1KGWA

Three dimensional structure analysis of the r337q variant of human pancreatic alpha-mylase
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTQVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALPHA-AMYLASE, PANCREATIC
publication title Probing the role of the chloride ion in the mechanism of human pancreatic alpha-amylase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 167
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2001-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1kgwA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1kgwA01
4MAZA 1PAMA 3WF1A 1QHOA 2ALWA 3EJUA 2Y2WA 2VJXA 1QBBA 2FH6A 4JFSA 5I0DA 1QNSA 4S3KA 3DX0A 4HPHA 2DH3A 3WF4A 3A3HA 1W2PA 5IFPA 1JDCA 4LX4A 1LLOA 1JYXA 2VX5A 3O6AA 3WH8A 3DX3A 3WMBA 2X1IA 1D3CA 2XPKA 4CD4A 3ZJ7A 2JE8A 1Q4NX 1SMDA 2XYLA 4J3XA 1JI1A 3BVXA 3N9KA 1EO5A 2ZX9A 3OLGA 1E15A 4MB1A 1E71M 1RH9A 4FNSA 4QCEA 2IUZA 1CXLA 4HU0A 3CZGA 3RJXA 4QLLA 3EBVA 1HN1A 2WYSA 3W25A 1ZBVA 1CWYA 4OIFA 1OGBA 3ARSA 1W9XA 1UA7A 1ZJAA 2GJXB 2WMGA 4MADA 4YHEA 4UFMA 4B15A 5E70A 2ZUNA 2J75A 3W82A 2E9BA 2YDRA 4B16A 4JFTA 1J01A 2OWXA 2Z1SA 3GXNA 2BHUA 4CVUA 2XVLA 3W38A 3T0BA 3K4DA 4JCMA 4WJXA 4JHZA 1F4HA 3RJYA 3EMCA 1E4IA 1UQYA 1M7XA 4UQEA 3D3AA 3RIKA 3H55A 2ZOXA 1O7DC 3GBDA 1UR0A 1H5VA 2BV9A 3AFBA 1XCWA 3WD1A 4P8XA 1QWNA 4XV0A 3MMDA 3CC1A 1I75A 1QHPA 2Y8KA 2D24A 2J7BA 3A47A 3A4WA 2GDVA 4X9YA 1MW0A 5BRQA 3L2LA 5I6SA 1UD3A 1ODZA 2ZX5A 1WCGA 3VIHA 3WQVA 3SCRA 3F5JA 3HG3A 1ZJBA 3ALFA 4QDMA 4JFVA 1JGIA 2V3DA 2QV4A 2VZTA 4UNIA 2WLZA 3BSGA 3PTQA 2FDMA 1CXKA 3ZT6A 1KGWA 3AZSA 1JZ8A 5FCZA 1M04A 1Q6EA 1Q6DA 3MUAA 4NI3A 4ACZB 2FGLA 1A3HA 5JBFA 1V03A 1HIZA 3IJ7A 4NF7A 5F7UA 4HMEA 4FMVA 2YLAA 1KR0A 3FY1A 1EXPA 3WFLA 5ABFB 3MUZ1 1KCLA 1UR4A 3QR3A 2DSWA 2BNJA 2W92A 4M24A 3WENA 1PZ3A 1HKMA 2ZXAA 5CPTA 1C8YA 3HMCA 4UOZA 2CKSA 2XVPA 3AROA 2EAEA 3UG5A 2CERA 4N0RA 5M17A 2JEPA 1H11A 3KL5A 3SCQA 3DDFA 4H8VA 4AD2A 1H41A 1JDAA 3W26A 4TOQA 4JKMA 1XD1A 3EDEA 3T0AA 4IUGA 1TQSA 5DMYA 1TQTA 1HL9A 1UH4A 1RP9A 4Y7EA 2EJ1A 2VURA 3AHVA 4U3AA 1JFXA 4XZBA 3WQWA 2WHMA 4P7RA 3D4ZA 4UFKA 1E6NA 3THCA 1XCXA 4U33A 2GFTA 4CCDA 3WNKA 1ESWA 1GOIA 1R8LA 2E0PA 3RMEA 4U3CA 3ZT5A 3A4AA 3SUSA 4AYSA 4W7VA 1O6IA 4ML4A 1QVBA 4TX6A 2F2HA 4CN4A 3LPGA 1HWWA 2PI6A 3II1A 5HPCA 1E1EA 4LYRA 1QHZA 4ATLA 3ZR6A 1CXIA 2PWFA 5EFDA 1JXKA 2WKGA 1XV8A 1JAKA 3NCOA 4WLCA 1JYWA 4M82A 2CBIA 1MVYA 1J0YA 2EXOA 3OGRA 1NM9A 4KMQA 1TQWA 1E6QM 3CMJA 1HL8A 3PZVA 3VDAA 3DYPA 4KWUA 2JFEX 5C70A 5CGTA 4W8BA 3CUIA 5JIWA 1RP8A 2GDUA 2Q8XA 1D7FA 4AD1A 4MDOA 1V0MA 3WUFA 1UR8A 1HJWA 4DUVA 3MSDA 2XM1A 4GI8A 3OLDA 1TVPA 4IPNB 5A8PA 3MO4A 4M1RA 4PTVA 1VBRA 1W91A 3G6MA 3T2OA 4Z2JA 2XM2A 3LXCA 5I23A 1MQQA 3K8KA 4PMOA 4CU7A 3L4UA 1E6PA 2CBVA 3CMGA 1BFNA 3CZSA 4CN6A 5M5DA 4GZEA 1SYTA 2ZWZA 4HP5A 3U57A 3A21A 1W3LA 1QNRA 3WQ5A 1CGUA 3BC9A 4BZYA 1MXDA 1GOMA 3GXFA 1VF8A 3MUIA 3VDBA 4H8HA 1DTUA 3THDA 4C7GA 3DX4A 3AS3A 3WMCA 3FAWA 5A6BA 1M01A 1WZLA 1WO2A 2YBUA 9CGTA 1JZ6A 2YIHA 1RPKA 3RCNA 3CTTA 3CLWA 3T2QA 3HG2A 1J0KA 4TTGA 4PMQA 4F66A 3EJRA 1K9EA 4JIEA 3VIPA 4B9YA 3B9EA 3WNOA 2X2JA 1FP9A 3MMUA 1YHTA 4GO8A 2O9OA 5A2AA 3VIFA 2PWEA 3N12A 1HXKA 1Q6GA 1GJUA 2F61A 2F1AA 1V3KA 5A3HA 1JYNA 3PTKA 4DUXA 5C71A 1GVYA 1R75A 3EJQA 3CZKA 1W9BM 3EDJA 2W66A 3NUKA 3LXAA 1QX1A 4PMUA 3NDZA 2F8QA 3CHCA 1KXTA 2QHAA 5A6BD 2WMFA 3MMWA 1W2VA 5CG0A 2WBGA 2W5FA 1OM0A 4A4AA 1K6AA 2J7EA 4UQAA 3HG5A 3QHMA 3WL1A 2J77A 1HKIA 1HVXA 3DC0A 3VMOA 4W89A 4RE2A 4E4PA 4U2ZA 1BGAA 2YL9A 2XVNA 2J7FA 4DUWA 1QI5A 2VVNA 1W1TA 1C8XA 3UETA 1DWGM 5FL0A 4HMCA 2XIIA 1H09A 1FFQA 2HISA 3UR8A 4HZ8A 2VR4A 1CGTA 5E0FA 4FLSA 1G94A 3VIMA 1FHDA 2Y4SA 4AZ5A 2G3NA 4D6IA 3KZSA 1E5NA 4CCCA 4M81A 2WPGA 3CHDA 1VBUA 1PX8A 1DP0A 5JUVA 1SMAA 4AZ6A 4W93A 5D4YA 2FHFA 5BXRA 2EADA 3D52A 1EQPA 1FP8A 4MNLA 1TQUA 3GXPA 1S46A 2IGTA 2V3EA 4AC1X 3HZ3A 1XD0A 2DT0A 1VAHA 3WD4A 3WH5A 1EGZA 5AC5A 4PMVA 3KL0A 3VKKA 1HP5A 2QPSA 4YPJA 4MDPA 4M29A 1CECA 3ARRA 3J7HA 3ALGA 1E55A 1R85A 5BYWA 1E6XM 1GOQA 2DQXA 1E4MM 1DHKA 3L4XA 4GQRA 3SCTA 4PTMA 2C8NA 4B3LA 4PMXA 1HTYA 2PBOA 4EE9A 1OB0A 2WMIA 1MQPA 1WP6A 3ARYA 1FHLA 4NZCA 5A94A 1P6WA 3W53A 4GI6A 4W84A 3SUUA 3VIIA 4Z2IA 4TXEA 4W8AA 4HOXA 3L4YA 4CN1A 2GVYA 3LRLA 2VX7A 4ACZA 1ITCA 2WK2A 3ZQ9A 4EK7A 1VJSA 1M53A 3L4TA 4PBGA 1JIBA 3ZOAA 2UY4A 1UD2A 1C8QA 1W3HA 3WEOA 1XRVA 1XSJA 1TUXA 1B2YA 2WLYA 1R47A 2ZX6A 1J0IA 3CZJA 4MNJA 4AYGA 4PSRA 1WZMA 1H1NA 3TP4A 1U33A 3T2PA 2YL6A 3W4RA 1B30A 3S5ZA 3MANA 1OT1A 2E9LA 3TTYA 2VRQA 3AOFA 2FGZA 2O9PA 4XX6A 2CCRA 3PTMA 1MXGA 1TA3B 1R34A 4FLOA 1XH0A 4CU8A 1DWJM 4U5KA 5KEZA 1I1XA 1HT6A 1UD5A 4Z2HA 3AHXA 3CV5A 1JZ5A 1XSIA 5EFFA 2HVMA 2EQDA 5E9AA 2VZUA 3BVUA 2XGIA 5I3DA 4D6GA 1ITXA 1UKTA 5I2UA 1E70M 4P7NA 7CGTA 2EACA 3WBAA 3VILA 1ZL1A 1PJ9A 2XSAA 3VIKA 1OCQA 2V5DA 4B9ZA 2PF0A 1WDQA 1W32A 3CUHA 5ABHA 2V38A 3ARTA 3GYCA 3BUIA 4CVWA 1FH9A 5D8ZA 3T09A 2PWHA 4PMYA 4AZCB 5IDIA 3BMWA 3NSNA 1MW1A 1NP2A 3O2LA 3EMZA 4AZ7A 1E3XA 2FYVA 1W9PA 2CIPA 3U5UA 5IHRA 4L4PA 2YKKA 4NX0A 4WKHA 4P7QA 2AAAA 2WVUA 2CEQA 4CKQA 3PZ9A 2E3ZA 1HJXA 1JI2A 3F5KA 1Q6CA 1EDGA 1JG9A 3LPFA 4M80A 1J12A 3ZJ6A 1FH7A 1NOUA 1OINA 1CGWA 2XUCA 3A4XA 2A3AA 2XFRA 5IHSA 1T0OA 1U30A 1UQZA 3WQ4A 1UR1A 3LRKA 2YLLA 3WDHA 1X6NA 1JNDA 1E73M 1UHVA 2JALA 1E0XA 1JFHA 3AXXA 1MYRA 2MANA 3SUTA 4ACYA 1EDQA 5A6JA 3WL0A 2BVTA 3VM7A 3W6LA 3LXBA 2V5CA 4KRTA 3OLIA 1DWIM 3EJTA 4J3SA 2VL4A 2GUYA 1TCMA 4WSJA 3SURA 1KXHA 1HKJA 3CUJA 1V0NA 2CNCA 1R87A 5AYIA 2YFNA 4E2OA 1Z32X 3WKZA 1CBGA 1GPFA 5M03A 1BGGA 3RM4A 3VGEA 1B90A 3ECQA 2D20A 4XUYA 2OW7A 5HBFA 4HPGA 1GZJA 1R7OA 3OZOA 3WF3A 4ATDA 1QI4A 1H4PA 1K9TA 4AZIA 3WNNA 3AYRA 1MQRA 4GZJA 1EDTA 1JZ2A 2PWGA 4PYSA 3CUFA 1HP4A 3U7BA 1GVIA 1BVNP 1VEOA 3VGGA 1V6YA 2WMIB 3VINA 1GCYA 4HZ6A 2J47A 1TQVA 3AS0A 4AWEA 4M8UA 1OIMA 5IFTA 4LGXA 4UQCA 2J7CA 4V2XA 3DHPA 3MS8A 4W88A 3GXTA 4C7DA 2WB5A 3NIYA 4TUFA 1AMYA 3WH9A 1AVAA 3GTNA 2F7PA 1ZS2A 3TOPA 4PEEA 1C90A 3WY3A 4ZFMA 1ZB5A 3S6TA 4OJYA 5EB8A 3W29A 4D6CA 2A3CA 3BCFA 1AQMA 3WF0A 2F1BA 3A5VA 3MKKA 4AMWA 4OOUA 2OSWA 1ISYA 2WW5A 2ZUWA 2YJQA 4JHOA 1E40A 2D0GA 1UUQA 1B3ZA 4UTFA 2Y5EA 3PZNA 3A6OA 4IPLA 2W67A 2D0HA 1H0GA 1FA2A 2FHBA 2D0FA 4BCEA 3BVTA 3L4VA 1NH6A 1J10A 1KQZA 4HA4A 3ARUA 4WKAA 3DX1A 1MWOA 1EQCA 5CSUA 4H04A 4PUEA 3AS2A 1Q6FA 3DYMA 5JIPA 5D8WA 3BAJA 1KGUA 3ARXA 1OWQA 1UD4A 3VX0A 1E6SM 4AD0A 1QPKA 4MB4A 5C8BB 4MB5A 4MJ2A 2E9MA 3VDCA 3T08A 1MW3A 1US3A 3N13A 1G1YA 1E5JA 5FD0A 3K46A 3ARVA 1TZ7A 3SUWA 2G8ZA 3RO8A 2YBTA 4TX8A 4TVDA 3BUPA 1KWGA 3RM8A 3BLBA 2EPNA 2BY3A 2WSKA 2VRJA 1JZ7A 3UCQA 3WUEA 2ZXBA 2VQUA 3QHNA 2XN2A 3TTOA 1UD8A 2VR5A 3GH5A 2D73A 1W1YA 4IISA 3QHOA 1GOOA 4HTYA 3VX1A 2Y8VA 5CJ5A 4P8UA 2VMFA 3APGA 4D6JA 4LXFA 3WY4A 3TTQA 4FNQA 3VOCA 3WDQA 5HOSA 2VO5A 1U2YA 3HG4A 2ZUTA 5I78A 6A3HA 3GH7A 1V0LA 2J7GA 4QCFA 1VFFA 4MJ4A 3K1DA 5E1QA 3WY1A 1JAEA 4PCTA 4TVCA 4X0NA 1ISVA 4BQ4A 3I3BA 3RDKA 3VIJA 3AZRA 2BVDA 5FKYA 2WC3A 2EO7A 4DM2A 1JNEA 1V02E 3WDIA 5EMYA 2XVGA 1JZ4A 3TONA 4DO4A 1RD6A 5A1AA 3SCOA 1LL4A 2ZICA 2F18A 1XYFA 3AIRA 4LYQA 1E3ZA 5JBEA 4JFWA 5CPQA 5D9OA 1CYGA 3ZR5A 4UR9A 2V3FA 2VCBA 1HJQA 4NRRA 1DWHM 2ZE0A 5DEZA 6CGTA 2OSXA 4D1IA 2QPUA 4NSBA 1KXQA 3ARZA 4WK9A 1UWIA 4FLQA 1OIFA 2FE0A 1TA3A 5A6AA 3GBEA 2WC4A 4D6EA 8CGTA 4PCSA 2NT1A 3D51A 4GINA 4AZGA 4FF5A 3QOMA 4JZ5A 3L4WA 2W62A 4BQ2A 2VUYA 1IZJA 1W9UA 5DFAA 3BVWA 3BAIA 4UOJA 1KCKA 3D5HA 4UFJA 5I24A 2NW0A 3VIOA 3K4AA 1PPIA 1E72M 1WPCA 4ZEPA 2CBJA 1DWAM 2X05A 4BQ3A 3RILA 1E0VA 3VMPA 2IXUA 3KE0A 4URIA 2VRKA 3CGTA 5AYBA 3IJ9A 1GQJA 2EPKX 4DWSA 4H8UA 3M46A 4ZXOA 2QMKA 3VVGA 2JIWA 1H0IA 2J79A 5FL1A 3AYSA 1KGXA 3FXYA 2QLYA 2J4GA 4UZUA 1B3WA 5CZKA 2PC8A 2XTKA 2VX6A 1CLXA 3AIEA 2X2YA 4GKLA 2JEQA 3NYDA 1NP0A 4DO6A 3T0DA 1BYBA 4UCFA 1E9LA 4XB3A 1VJZA 2XN1A 1QW8A 4IM4A 2B31A 4AZCA 1HJUA 1HNYA 3GXMA 4UQ9A 4A3YA 1VEMA 2WHJA 2VZVA 1SZNA 2WM0A 5A2CA 3AIBA 2WWDA 3PN8A 5KZ6A 4AIOA 1B3YA 2F7OA 4PUDA 1KQYA 1PX3A 4ZE4A 2CHNA 2F7RA 1B0IA 4GIAA 4V27A 3K8MA 2WNWA 2XIBA 3QGVA 2EBNA 3PZMA 4WSKA 4UZSA 3GXIA 4CU6A 3WMSA 5BWFA 5DF0A 2QF8A 3HU7A 4S3JA 5LYRA 3EDDA 2WMJA 3BAYA 1BSIA 1UG6A 1VB9A 1V3HA 2UY3A 3SCSA 4DWSD 2VC9A 5FIPA 5BXPA 1NOWA 2WSPA 5HDRA 3WNPA 2BY0A 3GNPA 2DT2A 1EA9C 4JL1A 4CD6A 1UWSA 4PRWA 1BVZA 3VGFA 2ZXDA 3UERA 3VD5A 1CZ1A 1CNVA 4X0VA 1GONA 3GZAA 5LA0A 1VFUA 3VD4A 1ISXA 2CKRA 3WNMA 3FHAA 3I3EA 3PHAA 3AXIA 4QFUA 1CGYA 2A3BA 4C7FA 4PMDA 2VI0A 1J9YA 1HF6A 2D22A 5I77A 1IV8A 4FNPA 1B9ZA 3ZJ8A 4AMCA 1EOMA 2X09A 1WZKA 1R33A 3LPPA 1IT0A 1CLVA 1UASA 1WNOA 2IXVA 2J25A 3RM9A 4H41A 2J74A 3DHUA 3MU7A 3UR7A 3WSUA 2DEPA 1ODUA 3PBGA 2CETA 2BS9A 4QAWA 3GH4A 2YA1A 3UG4A 4CD5A 2WVTA 1V02A 2YDQA 3AIUA 1UKOA 4V28A 1OBAA 2WVVA 1E0WA 1WE5A 2J7DA 3AMLA 3CIVA 5IXEA 1EIBA 3MSGA 2XHYA 2XSBA 3FN9A 5HNNA 3AI0A 3U7VA 3SEPA 5CQ1A 4K68A 3SCUA 4Z2LA 3OG2A 3W37A 3NJ3A 5GQBA 3IANA 1EOKA 3VNYA 3AS1A 3BAWA 2VX4A 4TVUA 4E8CA 1NQ6A 2PWDA 1DEDA 3BLKA 1QNOA 4LPCA 1UYQA 1ECEA 5LA1A 2D3NA 2BXYA 4HOWA 4P8WA 3ZIZA 2G3JA 1PX4A 1ZBCA 3B8SA 3RPMA 2XGBA 3CH9A 5CLWA 3NSXA 3MUY1 7TAAA 1GUVA 2D23A 1NWTA 1UKQA 4CD7A 1E6RA 1J11A 1V6XA 3WEMA 3VTRA 4P7LA 3JUGA 2DSZA 1R7AA 1GJWA 1G0CA 1K9DA 4PN2A 4JKKA 1KR1A 2ZUSA 3BXWA 5A8NA 1BYAA 1E6ZA 2DSVA 2XN0A 4MB3A 5D9NA 2J8FA 2E8ZA 4HA1A 3AIQA 3WQ6A 2XWEA 1QW9A 1XYZA 4GI9A 1KTBA 4J7RA 3PZQA 3WBEA 2ZX7A 3OZPA 4DWSB 2JF7A 3AMCA 1NWSA 4OBSA 3LX9A 3VSVA 4BF7A 3F4VA 1AQHA 3WELA 2JIEA 1BF2A 4OKDA 1WDPA 2DH2A 3W81A 1LWHA 3ZSSA 4N42A 3D50A 1BQCA 5A2BA 4MNMA 3H54A 3VU2A 2VVSA 5CXPA 4F79A 1WB0A 3WUBA 1E1FA 4L4OA 2YA2A 5GNZA 1K9FA 3BMVA 2CHOA 4UFLA 1TR1A 1ZBWA 3BCDA 2PB1A 1V3JA 2J62A 3CHEA 3SCPA 1V6WA 1QNPA 5BXTA 3DYOA 3PZOA 2VQTA 1HKKA 1E4NA 1W3KA 2J8GA 4GZIA 3OBAA 4HOZA 3CZNA 3ZM8A 3MV01 1BG4A 4J28A 5HXMA 1JXJA 1QI0A 4D6HA 3AQUA 2CITA 3WDRA 4WF7A 2GSJA 4NXSA 1JYVA 4R27A 4AIUA 2ESCA 2DT3A 3O9NA 1OSEA 3BUBA 3A22A 1CPUA 2ZWYA 3EYPA 1X6LA 3SCVA 1KTCA 4CCEA 2VT0A 5I79A 3UG3A 4W8LA 2WZIA 3W27A 1DWFM 4OBRA 3VSUA 4F8XA 4U2YA 1N82A 2WCAA 4HMDA 5BRPA 5GNXA 1V6UA 2WAGA 2G3MA 2OLHA 1QWUA 1BG9A 5A6KA 3VO0A 4TTUA 3ZO9A 3B9DA 2WANA 4UOQA 4Q22A 2ZUUA 4JFUA 2WXDM 5A6SA 5GPRA 1W3JA 1JF6A 3CO4A 1VIWA 1WDSA 3IAQA 2GK1A 1JZ3A 2XFFA 3WD3A 2UY2A 1PIFA 3LRMA 2WVVB 1VENA 3NSMA 1QI3A 3BAXA 1UZ4A 3G6LA 1GOKA 1E56A 4CD8A 2A3HA 1L0PA 3WUGA 3QOKA 3PZTA 3GDBA 2TAAA 1LG1A 4W7WA 3VPLA 1H2JA 1LQ0A 1AQ0A 1ZU8A 1V0KA 3BSHA 3U5YA 1UZ1A 1EHNA 1V3MA 3BAKA 2VNCA 1W1VA 1UKSA 1MFVA 3AICA 4PMRA 2G3IA 5CPSA 1NWUA 4DM1A 2E4TA 3VSTA 5GNYA 2UWFA 3CZ8A 4AD5A 3LPOA 1KBKA 2VTFA 4EAMA 3IJ8A 3ARQA 2O9TA 3AIVA 4P8VA 1VRXA 4H2CA 4Z2KA 3CBWA 1LL7A 1MFUA 5I5RA 3KEHA 1V6VA 1BYDA 2E8YA 2OW6A 4AXNA 1TFVA 1CENA 1G5AA 3KLKA 3GXDA 5BROA 4D72A 4EANA 2WMHA 3CZLA 4J27A 2BVYA 4Q7NA 4B3KA 1CXEA 1GORA 1CEOA 2EEXA 3CZEA 1UWUA 3MV11 1BHGA 1B3XA 4PTXA 4JKLA 2VCAA 1HJSA 1LF1A 1R46A 1H49A 1BTCA 1NOFA 1C91A 4KGJA 3POCA 2ZUMA 2D3LA 4M56A 4DO5A 2CPUA 2X8RA 4UQDA 2DIEA 5A6LA 1LJYA 2BFGA 1VFOA 4XZWA 3WEZA 5TD4A 2WCSA 5A6MA 2EPMX 1QOXA 2CYGA 4AEFA 3S5YA 4JAWA 3GNRA 3VGHA 1MW2A 4J3TA 2XFYA 2WCGA 1LL6A 4D71A 2YA0A 3FNDA 3NDYA 4D1JA 2YL8A 1OD0A 2W4XA 2GJRA 2Z1KA 1XH1A 5M3WA 3IAPA 3A23A 1FFRA 1GQKA 3BUDA 4F9JA 3OLEA 2W91A 1H3GA 2XJ7A 2WZHA 1J0JA 1M03A 2A3EA 3VGBA 3ZSTA 2RGMA 3WH6A 4PSPA 1UA3A 4EKJA 1W9VA 3EJSA 3L4ZA 2YDSA 2YL5A 4CUCA 3DX2A 3A24A 4J3UA 4RE4A 3AMKA 3ZMRA 3HN3A 3W6MA 1R86A 3KWXA 5HPOA 1XH2A 4LQ1A 1C7SA 5E09A 3VIGA 1CIUA 5LA2A 1XHGA 1TVNA 1PBGA 2W63A 3WF2A 2WBKA 3AMGA 3POHA 1JF5A 3AJ7A 3EDFA 2V3GA 3LMYA 4KGLA 3MI6A 2CBUA 3I3DA 1J0HA 1UR9A 1OD8A 4U31A 2ZXQA 5ABGA 1GHRA 3SIMA 1ISZA 1NARA 1Y7VA 3E1F1 4E8DA 3BH4A 3S2CA 3ZJKA 1LWJA 4J3WA 2WMKA 3FW6A 3CHFA 1UWTA 2UY5A 3UESA 4Z2GA 2DDXA 1W9DM 2D2OA 5A69A 4FK9A 4F9DA 2ZIDA 2XG9A 1L8NA 3TA9A 3VM5A 3ARPA 3TV8A 3WD0A 2WC7A 2DPEA 5A8QA 2WVSA 1JD7A 1WZAA 1VEPA 1EO7A 1A47A 4U5IA 4BS0A 2J78A 2GK1B 4A3HA 2EABA 2WZEA 3AIWA 1VFMA 4QLKA 5FOOA 3PZIA 2OYKA 2Y24A 4OGZA 3WN6A 1UWQA 1O7AA 1UKPA 1EHAA 5EBAA 3BLPX 1BPLB 3IGUA 3KL3A 4CGTA 1V3IA 3WQ8A 4PMZA 2FH8A 7A3HA 1WDRA 3M7SA 1UR2A 3WDPP 1ISWA 3GM8A 3W28A 1EH9A 2EPLX 3OB8A 1ZBKA 5BCAA 3TTSA 3B9AA 1W1PA 2WWCA 2VZSA 4OOZA 1V3LA 5D9MA 3SUVA 1IZKA 2WKLA 4MPKA 5AY7A 3N17A 1XGZA 3DECA 5BXSA 3BGAA 1HXJA 3K8LA 4FNTA 2EPOA 1X1NA 5A8MA 1HX0A 1UOKA 3CUGA 1TE1A 3AHTA 4KRUA 3WY2A 3VMNA 2VCCA 4QP0A 2X2IA 4AD3A 2DSUA 2O9RA 1JL8A 5JBDA 2X2HA 4FNUA 3ZT7A 1PEZA 4MNKA 1GQIA 1KBBA 4W87A 4AEEA 3N18A 1TG7A 1C93A 1UH2A 4WKFA 1WAWA 1UD6A 2W61A 2JF6A 3AISA 1E4LA 4PMNA 1WKYA 3BUQA 1US2A 1TMQA 1KB3A 2NSXA 4NXKA 2J7HA 3SCWA 1NWRA 4ZENA 1E43A 3N1AA 4BA0A 1C7TA 2FHCA 2BXZA 1JDDA 2D1ZA 1YQ2A 4HA3A 1QI2A 4W5UA 4GXPA 4AISA 2OYLA 1C92A 5E6YA 4WIWA 4FLRA 1BYCA 4ZE5A 1G9HA 3WH7A 1LG2A 4W5ZA 4P7OA 3N15A 1OT2A 2XWDA 4UQBA 4LYPA 2DSKA 2G4FA 1CXFA 3ARWA 4AY1A 4J3VA 2GJXA 3VDHA 1F4AA 4D6DA 1D2KA 5CSYA 1GNXA 2ZUVA 2RGLA 3WD2A 4DWSC 3OIHA 4GPNA 2CESA 2XVKA 1CGXA 1PZ2A 2G41A 5A95A 3EMQA 5DT7A 4YN5A 2WHLA 3AXHA 3M6DA 4NZJA 3VNZA 4HU8A 2WHKA 1HJVA 4HZ7A 2CXGA 4OZOA 4W85A 4PTWA 2ZX8A 1OGGA 3N04A 1B3VA 5ECUA 2OYMA 1I1WA 4NRSA 1B31A 4H7VA 4KH2A 2C0HA 4GO9A 3VD3A 1JD9A 1B1YA 3CPUA 4NZFA 3EJPA 4YHGA 5E6ZA 1GW1A 1GQLA 2O92A 3L2MA 1CDGA 8A3HA 2DIJA 3FAXA 1V08A 1XSKA 1BLIA 4GQQA 1OGSA 4OUEA 4W86A 2BHYA 4MTVA 2GJPA 2DT1A 3KLLA 3BVVA 5DT5A 4MAVA 2F7QA 3F5LA 3W24A 2PBGA 4AIEA 1C3FA 5AC4A 1UH3A 1QBAA 2BY1A 3VGDA 5DO8A 2OSYA 3DDGA 3PZUA 2QMJA 4ATWA 4AZHA 3N11A 5ABFA 1SR0A 3OGSA 3W0KA 4JL2A 3AZTA 3FHQA 1KWKA 4JCLA 2VZOA 1HVQA 3M07A 5ABEA 2X0HA 2YFOA 2BY2A 3UEQA 3H53A 4QLJA 3OGVA 4W7UA 2AMGA 2DGAA 4UFIA 1CXHA 1G01A 5E0CA 4UFHA 3D4YA 2C7FA 5D9PA 4AZBA 4AD4A 2AOSA 1KXVA 1GOWA 1PS3A 2BHZA 3AHYA 4ZXLA 2YOCA 3IK2A 1KFWA 1PIGA 4BQ5A 1CGVA 3WFZA 4D6FA 3WDJA 1J0ZA 2X0YA 1FOBA 4R5EA 3WIJA 2VOTA 1UWRA 4RL3A 5A8OA 4AW7A 4RE3A 1J18A 2OWWA 1BAGA 2OWCA 5CGMA 3PZGA 3EDKA 5CLTA 4AMXA 1CTNA 2NT0A 3VD7A 3VUPA 3AHZA 3HJEA 1GHSA 3AMDA 3WNLA 3GNOA 6TAAA 1FH8A 1QNQA 2E40A 3SCNA 3VD9A 4FNRA 3OA5A 1SFSA 1XC6A
chains in the Genus database with same CATH superfamily
4I3SH 4KRLB 2RAGA 3WF1A 1QHOA 2VM9A 1KZQA 4L0PB 4IIGA 5KINA 4XBSA 3PSWA 4XTRC 4ZQMA 3W2LA 4Z7UF 3BL3A 2VX5A 1W1ZA 2NCEA 3IXAA 3GKAA 5D09A 4PY7B 3X12A 2ITCA 3QUYC 4G6AD 4BK5C 2QQNH 4K8RH 4S1QL 1QR4A 3U6RB 2BHUA 4Q8BA 1EHLL 3VI2A 5KVFE 2CDFB 3FGCA 3CXOA 3FSAA 1EDYA 3DETC 3N43F 3ALXA 5BOFA 3C6CA 2DQHH 3RUBL 3UWUA 4A8RA 1I75A 4U1KB 4XCYA 1BX2B 1ZDSA 3SDYL 2GGEA 4K9EC 1JGIA 1MXSA 4R0LC 1M7OA 3GLEA 4ZPVB 3UYIA 1X6UA 4ZGYA 1Z3NA 3T6QC 1V03A 4F33B 1BECA 2YLAA 3LK6A 2E9WA 3STZA 1NBZB 1VGKA 4L3CB 3K2UL 4JRXE 1KKRA 1AG6A 4PB9L 5AFAA 2IPUK 5D04C 3FQRA 3SQBB 1H11A 4HTBA 1UZ6E 4M6VA 3FT3B 5MEOB 1M6UA 4MMYA 4TQIA 3W07A 4O51B 1PV8A 4M8QA 5FEXA 4YHNB 2AXFB 1KCRL 2V82A 3CQQA 4TUOA 2NX9A 2ZWLT 5B38A 5CJMA 2DBJA 5JUEL 4NJAL 1CXIA 1QSFE 3F7QA 2XH2A 1BXNA 4TMBA 4WLCA 2CBIA 3RPKA 1DVTA 1RIUL 3W0WD 1D9KD 3CMJA 5CGTA 3ES6A 5D03A 4OLUL 4ECLA 3BX7C 1JPHA 3BZGA 3NSJA 3KPRE 4ANXA 4HWUA 5EWIL 2VEIA 3LHTA 3MO4A 2DYPB 1J9TA 5F0MB 3MA9L 1W91A 1E6PA 2XTJC 3A64A 4BKSC 1UXWA 2IGFL 1Z5LB 3S37H 2XFXA 2J6WA 1IVTA 2BSBA 1KC5H 3ZKMD 4IGSA 4L61A 2IO5A 1VF8A 4K3DL 4FXFA 2V8LA 2FWLB 3CFTA 3SDDB 3I6SA 1NFAA 1ECYA 5JR1H 4GRLD 5C2BH 1F3DJ 3M0KA 3KHOA 2O30A 3FSWA 3V4PL 4MNHB 4TTGA 4X6DF 5I6XC 2DQEH 3DOIA 4W6XB 2R1LA 3MUCA 2BWDA 4JY6B 4PBDA 2A1WL 3CIWA 3TJHD 2ED6A 1BZ7B 4JRXA 4RAUA 2Q7AA 2IPGA 5JU6A 3GSUA 3UZVA 3OTRA 2OMYB 3O3BA 3SGKC 3PAUA 3MRIA 1Z9OA 4MCZB 4XZMX 3FB6B 3HJZA 3ZTDC 3FDKA 5ESQA 3P40A 3BI9X 3VQLA 3JVFC 4GKZB 5BV7C 3BPCA 2G96A 2DQCH 5FL0A 4YXKL 2HLAA 1WFMA 3J8F7 3U4EA 1TTQA 1H0DB 5E0FA 1FCCA 1QSFA 5HYJE 4O4VA 4YVUA 4EBQH 3CHDA 2O61A 3W2DH 3D52A 1IBDA 1XGRA 3NK3A 3LN3A 1V7ML 2IAMA 1QBML 4MRCA 5AL8A 1JRHI 3KPQB 4Q2ZB 5BOPA 1DSFH 4EE2A 3KPRA 1HP5A 4CNSA 5F8QC 1NGYA 2L7EA 3RU8H 3DX7A 3N3MA 4FX8A 3INUL 2OGYA 1K2DA 3H2OA 1UBSA 1JMZA 2WMIA 1JMXA 3VFUB 1GVFA 1D5ZB 3EKLA 1RK0A 3MFFA 2J24A 4YE0A 2GSMB 4CC4C 4ACZA 4XHJD 1EUNA 4WGXA 5IF0A 2P88A 1JIBA 3ARDB 2JV6A 4WKZA 4HGWB 5DRWB 4AQ8A 4YHLL 1TJGL 2ZX6A 1YYLL 1M1SA 1WZMA 2WHVA 1VPXA 4XZUA 1LUCA 4EZLA 2CCRA 1XH0A 5CCGE 2W07A 2FB3A 1ZLWH 2L0DA 3ULUH 1D9EA 1DWJM 1HT6A 5H2BA 3AYTA 3FEQA 4KTEH 3TA3A 2RD0A 1OAQH 2B3RA 1KYFA 4D6GA 3T65A 5GRJH 1GW6A 1IBZA 3DOSB 2VGFA 7CGTA 3EO0A 4O2FB 2FUTA 5I19H 2HX8A 3VOJA 1U93A 3EKZA 2P9RA 4HUWB 4BIKA 1RBOB 2HNEA 3F7YA 3MI2A 1H63A 1VERA 3ARED 5JW5B 4ZMQA 3EZ8A 4J1OA 5D8ZA 2R1NA 4PMYA 3LQAH 3G18A 4M6PA 2ZZ7A 5IG7A 4WFFE 3M1ZA 2HBXA 3DIDA 4M93B 2CIPA 4MXVF 4ZNEE 3RCMA 2AAAA 3PV6A 1U1UA 4A6YL 3PZ9A 3MSPA 4B5XA 3FU9A 2HXAA 4K2UL 2Z92B 5MKGA 4L37A 2ZXEB 4G9FD 2A6KA 4ZQKA 3V6ZA 5HYJA 3SUTA 4EI5C 1N64H 4KJYA 4Z3JA 1BWKA 4N26A 5CAHA 1J05B 2VL4A 3VFWA 2DZUA 3B4YA 4RWHA 3M1OA 4EUPB 1WIOA 3QEUA 1OSYA 1ZVSB 3L1OL 2BGSA 5GHWH 3UPAA 4PJXF 2BODX 3ZKXC 3UEZA 3IJYA 5IP4A 4LMQE 3EGDB 3KLAB 1MZZA 1XF3A 1IJ9A 4AZIA 1FFOA 4RCAA 4EOWL 3CUFA 1SYSA 1C5DB 2I9TA 2FT6A 2BP8B 5HK4A 4IJBA 4YNYB 1H7RA 2H6UA 1XF5A 5CEWA 4FFYH 4LGXA 4UQCA 1FA4A 1PCXA 1QNVA 4W88A 4FA7B 2BW5A 3NIYA 3RUGB 1ZS2A 4DQOL 1R3VA 3TWCL 3CFEB 4FD0A 1L9SA 2NZLA 3UFYA 3BCFA 4NQCB 3IDMB 4MZRA 4AWSA 3P2BA 3CFCL 4Q8WA 3PDOA 2V9QA 2PCPA 4U1SA 3TN0A 1O5KA 1Q9KA 1PEWA 5TDOB 3HAEG 2WNXA 4LGRB 2J43A 3YPIA 2NY4C 3CFIC 2VD9A 3NURA 4CILA 4OE7A 2RDUA 1Y1UA 1EO8H 3DJ9A 5JIPA 1TTUA 4XX1G 1E6SM 2PYED 3LENA 2FFIA 4LRNL 4JPIB 3AQYA 1FH5L 1SFJA 1PZBA 2QLVB 5RUBA 4MJ2A 1N6VA 4ZSUA 3QEHB 4FP1A 2ZOOA 5F4XA 3N6YA 4X4YA 2NZ9D 2F6XA 4ZNEA 3NO5A 1Q2RA 2Q6ZA 2IKIA 2Q6WA 1X5FA 1D2OA 3FFDA 5DCDA 1H3WM 3VFTB 5F7EL 1WEJL 2IQAB 2V2XA 3QHNA 3O07A 3GFYA 1H15B 3G08B 5FYKL 3SSGA 1GVQA 4G5ZL 5EU5A 1MHCA 4FQ2H 5CJ5A 2Y8VA 4I0PC 3L5JA 4LXFA 3NJGA 4Y1SA 5E5MA 1GYAA 4QTHB 4IGBD 2BJMH 2J7GA 1HKWA 2W88A 5JW3L 4UB0L 3BMXA 5JYMA 3UBGA 3I3BA 4Y4FB 5IJVA 3RDKA 1KM4A 3AG2B 1GPOL 3SKJL 3I10A 2C34A 4UQ2A 2CDGA 2YAHA 4U6XA 4JFWA 5D9OA 4QS6A 1M7JA 3UZYA 5HHPB 4Q4PA 1NC4B 2NY7L 5BZWB 4M7KL 2N4IA 3VI3B 2Y1VA 8CGTA 3TH3T 2NT1A 4AZGA 4EF8A 2W62A 3RLUA 4TUKL 3IN2A 2Y69B 4GUCA 1KCKA 5FUCC 1FCGA 1ETZB 4K94C 3M64A 3HC3L 2DMBA 3HC0B 1XUZA 4X61A 2VRKA 4YXLL 1Z3RA 4DO7A 3RL2B 4GFTB 4F8TA 2XRAL 2XTKA 2VX6A 8XIMA 4GUIA 4GKLA 2JEQA 3RIFF 4GI4A 4UCFA 4IM4A 2Q0ZX 1MFAL 1I45A 3MA9H 2AGTA 4AW4A 1F76A 3VFNA 3AW5A 3CPLB 5F7YC 3Q43A 1NINA 3GXIA 4XPTH 1W8OA 5DF0A 3BGFC 5GGTA 4FX6M 3B0XA 5JHDD 2V5RA 2BY0A 4LASL 4G6FB 3FBQA 1XCQB 1ZGDA 1EA9C 3VGFA 5KJ4A 2VUKA 2QZRA 2FJHB 4ZMOA 4U1IB 4HJ0C 2PNDA 2R8SL 3WN5C 4FYRA 4HKJA 2EYRA 3I4EA 1Q9LA 3I3EA 2ODHA 3LZ3A 4C7FA 4F7PB 4O0KA 3NJXA 1YTKA 3WO3B 3SBWC 3FU5A 4XGZA 2FSEA 1XBVA 3OR6B 3L9RA 4A2FA 3CZUB 3WI9A 3O2DH 4O00A 4X6CE 3MCMA 4L0ZA 4LCQA 2HRGA 1PU0A 2PLKA 2VSDA 4WCJA 2APBA 3OVQA 4DAIA 2VR7A 1RCYA 5ITBL 1TYJA 2Z91B 5I1KL 4FI8A 4MM1A 2VX4A 4TVUA 3SPGA 2JJTC 3CL8A 4LGPB 3I6TA 5E7BA 1U9KA 4HOWA 1I8AA 1YEWA 1OB1A 4JYEA 3G6JE 4OY9A 1OCRB 3LLDA 3PSVA 2WLHA 4XPAH 1IAIM 6ENLA 4TQTA 2XT1B 5HA7A 4NQVB 4GG8A 1ZHKA 3QUYA 4B5VA 2AQSA 5ADPH 1E9PA 1QBMH 4YSQA 5FOJA 4BK5A 1SXNA 4MKMA 4CSZA 3RY4A 3EGSB 1T7WA 2XTJE 3D25A 4L9LB 4NQXB 3UABA 1AQHA 3W81A 2DH2A 1XYAA 1JVKA 4QITA 1GZQA 4X98A 4G1EB 3CMOL 2DQGL 5CUSL 1O5PA 4TV3A 1RCQA 2UY6A 5CXPA 3SKUD 3UBFA 2BASA 1WV2A 1SO4A 4NKCA 3DFNA 2XIOA 4IRJC 4XMKL 3LZFH 1WFIA 5T1DH 4YHYB 2VKWA 4R0LA 5BJTB 5ACZB 4JMNA 1T66C 3SPVA 1S9XA 1O6TA 3PGDB 1YYLH 1QK2A 5JOPE 1W0WB 1IIIA 4O8RA 5KN5A 1QFHA 3O9NA 5C9JA 3BUBA 4H1LH 3CFJB 1IKNC 4J3OH 3V0JA 1RD5A 2HT4C 1I3UA 3SCVA 5DLML 3ULVH 3A4JA 2QCLA 1X7QA 4F8XA 2A0LD 4HMDA 4U2YA 2JELH 2V9RA 1RUKL 1HEZA 1M57B 1AL7A 2G3MA 2QT6A 2R1WA 3U36B 2OLHA 1BG9A 3QXUA 4RZ5A 4YE4L 2A7NA 4X6CA 4TSAH 2CWRA 1UCTA 5A6SA 1JK9A 2YAMA 3FB7A 1TKKA 3AXLA 4XODA 3R1GH 4L5FL 5I02A 3R19A 1HNGA 4CRPA 4J8QA 3QOKA 2MQ3A 2NXZC 4YBLB 2TAAA 4W7WA 2VD8A 2BDNL 3TV3L 3BKJH 2VR9A 2X4SA 4PJBE 3W7QA 3BO9A 2G2NA 5LNEA 3G6JA 5KAQF 4XVUD 1U8CB 3R8BB 1O1HA 5AHLA 1UCWA 3VFLA 2O9TA 3MV7D 4NUJA 1D5XB 3FXGA 4JPKL 4F15B 3T0ED 5DK2A 1PLAA 5LXXA 2Y72A 1YJDH 2WMHA 1HHIB 3O6DA 1CEOA 1NGXA 2OKTA 1LM1A 2HG0A 5DBUA 1C91A 4OM1L 2WZPA 3MNWB 5DC0A 3TJXA 5IOPA 5IHZA 2YYTA 1AKJD 3OKMA 5KSBF 5CPNA 3CIXA 2DOCA 4K5LA 1CF8L 3MDJA 1MUJB 4QR6A 4HKBA 4YO0A 3RX3A 1IUZA 3QUXB 5FJUA 2XFYA 4GC4A 4XX5A 1L9PA 4AZUA 2JGYA 2YA0A 1GMEA 5KG9B 5DI8B 2GEEA 2W4XA 4RMTA 4B53A 1D5RA 1OW0C 2ADIB 3NTYA 4LAOA 5C1MB 3ZS4A 3DO7B 1HFBA 3NBNA 4DI9A 3WH6A 1NAMB 1BQSA 3S9ZA 1HH6A 5J1AB 2UZXA 1CFVH 4HK0A 1IAKA 2GSHA 4Z1PA 1FNFA 1HOCB 4EVNB 2N59A 2X4UA 3LMYA 5DVLA 3SGKA 3QFJE 3SIMA 3NQ2A 1Y18B 1I4NA 3M0IA 4PJ9D 1TJIH 3B8TA 1MN4A 3IJ6A 1I1YA 3WUWA 4I9WE 1JZJA 1N6QL 3K6OA 4P3DA 3GM0A 5C08D 4LBEA 3BW3A 5DS8A 4ODXB 1DXIA 3UBHA 5BMXA 4N2CA 4N2KA 4XNMB 3NL3A 2VDOL 4PJBA 4K07A 2VSKB 5IB4B 3AU1A 1NTHA 1ZIAA 3OF6A 5DD6A 2XBDA 3HZVB 4QYOB 3VE0A 4Q4SA 2ATKA 4KVPA 2ZONA 1P1XA 2MPAH 3F4NA 3SKJH 1ZV2A 4LOVA 5DC4B 4P07A 4LSTL 3LNFA 4D0DA 4JTSA 1DJYA 4UDTB 5A40E 4NZUL 1KBBA 4CC4A 3HV8A 4EXKA 2XY2A 2E6YA 2VDQH 4XR8C 4WKFA 5LNSA 4YIQA 3NA9H 3AISA 4BUQA 3D1MC 4OIIL 4N2LA 4N8PA 3BUQA 3VYLA 1TMQA 2NY7H 3PF2A 1H6TA 2FHCA 2HVOA 1X97A 2EHHA 2QCGA 4W5UA 4DQAA 4O9HH 4Z0XA 1FG9C 4HIQA 4O4WA 5GS2H 4W5ZA 1RPQA 1T6MA 4FQHA 2NWSA 4ISVB 3BCJA 1HXMB 3MLVH 3FTYA 2G5UA 3FO1A 4YXLH 4N2MA 1X9QA 5GGRA 4J23A 2GGGA 1U8IA 5ISZD 4JM2B 3AB0B 4MD4A 5IW1A 2WXFA 5CJNA 4ZB2A 4DEWA 3FOMA 4WFEE 3QFJA 1WOAA 5JQIB 4Y9AA 3SO3C 4OIBA 4F37K 4NN6C 5CU9A 2YRBA 4FXLA 1EWEA 5ACMA 1JD9A 3CPUA 4XZLX 2QJHA 3L2MA 8A3HA 1T2QH 2E6FA 4DFIA 3H8AA 1ZUAX 1S78C 2BHYA 5IOBA 4ORMA 2AERT 4AIEA 4GQ9L 3TNMB 2QULA 4W1TA 4ATWA 4EI5A 1LOSA 3W0KA 2R8SH 3L66A 5ABZA 2X0HA 2BY2A 1VZIA 2Y5JA 1MHEA 4W7UA 4A38A 5LSMA 4LVBA 9XIMA 5E8DL 4Z7QB 1LMKA 4BK8A 4MAYC 4QE4A 1HCZA 1GOWA 1WCBA 1PS3A 3SR7A 4Z7UE 4YEEA 5HINA 5CKGA 5E2TL 3RG1C 1VR6A 4LUTA 4LUSA 3SKNA 1R3YA 3GHBH 3S6CA 2CK0H 4KRNA 1AMKA 5EOQH 3DI2B 1R2RA 3VE9A 2EE3A 1R5VA 4QWWD 5CD3B 1YUKB 3WHE0 5ITBH 3G1XA 5CS7A 2Y70A 4MJHA 3WNLA 4N2EA 4WU5A 3NEOA 3OA5A 2DM4A 3VNKA 4P9HC 3TJPA 5FUCE 1I7RB 1QBBA 5MF5A 1E27B 5TFSL 4ZFZB 3EX3A 3K0WA 3E02A 3PFQA 2V81A 1JHKL 2CRMA 3PLYA 4LCVA 1D3CA 1HL2A 3DBSA 4NI6A 5A6TC 1ZHNB 2Z31D 4LSPL 3ZDZB 2AJXL 4JB9H 3V0AC 3SQOH 1TPWA 4AVHA 4NVTA 2IUZA 2X4NA 3FYYA 1OFBA 4NQEB 1HN1A 1TZHB 5LCVA 2NV1A 4Z7NB 1UA7A 4C6OA 1CDUA 2K3HA 2J75A 3MC0A 5CEZD 4TTDD 3HE7C 2XVLA 3CMOH 4WJXA 4HSNA 1MWAB 2WXOA 5CUSH 4P3WA 4PRIE 2UV3A 4QRRB 1JPST 3LV3A 4XMKH 3GO2A 1EP1A 3A4WA 4ZD3L 1ODZA 3GI8L 3KX6A 1ZANL 3WTTA 1IQDA 3PHOB 4Z7OB 2PETA 4PLOB 1L7IL 1P69B 1CFMA 5IR1B 3UACA 4JICA 2K7QA 2PPEA 1P1ZA 3IRPX 1XB8A 3LU2A 3FONA 3NT0A 4HS6B 2WXGA 4Z7UA 5M95B 5I73B 1AQKH 4RFNB 3KL5A 2HJLA 3N1FC 3HR6A 5IZ7A 4TOQA 2Q86B 3EDEA 4MGGA 3FJLA 3BZ5A 5PTDA 4Y7EA 2FLRT 1MCWW 1GY2A 4XKMA 3QG6B 2FB4H 1F9CA 4FFZH 1ET8A 5JMOC 1G4EA 4AXWB 3HI5H 3UYPA 3TKFA 4AL8H 4DP9X 3A4AA 1R1CA 4WI9A 4RPQA 4JY5H 3LPGA 4Z3IA 3TV3H 2NOYA 1DQDH 2PI6A 3WQOA 5DSCB 3S6OA 4ATLA 4OZGB 4DFHA 1NDMA 4I0KA 4JTJA 3TJIA 4TVPH 2PDXA 3GINA 5BMWA 3P2TA 5IB1B 4KWUA 5AW6B 3TNNB 4YTQA 4H19A 2X6VA 1BJ1J 4LLWA 3GMQA 4NBZB 4GI8A 1MEHA 4NO0D 4M1RA 4JEGB 5ID1A 3WNJA 2HLEB 3P5ZA 3GRWA 1UFGA 3S4SG 2NY2B 3MXVL 3T4CA 4GBXD 3N2MA 3QNYA 4GZEA 1GOGA 1J1XH 2DVXA 3OJ2C 4I18C 5T3XH 1W3LA 1CGUA 5EO1A 4PRIA 4L7ZA 2ICWI 3VH8B 3MJ7A 1WS8A 1G9ML 3H9HA 4XBGB 4GAGL 1AS6A 2OZ4L 3HB9A 4P99A 4H8QA 4PFMA 3CTTA 1AGFB 1VHCA 4NO5B 4OD3L 1I9IL 4XAFA 3WN5A 4LCWB 4GO8A 5KVDH 3MNZA 1IAMA 4WXZA 4LLUA 1S7WA 3K6NA 3SBWA 4U1GB 4N0YH 5A3HA 3O4LB 2NNAB 3EBGA 4DKDC 5DUBA 4KEMA 1ZRUA 3TCEA 4PYGA 5LB1A 2YB4A 3L54A 5JH1A 4HIHB 3C56A 4LALA 4OI9A 4YBHA 3RBGA 4RKAA 5BS0E 3UPBA 4NJIA 3SCMD 1H51A 1H7XA 5AZUA 2PWUA 3THMH 2XVNA 2JJTA 3D48R 4RGNB 4PUBH 3MRMB 4GXMA 3UIZA 4JZOA 4N20A 3ES8A 4OF3A 5B8CB 3Q6FA 4JN2A 3AALA 4HZ8A 1IEQA 2VDOH 4AVJA 2DLHA 2IXQA 1DP0A 4AZ6A 3ABZA 4MNLA 1XD0A 1BF8A 2IG2H 1T04A 3WBYA 3B7YA 5C3IA 3DLQR 4YPJA 5M2FX 5BU9A 4OM0L 1CFTB 2CUMA 4MFDA 3QIBD 1SSDA 4HDIA 3LQLA 1OB0A 4LSTH 4GLEA 4KBPA 2IMNA 1IJNA 4HPOH 3TCSA 4IRJA 3SUUA 4EUPG 5HJ3A 5C2UB 4W8AA 3SDAD 4D94A 3CVHB 4DJEC 2P76A 1OEZW 3ZQ9A 1JCXA 3MNDA 5IUSA 2CLRA 4IQJA 2P3ZA 1S7UA 4YDJA 2OL3B 1FGNL 2R69H 3Q6GH 1AZZC 4B96A 1XM3A 3RVVC 2BINA 3IJHB 3FUJA 1QASA 3R06A 4PSRA 2AC0A 4XP4H 1IKNA 1B4JH 3LTVA 4L23A 2FGZA 4Y19E 1T5KA 4FLOA 2ZP8A 3DGGB 4CNUA 4POUB 4X6CF 3DI3B 4U5KA 1NWOA 4WAFA 2EDTA 3BDKA 4OZFH 1AW1A 3O3EA 3O6ML 3X14B 1DDHA 2R7EB 1TUFA 4U4IA 4IL0A 3GMOA 4MYAA 2XG5A 4PV9A 3RVXC 1WDQA 3V5DB 1KCUH 2QELA 2X16A 2GJ6E 2NY6D 5ES4B 5BS0A 1WQ5A 4ABUA 3C6EA 1OCCB 3G6JF 4P7QA 3NACL 2VISB 4MTMA 1HQRB 5DJXB 3B5TA 5BW7C 2CA4A 4KKBD 2XUCA 2XFRA 5KJRH 4LVAA 2Z9TA 4Y6GA 1UHVA 1BV8A 2WLMA 3HMXL 4J3ZA 2JJUA 4NYYA 2EXWC 2MOQA 2BVTA 2PPDA 4JHUA 2JCWA 3U0WL 3L5MA 3WL9B 5CCJA 1LEGB 3M1CA 1HKJA 3FQ2A 4K3GA 4YIWA 2DEXX 5D7LE 4DKFL 1T6BX 3DESA 3GKFA 1T89C 1NBVH 1MUCA 2BSLA 1E4XH 4JO3H 1SJEB 4HJIA 2BPBA 1CWVA 1SHMA 4KU1A 1ELSA 4PJFF 4DOHB 3NPXA 4DUOA 3NCXA 4Z1AA 3H2FA 3VGGA 3ZHLA 1OW0A 3GFUA 4FQLH 4JFED 4HCRL 4HFUH 2ZCHH 4WO4B 4C4UA 4NNPL 4E0CA 4J4PC 4MA8L 3NJNA 3ETBF 1XR2A 1UM5L 4Z0BH 3CWGA 4U10A 4OOUA 4ROPA 4Y19A 2EDYA 4ZFGL 3QFDA 2QCFA 3CLEH 1FQ0A 3GUFA 4N5ED 2BLEA 4DTGH 3QSTA 4JPQA 2YQ2A 4K55A 4R2GB 2D0HA 2H26B 2AQ1A 4HU4A 1TITA 4FFVD 5FO8A 1XL6A 4U05A 1PQZA 1EQCA 2A4AA 5CSUA 3DSFH 3TT3H 3BDXA 4P46D 4NP9A 5CZJA 3EYSH 4ZXBB 4MVBC 1SBSH 2GJ6A 1P0BA 1WBXA 1YEIL 2RBLA 1RJZB 1EJWC 4P2RB 3WKNA 5ID0B 3D0VB 3FRPA 3V4LA 1IEBB 4QY8B 5I17B 3RO8A 2EP6A 4Y5VC 5E2WH 4CBPA 5HYIA 3BUPA 3AJXA 5FKAA 5I18L 3DMMB 3K13A 3UCQA 4XBPB 1IXPA 1S3RA 4WEVX 1IVLA 1JXDA 3TTOA 1QFWM 3PWVB 5IWLC 3TE9A 4MG4A 2R1MA 1W1YA 4XO6A 4HTYA 1JCLA 1YEHH 3QUMB 4HWNA 3TTQA 4UT9L 2ZUTA 3IU4H 3H3KA 3GH7A 1ITBB 4Q6IB 3TX4A 1QJWA 1RK7A 4MJ4A 2YZRA 2X6MA 1JAEA 5E2UL 1TMHA 4HS3B 1A4JA 1OE3A 4KZDH 3SY0A 4GA8A 1DVFB 5CEXB 2YARA 4CEUC 2W8CA 3S8FB 1A6TA 4UC5A 3O8XC 2EDDA 3GNML 5ENLA 1YDPB 3CNYA 3PPGA 2EH7L 1KBGH 4XK2A 1OTTD 4O2CB 4D6EA 1FC2D 4EI0A 1AHKA 3P54A 3OVPA 4C56D 3U30C 2X4RB 1EAPA 4AM0A 3HOJA 4JX5A 2RHGA 3K4AA 5DN1A 4BRJA 3HNVL 4IIEA 3FTVA 1D5IL 3AUWB 1MQ8A 5HHNB 3IJ9A 1GQJA 1EBHA 5FL1A 2Y7EA 4DLMA 1U8LB 6XIAA 3BSZA 3TC7A 1SGJA 2KPNA 1FDYA 1G7LB 5DVKA 1NP0A 3TWBA 5T33L 1HJUA 3NYZA 2JTDA 3JWDH 3I9PA 1TIWA 1GA2A 2NX5E 3PN8A 3USZA 5DRXB 5CPOA 1T6VN 1KQYA 1CZ8H 2R2HB 2F7RA 3QJFA 3ULSA 4S3FA 1E5YA 3MVIA 2AAMA 4F40A 4H13C 3WMSA 2Q3OA 1S5IH 4E42B 4C1LA 3GTVA 2ZVRA 2CU9A 2MRYA 3DX6A 2YGOA 1MEXH 2CO1A 2R1KA 4GAGH 2VXSH 4Z8FH 4CD6A 1TPFA 1YHPA 3VXPB 1W8NA 5IEKB 2L8AA 2Q8BH 5D7EA 4XD4A 4B0MB 1CNVA 3PB2A 4WV1C 1PYWB 2HT2D 3QIWC 4YMPA 3NK4A 2YXOA 1CFQA 3AXIA 3DVNA 3FVDA 2KT6A 1MHPL 4E8GA 2R23B 5I77A 4MAYA 2OMVB 3TC9A 4A2LA 1IT0A 1TYGA 2QGDA 4M61A 3VB8A 4ZMZA 3E2HB 4AZ8B 4L9ZA 3UL4A 4FG4A 1FRGL 4EX4A 1EQWA 1YQVL 1PKYA 4WWOA 3G1YA 3FN9A 3QCUH 3AI0A 1IT9L 3W73A 1XMWA 1NL0L 3V36A 1XEUA 2V30A 1HXYA 1TPXC 4F8PA 3BKCH 3EX1A 2KZ1B 1KGIA 1Q38A 1A6ZB 3KVKA 1I8MB 2EXSA 1UIPA 4JFHE 3IMTA 1OE2A 2J6EH 7REQB 2XGBA 2W6RA 1QOQA 2GSIB 2D23A 5FUZH 5J7CC 3LMJH 1KB5B 5CO1A 3SYCA 5C6TH 4BFJA 1G7HB 2QKIB 3LZLA 2BVPB 1IAIH 5I2IB 3PC0A 3P4LA 4KRMB 4KTGA 4WK2B 3H2QA 2X4QA 4AVNA 2VRAA 3HE7A 4BFBD 3K5SA 1YBQA 2NX5A 3GW3A 4V1DE 4BHUI 2CIIB 1BWMA 1TTBA 4HH8A 3RVTC 2D03H 5B39A 3QXVA 1RBLA 1SDDA 5GNZA 4HUVB 2CHOA 1V51A 2ZAHA 1AZNA 4I9JA 2VXNA 1S5WA 2F0CA 4OGXL 1TQJA 3EX4A 3CZNA 4PODA 1AHWC 2A9DA 5E5CA 3OR7B 4H6EA 1JNNL 4JG5A 5KVEH 3TQPA 2EECA 1A0QH 1R3LB 4QIUA 3MUJA 3V4VH 1F1DA 5JPNC 2H0EA 3REVA 1CL7L 5C0RL 3OJDB 5CCHE 3W76A 3GMRA 1BQUA 2A7RA 3GNNA 3QUKA 3FIGA 2C1IA 2XKSA 2BZ7A 3VTTA 1XF4A 2IH8A 3ZVHA 5KVGL 5C0GA 3UADA 4CNNA 4XMUA 2XG4A 3MLTA 3GDBA 4ZMWA 4PWFA 1FWTA 1Q0EA 3BPNB 1INEH 4G8GE 4HNTA 1V3MA 4QXWA 2ZXWB 3NRFA 4FABL 1W1VA 1UWEH 1GY1A 5F1IA 3FJ4A 1D6EB 5KSBE 4PWIA 1I1AD 2UWFA 3CZ8A 2FPYA 4XTDA 2X6CA 4GNVA 4LAQH 4Y90A 32C2B 3HMXH 4OLZH 3G1FA 5AZ1A 5F4SA 2AXGB 3FTGB 3KLHD 4Z2KA 1MFUA 1N8OE 4HHAB 4ZYKB 4BF5A 3L95B 4WI0B 3LCGA 3GXDA 1KPUB 5BZXA 2O6CA 1B3XA 4RMVA 4C91A 1R46A 4OGAD 4V1DA 5TE6L 4I18A 3SJVD 4M56A 3UJSA 4WGHA 4W4NA 3S5SA 4JLRB 5CR1A 4R9XA 2FX7L 3D5OF 1YNYA 3EW3B 3CSBA 1TIMA 4FULA 4CVZB 4MY8A 5ICYA 2Q20A 1D6VL 3L3GB 3UWVA 4AEIL 1ZXKA 2DWDB 3OWEA 5D1QC 3RTLA 1B2WH 1T7ZA 3I50H 1WA0X 4XRCA 4NNPH 4XP1H 4MQXC 3LIZA 1IEXA 1ZA6A 1UENA 1VPOL 3GSWB 4IBUA 3ESPA 3KVPA 3BWWA 3KRUA 4GFIA 3SRDA 1PBGA 3NAVA 3V9FA 1Z9NA 2NWRA 4IL2A 4X9SA 2YEVB 3P84A 4PUNA 5KSAD 4OFIA 4F57L 1ZGLA 4XPBH 3VOHA 1MJJA 4DX3A 5I1LA 2GK0B 4J3WA 3FUFA 4LF3A 2OQLA 4FK9A 3N0PB 5I0ZA 3VM5A 5TGBB 2GC4C 3T1FB 1IC7L 1DQUA 4OVXA 2WC7A 4M9OA 3MYOA 2DWYA 2V69A 4F7MA 4A3HA 25C8H 4BFEA 1I2NA 2BCKA 4R7XA 4G8GA 3PZIA 4XNZB 2CHDA 4GG6E 1IEAA 1SZGA 1UWQA 4HIBA 1BPLB 5KSBA 4A39A 1MNUH 1MQKH 3WSQH 2ZUQC 1FNAA 3WDPP 4F2FA 3OG3A 3W28A 4JM4L 3RYSA 1UJ3B 2Z93A 4D0BB 5FO9B 3I6RA 2H1PL 1CTOA 2EPOA 5GSVA 4F24A 3CWOX 3H4HA 3PXJA 4KRUA 2P8LB 1ZT4B 4LQFL 3GJEB 1I7TA 3N9SA 3D0LB 5H8PA 1CLOL 3TFBA 3TA4D 3ZT7A 4F0LA 4DJEA 3UJIH 1WAWA 1E4LA 1F2XK 3EOYG 4NXKA 2J7HA 3NTCH 1PZDA 1E43A 1HU8A 5J56B 3HBZA 3S96B 5AG8A 2HJFB 2D1ZA 6PCYA 1G9HA 4LVEA 3BLOA 1OT2A 4OH2A 3DVGB 1D5MB 3NABL 1ILSA 5A2LH 2DZSA 2Z65C 3S4SB 4B2DD 2BSCA 4ODHL 3FTXA 4ZFOL 3LB0A 2DRUA 3B8DA 1AFSA 2HE8A 4R90H 3O0RL 4YN5A 3DGRA 1X8FA 5F9JA 1N8IA 3AU0A 1LO3H 2CXGA 1KTLA 4JO2H 4ADIA 5IHUH 4KRZA 5ECUA 1T96A 4H7VA 1VF5C 4PP2A 1IU1A 1QEWB 2FD6H 2NY0B 4DCQB 5BW7A 4OJCA 3NGFA 1V7NH 3W24A 3RQ3A 4Z3HA 2PTTA 3DROB 3PGFL 1QBAA 3QQDA 4PJGF 2GTWB 1OPOA 4GG6A 1OG6A 3U2SA 4YX2L 3TXVA 3TEUA 3TURA 1FL3A 3B9VA 2WBJD 2YO3A 4HUKB 5F2GA 1B4RA 1MHPH 2BZCA 2BP0A 1OCJA 3P3TA 1C8VA 2CKNA 3OB0H 5EF3A 1OAXH 3LHPL 3DEQA 1T89A 4UNKA 2UUDH 4KQ3L 5J9PB 3RWJA 1HHGB 1QFUH 1NOAA 3MP4A 4WTXA 3WDJA 4W9CC 4PI2A 1XB3A 4JRYE 4R5EA 4O54A 1WWWX 2VOTA 4BV1A 2YSSB 2APSA 3LDBC 3UWQA 3HTLX 5CGMA 2VC7A 4Q0XH 3H7BB 3VUPA 3JUZA 2VXTH 2E40A 2BNUB 3VD9A 2FB2A 4FQQA 2BNRB 5GS0L 4GAYA 1YE6A 3SY1A 4J4PA 4G1MA 1QNSA 1KGJA 3WF4A 1U0QA 3PNRB 3OZKA 1HL5A 2A38A 3BW9B 4HKXB 3QUHA 2XYLA 1JI1A 3V7MA 4NKMA 5H35B 4TNVF 1FIGH 1M05A 1O1ZA 1KTDA 5LWYL 2P52A 3MRLA 4NQTA 4PCFA 1H1YA 3W82A 2FECI 2QJGA 3IFNL 2JXMB 3ME3A 4K71C 5JIIA 2G37A 2QUUA 4N0FA 4QGTA 2N0MA 3C5SB 5U7SA 1M7XA 4YHKL 4WWNA 4F8QA 2A74B 2K3TA 3KR3L 4Y5VA 3W7MA 5TIMA 4ORGA 2X1TA 1Z9SA 1QSED 3AWFA 4M7LH 5G4NA 5I6SA 2P80A 1UD3A 4L8BB 4OGXH 3VXTB 5IWLA 4DK6A 4UILH 4QDMA 2UYLB 1H7PA 4MSWB 4GXVL 4P2OD 2YGVA 1A7OL 1QFWL 5JHLL 3VH8G 3ZPDA 1JNNH 3FRUB 1GGUA 3QPYA 1RZGA 1KR0A 3NCBB 2EYTA 4Z7IA 2XWBA 1HKMA 1CL7H 2X3AA 3V0HA 4WDWA 1PG7L 2PF6A 4BFAA 2DQIL 1ZOXA 4WHTA 2ENQA 5M17A 3K6IA 1TPB1 1N59B 3DDFA 4JRYA 3K1KC 4AD2A 1JDAA 1UP2A 3T0AA 3O8XA 1QOKA 2BMKB 4S1QH 4ROQA 3B9KD 1HL9A 2FZ3B 1EHLH 1ZHAA 1FYTB 4QS5A 3RTQB 1GK8A 4GP4B 5KZDA 2C3VA 4OUUA 3PWPD 3FUKA 3MRFA 4N86A 2MHAA 4GJJA 2APVA 3ALPA 4V1XA 4TX6A 3QQ0A 4DW2L 3IIPA 2PPAA 3RLHA 3SDYH 4YDIL 4NT0A 3MLRL 3G9VA 3PNWA 1SOKA 1IC1A 3OGRA 4LVOB 4TXVB 1BJMA 3PJTA 1I1FB 3HPXA 2C1PB 2WJDA 1QD0A 2Q3ZA 1LEKB 1NBCA 5L8LB 1A5UA 1M1XA 4GS7B 3U1SL 2XM1A 3V1PA 3K2UH 5F7FA 3TVMD 4LHJB 3QVQA 1XRFA 4PB9H 1B57A 3PABB 1HEJC 1OC6A 4HWEL 4O53A 3C2VA 5FLVA 3T40A 2EDQA 3SBFA 4X6BA 3TBSA 3U0PA 3THDA 4P23D 1D6VH 2WWMC 3DX4A 3RB7A 3CV6A 3DSNB 1IGWA 2RACA 1KCRH 3RCNA 4WV1A 3QIWA 3ZTJG 2XLLA 5JUEH 3B9EA 1XR8A 5SWZD 2VLLB 4NJAH 1YEFL 3ZDXB 4F0RA 3KDNA 1TU2A 4WSHA 1EWHA 2XH4A 4GACA 3CHXA 1LRTA 3Q2NA 1OAJA 1JYNA 1RIUH 4LNVA 4BH7B 1W9BM 1WKDA 1HO1A 4OLUH 4PMUA 4LY8A 4M43L 3O15A 5EWIH 5A6BD 3HFML 3OBEA 3P69A 3ATAA 2DZVA 2D3JA 3QHMA 1EXUB 2H45A 4XVJL 4EXQA 4NN7C 2IGFH 1BGAA 2YL9A 2OMWA 1IC7H 4MLIA 5BZDA 2I5YL 3QY8A 4BUHA 4G8FA 5AVVB 4ZMPA 4K3DH 5EBGA 1OC5A 2I32A 3SPHA 1Q9WB 2DBLL 4H83A 1OQFA 4MSSA 2DQJL 3HHSB 3ILPB 2KZHA 2Y4SA 3V4PH 1M68A 4JHWL 1UWFA 4PJDB 4MWFB 3TO4B 3UR2A 4P04A 1FP8A 4C60A 4AC1X 5HJLA 2A6JB 4YDVA 4L1HA 4N2BA 2A1WH 4UV7L 3BQ6A 4PV1C 3WS3B 1R85A 1CDHA 1KENL 1GOQA 2CUAA 4KKAD 5AAWC 1AGCB 3OGCA 4H0GA 4LQFH 5A94A 1XG3A 3QQNA 1CLOH 1LLWA 4N1HB 4FI7A 4RFOL 4IU2B 2IAND 3FCPA 4Y16B 3DAQA 5D1QE 4GHRA 5GGTL 2VX7A 3WKML 1ITCA 2YMTA 3L3OC 1UADC 5IFJA 1AHWA 4NENA 5TAOA 4YXKH 1XTLA 4YLQT 1TUXA 3CZJA 4R4ND 4MNJA 5SX4I 1U33A 3CFUA 2I1OA 4NYUA 1XIGA 3TQ0A 3PTMA 5JPNA 3IBOA 5EPMA 4UT7L 4JFDE 3ECVA 3NZUA 1SOSA 3CV5A 3IGKA 1V7MH 4PRDB 2W0UA 2QYGA 3BJFA 3P30L 4IU3A 1E70M 5IQLA 3WEXB 2EVJA 2ZA1A 3DPDA 4B9ZA 1KNWA 2PF0A 3DHFA 2J71A 2V38A 1UWXH 3CQHA 4FAAB 3INUH 5FYLL 4M19A 3QCTL 2ARWA 2W65B 4C6KA 4POYA 2QDDA 2OX1A 5XINA 4UI2A 1U58B 2E9IA 3EH4B 4N2FA 4J2QA 1K4GA 4XE5B 1UQSB 4RWYL 2NQ9A 4Y2DD 3MC5A 1Y65A 3Q58A 1SEBA 3II2A 2CLPA 3ZJ6A 3ILDA 4IBZA 3H4XA 4PJFE 1VADB 3LRKA 4YHLH 1TJGH 4YX2H 4PGZA 3NFPA 2FWOA 3FU7B 1ACYL 1H5BC 1ORSB 2YEZB 3PUUA 3E8UL 5MI0B 1XLKA 2DDQL 2D9CA 2YFNA 3REWB 4Z3FA 2WQRA 4PRHB 4P48A 2DKMA 5EMKA 4O14A 5INDA 2PR9A 4UM9A 1ZXQA 5KSUA 4HK5A 3MGOA 4MKSA 4KJQC 4F1SA 5ICXA 2ZUYA 2CSPA 5AOZA 4LEEA 4GZJA 1DR9A 3GG7A 5I1JL 5D1XB 4PYSA 3OVUB 3CLMA 4DBUA 2BS71 2CKBA 5D1QA 3S5LA 5TNVA 3LN4A 4E3VA 1RK1A 1VDGA 1F3RB 2FEEL 4HVBA 5IFTA 3MBWA 1JGDA 1X5AA 4FMFA 1XGYL 4A6YH 3GE7A 2WXRA 5SX5K 3MI3A 4PEEA 1C9WA 5BO1L 4ZFMA 4K2UH 1B0RA 3RWEA 4I4WB 5E0KA 1OYAA 3CSFA 2PTYA 1T5AA 2FR4B 4K7YA 3IWPA 3KXFD 1E40A 4M4PA 1J8HB 1UUQA 3I7SA 4PE8A 1J6PA 3SJNA 4JFDA 3L3IB 2VEKA 4KEUA 2JKRM 1H3TA 4A7TA 4MAUL 4C6BA 4E6MA 1GPWA 3GSQA 3BLLA 1U8HB 1EJOL 1EAOA 1C29A 5EU6D 3OC8A 4H9VA 3R8QA 3L1OH 1LBFA 4GUQA 2YS4A 5HI4C 2E9MA 1YMYA 2GTZB 3WGUB 3F7PC 2NTSP 2VB5A 5HHME 4DEUA 1K7FA 4EOWH 3D0AA 1TZ7A 2G8ZA 1EUUA 4O13A 1ANUA 4I0CC 3KOXA 3RWGA 2G30A 4E9YA 2X70B 1OC7A 1Q7MA 3ZLFA 4PJFA 1QFWH 5JHLH 4DQOH 3TWCH 4BH8B 1I8KB 3W23A 1MREL 3W1NA 4IJ3B 3WDQA 3W02A 4EPKA 5AAPA 3HG4A 2MTPA 4P4RB 3CFCH 3TUUA 2DMCA 1YAZA 4NO3A 1IB5A 4BQ9A 4NAQA 3O3AA 2ZTKA 4DELA 3STFA 3GHEL 2W9DL 5AYQA 4NL1A 2TRHA 1FKWA 4TS6A 4BKTC 2F58L 3VFMB 2PP7A 4LRNH 1TTGA 3M0VA 1FH5H 3P14A 1Q6QA 5F89A 5F1UA 5DHMC 2HWGA 4I1NB 2OSXA 2QFPA 4L1GA 4GMSL 1JCNA 3L08A 2V5KA 3R1ZA 7PAZA 3S2LA 4DW2H 1G9EA 2VO8A 5DYOA 1JWSA 2PTDA 1I31A 2QVIA 2C7UA 5F7EH 1WEJH 4F7KA 4YLCA 3ZDYB 5FYKH 3GTHA 4G5ZH 4ZXOA 2XCMC 1ZHBA 1RIVL 3NIGE 1TFHA 4LEBA 2ICEC 2GSGA 1DJZA 2X2YA 4NN5B 2NYYC 5CN1A 5JW3H 4UB0H 3T0DA 5DJYA 1P7TA 4LYKA 1QW8A 1F6FB 1K85A 4LU5L 4RAVA 2VFEA 4LVGA 5CILL 1IBBA 5IFAL 4AWTA 4QRBA 1GPOH 4PUDA 2CHNA 1LYQA 4UZSA 1ZS8A 3OPZL 4CU6A 3VWJD 3H2WA 2WWKT 4S3JA 3LG3A 4GG6F 3CSGA 3OJVC 1INDL 1HINL 4F5CE 4DWSD 4A7VA 1RPUA 1TR7A 2PCEA 1GGBL 4MZ2A 5AYXA 5GGSB 3WNPA 1F90L 3TFKC 5DTFB 4M7KH 1UWSA 2YD4A 4KESA 5D72L 3TEYA 3H4WA 1AY1L 2Y7QA 2N7BA 4TUKH 3E49A 1YEFH 4WI7A 1E9ZB 3BRDA 5GGVY 3HC3H 1UB5B 2VI0A 2IDSA 1IEVA 3WFCL 4UIOA 4M3HA 5FYJE 5C07B 2IXVA 2HUHA 1W72L 1KG0B 3DHUA 1KCXA 2XRAH 4XSLA 3LH2L 2CETA 4PUUA 2EDXA 3LRSA 1MFAH 4N6QA 3V10A 5IXEA 2K45A 3SN0A 3EHBB 1LMIA 3AAZA 3G6AA 3HC4L 1YEDB 4XVJH 2AK4E 1ROWA 4UT6A 4N68A 4P2AA 3HUJB 3MRNB 3TR2A 2A6IB 3BLKA 3C87A 2BXYA 1JFQL 4ZA0A 1ZBCA 4LASH 3UFIA 4JQ2A 1UC4A 4CD7A 2DQJH 5H37A 3UOAB 3HB3D 5EEXA 3S0CA 4JHWH 3QDJD 4LLQB 1E6ZA 2E6JA 3PBUA 2BVUA 5BVJA 5F0PB 2H3NB 4GRMA 4TQPA 2JIXA 4MA3A 3ENLA 4ADUA 1UVQA 4MFHA 3H85A 5C9WA 2RDWA 4J2MA 4A8LA 1BD0A 1FHVA 4LLDB 2Z2BA 3Q5YA 5AB1A 3C60D 4N25A 3LJ3A 3VXUE 1TR1A 4F5CA 5I1KH 3F7VA 1GSKA 2OR9L 1JRCA 5BXTA 5CC5A 2EG8A 3V0VA 2CBMA 1QTSA 3DRTA 3AQUA 4QRQA 4RXGA 4HUUB 2OMNA 1OPGL 4CCEA 1CIDA 1OVDA 2P5WB 3QZPA 2O72A 1AXSA 4FEIA 3REQA 4WCYL 1J9RA 3LH9A 4YHIA 1QWUA 3ASNB 5FYLH 4X7DC 1VIWA 3PJUA 4G8EA 3RLGA 4MLJA 4HIPA 3WD3A 2WB1A 3PQYD 2OX5B 2DQGH 2AK4A 1L0PA 1JVNA 4KK6D 1E67A 3QDGD 3H2PA 3C6LD 3MYPA 1KNOB 2PDMA 1Q1JL 3UT0A 2VNCA 2YJLA 3HZYB 1ET7A 1SJXA 4ERAA 1R5WA 4I0PA 4JFXA 4EAMA 3T07A 3EG9A 5AVTB 5IB5A 2Z6JA 3UXKA 3CBWA 3N5AA 3MACL 3MHUA 5FACA 1PZCA 1FCUA 5DLMH 5AZ2L 3LQMA 5LCVL 3I9AA 3P1VA 1BHGA 4APQC 5ENWA 2FO4B 5D7IE 2VCAA 2GIYA 1RUKH 3MZTA 1OCZB 4KGJA 3ZL1A 3P74A 4YE4H 1LWIA 3S1VA 4MS8D 2CZVA 4TV5A 3WCYA 3EWCA 3GG0A 2J8UF 4G11A 3D2UD 2GQAA 4JAWA 3V5CA 1YPZE 3UTTB 3W00A 2WQWA 1U5VA 3VXUA 4L5FH 4R85A 1RCXB 4I3GA 1K5NA 4YGVA 1XGYH 3G5WA 2BDNH 1Y1DA 1U3YA 2BNQE 3KS6A 1T4KA 1CT8A 3WLWC 1H9VA 1XQLA 4LBSA 2AV7A 4OZ4B 4XBMA 4HV8A 3QW9A 2RIKA 3CQFA 4H8WC 4EKXA 3FL7A 4KROD 1BW8A 1E28B 3O3DA 4JPKH 4KZEL 3AJ7A 3EDFA 4AIBA 4GQZA 4DZ5A 1RK6A 3ZL4L 1OD8A 1ETA1 4G42A 4UINL 4AVKA 4ZO6A 4E8DA 1XH3A 4F20A 1OFDA 1SDAB 5I9QB 5J5RA 3I9IA 4OM1H 1OGTB 1IM3A 5DEFB 3TF7C 2DI9A 1WDDA 5A8QA 4Y4KD 1CF8H 1F8TL 4LY4A 1NBYA 2PTWA 1LD9A 5BQ7A 2EXYD 4LLYB 3KPPA 2WZEA 1UROA 2ROYA 3N4EA 4WU7A 4ETQA 5F1SA 4K94L 4M6ML 1O7AA 1EHAA 4PZVA 4N2NA 2ZBTA 3COTA 3E0GA 4N8VA 3TSBA 5C92A 1EH9A 2DLIA 5C0EB 4UBDC 4P2QB 1KYAA 3IGXA 4HSHA 1W1PA 4L4TB 1PKQB 4R7LA 5IQ9B 1LWRA 5T1LB 5D9MA 4KXAA 2Y7OA 1PKNA 3U7YL 5AAWA 4XBKA 3GHEH 2XX0A 5D7IA 4FTDA 3GHSA 3GXUB 1OCBA 2F54D 3P5YA 3ZKQD 3WE6B 4KS0A 4JGMA 1NMAL 3D3VB 1IR1A 3L3OA 1YPZA 4XSMA 1YNPA 3MNVB 1EB3A 1N6QH 2NSXA 4ZENA 1WD8A 4NAFA 1VKFA 2ENPA 2OO6A 4U1MB 3EJYD 3VZZA 2BNQA 3DI0A 1AO7B 1X5ZA 4J8RA 2WO2B 3N15A 2XWDA 2GI0A 3ARFB 4J3VA 2AJSL 4BEIA 1RQEA 1RIVH 3CHRA 1KELL 3QPKA 4J3BA 2XI9A 3O6FD 3WHXA 4PJGE 1LZOA 3WLSA 2OMUA 1AG1O 5CILH 3VNZA 3GSVB 1GJIA 1ZGLM 3L5LA 1HJVA 3L8QA 2YAOA 2ZZUT 3DOPA 4PFHA 4PTWA 3IMSA 4LCRA 4AKQA 3IVKA 1B31A 1KSRA 2C0HA 1B1YA 4P5TC 4NZUH 5TBOA 1INDH 3PP3K 2RAMA 5AW2B 2NSMA 4OIIH 3I6EA 2NV2A 3PPEA 5AOMA 3VXRE 2OSYA 1VRDA 3PZUA 4QNWA 3BO8A 4DZAA 2R1XA 4ES9A 1AY1H 2J1ZA 1H5BA 3LBOA 5DRZA 1AMXA 5KYUB 1EC8A 4A7QA 4U0QB 3PUDA 1L9QA 3O45B 1WUNT 4BSVA 2YQBA 3F7KA 9PCYA 2O93L 2JB6B 3F5WA 4D0CA 3E0LA 4IFRA 1VH7A 3WFZA 5KOMC 2ADJB 5CWSA 2JKEA 4ZUSB 5AWNL 2RGSA 1ZALA 4IOFC 2OWWA 4R6UA 2BVOA 3SFWA 2P26A 2G75A 4PJHB 2X0UA 4ZS6D 3ZYIA 4EIGB 1P4CA 3HC4H 3FA5A 2VE6A 3WQDA 5E8OB 4RMBA 1QNQA 4JTUA 1J5SA 1S7VB 1K4CB 2JKTM 4HHPA 2N1KA 5J11C 5EPDA 5AOKA 3TBTA 5E9DD 3FC8A 1IGJA 3GF8A 3DX0A 3GB7A 4DGWC 3KDPB 1XF1A 4DAFA 1YXDA 2FJSA 1Z89A 3OZYA 4GQ9H 1LLOA 4B91A 1RA0A 3DTDA 4EF3A 5E5RB 5C0AE 5E6ID 3H23A 4H1LB 2BVWA 4TMPA 1TB3A 4MB1A 1RH9A 4B92A 4O02B 2E28A 5FB8B 2H0FA 4AV5A 5E8DH 2VXQL 4PJGA 1ZJAA 5KYXA 2V5LA 4B15A 3FVMA 4N9GA 5E2TH 3GS7A 3W38A 4RE0A 3GC2A 1NEPA 3EFOA 2HQAA 4ZW7A 2XPGB 2A2IA 1AQFA 2HXTA 1XIWD 5IVOA 4QHKJ 4XV0A 2CDEA 2YQ3A 2J7BA 4RZCA 3IJIA 3VIHA 4L5ZA 3WQVA 1ZJBA 3VXRA 3VRIA 2B1OA 1XDJA 5IMKB 2OMZB 1BA9A 3ZT6A 1KGWA 5TFSH 3FFCE 1PKOA 5FGRA 1JHKH 1WWBX 4FQXB 1U3NA 3IE9A 1OPGH 2V9TA 3WX7A 1MRQA 1A6VL 3GZQA 4H6QA 4M24A 5CPMA 3WENA 4LSPH 1EBPA 2AJXH 3RU6A 3SYOA 2ZXAA 2AJZB 4ZTEA 1S9VB 2EC8A 3LV5A 4G56A 5D71L 4OCNC 3O11B 1SUHA 1LL1A 4XH2A 4MNQD 3X3FL 5EEZA 2L7JA 1G4SA 5LHDA 3V6FA 1H5YA 4ENED 1EEZB 2ARJQ 5ESVB 4QRTA 3WQWA 3DUHA 1E6NA 3SAZA 5DHEA 1B3IA 3QULA 3TYFB 3MV8B 1GOIA 4KPLA 2E0PA 1COBA 2CJSA 1IE5A 1CICB 1NUNB 1FUYA 5JMRA 5L6YL 5GIRA 4DGVL 3TU6A 2HFTA 1AR1C 1BOGB 4NX5A 4ZD3H 1U8OA 3BEVA 5HPCA 3GI8H 3ZBMA 2PSNA 4Y2OA 1XBRA 1ZANH 1TNNA 3ZR6A 2YAQA 2R1YB 5IOKA 1J0YA 4RCXA 4P59L 2ICEA 1L7IH 3U48A 3ENEA 5C0AA 1FWHC 3LKNA 4W8BA 4QHUB 4ONFL 4GXWA 2IGLA 1TVDA 1XIMA 1DKWA 4Z2JA 4PGBA 4P4KB 1NFGA 3CMGA 3NDOA 4YSRA 3OW1A 4KK5C 1I1CA 2NY3C 4RMUA 2GITB 4GUJA 3H2CA 5J12B 1QSZA 2X42A 3U57A 2QV5A 4HEME 5D7JB 4U1JA 2RFXA 1GOMA 3ILQD 3C8DA 3NL2A 3B9OA 4ZDHA 3ABMB 2VKZG 1AZBA 5I75C 1WO2A 1RPKA 2XBTA 1WYJA 1EFXB 4EOUA 1A25A 3FFCA 3T6ZA 1ZV5A 4L1WA 1CN4A 5JLZA 5HHOD 4GKSB 1I8IA 5FGBC 2E47A 3TGXA 2ZT9C 4IXXA 1TWDA 4QHMA 3MJ9A 3QISA 2O56A 3E5BA 3PK7A 4KZEH 3NJVA 2X4OA 3ZL4H 3CHCA 2SFPA 3D46A 1PG7W 4P2YA 3GX9A 5DHDA 3UO1L 4NZRL 3PWJB 4XWOC 4BDVB 2J7EA 3MXVH 1PLCA 5HGAA 4BCYA 1T0NB 2I7OA 4E4PA 1S9YA 1J4EA 2R15A 3ZDWA 3U9WA 3PRZA 1T0MB 4Y9MA 3WFAA 3QDHA 3LEVL 5KYYA 1FFQA 3EH1A 3MRJA 2HISA 3NIGF 1G9MH 5CR8A 1IF2A 2FTAA 3CU2A 2OZ4H 3VD1A 2V2TB 2M26A 1S2UA 4M6MH 1V8HA 3GPEA 1EJ8A 1FF5A 2N7AA 4OD3H 1I9IH 1ZPUA 4FQPA 3ZKND 1OWWA 2EE9A 1SMAA 1W3TA 3S46A 4ZAKB 5LAXB 1TQUA 4ODVL 5DEJA 1EGZA 3BSZL 3GHTA 1FWEC 5F6IB 4X7CC 1CECA 1ZE3H 1E55A 3O6KL 3KPOB 1ZKAA 1NCNA 2OXGA 2O4EA 3V0GA 4C6EA 2Z28A 4HJJL 3MWCA 1W8EA 4R3UA 1J2WA 4GI6A 5DQ9A 2NLJA 2OQJA 4HEMA 1YXCA 5JOFB 3EYUL 3QK0A 3NG3A 5AKRA 4LT9A 3OMNB 1LE5B 4EPBC 1VJSA 3CFQA 1TTIA 1KZYA 4DAGL 1CC3A 2EIEA 2O6EA 2DIAA 3UPCA 2XWCA 3U3HA 5MENB 3SBQA 1SY6A 1MI5D 3OZMA 3NVTA 4M6QA 2E9LA 3NJKA 4QYAA 2AJSH 2X4PB 1NEUA 3DXAD 4CU8A 2J20A 1UD5A 2VLKB 3LNPA 3BVUA 1HJCA 2W38A 4GKNA 1EP2A 2LAGB 3VIKA 3D4GA 4A7SA 1XXFC 4FTVE 1U92B 3TCTA 4MMZC 2Z7YA 4OM0H 1WC7B 3KBMA 3GSNB 3KS5A 2PUQT 1KXTB 3DVFA 4NC2B 3NSNA 5CBEA 3TSMA 3L3DB 2Q3XA 2WJZA 3VXSB 5HQMA 2E5EA 4CMMB 5HWJA 4F3FB 3KW3A 5DUPL 3EBAA 1CLZL 1FGNH 1T0OA 2NW3B 4PJAF 2Z1WA 3WDHA 1JNDA 2J1KA 3GJFA 3MRPB 2MH4A 1XL4A 4C83A 5K1NA 3U6XS 4BFIB 3PUGA 3WJSA 3BZFA 4C6CA 3E2VA 4QQUA 4APQA 3TOYA 3CQIA 5FECB 4IK6A 3CK5A 4QRPE 1BBJB 2QW5A 3O6MH 1WIPA 2DICA 2VAJA 4XCEA 5I3IA 1BGGA 4N3TA 1E9YB 3IDUA 2D20A 4GJIA 1TYEB 4U49A 2PDIA 1KJ2B 1I3RA