1TX0A

Dihydropteroate synthetase, with bound product analogue pteroic acid, from bacillus anthracis
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
273
structure length
265
Chain Sequence
KWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSDGGSYNEVDAAVRHAKEMRDEGAHIIDIGGKVSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DHPS, Dihydropteroate synthase
publication title Crystal Structure of 7,8-Dihydropteroate Synthase from Bacillus anthracis; Mechanism and Novel Inhibitor Design.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Transferase
total genus 95
structure length 265
sequence length 273
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2004-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00809 Pterin_bind Pterin binding enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 1tx0A00
3V5OA 4MWAC 3TYUA 3H26A 2YCKX 4C1NB 3BOLA 4NHVA 1AJ2A 2H9AA 3TYEA 4O1EA 4DJEC 3BOFA 1TWZA 4C1NA 2Y0FA 2DQWA 2DZBA 2DZAA 4D8AA 4S3CA 1AJ0A 1Q85A 3H21A 3TYDA 3TYCA 4DJFA 2VEFA 2BMBA 4DB7A 3TYBA 4S3DA 4HB7A 4S3BA 4S3EA 4S3FA 2Y5SA 4S23A 4D8ZA 4DJDC 2VP8A 4DJFD 2E7FA 1EYEA 1Q7QA 3TR9A 4PZVA 1AD4A 2YCIX 1TX0A 4MWAB 3TYAA 3H2CA 1Q8JA 5JQ9A 3H23A 1AJZA 1TWSA 4DAIA 4MWAA 3K13A 4S38A 4DJFC 3H22A 3H2NA 4NIRA 4O0QA 3TZFA 3MCOA 4DJEA 3MCNA 3TYZA 3H2FA 4DJDA 3H2EA 1Q7MA 1TWWA 2YCLB 4O1FA 2OGYA 3H2AA 1F6YA 4MWAD 3H2OA 2YCJA 4CCZA 4G9PA 4NILA 3TZNA 2VEGA 4D9PA 2YCLA 3H2MA 3NOYA 4DJED 4DJDD 4MWAE 4S39A 3MCMA 1Q8AA 4NL1A 1TX2A 2Y5JA 3H24A 1AD1A 1Q7ZA 4S3AA 2H9AB 4DAFA
chains in the Genus database with same CATH superfamily
5FJTA 4NZFA 4WCJA 4J4KA 3SY8A 4KPLA 4HA1A 1TV8A 5RUBA 1XFCA 3W7KA 4W9TA 5C9ZA 4R9OA 3QR3A 4TXEA 1Q2SA 3GG0A 3I4KA 3PBMA 4HIBA 2CCRA 1E6ZA 3FV9A 1EPVA 1HJVA 1CW2A 1SW7A 3P81A 4GLEA 4GZ7A 3R43A 5T26A 3W7DA 4HYWA 4JIRA 3LG3A 4FEZA 4EWJA 2F2HA 3AXKA 3SM0A 3APYA 3LTPA 3EOLA 1ELSA 3N15A 3ZLGA 3FXGA 1MNZA 5I3FA 4K1WA 5BXTA 3EDKA 3C2EA 1LG1A 1SSDA 3W1RA 1HL8A 2GQ8A 2NXIA 3WIJA 3PF3A 2HE8A 5LZLA 3TAOA 1JZ6A 2FJUB 5D9OA 5CBJA 3C8NA 4K68A 3TWAA 1EHNA 4J3ZA 3K1DA 3MBDA 2QF8A 3V3WA 1PTDA 4CQDA 3W27A 3I4EA 4BQ5A 3RPDA 1KTCA 4NUWA 4O8RA 4MVAA 1GVQA 2QF7A 5HJXA 2ZRUA 5BU9A 5BYWA 3C5QA 3O05A 4KF1A 5CZJA 4D6EA 3BLFA 4O18A 1JNEA 3GLCA 5KETA 4XO6A 3L2IA 3RCMA 1NFGA 5MKGB 4AZ5A 5H1WA 1W1ZA 4F0KA 3DX5A 4P7RA 3WBEA 1EJTC 2YLLA 3KS5A 4BEUA 1GZGA 1OFEA 3HG5A 3K4DA 3OGRA 3TA9A 4UQEA 2OCZA 1AK5A 3F5KA 4RX0A 2AQVA 7REQA 1TRIA 4UWMA 2IPJA 1FX6A 4D71A 1WDDA 3VMPA 4CU6A 1GOXA 5HPCA 3PB0A 2HJPA 2D3NA 4MZ1A 2R1NA 1XQKA 4DZ5A 1XSJA 5CGMA 3GW3A 3IUDA 3OQ8A 4IGHA 1Y5VA 1HT6A 1BAGA 2XHYA 4BEQA 3W7NA 4ZE4A 4JYDA 1NAL1 1FH8A 2IQDA 2PDWA 3PZQA 2QCLA 4HCDA 3WL1A 1XIEA 2J75A 2ZZ3A 4KETA 3RCNA 3WQEA 4LOCA 4CD8A 3Q37A 2HMCA 4O11A 1YIXA 3LGEA 3P84A 3P8JA 2XDFA 3O15A 2Y7FA 3CWNA 2VMFA 3S1UA 2PDBA 3NQ7A 2XIBA 3IJ7A 2FPYA 1GNXA 3DECA 5HUPA 3N4AA 5C9RA 1ICQA 3AMGA 3APGA 3HV8A 3K5XA 4B9ZA 4ECLA 2PP3A 1LYXA 1NWTA 5AZ1A 1EGVA 3G1RA 5BXPA 1F8IA 1PIFA 1DTUA 1E72M 3TMQA 4UQ9A 3UWUA 1FWWA 2Z6JA 1XLEA 2PWFA 3M9YA 3OODA 6REQA 5KEZA 3GFZA 4HOZA 1ZRQA 3NA8A 1X8CA 3KOXA 4ERGA 1WBHA 2DUAA 1W0MA 1V6XA 3W6MA 1IWAA 1K8YA 1OCNA 3IARA 4MGGA 4PFHA 3F4DA 3ZVIA 1TZ9A 5I78A 3UCCA 2POTA 3INPA 4CCDA 1EJSC 5FJIA 3NDYA 5ENLA 3GS6A 3SZ8A 4JX4A 3JS3A 1XG3A 4RPQA 5HOSA 4TVCA 4M29A 3QBUA 5BW6A 1S38A 3OIXA 3A3HA 3H6OA 3AS2A 3MYPA 4YTRA 5G1TA 1RUSA 2VQUA 3NG3A 4PRRA 1WXJA 4PFMA 2J4GA 2A3BA 1M65A 1XQLA 2WZMA 2FZDA 4YN5A 1BQGA 1GKQA 1I0BA 1EGZA 4C91A 2IXUA 3MTWA 1H7XA 4N9DA 1BF6A 4FNPA 1M41A 3TYCA 1Q4NX 1PB0A 2CBJA 4S3DA 3WLIA 3TVAA 3CIXA 5AHNA 4FAMA 3RRAA 4GNVA 3GTIA 3HQOA 1FH7A 1W31A 3QH2A 5CEWA 3ZR4A 4UC5A 3QZAA 4F9DA 2AMGA 1K7EA 5I5RA 1A0DA 3MT1A 3HQNA 1AJZA 2GDQA 1AQHA 1D3CA 4RV8A 1KQYA 3K13A 5IOBA 4J9JA 3OYZA 1TV4A 2VDIA 2UY4A 2YL6A 4CQCA 3LOTA 2AL1A 1LLZA 3P80A 2YCEA 2IUZA 3H2EA 2DSWA 3LGGA 1EFZA 3WO8A 4LEQA 3IK4A 3H2MA 2BBFA 2Y5JA 3BCDA 1W5OA 4M1BA 3USZA 3R94A 3EXSA 5BMWA 3LCWA 4H6RA 1GVYA 2F2KA 5AN7A 3TUUA 1RK5A 3GKFA 3WF2A 5FF4A 4J35A 3BZGA 2C3ZA 2ZCGA 1RPXA 2EAWA 4ZL1A 2V67A 3VD5A 3NQVA 3R13A 5BOFA 1L6SA 3WBAA 3ARZA 4LS1A 4AHQA 1FY6A 2VGBA 1JF6A 5AYYA 2PSNA 1O6IA 4D8AA 4IICA 4M5PA 4H9UA 2FHCA 3PWGA 3UEQA 3REQB 4LRSA 3S9ZA 4MMWA 3NVDA 1P4CA 2CZEA 3WN6A 3S2NA 3PBWA 4I9JA 4L4PA 3EXTA 3W73A 4J2PA 3PN8A 5EY5A 3F5JA 1AQ0A 1KM0A 3LMZA 3A22A 4H19A 4AQLA 3ZO9A 1Y5XA 2WWDA 3W7JA 1LZOA 3LX9A 5C2GA 3POCA 3CMFA 4KIEA 2C1HA 2VC7A 3BAWA 1HVQA 3TMLA 1ONEA 2VO5A 4UQAA 2JALA 3G0UA 5CAHA 1ECQA 3GHSA 4XD4A 5D4YA 3UJFA 1W3TA 3KEHA 1TIWA 4KBXA 1X97A 4LUJA 3T2PA 3GQYA 3HGOA 2WWCA 4P8XA 3TE9A 3UJRA 4Q22A 1A47A 2W67A 5E6ZA 3AMDA 1SJDA 5C7VA 3DFHA 2YLAA 1GT8A 4FPSA 5G1YA 4RDZA 1XV8A 1IIHA 2JKAA 1CENA 4Y9PA 3U8GA 1YDNA 2DJLA 4FLOA 3B8SA 3I7RA 2PCQA 3MDWA 1AMYA 2RDTA 5D2TA 3GE7A 1V7YA 2OEJA 3P6LA 4WD0A 4NJJA 1BKSA 1IT0A 1GOOA 4L4LA 1LRNA 3A21A 4CCEA 1OYCA 1UCWA 4NX5A 4M6PA 1ZY9A 3NGFA 2VKZG 3QKZA 1WZKA 3QGVA 4XB3A 2GGHA 4W7WA 2BHUA 3BZJA 3CBWA 1UB3A 3KM8A 3D5HA 4QS6A 1OF8A 3CUFA 2ZUNA 1IZKA 2DSKA 1XIHA 2CXGA 2FDMA 5A94A 5XIMA 4K37A 3WQDA 2QCEA 1NQKA 4UMAA 3WL0A 4A3QA 3OZYA 1F74A 7TIMA 4GCXA 4Q8UA 1XG4A 2QPSA 4QG6A 2HK1A 3W84A 4G7EA 3SCQA 3LXBA 3B0PA 2VRQA 3FY1A 2B0MA 2WSYA 4JD4A 1XRFA 2QQ6A 3KLKA 3T4CA 4IP4A 1NDZA 3IGXA 4AYSA 3COTA 1PDZA 4MB1A 3MUZ1 1TX2A 3PZ9A 1KCKA 4UNIA 1OFRA 4W93A 2WMHA 1G01A 4M1RA 3S5NA 1XGDA 1FWAC 2YDAA 4AZGA 2G3IA 3W29A 2QGYA 3AZTA 3DHPA 4EAYA 3BOFA 1E4NA 1E56A 4TIMA 1QPOA 1FHVA 1X38A 3AIUA 3HG2A 3WCZA 4MOZA 3SRFA 1H50A 3E2SA 3LRLA 5FEPA 2WVVA 2XGIA 1R47A 2QUVA 1UR1A 3VGDA 3D6NA 3P7YA 1FWRA 3EXRA 1IYXA 3GX9A 2VR2A 4GINA 3MV11 3BCJA 3SGUA 4AIOA 3EPOA 4GMEA 1ZUAX 3ECQA 1JCXA 4ZOAA 4LVDA 3M0LA 3VDAA 2OX1A 1CPUA 1CGXA 5CZTA 3GC5A 3U2ZA 1JI2A 1QOXA 2D0HA 1OIMA 1WKFA 1SW0A 3WQCA 4H1ZA 4LYKA 3OBKA 4B5UA 4CLMA 1V0MA 1FDZA 2QCDA 2WMIA 5C6MA 3PZOA 1HKWA 3LV6A 5BROA 4UFLA 1O5XA 1WXYA 3UGRA 2CWXA 2BV9A 4X3ZA 4IUGA 2X1SA 4OJYA 5CH9A 4C6IA 2OGYA 2I5GA 3MKKA 3FN9A 2QDEA 1VFHA 5CG0A 4D9PA 1Q6LA 1BVWA 3GXIA 3P67A 4IQJA 2JBMA 1QNPA 4HHMA 3A47A 5IFPA 1E0VA 4B92A 3GDRA 3WD1A 2DZVA 3HFYA 3VPLA 4CNNA 3CV6A 3UNTA 2PGRA 4J28A 2GK1B 4Z0JA 5ECVA 1A5AA 2NV1A 3SJ3A 1UWTA 2BHZA 4R5EA 1KGWA 1UROA 5FA5A 1Q85A 2OOGA 3OVGA 4AIEA 3VABA 3WJSA 3WNMA 1QWGA 2YDRA 1F7BA 2Z7KA 1XICA 4JQAA 3DI1A 5DMNA 1M9HA 4MPKA 1CLKA 1A0EA 4NAFA 3PSVA 3PUEA 1H1NA 1KKRA 2PA6A 3LD5A 2PD5A 4L9ZA 5FAGA 3T09A 2R1PA 3W7IA 3EA1A 2YB4A 2ISWA 3VX0A 4QJ5B 5G2WA 4NZCA 3OHIA 1JL8A 1CLXA 3WJZA 1KM6A 4CD6A 4TVUA 3SCUA 4IG2B 4YHEA 1ZB5A 3DKJA 3FGCB 3AU6A 2XH0A 4D72A 3KOYA 3TTOA 4HP5A 2XVKA 1G69A 4GHRA 3AO0A 3VDCA 4XBJA 3A4AA 1SVDA 8CGTA 3CT2A 3TW6A 1RD6A 5A6AA 4DNHA 4XAYA 5DXYA 3KL3A 4LW7A 1G4SA 1SZFA 3ABZA 5HBFA 3BGAA 3L9CA 1IR2A 1MW3A 4O4VA 2VFIA 3LHYA 2MNRA 3OA3A 1XRVA 4AWTA 7A3HA 4FF5A 1KBLA 5CSUA 3BURA 4M81A 4A29A 4ORMA 3OLIA 2BGSA 1W8SA 3F7JA 4A3HA 1XD1A 5CJMA 1BWKA 2DV0A 3TWBA 1ITCA 4F2TA 4DM1A 2R14A 1JUBA 2G8ZA 4JQ1A 3USBA 3AHZA 3TK7A 5DRIA 3KRBA 4F0HA 1LF1A 2O92A 3ANYA 4P7QA 4WEVX 1EF3A 3G1FA 4R34A 4JKMA 4WSHA 4RW3A 4Y9MA 3AAMA 4JKLA 9RUBA 4N0RA 2D2GA 3O8AA 1BXNA 3IIPA 3ARYA 1M3UA 3CWOX 4L4MA 4CCCA 3IUIA 3MUCA 4KW2A 4DJDA 5DF0A 1L6FA 4QR6A 2IW0A 5C9WA 3HBLA 2XM2A 4ZB2A 4DVOA 1XGEA 5TQLA 1EC7A 3CZLA 3IAQA 1E40A 4S39A 1WXZA 1MXDA 1FDJA 2E3ZA 4Y8FA 3FVMA 5LA2A 4E6MA 1W32A 3PVFA 2VUYA 3MW7A 3B0XA 1BG9A 1PE1A 4NHVA 2ZZ5A 3TYEA 1F4HA 4ZXLA 1N8WA 3W02A 3MHFA 2GOUA 3PY2A 3QC0A 1XBZA 3H53A 1RXOB 3CAVA 2E28A 3KL0A 4EE9A 1OFAA 1D7FA 2YL5A 3B8VA 4FIRA 1AZ2A 4HZ6A 4ZOCA 2G95A 2DIKA 2R91A 3VOGA 4K36A 1ZSXA 4JTKA 2QDDA 3RFAA 2HK0A 1SO3A 2E6AA 1HJWA 4PTVA 1WDSA 3NZGA 4OT7A 4R53A 3GHRA 3S83A 1W1PA 4O28A 1V3MA 3G77A 5FSDC 4D2JA 1J79A 2I5QA 4G2DA 5FL0A 4GJIA 1CGWA 4N2YA 1YX1A 3PBUA 2OEMA 3NDZA 4IFKB 2HCVA 4DPQA 2SFPA 4ATLA 1ZS2A 4YMZA 2E8YA 1ZJBA 2VEMA 3AS1A 3VNZA 3EPNA 2VFHA 3KOZA 4A2SA 2DZPA 4GKTA 5AVHA 1X8FA 3IANA 3A24A 1S1RA 3OVRA 2WZTA 3ZZ1A 3ITOA 4U2ZA 3W28A 3LHZA 2RGLA 1OF6A 3UZWA 4LF1A 4ORIA 3KVLA 2FJKA 1TJ1A 4E0CA 1QRQA 2Z00A 1WOBA 2EO7A 1FKXA 3W82A 1ME7A 4PC8A 4JQ4A 1EQCA 1S46A 4E3VA 2PP1A 2DDXA 4QDMA 1OX5A 4IX2A 3WQWA 4F3HA 5I3JA 4H8VA 3ZS4A 2WM1A 3XIMA 4KRUA 3P93A 1R9XA 3SQLA 4ZMGA 2J7HA 1MSSA 1B30A 3T7VA 2Q3OA 3T0TA 4F9JA 2PE4A 3R6IA 4K7VA 1A4MA 3VD9A 3C4UA 4W5ZA 4X9SA 1VB9A 3I6RA 4HD5A 2VEKA 5T9BG 2GJLA 3UCQA 5TF0A 3HTWA 4Q7BA 1P7TB 1EH9A 3BAKA 5D2XA 3P61A 4DBSA 3BANA 4HU8A 1EIXA 3W1QA 3TJIA 2OYLA 1GOMA 2NUXA 3MYOA 3SUWA 4FOJA 3CAWA 1J5TA 3AIEA 2PODA 3TN4A 3LB0A 2J66A 5J5RA 4B5VA 2E0PA 4Z42C 3MKVA 5M17A 2E6YA 4DYJA 3W6LA 3VDGA 3ISIX 2P10A 4Y96A 2D69A 3QTPA 3PZGA 1CGUA 1C93A 3RO8A 1L2UA 2ZIDA 2ALDA 2Y8VA 3HV9A 2Y62A 2FMNA 1Q5MA 2JGYA 1WAUA 4MY1A 3VTRA 1V02E 2PDPA 4O1BA 1OX4A 1E0WA 1K9DA 1ZL1A 1A5NC 1ICSA 2CXEA 5CC7A 2PWHA 1E0UA 4H41A 3A9BA 2WV8A 4QXIA 3UZXA 5GNYA 2W66A 2P53A 2VI0A 3A4WA 4CN4A 3NL3A 4B5XA 3FA3A 2Q09A 2YGYA 3DFYA 5M3WA 2PDGA 1SGJA 1H5YA 3ZXWA 4ZQPA 2A0NA 4PMJA 1XBVA 2EEXA 3SO7A 1UR9A 3U5YA 3GR8A 1HKKA 4YLWA 2OGJA 1BSIA 1P1XA 3H2OA 1B54A 4YWIA 1OCJA 4KMQA 2HXUA 1FRBA 2O7QA 1Q2RA 3AMKA 3DFSA 4GUJA 3ITGA 3WDHA 1OC5A 5HJYA 1O95A 4REQA 2PCEA 1U30A 4IJBA 5DY3A 1TUXA 1C8XA 2V0TA 2PGFA 1CWYA 3LTSA 1CXIA 3UY7A 3QOKA 3UZYA 1KRMA 4JTTA 1JYVA 4NZ5A 3R7MA 1Q6OA 3UA3A 5I6SA 1TPVA 5EFDA 3I3DA 3VKCA 3FKKA 4GQBA 3W1TA 3BTNA 4JEQA 3CHFA 1N55A 4G7EB 2YXOA 3BAXA 4UOQA 2ISVA 4UTTA 1B9ZA 4ZQOA 2E7FA 1C92A 2NSXA 3UW6A 1IT8A 3WFZA 4B90A 5A6MA 3TQ0A 4PMDA 3V0UA 1F3TA 3SIMA 1C8QA 4FA3A 2F7FA 4ENLA 3KRUA 2F6XA 1E3ZA 1TR1A 2OZ3A 2ZRZA 3WQVA 5D33A 3DBNA 4DIAA 1UKQA 3TLQA 3W1MA 3WDIA 1RA5A 1QW7A 1TPB1 4N6EA 4JGDA 2OO0A 2GSJA 1UWAA 2GJPA 3URNA 3IWPA 2GDVA 2NZLA 4FR1A 1TZZA 1JZ7A 4Q4PA 3T2QA 3AYRA 4KRZA 1QO2A 4AXNA 4ZB0A 5CPQA 4QSFA 4FX6M 3NPUA 4RNFA 3GD6A 3ZLFA 1DQWA 1R30A 1JZ4A 1EC8A 3ANUA 5CGQA 2YKKA 4D6DA 5I09A 4WY0B 4KCWA 3W01A 5I2UA 5FIPA 3WH5A 4R7WA 1TTJA 2O56A 4GYKA 1ZAJA 1TELA 5LNWA 2WSQA 4F8XA 3OVQA 3KAOA 4CNPA 1U1HA 1O94A 1A3WA 4UCFA 2EXOA 2WCSA 1KR1A 1O1HA 1YDVA 1ISZA 4BK9A 4OV9A 1K8CA 3VCNA 3WJWA 4L6HA 4NXKA 4ZB5A 3BLPX 5B80A 4HHHA 1GORA 5C0QA 4MJZA 1EJXC 2DJXA 3R8RA 2UY3A 4LBRA 2PPGA 2Y1HA 1K6WA 5HAOA 3I3BA 3AFBA 3FJ4A 4CNUA 4QAWA 1HX0A 1TVNA 3ONBA 3C2VA 4GH3A 5C2XA 3N2OA 5HJLA 3NYZA 1KM1A 4ICMA 1US0A 4A22A 5M2FX 4NRRA 4LXFA 4LJ3A 2C0AA 4XZHA 3C3UA 2F8QA 3ZWSA 3CL6A 3HPXA 2TRSA 5LYRA 3RX4A 1A5KC 2PZNA 1BTMA 1E9LA 3SFKA 3W07A 1PX3A 1EBHA 2AOSA 1ZJHA 1E51A 1WNOA 4NNBA 3FS2A 4B5SA 4JYEA 4CEXC 1B5TA 3PTKA 1C3FA 4A8LA 1ITUA 2DT1A 1ZCOA 1K4GA 4NASA 3ARTA 2Y63A 1S2TA 3L2MA 1FUYA 3U57A 5G2HA 1DJGA 4YJ5A 5CC5A 1S3TC 1KXTA 2C19A 3DYPA 3CQHA 3ZJ7A 4J40A 4A8IA 1WYIA 4ZQCA 2V3GA 4P5UA 4RLIA 1N8IA 4U33A 3CO8A 1MMFA 1UOKA 3E74A 3I68A 3CYVA 3R5EA 3S2JA 5HMSA 3BICA 4IMGA 2GJXB 3FSUA 1BKHA 2EPMX 4YHGA 7XIMA 3M0JA 3EX2A 3CC1A 4UMBA 2HV5A 1GQLA 5AC4A 4BF5A 2NQLA 4L56A 2Z1XA 2WSRA 2RFGA 1BRLA 1LORA 4QEEA 2A3HA 1LL6A 2OELA 5G2IA 2VQTA 3RGTA 1W9UA 4O0QA 1JXJA 2ZE3A 4DO7A 2I17A 1MZHA 5LHFA 2YOCA 3MDUA 1XUZA 2CBVA 1RLCL 1SO4A 3TC7A 3LLFA 4HOWA 2I56A 2VEIA 1TRDA 3K1GA 1T6MA 1XIGA 2PWDA 3G1HA 4I7UA 1LWHA 2JF6A 1D8CA 3B9AA 1V02A 3GR4A 3TDFA 5JUVA 4IX0A 5FF7A 4QLJA 1AW5A 3W88A 1ZBWA 1KBIA 4OGZA 3WMLA 3WK1A 4KCVA 1AJ2A 2A79A 1M04A 3HGJA 2J7EA 4C1NA 2TODA 3FHQA 3GIYA 2QJHA 1WKYA 2DZBA 4LAOA 4YVXA 1T0OA 3TONA 4Z1DA 1QR7A 3CMJA 1I1WA 1TJ2A 2E5CA 2WSPA 3CM4A 1GK8A 1H0GA 2AL2A 1MO0A 2NX1A 2VGGA 2Z2BA 1JCTA 3DYMA 3SGGA 2KZHA 1EBGA 2YYTA 5I3KA 2C18A 4NZ4A 4JTHA 4H8UA 1LOQA 3B97A 3G18A 1DTNA 2ZVIA 3FW6A 2CC0A 1PX8A 4AD3A 5T91A 3GY1A 2HEJA 4NIRA 4ZA0A 4FLSA 1Y0EA 1F8MA 1PS9A 2XISA 2PF8A 1DL3A 2F9RA 1P6CA 1VRXA 1QK2A 1O60A 1EJUC 4Z2LA 5HUOA 2VZVA 1GVFA 3GM8A 1Q66A 2H3DA 3BH4A 2IQ0A 3ZM8A 3NFUA 3WLJA 1GVEA 2E5BA 4WDTA 4D6CA 4RDVA 2FVKA 4IIBA 3FX4A 4C6QA 4XAZA 5C8BB 4UIOA 3G5EA 1F6PA 4B16A 4GVHA 3GH4A 2X0YA 1LLOA 3SAZA 3LHTA 1EPXA 2L5HA 1QVBA 1HN1A 4G56A 5EFFA 3YPIA 2CHNA 4QNEA 3MA8A 4S3KA 1HNYA 3HJEA 1SMDA 3BE7A 4A3UA 1WA3A 4QEHA 3T6CA 1FKWA 3BSGA 3N3TA 3AIRA 3BQ5A 3OYXA 1RK6A 3TCSA 1TPFA 1O5KA 3NL5A 3S3GA 4XK2A 3WFLA 1J9YA 4G6CA 1LT8A 1QNOA 3GB6A 4EIVA 4DZHA 4Z17A 3IIVA 5CJNA 3K4WA 1VJSA 3WQPA 1VRDA 5GVJA 4GG9A 1RALA 3U2OA 2W4XA 3G8RA 3N1AA 4JR5A 2TAAA 3UXKA 2I1OA 2I57A 3GVVA 4WJXA 1FWDC 3AS0A 1YHTA 4XZNX 2G4FA 4MLRA 3M7SA 1J4EA 1OABA 4WSJA 4U5KA 2DUZA 3LXAA 3IIXA 3UPMA 4H9XA 1H7RA 5IM51 3MMUA 1ISXA 1AFSA 3FEMA 1QNQA 2BGQA 1AODA 4O19A 3CT7A 3KBSA 3W87A 2F38A 3FYYA 3F5LA 3APTA 4FHAA 1WOAA 3GU1A 3W37A 3CV7A 4QFUA 5GJMA 5EMYA 3I6TA 4P7LA 1E9IA 1WUEA 3QPEA 3C0QA 3TJ4A 1TV5A 3AIWA 2V63A 1W5NA 2HVNA 1CTNA 3GDMA 1QT1A 1LBFA 4XISA 4K3ZA 1G4EA 3W7HA 4O1AA 1QXLA 3WLLA 1REQA 3O7UA 2CLHA 3MQTA 2WMJA 3ZJKA 4BHYA 1RLDA 1JNDA 5K7JA 3QQWA 4XO7A 3UPBA 1BG4A 3PFMA 3L4UA 4C6BA 2YDQA 1TWSA 4DWSD 4LALA 2V3FA 4Z2HA 3OP2A 4GWEA 2V5BA 4QQ3A 2ATSA 4UTHA 1J01A 1A50A 2QUNA 3CPGA 4QNWA 2WNWA 1DE5A 3K4AA 1NSJA 1TWWA 2YCLB 3K2GA 1CBGA 1TE1A 3BAYA 2R24A 3UWYA 3E2QA 5A8OA 3ABRA 3QRHA 2G3MA 2ZC1A 1JZ2A 3H4GA 2FZBA 1UP0A 5CBIA 5HANA 2WMKA 3GH7A 5BXSA 3T44A 3NDOA 1R3YA 2LLEA 1B2YA 2WQDA 3QEZA 1BF2A 4EOUA 3BMXA 1POJA 5BRBA 2E9LA 1DJXA 3WNPA 2XM1A 3K8KA 4RDYA 3BG9A 3TSDA 1K7XA 5TBOA 2DQWA 1HUVA 3E5PA 4O1CA 3Q4DA 3CS2A 1JGMA 2BASA 3BLOA 1XYCA 3DC0A 5ABHA 4GYJA 5DRCA 5FACA 4WF7A 2PDHA 3PZIA 3O2LA 2X1TA 1HZYA 2W92A 3FEQA 4RNHA 1M7JA 5H2ZA 3LBCA 1L9WA 2PMQA 3UU0A 4UOJA 4C6PA 3QGKC 2J88A 2EHHA 3F4WA 3LM7A 2G41A 1XIFA 5CPLA 1VZWA 4HYRA 2XIJA 1E6RA 2IXVA 3A64A 4TQTA 3CQ0A 3UYCA 2ZTKA 3N12A 4W5UA 4IQLA 4M7TA 3BLEA 3M7WA 5CAKA 1F07A 3DESA 1EOMA 4C6KA 2D20A 3N14A 1P0DA 3EWUA 1J0YA 4AH7A 4HTYA 3KBMA 3UVAA 1C8VA 5CZSA 4A8RA 2FZ8A 2W27A 1JYXA 5G4WA 1QK0A 1C9DA 3TEVA 2WW5A 3ARSA 2W79A 4JTQA 5JH2A 2ZKMX 1YTDA 3IV3A 4H6KA 3FVDA 1KFCA 1Y7VA 2FZNA 4JOMA 4P7NA 3TYAA 4E4FA 3EOEA 3TJXA 3NSNA 3B8TA 1HFBA 5JVLA 1VF8A 3UFYA 2PTXA 2A3CA 3CEUA 3RMJA 2XFRA 2CYGA 3NL6A 1D3GA 1E15A 1UR4A 3WNNA 5AHIA 2XWDA 2YW3A 2HQAA 2B4GA 2UZ9A 5GNXA 5I02A 3FIGA 1IEWA 2FZMA 5HXMA 1KR0A 1EWEA 1H51A 2PDYA 3PTDA 4D6JA 4PMZA 4LV4A 2CITA 3LBOA 3JZUA 1TJRA 2YDSA 1ZALA 4YTUA 2OFJA 1H7NA 3L12A 1P48A 4IIDA 5FOOA 1H3GA 1MZRA 3LCGA 3L65A 2PAJA 4PN2A 5A1AA 4UFKA 2OODA 3THDA 3BARA 2G50A 3SCVA 3BJFA 4A21A 3QW3A 4CKQA 7ENLA 2WC4A 1J0KA 3RF9A 1X6NA 4DBEA 3M4HA 1V8EA 1TTIA 3IVSA 2PUZA 3CASA 3CUXA 3NO5A 4CCZA 1TREA 1J0ZA 1R3WA 2AMXA 4TMBA 4AMCA 1UZDA 1N8FA 3WQ8A 3E0VA 5MHBA 3U48A 3ES8A 3ERPA 5L6UA 3WEOA 3R10A 1SYTA 3LEPA 3MBFA 3QXBA 5DT5A 4MAZA 1XSIA 2CZFA 5IBXA 1EEXA 1I1XA 1KFLA 2OQLA 4QJ3B 5HNRA 1V3LA 4A6GA 4H6QA 2WM0A 4ZEPA 3D0CA 1GG1A 4HOXA 3QOMA 3VC6A 5K3VA 1GEHA 1YNPA 4H8NA 3EOUA 2VT0A 2QVHA 1BD0A 4GRSA 4HB7A 4LUSB 5TAOA 3UXDA 2W62A 3UA4A 4KWUA 1W8GA 2GSHA 2YX0A 2DSUA 1OSEA 4H9VA 1UH3A 4W8LA 5I23A 4F2BA 1T5AA 4MY8A 3U2CA 3WH8A 2HISA 2VZSA 5FD0A 3VOHA 1Q7QA 4A2RA 3WK3A 2XH7A 4TOQA 4DUVA 5A6BA 3LS9A 4I6KA 1S2CA 1TFVA 4ZO8A 3S2MA 4ML4A 1QHOA 1QBBA 1PSCA 4PTNA 4DWDA 5IDIA 1GKPA 2FH8A 2J27A 5LNVA 3RR4A 3VIJA 2CLKA 4U4MA 1J8VA 1TB3A 2OU4A 2XFWA 4ZZ9A 1XRTA 2WBGA 1UYQA 1FFQA 3H2FA 3EDDA 3N13A 2WYSA 3EWYA 1Z89A 3TZNA 1AQMA 4YCOA 1IXQA 3JUGA 3FAXA 3GYCA 1TPH1 3F2BA 4TTUA 3CIVA 3ZSTA 4JBRA 2G3FA 3HG4A 3M6YA 3E0WA 4EACA 1DWJM 4MY9A 3KCLA 4NXSA 1XLBA 5AHLA 2FIQA 1A0CA 3DCPA 3TQKA 4Z1AA 2CBUA 3R1ZA 4X2PA 1EX5A 4HJFA 3HN3A 4WK9A 2VX6A 3BAJA 1H49A 1CB2A 3OBEA 3P5YA 4B4FA 3L7RA 2JIWA 3L23A 3LHWA 3P5ZA 4ML9A 4BA0A 1L0PA 3CK5A 2TMDA 1TR9A 2C16A 2NX9A 3E1F1 4DJFA 3Q65A 3WLMA 4LRTA 4C5YA 3UP8A 3M16A 3PZVA 5MKGA 4Q32A 4HZ8A 3TAKA 4HSHA 1WAWA 1YEYA 2VP8A 1E1EA 3JVAA 5HMDA 3UJ2A 3WLHA 4NZ3A 1OM0A 4AZCB 3EDJA 3ATYA 4WDXA 2X40A 4KWWA 3TR9A 3TFCA 1ME9A 3VYLA 1TQXA 4G8TA 3HGSA 4DYKA 5FJUA 3DFTA 1KFKA 2V6AA 2PWGA 1TYGA 1UWQA 4QIUA 1JUEA 3GYEA 3T1GA 5F4SA 3UVIA 3W2KA 1FWEC 4EF9A 2BXVA 2FZ9A 2Y70A 4FI4A 1O1ZA 1KBKA 1GTHA 4CVWA 2B81A 4KT2A 4BJHA 2R1LA 4XTDA 2DP3A 1UZHA 4QTGA 1RR2A 2GQ9A 4Z2JA 4US5A 2BS9A 5I79A 1J10A 3NURA 4FNRA 3EWZA 3LA4A 2GJNA 3BQ6A 4WHBA 2DT3A 4UNKA 4AHPA 2QUMA 4NI3A 5A6JA 2WNZA 4C7GA 1JZ8A 1XRSA 2ZX9A 4ZO6A 4HTBA 4KWOA 3VMNA 3P60A 1Z6KA 1PKLA 4LY4A 2VXNA 2POZA 2GSEA 3P14A 4QJ4B 1B3ZA 1CGTA 1MVYA 2YA1A 4JFSA 1GQIA 4GGBA 3W70A 3WNOA 3BJSA 2FTWA 1HTIA 5EMJA 6A3HA 4DJDC 1UWIA 3U2EA 3LCHA 1H60A 1ZPTA 3FKRA 1UD5A 1PZ1A 4X2RA 3G0SA 2Z6IA 3P74A 1XIDA 3AWNA 2CNCA 2QW5A 5CPSA 3CTLA 1NVMA 4IPIA 1FWIC 5I0DA 2W91A 2E4TA 4HK7A 4XSLA 4N4PA 2MANA 5BMXA 1JDFA 2Y24A 4DLMA 3SY1A 2ZXAA 1KRCC 2FTPA 4E4UA 4H9ZA 1UD4A 3VNMA 3S2CA 5DLCA 3VZYA 3N19B 5DCDA 5LGZA 2OJPA 3GTHA 4Y2WA 4J1OA 2Y8KA 3SEPA 3KCOA 1F76A 2Y2WA 4GIAA 1UWUA 3VC5A 3TC6A 3NEVA 2ZUSA 4MM1A 1Q4WA 3BCFA 3CIWA 1F3WA 4WZHA 5LKYA 1VGAA 2XG9A 4BF9A 5SWUA 2C15A 3KXQA 4M24A 2H9AB 4QE1A 2Q3RA 4Q8MA 5LIKX 2AAMA 3VIHA 1W2PA 3S5ZA 4GBDA 1PZ0A 2B31A 5D30A 4JX5A 1JFHA 3R0UA 1TV7A 2CLOA 4H9MA 3UYIA 2I9EA 2FMOA 3SCNA 3HPAA 1WO2A 4HSOA 4GGHA 1R6WA 1V0KA 3H21A 2F6UA 4HN8A 3QZ6A 5GQBA 3M5XA 5H6HA 4N02A 2OT0A 3RM9A 1J0JA 4C5ZA 1TPDA 3DGBA 4JKKA 1ODZA 4O0KA 1LLWA 1F3EA 3H54A 3AYVA 2QS8A 3KFTA 1XLKA 5FSEC 4IMDA 3VNIA 1NWSA 4HPXA 4JIIX 3T8QA 3C0SA 3PTMA 3EMCA 4XIMA 3EKZA 3H23A 4O54A 3TN6A 3G1YA 2R82A 4XZLX 4L9YA 4KWVA 2Z28A 4KGJA 1ESWA 4OWGA 1ODUA 2NV9A 4CNSA 3QV8A 1A3XA 2ZADA 3GNNA 1JI1A 4UTWA 2FVLA 2O0TA 1WX0A 1K4HA 3C2OA 1GOIA 3UWQA 3R58A 5BZAA 3CGTA 1ZTVA 3WUEA 3OIHA 4YPJA 1IXOA 1CXLA 1GHSA 3STPA 1W6TA 4AZ6A 4GC4A 4C6NA 1U1JA 2AKZA 3WFAA 3MI3A 1ONRA 1JDAA 2RHGA 1AW2A 2D22A 2YB1A 5E9AA 5HWMA 4PEKA 2WB5A 4R27A 5AYZA 4CU8A 1Z41A 2BXYA 3R2GA 3N04A 2XSBA 3UBPC 4AWUA 1G9HA 1G7VA 1TZ7A 3U5UA 1YPIA 1MRQA 3V18A 1C7TA 4H3DA 4GUIA 3M41A 4DWSB 2J7DA 4CNOA 1RH9A 1VCVA 1YE4A 3FK4A 5ABEA 2NLYA 1T99A 3REQA 4K1GA 5JMUA 3LM3A 1DXFA 3GXPA 1AL8A 3S1WA 2PB1A 3D3FA 3C86A 4RNJA 1E73M 1O4UA 3AISA 3EA3A 3F2CA 3DIPA 5CPMA 3W53A 3L4TA 4IPLA 1OT1A 4XVDA 4ZOBA 3ITCA 4OHQA 2XZ7A 4FMVA 3B8WA 1NY1A 6XIMA 4QITA 3IUHA 2HBVA 1DXEA 1FCQA 4N9EA 3N6QA 4AD2A 3ZR6A 1OJXA 4Y9AA 2WKLA 1B57A 1R3SA 3VKKA 4NSBA 1IIGA 5LNUA 5E9XA 3QY6A 4O1DA 1R5YA 1J5SA 3GBDA 1BVNP 2YSWA 4PA8A 2QCHA 4JHZA 5FEXA 4PUEA 1EXBA 3VDHA 2XIOA 3MS8A 3C2FA 4H9TA 3C2RA 3SN1A 3RXZA 1UIOA 1DQUA 1UOZA 2VGIA 3OZOA 1JRBA 2A4AA 2QUTA 3S47A 1VP5A 1EDTA 1OIFA 1RVKA 5REQB 2EPLX 3UQNA 4JXCA 3AIVA 4O4WA 2FDSA 4XAFA 2NVDA 1B90A 2YA0A 4PH6A 3HFTA 4JIQA 4R3UA 1NU5A 2XINA 4M6QA 4S3BA 1I45A 4S3EA 2DUXA 2R9RA 3F03K 4C6DA 1NDWA 1EL3A 3ARPA 5K4ZA 3DOPA 1J11A 2PDXA 4N9BA 3NSXA 1W9BM 2AQWA 1VCGA 4GA8A 4ERAA 1F5ZA 3TP4A 2X42A 1TX0A 1H4PA 1J0HA 3SCOA 4Q8OA 3I7QA 5DN1A 1PV8A 2ATMA 4C6FA 2DFAA 3B40A 4FNQA 2IPWA 3OZMA 2GGIA 4FO4A 5CBBA 1TV2A 5DANA 1LQ0A 2HS6A 4ZCWA 3SCWA 3W1NA 1D9EA 3PR2A 4U5IA 4O52A 4S2BA 4AEFA 1QAPA 3P2VA 3WF3A 2WANA 4DN1A 2NX3A 3QJAA 5BWAA 2BOFX 1XLFA 4M51A 5IRPA 4YXGA 4FXRA 3U6WA 1DP0A 4JL2A 1JGIA 3MP3A 4LVGA 1OG6A 4UTTC 1FDYA 3BOLA 1TVLA 4NJHA 1UIPA 4DUWA 1P0KA 1US2A 1CNVA 3FJLA 3DFQA 1W3LA 5A8GA 4ICNA 4PYSA 1BPLB 4UQDA 2J7CA 4XKYB 4GIEA 4GPNA 1FA2A 3UG5A 4HJWA 4JDYA 2ZC8A 1QOQA 5ABTA 5EMKA 1TKKA 4K6AA 4J3VA 1Q6FA 2X09A 4M6UA 4LWWA 5M5DA 2YFNA 5AC8A 5EGRA 4PUUA 1ISYA 4QLKA 4M3PA 4OECA 2Y7GA 2YL9A 3WLSA 3GU2A 4PUNA 4UR7A 2GYIA 2H3BA 2Q71A 5KINA 3B8UA 3PANA 4MYAA 4WX2A 5F2IA 1WUFA 2C71A 3JU2A 3FSTA 4POCA 1Q63A 4LAMA 3PAOA 2AQOA 4MTVA 2BWGA 3TLLA 4C6CA 1KTNA 4LY8A 4XZIA 3UXIA 2XVPA 5KZMA 5FL1A 3CMGA 3IJIA 3R12A 1F4AA 3QF0A 3VZZA 3R4IA 3C2YA 3SN0A 2YZ5A 3NOYA 1ZFJA 1QASA 2Z29A 2ALRA 2NVAA 4QE4A 3MV01 2PD9A 4L80A 4DQWA 3VNJA 1OD8A 4LX4A 1O68A 1SZNA 1KB3A 5KZDA 2QV5A 4OQVA 5CG7A 1DVJA 3LPFA 5H8PA 2GK1A 4PTWA 4V15A 5CLTA 5CSRA 2BP1A 4FF7A 1EOKA 4RZ5A 3AXHA 4AYGA 2PDMA 4F48A 5HNNA 2X0SA 1RD5A 3SCSA 1VYSX 4XZWA 1NM9A 3KBNA 4E8DA 4Q8PA 4AC1X 1J18A 1HP4A 4IFOA 1RZMA 4GJJA 3RCYA 4E2DA 2C14A 2BB0A 4QROA 3UXLA 3GUGA 2VGFA 4WR3A 1ADOA 5DY2A 4ZVJA 1FVPA 4IXHA 4ROPA 1I2QA 2WCGA 2BZNA 1WDPA 4NT0A 4YYFA 4GJ1A 4IG2A 4JTRA 2DVTA 3CQJA 3FGCA 2HTMA 4TVDA 1VHNA 3MSGA 3WLTA 3RYSA 1UG6A 3ALGA 3T81A 1ZGDA 1VJIA 3NO3A 5DFAA 2BTMA 1XUUA 3VD7A 5IDZA 3H24A 3IACA 4GK8A 1RBOB 1LROA 8XIMA 1DJIA 1RA0A 4E8GA 2VC5A 4HNCA 3CZKA 3GUWA 1NDYA 4GUFA 2A2IA 1UW9A 2JFEX 1JXKA 3RM8A 3QGAC 4EPKA 4GI9A 1VS1A 1X96A 4H7CA 2I9UA 4W4QA 4UTLA 1XCWA 4GI8A 3QQ0A 3EWXA 2A21A 3W1PA 3OPSA 5EMLA 2ACSA 4MJMA 1V3KA 4NG3A 4AZHA 3WF1A 2ZXBA 1XYMA 2BY1A 1VBRA 1DPMA 1O7AA 3QZEA 4C6JA 6XIAA 4I9TA 5CSSA 3W1XA 1TJPA 5DCEA 1XH2A 3LBMA 4DUXA 4JL1A 3EBVA 1JCMP 3KLLA 1ICPA 5AC6A 6PTDA 1Q6EA 1TWDA 2C13A 3N34A 4Y6GA 4DO5A 2X2YA 2ON3A 1UR8A 3FOKA 5AFDA 3DERA 2RGMA 2ANUA 2DVXA 1FWBC 1YTEA 2IS7A 3EPMA 4PMXA 1RBAA 2WZIA 1PHWA 3EB2A 4HA3A 4K2SA 5D2VA 3KE0A 3MWCA 2NWRA 1HGWA 1A53A 5D09A 3IGSA 4K7YA 3TH6A 1SPQA 2DU2A 1L2QA 1Z69A 3LXCA 3OLDA 2UV8G 2OLHA 1VFSA 4XQ6A 3UR2A 2VD9A 4Y90A 1JPKA 4WKFA 3KDOA 4OBSA 4DF1A 3LRMA 1UZ1A 4PUKA 3CB3A 3MUXA 1NDVA 3IRSA 1UD3A 1X1NA 4NZJA 5KTLA 5CPOA 3D3AA 4JTJA 3CHEA 3WH7A 1IHIA 4V1XA 1WDWA 1E5JA 1N82A 1ITXA 2X1UA 4PRTA 5B7ZA 3T55A 1IEQA 1L8NA 4AMAA 4BKNA 4HK6A 1I4NA 2VJXA 5C71A 4O57A 1GOKA 3UXAA 2W5FA 3O6CA 3IS4A 4DHGA 3DHFA 1TVPA 1TCDA 4AX6A 2X7VA 4ZO7A 3GZ3A 4I9MA 1OFOA 3VE7A 1EHAA 5EU9A 1E71M 2A3AA 2OB3A 1UPMB 1SJBA 2VYOA 1YPFA 2HNEA 2J8FA 4LNCA 3S5OA 2V5LA 3TW9A 3W3OA 4P8WA 4UTIA 3SQMA 5F2MA 1RV8A 2J9YA 3IJ9A 3V4BA 4W86A 4JTGA 1DIEA 3JZEA 5A2CA 1QW9A 3WNKA 3IGHX 4WUIA 2HVMA 3QYQA 3MMDA 3KS6A 4IFKA 2WLYA 3MMWA 2OWWA 1KFEA 4FNUA 3QV6A 1CXEA 3VE9A 4DJED 4L9XA 3P0XA 1CECA 3CLWA 3S0CA 4J7RA 4OVXA 3EKGA 4OZOA 1H2JA 3V5OA 4Q3MA 1B9BA 4W8BA 4RR4A 4V2XA 1WDRA 5D02A 4Q8WA 3H7VA 4RXFA 3VIKA 2V5KA 4PBEA 3GTFA 2ZDRA 3V0SA 1SJCA 5C9UA 2W63A 4KWSA 5TD4A 3W1AA 1FCUA 1FWFC 4RZ6A 3W86A 3MU7A 4ALDA 4I5UA 4WRHA 1FQ0A 2PC4A 4MF4A 1QNSA 4NAEB 3O0KA 4QX4A 3GVRA 2WMGA 3IVUA 3M1ZA 3AYTA 4JN8A 1V6UA 1R3QA 4HKPA 3UNDA 5DEZA 1EP3A 3VOIA 1DHKA 1XIMA 2TYSA 4C1KA 1DQXA 1D7KA 3MC5A 4CU7A 3VGGA 2BG5A 2E6FA 1QUMA 3ZT5A 3CQIA 3PUDA 3WELA 3GXMA 3MCOA 1QI2A 2XU2A 3MCNA 2A7RA 2OKTA 4PMUA 4PTMA 1KCZA 2VOMA 4UCGA 4MWAD 1P7TA 3T0DA 1DJWA 1KFBA 2XN2A 1W17A 4WJEA 2PDNA 2NXGA 2E68A 1NQ6A 4F0RA 4GY0A 3PWIA 4LUYA 2XVGA 4DUOA 2NQ5A 4IIEA 3OJGA 1MRAA 2ZX7A 3RLUA 3QW4B 4W85A 1YW1A 3J7HA 2J6VA 2EJ1A 1RPKA 1LBLA 4UTJA 1OK6A 4WJ8A 5E6YA 1H62A 1E4LA 3TSBA 2CHOA 3EMZA 2PWUA 5CPTA 1QI0A 1FWJC 1W1YA 2DZUA 5AC5A 4HMNA 1AJ0A 1JVNA 1SW3A 3UERA 1EDGA 3BLDA 5E5CA 3I10A 1TA3B 3CEPA 3W2JA 4FXJA 3SY5A 3QLLA 1SZGA 2IKJA 3PG8A 3WK2A 4YVPA 4GXPA 4F79A 3TR2A 3GBEA 1V0LA 4FXSA 4BS0A 3QFEA 4KFPA 1R2TA 4RXGA 2EQDA 5CJ5A 2VHLA 4F2UA 1K9EA 2QDHA 1KXQA 2BVDA 4IPJA 2KAUC 2YXGA 4DI8A 3KBJA 2NVCA 4AY7A 1FBAA 3TZFA 1XLGA 3SR7A 2WNNA 1YADA 2OWCA 2EGZA 1NTHA 2J9ZA 4AUBA 1MW0A 3ITVA 4DXXA 1H7OA 4UZUA 3PBGA 4UQBA 2ZXDA 4YWSA 4KH2A 1NARA 1CT5A 1WZLA 2QJMA 3VGFA 1E6XM 2XVNA 4W87A 4GC3A 2PLKA 3KDNA 4G1KA 1YNQA 4L5ZA 2Z1SA 1JDDA 3PM6A 5HA7A 2ZOXA 1KM4A 3S46A 4JIHA 4FIQA 1F2JA 2WJEA 4IPPA 1QBAA 1XR2A 3SSZA 3BW3A 2CKRA 4Z1BA 2DT0A 4XAGA 1MXSA 1E0XA 1E1FA 4XBKA 1V6WA 1XYFA 1WE5A 2W9MA 4KEMA 4MKNA 2PDKA 1P5BA 4DY1A 1EX1A 2Y6ZA 3F4CA 3FXYA 2PBOA 3W1UA 5PTDA 5AOUA 3WMBA 2VEFA 2OG9A 4CGTA 1BYAA 1V77A 4MAVA 3WEZA 3HMCA 1LL4A 4ZQMA 1MQPA 4ZSUA 3NQ8A 3FJ6A 2ZA2A 3ATZA 1XX1A 4JN7A 2QYGA 1Q6DA 4UOZA 1W91A 2YIHA 1I6NA 5AKQA 2O9PA 3WUBA 3AIBA 3E2RA 4PTXA 4GY1A 3NZRA 1LQAA 4WGXA 4X9YA 5H91A 4LVAA 3CL8A 2D3LA 1BWVA 2R94A 1OGGA 4URIA 2XIIA 4O15A 4MJ2A 1F6YA 3L5LA 1JDCA 1PKMA 1PZ3A 3ME3A 3QMTA 4GY7A 1DEDA 3RILA 2OO6A 5K9DA 2QJNA 4R33A 2Q6ZA 1PWMA 3H7UA 5CLWA 1IWBA 2Y7DA 4IISA 2PTDA 4RZBA 3ID7A 2FFCA 4L64A 4BI7A 1OVDA 1KXVA 3KTXA 1MFUA 1QPRA 3LGDA 2WKJA 3IRDA 3LRKA 1U2YA 4AZ7A 1PIGA 1XC6A 1VH7A 4DJEC 3VUSA 4WY0A 3B05A 4MB3A 1DWFM 1VBJA 3BWWA 2WJFA 2GQ3A 1Z8AA 1AH3A 2GWGA 1HW6A 3W4RA 3VOJA 3LLXA 2ZA1A 2QIIA 4J3UA 2OVLA 2ONEA 1DORA 1BLIA 3HQ1A 5E93A 4ADTA 4O12A 3M46A 1UA7A 3VX1A 2ODOA 5A8NA 2J79A 1A5LC 4AZBA 3P0WA 2QCGA 2CEQA 4DLFA 4LV9A 1TCMA 1A5MC 4N4QA 4JHMA 4JNMA 2GVGA 1RJQA 3QHOA 2VZTA 3R25A 1FWHC 2CHRA 1EO5A 2INEA 2XN1A 1X6UA 1MQQA 3AXMA 2PF0A 4M8UA 1Y65A 1OC6A 2OLAA 1SFLA 5EYWA 1XW8A 5A8PA 3C61A 1VQTA 3QTGA 1XYZA 2OYMA 5HK4A 2W61A 4PCFA 2BY2A 3GU9A 1KC7A 3G1VA 4RK8A 2E09A 4P61A 1GEQA 3AHXA 1VYPX 3UG4A 6CGTA 3DGRA 4JPGA 3BV4A 2BVWA 1HJQA 3ITXA 1MEWA 3VUPA 3T08A 1WV2A 3CTTA 4MWAC 3BW2A 3HGRA 1H61A 3G1XA 1SZRA 4KKXA 2UBPC 4TU1A 1XIIA 1JZ3A 4LYRA 5HR7A 3PP7A 5A8MA 2CETA 2G0WA 4O53A 4NVTA 4UR9A 5BNKA 3WLRA 4RCXA 1P43A 3MI2A 2HVOA 3R8GA 1TMLA 1OYAA 1BYDA 1B4KA 1XKJA 3N9SA 4GXMA 2Z1WA 2P3ZA 3EWCA 4C7FA 1L6YA 4WOQA 4OBTA 1PCKA 4PTDA 1Y5WA 4JFTA 3ZVHB 3VIPA 1ZBKA 1POKA 2GJXA 3T4WA 3VNLA 3PUOA 3NTYA 3KBVA 1UASA 2G3JA 1TG7A 2ZE0A 2V2CA 4K8HA 3KVJA 3MUAA 1MUMA 3B8DA 4K38A 1VBGA 1XJBA 3M0XA 3AMCA 1B3VA 1R8LA 3UCDA 1JF5A 3NQFA 1XXXA 4HBKA 1HO1A 2YCJA 2OSWA 3S1VA 3U7BA 1XBYA 3GFXA 3BSHA 9XIMA 1V93A 2ZX5A 3TTYA 4CN6A 4E38A 5XIAA 2CFFA 4Q4KA 4I8DA 4JTIA 4NY2A 4DZIA 3GVQA 2ZA3A 1VR6A 2OXNA 3THCA 3LY0A 3SRKA 4NJIA 2XTKA 4HZ7A 3LU2A 3NQAA 1RCXB 4XV0A 3L5AA 3IPWA 4DRSA 3KZPA 1L6GA 4RE0A 4JZ5A 4HMCA 4I90A 4YYCA 5AHFA 5HDRA 3VM7A 5EKYA 5IXEA 3O06A 3M5YA 3TXZA 4JQ2A 1CGVA 1DE6A 1RCQA 1UUQA 3DU0A 4NJKA 3JW7A 5LGXA 3RUBL 1VLIA 5C54A 1W3KA 2V82A 1Q6GA 5ABFB 3FCPA 2V30A 1KWKA 3DDMA 1S5NA 4QE5A 3KWXA 3OZPA 3P82A 5D38A 1XYBA 3EOSA 1JYNA 1Q13A 4BQ4A 3BOXA 4LUTB 3AUOA 5C2CA 1EUAA 3GVGA 2OPJA 4ZR8A 1X39A 1R7OA 3NWRA 3GHUA 2E1DA 3CZJA 2PTWA 2VCAA 3NO1A 3TOPA 1NOWA 1XYLA 2WK2A 3ICJA 1VFUA 2VELA 5GJPA 2EG7A 4B4HA 5A69A 3B4UA 3WH6A 1BYBA 4BY3A 1TPWA 3CH9A 3URQA 1F61A 3PJXA 1W1TA 1VCFA 3V0TA 1GONA 2NQHA 3OTRA 2XJ7A 3B9EA 3M43A 2PBGA 4F0SA 3CAQA 2REQA 3W24A 4IH3A 3WD2A 5F7UA 3R11A 2VRJA 2WBKA 1IF2A 1LOLA 2FKPA 3ZWTA 1US3A 2XVLA 4KEZA 2XSAA 3MVIA 3C8FA 4TMCA 4H8HA 3NPXA 3LPGA 2PFHA 3HZ3A 4S3CA 3H4WA 3Q94A 1XCXA 4HCHA 3T2OA 4AVOA 1KM5A 2IMRA 2OTDA 2ZUMA 3U9IA 3B0UX 3N11A 1GZ1A 3GXNA 4MB5A 2WO5A 4X22A 3B03A 5C9XA 3AHTA 5CSYA 4GE8A 1MDRA 3VIMA 4IMCA 1BSLA 1NF7A 1S5TA 1CCWB 1W9DM 2J7BA 1QPQA 4LBUA 2B7OA 3UR8A 1Q6CA 1XGZA 2WZEA 4GX9A 4PL1A 3S5YA 3CPUA 4RDWA 3OEXA 3FHAA 2QT3A 2VWTA 4LPCA 1IZCA 1LRTA 1K9TA 2JGQA 1A5UA 1S1PA 3WQOA 4LC8A 5LIUX 4NYYA 4P7OA 3CH0A 3TTSA 2DSZA 1BTCA 3M5VA 1B3XA 1DJHA 2WQPA 3TTQA 2YW4A 2X16A 3VCRA 4H2CA 5E0KA 3STCA 4X0VA 4LVFA 2J13A 4UFHA 3WDPP 3CAKA 1JCYA 1Z48A 4DBWA 5A5WA 2NUYA 3WBXA 2FVMA 3GDLA 3CL7A 4JTCA 3SDOA 4X0NA 5E09A 4GACA 4QCFA 3SECA 5I00A 3VIGA 2OWXA 5G4EA 4CD4A 2PWVA 4RE2A 1KV8A 1RSCA 3CUIA 1SMAA 4MUZA 1VBHA 5IFTA 1G0CA 1M6JA 3OGVA 1MW1A 4UTWC 4OBRA 3EZ4A 2HNHA 5ABGA 2ABAA 3UZJA 4Q8VA 9CGTA 5AYBA 3C56A 3AOFA 2ZDSA 3NXFA 1SO5A 3GZAA 3MSYA 3H55A 3WLQA 1GVRA 1ZBCA 3IJ8A 2H8ZA 4AD5A 4MYXA 4MWAB 4XX6A 2H90A 4EK7A 5CPNA 2PZ0A 4J2MA 3UWVA 3GXFA 1BGGA 3W7LA 3KWSA 3URBA 1AG1O 3V5CA 2Z24A 2WXDM 4GD0A 2Z25A 4P8UA 3SRDA 3GDKA 3XINA 1EDQA 3I7SA 3G2GA 4AU0A 3WF4A 3WQFA 1CX9A 3GRIA 2YCLA 2ADAA 3LCXA 4NU7A 4LQ1A 1E6SM 3GDBA 1TPC1 1V6VA 1NWRA 3IJDA 4DO4A 1OGSA 1H1ZA 4C6OA 3W71A 3MHGA 5CCZA 3AALA 4QLLA 4D6FA 2WPGA 2HS8A 1PBGA 4LU0A 3MVTA 2OSYA 4AFYA 1E9ZB 4TV5A 4P8VA 1HO4A 4BI6A 5BWFA 1V08A 2QNEA 1PVNA 2OX4A 2PLMA 4HPHA 1KFJA 1I9CB 5AECA 3OOQA 3NUKA 1OG0A 3N29A 3QPYA 3GVWA 5A2BA 1U5VA 3T8LA 3NIYA 1W2VA 2OQHA 3PAJA 3NL2A 2P50A 3WYZA 1ZCCA 1VYRA 4L6DA 3SCPA 3QKEA 2E40A 4HNLA 1KBJA 5L9FA 2GWNA 3UJEA 4AF0B 1I2RA 1KQZA 1LUCB 3NQCA 3F4VA 3CV2A 2W0UA 2QAFA 2O55A 2DW6A 4E3TA 1LRQA 3HOJA 3E6EA 1DWIM 1X98A 3SCRA 1NFBA 1S5WA 4B15A 3TX9A 3VDBA 5JIWA 5I3DA 3MP4A 3IJLA 4MUPA 1RQHA 4JS3A 3V5FA 2EPKX 1PDYA 2DH2A 3QMSA 1HKMA 3QHMA 5D8WA 1NOUA 1QHPA 4HA4A 3W38A 3WMCA 1DKWA 3NQGA 3CWHA 4XZMX 1O66A 2V9DA 3HA1A 2PTZA 1L6WA 3PULA 2O9RA 1GG0A 3TQVA 3RM4A 4QGCA 4F4RA 4JICA 2E8ZA 2XUCA 4GYPA 5A6SA 1VBUA 2EG8A 3HJZA 4P2VA 1GW1A 5G5IA 3ZR5A 3N3MA 2CZDA 4NJGA 2VFFA 4AY1A 4ROQA 4A3YA 1QFEA 2GGEA 4HVXA 2W6RA 2QCFA 2V81A 1VEPA 2NWSA 2BSLA 3TIMA 2XN0A 4OE7A 2A6LA 4ZENA 4Z1CA 4Q6XA 4LYQA 4EKJA 1E43A 1F73A 4O14A 2YA2A 4WKHA 3DAQA 3NQ6A 1XHGA 4M0XA 2PS2A 1UZ4A 4W84A 3R79A 1GYLA 2WVSA 5HWNA 1DHPA 1RBLA 1R86A 4GH1A 2ZZ7A 2JEPA 1KW1A 1G4TA 1C91A 3BGGA 2WZHA 4AHOA 4IMEA 5EBUA 4LUIA 1E55A 1W5PA 1VPQA 4MDPA 2Z2AA 4CQAA 4ASTA 3W7QA 2J47A 1TJ0A 1EC9A 1WP6A 1BHGA 4MPQA 4WLCA 5FKYA 1KCXA 4E5TA 1X6LA 5EBAA 3RO6A 1S3HA 5M03A 2BFGA 2J24A 3AI0A 4X61A 4UFIA 1P1MA 3CXOA 3S2LA 1HQTA 2WPBA 2I7GA 2G5WA 1QPNA 1PX4A 3V1HA 5A6KA 4US6A 2YCKX 3QQ1A 3ZMRA 4GUHA 2VCCA 1Y8BA 1KTBA 3VVGA 4NKCA 4F0MA 4E2OA 3VAVA 2R1MA 2A85A 4YTSA 5D32A 2J8TA 2TPSA 2YYUA 2E9BA 2FYMA 4PL2A 2QXWA 4RJEA 2DZTA 4WGHA 1WDQA 1PPIA 2PDUA 1MEHA 1QPKA 4HMDA 5LXXA 5JU6A 1KLZA 1WKDA 4HU0A 3RNDA 5K2ZA 4Y9NA 4HT3A 1XLIA 2V38A 5HQMA 1WZMA 4WVXA 3ZJ6A 1UJPA 3LMYA 4LUSA 1I60A 1XDLA 1RY0A 4D6HA 1EYEA 3TJLA 4LBSA 3B0YA 1P6WA 1R87A 1MWOA 3I65A 1CZ1A 1A4LA 1LM1A 5EA9A 1ZBVA 2D24A 1EP2A 2ZVRA 2WC7A 1UKOA 1TPUA 1JD7A 1OT2A 3PZNA 4UXDA 1R38A 2D73A 3JRKA 1EJ7L 3LYEA 5D9MA 3STGA 2EKCA 3RG6A 1TSIA 5D2WA 5JBEA 4CD7A 2BX7A 2WNQA 4HQVA 1G4PA 3NM3A 1XSKA 4MFEA 4GO8A 5MF5A 4Z1YA 2D2HA 2X2GA 3H8AA 3BG3A 3LERA 5DMLA 1ZP4A 1G7UA 4IUOA 1OFPA 1V7AA 4ZTYA 4OIFA 4J3TA 3VD3A 3MO4A 2ZX6A 1IXPA 5K4XA 4MKSA 5FJRA 4R7OA 3N25A 2J74A 5LA0A 3L68A 3V1PA 1XLCA 2DZWA 1FP8A 3E49A 4L1XA 3MHUA 1V3IA 1KM3A 1ZENA 3NCOA 1M7XA 1PJ9A 1V51A 3GO2A 1F6KA 4Q6JA 4UQCA 3A6OA 3M0MA 4GO9A 2UY2A 2Y5SA 2VZOA 3QY7A 3B04A 3EB4A 2DPEA 4F66A 2PRLA 1JAKA 3LLDA 3WD3A 2YXXA 2XH2A 3ZSSA 3E0FA 4N7QA 4BFAA 3GTNA 3WSUA 5H8MA 2IKHA 3GIQA 4AZCA 4B3KA 3U4FA 1S2AA 2G96A 3TXVA 2FLIA 3R0KA 4RUBA 3SI9A 4JFVA 4TTGA 1H41A 5KSWA 1VPXA 4KQNA 1LTDA 3ARXA 4RE3A 1W1VA 3FYPA 1OWQA 4G9PA 4JTFA 1T41A 3DBPA 3OA5A 4RNIA 1GYMA 4NQ1A 4B2DD 3G8EA 4HCLA 3RU8X 3NEHA 3L4WA 1BQCA 4OV4A 1PZ2A 5AHMA 2E5DA 2NT0A 4B2DA 1PEZA 3P62A 1QO5A 4DAFA 3NQMA 1R3VA 5KITA 1KGUA 4MSSA 2WC3A 4EAMA 3PC0A 3AZSA 1M53A 3GAYA 3DG6A 3L2LA 4JTEA 4CVUA 3BXWA 1FHLA 1GJUA 5T9CE 4V33A 3WEMA 3S6DA 1Z42A 5FI8A 1PXGA 3MUY1 4G1NA 2VDGA 1JPIA 1OFBA 4XUYA 1EGMA 1JULA 4DB7A 3GC4A 1GKRA 2BXZA 4QISA 4H7ZA 2X8RA 2NQ9A 4DXKA 1EJVC 3VFLA 1XLMA 3KHJA 1HIZA 4XSMA 4Z0SA 2PGWA 4GNKB 4LF2A 1CXFA 1YBQB 4RKAA 1SZEA 4AWSA 4HA0A 4ZFCA 3G6MA 4AB4A 5B7YA 4QP0A 2EJAA 2NXHA 3V16A 1JD9A 1SR9A 3IIOA 4IWWA 1LQ2A 2D0GA 3QHNA 1HF6A 2PDCA 3E0LA 2OYKA 4C6MA 3MWAA 1CYGA 4MKVA 2REQB 2CLFA 3MP5A 5D04C 3W9ZA 4OFCA 3VI2A 1TQJA 2DIEA 2QDGA 3I3EA 3WG6A 2HZGA 1Q7MA 2V69A 3BLLA 3SFWA 1VENA 5BRQA 4LAZA 4FALA 2EBNA 1SJAA 5AB3A 3BJTA 3PNZA 4LS2A 4HMEA 3EAUA 4I8YA 1DWHM 5GJNA 5DELA 3M47A 4LFYA 4ZSTA 3RX2A 3AROA 3NSMA 1YQ2A 2FH6A 4HU3A 1GOWA 2CLLA 5DMYA 4JYFA 3XISA 1QDSA 5I07A 1P0EA 1T40A 4MNJA 3UG3A 2A7PA 1SM9A 1BWLA 2H9AA 4DI9A 3QV7A 2E67A 5F4XA 3DC8A 1IT7A 3PK7A 4J27A 3VXGA 4ZFMA 4IGNA 4UNLA 1MEIA 2PGEA 4JCLA 4Q4QA 3URAA 5DX7A 3MMTA 4QDPA 1SFJA 1ZU8A 4GVFA 3UG8A 3LTYA 3L0KA 2IKGA 4MIMA 1ZAHA 3O07A 3DEQA 1VD6A 2XYLA 3VGHA 5I3IA 2CKSA 2CERA 3SBFA 3AXXA 2Q8ZA 2DGAA 2DT2A 3LENA 1E1CB 4K8EA 1GJWA 8RUCA 5KZEA 1AD4A 2G97A 3HM7A 3QC3A 2O4QA 1R85A 2P1FA 3O0FA 3NNTA 4ACZB 1KCLA 1Q45A 3MJYA 3WBYA 2Q8LA 4EX4A 1UR2A 3E5BA 1OFQA 3WZ0E 3UGVA 1JPHA 2JF7A 2YFOA 2CLPA 3E3HA 3TN3A 3PNUA 3A3WA 1W9VA 2XIQA 2QV4A 1RCOB 5HNTA 4S3JA 2IKIA 1J2WA 2HBXA 4QJ1A 2Y85A 1VAHA 4DZAA 1T7LA 3AIQA 4C6EA 2F84A 1KNWA 1A5BA 3GC2A 4MJ4A 2C91A 3N2CA 2PC8A 1NIUA 4JY8A 3UWZA 4PUMA 1FP9A 5BRPA 1XYAA 2A3LA 3U0HA 1RJPA 3ARRA 1ISVA 4PB4A 1EUNA 4GCAA 2VVSA 5E0FA 5A6LA 1FWSA 1IEXA 4NI8A 4GZIA 4DPPA 2VX5A 3N2XA 1J6PA 3G0XA 1ZJAA 1BFNA 3LCLA 1V4YA 3CU2A 4H4IA 4JTLA 3DUGA 5FEZA 4MLJA 3A9IA 1W3JA 1E4MM 2ISDA 3KHDA 1PTGA 2J77A 3IJ6A 1R7AA 4FK9A 1WKEA 4DWSA 2J8GA 5CZKA 1UR3M 4U31A 4D6IA 1JRCA 4LYPA 3PJWA 3S4TA 1VIZA 2OMAA 8A3HA 4BQ2A 2DSVA 1VPYA 3G22A 1V6TA 5CZ0A 3OG2A 3TFXA 1Q8JA 2D23A 3RJYA 4EP8C 2YJQA 4PMVA 3AUJA 2A6NA 1TWIA 5LNRA 1CIUA 1X1OA 1FH9A 1RY8A 3OBAA 4XWUA 4ZXOA 3RIKA 4EWND 4UTFA 4UBPC 3H2AA 2YZRA 1R9ZA 1E3XA 5GNZA 4JHOA 5FEWA 1RVGA 5LA1A 4DNMA 4IQDA 4JAWA 4H7VA 1XIBA 3EEZA 4GFSA 5A95A 3R89A 1NFPA 4U10A 3DI0A 3RN6A 3ONCA 1AW1A 2O4MA 2NT1A 5I06A 3R8HA 1K3UA 1W1B1 1S39A 4QCEA 3N4FA 4QBXA 8TIMA 3RU6A 2QJJA 5HNUA 2VWSA 2WHKA 2X1IA 1ZP3A 1DWAM 5U4NA 1SO6A 2BVYA 1IEIA 3VINA 5REQA 1OCBA 4S3FA 1PTAA 3S5SA 3DFOA 3WQ6A 3RX3A 2EF9A 4ZGYA 4PSRA 7REQB 3CZEA 3DG7A 5EMUA 2P8CA 2E9MA 3CPRA 4FXFA 3EA2A 1ISWA 3B3DA 2PI6A 3MO7A 1IXNA 4EXQA 4GXWA 1JCNA 4ZODA 1RP9A 1YE6A 1K77A 3QVQA 4O8AA 3OLGA 3QYSA 1F3XA 1KWGA 2AGKA 2OZTA 4RL3A 2WJDA 5EL1A 3T78A 5HWJA 1TPEA 4JTSA 3GIPA 4IT1A 3LZ5A 1FWNA 1GTEA 4FR6A 4UMCA 2Q01A 1FXPA 1EF2A 5LIYX 4YCPA 4R7JA 4I6VA 2DW7A 1W3HA 3QSTA 4KCTA 4L7ZA 3BG5A 3MSRA 4L4OA 3V7PA 4DJDD 3W7GA 2JEQA 2GLKA 3LHUA 1YNYA 1JCJA 2VM8A 7CGTA 1RAKA 5EMMA 3VKBA 3SRHA 3WDJA 2UWFA 2VURA 4YU1A 5JXQA 2PU1A 3NYDA 1TWZA 2ZRWA 4IMAA 4AW7A 1KRAC 1XKYA 3SJNA 1PKYA 1UC4A 1XDMA 2GVEA 4L61A 1LDCA 2V2DA 3NPWA 5HATA 3CHVA 1PO9A 3QY8A 4G5DA 1I2OA 4DM2A 3GNDA 2A1YA 4GVIA 2Y8UA 2C6QA 6REQB 4YS1A 1W1A1 1EIBA 1MUWA 4XKYA 1MXGA 3QLDA 1R9YA 4IIGA 4GUGA 2ZRVA 1W3NA 5DCBA 3LI1A 2J78A 2GJRA 2UY5A 4GVGA 4L6OA 2R1KA 4JX6A 3GSMA 4NX0A 1VJZA 2XH4A 3PTQA 3E12A 4QHRA 1V6YA 2X1RA 1E70M 3WENA 3VU2A 2IPGA 2ICSA 2GUUA 4DO6A 1ZQ5A 5E1QA 3HQPA 3W0KA 3CHDA 2ZUWA 1YXCA 3MB9A 3RLVA 3MZNA 4ZO9A 3W1LA 2FTYA 4BQ3A 4B5TA 1SU5A 3L4ZA 3W83A 1ML1A 1SFSA 2DIJA 2QCNA 2Z0IA 5E70A 1VC4A 1HG3A 1D2KA 2Y5EA 1E0TA 5FCZA 3KTCA 4YVVA 3N6HA 4E4PA 5M1TA 1EEPA 3P8IA 4PUWA 5D8ZA 1JZ5A 4OTKA 2C1GA 4EANA 3NQDA 3LPOA 3L4XA 1F9CA 3W00A 3BMVA 2AKMA 4PGLA 3TYUA 1TTPA 3TA6A 3Q45A 4JTUA 3W76A 3L66A 4Q8TA 1MFVA 1LBMA 4GKLA 1N2VA 4GYFA 4LCRA 3WQGA 3U3HA 1DJNA 2V8ZA 2A3EA 1VEMA 2DZAA 3C0JA 4BF7A 3ABOA 4I5RA 4R85A 3UR7A 5HINA 3TCEA 2J6XA 3PZMA 2Z1BA 3PB2A 3DXIA 1B3WA 1XLJA 1DXIA 3N6JA 4E2VA 1TUFA 2FB3A 1HL2A 3KZSA 4N9CA 2FHBA 4IGSA 2OKOA 1X1ZA 1GVOA 3HPSA 5J8LA 1XP3A 2VR4A 2WJZA 2E6DA 4AIBA 1WCGA 3CUHA 1R3TA 3DENA 4C60A 4GQRA 1T8QA 1V79A 3V75A 2NUWA 4R88A 1XPYA 3WK0A 1LWIA 3DH7A 3IEBA 3RAOA 4XD3A 1JQXA 1K1DA 5LIXX 2ZRYA 3UETA 2O9TA 3S6OA 4BWLA 1K02A 1MDLA 4ZOEA 3D47A 3W7OA 1U33A 2QJGA 4JY9A 6TAAA 2PDQA 5HULA 1XLDA 3ENLA 4GOAA 2BY0A 3IVTA 4PMYA 1M1BA 1ADDA 5IHSA 1OX6A 3KRZA 2RJHA 4JQ3A 3PS7A 2BODX 1CXKA 3EX3A 5I7GA 1XL9A 1OY0A 4G7FA 2ACRA 1NF0A 4EPBC 1XDJA 2J9XA 4LB3A 2ASHA 2GVYA 3SB0A 4EPDC 4TX9A 3M0YA 5DBUA 3MI6A 2P0IA 5DQPA 1EYWA 2PDJA 3PUGA 4X60A 4AVNA 2CZ5A 4LT9A 2YBUA 5D37A 3EWWA 3N73A 4F40A 1MUCA 2BY3A 3GDTA 2NLIA 3FLUA 4GQQA 4W7UA 4D8ZA 2WVTA 1UP3A 1U22A 3HG3A 4GZJA 2XGBA 3WMSA 3W7EA 5D9PA 1JR1A 1AUSL 1I8JA 3HPFA 2VCBA 4XAPA 3SIZA 2Z26A 4M80A 3H2CA 2AGTA 3M0HA 3C0LA 1HJSA 2X0HA 3F1QA 4QG9A 1KGXA 1AVAA 1JJKA 1JPDX 3STFA 1VLWA 3LV5A 2P3EA 4H04A 3FNDA 3Q2DA 4FLRA 1PIIA 4MDOA 3HMJG 1AA1B 1UKTA 3I6EA 3UESA 2ZTJA 1QNVA 3K8LA 1CDGA 3F2DA 3ITTA 3NGJA 1GGOA 1KA9F 4W88A 1N7KA 1JAEA 3F4NA 4C65A 1PAMA 3WH9A 3ALFA 1AQFA 4CQ9A 1K7FA 2VC6A 1UJQA 4UTUA 3OW1A 1GWJA 2CESA 2PU0A 2OQYA 3KP0A 3WUGA 3N2TA 4LSBA 5DT7A 4E8CA 4TR9A 1RP8A 4DELA 4ES4A 1A3HA 2YR1A 1W9XA 2QZRA 4EVZA 2JQXA 2CPUA 1VFFA 1P0BA 5CGTA 1PCWA 3B9DA 1T8XA 1UMLA 1DIOA 4YTQA 4LC6A 5FJOA 4MHBA 4JTAA 3OG3A 4GI6A 4FX7A 2QVNA 4HGXA 2VOTA 4R9XA 3CO4A 1B3YA 1UD6A 3DHUA 5A2AA 1GOQA 1SQ7A 4UB9A 1DOSA 4Y8EA 3N9KA 4H6EA 3WBWA 2GQAA 3AU2A 1I2NA 1Q65A 4RE4A 7ODCA 3WLOA 3IK2A 5HMEA 3NZPA 2V2HA 4XUGA 1X7IA 4B9YA 2X05A 1QNRA 4ADSA 5EB8A 1DJZA 5FF3A 4KEUA 2QPXA 1NP0A 4IM4A 1AL7A 4ICCX 3GNOA 4HNUA 1Q6QA 3RPTA 2XGZA 3WY1A 5JIPA 4INFA 5HMFA 5LHEA 4QM1A 1GQNA 1KLYA 4AISA 3ZIZA 4LANA 3QM3A 3S42A 1GHRA 2GPTA 1EA0A 1SUXA 4UTMA 4U28A 4PMRA 4UUIA 4A05A 2FPVA 4Z2KA 3KTSA 5CC6A 2OR2A 3KVMA 5DMMA 1OBAA 1B4EA 3Q67A 1J12A 1QI4A 1OK4A 2PRHA 2WVVB 4PB5A 3PPCA 1CGYA 2PWEA 1QU4A 3VKDA 1IV8A 2ZYFA 3M0ZA 3A12A 9XIAA 2MUCA 1I0DA 3PZTA 4M7SA 3OO2A 1ME8A 1UUMA 5BOOA 2P0OA 2BVTA 2QIWA 3AQUA 3AJ7A 2EPNA 4WKAA 3ARWA 2I16A 3PBVA 4EF8A 2V68A 2C79A 1TTQA 4L1WA 4NAEA 2BNJA 4C6LA 2QCDB 2WMIB 4Q4MA 4S3GA 1HP5A 1QCWA 1GQKA 4Q7NA 3ZLHA 3VNKA 3M64A 1ADSA 4TX8A 2ZFAA 3HF3A 1A5SA 1XF0A 1V5XA 1RQEA 1FHDA 5IHRA 1W9PA 2Q8XA 3QR1A 4HPJA 2O9OA 1ZJIA 2V3DA 1QI5A 2B7QA 4V28A 4NILA 1JIBA 4WY0F 4QRNA 1UQYA 1ZHAA 3OB8A 1HKIA 2DQXA 5KMYA 3CUZA 3JR2A 1IQ8A 4HK5A 4WIWA 4I7WA 4DYEA 5C7HA 4U2YA 3WKZA 1VHCA 4HZMA 3VKJA 1JPMA 1HKVA 1PL9A 3B8IA 3LZ3A 4WDUA 2ZXQA 1GVIA 3OGSA 1FTXA 2F61A 1IEVA 1Z7AA 2QULA 1RJRA 4GABA 3O6AA 1NOFA 3QFWA 3GNRA 2G3NA 1C7SA 4V1YA 3ZQ9A 2PDFA 4PCSA 1X7FA 3WLNA 4NAFB 2RH9A 3C52A 3V36A 1G6CA 1TA3A 5JBFA 2GVJA 1QWKA 3K30A 1GQJA 2CLEA 1PYMA 2OT1A 1YMYA 4TX6A 1XLHA 4CEUC 3W23A 4E2BA 2WOQA 5U7SA 1HKJA 4FP1A 3TROA 4AD4A 1XLAA 1B31A 3EWDA 3NQ2A 3L5MA 3EWBX 5FF2A 3WJXA 5DXXA 3H22A 4O13A 1IGSA 1FFRA 3A3XA 3D46A 1DJQA 3GNPA 1R0MA 3VGEA 1VFMA 2ISFA 2O7SA 1QOPA 1KO0A 1JDEA 3FDGA 3GNXA 1UUOA 4OOZA 2NQJA 2VR5A 4NL1A 4JIPA 4PUDA 4PRWA 5F2LA 5E0CA 2QEZA 1PWLA 4KIRA 4EXAA 1K6AA 1NWUA 2YPIA 3IV8A 3II1A 3VIFA 2OSXA 3GWQA 4FB7A 4IIFA 3FJNA 4NNAA 2OOFA 4MNKA 4Q4RA 1H09A 4MZ8A 1FWCC 1H1YA 1K8ZA 1YXYA 1WPCA 2ABBA 1MW2A 5F1UA 1C9WA 4CNTA 3NOEA 1Q3NA 2R8WA 5I3GA 4AEOA 4LGXA 1FCVA 2ZQ0A 5HQLA 4Y7EA 1UPPA 5AC7A 1NH6A 1XIJA 1ONXA 3W25A 4KRTA 3S1GA 1M68A 2PDIA 4MADA 3DKLA 1J96A 1W56A 4FNSA 1O12A 2ZZ6A 4J5NA 3E96A 4TO8A 1KXHA 3FDKA 4UTKA 4GX8A 1GZJA 3VO0A 4GYPC 4NZ1A 2VVNA 4ACYA 3HIJA 3AJXA 2G37A 4XBSA 3LPPA 4J3XA 4N6FA 3B9NA 1QJWA 3RHGA 3PBYA 1OADA 4OUIA 2GOKA 3BC9A 4IPNB 4AVFA 3PHAA 5LIWX 1LT7A 3NQEA 1GCYA 1U5HA 3EB3A 3L0NA 4GZEA 4IOTA 3VOFA 3BDKA 5F1VA 4EXBA 2GGGA 4ZBCA 3NZQA 3VGBA 2W3ZA 4ATWA 3CUJA 3UJSA 3VOCA 3CQKA 2J25A 3RITA 1GVSA 4I3GA 1WB0A 3QN3A 1U83A 2EKGA 2WCAA 3ARVA 3CB8A 4LB4A 3ABQA 5D9NA 4GQGA 3C6CA 2VC9A 1CB7B 2BMBA 3O9NA 3E2VA 2H8XA 1AZ1A 3W22A 1S2UA 2VFGA 2QHAA 3CUGA 3EGJA 2VFEA 3KOFA 2INZA 1H0IA 3N17A 2R6OA 3PFRA 2OZ8A 1NELA 1MNSA 6TIMA 1OZMA 4EPEC 3MUIA 1GJPA 5D05A 1QATA 4O16A 1WBJA 4XTIA 4D6GA 3QSRA 1ENUA 3BAIA 5ECUA 5CKSA 2V5DA 3HU7A 4PBFA 4ZQNA 4FX8A 2QMKA 2QUUA 3P3BA 2GFTA 4K8GA 1XBXA 1CEOA 3RK8A 2YBVA 3B06A 2JIEA 3H2NA 4WOZA 4H2HA 3GXDA 2HPIA 1V03A 2VX4A 3WJYA 1BVZA 1PYFA 3PPFA 2JE8A 4ZE5A 1ONWA 2Z1KA 2IQTA 5FF0A 1YKWA 2CLIA 2WKGA 2E25A 5EPDA 1OFDA 1UH4A 1D3HA 3V35A 3GAKA 1AMKA 2Y7EA 3LQLA 4MWAE 2GDUA 4PBGA 1CI1A 4YL2A 5J04A 5LNSA 4FOUA 1XM3A 3N2MA 1W37A 1XPGA 5LSMA 3VNYA 4GISA 5H8UA 1GYNA 2P5NA 1XH1A 2QCCA 3S9YA 4O0ZA 3WLKX 3BW4A 1UHVA 1EJWC 3W7CA 1V3JA 3THUA 1PHQA 3TC3A 3N9RA 3E38A 3LN3A 5AYIA 4ATDA 1GPWA 1H7WA 1OGBA 1BXCA 5I3HA 5HR6A 3A5FA 4HNTA 3T42A 5KZ6A 4XKMA 1K9FA 2VRKA 3AWOA 3TYBA 2RDXA 3TW7A 3CHCA 3W7PA 4JDBA 3C3NA 2AAAA 4AY8A 2RDWA 4KS0A 1HXJA 3BGJA 1OQFA 3G3MA 1VFOA 4HNOA 3KBWA 2BOEX 4H9YA 3VIIA 1JG9A 3VD4A 1YYAA 2PEVA 1OCQA 3A4JA 1EP1A 4LVBA 2BHYA 1E5NA 3ZVHA 4NRSA 3A13A 3G3DA 4WXZA 4DAIA 2GVLA 3MKCA 1HVXA 3UT0A 3LUTA 2C0HA 3O63A 4KCUA 1IE7C 3AHVA 4CQBA 3T0AA 4MNMA 3QR0A 2ISSA 2E1WA 4WQ6A 4M56A 3NJ3A 3DN5A 1TMQA 3M0VA 2BGNE 2J7GA 4Y9OA 4BR1A 1U1UA 4C1LA 3FYOA 3KP1A 4RW5A 4NYUA 3K8MA 3WX7A 1VFLA 2C1IA 3ABXA 4AG0A 3O3RA 1I2PA 3UF9A 3UR5A 3G1DA 1A5CA 4Q33A 1HJXA 5XINA 3VILA 2P76A 3QPZA 1UQZA 1OX4B 4B3LA 2VENA 2XPKA 2QJIA 3MZ2A 3T05A 3EYPA 1P6BA 1UWRA 3IJQA 4XZ9A 3IAPA 4GNJA 1UH2A 3TYDA 2YL8A 4IP7A 4PSPA 1XFBA 1NEYA 3IGUA 1KFWA 3W2MA 6ENLA 1M5WA 4D1IA 4PCTA 2Y88A 1W3IA 4LAKA 3W2LA 2CW6A 3EX6A 2ACQA 2NW0A 2EPOA 3W26A 2ZX8A 2VUNA 4KESA 3W7MA 1B0IA 1H63A 1XCFA 5ABFA 2FHFA 1WQ5A 4PZVA 4F0LA 3T40A 3RPMA 2GUBA 2DY3A 2J7FA 2OEKA 1HL9A 2BLEA 3LNMA 3ITYA 4LUTA 5DBTA 4IQEA 5DO8A 2HXTA 1EZWA 2JKPA 3EOOA 4JNYA 3BUVA 3W2NA 1TIMA 2DVUA 1B3OA 4IHCA 3WNLA 5CXPA 1AH0A 4XVEA 4GIYA 2J62A 1UKPA 4Q4SA 3MPGA 1P0NA 4W8AA 2WVUA 1ZAIA 4REQB 4MB4A 1V3HA 1QW8A 4PULA 1K8XA 3WQ4A 1YXDA 4IGMA 5K9CA 5GPRA 3MSDA 4NF7A 5FESA 1M7PA 1LWJA 3E9AA 3LCIA 8XIAA 4HNVA 1K70A 3WUFA 2RDUA 1LL7A 1DIKA 3NZ1A 4B91A 3FA5A 4DEFA 1RHCA 3NQBA 4QDWA 1PKNA 1Q6RA 4J3WA 1E6QM 2ZBTA 4Q8NA 3VMOA 4HYVA 3KRSA 3R0DA 3PG9A 1MI3A 2HSAA 1ECEA 1EZ2A 2Z2UA 1DV7A 2HDJA 2PLCA 3BPWA 2X7WA 1M7OA 1DYSA 1XH0A 1E4IA 4K39A 3TOYA 2I14A 2YCIX 4Z08A 4A4AA 4ERIA 3N2BA 2F6KA 1E6PA 1RQBA 2FGLA 5T8GA 2QMJA 3DFNA 3H4XA 3G1SA 2D2JA 3LHVA 3T0BA 5I24A 5TNVA 3W72A 4DJEA 3AMLA 1TMHA 2CZVA 3VZXA 5AHEA 1QHZA 2QLYA 3SUTA 4H00A 3MCMA 1KM2A 3TQPA 2FPTA 3KX6A 1O5RA 3NAVA 4CN1A 4JFWA 1FWGC 1IR1A 3RLHA 4UFJA 3BSMA 1DIDA 3BO9A 2FFIA 1THFD 3ES7A 4QS5A 4GI4A 1G1YA 2HPMA 4LCQA 1UKSA 3EKLA 1R2RA 3G6LA 2Y89A 4KFNA 3POHA 3WDRA 2CU0A 1VFTA 2NSOA 3KOWA 1TV3A 3NXLA 3W7RA 1S2WA 4JN6A 4YTTA 3VNDA 3B9OA 3M07A 3OU8A 1W5QA 1OZQA 3W6YA 4I9AA 4JTDA 4V27A 4LAUA 3DZ1A 4QSHA 4W89A 4KGLA 3M0KA 2Z4GA 1OEPA 1BGAA 1GW9A 3O6YX 1LJYA 4AX7A 2ACUA 4LS0A 2CIPA 1KD0A 1MYRA 3AS3A 2VZUA 2Y61A 1JEZA 4PCPA 1XS2A 3VCCA 3L4YA 4IJCA 4HU4A 4S1FA 4MFDA 4DX3A 1XI3A 3VIOA 1C90A 3DFPA 2DEPA 4Z2IA 4XD5A 2HE5A 4MWAA 1XINA 3WD0A 4B5NA 2VL4A 1G67A 3AXIA 3WF0A 5A6BD 4M6VA 2IPFA 4Z2GA 3BLIA 1E6NA 4UZSA 4OU1A 2XSXA 5BOEA 4QQUA 3ITLA 3UD6A 3M6DA 1FHUA 3KL5A 4KFOA 3OHMB 3LSBA 3CJPA 4H83A 4AIUA 2GUYA 2WHLA 1FCBA 3EMQA 3CNYA 4FSAA 3PJTA 2VEPA 5F4WA 4XIAA 3H26A 1GUVA 2QKFA 1R3RA 4OOUA 4DWSC 3KVKA 4NP7A 3OLEA 3EX1A 2XFYA 2QR6A 3THQA 4B5WA 1UR0A 2HRWA 1R2SA