1TX0A

Dihydropteroate synthetase, with bound product analogue pteroic acid, from bacillus anthracis
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
273
structure length
265
Chain Sequence
KWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSDGGSYNEVDAAVRHAKEMRDEGAHIIDIGGKVSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DHPS, Dihydropteroate synthase
publication title Crystal Structure of 7,8-Dihydropteroate Synthase from Bacillus anthracis; Mechanism and Novel Inhibitor Design.
pubmed doi rcsb
source organism Bacillus anthracis
total genus 95
structure length 265
sequence length 273
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2004-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00809 Pterin_bind Pterin binding enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 1tx0A00
2DZAA 3V5OA 2VEFA 4DJED 1AJ2A 3MCOA 4NILA 2YCLA 4O1FA 4DJEC 3H21A 3H2EA 1Q7QA 3MCNA 4MWAD 3BOFA 4DJFA 3H26A 4O0QA 4S39A 4D8ZA 4CCZA 1TWZA 2H9AB 4DAIA 4S3DA 1AJ0A 1EYEA 1Q7ZA 2BMBA 3TYAA 1Q85A 1Q8JA 1AD1A 4DJDA 4NIRA 3TR9A 4C1NB 2VP8A 3TZNA 3TYEA 2DZBA 1TX0A 2Y5SA 3H2OA 4HB7A 3TYCA 3H2MA 4DJEA 4MWAC 2DQWA 4S3FA 4C1NA 3H2FA 2Y0FA 4S3CA 4NHVA 2OGYA 3H23A 1AD4A 4DAFA 3K13A 1Q7MA 4NL1A 3H2AA 4D8AA 4MWAB 2H9AA 4DJDD 4PZVA 2Y5JA 1TWWA 3H22A 1TX2A 4O1EA 3TYUA 1TWSA 4DJDC 1F6YA 2VEGA 4D9PA 2YCJA 3H2CA 4DJFD 4DB7A 2YCIX 4MWAA 4S3BA 5JQ9A 4DJFC 3BOLA 3NOYA 3MCMA 4MWAE 3TZFA 3TYDA 4S3EA 4G9PA 1Q8AA 2YCKX 2YCLB 3H2NA 2E7FA 1AJZA 4S38A 3H24A 4S23A 3TYBA 3TYZA 4S3AA
chains in the Genus database with same CATH superfamily
3AI0A 1GKPA 4JL1A 2FYMA 2VEKA 4L7ZA 4HNLA 4IPNB 2CZFA 1BYDA 4GZ7A 5HJXA 2TAAA 4CCZA 1PTGA 1VIZA 1CDGA 4I9JA 4RPPA 4M5PA 4O0ZA 3DH7A 3S2MA 1MXSA 2GDQA 4GQBA 1XLIA 3AICA 4ZQOA 1JPKA 4GZIA 2DZBA 1KGUA 4EP8C 4UFIA 2B7OA 1I4NA 3H2MA 4UR9A 2DQWA 4LYKA 3MSRA 5K9XA 1A49A 4FLQA 1US3A 3SB0A 1FWTA 3MUY1 4PTMA 4DYJA 4H6KA 1OIMA 5C9ZA 3OLEA 4MGGA 2PDJA 3A3WA 3LG3A 4TTUA 4PRTA 3LS9A 5LNWA 4DWDA 4LEFA 1CGVA 3WG6A 1BSLA 1VS1A 3O6DA 1MO0A 5M5DA 3KBMA 2WAGA 3VINA 3M7SA 4H8VA 3W1NA 3EOEA 1WDWA 1WAUA 1F8MA 3W7GA 3NPXA 3AAMA 3ERPA 1BVNP 2FVKA 3UGVA 3VD5A 1YEYA 4X9YA 2QGHA 5HDRA 5I09A 2VGGA 5M17A 5I3HA 5LA1A 1F5ZA 4JKKA 4NP7A 4M6PA 3LBMA 3A5FA 3THUA 3L2IA 4XAYA 4AWSA 1VR6A 3M5VA 4IZGA 2INZA 1KB3A 1VCVA 2EKCA 1VPYA 2EPMX 1NH6A 3WQFA 4LVBA 3AYRA 2QDDA 3TQVA 4ZA0A 3AS2A 1K9DA 1J5TA 3EB4A 4BR1A 2PD9A 2RDXA 1PHWA 2PWHA 3ITTA 4UTWA 3UJSA 1VB9A 1UWTA 2QEZA 5A8NA 3OLIA 4NI3A 3UZ5A 1P0NA 1W0MA 3ES7A 1DJXA 5D9MA 2YL5A 3UVAA 4AF0B 3NURA 3HGSA 4J2MA 4QNWA 3DERA 4JFUA 3NM1A 4UBPC 4QE1A 1R7OA 4XAGA 4HU3A 1GVEA 4H01A 2NVCA 2VD9A 1A50A 2YLLA 5BYWA 4HQVA 4XZIA 1UC4A 3WLPA 4JTFA 4UOZA 1GOMA 3D6NA 4O28A 3G1XA 2ZUSA 2VX5A 2IS7A 4ZL1A 4DJFC 3BMVA 3PULA 3TX9A 4Z2IA 2WSQA 3BOLA 3T2QA 4HU4A 2NQ9A 3WK2A 3R0KA 1XFCA 1W1B1 4GYPC 3GIPA 9XIAA 2OOFA 1JF6A 4I5XA 4LCQA 4AZBA 3AXXA 2JKEA 1UIOA 4HKPA 3N9KA 1X1ZA 1JAEA 1E1CB 2CHRA 3ZIZA 4GY7A 2OVLA 3L4XA 2J8TA 2NW0A 3BSGA 1EXPA 1ZFJA 3IRDA 1MW3A 1RBLA 4DLMA 1P5BA 1YBQB 3AMGA 3W28A 3OB8A 1LG2A 5ABTA 1WDPA 1MYRA 3HGRA 5CPOA 1YTEA 2F6KA 1FWCC 3G8RA 2VYOA 4PCPA 2XVPA 4P8UA 3K8LA 4A6GA 1TX0A 1WZMA 4V33A 3UWZA 3GG8A 4JEQA 1TJRA 1Z3NA 4X22A 3ZSTA 5ABFB 3V1HA 5FF3A 1E4NA 1N55A 1US2A 1A0EA 2OQHA 4XD6A 3EWYA 3CMFA 1HJSA 1XYBA 2WWCA 1P48A 1ZBCA 2D24A 5C5YA 4JNMA 2X7VA 1EEXA 2ZC8A 5TBOA 5BMWA 1AH0A 2W27A 4L4MA 3LZ3A 5GJMA 1UD5A 4O4VA 1O5RA 3E3HA 2OSXA 3O0KA 4F79A 4YHGA 4Y7EA 1F05A 5MKGB 2OEJA 1NIUA 5CJMA 1FOBA 4JDBA 4TO8A 1JQVA 4UCFA 4MNJA 4K8GA 5AN7A 1WDSA 1W56A 1AW1A 2WM1A 2UBPC 4JTIA 2OWWA 3ZWSA 3GHTA 4TMBA 3HJEA 3HO8A 4IGSA 2QQ6A 1G94A 4C6OA 2FGLA 3KBWA 3PPCA 2BY0A 4V27A 4UOJA 3H70A 4O53A 3C2YA 1J2BA 1RBAA 4BQ3A 5HINA 2ALRA 3N25A 1SW0A 1HO1A 3N2TA 1HL8A 3P62A 4UTMA 4GIRA 4JQ3A 1SYTA 5D2XA 1Q5MA 1OZQA 3BL3A 2DP3A 5BRPA 4H9UA 3ZM8A 3PTKA 3A9IA 3HPXA 1JIBA 3OODA 3MZNA 4A8LA 4HOXA 4DBWA 3OQEA 3DFSA 1T8XA 1R47A 1S5TA 4JR5A 3IV8A 5LA2A 3V0TA 2ISFA 4XZMX 1UR1A 3ITXA 4JY8A 2VVNA 2PTDA 1EP1A 5AYBA 3UEQA 2NZLA 2OX4A 2G97A 1VBHA 4F0MA 3NXLA 1Y0EA 1KBIA 2YCEA 2CIPA 2PURA 3GTIA 2INFA 2Y7GA 3EDKA 1W32A 1CLVA 2FZBA 1JD9A 2VNCA 1K77A 1E3XA 1UIPA 4FPSA 4AF0A 2VURA 4OV4A 1UWSA 3OIXA 3CPGA 4WDTA 5C2CA 1TYGA 4NF7A 3U6WA 4DRSA 4I9TA 3AMDA 3P67A 3EWCA 4HU8A 1UB3A 5A6MA 3HG3A 3FDGA 3UGRA 4LUTB 3G77A 1HKVA 2VTFA 1AH4A 1MVYA 3CIXA 2WVTA 3VKAA 4GJ1A 1DE6A 5BXRA 4OWGA 2J7CA 4Q6JA 4LVGA 1V7AA 1QW8A 3O15A 1CX9A 3KLLA 1E6XM 1Q7ZA 1J96A 5AZ1A 3IPWA 3HV8A 2VEPA 1MZHA 3B8VA 4HSNA 2VP8A 1WXYA 2VRQA 6ENLA 2RGMA 1GWJA 5DO8A 2ZX7A 3LXBA 3QZ6A 3M0LA 1NFGA 3QTPA 4U3CA 2OWXA 2PDLA 4LNYA 1OQFA 1QHOA 4CCDA 4MIMA 5AC5A 4KQNA 3W2MA 1D8CA 4ZCWA 1JDDA 1C3FA 3N9RA 4RE2A 3MUIA 3CS2A 4TX8A 3T40A 3EMZA 4UFMA 5BXSA 5LKYA 2R1LA 4A29A 3G1DA 2E1WA 3MDUA 4PMYA 2D69A 3SN0A 5A3HA 1GJPA 3WNNA 2PDIA 3VVGA 3F4VA 3TSMA 2OSWA 5HMFA 5DFAA 1Q6GA 2BG5A 3M0IA 1EBGA 2D3LA 3RCYA 2I14A 4B5NA 2PGRA 4X61A 3FKKA 2PDYA 3CJPA 4ATLA 1UBPC 3VNJA 4D1JA 2FHBA 1ODZA 4AD1A 3W74A 3JS3A 3I4EA 4WR3A 1J0KA 1Z6KA 4OFCA 4ZQRA 4CQ9A 5DANA 4LT9A 3ZFHA 3N15A 3VUSA 4ALDA 3K1DA 1EOMA 3BG9A 1G4PA 2W3ZA 4WJXA 1WE5A 3N4FA 1RJPA 3VNMA 4ILSA 4N9CA 2CBIA 3WLKX 4CVWA 4PBFA 3VIMA 4OECA 1D3CA 1VFOA 4RZ4A 5FESA 3C0JA 4MKSA 5C8BB 5M3WA 1OFBA 1XD0A 3IUHA 2VL4A 4EAYA 5A5WA 1TZ9A 1CENA 3L5MA 4IL2A 4Y90A 2JGQA 3WD1A 5MKGA 2OYMA 1VYSX 3VX0A 3DDMA 1XBXA 4IJRA 2PDNA 2VZUA 2VZSA 4LVFA 3UPWA 2OQLA 5CGTA 4H9VA 4U4MA 4PMRA 4RPQA 1UC5A 1U2YA 1BVZA 2GGGA 4IICA 3TOYA 2ZCGA 1ZBVA 5C0QA 2HK1A 1DP0A 4UFLA 4IJBA 3UP8A 1CIUA 3G3MA 2RDUA 4QJ3B 3WLRA 4AMCA 4AU0A 3F2DA 2Z1WA 2CXGA 1XISA 4RUBA 4J9JA 3W76A 2FPVA 3KOYA 3CLWA 4IOTA 1XQLA 3CPUA 4IG2B 3PUDA 2YCLB 3W1TA 3AJ7A 4R5EA 3CQIA 1BKSA 4MSSA 4G7FA 3TSDA 5BRQA 4N4PA 5E9AA 1PSCA 1P43A 2QPUA 1N8FA 2VR4A 2E8ZA 1H1YA 3AROA 3IIOA 5I3FA 3SAZA 1JCLA 3IIZA 2GQ3A 4YTUA 4Q7BA 4OGZA 3FEQA 5HPCA 1NVMA 1U1JA 3W1AA 1BYCA 5D8WA 2PPGA 1Y5VA 4NAFB 3ITGA 4NAEB 1AQ0A 2E1DA 3HPZA 3R89A 1K02A 1A5KC 3XIMA 4WF7A 4QEHA 1TIWA 3SCWA 2PBGA 3G0XA 1XHGA 4YTRA 1EJSC 2G3JA 4XAZA 4TU1A 1V79A 3DCPA 1RY8A 1VBJA 1E6NA 3M16A 3U2OA 4LUTA 4RW5A 2E4TA 1TE6A 3ZVHB 3P93A 3N13A 3HG5A 3I3BA 3EOOA 5F1VA 2EJ1A 4W84A 2EEXA 1M1BA 2J75A 2A3BA 3GK0A 4P5UA 3NSNA 1UPPA 3JW7A 2V2DA 2YL8A 3RM9A 3TFXA 3W83A 4H9XA 1EX1A 1GG0A 3LOTA 2WKJA 4OE7A 4PE8A 3W88A 5REQB 3LUTA 4WEVX 3HQNA 1U5JA 4IQJA 2ACRA 5D03A 2Y89A 5HUOA 4ENLA 3MTWA 2AKZA 1KXHA 1UP0A 1E73M 4Q4KA 3PB0A 2ABBA 4N2YA 4BCEA 2C1IA 1R3RA 1K9FA 3GNPA 1SFLA 3IK2A 3B97A 1BF6A 3TMLA 5AZ0A 2P3EA 2W0UA 4H1ZA 4JIQA 1RJRA 4J1OA 1F07A 3CHVA 3STEA 2J88A 1UH2A 2VGBA 1H0GA 2VM8A 2GVJA 2OJPA 4FXSA 2ZTKA 4MJMA 4D6DA 1WUFA 4H9TA 3TC3A 3WMBA 1NFBA 1VBRA 1XSIA 1KC7A 1IZCA 1OFEA 4LXFA 3TWBA 3UF9A 2WZEA 4XAPA 4RDVA 1DORA 1LRTA 1EO5A 1OB0A 4OOUA 3L0NA 3ZR4A 3PZ9A 5TQLA 4D8AA 1GOQA 1DE5A 3T0TA 3F4WA 1IWPA 4NVTA 4GQ0A 2XVNA 2PFHA 4O12A 4E8GA 1M04A 4H8NA 1OCBA 1T8QA 4Q4QA 4FNUA 1CB7B 4IHCA 3TZFA 1JRBA 2XVGA 1J5SA 1PS9A 1XIJA 4L5ZA 3NZPA 1B4EA 2YYUA 4U5KA 1JNEA 3S5SA 3VGHA 3WLSA 4PUMA 4LAKA 3INPA 1PJ9A 2DJXA 1VHNA 4LRSA 2J13A 3MBFA 1VCFA 3W2LA 2JEPA 4LOCA 2CWNA 1LF1A 2E6YA 5I23A 3NQEA 2Y6ZA 6REQB 4GK8A 2AOSA 3AWNA 1J6PA 4KERA 3UCCA 1BG9A 3RAOA 2MNRA 5JBFA 4D6EA 2OTDA 3G1SA 1A5SA 3LY0A 1E9ZB 3AO0A 4IG2A 2XFWA 4JHZA 1YE6A 1IT7A 4IIFA 4BQ2A 7TAAA 1JD7A 1UR8A 1QWGA 4IGMA 1HJVA 2WNWA 4ML9A 5CC3A 1ZAIA 3ITOA 3WF1A 3ATYA 3QR3A 3PJTA 1QNQA 3ZOAA 4QGCA 2H6RA 3ITCA 1JZ4A 3RO8A 4NAFA 4HPJA 3DFTA 3WBAA 1WZAA 1DIOA 4WJEA 4C7DA 1PPIA 4HT3A 3QR1A 3UD6A 1X97A 3TONA 3A22A 5E9XA 1DOSA 2BBFA 3NUKA 2IPFA 3CLMA 4Z1AA 4GCAA 2DW6A 4CLMA 3RCNA 1K9TA 1GZGA 3S1UA 3ZVHA 2PDBA 4JX6A 1A4MA 3MSGA 1RALA 2F84A 4N42A 4JEJA 3LNPA 3ONBA 3SY5A 1X96A 1JDFA 4C6KA 1QPQA 3WQ6A 1YNPA 1J01A 4MFDA 1S2AA 5HK4A 1AL8A 3WNOA 5REQA 1RVGA 4DXXA 1UOKA 1HL2A 3BQ5A 4R3UA 1XH2A 4MNKA 2QV4A 1KM6A 1Q63A 3PWGA 4LUYA 2CPUA 3BZJA 3RR4A 4MWAC 1IGSA 4QQ3A 3WDJA 1Z9AA 4XX6A 3H2FA 3VYLA 2WZTA 2NQZA 1VHCA 1DJYA 1LJYA 1NJJA 1LWHA 3FFSA 1JXKA 1UH4A 1XJBA 4GNKB 3EOUA 3CASA 5K3VA 2DH2A 2XVLA 5K4ZA 5E0FA 1V6XA 4PN2A 5FEWA 3FLUA 4AIBA 5HWNA 1GVFA 5HR7A 1LBMA 2AMXA 5KEZA 4D71A 1FWSA 1OK4A 3NQ2A 5FL1A 4AHOA 2OLHA 3GH4A 1QBAA 2JFEX 4UMCA 4X60A 3I7RA 1OADA 3VA8A 4LALA 1ZB5A 5I7GA 3ZJ7A 1O60A 1RQEA 2JIWA 1KCZA 3LU2A 4MLJA 3B0XA 3W7PA 5E09A 1FDZA 1GOIA 3DU0A 3G6MA 4GLEA 1W5OA 4FF7A 2J47A 4S39A 1XRFA 4US5A 4KRUA 4QROA 1W1TA 1G4TA 4A8NA 2V69A 1OK6A 2V3EA 1QK2A 1W9XA 2IQTA 3O0FA 3M6YA 3QTGA 4F0LA 3WFZA 3DC8A 3UJRA 5G1YA 4JQ1A 2BDQA 2DFAA 3T0CA 1E0WA 3L4WA 3LDVA 3VFCA 4G8TA 3VGBA 5HWJA 2HRWA 3R0UA 3UR2A 4BA0A 1EGZA 3VX1A 2XSBA 1YDNA 2WPGA 1GJWA 4HMNA 1D3HA 2HQAA 3WK1A 6REQA 4KW2A 2VC9A 4M6UA 1VEMA 4GJIA 1E6QM 3SCSA 1PL9A 3ZVIA 3NQBA 4DI8A 2C7FA 3TTOA 3FY1A 5J5RA 3T0BA 3QPZA 2YL9A 1H61A 1RR2A 3FJ4A 1IXOA 2PMQA 3HFYA 1D8WA 3BK0A 3SCNA 4TIMA 5C55A 3W7NA 5A6AA 4DY1A 1KRCC 2J7DA 1FHUA 1TPDA 4NQ1A 1UW9A 4DUOA 3LSBA 4ZENA 1V77A 1PCWA 1DWIM 1TR1A 4PMXA 1WDDA 1D3GA 1RAKA 1S1RA 1XLLA 4O1FA 1CXEA 2WSYA 2ABAA 1WZLA 1RCOB 3N6JA 2QT3A 1W1ZA 3S1GA 5A2CA 1F3TA 2XUCA 1NTHA 1S3TC 4K2SA 3PVFA 2G41A 2O92A 4DO7A 1UJPA 4KH2A 4RKAA 3OG2A 3SJ3A 4RK8A 3WQPA 4QE4A 2EBNA 2FZ9A 3QW3A 2C1GA 3TLQA 3TC7A 4KFOA 3H2OA 1O4UA 4L56A 2A7NA 3L4VA 2Z4GA 4YCPA 2VENA 4NJKA 3NNTA 3SRDA 4DPPA 1SJAA 3BAKA 5EFDA 2VR2A 1VJIA 1OSEA 4CNPA 3VI2A 3CIVA 3M1ZA 1K4HA 3W25A 4HSHA 3U9IA 1DIKA 1S5VA 3B03A 2P5NA 4JNZA 4C1KA 1K8ZA 3WYZA 5AKQA 3GBDA 3VIFA 2A3CA 4O8AA 4FNRA 5D38A 1GZ1A 2W5FA 5FF7A 4A4AA 4K36A 1SFJA 4EPBC 3M64A 3IVTA 4QSHA 4XO7A 5C9XA 2NLYA 2Z24A 2NX9A 1KCXA 4O1DA 3PBWA 1YPXA 2A85A 2RKXA 1EGVA 1J11A 3EA3A 1YKWA 4S3GA 1Q66A 4AWUA 4PUNA 1Q6QA 4PSRA 1SO3A 3H26A 3CAKA 7XIMA 2ISWA 2NSXA 1O5QA 3RMEA 4CQDA 4XSLA 4DAIA 5E93A 3GU1A 4ZO8A 4CQBA 4BF5A 1R8LA 1UUOA 4NZ1A 2J6XA 1KNWA 1CZ1A 1MDLA 3ARSA 4ROPA 3SN1A 2B0MA 1TTJA 1HVQA 4BQ4A 4HHPA 3AYVA 4B2DA 4HYRA 1RSCA 2ATSA 1MW2A 5CC6A 3FAWA 2V5CA 3GFYA 3NIYA 2W6RA 1PXGA 4NSBA 5CG0A 4P8WA 2C16A 5DXYA 2YA1A 3APYA 3W26A 2FGBA 5IBXA 1E0XA 3LCXA 5CH9A 3EX6A 1NM9A 4GNVA 3E0FA 2WWDA 4ZFMA 3PTQA 3L65A 1WUEA 2RHGA 1ZENA 2PDFA 3NA8A 4WOZA 1NARA 3QH2A 2WKLA 4E4FA 3CL7A 1OX6A 4PTXA 2ZZ6A 3WIJA 2PU1A 3SIZA 1T96A 3FKRA 4JY9A 4N9DA 2Z1BA 3IVUA 3VO0A 1EC7A 3THDA 1TTQA 1ENUA 2AL1A 1K4GA 1AQMA 5CJNA 4G2DA 1KM3A 3IIVA 3WF0A 4AD4A 3LEPA 4Q8WA 1DIEA 4PUJA 4I9MA 4S3AA 2ZZ1A 4JTCA 4LX4A 1QOXA 1E15A 3BG3A 1MUWA 2QVNA 4JTGA 2PF8A 1DXEA 4NJGA 4MY1A 7ENLA 5K7JA 4D6CA 1SPQA 3POHA 2FZ8A 4GX8A 4YPJA 3W85A 1G6CA 3MVIA 3WF4A 1QWKA 2VEMA 1BGGA 4PMOA 3KVJA 5CPQA 5F1UA 1J8VA 1MUMA 2BODX 5IOBA 2CWXA 2ZWYA 1W5PA 3WZ0E 1I2NA 2AGTA 4DWSD 3USBA 1QVBA 1CEOA 5BNKA 5HXMA 4ZBCA 1GQNA 4RXGA 5CSUA 3H4GA 3UA4A 2PU0A 4WVXA 2OGYA 3WBEA 1BAGA 4DIAA 3SR7A 1ZBWA 4W9TA 1SGJA 3DKLA 4IX2A 1QASA 2P76A 5DX7A 1N2VA 3WLLA 3CXOA 2JGYA 2ZUNA 4U10A 1TX2A 4O1EA 4GH1A 4R33A 3S9ZA 1PX4A 1ZL1A 3HMJG 1KFCA 3RU6A 3WLTA 2YCIX 5I24A 1ZSXA 4LB4A 5LXXA 1XCXA 1P0BA 3MCMA 3SQSA 1NWUA 2IUZA 3MC5A 4AD2A 1XYCA 1QI0A 4KGLA 1VLWA 2G3MA 1FWRA 4PMDA 1EZ2A 3L9CA 1CXKA 1EO7A 4YTQA 4AYGA 4GISA 1H7WA 3MW7A 4A3UA 4ACYA 2C13A 4Q8UA 4TV5A 2DQXA 3TROA 3N2MA 3CO8A 4K38A 4I6KA 2AAAA 3WK0A 4CKQA 4MB5A 3VDGA 2VMFA 1VEPA 3WJXA 1DIDA 5DT5A 3M0XA 4O4WA 3STCA 1XKYA 2XVKA 3WFAA 2WXDM 5XIMA 4GIAA 1KFBA 1BHGA 4DEFA 1XIEA 2BVTA 3C2FA 3EOSA 4LAMA 2VZTA 3HQOA 2QKFA 4OZOA 2AQWA 5BZAA 1V0NA 1CGXA 4CQCA 1MMFA 4KKXA 1X6UA 3ARXA 3OW1A 4UQ9A 3AXHA 1FWHC 3WQVA 3E38A 1UKTA 1PKMA 3VMPA 4UTKA 3FHQA 2ON3A 3S1XA 4DN1A 2YB4A 3P8JA 1L6SA 3T1GA 2PGEA 4KWUA 3MV01 3ALFA 3GDBA 3GB6A 3TUUA 3RYSA 3HMCA 3WCZA 1PDZA 3BGAA 3V5FA 4ORMA 2XG9A 1ZJAA 4NU7A 1JEZA 3B9OA 1ISZA 1YXYA 2VRJA 1G7VA 2UZ9A 3LCFA 3L4ZA 4PCTA 3N3MA 2E5DA 1VJSA 2FQIA 3SGUA 3CTTA 2Q3RA 4LF2A 4S3KA 5CSYA 3FOKA 3QEZA 2GJRA 4DXVA 1PV8A 3CTLA 4NX5A 3EAUA 2CFFA 1W3LA 2R82A 4DJFA 3K2GA 1HW6A 2E3ZA 5LNUA 3NQGA 1XSKA 2O0TA 1KQYA 1UA7A 4GYPA 2HROA 2QJGA 2D0HA 5D37A 3AIQA 1QPRA 3T8QA 4CD8A 1ZPTA 3OZMA 4FX6M 4WHBA 2Y5SA 4UTJA 1NQKA 3QLDA 4UQCA 2CETA 4AY7A 3NDOA 4Z2GA 2X0YA 4FNPA 2CCRA 4C91A 2VC5A 1YNQA 4ZO7A 1GHRA 1ZJBA 3CMGA 1VFMA 1EJRC 1VBUA 3MPGA 3RGTA 5EA9A 3VXGA 3K8MA 2OXNA 3WJYA 3WDRA 3RN6A 4KCWA 3M47A 1ZRQA 1PBGA 4LUJA 4XO6A 1IR2A 1ECQA 2WMJA 5FKYA 1KLYA 4UNLA 3S47A 1FKXA 1OT1A 3WLNA 4MY8A 2XWDA 2IXVA 2WZIA 1Q6LA 4ACZA 4GRSA 3LHZA 2WSKA 4YL2A 2PBOA 3VIOA 3TTYA 3C6CA 4L1WA 2P0IA 3QHOA 1VFFA 3G0UA 3VTRA 4CD4A 3CUXA 2GQ9A 3W02A 2GPTA 2PC4A 3LTYA 4PCFA 4HYWA 3OVGA 2QJNA 4WDUA 1UR0A 1ZS2A 4QS5A 4E2VA 4QX4A 2WOQA 4M3PA 4U28A 1ZU8A 1T99A 3CAQA 5EL1A 3ITYA 1DXIA 2A3EA 2F2KA 4PTVA 3ID7A 2YFOA 3EX4A 3B06A 5ABEA 4S2BA 2PODA 2V81A 5FF0A 2FFIA 1XCFA 3NEVA 3AZRA 4J3WA 4E4PA 2Y7FA 2PAJA 4WIWA 4DHGA 1U30A 4IIGA 3KW3A 4OUIA 5C7VA 1TWSA 1I9CB 4A8IA 2CW6A 1I0DA 3A47A 1UKPA 4C60A 4US5D 1CGTA 3GTHA 2C79A 1RZMA 2Q3OA 4ONVA 2YOCA 1XPYA 2Y4SA 3AISA 1JCNA 4GXMA 5CZSA 2E6FA 4R9OA 1WDQA 3L4UA 5HAOA 2EPNA 1TPC1 1BRLB 4WXYA 1TKKA 3CV2A 2HV5A 1XUUA 1EF3A 3T9PA 4Q22A 2FB3A 5GJNA 3L12A 2ODOA 4FF5A 1PUDA 1KKRA 3P5ZA 3VPLA 4IFRA 3F4CA 1OFDA 3W2NA 3WJZA 4PMVA 3QSTA 1BXCA 4KFPA 2YGYA 6CGTA 1UA3A 2ACUA 4ZEPA 1KQZA 2VCCA 3T07A 4EXBA 3GS6A 3UPMA 3GAYA 1FP8A 2PD5A 3TA9A 2GL5A 4U31A 3WQ5A 3KTXA 1POJA 3HGOA 2WNZA 2XN0A 4QM1A 3LSCA 2MANA 2OX1A 3UESA 1MRQA 3SUTA 4ZODA 1ADSA 1QRQA 2BY3A 3WQ4A 4HHMA 4RR4A 3GY1A 3VILA 2ZA2A 1SW7A 1TV3A 1NDVA 4PODA 5CG7A 3ZJ8A 4F40A 2OZ0A 3N2XA 1H5YA 2DVUA 1V7YA 1RLDA 1NF0A 3MUCA 4FEZA 3UJ2A 1P0EA 1UR3M 5CSRA 2OEMA 1O1ZA 1PIGA 4F0SA 8XIAA 3OGSA 4OKDA 4GQGA 4UOQA 5I02A 2DJLA 4C6CA 3BLPX 4WGHA 3CGTA 5AHIA 4MM1A 3VABA 1LYXA 3FAXA 2VR5A 3USZA 1AL7A 1LRQA 3GLCA 3KP1A 3LENA 3BLOA 1LUCB 5A6BA 4Z08A 4AY1A 2PF0A 3H2EA 3UXKA 2DSWA 2YBTA 1GONA 5HQLA 1KWGA 1W17A 3AUJA 2BS9A 3UJEA 1K03A 2Z6IA 4HBKA 4PBEA 1XIFA 3DUGA 3MU7A 3E1F1 2UY5A 1ZJIA 3N6QA 4HNOA 2EJAA 3S6DA 3V1PA 3UXDA 3PZMA 5D4YA 2BLEA 2BP1A 2I57A 2R8WA 3QY8A 3SCVA 2OELA 4JZ5A 5D30A 3LB0A 1Y65A 4JIIX 1K7EA 3VGGA 5M2FX 1FH8A 4AWEA 1SZRA 2F61A 3QVQA 3ABXA 5I03A 1TVNA 4QQUA 2PLJA 3G8EA 3EEGA 1T6MA 3QN3A 2ZICA 1XL9A 2P50A 1E6PA 2CLOA 3D0CA 5LSMA 1NQ6A 3NVDA 3N6HA 4UFKA 4DB7A 4PC8A 4H3DA 4DI9A 4MJZA 4UXDA 3C0SA 1AMKA 4XQ6A 3KEHA 1ME9A 4JTEA 4AZ7A 2TRSA 3PWIA 5TD4A 4O14A 1KO0A 3DENA 4FP1A 4GKLA 3TA6A 3CZEA 5EKYA 1M41A 2D1ZA 1C8VA 2QCFA 3A4JA 2PP1A 3COTA 1UZ4A 2ADAA 3TJ4A 4ZOAA 4Q8OA 4J27A 1ZALA 3KCOA 1MFVA 1RK6A 3MO7A 3TTEA 3WH9A 3VIKA 5LNVA 4CN6A 1YX1A 5F2IA 3IJLA 3DG6A 2PDWA 4BEUA 5LXEA 4TVUA 1NP2A 1QW9A 1K8YA 4Z1YA 3NZQA 2QAFA 2FTWA 5G1MA 1EXBA 3VAVA 1OG6A 4PMQA 3WENA 5CCZA 1SO4A 3VKBA 4ZZ9A 1CWYA 4IIEA 2JIEA 3QMSA 1MDRA 4AZ6A 3IV3A 4F9JA 3KRZA 5KZMA 2EF9A 4G1NA 3TAOA 4ATDA 3CYVA 1YDYA 2AAMA 2QMJA 4GVFA 3SCPA 4DJDD 4UZUA 5JH1A 3M0HA 4DQWA 2HEJA 1TMLA 2GJLA 4RDWA 2GSEA 2AQVA 3PPHA 1A0CA 4ZE4A 1Q2SA 2E9MA 1JYXA 4K8EA 1B2YA 4FX7A 4NZ5A 2HISA 1OD0A 4YLWA 4FK9A 3NR0A 6TIMA 5H8PA 1DWGM 3W00A 4QG6A 1OG0A 2V68A 4ECLA 2VX6A 3SUSA 4N6FA 4AZIA 3WY1A 3GR8A 1E6RA 3QV7A 1F73A 3VU2A 2X42A 3KOZA 3S2CA 1Y5XA 1AQHA 1J0HA 3ECQA 2IXUA 1MXGA 4G7EB 3EPMA 4K7YA 4DM2A 2FH6A 2JBMA 2WHKA 2WMKA 3KFTA 4AZCB 3A6OA 3KZSA 3KL5A 2F9RA 4FXFA 4D6JA 1AD1A 1KXQA 3N19B 4G5DA 4QTGA 1NAL1 5HANA 1TZZA 5M03A 3A24A 4WK9A 3CL8A 3RM4A 2BGNE 3DOPA 4DM1A 2Q01A 3W1LA 5FOOA 2ATMA 3IUIA 4MAZA 1KM2A 1KRMA 4S3FA 1SO6A 1YW1A 1GVYA 1XF0A 3G1VA 1J2WA 3PB2A 1LUCA 3ARYA 1NDZA 2Z2UA 2V63A 4PRWA 3SDOA 3TJIA 1UG6A 4AH7A 1E3ZA 4Q4MA 3PAJA 3GG1A 2QPXA 4C90A 4CD5A 1UZ1A 3LI1A 1L6YA 2E0PA 4B16A 3R8GA 2FTPA 3M0VA 3PNUA 5CPNA 4B15A 3AQUA 1VFUA 3T4WA 3LCIA 3CB8A 1C8QA 1L2QA 3P84A 3CHEA 4WGXA 1P0KA 3D3AA 4JTQA 2CZDA 2QXWA 2DZXA 2E7FA 3J7HA 5MF5A 4NX0A 5D2VA 2J25A 4W5ZA 2QLYA 1VBGA 1TTPA 3TQKA 3GU9A 1BEUA 3ZS4A 2YZ5A 4F48A 1G4SA 3MCNA 4H4IA 4QDMA 4E8DA 4RNHA 3GWQA 1TUXA 3W81A 4RNIA 1WV2A 3CB3A 4Q8TA 4AAJA 2X2GA 1GNXA 5GNXA 1TFVA 1KV5A 2EAWA 2ZBTA 4X3ZA 3KL3A 5TIMA 3GTXA 1JULA 1ZLPA 2RAGA 3VKDA 4LJ3A 1RH9A 3ZT5A 5DLCA 5BW6A 3FNDA 4O1CA 4PH6A 1VCGA 3M43A 1XIHA 1OJXA 5D04C 1UBSA 4PGLA 3SCUA 2YDAA 5EBAA 2ZXQA 3QZEA 1R3VA 4W93A 3VOHA 1X1NA 4ZQMA 2I17A 3WNMA 2QUMA 2XZ9A 2GSHA 1D9EA 1C8YA 2FH8A 3IIXA 1UKQA 1KGWA 4DJFD 3W6MA 4HZ8A 1KA9F 4JN8A 1JVNA 4JIPA 4NJJA 2QS8A 2WC3A 3NL5A 1I8JA 3WX7A 1MEHA 1I2QA 1HKIA 3CH0A 4IUOA 2VZVA 3LGDA 3AIVA 2EGZA 2CBUA 1YIXA 4JTTA 3FSUA 3W29A 3ES8A 2NWSA 1LRNA 2OLSA 1V8EA 1UUMA 2J7BA 2D22A 2JF7A 3EYPA 5EU9A 3LXAA 3GNOA 3UCQA 4ZQNA 5FEPA 3KUMA 4ZQCA 3FJ6A 3U2EA 2INEA 3F1QA 3NOEA 1UWUA 1FHVA 4W7WA 4Y2WA 5CC5A 1HGYA 4QIUA 1VJZA 5CAKA 4M1BA 4QCFA 4AX6A 4EIVA 4DO5A 4BS0A 3HURA 1JDCA 3QHMA 5FSDC 4WDXA 4XBJA 1AVAA 3FN9A 4DUXA 8XIMA 4IQEA 3BO9A 2ZDSA 5H6HA 4NUWA 3XISA 3TC6A 3C3UA 3CQ0A 1V03A 3E96A 1CYGA 4GXWA 2I5QA 1E4IA 3S5NA 4MY9A 3E0LA 3S6OA 2NUXA 3GBEA 1EFZA 4BF7A 1IWBA 4AHQA 1F6YA 2QUUA 3ZJKA 1BSIA 1AW5A 4GNJA 2X7WA 5HMDA 3NL2A 1GKQA 4MWAA 1GOKA 4I7WA 3W73A 3O8AA 1ZJHA 3NQFA 2GYIA 1SFTA 2GJXB 1X6NA 1FWJC 4M6QA 1X39A 4ZMGA 1ONWA 3W84A 1V51A 1TQJA 1O6IA 1XICA 7TIMA 3F2BA 2DZAA 2JEQA 3BQ6A 2A4AA 1Q7QA 3R13A 4WDWA 3QGAC 1TWZA 4K1WA 4LY8A 2O9PA 3U7BA 2QDGA 8TIMA 3F2CA 3P6LA 3S46A 5C54A 3GDKA 1O68A 2QF7A 2HBXA 1XGZA 3W2UA 4U2ZA 1IEIA 3BV4A 1U5VA 4CU7A 1H7NA 4HB7A 5LNSA 4QBXA 3B4UA 3N34A 3I4KA 4GZJA 4M6VA 4C1NA 1R30A 3BJFA 1TVLA 1U5HA 2TSYA 5CBBA 3AHVA 1H49A 4WOQA 3V7PA 4O13A 1DWFM 3FXGA 5A8QA 4NL1A 1L8NA 1O5KA 3C4UA 5IRPA 1VLIA 3CEPA 5DQPA 2PTZA 2YCJA 4W89A 1ZQ5A 1L6FA 1W1A1 2NXIA 1OF8A 1XDMA 4W4QA 4AW7A 4KWWA 1NDYA 3S3GA 3TJXA 4TV6A 2R24A 3QXBA 3TYDA 4PB3A 3UYCA 4ERGA 2V9DA 1XLBA 2QCDB 1NOFA 1E55A 1TMQA 4HPGA 1G4EA 4GVGA 1FFRA 2VFEA 3NYDA 1MNZA 4IUGA 2FTYA 4IISA 3PZVA 3CWHA 3KL0A 4OBRA 2VHLA 1V3HA 1NU5A 2J9ZA 4RE0A 1GG1A 1L6WA 3VZYA 4DO6A 1IGWA 1KV8A 1KTBA 3ICJA 5CJ5A 1WOBA 3BARA 3FVDA 2BFGA 4KCVA 4YU1A 3I6RA 2OODA 4LC8A 2VFIA 3T08A 3CHCA 1VKFA 3I68A 4JXCA 4JDYA 3U7VA 1R5YA 2HS6A 3UZYA 5FEZA 3Q45A 3PPFA 2PWUA 4V1YA 4KWOA 3L68A 3JR2A 2DZUA 4YS1A 1QR7A 3E2SA 5B80A 1IEQA 3N14A 5AYZA 4C6BA 4C6NA 3TP4A 4J3TA 4DUVA 1ZHAA 1P7TB 2WMHA 2ZZ4A 3CZLA 4H6QA 4X0NA 4B9ZA 1XIGA 4JS3A 1S1PA 3KRUA 5LZLA 3K30A 4GE8A 4I8DA 5D2TA 3W01A 5A6BD 1TV8A 5I78A 2NQHA 5M1TA 3GNRA 3GG7A 5DELA 5I3JA 1NEYA 2WQPA 3R11A 1HJUA 3GVGA 1E9IA 2G37A 1Q45A 2VD8A 1B3VA 1CB2A 4AC1X 1H5VA 1JG9A 2OWCA 5G2IA 3ME3A 2QDHA 3ZLGA 2XGIA 4AEOA 1LP6A 4DJEC 1SO5A 3A4WA 1YDOA 1YPFA 4S3JA 1Q6CA 4BK9A 3NGJA 3P2VA 4RLIA 5AHMA 2GUYA 2PS2A 4S3DA 2BMBA 1W9BM 1SU5A 1Y8BA 5GPRA 3SJNA 4KRZA 1X8FA 2GJXA 4YVXA 1EP2A 3GYCA 1H41A 3RNDA 3CO4A 4EWND 3N29A 3B0VC 3CC1A 2XIOA 3TNBA 1ZCCA 4NZFA 2ZWZA 4AZ5A 1GTEA 3PPGA 4A22A 2DEPA 2QCEA 2V8ZA 3OG3A 1GHSA 4HJWA 3EKLA 1M01A 1NP0A 4UC5A 2Y8UA 4P61A 4JL2A 1TO3A 4HP5A 1NWSA 3WFLA 4H2HA 2P1FA 2ZFAA 3ZJ6A 1GZJA 1FP9A 2OCZA 1SFSA 2QCNA 4V2XA 3AXIA 3EDJA 4GUJA 3DG3A 4CCEA 1YPIA 2P3ZA 3VGEA 1PZ3A 4JYEA 3G1RA 4QRNA 1SZEA 4MKNA 3C0QA 4F9DA 4UFJA 5KZEA 1XC4A 4GKTA 3BLFA 2JE8A 5BMXA 3Q94A 3VOJA 2Y1HA 4AHPA 1MQQA 2PDKA 4HU0A 1RK5A 2V2HA 4H9YA 2O9OA 5IBXC 4QEEA 1PX3A 1TUFA 5A6KA 4O8RA 1Z44A 3TQ0A 2DW7A 1EJUC 1S2CA 2BHYA 1ESWA 4EXQA 4XIMA 3U4AA 2PCEA 5KZDA 3OQ8A 1BXNA 2Y85A 1YDVA 3MUXA 1MEIA 3SFKA 3ABRA 4YIWA 3TZNA 2EPKX 4ZE5A 2QCDA 3VC5A 1XI3A 5JBEA 3QC3A 3ANUA 3ZT7A 4XZHA 4CNUA 2WBKA 3ITVA 4P8VA 5TAOA 3B04A 4LS2A 3WO8A 3TWAA 1E43A 4QHRA 3S1VA 1ZTVA 4QDWA 2VCAA 2QJHA 5K9DA 2VRKA 1FHLA 3GXTA 1LORA 2GVEA 3LHUA 2CITA 3VIPA 1KM1A 1XH0A 3GW0A 3VZZA 1JDAA 1CCWB 2I56A 1DJQA 1POKA 4HK7A 1F3WA 1PAMA 3EWBX 3W22A 1A5AA 3WBYA 4HOZA 3QOMA 2FDSA 3EB3A 1UD6A 3AMKA 4QR6A 2EXOA 1QOQA 4D2JA 1EX5A 1FWNA 2HS8A 2V67A 1LDCA 1R9YA 3GSMA 1GQIA 4JN7A 4WLCA 3KE0A 1JPMA 3NQMA 1UMLA 4HPNA 4YMZA 5BOFA 3KVKA 1L9WA 1P7TA 2J7EA 3MUZ1 3QRHA 2REQB 4NT0A 2WMIB 3N2CA 4WY0F 2DY3A 4M80A 1SJDA 2DT2A 4EPEC 5CGMA 2Z1XA 2ZZ3A 2VFHA 4OBSA 1WKEA 2F2HA 2HJPA 3L4YA 5KZ6A 3G3DA 5ECUA 4DZHA 4PA8A 2BOFX 3GM8A 2YA2A 3VIJA 3DN5A 4YWSA 1CXLA 2GFTA 2I9EA 3RFAA 3OJGA 2WVSA 1A5LC 4UWMA 2BVWA 1OBAA 4LCSA 3WLQA 1RD6A 4HK6A 1XDLA 2WPBA 5IFTA 2RDWA 4Z2JA 4LS1A 4M81A 3R8HA 1XYMA 2OLAA 5EMLA 4GC3A 4PZVA 3QF0A 2QVHA 1J0YA 4QXIA 4JCLA 3R4IA 3U48A 3NG3A 4LTSA 5G1TA 3TE9A 1WKDA 3LRMA 4LGXA 3IJ8A 1W91A 1CPUA 3A4AA 1QI4A 1TCMA 1MW0A 3STPA 2TYSA 3TCSA 4AIOA 5C70A 4AEFA 3ELFA 3LGEA 1RBOB 1CI1A 3CM4A 2Q02A 3PTDA 4PSPA 4OU1A 1AJZA 3WQCA 4JOMA 4TUFA 3CZ8A 3MA8A 3TYZA 4QJ5B 2QMKA 1TV4A 4GA8A 5HNUA 3LN3A 3TAKA 2YSWA 2BXZA 1WNOA 3E2RA 3O05A 3LHWA 2E68A 3RXZA 3U5UA 3V0UA 1G7UA 1KCLA 2XH4A 3BTNA 9RUBA 2Y2WA 1JZ2A 3QY6A 1G5AA 2V5KA 4HMCA 2BVDA 4FS9A 4GQRA 1ZAHA 4KIRA 2WCSA 1HL9A 1LT7A 1EDTA 3EMCA 4EF9A 4Z1DA 3WQ8A 3B8UA 5LIYX 4W8AA 5EBUA 2VEIA 4IFKB 2ZUUA 2ZX8A 1S2WA 1CECA 3GXDA 3LBOA 3V3WA 1ITQA 4WJ8A 1TWIA 1YQ2A 3BMXA 1MUCA 1X98A 3I7QA 4XUGA 3TVAA 5F2LA 3NDYA 4B5VA 1H4PA 3FDKA 2J78A 3TYUA 4UUIA 1OD8A 3O63A 1DTNA 1TRIA 4K37A 3D5HA 1MW1A 4UNIA 2VFDA 5D33A 1XLMA 1BKHA 4GX9A 4M29A 2PZNA 2ZXBA 2IW0A 3FGCB 1FWDC 4MB1A 3TR2A 3BURA 1MQRA 5LHFA 2ZXAA 4LAOA 4TX6A 1VAHA 2FMOA 4ROQA 3G18A 3TH6A 5H8MA 4L4LA 3H24A 1KKOA 4R34A 2ZUVA 4HGXA 1AJ2A 4AD3A 4B9YA 1DL3A 4RV3A 4H2CA 4WY0B 2FJUB 2QIIA 3GTNA 3URAA 4NY2A 4KWVA 1K7FA 1SSDA 3MI6A 3SGZA 1W3HA 4GACA 2WK2A 3C8FA 1PIFA 4YCOA 3ENLA 1PO9A 4LVDA 1XS2A 1DPMA 1RJQA 4E3VA 3TNOA 5B7YA 1ZAJA 5LA0A 3WF2A 4BKNA 1XD1A 2XZ7A 3GVVA 3H4XA 4O15A 4LEQA 4B3LA 1RUSA 1JZ5A 2CNCA 2ZQ0A 1B3YA 2HZGA 1OZMA 1JCYA 1ISWA 5KITA 7REQB 4PRRA 1YTDA 2BHUA 3WD2A 5MHBA 1I0BA 1QW7A 2QV5A 3TQPA 1E56A 1QJWA 3WEOA 5LNRA 4DBSA 3MV11 1Q6OA 4POCA 5BOOA 1JUEA 3UXIA 1OEPA 4OIFA 2D2OA 3T6CA 6PTDA 1KXVA 3G1HA 4S1FA 4E2BA 4F3HA 3KCJA 1DJIA 1CT5A 2FIQA 1QI2A 1TV5A 5I6SA 2A0NA 4A8RA 3BAYA 3I6TA 3BMWA 4PFMA 1TA3B 1V3KA 3S9IA 3YPIA 1AQFA 2Q09A 3BCFA 1I1WA 2WJEA 1LQAA 1I2PA 1OYBA 4XD4A 1OWQA 3SI9A 2D0GA 4FLOA 5EB8A 4HTBA 1RHCA 4DZIA 2POZA 5A6LA 2DSVA 6XIAA 4LYQA 3EKZA 4R9XA 4Y96A 1UWAA 3QMRA 3SEPA 3AHYA 3UA3A 6ALDA 4PFHA 2SFPA 1WBJA 3QPYA 1LL4A 5JIPA 4JCMA 1L8PA 3VCCA 5IDZA 1XWYA 5AHFA 3GKFA 2DIJA 2OB3A 1KR1A 1FRBA 5DMLA 5JXQA 4DWSC 4X63A 1UWQA 3PBUA 2NLIA 4QAWA 3VOCA 1I2OA 3PN8A 2V6AA 1G9HA 2DZWA 2GJNA 1U83A 1W9VA 4OV9A 4IFKA 1W3IA 2X0HA 3GNNA 1PTAA 1S2TA 2KZHA 3GFXA 2HMCA 4DLFA 3FV9A 4UQEA 1EA0A 1H51A 1R3SA 2ZIDA 4RL3A 2Z1SA 2EG8A 3W7CA 1QOPA 1H60A 5I00A 4KEZA 1CGWA 2W62A 1V5XA 3TOPA 3VD7A 3BCJA 1XLDA 1PZ2A 1AMYA 1Q4WA 1A5NC 3MHGA 2EG7A 5JH2A 4AVOA 3EEZA 4IXXA 2HXTA 3EMQA 3QYQA 1DTUA 2NX3A 4DO4A 4CD7A 3BANA 1GYMA 4X0VA 1UD8A 1E1CA 4TX9A 5A2BA 3FGCA 4RX0A 2JF6A 1JQXA 2NWRA 3LNMA 2Y8KA 5IFPA 1YBQA 3M46A 1VYPX 2TODA 3ATZA 4X2RA 1BTCA 3CV6A 6XIMA 1J18A 3ZO9A 3HGJA 5DN1A 2A6LA 3BE7A 2YDQA 4MLRA 3WUFA 4FALA 3DI1A 1YYAA 1VENA 2XGBA 5CXPA 1DQXA 3ZLFA 3IEBA 3VNZA 4AWTA 2CLLA 2D0FA 5F4XA 1DV7A 1WAWA 1XM3A 2HSAA 4WY0A 3LPPA 2A79A 3THQA 3T09A 4MJ2A 1QNOA 2FZNA 3FA5A 5CAHA 5A94A 1OFAA 5ABFA 4HA0A 3MANA 1G01A 2QJIA 3RLHA 3U2CA 3WH8A 3IVSA 4JTSA 3L67A 1UZHA 3N04A 1QNPA 4M0XA 1WB0A 3PFMA 4PR4A 3W7JA 4CU8A 2BY1A 1QFEA 3PBYA 5E6ZA 2O56A 1P6BA 1AODA 1ONEA 3VNKA 3F4NA 1FDYA 2OOGA 4JBRA 4FA3A 3VIGA 7REQA 3DECA 4D8ZA 3LZ5A 4DXKA 1ZCOA 3UWUA 1H1ZA 2C14A 1SVDA 1ELSA 1JGMA 3OBAA 5E1QA 4FSAA 3CK5A 4M19A 2X05A 4A2SA 4LYRA 4O1AA 3ZXWA 2HE8A 1WP6A 4B5XA 3R6IA 4QG8A 4EXAA 4JKLA 1V0MA 3H54A 1TA3A 5GNYA 3K4DA 4HA1A 4S2CA 3VOFA 4AC7C 3U0HA 5BU6A 3UR7A 1VP5A 1E0VA 8RUCA 5H91A 1LTDA 3M0MA 3N73A 4REQB 1KLZA 4PULA 4AY8A 5C9WA 1LZOA 3RMJA 1I60A 1TREA 4LNCA 5A6SA 2O9TA 5DCEA 3AHXA 1SZFA 4XZLX 2Y88A 3OOQA 5FJPA 4HMDA 2X1TA 5A2AA 1GGOA 4YYCA 1GPFA 3DHUA 4LUSB 7A3HA 2XJ7A 5D2YA 1B3WA 4TXEA 3AIEA 2YDRA 4PMNA 2R1NA 1UWIA 3RR1A 3BSMA 1JFXA 3B0YA 2X1RA 2KAUC 2R14A 1X38A 2GVLA 2BZNA 5K2ZA 2W61A 5I3KA 3TN6A 1W31A 3MJYA 3BAIA 2G0WA 5HWMA 1Q6RA 1IF2A 2A21A 1WXZA 1J6OA 2H90A 3W6LA 2E5CA 3UZXA 3V75A 3LK6A 2ZX9A 2O9RA 3DIPA 3MBDA 4JX5A 2Z1VA 3EWZA 2P8CA 2G5WA 3ZQ9A 3ANVA 1AA1B 5BCAA 1B30A 3HQ1A 1HTIA 3QMTA 3MYPA 5DY3A 4J5NA 1NWTA 1T40A 3WDQA 3RRXA 2OFJA 1O95A 1QMLA 3NSXA 4XK2A 2G96A 2XIMA 2F8QA 4A21A 5DRIA 2ZE0A 4I7UA 3H7RA 4UTHA 4TMCA 1SJCA 4F2BA 4JFTA 1LL6A 4GQQA 1SM9A 4LU0A 3IJQA 1TB3A 1GYLA 1AH3A 4UCGA 5FAGA 2X16A 3M7WA 3W1MA 1IIGA 3U2ZA 1QK0A 3W7RA 1YTKA 1WX0A 3E12A 3B0PA 1DQUA 2WVVB 2W79A 4O19A 3G1FA 3WH7A 3EPNA 2ZX6A 2L5HA 4UTFA 1V4YA 1U1UA 5HUPA 3I65A 1F3EA 4Y9NA 5LIXX 1E1EA 1OM0A 3GU2A 1AUSL 1RA5A 3M9YA 4KETA 3LLFA 4UTTA 4MZ8A 1KTNA 3GRIA 4C7GA 4LAZA 3E2VA 1OIFA 2YDSA 5JVLA 2PWDA 2OQYA 3NZGA 3TN5A 4MUPA 4C6MA 3QV6A 1BWVA 1E5NA 4HOWA 1RVKA 3PZQA 1PZ1A 4Y8FA 2HNEA 3LA4A 1XG3A 1E6ZA 1EWEA 3TU9A 1Q85A 1E0TA 4OJYA 3UQNA 3E0VA 2P53A 3UWVA 4BQ5A 3OBKA 5EGRA 3QHNA 2XN1A 4O52A 3LM3A 5D9PA 1I45A 1R3TA 1TTIA 1IT8A 2A3AA 2RGLA 3C2EA 3WNLA 1MXDA 4O10A 3RITA 3NQDA 3ZYZA 2EG6A 1NOUA 1S39A 1VPQA 4XAFA 1UKSA 4QLJA 4GYKA 1QCWA 2BNJA 4GYJA 2VJXA 2OYKA 4IMDA 3FX4A 5FL0A 5AC4A 2WNNA 4D6GA 4IQLA 3AMCA 1SUXA 3SO7A 3NDZA 4CNTA 3WD0A 1B9ZA 3RLVA 4KS0A 2XH2A 1CLXA 2PP3A 3B9EA 2ISVA 4CNNA 1GQJA 3VK5A 2C1HA 3W38A 1XC6A 2VVSA 3ARTA 3KP0A 4PTDA 1VH7A 1Z32X 3L21A 1AFSA 4L6DA 1WOAA 2W92A 1HN1A 1C91A 4AZHA 4REQA 1FWFC 1TPEA 1JZ6A 4MYAA 5CPMA 1S5WA 2YCLA 4CQ8A 4WUIA 3LLXA 1LLOA 1H0IA 3E0IA 4IF2A 4EPDC 1OYAA 4F0HA 5C9RA 4LUSA 4INFA 1ONXA 4IT1A 1XLAA 4L64A 4ZQPA 4I90A 4NIRA 2B7PA 3BC9A 4JFWA 3S5ZA 1EIXA 1V6VA 2CLMA 3S8HA 3L0KA 3B0UX 3RPTA 4QFUA 3N12A 4H83A 3W1QA 4PEKA 4NAEA 2G8ZA 5I77A 4HSOA 3MQTA 2C8NA 4IMEA 3OGRA 4NI8A 3F03K 1GEHA 2BOEX 4B5UA 1Q13A 1J0IA 3WBXA 1HJWA 2RDTA 4ZTYA 1HVXA 1UD4A 4C65A 4I9AA 1FDJA 4F0KA 4Q32A 1V6TA 4GXPA 3GH5A 3BW4A 4P8XA 1W6TA 5D9OA 2NUYA 1XP3A 3EB2A 1S2VA 5LGXA 3E74A 3LXCA 9CGTA 4O1BA 4LH8A 4XKMA 2E25A 4AEEA 3S1WA 3P82A 1GVIA 1BQGA 1TPUA 1JZ7A 1R87A 4JTLA 3UWYA 3U57A 4KWSA 1KD0A 2AKMA 3PANA 3UPBA 5I2UA 3UFYA 1BYAA 3ALGA 1UR2A 2OKTA 3JRKA 3STFA 5EMKA 2Z1KA 1JPHA 1QNVA 1IXQA 1V6UA 2J4GA 3H12A 2NQJA 3PZTA 2WVVA 3SFWA 2OZTA 5L9FA 2X30A 4JYDA 1LBFA 1R38A 2A7RA 4GGHA 1OX5A 3H4WA 4GH3A 3VM5A 3PY2A 3R94A 4H9ZA 3TR9A 1EP3A 2PZ0A 2UY4A 2WHLA 4L61A 1W2PA 1H7PA 3EGJA 1RA0A 4LANA 1KFWA 5T8GA 4CN4A 3GG0A 5D9NA 4BEQA 2VFGA 4WSHA 4F2UA 1JCJA 4MYXA 1BWKA 2W66A 5XIAA 1M7XA 1OF6A 1C93A 3PNZA 4FR6A 4GBDA 5FI8A 3GHRA 2EPLX 1XLGA 3REQB 3PBGA 3QKEA 1IEXA 2V30A 3O06A 5CPSA 1HGWA 1ONRA 1QU4A 4PTNA 4UIOA 5A6TC 5BXPA 3MO4A 4K1GA 3UNTA 3UG3A 1FXPA 2OZ3A 4F0RA 1GOOA 5I5RA 1EHAA 4LS0A 4CEXC 4GOAA 2ZUMA 5PTDA 3WL1A 2CBVA 4W8LA 2GOKA 4E2OA 3V4BA 3W7LA 4MTVA 4ZVJA 4ZSUA 3WK3A 2QUNA 2VFFA 4XTDA 3B8WA 3VMNA 1NWRA 4NXKA 3HB9A 3ZWTA 3SRKA 1H63A 5A8PA 2C6QA 3CMJA 3S2NA 1GQLA 1E1FA 2HVMA 3ZR6A 1G69A 3R5EA 4HK5A 1H50A 4W87A 1J79A 2XYLA 5LIKX 4KRTA 2ZA1A 5DCDA 2GVGA 4GO9A 3M0ZA 3W7MA 2ONEA 3FA3A 2GGEA 1XIMA 3N9SA 1C7TA 4JQ2A 1Z48A 1VQTA 3LV5A 1AZ1A 5EMUA 3FSTA 3IUDA 3DBNA 4N6EA 2FLIA 3WSUA 1XBZA 2DZTA 2Y0FA 1B90A 5FJOA 3HU7A 1A5UA 2XHYA 3WUBA 1B1YA 2E9BA 4MDPA 2DPEA 5DMYA 1D7FA 2WVUA 4U3AA 3CT7A 3HV9A 5FAJA 4KBXA 1TG7A 4QLLA 5AY7A 3C3NA 4J3SA 1H1NA 3FYOA 4NKCA 1JUKA 4BWLC 3WELA 1Q6FA 2DH3A 1HX0A 2RFGA 1H7RA 2EPHA 2PEVA 2XDFA 1YHTA 2CLEA 4LRTA 7CGTA 1DJZA 5IHSA 4ORIA 5HQEA 4NASA 1OYCA 3CV7A 3IJDA 4JIHA 4XKYB 1CNVA 2OSYA 4NNAA 2WLZA 4LC6A 4Z2KA 3RJXA 2GQAA 1J12A 4BFAA 4NJIA 4MDOA 1OINA 4JX4A 3M44A 4X9SA 3MWCA 4Z42C 1UASA 5B7ZA 4J28A 1B54A 3NL6A 3UG5A 1ICPA 4CU6A 3N1AA 1M6JA 4WKAA 4C7FA 2WC4A 5HPOA 1QNSA 3DBPA 2DVXA 2W9MA 3KCLA 4HNCA 1JL8A 5TF0A 3FEMA 1EJXC 1K7XA 1XBVA 1EB3A 2FB2A 3M5ZA 5G2HA 1S2UA 1F2JA 1ME7A 2XIIA 3WQOA 3HBLA 4DJEA 2ZA3A 1G1YA 1B0IA 3RF9A 2QF8A 3UJFA 1WXJA 1RCXB 2CLIA 5D09A 4YN5A 4O54A 5AYIA 1ML1A 4LB3A 3RO6A 3U3HA 2ZZ2A 3GNDA 2JQXA 1R9ZA 1TR9A 4MG4A 3NEHA 3AIWA 2C19A 2YB1A 3T05A 1PE1A 1WKYA 4WZHA 3V5CA 3BAXA 4S3BA 2GGJA 3NVTA 5HJLA 4JNYA 1S5NA 3JZEA 3V0SA 4KEMA 3VC6A 2XM1A 1GOWA 4J40A 1Q4NX 3CUGA 2WMGA 3MJMA 4I5UA 4UNKA 4UTUA 2WHMA 2F38A 3W4RA 4ZOEA 4M82A 3REQA 2F6XA 3GUWA 2QUVA 4FNQA 1SQ7A 1EH9A 2J9YA 2VC7A 4DBEA 2VI0A 3LPFA 2VWSA 3H55A 5AYXA 3AOFA 2BX7A 4LCRA 4FR1A 2DSKA 3WH6A 4GFSA 4HPHA 5I07A 3W07A 4LV9A 2PTXA 2EPOA 2PRHA 2X1SA 5SWUA 1N82A 2FGZA 3BG5A 5A8OA 3TDFA 4FIRA 1V0KA 1IHIA 3MZ2A 4UR8A 3T7VA 1E70M 2PCQA 2HTMA 4Y9PA 4PYSA 3N2BA 3STGA 3LM7A 2ICSA 3WUEA 1HFBA 1ZY9A 4D1IA 4H41A 3MKVA 4PEEA 4A05A 2PDQA 2DU2A 1DHPA 3V36A 4GUIA 3HM7A 4LBUA 3LRKA 1R2TA 3VD4A 5F2GA 4B90A 3AFBA 3LQGA 4D6HA 3M0KA 1CXHA 4EAMA 5FIPA 1XINA 1PYMA 3MKCA 3AS0A 4XSMA 4DYKA 4PUDA 1YADA 1JR1A 3CQHA 2B4GA 4MWAE 3BVJA 4WKHA 2G4JA 2XN2A 3AIUA 3A3HA 5D2WA 2DV0A 1VFSA 3UY7A 3S5OA 3UR5A 4GC4A 1VFLA 4IGNA 2QGYA 4YXGA 2RH9A 1R6WA 4IMCA 1PVNA 4ZR8A 3VFLA 2BXVA 2IKGA 3BXWA 4NILA 4WSJA 2J77A 3DXIA 4IIDA 4DNMA 2RJGA 2NV1A 4QJ4B 2HXUA 1H62A 2O55A 4I3GA 1OX4B 2V3GA 3R8RA 3WH5A 1I75A 3VNLA 3BDKA 1RY0A 1QNRA 2RUSA 4KMQA 1XLJA 5BXTA 2WSRA 2A7PA 3ABOA 4XKYA 3O6CA 5KINA 1KW1A 2Y24A 3IAQA 5F4WA 4JTAA 1KFJA 3W82A 1O66A 1Q65A 2XFYA 2Q71A 1GCYA 4GWEA 1ADDA 4B4HA 5I3GA 3H6OA 1XLEA 2QUTA 2PTYA 1XDJA 1LL7A 2E8YA 4Q8NA 1MEWA 1Z41A 1Y5WA 4E5TA 1HUVA 3GE7A 3BSHA 4K7VA 2QYGA 1HT6A 3DAQA 4HD5A 2A3LA 5JU6A 1R0MA 2ASHA 2WKGA 3A3XA 3DEQA 3EKGA 4HVXA 4GINA 2G3IA 2ZKMX 4C6QA 1AW2A 2E77A 2V3FA 4H9MA 3W1XA 4MNMA 2PRMA 2AL2B 2J7HA 4EK7A 2GUUA 3W37A 3PSWA 2ZRYA 3MP3A 1A5OC 3TKFA 3K1GA 2XH0A 1W1PA 1EYWA 1F6PA 3P8IA 2ZZ5A 1F76A 3OA3A 4JAWA 1HKWA 1MSSA 3LPOA 3VD3A 3VUPA 1P0DA 1ALDA 1SZGA 4YYFA 1XGDA 3EXTA 4CN1A 4HN8A 3OBEA 3APTA 3MP5A 3WLOA 4O17A 3Q4DA 3DKJA 3HPAA 3CUHA 4K8HA 5AVHA 2XM2A 1GOXA 4UMAA 2ZADA 3CU2A 3IJ7A 1VFHA 1Z69A 1B4KA 4JQAA 3KWXA 1VRXA 1OCQA 5EFFA 3KOWA 1J0ZA 1SMDA 3E5BA 4DAFA 3H7VA 5HA7A 3UXAA 4DWSB 2QIWA 3HZ3A 2R1PA 5T91A 3H22A 1A3XA 1R9XA 1ADOA 4MOZA 2CYGA 4ZXOA 1DXFA 1GORA 3ARWA 4XZNX 1DWHM 3BGJA 4Q7IA 2JK2A 2ZTJA 2NXGA 3C0LA 3QY7A 4PUEA 1K6WA 2WYSA 2YXGA 1T7LA 2G3FA 1NFPA 4RZ6A 3RPMA 4QLKA 4IM4A 1U22A 3KDNA 3GH7A 4GIYA 4ML4A 5FCZA 1U33A 4S38A 2IKIA 4XVDA 3NYZA 1V3IA 2ESCA 1KRBC 2CESA 3QBUA 2GUBA 4UZSA 1IZJA 1DHKA 3L4TA 1J4EA 2J9XA 3P61A 4L65A 1DJWA 3VCRA 3BW2A 4A35A 1JUBA 1GTHA 1W1IE 3DZ1A 5CZJA 3DG7A 3NQ7A 4EF8A 2W67A 1U1HA 4U33A 1PTDA 2VDGA 1H7OA 1QHZA 2HDJA 2OR2A 1TPFA 3P80A 2HCVA 3SRHA 3LCWA 3W6YA 1BLIA 3W1UA 5D05A 1DWAM 4DYEA 1QPKA 1W1YA 2Q8ZA 4TR9A 1A80A 3ZT6A 2Y7DA 3GTFA 1RCQA 4GFIA 4Q4RA 3FIGA 1EJWC 4IPJA 3GVRA 4B5TA 1OX4A 3AS1A 4RW3A 3THAA 3MMTA 5CZTA 1TWWA 1EDGA 2GVYA 4Q4SA 4IP7A 3NFUA 2Q8LA 5AB3A 1CTNA 1RQBA 4QG9A 1MZRA 5TNVA 2YXXA 2VT0A 5FJRA 4ZGYA 3OVQA 3UZZA 4ZXLA 2F7FA 2CHOA 3U5YA 4E38A 1GK8A 3NXFA 3ORWA 2ZX5A 4W86A 2Z7GA 2PB1A 3B9NA 4LSBA 1A5BA 1XLCA 4FXJA 5FF2A 1E71M 3KXQA 2G3NA 4NYUA 2P8BA 1G0CA 1F7BA 1QO2A 2O4QA 3MSYA 3OYXA 3T42A 1TCDA 2VELA 3SSZA 3KBSA 1ITUA 2B31A 1HXJA 1NOWA 1A3HA 2ZE3A 3AWOA 2FZDA 3ARUA 2YLAA 4FHAA 3T2PA 3ZMRA 1R3WA 3BLEA 5J04A 1VFTA 4NXSA 5E0KA 4JKMA 2XSXA 1JNDA 1FWBC 1W9UA 2YBVA 2YA0A 2ZRUA 4KFNA 1KFEA 2AL2A 1F6KA 2Z2AA 3KX6A 1M3UA 1KGXA 3SADA 2OZ8A 3BAJA 1KM4A 4HNTA 1PB0A 1KBLA 3GIYA 3TYCA 1WZKA 3HN3A 1EC8A 3L5AA 3O2LA 5HATA 2J6VA 1GPWA 3SBFA 2BHZA 4IX0A 1P1XA 3LQLA 2PDUA 3PFRA 1LOQA 3FJNA 1H09A 4EKJA 3RUBL 1OHLA 3ZLHA 3GR7A 3MI2A 4H6EA 1UOZA 1TQXA 1EPXA 4HJFA 4J7RA 4GD0A 1V02E 1K3UA 3C8NA 4GYFA 4LV4A 3UT0A 3LBCA 3MY9A 2HNHA 4QNEA 1M65A 3EWUA 5A6JA 3WN6A 2NXHA 3ABZA 3P14A 4O11A 1TPH1 3URQA 1BXBA 4GY1A 4Y8EA 4MFEA 1PEZA 2JKPA 1Y7VA 3CUJA 1ZBKA 3W70A 4DWSA 1EC9A 3BLLA 3MCOA 1OC5A 2NX1A 1I1XA 3NTYA 5DY2A 1JYWA 3QJAA 1ITXA 5JBDA 4JD4A 1YXCA 3W53A 3ABQA 1DVJA 4GABA 1XLFA 3GIQA 5FSEC 1SZNA 4XB3A 1JJKA 3W9ZA 3GZ3A 3JZUA 3VGFA 3R58A 2B7NA 5U7SA 3OZPA 4BI5A 1TJ0A 4NZJA 3O3RA 3V35A 3TYEA 1QBBA 3PWAA 2I5GA 3OLDA 4JPGA 1XIDA 3D3FA 5D02A 3LHVA 3AHTA 3W86A 3VDCA 1CBGA 1CXIA 4L6HA 1SR9A 1FA2A 2BGSA 2O7SA 3CAVA 3G22A 3DX5A 5DBTA 3ARRA 1R86A 4BZYA 2IMRA 2C3ZA 2WNQA 5G4HC 1AG1O 3C86A 3U8GA 1UQZA 5IXEA 3K5XA 3DFQA 3TN3A 3W24A 4XVEA 3IJIA 3DHDA 2DVTA 2QPSA 5AHNA 3SZ8A 3BCDA 1WYIA 4F8XA 1TIMA 3VD9A 3MHFA 1OGSA 2IPWA 1ICSA 3GVQA 1FKWA 4IMFA 1TZ7A 3N17A 4OOZA 1B3OA 4DJED 3APGA 3I10A 4Q8VA 3WLJA 3OHIA 4WSKA 1IIHA 1IE7C 3F5LA 2VDIA 1EGMA 2Y5EA 2Z0IA 5A8MA 2ANUA 3EX2A 3SCRA 1Q6EA 1GEQA 3JVAA 2B7QA 2QULA 4WCJA 4PCNA 1OFQA 2FKPA 3W2KA 3DI0A 4IP4A 3KRSA 3PZIA 1W3JA 4I6VA 3BZGA 4PL1A 5CLTA 1WA3A 3PTMA 4IMGA 3QPEA 1AD4A 3RK8A 3GUGA 2R9RA 3QFEA 2PWEA 1LLWA 2GK1B 5I06A 2YIHA 1C90A 3FHAA 1AK5A 4MNLA 3BAWA 2WV8A 2CU0A 3CZKA 2VEGA 3S0CA 4HCHA 2ZUTA 3TXVA 3WEZA 4B2DD 4Q7NA 1UJQA 2WW5A 4RCXA 2Y8VA 1TELA 4FXRA 1C92A 4OTKA 1DYSA 1HKJA 1UR9A 3GXFA 4KCTA 2CERA 1EKOA 4ZOBA 4QITA 4KPLA 3QW4B 1JF5A 1XPGA 4D72A 2CC0A 5I3IA 2Y62A 2ZRWA 3KLKA 5K9CA 4C5ZA 2FDMA 3L23A 4HPXA 3V16A 1R3QA 3VIHA 4NG3A 1VD6A 3B40A 3URNA 1BRLA 4BY3A 3P0WA 2BXYA 2Q6ZA 3GZAA 2WQDA 2X40A 3UG8A 3HIJA 3IGUA 3LRLA 3K4WA 3ARQA 2UV8G 4XZWA 3FYYA 3PS7A 2DUZA 2GLKA 3TYAA 2J24A 3L5LA 3WKZA 3CNYA 1BQCA 1R7AA 1LROA 3CHDA 1UP3A 4Q4OA 1M68A 1OY0A 1B5TA 1EWDA 1BG4A 3L66A 4XZBA 3P7YA 2GJPA 1RD5A 2Z26A 1CGYA 2WBGA 1NDWA 3DESA 1MRAA 2TMDA 1BVWA 3WQWA 2GDVA 3FW6A 3AIBA 5H1WA 2D73A 4JHOA 3MKKA 4NZ4A 1CXFA 2QAPA 3IIPA 3P60A 1XSJA 3VIIA 3QGKC 1V3LA 1HP4A 1IXNA 5HQMA 3ARZA 3PBVA 4GI8A 1R2SA 5G4WA 1O5XA 1IEWA 2R91A 3QSRA 4ZOCA 1ZZMA 3BGGA 4US6A 1UHVA 4FLRA 4C6DA 4WKFA 1Z89A 3NZ1A 3VDHA 1QPOA 2FZMA 5AC7A 4V15A 4CCCA 2WM0A 4LWWA 4XTIA 4Q8PA 4M56A 5FJUA 3BJSA 5LIWX 1OFRA 3MWAA 5T26A 1YLVA 4NRRA 3SQMA 4H7VA 3C2OA 4IP5A 1GUVA 1H7XA 3E6EA 1FH9A 3AYSA 4MAVA 3B9AA 3Q58A 2H8ZA 5I0DA 3TK7A 3EDFA 4JTDA 5FEXA 2QCCA 2BOGX 1SR0A 1UUQA 3UERA 1S38A 4M51A 4BHYA 3LX9A 4MZYA 3O6AA 1V0LA 5FA5A 3HF3A 4G1KA 2CHNA 1B31A 3TXZA 4LW7A 2Q8XA 4L4OA 4UTTC 5ABHA 1FVPA 2XU2A 3SY1A 3A21A 3HG2A 1FCUA 2I16A 3AZTA 3GHUA 4I5RA 2YJQA 4KIEA 1NF7A 2BVYA 3K13A 4OUEA 2I5IA 4FO4A 2Y70A 4LVAA 2VKZG 3KBVA 1GVQA 4FAMA 5BRBA 4M24A 4J3VA 4K6AA 4I8YA 1HNYA 7PTDA 3W72A 1T0OA 1F4AA 4IQDA 3NSMA 1XUZA 4O16A 1A53A 1TWDA 1P1MA 1TMHA 3K4AA 1GKRA 2X09A 1ODUA 3AHZA 1FHDA 4CVUA 3H2NA 2FMNA 2DSUA 2V5JA 1W8SA 2Z29A 3OHMB 2OGJA 1HP5A 2GK1A 1KTCA 1E51A 4YHEA 3I3EA 3UW6A 1IZKA 3LMZA 5FF4A 4AVNA 4AMAA 3HTWA 4PMZA 5GJPA 5DRCA 2I9UA 4ATWA 3WBWA 1XYFA 2BB0A 3KWSA 1O94A 3I3DA 4DPQA 3THCA 4XG1A 3HFTA 2VC6A 3LGGA 3SCOA 4J2PA 2QJMA 4OVXA 3LTSA 5KSWA 1IT0A 1DBTA 3P0XA 5AVNA 1Q6DA 1HQTA 2P0OA 4J35A 4MPKA 2TPSA 5AFDA 2OT1A 3T44A 3MYOA 1F9CA 3O07A 1XYLA 1UZDA 4XV0A 1XQKA 2VOTA 1FWEC 3QV9A 4Q3MA 4GBUA 4HCDA 4FOUA 4EPKA 2XPKA 1XBYA 2AQOA 1NSJA 3IS4A 4UQAA 3FVMA 5JMUA 3T0DA 2WB5A 1A5MC 3SCTA 5DCBA 1E5JA 4A3YA 4IXHA 3BUVA 3UY8A 1HJQA 1TVPA 3SW6A 5CKSA 4L4PA 3S83A 4RNJA 3M0YA 1MWOA 1C9DA 1GVRA 4AZGA 2AGKA 4JTHA 4DF2A 2GGHA 3E2QA 4AIUA 3QYSA 3ZSSA 1KM5A 5JIWA 2RJHA 2G95A 2J79A 2PGFA 4O0KA 5D8ZA 3CZGA 4Q4PA 4IL0A 2OMAA 1WKFA 4G7EA 3NPVA 5HOSA 3M41A 3RX4A 1D2KA 3NCOA 3LD5A 2YW4A 2VGIA 4AZCA 3TEVA 3C2RA 4QP0A 1A0DA 4MPQA 4HMEA 1LG1A 5E70A 3A5VA 1UR4A 4GUGA 1UD2A 4AIEA 4JYFA 2X8RA 4ZSTA 2IQDA 3UXLA 2PLKA 2P88A 3B8DA 3A9BA 3NM3A 2ZC1A 3VZXA 3CWOX 3VDBA 3SURA 3FYPA 1DJHA 1DWJM 3NO5A 2Z7KA 3R79A 4MB3A 3PG8A 2J7GA 2WHJA 3OEXA 4ICNA 5ECVA 4NJHA 4OHQA 3H2CA 3BOXA 1W1VA 3BPWA 3IAPA 3L2MA 2ZUWA 4DZ5A 5KMYA 1RQHA 3ISIX 3RG6A 1XRVA 4IFOA 2E9LA 4RE3A 5J8LA 1O12A 2Z27A 2GOUA 1W9DM 3KS6A 4Q33A 1BD0A 2YCKX 4FOJA 2QZRA 1VIWA 3RX3A 5BWAA 3RJYA 5KETA 2OG9A 3PG9A 5A95A 3MDWA 1B9BA 3W27A 1RLCL 3OVRA 1TPWA 1MNSA 1VGAA 3IJ9A 3NQ6A 4P7LA 4JGDA 3UETA 3CHFA 3GX9A 3KDOA 4ES4A 3F5JA 1HZYA 1IV8A 4KEVA 4RDZA 3S4TA 1ICQA 3C52A 4TOQA 3GD6A 2J66A 4R7WA 3LPGA 2W91A 2VQUA 3O1NA 4DJDA 4CUCA 1FWAC 2QR6A 2FFCA 1VC4A 2C91A 4KGJA 4W88A 3UYIA 3H7UA 4CD6A 4TVCA 1VZWA 5C2GA 2Z25A 4EOUA 2Y7EA 4FX8A 1GYNA 4AD5A 3ONCA 4MMWA 4GGBA 2CZEA 1LQ2A 3BLKA 2DT1A 2XFRA 5AHEA 2VWTA 4UTLA 3GHSA 1VRDA 3G0SA 1RPKA 5CSSA 3T0AA 4NZCA 3EXSA 3PBMA 5K4XA 2DGAA 2D20A 1FFQA 1LOSA 4D9PA 5HNTA 5AOUA 1RP9A 4HNVA 2O4MA 4HCLA 4ACZB 3A4XA 3DFPA 3KOFA 4LYPA 2YX0A 3N2OA 4Q8MA 1H3GA 3QQ0A 4GVHA 2PRLA 4BF9A 2X1IA 4I7VA 2YFNA 4J3UA 2X0SA 3KBJA 5J5DA 2F6UA 3GQYA 3KM8A 3GC4A 2PP0A 1KFLA 3W7OA 4OBTA 4F66A 1B3ZA 1PWLA 1KM0A 4BWLA 2NUWA 1XCWA 1JAKA 2UY2A 1EBHA 4H00A 3VM7A 3T8LA 4JICA 4ADUA 5FJJA 4GG9A 1R3YA 1Q3NA 4YTSA 1JGIA 2E5BA 4HNNA 1Q8JA 3GKAA 1E9YB 5CBJA 4GIEA 4NZ3A 3QOKA 4AXKA 4GZEA 3P81A 4F2TA 1IYXA 1P6CA 3VKJA 5A69A 4RZ5A 2DUAA 2FHFA 3EBVA 5I3DA 1XKJA 3NQ8A 1BFNA 3RCMA 1IR1A 2D2GA 1WCGA 1ZNNA 4ZFCA 5DXXA 1M7PA 1GT8A 1DQWA 2WJDA 3BH4A 3AZSA 3SCQA 3W7IA 1ECEA 1GVOA 1PX8A 1W5NA 4R85A 3MHUA 5LHEA 1OC6A 3UWWA 3QQWA 1ME8A 3KVLA 1Q2RA 5ENLA 2PDMA 3KVMA 1FWIC 4QAIA 3BJTA 3L0GA 3HPFA 4W85A 4GPNA 1PHQA 1K9EA 4S3EA 1L0PA 3N3TA 3S42A 3K46A 3WF3A 3V18A 4CEUC 2VOMA 4M1RA 3Q2DA 4UTWC 3T81A 1BPLB 1REQB 2VEFA 3CUIA 2OYLA 1RXOB 2V5DA 2ZRXA 3DYMA 3WEMA 3OO2A 3AMLA 4C6FA 3WD4A 3SY8A 4EX4A 2VZOA 3H8AA 6A3HA 2R1KA 2R1MA 3PZGA 3LHTA 4P7QA 3DFHA 3MMUA 5HR6A 4HTYA 1P6WA 1TPB1 3GDLA 2QCHA 4OQVA 3OU8A 4E8CA 3R1ZA 4HZ6A 5LGZA 3Q67A 1K6AA 3KHJA 4G56A 1DJNA 3UCDA 3SSJA 1RPXA 4Q8QA 3CEUA 3SRFA 2QCMA 3GAKA 5CPTA 3B8SA 1F3XA 5A1AA 4XISA 5CEWA 1VPXA 3R12A 4HA3A 2CZVA 3M4HA 1FCBA 1KXTA 1KR0A 4JIEA 4ICCX 3TIMA 1F61A 3NWRA 3IK4A 3UVIA 4FMVA 1HKKA 3CWNA 4GCXA 4H7ZA 4KCUA 2PDGA 3GC2A 4IIBA 4PBGA 2ALDA 1CLKA 2WLYA 1K8XA 2FHCA 1Q8AA 4JTRA 1J10A 3PM6A 4P7NA 3VNIA 2VUYA 4BJHA 1J9YA 2J62A 2NVAA 3N4EA 4CNOA 3UR8A 4EVZA 2FJKA 4H8UA 5G5IA 3S9YA 1OVDA 2C15A 3R7MA 4HN4A 2PA6A 3EWDA 1UP2A 3CIWA 3EXRA 4MHBA 3H53A 2B81A 1Z8AA 2C0HA 3W7KA 3NO3A 1TJPA 4N9EA 1JXJA 4Z17A 1W37A 1AJ0A 2E40A 3GO2A 5AC6A 3NJ3A 2V82A 2PI6A 1O1HA 3QV8A 1LWJA 4LY4A 3DFNA 4Z2LA 3NAVA 1Z42A 4L1GA 2VCBA 3B05A 4B92A 3RILA 3LV6A 5AYYA 4NHVA 4URIA 1W3TA 3KTCA 4N02A 1X7FA 3TN4A 4A3HA 3ZZ1A 3E9AA 5KTLA 5HJYA 2OKOA 3W71A 3OZOA 4N7QA 3UU0A 2QCGA 4L9XA 4JFVA 4C6PA 1FX6A 3WLIA 3FK4A 2POTA 1FH7A 2H3DA 5FD0A 2BTMA 4V28A 4B5WA 3AIRA 3TJLA 4ZTXA 3RHGA 2PDXA 2NV2A 2QNEA 1PKLA 5A8GA 3RDKA 3BLDA 3MMDA 1QAPA 2R94A 4B4FA 4AX7A 1KBJA 5BOEA 3GFZA 1VYRA 3PC0A 1JDEA 4UTIA 1AZ2A 2PLCA 4LPCA 2YXOA 5CGQA 4Y9MA 4E6MA 1QDSA 3G1AA 1W9PA 3TLLA 2ZYFA 4Q6XA 2CLHA 2XIQA 1NY1A 4Y9OA 1LWIA 4A2RA 2DDXA 4OT7A 4DF0A 4RE4A 4ADTA 3CYJA 1UQYA 4H8HA 3P74A 2ZVRA 5FJIA 5AC8A 3KHDA 5AHLA 2XSAA 3LTPA 1REQA 2VX4A 1LQ0A 1M5WA 1MI3A 3H23A 3AUOA 2IPJA 3NGFA 2Y63A 1E9LA 4L1XA 2HVOA 5GVJA 1EEPA 3WDHA 3GC5A 4K68A 5JUVA 1FXQA 4XBSA 2YBUA 5T9BG 3WDIA 4GVIA 3AYTA 3ZR5A 3O16A 3O6YX 4N0RA 1HF6A 1XRTA 3GW3A 3RX2A 3CZJA 2IPGA 1GW1A 3G2GA 4YVVA 2XIJA 4JHMA 2ZDRA 1THFD 3GYEA 1TE1A 3DYPA 3U4FA 5DT7A 3EDDA 5BROA 1LOLA 4FLSA 1KRAC 4BI7A 1S3HA 4E3TA 3IRSA 3PJWA 2BSLA 4G9PA 1N8WA 1Z7AA 1LBLA 4IIHA 2ZZ7A 4LFYA 2V0TA 4YTTA 4WRHA 2PDHA 3O9NA 4PUUA 4IMAA 4AISA 1PDYA 3VMOA 4AVFA 4EANA 1C29A 1WPCA 4UQDA 2JALA 2OPJA 3W7DA 1XLHA 3M5YA 3PUOA 2EO7A 5EMMA 1EL3A 3VKKA 1EDQA 3MP4A 3T2OA 2XFFA 1FUYA 3WUGA 5GQBA 3DGBA 3PSVA 1KCKA 4JTJA 2VGFA 3TV8A 3TW7A 3CQKA 3PHAA 3IJ6A 4UFHA 4UR7A 3KBNA 3QR0A 1E4MM 2YKKA 3A12A 2JKAA 3MS8A 2IKHA 2P10A 3LI0A 2NT0A 2FVLA 1H11A 1C7SA 5E0CA 4PB4A 3FXYA 1LCOA 1W8GA 5H8UA 2VO5A 3S5YA 3A13A 1X6LA 2WJFA 4R7OA 6TAAA 4PUWA 3AXKA 3EDEA 1TPVA 2E09A 1KBKA 2Y61A 2J27A 3RLUA 4FB7A 4GUFA 3IARA 1UD3A 1MQPA 4C6LA 3SQLA 3G6LA 3TW6A 4CNSA 3F4DA 1TV2A 4L9YA 4N9BA 3TTQA 3PR2A 2A3HA 2X2YA 2GGIA 3IANA 5HMSA 3FJLA 3NQVA 2CBJA 4PUKA 4ZO9A 2YPIA 4B91A 3LHYA 2YR1A 1XX1A 2ISSA 1TJ2A 3Q65A 1HO4A 2A2IA 4HIBA 3H21A 4MWAD 3MT1A 1CW2A 3DC0A 2E6AA 1E40A 1F8IA 5GNZA 4LF1A 3ARPA 2REQA 4E2DA 2PC8A 4DBUA 2WMIA 4XD3A 3QC0A 4WQ6A 5LYRA 3DHPA 3WQGA 4GUHA 5RUBA 3VE9A 1E72M 3MMWA 3MVTA 1BF2A 2O7QA 4JFSA 5U4NA 2QDEA 3GXNA 4MVAA 3IGSA 4P2VA 1R2RA 2UWFA 3LYEA 3NO1A 2GWGA 3OIHA 4KESA 5F4SA 4Z0SA 2KX9A 1LM1A 4HNUA 4IJCA 4DBDA 2WMFA 4CGTA 4DZAA 5ABGA 1P4CA 1E6SM 2PGWA 1TV7A 1SMAA 4NYYA 2QCLA 2VDHA 4RV8A 3T4CA 3S6TA 1YNYA 1G67A 5EMJA 2AMGA 1OGBA 3QLLA 2YYTA 4GJJA 3UWQA 3FA4A 7ODCA 1JZ3A 3PK7A 5IM51 2GSJA 3OPSA 4UMBA 3RPDA 3M0JA 2DSZA 2PWVA 4QSFA 1VF8A 1W5MA 5CQ1A 4YNGA 2NT1A 4D6IA 1QATA 3VNDA 3FCPA 4QS6A 3EZ4A 4Z1BA 4GMEA 4PCSA 3V5OA 3ANYA 3A23A 4UQBA 2DORA 4AD0A 3M5XA 1HJXA 3SUWA 5HULA 3GDTA 4R53A 3WL0A 1IQ8A 3O7UA 4O0QA 4DNHA 3LERA 4DVOA 4XD5A 3D47A 3QFWA 4AG0A 4V1XA 4IGHA 3EX3A 3E49A 4BI6A 1KBBA 1GVSA 5XINA 4L6OA 4D6FA 4XWUA 3LLDA 3W87A 1JI1A 4WD0A 3UG4A 1D7KA 5EY5A 1DJGA 2EHHA 1S5MA 1JYVA 3CV1A 1L6GA 4MUZA 1QTWA 4QCEA 1E0UA 2PTWA 3QKZA 4Y9AA 4C6IA 3XINA 4LQ1A 1PCKA 1M7OA 2CLFA 4K3ZA 4GHRA 4PMJA 4Z1CA 3SUVA 4HA4A 3H2AA 4AXNA 4QE5A 4MWAB 1T5AA 1XG4A 3OGVA 4IH3A 3WJWA 3W23A 3VE7A 2E67A 1WDRA 3W0KA 2ACQA 4AB4A 1JCTA 5CZ0A 3R2GA 1JCMP 2HE5A 1C9WA 3DFYA 3NOYA 3BLIA 4MF4A 4D8LA 3TFCA 2ISDA 3SIMA 1JPDX 1YMYA 2PSNA 3KTSA 3OYZA 1NELA 3UNDA 1L2UA 2WCAA 1EHNA 5C71A 4JN6A 4XZ9A 4DELA 3W1RA 4S23A 1QI5A 1IEVA 1PYFA 3AU2A 4IPLA 3KS5A 3P3BA 1UCWA 4P7RA 4ZB2A 2PWGA 4HZMA 4HYVA 3CPRA 4A3QA 3BOFA 4QISA 1OFPA 2Z2BA 1FY6A 2I7GA 1EUNA 4FNTA 2WZHA 2HK0A 1DKWA 3OA5A 5EMYA 1I6NA 2DUXA 3W7QA 1K1DA 3QM3A 3W7HA 4GO8A 3VKCA 4R88A 3AALA 2A5HA 1V6WA 3CL6A 3WMLA 4C1NB 5HBFA 3I6EA 1ZGDA 2VQTA 4R7JA 1FWGC 3MI3A 4KEUA 4W7VA 4Z2HA 1H2JA 1F74A 3FS2A 3LCLA 3NPWA 1KWKA 1JI2A 4L80A 1IWAA 5LIUX 3S2JA 3WLMA 2XWEA 1FWWA 2YW3A 3RIKA 1W3KA 2OT0A 1X1OA 1EPVA 1T41A 3SGGA 2A1YA 1XR2A 4FIQA 2GQ8A