1TX0A

Dihydropteroate synthetase, with bound product analogue pteroic acid, from bacillus anthracis
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
273
structure length
265
Chain Sequence
KWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSDGGSYNEVDAAVRHAKEMRDEGAHIIDIGGKVSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 7,8-Dihydropteroate Synthase from Bacillus anthracis; Mechanism and Novel Inhibitor Design.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Transferase
molecule keywords DHPS, Dihydropteroate synthase
total genus 95
structure length 265
sequence length 273
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2004-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00809 Pterin_bind Pterin binding enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 1tx0A00
4S3CA 3TR9A 4DAFA 3H2FA 3TYUA 3TYZA 4DJFC 2DQWA 4NHVA 4MWAC 4O0QA 3TYBA 4DJFA 3MCNA 3MCMA 3H2CA 4S3DA 3H2NA 3MCOA 2DZBA 3TZNA 1AJ0A 4G9PA 4HB7A 3TYDA 3H21A 3TYEA 1AD4A 4MWAB 4S3EA 3NOYA 2OGYA 4S23A 1TWSA 2BMBA 4DJEC 4S39A 4CCZA 4DJDC 2E7FA 2DZAA 3H23A 4DJED 3H2AA 3H22A 1EYEA 5JQ9A 3K13A 4O1EA 4D8AA 2VEFA 4MWAD 1AJZA 4S38A 1Q7ZA 3H26A 1TWWA 4S3AA 4NILA 3TYCA 1Q8AA 1TWZA 4DB7A 4D9PA 1AD1A 4S3BA 4DJDA 2Y5SA 4DAIA 4DJDD 4C1NB 3H2OA 3BOFA 4NIRA 2VEGA 1Q85A 1Q7MA 4S3FA 1Q7QA 4NL1A 2YCLB 1TX2A 2H9AA 4PZVA 2H9AB 2Y0FA 3H2EA 4MWAA 4C1NA 4DJEA 1Q8JA 2YCLA 2YCKX 3BOLA 3V5OA 1AJ2A 1TX0A 1F6YA 3TYAA 4D8ZA 2YCJA 2VP8A 3H2MA 3TZFA 2YCIX 3H24A 4MWAE 2Y5JA 4DJFD 4O1FA
chains in the Genus database with same CATH superfamily
4H9TA 2KAUC 2Y88A 6CGTA 4N0RA 3B9DA 3R0UA 1VJIA 3KUMA 1A80A 4H7CA 3VDGA 4C6NA 3H2CA 2VRJA 1KBJA 2DZBA 3FA5A 1XCFA 3W7MA 1KRCC 1QW9A 2QPUA 1LWHA 4HBKA 3THCA 1BXNA 1EL3A 3NOYA 2B4GA 3M0JA 5C5YA 3I4EA 1FWFC 1E6ZA 4GACA 1DQXA 3SSJA 4FXSA 1Q2RA 2ZRXA 4IQDA 3CUGA 1W91A 1PHQA 2QDGA 4AIEA 1Q5MA 1W3HA 2Y7FA 1JG9A 1KXTA 3QV7A 4ES4A 1N82A 3PR2A 3LUTA 2Q09A 3NZGA 1XLLA 2H90A 1J0YA 5FOOA 4JL1A 3PZTA 4XKMA 2WQDA 4DRSA 3HGSA 1TJ0A 2VEIA 1Q8AA 3W7IA 3VIHA 5K3VA 1U2YA 4MYXA 3V5CA 2R94A 1ENUA 1V02E 4F48A 5LGZA 4FP1A 5HWMA 6REQB 1WV2A 1F6PA 1XSIA 1BXCA 3AQUA 1CCWB 1XYBA 1E56A 1VBHA 3UNDA 4Z17A 1VLWA 3GHTA 1Q6EA 3QH2A 3W53A 1NP0A 4LUJA 4O1FA 3AFBA 2BZNA 4DI9A 4TX8A 3O3RA 3WH8A 4UTTC 4QROA 2DVTA 1PEZA 3LQGA 1PX3A 1M6JA 3BMWA 1JCJA 2V2DA 3GNPA 1M68A 3QW3A 4JGDA 1DWJM 5I77A 4S3EA 1Q6CA 2A7RA 5JUVA 3MANA 2EG6A 1XYCA 2VQUA 1JUBA 1EJWC 1R3SA 1JIBA 3CZGA 1GVYA 4S39A 1G9HA 2VZUA 4M3PA 3H22A 1TPUA 1VCFA 1MW3A 3K5XA 5HXMA 1R9XA 4XZBA 4LCQA 2V2CA 4XAGA 3MKKA 3KOZA 2FLIA 1KRAC 4YHEA 1RP8A 1THFD 4DAIA 3E1F1 3TXVA 4DM1A 1P1XA 2PAJA 2ZA1A 1CLVA 2BGQA 3CMJA 4AX6A 1EPVA 3VNLA 4LYKA 2Z6IA 3MT1A 1RZMA 4MDPA 4DO7A 3TLLA 5F2LA 3HOJA 1Q8JA 3KWXA 3VIOA 3IPWA 3L68A 1GVOA 3BGAA 1FWSA 1UD5A 2JKAA 3T09A 4MB5A 2OEKA 3K8KA 2UZ9A 3E5PA 3URQA 3DYPA 1LBMA 1TMQA 4WOZA 2NLYA 4QDPA 1XH1A 4MZ1A 1FWTA 3BLFA 3URBA 3FHQA 1UHVA 3OG3A 1OCBA 3A64A 1RP9A 3VOIA 3HM7A 4HA0A 5EMLA 3LM7A 3N6HA 4HB7A 3W7CA 1AQHA 3EWXA 4L1GA 1B3OA 1HVXA 2DU2A 2OLAA 3OYZA 4Z2LA 2DFAA 4QAIA 1KFEA 1ZCOA 1TV5A 1NDYA 2GQ9A 5LIUX 3FYPA 1TPWA 3LCHA 2ZUMA 4CD4A 4CQBA 1LT7A 3MO7A 1E15A 1OT1A 4KKXA 5KZMA 2WSPA 3EA1A 1V6TA 2CIPA 3IAQA 3OLDA 4P2VA 4MMWA 1ZBWA 3UA3A 3WLPA 3EGJA 1F9CA 1QO5A 2HQAA 2QCEA 3GU1A 3H12A 2FKPA 2WMJA 1MFVA 4LFYA 2INZA 3CQ0A 4D6FA 2UBPC 3DDMA 4QBXA 5JMUA 4TMCA 3TN4A 2PZ0A 1YDYA 1H60A 4LAZA 4CN6A 1W1A1 2JGYA 2XWEA 2ESCA 2BSLA 4RZ5A 4I6KA 4GKLA 4U33A 2WCAA 3ABRA 1K77A 1V8EA 1DORA 2CEQA 3VD9A 2A3EA 4L4PA 3WQ8A 1FH9A 3C86A 2CHNA 5AFDA 3KOFA 2D22A 3IEBA 5TNVA 2A3AA 4NNAA 4B5VA 3STFA 3W7JA 2OCZA 1XV8A 3BSHA 4PEEA 4IJBA 3MCOA 2D2HA 4BF9A 2PGRA 4O18A 4BF7A 4B5TA 4PSPA 2OWWA 1A3XA 3CQIA 1MW2A 3WBEA 3BW4A 1MSSA 5DMNA 4HSOA 3MMUA 1M1BA 3R6IA 3N19B 4L65A 1NFPA 3LOTA 3QYQA 3M0IA 1IGSA 1AW1A 2QUUA 3IARA 3FKKA 1EQPA 1S38A 3WLRA 5RUBA 1Q66A 2VVSA 2QUVA 2QYGA 1XRVA 2J74A 2O9OA 1JPDX 3P6LA 1H41A 4LU0A 2J75A 1WO2A 1A4LA 4DWSD 6ALDA 1F3TA 3SN1A 4CQAA 3W02A 4CEUC 4Z08A 5DFAA 3SURA 2Y8UA 5MF5A 1UW9A 3T55A 5IOBA 4A8NA 1IHIA 2VEMA 4IPPA 1QMLA 1UR9A 5ECUA 3G1FA 4PMUA 5CZKA 2OU4A 3UWWA 3P14A 3GX9A 1HT6A 1T6MA 2E9BA 1FA2A 2YSWA 2ZRYA 4JR5A 5I3JA 4NASA 3S9YA 2V3DA 5M17A 4D2JA 2PLCA 3DU0A 1E6QM 3WUGA 1FWGC 1A0CA 4EF9A 2BVTA 1F3EA 3LS9A 3I3DA 4HNNA 1JCNA 1GQLA 2JF6A 3M7WA 3N73A 4W87A 4KEVA 3GC4A 3GFZA 4UTMA 5C9XA 3DG7A 1R7OA 2ACSA 3ANUA 4ZO7A 3GH7A 1QVBA 4C6IA 1AD4A 4QFUA 2A4AA 4ZBCA 1S2AA 4MY1A 1A3WA 3WH5A 4DHGA 1AQMA 2PS2A 5E9AA 1JNEA 1ICQA 2CZVA 4GI6A 4JTEA 4FALA 4A2RA 9CGTA 2ON3A 3EA2A 5JQ9A 3OLGA 4TV5A 2VZSA 3G1YA 5CH9A 1G67A 4MNMA 4YHGA 3PJXA 4JTLA 3SCRA 3PWGA 4H8HA 3E2RA 1X7IA 4MJMA 1KCKA 2EO7A 3D46A 4O57A 1TWZA 3AIVA 2OKOA 4ONVA 3ICJA 1UA7A 1QPQA 2F7FA 2GWNA 4F0SA 4UWMA 2PA6A 4N9DA 4AIBA 3WDQA 4I5UA 4QIUA 3GR4A 1ZPTA 1Q63A 4Z2JA 4EPBC 2VI0A 1X98A 3GU2A 2D2GA 4V27A 1J18A 3WQOA 1U1UA 2BY3A 2VFEA 3U48A 2POTA 2J79A 3VMOA 2E5CA 2BNJA 4DO4A 2IQTA 3QR0A 1V08A 3L2MA 3NQEA 3QHOA 1OCJA 5G4HC 3RM4A 4LS2A 1XX1A 1H7WA 2F38A 2ISSA 3ITVA 4Y9MA 2GK1A 1FHVA 4MSSA 3PBWA 3MZNA 2FYMA 3EOUA 1HP4A 1IIHA 3BJTA 2ZWYA 1SW3A 3R8GA 3EDJA 2NQZA 4GXPA 4Y8EA 1CECA 4PB5A 1MFUA 3U2OA 1R0MA 4LGXA 3L23A 4AW7A 1M01A 1WOBA 2DT0A 3OLIA 4Y90A 1DL3A 4HZ7A 4JBRA 3JW7A 3FYOA 3WLHA 2G37A 1XQLA 4H3DA 1EXPA 4GE8A 2PDPA 3H70A 3W1AA 3IRSA 1PHWA 2PD5A 3ZR6A 1CI1A 4IP5A 3N04A 4NZ1A 2EHHA 2YJQA 4D6IA 2XVKA 4Q7NA 3CHVA 3WNPA 4WGHA 3N9RA 1RD5A 1IEIA 3NPXA 2GUBA 2DW6A 1DWHM 4DPPA 5C6MA 2QDHA 2NQJA 1N8IA 5FJJA 4X22A 1IF2A 4OIFA 3GVWA 3UJRA 5HK4A 2PBOA 3C0LA 1B54A 4ZSUA 8XIAA 1MDLA 3GYEA 5GJPA 2ZFAA 4RK8A 2VQTA 1LOQA 4B5UA 3AHTA 3TLQA 4KWVA 1OG0A 5D04C 4XZ9A 3H2MA 1QR7A 1VEOA 3RILA 3PNUA 3UY8A 1QNQA 3CZEA 2XHYA 4NJGA 2ZIDA 1TCMA 4XZLX 5IDIA 1ISVA 2A7NA 2TMDA 2D24A 1IV8A 3RJXA 2E77A 4S3DA 1AH0A 4GC4A 1C3FA 1NFGA 4GABA 2JIEA 4JTQA 4GD0A 3FAWA 1PB0A 3M1ZA 1SVDA 2VC5A 2GWGA 1DVJA 3ARUA 3ABXA 1JYXA 1FCBA 3MYPA 4H01A 4HZ8A 5CGQA 5DN1A 2H3DA 2J7EA 1GTHA 4N4PA 4Q33A 3L4XA 4UNLA 3TN5A 1TPC1 1HKJA 4ZEPA 3ARYA 2OO0A 5F7UA 5A94A 3EWBX 3VGBA 2AQWA 2F6KA 1XISA 5FSEC 2IKHA 1SO5A 1DWFM 4G2DA 1CXHA 5AY7A 2V5BA 4I90A 5CXPA 3CWHA 3HBLA 3EX4A 3COTA 3SN4A 1CX9A 3JUGA 4OBSA 3V35A 3V0TA 4NUWA 4PSRA 2C1IA 1R5YA 5EMYA 1US2A 1C7SA 3UGRA 1AQFA 3GXFA 1S2WA 5DO8A 2FZ9A 2XSAA 3LMZA 4ZQOA 1NJJA 1ISWA 3WEOA 2PDLA 4A4AA 4PULA 2IW0A 4UNKA 1LG1A 4GZEA 1B9BA 2OR2A 3ABSA 1KGWA 4MM1A 4FB7A 4ADSA 2HEJA 4FLQA 1QPKA 2GJLA 3LHTA 1KC7A 2PLKA 1LL6A 2QS8A 3MKVA 1QBAA 1NOWA 1R7AA 3TFXA 5A8OA 2ZRUA 2C1GA 3VOGA 2A7PA 4O8RA 4JYFA 4PBGA 4LT9A 3JR2A 4GIYA 1XLAA 4TUFA 1AJ0A 3MWCA 4NT0A 2F61A 4CNUA 3KHJA 3VDHA 3LD5A 1S2VA 1KM1A 1MW1A 3HMJG 1YHTA 3MY9A 3ITCA 3HG5A 4AZCB 3N12A 3EYPA 4DJED 5T8GA 3BMVA 3S2MA 3L0NA 3SUUA 4GI8A 4PCNA 2J88A 4GZJA 1V03A 2TAAA 4JIHA 4IOTA 1QT1A 4AAJA 3TWAA 5CBIA 3T2PA 3TE9A 1XBXA 1SW0A 3L4TA 1QI3A 3C2OA 4BI7A 2QCFA 2E1WA 3O7UA 4RDYA 3ID7A 4LSBA 2CETA 3M47A 1QW8A 3LENA 4KEUA 4LNYA 2CERA 3M0ZA 3SGZA 5JIPA 1KLYA 3SDOA 4E2OA 1UYQA 1TPVA 1K9TA 2XFYA 1W9VA 3UXDA 4LVAA 4UFJA 3DFYA 2OYLA 4MKNA 1Y7VA 3KXQA 3H55A 4CN1A 3FLUA 4PC8A 1TX0A 4MADA 2FTYA 1H2JA 2GVYA 5H8MA 1J01A 4DJFD 1XYLA 3QVQA 1S2TA 4WLCA 4R9OA 1XIHA 1R9YA 4ADUA 3IJQA 1LWJA 5LHEA 4P7RA 3PK7A 4NRSA 4QG6A 2WJZA 3BL3A 8A3HA 2PODA 2Q8XA 3LG3A 1OC6A 1J0JA 2VOMA 3QC0A 3M0LA 4I8DA 2VRKA 2PCQA 3GFXA 2DGAA 5K2ZA 2WMGA 4UCFA 5AYYA 4ROQA 3NG3A 1SZFA 3BAJA 3NYZA 2YZRA 1RAKA 1KM6A 1ZLPA 4HNLA 2QCCA 3H4GA 2EAWA 1NARA 2Y1HA 4FX6M 4DZ5A 3M0YA 5FEXA 3KW3A 3OA5A 5AHMA 4NILA 2OQHA 3BW2A 1JL8A 1ISZA 2QCDB 3W24A 2RUSA 1ECQA 4ZQCA 1XLMA 3G22A 4D6CA 2GQ8A 3WUEA 1Q85A 3VE7A 1OX5A 2VR2A 5HNTA 2PRLA 2QJGA 2PDQA 4QXIA 3EX2A 3AIWA 3IGHX 4KFOA 1CTNA 3HO8A 3JRKA 3CT7A 4JTDA 1PO9A 5IFTA 1SMAA 2FQIA 4JDYA 1M5WA 3ZLGA 1ZQ5A 6ENLA 4F2BA 2ZXAA 4KH2A 3ZFHA 3RM8A 1JDEA 2O0TA 4V28A 3GW3A 4RCXA 4LALA 4EP8C 5CPLA 3RGTA 1Q45A 5D4YA 3U6WA 3L5AA 3W73A 1K7XA 4NJKA 4MPQA 2RDWA 5DMLA 2GPTA 8XIMA 4NZ4A 3MSRA 3VIFA 3AC0A 4V2XA 1PZ2A 1IWBA 3GD6A 1I9CB 1XM3A 1I2OA 1E0TA 4Z0JA 4X2PA 2QF8A 4UMAA 2BOGX 1VYRA 3APTA 3QTPA 3DEQA 2CU0A 3LXCA 3W87A 2XU2A 4HHMA 1ZGDA 3F2BA 1O1HA 3M0MA 5EMUA 2XSXA 1PZ1A 3W2MA 3R89A 2PURA 1YX1A 1W6TA 4R7JA 4JKMA 2HV5A 2ACQA 2WMHA 4R33A 4I9JA 3E5BA 2OT0A 3PG8A 3RF9A 3BV7A 3UQNA 2XGZA 3TK7A 3GNXA 1FH8A 3RK8A 2FHCA 1NEYA 4WDXA 5E0CA 3N29A 3BK0A 2R14A 2ZZ5A 2W92A 4EANA 3HB9A 2HS8A 5AYZA 1WBJA 4I5XA 1WBHA 3GG1A 1PYMA 3V4BA 2C7FA 1XLIA 5I2UA 4UOQA 1MNSA 3PPFA 2B0MA 6TAAA 1VPQA 1A53A 4GNVA 1UA3A 5H1WA 3ELFA 3DC8A 1PYFA 3Q94A 4C6EA 1DQWA 1ESWA 1BXBA 2WJEA 3GNOA 1QHOA 3GDMA 1GPWA 3DECA 5HWNA 1VFUA 3VD7A 5FKYA 3GH4A 2R1NA 4PGLA 4AX7A 2DZWA 3B9NA 1KBBA 3SADA 1EQCA 5A95A 4LF1A 2OGYA 4RW5A 4TVCA 4IZGA 2Z2UA 2XVNA 2TSYA 1LT8A 4X0VA 1G0CA 3CH9A 2J8GA 4YU1A 5DY2A 2EPOA 4M82A 5F2GA 1UR0A 3PTDA 4GVFA 4H00A 1UBPC 3NO1A 1A5OC 4L6DA 4YTTA 5CPSA 2VL4A 3L4ZA 1UR3M 3IV8A 1KCZA 1W2PA 2GJRA 4Z1BA 5KZ6A 1EZWA 5HR6A 4ZA0A 3CYVA 5F4WA 3RLUA 1BSLA 2D2OA 2OEJA 1TPFA 4O15A 2I9EA 4DUOA 4KIRA 3QZEA 1WZAA 1V93A 3VM7A 1DJXA 2X1IA 1P7TA 4M29A 3ZSTA 4AF0A 2DEPA 5D9PA 4E2BA 4Q7IA 5D38A 4RPPA 4OTKA 7TAAA 2HJPA 1XGDA 1OADA 2FIQA 4Q4OA 4W8LA 4W8BA 3CWOX 3BZJA 1QXLA 1RV8A 3AHYA 1UC4A 2P76A 4FSAA 3RIKA 1SO3A 2XPKA 4P7QA 3CLWA 4ZOAA 5I3FA 3VIKA 3M43A 4AVFA 2R1PA 4IMEA 4LOCA 2NVCA 3BANA 3FA4A 7TIMA 1F3WA 3WY1A 1WNOA 4MVAA 3WJWA 1KR1A 4GGBA 4YN5A 3O2LA 1EUAA 3EEZA 3KOXA 4AIOA 1GW9A 2VTFA 3CH0A 1HUVA 4DZHA 2E7FA 4O54A 4UFIA 4F2UA 3ITGA 1CGTA 2HXUA 2WVTA 3OLEA 5FJIA 3UP8A 3EOEA 1MQPA 2XJ7A 1IT0A 3WD2A 2PU0A 4UTWC 4JOMA 5HULA 1R6WA 1NWUA 1VFTA 1Z6KA 4QLLA 2IPFA 4WSHA 1OC5A 4M56A 1W1YA 4O8AA 4TXEA 3VIGA 4E2DA 5CG0A 4AQLA 2IS7A 5EMMA 3A4AA 1QATA 2VX4A 1L8PA 3N2TA 3FCPA 1K9FA 5M5DA 4MF4A 4IPJA 1IEVA 3ITXA 4RKAA 2D0GA 1FQ0A 1P0BA 5C2XA 1H0IA 3I7SA 2VUYA 3GIPA 4MZYA 4QTGA 1S1PA 1JD9A 3EA3A 4UZUA 2XFWA 3UCDA 1EP3A 3GNNA 3Q45A 1TWDA 4DF2A 4F0MA 4HJFA 2W63A 5JVLA 1BAGA 1MEHA 4QJ4B 3SO7A 2OWXA 1PBGA 1TJRA 4XISA 5J5RA 3L21A 2VKZG 1W56A 4KBXA 2R1LA 1UP0A 3FSUA 5CGMA 1RQBA 1TWIA 4WKAA 3GDKA 1DJGA 3CNYA 3W7OA 2D23A 1GT8A 4JKLA 3N15A 4GIEA 1EJSC 5CGTA 1OX4A 3M5VA 3TSDA 1H3GA 3GZAA 1FDJA 2ZX7A 5HBFA 5D8ZA 3VABA 1UWRA 1XL9A 2WB5A 4LVBA 2NQHA 3I7RA 3D0CA 2OXNA 3FXYA 5G2WA 1VP5A 1QNPA 5A8PA 3EDDA 2WMIB 1TQXA 1XYMA 4UUIA 4AY7A 3HQNA 4Q6JA 1OD8A 3VFLA 5A69A 2ZX8A 3OIHA 4JNMA 1K8XA 1NY1A 2X1SA 1G69A 4R7WA 3T40A 2VD9A 2ALRA 5PTDA 4RE0A 2GJXA 2QULA 1QNOA 3WMLA 2ALDA 1LWIA 4O14A 1KCLA 2O4QA 3N1AA 5GVJA 4DJEA 1GYNA 4BK9A 3BICA 4CNPA 4PTVA 3M6YA 4JTSA 4GJJA 2WNQA 3BUVA 1W1VA 3BLDA 5DRIA 1K02A 3RYSA 2AQOA 3LPGA 3NQ8A 3T9PA 4O0QA 3L66A 4KCWA 4C6MA 4XSLA 2G4FA 3HU7A 3CAQA 3NQVA 1MEIA 3W83A 4GBUA 3LB0A 1OINA 1O1ZA 3C6CA 4AVOA 1QPNA 4POCA 1IT7A 3PY2A 4BWLA 3IK4A 4LUYA 4H41A 1D2KA 1OABA 2F6UA 1NIUA 4E2VA 4JN6A 3W2KA 4XAPA 3RMJA 2X0SA 3QY8A 5G1TA 3B8VA 3QYSA 3BVJA 3PZOA 2XINA 3WF4A 4KRTA 3R94A 4X61A 1XH0A 3B04A 3AXKA 1XIIA 1PJ9A 2R24A 4LYPA 2IKJA 3MHGA 4WDUA 1LQAA 5BXPA 1LUCB 3TAKA 1VCVA 2F2HA 4Q3MA 1ZHAA 3NZPA 1T8QA 5I24A 1UOZA 3GXNA 1SQ7A 2XISA 4MJZA 2GVGA 2HBVA 2XGBA 2C0HA 3OHIA 1FFRA 1X7FA 1GJPA 1GHRA 4O53A 4UTWA 2CPUA 3MU7A 2XVLA 1GVRA 1VFHA 2VP8A 1QK0A 2VO5A 3TZFA 1AL8A 3KRZA 5TIMA 4XAYA 2Q3OA 3B40A 4S3CA 2F84A 5XIMA 1J8VA 4NAFB 3AXXA 4LRSA 5TBOA 3CASA 3NL5A 1GORA 1YEYA 1HJSA 5JU6A 5DLCA 1ZNNA 3WK0A 2BY2A 1XFBA 3V16A 1S3TC 4RXGA 3T2OA 3NQDA 4PMVA 1YNPA 3F03K 4V1YA 1UOKA 1VF8A 3SUVA 2V63A 3WF0A 2PDMA 5BOOA 2V9DA 1U30A 2BY0A 1LOSA 5LNVA 2W67A 5I78A 2BHUA 5AECA 4J2PA 2CXEA 3PM6A 3SB0A 3H2AA 1RR2A 2J62A 3NQAA 2VDHA 3UZWA 1K4HA 3M64A 1BWLA 1WDPA 4RUBA 3A9BA 2ZICA 3ZT6A 1VEMA 2PWVA 2JFEX 4HK5A 1BVZA 3KCJA 1AD1A 1V79A 1BF2A 1ZAJA 5D02A 4LNCA 4RDVA 4ZB5A 4UOJA 2CLMA 4JN8A 4HK6A 1IQ8A 2QPXA 5DXXA 1BTCA 4G8TA 3SM0A 1GZJA 3W70A 5E93A 3LRMA 4RDZA 1B30A 3RPTA 3IV3A 4I7VA 3WLLA 3N2MA 3QFWA 3XISA 4JXCA 3MMTA 2FHBA 1PTGA 2UWFA 2UY2A 4YVPA 4IT1A 4JEJA 4K2SA 4Q8NA 4KWWA 2WYSA 4QE5A 4JIEA 3W2LA 1RSCA 2Y5JA 2R91A 2V67A 1XBZA 1LROA 3O07A 1V02A 3S5YA 1QI5A 1N8FA 4XKYA 4HNCA 2VZVA 3K4AA 5REQB 4YIWA 4HIBA 1RQHA 2QCLA 3LNPA 3RJYA 1SFSA 2X8RA 1QDSA 4G9PA 1HKMA 5E0KA 3FHAA 3KTXA 3VGDA 1AQ0A 3T81A 2GVJA 1UASA 1OBAA 1XGEA 1US0A 2QEZA 3AOFA 5AN7A 1K8YA 5HJXA 1JCMP 1TPB1 3NQ6A 3IJ7A 1ITQA 3ONBA 3N6JA 1AJZA 3M5ZA 1I1WA 3VIMA 2B7OA 1YMYA 1KM5A 4X3ZA 2J78A 4UNIA 3WBAA 3MV11 4CVUA 3GLCA 2H8XA 3WK2A 1JDDA 4K68A 3H2OA 3A5VA 1FX6A 2J66A 3BOFA 4GYKA 3T05A 4XAFA 4WEVX 1NWSA 5AVNA 4ASTA 4DELA 1JRCA 3BE7A 4IMDA 2DJXA 1HO4A 3U2ZA 3EKZA 1OCQA 1XD1A 4LC6A 4UBPC 4M24A 1HVQA 2DP3A 1ITCA 4YCPA 3OVRA 4QAWA 4PE8A 1YXDA 3S0CA 3ZJ8A 3O0FA 3CXOA 5DMMA 4AG0A 3GM8A 2CLOA 1UKOA 5DEZA 1WUFA 3CZ8A 4XB3A 3VKBA 1A5LC 5CJ5A 2ZYFA 1TV8A 1WKYA 2HS6A 4HPXA 3EWUA 1GOQA 1XIBA 4J3UA 4AF0B 3GBDA 2XIJA 1ICSA 4I9AA 2F8QA 3UWQA 2ONEA 3HN3A 3S83A 2CKRA 2VWSA 3LHVA 3MKCA 4PUDA 4WRHA 1H5YA 3WD4A 4YVXA 4AD5A 1Q6DA 4MWAD 3BARA 2TPSA 3QHNA 2PWFA 1K3UA 5C9WA 1EJTC 3BGJA 1LL4A 3KS6A 2I17A 4H7ZA 5I6SA 2XZ9A 4WOQA 3A3HA 3HQOA 1IXOA 4MUZA 3R4IA 3P7YA 3DFQA 3QOKA 3QJAA 4XQ6A 5J8LA 2PUZA 1D8WA 4Q4QA 4ACZA 1JQVA 4GC3A 4LVGA 3N34A 1WB0A 3REQB 4ICCX 4Z2KA 4FIQA 4XBJA 1KKOA 2V30A 1XBVA 3V5OA 4US6A 1A0DA 1HFBA 3AMLA 5F4XA 1TV7A 1G7VA 2YXGA 4JZ5A 3TVAA 3B9EA 3WJSA 4C7FA 2C79A 4ZQPA 5E70A 3TSBA 4HN4A 2BY1A 4DLMA 1VBJA 3EPMA 1A5SA 3N11A 3GH5A 3CV1A 5D33A 4KIEA 5BRQA 2VR4A 4E4UA 4DVOA 1LBFA 3AICA 1D3CA 4JQ2A 2Y7EA 3P8IA 5LNSA 5HUOA 4HMNA 5H6HA 1C8YA 4K39A 1P6WA 1HKIA 4Z2HA 1SJAA 2HCVA 4Q32A 1O5XA 3H53A 1CXIA 1UH3A 1EEPA 1F05A 1FHLA 3SY5A 3PTMA 2WVSA 4ZB2A 4P5UA 3PZMA 4GINA 1L9WA 2WHJA 1LCOA 5F1VA 1TMHA 3F4NA 4A3HA 3KRSA 1DKWA 4G1KA 3M07A 1IWPA 4M7SA 1J12A 2OPJA 4IPIA 5EBAA 2ZUNA 4DJDD 1MXSA 5TD4A 1EWDA 3U4FA 3CAKA 5D30A 3A3WA 3QW4B 3ZJ6A 2ACRA 2QW5A 2X0HA 3CV7A 2QCHA 3LCFA 2ISWA 1VPXA 2PGFA 1I8JA 4R9XA 4Y9NA 5CC6A 2GQ3A 4GFSA 4FXRA 5CSUA 1LQ0A 5HOSA 2GYIA 1HJVA 1UZHA 1HL8A 4C65A 5LA1A 1U1JA 4AXKA 4RE2A 5AHFA 5LA2A 3NR0A 3WIJA 1ODUA 4AH7A 3GWQA 4WSJA 3KOWA 2W66A 1EUNA 5JBEA 2GZXA 3RCMA 1PS9A 3HJZA 2DUAA 1LOLA 3GXMA 2B7NA 4LUIA 3KVJA 1OF8A 4PMXA 3BQ5A 3SIMA 4ECLA 2JIWA 3GVVA 3M44A 4Q8UA 3UVIA 1X39A 1J4EA 2QMJA 2BG5A 2ABBA 3WMSA 4ZMGA 1H61A 3ARSA 4C6FA 4UQBA 3FVMA 1QNSA 2W3ZA 2PDJA 3LTSA 4H19A 4PCTA 3GTHA 1XDMA 1EF2A 1R85A 3PULA 1YDOA 3HPSA 4MLRA 1JEZA 1KV5A 2WPBA 3G77A 4IFKA 1PPIA 4ERIA 2PZNA 3N4AA 2AAAA 5A6BD 2QGYA 1L6YA 3WF1A 2OB3A 3VD5A 2ZQ0A 1SR0A 2O9PA 1H0GA 4KFNA 2ZX5A 4W5UA 4P7OA 3PUDA 4HMEA 3PFRA 1GWJA 1H7PA 2X42A 3IGUA 2YDSA 5ABEA 3L67A 4TR9A 2JEQA 4MTVA 3AS0A 1J96A 2C8NA 1B0IA 2CHOA 1R3QA 4Q8QA 3TQPA 2HVMA 2PDBA 4CQDA 4EAYA 1SGJA 1TE6A 4PBEA 4MKSA 4ICNA 2O92A 2ZCGA 3ES7A 4O50A 1FKXA 3LXAA 4DZIA 4CQ8A 3TW7A 2Z4GA 1DPMA 3GHRA 1FFQA 4W85A 3EB2A 4LUSB 4IGMA 2J77A 1W9BM 2WPGA 1KBLA 3KE0A 3SQSA 4ZO9A 1TZ9A 3MTWA 1PDZA 3BAIA 2P0IA 3CMFA 2V5KA 1UR2A 4BI6A 4Y9AA 3S1WA 1Z7AA 4LEQA 1SR9A 1TJ2A 3PFMA 1W1IE 4DPQA 2XUCA 1LQ2A 2CITA 4D8AA 1ZTVA 3WQ6A 1XHGA 3W7KA 5G2HA 1UB3A 3N3MA 5DQPA 3AYVA 3PF3A 3OZMA 3WMBA 4W93A 2I56A 2Q6ZA 1YPFA 4XZNX 2W62A 3W4RA 3CMGA 3W22A 3W37A 1W9DM 2B7QA 3WQPA 3RCNA 3LI0A 9XIAA 3W82A 1I75A 4W88A 3GS6A 1RBLA 1TTQA 1E9ZB 4O1DA 5AHLA 2HROA 4GZIA 1WOAA 4YMZA 2ZXBA 1VFOA 4XKYB 2WWCA 2YCLA 1MQQA 4C6PA 4QM1A 5E6YA 1FP8A 1EJ7L 3SQLA 3D47A 3HG2A 3OVGA 4ZFMA 4LYQA 3T4CA 4F2TA 2VOTA 5DF0A 5LIWX 3IK2A 3NZRA 2RHGA 3FJLA 3NA8A 1PAMA 3CUJA 3UG5A 4UTHA 1ZAHA 4REQA 4UZSA 1LZOA 1KQZA 2ZRWA 4HSNA 4QEEA 4A6GA 5M03A 3SIZA 1T41A 2FZ8A 2VCBA 1OT2A 3CQJA 4TVUA 3S6OA 2XN1A 2Z7KA 1YTKA 2XIBA 3NOEA 4FXJA 2QCNA 4EWND 4KRZA 1YIXA 1PCKA 4L4MA 2YDAA 4D6HA 1NSJA 3T44A 3OOQA 1CDGA 3K8LA 1RA0A 3DBPA 2I14A 2JF7A 3WH9A 1H50A 3VGHA 5A2BA 4ATLA 4QQUA 1KB3A 4V33A 4WXYA 3UERA 1B3YA 4IQJA 3P82A 4CCDA 2I57A 3U2CA 4ZOBA 3W3OA 3L9CA 5FD0A 3TKFA 5EFDA 2BOFX 3S2JA 2PP3A 1ITUA 3TOYA 4WJ8A 3T07A 3F5JA 3OZYA 3GNDA 3KEHA 2JK2A 4GIAA 3S5ZA 4DEFA 5H91A 4O1CA 3W1PA 1LLWA 1R87A 3IGSA 3QR3A 1VHCA 1NWTA 4W8AA 3DYOA 5DX7A 4NI8A 3LX9A 3N9KA 1J2WA 1DIEA 3R2GA 3S9IA 4N9BA 1F6YA 2OGJA 4JTTA 4HOXA 2O56A 5I79A 5BXRA 4CUCA 1EHNA 4CCEA 4MB4A 3H2FA 4L9ZA 3IIVA 3H6OA 3ZSSA 1FWBC 1OQFA 4OKDA 1TE1A 2D3NA 2QZRA 3O05A 3OZOA 3VOFA 4OE7A 3VCNA 4GQGA 4FOUA 1G4PA 1ONWA 3BCDA 1H51A 2WMKA 3DHUA 4OOUA 2G96A 1V7AA 3LHZA 4MDOA 2VENA 3PTQA 3PG9A 1X1OA 3A4JA 1P5BA 2YOCA 3W26A 4FOKA 1JPIA 3VIJA 4RLIA 2J9XA 2CLIA 2GDUA 3APYA 4ENLA 4XVEA 4ATDA 3FK4A 4UTIA 1EDGA 1TR9A 4C5YA 3LLDA 3TOPA 3WLKX 4DYEA 1E6RA 2QXWA 2IKIA 1YE4A 1UKPA 3EX3A 5EBUA 3KL0A 1EC9A 3MHFA 3WYZA 1TTIA 3O6YX 3OW1A 3USZA 2NQ9A 2VUNA 2YFNA 3LHUA 3A12A 3DKLA 3UXKA 3U57A 1TX2A 1REQB 5A6MA 3MO4A 1CENA 5AHEA 5CAHA 3E12A 4O17A 5G1MA 3BAWA 1DJWA 3ZT7A 1EJVC 3RITA 3WFZA 5HQMA 3CB3A 1EA9C 3LNMA 3R7MA 2DUZA 4TX9A 4JTRA 4B3ZA 2G3NA 5CZTA 2QDDA 2VDIA 1XDJA 1FXPA 2YL5A 1VR6A 3NJ3A 1D3HA 6XIMA 3S5SA 3GXIA 1JRBA 4G1NA 4V15A 2BVYA 3TJLA 1UROA 2QIWA 4IMFA 4MOZA 3LI1A 3UPBA 3EWDA 3AUOA 3CJPA 1V6WA 4WKHA 3L4YA 3VOCA 5CG7A 4C6OA 3HTWA 1BRLA 3QMTA 3TC6A 1QPRA 1GEHA 5AYIA 3SCQA 1Y65A 1NM9A 1KO0A 3W38A 2OQYA 1IWAA 2ISVA 1W1B1 4IJCA 3FIGA 1AMYA 3V1PA 3NFUA 2WJDA 5AZ1A 1UIPA 4XWUA 4PODA 3PBYA 3TNOA 2BDQA 2ZUVA 2ZC1A 3NPVA 2C0AA 3UBPC 2OX4A 2ZUSA 5I3IA 4DM2A 2PLMA 5EA9A 4N6FA 2EEXA 1E9YB 3NQBA 3OQEA 3ABOA 3VKKA 3ANYA 1Z9AA 2Y8VA 1G94A 1VENA 2NQ5A 5A6TC 1V0KA 2VFDA 2O9TA 1W17A 1IZJA 1J6OA 1I2QA 1XYFA 4FLSA 1RUSA 3HG4A 1OJXA 3WK3A 1O12A 4HZ6A 1JVNA 3KM8A 5A6KA 2E9MA 5GNYA 5D9NA 1PKNA 3NSNA 1DWGM 3CHDA 4NG3A 2JKEA 4MWAB 1U5VA 3TJXA 4KQNA 2VJXA 3TC3A 2BASA 5LHFA 1Z3NA 1W3KA 1P0DA 1YNYA 2YB1A 4QLJA 3T0CA 2D0HA 3B03A 3K13A 4KW2A 2AOSA 3RNDA 5K9DA 3STEA 5CLTA 1F4HA 1W9XA 3AMGA 2JKPA 3URNA 4JS3A 3KVKA 4DBDA 3TH6A 1PVNA 1A5MC 1UR4A 3LLXA 3LERA 2PDKA 3ZM8A 3O16A 4B5SA 4E4FA 5MHBA 4LB3A 1K70A 4DLFA 3PBMA 1S5MA 2ZDSA 2Y85A 1F61A 3PVFA 5IXEA 3QMSA 3IACA 1KXQA 1SFLA 5AYBA 5LYRA 1SYTA 2XDFA 5LGXA 3WQEA 2FPTA 1FDZA 1VC4A 2Y24A 3RXZA 4GVIA 3PAOA 4PTNA 3ORWA 4HOWA 1VRDA 1WDQA 4XAZA 1K9EA 3B05A 4EXBA 3OGSA 3KFTA 2VC7A 1E9IA 4G7EA 2P3ZA 4GZ7A 3VMPA 3G1VA 4WXZA 1EZ2A 1A50A 3V75A 5C70A 5ABFB 4OQVA 2DVUA 4NZFA 3WO8A 4PN2A 3WENA 2HSAA 3URAA 4L9XA 1TSIA 5CAKA 5CLWA 3B3DA 4HA3A 1GVQA 3ATZA 4B9YA 1SW7A 2XTKA 1ZL1A 4RNHA 3LV6A 1OFOA 3K2GA 3G0SA 1QI4A 3NQ2A 4LB4A 4TTGA 1Z44A 2C91A 3S3GA 2CZFA 4ZB0A 4IIDA 2Y6ZA 5G2IA 4JTAA 3EWZA 5LKYA 1HQTA 3LPOA 3SY1A 3KP1A 1XKYA 4LAOA 1IIGA 4IIGA 3AO0A 1TKKA 2GSJA 3VNMA 3NQFA 3O6CA 3HV8A 5LNRA 4TMBA 3BOLA 4NZ3A 3DGBA 4C91A 2OYMA 4GK8A 3BAYA 4NZCA 3LYEA 1R46A 1OFDA 1KGXA 1EDQA 1XLGA 4W4QA 3C0QA 1EWEA 4ML4A 1X38A 3V7PA 2PDNA 2Z2AA 2ZUUA 1AW2A 3TCSA 4NQ1A 3WBXA 3CO4A 4MJ2A 2ZUWA 3EPOA 1AODA 1TJPA 2NWSA 3HMCA 5KINA 4GQ0A 1IZCA 4BR1A 2YL6A 2D73A 4RZ6A 1F76A 3WF2A 1FWEC 3FKRA 2OZ3A 3ARZA 3VDBA 4JYEA 4LH8A 4FA3A 1W9PA 4GCXA 3QV9A 4CKQA 1W0MA 4BQ3A 1ZB5A 1BG9A 2CLLA 3AZRA 1OK4A 3NO3A 2BOEX 4QJ3B 3VNKA 2QAFA 3DG3A 5CSSA 5KZEA 3L5LA 1PKLA 1UWQA 4GA8A 1DIKA 3RO8A 3QSTA 3OBKA 3B8WA 4L56A 3WZ0E 4U2YA 5FAJA 1BYCA 2A3LA 3EWCA 2VEGA 2CKSA 1N2VA 1KFKA 3UXIA 4AZIA 1KFBA 4QE4A 2DSWA 5MKGB 3KZPA 4MJ4A 3WSUA 1YPIA 1AK5A 1IR2A 5A8GA 1IR1A 3EEGA 5LIXX 3NL2A 3W25A 2CCRA 4G5DA 4LANA 1XQKA 2ZZ4A 1GJUA 3TQVA 1V3MA 2ZKMX 4CNTA 3PUOA 4NNBA 1P7TB 4Z2GA 2BFGA 3UR2A 4LCRA 1MYRA 3DN5A 4IXXA 3MDWA 4DBWA 5CZ0A 1MVYA 1CXKA 1HXJA 1FXQA 4NX5A 2BWGA 5CCZA 3KL5A 3HPAA 2WC7A 3TYEA 1JYVA 4GVGA 4I9MA 1GK8A 3ALFA 1CGWA 4HP5A 1E1EA 4EE9A 2QCDA 3F4WA 4NSBA 2J8FA 5DELA 4O4WA 2NXHA 1IYXA 4XIMA 2IUZA 4LW7A 4RE4A 4YTRA 2XWDA 3NTYA 4Q4RA 4LS0A 2YBUA 4GVHA 3LCWA 3MV01 2ICSA 3K1DA 1LRQA 2IPGA 4XTDA 3FN9A 5DCDA 1SZGA 3N13A 5K4XA 4XBSA 2QV4A 4LUTB 3VE9A 3IUIA 3REQA 3FJ4A 2J27A 5FJRA 1T7LA 2EKGA 1P0EA 4ZFCA 4S2CA 3NURA 1O60A 3C8FA 2VC9A 4NZ5A 4C1LA 4EVZA 3SCVA 2OTDA 2YGYA 4H6KA 3NAVA 4KRUA 2V3EA 3E96A 5C7HA 4RNIA 4H83A 3RDKA 1WPCA 3KRUA 1SMDA 3DOPA 4OZOA 5DMYA 1WDWA 2FGLA 3TJ4A 1PZ0A 1KXHA 1UUQA 3L4UA 2V5LA 6A3HA 1EC7A 2REQA 3CV6A 4UR9A 3OVPA 5D9MA 1ADOA 4JQ3A 1OF6A 3MP3A 3ZJKA 1X8FA 2VT0A 1RXOB 3C4UA 3I6EA 3GDLA 3CIXA 2Y62A 3WNLA 4WUIA 3WNOA 2VMFA 4L6OA 1JZ3A 4PCPA 1RLCL 2WV8A 4QITA 4A3UA 2OO6A 4AZ5A 3T08A 2X7VA 2Z1VA 4JTHA 4CGTA 3B0UX 1W37A 4AWEA 3U5UA 2WVVA 1XFCA 1E70M 3WBYA 3HPFA 3PPHA 3BGGA 1E72M 3LGGA 2CFFA 4WSKA 3V5FA 1ZBCA 4H9VA 3P60A 5HUPA 3IJ6A 3R5EA 2ZZ6A 2OSYA 1TV4A 2NXGA 3SN0A 3LGEA 2X09A 4N9EA 1TTJA 4C5ZA 1ITXA 5D2YA 1NOFA 1MUWA 2YL9A 2ZDRA 1JZ4A 1ONRA 2VGGA 3EWWA 2G3MA 3LTYA 3I10A 5I09A 1U83A 3KZSA 3EMCA 2QUNA 3DFOA 2NSOA 3PPCA 3QFEA 4KCUA 4QE1A 4BJHA 2FFCA 5DY3A 3BWWA 2OLHA 2WNZA 3OVQA 2OOGA 1AH3A 5C9ZA 1BKSA 5KEZA 4E38A 2Z29A 4J40A 2PDCA 3NL6A 4UXDA 3HG3A 3W1TA 2YR1A 3DHFA 4DJEC 5BXTA 2CHRA 3Q58A 3WDJA 5I3GA 1V0LA 3O9NA 2RH9A 1ME9A 4LUTA 1UPMB 2GLKA 3KBWA 3VX0A 1VBRA 3BOXA 1CZ1A 3KLKA 4CD7A 2E8YA 1C92A 1X6LA 2AAMA 1GNXA 5F2MA 4O19A 1M41A 1CXEA 2E8ZA 2ACUA 2PCEA 4ACZB 3ALGA 4AEOA 4MUPA 3W7RA 3W88A 4M5PA 3LHYA 1FOBA 4B5NA 5BW6A 3QQWA 1DWAM 3U0HA 1HW6A 1L2UA 4AHOA 3C2RA 3B8UA 3LBMA 1KQYA 3BLKA 4UTTA 4KGLA 3N4EA 1TPH1 5C71A 3NGFA 3CPGA 2CBUA 4K8EA 3VD4A 3IJLA 3OQ8A 1L6SA 1J9YA 4AD4A 4LY4A 1R3TA 1RD6A 1WDDA 1M65A 2YZ5A 2A79A 4GBDA 3W7EA 2DW7A 3PUGA 4LV9A 2ZOXA 1H11A 1DWIM 1GOXA 1V6XA 3AU6A 2BXYA 2GSHA 1JQXA 1S5WA 1EXBA 3G1XA 2V5CA 3EKGA 2VXNA 4V1XA 1D3GA 4H2HA 1E43A 3MI2A 2NUYA 1SFJA 4BCEA 1FWDC 1GKRA 4AZCA 3GDRA 3WELA 4FO4A 2GFTA 4GWEA 1JGIA 3VOJA 4Q4MA 1IT8A 4X9SA 5AZ0A 2WXDM 1EBHA 3O8AA 3WLQA 3ITLA 4DZAA 3UR5A 2ZVIA 2OJPA 2XIIA 3GXTA 1DYSA 5DT7A 4WHBA 4MHBA 4OV9A 3SI9A 5DBUA 3R12A 1BHGA 2BGNE 2J7CA 2HNEA 1XLDA 4FNRA 1KRBC 2R6OA 3WD3A 4ZO6A 2EG8A 2W27A 2YCKX 3VUPA 5AC8A 1DHPA 4D6GA 5B7ZA 1LUCA 1F7BA 2PTYA 3JS3A 2O9RA 3DFHA 3RPMA 1EGZA 1Y5WA 1GTEA 3ZXWA 2ISFA 1UC5A 3HIJA 5FA5A 2NUXA 3N3TA 4HTBA 4N2YA 1XRTA 3QY7A 3ZT5A 3TYBA 4QJ1A 3R11A 3FW6A 3W28A 2DUXA 4F79A 1TV3A 1WXYA 4AISA 4PMNA 3ONCA 3W07A 7REQA 2WK2A 4HNVA 1S1RA 1AW5A 1EC8A 2ODOA 2E6YA 3WD1A 2G0WA 2UY4A 2X40A 2JE8A 1PIIA 1A3HA 1OGGA 5C8BB 2J7DA 4O4VA 4KWSA 1H09A 1NF0A 1V3HA 2Y5EA 4C6JA 2A0NA 5T9BG 2PDIA 2XYLA 1FCQA 1LRTA 4WF7A 2WW5A 1NDVA 1FUYA 1HIZA 2P50A 3WQVA 3MSYA 2ZA3A 5CJNA 2VEFA 4UOZA 1WA3A 3WMCA 4S3GA 3C3UA 4HCLA 4ORMA 4R88A 2ADAA 3GYCA 3GRIA 1DP0A 4ATWA 3LQLA 1ISYA 3DERA 3UNTA 1OZQA 2FPVA 4IGNA 2R82A 3TTEA 3WEMA 1UUOA 5DRCA 3UR8A 1P6BA 2J9YA 1RBAA 1O5RA 1F5ZA 1XG4A 4JHZA 1WDRA 2E40A 3THUA 4EXQA 2P1FA 3RO6A 1MW0A 4EKJA 5AYXA 2FDSA 1I45A 4LEFA 4PTDA 5BNKA 4AYSA 4Y6GA 2X7WA 3G1RA 2W4XA 4DXKA 4GKTA 1EPXA 2PB1A 3CPUA 4UMBA 3L5MA 4BFAA 3HQPA 2OFJA 3KDOA 1Q3NA 3MWAA 3AIRA 3AIUA 3V1HA 3FXGA 3N6QA 2BLEA 3LA4A 3SBFA 2DIEA 1OG6A 4QG9A 3OYXA 3K4DA 9XIMA 1YXYA 1OX4B 4HHPA 4M19A 1B3VA 2Y2WA 4AY1A 3EX1A 4LYRA 3FOKA 3QGKC 5I3KA 4YLWA 2HNHA 3GVQA 4GY1A 1OFBA 4PMZA 5U7SA 1BLIA 1F3XA 3PZQA 3G1AA 3GG8A 1C29A 1W2VA 1PX4A 3NPWA 4OUEA 1BSIA 5A6SA 3GUWA 2J24A 4WJEA 3GXPA 2VGBA 3OA3A 4PUMA 3UESA 2VD8A 1JZ8A 2Y89A 1XC4A 2GUYA 2VURA 4JIRA 3E02A 2Y5SA 3WLTA 2A3BA 3MBFA 3IVTA 5JXQA 4NAEB 4O0ZA 1ZSXA 2Y8KA 2Q71A 4H7VA 4AVNA 2XN0A 3FEQA 4UQCA 1QHPA 2QUTA 4YYFA 4CNOA 4RZ4A 1NH6A 2EPKX 4E6MA 4J3WA 3SCTA 3SW6A 1K8ZA 5FJTA 4MNKA 3WQDA 2OQLA 1UKQA 3G1SA 1LTDA 2OOFA 2BS9A 3W1NA 5G4WA 5EPDA 1HJQA 1NELA 3P74A 2CBJA 3MB9A 3W1QA 3UZ5A 2E6DA 1GOKA 3EB3A 2WMIA 4GO9A 4XIAA 4Y7EA 4AUBA 1TB3A 1W3TA 1JUKA 1GQIA 3IRDA 3CO8A 5FF3A 2QVHA 3TN3A 4EOUA 3WDRA 2R8WA 1QHZA 5FL1A 2PEVA 2E6FA 1R2RA 2X2GA 4H6EA 4O0KA 2HK1A 4D1JA 2CWXA 2PDXA 1KFWA 3R13A 4PUEA 3WNMA 5HQLA 3W81A 1TIWA 4LAKA 4O28A 1P4CA 4P61A 3NUKA 4HYRA 3W7NA 2BODX 1NF7A 3V18A 4CQ9A 1PTDA 1RK6A 1JFHA 4AXNA 2ISDA 2I5GA 2PLJA 3HV9A 4NY2A 5ABHA 2E0PA 3K46A 3MW7A 3OIXA 4CNNA 2J7BA 3POCA 4WZHA 4DBUA 4PFHA 1EIXA 3A24A 2VCAA 2Q02A 3DIPA 1CB2A 3GZ3A 1E0VA 1M7OA 1WAUA 4MY9A 4UQ9A 4OFCA 1SPQA 2J25A 2ZZ3A 3GG0A 4HOZA 5K7JA 4Y2WA 5HNRA 5FACA 3WDHA 1NU5A 3E38A 1AFSA 1V3LA 2E68A 2HE5A 3TYUA 2NVAA 1ZY9A 4XV0A 1S39A 1SZNA 1JPHA 4MFDA 3G1HA 5EY5A 4NVTA 3D6NA 2E5DA 1CIUA 4AD3A 1X8CA 4TU1A 5M3WA 6XIAA 4K38A 2XIQA 1YPXA 2FVLA 4H8VA 2HZGA 1PWMA 1DJQA 3S4TA 4OUIA 2PRMA 1VPYA 2QJIA 1N55A 4N6EA 4LCSA 1R30A 1VJZA 3Q37A 3AS1A 2WO5A 2CESA 4LS1A 2WSKA 3PZIA 2DZAA 4HU3A 4X0NA 4U5KA 4PUUA 3VOHA 5H2ZA 1C93A 3BJSA 2OEMA 3W6MA 1Y5XA 1FWWA 4B4HA 1SU5A 4JDBA 4D9PA 3RRXA 1EOMA 1EO7A 1OFQA 1RVKA 2P8CA 1C9WA 2XH4A 2WBGA 1I6NA 5HWJA 1E3XA 5A6BA 3AXHA 4W9TA 4HCHA 1DEDA 4B4FA 3W23A 5C55A 2Y0FA 4KFPA 2PDHA 3EOOA 4FNPA 4UFKA 2PMQA 1HKVA 3DHPA 4Z1AA 1TR1A 3ZWSA 5I3HA 1PZ3A 2FHFA 3N2CA 3BJFA 3H24A 3QV8A 3TA9A 4URIA 3WQGA 1QAPA 5L9FA 4DBEA 1G01A 1L6WA 5FESA 1XGZA 3GUGA 1KFCA 3LRKA 3A23A 4Q8MA 1QASA 2J8TA 4B91A 2PTWA 1FRBA 3KHDA 3ENLA 3O6DA 4AC7C 3WN6A 1SSGA 4WGXA 4ZODA 1ONXA 4PUJA 1B31A 3BC9A 5HR7A 4KESA 3DAQA 1WP6A 2PSNA 4LWWA 1WXZA 1GVSA 3QSRA 1X1ZA 5BWAA 1GG1A 2IPWA 4ZXLA 2TODA 1I2PA 4JX5A 1TWWA 3IIPA 3U2EA 3N2XA 1UD2A 3AYTA 3N4FA 3VKJA 3O06A 4FXFA 1ZENA 4B5WA 4DJDA 3L2IA 5KZDA 3F7JA 4DXXA 1YTEA 1R86A 3SCPA 4YCOA 3GSMA 4DXVA 3UZYA 5HA7A 4GXWA 1A4MA 1J0KA 2A85A 2OX1A 2WNWA 3P8JA 3DENA 5ABGA 2Z0IA 3IS4A 4D72A 1KCXA 3NO5A 1HO1A 5CBJA 4UCGA 3UYIA 3TW9A 2GGHA 2UY3A 4W7WA 4FLRA 4B92A 4MWAE 4JFVA 1HP5A 4RV3A 3TN6A 1W1TA 4OV4A 2KZHA 3GR8A 1DJNA 1EX1A 3N2OA 4K36A 1KW1A 2OVLA 4XUYA 2G5WA 1XYZA 1JNDA 4IP4A 3GG7A 2J6VA 3MUCA 4R53A 1CB7B 2ZX9A 1ZCCA 2HK0A 3EXRA 3QEZA 3IAPA 1F73A 1FWJC 3AS2A 1A49A 1I2NA 2V6AA 2YDRA 3WKZA 3S1GA 1HN1A 3W2JA 1PKYA 2E5BA 4JTGA 4RDWA 4PRWA 5HMFA 4F0RA 4CVWA 1EP2A 3C2EA 2E6AA 3D3AA 3PN8A 1NQKA 4K3ZA 3BLPX 1QI2A 3L2LA 3I3BA 1NWRA 4A29A 4QDWA 1EKOA 1VZWA 2GJPA 2PWUA 3J7HA 2BTMA 2YLLA 3QF0A 1M9HA 2WM1A 2VX6A 1UWUA 4HKPA 1TVPA 3B8IA 3EAUA 1W5NA 1MDRA 3ZJ7A 1JGMA 5CZJA 3HJEA 3VNDA 1V3JA 3THDA 5BXSA 3SCWA 1LORA 1QNVA 3M5YA 3NPUA 4A3QA 1GGOA 5FF0A 2ZZ7A 4EIVA 4G6CA 1UBSA 2E1DA 4AWUA 4X2RA 1VRXA 3BG3A 3U7VA 5AC4A 2POZA 3DFPA 4WKFA 1QFEA 3L0KA 1PV8A 3C2FA 4WR3A 1SM9A 1SSDA 2PWEA 4IF2A 3AMDA 2TRSA 4O11A 1HF6A 3WH7A 1LG2A 1W1ZA 2X0YA 4PCFA 3E3HA 3NQGA 3TYDA 1OFRA 2VHLA 1KTBA 4EPDC 2V82A 3W9ZA 4HNUA 5MKGA 2F9RA 4IFOA 4JX6A 4H4IA 2XM1A 3BZGA 1I0DA 4HNTA 2FVKA 3ZZ1A 3RR4A 3VNIA 1J2BA 4IL0A 4KMQA 3NSMA 4W84A 3C8NA 4UQEA 3VTRA 1JZ6A 1US3A 5FL0A 4GISA 1DE5A 2X1TA 3ARRA 3SUTA 3MS8A 5T91A 1FHDA 4P8XA 5CPQA 4GIRA 3N2BA 2YIHA 3HFYA 4RL3A 4ZL1A 2UV8G 3VYLA 1Z8AA 4DIAA 4TIMA 4YWSA 3QTGA 5ECVA 1EO5A 1JCTA 1NTHA 1VFSA 1F07A 3W1RA 1M03A 5K4ZA 2HISA 3E6EA 1R3VA 1MZRA 1TVNA 3WG6A 3TV8A 1MUCA 4PMOA 3PSVA 1QOXA 3VD3A 1E55A 2YCIX 2F6XA 3U7BA 4R7OA 3PS7A 1JDFA 3VM5A 3KCOA 3RFAA 3W7HA 1XRSA 4LX4A 4Q22A 1HL2A 2FH8A 3P84A 4IIBA 1G4SA 1XH2A 1G4TA 3OU8A 3CT2A 5D2TA 5CZSA 2A3HA 3C2YA 3E2VA 1HL9A 1Q6GA 3GKFA 4C7DA 1TV2A 1NQ6A 4HN8A 4AZGA 4FX7A 4YNGA 4IICA 3WQWA 3CUIA 1YLVA 4JY9A 2PDWA 2WZIA 3HGJA 4LJ3A 3PBVA 3HFTA 4O10A 1VIWA 2WOQA 1WKDA 1CGVA 1EJUC 3KBNA 3CZLA 1RCXB 3NWRA 1HG3A 3PTKA 3PNZA 4E8GA 4ERGA 5AVHA 1P0KA 1XUZA 4JTIA 2CZDA 2E28A 4FK9A 2HBXA 2VM8A 5GNZA 3CAWA 4IISA 2QF7A 5CC7A 5C9UA 3TMLA 2RDTA 2WKLA 2XH0A 1CXLA 3VGEA 1TO3A 4IGSA 1FWNA 4PRTA 3NXLA 7PTDA 1BD0A 3JZEA 3UT0A 3NXFA 2HWGA 2RAGA 4NF7A 2ZTJA 1BEUA 1O94A 1LDCA 5FIPA 3OJGA 5M2FX 4FMVA 2XZ7A 4H8UA 4OWGA 1XXXA 4PUNA 1Y0EA 4WIWA 3VPLA 4PBFA 2A1YA 2WZTA 4P8UA 1HX0A 3WFLA 4KEZA 2FZDA 4FPSA 2YW3A 1XLHA 1Q6OA 4NXKA 4QSHA 4MLJA 2YB4A 4JL2A 4XK2A 3ZOAA 2DT1A 4XX6A 3UJSA 3SAZA 2RJGA 3MMWA 1DJIA 4GYJA 4OVXA 3MYOA 1YBQB 5AC5A 1QUMA 2VR5A 4KETA 1E1CB 4E8CA 2C19A 3RM9A 2QCGA 4S3KA 2I1OA 3TMQA 3LRLA 2PU1A 1PXGA 2UY5A 1EX5A 5LNUA 5C9RA 2EGZA 5BRPA 2VZOA 2VCCA 1Q6FA 3AYSA 4NIRA 3F1QA 4F4RA 4U3CA 3FJNA 3R79A 3RR1A 4RR4A 4MWAA 1JCYA 1U22A 2DZVA 3OHMB 3UXLA 1I2RA 2DDXA 3OGVA 2XGIA 2PDUA 1L8NA 3ZQ9A 4J7RA 1JZ2A 1PX8A 4GYFA 1OFPA 2FFIA 4ICMA 3PAJA 1S5TA 3A3XA 3LZ5A 4B15A 2ZWZA 1H62A 2I16A 3WJZA 3MA8A 1SZRA 3QC3A 4U28A 4JFUA 4AMCA 4QEHA 1TUXA 1YNQA 1OYAA 1OFEA 1UG6A 3LSCA 2KX9A 1GYMA 4EPKA 2HVNA 1G5AA 1E4NA 4IM4A 2NQLA 3OG2A 1AH4A 2CZ5A 5BZAA 4GGHA 2PF0A 3T78A 1T99A 5BMXA 5CPMA 1WAWA 4NRRA 3R0KA 3GY1A 2VGIA 4NAFA 2ZE3A 3SGUA 1PUDA 1P1MA 4GJ1A 5J04A 2HE8A 3APGA 3WUBA 1SUXA 4DYKA 1E4IA 1YRRA 3MVTA 3IANA 2WZEA 3VINA 2ATSA 2CZEA 2QV5A 1MNZA 3QR1A 2VELA 4Q4PA 3E0VA 3ABQA 4C6BA 1UP3A 4H9ZA 3LTPA 4ZENA 3V3WA 2AL1A 2H9AB 3KVMA 4Z42C 3QY6A 2OZTA 3QZAA 1M7XA 3STPA 1PSCA 1OM0A 4CU6A 2A2IA 4M7TA 4AEFA 3TROA 2PWHA 3CK5A 2PTDA 2Z28A 3HA1A 1L0PA 4UIOA 4GQBA 3NQCA 4FR1A 4E3VA 2BBFA 4OBTA 3DXIA 1BF6A 1IEWA 2VDGA 5GJMA 3MSGA 4Q7BA 3VK5A 4Q8VA 2GVEA 1FBAA 3W1UA 1BQCA 3NSXA 5A6JA 4WVXA 1EF3A 1C90A 1X6UA 4A3RA 4CNSA 3BURA 2PD9A 2WCSA 2QT3A 1ELSA 4DY1A 2C1HA 4EWJA 5A8NA 2PDGA 1NDZA 3TQ0A 5D8WA 4U10A 4GI4A 3WF3A 1ADDA 1OCNA 1T8XA 3H8AA 1SZEA 3DYMA 2AL2A 3SUSA 5CPTA 4A05A 1VH7A 3Q67A 1FHUA 2I5QA 2ZXQA 3EZ4A 1XICA 3WDPP 3CAVA 1B2YA 3CLMA 2G3IA 3DFTA 3IGXA 2GJXB 5G1YA 4JN7A 3BAXA 4Z1YA 3A5FA 4DO6A 2WCGA 1M7PA 1OEPA 2H9AA 1EDTA 3EXTA 2CNCA 4GOAA 1H1ZA 3P2VA 1JDCA 2DIKA 3VGGA 4J3SA 4HVXA 3ME3A 1WYIA 3CBWA 4JHMA 2O4MA 2QAPA 4Y9PA 1U5JA 1XG3A 2YW4A 3W7QA 3B9AA 4HD5A 1K4GA 2FTWA 3TA6A 3I4KA 1F2JA 1VB9A 3KL3A 2RDUA 4BQ2A 3VMNA 4MG4A 3KCLA 3G3MA 3PPGA 4J3XA 4HJWA 1QWKA 4IG2A 1E6NA 4IP7A 1L6GA 2QJJA 1I4NA 5LZLA 1TPDA 4ZTXA 3ZYZA 3UYCA 1VD6A 2WC4A 5ABTA 3AUJA 4L5ZA 1H7XA 3OBAA 4ACYA 3TX9A 4XZWA 1KWGA 4NNCA 2GGJA 1CLKA 4CU7A 5J5DA 3EOLA 3LPFA 4HPNA 4QLKA 4I9TA 4A8LA 3MBDA 2ANUA 3OODA 1PTAA 1GQJA 3P5ZA 1JCXA 1EGVA 1POKA 1K6AA 3FS2A 3MDUA 3RLHA 1B3XA 4AD2A 3E0IA 1O7AA 4L4LA 2BHZA 1M04A 3VIIA 2EXOA 2OWCA 1MQRA 1LRNA 1P0NA 1R2TA 1Z42A 3UGVA 4FOJA 2NX3A 1X6NA 3ECQA 3AIQA 3PWAA 1ADSA 1FWCC 4E8DA 1GJWA 4TV6A 3W27A 1H49A 2DH2A 2QJMA 1AZ2A 1H4PA 2Q8LA 1UD3A 2A5HA 4ZR8A 3M4HA 3PJUA 2PFHA 1JUEA 1IGWA 4NAEA 1EFZA 2CXGA 4ERAA 2PP1A 2NT1A 1MI3A 4FNTA 4FS9A 1YBQA 3W2UA 2A6NA 3DZ1A 3H4WA 3G5EA 5DXYA 1CLXA 4Z2IA 3NCOA 4MAVA 1CXFA 1Q6RA 2QQ6A 1OSEA 1DXIA 4X63A 3DGRA 4ZE4A 4F3HA 4B3KA 3N25A 3NDYA 3BO9A 3O6AA 4JX4A 2XSBA 3R8RA 1VJSA 4DWSB 4DUWA 2EPHA 3L65A 3S1UA 5EU9A 4HA1A 3IJDA 3UW6A 2AMGA 3QHMA 4JQ1A 2PF8A 4PH6A 5I06A 1T96A 4J3VA 3TYCA 4QRNA 1IXPA 2FZBA 3U3HA 5KITA 2G4JA 2ZZ1A 2YPIA 4M6VA 2C18A 3MQTA 2NZLA 3CGTA 3ZMRA 3G2GA 4GYPC 4LBSA 3TTYA 4ILSA 3TTSA 1K03A 4ZVJA 3BG5A 2H3BA 3ZO9A 4MYAA 1YDVA 3FNDA 1CWYA 2C13A 4U31A 3VNJA 3GHSA 1D9EA 4MB1A 4AB4A 4LPCA 3R43A 2ZE0A 5I5RA 2QVNA 2YCJA 1E0XA 4FHAA 2G8ZA 1KBIA 3WL0A 5AB3A 3W7GA 5C0QA 1A47A 3RU6A 3KTCA 3A9IA 4HMCA 4LC8A 4KWUA 3AAMA 4F40A 3BSMA 1TIMA 1UZDA 1K6WA 2W6RA 1WDSA 3PWIA 3GE7A 4DNHA 3KWSA 1W5MA 4IL2A 3LZ3A 2DZXA 1KBKA 1W3JA 2FGBA 6PTDA 4MY8A 1TWSA 4PL2A 4BA0A 1UWSA 3QPEA 2VX7A 1TTPA 4UTLA 1VKFA 2C3ZA 3GAYA 4U3AA 2QNEA 5HPOA 3WJXA 4TOQA 4I3GA 3U5YA 1E3ZA 1WXJA 3SFKA 1K7FA 2YA2A 1JAKA 5XIAA 1SJDA 3MVIA 3UJFA 1UR1A 3CZJA 3VKDA 2WJFA 5BOFA 3EBVA 3LCGA 1J10A 3NNTA 6TIMA 3R58A 3KBJA 2PPGA 3TEVA 2OT1A 4P7NA 1XC6A 1LLOA 1TREA 1XRFA 1DJYA 2OSWA 3PBGA 2PDYA 2VFGA 4GPNA 5BCAA 3MHUA 1GOOA 3D5HA 2ZTKA 4JCLA 3MMDA 2DT2A 1R3YA 1ZP3A 1VHNA 4PTXA 3G0UA 4M8UA 1Q6QA 4JYDA 2E9LA 3I7QA 4YWIA 4L1XA 3NQ7A 1UD8A 2L5HA 4H04A 5HMDA 3UFYA 3RLGA 2PC8A 3SRFA 3IJ9A 4JICA 2PWGA 1Z69A 4NJIA 4FIRA 4R3UA 1TG7A 2WVVB 3UEQA 3DH7A 1RJQA 1W5PA 1HJWA 1XLFA 4S1FA 1GZGA 3PUEA 3SFWA 4L7ZA 3EDEA 1UIOA 3LK6A 2VC6A 3EKLA 1TYGA 2X1UA 3WQ5A 1JPMA 3GR7A 3GIYA 2XIMA 3IIZA 2EF9A 3MJYA 4DF0A 5A8QA 1YTDA 1KRMA 3V0UA 2R9RA 3B0PA 4IIHA 2EPLX 1MZHA 1B90A 3T0TA 1Y5VA 1RJPA 2I5IA 1W31A 3M0XA 4IX2A 3DUGA 3W6YA 4BF5A 2ZUTA 1L6FA 5KSWA 4CEXC 1KTCA 1UCWA 3AXIA 3FVDA 3NM1A 3B97A 1JPKA 5BRBA 2DSVA 3C0SA 1G1YA 3C61A 3VVGA 4HQVA 1V51A 3SECA 3BG9A 4ZCWA 1BVNP 2G3FA 1VCGA 1R8LA 1B4KA 3G3DA 4M1BA 2ATMA 3AU2A 1X1NA 4Q4SA 4DJFC 1RJRA 2AMXA 1UJPA 3ARWA 1ZBKA 4JEQA 4RXFA 5L6UA 4LTSA 4LVDA 4FF7A 1F6KA 3WLJA 3HGOA 4K8HA 4L9YA 4BEUA 4FNUA 2WSQA 2HRWA 2V0TA 3SJ3A 2B7PA 5E09A 5FF7A 4IXHA 4UQAA 4D6DA 2WKGA 3PANA 1H5VA 1E5NA 4GUJA 2Y7GA 5A3HA 3IVUA 1GVFA 1LM1A 4IIEA 2OYKA 1D7KA 3G18A 1LF1A 5F4SA 1RPXA 2HTMA 4YL2A 4MB3A 3WBWA 5D9OA 1UZ1A 1E71M 3CL8A 2BB0A 4D6JA 3WEZA 1JCLA 1WQ5A 1CT5A 5D2XA 1OIMA 2V2HA 4S3BA 3NGJA 3I65A 3A4WA 4YTSA 2EKCA 5BU9A 4W7UA 5BMWA 3M16A 4QGCA 1S2CA 3KTSA 4O13A 5EFFA 5F2IA 3UJEA 5CSRA 3UY7A 2Z1KA 3ISIX 4QCFA 2H6RA 3UZZA 4UFMA 1QPOA 4FI4A 4F0KA 1NOUA 3E2QA 3B06A 1W1PA 1WKFA 1TZZA 3EXSA 3S9ZA 1RY0A 1KA9F 4H9UA 5HJYA 1QU4A 3OBEA 3GKAA 2CW6A 1RCOB 4CD6A 1H7NA 4G56A 4XZIA 4XO7A 1W8GA 1NFBA 2GUUA 2Z1XA 3T42A 3EX6A 3G8EA 4MPKA 4ALDA 4IIFA 4ZZ9A 1O4UA 4JFSA 4JNZA 1K8CA 3QM3A 4GHRA 4YTUA 2YYTA 1HNYA 2J47A 3WLMA 2E25A 3ZR4A 4DWSC 5CBBA 3LBCA 3M46A 4HGXA 2J7HA 2VYOA 5EYWA 4ZQRA 4J9JA 2PWDA 3GTNA 1JR1A 1OD0A 1CBGA 4M6UA 3W72A 4TO8A 5HQEA 4PMDA 4C6DA 4W7VA 2G97A 2Y61A 3LM3A 3VAVA 2PTXA 2REQB 2DH3A 1OB0A 4B90A 1OGSA 1GPFA 1QTWA 3RAOA 1DIDA 2X2YA 3M41A 4L1WA 4CD5A 4D8LA 4C90A 1XPYA 5FF2A 1R9ZA 3DC0A 1QBBA 3VZYA 5T26A 4PMQA 3NEHA 1G7UA 2V8ZA 3KLLA 2NW0A 1XUUA 1TCDA 5REQA 1DJHA 2WANA 1BFNA 1UR8A 2WVUA 3GTIA 1P43A 3H7RA 4K1GA 4AZ6A 1XLJA 4IGHA 3EWYA 4B16A 1J79A 4Q6XA 3BPWA 2JALA 3LBOA 1JAEA 4LXFA 3VU2A 1OZMA 4NKCA 2V5JA 3MUZ1 4UQDA 1QOQA 5M1TA 2AQVA 2GGEA 3BLLA 4AC1X 5JBDA 2IXVA 3GK0A 4RZBA 4EPEC 4AZ7A 3UWZA 3EOSA 4BEQA 5DT5A 5I00A 4YXGA 3SCNA 3TDFA 3R8HA 3S6TA 3MSDA 2ZRVA 4BI5A 2D20A 4PUKA 3ZLFA 1UUMA 2J7FA 3F5LA 5BYWA 1MXDA 1O95A 2XIOA 3C2VA 1V5XA 3M9YA 1XIDA 1QK2A 4IJRA 4XD5A 3BLEA 4OT7A 1A5NC 3W0KA 1J11A 3GQYA 1WE5A 3TUUA 3W6LA 4K6AA 3S2LA 3CS2A 5BOEA 1W32A 2GVLA 1YDNA 1XR2A 4G7EB 1FCVA 4FLOA 1QI0A 3CYJA 3NM3A 4EXAA 1OVDA 1R3WA 4KF1A 4J1OA 4HYVA 1RPKA 5HDRA 1BYDA 1OFAA 3FDGA 4JHOA 5IBXC 4Z1DA 3W76A 2B31A 1XIEA 1WZMA 3G24A 3RMEA 2QHAA 4FF5A 4BZYA 1FWIC 1V3IA 3DESA 5HMEA 3TR2A 1R47A 4L6HA 3W7PA 3BV4A 3CM4A 3VZXA 1GQKA 1KM2A 3W1MA 1KGUA 4LBRA 4ZQMA 2EG7A 3CWNA 3VDCA 3MUAA 3VO0A 4XO6A 4G7FA 3RU8X 2NX9A 2DIJA 3V0SA 2P8BA 2BXVA 4LRTA 7ENLA 4ML9A 4JKKA 1W9UA 3MI6A 4GRSA 1PKMA 3NYDA 5CC3A 4I6VA 3S47A 2WAGA 4AFYA 2ZXDA 1B1YA 1H63A 2NLIA 1T5AA 1POJA 4DX3A 1WCGA 2CLPA 3TZNA 1BVWA 3B0XA 3OP2A 3EMZA 4JIQA 4ORIA 3WK1A 1AMKA 4C60A 1P48A 1OHLA 3STGA 1MWOA 2IPJA 2J6XA 3AALA 3VUSA 1V4YA 4OU1A 7A3HA 4AD0A 4QQ3A 4TTUA 4A21A 3CL6A 5CSYA 3A47A 1GG0A 5T9CE 1E51A 4XVDA 3QGVA 4QDMA 1EOKA 4B5XA 1S46A 4AYGA 3AROA 5B80A 1UH4A 2VZTA 1F8IA 5IHSA 4HMDA 4PCSA 4QS6A 4YYCA 3H4XA 1TA3B 4L4OA 5I3DA 3F2CA 4RX0A 4NYUA 4GQQA 3UF9A 1UWAA 5EL1A 5LIKX 4HYWA 1BWVA 4C1NA 3ARPA 2V38A 4KPLA 5BU6A 2E09A 4N02A 2Z7GA 4IHCA 3E0FA 4QG8A 3PB0A 4DN1A 3ITOA 1S5NA 4L80A 3OB8A 1XF0A 1B57A 1XIMA 3S5NA 4DO5A 1W5OA 3HGRA 2Y7DA 4LAMA 5IFPA 4JNYA 3CQKA 1O5KA 1UPPA 4F0HA 4QCEA 3W85A 1W5QA 4CLMA 1GKQA 1DIOA 2EPNA 2HMCA 3DCPA 5HPCA 2YDQA 3P61A 4C7GA 2PGWA 3UPWA 1F74A 1Q2SA 3VA8A 2OG9A 1K9DA 2O7SA 4J35A 1YE6A 2Z25A 4M51A 1PWLA 1XCWA 2R1KA 2DPEA 4NYYA 1DTUA 3BW3A 2FPYA 3LN3A 5KETA 3O15A 3WD0A 1ZJAA 5EKYA 1KFJA 1ZZMA 2DVXA 3PJWA 2CLEA 2ZRZA 3ZLHA 3S1VA 5A2CA 5EMJA 1MUMA 3RCYA 1SO6A 2Q01A 3TIMA 4AY8A 4RNFA 3TTOA 4WY0B 1IEQA 5D05A 5FCZA 4H2CA 1MXGA 3LU2A 3TC7A 4W5ZA 2C16A 4GG9A 1E1FA 1KWKA 4NL1A 1SJBA 1AL7A 1BPLB 2WZHA 4AIUA 2CLFA 1DXFA 2DZTA 3L4WA 1C8QA 1Y8BA 5A8MA 5I03A 3KOYA 3RX2A 4HT3A 3T8QA 3W1XA 5IDZA 3GFYA 4KGJA 3JZUA 4IG2B 4LQ1A 3KBMA 4R34A 3TCEA 5AC6A 1GUVA 5H8PA 1GVEA 5FJOA 1Z32X 3POHA 3TR9A 3W75A 3D3FA 3S8HA 2V3FA 1O68A 1UZ4A 2DQWA 5AHIA 3CTTA 3EMQA 4HTYA 1REQA 1Z48A 4H9XA 3O1NA 5CC5A 4JQAA 1XSJA 1TJ1A 4E0CA 5LIYX 3N9SA 3U9IA 2X16A 4BHYA 4UTUA 3EDKA 3TNBA 1JF5A 2C71A 5IHRA 3NL3A 2FB3A 1OC7A 3BQ6A 2NWRA 2YCEA 4GX9A 1N8WA 3FEMA 4CCZA 3FV9A 1KLZA 2Z2BA 4HU0A 4PMYA 3T0BA 2P3EA 3UCQA 1VAHA 2CC0A 4PB3A 4JTCA 3AYRA 2QR6A 5E5CA 1O66A 3KBVA 4M6QA 4UB9A 5CJMA 3ARVA 1DBTA 2ABAA 3AI0A 3FJ6A 4INFA 3II1A 2GSEA 2WSYA 3ES8A 5CEWA 3DKJA 4IPNB 1R2SA 1RK5A 4AHPA 4PZVA 3QGAC 3SJNA 1AUSL 3GC2A 3DG6A 3GVGA 1DHKA 1XBYA 3SRHA 3VZZA 2Y4SA 2IQDA 1BKHA 1P6CA 4H6QA 2AGTA 1UQYA 3INPA 1XINA 4R85A 1OK6A 4KERA 2NVDA 3UA4A 2DT3A 4ZSTA 1HGWA 1M53A 1XS2A 5HINA 3GNRA 4RNJA 1D7FA 3KP0A 4EAMA 4FAMA 1NP2A 1VGAA 1RCQA 2QMKA 3CEUA 3MCNA 1PE1A 1DE6A 3LCXA 4I7UA 1VQTA 1WX0A 3LSBA 3QN3A 3GDTA 4OECA 1WZLA 2R1MA 3FAXA 4XG1A 1UJQA 1A5UA 4FZIA 2PI6A 3PSWA 1IXQA 3N17A 4QP0A 3CIVA 1E0UA 3E2SA 3R1ZA 4Q8WA 1WKEA 1XPGA 3QLLA 3V36A 2RDXA 1VYSX 3SGGA 1IEXA 1HKKA 1UWIA 4XUGA 1JXKA 4R27A 3K8MA 3M5XA 5E9XA 1O6IA 4MZ8A 5TQLA 2YBVA 2YL8A 1ZAIA 4EACA 4GI9A 1PIFA 2YXXA 2O55A 2E4TA 4A22A 3QRHA 1Q7MA 3L12A 1Q7QA 2G50A 2ZA2A 4GFIA 1H7OA 2XH2A 1V3KA 1IZKA 4HHHA 1EHAA 2FGZA 3P0WA 2GL5A 3BSGA 1TRIA 1GW1A 1GEQA 1M3UA 4D8ZA 1AG1O 2ZC8A 4HPHA 4I8YA 3OZPA 2JGQA 3Q2DA 1JI1A 1VFMA 1EEXA 3UZXA 3S42A 2CLHA 3M0HA 3UWVA 5EB8A 3W7LA 3VIPA 1GHSA 1E9LA 1RALA 2EBNA 1A5AA 1TFVA 3GB6A 4LV4A 1E4LA 3GDBA 3HQ1A 2CBVA 2BX7A 1RHCA 2W79A 1OX6A 2CLKA 1HJXA 4P8VA 2RKXA 2YX0A 5A1AA 3N14A 5C2GA 2QLYA 3NDZA 4GLEA 2Z27A 4AWTA 2FVMA 3TW6A 3KVLA 1I1XA 3P80A 4LVFA 4QX4A 1HJUA 3LY0A 3G6LA 2FMOA 3ITYA 3CIWA 1EBGA 4J4KA 3TQKA 3WQ4A 3WLIA 4XSMA 1FWRA 4MKVA 1XLKA 3SCSA 3QQ0A 3W86A 2PTZA 2C6QA 5B7YA 1ME7A 3GU9A 3NVDA 4BQ5A 2HVOA 2OELA 2YCLB 2YA0A 3HF3A 4UFHA 1NAL1 1ZFJA 5E6ZA 3UPMA 2MUCA 3S1XA 3H7VA 3ITTA 1ML1A 4E3TA 4CU8A 1DV7A 1YADA 2CWNA 3RX4A 1Q4NX 5A6AA 5K9XA 1RBOB 2INEA 3IJ8A 2JBMA 1A5CA 3NZQA 4C6QA 1XCXA 1ECEA 4DNMA 4FX8A 3IIXA 3DHDA 1XIFA 3DX5A 3R25A 1DTNA 3H2NA 4Q8TA 1CGYA 3WQFA 5D09A 1IE7C 1C9DA 8RUCA 2Z26A 1ICPA 4CN4A 2ZX6A 7XIMA 4WY0F 2O7QA 1HGYA 3HURA 4LBUA 1KD0A 3CEPA 1QRQA 3AJXA 4PTMA 1KM0A 2NX1A 3AJ7A 5GNXA 1WUEA 2J7GA 1E40A 1JF6A 3H23A 3DI0A 2GGGA 3FGCB 4F8XA 1YKWA 4RE3A 2EQDA 4WCJA 3VILA 3A21A 4M80A 1A5BA 5E0FA 2F2KA 1DXEA 2JQXA 5AHNA 7CGTA 1Z89A 2FJKA 4N4QA 2CBIA 4Q4KA 2D1ZA 4C6CA 3CV2A 2YA1A 1TELA 4GCAA 1TUFA 3NVTA 1MEWA 1LLZA 3G8RA 3ZVHA 3RN6A 2XH7A 3B4YA 4JIIX 1YQ2A 5LNWA 3PJTA 1VS1A 4PYSA 1AJ2A 1RLDA 1NVMA 3TONA 3VKAA 1I0BA 2PRHA 5FJPA 3T8LA 3TTQA 1QW7A 3E0WA 2BVDA 3SEPA 5JIWA 1XWYA 1BGGA 3HZ3A 3KBSA 3U8GA 4GJIA 3NIYA 4K1WA 2GDVA 3NEVA 4NHVA 3P93A 1XIJA 4DJFA 5A2AA 3FGCA 3WNNA 3GO2A 5IRPA 2VWTA 3DBNA 4J2MA 3WDIA 3OGRA 2PBGA 2V69A 2BXZA 1E73M 4NX0A 3SCUA 1W3LA 4F66A 3MPGA 3SSZA 3GC5A 4OOZA 3WJYA 1LP6A 4CCCA 4PFMA 3IWPA 3UVAA 3AS3A 3E9AA 3BMXA 4RW3A 1I60A 1V7YA 1ZU8A 4ROPA 4IQLA 4F9DA 5C54A 3UR7A 1VBGA 4BQ4A 3Q4DA 2DZPA 3KRBA 5D2WA 4AZHA 2A3CA 4OHQA 1W3NA 3LCLA 4KEMA 4PUWA 1GQNA 4GO8A 4K8GA 4JTFA 4YTQA 4LUSA 1K1DA 4HNOA 2BHYA 3LXBA 3E74A 4CD8A 3VNZA 2OMAA 4EK7A 2NT0A 3B8DA 1C8XA 1XLBA 3HPXA 2VFFA 1FWHC 3A6OA 4UMCA 4UR7A 4P8WA 3A13A 4S3FA 3NDOA 1XSKA 3ZIZA 3MUXA 3S2CA 5G5IA 3GAKA 1A0EA 1JI2A 3I6TA 5DANA 1EA0A 4PL1A 3BDKA 3MI3A 2WC3A 3W00A 4N9CA 4GNJA 2GOKA 2C15A 1FVPA 2ZBTA 1ZJBA 4ZQNA 3BAKA 1KKRA 4MAZA 3T0AA 4HPGA 1VFLA 1FWAC 1DQUA 4HPJA 1CGUA 5AKQA 4AMAA 1XW8A 1EJRC 1B3ZA 5LXEA 4RJEA 4IMCA 3RX3A 4JIPA 1D8CA 3ANVA 1V6VA 4OGZA 4PMJA 1BTMA 4A8IA 3G1DA 4IFKB 1F4AA 5IBXA 1ZP4A 1VLIA 4W89A 1KM3A 3SRDA 1LL7A 2DQXA 3WUFA 2BMBA 3VC6A 4O12A 1ZJHA 4HU8A 2XM2A 3PHAA 1E0WA 2ASHA 3QZ6A 1LJYA 3CU2A 4XZHA 2PC4A 5ENLA 4H9MA 2JEPA 1JULA 3AMCA 2QGHA 1OYCA 2V5DA 4GH3A 5D32A 2G95A 5HMSA 5HJLA 3P0XA 3AHZA 4P7LA 1QWGA 4Z1CA 3DI1A 4RV8A 2XVGA 1PCWA 1E6PA 3BH4A 4GY7A 3QLDA 3QPYA 3RG6A 3TU9A 3BXWA 2GJNA 3AMKA 3LLFA 4HCDA 3VC5A 4Y9OA 2FMNA 2WSRA 3ZVHB 1KFLA 2IQ0A 4Y96A 2QIIA 3GHUA 4BKNA 2DV0A 2Z1WA 1T40A 1ZS2A 5FI8A 2W91A 3W29A 1H7RA 4NU7A 4O52A 4KCVA 4BS0A 3H7UA 1OWQA 3EB4A 1OYBA 5LSMA 4H6RA 3PC0A 1QO2A 5I23A 5I07A 3WNKA 1YW1A 4Z0SA 1E4MM 2EPMX 3YPIA 3W71A 8CGTA 3STCA 3VNYA 3WQCA 4WJXA 3H54A 1BYBA 5ABFA 3T4WA 1FCUA 3RRAA 5I02A 2VRQA 1B5TA 9RUBA 1B3WA 4J28A 3SCOA 1FY6A 3CUHA 5D37A 2B81A 4Q8OA 1PIGA 4YJ5A 4GMEA 4WD0A 2H8ZA 4IFRA 4S38A 3PZ9A 4MNJA 2RGMA 4QS5A 1Q13A 3AHXA 3UG4A 2AKZA 1UD4A 2QJNA 2HPMA 4F0LA 4IX0A 1RH9A 2DORA 1OGBA 4B2DA 4XBKA 1ZJIA 3R0DA 3IVSA 2I7GA 5U4NA 3SQMA 2DZUA 4LF2A 4K7VA 5CPNA 4ZOCA 4WDWA 2BVWA 2A21A 1EGMA 4JAWA 2QCMA 5A6LA 3MP4A 3ERPA 4KWOA 2HXTA 4IUGA 1C8VA 2Z1SA 3SRKA 2YYUA 1KV8A 3EPNA 2WHKA 2NSXA 2FB2A 1XIGA 4X60A 1W54A 4UFLA 1TQJA 3QOMA 2NXIA 3WL1A 2FDMA 2GK1B 2P10A 3QBUA 4RPQA 3TJIA 1UP2A 3VCCA 3F4VA 3KAOA 1RQEA 3UG8A 4LAUA 4MWAC 1ZBVA 1T0OA 3QKZA 3P62A 2XG9A 1YYAA 2V81A 1C91A 2WNNA 4H1ZA 3B4UA 1K7EA 3FYYA 3QPZA 3FDKA 1SO4A 3G6MA 4FEZA 1O5QA 1XDLA 4ZOEA 1ISXA 3UD6A 3SUWA 4XD4A 3MP5A 1UWTA 1JYWA 5KMYA 2FJUB 1V77A 4WQ6A 1J5SA 5AOUA 3HPZA 1XKJA 3ARTA 3W01A 3ATYA 4IH3A 1DOSA 1HKWA 4C1KA 4KT2A 1UH2A 4ZXOA 3WH6A 2XFRA 1TZ7A 1OY0A 4S3AA 4EX4A 1GOIA 2SFPA 5AC7A 1QJWA 2EJAA 1ONEA 1HZYA 1EB3A 3AWOA 3GW0A 1BYAA 4GYPA 5DCBA 1B9ZA 2YBTA 4M6PA 1MRAA 2C14A 4U2ZA 1GYLA 3QXBA 3C5QA 5JH1A 4DF1A 2VEPA 4U4MA 3A22A 2DY3A 4US5A 4D1IA 4K7YA 5SWUA 3C0JA 1M7JA 2P0OA 2OKTA 3CZKA 4XZMX 4X9YA 3LCIA 4PTWA 3BLIA 3GXDA 2W61A 3USBA 1JZ5A 1R38A 1JYNA 4ZGYA 4JQ4A 4UR8A 2Q8ZA 1AVAA 1J5TA 1VFFA 1Q6LA 4QNEA 5GQBA 4OJYA 2V68A 4C6LA 4JFWA 4Y8FA 3VX1A 2NV2A 3CUZA 4JY8A 3BCFA 5LXXA 3SR7A 3GVRA 4TX6A 3P5YA 1ZRQA 5BWFA 3M0KA 1XD0A 4HSHA 2CYGA 1KTNA 2AL2B 3ZS4A 4DUXA 1KXVA 4Q8PA 3VXGA 3S46A 4DWSA 3MUY1 3FFSA 2AGKA 2PE4A 4GUGA 3RHGA 1UQZA 3UCCA 4IWWA 1JFXA 4IPLA 4NJHA 2D0FA 4GY0A 4YS1A 2QUMA 4B3LA 4JCMA 3B9OA 4DUVA 2VNCA 3BLOA