1JUBA

The k136e mutant of lactococcus lactis dihydroorotate dehydrogenase a
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
311
structure length
311
Chain Sequence
MLNTTFANAKFANPFMNASGVHCMTIEDLEELKASQAGAYITKSSTLEKREGNPLPRYVDLELGSINSMGLPNLGFDYYLDYVLKNQKENAQEGPIFFSIAGMSAAENIAMLKKIQESDFSGITELNLSCPNVPGEPQLAYDFEATEKLLKEVFTFFTKPLGVKLPPYFDLVHFDIMAEILNQFPLTYVNSVNSIGNGLFIDPEAESVVIKPKDGFGGIGGAYIKPTALANVRAFYTRLKPEIQIIGTGGIETGQDAFEHLLCGATMLQIGTALHKEGPAIFDRIIKELEEIMNQKGYQSIADFHGKLKSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords dihydroorotate dehydrogenase A
publication title Lactococcus lactis dihydroorotate dehydrogenase A mutants reveal important facets of the enzymatic function
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Oxidoreductase
total genus 118
structure length 311
sequence length 311
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2001-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 1jubA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1jubA01
1Z48A 3T78A 1BWKA 4GBUA 3IGXA 2I14A 2EF9A 3TDFA 2Z6IA 1AG1O 5D2YA 3W7RA 2B7NA 3W85A 1A53A 2H8ZA 1W56A 3R89A 2V9DA 1D3GA 1QDSA 1FXQA 5D37A 5LHEA 3UPWA 2Z1BA 2ZCGA 3NQ8A 1WA3A 3TAKA 2RH9A 4ZQNA 3DFNA 1XBYA 4RR4A 4ADSA 1Q45A 5K3VA 4QJ1A 3EWZA 1SU5A 1FY6A 3GZ3A 3M1ZA 3TXZA 3P84A 4QSHA 3HB9A 3STGA 1EP1A 1ICQA 5BMWA 5D05A 1L6SA 5SWUA 1QNVA 4IPJA 3M16A 1KFBA 3P5ZA 3VE7A 2QCGA 3W2JA 1TTIA 3NM1A 1SSDA 4AXKA 1YADA 1KTCA 2XN1A 1FDJA 2A21A 4HSNA 4N2YA 3W88A 2IQTA 3HGOA 1VCVA 1F6KA 1TCDA 3RLVA 4O18A 3LGEA 1DV7A 4C1KA 3H53A 1KTBA 1QPOA 3M5ZA 3GDLA 5J5RA 3RNDA 2A7RA 4AF0A 4M19A 3N3MA 1M5WA 4K7YA 2H6RA 3CT7A 1N7KA 3G24A 5CPMA 5LNRA 1OX5A 3NVTA 1TRDA 4UTTA 3NEVA 4TIMA 2QUTA 4YLWA 3T4CA 1EB3A 1ME8A 1NSJA 3FJ6A 3G0XA 2B4GA 2J9YA 1KFEA 5D2VA 2Y7DA 4FXRA 3HJZA 3NQGA 4PCFA 3TFXA 1SO4A 5G4EA 3G1FA 2YW3A 4R34A 1LLWA 3ZWTA 1YLVA 2CLKA 4AHQA 5HWNA 4HNVA 2G95A 3M5YA 2GJLA 1TPH1 3S5NA 3WK0A 4IX0A 4N02A 2CLHA 1LP6A 3CTLA 3LXBA 1VC4A 5I3HA 5AYYA 2WV8A 4N9CA 3GNDA 4O28A 1OVDA 1DQXA 4DBEA 5LNUA 1MSSA 1J4EA 3B0VC 3CEPA 2V2CA 3PULA 2CZDA 4LVAA 4PL2A 1W3TA 3CU2A 4BI5A 3S8HA 4MPQA 3UY7A 4B5NA 3L0NA 1G7VA 4MY1A 2FFCA 4K38A 3O07A 5I3KA 5D2TA 1DHPA 3HQ1A 3SSJA 2NUYA 3WJZA 2VXNA 4IMEA 4Y8FA 1QAPA 2PRLA 3W07A 3W1LA 3BLEA 1PVNA 2ZRWA 4LUIA 4UC5A 5KMYA 5CPOA 1OK4A 3IVSA 3EWXA 3CWNA 4QAIA 1JCMP 3TSDA 3DGRA 2J88A 3SFKA 1DJNA 3DXIA 2ZFAA 3ATYA 3STFA 4FNTA 5D04C 3TUUA 5G1TA 1EP3A 2Y70A 3PY2A 5K7JA 3QMRA 3LI0A 4MY8A 4UUIA 2W79A 2DZWA 3FA5A 3C6CA 1L6WA 2VENA 3UNDA 1O5KA 1OK6A 2A5HA 4XKYB 5K4XA 3W7OA 3ABSA 4S1FA 1X1ZA 2QCEA 3BO9A 1VYSX 4RZ6A 4XBSA 4CLMA 3B06A 1KV8A 3RK8A 1Q6LA 3NQCA 1KFKA 3PBYA 3PUOA 2AQWA 5C6MA 2FB2A 4JXCA 3DAQA 4HNTA 3JRKA 2R8WA 2X2GA 3NQFA 2NWSA 2JK2A 3LCFA 5KZMA 3KAOA 3A23A 3HMJG 5C55A 2ZZ2A 3GXNA 3RLUA 1W37A 4EVZA 3GKAA 1QFEA 5G4WA 4LVBA 3QPYA 1H61A 2Q3OA 3MYOA 1GOXA 4OT7A 3DBPA 5CSRA 4OE7A 3ZR4A 3WJYA 4H4IA 4OHQA 1I2OA 4CQ8A 2QCFA 5DCBA 4NZFA 1GVQA 1H7OA 4NVTA 4O11A 3GDMA 1K03A 4UTMA 2AAMA 3LHZA 3LCGA 1OJXA 4XKYA 3UWUA 5AC7A 4GUHA 3W1PA 3EX4A 4Z0JA 2B7OA 2A4AA 3M0ZA 1VR6A 3N9SA 4A3UA 3W2KA 1N55A 1AL8A 5D03A 1EWDA 1K7FA 1W5OA 5E93A 2A6LA 4RKAA 3W2UA 5DXXA 3PAJA 1TV7A 3KVMA 3P5YA 1CI1A 5FF4A 4I7UA 1VS1A 3O6YX 2D73A 4DO5A 2Y62A 1GYNA 3A21A 4WOQA 3BARA 1MEIA 3DZ1A 3HF3A 1KLZA 4N9EA 4HPJA 5KZDA 2X1UA 2YZRA 1JUEA 3W1MA 1JCXA 1B4KA 4XQ6A 4PH6A 3THQA 1VHNA 2I1OA 3TCEA 1IXOA 4XUGA 1OYCA 4IPIA 4EWND 2YCEA 4ORMA 4AWUA 3GK0A 1TJRA 3LB0A 1FXPA 2WQPA 2ZTJA 1DJQA 5EBUA 4LW7A 2CW6A 1G4SA 2EAWA 2E6AA 3GXPA 5K2ZA 4BK9A 5F4SA 4DBDA 4Y6GA 1R2TA 3EKZA 3W2LA 4IXXA 2NXGA 3Q2DA 1W1ZA 4K6AA 1MZHA 3V75A 8TIMA 3NR0A 3T40A 3DFSA 1YTEA 3NQMA 3NZRA 1K7EA 2CZEA 1SUXA 1ICSA 1GQNA 3NPUA 3OVPA 3C56A 3W86A 2P1FA 1SO3A 2BXVA 1AK5A 3FYOA 1XKYA 2FIQA 4LS0A 3FS2A 4QISA 3IVUA 1OFOA 3GDTA 1L2UA 3LCLA 3QC3A 1VPXA 1XL9A 2FPVA 2YXGA 1ZNNA 4UTWA 5TBOA 3KXQA 4Z1BA 3LXCA 4N6EA 2C15A 1R47A 1QPQA 4DELA 4DQWA 3S9YA 5KSWA 1EP2A 3GYEA 5A5WA 4LRSA 3QFEA 1ADOA 4N4PA 4UXDA 4RK8A 1BEUA 3L5LA 4YCPA 1VQTA 1VRDA 4JTGA 4FB7A 1JQXA 1GEQA 1SQ7A 2Z6JA 4EOUA 3G1SA 1G4TA 3W23A 3I65A 1D9EA 5HQEA 3FKRA 2QDGA 3W9ZA 3G1AA 3P61A 2ZZ3A 3O16A 3PBWA 4K8HA 1TPUA 1F73A 3CWOX 4FX8A 1EUNA 3N73A 3P74A 4M5PA 4JX5A 2Z0IA 5HUPA 3L65A 5L6UA 1X8FA 2E6FA 3TQVA 3VE9A 5HWJA 3USBA 2FTPA 1GVRA 1I8JA 3DU0A 3QW3A 3QMSA 3TW7A 3LRLA 1Z44A 1O4UA 3SECA 2YFOA 3BW3A 4DO6A 4LS1A 3TC7A 3GIYA 1QPRA 3MMTA 3IIPA 2NUXA 4NJHA 5BOOA 1GYLA 3GAYA 2VC6A 3PUDA 2PE4A 5K9CA 1IIGA 3MHGA 4UFKA 5CZSA 3PB2A 2EKCA 3ELFA 2QUUA 1OYAA 2HMCA 5DELA 1LCOA 1T8XA 3I6RA 4X9SA 1OG0A 3IEBA 3W84A 3QZEA 3VI2A 4YMZA 3LXAA 4DF1A 3MP3A 2YFNA 3QEZA 3WK1A 3WK2A 3HGSA 2B0MA 2OT1A 2OT0A 2P0OA 3TQ0A 3F4WA 3UWWA 2F84A 1SZGA 2NXHA 4MFEA 5MHBA 3FIGA 3LERA 3E96A 1H1ZA 3G8RA 3G0SA 4K39A 5CSSA 4OV4A 3UWZA 2YYUA 1N8FA 3ABQA 3INPA 3DKJA 3GDRA 1LOQA 1ME9A 4LS2A 1NAL1 3M5VA 2H90A 5AHIA 4HNNA 2YPIA 4TX9A 3G0UA 2XN0A 1K7XA 3G1YA 4FXSA 4O8RA 1K8XA 1TTJA 5G2HA 1Q3NA 1EEPA 1QOPA 3E49A 5H91A 1F05A 4N9DA 4IGHA 1TIMA 3W7NA 3L21A 3TW6A 1Q6OA 4JYFA 4WOZA 3QF0A 1PCWA 1TJPA 2VELA 2Y7GA 4IQLA 5G5IA 2WPBA 1OYBA 3P60A 1XUZA 1DOSA 4DXVA 4DEFA 4WX2A 2CWNA 1O94A 2Y61A 5EL1A 4JTJA 3PG9A 2CLIA 4K7VA 1TPDA 3Q94A 5DBUA 3O63A 3T55A 4LNYA 4BWLA 1TRIA 5E1QA 1LZOA 1XBVA 3LOTA 3LTYA 4AF0B 2LLEA 5C5YA 3FJLA 3EXTA 1JCYA 1IXPA 3HG5A 1PV8A 4NX5A 1AL7A 1NVMA 2ZRUA 4ONVA 2KZHA 1B3OA 2J9ZA 1XC4A 1U5JA 3MBFA 2YGYA 1GT8A 1WYIA 5HWMA 4ICNA 2FJKA 2ZDRA 3W7PA 1W3IA 4IMFA 1KM2A 5FESA 3M44A 3NGJA 3B8DA 4JGDA 3LV5A 4GE8A 3EXSA 3QQ0A 4BR1A 4UFLA 1Y0EA 2J6XA 4FNSA 3W72A 3TR2A 2J24A 4JTUA 1PE1A 1KM0A 4Y9AA 3P8JA 3Q37A 2CZFA 1JUBA 4O4WA 3OVRA 3L0KA 4AVFA 4YL2A 5EKYA 3B0UX 1TQXA 3UY8A 1P0NA 4RV8A 4RCXA 3NPVA 4RXGA 3RMJA 3IGSA 1T96A 2X1TA 5HMSA 1TTPA 4LVFA 1GG0A 4P2VA 4AMAA 1SPQA 2QCHA 4GUIA 3S5ZA 2EHHA 3UWYA 3O06A 3W1QA 2HTMA 3MI3A 3EB2A 2GVJA 2E77A 3QJAA 4UTHA 6ALDA 1SSGA 3W7JA 2CFFA 3G1XA 3C61A 1BKSA 2TPSA 1DKWA 2HSAA 2VEIA 1ZHAA 1I2RA 5KTLA 1JVNA 1C9DA 4LU0A 3NPXA 4ALDA 1W5MA 5HJLA 2A6NA 4I9AA 4Y90A 3BW4A 4JTLA 5D09A 3LHWA 5AC6A 5F2IA 2ALDA 2QJIA 1SO6A 2ABBA 1RZMA 2E1DA 2GQAA 4G1KA 5DN1A 5HINA 1H5YA 5LZLA 1IXQA 1LBMA 1W5QA 2NX9A 4N9BA 4PL1A 2P10A 1VLWA 3SIZA 3WJSA 4FO4A 3LCWA 2H3DA 1C8VA 2JKAA 2X1SA 3W7CA 1J5TA 1RQHA 2Z2UA 1UUMA 4BWLC 2BX7A 1KW1A 4ZQMA 5C2XA 2OJPA 1MXSA 2R14A 1F76A 3BLIA 4NJIA 4ADUA 3N34A 3S0CA 4DO4A 4O19A 3FKKA 5I3IA 1WBJA 2TYSA 3W7IA 2CLLA 2ZA2A 4PODA 3CPRA 4UTJA 3NO5A 4WXZA 2VFFA 1GJPA 4RZ5A 5CKSA 1FDZA 3EWWA 3G3MA 3MUXA 3F4NA 1FWNA 4UMBA 3VNDA 2JKEA 4JR5A 3UQNA 3UYCA 1FDYA 3IIVA 1FX6A 1A5SA 4RLIA 5BMXA 1XBZA 3MYPA 3LLFA 4HKPA 5DY3A 5D02A 3QYQA 2QJGA 1OX4A 2RKXA 3QSRA 3ABRA 1EPXA 4AHPA 2RFGA 1TREA 3PS7A 2V5LA 5T26A 4XTDA 1WQ5A 4LRTA 3N14A 3R13A 4PC8A 5CZJA 3I68A 3O05A 5AYXA 1G6CA 4GXMA 2H8XA 3L9CA 4JS3A 4MZ8A 1H51A 1UCWA 5I3GA 4X3ZA 4DF2A 2ZBTA 3P80A 4JTFA 4L4MA 4M7SA 3KHJA 1VH7A 2E6DA 1H1YA 2JGYA 2C13A 1H7XA 4UNLA 2Q8ZA 2DZPA 1H63A 5DY2A 2B7PA 4IUOA 4UTTC 2VOMA 3TK7A 4O0ZA 5D32A 1GVSA 4IMGA 4OQVA 4CCDA 4BFAA 2PCQA 1LORA 4FF7A 3M41A 1DORA 2BSLA 4M6VA 3S1WA 4OBTA 1KV5A 5AB3A 1P5BA 2XN2A 4O1CA 5CGQA 2QEZA 2ZRYA 4IXHA 5F2GA 1JQVA 3IV3A 2DZXA 4FHAA 4ADTA 3OEXA 4MJMA 1YTDA 1KM1A 1Q6QA 1L6YA 1PS9A 4L4LA 1G7UA 1WXJA 1T99A 3LHUA 2Y88A 4JTHA 4DF0A 1WOBA 1R30A 2V82A 1X7FA 1G67A 1GZGA 4H3DA 5I3JA 5HNRA 3QH2A 3EWBX 2DJXA 5CZ0A 1A5AA 3DI0A 3MI2A 4S2BA 2V8ZA 3MP4A 3NL5A 2O7SA 3T44A 1RQBA 1QWGA 3ZS4A 1NFBA 2OZ0A 4O13A 3F1QA 4UTLA 3LRMA 2BZNA 3NPWA 5KZEA 3EX1A 3CM4A 4Z08A 4FNQA 3W7HA 1AMKA 3E12A 2E6YA 3H54A 1RPXA 3M47A 4CNOA 3WK3A 2O7QA 4LC6A 4D2JA 5LNWA 3MHUA 2G96A 4KFOA 1ALDA 1TV8A 4O50A 5FEPA 2BTMA 2QR6A 4MLJA 4OWGA 4O57A 4WJEA 4WD0A 4BI6A 2ISWA 1HTIA 3BG9A 3GR8A 3NQEA 1HL2A 4HN4A 4ZL1A 3KFTA 2V81A 3QSTA 3HGRA 3N2MA 3ANYA 3IIZA 1GTHA 3NL3A 1K8ZA 2WSQA 3EWYA 4TO8A 1ZAHA 1GPWA 3A24A 3QMTA 1S3HA 1QR7A 4ZMGA 3M5XA 4A2RA 3OG3A 5F4WA 1OHLA 2A0NA 4EF8A 3HG2A 4WUIA 2GOUA 2NWRA 4JTIA 4NNAA 3MI6A 4YCOA 3SY5A 1J2WA 2NUWA 4AH7A 3GDKA 4UR7A 3B4UA 5LNSA 3TC6A 4P61A 3SGUA 1FWSA 1OF6A 3D0CA 3CC1A 3IIOA 4ZQPA 4JD4A 2HS6A 2TRSA 2C0AA 1RQEA 2VFIA 3KRUA 5IBXA 3W1TA 1H7RA 3GR7A 2NXIA 4OU1A 4JTSA 3NNTA 2QCLA 4ORIA 1B9BA 1XBXA 3U8GA 2GJNA 3T7VA 4KFNA 3PR2A 2Q3RA 1U83A 2FB3A 2C18A 2E5BA 2YYTA 1KBJA 4JYEA 3W6YA 2RDUA 3TSMA 1CW2A 3I7QA 1DVJA 5F1VA 2BLEA 2JKPA 4Z0SA 4QIUA 3CB8A 5K9DA 4AWTA 4IJBA 2C14A 2E5DA 1WDWA 2J9XA 3PSWA 2Y85A 1L9WA 3EWUA 4OV9A 1W54A 2Y7EA 5TQLA 2YR1A 4NQ1A 2DZUA 3HG3A 3CLMA 4PTNA 3GB6A 1VZWA 1YDVA 2QCDB 3FYPA 4K37A 1YDNA 1NEYA 1DBTA 3PSVA 4LT9A 4AB4A 5H2ZA 1UB3A 4ZQOA 3LTSA 3G1HA 3W7DA 4O10A 2YDAA 2ZZ1A 4MKNA 4NNBA 5EA9A 2A2IA 3I7SA 3LDVA 2GUUA 4IWWA 3P8IA 3CQ0A 1W5PA 2NX3A 2ZRZA 4JTEA 5AHMA 3VKJA 1TB3A 1IGSA 3IGUA 1WX0A 3W76A 4FNRA 2FPYA 5F1UA 3W1AA 1XCFA 3BVJA 3G1DA 5FF3A 2NLIA 3TJLA 3OHIA 1SZFA 4MOZA 5KITA 2QCMA 1I2QA 1JUKA 3C8FA 1SR9A 3NL2A 1I4NA 4GWEA 1W8SA 1I2PA 2HS8A 1XFBA 1ML1A 1G69A 4MY9A 4TMCA 1S5WA 4POCA 1HO1A 3W1UA 2QCNA 1AW5A 4YWIA 2QCDA 4UNKA 5HULA 1IXNA 2WNZA 3P7YA 3YPIA 3LM7A 3PBUA 3PF3A 3L2IA 4HPXA 2H3BA 3U2OA 4LTSA 2Q8LA 1Z42A 4NNCA 1XUUA 3W7LA 4XWUA 1W0MA 1OFPA 3GX9A 1H50A 2QJHA 3TSBA 1XDMA 4MJZA 3PBVA 4RX0A 2R94A 4LC8A 4LY8A 3LBCA 4R33A 1R2SA 2NX1A 3BG5A 3M7WA 1YYAA 3GNNA 5U7SA 4N6FA 4JNMA 4JX4A 3I7RA 5LSMA 1IIHA 1AW1A 4UTWC 4XBKA 1RVGA 2QF7A 2YW4A 3HOJA 1ZAJA 3E9AA 3HO8A 3NQVA 5IBXC 1S5VA 3EX3A 2ISSA 4JN6A 4NZJA 4MLRA 1H7PA 2NZLA 1RD5A 1I45A 1JR1A 3C2VA 3UXDA 3W3OA 1KA9F 4NXSA 1WBHA 1TPVA 3PG8A 5EMUA 4KFPA 3UXAA 3B04A 5AHNA 1M7OA 2G5WA 3GLCA 3M9YA 2W0UA 1FBAA 4O14A 3TROA 2QAFA 4NT0A 2PRHA 4FX7A 4Z1AA 5U4NA 4UFJA 2X1RA 3M6YA 3UWQA 4AWSA 4WQ6A 3W73A 1ZAIA 4LOCA 4DPQA 2A7NA 1TPC1 3HBLA 4MVAA 5F2MA 1KFLA 3CIWA 3STCA 4A21A 3R12A 4R7JA 2JBMA 3EX6A 4CNPA 1TV5A 2A1YA 3BG3A 4JTTA 3SR7A 3TX9A 1YXCA 3B03A 1R2RA 2V5BA 1W5NA 3GVGA 1ME7A 1LOSA 2ZQ0A 4HT3A 1GTEA 3BW2A 4H6KA 3WJWA 1K8YA 5LGXA 2YSWA 1V7YA 4O4VA 3PVFA 1OFBA 5FF0A 3PWAA 4O52A 1FWRA 5BNKA 1DL3A 3SJ3A 5IM51 3TMLA 1ICPA 4MZYA 3UZ5A 1E51A 3JR2A 3LHTA 3MBDA 3O8AA 3TJXA 2C6QA 3DFQA 4IMCA 4UTUA 1BWLA 3DFPA 4IOTA 4WXYA 4TU1A 2B7QA 1JCJA 2EPHA 5CPLA 5F4XA 4Z1DA 4LVGA 5LHFA 5ABTA 1THFD 5FI8A 2DJLA 4QNWA 1GWJA 1VJIA 1M6JA 1SW7A 1YPFA 3B0PA 3B05A 4WY0F 1G4EA 2Y7FA 5KINA 1MO0A 5FEZA 2ATMA 1OFEA 4I7WA 3M43A 1HUVA 3HPZA 1CX9A 4O1AA 2WNNA 3SI9A 1LOLA 3W87A 3P62A 5AHEA 4E38A 3EEGA 4QNEA 2ISVA 1TQJA 4AHOA 4MYXA 1UUOA 2DZSA 3IIXA 4Z1CA 1HO4A 3HPXA 5AN7A 3A5VA 4KKXA 3W1NA 3NQ6A 3PB0A 2UV8G 2XFWA 4MIMA 3DI1A 2QCCA 2ZTKA 3DFTA 3UWVA 2JGQA 3W7QA 2PC4A 1HFBA 2CU0A 5AC8A 4E0CA 3EKLA 2FLIA 4CNNA 5I3FA 1GVFA 1HG3A 3NG3A 2ZA1A 4JX6A 1QO5A 1YXDA 3S1VA 1YDOA 3FOKA 3O15A 5AHLA 5DXYA 1FWWA 1JULA 4R53A 5BRBA 2J27A 4UCGA 3A22A 2A85A 1PHQA 3W7EA 4O1BA 1TPWA 3BK0A 2QUVA 3THAA 1Z41A 3C3NA 1LLZA 3W83A 4JIQA 3OVQA 3LTPA 3G1VA 5LNVA 3LX9A 2VKZG 2CLEA 2A7PA 1A5BA 3VCRA 3GXTA 4NX0A 4ZZ9A 1OX4B 2ZYFA 1WAUA 3RFAA 4JY8A 1D3HA 4CQ9A 3MJYA 1KM3A 1LM1A 1KM4A 2CZ5A 3CEUA 3C0JA 4OGZA 4U28A 3N19B 3KVJA 1F6PA 4PEKA 3W1RA 3PUEA 1JRCA 1FCQA 4HSOA 4QM1A 4NJKA 1KFJA 3O6CA 1TPEA 1EX5A 1JCNA 3F03K 3LCIA 3L67A 4CCEA 2GQ9A 1QO2A 1XDLA 3G8EA 3QRHA 3ZWSA 4GJ1A 3C52A 1RV8A 4ZVJA 2QKFA 3W7GA 3S5OA 4YXGA 4Q33A 1QMLA 1DQWA 2VFDA 3LLDA 2AGKA 3S5YA 4GUGA 1ZALA 4JEQA 1PCKA 3PM6A 3LCHA 4PFMA 5D2XA 2ZA3A 4LV4A 3BV4A 4A22A 4IX2A 1H60A 3RU6A 3CIXA 3A5FA 3O1NA 5K4ZA 4CQAA 3KVKA 2WSRA 3UZJA 1OFQA 4J9JA 3LI1A 1LBLA 1VCGA 3MP5A 5HUOA 2BWGA 2Y89A 3W75A 3S42A 3LHYA 4HNUA 1EWEA 4CCCA 2QDHA 3C2OA 3MWAA 5E0KA 3A9IA 5LKYA 1FCVA 4DPPA 2RDWA 4RZ4A 1LBFA 3QM3A 4KWVA 4GUJA 2ZRXA 3ATZA 3KX6A 4M6PA 3TXVA 3MO7A 3TV8A 1LRNA 5G2IA 2VEPA 3TQKA 1TPB1 4S2CA 1XM3A 1GVOA 2FQIA 3PC0A 1FQ0A 1AW2A 1R46A 4UFIA 4WZHA 5FEWA 5AHFA 4M7TA 4O0KA 2OCZA 4JDBA 1ZCOA 1EIXA 3DH7A 2Y63A 2TMDA 2WO5A 3TE9A 5D38A 1P4CA 3DFOA 3KRZA 4TR9A 4QQ3A 2VFEA 5G1YA 3L66A 2E68A 3R2GA 1FCBA 4GFSA 1LTDA 1P1XA 3E02A 1SZNA 3W2MA 3S1UA 3NOEA 3OIXA 3SZ8A 5LGZA 4FIRA 4C1LA 2WOQA 4X22A 1OABA 5G2WA 4MFDA 3NAVA 5TIMA 1A5CA 1SW0A 1FWTA 4FNUA 4A2SA 4MUZA 3TMQA 1A50A 5FF2A 3C2EA 1LRQA 3ZFHA 2I9EA 4NUWA 4RJEA 3P82A 2DZTA 2WKJA 2DP3A 4UR8A 4UTIA 2CLMA 1O60A 1SZEA 2X16A 7TIMA 3TFCA 4TMBA 2GQ8A 2X30A 1PHWA 2Y6ZA 5HR6A 1MEHA 1F2JA 3TKFA 4AAJA 1VLIA 4GRSA 1F5ZA 2C1HA 4JICA 3TU9A 2RHGA 4NU7A 3L5MA 2NV2A 4EIVA 3R5EA 3V1PA 1H7NA 5EPDA 3BGJA 5L9FA 2EGZA 1YTKA 1LRTA 4O17A 2CLOA 3MHFA 1ZY9A 1UJPA 3C4UA 4E2DA 3W22A 3LCXA 3WJXA 3DHFA 1B57A 1LYXA 4UIOA 1JJKA 2TSYA 2FPTA 1MEWA 3EX2A 3FFSA 3NDOA 1X1OA 1XI3A 3QQ1A 1PL9A 1O95A 3G22A 3BGGA 1K02A 4UMCA 3WFAA 1K3UA 3TNOA 5CPNA 3STEA 3L5AA 3O6DA 4I7VA 3TAOA 1JRBA 3NL6A 6TIMA 5AFDA 4JTKA 1VYRA 1JCLA 1OF8A 1YXYA 3UD6A 1F7BA 1TPFA 3HPSA 4O15A 5AOUA 1WV2A 4RXFA 5C54A 4LV9A 2C3ZA 3KVLA 3E0IA 3W70A 1BTMA 3W2NA 1X6UA 1QOQA 1ZENA 4E2BA 3AJXA 1UASA 2R91A 2E09A 1C29A 2ZZ5A 4KWWA 4O1DA 2CLFA 4MZ1A 5D2WA 1VYPX 1B4EA 4XZ9A 3EXRA 3QW4B 3L0GA 2YX0A 1F74A 3S1XA 1OX6A 3AO0A 4FX6M 1W3NA 3NZ1A 1SO5A 1TSIA 1ZJIA 3GKFA 3W1XA 3FEMA 2ZZ6A 5HR7A 1TMHA 4UTKA 2F7FA 1G4PA 3ABOA 3TA6A 1Q6RA 3MW7A 1SFLA 3G18A 4UMAA 2WNQA 3NM3A 4NJGA 3OA3A 3DHDA 3LHVA 4O54A 3DKLA 4LVDA 1YPIA 3W71A 4W9TA 1KTNA 4HHPA 4FNPA 3P67A 4O53A 3Q58A 4HIBA 5CZTA 3NYZA 4Y96A 1VGAA 1M7PA 3W74A 4FIQA 1V5XA 1XXXA 5GVJA 2ZRVA 1W31A 2VEMA 2ATSA 3GAKA 1KM6A 3JS3A 1SW3A 3U6WA 4ML9A 2DORA 2RDTA 5EY5A 1FUYA 5CG7A 3TIMA 4ZQCA 3NXFA 3DENA 1NF7A 4O16A 2V0TA 3SGZA 1QPNA 3W7KA 2WJZA 3OBKA 3UPBA 2VFGA 3LRKA 1FCUA 1P0KA 2PRMA 4JY9A 2C16A 3HG4A 4FEZA 3IVTA 5DCEA 1KM5A 4MYAA 3C2FA 4NXKA 3P81A 4BF9A 4M6QA 3W7MA 2NV1A 2QAPA 1H7WA 5F2LA 3C2RA 1VHCA 4N4QA 1TYGA 4A29A 4ZQRA 4GUFA 1UBSA 4UFHA 1ONRA 4O12A 3IRDA 5AYZA 2OMAA 1QCWA 2ABAA 3S6DA 4EF9A 2C19A 3NQ2A 5FF7A 1LROA 4WY0B 5DLCA 3CHVA 4K36A 1RR2A 3VFLA 4AEOA 3N9RA 4GNJA 2OX1A 1H62A 3KOFA 3K30A 5D30A 5DCDA 2FDSA 3NQDA 2G97A 2V2DA 2PURA 4GC4A 4U4MA 2ZZ4A 1PIIA 1TTQA 1WOAA 1OFDA 3NA8A 3NQAA 5BW6A 2WSYA 2VEKA 3KRSA 4K8EA 4JYDA 3LBMA 2GVLA 4JDYA 4XTIA 4JIPA 5FEXA 5A8GA 1SFJA 1IF2A 2W6RA 5D33A 4X2RA 1VCFA 2DZVA 1TO3A 1EUAA 1GG1A 4PA8A 2GPTA 4NJJA 1LDCA 3QPZA 5K9XA 2V30A 3TH6A 1T0OA 5J5DA 5EYWA 1EA0A 5DBTA 3L68A 1ZFJA 3HIJA 3FLUA 1I2NA 4Q4KA 1NF0A 3RF9A 3H55A 4WY0A 1S5TA 3SW6A 4LUJA 3LV6A 1KFCA 4IMDA 2DU2A 2ZZ7A 3NQ7A 2V2HA 2VFHA 1KLYA 3BPWA 1OFRA 4LWWA 2GVGA 4QITA 1O5XA 3N2XA 3BLFA 4BI7A 3R8RA 1KBIA 4Q32A 3G3DA 2E5CA 4UFMA 1OFAA 3HGJA
chains in the Genus database with same CATH superfamily
3QTGA 2DIKA 2YBVA 1BWKA 3L4TA 1EC8A 3IGXA 2XIIA 2I14A 4PMOA 1W1A1 4DZ5A 3TDFA 3UZXA 3HM7A 4F8XA 5D2YA 1XIEA 4S39A 1A53A 3GHSA 5IHRA 5D37A 5LHEA 3LUTA 4C6JA 3UPWA 2Z1BA 4Q8MA 1H11A 4BKNA 4H04A 3TAKA 2CETA 4B5WA 1XLCA 1C3FA 4W86A 4TX6A 3R43A 1Q45A 3GNPA 5K3VA 3EWZA 4XKMA 3GW0A 3M1ZA 3HB9A 2WSPA 4ZFMA 2J4GA 2HJPA 1QNVA 3EDJA 1VEOA 3W2JA 5CSUA 1TTIA 3MZ2A 1SSDA 3NM1A 2WHKA 1FDJA 1JZ6A 1F6KA 3RLVA 1EYEA 5B7YA 1QJWA 4O18A 3LGEA 1BRLA 2GGIA 3GG0A 1MXDA 3M5ZA 4ATLA 4J3SA 5J5RA 3TWAA 3BLOA 5T9CE 1GOMA 5FJRA 1M5WA 3AXIA 3AYSA 2IW0A 1V6TA 1OIMA 2DEPA 3G24A 5CPMA 5LNRA 3G1RA 5RUBA 4RDVA 3EDEA 4PMNA 4LBSA 3VM5A 3NEVA 5AVNA 2QUTA 4YLWA 3V7PA 1TVNA 2B4GA 2J9YA 4PCFA 3G1FA 4R34A 5LA0A 1EGMA 1Z9AA 4AY1A 5A6BD 1BVNP 1YLVA 4AHQA 1PX4A 4QG9A 2G95A 1JNEA 4N02A 2CLHA 1LP6A 1JDAA 2PUZA 2BHZA 2IQ0A 3R8HA 4DBEA 2W67A 1IZJA 3DIPA 1BYCA 1UR1A 4FOUA 4UZSA 1EFZA 3H2MA 5FJUA 5AZ1A 3PULA 2CZDA 4DAIA 4LVAA 4PL2A 3VDCA 4F2TA 4K68A 4MPQA 2PP1A 1F4HA 4OBRA 3L0NA 2FFCA 4K38A 3O3RA 1TE1A 2QUMA 3O07A 5D2TA 4GGBA 3GNXA 1DHPA 3SSJA 2VXNA 4OBSA 1GQJA 1ZTVA 2VGBA 3VZXA 3W1LA 1DWHM 3IJ8A 2ZRWA 4UC5A 2BB0A 2WC7A 3IVSA 1W2PA 3EWXA 4J3XA 5HDRA 3T07A 1RY0A 2XU2A 2CWXA 4DWSC 4J1OA 1EA9C 4QTGA 1DJNA 4Q8VA 2WZIA 3ZSTA 1W6TA 1XYMA 5D04C 3TLQA 3T81A 4M6UA 1YNYA 4YTRA 2Y70A 4ZR8A 2VGIA 5AYIA 4UUIA 1WZKA 1ELSA 4B16A 3GTIA 2BHUA 4KMQA 3WELA 2Y24A 1O5KA 2A5HA 2HROA 2BOEX 3GM8A 4GGHA 4XBSA 4CLMA 4M51A 3WQWA 3B06A 3QKZA 1Q6LA 4PRRA 4HMDA 2Y8UA 3JRKA 2R8WA 2X2GA 1QBBA 4CN6A 2NWSA 3K46A 3KAOA 3GXNA 1TA3B 3FA3A 3RLUA 3H12A 4EVZA 5HNUA 3NFUA 3AISA 2PU0A 5G4WA 4LVBA 3TQPA 3UG8A 3GFZA 4GG9A 1PIGA 2X42A 3MYOA 4Q6JA 5HANA 2VM8A 3ZR4A 1J0ZA 1DE5A 4E8CA 4WCJA 2NQ9A 2QCFA 2PDIA 4NVTA 1H7OA 4O11A 4DJDD 1MUWA 2JFEX 4P7LA 1S5MA 1OJXA 4M8UA 4EK7A 3CMGA 5HOSA 2EPNA 1JEZA 4XISA 1S5NA 4XVEA 2PDKA 1YIXA 4W85A 5DANA 5AC4A 3N9SA 4CD7A 2J66A 1B9ZA 4F66A 3HFYA 2WK2A 1UYQA 4QRNA 4RKAA 5CPTA 5DXXA 3BSMA 4NZ3A 3P5YA 2XFYA 5FF4A 1HJSA 3PZVA 3BLLA 3WQCA 2D73A 3A21A 1YEYA 2GDUA 5KZDA 1GZ1A 2PCEA 1JUEA 4PUJA 6PTDA 1KQZA 3BDKA 1PEZA 1NWRA 4EWND 3GY1A 3UGVA 4AWUA 1TJRA 3NOYA 3AUOA 3QN3A 1Z3NA 3GXPA 3WH7A 1K77A 5F4SA 1R2TA 3EKZA 2WM1A 2NXGA 4NIRA 3Q2DA 1W1ZA 2PD9A 3RX3A 4KCUA 1A5OC 1YTEA 3NZRA 3RRXA 3W86A 1UR3M 1KXVA 3FYOA 4LS0A 1Y8BA 4K8GA 2R1KA 4QISA 2YXXA 1UP0A 3CPUA 3LQLA 4GY1A 2FPVA 2Z1SA 1IT7A 3RPMA 4MJ4A 3WQDA 2C15A 4YN5A 4DQWA 3S9YA 5KSWA 2YL5A 3GYEA 1ADOA 1XLFA 4LBRA 4YCPA 2I5GA 4JTGA 3F5LA 4FB7A 4Y8EA 2Z6JA 4EOUA 3W23A 1UH4A 3FKRA 2XM1A 3P61A 1FWFC 4B5XA 4FX8A 4M5PA 3SCNA 3A4AA 3RLGA 1XLJA 2HPMA 3M0MA 3U4FA 3VE9A 4D72A 3TEVA 2PWDA 2IPWA 3QMSA 3NUKA 2PDGA 4C91A 4F2UA 4L6OA 3TC7A 1JI2A 1NDVA 3SRKA 3DX5A 3N9KA 5H8PA 3IIPA 2NUXA 4J2MA 4XZMX 5BOOA 3GAYA 3QTPA 4S3AA 2E8YA 2W5FA 2PE4A 1IIGA 2D1ZA 4KCWA 3MHGA 1UG6A 1TWWA 2QUUA 1OYAA 1DWGM 1UWIA 4ILSA 4A6GA 2XINA 5DELA 1T8XA 4I9MA 1HJUA 4IJCA 3VGBA 2Q09A 1XCXA 3U2ZA 5JUVA 4YMZA 3LXAA 4DF1A 3MP3A 1FFRA 2BV9A 3UZWA 2D0HA 1DPMA 1S39A 4HZ7A 5EFFA 1EBGA 3NDYA 3IRSA 5M2FX 5FL0A 2D2JA 2QMKA 3WNLA 1SZGA 1XGZA 1WDSA 8XIMA 3LERA 1H1ZA 1WZLA 3G0SA 4GZEA 3GYCA 1UKOA 3UWZA 2YYUA 1HKWA 1N8FA 3ABQA 3BXWA 1X96A 3DKJA 5HATA 3S5SA 1ME9A 4S3EA 2O9OA 4LS2A 4PTVA 4E3VA 1Z69A 3WLIA 3QV6A 3QR1A 1T40A 3CQIA 2INFA 4ROPA 4P8UA 1D8WA 4UQ9A 4NAEB 4C6KA 2E4TA 4FXSA 4O8RA 1E71M 1Q3NA 4ZO6A 3E49A 2NQLA 5CAKA 3CV1A 1RJRA 1TIMA 3W7NA 4AVOA 4GI6A 3L7RA 2XGBA 3MPGA 4WOZA 3QF0A 2E9MA 2VELA 2Y7GA 3W0KA 2FVLA 2ZXBA 5GPRA 4IISA 3I3DA 1F4AA 3H24A 3I4EA 4TVUA 3GUWA 4LANA 1CIUA 1XINA 4DEFA 2QLYA 2DSZA 5E09A 5EL1A 3PJWA 1EJVC 3U3HA 2CLIA 1TWIA 2WZTA 1WUEA 3SCVA 2WCGA 4KGJA 3T55A 1O68A 1XBVA 2PF0A 4BF5A 3LTYA 3VXGA 3WQ4A 3AHXA 4HPGA 1XIIA 3OPSA 1X6NA 1Q6GA 1WAWA 1JCYA 1IXPA 1XG3A 3HG5A 2V69A 1K9FA 2G4FA 2IKIA 1NVMA 2KZHA 4H2HA 1WKDA 5JH1A 3MBFA 1GT8A 3POHA 4ICNA 1XIBA 2PLMA 2DGAA 3W27A 4ZSUA 1BHGA 5FESA 3MUCA 1J9YA 3M4HA 2O9RA 4IFKB 4BY3A 4UQEA 3QQ0A 1Y0EA 3BAKA 4AY7A 4CQBA 2WZEA 4ECLA 4HA3A 4FNSA 4I9JA 3GC4A 1KM0A 1TV4A 2VRQA 4G7FA 1LWHA 2P76A 3THUA 3QC0A 3NVDA 4I8DA 4QJ4B 1LQAA 1NIUA 5EKYA 3B0UX 3UY8A 1L8PA 2OYMA 2JIEA 3PTQA 4AMAA 4Y9MA 4GUIA 2QCHA 2EHHA 3AIVA 2PTDA 5BU6A 1EJ7L 2ASHA 3PPGA 3C86A 2E77A 3QJAA 3A9BA 3P3BA 1E56A 3G1XA 3C61A 4IFKA 1DKWA 3O0KA 1I2RA 5KTLA 1C9DA 2WCAA 3AALA 4GIEA 4ALDA 3WH9A 3WQOA 1W5MA 5HJLA 2A6NA 4I9AA 1GKPA 1PZ1A 3AROA 2QJIA 1SO6A 4OIFA 2WVVB 4G6CA 4A3YA 2PB1A 2WC4A 2E1DA 1K9DA 1VP5A 4NRRA 1U5HA 1LBMA 4TX8A 2NX9A 4N9BA 4PL1A 2P10A 5T91A 4UOZA 3SIZA 4ERIA 1Z7AA 1W9UA 2C7FA 3UG4A 5I24A 2X1SA 2O9PA 1RQHA 4L6DA 2FVKA 2Z2UA 3A3HA 5CLWA 4BWLC 4D8LA 2BX7A 2C0HA 4DN1A 5M5DA 1FWAC 1MXSA 4EAYA 2OXNA 5REQB 3OYXA 1NWTA 1PKNA 4DO4A 2VJXA 3I4KA 4Z2JA 2X05A 7TAAA 5LXEA 1WBJA 4C1NA 2CLLA 2ZA2A 3BC9A 4OOUA 4UTJA 2WVVA 1FDZA 3TN5A 4B5SA 3UPMA 2JKEA 3UQNA 4H9VA 1XF0A 3VDHA 1FX6A 4C6QA 2QPSA 3LPGA 3LLFA 1S1PA 5D02A 3QYQA 1OCJA 5AECA 3ABRA 1EPXA 1H2JA 2EQDA 4EPKA 4NI3A 1WXYA 1TREA 4XTDA 2R9RA 1MRQA 1WQ5A 3WLJA 3N14A 4IIBA 5CZJA 5AYXA 4WEVX 1QNQA 4DJED 2H8XA 1EF2A 1Q85A 4M7SA 5A6AA 3BOLA 5REQA 2DQWA 2JGYA 4L1WA 2Q8ZA 4HB7A 1R87A 2GUYA 3PTDA 4O0ZA 5ABFA 3I10A 5I09A 1GVSA 4H1ZA 3M41A 1DORA 4WDXA 4M6VA 4US5D 1KV5A 2POTA 9XIAA 3R94A 5AB3A 2XN2A 1BSIA 4IXHA 5F2GA 3M0IA 4ADTA 2ZVRA 1PS9A 3U7VA 1G7UA 3RXZA 1BD0A 4NSBA 1PWMA 1R30A 4FMVA 1G67A 1GZGA 1HP5A 2PAJA 3WDHA 2WYSA 4GNVA 4LYRA 5I3JA 1A5AA 5EMYA 3WDJA 2V8ZA 3NL5A 4QJ3B 3T44A 1QWGA 4J35A 4JTAA 2B31A 2ZE0A 3F1QA 4UTLA 3LG3A 3NPWA 1U33A 3D5HA 3WDQA 3RM9A 3W7HA 1R3RA 4LEFA 1B5TA 3TTOA 3WG6A 2G96A 3Q4DA 1ALDA 1NFPA 2FJUB 2QR6A 1A4MA 2VCBA 3K4WA 4H7ZA 3E0FA 4O57A 4WD0A 4BI6A 3ZMRA 3KBSA 1HTIA 3GR8A 3QBUA 3ENLA 3A12A 4GXPA 4ZL1A 3EPOA 3PPHA 3ANYA 1W9VA 3IIZA 4GYPC 5LIXX 4TV6A 2W92A 3EWYA 2WQDA 3VUSA 4AZ6A 1AQFA 3IJ7A 1QR7A 3UGRA 4A2RA 5CBIA 3BSHA 1OHLA 2FZ9A 2J7EA 2Q01A 1MVYA 2H9AA 1V3LA 3HG2A 4WUIA 2GOUA 3PJXA 4NNAA 2XSXA 4YCOA 1J2WA 3OJGA 2NUWA 3MV01 2DT0A 1XLEA 4F48A 3TC6A 5LNSA 1FWSA 4P8WA 4XAFA 1PWLA 1I1WA 5IBXA 3W1TA 5LA2A 4JTSA 3NNTA 4ORIA 4JL2A 3H2FA 1XBXA 4IFOA 3U8GA 3T7VA 4MM1A 3PR2A 1XX1A 5A1AA 1FKXA 4JYEA 3TSMA 5I0DA 1J0YA 3NXLA 5F1VA 4R7WA 4FLSA 4IJBA 5A6TC 4B5UA 5DMYA 2E5DA 3VOFA 3PSWA 3BZGA 4BF7A 3ORWA 3EWUA 3N4AA 4PCTA 4AIUA 5DO8A 2CPUA 4PTNA 1V0MA 4W7WA 4B4HA 4K37A 3SDOA 4LT9A 4J40A 1UB3A 1P43A 1J0JA 3KTCA 1CLKA 3LTSA 3W7DA 1OBAA 3I7SA 4IWWA 4WDWA 3CQ0A 1E0TA 3KW3A 1OZQA 2NX3A 5AHMA 3ZR5A 4D6HA 4FZIA 3UG3A 3UXLA 4Q8PA 3W1AA 1B54A 3GTNA 3G1DA 3CZJA 4X61A 3OHIA 2HXUA 5KITA 4OTKA 1SR9A 3M0XA 4YVVA 3U9IA 1W8SA 1UC4A 2HS8A 1G69A 4IL2A 4MY9A 2XH0A 3VKAA 4POCA 5HULA 3GTHA 1WE5A 3LM7A 1KRMA 4GI4A 5A8MA 4LH8A 1HL9A 3ARYA 3BH4A 3IWPA 4RE3A 4HPXA 3H22A 3U2OA 4HCHA 2IS7A 1QI2A 4NNCA 4XWUA 1OFPA 2CEQA 3GX9A 1H50A 4U2YA 3VOJA 3PBVA 1B3YA 3G6MA 4RX0A 2R94A 4P7OA 4R33A 2XTKA 3M7WA 5U7SA 3GC2A 4JNMA 4UOQA 1XRVA 3AXXA 1A49A 2VX7A 4UTWC 3CO4A 4KEMA 3EDFA 3G6LA 1T8QA 2YW4A 2Z26A 4I6VA 3E9AA 3OLIA 1E6ZA 3ITOA 4NZJA 1OB0A 3N1AA 4L56A 4P5UA 3C2VA 2WVUA 4Q4MA 1GEHA 5EMUA 3VNYA 1QNOA 1VB9A 5LIKX 5AHNA 2G5WA 1QASA 3CXOA 2W0UA 1FBAA 1FKWA 4RUBA 3WQFA 4NT0A 3SQMA 4WSHA 3FHAA 3UWQA 3DEQA 2PDCA 2ZDSA 4AWSA 4WQ6A 3GNOA 2WLZA 4KWOA 1KFLA 1F07A 5FJPA 4LPCA 3MMWA 4C5ZA 4IPNB 2JBMA 4L9XA 3S2LA 1DJIA 4TOQA 4FALA 1E0XA 1YXCA 3ZQ9A 3CB3A 1R2RA 3H2OA 1W1VA 2WB5A 2CKSA 3KZPA 3WLSA 1LOSA 3WJWA 3KLKA 3IUDA 1K8YA 1G1YA 2PDWA 3M0JA 3SCQA 5CLTA 1DL3A 2VR2A 1UZ4A 2VZTA 3AIBA 3LHTA 1DXFA 5DF0A 3R0UA 2C6QA 3DFQA 4UTUA 3NIYA 2B7QA 1JCJA 2YXOA 1N2VA 5ABTA 2OSYA 3CUJA 3H8AA 3UCDA 4L80A 1E73M 1M6JA 4GVHA 4MHBA 3H26A 4WGXA 1SW7A 4AYSA 4GH1A 2XIMA 1HUVA 2BY0A 1MW1A 4GX9A 3SN1A 4IGSA 1OCQA 4OUIA 2E9BA 3GVWA 3W87A 4GPNA 1R9ZA 4MWAC 2YDQA 1J0IA 1TQJA 2J7BA 4E5TA 3BOFA 4PMJA 2DZSA 2EXOA 1HO4A 2YIHA 3A5VA 2UV8G 2YL8A 4C65A 2QCCA 2ZTKA 3GXDA 3W7QA 1FH9A 1HFBA 3PZQA 3EKLA 5HA7A 4IM4A 1A4LA 4CNNA 2IXVA 4H8HA 1QO5A 1C91A 1YXDA 3S1VA 3FOKA 1HKVA 3EA1A 1JULA 4R53A 4WLCA 3W7EA 5C71A 4WSJA 2OEKA 2GSJA 4RW3A 2DVUA 4AD0A 3CV7A 2J7HA 2VUYA 1V0LA 3OVQA 1DJYA 5GNZA 2YJQA 1HT6A 3PNUA 2CLEA 4A8NA 3MSDA 3S83A 2QVNA 3GXTA 4REQA 1BLIA 2ODOA 2XVPA 2VDIA 3WD0A 2DDXA 1FWCC 4GIYA 4UQDA 5E70A 1F6PA 1JRCA 4I5UA 4HSOA 1PSCA 4B5VA 4H9TA 2DUAA 1QW9A 3L67A 1RA5A 4CCEA 2GQ9A 4GHRA 3P6LA 4ZSTA 1AMYA 2AQVA 1V3KA 1POKA 4LSBA 3W7GA 4QS5A 3EPNA 1QMLA 1C9WA 1EDQA 3ZR6A 6TAAA 4J3TA 2AGKA 4JEQA 1ZALA 1Q7QA 1G5AA 4PFMA 3LCHA 2P3EA 3R10A 3BV4A 4IX2A 2A3AA 2OTDA 3WLOA 2GK1A 1RCQA 4CQAA 2FGBA 3OLEA 2I16A 5CAHA 3UZJA 1R9XA 1G01A 1RXOB 4JN7A 1VCGA 3MP5A 2OKTA 2BWGA 2VQTA 1DYSA 1ZJBA 1CXFA 2OGYA 3LHYA 4XO6A 5I2UA 4CCCA 3FXGA 3VD7A 2J6VA 3K5XA 1LBFA 1FHUA 3M6DA 3GVRA 3HMCA 1XR2A 3ATZA 2OLHA 1O7AA 4NZCA 4FF5A 2W27A 3IJQA 1S46A 2VEPA 3ZO9A 2FQIA 3KBVA 3AZSA 3VKBA 4O0KA 4DY1A 2PODA 1JZ2A 2Y63A 3AC0A 4KEVA 2GSHA 4HU0A 1TWSA 1AODA 1P1XA 3E02A 3T6CA 1V6XA 3S1UA 3OIXA 4V28A 5LGZA 4O1FA 5HQLA 1OABA 2G50A 4ZE5A 1IV8A 1A5CA 3P2VA 1J93A 2PLJA 2YZ5A 1FWTA 1LLOA 1R3WA 1LRQA 4GI8A 2GGGA 4WKFA 2DZTA 3R79A 4XSMA 1O60A 1XPGA 1L6GA 2X16A 4DUVA 2P8CA 1OD0A 1EKOA 1MEHA 1F2JA 2G3JA 2CNCA 4GRSA 3URQA 2QZRA 3SN0A 3GRIA 2C1HA 3AXHA 4HMEA 4JICA 1H1NA 4A3RA 2YLAA 4MKVA 2NV2A 1Y5WA 5L9FA 3MY9A 3RPDA 4B90A 1YTKA 1LRTA 2CLOA 2AL2B 3UVAA 1UJPA 4JNZA 1JGMA 1Y5XA 1JJKA 2UWFA 1UD2A 3EX2A 2BNJA 4YNGA 4CD6A 1PL9A 3B8UA 5D9OA 1HVQA 1NM9A 4LFYA 4BQ4A 5CPNA 2XZ9A 1PJ9A 4GQ0A 5AFDA 3LZ3A 4YJ5A 2VEFA 1F7BA 1HXJA 1DJGA 1A5MC 7XIMA 2OEJA 2PS2A 4Y7EA 4HK7A 4JKMA 4GD0A 4DZAA 4BZYA 5C54A 4LV9A 1XYFA 3K8MA 3VNZA 2QQ6A 3FJNA 4GYFA 4ES4A 1NQ6A 1V3JA 3D6NA 1FWEC 1BTMA 1QOQA 4E2BA 4QE5A 1I0DA 3U57A 3THDA 2EPKX 4IIFA 1S2TA 2F6UA 3SBFA 2AL2A 3GWQA 3QW4B 4XAGA 3ZJKA 4DJEC 1ZSXA 3AFBA 1F74A 3S1XA 1TSIA 1ZJIA 3W1XA 5E9XA 4H9UA 1TMHA 2BMBA 2I57A 1XW8A 3AICA 3MW7A 3VOHA 3MDUA 1CECA 2DPEA 2DSUA 3U4AA 2G3NA 4U33A 7PTDA 2YBUA 4MDOA 3DHDA 3DKLA 4LVDA 2J47A 3W71A 4QCFA 2ACSA 4B15A 3GHUA 3P67A 1GHSA 1A3HA 4ZTYA 4C7FA 3VAVA 1WO2A 3NYZA 1REQA 5EBAA 1E3ZA 1TJ1A 4ICCX 4CU6A 2VEMA 4EP8C 2WMKA 3GAKA 1KM6A 1SW3A 1XYAA 3IK4A 4FP1A 2RDTA 2FMOA 2E0PA 4XD3A 1DIEA 2CLPA 3PZNA 5HNTA 3TIMA 1T5AA 1NF7A 5I6SA 1XC6A 3W7KA 2WJZA 2CIPA 1P6WA 2VFGA 1E0UA 2ZC1A 4AG0A 1P0KA 2HBXA 4FEZA 5EMLA 1QOXA 1QW8A 4WIWA 3AYTA 4NXKA 4PMDA 3WL1A 2EG8A 3C0LA 3W7MA 2NV1A 3RIKA 3GE7A 2VC9A 2WVSA 1VHCA 1FP9A 4CKQA 4W89A 4A29A 2PFHA 3R7MA 2FVMA 2YBTA 3QHOA 3N2CA 3EYPA 2ABAA 2BP1A 3DBNA 2G4JA 1EJXC 5CJMA 4K3ZA 1E6SM 3FNDA 4WY0B 5DLCA 2C8NA 4DXXA 4R7OA 1X7IA 4JIRA 1JPKA 2QW5A 1NDWA 3SCPA 1P7TA 5DCDA 2BOGX 3HV8A 1VFTA 1YE6A 1QK2A 3B9DA 2ZZ4A 1PIIA 3VINA 4JN8A 3NA8A 2ZUVA 2IPFA 3N6QA 2F2HA 3KRSA 3SADA 3TVAA 4JDYA 1XS2A 5JH2A 4IPLA 4MGGA 5FEXA 4DJFC 1SZRA 1FRBA 3WH6A 4KF1A 3WNMA 5J5DA 1ZFJA 3WDPP 1I2NA 2Y5EA 3RF9A 3H55A 1RVKA 3CL8A 4WY0A 4EX4A 4LUJA 3LV6A 5BXSA 2DU2A 2ZZ7A 1MFVA 1S1RA 3BPWA 4LWWA 5LIWX 2IKJA 3BLFA 4HZ8A 1A0EA 3G3DA 3HV9A 1OFAA 1LQ2A 3CH9A 4C6OA 1Z48A 3T78A 1JFHA 3LLXA 2DSWA 5D9PA 5HXMA 1RSCA 4ZBCA 3UG5A 2FZNA 2Z6IA 3H4GA 4DX3A 2B7NA 4JTCA 3R89A 5GNYA 3GXFA 2V9DA 1O66A 2ZCGA 4IL0A 2PDJA 4R5EA 3RN6A 2UY3A 4YTTA 3BTNA 1LUCA 3P84A 4KEZA 4QSHA 1ICQA 2Z25A 3TCSA 4IPJA 2GGHA 3AMGA 2V6AA 3H21A 4RE4A 5DEZA 1U5VA 2QIWA 3P5ZA 3VE7A 5BOFA 1N82A 1YADA 1KTCA 4N2YA 4QROA 4P8XA 2WMGA 3EMZA 1ZU8A 3U48A 1KTBA 1E43A 4UR9A 2Z4GA 3AIEA 2CYGA 1Z32X 3L2LA 3KWXA 4AF0A 1EIBA 3CBWA 1RPKA 3FVMA 2Y2WA 3VNJA 1B2YA 3PBGA 1ME8A 4F3HA 3G0XA 3FJ6A 4MPKA 5D2VA 4FXRA 3U2EA 3HJZA 3TFXA 4L7ZA 3TYZA 1WCGA 2YW3A 5ABGA 1CDGA 1KWGA 4Q7BA 1LLWA 1K4GA 1OQFA 2OWXA 3NZPA 4HNVA 2GJLA 1Q6EA 3K8LA 3CUZA 3UU0A 1E0WA 3CTLA 4F2BA 3LXBA 2DW7A 1VC4A 3OB8A 1KC7A 2PTWA 1OVDA 1DQXA 2FH8A 5LNUA 3QGVA 4RNIA 1MSSA 3OGVA 3B0VC 3CEPA 5A6BA 2V2CA 1W3TA 3S8HA 5EB8A 1CGWA 3UY7A 3GXMA 4B5NA 4CN4A 1G7VA 2ALRA 2DZAA 3WBXA 4GNKB 2OX4A 4LY4A 1WKFA 3REQB 4DM2A 3HQ1A 3VDGA 2NUYA 3TC3A 3ZT6A 1LL4A 1CXIA 1S2AA 4F0KA 2PRLA 4QAWA 2J8TA 4C6MA 3EEZA 1EZ2A 5FJJA 6A3HA 1OK4A 2XFRA 4BHYA 3CWNA 1QW7A 3E2QA 4QAIA 3IAPA 3FAWA 3TSDA 3DGRA 4G56A 3B3DA 3RM8A 4JCMA 4FR1A 4MDPA 3TTQA 3AYRA 4WSKA 4FA3A 5G1TA 3KCOA 1JZ8A 2IPGA 1PYMA 4GYPA 1AFSA 3PY2A 3M0KA 4UNIA 3QMRA 1E70M 3SJNA 2W79A 2VENA 1EPVA 2FYMA 3TR9A 4ZE4A 3UNDA 1R86A 2PBOA 4XKYB 3ABSA 3BJFA 5A69A 4OZOA 3RK8A 5C2CA 3REQA 3NQCA 1KFKA 2R1PA 3PBYA 2FB2A 2A79A 3DAQA 4HNTA 2W63A 3NQFA 3WUEA 3A23A 3HMJG 3IJLA 2QYGA 1PZ0A 3DC0A 1LQ0A 2OWWA 1BXBA 2GLKA 3WQ5A 1W37A 3VZZA 1QFEA 3SN4A 1I6NA 3QPYA 1EDTA 1U1JA 3EA3A 2BVWA 5CSRA 3WJYA 2DFAA 4OHQA 2Z1XA 5DCBA 2REQB 3GDMA 4I6KA 3AZTA 1F8MA 4EAMA 2AAMA 3LCGA 2AGTA 4XKYA 1V3IA 1JYVA 5HPCA 4GUHA 2OOFA 1YKWA 3NSXA 2B7OA 1FVPA 2A4AA 4HNOA 3UA3A 4QLJA 4A3UA 4RV3A 3A3WA 2X09A 2YL9A 4DJDA 1H0GA 1K7FA 2A6LA 1AQ0A 2GUBA 2J78A 3LS9A 5A8QA 1O5QA 3PAJA 4AD4A 4I5XA 1CI1A 1NP0A 1O5RA 3CUHA 3UW6A 4I7UA 2GGEA 1VS1A 1ONXA 3ZSSA 4DO5A 2Y62A 4BJHA 2X41A 4H2CA 1E72M 3RUBL 3LGGA 3DZ1A 3BV7A 1A5NC 4ZXOA 1HJQA 3TN3A 3WBAA 1K9TA 1EQCA 2REQA 4LYQA 1NDYA 3ERPA 3TCEA 4M82A 1OYCA 4IPIA 5A6MA 2X0YA 4ORMA 1R7OA 3GK0A 4JOMA 3WENA 1XWYA 5B7ZA 1OSEA 2Y0FA 5EBUA 4LW7A 2CW6A 3H2AA 1VBHA 2HVNA 2EAWA 3EMCA 2E6AA 5K2ZA 4DBDA 4Y6GA 4PBGA 1J11A 3RX2A 1E6NA 4K6AA 1GONA 1MZHA 3VU2A 3T40A 5FACA 1QUMA 3SUVA 4S3BA 1ICSA 3NPUA 3OVPA 2XHYA 1DTUA 2BDQA 3AYVA 3DCPA 2UY2A 3FS2A 4LAOA 1GVEA 4DYJA 1IEVA 1V51A 3WY1A 1GYMA 3IVUA 4HSHA 1M7XA 4W5UA 3GDTA 1L2UA 3VIJA 4QE4A 3LCLA 3COTA 4UTWA 3VNIA 1V02E 1R9YA 5JU6A 3FA4A 3KXQA 4Z1BA 3UFYA 2Z27A 1ZPTA 3F4DA 4JFSA 1R47A 1QPQA 4OVXA 4GACA 4DELA 1ZBCA 2HDJA 5A6LA 3QFEA 2I56A 2ZUSA 4C6FA 3L5LA 1LT8A 1KO0A 1JQXA 1XRFA 3DC8A 1XIFA 3I65A 3QQWA 2HXTA 2YLLA 1XIJA 1GOKA 5HQEA 1XLLA 2ZZ3A 3O16A 3PBWA 4K8HA 3GSMA 3P74A 5HPOA 1EJSC 5HUPA 1AJZA 5J04A 4DZIA 4KCTA 3RG6A 1MYRA 2V5KA 2E6FA 1DIKA 3TQVA 1JZ3A 3USBA 3APYA 1PXGA 3E1F1 4GYKA 3DU0A 4H6EA 3S46A 5DMLA 5J8LA 3TW7A 3LRLA 1NP2A 1O4UA 3WFZA 3ZLFA 4V2XA 1S2WA 2ANUA 2YFOA 4AD5A 1WKEA 1JZ5A 2EJAA 1E9ZB 3KCJA 3D47A 3GIYA 3AWOA 2WBKA 4YWSA 2J62A 4ACZB 5A2AA 3ANUA 3TYBA 3PUDA 5A6SA 1UKTA 3PB2A 2PDFA 3ELFA 3KEHA 3VILA 1ZJHA 2XDFA 3TZFA 4AYGA 3I6RA 5LXXA 5A6JA 1OG0A 4TQTA 1MNSA 2V3DA 1Q2SA 2BOFX 3KRBA 3TTYA 5C9XA 3HGSA 2B0MA 2OT1A 2OT0A 2C91A 4S3GA 2OSXA 2NXHA 1MWOA 2YCKX 3S2JA 2XM2A 3ID7A 4EANA 3SUWA 2QDDA 2E25A 1B0IA 2E67A 4ACZA 1W91A 3QV7A 2VWTA 4X60A 3M5VA 5AHIA 3TJ4A 4RDYA 1C7TA 2YPIA 3R8GA 3PWIA 2PU1A 4TX9A 2V3GA 2WPGA 5CQ1A 2WW5A 3B97A 3G1YA 3DHUA 3BLKA 1I60A 1F05A 3MDWA 5JBEA 1JG9A 4MKSA 4Z2KA 1Q6OA 4HD5A 1KBBA 1UWAA 4JYFA 1W8GA 5FD0A 2J25A 2DVTA 5EU9A 4HCDA 4F0HA 1DOSA 3WBWA 3Q67A 8CGTA 1WKYA 3OGRA 1O94A 4WK9A 1GCYA 2X1IA 4JTJA 3PG9A 4CQCA 4CVUA 1HNYA 3Q94A 3VIPA 1WDDA 4DWDA 1TRIA 2OG9A 3V16A 3OZOA 2P8BA 6XIMA 4KBXA 3SQLA 3O0FA 3CV2A 1XC4A 1UR2A 5DT7A 2ZADA 1U5JA 3WLPA 1ISWA 1R3YA 3WUBA 5HWMA 3EDKA 3W7PA 3E5BA 4IMFA 3T4WA 2BG5A 3CUIA 4GQRA 4PTXA 1KKOA 2PD5A 4Q8QA 1XDJA 4KQNA 3RYSA 3DN5A 3V0UA 4BR1A 1AA1B 2J6XA 4KWUA 3W72A 4JTUA 4ATDA 3II1A 2OGJA 1NU5A 4Y9AA 2CZFA 4EPDC 3ITYA 4R27A 4W7UA 3AIQA 3ZJ8A 3OVRA 3LPOA 3QV8A 4AVFA 4AEFA 2NW0A 2E9LA 4RXGA 3RMJA 1J18A 5HMSA 3EWCA 2HISA 5D4YA 1XD1A 4S38A 1EF3A 3ZT5A 2V63A 2HTMA 2DT3A 3LPPA 1VFUA 2GVJA 1QHPA 3DDMA 3UZZA 2NQJA 4JFUA 4PMZA 4GCAA 4C6LA 2CFFA 2O56A 1BKSA 2HSAA 2VEIA 1ZHAA 4LU0A 3MKVA 3NPXA 3ZYZA 3B0XA 1EHNA 4JTLA 5D09A 5AC6A 2VRJA 5F2IA 4BQ2A 5CC3A 2ABBA 4PE8A 4G1KA 5DN1A 1UA7A 4H7VA 1H5YA 2W62A 4YTUA 2ZWZA 2O9TA 2VR5A 1EXPA 1C8VA 1BPLB 2JKAA 1Q6CA 3IJIA 4YHGA 2QMJA 2WHJA 1UUMA 1VBRA 3C3UA 3OTRA 1XSIA 1V6WA 2ZX6A 1C8YA 1XH1A 1HN1A 4NJIA 3N34A 1O12A 1OT2A 2XH4A 4JTDA 5I3IA 3M0VA 5KZ6A 4LCQA 4IQDA 1UPMB 3W7IA 4WXZA 2VFFA 1GJPA 4RZ5A 5CKSA 3F4NA 1FWNA 3PJTA 1W32A 3K4AA 4JR5A 1J6OA 3IIVA 2QF8A 3GZAA 1A5SA 4RLIA 1IEIA 1G0CA 3U0HA 4E2VA 4H6RA 2WAGA 2PC8A 3ME3A 3ARSA 2V5LA 5T26A 1V93A 4LRTA 3R13A 4NP7A 3K1GA 1UCWA 2HVMA 4RPPA 4O1EA 2PWEA 4JTFA 3VTRA 1H1YA 1H7XA 4UNLA 2DZPA 4WKHA 1H63A 1B3ZA 2B7PA 4UTTC 1HKKA 5D32A 2ZX8A 4JTRA 4CCDA 5XIMA 4FF7A 4J28A 3VX1A 3V18A 2BSLA 4DJEA 4KIEA 3WLTA 5CGQA 5CCZA 1R8LA 1TVPA 2NSXA 2VZSA 2DZXA 4FHAA 4XZWA 4CD5A 1BQGA 1YTDA 1DP0A 3SIMA 3HJEA 3IGHX 3KBNA 3AI0A 3RDKA 1WXJA 2ONEA 4ZCWA 3FGCA 2Y88A 4JTHA 2V82A 1X7FA 1ZQ5A 4US5A 4WDTA 4QR6A 1R6WA 3UERA 5CZ0A 4S2BA 1RCOB 4RNJA 4GZ7A 1PKYA 3CHDA 2QNEA 2BHYA 3LRMA 5KZEA 3EX1A 3VIKA 3DYOA 4PTDA 4Z08A 3D3AA 3P0XA 3LD5A 2AQOA 2E6YA 4ZXLA 2O7QA 3RAOA 4D2JA 5LNWA 3MHUA 4KFOA 1HKJA 1UR9A 3RMEA 3W25A 1TV8A 4O50A 1V0NA 4MLJA 2TAAA 2YA2A 1NJJA 3BG9A 1HL2A 1A5UA 3CLWA 5TD4A 5I03A 4L4PA 3KFTA 2PDHA 1GGOA 1E5NA 1XH2A 3AMDA 1CYGA 1K8ZA 2J7GA 3HQPA 4TO8A 1ZAHA 2BBFA 3QMTA 1CGVA 1UUQA 4ZMGA 4H9YA 3V5CA 3VO0A 3FSUA 4JNYA 5F4WA 1RH9A 4JTIA 3UETA 3WF2A 2E40A 4Q8WA 4AH7A 4UR7A 1OF6A 3CC1A 3OODA 3R0KA 3KCLA 2WNWA 4FPSA 1P6CA 4JD4A 3CASA 3PPFA 3KRUA 1RQEA 1V3HA 3N4EA 2NXIA 1E55A 5HMDA 2NT1A 1B9BA 2GJNA 4F0MA 1E9YB 3B8IA 4IG2A 1OC6A 4PUMA 1U83A 3FY1A 2E5BA 4AXNA 3LPFA 4D1IA 4IICA 5FL1A 3W6YA 1CW2A 5CBBA 3VGGA 1DVJA 4LAUA 4IF2A 4QIUA 4HHLA 4HN8A 1XHGA 4GZJA 3E5PA 2J9XA 1BSLA 3UP8A 5ENLA 4Z2LA 3B8TA 4H6QA 1E6QM 3OZYA 3VNMA 2Y7EA 3CLMA 3OZPA 3GB6A 1UR8A 4F4RA 1YDNA 2IKHA 4PMVA 3MA8A 3SO7A 3G1HA 4NNBA 1VPYA 5EA9A 2A2IA 3LDVA 2GUUA 4JTEA 2YB4A 4IT1A 3VKJA 1IGSA 3IGUA 1WX0A 4FNRA 2GZXA 3E74A 3TLLA 2FPYA 4E8DA 5F1UA 9XIMA 1XCFA 3BVJA 1J8VA 4JQ3A 4MOZA 1E6PA 1I2QA 1ISVA 1GJUA 1CENA 1F9CA 1I4NA 3EB4A 3RGTA 1XFBA 2PMQA 3RR1A 6XIAA 1XYCA 4UNKA 3TYDA 2WNZA 2XVLA 1E3XA 1Q7MA 4HK6A 3FSTA 4JTQA 3B8SA 1B3VA 3V1HA 3PF3A 3L2IA 3WNNA 2H3BA 3VFCA 5CJ5A 4UTFA 2DSVA 1XLKA 3TSBA 1XDMA 1XPYA 3GG7A 1YYAA 2PGRA 4N6FA 4XX6A 4JX4A 3I7RA 1IIHA 1AW1A 3VGFA 2CITA 4S3KA 1RVGA 3HOJA 1ZAJA 1HVXA 3HO8A 2X7WA 3NQVA 4R9OA 4WDUA 1FHVA 1S5VA 5IBXC 3T09A 3UJRA 2J7CA 3NGFA 3OLDA 2WANA 1E6RA 3OG2A 3L4YA 3NO1A 4MADA 3RCYA 3WZ0E 4AD1A 2PTYA 3LYEA 4KFPA 3W6MA 3SCOA 4GQGA 4I9TA 4I8YA 1V6YA 1XIDA 4FX7A 2ZICA 2X1RA 3TN6A 1TWZA 1ZAIA 4DPQA 3ZIZA 5F7UA 3HBLA 4S3JA 2QXWA 3CIWA 3CPGA 3STCA 1FHDA 1C8XA 3R12A 4R7JA 1UH2A 3A4WA 1UD4A 3KE0A 3EX6A 4CNPA 4D6IA 1IQ8A 3BG3A 4JTTA 3TX9A 4H7CA 3B03A 1CXLA 4YYCA 2JF6A 4I90A 2IKGA 3S9IA 2ZXAA 3NJ3A 1ZGDA 1S38A 3TZNA 2GWGA 4O4VA 1OFBA 5FF0A 1FWRA 1TX0A 5A8OA 3GH7A 2XSAA 4MZYA 1X6LA 3MBDA 3TJXA 5C7HA 2QDEA 1BWLA 1T7LA 2EPHA 4UQAA 6REQA 5F4XA 3MSRA 2GGJA 2OEMA 1THFD 1GWJA 4LUYA 4PTMA 3WF0A 1CT5A 2Q6ZA 2Z00A 4GK8A 3B0PA 4EPEC 1G4EA 1DQUA 5KINA 2ON3A 4I7WA 3M43A 4S23A 1CX9A 1Q65A 2WNNA 3ISIX 1LOLA 2PGWA 3P62A 3NDZA 4QNEA 3GD6A 2INZA 4Z1CA 5PTDA 3IANA 4J3VA 2B81A 2J7FA 3L4XA 3UWVA 4ZGYA 3VPLA 5GJNA 4W8AA 4CVWA 1JD9A 2ZA1A 1K4HA 1OGBA 4HJFA 1YDOA 3BMWA 5DXYA 2ZX9A 4W93A 4HNLA 2J27A 2SFPA 1V6VA 1IEWA 1OEPA 3MVTA 4C7DA 5JXQA 1OT1A 1TPWA 1TJ0A 3GU1A 1Z41A 3C3NA 3CNYA 3FN9A 1LLZA 3W83A 3DGBA 1Q7ZA 3G1VA 4DLFA 3CTTA 1TMQA 2A7PA 3VCRA 4AD2A 4ZZ9A 2ZUNA 1KXTA 1OX4B 4JBRA 1Q5MA 1WAUA 2DT2A 3WN6A 3IJ9A 1E1CB 3MJYA 1LM1A 2CZ5A 1W1IE 3C0JA 3CEUA 4OGZA 5I00A 3KVJA 4PEKA 4QM1A 4NJKA 3O6CA 4AY8A 1EX5A 1QI3A 1DE6A 1JCNA 1QO2A 3WEOA 2J8GA 4HVXA 3ZWSA 5BU9A 4GJ1A 1GW9A 3C52A 3VUPA 1RV8A 2ZUUA 1ONEA 2QKFA 3S5OA 4YXGA 1DQWA 2VFDA 3LLDA 1CLXA 1MXGA 4AIOA 4GUGA 4WR3A 3FEQA 5C70A 3PM6A 3PFRA 1MQRA 4LV4A 3F5KA 4A22A 2ZX7A 3A5FA 2GJXB 3KVKA 1U2YA 4L6HA 1YQ2A 3UR5A 1E1CA 1OFQA 4H00A 4QLKA 3LI1A 5T9BG 3V36A 2Q8XA 5HUOA 1ITCA 4HNUA 3C2OA 5BROA 1YDYA 1EC9A 4UQCA 3TWBA 3WLMA 1C92A 4DPPA 2RDWA 5DMMA 3QM3A 3M0LA 3QR3A 2JEPA 5H8UA 1E40A 1XSJA 1BVZA 4M6PA 4PUWA 3TXVA 3MO7A 3TV8A 3M0HA 4X63A 1US3A 4J7RA 3TW9A 5B80A 4PRTA 3PC0A 5I79A 1Q4WA 3WYZA 4UFIA 1SJCA 5AHFA 1JAEA 4JDBA 2NVAA 1EIXA 3N4FA 3ITVA 2XUCA 2UZ9A 3DFOA 4TR9A 4QQ3A 2VP8A 3L66A 2E68A 1JPHA 3BQ6A 3EMQA 5IDZA 1R3QA 4C1LA 4ZB5A 5G2WA 3NAVA 5TIMA 5C9WA 1SW0A 2E7FA 4NZ4A 3XIMA 4AMCA 2I9EA 1ODUA 2VOTA 4QLLA 4EXQA 4UTIA 4M1BA 3UR7A 1X38A 2CLMA 1FWGC 2HQAA 5BWAA 1FWBC 2GVYA 3TFCA 4TMBA 3V0SA 2WMFA 1TA3A 2Y6ZA 1ESWA 5HR6A 3PTMA 4D6CA 5ABHA 3TKFA 1VLIA 1DWFM 1F5ZA 2DT1A 2RHGA 2Q71A 4NU7A 3QR0A 4AZCB 3IJ6A 3TJIA 3GBDA 4XD4A 4O17A 3W22A 5CJNA 1GOQA 3DHFA 3TYUA 2FPTA 1AZ2A 4ZO7A 3S2MA 3G22A 3BGGA 1K02A 4U10A 1JDDA 4M3PA 1K3UA 3TNOA 1AQMA 3O6DA 1ITUA 2HNEA 1VYRA 4JTKA 1JCLA 2R6OA 4KH2A 3UD6A 1YX1A 3B9EA 1BG9A 4PUEA 1TPFA 3RPTA 3WMBA 3AMLA 3HPSA 4O15A 2DQXA 5C0QA 4Q4OA 4RXFA 3LSCA 5DX7A 4X9YA 2G3FA 5D9NA 4MUPA 2C3ZA 3E0IA 4IP4A 3QLLA 1X6UA 3AU6A 4AZCA 3AJXA 1UASA 2R91A 2ZZ5A 4MZ1A 3AXKA 3EBVA 3R58A 1DJWA 5D2WA 1B4EA 4XZ9A 1VENA 2W3ZA 1R38A 3EXRA 2F6XA 3L0GA 4UOJA 5C8BB 2YX0A 4ML4A 3VMPA 5CBJA 1RLCL 1XGEA 3GKFA 2V5DA 3QPEA 4INFA 4XAPA 2PDYA 4D6JA 3VCNA 4Q8OA 4PGLA 1SFLA 1W3HA 4ATWA 4UMAA 1UOKA 3PK7A 4GY0A 3WF1A 3LHVA 3LNMA 1O1HA 1YPIA 4W9TA 4HHPA 2JIWA 2I5QA 4O53A 1Y7VA 3P14A 5CZTA 4PR4A 1FWJC 3JVAA 1UW9A 4LUSB 1VGAA 1UD3A 4P7QA 1V5XA 1XXXA 2ZRVA 2FH6A 3JS3A 3UVIA 1X97A 3ZLHA 5EY5A 1W3JA 3WFLA 2A3LA 5AKQA 4CNUA 4O16A 2V0TA 3WQ8A 4C6NA 5I07A 3VGDA 1J6PA 3VD4A 2WKLA 1E9LA 2QPXA 2PRMA 1FH8A 1BXCA 5DCEA 1W9DM 1GVYA 1KM5A 4BF9A 4ZA0A 3VDAA 1H7WA 4PZVA 5F2LA 4MNJA 4MAVA 2PP0A 1TYGA 4LCRA 4Q8TA 4LF1A 4ZQRA 4XUYA 3NZQA 4UFHA 4XG1A 1EH9A 3IRDA 2W4XA 4B2DA 4GVIA 4HOXA 1KRAC 3E6EA 5JVLA 4GISA 4W7VA 1E4MM 4K1WA 2NLYA 4K36A 1PTGA 1UPPA 3H4XA 1GOIA 1O1ZA 3N9RA 4GNJA 2Z2BA 2OX1A 6ENLA 3KOFA 3K30A 3K8KA 2V2DA 3PZGA 4U4MA 3BCDA 2P50A 1TTQA 1WOAA 3NQAA 1ZL1A 3VVGA 3CUXA 2WSYA 1R0MA 3LBMA 2V67A 3Q45A 3HZ3A 1DJZA 1SFJA 1IF2A 2PP3A 2W6RA 5D33A 1VCFA 4L65A 1W1PA 2QJJA 4Z2GA 1GG1A 2BXZA 2GPTA 4JEJA 3FVDA 5K9XA 3TH6A 1EA0A 2HE8A 3L68A 1F3XA 3HIJA 1YPXA 3FLUA 1NF0A 3SW6A 1TKKA 1CGUA 4IMDA 1A80A 1M9HA 1H41A 1PPIA 1POJA 1CB7B 1KLYA 2GVGA 3KLLA 4FLOA 1O5XA 3N2XA 2VVSA 3R8RA 5AC5A 1QATA 4UFMA 4DWSD 5IFPA 3CQJA 3BGAA 2BGNE 1U1UA 1A5LC 4W87A 2EF9A 1Q13A 1AG1O 2A3BA 4NAEA 2D22A 3W7RA 1W56A 3SCSA 1ISZA 4NZ1A 2OZ3A 5H6HA 1PZ3A 1QDSA 1FXQA 2FFIA 3NQ8A 1RUSA 2FZBA 3BLPX 3HFTA 5BXRA 4Q3MA 3ITXA 4ZQNA 3DFNA 1XBYA 1YBQB 4EKJA 4ADSA 1SU5A 3GZ3A 1RLDA 3STGA 1EP1A 2P0IA 5HMEA 1X8CA 1AH3A 5JBDA 5SWUA 1OGGA 2CBUA 1UKPA 2BY1A 4AXKA 1XLDA 2Z7KA 3LQGA 2XN1A 4AZIA 4HSNA 2XG9A 4DI8A 3UYIA 2XWDA 4H41A 2CCRA 1V3MA 3DUGA 4GBDA 4IZGA 1KBKA 3GDLA 2A7RA 2WZHA 3N3MA 1CTNA 4GKLA 1OINA 4K7YA 2H6RA 4H9XA 3TP4A 3CT7A 3WQPA 1G9HA 1N7KA 1TG7A 1OX5A 5I7GA 1TRDA 2PTZA 4UWMA 4UTTA 4JHMA 1YBQA 4Z17A 3T4CA 3PN8A 4AFYA 4IHCA 1KFEA 2Y7DA 1W3LA 5G4EA 1BAGA 3NWRA 4ZOCA 4FS9A 3ZWTA 4NZ5A 2CLKA 5HWNA 5CSYA 4B9ZA 4MNKA 3ZVIA 4AU0A 3S5NA 3WK0A 2ADAA 4U5IA 2YA1A 1VF8A 3WQEA 1FWHC 5AYYA 2WV8A 1MDLA 3WH8A 3GNDA 4O28A 4YTSA 4LB3A 2YCLB 2PZ0A 4V1YA 1M41A 2NT0A 1RP8A 2F61A 3NSMA 1PTAA 5I3KA 2OQLA 4QS6A 3XINA 3WJZA 4Y8FA 1QAPA 1C7SA 4MB5A 4NF7A 3VIFA 3W07A 3WUFA 3A3XA 4LUIA 1MW3A 1XISA 4KW2A 4RE0A 5HK4A 5KMYA 4IQEA 5DFAA 4YVXA 1MW0A 4WJ8A 3MO4A 4C6DA 4Z2IA 1EGZA 1VEPA 1TX2A 1JCMP 2J88A 3FV9A 4AD3A 3ATYA 3STFA 4FNTA 4D9PA 3SY8A 2PDUA 1Q6FA 1DWAM 4PYSA 2YCLA 1X1NA 1IR2A 3E0WA 4CU7A 4CEXC 3FA5A 1L6WA 1U30A 4WVXA 2OO0A 2ZOXA 1VFLA 5K4XA 1OC7A 3W7OA 2PWUA 3BO9A 3EA2A 4RZ6A 2Q02A 3H70A 2WMJA 1KV8A 4IGMA 1D3CA 2AQWA 3THCA 4RNFA 4AUBA 5A95A 4JKLA 2VD9A 1NH6A 4HA4A 4PUUA 3LCFA 3MMDA 5KZMA 3SUTA 4JIEA 5E0FA 1RJQA 5C55A 2ZZ2A 4ICMA 1Z8AA 1PB0A 3GW3A 2Z29A 3TYAA 2FGZA 4OOZA 3OZMA 2Q3OA 1GOXA 2AL1A 1GK8A 1LJYA 4D8ZA 7A3HA 1W9BM 2ZC8A 4DYEA 4YTQA 1WDRA 3ABXA 1DJXA 3ALGA 4LEQA 4KIRA 3UWUA 4LUTB 2PBGA 5HNNA 4GJIA 3EX4A 1VIZA 1VR6A 4US6A 4YHEA 4L9ZA 3V3WA 3GUGA 1KGXA 1N55A 1FFQA 1XH0A 5D03A 1ZB5A 3LMZA 4W84A 1W5OA 5E93A 1F3EA 3W2UA 1KB3A 1TV7A 2VDGA 3KVMA 3LK6A 4BEQA 1MFUA 1L0PA 2VC5A 1GYNA 1HZYA 4WOQA 1UWUA 4RNHA 1NOFA 3HF3A 4DXKA 4G8TA 1PKLA 1KLZA 2X1UA 3OP2A 4GQBA 2VD8A 3BANA 1JCXA 5CXPA 4XQ6A 1TUXA 1R3VA 4PH6A 4AZHA 2NV9A 4H01A 5I06A 4XUGA 1VFFA 4X0VA 2YCEA 3LB0A 1XKJA 1JPMA 1QI5A 5G4HC 3K13A 3A6OA 4BK9A 3W2LA 4IXXA 3VD9A 1AD4A 5HAOA 2D0FA 1YMYA 3GC5A 4MF4A 3LY0A 3DFSA 4IP5A 1K7EA 2CZEA 1SUXA 4K1GA 5BCAA 4GH3A 3C56A 4E4UA 3VOIA 1ECQA 1SO3A 1AK5A 3CL6A 1E6XM 1XKYA 2FIQA 2QV5A 3CAWA 1QNRA 4XZLX 1XYLA 2W9MA 1WDPA 3PNZA 1KBLA 1OFOA 3T0DA 2XSBA 1NWUA 1UWRA 3N18A 3GNRA 1XL9A 4D6GA 2YXGA 4N42A 1ZNNA 5TBOA 3M64A 4ROQA 4GKTA 3UJFA 3LXCA 4N6EA 3LA4A 2HWGA 1BYAA 4LJ3A 2RAGA 3PZOA 3S1GA 1TIWA 3SRFA 3ITCA 4BS0A 1B90A 1EP2A 4LRSA 4QSFA 3H23A 3FAXA 4UXDA 1BEUA 1Q63A 1VQTA 1VRDA 1SQ7A 3VA8A 3G1SA 1G4TA 1D9EA 2GOKA 1IWBA 2ZVIA 2QDGA 4Q4RA 2OO6A 1F73A 3N73A 4JX5A 2WJDA 3L65A 1X8FA 3N2TA 5HWJA 3CYVA 4DJDC 3B8VA 1KRBC 1N8WA 1KXHA 3BW3A 3KTSA 3CGTA 3VD5A 1E4LA 3HURA 4LS1A 2ISDA 1QPRA 5E9AA 1J96A 4QCEA 3VKCA 4DNMA 1NOWA 1QWKA 4V27A 4HTBA 2VC6A 3UT0A 5K9CA 1LL7A 2EKCA 3DFHA 1ZUAX 2HMCA 1TZ7A 4NILA 3VM7A 4X9SA 4Q4SA 3QZEA 3MV11 4E2OA 2OFJA 1UZDA 4GFIA 2BY2A 3IPWA 2YFNA 4GIAA 3WQVA 3WK1A 3WK2A 4KS0A 2D3NA 4W8LA 2P0OA 2VWSA 4M29A 2JALA 3UWWA 2F84A 9CGTA 3DERA 1X39A 2O0TA 2VCAA 4MFEA 2OELA 4LF2A 1JPDX 3E96A 3G8RA 2G3IA 4A3HA 3ARXA 4W88A 2CESA 3GG8A 1GUVA 2G3MA 1JYNA 3VOCA 3N3TA 1A47A 1KCLA 2H90A 1UC5A 1PIFA 4HNNA 5I77A 1NQKA 3R6IA 5BWFA 2XN0A 1SJDA 4GA8A 3T1GA 3SUUA 1TTJA 4IQJA 5G2HA 1LF1A 1EEPA 1QOPA 5H91A 3KM8A 1UWSA 4IGHA 3OU8A 1RBLA 1UH3A 3BMXA 1PCWA 3QKEA 5A94A 4H19A 2ZUTA 4IQLA 3CZLA 5G5IA 2WPBA 1OYBA 1XLMA 1VEMA 5I23A 1CXEA 4R85A 1KKRA 2VHLA 1MNZA 4U5KA 1TMLA 1V79A 3QHMA 2Y4SA 1TPDA 3O63A 4RDZA 2WHMA 1TV3A 1BRLB 5E1QA 3ES8A 1EOMA 4DAFA 5C5YA 1MUMA 4GZIA 4RE2A 3FJLA 3EXTA 4XD5A 4A3QA 2HK1A 1IGWA 3APTA 1AL7A 3BL3A 4JPGA 2ZRUA 2J9ZA 3AJ7A 2G37A 3H2CA 3P0WA 2QJNA 3MQTA 3SRHA 3H4WA 1GHRA 1W3KA 5FSDC 1UBPC 3B8DA 4JGDA 2FZ8A 3LV5A 1DIOA 2CERA 4GE8A 3EXSA 2ICSA 2VRKA 4PB5A 2HV5A 2OYKA 3TR2A 2VO5A 4YS1A 3LBOA 3O6AA 4AZ5A 3Q37A 4G9PA 1JUBA 1TR9A 1DHKA 4O4WA 4LBUA 4RW5A 2D2OA 4HHHA 1CWYA 1P0NA 4HYVA 4RV8A 4RCXA 3T8LA 3NPVA 3RO8A 1I9CB 1T96A 2X1TA 3PP7A 1W1TA 4DRSA 3TNBA 3GS6A 1EHAA 2J75A 1QTWA 1TTPA 2R82A 1SPQA 1IHIA 3E0VA 3UZYA 3UWYA 3W1QA 2W66A 3MI3A 1V08A 4NY2A 4UTHA 2DH2A 3EOOA 2P3ZA 2WMHA 4KT2A 4M80A 3I6EA 3WD4A 1JVNA 3KP1A 4QG6A 3VGHA 1XLAA 4WKAA 3VZYA 4Y90A 1ZS2A 3ECQA 3MMUA 1EJWC 1HP4A 3GQYA 3UCCA 3L4VA 2GQAA 4XBJA 5LZLA 4GVGA 4E6MA 1XRSA 1XIMA 3C2YA 1A5KC 3WJSA 4FO4A 4XZBA 2PDLA 1E0VA 2ZXQA 2FTYA 4MB4A 4C6CA 1C90A 4FSAA 2X40A 3S6OA 2PLKA 3WEZA 1KW1A 2KX9A 4TUFA 2YB1A 3BLIA 4ADUA 4R3UA 1BG4A 4O19A 2VT0A 3FKKA 4XZNX 3UF9A 1IR1A 3CHCA 4BA0A 3UXIA 3NO5A 3W28A 1XICA 2Z7GA 3G3MA 3MUXA 5GJMA 3VNDA 1SMAA 3PHAA 3UYCA 4OJYA 2XIOA 4Q4QA 4UCFA 1XBZA 3MYPA 2QJGA 2RKXA 3QSRA 3KL0A 4AHPA 2RFGA 4LAMA 1JAKA 2DIJA 5I3DA 1ODZA 3LEPA 4JAWA 1XLGA 4B4FA 1M65A 3O05A 3C0QA 1G6CA 4GXMA 3TA9A 3L9CA 2QVHA 4JS3A 3TN4A 1KR0A 3L2MA 4X3ZA 2ZBTA 3WQGA 1E1EA 4DVOA 4L4MA 3KHJA 2E6DA 3N17A 3OOQA 4Q4PA 4DUXA 4IUOA 3TK7A 4F0RA 1QPKA 2PCQA 2R1NA 1LORA 2PDPA 3H7UA