P8LB 1OE3A 4QCIB 2W0PA 1AQ8A 1F3TA 1CLYH 2NVAA 1G9MH 3W37A 3D85B 1DBJH 1UACH 3TN3A 3HI5L 5LNSA 3V4PL 4PWKA 2UWEF 1AGCA 3WHE1 3GTVA 4Z7VA 1W9VA 2BX7A 2R9RA 2R9HD 2XGBA 5AKQA 3S5LG 3U6WA 1NAMH 5E2VH 3TBSB 5TQ2L 3UJJL 4C59B 3ME0B 5IJKA 3NCYS 2ZRZA 2JIXA 4P57A 4PRRA 5HMDA 3O4LA 3UXIA 4E9LA 5IQMA 4ZX3A 4DF9A 4Z78A 1H8OA 1AHWC 3OAWA 3VH8A 4YDIL 4FNRA 5FF0A 5JPNB 3ECBA 2PBGA 4WHTB 1LTDA 2I26N 3A9BA 2XG4B 5IB4B 3U2JA 4QRPE 2H8ZA 1AQFA 5IBUG 2P3YA 1E4XH 3MV01 3U7AA 5ECGA 4G8GD 3MLSL 3TJIA 1IC7L 1PY0A 1G4MA 3GS6A 1F3RB 1UH2A 3N85H 4Y2LA 1Q66A 4G6JH 9CGTA 3NVQA 1MRQA 5AVYB 5F3HB 4PWHA 2ZX8A 3M0IA 1XQ4A 3BPCB 4LSSL 5ITBH 1CBVL 3TF4A 2VR9A 1FL3B 5GJSL 1B4EA 1PX3A 4NHUA 4U05A 1KFCA 2YD6A 4MXVF 4QTHB 2V5JA 4KEMA 2R1PA 1G87A 2WXOA 3AFLA 4HUVB 1AL7A 1M68A 2B81A 3MSRA 4F91B 1I85A 4I2XA 3VGEA 3H2EA 2VJXA 1OX5A 4NASA 4ZS6D 1OC6A 1K4CB 5DA0B 1YAZA 3MJ8A 4R90H 3IDIA 5AQ0A 1UR1A 1ETB1 5EN3A 1SPDA 4X2UA 5TK2A 5B39A 1F4YH 3APGA 2FGLA 3HBLA 3EOAB 1LWJA 3I85A 5KBNC 1H6FA 1IR2A 5DK3A 4GK8A 4JDEB 1Q0YL 3C6LA 2A3BA 3CBKB 3L9RB 4HCFA 5AYQA 3O11B 5D4HA 3EJPA 3DGGB 3TN0A 4IMGA 4PS7A 5FF6B 3UFIA 2FQIA 4A35A 1U8JB 4M7LH 4UM8B 3O6FB 5TQ0L 3ECWA 2WWNA 2DQDH 2JNZA 4DK3A 1KY6A 2VKWA 4Y2NA 3GJEB 1QI4A 5E7FA 4ZFGH 3S96B 1NGPL 3IETB 3MUZ1 5JIMA 2ZZ1A 3BFWA 4P5TA 5J11B 3WNOA 1LEGB 1MHEA 1MFBL 4APXB 1TFVA 1X5FA 1ZP3A 3P5YA 4YZFE 3R8RA 3QFDB 1M04A 2P10A 4HN8A 3JUZA 4IT1A 5FJOA 4JEJA 4A4AA 1JGVH 1R24B 4LP4A 3P93A 2OJPA 5C9RA 1HL5A 1JPKA 1NFBA 5JQHC 4YHIA 1AW5A 1VH7A 3UR2A 4WDXA 2YL9A 3B7UX 1ZMYA 2ADYA 1Q8JA 1FZKB 2ERJB 3WCZA 4PHZA 4HTBA 4KI1A 2J6VA 3DMMC 3C8HA 4K23L 1FX6A 3BSZH 4JIPA 4FFZA 4MQ7B 3LHZA 1X6LA 2Z31D 4DNMA 1IQDA 3ARED 3F7KA 2I5YH 4Y5VA 1T03L 1TX2A 2HQAA 2NV2A 4FZ8L 2V9RA 3C6LD 1AO7A 5C3IA 4RISL 1KNWA 1TZAA 3MBFA 1M71A 4M3JA 3MYJB 3CV6A 4TMBA 5T1LB 2XPGB 5I2UA 1BGGA 1OZQA 2PGFA 2Z4TA 3SN0A 1W9XA 4N20A 1JYVA 3SUUA 1Z66A 5L4MA 5XIMA 4CQ8A 1EXPA 1FWIC 3AG3B 1IXOA 4HETA 2X0SA 3RYSA 1KLFA 2CHZA 4DEPC 4Q33A 3NIDE 2WQXA 4P9HL 2XFGB 2ACRA 3DX6A 1EQCA 1VENA 2RR3A 4CD7A 2CHDA 3T4AA 4HNUA 4MB5A 5AC7A 1NGQH 1SDDA 3GPSA 3B8UA 4MBRA 1CQYA 2R8SH 3W86A 3ME3A 3VSTA 4L5FH 4M61A 3CZEA 5K1NA 1MPAH 3PWLB 4P7RA 1HVQA 1LE9B 3N4EA 2PTYA 3RPDA 2NNCA 2Z64C 2C1OB 1I8MB 4TU1A 1YDNA 1KLGA 2AK1H 1JGDA 4QHPA 3RVWC 2EGZA 4JR5A 3WE6A 4N6FA 1UWXH 2Q5BA 2R82A 1JZJA 1NDYA 1F6YA 3GUTA 4GKOA 4P8XA 3WLHA 3VAEA 2WCGA 1FUNA 5K4ZA 2ITDB 1AD0B 2OJ1A 5F8QC 3SRDA 1N4XH 4AF0B 4KWUA 2XQ0A 3KBHE 1URIA 3KCWA 3MKGA 3MOBL 2ZXGA 1BEXA 4MD0B 5CGYD 1EV2E 1IT7A 3L7RA 4LB4A 1VBGA 4YE0A 5ERWA 3LKOA 3G6JF 3DHDA 2ZOUA 4DO7A 1D7KA 4JTGA 3QXTA 1GK8A 1PWMA 1XIWB 4K9EL 3ZL4H 4GFIA 4ACZA 1B54A 2ZF9A 2KL6A 4IDLA 2WXKA 2Y6TE 3NIFE 2DKUA 4W5ZA 3TMQA 4P4RA 5JHLL 2CRMA 1X3DA 3MCLH 1GOKA 4UBPC 2W61A 2NUYA 3B34A 1NCAL 3AXHA 2PWFA 2JEQA 5GHWH 4F3HA 1XI3A 1BM3H 4DBEA 1HQ4B 2GVEA 5IFJA 5AW9B 1O75A 3NL3A 4O8RA 1XPGA 1TRDA 1QWNA 3MRBB 1XMEB 3WFDL 2OXNA 4QWWD 1ZHKA 3NPXA 3S9IA 2QS8A 1NCCH 4G43A 2EKJA 3UPAA 2ZXWB 4NO0D 3DETD 3QVQA 3GRWA 2YD8A 4XAKE 3QEGL 5EMYA 4LC6A 3RJOA 3WKPA 1GVSA 2J9ZA 3I02A 3QEUA 4MJIB 3AISA 4AU0A 3G6DH 1EVTC 4ENLA 4EZLA 1QFHA 4N6RB 1F07A 1YG9A 2Y5JA 3PV6A 3RU8H 2X70A 4ZRGA 1O66A 1E67A 3PP3H 3QORB 3FPYA 4ZFQA 3QISA 1FGVL 3U9UA 2Z8RA 2WBXA 2ZOLB 4MQXC 3CMOH 1N6QL 5EIIA 1O6TA 2V0AA 1KFAL 3CZGA 5I8EB 3RUGF 1JV5B 3KWXA 3MN8A 3AOFA 3P77B 2X53A 2W92A 4PJHA 4OZFA 1W2PA 5DYOA 1FTXA 2UZYA 3RAJL 3WD4A 5BVPL 1A1MA 2IJ0C 1L9RA 4IJ3C 5I9QB 3T44A 4XC1H 2XPYA 2G50A 2X1RA 5ECVA 1CPUA 1D2KA 5TF0A 4HKPA 1M57B 4FQJL 5CN2A 12E8H 1BBJA 3NCOA 4AUYA 2IPUG 4OLZL 2UYLA 5GS0L 2QTVA 3A67H 3B7RL 1PG7L 1DN2A 4FFTA 4TOYH 3KXQA 1EZSA 2ZQKA 2E9BA 4PTTA 2XINA 3L67A 3BSZA 4MNQE 3NJLA 5DQPA 1DTNA 2E47A 3BJ91 4TLTA 3GO1L 5DJAB 2WO3B 1NFPA 4HIBA 3SPVB 4GO6B 3HZYA 5DYFA 4BFNA 3KVMA 3MNMA 4MDPA 4JJOA 1QEWA 3R58A 4I5RA 4S3BA 4XPBL 4PJAE 1UR0A 3VCNA 1QTPA 3IGFA 3KYKH 4KVCH 4UNUA 3KLAB 1WVZA 3W11D 1PZAA 1NLBL 1LDSA 2ISFA 4B3LA 1A1NA 5DRWA 4PRIE 1DANU 4PV8B 3TO4B 2CZEA 1A7NH 1YNKH 1P1VA 4AJ0A 2BHZA 2YMOA 5EC1B 4YGVB 1BLNA 1LL1A 1U8NB 4HIJB 3WNNA 4EQ2A 3EYVA 5DD5L 3NJGA 1KT2B 3KM1A 2NY5C 5DJDA 1ISVA 1VDGA 3NJHA 3G3DA 2VMFA 1CGSL 4CDHA 5CSGA 3V4UH 1F02I 5DRZB 1M7XA 3QE5A 1IWPA 1A6TB 4GRWE 3IFPB 1LLZA 5DJ8A 1G7LB 1S7SB 4HT1L 2EDXA 3IJEB 4HWZB 4UB0H 1EJXC 4ASTA 3LPOA 3S37H 3M17B 4LC8A 5C8JA 2W9DH 2VC7A 3E8UH 4FP1A 4MASA 5EOQL 1YEDA 3QQXA 4EJ1C 3UQNA 3PWAA 1OTSD 4PTUB 4UMSA 3C61A 1EO8H 4FNTA 3KLLA 4JKPL 3U9UB 5TE7L 4HJFA 4DJFD 8TIMA 1H5BB 1KG0A 2Y5SA 1W2KT 4GBXD 5M3WA 2WOBA 1VRXA 4ZUSB 4YTRA 2ZUWA 1QSVA 3RVUC 4KC3B 2M1KA 3P0GB 4PJ5B 3G1AA 5JOPE 2O5ZL 5AC6A 2AQPA 5E8OA 3BLKA 1AHKA 1JV2A 4ZQKB 5K3VA 1XZ0B 4LVGA 3V52H 2PXYB 3LEVL 4YMPA 4B9IA 1E9OA 3QAZC 2YD4A 5KJ7E 4RE3A 2YOCA 3EXTA 5CPMA 2VISA 5D1QD 3BW4A 1TQVA 3P62A 4KK8C 3O6CA 3M8OL 2OR9H 4JFFD 3NQVA 4N90E 4Z0XA 3V4VL 3DVNB 3PXLA 1KRMA 3GG1A 2HFFB 3L21A 2HJKB 1JNLH 3TCLB 2DT2A 2QVHA 3KBFA 1NFAA 7ENLA 3TNMB 4GRLC 1MHCB 1CO1A 4K5LA 2J8UB 1OB1A 5G55A 3WKMH 5L9DH 4JTJA 3EOYG 1P7TB 4UT6H 4ZOBA 2R4RH 1JPGA 3FFCD 3GK8H 5HHOA 1S7UB 4ABWA 5IIEB 1RCQA 1U5VA 4MNQB 5DMGD 3ESPA 2BC4B 5F7MC 1R3WA 3PHSA 3L7FB 1H60A 2GW5A 5H2BA 2L7EA 1O1ZA 2R4RL 3GK8L 2BSDA 2ITDA 2FVNA 1QABA 3L5HA 4WFGE 2Q7YB 1V02A 43C9A 3QSRA 5F21B 1SFJA 1CBJA 2MFNA 3HRZC 4TUKL 3SY6A 2QJGA 3LRSA 2YS4A 3UG8A 5D7IB 1JGDB 4JMXA 3KE0A 5C0NC 4TTUA 3O8XB 4TVPL 4MZ3A 4H2AA 4HSHA 1U42A 2EICA 2PR4H 4GRWH 5IR1A 1A47A 1QD0A 1KCWA 1AJ2A 2YZ8A 1F2JA 4QT5B 3UAJD 2WJZA 4C6LA 3CFUA 4M7SA 3BO8B 4AT6A 4RBPH 4CU7A 5K9OA 5E03A 2Z2UA 4P4KB 1AH1A 1TRIA 3S2NA 1UWIA 5BW6A 2VIRB 5D7LD 2HVJB 1VCVA 4WFFE 5EOCL 3EYFA 1AGBA 2E27L 4K68A 3NIGB 4XXDA 5BS0B 4LV4A 3NQAA 2XC8A 4HJEA 4GKZA 1ZA6A 3DCPA 4FNSA 1LLAA 4P46D 2BMBA 2YC1A 4W89A 3LCWA 4YGAB 5AB2A 4KDTA 3SYOA 3BKYH 2EEBA 3M17A 5F70A 1UZ1A 2F18A 4GH3A 1OC5A 4CCEA 4E4FA 2QSVA 2CDGA 3B1TA 4F58H 4V27A 5D1ZD 4PJCA 5GIRB 2Q3RA 3VVGA 1FZOA 2H7WA 3U1SH 1FCUA 3U0PB 4Y4KB 1HK6A 5A6IA 4DH2A 1BJ1J 4PRAA 1I6NA 2OZ4L 1U95B 1NJJA 4F2UA 4K94H 5KSVA 3BJSA 3RTQA 4NM8L 3IJHA 4PJFA 5KW9H 2P80D 1P0SE 3BQUC 4N90D 1TA3A 1GWJA 3NQBA 3UC0H 3PNZA 2PPFA 4ONHB 3THUA 2HRPH 1DCLA 4A7TA 4XOAA 2WMGA 3VOIA 4XWUA 1VJSA 3QFDA 2OQJA 5C9XA 4RFOH 3OOQA 4MPKA 5FUCE 4B9PA 4LSUH 1M2VB 1QWHA 2QQQA 5IMOA 3B4NA 3NYKA 3OHXB 1NMBL 2F74A 4HC1H 3N43F 5DLML 4B3KA 4LSQL 3RWFA 1XSOA 3OJ2C 1HHJA 3ZKQD 5B4MC 1LORA 3WNPA 1KJ2L 3CC5B 3FTZA 3KBWA 3NEHA 2D8KA 4D0DB 4CBZA 3CHCA 4KEUA 4LVAA 3WQOA 3GO1H 3N1AA 1WFMA 2RB8A 2X10A 4KUCF 3QYSA 5D33A 4RKAA 4OGQC 4YWGH 1KKRA 3PL6C 3TVMA 3UA4A 1IBBA 3CLFL 2X6VA 2UYLB 1E2ZA 5CCZA 1PG7H 3CIAA 3B5HA 1F6LL 4O10A 2JKNA 2ZKHH 4YHOH 3ELFA 4L4VE 3UTOA 3ZRSA 2XX1A 4JQ3A 2POTA 4B5SA 3ELAT 2BVTA 4HK3N 4GG8A 3GMNB 3UZZA 4XP5L 3WUWB 3WTTA 1IEIA 5KJRL 4RDYA 4UM9D 5HJGA 5D8JL 3H9SB 4AG0A 4XHJC 4KRPD 1FIEA 3N5AA 4MAYD 3O8XD 1DIDA 1AHWA 1UCWA 1JQVA 3VXSB 1HUVA 3RAJH 4WTQA 2OFQA 3G6AB 1I9RH 3BP6B 4JZOA 4C6EA 3GBML 5L4IA 4M00A 3OAZH 3TO2A 5CCKL 1ALDA 3KPRE 2NQ9A 2OL3H 1I1RA 4LE8A 5TF1L 3C2FA 5FFLA 3CWOX 3RR1A 3LNHA 1ZA3A 4N9EA 1EUNA 1EWEA 3GBNH 4MSWA 1XC4A 1HW6A 2NVCA 2X3AA 1MLBB 5K4XA 2EYSA 3LKNA 5BS0D 3MRIB 1J5DA 1EF3A 2VC5A 2YPVL 3T6WA 3VTAA 3K4DA 3P4OB 4QJ3B 1KTNA 2L8AA 4G43B 1EXUB 4B27A 1EMTL 3F5WB 3G1DA 3GAYA 4HHWA 1X5HA 2F0CA 5LG1A 1KC7A 1RKRA 4N1HB 1TIMA 5A2CA 1CDUA 1N2RB 3KGUA 2JTDA 3RWJA 4OGYL 2K8QA 1TWSA 4ZSOA 3BWAB 4FJYA 4LCIL 4LAMA 2CKBL 5D6DA 3KJ4B 1LNUA 4YPGB 3IDYB 2I5QA 1R4XA 2FECI 4QHLB 4AC7C 3ZKND 1OSPL 1PQZB 1U58B 3FL7A 4F7KA 3GHSA 1PDKB 4OD1L 2VMJA 4WU5A 4JJ5A 5AHEA 2GYSA 4I7UA 3I9GL 3IN2A 1Q8MA 3QK0A 1JZ4A 4KS0A 5D96C 2LQRA 1MSPA 1BEYL 5KSUA 5LLIC 2E6QA 5IQNA 2WB5A 1GSKA 3IDGB 2BSCA 4ZTYA 1QTSA 2NYKA 3PQYB 4OGYH 4MA1B 4X7TB 5EBWA 3VFPB 1MO0A 2NTFB 3EYPA 4IMAA 1Z0NA 3MCYA 1NCDH 1HZHH 2OLDA 3W2UA 2Z2AA 3VGBA 2YCIX 2EUZA 3K80A 1F3XA 3ATFA 3GRWH 3IJSB 4AKOA 2XVNA 3FT2A 4I18C 3A4JA 4PCNA 3VX1A 2VEKA 4G6CA 1LTXA 5AYUH 2NYYC 4NQDB 3SO3B 3LQGA 2FJHA 3KTCA 2G2RB 4TRPL 1DBAL 3PFUA 4IHOB 3M64A 3V35A 1ADOA 4JNYA 3ARDC 4JG5A 4S0SD 4KUZH 5E95B 4P2OC 5CCKH 1Q6GA 5JQ6L 3OYZA 3G6MA 1J8HD 1UYWL 1A50A 1SOKA 1T8XA 4BFJA 1JWMA 4TQEH 3UYPA 4HKZA 5FO2A 3UP6A 3FJ4A 4MS6A 4QP0A 5AW8B 2MANA 3EYUH 4CEXC 3IJYA 1TVBB 2OM5A 1V0KA 4EP8C 1AOHA 4XX1G 5AVXB 3V9CA 3VI3F 5JXAL 1SLVA 2PP0A 1X4ZA 2OP4L 1IQ8A 2QPXA 4WY0B 1SXBA 1PKMA 2YRBA 2OFJA 2HH0L 3SCMC 1N70A 3QIBC 1ZK9A 3FN0H 5AW5B 2NY2C 4OM1L 2DT0A 3P4LA 3MV9A 3W24A 2YAHA 3T3PB 3QA3A 1C90A 1JK8A 4FI8A 2K9UA 4NRSA 5D03A 1A4KB 2HJFA 2DS4A 3O3DB 4QT5A 3MJWA 1MHPH 6FABH 2WYTA 2CZFA 3OPZL 1ZVSA 4HBKA 4G1KA 1YEHL 4JHBA 2VGIA 4PJ8A 3F4WA 3FU7B 4H00A 1HOCB 4CVXB 1ZWIB 3OA5A 3RO8A 4OAWA 4WSHA 5GGUB 2QQNH 4H8HA 4X9BA 1QPNA 4ZB0A 5BZAA 1OARH 3BEWA 4ZZKA 1W3JA 1XYLA 1HXYA 4NO0A 2P0OA 3GH4A 3IARA 2GC7C 5E4EC 4PRPD 1AODA 3N4FA 2IQTA 3N2TA 2HRPL 4YU1A 2AFNA 4D6EA 5FB8B 3VRLE 4K3ZA 1JTOA 5HHOB 1X8FA 1AKJB 2H26B 1CLOL 4PJHE 4C65A 1HH9B 1ZJAA 1ILUA 4LASH 4I9MA 1R3RA 2A4CA 1TJGL 5FGSA 5C0JB 1CLKA 1BJMA 1KBIA 4P5TB 2BNJA 1JPEA 4R9XA 1DJYA 3UZVA 2WVVA 4DQAA 4Q14A 2R83A 2J47A 1BZEA 2A1WL 2DV0A 4N2CA 5FAGA 4DJDA 1UR4A 1ZTXL 2IALB 3RNKA 3ZE2E 1RIVH 2TODA 2CRZA 2R1WB 3CFEB 4XAZA 1DV7A 4M7LL 4N4YB 5IMLA 1THFD 2FVKA 4D8PA 4WGXA 1MCHA 1E6OL 4I0PD 2I60H 4NX0A 2NUTB 2QVKA 4PVNA 4JHZA 1MFEH 1I7TA 3UX9B 1Z42A 3I2CH 4LS1A 4PRNB 4IWWA 3BPNB 3IMRA 3MRFB 4LCWD 4FEZA 32C2B 1U30A 5B39B 1H1NA 4OZGB 4Y88A 4IJTA 3QLLA 1YEHH 4RNRA 3GWJA 3RP1A 3W1NA 1AD9B 5GZOA 3OR7B 5DU7A 3AIUA 4U1MA 2X7LB 4RLIA 4WJ8A 4PWIA 3TYCA 4GJJA 3SD2A 3ARSA 4RGNC 4S0HA 4TXEA 2WSYA 1YJDH 3W9DB 3VXUE 1X5MA 2VQ1B 4LXFA 3DOIA 2G2NA 1KCXA 2Y62A 3G9VA 4OTKA 3HN8A 2WNWA 3PFQA 2YMXL 4FXGB 3IVKB 3FSTA 3BWZA 1TV7A 1R3KB 1D5ZA 1TTAA 2WLNA 1SHMA 1QFUH 4OFYD 3IFPA 3HLAA 3IS4A 1H8NA 3LMZA 1TQXA 3EYUL 1BZ8A 4LMQI 5I8KH 4LSPH 4D3CH 1P1MA 1AANA 4BFKA 3HMWL 3HZKA 4JUTA 3N85L 2OLAA 3KPRD 4CC0A 1LO2L 4JFHE 4ZW8A 5DFVD 5IEKA 2WW5A 5KTLA 2H1PL 5GSRA 4NSBA 3VIPA 1BSLA 4G6MH 3N9GH 4U1GB 4DPRA 1WZ1H 2YWYA 3B2PA 4LSBA 3ECBB 3UYRH 3QJTB 3CH1A 3W6MA 5IM51 4ESKA 4PRBA 1PKQE 1GKQA 4MDIB 3VD0A 4U5KA 4HF5L 1E50A 1KBVA 2EO1A 2FYYA 3KUMA 1OFRA 5HUOA 5JU6A 5I18L 3QIUA 3CG8A 3KVKA 4O15A 5SWQB 3R06B 1OBAA 2ADFL 3EO9L 1NCGA 4AY7A 2JKSA 2J6EA 4P2RB 3KL0A 4Q6KA 1BGXH 2ZRVA 1QRNA 5C2BL 2RA1A 3LNGA 4YO0A 4OCXL 4XCYA 5TK4A 2JIWA 3N43B 4ZMTA 3ULVC 3AUWB 3GDCA 3V52L 4OCNC 2Z26A 2GJLA 4L1XA 3BHBB 4H0IA 3QFJE 4GAFB 1SJHA 3WS3B 1VQTA 1OSPH 2BOBA 5H94B 4UXDA 3GF8A 2IKIA 1EFXA 3FB7A 4NU7A 4Z76A 1T4WA 2WLYA 1UWXK 3ISYA 4XBGB 5F3BB 3IGXA 3Q94A 2E56A 3OAYH 3G1VA 4S3EA 3F04A 1BD2A 2NLJA 2YGYA 4MIMA 1PHWA 5I1DB 3PUUA 1IGFH 1UXSB 5AL0A 1WFJA 1E4KC 1FXPA 5D6CB 1LQ2A 3D2UA 5TDOB 2B77A 2BWGA 2P1YA 3HV8A 1B3YA 3ZLGA 4K71C 4OZHB 9XIAA 1UH3A 4F7TA 1Z6KA 1JK9B 2YGVA 2FJFB 5CSZB 4AJVA 4YDNA 1YY8A 8CGTA 3T8XA 1JZ7A 3BEVA 1LDPH 4Y7EA 4M6PA 4C60A 1M9WA 5K39A 2G0WA 2O72A 1QO3B 4JO5A 4PYHA 5BW7C 4IXHA 1FSKC 2VLRE 5CINH 4YBQC 3ILQC 5K9DA 3QQ4B 4XB7A 5KYXB 3EKZA 4NKIH 1XR8B 3QG6A 5ETUB 1EHLL 2CJUH 3TNBA 3HZMA 3A5VA 4MMYA 4U6XB 1WZKA 4OGAD 2X7LA 3AZTA 5ABGA 2K0RA 3TXZA 1CFSA 2V2WB 3CMGA 1MIEH 4TTGA 3RX2A 3GRGA 3PQYE 2VMEA 3L5WA 2ZNWA 4NO2A 1CXKA 2I7OA 4NKQB 5B38B 1OF0A 2P52A 3CL6A 4OZIE 2WD0A 4UZSA 3KYKL 1RZ7L 4IMFA 3ZLQC 1LM8V 2P5EA 4YX2L 3UETA 3HS0C 2LLGA 2Z29A 1YADA 4NIKB 5GGRB 1EAJA 2ZF8A 2O7QA 2BIPA 2EAEA 3FH8A 3FB6A 5IJKC 5EO9B 3N29A 1IGWA 3LB6C 2C14A 2H41A 4NQEB 1RUSA 3EWDA 1YEEH 4UTCA 2XTSA 1QPQA 3GUFA 2HBVA 2AJXH 3VKJA 1KJ2H 1OXYA 3QUZA 4AF0A 2HNHA 3ZDXE 4FQJH 4Q74A 2P8CA 2O5YL 1T4KA 4QRSA 1DQQA 2PDJA 1HNYA 5FWQA 4XC1L 4XZUB 3CBRA 2GJ6D 5EUOF 4AV4A 1OSZB 1AKJA 3GZ3A 3U7BA 2YR3A 1ZKAA 1MEHA 4D6CA 1TF4A 2BOGX 1S9VB 3BW9B 5C0AD 1IGSA 4IRSA 2V2HA 1UC4A 3FT3B 3LSOB 3MTRA 2CO1A 3QNFA 4NENB 1CU4H 3L48A 1HESA 3WNKA 4Y2DC 2X9WA 5C0AE 4QRTB 3JTBA 5PCYA 1HXYB 3IWPA 1ETJA 3QZEA 1YPFA 3AWGA 4ATWA 1MWAA 4WUKH 3DVFA 5T33H 4QRRA 2DH2A 3VB9A 1TJHL 5CIPA 3VXRE 4B9CA 2I85A 3M0ZA 3W27A 2XHYA 5IHRA 2D9CA 3E7JA 5IHLB 3TV3L 4XO4A 1BOGA 1V51A 3G6DL 5AUMA 1NFGA 4KFPA 5CBAB 3F12A 1Q6RA 3IMSA 3H23A 2ZSVB 6REQB 4PJ6A 4F0HA 2B08A 1FO0H 3QW9A 5HYSG 3VUSA 2DZXA 4G3YL 3BKYL 4A2RA 3C60D 1E2WA 3MV8E 4M5ZL 3R0UA 4MCYA 4L6OA 3L2NA 3TWCL 2PPGA 1T96A 3DO7A 3PAJA 3PUEA 1UKPA 5C0CA 4AZCB 1I4FA 1JHLH 2FB4H 3AREB 3CH8A 2PDKA 4FQXA 5IWLA 3NO5A 1NCAH 3WF1A 2EEXA 1A5BA 4PP1D 1MDRA 3O2WL 3LU2A 1UD4A 2ZCHH 3NAAH 5EEXA 1A6VL 3V16A 3GC3A 1KCUH 2WQAA 3U4EB 3WNIA 1VGKB 2X1XR 4GAYB 4RWYL 3RFZA 4DZBA 5CIPB 5ISZD 4YHKH 3TZVC 4AK2A 2OODA 3VXUB 1SO5A 2KI6A 1TJ2A 5I1IH 2JXMA 2VCCA 1NCOA 1U91A 2H2PD 3QZOA 4YDJA 3VWJC 4IP7A 1EBAA 4KKAD 1FWBC 4NENA 2PF8A 2E09A 3TE9A 2IDSA 1LQAA 4NC0B 4M6NH 2F5BH 2ITFA 1DLFH 1F58H 1ITQA 2VLLA 2DLGA 1WGVA 4ALAH 3CHFA 4W4OA 3TN6A 4NLHA 2ATPB 1D6EA 3V0WH 4FN0A 4EKJA 1PFOA 1RJPA 2X88A 3IJ9A 3SKNB 4L18A 3PF2A 4B2DD 3ZJ7A 3WJLC 2FVMA 3CQPA 4G11A 4O52A 2EILB 4O17A 4A8LA 2A74C 5AW0B 5C0FB 1S9KC 1W1PA 4P61A 2OPJA 4O02B 4MY1A 1GPFA 3CSYA 2NY5L 2XWRA 3VNYA 1BQLH 3EFDH 3UTSD 4UM8A 2P3EA 2CBMA 4C54A 1EO7A 1GPOH 5ANMA 1UZDA 1CGTA 3VCLA 3W22A 1NGQL 3ZJAA 4CAGA 4X9FA 5FF3A 3EGSA 1C5CH 3QFJD 1UTDA 1MI5B 1WDSA 3B97A 4OF3A 2Q8BH 1TQCB 4GRSA 3STCA 3VDGA 3RL2B 3WQPA 5AD0A 3ULSB 4JTIA 4NOFA 2EVGA 4LUTA 3FQTA 5GS1A 3SBPA 1T7LA 2GJ6B 3TX9A 1TZIA 3D85D 3SZKC 4BY3A 2J1ZA 2B7PA 4U6HA 2OR9L 4NBZB 3N9SA 2HCVA 3N1PC 1GY1A 1F6FB 3FQXB 5KTEL 1OADA 1GSMA 1KFBA 2PW2B 1FLRL 1YLBB 1XR8A 2HFGH 3QG6B 4LRIA 5ETUA 4FZ8H 5A7EA 2V7HB 3NSDA 5E51A 3K6SA 1T03H 1XDMA 2WIMA 2C3ZA 3DUSB 3FHAA 3NZ8B 3RX5A 2X6MA 3D3FA 2P24B 2PMZA 1UWYA 2NXHA 1ZA3B 4KU1A 2YOAA 3CZLA 2EINB 4KZEL 1OZMA 2BP1A 4KHXH 4LQFL 1QSEB 1M56B 3CWHA 4JAMB 3E9TA 5ID0A 3PZGA 4M0XA 2GT9A 3PY2A 5D2VA 3AUVA 4JZOB 3ZT7A 5DFWH 1I0DA 1BZ7B 4CVZB 2GJZB 3LKPB 3EHBC 4HK0A 3UROR 3QC3A 4WKAA 5HMEA 2ICWB 1Z7JA 5LAPA 3C4UA 3LIZL 3LH9A 1QBML 2E0PA 2HLFC 2HN7B 3IBEA 3LN5B 4R0LB 3FDKA 4M24A 4HT1H 4JQ2A 5A8MA 3U30C 5GVJA 2NR6D 4KRTA 3STZA 2CSPA 2EC9T 2VDOL 1IF2A 2GEEA 2P7TA 2ED9A 4AISA 3V4UL 4NKOB 4Q8BA 3IIVA 3RWCA 2VZUA 4Z7WB 3VK5A 5HI4C 2Q02A 1FLRH 4XD6A 3FO2B 3FTXA 3MA9H 4KJWC 4PZVA 1DVXA 3Q8AA 1HVXA 3VXUD 4LFHG 1W3IA 3PZ9A 4Q8WA 3P4MA 1G1CA 4P5MA 3PSWA 3MXWL 4K5MA 4ODVH 4ENZA 2DQDL 1Y5VA 3LTVA 3WTXA 4W9IC 1U8IB 2W9LA 3FUHA 5K59F 2O0TA 2OGJA 1CXEA 2KZKA 1G9NH 2P8LA 3KCPB 2IWEA 4CNIB 5GGTA 3ZVHB 4N0FA 3BC9A 3W7QA 1TZ8A 3A3YB 1BQHG 3MYPA 2FYYB 1BA9A 2W66A 2V9TA 4Y9EA 3GR4A 5F4XA 3B8YA 4TVPD 1TB3A 3GC5A 2AJZA 3EO1B 4UNTA 5FAAA 2YA2A 5FFOA 1CF8L 1BFOB 4DXXA 3ARGD 1E0WA 1OY3B 4H0LC 2GJXA 3FKRA 2NW2B 2XWBB 2BTMA 2PF6A 3GMMB 3HUJB 3E5PA 3S9YA 2B8OT 1FL5A 3DI2B 2WZPA 4LGRB 5JR1L 4XMLH 3O2VL 4JGJA 3DBNA 2NLYA 4QDPA 3G5YA 12E8L 1N8ZB 1LF1A 5AVTB 1YAIA 3NURA 1OK0A 3V18A 4ODTL 8XIAA 1JNNL 1XSJA 3MLYL 3RKDC 4PG9A 3VXOB 1PS3A 4EF8A 2BODX 4QKTA 1HZLA 1E28B 2YGQA 1SGKA 2Q8ZA 3OKMB 4ZFFB 5DWUH 3URBA 5D93B 3WEBA 4EE9A 1U3HA 3D12B 3BUIA 4FXGA 5C3LD 5A6BA 1IC7H 3CE1A 1ND0A 4H1LB 3NJJA 3DFPA 3H70A 5I1IL 2OEMA 1HI6B 5CJ8A 4NRYA 2E5EA 4NT6A 5DVNA 2FEDD 3O3AB 1CI3M 2VDLB 1T22B 4DP7X 2YN5A 5E6YA 3O2WH 3LZ5A 1OE2A 1MVFA 2VDMH 2GUOB 1EPVA 1VZIA 3CUPB 3VDBA 2PDUA 2VGFA 5BQ7B 1FWHC 2G4JA 4Y2WA 5T9BG 5KS9B 2Z4QB 3LHWA 4HIEB 2VP8A 1MW3A 5J6HB 1B2YA 4CGUB 1I60A 5TE6H 3D2UB 3N1QC 1QSED 2YPVA 5HDRA 4AIOA 5KSAA 4LVDA 1NCHA 3AWEA 4NNXB 1XLBA 1PSKH 4GXUM 3SCMA 3QIBA 4JHAL 4P23A 2ZWSA 3K72B 1DBJL 1UACL 4YEEA 2FNBA 2AVGA 5I1CH 5GHWL 2YKLH 1UA3A 4POZD 5EF3A 3QG7L 3BHBA 2NY6B 3BPOC 4S1DC 4X6CA 4PGDA 3NCJL 3SOBL 3PHAA 4NPYA 2HT3C 3N40F 4P2QA 4XMZA 3VFOB 1RZFL 2ETWA 4B3VA 1VFBB 5JHLH 4JFFB 3WD3A 4YO0B 2YPKA 1K9TA 2Q86B 3IDJA 3O05A 2HXUA 1HKVA 1IGTA 1BYDA 3HIZA 4JDVB 5EBMA 4AYMC 4CU6A 9PCYA 2Y61A 3VXTA 3D18A 1UUSA 4BQ8A 4MYXA 3FYEB 1PV8A 1EEZB 4S1QL 4B5EA 5KEZA 5CGMA 4GRWF 1R5YA 4INFA 3TKFA 2G9KA 1A14L 5HYJE 2X4OB 2GFBB 2VW6A 4PJDF 1RV8A 4IM8A 4GAAA 3OAUH 2FFCA 3WN6A 1D6VL 2CXKA 3LMJL 4BXSV 1ADWA 3CM4A 3VILA 5DJ6B 3QJSB 5HI5D 1WYJA 4A2MA 1JI1A 3G7TA 4N8VG 3TSMA 2C1PB 1ETZB 1AGFB 4G9FE 1LO0H 2YSTA 3MLTA 1ITXA 2FB3A 4OTXH 3OC8A 4WDIB 4AH2A 1YTDA 4XO6A 1JFQL 1FPTH 3WDPP 3SDCD 3HCVB 5D7JA 3HB9A 2PLTA 2V6AA 3HGRA 3W1RA 4PJ5A 1L8PA 3VIGA 5I2IA 5T1JA 1Z8AA 5JO5B 4KXZH 3FRPG 3IJYB 1MCNA 4MKNA 1NUFA 3WY1A 2ATMA 3LSCA 3MY9A 1GIGL 1I2RA 1SFTA 3EH2A 3V6ZA 5CG7A 5JW4Q 2YSSA 3RRQA 4M1CC 3IV8A 3OVUB 4DSYA 5DHDA 3MCG1 4PJ9C 5HNTA 3DSFH 4Z0BL 3EFFB 1N82A 4G6FB 1PMYA 3HOGA 1XDTT 3N2MA 3IPFA 4B5ZA 1EO5A 1MJUH 3T3PF 5FJJA 4QGYA 5JO5A 5F1KC 1S1RA 3A3WA 1AP2B 2OMNA 4AQ1A 2J74A 5DJ8B 3BGAA 2D2JA 2HEJA 2HX7A 3IFLL 3MSPA 1RU9H 4RESB 5IBTH 1UPPA 5IV2B 1I9JH 3U46B 2OZTA 1MAKA 2XKSA 1JWUB 5CZ0A 3RJYA 3OX8B 2CLPA 1PS9A 1WBYA 2YO3A 2WM0A 1N5AB 2HTKC 1T1ZB 3EYOA 4OKDA 4KJPD 5IUCA 3W76A 3CO4A 2F8OA 5HINA 2AJUL 2KZHA 3DRQB 4LBEB 1OG0A 3WIHH 5ENLA 5FL0A 3SGEH 2GJNA 2CJSA 4ZQNA 3HRZA 1S9YB 4Y4KD 4Q9RL 5DCBA 3FPXA 4QE5A 1IEVA 2HKFL 1CK0H 4JKMA 5G4WA 2PCPB 3LPWA 5JBDA 3QRGH 2K8MA 3KLAA 1IIIA 1R2TA 3VW3L 2DICA 3UMNA 4K07A 1PQZA 1U58A 4QDGA 1KM3A 1PU0A 4GGHA 4DZHA 5LNVA 3W7JA 3N41F 3R0KA 1DORA 3KLDA 5FYKL 1F97A 1HC1A 3EGDA 2DQJH 2JI1A 5EBMB 1TG8A 3C9NA 5AKSA 3OZYA 3ARVA 5IK3B 2DIAA 3QIUC 3L3OB 4AHQA 4JPVL 1OF6A 1WXYA 1TPB1 1YDPB 4CMMA 2GSHA 2W5FA 1H3PL 1V6VA 3DXIA 4XISA 3B9VA 3EO0A 1GYVA 3D07A 4U31A 4ZO8A 4XZHA 3SDOA 3SR7A 4E9SA 4JB9L 1IC0A 1DBMH 1SUHA 2UWEE 3FUFA 4PEKA 4AVJA 1UPMB 4H04A 4BCZA 4FFWD 4HH8A 1AZCA 4UIKH 2V9UA 3SO5A 3GW0A 4JYEA 5IVZA 4RAUA 5FYKU 1E8WA 1ZVSB 1NVMA 1EWDA 1B3VA 2P9RA 2OA9A 5HGHA 1FNGA 3C09B 3DXAE 3GLZA 3GNXA 3PJTA 1MFAL 2RH0A 1TZZA 4KQ4L 1JVKA 2C5DC 5C0EA 2BSEA 3EJYD 4LPVA 2ALRA 1LO2H 4AEEA 1NEPA 3NL5A 5B3SB 1XYCA 4K7PX 4RMUA 2W65B 3CFIC 1UUOA 4H19A 3QNZB 4NUPA 3M0HA 2WKOA 4J3VA 5JIDA 2BP3A 1PAZA 1XHGA 4KVNH 2OB3A 3NA8A 3MNZA 5FECA 4R8WL 3H53A 4Z5RB 3G1YA 3N44B 5H6HA 1PCXA 3TYEA 3TCEA 3K0YA 2MCMA 2JKPA 4HN4A 3T6ZA 4ZMGA 2CLRA 2HS8A 4W87A 3PWPB 2YCJA 3DO4A 1I3RB 3ETSA 1LT7A 1HO1A 3VFSA 4NJKA 1UZ8A 4R2GC 5HY9B 1K5WA 3KPOA 3UWWA 1YXYA 2IKHA 3VRIA 3V5DA 5K93A 2ZX9A 3ATEA 4XI5D 3V9FA 2VDLL 4GI8A 3V0IA 3AYSA 3CPUA 5FA4B 4Q8QA 2PODA 3NIDF 2C9SA 2G2RA 3PS7A 4UUIA 1KPUB 3I6GA 4UTLA 1PKQB 3S3PA 3APFA 3L08A 4PJ5D 4C57C 2BSSA 4F37F 3OHXA 2BASA 4ZB2A 4DB7A 2ZRUA 3CWNA 2FSEB 2R2BA 3L54A 2I60L 5F96L 1FL5B 4US5A 3CFDA 2VKXA 1O5QA 4P06A 2YUXA 3QDJD 2EDWA 3WIFB 5A6JA 5K9XA 1V3LA 3OF6A 5C07A 4X7CC 1A7BA 3A5FA 1ZTXH 1NOFA 5GJMA 3HPJA 4O28A 1OFPA 1E2VA 3THDA 1BJ8A 2HMCA 4XODA 1CLYL 1HN1A 1AD0A 4KY2A 3NJFA 4ZX4A 2R2BB 1Z5HA 5EO0B 2XSKA 3EOBA 4JJ5B 4GRMA 2PDHA 3W00A 4G6AD 1TJGH 3K5SA 1QTYT 2HFEA 5GGTL 3FZUD 4I87A 2BXVA 2BRQA 2PDCA 3G9AB 3G0SA 1UADC 4UTBL 3IVUA 3MUXA 1H63A 1U8IA 4ZXBC 4HH9B 4GBXA 2JGQA 3PWUB 3NCCB 3FFCB 3WNMA 2R1MA 4F0KA 5DUBA 3QKEA 2ZOTA 3KPOB 2V63A 3VKBA 3OKLA 3M5XA 4OCRH 1XAKA 2CBQA 3QUYC 3AO0A 3B40A 3PUOA 3RPIA 5CO1A 3TW6A 1R6VA 5J5EA 2AQ2A 2CR3A 3ZZLA 1OD8A 3C8DA 4HCRL 3STZB 4UF7C 3GSRA 3NP3A 2R27A 1NH6A 4LPWA 3KBSA 2ED7A 1TDQA 4XVUD 3SKOB 1KFLA 2E28A 4HK0B 3ASWA 3D05A 2A3HA 5T1LA 4PFMA 1YEKL 2HVKA 2ZD0A 5JXED 3WQ5A 5D6DC 1OCBA 2Y5TA 2DBJA 1H7WA 1RJLB 2FX8L 4NSKB 2PRMA 3ZYOA 3PTQA 4Q9QH 3D39E 4ORGB 5D7LB 1NAKL 4L23A 5FV1L 3TASA 3THML 5JXAH 3EWCA 3WUWA 4TNVF 4GG8B 1OAKL 4PV1C 2F5AL 3SE6A 4TX6A 4O0QA 3M7SA 3RU6A 1ZE3C 2QCEA 3FUDA 4FALA 5FJUA 4O51B 5EOCJ 4RJEA 4WWKC 1RIHL 1ZU8A 4GMTL 3SUVA 5GGSY 3TNNA 4YXLL 2APWA 4J3OH 4M6OH 3T4AC 1JRHH 4WU7A 5IT2H 3B0PA 4S23A 5LHFA 1QOQA 5E8EA 1GOHA 3EGDB 1OALA 2WY3B 3QEHA 1G9HA 1ADQA 5EZPA 2GC4C 3UVIA 4UQ2A 3CDZB 2F74B 3GIYA 1MI5A 2X28A 4U3HA 2N7SA 1I1WA 4PGCB 4L8SC 3B0YA 4PGCA 2WUCH 5DHVA 5KANI 4P2OA 1IAOA 2WN2A 4AVIA 4I6VA 3S0CA 4BI7A 3PB2A 4XN4A 4LOVA 4JTRA 4DPBX 4R84A 4ZUVB 1SDYA 3DSNB 2J77A 3BLIA 3MI3A 4LTSA 1BOYA 2NZLA 1N26A 4KJQC 4ZAKD 1SQMA 3O6FA 1QW8A 3L95A 5FW6A 5H37H 2PSNA 3IJHB 4PJFB 4I0KA 4W85A 4JFXB 5LGXA 4O2CA 4R3SB 1DP0A 4QTGA 3HOJA 3I9GH 1K7EA 4HUXA 3UGEA 4M1RA 4PTNA 4C8XA 3UCCA 4RZ4A 4XNYL 3FCPA 2GTWA 2AABH 4XMXA 1JEZA 4CQDA 2DORA 2E6JA 3V8CA 4EEEA 4YDJB 4FXKB 3PBMA 2ZVRA 4WJG3 5FF7A 3VIOA 5C70A 2INFA 4JHOA 1I8KB 1GOGA 5ABTA 4I2XB 4DY1A 1BQUA 5IJBC 4I7ZC 3SKJL 3T81A 3NACH 1FZJA 2HSAA 2Z8VC 4GYPA 1GC1C 4WKZB 5C0IB 1N55A 1ZPLA 2Y0FA 5C6PB 5T9CE 35C8H 1UM5H 3OGCA 2EXOA 4G82A 3RJDA 1WIPA 3MRRA 2CC0A 3W07A 5DO2C 3RDTD 1ENUA 1ZSXA 4RA0C 3AABA 3SYAA 4H26B 3NA9H 2DMGA 4M4PA 2J4GA 1JN6A 1XF5A 3S46A 3VUAA 1CIUA 4WDIA 4ZR8A 3NFUA 4QAIA 3B0XA 2P8MB 1KRBC 3MLTB 1JJUA 1C8VA 4JN7A 4WEVX 2NDGA 5C2UB 1T0NA 3OKNA 4DVRL 1KTRL 1KT2A 4X22A 2X0WA 8RUCA 1JGUL 2ZKYA 4PB9L 1BF5A 1P1ZA 2XWJA 4IU2A 1AH0A 3F4NA 4ERGA 3QUZD 2ICWI 1KBLA 1TNNA 5EC1A 4XVJH 1HKJA 2RFGA 2VCOA 1HWWA 3GJFK 1NIAA 2FX7H 3P0YL 4UV7H 5A2JH 1AR1D 2YEQA 1GVFA 1QTWA 2D23A 2XIQA 4AB4A 3Q44A 1DN0A 2G0KA 2GI0A 1VGEL 4MY9A 5AL8A 1CICC 3W73A 5EO0A 2KLTA 1XGZA 3X2QB 1GHFH 2OMYA 2DQHH 5I6KA 1G7HB 2VWSA 4A55A 3QEQD 1X5JA 4QXUL 3P4NB 3V1HA 3QH2A 3RWGA 5KSBE 2XWTB 4N0YH 2IVFC 3A23A 1Q1PA 2RCSH 1LT8A 5K9JH 2BDQA 3N4AA 3UDWC 2ZJSL 4JFDE 1CFQB 4HCGA 2OJZL 4EF9A 1IL1A 4W9ZA 4YSEA 5EEUA 4PGDB 1NY1A 5GZOC 5F1UA 3QWQB 2VR4A 4BI6A 3KYNB 3BKJL 2QFRA 1JCYA 3H54A 4RFOL 4UC5A 4LF2A 2IPGA 2O5XH 4HG4J 2GDUA 3DERA 1W37A 2VQ4A 1U0QA 1WLHA 3R19A 1QUMA 2GWNA 2WXIA 3B56A 4GQZA 5DUJA 5DZAA 3W1QA 3UC0L 1YNTA 3KCJA 4LHJB 1KXQE 4FAAB 2NQCA 2Y69B 4KMTL 2NXZB 2HVMA 3PYCA 1XZ0A 3Q1SL 2BHUA 4KKBD 3UOAB 4ICCX 2AGJL 2XETA 3DURA 2JQAA 1LP6A 2X70B 5GJPA 5L6YL 2FTWA 4N9DA 4NQDD 3AGVA 4AIUA 1EBPA 2EHHA 3TIMA 4BK8A 2CESA 4WGKA 2NY7L 3ZL2A 3CU2A 1QDSA 1QW7A 4HEME 1DDHB 1CVRA 3MUHL 5JW4R 1R86A 2GSGA 4P3DB 1XYAA 5ACMA 4QNEA 3DOSB 3NVDA 4GJIA 1SZNA 5BZXA 5J3HD 3PANA 3R8BB 4YHPA 4OOUA 5AYYA 2ENPA 2R2HA 2IPTH 4Y5XA 4D9QE 2P43B 3T8XB 3CZ8A 5LNUA 3KVJA 5EN2A 3BQ5A 1TYGA 3ZRFC 1IGML 5D7EA 3CSBA 1BPLB 2EKCA 1QXLA 1N8ZA 1RUKL 1RUMH 3MLUL 1A3LH 2ORBH 4MA7L 4JEQA 5IRPA 4Z7WF 4HUUB 5CC7A 2BZCA 3VFMB 4GG6F 1Y1DA 3H2QA 2EIZB 1Z48A 3M44A 5GSVA 1NQ6A 1KEGL 3VNZA 4JM2D 4JFZL 4EI6A 5AALA 3EGJA 4RDWA 1PYMA 3PJLA 4GUCA 5LAXB 1WTGT 1D5IH 1F4XH 1L6YA 1Q85A 1Q6EA 3U4KA 3CPRA 1SVBA 4K7PH 4ZQTA 3QOMA 4O5LH 3EX3A 4R0LC 4N0FB 2R56L 1OM3L 4FJ6A 5GS2D 4YXHL 4M8QA 3KCPA 1MXSA 3BLLA 3WXVL 2OKTA 3ZZSA 2H32B 1O1HA 1B88A 2YLAA 3CFCL 5DD3H 4F8NA 4OIFA 3IGAB 3B9OA 2G5BB 2I9LA 5T5FL 2FEEL 4WWID 3FK4A 4Y9MA 4OFCA 2CK2A 2BV9A 2H8PB 4QF1B 3FA5A 1B3JA 1CFMA 1SW0A 1A6AA 4UQCA 3H26A 4X9YA 5LNRA 5ILTH 2X4UB 1ZK5A 2BCKB 4QGTA 2Z8SA 1GHRA 1ADQL 4KY1H 1D3CA 4YSPA 2LU7A 1GVRA 3LZFH 1H7NA 5EOTA 3EWBX 3GXDA 4TVUA 4GYFA 5ESAA 1S4IA 3N14A 4H9VA 1PEZA 4G70B 4ML9A 1OAQL 2VR8A 2E7LA 3OGCB 3K0WA 4X7SH 4S11A 1HJUA 3F6IA 4TPRL 2REQB 1Q6OA 3MLRH 1YE4A 1W32A 3FAXA 1WITA 4LCWA 1JPSL 4AXWB 1SOSA 3WF2A 5DT7A 4QR6A 2EPLX 3MS8A 4TNWK 2XNAB 1GKPA 2XUCA 2YJQA 2OL3A 1UATA 5I16B 3N2OA 4C55A 3HLAB 2NW3A 3CN1A 2E46A 4N6EA 2ASHA 3U4BH 4UIMB 2EXYC 2X44D 3QI9C 1R5IA 5HHPA 3EX2A 3VDHA 2SODB 3K8KA 3NZ8A 3C60B 5C09E 3PUDA 3E0VA 1R47A 1AZRA 4I9TA 4C58B 1N5YL 3GTNA 1T7XA 2NXYC 2PP3A 4NPKA 3LY0A 2X12A 1A4JB 2Y36H 1UD8A 3NRQA 4EDXA 2A74B 2MNWA 3QCUL 4U1MB 3Q8CA 3DX8A 5EOQH 1JRHI 3E6FB 2AQOA 4UTMA 1JPIA 2XDHA 2F61A 4OFVA 5CD5D 2Y4SA 4NT0A 1OHQA 2DEWX 2Q2LA 3E2HC 1DJGA 4BEQA 1ZAGA 4B3EA 1ZXKA 3LQLA 1F9CA 3LN3A 4OUUA 3A6CH 5B1BB 5I75B 1U93B 1H11A 4K8GA 2GSJA 3ASNB 1UZHA 3NNTA 3UJ2A 4Z77B 5D7KE 3OXSA 1ODZA 2OU4A 4N2GA 3CFNA 3H3BC 4MKTA 3NTYA 2J20A 4XCNB 1G6RL 1HU8A 2X9XA 4BYHA 3EPNA 4LANA 1JHKL 1UWFA 4JO4H 1TIWA 5C7ZA 4LW7A 3VCRA 5SX4I 1ZANH 5CFHA 4KRUA 3CV2A 5MI0B 3IUHA 3HNVH 3H7BA 4XOEA 1MQPA 3WK1A 2UY3A 4L5ZA 1I8IB 4S1RH 3IDJB 2KMWA 4ZNEA 2FATH 1IEHA 3OBEA 3EEGA 1J8SA 5EMJA 4L29B 3IT8D 2VWTA 3MDUA 4B4HA 3D52A 5CAKA 4M6ML 2BSTB 4KKLC 1S5IH 3O6FD 1CE6A 3HN5A 4K5PA 4NPYB 4U7SA 4HIIA 4XGZA 1JZ8A 4XXWA 5A40E 1JCJA 2CZ5A 2XDFA 5REQA 5LIXX 1C7TA 5T1KB 2PCXA 2J4WH 1Q72H 4PJBB 4XWGL 5CLXA 4XNBA 4G7VL 1XR9A 1N9PA 1QUNA 1CLZL 2K4AA 4HXBL 3IDIB 4ADGA 4L3AA 1XPYA 5AYIA 5DBUA 4JZ5A 4L4OA 2ZCKH 1BX2A 3JVGA 4LRNL 2DLIA 4U1SA 5BMFL 1TR7A 4H9YA 4HC1A 1SNRA 5F1IB 3ZHFA 1TE6A 2VUOA 3CIQA 4ML4A 1H8LA 4DESA 3M7OA 1EUTA 1BYCA 1IYXA 1AIFB 2WXQA 1RURL 4FYQA 2Y1HA 1BM7A 2B59A 2VZOA 5F6HJ 5MEOA 4I5XA 2Y9RT 4F9DA 5T8IA 5FC9A 1WRFA 5EWIL 3BKML 3OR6B 2KLSA 3KWWA 1JGLH 4XB8A 3O3AA 4JVWA 4EPDC 3PJSA 1UG6A 1C9WA 4ZFOB 1P6WA 1A9EA 4FA8A 1KFAH 1E42A 4I9WD 4ENEC 5I3JA 5I0DA 3QKZA 1TQUA 1OAZH 3SJVB 1ZLUK 4AEHL 1VFAB 4OZIF 3IE9A 2WVTA 4L6DA 7REQA 1HCVA 1MDLA 3EXRA 3WLPA 2WLIB 4I89A 4JW3A 2J62A 1HJSA 2A77H 4LLVB 1OO2A 5JHLA 4G71B 2AL2B 5CEWA 2XACC 1F76A 3HZVA 1OANA 4FYSA 3QR3A 4DZ5A 2B5IB 2WXHA 5JHDE 4NS0A 2E9MA 4UTIA 3HPJB 1S7XB 2QV2A 4OLVH 4WKHA 2XKUA 4N9CA 5CZSA 4EUPB 1VEMA 5T5FH 2IEPA 3QOKA 1HL4A 2WO2B 3L4WA 5DHYA 2O4QA 3ZJKA 1V3MA 5LXGL 4TF4A 1MVUA 4WK9A 1EGMA 3T1FB 4FB7A 3D87B 1GYWA 3C86A 1L9SA 4K8RH 4J35A 2R56H 1OM3H 3ULUD 2CEQA 4K39A 3WJZA 2MPVA 2X41A 4RCAA 4U1NB 4C5YA 5ADPH 2DYPD 4PRIB 2FCBA 3DC8A 4GSRA 3JR2A 3LGDA 3B2UD 3FTUA 2FPVA 3MBDA 4ADUA 4NVTA 3FB5B 3STLB 5JQIB 3GU9A 4G8TA 2X4RA 3PR2A 1SJBA 5BO1L 4HTYA 5GGRA 4JQAA 2JB6A 2R29A 4IK7A 1WG3A 2XBTA 3O11A 4OZ4A 5KYUB 1NP0A 4KK9D 1LL7A 1QI0A 3K71B 2YDSA 3E6HA 2V17H 1AD4A 2CZDA 3BOXA 4O16A 5H91A 3IWVA 3EFOA 2AQQA 3OQ3B 4FHKA 4NUGL 5GGVY 4BE5A 2VDPH 4PCYA 2K7QA 3L5WB 1B6UA 4EMZA 3TWBA 1BAGA 1NA8A 4DKFL 4U1IA 4R4BA 3BSHA 1U3YA 4Y1AD 1N2RA 5C0AB 3ALWA 2E9LA 5TJWK 3K7UA 1BZ7A 1F6AA 4P2QE 1MEXH 2A3LA 3AXKA 2NUXA 3RZCA 3M0KA 5BRZE 3PJSB 3MBXH 2WMKA 3NPWA 1E6RA 3J8F7 1OEZW 2VLKA 2WPBA 3CEUA 4JRYB 2FTPA 4L4TB 4RAUB 4WW2C 3SUWA 3FJTA 4U2ZA 1YY8B 3ZTEA 5I0XA 5BV7L 4LY4A 4YVVA 1Z9AA 2N1TE 4G9FD 3REVB 3GDRA 3B6SB 4JFTA 1GOQA 3MZNA 3FW6A 3ISWA 4JFHD 4N2LA 4JPWH 4DW2L 2BRRL 2FAUA 4RISH 3NT0A 4R4BB 1FJ1A 4N0CC 3QORD 3WL0A 4YSDA 3C9NB 2Y07H 3HE7C 1RBAA 2A6DA 4TQIA 3PZIA 2C0HA 3Q65A 5B7YA 2BSED 2ZUYA 4H20L 4LHUG 1IIGA 1SF3A 1FBIL 4FG6D 4LOUD 5IB1B 1W8SA 2DQTL 4QY8A 1YE6A 3EGSB 5FYLL 1JVLA 5K7JA 1YO4A 3SB3A 2NUPA 1A64A 4HBCL 4HX1B 3T4CA 4IP4A 3SQMA 3R10A 3CL7A 4GT7A 5FOBB 1ZD6A 1X1ZA 3CSYB 3VNIA 5EUOB 3SODB 4Y4HA 2XH7A 1KA9F 3BDXA 4WWNA 5AZUA 4MWAE 3PJUA 3GGWB 1AZUA 3JYBA 5E4AA 1VLWA 1UKTA 4LCWE 4WUUD 3UBPC 4Z2JA 1FV1B 5ALBH 2YCEA 4BQ5A 1JNHA 4YTUA 5LA0A 5DZNA 1SLUA 4G5DA 2VERN 2CBPA 3WFHA 3A3XA 3DROA 2D03L 4XZNX 3W7NA 3BCJA 1QBBA 3L6FB 2XVLA 4IS6A 1ED3B 4XO5A 4IMLA 5FPIA 2C7UB 4WWKD 4MLSA 4NQXA 4ANUA 1UMYA 5FCUH 3TROA 5C6MA 3ZTCC 4DUVA 3LZLA 3VFNA 3FBQA 1K85A 1TA3B 1R0AH 1O95A 2NXYD 1JFHA 4R7LA 3VD2A 4DFHA 1YMMA 3FA4A 1WP6A 5FKAA 1GUVA