1JUBA

The k136e mutant of lactococcus lactis dihydroorotate dehydrogenase a
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
311
structure length
311
Chain Sequence
MLNTTFANAKFANPFMNASGVHCMTIEDLEELKASQAGAYITKSSTLEKREGNPLPRYVDLELGSINSMGLPNLGFDYYLDYVLKNQKENAQEGPIFFSIAGMSAAENIAMLKKIQESDFSGITELNLSCPNVPGEPQLAYDFEATEKLLKEVFTFFTKPLGVKLPPYFDLVHFDIMAEILNQFPLTYVNSVNSIGNGLFIDPEAESVVIKPKDGFGGIGGAYIKPTALANVRAFYTRLKPEIQIIGTGGIETGQDAFEHLLCGATMLQIGTALHKEGPAIFDRIIKELEEIMNQKGYQSIADFHGKLKSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords dihydroorotate dehydrogenase A
publication title Lactococcus lactis dihydroorotate dehydrogenase A mutants reveal important facets of the enzymatic function
pubmed doi rcsb
source organism Lactococcus lactis
total genus 118
structure length 311
sequence length 311
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2001-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 1jubA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1jubA01
1P0NA 3IIVA 4O14A 5FEPA 3P61A 3PVFA 5CPMA 2YGYA 2E5CA 7TIMA 2JBMA 3G1AA 2VC6A 4ADTA 4ML9A 3ATYA 4OE7A 5K9XA 1DBTA 4FX8A 3TJLA 1H60A 1TREA 5AHEA 3QW4B 1TPB1 2CLFA 4QQ3A 5GVJA 4C1LA 5HUPA 5DY2A 5K3VA 2CZEA 5EY5A 3WK0A 3KX6A 1TV5A 1AW5A 3ZWSA 3O8AA 1V5XA 1TPWA 4MJZA 4OQVA 3W7EA 2GVLA 1YYAA 2YR1A 4ADUA 2CW6A 1IXQA 4NJIA 4A29A 2YFNA 1TJRA 2ZBTA 3HQ1A 1KV8A 1I2RA 4YCPA 3NZ1A 4DO6A 4UTTC 3PSVA 1CI1A 2ZRZA 3W7IA 3OVQA 4XUGA 4NX5A 1FX6A 5E1QA 2D73A 3HB9A 1C9DA 3OA3A 3VE9A 3BV4A 4CLMA 1SW0A 2A0NA 2JGYA 1XKYA 2G97A 4ZZ9A 1PCWA 3Q94A 4K8HA 2BXVA 4UTWA 1H63A 5BW6A 2CLOA 4DO5A 4EOUA 1RVGA 2DU2A 1TTPA 3QM3A 2QUTA 1TQXA 5FI8A 2QCDA 1J5TA 1O60A 5KSWA 5I3JA 4ZQOA 5AC7A 4LUIA 2QDGA 1AK5A 3KVJA 2C1HA 1KFCA 1A53A 4ZQRA 4ZMGA 2WQPA 5D30A 4QSHA 1M7PA 1H7PA 5F1VA 2W0UA 1W3IA 2A7RA 4S1FA 1PL9A 4O17A 4Y90A 5LNWA 1B57A 3SECA 4FX7A 2A6LA 3EXTA 2QCHA 5D09A 5CPOA 1L2UA 2ZZ7A 1AW2A 1OX5A 3L66A 4M6PA 3PBVA 1W3NA 2BLEA 3TIMA 4TIMA 2YCEA 2Y62A 4N4QA 3P5ZA 3TV8A 1H5YA 3EKLA 3FOKA 4NJJA 2V30A 4O18A 2VFIA 1DJQA 2J88A 3C8FA 1FWWA 3EX4A 1G4EA 1W5QA 1DHPA 3F03K 3HG4A 3KVLA 2ZYFA 3W71A 2ZZ1A 4IUOA 4GUIA 3DFTA 3UNDA 1R2TA 2A5HA 1MEIA 3IEBA 1VR6A 4PA8A 3QEZA 3GXPA 1S5TA 1FDYA 4CCDA 3PULA 4R53A 1SZNA 4K7VA 3TROA 3LI1A 1UBSA 3O1NA 5BOOA 3WJSA 1LZOA 1OF6A 3DKLA 3LM7A 1VCVA 1VHCA 5L9FA 3W1TA 3UYCA 1FDJA 1WBJA 1KFBA 3W7HA 1T0OA 1ZY9A 2WSQA 1GEQA 4UFJA 4WOQA 4WOZA 2WNNA 4X9SA 3H55A 3NA8A 1TB3A 5U4NA 3C3NA 3TSMA 3LCWA 5KZMA 2V8ZA 2ZZ5A 4UFHA 1KFJA 1SZGA 2FJKA 2WOQA 1QOPA 3DFPA 3T78A 3TFCA 4K7YA 2Y89A 3QSRA 1RD5A 5CZTA 1ZFJA 1OVDA 3EXRA 3SW6A 2DZPA 1OFEA 1TV7A 3PM6A 4YXGA 2TMDA 1T99A 3T55A 3UWVA 1KM2A 3NL2A 2RFGA 5KINA 1FWTA 3M5XA 1OFOA 4O28A 5ABTA 4MLRA 4IXHA 3G3MA 3P8IA 3I7QA 1M7OA 1SUXA 3PF3A 4CQ8A 2ZZ2A 2UV8G 3GXNA 2C15A 1RQHA 3TMLA 5D38A 2ISWA 5D2WA 1AL7A 4AWUA 3M6YA 2Q8ZA 4JNMA 5DCEA 1W5MA 1BEUA 1HFBA 2JK2A 3UXDA 2NUYA 2WPBA 4EF9A 1R47A 1YPIA 2E09A 6ALDA 1M5WA 3TNOA 1TRDA 3W9ZA 5EPDA 3NO5A 2H8ZA 4UNKA 3N73A 1G4TA 1PIIA 1OF8A 1MSSA 2H3DA 2ZCGA 1KM3A 2V2HA 4DELA 3CU2A 1HL2A 2YPIA 5DXXA 4L4LA 4KWVA 1VJIA 3PBYA 5AB3A 4GUFA 2FIQA 5TQLA 4FXSA 3L0KA 4RXFA 1WOAA 1I2PA 4JDYA 3SFKA 3B05A 5FF0A 4UTUA 1UB3A 4XBSA 4HSNA 1FUYA 5E0KA 5J5RA 4LWWA 3W7GA 1FBAA 5BRBA 3EWBX 5C6MA 4WX2A 1KTCA 4LTSA 3UPBA 3GLCA 3BGJA 1EB3A 3V75A 3DZ1A 3LHZA 2JGQA 3ANYA 2NX3A 3N9SA 4P2VA 2PURA 2DJLA 1LDCA 1OX6A 3NEVA 2W79A 5HNRA 3GYEA 2NXHA 3R12A 4PL1A 4K38A 3OVRA 3M16A 3G3DA 1W37A 1PVNA 1M6JA 3L21A 1CX9A 5EKYA 3AO0A 1MO0A 5K4XA 2RHGA 2QJGA 3ELFA 4LU0A 1EX5A 1LBMA 1JR1A 1J2WA 4JX6A 1W0MA 3F4WA 3GDMA 5FF3A 1WDWA 1WV2A 3F4NA 3S1XA 1NF0A 2QCMA 4K36A 4NX0A 2R14A 1GVSA 3INPA 3TW7A 3RLUA 1YDNA 4LVBA 3QC3A 4NJHA 4O57A 1B9BA 1F6KA 2HMCA 1SSGA 1C8VA 1F74A 3PUEA 3ABSA 3NAVA 3LI0A 2DZUA 4AWSA 4JTFA 4FNRA 3G1XA 1VLIA 1TJPA 3HO8A 1ZENA 3GDTA 1NSJA 5A8GA 3G8RA 2R91A 3UWYA 2EHHA 3M5VA 3CPRA 3P84A 1A5AA 4RV8A 4KFPA 3SIZA 3TK7A 3W85A 3DFQA 1J4EA 2ZFAA 4WZHA 3DI0A 3W70A 5K2ZA 4LS2A 3FA5A 2NXIA 4FB7A 5FEXA 1JUBA 3ATZA 3C4UA 1O5XA 3UWZA 3NM1A 4NJKA 1BTMA 3DXIA 1JCYA 3GK0A 4B5NA 4OV9A 3GR7A 2ABBA 2YZRA 1VZWA 1SFJA 5D03A 3PR2A 5LGXA 1W31A 4AVFA 3NQ8A 5I3IA 1F76A 5U7SA 4GUHA 3DKJA 1GWJA 2VEKA 5MHBA 3NDOA 4AHPA 5AFDA 5FF2A 2CLEA 3DBPA 4O54A 1OJXA 5CPNA 5FEWA 3SR7A 4JR5A 3H54A 5HR7A 2CU0A 2V0TA 3L0NA 3LTYA 3G24A 2X16A 4MKNA 3L9CA 4LOCA 4O4VA 4O13A 3W1XA 2Y63A 4RX0A 4HNUA 3JRKA 3MHUA 2FPYA 3T7VA 1JJKA 2Q3RA 2J27A 5D37A 3QMTA 2QAFA 4OGZA 4A22A 3DI1A 2V81A 3O63A 4JYEA 4HIBA 3WK3A 3I7SA 1ML1A 2ZA1A 4O4WA 1XBVA 3ABRA 4IMFA 3SZ8A 2OZ0A 5F1UA 3IVSA 3A22A 4QJ1A 3CIWA 3N2XA 4N6FA 4Y96A 1H51A 4UTIA 1Q6OA 5D2TA 5G2IA 2V5BA 1SO5A 2HS6A 2B7NA 3LTSA 3HGJA 5KZEA 2ABAA 2Z6JA 3HIJA 1X6UA 3NQVA 3NZRA 2BTMA 4MYXA 3G1VA 3EWXA 4O53A 2A2IA 4MFDA 3IV3A 3FKKA 1TPEA 3CIXA 1N55A 4AHQA 4HHPA 2QCLA 1AMKA 1DL3A 1VCGA 2Z6IA 4DEFA 3RNDA 1XBXA 4HPXA 1KM0A 1QAPA 4E0CA 4JGDA 4QNWA 1OX4A 4DF2A 3GKFA 1VC4A 1ICQA 4FF7A 2TSYA 3W74A 5BNKA 2FPTA 5LGZA 2C3ZA 2ZZ4A 1FCQA 3U2OA 3QQ1A 5F2LA 4GFSA 4MZYA 4NJGA 3MMTA 3TW6A 4NNBA 4H4IA 4HSOA 3TDFA 4JD4A 5F2GA 3TUUA 1F7BA 1VS1A 1WX0A 2QEZA 2WSYA 3M47A 3W7KA 3MYOA 2NZLA 4LC6A 1K7EA 3W1PA 3T40A 4OU1A 3LRLA 1TTIA 3LCIA 1EEPA 1DOSA 4Z1CA 3O06A 3B4UA 1Z44A 1D3HA 1N8FA 2Q3OA 2HS8A 3L65A 3P62A 4Q4KA 3TXZA 1JCMP 1YXCA 1Z42A 1ME9A 3C56A 4CNPA 5DCDA 3S5ZA 3MHFA 4XKYA 3RU6A 2H3BA 5C54A 1IXOA 2OX1A 1CW2A 2WV8A 3G1HA 2NUWA 1TPC1 1XUZA 4LVDA 1RR2A 4QAIA 1FQ0A 3C52A 1YDVA 3BLEA 4IQLA 5HWMA 3I7RA 3M9YA 4OHQA 1TYGA 3FS2A 4DXVA 4Q33A 4TU1A 4RZ6A 1WYIA 2B7PA 3USBA 2J9ZA 3K30A 4MOZA 3FYPA 2YDAA 1ICPA 1Z48A 2ZA2A 3QH2A 2VEMA 4IOTA 2RDUA 1L6SA 1BKSA 5AYXA 4AF0A 3GXTA 4IMGA 1Q6RA 3Q37A 2GJNA 3L5LA 3KFTA 4UMBA 3TKFA 4LV4A 2Y6ZA 1EP2A 4LRSA 3GX9A 3G0SA 3MBDA 3NQMA 1EWEA 3TQVA 4MZ1A 4BI6A 1BWKA 3S9YA 3BW4A 4GJ1A 1LM1A 3TAKA 4JN6A 3ZS4A 3MJYA 3E0IA 4O1AA 5I3HA 3DAQA 2ZA3A 1JRBA 2WKJA 3MW7A 3W1UA 4PH6A 1W54A 5BMXA 3QSTA 1OX4B 3L5AA 2LLEA 4E2DA 3PB2A 1L6WA 3EKZA 3PWAA 5F4XA 4FNUA 2CLLA 3FFSA 3TSBA 3TQKA 5IBXA 2GQ9A 2DP3A 3O07A 4IPJA 4DPPA 1W8SA 3SGUA 4N9BA 1OFAA 4RCXA 4UMCA 3V1PA 3CC1A 4ZL1A 1KM6A 2ZZ6A 1T8XA 2CZDA 2Z1BA 3W1RA 4FNTA 2C19A 5K9CA 3EWYA 3VCRA 5CSRA 1W3TA 1OK4A 5K4ZA 3HF3A 3NQ2A 3W1LA 2VKZG 4UC5A 1DVJA 1ICSA 4N2YA 4LS1A 4LT9A 3S5OA 2TRSA 3TE9A 3NPXA 1SU5A 1UJPA 3NOEA 1G69A 4JX4A 1RZMA 2NV1A 3STEA 3QRHA 3STCA 2A21A 3O15A 4XKYB 3HGSA 5C55A 3B0PA 4K8EA 1XFBA 4H3DA 1VYSX 2GOUA 4A21A 5CZSA 2NUXA 1KM4A 4FNPA 3UWUA 4BWLC 1FWNA 3NPUA 5CG7A 4QISA 3C2VA 3W7JA 1SZFA 2YFOA 1Z41A 4UTMA 1F6PA 2DZVA 2NV2A 4XTIA 1P4CA 4GNJA 3NL6A 1THFD 4TMCA 4TO8A 3S42A 4A2RA 1R30A 3W2UA 3RMJA 4AF0B 3M7WA 3P74A 5G2HA 1UCWA 2VFGA 3ABQA 2QUUA 4JTIA 3C2EA 4G1KA 5HMSA 4DF1A 4N9EA 1EUAA 1GVQA 2QDHA 3R8RA 1R2RA 3SSJA 3CEPA 1JQXA 3LCXA 2Y7GA 1RPXA 3MP3A 5FF4A 5F2IA 1TO3A 1A5SA 1F2JA 1LYXA 1PHWA 1IGSA 3DGRA 3TFXA 1L6YA 1W1ZA 3W7MA 4X2RA 1FXPA 5EA9A 4A2SA 4NUWA 1EP1A 3W22A 2F7FA 2NXGA 3LOTA 5HJLA 1U5JA 2Y7DA 3W7CA 1F73A 2FPVA 1OFQA 1PCKA 5CGQA 1ZALA 2PE4A 2QF7A 2ZTKA 4O50A 2J9XA 4WJEA 2FLIA 1V7YA 2ZTJA 2E6FA 2EPHA 2GVJA 3W2MA 1AG1O 5G4EA 2RKXA 5DCBA 1PS9A 4Y6GA 1EUNA 1S3HA 2F84A 1GOXA 3M43A 1NFBA 2IQTA 3TCEA 5C5YA 4LC8A 3T4CA 2ATSA 4UTWC 4PC8A 1L9WA 3E9AA 1XBZA 1G67A 4TMBA 1QPOA 4OBTA 4UFKA 2QCCA 1EPXA 5LNRA 3A21A 4JTTA 2C14A 1VQTA 2VELA 3I65A 3W1AA 2TYSA 3W2LA 3DHFA 3OVPA 4ORMA 4ADSA 4M7TA 2QUVA 1UASA 1NVMA 5T26A 1D3GA 2HTMA 3D0CA 1YADA 1ZCOA 4POCA 3PG9A 3TH6A 3MYPA 3VE7A 4UCGA 2AQWA 1P0KA 1FWSA 3P82A 3UWWA 4U4MA 3HG2A 1SW3A 2Y7EA 1NEYA 4I9AA 4UTJA 1W5PA 1FCVA 1MZHA 3B06A 1MEWA 2V82A 3G8EA 1PV8A 1EIXA 2H6RA 4BR1A 3MI2A 1N7KA 3N9RA 3GDKA 4YL2A 2Q8LA 1KV5A 5G1YA 1XL9A 1QO2A 3KVKA 1FDZA 3LRMA 3P67A 4Y9AA 3A23A 3W86A 4QIUA 4FHAA 2NX1A 2E5BA 4O15A 5G5IA 2OCZA 3GDLA 4JTUA 2E77A 4IMEA 4NZJA 3KAOA 2X1TA 1R46A 2J9YA 5DY3A 2QCEA 5FF7A 3GB6A 4WY0A 1NAL1 4K37A 1SO4A 4FIRA 5I3KA 3LTPA 3LX9A 3FJ6A 1LRQA 1JULA 2B7QA 4S2CA 3S6DA 3JR2A 4XWUA 4MYAA 5HR6A 1WA3A 1H7NA 2EF9A 1TIMA 4LV9A 4CQAA 4QITA 2DZTA 1ZJIA 3W7PA 4AWTA 1KW1A 2X1SA 4BFAA 1O95A 3WK1A 1LROA 2E6AA 3W72A 2DZXA 2G95A 2Y88A 3S1UA 1R2SA 3MP4A 3LDVA 3E12A 3HPXA 3IRDA 3A5FA 1P5BA 3OHIA 4GUJA 3S1VA 1LORA 1KLYA 1OFPA 3B0UX 4JDBA 2XN1A 3EWUA 4O1BA 3ZWTA 4O8RA 4FO4A 4BI7A 1X8FA 1NF7A 3W7RA 3PB0A 3MI3A 2JKPA 4Z1DA 2FB2A 4WY0F 2PRMA 5LHEA 2OT1A 4UTKA 3TSDA 1MEHA 3CT7A 4RR4A 4PTNA 4UFLA 3M1ZA 1SZEA 1QPRA 3TC6A 4UFMA 4FX6M 4O12A 2R94A 3C2RA 3C61A 1G4PA 3PS7A 3WJYA 3HMJG 2E5DA 3E96A 5KZDA 2H90A 4JS3A 3R89A 2Y85A 4Y8FA 5CZJA 1H1ZA 2PCQA 4O16A 4WD0A 1DKWA 2P10A 3HJZA 1H61A 5L6UA 3BGGA 2J6XA 3NM3A 1HTIA 1KFEA 5LKYA 3W23A 4WY0B 1B3OA 4BK9A 3CWOX 3NG3A 1XDMA 3BARA 2V2CA 1TPUA 4I7WA 1G7VA 5EYWA 2I14A 3GAKA 1OK6A 3B0VC 4YWIA 4ZQCA 3LHYA 3UPWA 5KMYA 1DQXA 2QJIA 3IIOA 3QJAA 3LERA 3P81A 3EWZA 3F1QA 4TX9A 3UQNA 3HPSA 4LW7A 4LVFA 3S1WA 5HINA 4UR7A 4W9TA 5EBUA 3PC0A 3W83A 1WOBA 4OWGA 3TAOA 1KM5A 5DN1A 2CLHA 5AHMA 3L68A 3ZFHA 4EF8A 3KRZA 4PFMA 1UUOA 1H7OA 2RDWA 4M7SA 2WJZA 2KZHA 4IJBA 2PRHA 4K6AA 4JYFA 1OYBA 1GT8A 2WNQA 4UTTA 2ISVA 5D02A 4PEKA 4LS0A 3LCFA 1G6CA 3QZEA 4C1KA 1H7WA 4ORIA 3CM4A 3P60A 1YTKA 1K8YA 2X30A 2JKEA 1MXSA 4R33A 3UD6A 5D2VA 1SO3A 1Q6QA 4IPIA 1OG0A 4JTLA 2VEIA 3W2NA 1I2NA 4TR9A 3W2KA 3O16A 3ZR4A 5AN7A 2JKAA 4R34A 4X22A 3FKRA 4GE8A 3MWAA 4LVGA 3DFSA 3LGEA 1S5VA 2FB3A 4RK8A 3LCLA 3NQAA 3WJXA 3BVJA 1SO6A 1ZAIA 1LOQA 3L5MA 1TRIA 1G4SA 4Z1AA 4NT0A 1JVNA 2TPSA 4U28A 4AAJA 1VRDA 3LV6A 3VI2A 3PUOA 1H62A 4E2BA 1GYLA 4JX5A 1KBIA 3IGUA 5AHLA 6TIMA 1JRCA 5D2XA 3QW3A 4O10A 1PHQA 2ZRVA 1IIHA 1XBYA 3CTLA 1VYPX 4AEOA 3WJWA 4N02A 2X2GA 4WQ6A 3SJ3A 1FY6A 4ZQPA 4Z08A 4OT7A 2AAMA 1F05A 4ONVA 3GIYA 5LNVA 4YMZA 3JS3A 4HNVA 1C29A 1H7RA 1VHNA 3G0XA 2ISSA 4JXCA 4UR8A 3W2JA 3IVUA 3TU9A 4DBDA 1JUEA 4O0KA 3OEXA 3SGZA 1TPDA 4Q32A 3U6WA 1IF2A 4DBEA 3UWQA 3MBFA 3I68A 1B4KA 3MHGA 3WK2A 3RLVA 5CPLA 4JTGA 3IGXA 3EX1A 2DJXA 4IXXA 3GR8A 4KFOA 1H7XA 1I8JA 2VXNA 3CB8A 4N6EA 1K8ZA 3LHUA 3WFAA 3HG5A 4DO4A 2RH9A 4ZQNA 5AHIA 1SQ7A 1TTQA 3A5VA 3EX6A 1AL8A 4LNYA 1H1YA 4MY9A 3UXAA 1A5CA 2Z0IA 2QCFA 1XDLA 2GVGA 2CLMA 1GJPA 3QPZA 3VFLA 4YLWA 1O4UA 1RV8A 2NLIA 3G1FA 2GQ8A 3E02A 2FTPA 2QAPA 3CQ0A 5LSMA 2VOMA 5I3GA 3CHVA 3NQDA 3CEUA 3STGA 2CZFA 4O19A 4RJEA 3UZJA 1JUKA 5J5DA 1HO4A 1YPFA 3CWNA 4MUZA 3G1SA 2ZRYA 1YTDA 4JIQA 3SI9A 4MVAA 3P7YA 1TTJA 1Y0EA 2E6YA 2ZRXA 4I7UA 3B03A 1I4NA 1PE1A 3L0GA 3GVGA 1ALDA 3NXFA 4KKXA 2VFFA 3C2OA 3B04A 4DF0A 3TX9A 1YXYA 3VKJA 3W7LA 1K03A 5AC6A 3HPZA 3O6CA 1SR9A 5BMWA 4CCEA 4CNOA 1OYAA 2YW4A 3W87A 1QPQA 3W88A 3S8HA 1RQEA 3GNNA 1TV8A 3W1NA 3UY7A 2PC4A 3H53A 3O05A 3R2GA 3PUDA 1K7FA 5TIMA 3S0CA 3N34A 5D32A 2YSWA 3LXAA 2B4GA 4LVAA 2A4AA 3O6YX 2CZ5A 1GYNA 2EKCA 3M44A 5E93A 3EX2A 1FXQA 3M41A 3M5YA 4M5PA 5AHNA 1GTHA 3OIXA 1ZAJA 2E6DA 2C6QA 2NX9A 1XC4A 1K3UA 4UUIA 1DJNA 4AH7A 4PODA 4XBKA 1LRNA 2R8WA 1YTEA 3G18A 5SWUA 1IXNA 3LBMA 5CKSA 4UMAA 1DORA 4UTLA 1Q3NA 1QFEA 1OFDA 2VFHA 1TPH1 5K7JA 3HGRA 1QMLA 4JEQA 1K7XA 2XFWA 1F5ZA 4ALDA 1GG1A 3G1YA 2CWNA 5K9DA 5FEZA 2Y7FA 2ZZ3A 3GKAA 5H91A 2I1OA 4K39A 1LBLA 2YX0A 3BG9A 3FIGA 4O1CA 4BI5A 3QMSA 1KTBA 4RZ5A 2A6NA 4H6KA 1ADOA 2OJPA 4MIMA 5CZ0A 1HUVA 3LRKA 4RLIA 1LOLA 3RK8A 3QFEA 4HT3A 3FYOA 3N2MA 3W07A 5C2XA 3C6CA 3PSWA 3MUXA 4LY8A 1LCOA 1KBJA 1OFRA 5HULA 4WXZA 4J9JA 5H2ZA 3W6YA 3NVTA 2C0AA 4FIQA 2E68A 1LRTA 1BWLA 4JIPA 3MP5A 4MPQA 3EX3A 4I7VA 5D04C 2QCDB 4ZQMA 3W7DA 5KTLA 3HOJA 3BLFA 1YXDA 3R13A 2CLIA 2O7QA 5IBXC 2DZSA 2G96A 5D2YA 3W1QA 3C2FA 3TXVA 4O52A 3TMQA 5EL1A 2X1UA 3Q2DA 4JTEA 3KHJA 5DBTA 4MY1A 4NNAA 4NXSA 3NPWA 3A9IA 3STFA 4MFEA 2C18A 1W56A 1TSIA 1VYRA 3QF0A 1OHLA 3GDRA 4DPQA 3M5ZA 1Q45A 2CFFA 2V9DA 1W5NA 4EVZA 5KITA 1VGAA 3EXSA 4UTHA 1O5KA 4JTSA 5G1TA 3HBLA 2O7SA 5G4WA 5HWJA 2ZRUA 1ZNNA 2FFCA 3MI6A 4LUJA 2C13A 3NQ7A 4GRSA 3LB0A 1JCJA 1VPXA 1B4EA 3TQ0A 2RDTA 3IVTA 3N14A 3VNDA 4GUGA 4M6QA 1FCBA 3QQ0A 3IIXA 3LCHA 3DFNA 1SPQA 3FEMA 1E51A 2VFDA 1ZHAA 1A50A 4AHOA 3GZ3A 1X1OA 3G1DA 4GBUA 2EAWA 3RFAA 3PY2A 3SY5A 5F4SA 2HSAA 3NNTA 1I2QA 3N3MA 3NL5A 2OMAA 3A24A 1YLVA 1KFKA 4FXRA 3QMRA 2VENA 5AYZA 3EB2A 5AC8A 1GPWA 1Q6LA 5AYYA 4RZ4A 3W7OA 3BG3A 4HPJA 3QPYA 1GQNA 3L67A 3UZ5A 3LHTA 1LOSA 3S5NA 1ONRA 1HG3A 4KWWA 4FNSA 2QCNA 1LLWA 1TCDA 2XN2A 4BF9A 3HGOA 4NU7A 3W1MA 4XTDA 1GTEA 3KOFA 3I6RA 1IIGA 5IM51 3PBUA 4MZ8A 1QDSA 4E38A 1OFBA 1EA0A 3TC7A 1FCUA 5DLCA 5CSSA 2VFEA 4AB4A 4MLJA 1SSDA 4NVTA 1KA9F 3LHVA 1EP3A 4JTHA 1XCFA 4NXKA 4EWND 5HUOA 3TR2A 5G2WA 3HG3A 2J24A 1RQBA 4NZFA 2WO5A 3TJXA 2ZDRA 5AHFA 5AOUA 4O1DA 3Q58A 3NYZA 4IX2A 4D2JA 4FEZA 1LTDA 1X7FA 2YYTA 1IXPA 1OABA 2DORA 5LNUA 1K02A 3G0UA 5F2MA 4HNTA 1P1XA 2A7PA 1VCFA 3OG3A 2BWGA 3W84A 4WXYA 4Z0SA 3BW3A 2AGKA 3KVMA 5LHFA 1GVOA 2QCGA 3IIPA 4AMAA 1VLWA 3B8DA 2GJLA 1AW1A 2WSRA 3T44A 2QKFA 4JTJA 3YPIA 3EEGA 4UNLA 1QR7A 3LXCA 3W7NA 3W3OA 3NL3A 5FESA 1W5OA 1KM1A 3R5EA 3MO7A 3P5YA 4AXKA 3QYQA 1H50A 1G7UA 4N9DA 1QPNA 1EWDA 4Z1BA 3U8GA 4QNEA 1X1ZA 2H8XA 3LXBA 4FNQA 4EIVA 1SW7A 3LBCA 1UUMA 5I3FA 1XM3A 2P0OA 3E49A 3TA6A 3LHWA 3EWWA 3WJZA 3W7QA 1TPVA 4XQ6A 1GZGA 2P1FA 4N9CA 3KXQA 2W6RA 3NQGA 3PAJA 3FJLA 2C16A 4RXGA 1JCXA 3BG5A 3KRUA 2G5WA 1VH7A 3BO9A 1JCNA 3NQEA 1O94A 5DBUA 4M19A 3BK0A 1LBFA 2GUUA 3FLUA 1GG0A 4L4MA 1OYCA 3L2IA 4A3UA 4JY9A 4UXDA 4P61A 4HN4A 2VEPA 1KTNA 1K8XA 4N4PA 2Y70A 3ABOA 2FQIA 4MJMA 4Z0JA 4DQWA 2NWSA 2YW3A 4GXMA 1XXXA 3LCGA 2BSLA 4IGHA 1JQVA 1GVRA 5TBOA 4JY8A 3W76A 1ZAHA 1D9EA 3THQA 2A7NA 5DXYA 2X1RA 2Y61A 3DFOA 3RF9A 5F4WA 3G22A 1WQ5A 1A5BA 3LLFA 1QO5A 4IMCA 5A5WA 4X3ZA 3NR0A 1DV7A 3P80A 4O11A 2BX7A 3DENA 3S5YA 3N19B 4O0ZA 5HQEA 2EGZA 4NQ1A 4LRTA 3THAA 3DH7A 3PBWA 3IIZA 3OBKA 1I45A 2WNZA 4IWWA 2A1YA 2OT0A 4HNNA 4JTKA 3NQCA 1WBHA 4MY8A 8TIMA 5EMUA 1SFLA 2B7OA 4JYDA 2FDSA 2GPTA 3W73A 1KLZA 1FWRA 2ZQ0A 1WAUA 4KFNA 3BPWA 1QCWA 3O6DA 1S5WA 3DU0A 3AJXA 1LP6A 1T96A 1XUUA 4UIOA 1TQJA 4CQ9A 5LNSA 1YDOA 4PL2A 3LLDA 5HWNA 5D33A 3C0JA 4YCOA 4CNNA 3LV5A 2QR6A 2ALDA 1KFLA 3PG8A 2V5LA 4JICA 1U83A 3IGSA 5LZLA 4GWEA 2I9EA 2CLKA 4WUIA 3BLIA 4PCFA 1DQWA 3NPVA 4S2BA 3GNDA 4M6VA 1XI3A 1TPFA 2B0MA 3KRSA 2ZRWA 1ME7A 3P8JA 1WXJA 3CLMA 2E1DA 3NQFA 2ATMA 2YXGA 4QM1A 2Z2UA 5DELA 1TMHA 2QJHA 2PRLA 4IX0A 4BWLA 3DHDA 3NQ6A 1QWGA 2BZNA 5D05A 2A85A 4CCCA 1I2OA 3M0ZA 1QNVA 3BW2A 3W75A 2YYUA 2DZWA 1HO1A 2V2DA 4UFIA 4R7JA 4NNCA 4GC4A 4RKAA 1LLZA 1QOQA 3NGJA 2NWRA 3GAYA 4HKPA 4ZVJA 1JCLA 3UY8A 4XZ9A 1ME8A 1GVFA 2GQAA 4ICNA 4IMDA 4OV4A 2XN0A
chains in the Genus database with same CATH superfamily
1P0NA 3IIVA 4OJYA 1BVZA 2YGYA 4WF7A 7TIMA 2FTWA 1GOWA 4ML9A 2ZX6A 4BHYA 3LQGA 3TJLA 4QJ3B 5AHEA 4W5UA 1VKFA 3QW4B 2CLFA 3W4RA 3LA4A 2DSUA 3GHUA 4QQ3A 3T0BA 5DY2A 4RE3A 3LNMA 1W1VA 2OLHA 1AW5A 1WDRA 2CW6A 2BGNE 3B8UA 4PULA 1TJRA 1UOZA 5HXMA 1KV8A 4AVOA 4DO6A 1NTHA 4A3HA 3OVQA 5AY7A 3PPGA 2F2KA 1C9DA 3OA3A 1SW0A 4XD5A 1XKYA 4ZZ9A 1PCWA 3Q94A 1H1NA 2C7FA 5BW6A 3H12A 2E40A 4A05A 4LGXA 2ZIDA 1E55A 4XG1A 4HTBA 1TQXA 2CBVA 2UWFA 2HBXA 3LLXA 4BQ3A 3HQNA 3SCWA 5AC7A 3MVIA 5FSEC 1XLAA 3CWHA 3P0XA 3V7PA 1H7PA 5CGTA 1W3IA 1U30A 4H04A 2AOSA 4S1FA 1PL9A 2UZ9A 3QTPA 3O7UA 3B9EA 4FX7A 5EMMA 1QOXA 3EXTA 4B91A 5D09A 2ZZ7A 1OX5A 3L7RA 3L66A 4M6PA 5HPOA 3SUTA 4TIMA 1LJYA 3DUGA 4N4QA 3P5ZA 3FOKA 4NJJA 3USZA 2V30A 2CNCA 2VFIA 3MS8A 1W5QA 3ABXA 3F03K 1IZCA 3F4VA 2QUMA 4ES4A 3WSUA 3DFTA 1MEIA 3MC5A 2V5DA 2WKLA 2BVYA 3GXPA 4HOZA 1S5TA 2PD5A 3PULA 2VX5A 4DBWA 6ENLA 1OCQA 2GZXA 3LI1A 4RPPA 3O1NA 2YA0A 1LZOA 3Q65A 1XCXA 2IPJA 2QLYA 4C1NA 2PA6A 3W1TA 3UYCA 1ZY9A 4GVGA 4XSLA 2YDRA 3FNDA 4S3JA 4HU3A 1SJDA 5HAOA 1TB3A 2PLKA 3LCWA 3TONA 2HV5A 1QXLA 1GKRA 1KFJA 4AXNA 2WOQA 1QOPA 4OBRA 2OG9A 1E0VA 4K7YA 1GOIA 1RD5A 1PX4A 1DWAM 4PCPA 4ZA0A 1HGYA 2DZPA 4PCNA 1TV7A 2J7CA 2ALRA 2WVTA 1PX3A 4RDZA 4H8HA 1M1BA 4MLRA 3GFYA 3SSZA 4EPKA 3G3MA 3MMDA 1UWUA 3I7QA 4CQ8A 1A49A 3CQJA 1WDSA 2UV8G 3GXNA 3T1GA 1RQHA 1LWHA 4AWUA 2QUNA 2EG7A 1KKRA 2E9BA 3ZJKA 2JK2A 4E2OA 4AZIA 1KGXA 1R47A 1WDQA 2E09A 4JKMA 1J01A 4N0RA 4HA3A 3AS1A 5EPDA 3NO5A 1KWGA 1HKVA 1PIIA 1DTUA 4LUTB 1WKYA 3R0DA 3LUTA 2ZCGA 1KM3A 2EEXA 2V2HA 2VR2A 4EK7A 3WD2A 1WXZA 4L7ZA 4L4LA 1GPFA 1VJIA 4KWVA 3DFHA 1DP0A 4U2YA 2FIQA 1AJ2A 1F9CA 3KOZA 3KLKA 1I2PA 2XFYA 4J3TA 1Z9AA 3KZPA 3UXLA 5A3HA 3UJ2A 1A3HA 4HSNA 1MXGA 3L12A 1NDYA 2O92A 3W7GA 4NAEB 1FBAA 3GU9A 1E6XM 1VBJA 1KO0A 4LTSA 3BGJA 1EB3A 3PNZA 3V75A 1JYNA 2OLSA 1V6UA 2P3EA 2NX3A 3KS5A 1F6YA 4P2VA 2DJLA 1JPMA 2PPGA 3GYEA 4GJIA 3SFWA 1SVDA 1X6NA 3R12A 2ZX9A 2Q8XA 1IZJA 4KGLA 2PGEA 3FXGA 3G3DA 3APYA 1KXHA 3D3FA 4Q6JA 2QJGA 3ELFA 2PDLA 1LBMA 4GYKA 4F0SA 3SN1A 1WDWA 1WV2A 1VBGA 1CXIA 3OZMA 1XJBA 4PCTA 2H9AB 4NF7A 3S1XA 4K36A 2QCMA 2WVVA 4HHMA 3RLUA 3QC3A 4NJHA 4O57A 1B9BA 1F6KA 4GIRA 1XIGA 3QTGA 1O5RA 3NAVA 1JXKA 3A3HA 1UR0A 3B40A 3VNZA 1VFLA 3ITVA 1POKA 3G8RA 2PWUA 2C71A 3DYPA 5TF0A 4KFPA 2PWHA 3W85A 3AIQA 4WZHA 1T41A 3BE7A 3GG1A 2DFAA 3W70A 1KBBA 5K2ZA 4LS2A 3FA5A 2NXIA 1VFUA 3K13A 4P5UA 5FEXA 4HP5A 3UXIA 2WVUA 4AC7C 1O5XA 3UWZA 3TTQA 3VZYA 3DXIA 4ICMA 1JCYA 4WKHA 4J2MA 4B5NA 4OV9A 3OHMB 4R9OA 1GKPA 3SCQA 2IKIA 1SFJA 4DWSC 3NQ8A 5I3IA 4GUHA 3U5YA 1VBUA 3DKJA 2VEKA 3E0FA 3EPNA 1UKQA 2CLEA 2DIJA 5REQA 2V0TA 1GQKA 4NSBA 3TN5A 4DN1A 3PBMA 1EJVC 3RX4A 4HNUA 3JRKA 2YBUA 2HE8A 2Q3RA 3WMSA 2V81A 1BSLA 2FKPA 4HIBA 4V1XA 1GQIA 3ZYZA 1HZYA 4O4WA 4ZOEA 1SJBA 3Q67A 5F1UA 3KUMA 3GUGA 1V3JA 1H51A 4G5DA 4JQ2A 4NL1A 1V93A 4DYEA 3UJEA 4GI9A 1XG3A 3GG7A 2ZADA 2E3ZA 5C7VA 1Q6OA 4F2TA 3DN5A 2HS6A 3C3UA 3IJ8A 1JZ4A 2Z6JA 1EJTC 3G1VA 4MFDA 1ZGDA 4F8XA 3MDUA 3LN3A 5I78A 3VZZA 3VX0A 3PPFA 3D3AA 4DF2A 5BNKA 4YHEA 5LGZA 1J96A 3LG3A 2ZZ4A 1FCQA 5F2LA 4Z2GA 4MZYA 4NJGA 3GY1A 4C6FA 3H8AA 4HSOA 3VCNA 1C7SA 2O4QA 2PWGA 3TYBA 1A5LC 3MPGA 3PANA 1PDZA 2INEA 5M2FX 4LC6A 2BV9A 1K7EA 1E6NA 1Z89A 3W1PA 1UWSA 3LRLA 1CTNA 2YDQA 1EEPA 3UCDA 1DOSA 3ID7A 5CQ1A 1Z44A 4TVDA 1D3HA 5A6KA 1JD9A 3P62A 4HZ7A 3VAVA 3SIMA 4Z17A 4CNPA 5DCDA 1WNOA 4QTGA 4JQ4A 1R3SA 4XV0A 1IXOA 1CW2A 3G1HA 3QHNA 3EPOA 5CGMA 4XAZA 1OM0A 3C52A 3I7RA 1V7AA 2QZRA 4TU1A 1WYIA 2B7PA 1ISZA 3WNLA 1X97A 1Z48A 2ZA2A 3QH2A 4H9ZA 4DJED 3DX5A 1DE5A 3GIPA 3E0VA 1L6SA 3UJSA 1LWIA 1KD0A 4AF0A 1SMAA 1VFMA 1D8CA 3Q37A 2XVPA 3CMGA 3GX9A 4GZJA 3NQMA 3PZTA 1EWEA 3WN6A 4MZ1A 4DJDD 4IP7A 2IPWA 1BWKA 4GJ1A 1NWUA 1J6OA 3ZS4A 3LSCA 1E9ZB 2ZA3A 2WKJA 5A6LA 3UG8A 2LLEA 1QNOA 3CV1A 3PB2A 3TSBA 2CLLA 2BFGA 3BLOA 4B5SA 4TXEA 5CPQA 4DLFA 3FHAA 4IPJA 4DPPA 1WO2A 3V1PA 4R88A 4WJXA 4ZL1A 4FLSA 3WBEA 3O6AA 2PAJA 3W1RA 1UHVA 3ZQ9A 3GVWA 4IIGA 4UB9A 5E9AA 4CD5A 3VCRA 3VX1A 3NQ2A 4E5TA 4N2YA 2X0YA 4LT9A 3S5OA 2TRSA 4X60A 1Q5MA 2POTA 1UJPA 4PTWA 5CSUA 4L5ZA 2NV1A 3STCA 3O15A 3T0TA 5C55A 1HXJA 3EOLA 5GJMA 3CNYA 1VYSX 4OOUA 2GOUA 4A21A 2NUXA 1NQKA 4FNPA 3UWUA 2OQYA 3NPUA 4HHLA 4FXJA 4IJRA 2J8FA 4UQ9A 1Z41A 3OLIA 2BXYA 4XTIA 3NL6A 3IS4A 3WNMA 4AISA 3W2UA 2CESA 2PZ0A 1EIBA 4C6DA 4XZWA 2AL2A 3J7HA 3M7WA 5G2HA 2VFGA 1RA0A 1GOQA 1TUFA 4LH8A 4GD0A 3QY7A 4PUWA 4AU0A 5A8OA 1E6ZA 1Q66A 4R85A 4G1KA 5HMSA 1ESWA 3WH7A 1EUAA 1S1PA 3JVAA 3ITYA 3LMZA 1R2RA 4PUMA 2PDUA 3CEPA 1RPXA 3KTSA 3MP3A 2ICSA 3LGDA 1Q4WA 3H2FA 1EOMA 4Q8TA 4AW7A 5D9PA 3DGRA 5E70A 3W7MA 4L4OA 2A3AA 1FH7A 4B4FA 3W22A 2OEMA 2NXGA 1LG2A 2NQJA 3K2GA 3W7CA 3ARSA 2R82A 2PE4A 3THUA 3KBJA 1EF3A 2ZTKA 2J9XA 3AUJA 2FZMA 5T8GA 3K46A 4MDOA 2EKGA 4CN6A 1NWTA 3VIPA 1SR0A 4DXKA 1S3HA 4RV3A 4LJ3A 3TCEA 4LC8A 1L9WA 4E4UA 4K2SA 3CO4A 4JTTA 3W1AA 4GQGA 4NRRA 3DHFA 3MSYA 1PBGA 4ADSA 4JIEA 4M7TA 4BF5A 3V18A 1UBPC 1YMYA 1TR1A 3ARPA 2HTMA 2O9PA 3D0CA 2VC7A 4P7RA 3VPLA 3MYPA 3ARZA 4L9XA 4BQ2A 3W38A 2F6UA 4PUDA 1VD6A 3P82A 2CXGA 2XWDA 3I4EA 1SW3A 2Y7EA 1NEYA 4I9AA 3G8EA 2H6RA 4BR1A 3MI2A 1N7KA 4CD7A 4YL2A 1P1MA 4GO8A 3WD3A 2WNWA 2HJPA 5D9NA 3ZSTA 2CHNA 4FHAA 1RJRA 1RHCA 2NX1A 2Z00A 2OCZA 3GDLA 5ABEA 2E77A 4NZJA 1IEQA 1QNQA 3GYCA 3H23A 5FF7A 1NAL1 1WZLA 3LTPA 1LRQA 2VDIA 4LAZA 2B7QA 4GINA 2P50A 3BH4A 2OYKA 1TE6A 1A80A 2JEQA 4AZGA 3HFTA 3MUY1 2DW6A 1L2QA 3T0AA 2B31A 2UY2A 1E6RA 2DGAA 1ZJIA 3UG3A 1XLLA 1MRQA 4S3DA 2NVCA 1LROA 4CU8A 1BXNA 2DT3A 3VKKA 4QBXA 3RITA 1ECQA 4KEMA 4FOJA 2EBNA 4RW5A 5LYRA 1XS2A 3WX7A 4KQNA 4GUJA 4Q4PA 3RHGA 3SUVA 4IQDA 5XIAA 3EWUA 2ZXAA 4O1BA 2WAGA 3UCQA 4HD5A 4BI7A 3W7RA 4MB3A 3S1GA 2PLMA 4Q7NA 1CEOA 4LANA 1C8QA 4UTKA 3FDGA 2IPFA 4Q4MA 1PAMA 2WCGA 2NLYA 1MEHA 1XINA 1NWRA 4GBDA 1RCXB 3W25A 3A3WA 4HCHA 4AZCA 4S3AA 3QV9A 4O12A 1YDYA 2HCVA 2XFRA 2PZNA 3IANA 5ABFB 1G4PA 3UW6A 5JBEA 1OC7A 4GQRA 3RAOA 2R1PA 2ON3A 4JS3A 4GYFA 4IICA 5CZJA 2VX6A 2PCQA 2G3FA 2RJGA 4WD0A 5JXQA 3BANA 2P10A 3B3DA 4I8YA 5C7HA 2J6XA 1WZMA 3PJUA 1KFEA 1B3OA 1MI3A 4BK9A 1FFRA 3CWOX 1FWJC 1FRBA 3ECQA 5A8PA 2V2CA 1G7VA 2I14A 2XFFA 3CMJA 4GI6A 3AU2A 3LERA 3N6QA 3VNIA 3HPSA 3ITCA 4LVFA 3IK4A 1BXBA 1ONWA 4NYYA 1R3WA 2R1MA 3BQ6A 2GLKA 4PFMA 3HU7A 1H7OA 4RNHA 1EQPA 4M7SA 1GT8A 1E4IA 2EPLX 5D02A 4IFOA 1PZ1A 4DUXA 4EPDC 1UWAA 2B81A 1QPKA 4PTMA 1Q6GA 1K8YA 5JMUA 2JKEA 1TWDA 4INFA 1RLDA 1UPMB 1OG0A 2XIOA 4H41A 1W3LA 2ANUA 3W2NA 4F0MA 4GOAA 1MVYA 2INFA 2JKAA 3B9NA 3FKRA 4LX4A 4FOKA 1TVNA 3R79A 3LGEA 2BP1A 4AZBA 1E6QM 1GHSA 2PLJA 4Q4RA 3NQAA 1CIUA 3ZLGA 1SO6A 1ZAIA 4H83A 1GW1A 2INZA 3L5MA 3UF9A 1E5NA 1XLDA 4EACA 1JVNA 2TPSA 4U28A 3MCNA 3R11A 1HKKA 3AYRA 3IGUA 2XPKA 3TTEA 1JRCA 2ZVIA 4GH3A 5D2XA 3QW3A 4O10A 3CAWA 3N2BA 2ZRVA 3VGHA 4AEOA 4H7VA 2VYOA 1ITUA 3SJ3A 4EX4A 2AAMA 2GGEA 5C9UA 3PJXA 1F05A 2X40A 3G0XA 4XZBA 1XH1A 4JXCA 1H41A 4TOQA 5CLWA 3IVUA 2VWSA 1JUEA 3OEXA 3SGZA 4Q32A 1F3EA 4H2CA 1XW8A 3UWQA 2G37A 3MHGA 4PB3A 1WE5A 4MNKA 4KFOA 4DI8A 4DO4A 2J8GA 2RH9A 1SQ7A 3EX6A 1AL8A 3AIVA 1ODZA 2ACRA 4AWEA 2HEJA 4MY9A 3SRFA 4GVHA 4PMJA 4YLWA 1V3IA 1VFFA 4MGGA 4PTVA 4ZFCA 4V15A 1J0KA 5LSMA 3NQDA 3CEUA 3NZGA 5D4YA 4RJEA 2QVNA 1EZ2A 4G1NA 3PZQA 2CERA 2ZUUA 2ZRYA 2ZX7A 3P7YA 2Z1VA 1TTJA 1Y0EA 4JHMA 4RE4A 1QJWA 4JZ5A 3VTRA 3TC3A 4RDVA 1M9HA 4HHHA 1ALDA 3AOFA 3RO6A 2XSXA 1HQTA 2VFFA 1UKTA 2P53A 3TX9A 1UR9A 2EPMX 4NI8A 3MVTA 5AC6A 3RG6A 4UQCA 2W4XA 4ZODA 2W61A 2CHRA 3WNPA 1OCJA 4CNOA 3RIKA 2YA2A 4CEUC 3DC0A 1FFQA 3VC5A 1V8EA 2O9TA 3UY7A 1XICA 3H53A 1PSCA 4PMVA 1K7FA 5TIMA 3S2LA 3LXAA 5IDZA 2B4GA 1QHZA 2GK1A 2A4AA 2EPNA 2CZ5A 3IRSA 3OZPA 3VUPA 1UIPA 4ROQA 3SCSA 1A4MA 2FZ8A 1D8WA 3M5YA 4JKLA 1LQ0A 1UC5A 1GKQA 2C6QA 2DT1A 1XC4A 3QZAA 3FA3A 3URBA 4UUIA 1E5JA 1VENA 2FJUB 1B3VA 1FWAC 1LRNA 4XIAA 1YTEA 4DJEC 2X0HA 3G18A 4IGMA 5SWUA 3MKVA 3OODA 3V36A 3PZOA 4GKTA 4UMAA 5HATA 2GDQA 1OB0A 1Q3NA 1QFEA 4MADA 2WJFA 1CENA 1F5ZA 1TE1A 4ALDA 4DJDC 3OBEA 2X7VA 1VB9A 3VCCA 3NGFA 2Y7FA 2I1OA 2E4TA 4K39A 4C6OA 1LBLA 3BG9A 2BY1A 4LCSA 3OLEA 3QMSA 1M3UA 4LCRA 2WZEA 1A47A 2VCAA 4M82A 3TTOA 1FVPA 4H6KA 1ADOA 5A2BA 3MQTA 1ZRQA 3SB0A 5CZ0A 2FGBA 1R3QA 3DC8A 3D47A 3RK8A 1AVAA 3FYOA 3N2MA 4LCQA 1KBJA 4DLMA 3M07A 3RX2A 4W8BA 4EANA 5H2ZA 3W6YA 3GUWA 4XZNX 4C7GA 3NVTA 2W27A 3F2CA 4FIQA 1C90A 1TVPA 4BA0A 1LRTA 4JIPA 4A6GA 4I7VA 2QCDB 5KTLA 3BLFA 2O7QA 2DZSA 5D2YA 3W1QA 4V1YA 1R3TA 3ARWA 3CJPA 4IF2A 2VZSA 3KHJA 5DBTA 1L6GA 2OWXA 3A4XA 1R86A 2HK1A 2X1IA 1KXQA 4HZMA 1VYRA 1XLCA 5PTDA 3GDRA 1IT0A 1UA3A 1Q45A 4JTCA 1VGAA 4MHBA 3VNLA 5HJYA 3DBNA 2XIBA 1BQCA 4L9ZA 3HBLA 1M68A 5I7GA 3MI6A 3NQ7A 4GRSA 1JCJA 1VPXA 4AFYA 4D6DA 3SY1A 2J7GA 2GSJA 4YU1A 1V3KA 1V6TA 3DFNA 1ZHAA 1A50A 4AHOA 4GBUA 4PE8A 2EAWA 4LAUA 5ABHA 1MNSA 3NNTA 1LUCA 3GHTA 9XIAA 1RY0A 2WJDA 1KFKA 1FTXA 4ZB2A 5I77A 4V2XA 2PI6A 1GQNA 1CXHA 3UZ5A 1A0CA 3QGKC 3UERA 1HG3A 4FNSA 4NZ1A 2OSWA 2JQXA 1EJXC 4BF9A 1P7TB 3WL0A 1AQMA 1GTEA 3WH8A 4GVIA 3WBXA 1OFBA 1T7LA 5CSSA 4AB4A 4MLJA 4NVTA 3EMQA 3H7UA 1K6WA 4A3RA 3AWNA 1RQBA 2ODOA 1XRFA 3TJXA 5AHFA 5AOUA 1C8YA 2QDDA 1X7FA 3TP4A 4ERAA 2JEPA 1IXPA 4MKSA 1KCKA 2DORA 3N12A 4LBSA 3KDNA 5F2MA 4NRSA 4HNTA 2WSPA 1CECA 1P1XA 2A7PA 3IJDA 3OU8A 3TYCA 1Z32X 4WGXA 3KLLA 4YVXA 3BW3A 3KVMA 1GVOA 2QCGA 1VLWA 1AW1A 2E28A 2V67A 3T44A 2QKFA 3YPIA 3W7NA 3ZO9A 3ICJA 3MO7A 4AXKA 1V3LA 1JFHA 5AYIA 4WKFA 2OELA 4N9DA 4HNCA 1EWDA 2NVAA 2GGIA 4Z1BA 1X1ZA 4QS5A 3FGCB 3AS0A 3VGEA 3LMYA 4TVUA 1WKEA 1FWCC 3LHWA 3AMCA 3WJZA 1TPVA 1R8LA 2OSXA 2PLCA 1O12A 4XQ6A 3WLLA 5EMYA 1P0DA 2P1FA 2QIIA 3NQGA 3D46A 3KRUA 2G5WA 3TTYA 3BO9A 1HT6A 2XSAA 1GYMA 2WW5A 1CZ1A 1G5AA 2GUUA 4Q4QA 4L4MA 3KBSA 4JY9A 2Z28A 4N7QA 3PTMA 1OQFA 4N4PA 3BJFA 3ABOA 2FQIA 4MJMA 4XK2A 1H49A 1UJQA 1EKOA 4E6MA 5IRPA 1EJWC 1DXFA 3N11A 1S1RA 3W76A 2HXUA 3CTTA 1D9EA 3THQA 2A7NA 3OB8A 5DXYA 3DFOA 3WF4A 3G22A 1WQ5A 1FOBA 5DMYA 5HQEA 5JBDA 4LQ1A 4XX6A 4C5YA 4YTTA 4IWWA 2OT0A 4JTKA 2VT0A 5BXPA 2B7OA 3L4YA 2FDSA 2OGJA 1KLZA 3AHXA 1WAUA 1DE6A 3M0IA 1WUFA 3BPWA 3BSMA 2W66A 4RNJA 4JL1A 2ESCA 2BNJA 1T96A 4PMOA 3DEQA 3TYUA 3N18A 3BWWA 5LNSA 1YDOA 4JTQA 5D33A 3C0JA 4HJFA 1DHKA 4LUSB 1U83A 3R10A 4WUIA 4DJFD 1V0MA 3U2EA 4O8AA 3NPVA 3WQ5A 4M6VA 3SADA 1W6TA 4NAFB 2A3LA 3POCA 3N6HA 4YTQA 2Y2WA 2QJHA 1V0LA 3WDJA 3ITOA 4EP8C 3RLHA 4QDMA 5D05A 2VZUA 3M0ZA 3W75A 2YYUA 1HO1A 1RALA 1PTGA 1G9HA 4R7JA 2XH2A 5A6BA 4NNCA 3D5HA 1LLZA 1UD8A 1I0BA 3GAYA 1JCLA 1Y7VA 3MB9A 4ICNA 1GVFA 2GQAA 4YVVA 2XN0A 1K6AA 1PXGA 1E43A 3E38A 3KBVA 3P61A 1QW7A 2OGYA 4UQAA 5CPMA 4F4RA 5CJ5A 2JBMA 4ROPA 4J2PA 1CXLA 4GKLA 3ATYA 4OE7A 3U4AA 1DBTA 4CU6A 3LD5A 3REQA 1TREA 3N4EA 2V3GA 1TPB1 4I8DA 3THDA 5GVJA 1QTWA 3QOKA 1S46A 4GYJA 2CZEA 4QGCA 4IG2B 4DB7A 2ZC1A 3KX6A 3MSGA 1HL9A 1WXYA 1ITXA 1WZAA 4Q8VA 1TPWA 2GVLA 1TELA 1R85A 2XISA 3SRDA 4AZ7A 3HQ1A 2EJ1A 3LPFA 4P8XA 4UTTC 1BF2A 1A5OC 2ZRZA 3CZGA 4XUGA 3GS6A 2GSHA 1ZL1A 3VE9A 4HU0A 4CLMA 2A0NA 2G97A 3EOSA 5ECUA 4HU8A 4AIEA 2BXVA 4HU4A 1FKWA 2BS9A 2QV5A 2NQLA 1QWKA 2OFJA 1B31A 3BICA 2WBGA 3CV2A 2WCSA 1NOUA 3C0SA 5KSWA 5C9WA 5I3JA 3MZ2A 4BEUA 3TN4A 1PZ2A 1AK5A 4BS0A 2WMFA 1BVNP 1CB2A 4ZMGA 1U22A 1VJSA 1M7PA 3PZIA 4QSHA 5F1VA 2HBVA 2Z1XA 2W0UA 5AKQA 1XYFA 1M7JA 4CVWA 4B3LA 2HE5A 4Y90A 2A6LA 3LPOA 3WD0A 2J62A 5CPOA 1L2UA 3CAKA 3PBVA 2CZVA 3TIMA 3VOIA 8RUCA 3TA9A 3RPTA 4Z1YA 4ZOBA 3C2YA 1A0EA 4PCSA 3C8FA 4YTSA 3GQYA 3SUSA 1DEDA 2ZYFA 3S6TA 4IUOA 4GUIA 3UNDA 3SAZA 1F07A 5FJUA 1UR1A 1S5MA 1JF5A 2G3JA 3QEZA 3LY0A 1EO5A 3OLGA 4CCDA 1AD1A 1US3A 4R53A 3TW9A 4KCVA 4C6BA 3WJSA 3LM7A 1VCVA 5M5DA 1WBJA 1JDFA 1T0OA 1LF1A 2WSQA 4WOQA 3AQUA 4WOZA 2WNNA 2PMQA 4ATLA 3QN3A 3C3NA 5KZMA 3W0KA 3OW1A 4UFHA 5CPTA 3I6TA 3DFPA 3T78A 1N82A 3F7JA 5A8NA 2ZUVA 3AAMA 2ZDSA 5CZTA 3EXRA 2BMBA 1K4HA 2QMKA 3OZYA 1T99A 1UZDA 1BYCA 4XISA 1HKMA 4PMRA 1KM2A 3AMKA 3NL2A 5KINA 2O56A 3M5XA 5ABTA 4WLCA 3CASA 4ICCX 1Y5WA 1E4MM 3PF3A 4L1XA 4C90A 5HK4A 3VD3A 3WQPA 2WC4A 1Z8AA 2VP8A 3BXWA 3TMLA 2ISWA 1AL7A 4C91A 3M6YA 3NUKA 1GONA 2Q8ZA 1F8MA 4PUKA 3KEHA 2Y8UA 5B7YA 1U33A 2BXZA 3TNOA 3W9ZA 2H8ZA 1AA1B 1G4TA 2FGZA 1YNPA 3AXXA 3AMLA 5AECA 4HTYA 3FAXA 3RCYA 3TCSA 4M56A 3CU2A 1HL2A 2VX7A 2YPIA 1UQZA 1JZ5A 4ZTXA 4LY4A 3F4DA 5TQLA 4FXSA 3L0KA 3FX4A 1RSCA 2BOEX 1RK5A 4FALA 3OPSA 4XAPA 3WQVA 2Z7KA 1ONEA 4Q8WA 4XBSA 2EXOA 5BRQA 5FL0A 2E1WA 5E0KA 3KTCA 1JXJA 4C1NB 5HPCA 3FSTA 5C6MA 1ZU8A 1NFGA 2V3DA 3UPBA 3GLCA 3BUVA 3DZ1A 3ANYA 3N9SA 2NSOA 9CGTA 1QHPA 3MUCA 1OX6A 3FK4A 1ZLPA 2W79A 3SRHA 5HNRA 1NQ6A 2WJEA 1TV2A 3UVAA 4PL1A 4F40A 1TWSA 3KZSA 1TG7A 5I5RA 3EEZA 3CUXA 1W37A 5BZAA 3PZNA 1CX9A 4GA8A 5EKYA 1MQPA 3AO0A 5K4XA 4H6QA 2V68A 4KESA 4NYUA 3IAPA 4JX6A 1W0MA 1AFSA 1NF0A 1EJUC 2Y0FA 2R14A 1GVSA 4ILSA 4LVBA 3VDCA 1SSGA 3PUEA 1G01A 1B9ZA 3UETA 4XO6A 3LI0A 4JTFA 1VLIA 4PMXA 3MJMA 1ZENA 2VGFA 3GDTA 5GPRA 1MMFA 2OKOA 3BMWA 3EDEA 2G4JA 1KQZA 1A5AA 2GDVA 1JNEA 3DFQA 2ZFAA 3CZJA 3DI0A 3COTA 1LWJA 3FJ4A 4JIRA 3RO8A 1JUBA 3NM1A 4J3XA 9RUBA 3GK0A 2DH2A 2BOFX 2J47A 4B5XA 2NSXA 2ABBA 1AZ2A 4JFWA 3PR2A 5LGXA 4AVFA 5U7SA 3HMCA 2XGZA 5MHBA 3LYEA 3NDOA 4R3UA 5AFDA 4I5RA 5FF2A 2C8NA 1OJXA 2ZXBA 4JR5A 5HJXA 5HR7A 3L0NA 3LTYA 4PYSA 3RPDA 3L9CA 4ZB0A 4LOCA 2VNCA 4KEUA 2Y63A 1QI0A 3UP8A 4GX8A 5A2AA 4HOXA 4Q4SA 3B9OA 2J27A 3A4JA 3QMTA 3AS3A 5D37A 4OGZA 3M64A 4DIAA 3I7SA 1QK2A 1GHRA 3WLHA 3WLNA 4IMFA 2Z7GA 3LZ5A 3A22A 4Y96A 2ZX8A 1UW9A 4UTIA 4F0KA 3LTSA 2B7NA 1Q85A 2ABAA 2FYMA 4MG4A 4DO7A 2CPUA 1UZHA 1X6UA 3NQVA 3NZRA 3CUIA 1XISA 4O53A 2A2IA 4RE0A 3FKKA 5B7ZA 1TPEA 4LBUA 2I16A 3EOUA 4X9YA 1TVLA 2PDBA 1DL3A 1VCGA 2YCJA 4UCFA 4LYRA 4OKDA 2WMKA 1PTDA 3TN6A 2TSYA 3W74A 1XYAA 2FPTA 2C3ZA 3RM9A 4UR9A 2WB5A 3MMTA 3DFYA 4NNBA 2VMFA 4JD4A 5F2GA 2UY4A 4AC1X 1WX0A 2HROA 2QEZA 2Y1HA 3M47A 4DZIA 1KBKA 3AHTA 3WF1A 2OU4A 1B0IA 3T40A 4OU1A 3NO3A 4MWAC 5REQB 4HPGA 3LCIA 2X42A 2GVYA 4Z1CA 2CCRA 3CUZA 1EBHA 4MSSA 5H8MA 1S39A 3ZIZA 2PTYA 1FH9A 5KZ6A 3L65A 2QGHA 3IJQA 1HVXA 1JCMP 1YXCA 1Z42A 3C56A 3IJ6A 4TX8A 3VNYA 1G0CA 3RU6A 1TMLA 2H3BA 2XU2A 4KEVA 1EDTA 1YNYA 6A3HA 5C54A 2OX1A 3NWRA 4LVDA 2G50A 2FZBA 1XX1A 1HKJA 1UH2A 1OSEA 3I6EA 3QFWA 1XQKA 3M9YA 5HMEA 3FS2A 2ZKMX 4Q33A 4W84A 1UUQA 4GO9A 3K30A 1M04A 3P6LA 4J3SA 3NSMA 5GQBA 3GXTA 4IMGA 1Q6RA 4UMBA 3TKFA 1E72M 1EP2A 3SJNA 3L4ZA 3MBDA 4J4KA 2YKKA 3E0WA 2WLYA 3S9YA 3TAKA 2PDKA 3URQA 2EO7A 2VVSA 4IH3A 4XO7A 3W1UA 3R6IA 4PH6A 2ZUMA 1W54A 4DJFC 3QSTA 4WDUA 4D8LA 1S2UA 3PWAA 5IBXA 3STPA 3VIHA 4Q8PA 4RNFA 4PUUA 3O07A 4NY2A 5DO8A 1OFAA 2BASA 1PZ0A 2OYMA 2WBKA 2Z1BA 2C19A 5FL1A 3BMVA 3EWYA 4K68A 1OK4A 4Y8EA 5K4ZA 1QHOA 4UQBA 1DVJA 3DG6A 1ICSA 4G7EA 4W7VA 2EQDA 3V4BA 1PIFA 2FZNA 4JX4A 5CC3A 2X2YA 2A21A 1BG4A 3HGSA 3GG8A 4K8EA 1CBGA 5CG7A 1HJUA 1SZFA 3A64A 3PWIA 2DZVA 1THFD 4TMCA 1J9YA 4TO8A 2RAGA 2TODA 3PHAA 1R30A 1BFNA 1U5HA 1QI2A 1XG4A 1V6XA 3ANVA 3ITGA 3RMJA 4AF0B 1US2A 2Z1WA 3ABQA 4TUFA 2J7DA 4JTIA 3W6LA 5DT5A 2C1GA 1UR3M 4ENLA 2QDHA 2GWNA 4KWSA 3SSJA 4GNVA 1JQXA 2WMHA 5FF4A 5F2IA 4AYSA 1A5SA 3EOOA 4E4FA 3AALA 3TFXA 1ZP4A 4LAKA 4X2RA 1RP9A 5EA9A 2ISFA 5CLTA 2XSBA 1PYFA 4ZO9A 5ABGA 3N1AA 3PAOA 3LOTA 3T6CA 3B8WA 1FWGC 1U5JA 1XSJA 2Y7DA 5AC5A 1F73A 1QBBA 2VQTA 1OFQA 5CGQA 1ZALA 1FP8A 2OWCA 3SCTA 1V7YA 3ISIX 1DTNA 2EPHA 1U1JA 1AG1O 2Z26A 2J75A 2C91A 3UNTA 4B2DD 4I6VA 3ARTA 3GO2A 2Y24A 1J93A 4PBFA 1EUNA 4IISA 1GOXA 1Q65A 2VGGA 3TTSA 6CGTA 3E9AA 1K9DA 4JQAA 4TMBA 1QPOA 4OBTA 4GY0A 2QCCA 1EPXA 4JCLA 1C92A 2JE8A 3UA3A 1C93A 2C14A 4WVXA 3V0TA 3WNNA 5LXXA 3W2LA 4ORMA 1JZ7A 1FWDC 4HSHA 2GJPA 1E9LA 5JQ9A 1UASA 1XH2A 1ZCOA 2BVWA 2CEQA 1XKJA 3S3GA 4POCA 3G6LA 3VE7A 4YS1A 2D2JA 1CCWB 1P0KA 2WC3A 5GJPA 7CGTA 2WM1A 2AL2B 3HG2A 3M0YA 3MY9A 1MZHA 4JAWA 3B06A 4FAMA 1MEWA 4D6JA 1PV8A 1PKLA 5T9CE 3N9RA 1JYWA 3KVKA 3P67A 4LPCA 1Y8BA 3W86A 1ENUA 3NJ3A 4H01A 1L0PA 4O15A 5G5IA 4IMEA 2J7HA 3KAOA 2X1TA 5A6TC 1R46A 2J9YA 5DY3A 2QCEA 4US6A 3GB6A 4K37A 4LB3A 2HNEA 4DWSD 3LX9A 3FJ6A 5I24A 4DBSA 4E2VA 3QKEA 5CJMA 4JCMA 4E8GA 2JFEX 4MYAA 2D0FA 1TIMA 3BDKA 4QITA 2DZTA 1JI1A 4K1GA 3AYVA 3BLKA 1KW1A 4BFAA 3MCMA 1I60A 4MNLA 4V27A 4XVDA 1O1ZA 3W72A 3S1UA 1R2SA 3LDVA 3MU7A 2ZXQA 2PDMA 1XYLA 1ZPTA 3PZVA 4ZTYA 3ZT6A 3ZT7A 4JN8A 1UWQA 1K70A 5CH9A 4DY1A 1OFPA 2XH7A 3PZUA 2XN1A 2PDXA 4AD0A 2CYGA 1WKFA 1TA3A 4FO4A 4HPHA 3SEPA 1X8FA 1BGGA 1P43A 3PB0A 4KT2A 4JBRA 1SZRA 1VEOA 4WY0F 5LHEA 4GQ0A 5BU9A 3CT7A 3S47A 1AUSL 3UR8A 4QG6A 1Z3NA 3TC6A 4UFMA 3E3HA 3VD4A 3C61A 3U48A 3WJYA 1YEYA 3HMJG 3E96A 3ENLA 2PBOA 3R89A 2H90A 2DUXA 3N29A 3N2TA 2PTZA 3HM7A 4Y8FA 1H1ZA 1WUEA 5HQLA 3JU2A 1EBGA 3NSXA 3WDPP 2QPSA 4DUWA 2G3MA 3NM3A 1HTIA 1X7IA 1DIKA 3FEQA 3WH6A 3EMCA 2V3FA 1TPUA 2XINA 3BARA 3FY1A 3GAKA 3B0VC 4Y7EA 4ZQCA 3KWXA 3LHYA 1EOKA 3WLSA 1DQXA 4M1RA 1UC4A 1NY1A 4EE9A 3P81A 3EWZA 3F1QA 1J0JA 3UQNA 1J79A 4W9TA 3PC0A 3W83A 1WOBA 2EJAA 4OWGA 2YCIX 1ZBKA 2DUAA 1CGVA 3U7BA 1RVKA 4EF8A 3KRZA 2RDWA 3BSHA 1UWTA 4IJBA 2PRHA 3II1A 1M7XA 1NFPA 4ZGYA 5FJPA 1T6MA 5EBAA 4LS0A 4C1KA 1H7WA 4MWAE 3T4WA 3IUHA 5D9OA 3OQ8A 2FTYA 4EKJA 1WKDA 1YIXA 1E40A 4R33A 3UD6A 4H9VA 1SO3A 1UZ4A 3GTNA 1Q6QA 4IPIA 1L8PA 4U33A 1Q4NX 4JTLA 1OC5A 1I2NA 4ZXLA 1BPLB 4LALA 2AAAA 1O1HA 3W2KA 4TR9A 3U0HA 2DPEA 3AYTA 5AN7A 4AZCB 5FJRA 4LVGA 6TAAA 1MUMA 2FB3A 3U2ZA 3R94A 2PF8A 4A8NA 1SJAA 1HVQA 3T2QA 2VZVA 4CD8A 1ZZMA 1UROA 4AYGA 3GHRA 1RA5A 4O0QA 4E2BA 1V6VA 5CZKA 1QI3A 3WFZA 2ONEA 6TIMA 2XWEA 2HK0A 2Y5SA 1XHGA 5A6SA 2W67A 1PHQA 4XD3A 2YB1A 4ML4A 3VKBA 1VYPX 3ITLA 4N02A 5G1MA 1XV8A 2X2GA 1FY6A 1S2AA 4ZQPA 1A3WA 3OGVA 4IP5A 2Q01A 4C7DA 3WLKX 4ONVA 3JS3A 4DJDA 4ZOAA 1H7RA 1VHNA 5JBFA 2ISSA 4NILA 1PKYA 3VD5A 4UR8A 3W2JA 1CYGA 2OODA 1Q7MA 3UZXA 4X2PA 1TPDA 1JIBA 5C9ZA 2Y8VA 4QSFA 1IF2A 1J0YA 5DMMA 2CBUA 3RLVA 5CPLA 3KTXA 1PX8A 4F9DA 3A12A 3GR8A 2FZDA 2REQA 2VXNA 3CB8A 3EGJA 3VOHA 5DEZA 2QVHA 3CUGA 5LA2A 4ZQNA 3A5VA 4P8UA 1A5CA 3VUSA 2Z0IA 3L4TA 4WKAA 2NLIA 1AD4A 1GW9A 2FTPA 4Z42C 4MB4A 2QAPA 2XGBA 1KRCC 3CQ0A 4WK9A 2VOMA 5I3GA 4V28A 4PSRA 4O19A 3CPGA 4KCWA 1JI2A 1JUKA 5FJJA 1YPFA 2YDSA 3CWNA 1E1EA 1JDCA 1K1DA 1RBLA 2GFTA 4CN1A 4MVAA 4Y9OA 2OOFA 2Z4GA 2ZRXA 2OSYA 1US0A 1I4NA 1PE1A 4IFRA 3GVGA 3SCRA 4TTUA 2RUSA 2Y8KA 4KKXA 4DF0A 2JIEA 1EPVA 1YXYA 1J6PA 5A6AA 2PDNA 1SR9A 5BMWA 4FI4A 4CCEA 2WC7A 4HK6A 1QPQA 1RQEA 3W1NA 1REQA 3LZ3A 3KBNA 3R2GA 3K5XA 3PUDA 4D71A 1E0UA 3S0CA 1E3XA 3N34A 1EA9C 1TV3A 3O2LA 4FR6A 3O6YX 3WEOA 2ZVRA 3M44A 3V1HA 5E93A 3M0JA 3UG4A 5AHNA 1ZAJA 3KOXA 4AH7A 2R8WA 1KQYA 1KNWA 1XSIA 2Y4SA 3B8TA 3U2CA 3L4UA 5K7JA 3AHYA 3H7VA 4DWDA 4X61A 4JEQA 1BHGA 1K7XA 3CV6A 3AIWA 1NOFA 2XFWA 1GG1A 1YE4A 3T0CA 3UBPC 5K9DA 1XIJA 1VF8A 4ZFMA 3GKAA 2HVMA 2XIMA 4MPKA 2XVKA 4KS0A 1LT7A 3ZJ7A 2QW5A 3U3HA 4RZ5A 1XGEA 1T5AA 1A4LA 3HV8A 2OJPA 3WLIA 3VOGA 1HUVA 1RUSA 1XD1A 4MB5A 3WBAA 4RLIA 1LOLA 3WKZA 1QUMA 3PSWA 3WYZA 2P8BA 2PFHA 3G1RA 3W29A 7TAAA 4H1ZA 4J7RA 3RRAA 2E68A 4TTGA 3SDOA 4ZO8A 4PTXA 5FIPA 4MPQA 1NM9A 5D04C 1S5NA 3T8QA 4W86A 4GFIA 4ZQMA 3HOJA 3R13A 3KBWA 3TMQA 2J78A 3SCNA 1R9ZA 2GK1B 4MY1A 3NPWA 3TJ4A 3ZSSA 1OIFA 4Z2LA 3A9IA 1D3CA 1IZKA 2C18A 1W56A 1D7KA 1TSIA 5A95A 3O3RA 2Z24A 1OHLA 2CFFA 2R1KA 5KITA 3WDIA 1Q13A 3DG7A 2WQDA 5G1TA 3F5JA 1OZMA 5HWJA 1ZNNA 2FFCA 4LUJA 3N14A 3TQ0A 1EXPA 3VNDA 4GUGA 3WF0A 1W9VA 4O1FA 1FCBA 3LCHA 4JKKA 3FEMA 2VFDA 3JW7A 1MWOA 2YIHA 3EOEA 1MYRA 4OUEA 3B97A 3DERA 4LSBA 1I2QA 3NL5A 3R43A 1KRBC 3A24A 4FXRA 1AH0A 2VENA 1GVIA 4HPJA 2RJHA 1LOSA 3TVAA 1ONRA 1ISWA 4KWWA 3T07A 5E9XA 3EDDA 2QCNA 1EJ7L 2OXNA 4QRNA 3N13A 3Q4DA 4XTDA 3KOFA 3I6RA 4LAOA 4E38A 1R38A 1EA0A 3TC7A 5DLCA 4JL2A 7A3HA 1RH9A 4D1JA 1KA9F 3LHVA 4ACYA 1EP3A 4JTHA 4NXKA 4P7OA 5AYBA 4HK7A 1VPYA 1GJWA 1XRVA 3HG3A 1QI5A 2VVNA 1MW2A 3UR2A 2YLLA 4D6IA 2G41A 1R7OA 2PP1A 4O1DA 3Q58A 4IX2A 4D2JA 1B30A 1RLCL 1LTDA 3K4AA 1DIOA 2VR5A 3VYLA 2D3NA 1JPIA 1VAHA 2XUCA 5CAKA 1VCFA 3OG3A 2P3ZA 4FSAA 4Z0SA 3FVMA 3EZ4A 5AVHA 2AGKA 2C0HA 4AMAA 1XH0A 1XPYA 3B8DA 1V3MA 2FHBA 1MW3A 2I56A 2WYSA 1XIEA 4UNLA 1OY0A 3LXCA 3NL3A 1KM1A 2PGFA 3QYQA 5I07A 5HNTA 1JG9A 3GHSA 4BKNA 3LXBA 3IUDA 4FNQA 1UUMA 2P0OA 1TX2A 1MRAA 1LUCB 1XLKA 1GZGA 2WHMA 4N9CA 1DQUA 3IJLA 1HN1A 1FA2A 2VTFA 2ZUSA 3WIJA 2W62A 4H2HA 3B8SA 3NYDA 4BQ4A 4W4QA 1MXDA 3DG3A 3B4YA 4H8NA 4ERIA 4H9UA 5I6SA 4LUYA 3FLUA 1GG0A 1JEZA 1ODUA 2P5NA 2VJXA 1KCLA 2Z1SA 4XB3A 3NURA 1V03A 3BZJA 4Z2HA 4S3BA 3SCUA 4Z0JA 4GXMA 1XXXA 2X0SA 3W37A 1JQVA 5TBOA 4RDYA 2VRJA 3AICA 4B4HA 1XYZA 2GOKA 5FJTA 3LLFA 4IMCA 1HL8A 2W3ZA 4OTKA 1DV7A 3P80A 3RLGA 3V3WA 3DENA 3S5YA 5H6HA 2EGZA 3DH7A 1VIWA 3AXKA 4KEZA 3UR7A 3VIKA 4UNIA 4L4PA 2I7GA 1SFLA 4JYDA 3CH0A 4LBRA 3CUJA 3W73A 5J04A 2J25A 4KFNA 4PMZA 1IWPA 3DU0A 3VIMA 2J77A 2ZUNA 4JOMA 4PUNA 1TQJA 2DSZA 1AODA 5CCZA 2IKGA 1OT1A 3GWQA 4CNNA 3OG2A 2V5LA 3KL0A 1U2YA 4AX7A 1AQHA 3S46A 1L6FA 3C5QA 6REQB 4IMAA 3GNDA 2XH4A 1XI3A 2WHKA 4PBEA 1HNYA 4KIRA 1ME7A 3P8JA 1WXJA 1Q6CA 3S2CA 3U57A 4IX0A 4BWLA 3DHDA 3QHOA 1I2OA 4FK9A 2DZWA 2QJMA 2V2DA 1ITCA 2D20A 3MV11 4KIEA 3CXOA 4GC4A 5FA5A 3NGJA 1EF2A 2NWRA 3GC2A 3UY8A 4XZ9A 4DHGA 1BF6A 4HYWA 3CMFA 4OV4A 3ME3A 2FH6A 4O14A 4CQCA 3VNMA 3NO1A 1J5SA 3G1AA 2QIWA 3SM0A 1XF0A 4GHRA 2NT0A 1S2VA 3AXMA 3DECA 4UOJA 1KR0A 5FJIA 4LYKA 1IR2A 5HUPA 4MNJA 5A6BD 4D8ZA 5K3VA 2AGTA 4AIUA 3ZWSA 5XINA 3O8AA 2VM8A 1V5XA 1OGSA 3W7EA 1YYAA 2YR1A 3T08A 4I9MA 4A29A 5M1TA 1UD4A 5DT7A 2HNHA 3NZ1A 4MJ2A 5EFDA 4JPGA 3PSVA 3TYEA 3M0LA 1UP0A 3T2PA 1E70M 3HURA 2D73A 1F4AA 1L8NA 1R3VA 3HB9A 4C7FA 2QS8A 3GIQA 3BV4A 1UP3A 3BAKA 4FF5A 2IQDA 4UTWA 4OECA 4Q8OA 2HVNA 4IIEA 3SRKA 2CLOA 4DO5A 2PDYA 4QJ5B 1RVGA 1S3TC 1TTPA 2DU2A 3QKZA 3QM3A 2FHCA 5C9XA 1WAWA 3WDQA 7REQA 2QCDA 3VGBA 1O60A 4JQ1A 4GZEA 2QDGA 4DVOA 2C1HA 1I9CB 1W9XA 1KFCA 1FP9A 2WQPA 5D30A 2Z25A 1TKKA 4KRZA 1CGYA 3RJYA 1HJXA 5LNWA 4ZE4A 1B57A 3WD1A 3T81A 2FZ9A 2NT1A 2QCHA 2BB0A 1R5YA 1AW2A 1FHVA 4GY7A 2BLEA 1TJ2A 3TV8A 2WMGA 2DVUA 1V08A 1LQ2A 1DJQA 1K8CA 3MUIA 1FWWA 3REQB 1DHPA 3HG4A 3KVLA 2ZZ1A 1R2TA 4JNZA 1A5NC 5CAHA 1DWIM 5E0CA 3WLTA 1EGVA 1NDZA 3TOPA 3SY8A 3KRBA 1FDYA 3EPMA 7ENLA 4K7VA 3TROA 1UBSA 3CL6A 3EA3A 3H2OA 1K9EA 1HP4A 2DH3A 4Y2WA 1VHCA 4H9XA 4D1IA 1KFBA 2P88A 3E1F1 1GEQA 2G3NA 4JFVA 4X9SA 3H55A 1FWHC 4J3VA 5BWFA 3A9BA 1UD2A 1B54A 1XLJA 3GNPA 1RCOB 2V5JA 1W8GA 2FJKA 2OB3A 3HN3A 4ZR8A 4WRHA 3GD6A 3L4XA 3B0XA 5LIUX 2Y89A 3K8MA 1ZFJA 4H19A 2GJXA 1ZS2A 1OFEA 3PM6A 5JIPA 3KOWA 1G94A 3CHEA 3UWVA 4H00A 4F9JA 2RFGA 4DI9A 1FWTA 5JU6A 2V38A 1OFOA 2XIQA 2CBIA 3QY6A 3CGTA 1M7OA 8CGTA 4RUBA 2ZZ2A 3M0HA 5D38A 5D2WA 3WH5A 4GK8A 4JNMA 5DCEA 3UG5A 2PD9A 3UXDA 2NUYA 3PP7A 4EF9A 1YPIA 6ALDA 2WCAA 1M5WA 3R25A 1TRDA 3WELA 4IL2A 1E9YB 3N73A 5C2CA 4PRTA 1OF8A 2PWDA 1A5UA 1MSSA 3BJSA 5HNNA 3E2VA 4GZIA 2XTKA 4DELA 4RL3A 5A1AA 1EHNA 4HNOA 3ARRA 3IGHX 5AB3A 4PFHA 5HMFA 4JTRA 4QG9A 3SFKA 3B05A 3T09A 5FF0A 4I6KA 2IXUA 4MDPA 1UB3A 4UTUA 4M8UA 3BCFA 4J35A 1AQFA 3GM8A 3QLDA 2X05A 5J5RA 4GMEA 5EU9A 3ZOAA 4WX2A 2YBVA 1KTCA 2I57A 1H09A 2HPIA 3FHQA 3LHZA 2JGQA 4HZ6A 2FH8A 4IGSA 3IWPA 4DAIA 1LDCA 3ZVHB 4IP4A 4AIBA 1XRTA 3ERPA 1J2BA 1EC8A 1CPUA 2IQ0A 4K38A 2J7BA 2PBGA 4OOZA 1XGZA 1HJQA 3OVRA 4HVXA 4IPLA 4ERGA 1MO0A 3BAYA 3TN3A 3WQ8A 2Q6ZA 2RHGA 1WDDA 1EX5A 1EL3A 4L1WA 3FAWA 4AX6A 1J2WA 3H7RA 3F4WA 2EG8A 2ASHA 4B15A 5FF3A 3FA4A 1NU5A 3PFRA 3GXMA 4NX0A 4PEEA 1YPXA 3INPA 3TW7A 3VKDA 4ZSUA 4WSHA 1E3ZA 1YDNA 4CNUA 4I5XA 1SGJA 3URAA 1F74A 3DDMA 4HYRA 3NIYA 3ABSA 1EFZA 4J28A 4AWSA 3SQSA 3GTXA 1EC9A 1YX1A 1UKSA 4HOWA 4AY8A 2VD8A 1NSJA 5A8GA 3UWYA 1E1CB 2EHHA 3M5VA 3N2OA 3IACA 3SIZA 4RV8A 1EZWA 1J4EA 1JAEA 2WMIA 4FB7A 2RGLA 3CO8A 4LUSA 4C6JA 3ATZA 3C4UA 4L6DA 3GVVA 3UGRA 2KAUC 4NJKA 1BTMA 1HJWA 1TWZA 3GR7A 4FS9A 4AEEA 3CBWA 5C70A 4MKVA 3M7SA 5T9BG 1VZWA 5LIKX 3WENA 4H8UA 1LL6A 1VFOA 1F76A 1FHUA 4US5A 1UMYA 2DZBA 2F61A 3H4GA 1FKXA 1J11A 1ZBVA 2MNRA 4PMUA 5FEWA 5LA0A 1BKHA 3UZWA 2CU0A 3G24A 2X16A 4RE2A 1ZBWA 4O13A 3W1XA 4RX0A 3JZUA 5H8UA 3EYPA 3T7VA 1O6IA 2QAFA 3DI1A 3O63A 4JYEA 5LIYX 4PUJA 3T0DA 3WK3A 1ML1A 3CLWA 1KXVA 1XBVA 3ABRA 3LENA 2E7FA 3S9ZA 5AVNA 3Q45A 4QJ1A 3N2XA 1KRAC 3ZJ8A 4BJHA 1D7FA 1BQGA 1H4PA 2V5BA 1B2YA 3HGJA 5KZEA 3WH9A 4DAFA 3HIJA 5JUVA 4GYPA 2HPMA 4C6QA 2XG9A 4XSMA 2ZE3A 3IUIA 2WZMA 2BTMA 3EWXA 3APGA 3THCA 4KCUA 4JFSA 3V16A 2GYIA 4U3CA 3CIXA 2O9OA 1N55A 4AIOA 4AHQA 3CHFA 1PO9A 4YPJA 1UWRA 1LL7A 5ECVA 1XIFA 4XKMA 1AMKA 2Z6IA 4DEFA 1XSKA 4JQ3A 4OIFA 1XBXA 4Y9MA 5KETA 4AD1A 1QAPA 4E0CA 4QNWA 1BG9A 1OX4A 3CYJA 4P7NA 4KWUA 4U31A 3WLQA 4A4AA 4D8AA 3GKFA 4ZB5A 1ICQA 3PTQA 4FF7A 4W89A 3K4WA 3KP1A 3MTWA 4ZSTA 1DXEA 3QQ1A 2OZ3A 4MAZA 4DM2A 3QY8A 5I03A 4BQ5A 1XIMA 1C8XA 1DJZA 1LT8A 1PEZA 1TTIA 2QPUA 3FJNA 4D6FA 3AJ7A 1N8FA 5FACA 1IT7A 2HS8A 4Q4KA 5C9RA 1ME9A 3ONCA 3S5ZA 5GNZA 3MHFA 3S2NA 2Z29A 4XKYA 2VWTA 4QP0A 4FLQA 3EA1A 3CZEA 1WPCA 1XCWA 2AQOA 3VIFA 3OJGA 4QAIA 1J0HA 3KHDA 4JN7A 7PTDA 4FZIA 2QXWA 1TYGA 4DXVA 5D8ZA 2AMXA 3UYIA 4HB7A 3AS2A 4MOZA 2BVDA 3FYPA 3PZGA 2YDAA 1ICPA 4B5WA 2YA1A 2VEMA 4IOTA 1BKSA 3E6EA 2DW7A 3M0XA 5AYXA 1PWLA 2WZHA 2GGGA 3EAUA 2GJNA 3L5LA 3KFTA 4LV4A 4LRSA 3G0SA 1B5TA 3TQVA 1HJVA 4GQQA 4CN4A 1LM1A 4QXIA 1X1NA 3OYZA 4F0LA 4JN6A 3MJYA 3E0IA 5I3HA 3WQWA 2QF8A 3MW7A 1GQJA 4GVFA 3PWGA 5BMXA 1W9BM 4WEVX 4E2DA 3SN4A 1OADA 1OGGA 3OBAA 1XLGA 1L6WA 3EKZA 3PTDA 3VABA 3FFSA 3TQKA 2E8ZA 4GNKB 3WFLA 1DWGM 2DP3A 2DT2A 3SGUA 4N9BA 3OZOA 3CC1A 2BBFA 1XR2A 1SM9A 3H2NA 3N9KA 2P76A 1KM6A 2ZZ6A 1T8XA 5D9MA 4FNTA 5K9CA 1OWQA 3GR4A 5CSRA 1JGIA 3HF3A 3W1LA 1XGDA 2VKZG 3D6NA 5G4HC 4LNCA 1UWIA 2OVLA 4FA3A 4HMEA 3E5PA 1AMYA 4E8DA 4JNYA 3E74A 3TE9A 4FR1A 5A94A 4WIWA 1G69A 2QDEA 1M65A 1RZMA 3STEA 4TX6A 3ZLFA 3QRHA 1F3WA 4H3DA 4J27A 1HW6A 1J0IA 1KM4A 1FWNA 3RRXA 3VNKA 5FCZA 3W7JA 1F6PA 3OVGA 4M81A 2NV2A 5A2CA 4CVUA 3S42A 1GNXA 4D6HA 1NOWA 2OO0A 3UESA 1F3TA 2QUUA 4GZ7A 1ISVA 3NVDA 3C2EA 5J8LA 3VOFA 4DF1A 1POJA 1GVQA 3R8RA 5HOSA 1BYBA 5DFAA 2D2OA 2IUZA 1I6NA 2IW0A 2Y7GA 4B9ZA 2D1ZA 1W1PA 1KB3A 1KRMA 4L1GA 1TO3A 1F2JA 1LYXA 3CQHA 2XYLA 1PHWA 3CHDA 2EG6A 2QMJA 1IGSA 1NWSA 1L6YA 2XHYA 1W1ZA 2FDMA 2PB1A 4QEHA 2CIPA 4NUWA 5JVLA 3VDAA 1TZ7A 2F7FA 2V5KA 4REQA 1TX0A 2PCEA 3BV7A 1EC7A 1NJJA 4PGLA 3CIVA 2I5QA 4XZLX 2V69A 3IARA 1RD6A 2FPVA 4GC3A 5M3WA 2QF7A 1HF6A 4TV5A 4AUBA 4WJEA 5BXTA 1FWFC 3MA8A 2E6FA 3CZKA 3W2MA 3UWEA 4KERA 1IYXA 4G7EB 4NASA 2RKXA 5DCBA 3HZ3A 1PS9A 3VC6A 5TAOA 4YTRA 4M24A 2F84A 3M43A 4H9MA 4YJ5A 3MT1A 1QW8A 1QRQA 2BHZA 3CK5A 4PC8A 2XGIA 2PS2A 4QLJA 1XBZA 1G67A 4L6OA 1P6BA 1DJYA 4UFKA 2PDFA 2CHOA 4S39A 3QGVA 3RJXA 1VQTA 1VRXA 2I5GA 3EMZA 2AKMA 2FFIA 3I65A 4P8VA 2TYSA 3OVPA 2NQ9A 3B8VA 1XC6A 3GVRA 3V0UA 1DWHM 1NVMA 1MUWA 2PGRA 3TR9A 2PGWA 1UR2A 1C9WA 1KCXA 2OKTA 4U4MA 3E2QA 4UTJA 1W5PA 1FCVA 2WHLA 3CUFA 1IT8A 8XIMA 1EIXA 2I5IA 1PYMA 5G1YA 1QO2A 1FDZA 4M6UA 2YCKX 4Y9AA 3WDHA 5B80A 2E5BA 4KRTA 3KCJA 3WZ0E</