1JUBA

The k136e mutant of lactococcus lactis dihydroorotate dehydrogenase a
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
311
structure length
311
Chain Sequence
MLNTTFANAKFANPFMNASGVHCMTIEDLEELKASQAGAYITKSSTLEKREGNPLPRYVDLELGSINSMGLPNLGFDYYLDYVLKNQKENAQEGPIFFSIAGMSAAENIAMLKKIQESDFSGITELNLSCPNVPGEPQLAYDFEATEKLLKEVFTFFTKPLGVKLPPYFDLVHFDIMAEILNQFPLTYVNSVNSIGNGLFIDPEAESVVIKPKDGFGGIGGAYIKPTALANVRAFYTRLKPEIQIIGTGGIETGQDAFEHLLCGATMLQIGTALHKEGPAIFDRIIKELEEIMNQKGYQSIADFHGKLKSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Lactococcus lactis dihydroorotate dehydrogenase A mutants reveal important facets of the enzymatic function
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Oxidoreductase
molecule keywords dihydroorotate dehydrogenase A
total genus 118
structure length 311
sequence length 311
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2001-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 1jubA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1jubA01
5E93A 1XBYA 5ABTA 3PS7A 4N02A 4AWTA 4Z0JA 3L66A 4MOZA 2VFFA 2PRLA 3P81A 4JR5A 1RVGA 1VRDA 1VCFA 1OYBA 3BVJA 3KVMA 4UFHA 5LGZA 2Z6JA 3P74A 4BWLA 4LU0A 2OX1A 3C2OA 2ZTJA 2DP3A 4WOQA 1TB3A 4KFPA 5D05A 5F2MA 4CQ8A 1Y0EA 3G3MA 4CCDA 5K4XA 1TREA 3WJSA 3LHZA 2A85A 3WK2A 3QRHA 3UPBA 3VFLA 4GC4A 1P5BA 4FX8A 2G5WA 1GVRA 3TV8A 5CPMA 3R5EA 4POCA 4XWUA 4OV4A 1TTQA 3EX3A 3SI9A 1UCWA 2V2CA 3DFPA 4R7JA 1TTIA 1BWKA 3GR7A 3I6RA 1Q45A 3IV3A 1LRTA 4RK8A 1ME9A 3DU0A 1GTEA 3FA5A 1VHCA 3NZ1A 4OHQA 4X22A 3KFTA 3O6CA 1BTMA 1AW5A 3W88A 4LS2A 2AQWA 2QR6A 3DZ1A 1VCVA 3BV4A 3W7JA 3LV6A 5FF4A 3TX9A 4HNVA 1RV8A 2ZZ6A 2JBMA 4BF9A 2CW6A 4MFEA 2CLMA 4NNAA 4TMBA 1QPQA 1TPDA 4XBSA 3TIMA 4IGHA 1C9DA 3N2MA 4GRSA 3M5YA 3M44A 3DXIA 2Q3RA 4R33A 3NL6A 3HGSA 2G97A 1IIGA 1THFD 3V75A 3M5ZA 4UNLA 2CLOA 1XBZA 4HNTA 5EKYA 6ALDA 3TU9A 1W54A 1G6CA 2OZ0A 3MI2A 1SW7A 3B03A 5FF3A 2B7QA 4ZQCA 1XUUA 2GVLA 4S1FA 4OU1A 4I7VA 1WYIA 3GKAA 5I3KA 3N34A 3OIXA 3SZ8A 3P67A 4Z1CA 1JVNA 1OYCA 1IGSA 5DELA 4EIVA 3SY5A 1S5WA 4JS3A 1W8SA 1P4CA 1TPC1 5I3HA 3EX6A 1QPRA 3E12A 4IOTA 5CZSA 2QEZA 4AAJA 2I9EA 3EB2A 4H3DA 1H7WA 4J9JA 3MW7A 3NQFA 4AWUA 2CU0A 3C61A 4LS0A 3CIXA 1WV2A 4LV4A 2B4GA 5H91A 3TJLA 3FEMA 1H7PA 1J4EA 3LLFA 3WJYA 4UR7A 3G0UA 1SPQA 1XCFA 2C14A 2ZYFA 5D04C 4JTIA 2QJGA 3PY2A 3N2XA 1XKYA 1I2PA 4UTTC 4LVDA 2V5BA 1OX4A 1KW1A 1RQEA 2F84A 3W2UA 3P80A 3LXCA 2WPBA 1OX5A 4TX9A 4AB4A 1ZFJA 1QMLA 3I7SA 3UNDA 4ZQPA 2Y6ZA 1FWRA 1T8XA 2YR1A 4FNPA 3NXFA 3FJ6A 3GDLA 1P1XA 1JQVA 4CQ9A 3JRKA 2Y7FA 1WOAA 3FLUA 2J9XA 3P82A 5F2IA 2QCGA 4WJEA 5IM51 3W83A 5KTLA 4AH7A 3TK7A 5I3GA 2WSYA 1CX9A 5FEWA 1N55A 1JCJA 2W0UA 3NQCA 1YADA 1GJPA 2EHHA 5C2XA 4KFOA 1N7KA 2JKAA 4MYAA 1MXSA 4Q4KA 1PIIA 2NV1A 3QW3A 5D02A 4RLIA 3DKJA 3C4UA 3C3NA 2FFCA 4UTLA 1ICQA 4CLMA 4U28A 1TV7A 5IBXA 1P0KA 3TC6A 3TW7A 1HG3A 3GDRA 1C29A 2C13A 4BI6A 1QDSA 1W5MA 5AC8A 5D37A 1JJKA 4K8EA 1F5ZA 1K8YA 1F76A 3KOFA 4UMCA 3VKJA 2VOMA 3WJZA 4TIMA 3G18A 2CZEA 5AYYA 3DFSA 1YXYA 4UFIA 3WFAA 4O12A 3NM3A 2ZZ7A 2Q3OA 3WK3A 3QPZA 5F2GA 1G7UA 2J6XA 3NYZA 3SSJA 3M5VA 4LVFA 2C15A 3RLUA 2OCZA 2ZRYA 3W7MA 5FEPA 3UY7A 4FO4A 3NGJA 4DF0A 1BKSA 2X1SA 3BK0A 2QKFA 3TE9A 1QFEA 3STCA 1F7BA 1EUNA 3MWAA 3Q37A 3ANYA 3S8HA 1HO4A 4JN6A 4UTJA 1QPOA 1TQXA 1GQNA 3S6DA 2E6DA 5FF7A 3WK1A 3A21A 1QCWA 2YPIA 3G1SA 2YDAA 3PB0A 3UQNA 3OVPA 5EL1A 1SZFA 3QEZA 5CZ0A 3USBA 4K7YA 1W0MA 4Y96A 3FKKA 4MVAA 1ME7A 3W6YA 1LLWA 1YXCA 1YYAA 3W07A 3L0GA 5EY5A 3PBUA 4M5PA 1LRNA 2RHGA 4S2CA 4XUGA 2WOQA 4LOCA 2Y7EA 1A53A 3DI0A 2YXGA 3BLEA 1DHPA 1XUZA 4XZ9A 1CI1A 4RZ4A 1IIHA 4O1BA 1G4EA 1MEWA 3O15A 1RQHA 3FFSA 4OBTA 3QQ1A 2H3DA 1GT8A 1LM1A 3CM4A 1VLIA 5AHNA 1UJPA 2DZTA 3NO5A 3M16A 3PM6A 2A21A 2DJLA 4PL1A 3PVFA 4LUJA 1ALDA 1ZALA 5FEXA 2Y89A 4O50A 2QUTA 3R12A 1YTKA 3LV5A 3W72A 3TFXA 1F2JA 1SFJA 3JR2A 3UWWA 4RR4A 3TSMA 3LBCA 3M47A 1FWSA 2WQPA 1S3HA 3O6YX 3IGXA 1DOSA 3NPVA 3TDFA 1EB3A 2E09A 3HPZA 2TSYA 3FOKA 1LOQA 5F4SA 3NZRA 4XBKA 4AHPA 3W87A 1B4KA 4GNJA 3BPWA 2ZRWA 1DJNA 4IMCA 3W73A 4NXSA 4N2YA 5AN7A 6TIMA 1QR7A 1LTDA 4OE7A 3PBVA 4ALDA 1JCNA 4UXDA 3ZWTA 2ZZ1A 3W1QA 1MEHA 3W2NA 2XN0A 1L6SA 4C1KA 3FKRA 4YWIA 4K37A 4QJ1A 1ZJIA 5LNWA 4DO4A 1OF6A 3QSRA 2NUYA 1LLZA 1X1OA 4FXSA 4WUIA 2V82A 1Z48A 4TR9A 4NX0A 3LHWA 1M7OA 4GUGA 2VFEA 4NZFA 4O16A 3MI6A 1OG0A 4JGDA 1I2NA 2VEKA 2WV8A 1KM6A 3QMRA 3MYPA 1TJPA 3NPXA 1XI3A 1ICPA 1KBJA 3KX6A 2BWGA 5G4EA 3W76A 3PUOA 4FIRA 1JCLA 4LW7A 1OFPA 3Q58A 1FX6A 2FB3A 3B0PA 3G8EA 4A3UA 3NVTA 1XBVA 1ZCOA 3CU2A 4WXZA 1I2RA 4LNYA 3NM1A 5DCDA 2NZLA 1ZAIA 4K6AA 3TMQA 2Y61A 3PF3A 1PV8A 3HG2A 4DPPA 1XBXA 2E5BA 3WJWA 3VCRA 1KFKA 3BLFA 3CQ0A 1WAUA 1T0OA 3P62A 3GAYA 4MZ8A 3MO7A 4BI5A 3B04A 2P1FA 2HSAA 1OHLA 3I7RA 3B4UA 5G2WA 3BARA 2NX3A 4NJIA 2VFDA 3PSWA 2XFWA 1OFOA 2PRHA 3NA8A 3UXAA 3O05A 2NWSA 4GBUA 1PCWA 1TPH1 3OA3A 3IEBA 3K30A 1EX5A 4AF0B 3QZEA 1HO1A 4A2RA 3KAOA 1F73A 2RDWA 4JYDA 4O1CA 3GNNA 3P61A 3ABSA 1O60A 5CG7A 5CSSA 3UWZA 4RXGA 3TFCA 3LCLA 3LTSA 2R14A 1WX0A 2WNQA 3S1VA 1AK5A 3R89A 3A5FA 5TIMA 5CPNA 3SGUA 4M19A 5HWMA 3QMTA 4D2JA 3PSVA 3S9YA 4E2BA 1TTPA 3TSDA 3W71A 3ABOA 4DO6A 2DORA 5C6MA 2DZUA 1MSSA 4FNTA 4A2SA 5CSRA 4IUOA 3TUUA 4MY1A 3W85A 4E38A 4N4QA 3DI1A 5J5DA 1SUXA 1NSJA 4LT9A 3UZJA 3STGA 4CNNA 1H60A 3C2FA 2DU2A 3LGEA 1KTNA 2FIQA 5LHEA 3A24A 1YPIA 3P60A 3LBMA 1VYPX 3DH7A 5G4WA 5AHLA 1BWLA 2B0MA 2V5LA 1OFAA 2RDTA 3W2KA 2A1YA 2ZZ4A 1RZMA 2FPVA 2IQTA 3RU6A 4O15A 3ZFHA 3IIVA 4Q33A 1TMHA 3L5LA 1BEUA 4NVTA 3GYEA 3W7KA 1EP1A 3CTLA 4AHQA 4CNOA 4I7UA 4YCPA 3JS3A 5KMYA 4HN4A 4QM1A 3TR2A 2B7OA 3LHUA 2TYSA 5G2IA 2Q8ZA 1VZWA 4E0CA 3SECA 1G4SA 4JTTA 4Z08A 3W22A 1HFBA 3NQ2A 4AXKA 1OJXA 1JULA 2QJIA 3E02A 4GUFA 2PURA 3R8RA 4GUHA 3L5AA 4PCFA 2FTPA 3EX4A 1YDOA 4UUIA 1TYGA 3YPIA 3IIZA 5F1UA 5GVJA 3INPA 1SZGA 1VGAA 1G67A 4XTIA 3DHFA 3Q94A 4WY0B 1YDVA 2JGYA 2DZWA 1QOQA 1VYRA 2C16A 2ZA2A 4GUJA 5DY3A 4BFAA 3W1AA 1PHQA 1PVNA 3T7VA 2GJNA 3M0ZA 1DJQA 1SW0A 5D33A 4GWEA 1ZHAA 4UFKA 4JICA 1H63A 3MP3A 3DFOA 2XN2A 2R91A 4DF2A 3IRDA 1D3HA 5DLCA 5H2ZA 3M5XA 2A6LA 1O5XA 2EPHA 5DXXA 5AHMA 3OEXA 5K2ZA 4QITA 1KLYA 3C6CA 4FXRA 1GVFA 2EGZA 4H4IA 4O53A 1TPFA 1KFJA 2A6NA 3N73A 2YFNA 2GOUA 2BTMA 4UTKA 3RMJA 2A0NA 2J9ZA 2ATMA 1KTCA 3W1NA 3HG4A 1K02A 4Y90A 2HS8A 4LV9A 1GVOA 4Y6GA 2QDGA 5G5IA 4JEQA 3EKLA 5HJLA 1DVJA 3W7OA 1S5TA 4WOZA 1GVSA 1RPXA 3NQ6A 4FNQA 4PA8A 3W9ZA 3LTPA 1EP2A 3TC7A 3A5VA 1VLWA 1Q3NA 1H5YA 5KZMA 4ML9A 2QDHA 3W1XA 3CLMA 4L4MA 5BW6A 5MHBA 2NXHA 1O4UA 3CEUA 4JTKA 4O0KA 4QAIA 4HSOA 3H54A 5G1YA 5FI8A 4YCOA 1GVQA 4OWGA 4JIPA 2Z0IA 5DCBA 4MFDA 1O5KA 3TH6A 4KWWA 3EWWA 2V2HA 1ZAHA 1FDZA 5D09A 5LNSA 1K7FA 1G4TA 1XM3A 3EXSA 3B05A 2X1RA 4CCCA 2ISVA 4I9AA 2A5HA 4WQ6A 1M5WA 4JTEA 5F4WA 3OG3A 3MHGA 4JYEA 3GXTA 1A5AA 1I8JA 1KBIA 3W7IA 1IXNA 2QCHA 1VC4A 4EWND 3LHYA 3N3MA 3NR0A 4HT3A 2GQ8A 3MUXA 3C52A 2FPYA 3ZS4A 1O95A 3LLDA 3W3OA 3H55A 3LOTA 1PCKA 1W5NA 1A5BA 4O19A 1NAL1 3DENA 3AO0A 4JTFA 2X1UA 1DQWA 3G1AA 2VKZG 3UWYA 2DJXA 1X7FA 3EWXA 4OV9A 4N6EA 4DBEA 2FLIA 1KFBA 5I3IA 2CLKA 1OK6A 3G1HA 4NNCA 4PC8A 3IVSA 4UCGA 3KRZA 3L21A 3S1UA 3NOEA 4IJBA 1K03A 2A7NA 3L2IA 4IX2A 4JDBA 3TAKA 4YXGA 5T26A 1YTDA 1GEQA 3SGZA 3G8RA 2A7PA 4UNKA 1O94A 1IXQA 5LGXA 1I4NA 1WBJA 1A5SA 1KM4A 4ZQRA 3TKFA 2BZNA 3GDKA 1IF2A 1T99A 4N4PA 4MY9A 3CIWA 1UB3A 5BNKA 4UMAA 3LRLA 2C1HA 3QFEA 2ZA3A 4NX5A 2ZZ3A 4O13A 1W3IA 4HNUA 2G95A 1GG0A 2ZRZA 5TBOA 1AL8A 2PC4A 3O8AA 2ABBA 4MZ1A 4K8HA 4K39A 3MHFA 1GPWA 3W1TA 1OFEA 1F6PA 2VEIA 3MI3A 3VE9A 3EXTA 3BG5A 3QPYA 4RXFA 2CLLA 4DO5A 4X2RA 3P7YA 4MZYA 3NQGA 5KZDA 3M9YA 3NL2A 3W86A 3QQ0A 3T44A 3W7EA 4ZQMA 2NWRA 1FXQA 2VXNA 4ORMA 2F7FA 3V1PA 1XDLA 1DL3A 3CC1A 2WSRA 3S5OA 1FBAA 3HIJA 3G1VA 1VS1A 2ZQ0A 3OHIA 5HWJA 3F4WA 1LBFA 1KFLA 2E68A 4BWLC 5C54A 2V8ZA 1AL7A 4JTSA 1EA0A 4O8RA 5G2HA 2VFGA 3B0UX 3GVGA 3EWYA 3N14A 1SW3A 3W7DA 1WDWA 4Z0SA 4I7WA 3FS2A 3P5ZA 1HUVA 4P2VA 3OVRA 2CLHA 1UUOA 4PL2A 4CNPA 4MYXA 1XC4A 3PBWA 2H3BA 3B8DA 2Z1BA 5F4XA 1DORA 2FQIA 4MIMA 1MO0A 4MJZA 3G22A 3P84A 2YW4A 4O4WA 5FF0A 4S2BA 3CHVA 2Y85A 3U6WA 3P8JA 3IVTA 4OGZA 3HMJG 1QNVA 2VC6A 3G1XA 3GDMA 4ZMGA 5EYWA 1JRCA 4IQLA 1FUYA 4UC5A 2QCFA 1OX6A 3GDTA 3BGJA 3NG3A 2QCNA 5G1TA 1EUAA 4UTTA 1DV7A 3OBKA 1LBMA 4NQ1A 1VPXA 2J24A 4JTLA 1N8FA 1SR9A 2YW3A 1WQ5A 4EVZA 4MPQA 1LZOA 3E49A 3L0KA 1GWJA 1FDJA 2J88A 1X6UA 1SSGA 1WA3A 3NQDA 1J2WA 2ZZ2A 1M7PA 3FJLA 2YZRA 4WZHA 2VEMA 1TO3A 2CLIA 3HF3A 4FX7A 4LVBA 3U8GA 1RR2A 3P5YA 2RKXA 4UTMA 5FEZA 1TV8A 5D2WA 4MY8A 3OVQA 5F1VA 3W74A 2QCEA 4DPQA 3O07A 1OABA 2NXIA 3NL3A 5TQLA 1FXPA 4PTNA 3NDOA 4IXXA 1TIMA 4HKPA 5BOOA 1JUBA 5AHEA 5AYXA 3FYPA 5AYZA 2E6FA 1KV8A 3GXPA 3NQMA 5CZJA 4AMAA 4LC6A 1W31A 1JRBA 3GZ3A 1TPB1 3LCIA 4OQVA 1QPNA 1NF0A 2ALDA 1TSIA 4JYFA 3W1UA 4WXYA 1G7VA 1F74A 3TXZA 3WJXA 2D73A 1L9WA 3KVJA 4RZ6A 3KRSA 3NQAA 3CWOX 5KZEA 4EF8A 2NUWA 4M7TA 1KA9F 3T55A 4NZJA 3GIYA 2CLEA 7TIMA 3C2VA 2G96A 4UTWC 2TPSA 1H1ZA 2EKCA 4L4LA 1JCXA 5D30A 3HGJA 4ADSA 5LKYA 1R30A 2GPTA 2JKPA 3M7WA 5BMXA 5HWNA 1SZNA 3MMTA 4QIUA 2R8WA 5AHIA 1RD5A 3O63A 3RNDA 3HG5A 1KLZA 3BLIA 3CWNA 5C5YA 3EWBX 1KM2A 1SO4A 2HTMA 1H1YA 2W79A 3HQ1A 1KV5A 3VE7A 5HMSA 2ZTKA 4K7VA 1GYLA 3TXVA 1OYAA 1JR1A 4NJKA 2AGKA 3SW6A 2X2GA 3MBFA 2PCQA 3TROA 4RV8A 2H8ZA 1LOLA 3BW2A 3EEGA 3W2MA 3W1MA 2B7NA 3PAJA 2NV2A 1W3NA 5KINA 1Z42A 5F2LA 1R2TA 4GJ1A 3W7PA 5LZLA 4O10A 2XN1A 3HGOA 1HL2A 4Q32A 1SFLA 3KVLA 4O14A 4AWSA 1TPVA 2WNNA 2QAFA 5DN1A 2YCEA 4UMBA 4EOUA 1LRQA 4NXKA 1QWGA 2BX7A 2EF9A 4LS1A 1LORA 3TQKA 2GQAA 2WNZA 3UWVA 3E9AA 3TMLA 2AAMA 2JK2A 1UBSA 4GUIA 4ZQNA 4TO8A 1R46A 4X9SA 3EX1A 1GYNA 4LTSA 4O4VA 3KRUA 3NQ7A 4UTHA 3MP5A 5CPOA 1VH7A 4LVGA 3TNOA 4UIOA 4ONVA 4FB7A 2VFHA 4N6FA 3LDVA 2E1DA 1DBTA 2DZSA 3C2EA 3GR8A 3PUEA 1WXJA 3W7CA 2PE4A 2ATSA 3FYOA 2BLEA 3W23A 1D3GA 2ZRXA 5D32A 4WX2A 2V81A 3G0SA 1T96A 4HIBA 2P0OA 4XKYA 3LM7A 1FCBA 1FWNA 4LRSA 3RLVA 1KM5A 1W56A 2H8XA 3HB9A 3W7QA 1SO5A 4JD4A 4NJHA 1C8VA 1KFEA 4O54A 3UY8A 2TMDA 3R13A 1EEPA 2O7QA 4M7SA 3GK0A 2OJPA 3TQ0A 4UTUA 3C8FA 4MKNA 3LCWA 2Y63A 1H62A 3F03K 4EF9A 4M6VA 4NJJA 3SIZA 4JNMA 3L65A 4DEFA 3RFAA 3W84A 3IIPA 2H90A 1I45A 3BO9A 5HUPA 2GVJA 1H50A 2WSQA 4MLRA 5HINA 5D2TA 4O28A 2YYTA 3B0VC 1OFQA 4ICNA 3HG3A 5EA9A 3SJ3A 3C56A 4ZZ9A 4OT7A 1Q6LA 3LTYA 3PG9A 1GTHA 2W6RA 4IMDA 3UZ5A 1E51A 3WK0A 4IMFA 3KXQA 3LXAA 1TQJA 1FQ0A 1V5XA 2YFOA 3LCHA 1PE1A 3G0XA 3GXNA 1W1ZA 1PS9A 3W70A 5K4ZA 3CEPA 3EWZA 3GX9A 3W7LA 2A4AA 2GVGA 1TCDA 4MLJA 4FHAA 1XL9A 2GUUA 2WO5A 5K9XA 1KTBA 3PB2A 1OFBA 2CWNA 4PH6A 1H7XA 3DHDA 3E0IA 2YYUA 1OF8A 4N9DA 1TPWA 4XQ6A 3R2GA 5AC6A 1LOSA 4O17A 2QCDB 4Z1DA 5L9FA 5E1QA 1G4PA 5K7JA 3A9IA 3EX2A 3S5ZA 3MHUA 3MYOA 5D2VA 4HPJA 1NEYA 3FIGA 1IXPA 2GQ9A 3S42A 2ZBTA 3HJZA 4H6KA 1EP3A 5DCEA 3QM3A 5LHFA 4LVAA 5HR6A 1QO2A 5K9DA 4DQWA 2X30A 4FF7A 5HQEA 2ISWA 4CQAA 4K38A 2CZFA 4X3ZA 4Z1AA 4ORIA 4W9TA 5D2XA 3W7HA 4GE8A 5D03A 1K7EA 4JTUA 5AB3A 4M6QA 5A5WA 4PFMA 3A23A 2ABAA 4LRTA 2C18A 2I1OA 1B9BA 2QAPA 3O6DA 4B5NA 4GXMA 1H51A 3LRKA 3MP4A 1NVMA 3F1QA 2JKEA 2KZHA 3O16A 4JX6A 5K9CA 2R94A 5HNRA 4O52A 4C1LA 2YX0A 5I3JA 3L5MA 3T78A 4CCEA 3M43A 2HMCA 3ATZA 3QYQA 4IX0A 4LC8A 3W1RA 2QUVA 3L68A 3SFKA 1ZAJA 3DFTA 4HHPA 5DY2A 5AHFA 4PODA 1X1ZA 3G1DA 5U7SA 3W2LA 2V2DA 4FNSA 4DELA 2ZRUA 3NQEA 1SSDA 3DBPA 1JQXA 4JTGA 2A2IA 5CZTA 2ZRVA 3UD6A 3UXDA 5CKSA 2H6RA 2VENA 1Q6QA 4QNEA 2FB2A 4R34A 3LX9A 3BW3A 4A21A 2Y70A 2RH9A 1B4EA 3GAKA 3IVUA 3G3DA 2PRMA 3HPXA 4FNUA 5LNUA 3BG9A 3AJXA 2Y7DA 1WOBA 5D2YA 2J9YA 1P0NA 3BGGA 1X8FA 5FF2A 1AW2A 4IMEA 1A5CA 2VELA 1KM3A 4DBDA 3W75A 2QCDA 2CLFA 5CPLA 2RFGA 4RX0A 4A22A 3QJAA 1VHNA 3L9CA 2RDUA 2C19A 5DBTA 2BXVA 5J5RA 3IIOA 1JCMP 4UFMA 3IGSA 2E77A 1B57A 3LRMA 1H7RA 4G1KA 3VNDA 2QCMA 3B06A 2V9DA 1W3TA 1GG1A 1VCGA 1ML1A 1QAPA 4Y8FA 3HBLA 2ZCGA 3NQVA 1A50A 3HO8A 1Q6RA 4O57A 1JUEA 2VEPA 3RK8A 5HULA 5L6UA 1B3OA 1PL9A 3EWUA 1U5JA 3ZWSA 4HNNA 4AF0A 1H61A 1SQ7A 1YLVA 5D38A 5EBUA 3PR2A 2EAWA 2WJZA 1V7YA 1K8ZA 1RQBA 2TRSA 2WKJA 3EXRA 4JY8A 3QH2A 1OK4A 2Y88A 4K36A 3CB8A 2E6AA 1QO5A 2ISSA 2E5DA 4U4MA 2HS6A 1F05A 1EPXA 3LHVA 1JCYA 5C55A 4ZVJA 1G69A 3GKFA 3I7QA 1UUMA 3PULA 3I65A 5I3FA 3QSTA 1GOXA 3N9RA 3THQA 3DFNA 4HPXA 1GZGA 3NAVA 1KM1A 5HR7A 1L6WA 1YTEA 4DF1A 1TPEA 3VI2A 2YSWA 3SR7A 1AG1O 1S5VA 3T4CA 1H7OA 4JX4A 8TIMA 2A7RA 5E0KA 3LERA 1LCOA 2QUUA 1WBHA 4Y9AA 3C0JA 1DKWA 1TJRA 1HTIA 3GB6A 2LLEA 5AOUA 4KWVA 2V30A 5HUOA 3DKLA 4RCXA 1Q6OA 1D9EA 2ZZ5A 1IXOA 1K7XA 4HSNA 4PEKA 3ATYA 1EWDA 1YPFA 2C0AA 1ICSA 1LROA 1W37A 2NXGA 1FCVA 2YGYA 4IMGA 4O0ZA 4LUIA 2OT1A 1EWEA 4UTWA 2Y7GA 3LHTA 4O1DA 3PC0A 1J5TA 3TSBA 3PWAA 4RZ5A 4XKYB 4UFLA 4WY0F 4JX5A 4QSHA 1ONRA 1TRIA 2CZDA 2DZVA 4AEOA 2BSLA 2QCLA 1SZEA 4Z1BA 4BI7A 4TMCA 2V0TA 2OT0A 2C6QA 3L0NA 3EKZA 3O06A 1K8XA 4N9EA 3PUDA 2UV8G 3QW4B 5BMWA 4LY8A 1LYXA 1EIXA 4ZL1A 4WY0A 3NEVA 1TTJA 4WD0A 1MZHA 3TQVA 1ADOA 1ZY9A 3TCEA 1F6KA 4XTDA 3L67A 1YXDA 1KFCA 1NFBA 1SU5A 3BW4A 5EMUA 1NF7A 5FESA 4YL2A 1YDNA 5IBXC 1AW1A 1FCQA 1SO6A 1JUKA 4IXHA 1K3UA 3TA6A 4NU7A 1UASA 2I14A 1LDCA 3S1XA 2X1TA 4JDYA 3HPSA 5KSWA 4O11A 3HOJA 2OMAA 3ZR4A 2FPTA 2QCCA 3G24A 3UYCA 5A8GA 3GNDA 4AHOA 1I2OA 3G1FA 3LCGA 5U4NA 1FDYA 1W5OA 1XXXA 1AMKA 1OFRA 3CT7A 4ADTA 4JTHA 4DXVA 1TPUA 1M6JA 1MEIA 2B7PA 4R53A 3S0CA 3M41A 4UTIA 4ZQOA 3THAA 4NUWA 2NLIA 4FIQA 1FCUA 2C3ZA 4RKAA 2CZ5A 3UWUA 1R2SA 4KKXA 5LNVA 3TJXA 4YLWA 2NX1A 4NT0A 4YMZA 3IIXA 2DZPA 3E96A 1FY6A 5DBUA 3I68A 4LWWA 3C2RA 3MJYA 1Z41A 4QNWA 3S1WA 1L2UA 1OX4B 1PHWA 3PBYA 2DZXA 4BK9A 1FWTA 4QQ3A 4KFNA 4N9CA 3STEA 2ZFAA 3DAQA 5LNRA 3UWQA 1XFBA 4UR8A 4O18A 2J27A 3ABRA 4MJMA 1KM0A 3M1ZA 2GJLA 3DGRA 1SO3A 3H53A 1TRDA 4GFSA 3LXBA 1VQTA 3G1YA 5KITA 3RF9A 1W5PA 5LSMA 3M6YA 1LBLA 3UPWA 4MUZA 3W7GA 3W2JA 2CFFA 2Z6IA 3GLCA 3STFA 4FNRA 5CGQA 2FJKA 3KHJA 2X16A 3DFQA 5DXYA 2Q8LA 2E6YA 1DQXA 3NL5A 5K3VA 1U83A 4ADUA 3NNTA 4IPIA 4P61A 1XDMA 1R2RA 3ELFA 3LI1A 3BG3A 3D0CA 3NPWA 3W7RA 3QF0A 3U2OA 1L6YA 3QMSA 2Z2UA 4BR1A 1VJIA 2FDSA 2O7SA 5EPDA 1R47A 4FX6M 4TU1A 2NX9A 4JTJA 1W5QA 5SWUA 3LI0A 3LCFA 1Z44A 4AVFA 3MBDA 4A29A 4JIQA 3NQ8A 1CW2A 2NUXA 2Y62A 3N9SA 1H7NA 4RJEA 3QC3A 1VR6A 4JY9A 4O1AA 4UFJA 4QISA 4JXCA 2P10A 3TAOA 4IWWA 4IPJA 1LP6A 4FEZA 3P8IA 3S5YA 3HGRA 3LCXA 1FWWA 1OFDA 2ZDRA 3LB0A 2QF7A 3NPUA 1QOPA 4NNBA 3A22A 3TW6A 1TV5A 1I2QA 4N9BA 2QJHA 1OVDA 1ZENA 3W1LA 1ZNNA 3CPRA 5AC7A 1ME8A 2E5CA 3IGUA 3F4NA 3O1NA 1VYSX 2VFIA 5BRBA 3ABQA 3S5NA 3N19B 5AFDA 3W1PA 3W7NA 4M6PA 3T40A 3Q2DA 4E2DA 4NJGA 3KVKA 3PG8A 2JGQA 2ZA1A
chains in the Genus database with same CATH superfamily
2V3FA 1RA0A 1JPMA 4AWTA 1BG4A 4JR5A 3P81A 1OYBA 4GIRA 3BVJA 3KVMA 1VBJA 2HPMA 1UOKA 4LU0A 2OX1A 3S2CA 2PP1A 4FOKA 2OQHA 5D05A 2FJUB 2JIEA 4IIBA 5REQA 4QAWA 3WBYA 2WVVB 1W3LA 3WJSA 4C5YA 4ZSUA 3S9IA 3S47A 4QDWA 1W6TA 2V5DA 4DBSA 3LLXA 4FX8A 1S2AA 1EJXC 3APTA 1MDRA 3R5EA 3AU2A 1ZBVA 1UCWA 2V2CA 3GR7A 1Q45A 4DM2A 4NZ4A 1WXYA 1JXJA 3SCUA 3GG8A 1GTEA 4UQBA 1VHCA 4KCUA 4OHQA 5HDRA 4UTFA 3KFTA 1WKEA 4LS2A 4GKTA 1J01A 1KRAC 2JBMA 2CW6A 1FA2A 2CLMA 1UWIA 1WUEA 1Y65A 4MNJA 1WO2A 1UWQA 1TPDA 3V5FA 1ZTVA 3GUGA 1U22A 3N2MA 4IUGA 4GRSA 4W93A 3M5YA 2J7DA 4NZCA 2GQ3A 2HVMA 3WFLA 2CWXA 4UNLA 2CLOA 2NT0A 3AIQA 6ALDA 2QNEA 2VGFA 2C7FA 1K4GA 3MWCA 4I7VA 2PGFA 1V6VA 1WYIA 5JH1A 3GKAA 4Y7EA 5I3KA 3KOZA 1UR3M 4IICA 4L9ZA 1OYCA 4PCTA 4NAEB 4E2VA 4JS3A 1P4CA 1QPRA 3E12A 3Q45A 3CTTA 4IOTA 5CZSA 4IJCA 3BICA 2PCEA 2DY3A 2X7VA 2X40A 4AWUA 1Z6KA 3II1A 2BVWA 4DY1A 3R43A 1DP0A 1QK2A 4PTXA 4F9JA 3FEMA 1H7PA 1HL8A 2VZVA 5A3HA 2IKJA 1BWVA 1SPQA 1XCFA 1UA3A 5D04C 4WVXA 2QJGA 4K3ZA 2FMNA 3TWBA 1XKYA 2XWDA 4LVDA 1UC4A 4E8DA 1RQEA 4Z42C 2F84A 1B3WA 4JPGA 2JALA 2WPBA 4ATWA 1QMLA 3I7SA 4EP8C 3IGHX 1JYWA 2ZWZA 3AOFA 1T8XA 3E2RA 3T07A 1E5JA 3HV9A 4C7DA 4RNIA 1BXBA 1KB3A 1B90A 2PUZA 2Y7FA 2ICSA 2YL5A 4BJHA 1F6YA 2YCJA 4ZODA 4AZCA 1L8NA 3B9EA 4J3WA 3W83A 2NLYA 5KTLA 4WSKA 2R1KA 3TK7A 1XYZA 5I3GA 2XVKA 4L4PA 1OGGA 2OQLA 1ECEA 1GZJA 2W0UA 1YADA 1GJPA 1KCXA 2JKAA 2J8GA 5M17A 2HNHA 4C1NB 1MXSA 2ALRA 3UJEA 4EACA 3WBXA 2NSXA 3VDHA 4UTLA 1ICQA 2ZXAA 4CLMA 5IBXA 2UBPC 9CGTA 5E5CA 4CVWA 1YEYA 4I90A 4K8EA 1F76A 4TV6A 4UMCA 3BQ5A 3WH6A 3GFYA 5I07A 2YCLB 3AC0A 3CPGA 1R5YA 1QW7A 4ZO6A 4UFIA 1PZ0A 3M0LA 3MUZ1 2ZZ7A 3GU9A 5F2GA 1E6PA 1J5SA 2RJGA 3SSJA 1XG4A 1JDCA 4DX3A 5DMYA 5GJMA 1DHKA 5FEPA 5FJTA 5TNVA 4B3ZA 3TE9A 3WNLA 1QFEA 3MMWA 2VDHA 5BROA 1F7BA 1EUNA 5LA2A 4EWJA 1QPOA 4LUSB 1XLIA 1RY8A 2Z26A 3HFTA 2DW6A 1MI3A 3LNPA 3GR4A 4YHGA 4MDOA 2DSVA 5FL1A 5CZ0A 3SDOA 4B16A 1W0MA 4Y96A 3VD3A 1LLWA 1YXCA 5DX7A 1YYAA 4JHOA 5EY5A 2I16A 4S2CA 3LN3A 3D6NA 3L4UA 5LIWX 1EJSC 1UKPA 4BQ5A 2Z00A 4QJ4B 1V8EA 4RZ4A 2BDQA 1MEWA 1F61A 2WYSA 3WZ0E 1Z7AA 2VZUA 3H24A 2H3DA 3MZ2A 3H6OA 2YOCA 4L1WA 1LM1A 2ZDSA 4MB3A 1X7IA 4B3KA 3GBDA 5AHNA 5BRQA 2DZTA 2WC7A 1JEZA 7A3HA 4PL1A 1ALDA 5FJPA 3GWQA 2GJXB 1DJYA 3MKKA 1TWZA 1YTKA 3LV5A 4M82A 2OR2A 2A3CA 2BGSA 3TSMA 1IZJA 4F40A 3ONCA 2E09A 3FOKA 1LOQA 2J8FA 3CK5A 4H6RA 2WZIA 3R58A 3ES7A 1CXHA 3NSNA 1XP3A 3W73A 3VGFA 1A5MC 6TIMA 4LX4A 1LTDA 3ARYA 1UH3A 3WN6A 2ZZ1A 3PZGA 2ZX7A 5HMEA 2G3NA 4YWIA 4K37A 1OCJA 1WP6A 1OF6A 3QSRA 2V82A 1Z48A 4W7WA 3TYBA 1TX0A 4DJDD 1R3SA 1UZDA 5BU6A 4GUGA 4XKMA 2VFEA 4NZFA 3PZUA 2PWUA 3ALFA 1OG0A 4JGDA 3V0SA 4JIIX 2WV8A 1PJ9A 3QMRA 4F3HA 1TJPA 3NPXA 3S5SA 1AMYA 1E1CA 1KBJA 3KX6A 4YS1A 4HHLA 3W76A 2HV5A 1UUQA 1XINA 2RUSA 2WSPA 1JCLA 4LW7A 1OFPA 5LYRA 2FB3A 4D6GA 3G8EA 2GDUA 2Q09A 1ZQ5A 2ZADA 2IXVA 5IDZA 5DFAA 3N18A 3HMCA 1SYTA 2HVNA 2Y61A 4HBKA 4V2XA 1US2A 4U10A 4PTDA 5JMUA 2E5BA 3TP4A 1UPMB 3OU8A 4R85A 3K8LA 1A5OC 3P62A 3C86A 3AS0A 3MO7A 4BI5A 3RX2A 2F6KA 3WDPP 1OHLA 3WFZA 3MT1A 4PBFA 2XHYA 2GZXA 2D2JA 2ZICA 1KXVA 2HEJA 1T6MA 3NA8A 4A3HA 3BJSA 3LZ3A 3OA3A 2WBKA 3K30A 4AF0B 1IZKA 3QZEA 1Y5WA 2OEMA 3KAOA 1HN1A 2Z1XA 3P61A 3W25A 3ABSA 1C93A 5CSSA 2E67A 4DRSA 2XVLA 3LTSA 2R14A 1WX0A 5AKQA 1UR4A 1L6GA 3R89A 4MB4A 4GZ7A 3HA1A 5TIMA 3SGUA 1ELSA 1UZ4A 4M19A 1XG3A 2CXEA 1EH9A 3PSVA 4PULA 4E2BA 1TTPA 3GXIA 4HYWA 5C6MA 2DZUA 1MMFA 3TC3A 1KGUA 3TUUA 4MY1A 1S46A 3R25A 1PXGA 1UQZA 4E38A 2H9AA 3CYJA 3UZJA 3KTCA 3STGA 1S39A 4DWDA 3EDDA 1ITQA 3A24A 1FWBC 3N2CA 4H1ZA 4HGXA 2XIQA 4NP7A 4QLLA 1YNQA 1PWMA 1R86A 3SIMA 1A49A 5FJOA 3LPFA 1AD1A 5EMYA 4J3UA 1JFXA 3FAWA 3PZVA 3A3WA 3ARWA 3V36A 3M4HA 4NVTA 1A5NC 1NFPA 3W7KA 1Z69A 2VD9A 1UOZA 4YCPA 1VFUA 3OZOA 4WF7A 2VVNA 5AZ0A 2YA1A 4BF5A 3JS3A 5KMYA 4S3JA 2VC7A 2VO5A 3DDMA 4PMUA 4C65A 4RV3A 2Q8ZA 4E0CA 4JTTA 1DYSA 1SMAA 1X38A 3AIVA 4AXKA 3BMWA 4MNKA 2QJIA 4ZENA 1S1RA 2PURA 5A8QA 3GVRA 3NEHA 4PCFA 3DEQA 1UD6A 2VTFA 4TV5A 4F8XA 4XTIA 4ZO9A 1WE5A 1QBBA 1YDVA 2JGYA 4J35A 2XINA 3W1AA 4UQCA 1DJQA 1ZHAA 2BY1A 3DFOA 2QZRA 3H26A 3VNKA 2CESA 1D3HA 5HPOA 2VR4A 2A6LA 1O5XA 4F9DA 4GD0A 4QITA 2I5GA 1C9WA 1KLYA 1GVFA 2EGZA 4RZBA 2BG5A 3ARXA 1TPFA 3KBJA 1KFJA 4DJFD 2BTMA 3DGBA 3RMJA 2A0NA 1KWGA 4NIRA 2ATMA 8A3HA 1KTCA 7ENLA 4XD5A 2AL2A 3QTPA 3LQGA 4Y90A 2HS8A 4LV9A 1NQ6A 3UWEA 1XGZA 1S5TA 2OSWA 1GVSA 3OG2A 1EP2A 1GVIA 2ZWYA 1VLWA 4CU8A 4I8YA 2QDHA 2ZX8A 3W1XA 3UERA 2HISA 2X0HA 2PDIA 5FI8A 3RIKA 3SN4A 3SJNA 3TONA 2Z0IA 4MFDA 3CASA 2VI0A 1O5KA 2CBIA 1A3XA 4KWWA 4X0NA 3VKDA 4QSFA 2XSBA 3ZVHA 1G4TA 2B81A 1XM3A 2NQHA 2A5HA 4WQ6A 4JTEA 1E6ZA 3PJUA 4B5TA 1IEXA 1KXQA 1MUMA 3B9DA 2Z2AA 4PBGA 2EQDA 4JYEA 3VCCA 4YVPA 4LB3A 2O9PA 2QCHA 2UY3A 2GVEA 4EWND 1RBLA 2GQ8A 3WENA 4GY1A 3GXMA 3H55A 4F0HA 3OLDA 4O19A 1XLBA 3MO4A 3G1AA 1XLGA 4BEUA 3KLLA 1XRFA 4OV9A 5I79A 4GYPA 5I24A 3WF3A 3K8MA 1KFBA 4OKDA 5I3IA 4UCGA 5E0CA 4DWSA 2EXOA 3NOEA 4IJBA 3L2IA 3LM3A 3CO8A 3TEVA 4YXGA 2FKPA 3G8RA 4JCLA 4UNKA 4PGLA 1O94A 5LGXA 1E9LA 4H83A 4ZQRA 4IL2A 3GDKA 4J4KA 4MY9A 3MQTA 1NDVA 3NO1A 3FXYA 9RUBA 1ZRQA 3QFEA 3AS3A 2IQDA 3PFRA 1GG0A 3TYAA 4MZ1A 5TF0A 1XYCA 3RM8A 5I78A 3ARRA 1GJWA 1OFEA 3SFWA 1GNXA 4M1BA 4RE0A 2VMFA 2VEIA 5C8BB 3M07A 4WKFA 4L6DA 4XD4A 3R10A 1XYBA 2BNJA 3VINA 1EFZA 1FXQA 4FSAA 4BY3A 4ORMA 3ARUA 2F7FA 3PTMA 4US6A 3UETA 4AY1A 1DL3A 1WB0A 5FIPA 1VS1A 3OHIA 2YKKA 1Q2SA 3F4WA 5DANA 3VK5A 2J7FA 3N11A 2JEQA 4YTUA 3CMJA 4QTGA 4XAYA 4PUJA 3CL6A 4YTSA 4DUOA 3B0UX 4C91A 3NZQA 3WBWA 2UY4A 1SW3A 1WDWA 3FK4A 1L2QA 4KRUA 2C0HA 3EOUA 3U4FA 3H21A 3P5ZA 1HUVA 1RAKA 1UR1A 5D9NA 3MVIA 3VUSA 4CNPA 1J0KA 1MQPA 3GXDA 5F4XA 1DORA 1JGMA 1MO0A 1UYQA 1W9DM 3ITGA 2ZX5A 1D3CA 1PSCA 2YW4A 1ZUAX 4S2BA 1CXKA 3U6WA 3RITA 5E6YA 3P3BA 4LQ1A 3U7VA 4Q8OA 1O5RA 4D9PA 5H8UA 3RPMA 3G1XA 4I9MA 1JRCA 3DESA 2QCFA 1JF6A 1OX6A 1CGWA 3GVVA 1J9YA 1DV7A 5AC4A 1LBMA 2J24A 4M24A 4URIA 5FOOA 3CAKA 2QVNA 3L0KA 2J88A 2WVSA 5BWFA 1X6UA 3S4TA 3VKKA 4AUBA 4CGTA 1E4MM 1E6RA 3GVQA 1AJ0A 3JZUA 3VMPA 2HNEA 3NQDA 3PPGA 4Q8WA 3HF3A 1IT0A 4LVBA 3T4WA 3OVQA 2WBGA 1NQKA 1ZBKA 2ANUA 3GW0A 1PTGA 1UBPC 2F61A 3NL3A 4B92A 4F66A 4OIFA 1AJ2A 4IXXA 5AHEA 5AYXA 2XDFA 3FYPA 2BVTA 3VIOA 2E6FA 1KV8A 3GXPA 1JRBA 1UROA 3LCIA 1QPNA 3V5OA 1V02E 4WXYA 1F74A 2VNCA 3WYZA 1LT7A 3WJXA 1GUVA 4W7UA 2D73A 1L9WA 3KRSA 5BWAA 1Z8AA 4EF8A 1KA9F 4NZJA 5DF0A 2DDXA 1HF6A 3GNRA 7TIMA 1RALA 1BD0A 4XUYA 4ADSA 3ZM8A 3H2EA 2VQTA 1SZNA 5AHIA 3IJ9A 3MMTA 1EHAA 1GQIA 2PODA 1KM2A 3V0TA 4Z17A 3UGVA 1SO4A 4ZGYA 1KV5A 4H7CA 2DIEA 4XAFA 3RJYA 3FV9A 1A3HA 3WKZA 2AGKA 2UY5A 2X2GA 3SW6A 3VX0A 5E6ZA 5FSDC 2YCKX 3GH7A 4HNLA 2H8ZA 1LOLA 3FY1A 3BW2A 3FHAA 2B31A 3W2MA 4IZGA 2NV2A 4AIOA 5A6KA 2CNCA 1R2TA 4GJ1A 3W7PA 4O10A 2O9RA 3F4DA 1F3EA 1TPVA 4PUDA 3DUGA 1IE7C 2G4JA 4BEQA 1ZZMA 5M03A 1LRQA 1GK8A 4L80A 2IPGA 1U5HA 2EF9A 4U31A 1LORA 2VJXA 2GQAA 1Q6EA 3QOMA 2YLAA 5I2UA 4O8AA 3KDNA 5A2BA 2XIOA 5A95A 4TO8A 2Y5SA 3EX1A 4OUIA 1GOOA 4JAWA 3ZJ7A 1X96A 3MP5A 4UTHA 4ONVA 4N6FA 3LDVA 4AW7A 2WAGA 2DZSA 3JUGA 3FYOA 1XIEA 3WLQA 1D3GA 3RMEA 3SUVA 4LANA 1M7XA 3EOLA 4HIBA 5EFDA 4XKYA 3EDJA 3S3GA 1ISYA 3HB9A 5A8OA 3WLRA 3GHUA 3PP7A 2X8RA 2PD9A 3HV8A 3R8HA 3VGBA 5GPRA 3EPMA 3C8FA 2I56A 4MKNA 1H62A 4G9PA 4NILA 4EF9A 4M6VA 2VZSA 4B4FA 4V28A 1EQPA 3KW3A 3W84A 1EJRC 3AQUA 3IIPA 4P5UA 3MMUA 2F38A 2DZAA 4WDTA 5HINA 4HU3A 5D2TA 2XFFA 1OFQA 4ICNA 1BGGA 4AD5A 2DSUA 3QOKA 3PG9A 5C7VA 4IMDA 3UZ5A 1E51A 3WK0A 2ZXBA 3VXGA 5FAJA 1R6WA 1KFWA 1HVQA 1E3XA 3GXNA 2IPWA 2A3AA 3WF4A 2YA0A 3T8LA 1A5LC 3EWZA 3KCJA 2J25A 2GVGA 1DXIA 1TWIA 4H9XA 4OTKA 1KBLA 1XLEA 2GUUA 5K9XA 2DUAA 2CWNA 4PH6A 2WANA 4JN8A 5BOEA 3CQKA 2A3HA 4TX6A 3V1HA 4IGMA 5AC6A 1MXDA 1X39A 1LOSA 5CPTA 3ZO9A 5E1QA 3RRXA 5K7JA 4C6FA 2BHUA 5D2VA 4JKKA 1EGMA 4C6MA 2GQ9A 3BC9A 1UC5A 3QM3A 3WQ6A 5HR6A 3MCMA 1QO2A 5K9DA 2WVVA 2X30A 3N15A 1UP0A 1QT1A 2ISWA 4CQAA 1J8VA 2P3ZA 4GJIA 4HCLA 5BRPA 4Z1AA 3JW7A 5FJIA 4F0RA 4JEJA 5D2XA 2OGJA 3QV9A 4GE8A 2HBVA 5EMLA 3FVMA 2ABAA 5MKGA 2C18A 4GY0A 1UR9A 4YNGA 1H4PA 2ZOXA 2P88A 3LRKA 3MP4A 3KLKA 1R8LA 2OSYA 4X0VA 5K9CA 3O16A 3WDIA 3AXKA 3MB9A 2R94A 4C1LA 5A94A 1EC7A 3R0DA 4CD5A 3BAYA 3ITTA 2GDVA 3W1RA 3BE7A 3QV6A 3UJFA 4FA3A 3B9NA 3VC6A 1DWGM 4PODA 2ZXQA 3G1DA 1DJIA 4HPNA 4JTGA 4B2DA 2OVLA 4MAZA 1VFFA 3UD6A 3UXDA 4AX6A 3NJ3A 4XISA 4R34A 2Z1WA 3BW3A 2RH9A 3VMOA 1H1NA 4U5KA 3G3DA 3OLIA 3VILA 3ERPA 4FNUA 4WEVX 2G3IA 4XAPA 1K6WA 3BG9A 3AJXA 1WOBA 5D2YA 5DMLA 4UB9A 3OPSA 1QHZA 1P0NA 5FF2A 1GPFA 3BCDA 2VELA 4IIEA 4ASTA 3MSDA 2QCDA 3SQMA 5BU9A 2GUYA 3HJEA 1E3ZA 4IMAA 5J5RA 1GVYA 4UFMA 4B5VA 1C7TA 3IGSA 4GC3A 4OUEA 2PDMA 3E1F1 2ZVIA 3U2CA 1VCGA 1FWDC 3Q65A 3S9ZA 3TLQA 4NHVA 1MFVA 3LBOA 4JCMA 4O57A 3G77A 2DIJA 1G01A 2V3GA 4HNNA 4R5EA 1QNRA 2V5KA 4GQRA 4KWOA 1S1PA 1DWFM 3KP1A 1K8ZA 2WKJA 4JY8A 2PAJA 1FHDA 1MVYA 1GOWA 2BBFA 2FGBA 1JCYA 1JL8A 3I7QA 3OLEA 3I65A 1JNDA 3E2QA 1DJXA 4C1NA 3QSTA 2ESCA 3IUHA 4HPXA 3TTSA 2CLPA 2PD5A 3VZYA 2W5FA 1VBHA 1TPEA 1WKYA 1VP5A 2YSWA 2PWHA 4C6EA 1FFQA 2OLAA 3GNPA 2ADAA 4QDMA 4LBSA 4AG0A 5AOUA 3DKLA 1EBGA 3A4AA 3GTIA 3OBAA 3XINA 1UR0A 3ATYA 1YPFA 1ICSA 3BLKA 3UJ2A 3BAKA 2HK1A 1S2UA 2Y7GA 1RXOB 5D9MA 3FAXA 3PPFA 1MRQA 3PWAA 3WBAA 3ARSA 4JX5A 3ZR5A 2BOEX 3W82A 3ZQ9A 3RR1A 3NO3A 1TRIA 3QLLA 4HZ8A 2DGAA 1QI2A 2QCLA 4RE3A 3CLWA 4BI7A 1NIUA 2C6QA 4N9EA 3PUDA 4NASA 2UV8G 3S2JA 2CHRA 1LYXA 4ZL1A 2VEFA 4TX8A 4AD2A 3OO2A 1MZHA 2OYMA 1ADOA 2CBVA 4MUPA 3TCEA 1YXDA 3N6JA 1SU5A 1TR9A 3UR5A 4XZMX 5FESA 1YDNA 3RILA 1AW1A 4L5ZA 1Q8AA 4LNCA 4BQ4A 4ZO8A 4H9ZA 4IXHA 1K3UA 3C3UA 3TA6A 3E0WA 4NU7A 2HXTA 4GIEA 2POZA 4OOZA 3A47A 2X1TA 3HPSA 3OQEA 2OMAA 3ZR4A 3DECA 3QBUA 4XIAA 1XGEA 3G24A 2WKGA 4IP7A 1AMKA 4BHYA 3W26A 4JTHA 4DXVA 1EDQA 1TPUA 1M6JA 7XIMA 2B7PA 3KUMA 3WLTA 3S0CA 4UTIA 4F48A 3THAA 3THDA 4NUWA 3DCPA 2AAAA 2C3ZA 3K46A 3UWUA 1R2SA 2GSEA 3LZ5A 1QJWA 2W27A 4GI6A 5ABFB 2XIIA 1A0DA 4NT0A 3SGGA 3CUJA 3IIXA 2DZPA 2D0FA 4J3XA 1FY6A 5RUBA 4LWWA 3UXKA 4B9YA 4QNWA 3MJYA 4MF4A 3ZMRA 2WC4A 4K1GA 1OX4B 4BK9A 1IR1A 1XLCA 2O0TA 1PAMA 1PZ1A 4XVDA 4ZA0A 3PN8A 2J27A 3N4AA 4J3ZA 2PDBA 1TRDA 3EGJA 3G1YA 4S38A 3BGAA 1TA3B 2ACUA 2VCCA 4XIMA 4MUZA 3W7GA 3W2JA 4FNRA 3KHJA 2J47A 1LJYA 5K3VA 1MW3A 5DO8A 4E3VA 3KS6A 1F9CA 3PTDA 3ZJKA 1XDMA 1R2RA 3ELFA 3BG3A 1YW1A 3W7RA 1L6YA 3QMSA 1R47A 1E4IA 5PTDA 1H41A 1SJDA 2NX9A 4JTJA 4CN6A 3URNA 4S3BA 4AVFA 3WLHA 1AJZA 4A29A 4JIQA 5CBIA 1S2TA 2IW0A 4K1WA 3TJIA 4IJRA 4PBEA 4XX6A 2Y62A 4RJEA 3VNYA 3TNBA 1X97A 1JZ4A 3GNXA 4O1AA 2ONEA 4PTWA 3WQDA 3HPAA 3MCOA 3IAPA 4JXCA 5CSYA 3APGA 1BSLA 4EKJA 4IPJA 4FEZA 2BS9A 1XH2A 3S5YA 1OFDA 1J12A 3AALA 2PPGA 3NGFA 1NOUA 4N9BA 1Y7VA 2QJHA 2YCLA 1MW1A 4IHCA 1ME8A 3G6LA 1M01A 1PX4A 2CYGA 1F3WA 3IGUA 4TUFA 3F4NA 1HNYA 5BRBA 4HK6A 4QLKA 5AFDA 2L5HA 2UZ9A 3VGGA 5I00A 3KTXA 1TE6A 7PTDA 3Q2DA 4NJGA 3RYSA 2D3NA 4W87A 1XBYA 3KS5A 5ABTA 4Z0JA 1UKQA 2PDQA 4G7FA 2VFFA 2OKOA 1VCFA 1E9IA 4L56A 3VD7A 3AIEA 1H3GA 3MUAA 3SBFA 1XGDA 2DP3A 3AFBA 1TB3A 1E0VA 4RNFA 4A8NA 3EZ4A 1Y0EA 3KL0A 5HQMA 3G3MA 4CCDA 1MYRA 5LIYX 4FPSA 3UR7A 3QRHA 3VFLA 1CCWB 1Q7MA 1XLDA 3AZRA 1V6YA 4KESA 4I9JA 1GVRA 3TV8A 5CPMA 1WZLA 2CBJA 2GSJA 1WZMA 3SI9A 1XIGA 3DFPA 2OX4A 4R7JA 2W92A 5JUVA 2WMKA 1PIGA 2OWCA 4GCXA 5D9OA 4FF5A 4JKMA 4AWEA 4PMNA 4LY4A 4B5XA 3W88A 2QR6A 1UIOA 5FF4A 3TX9A 4FLOA 4MFEA 3SCSA 3RX3A 1QPQA 3TIMA 3AUJA 3B0XA 3CUHA 4IGHA 3H2NA 3WF2A 4LPCA 4F0SA 2Q3RA 4R33A 4AVOA 1C92A 3BOFA 3NL6A 4Z2HA 1THFD 4S3EA 3M5ZA 8CGTA 3WF1A 4C6JA 1W54A 1G6CA 2OZ0A 3MI2A 2J13A 2B7QA 5FJUA 1XICA 2PDCA 4Q8TA 3OIXA 1NFGA 2J4GA 3EDFA 4UZUA 3TTOA 2OGYA 4HNCA 4HZ6A 3VO0A 3N1AA 4C6DA 1K9EA 1TPC1 3RRAA 5I3HA 3UFYA 3EX6A 1MZRA 3B97A 4FR1A 4HNOA 1C8QA 4GH1A 2QEZA 4JQ3A 5FJRA 3A9BA 3EB2A 4E8CA 4H3DA 4PUUA 1E1EA 2PBGA 2CU0A 1RA5A 1W2VA 1XR2A 2B4GA 1P6CA 3WJYA 4PMDA 2X0SA 4UR7A 4NAFA 3RCNA 4C6PA 1CNVA 3N2XA 3PPHA 2V5BA 2XH4A 4DJDA 3MMDA 4AB4A 4ZOEA 8XIAA 5G4HC 3A3XA 3BJTA 1VB9A 1R85A 1RJRA 1KQYA 2NQ9A 3VIGA 1P6BA 3H12A 4FNPA 1UZ1A 5EMMA 1TVPA 1EYWA 3GDLA 1JQVA 1TMLA 1IWBA 3VNJA 3UXIA 4B15A 1WOAA 2INFA 3BLPX 5IM51 1V3MA 5I5RA 1KR1A 4AH7A 2WSYA 5HAOA 1QUMA 4WKAA 3UT0A 4BA0A 3PJWA 4XSMA 3AHYA 1RH9A 2Q01A 4A35A 1A80A 1OIMA 1PIIA 3T0AA 5D02A 1FH8A 1JDDA 1XS2A 3C4UA 1QW8A 3AISA 4NKCA 4U28A 1TV7A 3H4GA 1C91A 3D3FA 5AC8A 2C13A 2OSXA 3EWDA 4I9TA 3VKJA 2VOMA 4MB1A 2YCIX 3MS8A 1QPKA 2EPMX 3TLLA 5AYYA 2XM2A 2BXZA 3WFAA 2RAGA 1NDZA 3WK3A 1G7UA 2P8CA 2VUNA 4DAIA 1OT1A 3VOIA 3RLUA 1GOQA 4FO4A 3NGJA 1BVWA 1BKSA 3QKEA 1J0HA 2QKFA 2NQJA 3MWAA 1HO4A 2FZ8A 4UTJA 2E6DA 2XSAA 4IH3A 5JXQA 2YPIA 3G1SA 2YDAA 4QS6A 3OVPA 5EL1A 3IARA 1SZFA 3L4XA 1V79A 4IFOA 3FKKA 1TZ9A 2VX7A 3PBUA 1LRNA 4H9MA 2WOQA 4LOCA 4NSBA 1Q8JA 2OLHA 1LQ0A 4YYFA 1DHPA 4XZ9A 1CI1A 3AMCA 1ONWA 1CGTA 3O15A 1VRXA 4RDZA 1GT8A 1X98A 1J79A 4XZIA 4EK7A 4I6KA 4ROQA 3M16A 3PM6A 4AC7C 5I02A 3PVFA 4LUJA 1ZALA 5FEXA 5H8PA 3P14A 3U2EA 3TFXA 3AU6A 5ABGA 1F2JA 3UWWA 3LBCA 3M47A 1FWSA 2WCSA 1S3HA 1U33A 3IGXA 1JDFA 3JZEA 3R79A 3TDFA 1JZ8A 4XBKA 1GOIA 4AHPA 3W87A 1B4KA 1SJAA 4GNJA 1V6XA 2YBTA 2ZRWA 1J93A 4NXSA 4IMCA 4Q8MA 3L4ZA 1O12A 4UNIA 1OZQA 2DPEA 4DUWA 1ISVA 4UXDA 2ZXDA 3W1QA 1UP3A 1ZJAA 2D2OA 3M0MA 3W2NA 2Z28A 4KEUA 1L6SA 4C1KA 4QJ1A 1J2BA 2NUYA 3WG6A 1X1OA 1PTAA 2DT2A 4GMEA 4Q8VA 1M7OA 3EA3A 4ERAA 3SADA 4W85A 1IYXA 1KM6A 3CUZA 1AFSA 1NDYA 3DYOA 4S39A 5G4EA 1A4LA 3TN4A 3NWRA 1YBQB 1JAKA 1XYMA 3EKGA 1XBVA 3NVTA 2R9RA 4WXZA 3IUDA 2EPOA 4NI3A 4K6AA 2WVTA 3TMQA 3PF3A 3HG2A 3C5QA 2BP1A 1UA7A 1P6WA 3UCQA 2DT1A 1XLJA 1XBXA 2ZUTA 3VCRA 1KFKA 1EGVA 3SQSA 1RK6A 3GAYA 3QVQA 4FP1A 2HSAA 5CJMA 2FZDA 3I7RA 2A3EA 3CMGA 4WRHA 4DNHA 2WC3A 2ZC1A 2QXWA 4AZ6A 2XFWA 1OFOA 4AIBA 3UXAA 4GBUA 1TPH1 3IEBA 3C2YA 4LXFA 1QU4A 4JYDA 4O1CA 3GNNA 5XIMA 4PSRA 2BHYA 2GVYA 1O60A 2HROA 3WF0A 1N82A 3MKCA 3SCPA 3N2BA 4ATDA 1EOMA 3CNYA 3GNOA 4K8GA 4REQA 1OC7A 4CQDA 5HOSA 1TIWA 1E73M 2V38A 3FA4A 1DIKA 4A2SA 5G1MA 1ISXA 4N4QA 4ES4A 2VVSA 2WKLA 3LK6A 3LGEA 3Q4DA 4Z2IA 4L6HA 3P93A 3DH7A 1BWLA 2RDTA 2XSXA 1FFRA 4LUTB 1NARA 2IQTA 1DXFA 1LUCA 1YPXA 3HM7A 1M1BA 1TMHA 5IRPA 4M8UA 1BEUA 1E15A 1V02A 2XTKA 4F0MA 1KGWA 6REQB 4WJXA 4QM1A 4XZWA 4GIYA 4ACYA 1IV8A 3K4DA 3LHUA 1O68A 5G2IA 1US0A 1G4SA 3W22A 3K4AA 3DFHA 3WNPA 3ANUA 4LEFA 2HRWA 1X8CA 2D3LA 1QNQA 1YDOA 1JD9A 3YPIA 1B3XA 5F1UA 5GVJA 1UD8A 3QGVA 4KMQA 3KRBA 2PS2A 4D6EA 2DZWA 1CXEA 1VYRA 2C16A 2ZA2A 3LPOA 5DY3A 2GJNA 2WMHA 5LIUX 3AXMA 3QR3A 4GNKB 4GWEA 1YQ2A 3ZSSA 3T08A 2FHFA 1CLXA 5ABHA 1BQCA 2XN2A 2R91A 1HJQA 2P50A 1RVKA 3ZOAA 4HU4A 5JU6A 2XH0A 4MWAE 5A6SA 4W88A 1C3FA 4O1FA 4H4IA 4O53A 2O4MA 1EYEA 3CZEA 5C9XA 3GTXA 2YFNA 2YIHA 4IFKA 4UTKA 2J9ZA 1KWKA 3FHQA 1HKKA 4L65A 3WQVA 4HCHA 3WL1A 5G5IA 4JEQA 1ECQA 1DVJA 4LAUA 2J77A 1VBRA 1RPXA 5IFTA 3NQ6A 4DBWA 1S3TC 4LUSA 4FNQA 3W9ZA 4TVCA 1H5YA 1PO9A 2ZUUA 4UQ9A 1O4UA 1DJGA 2PZ0A 2PWEA 4QAIA 5G1YA 4ILSA 1GVQA 3F4CA 4OWGA 2JFEX 4JIPA 3P0XA 4RUBA 2CITA 5DCBA 3K8KA 5LNSA 3EXSA 1NOWA 4CD8A 3B05A 4MJ2A 2X1RA 5I6SA 2ISVA 4ZB5A 2YL6A 2PGRA 2PP3A 2QT3A 2D2GA 1LQ2A 2MNRA 3OG3A 4YU1A 3XIMA 1A5AA 1KBIA 2EJAA 3BCJA 1LUCB 1TWDA 5DRIA 1IXNA 3BLDA 1SM9A 3LHYA 4CQBA 3N3MA 1K9DA 1VEOA 3SM0A 1M04A 3MUXA 3C52A 2E40A 3W3OA 2HJPA 4HJFA 2V67A 2GJXA 4JTFA 2X1UA 2VKZG 1I6NA 2DJXA 3UWYA 4XAGA 1S2VA 2FLIA 1VJSA 2CLKA 4PC8A 3KRZA 1XFCA 4X2PA 4RPPA 2A7NA 3E5BA 1XF0A 1GEQA 4U2ZA 2CCRA 1I4NA 2GWNA 1KM4A 3TKFA 3U4AA 1W1PA 2PF8A 3QV7A 4YWSA 1P1MA 1HW6A 4H01A 4O13A 3CXOA 2WWDA 1XPYA 1WDPA 2PC4A 4AVNA 2ABBA 1FWCC 1V3IA 2GSHA 4K8HA 1MUCA 3E3HA 4K39A 3MHFA 3VUPA 4Y9NA 4D1IA 1F6PA 3W0KA 2G3MA 3B40A 3BG5A 1G9HA 2CLLA 1GZ1A 3KEHA 3P7YA 2PDJA 1P7TB 4GQBA 1N8WA 3BWWA 4AISA 3W86A 3RJXA 3FYYA 1BXCA 4ZQMA 3ICJA 2IMRA 4JL2A 4QDPA 3AMGA 1LL7A 2Z7GA 3RLGA 1ZS2A 3CC1A 3G6MA 3LENA 5A2CA 1IQ8A 2ZIDA 3HIJA 3KBNA 2ZQ0A 2DH2A 3H7RA 1E56A 4UBPC 3ECQA 1I60A 3CS2A 4H7ZA 2E68A 2HDJA 1KCLA 4FZIA 4ZXOA 1AL7A 3B9AA 1XD0A 4WIWA 1JF5A 2F2KA 3V3WA 3O9NA 1XPGA 5FJJA 4MPKA 1UG6A 3GVGA 3WLIA 3EWYA 2HBXA 5FACA 3SN1A 4U33A 2Y8UA 4I7WA 2PDGA 3DC0A 3E0VA 1LQAA 4OBSA 4DLFA 1Q7QA 1OBAA 1XC4A 3PBWA 2X0YA 4DWSD 2WJFA 2DSWA 2FQIA 1O1HA 2QJJA 4KT2A 1GORA 2RGLA 4Y8EA 3CHVA 3R94A 1W9PA 4LF2A 3W02A 1JCTA 2VC6A 3D5HA 4ZMGA 1FUYA 2CHNA 4D6IA 2E8ZA 1UWAA 4KW2A 3GDTA 4XZHA 4AYSA 3GIQA 4GVFA 2Q02A 4M29A 2WZEA 3TYEA 5G1TA 3ZSTA 1VPXA 5I06A 4JTLA 1N8FA 1OEPA 1XHGA 3WDQA 3WEOA 4AZ5A 1WQ5A 4F2TA 1XYAA 2VRKA 4MPQA 1GWJA 4AYGA 1WA3A 3T05A 3RU8X 4MJ4A 1J2WA 3FJLA 1QOXA 4WZHA 4WGHA 2POTA 1RR2A 4QCFA 3N12A 2HXUA 3C0QA 3BH4A 5FEZA 1HIZA 1TV8A 4FLQA 3KWXA 4L9XA 1NM9A 1T7LA 2Y8VA 4MY8A 4Q4SA 3WD3A 4NL1A 4MWAA 2FYMA 3O07A 3GFXA 4CNUA 5TQLA 1EEXA 1XYLA 1FXPA 1FKXA 5CAKA 3BXWA 1P7TA 3I3EA 4TTGA 2P8BA 4HKPA 5HMFA 2D1ZA 5BOOA 1JUBA 1EA9C 2W4XA 3CUGA 1N2VA 1TJ2A 2VR5A 5CZJA 3NQMA 4IGSA 4DO7A 1FH7A 3H2MA 4GISA 4KH2A 2OODA 4L1XA 2ALDA 1BQGA 1UKTA 3GO2A 4QG8A 1A3WA 3TXZA 4PMRA 3NQAA 2GGJA 3GH5A 4JZ5A 3T42A 2X09A 3T2PA 4LAZA 2G96A 1HJSA 2D69A 3RPTA 1W32A 1XKJA 2EKCA 4L4LA 1JCXA 1F4HA 3HGJA 3KP0A 4D72A 1R30A 1WDDA 4HTYA 3M7WA 4G7EA 3PBGA 2R8WA 3UG5A 3AHVA 3UW6A 3HG5A 1VBUA 2QDDA 1JPKA 5C5YA 4UWMA 3LSBA 3CH9A 3VIKA 3SURA 1OSEA 3UVIA 3REQA 4LGXA 3ARZA 5HMSA 1GQJA 5GJPA 5REQB 1PKYA 4PZVA 2CKSA 3MBFA 4RV8A 2BASA 3VU2A 3UF9A 3EEGA 3GHTA 3EOSA 2QUMA 3T6CA 4AIUA 5F2LA 5LZLA 1LL6A 2XN1A 3HGOA 3WUBA 2YA2A 4Q32A 3BTNA 2QAFA 3RCYA 4KEVA 2I7GA 4EOUA 2ZC8A 1IHIA 4GZJA 3OYZA 2WNZA 4E4UA 3CYVA 2JK2A 4L9YA 4Q3MA 4JQ1A 3NQBA 1R46A 1T40A 3KRUA 5CPOA 4LVGA 3TNOA 2VFHA 1LL4A 7REQA 1WXJA 2PE4A 5BCAA 3W23A 2ZRXA 3E0FA 5KEZA 4DUXA 5D32A 4WX2A 3WDJA 1EJ7L 5KETA 2V81A 4GGBA 1O6IA 3G0SA 3WMCA 2P0OA 3W37A 1EKOA 3LM7A 1FWNA 4LRSA 3RUBL 3H23A 1XX1A 1KM5A 1W56A 2H8XA 3UJSA 3W7QA 2Z4GA 4JD4A 3KBWA 3O3RA 3UY8A 2VURA 2EPKX 3BJFA 1TFVA 3R13A 2O7QA 3L4WA 4M7SA 4LH8A 2OJPA 1JZ3A 1DXEA 4UTUA 3BSGA 3LCWA 3SCVA 2QJMA 3LMZA 3QY7A 4PFHA 3SIZA 2PGEA 2MUCA 3L65A 4JFWA 4PE8A 1ZP3A 2H90A 1J0IA 1HT6A 1OIFA 4ZB0A 2GVJA 1R0MA 3GIPA 3VOCA 1XH0A 2HWGA 1W9XA 3B0VC 2QF8A 5EA9A 4ZZ9A 4OT7A 1Q6LA 5AYIA 5H8MA 2ZUWA 2W6RA 3BDKA 1C7SA 2WMIB 3BQ6A 4CNSA 2PDPA 4IMFA 2OWWA 1FQ0A 2YFOA 4KEZA 1PE1A 5D4YA 1B5TA 3G0XA 2QULA 2NVAA 1W1ZA 4CD6A 2W63A 4JQAA 3GX9A 3W7LA 1TCDA 1H7XA 2BB0A 1OF8A 3WL0A 1TPWA 4XQ6A 3R2GA 3WQ8A 4MWAC 3A9IA 4FOUA 3EX2A 4RE2A 3S5ZA 1EX1A 2P76A 3DIPA 2PF0A 1P48A 1Q6GA 2E9LA 1R3YA 2ZBTA 4AY7A 3CAVA 5CAHA 4HU0A 2PFHA 4DQWA 5C7HA 5HQEA 4K38A 3B3DA 1XJBA 3CV2A 2J78A 2OWXA 1F8MA 4ORIA 3F5KA 1XLLA 4HCDA 3FDKA 5D03A 5AB3A 4WDWA 2G3FA 2WZMA 4W89A 4KPLA 1YDYA 1B9BA 1OB0A 3A3HA 4JHZA 4R3UA 3O6DA 4GXMA 3M6DA 4B4HA 4JNZA 3PUGA 1AQHA 1RLDA 2A79A 4TVDA 4GYJA 3T9PA 2KZHA 5I3JA 3L5MA 3T78A 4IX0A 2FVMA 4C7GA 3PZTA 4IIDA 3SFKA 1ZAJA 3BV7A 1RHCA 4JOMA 1IWPA 5DY2A 2XISA 3VA8A 4Q8UA 1X1ZA 4FNSA 4DELA 4ZOAA 2ZRUA 3LSCA 1SSDA 3DBPA 1JQXA 1TV2A 4W84A 2PB1A 1TVLA 2V68A 2IQ0A 3CMFA 3VYLA 4D6HA 1NWUA 4F2UA 1I75A 4H9UA 3WLJA 3GAKA 3IVUA 4S23A 1XLHA 2YZ5A 3SN0A 3HPXA 1LWHA 4FS9A 4OECA 1X8FA 4IMEA 1KM3A 1I1XA 2VDGA 4DBDA 3W75A 4BQ3A 5HBFA 1TWWA 1XCXA 4DYEA 1SVDA 4TTUA 4A22A 1BTCA 1MWOA 3AXIA 1WZKA 4DJDC 3L9CA 2RDUA 1HJUA 4HTBA 2BXVA 1L6FA 2E77A 3PJXA 3OW1A 1H7RA 1A47A 2QCMA 2V9DA 1W3TA 3N4FA 3AHXA 3KDOA 5A6MA 3QFWA 2OYKA 2FH8A 3CHDA 1KKRA 4CKQA 2R1MA 3NQVA 2C1GA 1A50A 3IK4A 3CH0A 3RK8A 5HULA 2PDWA 3EWUA 2J7EA 3ZWSA 2AMGA 2TRSA 4GACA 3EXRA 3AROA 2YDQA 1UMLA 5C9UA 3QH2A 2Y88A 3KTSA 4E2OA 1E4LA 2Z1SA 2E6AA 4J2PA 1UW9A 1X1NA 1HGYA 1F05A 5C55A 2J62A 4UOQA 3WUEA 3B9OA 6A3HA 5EFFA 4QGCA 1E6XM 5IHRA 2HPIA 2C91A 3N9RA 4OVXA 3AUOA 3IUIA 1YTEA 4DF1A 2JEPA 3EA1A 4B2DD 5IHSA 5ECVA 3T1GA 1JZ6A 1AVAA 1CXIA 4KRTA 5LXXA 3LD5A 2A7RA 5E0KA 1LCOA 3WSUA 1WBHA 3WD2A 1DKWA 4EXQA 1TJRA 5HUOA 1IWAA 2ZZ5A 4HSNA 4ENLA 3CUXA 1EWDA 1W37A 1FVPA 4UQAA 2YGYA 4IMGA 4GVIA 4GH3A 4LUIA 2OT1A 1EWEA 3LHTA 5B80A 4P7LA 1XQKA 4XKYB 3V5CA 4UFLA 1JDEA 1ONRA 4PEEA 4AEOA 4R27A 2R1NA 2BSLA 4GO8A 3R7MA 4TMCA 3EKZA 3MUCA 2AGTA 5BMWA 1EIXA 2PLJA 3NVDA 1RUSA 4WY0A 3UCCA 1ONXA 4PSPA 1IEVA 3GG0A 3TQVA 1UMYA 1F6KA 4XTDA 3L67A 4YTRA 4UQDA 3W27A 2G37A 8RUCA 4GLEA 3EAUA 3GG7A 4JQ4A 2W62A 1TCMA 5EU9A 2FGZA 1DIEA 5KSWA 4R88A 1S2CA 2ZVRA 3W28A 2QCCA 4LSBA 3GZAA 3GNDA 3WNNA 3G1FA 3LCGA 5U4NA 1FDYA 1W5OA 1ZCCA 1OC6A 4R53A 4ZQOA 2REQB 1O66A 1FCUA 4RKAA 1KR0A 3O0KA 3QZAA 1V6TA 4AMCA 4DWSC 5LNVA 2VX6A 2ISFA 3TYZA 1GW9A 1CYGA 1ITXA 3KOWA 4YLWA 3UG3A 2TODA 4M0XA 3I68A 2R82A 3C2RA 4MHBA 3S83A 4NZ1A 1L2UA 1YMYA 1KBKA 3W4RA 3KCOA 4RDYA 4K2SA 5LNRA 1PTDA 3OODA 4TOQA 3UWQA 1XFBA 4UR8A 4O18A 1M65A 3M1ZA 3BL3A 4GFSA 4S3GA 2GFTA 1EGZA 5KITA 1UR8A 2XGBA 1D8CA 1E0UA 3UPWA 3GQYA 2CFFA 3GLCA 4IF2A 5CGQA 5HNNA 2X16A 3DFQA 5DXYA 2Q8LA 3T0TA 2Q8XA 1FWJC 1U83A 1XV8A 2NVDA 2AMXA 3ONBA 4AD1A 3GC2A 2QPSA 1U1JA 1W3KA 4P61A 4PMVA 3QF0A 3U2OA 1K1DA 4BR1A 3ITVA 5EPDA 4PUNA 1U30A 1W5QA 2WJDA 3LCFA 2XVPA 3MBDA 4EAYA 1YE4A 3N2TA 2AL2B 1CW2A 1HP4A 1PX3A 4REQB 3N9SA 3QC3A 2WWCA 4KIEA 2PDFA 3KZSA 4QISA 1DE5A 4R9XA 6XIMA 4IWWA 2FZNA 4IPLA 4KCTA 3R4IA 3LCXA 3LB0A 1QOPA 2QHAA 4NNBA 4LJ3A 3W29A 1EPVA 1I2QA 4B5UA 2BODX 1ZNNA 3NZPA 5A6LA 4LEQA 4DN1A 2E5CA 4D6JA 2VFIA 3O1NA 4ACZB 4EPDC 1BVNP 1Y8BA 3N19B 3EWCA 3NDYA 1YX1A 3WDHA 1BYBA 4E2DA 4KWSA 3PG8A 5E93A 3QR0A 1NY1A 1W91A 1HXJA 3WLKX 5A8NA 4PUEA 4MOZA 1KRMA 3DFYA 1AZ1A 4UFHA 3P74A 1CGYA 4BWLA 3C2OA 2ZTJA 4DBUA 4KFPA 2X7WA 2CC0A 2QDEA 3SCRA 4CQ8A 1UH4A 1EO7A 6CGTA 3LHZA 3D3AA 3ZXWA 5GQBA 5JBFA 1B3VA 1V08A 4HPGA 5HK4A 4GC4A 1P5BA 3PJTA 5CCZA 4AY8A 1WDQA 2G5WA 1GCYA 2PSNA 1CT5A 1C8YA 4IPNB 2E7FA 2E0PA 1TTQA 3EX3A 1NELA 3VDAA 3FW6A 1TTIA 1VBGA 1BHGA 1BWKA 3E6EA 2BFGA 1W9BM 3TTEA 5CGMA 3IV3A 1LRTA 1VIZA 3PTQA 4RK8A 1ME9A 3F5LA 3NZ1A 1JYVA 4AIEA 4HA0A 4XZLX 1BTMA 4AQLA 2AQWA 3BV4A 3W7JA 1EXPA 3FXGA 4YPJA 3R11A 4NNAA 3EDEA 1FH9A 1MW2A 3DX5A 1C9DA 4L1GA 3IJ7A 3M44A 1WNOA 3DXIA 4JTQA 3VGHA 1KCKA 1CZ1A 4ECLA 1XBZA 3ANVA 3B8WA 5EKYA 4KS0A 3SCTA 3TU9A 2O92A 1DQUA 3VVGA 3B03A 4DLMA 1XUUA 1HZYA 2GVLA 2XVGA 4S1FA 3H2FA 3SZ8A 2GLKA 2J6VA 4Z1CA 2IS7A 1IGSA 5DELA 2R1PA 4EIVA 1F8IA 3SY5A 1AA1B 1S5WA 4LALA 4PMXA 4X61A 2XWEA 3H2OA 3WD0A 4XB3A 2QV4A 3CZKA 2BY2A 1E43A 1TZZA 3TQPA 1H7WA 4J9JA 4C6OA 4W5UA 2ZUNA 4LV4A 5H91A 3TJLA 4S3CA 1J4EA 2Q6ZA 3UG4A 3G0UA 4LB4A 3UVAA 4JTIA 4UTTC 1I2PA 4QXIA 4YJ5A 2XUCA 4QRNA 5HNTA 1KW1A 3E0LA 3P80A 3LXCA 1Q13A 1OX5A 3CZLA 1UQYA 3FJ4A 4DI8A 1ZFJA 3ORWA 2FFIA 2WLYA 5ABEA 4QE4A 3UNDA 4ZQPA 2Y6ZA 3UZXA 1Q6CA 1FWRA 2FZ9A 1J18A 4GIAA 4M3PA 2NQLA 4WR3A 2YBUA 2VZTA 3FJ6A 4W4QA 1FWIC 3FLUA 3NSXA 3P82A 1Y5XA 1EO5A 3EDKA 2IKHA 5FEWA 1N55A 1JCJA 4JKLA 3NQCA 2EHHA 1JPIA 5C2XA 4KFOA 3W6MA 1U5VA 3CHEA 3VOFA 6XIAA 4KERA 4Q4KA 2NV1A 3QW3A 4RLIA 3DKJA 2NQZA 1WKDA 3C3NA 2OKTA 4O0QA 2FFCA 4BKNA 3TC6A 1HG3A 3GDRA 1C29A 2XIJA 1QDSA 1W5MA 4BI6A 1AQ0A 1VAHA 4TIMA 2OELA 4WSJA 2VRQA 1PPIA 4Q4RA 4D8LA 3SCNA 1BSIA 4GQQA 3DFSA 1VF8A 4O12A 2Q3OA 1TX2A 4AZCB 2J6XA 3NYZA 2Z1KA 2WMIA 3M5VA 3BSMA 4LVFA 2C15A 3N17A 1WAWA 2ZRYA 3UY7A 3BK0A 1B2YA 3STCA 2YB1A 3ANYA 3S8HA 3PWGA 4ZOBA 2Z24A 3O7UA 4ICMA 2QJNA 3S6DA 5FF7A 3A21A 4GA8A 5JIWA 2XGIA 3U48A 4H19A 3UQNA 4M81A 3T2OA 3QEZA 3GHSA 3USBA 3BANA 2OLSA 3CZ8A 4I6VA 4YIWA 1ME7A 3W6YA 2YDSA 3L0GA 4UR9A 4M5PA 3T81A 2JIWA 2RHGA 4XUGA 3URQA 2V63A 1XIFA 1A53A 3ARQA 2J7CA 3BLEA 3F2BA 3QHMA 1FWAC 1CPUA 3BLOA 3H22A 4O1BA 1G4EA 3VIIA 4LAKA 2XFRA 2G50A 4IG2B 1RQHA 3CL8A 4H9TA 1O1ZA 4OFCA 1RBOB 4OBTA 3GTHA 3WUGA 1TVNA 4Z2LA 3CM4A 4Q6JA 4HOXA 2A21A 3GU1A 2OO0A 3AZTA 4ZB2A 3WMSA 3U57A 1AH4A 3R12A 4C90A 5FCZA 3W72A 3E74A 3MV01 1AODA 4RR4A 3MANA 3O6YX 1DOSA 1K77A 4AZGA 2GGHA 1EB3A 3HPZA 2TSYA 3NZRA 4ZE5A 3W53A 3BPWA 1OQFA 1WPCA 1QR7A 4CD7A 4OE7A 3TYUA 1W9UA 1JCNA 4KIRA 3LYEA 4KRZA 3H8AA 3DYPA 5JBEA 1ZJIA 4GZIA 4TR9A 4NX0A 2RDXA 1FRBA 3OVGA 2KX9A 2V3DA 3LHWA 4JN7A 5H6HA 4HOWA 4XD3A 4O16A 1R9ZA 2WNWA 4KCVA 3MSYA 2VEKA 3MYPA 3LUTA 1BKHA 3PUOA 4ZXLA 2WMFA 2D22A 4CVUA 3Q58A 3EEZA 2PTYA 4QJ3B 1J6PA 1ZCOA 3AXHA 5DCDA 2NZLA 1ZAIA 9XIMA 3FGCB 4PB4A 4QCEA 2JF7A 2PI6A 1PV8A 3V7PA 4DPPA 1VEMA 1Q6DA 4I5UA 2Y2WA 1MQQA 3WJWA 3BLFA 2X2YA 3CQ0A 4C60A 4GO9A 1J11A 4HD5A 1T0OA 2FHCA 4P8WA 5LXEA 1QBAA 2P1FA 3L4TA 1ZGDA 3WQ4A 3BARA 3M0HA 2NX3A 1DE6A 1PKNA 2ZUMA 2PRHA 3WLPA 4JNYA 2PTXA 2ZUSA 3PANA 1EX5A 1HO1A 4A2RA 2EG7A 2SFPA 2RDWA 2QW5A 1M41A 2MANA 2Y5EA 5XIAA 5CG7A 3OP2A 3VX1A 3UWZA 3TFCA 3WY1A 5E9XA 1R7OA 1EQCA 3CGTA 4M1RA 4LYPA 1AK5A 3CQIA 1Q7ZA 2VHLA 4HN8A 3W00A 5CPNA 5HWMA 2E8YA 5JQ9A 3NSMA 3DBNA 4D2JA 3MDWA 4R7WA 3S9YA 3TSDA 5AYBA 5BXPA 3ABOA 3ITOA 2PTZA 2Y24A 4DO6A 5IFPA 2DORA 5CEWA 3TR9A 2DVXA 1EL3A 2OEJA 3UR2A 4IUOA 4X9YA 5J5DA 1QHPA 4LT9A 1NSJA 2XGZA 4CNNA 3KM8A 3C2FA 4RDWA 2DU2A 2GOKA 1WDRA 1KTNA 2FIQA 3P60A 4QBXA 2BY0A 5AHLA 3AS2A 2B0MA 3TN6A 1EC9A 2PWGA 1OFAA 5A6BD 2A1YA 2ZZ4A 1RZMA 2FPVA 3RU6A 1V3JA 1F3TA 1BYDA 1GYMA 3R8GA 4Q33A 1LG2A 3DERA 2O55A 1RLCL 3GYEA 3I6EA 3CTLA 4AHQA 4Y9MA 3IACA 3ALGA 2RJHA 5E09A 1GOMA 3TR2A 3NOYA 2TYSA 1E70M 2FTYA 3SO7A 4Z08A 1HFBA 2PU0A 2YL9A 1JULA 3URAA 3E02A 2CIPA 2HZGA 3AS1A 3R8RA 3CZJA 3B4YA 4UUIA 3IIZA 1SZGA 1HX0A 1G67A 4WY0B 1GGOA 1W1IE 1LLOA 3ZT5A 4GUJA 4FXFA 1PVNA 3G1RA 3T7VA 4INFA 3M0ZA 5CSUA 1SW0A 3QKZA 1XWYA 4BCEA 1H63A 2G3JA 4RW3A 2NSOA 3B8IA 2Z7KA 3IRDA 2Q71A 5DLCA 5H2ZA 4HHMA 4D71A 3M5XA 4H8VA 4LUYA 5DXXA 5AHMA 3OEXA 5K2ZA 3V0UA 3C6CA 1KNWA 4A4AA 3EYPA 3MTWA 3TZNA 2OZTA 1XRSA 2A6NA 1Z9AA 3N73A 1XIIA 4NRSA 3S46A 3W1NA 3HG4A 2PWDA 4GQGA 2DSZA 1GVOA 4Y6GA 1PYFA 2C79A 2VWSA 3EKLA 5HJLA 3W7OA 5I03A 5J04A 4WOZA 2WHJA 1VFOA 1BVZA 4UZSA 4PA8A 7TAAA 3UYIA 1K4HA 4PMJA 1S2WA 3A5VA 3LTPA 4U2YA 4IL0A 1Q3NA 4WJ8A 1HKIA 4ML9A 4L7ZA 1UIPA 2NXHA 4XO7A 3CEUA 3WQGA 2FH6A 4CNTA 4HSOA 3H54A 5LIKX 3CWHA 3UGRA 3PAOA 3TH6A 3EWWA 2V2HA 1ZAHA 1FDZA 4CQCA 2XH2A 1K7FA 1S5NA 3IAQA 4HYRA 4CCCA 1Q85A 3WLMA 4I9AA 1HKVA 1M5WA 1CXFA 5F4WA 4AEEA 3BZGA 4GBDA 3WNOA 4DZHA 4QE1A 3LPPA 1UWUA 4JHMA 1SZRA 3NR0A 3URBA 1EF2A 2FPYA 1KQZA 3GC4A 4HPHA 1MXGA 3LOTA 1RK5A 2VOTA 1PCKA 1W5NA 1A5BA 2WMGA 1NAL1 3AO0A 1KRBC 3GTFA 1XIHA 1X7FA 3UU0A 3EWXA 4N6EA 4DBEA 1OK6A 3IVSA 1FWGC 1UH2A 4X63A 3L21A 1K03A 1A4MA 4DUVA 4L4OA 4JDBA 4J27A 2A7PA 1B3YA 3W24A 5GNXA 1A5SA 3GYCA 1MUWA 1B30A 1IF2A 1T99A 4N4PA 3OJGA 2WZTA 1XIJA 4UMAA 3LRLA 3GM8A 2C1HA 3LPGA 4L6OA 3KBVA 2ZA3A 2ZZ3A 5HQLA 1W3IA 4HNUA 3WQCA 3ZR6A 2G95A 2ZRZA 4LAOA 1AL8A 3TJ4A 3O8AA 1B1YA 4Q7BA 4GYPC 2QYGA 3T0DA 1XD1A 4IGNA 3EOOA 1GPWA 1Q6FA 1W1VA 1ZU8A 3M0IA 3MI3A 2BOGX 4DHGA 4GCAA 3NQGA 3ME3A 3M9YA 4IQDA 4DYKA 4CN1A 3AHTA 2XU2A 3FVDA 4LCSA 4BF7A 3OZMA 1TE1A 4P7NA 1QI0A 2WSRA 4P7RA 3G1VA 1JZ5A 4DJEC 2GWGA 1FWEC 3OGVA 3ZVIA 1FHUA 1G1YA 1V0MA 1ITUA 4GX9A 1KFLA 1TJ0A 3OTRA 4JTSA 3V18A 4Q6XA 5G2HA 4ERGA 4AD0A 2VFGA 5M3WA 3PBMA 3N14A