1JUBA

The k136e mutant of lactococcus lactis dihydroorotate dehydrogenase a
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
311
structure length
311
Chain Sequence
b'MLNTTFANAKFANPFMNASGVHCMTIEDLEELKASQAGAYITKSSTLEKREGNPLPRYVDLELGSINSMGLPNLGFDYYLDYVLKNQKENAQEGPIFFSIAGMSAAENIAMLKKIQESDFSGITELNLSCPNVPGEPQLAYDFEATEKLLKEVFTFFTKPLGVKLPPYFDLVHFDIMAEILNQFPLTYVNSVNSIGNGLFIDPEAESVVIKPKDGFGGIGGAYIKPTALANVRAFYTRLKPEIQIIGTGGIETGQDAFEHLLCGATMLQIGTALHKEGPAIFDRIIKELEEIMNQKGYQSIADFHGKLKSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords dihydroorotate dehydrogenase A
publication title Lactococcus lactis dihydroorotate dehydrogenase A mutants reveal important facets of the enzymatic function
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Oxidoreductase
total genus 118
structure length 311
sequence length 311
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2001-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 1jubA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1jubA01
2ZFAA 3NOEA 4EIVA 3IIVA 3G0SA 4FF7A 4WX2A 4JIQA 4AVFA 3JS3A 1OFQA 3CC1A 1BKSA 1TRDA 3T40A 4AB4A 1PS9A 2KZHA 5U4NA 5LNUA 1XBYA 3TROA 5CPMA 1P0KA 3GVGA 3P5YA 4HPJA 5E0KA 1G4TA 3UPWA 4JTFA 5HWMA 2CLKA 2YX0A 3EKZA 5F1VA 5KZDA 3NQ7A 4ML9A 1OYCA 4UCGA 3HPZA 3QF0A 5I3KA 3E12A 3P74A 2ZYFA 3FJ6A 4CCDA 3PSVA 3TNOA 1TV8A 1TPC1 5EMUA 4NZJA 4C1LA 2DZPA 4LUJA 4NT0A 3MBFA 3SIZA 2B7PA 4LVFA 3B4UA 1L6SA 3LRKA 4AHPA 5K9DA 3LHYA 1EX5A 3NNTA 4IMFA 1ME8A 1SPQA 2TPSA 2BTMA 4LVAA 3QPYA 2DZXA 3MJYA 2TSYA 1VHCA 1TTPA 5KTLA 1H62A 3BPWA 5IBXC 3G8EA 1T99A 3OVPA 1TPVA 3Q58A 3NL6A 5D2WA 4YMZA 2E5BA 1KM0A 2XN0A 3Q2DA 1NF0A 2JKPA 2LLEA 1JCLA 3S6DA 1RVGA 4IPIA 3I7QA 1H7NA 4NXSA 3TXVA 3SZ8A 1I45A 2Z2UA 3W7OA 2NUWA 1OX4A 3PULA 3R2GA 3KX6A 4JTKA 4H4IA 1K8YA 3OG3A 5CPNA 1K7XA 1DHPA 1W5OA 2WSQA 4QISA 4RXGA 3TSMA 1WBJA 1B9BA 2E77A 4UTHA 3M6YA 3RLVA 2C1HA 4FX6M 4NJIA 3NQCA 4HT3A 4FNSA 4JIPA 5FF2A 3QEZA 3T7VA 5K3VA 1SSDA 5F4SA 3UWQA 2EF9A 4CLMA 2CFFA 3LHUA 1VH7A 3TQ0A 4POCA 3W88A 1OFEA 4UIOA 3FFSA 3E49A 4JYFA 5D32A 2YW3A 4O18A 3SW6A 5LNSA 3LCFA 3NQAA 4LVGA 3O16A 3G1SA 2X1SA 3T4CA 4RZ4A 3P67A 4I7VA 5AHNA 5DBTA 3G1FA 3LRMA 3PG9A 2Y7DA 4K38A 1H5YA 2ZTKA 1LOQA 3LERA 1LBLA 1OX6A 3LCXA 3QM3A 1SO4A 2VFGA 4TR9A 2F7FA 3RK8A 3UZ5A 3OVQA 4IQLA 3SSJA 2P0OA 4AWSA 5DELA 3IIXA 5CZSA 4UFJA 3WFAA 4XBKA 4N6EA 1DQXA 3R5EA 3CQ0A 1OX4B 2VEIA 4Z0SA 4M5PA 4N9EA 3IIPA 3L5AA 3T55A 1VQTA 2H6RA 5FEWA 1V7YA 2GQ9A 2W0UA 5EYWA 5C5YA 5HR6A 4ZMGA 3DFNA 1C29A 4A21A 4O15A 5BOOA 4WY0F 3W1UA 3QH2A 1EB3A 4BK9A 5FI8A 3G1AA 3P61A 1FQ0A 3NQ2A 2NUYA 2X1UA 4K7VA 3BARA 4JGDA 4LT9A 3NQGA 5CG7A 4AEOA 2CLFA 3TJLA 1EEPA 2Y88A 1F73A 2GQ8A 1FUYA 2C6QA 4MOZA 5LGXA 2GVJA 3QPZA 4TU1A 3H54A 3MP5A 3NQMA 1GWJA 1CX9A 1I8JA 4HNUA 4K7YA 5C2XA 1L6YA 3W07A 3ABOA 1JRCA 2E5DA 2FQIA 3HGOA 4JEQA 2BX7A 2B7NA 1FWTA 3YPIA 1BWLA 1XKYA 1XM3A 3ZWSA 2OT0A 1JULA 3FA5A 2G5WA 5LSMA 1OFDA 4WOZA 4AMAA 4OT7A 4O11A 4WXZA 3LOTA 4Y96A 3KVJA 2A7PA 1P5BA 3C52A 1Q3NA 1TTJA 2O7SA 3L5MA 4LS1A 1TPFA 2J27A 4XTIA 5E1QA 4LNYA 1S5VA 1KFLA 7TIMA 8TIMA 2QUTA 2C18A 3H55A 4RZ5A 1M7OA 1DJQA 2HMCA 4AAJA 4LUIA 2V2HA 1F7BA 1F76A 4O8RA 5HWNA 2VC6A 4RJEA 1KBJA 4JN6A 5I3HA 2YYTA 2V82A 2OMAA 4Z1BA 4HIBA 4LV9A 1H7RA 1AW5A 1XBXA 5F4WA 3G0UA 4XKYA 4JTHA 3S5ZA 4Q4KA 4O0ZA 3PVFA 1QPQA 3W7QA 1W37A 2FTPA 2FPTA 2R8WA 5BMXA 4UMAA 5CZJA 3CIWA 2H8ZA 3W73A 1YTKA 3JRKA 4FB7A 5F2MA 1YDVA 3N2XA 3P7YA 2FFCA 3B04A 2P1FA 3O6DA 1VCGA 2YGYA 3TMQA 4DF2A 2NV2A 3FLUA 4A3UA 4NJHA 4XWUA 4ZQNA 1PCWA 3VE7A 3IV3A 2QAPA 1X8FA 3USBA 2AGKA 1XDMA 3NR0A 3KOFA 3LV6A 3UQNA 4GNJA 3EWZA 2ISVA 3A9IA 1R46A 2ZDRA 1LTDA 5DBUA 2VEPA 3C56A 3DFTA 2ZRUA 5AYYA 3TU9A 3TJXA 3PB0A 6ALDA 3PWAA 2NWSA 2CLLA 2WOQA 2DU2A 1QO5A 4MY9A 2W6RA 1OF8A 2Q8LA 1P0NA 3TQVA 1MXSA 1KM2A 4UXDA 4CCCA 4UTWC 1GJPA 2QF7A 5D05A 5CSRA 4E2BA 1RPXA 4UUIA 4CQ9A 3W1QA 3G8RA 3BG9A 5D2XA 2A85A 3W7IA 1SFJA 3PG8A 3W7JA 3UY7A 1YXDA 3ZWTA 3QC3A 3LGEA 5K9CA 2Q3RA 4K8HA 3EXRA 1ME9A 3N34A 3O07A 1YDOA 3AJXA 3MO7A 4FNPA 3LXAA 4WOQA 4JTEA 3TV8A 1SZGA 3DFOA 4AWTA 3KRZA 3GDLA 1VYSX 4Q32A 4OV9A 5KITA 1OFOA 3LBMA 2V5BA 1W5QA 3BO9A 4X3ZA 4NUWA 1W5NA 3W83A 5DCBA 1X7FA 1TSIA 2YDAA 1I2RA 4NJGA 1JCYA 2Y85A 3CB8A 4NZFA 2Z6JA 1CW2A 1G4PA 1FDZA 4LTSA 1JCMP 5CZTA 1F5ZA 1H7OA 1LM1A 5FEZA 4NVTA 4I7WA 1XXXA 3KXQA 3O1NA 3PB2A 3SECA 5FF0A 3PUDA 3N9RA 2QCGA 3BG5A 4GC4A 1TQXA 1IXPA 1OHLA 5AHIA 2ISSA 4JY8A 3NQDA 5DXXA 1YTEA 2VFHA 5G2HA 4DBEA 1G4EA 3L0KA 4QNWA 4RV8A 1FCUA 3TAOA 3GAYA 4JYEA 3KAOA 3LCWA 3M47A 1KM4A 1RV8A 1TPWA 2Z1BA 1LORA 4TMCA 3G24A 3C6CA 3W71A 3FIGA 4DPQA 4Y9AA 3B8DA 1Q45A 1TYGA 3ZS4A 3IIZA 3GAKA 2DORA 2WNQA 4IUOA 4P2VA 2Y7EA 1EPXA 1ZAHA 4TMBA 3TC7A 1S5TA 5FF4A 1WBHA 4KKXA 4ZQPA 5DCEA 3EWBX 5K7JA 4EVZA 1TCDA 4L4MA 5EL1A 4LC6A 4MFEA 1TV5A 1P4CA 4GRSA 2B7OA 3QRHA 3KHJA 3INPA 5MHBA 5IBXA 3KRSA 1ZAIA 4MY8A 2WNNA 2VXNA 2CLIA 2VFIA 4O13A 2YCEA 4ZQCA 2JGYA 1W3NA 4DELA 2A2IA 1D3HA 1QOQA 4FXSA 5LKYA 1ZAJA 1LOSA 3S9YA 2A7RA 1OFAA 1SSGA 3KVKA 4O28A 1DQWA 2QCHA 2ZZ4A 4O10A 2DJXA 2Q8ZA 1N55A 3LLDA 4UFHA 2ZZ6A 3MYPA 2G95A 2R91A 1VJIA 3EX6A 3L0NA 1LLWA 3MMTA 1NFBA 4O4VA 3ABRA 5DY3A 1WX0A 3ZR4A 3TDFA 3V75A 1W3TA 2Q3OA 4FIQA 1KFKA 4RX0A 3IIOA 5D03A 4OQVA 3N19B 4QAIA 2WNZA 1W8SA 2FB2A 3C2FA 1PE1A 1NSJA 3M0ZA 3BV4A 3LXBA 3LRLA 1KM3A 2ZRWA 5D38A 3QZEA 1W5MA 1O4UA 3O6CA 1WOBA 2YR1A 4JTUA 4YL2A 1TB3A 4UTJA 1KFJA 2V8ZA 2G96A 4M6QA 3PSWA 3NM1A 3UZJA 3TA6A 2I1OA 3VNDA 4L4LA 1OYBA 3PBUA 3M5YA 1B4EA 2QCNA 4UNKA 3QQ0A 4ICNA 3W7HA 4MPQA 3RLUA 3GXPA 5A8GA 4GBUA 5BW6A 1EWDA 3THQA 1T8XA 4S2CA 2GVLA 1YYAA 1ZALA 2YPIA 3NQEA 1JR1A 3VCRA 4YWIA 1NAL1 2GJNA 1U83A 4BWLA 1TTQA 4J9JA 4O1CA 3UWYA 3TFCA 3SI9A 1FXPA 3MI6A 4ORMA 4WUIA 3C2VA 2C0AA 1QPRA 2YZRA 3HB9A 3LCGA 1JCJA 3B05A 1IXNA 3LTSA 3L68A 3DFSA 2J9YA 1ALDA 3S5YA 1OVDA 2OX1A 2QCLA 4IX2A 4LV4A 1QWGA 4EF8A 2YXGA 2ZRYA 3W2MA 2QJIA 3LV5A 4XTDA 2A7NA 1KM1A 2FLIA 4MZYA 1G67A 1TMHA 2YFNA 2A1YA 2DZWA 3BLFA 3DHFA 1ZNNA 5K4XA 3W1NA 4O0KA 1K03A 4JTIA 1ICSA 4IMCA 3P84A 3KRUA 3MWAA 1GVRA 1JUKA 2GVGA 1FCVA 2CLOA 2ZZ5A 1MSSA 3IEBA 4AHOA 4CNNA 3N14A 1FDYA 3MP4A 5D2VA 3NXFA 4O50A 2WSYA 5AC8A 3NEVA 3NYZA 4GJ1A 4A2SA 4R53A 3TX9A 3NPWA 4K8EA 1VYRA 1S5WA 3ZFHA 2TRSA 4TIMA 1RZMA 3EWXA 4U4MA 1ZJIA 2CZ5A 3M5XA 1MEWA 2DP3A 1TJRA 4M7TA 5HNRA 4ONVA 1C9DA 2H8XA 2JGQA 3P81A 3W7DA 2NZLA 1LLZA 4QSHA 4IPJA 4S1FA 3PR2A 3W9ZA 3O05A 4DPPA 3LXCA 3NPUA 5LNRA 5AYXA 2ZA2A 2A21A 3TC6A 3I7SA 3TCEA 1GVOA 4WY0A 4O17A 2QDGA 3JR2A 2TYSA 3LB0A 4PL1A 3W1PA 5K9XA 1SU5A 3IGSA 4UTKA 3DKLA 3HG5A 4IJBA 3HPSA 3DAQA 1GTEA 1K8XA 4PFMA 3CIXA 3DBPA 4JTJA 1AL7A 1HO4A 3B0VC 3T78A 3GXTA 5CZ0A 1DL3A 1D3GA 2OJPA 4Y8FA 2A6LA 4QIUA 2C19A 3I65A 4M6VA 2BZNA 2V2DA 5T26A 1GYLA 1GVQA 3SFKA 2ZTJA 1TO3A 4TO8A 1LZOA 1VZWA 1HG3A 3BW4A 4IGHA 4DBDA 3NAVA 4AF0A 3LHTA 5HINA 3BGGA 4IXHA 3TK7A 4JDYA 1EP3A 1VS1A 1I2PA 3HGRA 3LM7A 2VEMA 1XI3A 1EUAA 1H50A 1R2TA 2A6NA 3E9AA 2RDTA 4OGZA 1JCNA 2PRLA 3LCLA 3QMRA 1JVNA 1W56A 2FPVA 2J9XA 1KBIA 1OABA 3C61A 3LX9A 2CU0A 3W3OA 2NV1A 3DXIA 1SFLA 1PHQA 1WYIA 4ZVJA 5F1UA 4N4QA 3LHVA 4WY0B 1TTIA 3EXTA 3RMJA 5GVJA 1HTIA 2VFEA 3DKJA 1IXOA 5HULA 1IXQA 2HS6A 4I7UA 1FWWA 4GXMA 3TQKA 3PBYA 3WK2A 3IGXA 2H90A 3ANYA 3W74A 1D9EA 1UJPA 3RU6A 2EKCA 3W86A 4KFNA 3UWWA 1B4KA 2E6YA 1LRQA 3BW2A 1LDCA 1FX6A 2BXVA 5L6UA 1L2UA 4N9BA 1FCBA 4HNVA 3W85A 3HG3A 4NJJA 3M1ZA 3LBCA 2V9DA 4D2JA 1OYAA 4N2YA 5E93A 4AHQA 1R2RA 3PUOA 3NDOA 2DZSA 3EWWA 4N9DA 2HS8A 3H53A 4KFPA 3UWZA 1G7VA 4ZL1A 1M5WA 3W7CA 4KWWA 1UBSA 3L5LA 1NEYA 1FDJA 1AL8A 4RR4A 1QPOA 3DI0A 3QJAA 1B57A 5D33A 1FY6A 1NVMA 3NM3A 1HUVA 2CLEA 3QW4B 4MIMA 5G4WA 3W1AA 2Z6IA 1AK5A 3B06A 4MY1A 3NZRA 3PM6A 3DHDA 2NXGA 2J88A 3GDTA 4WZHA 1A53A 4IMGA 3TUUA 1ZFJA 4DF0A 2RKXA 4R33A 5SWUA 3TSBA 3W2NA 2X16A 2QUUA 4WD0A 1EIXA 5HUPA 1TPB1 2GOUA 4IMEA 1WDWA 2OT1A 2C16A 2VFFA 5TIMA 1OFRA 2I14A 3BW3A 4E38A 1ZY9A 2ABBA 3F1QA 3QMSA 1BWKA 5HJLA 3IVTA 2ABAA 5KMYA 3GLCA 3LTPA 4HPXA 3N73A 4LS2A 1A5SA 3NVTA 2NX1A 3W6YA 2WSRA 5DXYA 5G1YA 2PRHA 1TJPA 3NL2A 5FEPA 2RHGA 1DBTA 2OZ0A 3CHVA 5ABTA 4K6AA 3EB2A 1XUUA 1H51A 5AHLA 3G0XA 4EWND 4R7JA 4JS3A 3GZ3A 4Z1DA 5J5DA 3W2LA 2GPTA 1K7EA 2OCZA 3C2RA 3L0GA 4PA8A 3LDVA 3BLEA 4PODA 4N9CA 2QJHA 3WJYA 1BTMA 3A24A 1JUBA 4MUZA 1DJNA 2CZEA 4NX0A 4I9AA 3NGJA 4IOTA 4JNMA 3S1UA 1NF7A 1VLIA 3M9YA 3P8IA 3EX2A 4CNPA 1LROA 3W7LA 2W79A 4XQ6A 1LCOA 4XKYB 4LS0A 3CWOX 1LRNA 4NU7A 1OX5A 2E6AA 2Y70A 3IRDA 1OFBA 3HBLA 3LHWA 4JTGA 1UUMA 3NQ6A 3UWVA 4GFSA 5I3GA 1MO0A 2XFWA 4MKNA 4Y6GA 3GR7A 1I2NA 2ALDA 4IX0A 1TIMA 4KWVA 1OJXA 5J5RA 4NNBA 5HUOA 1ICQA 5FF7A 4DO6A 1X1ZA 2QCDA 3G1HA 3LTYA 4MFDA 4NXKA 1K8ZA 3GKFA 5LHEA 2IQTA 3GNDA 3F03K 4G1KA 2ZZ2A 1H7XA 4NNCA 2RDUA 4MVAA 4MYXA 3F4WA 3RNDA 4DO5A 3BLIA 3TKFA 1KV8A 4AXKA 3NA8A 4DEFA 4WXYA 3HF3A 4Z08A 1I2OA 1GYNA 3STFA 2C3ZA 1KTCA 3EX4A 4HSNA 4IXXA 4MYAA 4O1AA 3HOJA 2RFGA 3TXZA 3W7MA 5H91A 3RFAA 3U8GA 2Y7GA 3DFQA 2X2GA 3S8HA 5CKSA 3C8FA 4FNRA 1O5XA 4C1KA 3W1MA 2QJGA 3GXNA 1H60A 1SO5A 3QW3A 3WK0A 4O1DA 2VOMA 1CI1A 2QAFA 5D2YA 3W2KA 4HN4A 4X22A 3WK3A 3GDRA 2CLHA 1E51A 4UTTC 4QQ3A 3G18A 4YCPA 4O52A 2B7QA 3K30A 1H1YA 2WV8A 1TPH1 1UUOA 3QMTA 3WJXA 3L66A 5TQLA 5LNWA 1LRTA 1A50A 1J4EA 3TMLA 2D73A 3P62A 1RD5A 1K02A 3LI1A 5I3IA 4LW7A 1S3HA 3G1VA 1KM5A 3TR2A 4BI5A 4JYDA 1IIGA 4JD4A 3R12A 4OHQA 1YADA 3N2MA 4RZ6A 5EY5A 2BLEA 3BG3A 3UXAA 3E96A 2DZUA 1GTHA 3MBDA 4Z1CA 4NJKA 3HG2A 2QKFA 2A0NA 2E1DA 1ML1A 3UXDA 5AHMA 5LZLA 2QCMA 2UV8G 1I2QA 2CLMA 1UCWA 3THAA 1PHWA 5AYZA 4FXRA 3SY5A 1JUEA 1A5BA 4PH6A 2CW6A 3TW6A 2CZDA 1QCWA 3VE9A 2QUVA 4UFKA 5I3JA 5D2TA 3HGJA 3EWUA 2V0TA 4GUHA 3B0PA 3S0CA 2ZRVA 3F4NA 4FEZA 1R2SA 4ZQMA 1QAPA 4H3DA 4ALDA 2PURA 5EKYA 1DKWA 3GIYA 3OHIA 4AH7A 1V5XA 1SO6A 4IMDA 3GB6A 4LOCA 5AFDA 3ELFA 3KVMA 3HO8A 3S42A 1W31A 3EXSA 4CQ8A 1G69A 3P5ZA 3WJWA 5FEXA 3W87A 1LOLA 3STGA 3NG3A 5LHFA 3NPVA 5FF3A 2NX3A 1BEUA 4K37A 4FNQA 4QJ1A 2Y63A 1EUNA 5D30A 1AG1O 2EAWA 1Z48A 2NWRA 3EEGA 4KFOA 3DZ1A 3B03A 5L9FA 1GQNA 5C54A 3HMJG 2YW4A 5C55A 1Z42A 2PCQA 4BFAA 3DH7A 2EGZA 4LVBA 3W1TA 3M5VA 2YYUA 2DZTA 1H7WA 4LU0A 2JBMA 3MI3A 1OK4A 3A5VA 5DCDA 5G5IA 1FXQA 4M7SA 1Q6LA 3ATYA 5G4EA 5F2GA 1DV7A 3W2UA 1MEHA 1QO2A 2J24A 4EOUA 1RQBA 2J6XA 1ME7A 4JX4A 4FX7A 2GUUA 3AO0A 3I68A 3L65A 4GE8A 3BGJA 2ZBTA 3S5NA 2NLIA 3PAJA 3QSTA 3TIMA 2DJLA 1P1XA 3E0IA 2WPBA 1OF6A 4RK8A 4A2RA 1ZHAA 4UTLA 2X30A 2AAMA 1TQJA 3KVLA 3C2OA 3ABSA 3GYEA 2BWGA 2C14A 4O16A 3EWYA 3QQ1A 1W3IA 2NXIA 3IGUA 2FPYA 2FDSA 3LI0A 3L21A 4GUGA 4LVDA 4DF1A 3W1XA 1R47A 5F2LA 2GJLA 1KTBA 1AW1A 2YFOA 1N7KA 4DQWA 4N02A 1VPXA 3W7GA 3DI1A 3TE9A 3NO5A 3QYQA 4JDBA 3FYOA 1AW2A 1O94A 2C15A 4UTUA 3HJZA 3PF3A 3MI2A 5CSSA 5D37A 3TW7A 1RQEA 1Q6OA 2WO5A 3A5FA 3L2IA 5A5WA 1UB3A 4Z1AA 3GDKA 1I4NA 1KFCA 4K36A 1KFEA 1Y0EA 1YPIA 1XBZA 2A4AA 2E68A 1LP6A 2V30A 3A21A 6TIMA 1VCFA 1TPDA 2CWNA 1QDSA 4CQAA 4JY9A 5U7SA 1GEQA 3UWUA 3M43A 3W22A 2E6DA 1C8VA 3G1XA 2FJKA 2Y62A 4H6KA 1ADOA 5HR7A 5KZMA 3G22A 2J9ZA 2EHHA 3HGSA 4O53A 3ATZA 1WAUA 1ZENA 1FCQA 4HNNA 1DVJA 3P80A 4JTLA 1M7PA 1Z44A 2JK2A 4FIRA 2FB3A 3P8JA 4Y90A 1G4SA 3VFLA 1H61A 4QITA 4RKAA 2R94A 4MJMA 3W84A 2ZCGA 1EP1A 3WK1A 1X1OA 3PC0A 4ZZ9A 1KFBA 5BMWA 1VGAA 3W1LA 3UNDA 4A29A 2P10A 1FWSA 4JX5A 3C4UA 1DOSA 2JKAA 1VCVA 4HSOA 4YCOA 3CU2A 3PY2A 1HFBA 1VHNA 5G2WA 2TMDA 3M5ZA 1H1ZA 4M19A 5I3FA 5AOUA 3EX1A 5HWJA 3E02A 3M44A 2V81A 3HQ1A 2QCFA 4UTWA 4HNTA 3RF9A 1F6PA 3Q37A 3M7WA 1EA0A 4UFLA 5F4XA 1EWEA 3VKJA 1FWNA 5DY2A 1N8FA 1B3OA 4Z0JA 4K39A 2H3DA 1GZGA 3SR7A 1IIHA 1M6JA 1KV5A 1KLYA 5AHEA 1UASA 2Y7FA 1SW3A 4UTIA 4FO4A 4UNLA 4E2DA 3UY8A 4DXVA 3STEA 4BI6A 4O4WA 1AMKA 4GWEA 4BWLC 5LGZA 4P61A 1MZHA 5H2ZA 3MHUA 3FYPA 1KW1A 3MP3A 3U6WA 1G7UA 3DGRA 1PL9A 1Q6QA 2QEZA 4LY8A 4OBTA 3EX3A 4OV4A 3MHFA 1DORA 3OVRA 2WJZA 4AF0B 1WXJA 5F2IA 1T0OA 4UMBA 4NQ1A 4MLJA 2VELA 3SJ3A 4M6PA 3NL5A 1FWRA 2CZFA 2I9EA 3O8AA 1WA3A 2HSAA 3W7PA 3CLMA 3GR8A 4CNOA 1F6KA 2QR6A 5CGQA 4AWUA 5D09A 2PE4A 2WQPA 4JX6A 4GUJA 3R8RA 4XZ9A 3HG4A 1JCXA 2NXHA 3SGZA 4DO4A 1W1ZA 3R13A 1YDNA 1A5AA 2X1RA 1PVNA 4WQ6A 5AB3A 1ZCOA 3CEPA 2QDHA 3GNNA 2WKJA 3GK0A 1T96A 1XL9A 3G1DA 4JTTA 3P82A 4HKPA 4MZ8A 4O19A 3GDMA 4IWWA 2HTMA 5DN1A 1F74A 2ZZ3A 4UTTA 3Q94A 2RDWA 4ZQRA 4UMCA 3NZ1A 4N4PA 4GUIA 4OE7A 2B0MA 4Q33A 4W9TA 1GVFA 3W72A 4O1BA 3NPXA 1W0MA 3FKKA 1Z41A 4UFMA 3LLFA 4X2RA 3T44A 4LRSA 5LNVA 2B4GA 1PV8A 1JQXA 2F84A 4B5NA 2DZVA 3O15A 2AQWA 3QSRA 1FBAA 2VEKA 2Y61A 1KLZA 3KFTA 1TPUA 1JRBA 3DENA 3FJLA 2GQAA 1Q6RA 1W54A 4JTSA 2QCCA 1ICPA 1RQHA 2ATSA 3MHGA 5AN7A 2E09A 3IVUA 4ADSA 1OFPA 3DFPA 1THFD 3BK0A 1J2WA 1HO1A 1QNVA 2VENA 2V5LA 5D02A 4FX8A 2JKEA 2Y6ZA 3C0JA 3BVJA 1SUXA 1LBFA 1SW7A 1K3UA 4OWGA 3MYOA 3W23A 4PC8A 5AC7A 2E6FA 1XDLA 3L67A 1XFBA 3EKLA 2ATMA 1TREA 3TSDA 4XBSA 1VR6A 3O6YX 3TFXA 5TBOA 4MLRA 4S2BA 5CPOA 3OA3A 3W76A 4PEKA 1EP2A 3PBVA 4O54A 1OG0A 5KINA 3MUXA 2ZRZA 1QMLA 5FESA 3UPBA 3PBWA 3S1VA 4PL2A 4JXCA 5EBUA 4RLIA 5C6MA 4WJEA 3R89A 4NNAA 1PIIA 5EPDA 5HMSA 1YPFA 3P60A 3L9CA 2VKZG 3FOKA 4UC5A 5D04C 4RXFA 5HQEA 2XN1A 4BR1A 4OU1A 1VLWA 1YXYA 3W7EA 1QOPA 2ISWA 3IVSA 4ZQOA 1KTNA 3OIXA 3O63A 3SGUA 2Y89A 2ZRXA 3UD6A 1WOAA 4CCEA 1GT8A 3LHZA 1ONRA 1O60A 1OK6A 3NL3A 1U5JA 2R14A 1SW0A 2Z0IA 4O14A 3CTLA 2PC4A 2FIQA 3DU0A 5EA9A 4JICA 1GVSA 4MJZA 5IM51 3N9SA 4U28A 3G3DA 3B0UX 3C3NA 3WJZA 4QM1A 4LC8A 3QFEA 1XBVA 4UFIA 2QCEA 3I7RA 3WJSA 5AHFA 3STCA 5DLCA 2QCDB 1X6UA 4YXGA 3OBKA 1IGSA 1HL2A 5AC6A 1KM6A 1SQ7A 3UYCA 1R30A 3CT7A 2YSWA 4PTNA 5BRBA 3W7KA 1XCFA 1GG0A 4O12A 3G3MA 5BNKA 5KSWA 1TRIA 1QFEA 1XC4A 1VRDA 3LCHA 1G6CA 2NX9A 4R34A 3U2OA 5CPLA 3GKAA 3FS2A 1GPWA 1YLVA 3W70A 4MZ1A 4ADTA 2C13A 3CEUA 1L9WA 1W5PA 3S1XA 2EPHA 4GUFA 3W1RA 3N3MA 5G1TA 1XUZA 4TX9A 1PCKA 3HIJA 2E5CA 4BI7A 1WQ5A 1F05A 1GG1A 1VYPX 3CM4A 3PS7A 1LYXA 2V2CA 1O95A 3I6RA 1KA9F 4FNUA 3G1YA 1QPNA 2NUXA 2X1TA 2G97A 5K4ZA 3TAKA 3TH6A 1SR9A 3C2EA 1JJKA 2BSLA 2H3BA 4N6FA 1SZNA 3OEXA 3W75A 1SZEA 3W7NA 2ZZ1A 4UR7A 3S1WA 4PCFA 3CWNA 1YXCA 3W7RA 2A5HA 3FKRA 3S5OA 4X9SA 4ADUA 5KZEA 3A23A 4NX5A 5K2ZA 1K7FA 3W2JA 1MEIA 2XN2A 3MW7A 1YTDA 1H63A 4QNEA 4UR8A 3FEMA 4A22A 2VFDA 3NQ8A 4LRTA 4LWWA 1J5TA 4HHPA 1VC4A 3ABQA 1O5KA 3GX9A 2ZZ7A 1TPEA 1SZFA 4O57A 3VI2A 4JR5A 3D0CA 3HPXA 4FNTA 3V1PA 1WV2A 1SO3A 1JQVA 3A22A 1RR2A 4RCXA 4BF9A 3M16A 1QR7A 1F2JA 1TV7A 2ZA3A 1LBMA 2ZA1A 1L6WA 1GOXA 4FHAA 3PUEA 4XUGA 1H7PA 4ORIA 2PRMA 3LCIA 1IF2A 3NQFA 4YLWA 2RH9A 3NQVA 4E0CA 2ZQ0A 1A5CA 3O06A 4UTMA 2O7QA 5G2IA 3CPRA 4EF9A 3M41A
chains in the Genus database with same CATH superfamily
4ROPA 3NOEA 4DUWA 4EIVA 4K3ZA 4FF7A 3G0SA 2FDMA 4JIQA 3VINA 3JS3A 3DYOA 8XIAA 1OFQA 4GBDA 1CLXA 2KZHA 5U4NA 1P0KA 1OZQA 1KGWA 5E0KA 3I3BA 1UOKA 4JNZA 4XAYA 3NSNA 3MUAA 1P48A 2YX0A 3EMQA 2BVWA 2BBFA 3NQ7A 3URBA 1OYCA 5BU9A 6A3HA 1MQPA 3QF0A 1M03A 5EMMA 4IPNB 4NZJA 3CQHA 2VO5A 4ZCWA 2DZPA 4LUJA 5CG0A 4NT0A 3MBFA 3KL5A 2PCEA 4LVFA 4TTGA 3B4UA 2FJUB 3WBEA 3LHYA 2BTMA 3S3GA 2TSYA 1VHCA 3WNKA 3T0CA 2GLKA 5KTLA 4JQ1A 4PSPA 1P0DA 4Z1YA 3BH4A 2X40A 1T99A 5JXQA 3Q58A 3NL6A 2E5BA 3DUGA 3PWIA 3TQPA 1BLIA 1NIUA 3PBMA 4NAFA 4A4AA 3GFYA 2PP3A 3HZ3A 5I3DA 2Z2UA 4FLQA 2NUWA 3WF3A 4O1FA 1IT7A 3R2GA 4JTKA 3ARPA 2Z27A 3OG3A 2YB4A 1EJSC 5AECA 5I6SA 3DEQA 1B9BA 5GJMA 4GH1A 7TAAA 3M6YA 3RLVA 1B0IA 3GTHA 2C1HA 1XIEA 4GNKB 4NJIA 1S2CA 4JIPA 1MW0A 4DAIA 3QEZA 4BJHA 3T7VA 3UWQA 2EF9A 4PULA 3AZTA 1EJ7L 2BMBA 2P8CA 1ONEA 3WQWA 5A8OA 4CLMA 3AIVA 2XFYA 1YDYA 3K1DA 1LL6A 3A6OA 4UIOA 3FGCA 3E49A 3IJ8A 5D32A 2YW3A 4O18A 2WNWA 1K4GA 2X1SA 3T4CA 2R1LA 4JTQA 2VURA 2W4XA 4K38A 2ZTKA 1LOQA 1LBLA 3KL3A 3FHAA 1FVPA 1OX6A 3QM3A 2OLHA 2VM8A 4NAFB 1MZRA 3UZ5A 3B0XA 4XO7A 4UQDA 3H8AA 1XYCA 3DESA 4G5DA 1F8MA 3R5EA 3CQ0A 2VEIA 4Z0SA 1R3WA 2QDDA 1H0GA 3MSGA 3ITOA 4MDPA 5EYWA 5C5YA 2BY1A 5HR6A 1C29A 5BOOA 4WY0F 3W1UA 3QH2A 1HJXA 4IGSA 4K7VA 3H4XA 3BARA 2PGWA 1KBLA 3GH4A 4LT9A 1E6SM 4NIRA 2VX6A 1HGWA 3WH6A 2WZEA 3FW6A 2PDFA 3FGCB 4MOZA 2GVJA 3QPZA 3MP5A 3UW6A 3WLQA 1OWQA 1GWJA 3VZZA 3GHRA 4HNUA 1W9PA 3WLJA 3ITVA 1H4PA 1UW9A 2FQIA 4INFA 4JEQA 2JEQA 2QIWA 3YPIA 4W5ZA 1IZJA 4V33A 1UZ4A 3TN5A 1YMYA 5ABHA 3N6JA 3GBDA 2PBGA 4PMOA 4OT7A 1IEIA 3GTNA 4WXZA 3LOTA 2IUZA 2E7FA 4Y96A 2A7PA 3C52A 1J0YA 1QI3A 2O7SA 4KERA 2J27A 2ZX9A 3L5MA 3F2DA 1KFLA 7TIMA 2C18A 4RZ5A 4YU1A 1M7OA 4LUIA 3ITTA 2EEXA 5LIUX 2NV9A 2XIQA 4RJEA 4PUWA 3KZPA 2GFTA 2AL2A 1DHKA 1AW5A 1XBXA 4Q4KA 4QP0A 5IFPA 1Z7AA 1QPQA 5DX7A 1W37A 2FTPA 5BMXA 3IGHX 4UMAA 2Z1VA 1A5OC 3JRKA 1DIDA 4GABA 2EBNA 1CENA 3BTNA 1G9HA 3VD4A 4PB3A 1WKFA 4HMEA 1VEMA 1PCWA 1MNZA 3USBA 3II1A 3KOFA 2ZX8A 3LV6A 3DERA 4Q8PA 4RDYA 3UQNA 5CQ1A 2ISVA 3IJDA 5HNUA 2HNHA 3DFTA 3VIOA 2JFEX 1XKJA 3UJRA 4GYJA 6ALDA 3PWAA 4A3HA 2DU2A 1E0VA 4D72A 4F48A 2W3ZA 5D9NA 2Q8LA 3GE7A 3TTYA 4IH3A 4IICA 4UXDA 4CCCA 1GJPA 2AL2B 4BY3A 3MO4A 5A2BA 1N2VA 1GOWA 4J3TA 3WQGA 3DG6A 4E2BA 2FVKA 4CQ9A 3W7JA 4ZB0A 3TONA 4GC3A 3ZWTA 2Q3RA 1ME9A 2OSWA 3N34A 4ZTYA 3ZJKA 4E8DA 1ZS2A 1DWFM 3WSUA 3H7UA 1EKOA 4Y9OA 2QYGA 1SZGA 3DFOA 2WVUA 3SM0A 3FYYA 2V5BA 5C71A 1V7AA 3HU7A 4NUWA 3CZ8A 2YDAA 4NJGA 2Z6JA 1CW2A 1EJVC 1FDZA 4LTSA 4WKHA 1H7OA 4XAPA 4NVTA 5FF0A 3PUDA 1TQXA 1PDZA 4IGMA 1IXPA 4J7RA 4A6GA 5CPSA 5G2HA 3WBXA 1AVAA 3L0KA 3K1GA 4RV8A 3GG1A 3TAOA 3GAYA 1UBPC 3KS6A 3LCWA 3AQUA 3WNPA 2Z1BA 1LORA 3C6CA 3WUFA 3V18A 1W1PA 4DJFA 2RDXA 3A12A 3ZJ7A 2I16A 1D7KA 1Q6FA 1K9TA 3VABA 1ZAHA 4ZQPA 2QJNA 4FA3A 5E6YA 1UP0A 1TWZA 1XLAA 2BASA 3W81A 4L4MA 1I1XA 5EL1A 4MFEA 2PU1A 4GRSA 5FA5A 5MHBA 2NT0A 3WUEA 4K68A 4TX6A 2VFIA 1KKRA 1TWDA 1AQMA 3OB8A 4XD6A 1ELSA 4JKMA 1O7AA 1D3HA 1XD0A 4YVVA 1D7FA 4D6HA 2A7RA 1QTWA 1HT6A 3MA8A 2YCJA 4I9MA 2E8ZA 3IRSA 1XWYA 4KT2A 3GH5A 4GY7A 4YVXA 3V35A 4H6QA 1QATA 5E5CA 2Q8ZA 1LLWA 1CGWA 4JTDA 1Z8AA 1XIIA 3CUGA 1TKKA 1V6VA 3OLEA 3ZR4A 4BF5A 3V75A 1W3TA 3ZJ8A 3IJ7A 4FIQA 4UTFA 3IIOA 1W8SA 4XD3A 3ABXA 1PE1A 3M0ZA 3LXBA 1GPFA 2VVNA 3UG4A 2PTDA 3QZEA 4IP5A 4W8AA 1W5MA 3POHA 1DTUA 3PJUA 1AJ2A 2MUCA 3URAA 3PSWA 3NM1A 4LEFA 3UZJA 1J12A 4XSLA 1RBLA 4UNKA 3QQ0A 3RLUA 5LIXX 4IPLA 3RGTA 1E0WA 3HFYA 4S2CA 4WF7A 1KO0A 1LUCB 3VCRA 4YWIA 7A3HA 3QQWA 2DV0A 3CB3A 2YDSA 4ENLA 3PN8A 4ORMA 4WUIA 3C2VA 3HB9A 4PEEA 3U57A 3B05A 1XLKA 4QBXA 1A5NC 3JZUA 3N29A 3L68A 3DFSA 4Z17A 1ALDA 1OVDA 1Y7VA 4LF1A 1C8XA 2XIOA 1QWGA 4NZ5A 3ZQ9A 1JZ3A 4LAZA 3LV5A 2VC5A 1DE6A 4E3VA 1KM1A 2HROA 4DJEC 2A1YA 3BLFA 3VCCA 4Y7EA 5K4XA 1M41A 4O0KA 1Z32X 1K03A 4IMCA 3KRUA 2GVGA 4AHOA 1FCVA 2CLOA 2ZZ5A 3WLNA 1E40A 3F4DA 3IJIA 1KRAC 1ZL1A 4PFHA 3MP4A 4DBWA 1G0CA 3NEVA 1OY0A 1XLLA 2G4JA 2R24A 4JL1A 3W6LA 2GGHA 3ZFHA 1S5NA 2TRSA 4ZB2A 3B9AA 3EWXA 2X2YA 4H1ZA 3BDKA 2DSWA 2CZ5A 1MW2A 3FAWA 4M7TA 4B5VA 4ONVA 1R0MA 1FWCC 4DZIA 1FP9A 4K1GA 2QS8A 4CNTA 4HA4A 1AJ0A 1XLHA 1EH9A 1H3GA 4S1FA 2OEJA 3W9ZA 4ZXOA 4C6CA 3LXCA 2XZ9A 2AOSA 3NDZA 3BLKA 4GQGA 3I7SA 4NASA 3TCEA 3TC6A 3QGAC 1GVOA 2WMKA 4Q7IA 2KX9A 4KCTA 1XSKA 1GNXA 3CHFA 3DAQA 3SIMA 1H5VA 1K8XA 3B8VA 1E15A 3DBPA 4JTJA 4YPJA 4PBFA 1UH4A 3T78A 3B0VC 3PZQA 4K1WA 5C70A 1D3GA 3WH7A 3I65A 1XDJA 1W6TA 1DWGM 1OD0A 4DBDA 1X8CA 5TD4A 3BMVA 2OOGA 3BGGA 4IXHA 4FXFA 2CPUA 2HPIA 1VS1A 4K2SA 4M1BA 1PUDA 2VEMA 3BMWA 4DJDD 1H50A 1R2TA 3WDHA 1OABA 3HFTA 1C7SA 2DT2A 3R7MA 1WUFA 2CU0A 1MQQA 1BVNP 1JIBA 1ZJBA 2VYOA 4ZA0A 1U5VA 1S2UA 2F9RA 3RMJA 2C0HA 5GVJA 4PBGA 1IXOA 3NZGA 1DEDA 1IXQA 3KLLA 4IHCA 2HS6A 2WC3A 2J7HA 5HULA 4BF7A 1EBGA 3TJ4A 4HMCA 1EDGA 1XFCA 3W74A 2EKCA 3SJNA 3QHNA 3ABZA 1FX6A 2CBJA 4N9BA 3GRIA 2CERA 4HNVA 3H26A 4R88A 1A49A 2JQXA 1EBHA 1EXPA 1QBBA 2Z1SA 4QG6A 4LQ1A 4NJJA 3M1ZA 2PTXA 3WBAA 3VX1A 1D8CA 2GJPA 1Y5VA 5DEZA 3D6NA 3NDOA 1NH6A 3EWWA 2O9OA 1UKQA 4XB3A 2HS8A 8A3HA 1A0DA 3T0BA 1M5WA 2EO7A 3DFYA 4KWWA 3PWGA 2O9PA 2BFGA 5LIYX 1QPOA 1LLOA 2DSVA 1FY6A 1ZBVA 1HUVA 1M04A 3QW4B 4MIMA 3W1AA 1QK0A 1JFXA 4Q4PA 1DXFA 4MY1A 3AU2A 3ITXA 3DHDA 2J77A 2D2JA 4IMGA 3TUUA 1GOMA 2RKXA 3B4YA 5SWUA 1Q63A 3BCDA 4WSKA 1XLJA 3S5SA 2QUUA 3OOQA 3GW3A 4GVFA 3VDBA 4LUSB 2C16A 1FOBA 2PWHA 4XO6A 4DI9A 1ZY9A 2ABBA 2UY5A 4LANA 5KMYA 1ADSA 4EXBA 4GXPA 1FHUA 1H41A 1UR0A 4H7ZA 4I5RA 2PEVA 1X1NA 2PDKA 3R0DA 5DXYA 5G1YA 2PRHA 3OBEA 1TJPA 3NL2A 3L12A 3CHVA 4K6AA 1KCZA 3LN3A 1OGGA 1WE5A 2WZMA 4AYSA 4JS3A 4XD5A 3AHZA 4Z1DA 1TX2A 4BCEA 3C2RA 3I6TA 2E9BA 3L0GA 2CXGA 4N9CA 1EYWA 4F66A 1DJXA 5TF0A 5DMMA 4QGCA 3BAXA 2ZE3A 4QE1A 4S3BA 1XSJA 4XIAA 2PSNA 4Q4OA 4IOTA 4S3CA 3GY1A 1J0IA 3M9YA 1OCJA 3GWQA 2W79A 4XQ6A 1LCOA 3EA1A 3ARTA 1US3A 1EHNA 4NU7A 3SQSA 2Y70A 3IRDA 4ICCX 5BWFA 3IS4A 1O66A 1VEPA 3LHWA 3OGVA 1UUMA 4GPNA 5C0QA 1J0HA 3UWVA 3REQA 4BA0A 4US6A 1YKWA 3TYEA 4Y6GA 1XS2A 3RPTA 2E0PA 1I2NA 4IX0A 1AQFA 1IR1A 2BY0A 1ICQA 2NQ9A 2JF7A 2QCDA 3G1HA 2CYGA 3LTYA 1Q65A 4NXKA 3GKFA 2XVKA 3WF1A 3F03K 4G1KA 2ZZ2A 3GZAA 1TMLA 4MVAA 1I60A 2Q01A 4F0RA 5HQLA 1KV8A 5M5DA 3EOLA 3NA8A 1Z69A 1QBAA 5FL0A 4WXYA 3HF3A 1GYNA 3LQGA 4LUTA 4D6IA 3STFA 2GGEA 1KTCA 5JBFA 4JL2A 2BNJA 3W7MA 4HA3A 4ERAA 4H6RA 1IEQA 1TZZA 5AZ0A 3VC5A 2A3HA 4FNRA 4C1KA 1CXIA 3V0TA 3GXNA 1H60A 3QW3A 2V38A 1UQZA 4D6DA 1QI4A 2TODA 3W2KA 4HN4A 2PDMA 4ICMA 3COTA 1EZWA 1XH0A 3WK3A 3REQB 3AIWA 3VIGA 4UTTC 4QQ3A 4CQDA 3PZUA 4O52A 1V6XA 1MYRA 2WV8A 3WL1A 3WQ5A 3QMTA 4E5TA 4WDXA 2PGFA 3TR2A 3PZTA 4BI5A 4JYDA 3CGTA 4D9PA 3U7BA 4JD4A 2J79A 1YADA 2QUMA 3UR7A 5A1AA 1PEZA 4LUTB 2BLEA 5E6ZA 3RRXA 3UXAA 1W1A1 1E6ZA 2PC8A 1ZBWA 4YHGA 4Y9MA 5LZLA 6TAAA 1A5UA 4B3LA 1GQLA 2CLMA 4FXRA 3TW6A 1E1CA 2SFPA 3GTXA 2QUVA 5AYIA 1NQKA 2ADAA 3ARYA 5D2TA 3HGJA 2AKMA 2QJMA 2D2OA 1H2JA 4OBSA 4FEZA 1R2SA 1BGAA 2WWDA 4L64A 3WF2A 3I6EA 2FVMA 1RP8A 2YBUA 1XHGA 4AZGA 1SO6A 4XX6A 1VF8A 1RXOB 5AFDA 4F3HA 3ELFA 3HO8A 1W31A 3EXSA 4CQ8A 3CK5A 5FEXA 3W87A 4Q8MA 4GIEA 2EPKX 5JU6A 2XWEA 5LHFA 2NX3A 4FNQA 4QJ1A 2Y63A 1EUNA 5D30A 1BQGA 1AG1O 2XIBA 4PRTA 1ODUA 1T41A 4KFOA 3A4WA 2DFAA 5L9FA 2POZA 3BSHA 1GQNA 5C54A 5CC5A 3FA4A 2PCQA 2QPUA 1E9IA 1X7IA 4WVXA 3S6OA 1UIPA 3TOYA 3AXXA 1E1CB 3EOEA 3WUBA 4BQ2A 4A8LA 2Z1XA 5CBJA 3A5VA 1XLIA 2J7FA 4CN6A 1BTCA 4M7SA 3ATYA 3WEOA 3TYUA 2J6XA 4IFRA 2E3ZA 3I68A 2VI0A 3ZSSA 4GI4A 4HHHA 4IIHA 2ZBTA 3S5NA 4WSHA 3PAJA 2OB3A 2VX5A 2EPOA 1P1XA 4RK8A 2VCBA 4UTLA 1ZCCA 3ARRA 4FF5A 3GYEA 4O16A 1RHCA 1S1RA 3BZJA 3URQA 3QQ1A 4PMVA 3IGUA 2FPYA 4LVDA 4GUGA 4DF1A 2FHBA 1E73M 5JMUA 1KTBA 3AXIA 4E2VA 1OADA 1VPXA 3C8NA 4PTVA 1GORA 3TE9A 4JDBA 2HPMA 3FYOA 4ACZB 1AW2A 3CUHA 4UTUA 3HJZA 3PF3A 1UPPA 3AHTA 3L2IA 5A5WA 4Z1AA 3USZA 3BL3A 3OLDA 5M1TA 1ADDA 2VGGA 4UWMA 4AZCB 4K36A 4EXAA 3A64A 2PD5A 3RO8A 1EFZA 2YCLA 1YIXA 1TPDA 3B8IA 4CQAA 3P93A 2DY3A 2WMGA 4PMQA 3LEPA 4U3CA 4YHEA 1GEQA 2BG5A 3UWUA 3M43A 4C6KA 1QK2A 2GJXA 5HBFA 2WANA 1JZ7A 1DWHM 2Y62A 4H6KA 5KZMA 3G22A 4LBUA 2J9ZA 4XIMA 1Q7ZA 1V3JA 1VENA 3HGSA 1FCQA 1YE6A 2Z1KA 3N9KA 4JTLA 2UZ9A 4LNCA 2FB3A 4LAKA 1G4SA 1H61A 2R94A 4MJMA 4I9JA 3VGHA 1HP4A 4AY8A 1EP1A 4V27A 3RIKA 1DXIA 1VGAA 4TV5A 4JX5A 4EPBC 1DOSA 1QW8A 3SUVA 4J28A 2Y1HA 2Z26A 3HQNA 4EPKA 2KAUC 5G2WA 1EOKA 1WPCA 3M5ZA 1H1ZA 3DOPA 3E3HA 5AOUA 2FFIA 4Z2IA 1Q6CA 2HXTA 2V81A 1XRTA 3HQ1A 2WPGA 1PSCA 2AQOA 4HNTA 2BVYA 5CJNA 3TJIA 4UFLA 2PGRA 2YCLB 2VRQA 4PRRA 3VKJA 2CXEA 1B3OA 4GX9A 3SQLA 4B16A 1KV5A 4L1WA 3M0YA 4IISA 2BXYA 2Y7FA 1JGIA 2J4GA 4UNLA 2GJXB 3UY8A 3IACA 4BI6A 4L1GA 4GWEA 4M81A 4BWLC 3VNKA 1SFTA 3CO4A 1MZHA 3MKKA 4J27A 2HK1A 5HOSA 1HNYA 3HV9A 4C6NA 1PL9A 4LY8A 1EL3A 1RJPA 1JPDX 4OV4A 4NI8A 1WP6A 3L4YA 2WJZA 1TELA 1WXJA 5AC5A 5F2IA 2PAJA 3PFMA 4NQ1A 3RUBL 2DH2A 3E2QA 4M6PA 3DX5A 2I9EA 2EJAA 2Y4SA 2HSAA 4AWUA 1I0DA 3AIQA 4GUJA 3R8RA 3HG4A 4BKNA 3LM3A 4F8XA 2PI6A 2WJFA 4KEUA 3R13A 2BOFX 1A5AA 3S2MA 4WQ6A 5AB3A 3WFZA 4MF4A 1XF0A 4PMRA 2WKJA 2Z29A 3GK0A 4NL1A 1JYVA 4NSBA 2WLZA 4PBEA 5IDIA 1O68A 4O19A 2VWSA 3OZYA 2ZZ3A 4C6PA 8XIMA 3EA2A 4PMDA 3CQKA 2B0MA 3W72A 3NPXA 1A4LA 3M4HA 4PUUA 3AROA 3N13A 4B5SA 3LLFA 3WD2A 4OTKA 4LRSA 5LA0A 4AZBA 1GZJA 2ZUVA 2J8FA 5HXMA 1KLZA 1TPUA 3U2ZA 3FJLA 2ZX7A 1W54A 2ZUWA 3N18A 2QCCA 2DZBA 4QTGA 4A05A 1Q8JA 2OO0A 2XH0A 1DYSA 3UCDA 1RCXB 1PXGA 4CCZA 2VENA 2ZICA 3MY9A 3NZQA 4EE9A 2ISDA 4PTXA 4TV6A 4M56A 1SW7A 5E0FA 3UA4A 1AH0A 4GVGA 2OOFA 1TREA 3IUDA 3TSDA 4XBSA 3TFXA 1JZ4A 5E0CA 3QYSA 5CPOA 1NWTA 3W76A 4D6GA 1L6GA 4IFOA 2C1GA 7ODCA 4HOWA 3E38A 5DT7A 1XPGA 4H04A 2GDUA 3CL6A 3BLLA 5FESA 1VAHA 4E4PA 2EG7A 4DJED 1UR3M 4PL2A 3KTSA 1EEXA 2QLYA 4H2HA 4WJEA 2YA0A 1PIIA 4QE4A 3UU0A 4DUXA 1CGUA 1R7AA 4KESA 5HQEA 4BR1A 4RZBA 4CD8A 4OFCA 1VLWA 1YXYA 3W7EA 4LYQA 1QOPA 4G8TA 2WHKA 1VD6A 5HNTA 2PWVA 2Y89A 1WOAA 1NARA 3Q4DA 4CCEA 1GT8A 2OG9A 1QUMA 4GMEA 1IYXA 2ZXBA 2PDNA 3DYPA 3M0JA 3MTWA 1TZ9A 2J7EA 2FIQA 4HMDA 1GOIA 3KL0A 1SR0A 4MJZA 3DFHA 4EXQA 3G3DA 5BU6A 3C3NA 2XGZA 4QM1A 1B1YA 1CDGA 5I79A 1QW7A 3F5KA 5HANA 2V67A 5FJRA 3NSXA 2WCGA 3S1GA 1AD4A 5AC6A 1KM6A 1MXDA 1R30A 1LQAA 2XGIA 3QN3A 4O12A 5BNKA 5KSWA 1TRIA 4G6CA 3VD5A 4CQCA 1IEXA 1E56A 2NX9A 3GDBA 3U2OA 1TE1A 3AWNA 3UESA 3FS2A 1GPWA 3BOLA 2C13A 1Q2RA 3MMDA 4OVXA 3N3MA 3WMCA 4MPKA 3TN3A 4QR6A 4TX9A 2REQA 1PTGA 3HIJA 1WQ5A 1GG1A 2V2CA 3I6RA 3ANUA 2X1TA 2VCCA 3JU2A 4B90A 4A8NA 3C2EA 4ZSUA 1JJKA 1MUMA 3QV9A 1SZNA 3SGGA 4NRSA 1R3RA 3VD7A 2J13A 3T2QA 2W27A 4WDTA 4F2TA 1FWGC 1F3XA 1GVIA 2WSKA 3A23A 3W2JA 1MEIA 1XC6A 2XN2A 1L8PA 1YTDA 1D2KA 3N2OA 4WGHA 2VFDA 4LRTA 1VC4A 1O5KA 3STPA 4GY0A 1TPEA 4O57A 4Q8OA 3HPXA 4FNTA 3V1PA 4JPGA 3A22A 4UB9A 1EO7A 3QV8A 5J04A 3N04A 2REQB 1AFSA 3R4IA 1GOXA 1H7PA 1QRQA 4ORIA 1BG4A 1M9HA 2RH9A 5AKQA 1HKKA 3G2GA 4D8AA 4ZR8A 4QDMA 5G2IA 5JIPA 4WJXA 3N6HA 3OJGA 4RDWA 3UJFA 3BZGA 2FMNA 4IG2A 1KRMA 3UVAA 4KCVA 1MFVA 4XZHA 4KEVA 1BKSA 1TRDA 3T40A 3AJ7A 4AB4A 1PS9A 3NDYA 3GVGA 1QHZA 1K9EA 3UPWA 2CHOA 2PP0A 1E6XM 1CB7B 2INZA 4YVPA 3MMUA 5KZDA 4PCTA 4DJFC 1DTNA 5I3KA 4X0NA 3E12A 3FJ6A 4UQCA 3TNOA 5CGTA 4C1LA 4F2BA 1NQ6A 1LWHA 4YN5A 2GDQA 3BGAA 3LRKA 4AD1A 5K9DA 4GVIA 1ME8A 1M7JA 1GQJA 1UZDA 1GYMA 3MJYA 1TTPA 1PIGA 2WZIA 3VUPA 3G8EA 4PCPA 3OVPA 1TPVA 3ARUA 4HNLA 3V36A 4YMZA 2XN0A 4L1XA 1QNQA 4IG2B 3K4WA 3MUIA 1RVGA 4IPIA 4NXSA 3SZ8A 1OX4A 1VPYA 3E74A 4H4IA 1EJXC 5CPNA 4OUIA 1OINA 2OEKA 2FKPA 4LAMA 2BVTA 3FXGA 1I6NA 2E77A 4XV0A 2O55A 1PWLA 3WELA 4UTHA 2ZUUA 3QC0A 3SAZA 2GJRA 4NZ1A 5F4SA 3CZKA 1TUFA 2DIJA 2CFFA 3QGKC 4S3GA 2WVVA 3W88A 4B5UA 2J7CA 4BS0A 5I77A 3WDIA 3O16A 4KEZA 4U10A 4AZHA 1KXQA 4AFYA 3LRMA 5GQBA 3PTKA 4G7EA 2NQHA 3EKGA 4GACA 3LERA 3R0KA 2VFGA 1WB0A 2F7FA 3OVQA 4IQLA 3W38A 5DELA 4UFJA 2Z4GA 1OX4B 3H4GA 3T55A 5FEWA 1YW1A 4W84A 2W0UA 4MAZA 4B15A 2QPXA 2Y8KA 1A0CA 3WLMA 4CD4A 1GOQA 3G1AA 4B92A 1OD8A 4AX6A 2HZGA 1JPIA 3NQ2A 5I5RA 2NUYA 2X1UA 2G3FA 1TV2A 5DMLA 1U33A 5CG7A 4AEOA 3WDRA 4QAWA 3OGRA 2WVVB 4D1JA 3T2PA 2GQ8A 2P8BA 5LGXA 3H54A 5MKGA 1CX9A 1KD0A 1EX1A 3RX3A 1O6IA 3ABOA 4G7EB 1JRCA 1S2AA 2O4MA 2B7NA 2X7WA 1BWLA 5D9PA 1BD0A 3B40A 4FXJA 2WJDA 2YB1A 5LSMA 4AMAA 5CC3A 3PZNA 5FJPA 3OZPA 3GC4A 1JD9A 3BANA 1EA9C 1TTJA 1TJ0A 2VR4A 4LS1A 4RNHA 4F40A 5XIAA 1BQCA 4LNYA 1S5VA 3WFLA 3QXBA 3MZ2A 1V3LA 4JHMA 3OG2A 4N0RA 4AAJA 2IQDA 1Y8BA 2V2HA 4GYPA 1F7BA 5HQMA 4LEQA 4W8BA 4HIBA 1H7RA 4XKYA 3S5ZA 3PVFA 3LGDA 1E71M 5CZJA 5IOBA 2H8ZA 1YTKA 2J47A 4HOXA 2V69A 3N2TA 3P7YA 1HL9A 1E0UA 3V3WA 1VCGA 2YGYA 2QT3A 3VKBA 2NV2A 3FLUA 2UBPC 1TX0A 4XWUA 4ZQNA 2IS7A 3IV3A 1R8LA 2QAPA 1W1TA 1MRQA 3PPCA 4GNJA 2XVLA 4GZEA 3EWZA 1R46A 1Y65A 3KUMA 5DBUA 1CEOA 5H8MA 5AYYA 3OIHA 3TJXA 4YNGA 1RY0A 3KCOA 3PB0A 4N7QA 3VMOA 4MMWA 3S9IA 2NWSA 3DG7A 2WOQA 3SUUA 4LB4A 1QO5A 1F9CA 4FALA 1KQYA 2VC7A 2PLJA 1QOXA 2DH3A 1KM2A 1UD8A 4MUPA 1WZLA 5D05A 3WD0A 5CSRA 4DWSA 1BG9A 3W1QA 1FP8A 3ZM8A 2WAGA 4GNVA 3G8RA 3BG9A 5FSEC 3G6MA 1B31A 4CD7A 5D2XA 3U4FA 1SFJA 3UY7A 5A2CA 2ZX6A 3LGEA 4K8HA 2DSZA 3SB0A 2FGBA 1H09A 3LXAA 3RHGA 3UR5A 3TV8A 3VGFA 1W9DM 1E6QM 1UWSA 3A4JA 1ZBCA 2W67A 4Q32A 5C7VA 5KITA 1OFOA 3WUGA 1W5QA 3W53A 3NWRA 3CAWA 1XRVA 1X7FA 3CUXA 1I2RA 5GJNA 3JZEA 3VCNA 3CB8A 1PTAA 4C6LA 1F5ZA 4C5YA 1F3TA 4BQ4A 1FWDC 2R1MA 4I7WA 3WIJA 3RLGA 2X42A 3N9RA 4GC4A 4H8HA 4HZMA 3ZO9A 2W61A 4JFWA 1NM9A 3PTMA 2ISSA 2NVCA 3N15A 1YTEA 2VFHA 2YDQA 3FY1A 4QNWA 5C9RA 1FCUA 4DRSA 3VK5A 4ERIA 4JYEA 4DWSB 1V51A 1R85A 3M47A 3N6QA 4W7UA 1R3YA 4UOQA 4CEXC 4JN7A 1RBAA 4TMCA 2CNCA 1JZ5A 3W71A 3FIGA 3WLLA 4KEMA 3D46A 1PBGA 3DYMA 1J6OA 3ZS4A 2PDPA 3O2LA 3O9NA 1HQTA 2Y7EA 3FV9A 4KWSA 2J74A 3CAQA 5DCEA 3UBPC 3WG6A 5HA7A 1GEHA 1KGXA 4LC6A 1KGUA 1P4CA 1DJHA 3G77A 5KEZA 3MS8A 5FIPA 1E43A 2VXNA 1E4IA 4O13A 5HDRA 2VL4A 2JGYA 7CGTA 2A2IA 3KWSA 1LOSA 4IQJA 2WCAA 1GW9A 4KGLA 3KVKA 3VVGA 2C7FA 4O28A 1E6PA 3HPAA 3LLDA 1X38A 2R91A 2TAAA 4MWAB 3L0NA 3AMLA 1NFBA 4O4VA 4ZODA 3EPMA 3TDFA 2J75A 4LSBA 5ECUA 2Q3OA 4RX0A 1KFKA 1RJQA 5D03A 3F4VA 2WNZA 4L4PA 5I00A 4JIIX 2YL6A 3LRLA 3MCMA 4LAOA 5D38A 2PMQA 2CWXA 1WOBA 2JALA 3VIJA 1M53A 5DRIA 3QY8A 4UTJA 2G96A 2WLYA 2DW6A 1RLDA 3BCFA 2QHAA 3KBNA 4W85A 4L4LA 1W3JA 3PBUA 2QCNA 4JCLA 1GHSA 2J62A 2OGJA 2PDIA 4C1NA 4ZSTA 4GBUA 2DVXA 3THQA 2YPIA 3UXKA 2D69A 2QDEA 1Q8AA 1XYBA 2ZDSA 4O1CA 2I57A 3PTQA 3SSZA 1WAWA 3SN4A 2DIEA 2YZRA 2E9LA 3NGFA 5A69A 1IXNA 2OXNA 3WH9A 3PAOA 4LCQA 1LQ0A 2J9YA 3EDJA 3PPFA 4QLKA 2PDWA 4L65A 3WF0A 2YXGA 2ZRYA 2DZAA 2YBTA 3EBVA 2PWUA 2YXXA 4L6DA 3DG3A 3DHFA 4LB3A 4DX3A 1JDCA 4JTIA 1ICSA 3NYDA 3P84A 1JUKA 3IEBA 4XZLX 4AUBA 3N14A 1UD6A 4M1RA 5AC8A 1CXFA 4Q4MA 3NYZA 1ITXA 3TX9A 1OB0A 2VZOA 3VPLA 1X6NA 4C1NB 1B5TA 4GQRA 2XDFA 1V0NA 3POCA 3VM5A 3RJXA 1TJRA 2FTYA 2OFJA 3PJWA 2H8XA 1KNWA 4AXNA 2JGQA 3P81A 3H7VA 4QSHA 2PDCA 2CC0A 4DPPA 5BXPA 3GXFA 3WLPA 4G7FA 2G8ZA 3JR2A 2YJQA 2TYSA 1M7XA 4YTTA 3N11A 2VTFA 3S2NA 3V5OA 3NQBA 5D8WA 4IJBA 3HPSA 3NCOA 3GUGA 3VGGA 2CKRA 3WNLA 3LLXA 3KM8A 4C7DA 1DL3A 1J96A 2EPMX 3VTRA 4M6VA 5T26A 1GYLA 3SFKA 4AEEA 5IHSA 4BZYA 4TO8A 1VZWA 3BW4A 4IGHA 4I8DA 3LHTA 1F8IA 3CUFA 3LM7A 3EGJA 5JBDA 3LCLA 5BCAA 3AIUA 2FPVA 2E1WA 1XGEA 2J9XA 4XZMX 1B3WA 4M8UA 3C61A 3LX9A 1G5AA 1TG7A 4XKMA 1UR4A 3HQPA 3WEMA 1SFLA 5A6JA 1PHQA 5IHRA 1WYIA 4ZVJA 1A0EA 3LHVA 1TTIA 3EXTA 4IF2A 3NOYA 1WDDA 4GXMA 1FA2A 2VQUA 5A3HA 3RX4A 4GY1A 3GH7A 5HPOA 3CLWA 3W86A 2IKGA 4KFNA 1B4KA 4EPDC 1Q6GA 5L6UA 1L2UA 1UP3A 3M0HA 5JQ9A 3HG3A 1WDPA 3R1ZA 4N2YA 4NZ4A 1R2RA 3QV6A 2DZSA 1KXHA 4W7WA 3THUA 4MB1A 3L5LA 1NEYA 1AL8A 3E0VA 3QJAA 4JIRA 1B57A 4H8NA 2DPEA 2ZVRA 3C0LA 3UYIA 2IPFA 5IDZA 1HJSA 1NVMA 4WKFA 2CLEA 4F2UA 5G4WA 4ZO9A 2BP1A 2INEA 1JPKA 5GJPA 4AQLA 3PM6A 3GSMA 2NXGA 2J88A 1ZFJA 4DF0A 2GQ3A 1B3XA 5CC7A 5C8BB 3TR9A 3N4AA 4ACYA 1W9UA 7ENLA 5HJYA 4OZOA 4EK7A 6XIMA 4WD0A 1J6PA 4Y9NA 2OX4A 1WDWA 2BOEX 2BGSA 4CU8A 3WLRA 4E38A 3F1QA 5HJLA 1BWKA 4UQ9A 3WDQA 5CCZA 2ABAA 1K9FA 4GG9A 3GLCA 3LTPA 4MGGA 2BB0A 1A5SA 3E5BA 2NX1A 3W6YA 4KBXA 1PJ9A 3Q65A 1BSIA 1E6RA 2QQ6A 1OIMA 5FEPA 3MVTA 1XLGA 4DZHA 2OZ0A 3KBWA 1E0XA 4C65A 4HHMA 4IGNA 5FAGA 2PF8A 5J5DA 3SCWA 2GPTA 1PX3A 3VNJA 1K7EA 4NY2A 2WHLA 2VEGA 2Q6ZA 3THCA 2F2KA 3ID7A 3TTQA 4QLJA 3C5QA 3WQ6A 1JDEA 3M6DA 4MUZA 1DJNA 3GC2A 4I9AA 4JNMA 4REQB 2D3NA 3ZVHA 1XIBA 1LROA 3W7LA 4Z2LA 1PKLA 1CGXA 1UR1A 1F4HA 1LRNA 4WK9A 3O0KA 3MDUA 2E6AA 1OIFA 1OFBA 3VD9A 2BY3A 4JTGA 1TV4A 4AU0A 4DJFD 2WVSA 4HTYA 4DB7A 5I3GA 1MO0A 1B3VA 3ECQA 4MKNA 1U2YA 3GNOA 3FVDA 1GVEA 3KTCA 3UETA 4H19A 4I3GA 5FOOA 3AFBA 2ALDA 4NNBA 5HUOA 1X1ZA 1K8ZA 3KBSA 2IQTA 3OGSA 2YBVA 2RDUA 1R9XA 1E70M 4MYXA 3OW1A 1WKDA 4PMUA 3BLIA 8CGTA 4DVOA 4H9MA 3NJ3A 4DEFA 1BYBA 1I2OA 1JAEA 2D0GA 2C3ZA 2WB5A 4F0LA 3EX4A 2V63A 4HSNA 4Q8QA 2XU2A 4AY1A 3TXZA 1P1MA 3RFAA 1ZBKA 2ODOA 3L4TA 3ZVHB 3DFQA 3CO8A 4R5EA 2QGYA 4DUVA 2WHMA 1O5XA 4IP7A 2UY4A 1E4MM 4KMQA 4ZFCA 2VDIA 1B90A 4ZO6A 4O1DA 2VOMA 3PZMA 4FI4A 2RJGA 4YCPA 3N1AA 5D9MA 2B7QA 3O0FA 2VQTA 1TPH1 1UH3A 1NFGA 2ZKMX 3TMLA 1Y5WA 2D73A 3P62A 1RD5A 2PPGA 4MNLA 1ZSXA 4DY1A 4CVWA 4OBRA 5REQB 3N2MA 3AMCA 4RZ6A 2DZUA 1A3HA 1GTHA 3MBDA 5KZ6A 4NJKA 2PLKA 5C9UA 3T0DA 5H1WA 5CAHA 1ML1A 3N3TA 4IUGA 2VZTA 4UZUA 1I2QA 2OQYA 1PHWA 3SY5A 1JUEA 4PH6A 4W88A 2X0HA 1QCWA 2YKKA 3AMDA 1JYXA 3EWUA 4GUHA 3B0PA 2ONEA 2ZRVA 3QR0A 1M1BA 1XYZA 4CNUA 3BC9A 4ZQMA 2PURA 1DKWA 4R7WA 5DT5A 1MRAA 4HNOA 1LQ2A 3GIYA 4M24A 1V5XA 1ZQ5A 4RE0A 4J3XA 4LOCA 2ANUA 4WR3A 4YJ5A 3S42A 4ZENA 2HE5A 1IEWA 3STGA 3QOKA 3PBGA 3A9BA 1OT2A 2NLYA 4WSJA 3WLOA 3DZ1A 4WGXA 1JF6A 1RK6A 4Y9PA 1W17A 1UKPA 2ACUA 1GJWA 3HMJG 4XK2A 2YW4A 1IWBA 1JI1A 3MCNA 4LVBA 1WCGA 3W1TA 3M5VA 7XIMA 2I5GA 1UR9A 4IFKB 3TTOA 5DCDA 1VFTA 1FXQA 5G4EA 1DV7A 3MC5A 5HNNA 4HNCA 4FX7A 3AO0A 3L65A 4WDWA 3AS0A 3OP2A 5BRQA 1UHVA 3E2RA 1V6UA 2ZXQA 4PTDA 2DJLA 2G0WA 3E0IA 3RAOA 2X30A 3ABSA 2BWGA 3EWYA 3QVQA 1RLCL 2NXIA 3QKEA 5JVLA 2GJLA 3OPSA 3WZ0E 2WBKA 3CYJA 4FMVA 1BXBA 4JN8A 2PGEA 2C15A 1O94A 3MI2A 3AHXA 2X7VA 3QKZA 3AS2A 5D37A 1RQEA 1IE7C 3R25A 1JZ6A 3GDKA 1V6YA 5M17A 2ZXDA 4FK9A 2AMGA 1FWJC 3L4ZA 4MHBA 1HXJA 4L4OA 1YPIA 1XBZA 1EQCA 2V30A 3PZVA 2CWNA 3ITCA 1QDSA 2W66A 4JFSA 2BODX 3AXHA 1J5SA 3K8KA 1FFRA 3V1HA 3G1XA 2DEPA 1N82A 2G41A 3G6LA 3CMGA 3LSBA 3NURA 2OKOA 2EHHA 4O53A 1WAUA 1ZENA 4HD5A 1DVJA 1BVZA 1GGOA 3P8JA 1UD4A 4H01A 3TC3A 3VFLA 4QS5A 2INFA 1J0KA 1XIDA 1GQIA 3WK1A 3OQ8A 4ZZ9A 1I0BA 3W1LA 2WQDA 4FS9A 1FWSA 3EOUA 5E09A 2JKAA 2J25A 3R94A 3IJLA 2PTZA 3PY2A 2TMDA 1BAGA 8RUCA 4LCSA 4F0KA 3E02A 3M44A 3MANA 4F9JA 1ECQA 4G2DA 5F4XA 4L6OA 3L7RA 4ATDA 1W91A 2HE8A 2JIWA 3FSTA 2H3DA 1IIHA 3ARQA 1JYNA 3TWBA 3Q45A 1W8GA 2W62A 1LT8A 1SW3A 2DT0A 3F2CA 4FO4A 4E2DA 2PDQA 4DXVA 3BAJA 4GIRA 4P61A 1A3WA 4EKJA 5EB8A 5CSUA 3MHUA 2HCVA 1G7UA 2QEZA 1Q6QA 1WZMA 4OBTA 3EX3A 2Y2WA 1J93A 1DORA 1DJZA 3J7HA 3OVRA 3VIPA 1YNPA 4AF0B 1OEPA 3GTFA 4UMBA 5CSYA 3GVWA 1XCWA 4MLJA 3NL5A 2WBGA 4OECA 4ZO7A 2CHRA 2UY3A 4AW7A 4CNOA 3BV7A 1VEOA 1F6KA 2QR6A 1M3UA 2J7BA 3T2OA 5D09A 4YTQA 4GZIA 4JX6A 4R9XA 3GXMA 3GXDA 4ROQA 5I02A 4DO4A 1HKMA 4U5IA 1JGMA 4YIWA 3CEPA 4QFUA 3VC6A 3WF4A 3ES8A 1T96A 2ZE0A 3G1DA 4JTTA 1HKWA 5LA2A 2ZUTA 3IWPA 4Q7BA 4MZ8A 3GDMA 4IWWA 5DN1A 2RDWA 4ZQRA 4UMCA 1VFLA 3NZ1A 4GUIA 1XCXA 3OBAA 4DUOA 3FKKA 4X2RA 3NO3A 3SO7A 5LNVA 3UZYA 1X98A 1UH2A 2WM1A 5EMKA 4XZNX 3PNZA 4V1YA 3ALGA 4GJIA 2NVAA 3MUZ1 4GI6A 1YEYA 5A6LA 3DENA 2DUAA 2YIHA 1K8CA 2Y8UA 2V68A 1XQLA 5AN7A 4S23A 3QZAA 3CZGA 3BK0A 4AD3A 1HO1A 1SMAA 3T9PA 5CLTA 2ZX5A 4B3KA 3KRBA 3SCRA 1WXZA 3UZXA 1W1YA 2XTKA 3DC0A 4NF7A 4OWGA 4S3FA 1E5NA 3MYOA 1GKRA 1E9LA 3L67A 3EKLA 5HJXA 4HB7A 1VR6A 2C91A 1XV8A 4S2BA 3TOPA 2V5KA 1RJRA 1NTHA 3MUXA 3VKCA 1QMLA 1QNPA 1KKOA 3UPBA 4NZCA 2VUYA 2A3CA 3PBWA 2WK2A 3LPOA 5EBUA 4RLIA 5BOEA 3FA3A 1DIEA 3JVAA 3ZLGA 5EPDA 5HMSA 1PWMA 1YPFA 3VNIA 2XUCA 3P60A 3JUGA 1AZ2A 4MB4A 3ZT5A 1MDRA 1CXHA 2PLCA 4UC5A 3VDHA 1C8YA 2WMIA 2ZC1A 2ISWA 1V6WA 4M80A 4QQUA 4ZQOA 3BLDA 1UKTA 3WQFA 5T9BG 1AODA 2Z28A 1CLVA 2R14A 4NHVA 4MB3A 1WZKA 2XH4A 3F4CA 1JF5A 2HWGA 5IM51 3RDKA 5I2UA 3B0UX 1GVYA 3GUWA 3LK6A 1XBVA 4AEFA 4UFIA 3EZ4A 5ABGA 2QCEA 3STCA 1EJRC 1AZ1A 3CAKA 4GYPC 3LZ5A 3RMEA 1JEZA 3EDKA 4NG3A 1HL2A 3SUWA 1SQ7A 3BLOA 1U30A 3PJTA 3CT7A 3W7KA 2OYLA 4J3VA 1YQ2A 2WCSA 1XLEA 3H2NA 1WZAA 2PUZA 4RE4A 2HDJA 2WMIB 2O9RA 3GKAA 5FL1A 3RCMA 1UZHA 4QHRA 1CYGA 3CEUA 1L9WA 1W5PA 2XVNA 2EPHA 3UG8A 3H12A 5G1TA 2PDGA 1XUZA 2PF0A 1PCKA 4NILA 2ISFA 1EC8A 5FCZA 4L6HA 3L4VA 4PB4A 3SRDA 5BYWA 4UZSA 1LYXA 4R9OA 1O95A 1V93A 4FNUA 1QI5A 3T0AA 2NUXA 2G97A 5CBIA 5K4ZA 2OZTA 3RPMA 1SR9A 2H9AA 3H6OA 2BSLA 2H3BA 3WKZA 4RNIA 1X39A 1XYAA 3GNRA 3OEXA 3W75A 1SZEA 4EWJA 3W7NA 1B3YA 3S1WA 1RCOB 4XD4A 1QXLA 1LUCA 4J35A 2A5HA 1M01A 3S5OA 4X9SA 4ADUA 1NOWA 1QT1A 2VZSA 4GK8A 4R27A 1RA0A 4UR8A 4PCSA 4ZO8A 4DWSC 4LWWA 3CL8A 3UJ2A 4BHYA 4GGBA 9RUBA 3GX9A 2ZZ7A 3BJFA 1SZFA 3VI2A 3D0CA 1WV2A 1MVYA 4GQBA 2D1ZA 3CZJA 2QW5A 3LSCA 3M16A 3VM7A 2P3EA 1DJWA 1F2JA 2ZA3A 1L6WA 4XUGA 1KXTA 4PSRA 1NELA 4HYVA 3WEZA 4AD5A 3I3EA 3NSMA 4XUYA 2H9AB 1HJQA 3EYPA 1A5CA 4IIDA 5BXRA 1PKYA 2O7QA 3KDOA 3M41A 3MVIA 4ATLA 4BEQA 2YOCA 2IW0A 3W24A 4PUDA 4WX2A 4AVFA 1R3QA 4KQNA 4ML4A 1POJA 5LNUA 2OGYA 1XBYA 3TROA 2OZ8A 1IZKA 1SJDA 2P50A 2OU4A 4NP7A 1EJWC 1S2VA 3GBEA 5HWMA 2IPWA 4IP4A 2HISA 3EKZA 1CZ1A 5F1VA 2FZ9A 4ML9A 1Q7MA 4JFUA 4V15A 1CT5A 1NP0A 2FYMA 4PMJA 3R58A 4DYEA 1U1JA 4I90A 2VDGA 3PSVA 3V4BA 5E9XA 1TV8A 4MSSA 4QJ5B 2QGHA 4KPLA 1VJZA 2B7PA 4E6MA 3QR3A 1L6SA 4AHPA 4X2PA 1EX5A 2TPSA 5AC4A 3CIVA 5EFDA 2DZXA 1IT8A 3BLPX 2V5DA 3VFCA 3AS1A 3EB4A 3B9NA 3BPWA 3AS3A 3C0SA 1XP3A 1ODZA 4DYKA 3W27A 3CV2A 4HK5A 2LLEA 1JCLA 3S6DA 4GO9A 1TCMA 1XG4A 4R85A 3I7QA 4C6QA 4JTAA 3R10A 5H8PA 3R6IA 3W7OA 3PULA 2PDLA 2XFRA 3NFUA 1K7XA 1DHPA 4M0XA 2WSQA 4HMNA 4JHOA 3TSMA 2VHLA 3RJYA 1S2TA 1WBJA 1Z6KA 1XGZA 3RM8A 2C71A 3NQCA 5FF2A 4FNSA 4ZOEA 4DM2A 5K3VA 4YTSA 4ZE4A 4BEUA 1SJAA 2R1KA 3TQ0A 4POCA 2V3GA 1OFEA 3FFSA 3R11A 4JYFA 5LNSA 4F0MA 4LVGA 2R82A 3PZOA 3G1SA 1W2VA 1CECA 4RZ4A 2J6VA 4I7VA 3EA3A 3RYSA 3BAYA 3HM7A 1QHPA 3PG9A 2Y7DA 1H5YA 4HU3A 1FFQA 3LCXA 3AYSA 3O3RA 2UY2A 3ICJA 3RK8A 3APGA 3SSJA 2P0OA 4AWSA 4HCDA 3GR4A 4DNMA 3IIXA 5CZSA 5DQPA 3WFAA 4XBKA 1VBRA 4LY4A 3V0UA 1KCKA 4M5PA 4N9EA 3IIPA 3L5AA 1VQTA 2H6RA 4AX7A 4S3JA 3VMPA 4ZMGA 3DFNA 3L2LA 3E2VA 1BXNA 4BK9A 3NZPA 5FI8A 2F6UA 1EDQA 4J3ZA 1OCQA 4HSHA 4B91A 4GINA 3SCPA 4QLLA 4JGDA 2CLFA 3TJLA 3LD5A 4GI9A 1XW8A 4C6IA 4JQAA 1F73A 4AIOA 3VOJA 1WNOA 4TU1A 3P0WA 4FOUA 4LUSA 1HP5A 4Q8WA 3U9IA 4ZOBA 4K7YA 1X97A 4J4KA 5C2XA 3HMCA 4V28A 1L6YA 3PPHA 3W07A 1FWTA 1XKYA 5KETA 4F9DA 1XICA 1XM3A 5CJ5A 3ZWSA 2OT0A 2G5WA 2J7DA 3IK2A 3IARA 4AMCA 4CQBA 1OFDA 4O11A 1TR9A 4DHGA 2PFHA 4FLRA 4Q6XA 2PDHA 1Q3NA 1A3XA 2E40A 1RCQA 2V3FA 1AQHA 5E1QA 3TN4A 4MJ4A 2QUTA 2A3BA 3QV7A 4NI3A 2HMCA 1DJQA 3E2SA 5I06A 1QPKA 5HWNA 4H6EA 2I7GA 1KBJA 4JN6A 5I3HA 2YYTA 1O12A 3C86A 4LV9A 4PTMA 2J8GA 1PZ0A 1UD2A 5F4WA 4CUCA 3G0UA 4CN4A 4F0HA 3GVRA 4O0ZA 3MPGA 1WXYA 2FPTA 2R8WA 3CIWA 3T81A 3W73A 2OQHA 2HVMA 2V6AA 5F2MA 1BWVA 3N2XA 1B30A 3BQ6A 1BVWA 2P1FA 4W8LA 4TTUA 3O6DA 1QHOA 1NDWA 3TMQA 4ZE5A 4NJHA 3VE7A 5M03A 2AGKA 1XDMA 5IXEA 1LF1A 1FWIC 3WLHA 1BHGA 3ZLHA 1UA3A 1LTDA 3C56A 3GTIA 1ITUA 3B8UA 1A5MC 5ABEA 2CLLA 1CGVA 3KBVA 3W4RA 1LT7A 4JBRA 1PYMA 3M64A 2Z25A 3W01A 4DLMA 2W6RA 5T9CE 5D8ZA 4Z2HA 1OF8A 2CIPA 1P0NA 3TQVA 2GVEA 1K4HA 2X05A 4UTWC 3MUY1 2QF7A 5I0DA 1A4MA 4UUIA 4JIEA 1J11A 1RUSA 2NW0A 5AY7A 3W7IA 3CV6A 3PG8A 4JZ5A 2EG8A 1ZGDA 4YTRA 5K9CA 1NDYA 4IL2A 4G1NA 3L4UA 1YDOA 4QG9A 3ITYA 3MO7A 3M0VA 4FNPA 4HZ6A 1U5HA 3P3BA 2DQWA 4WOQA 1MMFA 4Q8VA 5CPQA 3VDCA 3BJTA 2OTDA 1A80A 4AWTA 4M82A 5CLWA 2YLAA 3GDLA 3AALA 3ONBA 4OV9A 4X3ZA 1PAMA 4AZ6A 3OO2A 1JCYA 2Y85A 4PR4A 4XSMA 1JCMP 1YHTA 1Q85A 5CZTA 3ARWA 3V7PA 1LM1A 4ZTXA 1JXKA 3O1NA 3PB2A 3BQ5A 5D9OA 5MF5A 3BG5A 4GD0A 3PUGA 3DC8A 1OHLA 4I6VA 1R6WA 2PDBA 3NQDA 4GA8A 1LL7A 4DBEA 1G4EA 2PWGA 3VZYA 1BF6A 1RV8A 4XAFA 1TPWA 3KZSA 3PK7A 1Q45A 3IIZA 3T09A 4QX4A 3OA5A 3S83A 2HV5A 4GQ0A 1S5TA 4H9VA 2DT1A 3FNDA 4EVZA 1TCDA 2FGZA 3S2LA 2PS2A 3OLGA 1E5JA 3AUJA 1SMDA 4IL0A 1TV5A 3O7UA 4A8RA 3QRHA 3KHJA 3INPA 5IBXA 1QNOA 3KRSA 3L2MA 2OQLA 1F3EA 4W4QA 2CLIA 2JIEA 1AA1B 2F8QA 1W3NA 5PTDA 5HK4A 2VRJA 4HN8A 1PTDA 4FXSA 2DW7A 2XM1A 3FEQA 1NFPA 1OFAA 3KOWA 1XYLA 4AC1X 2VGFA 2WHJA 3GNPA 2QCHA 3BCJA 2ZZ4A 2IXVA 4O10A 1A5LC 4UFHA 2ZZ6A 3BE7A 3MYPA 1JYWA 4S3AA 3W6MA 1VJIA 3ABRA 2XIJA 2WZTA 1WX0A 2XM2A 5DY3A 4QSFA 1XIJA 3T4WA 3TEVA 2PWDA 4OQVA 2FB2A 3C2FA 3IANA 2EQDA 1NSJA 3BV4A 1NP2A 2GSEA 3GS6A 1KM3A 4EAYA 1O4UA 3O6CA 4YL2A 3MMWA 2OLAA 1B54A 1TB3A 4LPCA 2JF6A 2V8ZA 4US5A 3A47A 4GIAA 3FDKA 3TA6A 4H9YA 2YL9A 2I1OA 3M5YA 4M29A 4ICNA 3H7RA 3W7HA 5A8GA 3EMZA 1E0TA 1VFFA 1K70A 4Q6JA 1EWDA 4EAMA 1T8XA 2GVLA 4PMYA 2G50A 1YYAA 4ACZA 1VFSA 1GK8A 1CCWB 4AIEA 1SYTA 2PDXA 4C91A 1NAL1 2GJNA 1ONXA 2PDYA 2ON3A 4BWLA 3UWYA 3TFCA 3SI9A 2X0SA 3NVDA 1WKEA 2C0AA 1QPRA 1EIBA 4AZCA 1W32A 1BPLB 3URNA 3ZR6A 3WLTA 1MXGA 2BXZA 3S5YA 2OX1A 5HMEA 2QCLA 4LV4A 1I9CB 2QJIA 3QTPA 2VUNA 4XTDA 2WC7A 4ZEPA 4MZYA 1G67A 2YFNA 3AIBA 4RDVA 5A6TC 4C6JA 4ES4A 4GGHA 3MWAA 1GVRA 4Q8NA 3OLIA 1MSSA 4CNNA 1IT0A 2PWFA 2PDUA 2PLMA 3S2CA 3CL7A 1FDYA 3VNYA 4DXXA 3TP4A 5D2VA 3NXFA 4O50A 2WSYA 4XAGA 1W9BM 1ZP3A 1LWIA 4A2SA 4R53A 5JUVA 3NPWA 3U7VA 4B2DD 1S5WA 1V08A 4F79A 4TIMA 4U4MA 1CXEA 3FVMA 2DP3A 3F5JA 5HNRA 3W7DA 1T40A 1LLZA 3TLLA 3TW9A 1R87A 2CCRA 3SN1A 4IPJA 3SRKA 3T8QA 2WMJA 3IJ6A 4I6KA 3VAVA 4FZIA 4S39A 2VWTA 3O05A 3CZLA 3H2EA 2W92A 4GO8A 5LNRA 4GKTA 2JE8A 5CGMA 2ZA2A 2A21A 1LWJA 2AQVA 4WY0A 4O17A 3HN3A 3LB0A 3TYDA 3W1PA 3QFWA 5K9XA 1SU5A 3VNLA 1E3XA 3DKLA 4GYKA 2G3JA 3HG5A 1K6WA 4H9TA 4FSAA 4PFMA 3CQIA 1AL7A 3CHEA 5ABFA 3QHMA 2DQXA 3GXTA 5CZ0A 3MZNA 4Y8FA 2PD9A 1DP0A 2C19A 4IIEA 4QIUA 4CNSA 4PUMA 2BZNA 4MNKA 1UWRA 2Z24A 2X0YA 2Y5JA 1GVQA 2QNEA 4XZBA 2XHYA 1QNSA 1H1NA 3NAVA 3TK7A 4JDYA 4KF1A 1V02E 1VBHA 3HGRA 3UJEA 4TVUA 1UPMB 1XI3A 3PNUA 3WQVA 4HCHA 3E9AA 4G9PA 4IPPA 2BHYA 3QMRA 1W56A 1TUXA 1G01A 4L5ZA 4CN1A 1KBIA 3LNMA 1Q66A 2HNEA 1OC7A 2IKJA 1C3FA 3U2CA 4S3EA 2NV1A 2VGIA 5F1UA 3GU2A 4WY0B 3R43A 3FXYA 1PX8A 2VX7A 4GXWA 3TQKA 3PBYA 3MB9A 2EG6A 3WK2A 3IGXA 2H90A 1CPUA 3QOMA 1UJPA 5ABFB 3CUJA 1BGGA 1NDZA 3M07A 2E6YA 5A6BA 1EHAA 1LDCA 4PGLA 1CGYA 4NYYA 3PZIA 3WMSA 1E6NA 7REQA 1HKJA 3ZT6A 3W85A 4L9XA 1XYMA 1C7TA 4AHQA 4HJWA 3E1F1 4D6EA 4DN1A 2BGQA 3F7JA 1I1WA 1QVBA 4KFPA 1UWAA 3UWZA 1G7VA 1UP2A 3W02A 1YNQA 3VDAA 2WW5A 4ZL1A 4PYSA 3W7CA 3GO2A 4RR4A 3T05A 2WKLA 5D33A 3AMGA 1IR2A 1AK5A 5A8NA 3TCSA 2NQZA 2DVTA 2WWCA 3GDTA 1A53A 4S3KA 2VR2A 3TSBA 3W2NA 3ZZ1A 4QS6A 3PTDA 4P5UA 4JCMA 5HUPA 1TPB1 1VKFA 4DWSD 3BWWA 4IMEA 2OT1A 5TIMA 3BW3A 4HTBA 2VVSA 5BZAA 2WSPA 7REQB 3QMSA 3IVTA<