2YZRA

Crystal structure of pyridoxine biosynthesis protein from methanocaldococcus jannaschii
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
309
structure length
307
Chain Sequence
TDLLKKGFAKMVKHGVVMDVTNVEQAQIAEEAGAVAVMALERVPADIRGGVARMSDPALIEEIMDAVSIPVMAKCRIGHTTEALVLEAIGVDMIDESEVLTQADPFFHIYKKKFNVPFVCGARNLGEAVRRIWEGAAMIRTKGEAGTGNIVEAVRHMRLMNEAIAQLQRMTDEEVYGVAKFYANRYAELAKTVREGMGLPATVLENEPIYEGFTLAEIIDGLYEVLLEVKKLGRLPVVNFAAGGVATPADAALMMQLGSDGVFVGSGIFKSENPLERARAIVEATYNYDKPDIVAEVSKNLGEAMKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pyridoxal biosynthesis lyase pdxS
publication title Crystal structure of pyridoxine biosynthesis protein from Methanocaldococcus jannaschii
rcsb
source organism Methanocaldococcus jannaschii
molecule tags Lyase
total genus 102
structure length 307
sequence length 309
chains with identical sequence B, C
ec nomenclature ec 4.3.3.6: Pyridoxal 5'-phosphate synthase (glutamine hydrolyzing).
pdb deposition date 2007-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01680 SOR_SNZ SOR/SNZ family
A PF05690 ThiG Thiazole biosynthesis protein ThiG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2yzrA00
3A24A 3OVQA 3HF3A 5LHEA 1LRNA 1EX5A 4O4VA 4GUIA 2VFFA 4K7YA 3QM3A 3FIGA 3O6CA 1XDLA 5CZTA 2B7NA 4LVGA 5KTLA 1G4TA 1JCMP 1TV7A 3RNDA 2VC6A 3TW6A 1V5XA 3B05A 1OVDA 1P5BA 1ZJIA 2B4GA 4RV8A 3E9AA 3TE9A 4XQ6A 3T44A 2QCCA 3L68A 2WQPA 1A53A 3B03A 4ZQCA 3W2JA 4MKNA 1K8ZA 2QAFA 3STCA 3LCGA 3QH2A 3EWXA 4O19A 3W1LA 2A7RA 4O13A 5AB3A 1VCGA 1M6JA 4Y90A 1H7PA 4IQLA 4HNVA 2YYUA 2FIQA 2VKZG 4JX6A 3ABRA 3QSTA 5J5RA 2WKJA 3G0UA 1TIMA 2V82A 5AHIA 4HT3A 2GVJA 4M5PA 3NZRA 4PEKA 2Y61A 5CZ0A 3HG5A 3F4WA 1Q6OA 2V5BA 2RHGA 4O28A 3PM6A 3L2IA 4Z0JA 4DBDA 4S2CA 5I3GA 4OGZA 5FF2A 3W7NA 2CZEA 3BO9A 3MBDA 5LNSA 4JTIA 4TO8A 2YFNA 3PS7A 3LV5A 4MYAA 3HBLA 4CNPA 1SFJA 2CFFA 4JTHA 4WOZA 2ZFAA 3BLEA 3EX1A 5DBUA 5HUPA 3R12A 2VEKA 1BEUA 3Q37A 2NV1A 1YDOA 1PHQA 3L0GA 3O07A 4QM1A 5BNKA 4JYFA 2E09A 3RF9A 3W7EA 2A1YA 4N9EA 3KVLA 4D2JA 1YTDA 1KFBA 5L6UA 4O10A 3W1AA 1YXDA 4QNWA 1OF8A 3W9ZA 2LLEA 1GG1A 1GOXA 1M7PA 2BWGA 3CIXA 4U28A 5AYYA 1XBVA 1TPUA 3LCWA 3THAA 1DV7A 2V2CA 5HJLA 5D37A 2VXNA 3P84A 4HIBA 4JN6A 4LY8A 3HGRA 4K36A 3N2MA 3PBWA 3TH6A 3T40A 3UNDA 2EF9A 3LI0A 3KVMA 4OQVA 1Z44A 3W7JA 1VC4A 3QJAA 4BI7A 5CSSA 4NNAA 4WXYA 2GQ9A 3DI1A 3KXQA 4O12A 3TK7A 2V2HA 1I2QA 3LXBA 2YDAA 3T55A 5TQLA 3THQA 3CEUA 2BSLA 1OYAA 3N9RA 3MP5A 4FIRA 4YXGA 2V2DA 1TYGA 4N2YA 1OYCA 3NGJA 3RU6A 1I2PA 1ZAHA 3HB9A 3QC3A 4I9AA 4JTEA 4JTUA 4AXKA 2H6RA 5CZJA 4ALDA 1FWWA 1Q6LA 4Q32A 3W7IA 1GQNA 3UXDA 1AK5A 5C2XA 4ZL1A 4N9DA 4JTLA 2H3BA 3BW3A 1THFD 4PH6A 1H7XA 2PRLA 3S9YA 1Q3NA 5HR6A 4DF0A 5I3JA 1O60A 1W5PA 2ZTJA 1IGSA 3N2XA 1X6UA 3SIZA 3PUOA 5FEZA 1K03A 2QKFA 3I7QA 4A22A 4K8EA 1UCWA 2QCNA 3G1VA 1H7OA 1A5CA 2ISSA 2Y7DA 2ZRVA 3MHUA 2NXIA 4UFJA 3DBPA 3DU0A 4ORMA 2O7SA 4KWVA 3TIMA 5HWJA 5EBUA 4H4IA 4AAJA 2NX3A 1UUOA 4QITA 3Q94A 3SR7A 3EWBX 4H6KA 3LHUA 4IX2A 3SFKA 3BG9A 3IIPA 1JCJA 3CWNA 4AH7A 4EF8A 3LHYA 3G1YA 1WOBA 3R5EA 4GUFA 1SW3A 1TJPA 1R46A 1Y0EA 5DY2A 1I2RA 5DN1A 2QCDB 4TU1A 3VNDA 3W83A 1RR2A 4WXZA 3G3MA 1AW1A 1OFQA 2HS6A 1W5OA 3T78A 1QMLA 5G1YA 3OVRA 3EXTA 3HGSA 3W2KA 3FOKA 3LCHA 3LGEA 2QCHA 3TMLA 3PB2A 3NQ7A 3M5VA 3PF3A 1QPOA 1A5BA 3M1ZA 1B4EA 2JKEA 4GUGA 1SUXA 3IGXA 4QISA 2CU0A 3N14A 1K7XA 1PIIA 2FPTA 3TQ0A 2EAWA 3S6DA 4NUWA 1L2UA 1ZY9A 3UWQA 2BTMA 4NQ1A 3GAYA 1F2JA 4AF0A 3FKRA 3QZEA 3VKJA 4RXGA 4TR9A 1LBMA 2Q8ZA 1Z41A 3TUUA 4FIQA 3DZ1A 1IXOA 3BLFA 1PL9A 1QFEA 3DFSA 4JGDA 3W7OA 1SSDA 3STFA 3UYCA 1TRIA 4IPJA 2Y70A 3LLFA 4L4MA 3UZ5A 2C19A 3M44A 3T7VA 3TXVA 4IMGA 1SO5A 3GDLA 4R34A 3O06A 4HPXA 1TPH1 5F4XA 4X2RA 1T8XA 4UFKA 2X1TA 1VLIA 1GVOA 2GJNA 3L66A 4FNRA 3DFQA 4FF7A 1YTKA 1UUMA 1OX4A 4K7VA 4FEZA 4O54A 5F2GA 5K9XA 2FB2A 4ZZ9A 1NVMA 1H7RA 3DHDA 4PFMA 3GDTA 5D33A 4LVFA 4DXVA 1J5TA 3HIJA 5DY3A 1C29A 3K30A 2KZHA 5G1TA 2BZNA 4UMBA 2G97A 1QO5A 1N7KA 5HINA 5K3VA 1FY6A 2ABBA 4I7VA 3TW7A 1O94A 4Z0SA 3G1HA 1EP3A 4UTIA 5LHFA 3STEA 3I7RA 1D9EA 1MEIA 3H53A 5AHLA 4JTSA 1DL3A 3JS3A 2ALDA 3MWAA 3PUEA 4BWLC 1FX6A 4JXCA 2YZRA 1KFEA 1TJRA 1F6KA 3HGJA 5KSWA 2HMCA 4MOZA 3QPYA 3C2EA 1VH7A 2WNNA 1B57A 5KITA 2NWSA 3HPSA 4TX9A 2RFGA 3M5YA 3TKFA 3W85A 2XN1A 3OEXA 3BK0A 3SGZA 4I7WA 5KZEA 4WX2A 3D0CA 3M43A 3WJWA 3P61A 1TSIA 4LS0A 4R53A 2BXVA 2RDTA 3MHFA 4P61A 1QCWA 2HTMA 3FKKA 5I3KA 5BMWA 3V75A 3WK3A 3P62A 3JRKA 3S42A 1LBFA 4MZ1A 4MLJA 3L5MA 4Y96A 4FX6M 2B7PA 1FWRA 3GDRA 3CHVA 3G1AA 2AGKA 3ZWTA 1KTNA 3PBVA 4JYDA 2DZUA 5DCEA 2E5CA 1KFJA 4JR5A 2EPHA 4Y9AA 1KBIA 4YLWA 5HULA 3KFTA 1JCLA 5DXYA 4JX4A 1W3NA 2VEPA 2HSAA 4LUIA 3DKJA 3NG3A 5EA9A 3T4CA 3EKZA 4FNTA 3SSJA 2FPVA 3O15A 4XKYA 3W7RA 1AG1O 1K3UA 3NQEA 3TA6A 5CPOA 1BWLA 2GQ8A 4A2SA 1DVJA 4PA8A 4MY1A 4QSHA 2QAPA 1FCVA 4G1KA 4AMAA 3QMRA 2JKPA 1FXPA 1W0MA 1O5KA 2ZRYA 1X7FA 4RR4A 1LROA 1W3TA 1I4NA 1B3OA 5FF7A 1F74A 2YCEA 2J6XA 3NPXA 1F5ZA 5EPDA 3L0NA 1FWNA 1WQ5A 4ADSA 4O1BA 2YYTA 3HMJG 1OFAA 5DCBA 1OF6A 4NX5A 1JCXA 3NL5A 2Y62A 5D02A 3W72A 3UQNA 3KOFA 3TMQA 1I2NA 4O4WA 1L9WA 4JNMA 3ZR4A 4ZQOA 3A21A 1SZEA 3GXPA 2H3DA 1RVGA 3W75A 1TV8A 4HNNA 3TSMA 1NFBA 5K9DA 1TTPA 2ATMA 1SO3A 4AWSA 1VS1A 5DELA 1LLWA 4CNNA 2C6QA 1TMHA 5EMUA 4IJBA 3KX6A 4Q33A 1H51A 1K02A 5EYWA 4NJJA 3TJLA 5G2IA 5KMYA 3BV4A 5AOUA 2CLHA 3MHGA 2YW3A 2GOUA 2QCMA 2NX1A 1XCFA 3TQKA 3A5VA 3C2VA 5F1VA 4L4LA 1GVRA 1YXCA 4O52A 3DXIA 3P60A 4JS3A 1NEYA 4A3UA 2Q3RA 4KFPA 3P5ZA 2OMAA 4O0ZA 1Q6QA 4NZJA 2B0MA 5EY5A 1XL9A 1LM1A 4JTJA 5HNRA 3C3NA 3IGSA 4LW7A 1ZFJA 3TU9A 1QAPA 1LZOA 1Q6RA 4EF9A 4BWLA 5G4WA 3FA5A 2FFCA 3PBUA 4LOCA 1GYLA 4LU0A 3L67A 3QSRA 5FESA 3S1VA 2NUXA 5F4WA 1TRDA 4Z1CA 1LOQA 1NAL1 1E51A 3KRSA 3TC6A 2CZ5A 1W56A 3GAKA 2E5BA 4XBSA 5IBXA 1R30A 1RQBA 3TQVA 4NJGA 4ADUA 4MZ8A 4IXXA 4GUHA 1I45A 1Z48A 3M6YA 1F73A 3PSWA 3TC7A 1S5VA 2CWNA 3WJSA 3VI2A 2DZSA 2ZTKA 3MI2A 4JEQA 5CKSA 4LT9A 3BG3A 1F6PA 3ELFA 3EXRA 4JYEA 4HKPA 1OFPA 3N19B 2H90A 2A7PA 2Y88A 4GFSA 1KM6A 2DU2A 4HHPA 4UFLA 4B5NA 1NSJA 5C54A 1F76A 3F03K 5I3HA 3CLMA 2JGQA 4KFOA 4DO4A 1G67A 3NL3A 4UTLA 1W5MA 3TSDA 4O1AA 5KZMA 4A21A 3LBCA 3U2OA 3B04A 1TQJA 3ABOA 2Y7GA 4IMCA 3QPZA 4N6EA 3S5ZA 2W0UA 1TPB1 2A0NA 4FX7A 4M7SA 2A4AA 3I68A 1YPIA 3LTYA 4YMZA 1LP6A 4O15A 3W7DA 3CQ0A 4MFEA 5D2VA 1GTEA 2A5HA 2YPIA 4ZQMA 3NA8A 3NXFA 3E49A 4HNTA 1QOPA 4BI6A 1VYSX 5A8GA 5C6MA 3NQMA 1OFRA 3MW7A 3VE9A 3FS2A 1Z42A 2H8ZA 4XBKA 3BG5A 5D2XA 5A5WA 2FB3A 1SO6A 1RD5A 3S5NA 4WY0B 1TREA 1YADA 3CC1A 3W7CA 2ZDRA 5AYZA 4RJEA 1FQ0A 1A5AA 3P67A 3CIWA 2Y89A 3KVJA 1O5XA 5U7SA 2V0TA 1M7OA 4ONVA 4FO4A 4UNLA 1SQ7A 3G1XA 1EP2A 3M41A 3NNTA 3GB6A 4GBUA 2GPTA 2Y63A 3WK2A 2C15A 3WJYA 2QCFA 2FLIA 3EWZA 4UTJA 4O16A 2J27A 3UWWA 4GE8A 2ZZ7A 4O11A 1FBAA 2QEZA 5LNUA 4X9SA 4LVBA 1EP1A 3NPWA 1FDJA 2JGYA 1TB3A 3LHZA 3G1FA 1FUYA 5AN7A 3P5YA 3A23A 1VYRA 4FHAA 1G4EA 3NM3A 1VGAA 2PCQA 3IGUA 1WX0A 1S5WA 2VFHA 4QNEA 3LCIA 3B0PA 5DBTA 3CPRA 3EKLA 3ZS4A 4YWIA 1LOLA 1VPXA 1K8YA 1LCOA 1OFBA 3TX9A 1LOSA 2A85A 3NM1A 3NPUA 3P7YA 1LRTA 2WPBA 3MJYA 1R2RA 5AC7A 2Y6ZA 4OV4A 3S1XA 2A2IA 3NQDA 3CWOX 3NQ8A 3DHFA 3USBA 3C8FA 4NXSA 3C52A 1JJKA 5D2TA 2JBMA 4GUJA 4ADTA 3W70A 3HG2A 5HMSA 2A7NA 5D09A 1JRBA 1TPDA 2P0OA 3MP4A 3TFCA 3H55A 3NQFA 4IGHA 2OZ0A 3M47A 3GYEA 1I8JA 4AHPA 3GXNA 3BGJA 4DPPA 4CQ8A 1OFEA 2DZWA 1VQTA 1KLYA 2ZZ5A 4P2VA 3UWZA 2WNQA 4AWTA 2QDGA 4DQWA 1AL8A 4RZ6A 3L9CA 5DCDA 3G24A 1U83A 1WOAA 3TROA 3RFAA 3W74A 2Q3OA 1TPEA 4QIUA 1KM4A 2C3ZA 3G18A 3SW6A 3UD6A 4S1FA 3SECA 1QNVA 3L5LA 1SZNA 3TV8A 1ADOA 3GNNA 1FWSA 5C55A 1VCVA 3LTPA 3W7HA 4UTTC 1SR9A 3O6DA 3O1NA 2PC4A 4DPQA 2ZCGA 2ZZ1A 1JVNA 4XTDA 4EIVA 1KFCA 3QF0A 1P1XA 3LV6A 3NQ2A 1K7FA 4JTKA 1W8SA 1IIGA 5HQEA 8TIMA 3AJXA 3W7PA 3ZWSA 3RLVA 3HG3A 4HSNA 3G8RA 1ONRA 2A6NA 1OHLA 3LM7A 3S1WA 3P82A 2YX0A 1LLZA 5H91A 4NJIA 4AEOA 3MO7A 4MY9A 2QDHA 1T99A 3IV3A 3C2OA 3NQAA 1FCBA 1GWJA 3W87A 4O14A 2Y7EA 5L9FA 1XBYA 3GXTA 4OE7A 2CLOA 2J9ZA 4YCPA 2QUTA 2NXHA 3QFEA 2ATSA 4MIMA 3A9IA 1G7VA 2WSQA 4LV9A 3V1PA 3UY7A 3STGA 4U4MA 4UC5A 3PULA 2DZTA 1OJXA 4UIOA 1GEQA 1OX6A 4PC8A 1YDVA 4FNPA 4QQ3A 5SWUA 2ZZ3A 3OG3A 3PG9A 3NVTA 2Z2UA 4O1CA 4RK8A 4JD4A 1VHNA 2ZZ6A 2J9XA 4KFNA 3EWYA 3VFLA 1FXQA 3L5AA 1BTMA 1QDSA 2JKAA 4JDBA 1XM3A 3INPA 3PG8A 3EEGA 1VYPX 2C0AA 3E12A 3O8AA 4JIPA 4LS2A 4RKAA 3LXAA 5G2WA 3EWWA 1N55A 3GKAA 4O57A 1AW5A 5U4NA 2QR6A 4OWGA 4IXHA 3G1DA 1VHCA 1H7NA 4IUOA 1TTIA 3O63A 3E02A 4E2DA 1RQHA 3LHTA 1G69A 2R91A 4Z1AA 4MFDA 3OHIA 2H8XA 3W7GA 4LTSA 4UFHA 4OBTA 5I3IA 1TPFA 1OFOA 2DZVA 1ZNNA 5K9CA 2QCDA 2NUYA 4K38A 5G2HA 1ML1A 4WD0A 1DOSA 3DKLA 4Y6GA 3G3DA 3Q58A 3W2UA 4AVFA 2QCGA 3TCEA 4BK9A 4C1KA 3EXSA 3I6RA 3LI1A 4GXMA 3HJZA 1KM1A 4MJZA 1HO4A 4ZVJA 5DLCA 5AHMA 5TIMA 1T0OA 3QYQA 1HL2A 1LRQA 2ABAA 1QOQA 2VOMA 1DJQA 1G4PA 1EEPA 1MXSA 1RV8A 4R7JA 4YCOA 1JUBA 5CZSA 3LHWA 1OFDA 3UWUA 4Q4KA 1MO0A 5TBOA 2AQWA 1WV2A 4LUJA 4NT0A 1LYXA 4M7TA 3B4UA 2Y7FA 4ZQNA 1FCQA 2X1UA 3U6WA 4O50A 2E6YA 3JR2A 4RX0A 5IBXC 3AO0A 1W54A 1JR1A 1VCFA 3NQCA 4M19A 1YLVA 1MEHA 2FPYA 3EX6A 4JICA 3B0UX 3LBMA 4JTTA 3ATYA 3N73A 1GTHA 4CCCA 4UTTA 3HOJA 1CX9A 1GVQA 1PCWA 4K8HA 1UASA 1MSSA 3IRDA 1XFBA 3GLCA 3TXZA 5BOOA 3U8GA 1WA3A 2G96A 3UWVA 2C14A 5E0KA 2ZA1A 4Z08A 5CPLA 3DENA 4N9BA 1HUVA 3FLUA 1YXYA 4UFMA 1BKSA 3MUXA 4UXDA 3QMSA 4FB7A 4UMCA 5C5YA 2DZPA 1BWKA 1GVFA 4IX0A 3PAJA 4ZQPA 3I65A 3LDVA 1H1YA 1XI3A 3GKFA 4DELA 3GDKA 1DQXA 1W5NA 1WBHA 4WY0F 1OABA 2NV2A 3NZ1A 3W76A 3MYOA 4ZMGA 4H3DA 4UR8A 3UPBA 3DGRA 1PV8A 2CLKA 2PURA 2RDUA 2DJLA 3GDMA 5K7JA 3GNDA 3CEPA 4LWWA 3SGUA 4K6AA 3HPXA 1PCKA 1W3IA 1U5JA 1XUZA 1HO1A 1TPWA 3W3OA 4FXRA 4MYXA 3NAVA 1ICPA 1JRCA 1FWTA 2E6AA 3DFNA 1LORA 3KRUA 2EHHA 3W2MA 5DXXA 3M5ZA 4YL2A 5LGZA 3N34A 1SSGA 2NXGA 3IEBA 4Y8FA 4PCFA 4NU7A 3BW2A 1DKWA 3BW4A 1UB3A 5D38A 1ZAIA 4CCDA 3GR8A 1W1ZA 4N6FA 1WAUA 2QJGA 4M6VA 4RZ5A 1XKYA 4MZYA 3MBFA 1HFBA 3M7WA 4JTGA 5E1QA 1CI1A 1O4UA 2YFOA 1EB3A 1SFLA 3KRZA 2OJPA 3O6YX 5BRBA 2CW6A 2QJHA 4R33A 1QO2A 1WXJA 1A5SA 4DBEA 3KAOA 5KZDA 4UUIA 3G0XA 3GVGA 4UTWA 3TNOA 2Z6JA 2VENA 2OCZA 1TTQA 4K39A 4CCEA 4GWEA 1KV8A 1FCUA 1OK6A 2TYSA 1S5TA 3R8RA 2ZZ2A 2V8ZA 4LRTA 3G1SA 3LHVA 3W1XA 1O95A 4EWND 1H61A 3F1QA 3QEZA 2X1SA 5FF4A 5F4SA 1D3HA 3PB0A 3TSBA 1I2OA 4X3ZA 2V9DA 1W31A 3IVTA 3YPIA 7TIMA 1P0NA 2P1FA 2WSRA 5J5DA 2YR1A 4OU1A 3EWUA 3NQGA 3ABQA 3UWYA 3UY8A 4NVTA 4W9TA 4S2BA 1A50A 2ZA3A 3LLDA 4IMDA 1EWEA 1RPXA 3W7MA 4O53A 4PTNA 4NNBA 1H50A 3QMTA 4K37A 1P0KA 1TO3A 2VEIA 1GZGA 4MJMA 5F1UA 1VZWA 4CLMA 1L6YA 4IWWA 3PR2A 3DH7A 1G6CA 2NZLA 4ZQRA 5BW6A 1X8FA 1QPNA 2G5WA 2CLMA 4AB4A 2VFGA 3G8EA 3QQ1A 4FNUA 1DORA 2J24A 1DQWA 4LV4A 4IOTA 2CZFA 4C1LA 4OT7A 5CGQA 5FI8A 6ALDA 5F2MA 3VE7A 3HGOA 4N9CA 4WOQA 1OYBA 2ZA2A 3CU2A 3P8JA 2QCLA 2CLEA 4HNUA 4TIMA 2TSYA 4MUZA 2YW4A 3EX4A 2VEMA 1WYIA 2OT0A 3W1RA 1JUEA 1QPQA 1TPC1 2ZRXA 4LS1A 1VRDA 5H2ZA 3M5XA 2GVLA 4PL2A 4GJ1A 1EUAA 3CTLA 3O16A 2Z6IA 1IIHA 1K8XA 2ZRZA 1IXQA 1D3GA 3PSVA 2GJLA 1GG0A 1DHPA 2X30A 3DAQA 3IIZA 3IVSA 1JCYA 4IPIA 3H54A 3LX9A 4DEFA 3QW4B 5LNRA 3C2RA 2ISWA 3NYZA 4FNQA 4JY9A 5K4XA 3S0CA 4MPQA 1GT8A 1EPXA 1IXNA 1J4EA 4ORIA 3O05A 4BI5A 4HPJA 1H60A 3B8DA 1XDMA 4UTUA 3UXAA 3SI9A 3DFOA 1N8FA 1EWDA 4RLIA 3WK1A 1IXPA 5LZLA 1XXXA 2ISVA 1QPRA 1XUUA 2NLIA 2ZYFA 5EL1A 1HTIA 3W84A 1NF7A 2E68A 4JY8A 3VCRA 1ICSA 5IM51 1JCNA 4XWUA 4RCXA 3IIXA 1V7YA 1LTDA 1H7WA 3MP3A 3SY5A 1PHWA 4UFIA 2F84A 5D2YA 3RLUA 1JQVA 1H63A 3NL2A 3BLIA 1KLZA 3W2LA 3NOEA 2TRSA 3EX3A 4WJEA 5FF3A 2V81A 1YDNA 1KTCA 1VR6A 3FYPA 5F2IA 1AW2A 2QJIA 5HWNA 2E1DA 5G5IA 4LNYA 5AHNA 1SW0A 3LTSA 1LBLA 2PRMA 3W1NA 4CNOA 4E0CA 3Q2DA 2B7OA 2FDSA 5GVJA 4FNSA 1H62A 2ZQ0A 1T96A 5K4ZA 3N9SA 3SJ3A 3UPWA 1DBTA 5FEXA 3N3MA 2W6RA 1EA0A 3W07A 4HSOA 2W79A 2TPSA 4KWWA 4WUIA 5FF0A 4Z1DA 2CLLA 1FDZA 3W2NA 5HWMA 5AC8A 2VFEA 1ZHAA 3IIVA 1ME7A 2CZDA 2XN2A 4AWUA 2OT1A 2RDWA 5D03A 3MMTA 3IVUA 2I9EA 4WY0A 3W22A 5LNVA 4O8RA 2VELA 4AF0B 5D04C 2ZBTA 5D2WA 4AHOA 4CQAA 2R8WA 4UNKA 1SO4A 2HS8A 4O0KA 3W7QA 5HUOA 1R47A 3WJXA 3M9YA 3C4UA 3FJ6A 1NF0A 3UZJA 3LCXA 3R2GA 2GVGA 1L6WA 4BR1A 3P81A 2PE4A 1KW1A 5LGXA 1ME8A 1DJNA 4XTIA 4EOUA 4XZ9A 1W5QA 3NQVA 2F7FA 5D05A 1TV5A 3NL6A 3QW3A 4E38A 2P10A 4ICNA 1X1OA 4J9JA 3LCLA 2ZZ4A 3C6CA 3P8IA 5LNWA 2C13A 2EKCA 2QF7A 1OX4B 3FYOA 1HG3A 2I14A 5MHBA 4X22A 1WBJA 4DF2A 2IQTA 2WOQA 1UBSA 2RKXA 3PVFA 4RZ4A 2Z1BA 3G22A 1Q45A 2E5DA 2QUUA 3R89A 2C1HA 4MVAA 2Y85A 4CQ9A 4IMFA 4NJKA 2DORA 3FEMA 1H1ZA 4JDYA 3L21A 5FEPA 4XUGA 3NO5A 1MZHA 3S8HA 4UTMA 4N4PA 1VJIA 2NUWA 2YSWA 2X2GA 1AMKA 4UCGA 1S3HA 3BVJA 2J88A 4O1DA 2E77A 3DFTA 2CLFA 1KM5A 4JTFA 5LSMA 2UV8G 4NNCA 5E93A 4LC8A 2TMDA 3CB8A 3W88A 1CW2A 2YGYA 3LXCA 1PVNA 1KM2A 1L6SA 3ANYA 1OK4A 2XN0A 1TCDA 3NDOA 4O17A 2Z0IA 1WDWA 1F05A 3C56A 2FQIA 3NQ6A 3L0KA 4TMBA 3P74A 3ZFHA 3EX2A 5AFDA 3W6YA 3CT7A 4JIQA 4M6QA 3TJXA 1KM0A 3WK0A 2RH9A 3HPZA 4FXSA 5LKYA 1FDYA 2J9YA 2FJKA 1YYAA 1UJPA 3KHJA 4XKYB 2BLEA 3QQ0A 3C0JA 4HN4A 2VFIA 3L65A 3TFXA 2DZXA 2EGZA 4UTWC 3LB0A 1B9BA 1KA9F 1XC4A 3GIYA 2WSYA 4OV9A 1KM3A 1AL7A 3ATZA 4UR7A 3M16A 3TR2A 2V30A 4DO5A 1G7UA 1QWGA 2DP3A 2YXGA 1J2WA 2XFWA 5AHFA 3F4NA 3W73A 4BFAA 4IMEA 3C2FA 3MYPA 3W71A 3PUDA 1EUNA 3W23A 4A29A 3ABSA 3G0SA 3S5OA 3BGGA 3LOTA 4BF9A 5D32A 2ZRWA 2GQAA 2G95A 3SZ8A 2C16A 3PY2A 3A22A 1MEWA 4WZHA 2VFDA 5CG7A 3BARA 5ABTA 1GVSA 3B0VC 4N02A 2CLIA 3MI3A 1GJPA 1SW7A 4QJ1A 3LRKA 2QCEA 3OBKA 1X1ZA 2JK2A 4LRSA 2B7QA 3LRLA 3R13A 2PRHA 1YTEA 5AYXA 1ME9A 1P4CA 3W1UA 1KFKA 3BPWA 3E0IA 3W1TA 1XBXA 5CPMA 4OHQA 5KINA 1GYNA 1H5YA 3FFSA 4M6PA 3TAOA 2E6DA 1SZFA 3W1PA 3KVKA 1B4KA 3RK8A 2E6FA 3FJLA 3OIXA 1ZENA 2A21A 3I7SA 5K2ZA 5I3FA 2C18A 4JX5A 3S1UA 3OA3A 1LDCA 5F2LA 4LVDA 3GR7A 3M0ZA 6TIMA 2X1RA 1ALDA 3E96A 4LC6A 1PS9A 4GNJA 3W86A 1ICQA 3EB2A 4PODA 2QUVA 4FX8A 1G4SA 4EVZA 4ML9A 3S5YA 4POCA 2D73A 3GZ3A 2NX9A 4NXKA 2FTPA 1TQXA 3NPVA 1RZMA 1QR7A 4Z1BA 3W1MA 1VLWA 5CPNA 5HR7A 4AHQA 4WQ6A 2WO5A 2ZRUA 4I7UA 3HG4A 3PBYA 1TTJA 1R2SA 1KFLA 4KKXA 3CM4A 4LVAA 3B06A 3W7LA 2I1OA 2BX7A 4PL1A 1SPQA 3W7KA 4NJHA 1OX5A 3W1QA 4O18A 4TMCA 3NR0A 1W37A 3LRMA 1SZGA 1PE1A 1RQEA 5T26A 4DO6A 1ZALA 3DI0A 2WNZA 1K7EA 1GPWA 5AHEA 1OG0A 2R14A 2DJXA 2OX1A 4GRSA 2R94A 4MLRA 2A6LA 3HQ1A 3TDFA 5AC6A 1EIXA 5G4EA 4QAIA 3IIOA 1ZCOA 4RXFA 1KBJA 3LCFA 1XBZA 2X16A 3MI6A 3NEVA 1R2TA 4NX0A 5FEWA 5EKYA 2V5LA 1ZAJA 3RMJA 3P80A 2O7QA 2WV8A 1C9DA 4DF1A 1JUKA 2AAMA 3GX9A 2GUUA 4A2RA 3OVPA 3PC0A 3QRHA 3LERA 1C8VA 1JQXA 1YPFA 3WFAA 4UTKA 5CSRA 3HO8A 3WJZA 4MY8A 1SU5A 1KV5A 3DFPA 4NZFA 3GK0A 1JULA 5D30A 1IF2A 5BMXA 4N4QA 4GC4A 3PWAA 4UMAA 1TPVA 3C61A 2Q8LA 4UTHA 1F7BA 1M5WA 1KTBA 3A5FA 4E2BA 3TAKA 2NWRA 2WJZA
chains in the Genus database with same CATH superfamily
3OVQA 3VFCA 1LRNA 1EX5A 4JTDA 4L9XA 5DRCA 3CT2A 1G4TA 1JCMP 3TW6A 3LGGA 2B4GA 3VZZA 3TE9A 5D9NA 3T44A 3L68A 2WQPA 4AZBA 1FWHC 1XYCA 2QJNA 1XLKA 1EYWA 4W7UA 3UERA 3V3WA 5KEZA 5I06A 3NSNA 1NDYA 2VURA 3QH2A 3EWXA 2HK1A 4I9MA 4O19A 3V5OA 4HNVA 5FJUA 4H6EA 3U5YA 3L4VA 3R8GA 1IE7C 2Y61A 5CZ0A 4IPLA 4KIRA 4HPNA 3L2IA 4Z0JA 4DBDA 2CZEA 4GZIA 4W85A 3CASA 3KOYA 4YNGA 3HBLA 4CNPA 4ICMA 1SFJA 2XWDA 4FALA 2WKGA 1BF2A 4ZOBA 4JFSA 3VIOA 2ZFAA 3EX1A 1OGGA 1FP9A 5BNKA 2VRQA 1K70A 3NSXA 2OSXA 4JYFA 5A6AA 3ZVHA 4EAYA 4NRRA 3W7EA 4A05A 1UR0A 4N9EA 1VB9A 1KFBA 1YXDA 3RX2A 3W9ZA 4D72A 2FVLA 3LPFA 1WXZA 1TPUA 3THAA 1QNOA 2OR2A 2D3NA 3HGRA 4K36A 5BU9A 3N2MA 4ZSTA 2EF9A 1CIUA 3LI0A 4IUGA 4D8ZA 1Z44A 3W7JA 4HZ8A 4BI7A 5CSSA 1WZKA 4NNAA 3AISA 4Z2GA 3L2MA 2ZE3A 5FJPA 3OW1A 3WLMA 3DI1A 1FH9A 2J66A 4O12A 3TK7A 1JD9A 3BCFA 3VIFA 3THQA 4R7OA 1AUSL 3UP8A 3N9RA 3MP5A 2XDFA 4YVXA 2VQTA 1TYGA 1GUVA 1OYCA 3NGJA 4W88A 3AXKA 3HB9A 4I9AA 2JEQA 4LAMA 3C0QA 4ZTYA 4AXKA 3S2MA 1FWWA 5CPSA 3KW3A 4Q8QA 3W7IA 2WLYA 1GQNA 2F61A 4ZL1A 4N9DA 1E1CA 3M46A 2ISFA 3E2RA 1H7XA 2OPJA 2HXUA 2ZTJA 2EG8A 3ZSSA 3WENA 2E40A 2BS9A 3TTSA 4K8EA 2QCNA 3DU0A 2O7SA 5J8LA 4DN1A 1XLHA 1O68A 3WDQA 2WVVA 3IJIA 4ZO9A 4QQUA 3TIMA 5EBUA 4H4IA 3SUSA 4AAJA 4QITA 3SR7A 3EWBX 4IX2A 3BG9A 4L5ZA 4OUIA 2NSOA 5EMYA 3G1YA 4RNIA 4WKFA 3EOUA 3ANVA 4GUFA 1TJPA 1QPKA 1I2RA 2QCDB 3W83A 1RR2A 2VR5A 3BAYA 4WXZA 3G3MA 3PJTA 3DOPA 2PDHA 3TTQA 1QMLA 4GH1A 3OVRA 3GFYA 3HGSA 3W2KA 4B9ZA 4FA3A 1AJZA 4GYFA 2ADAA 4IZGA 3PUGA 3RCYA 1XV8A 4YTSA 4S3BA 2F9RA 3WLRA 4I5XA 2JKEA 4LUTA 3AS1A 4EANA 3N14A 4F8XA 4LPCA 1PIIA 1HKIA 1OSEA 3RO8A 5H8UA 1DJWA 4HOXA 1DP0A 3GAYA 1EA9C 1UZ1A 3FKRA 3QZEA 1O6IA 1CLXA 2J4GA 3TN5A 4JNZA 4R27A 1LBMA 2Q8ZA 4C7GA 3TUUA 3OPSA 4FZIA 1PL9A 1XRVA 1KR0A 3CMJA 4JGDA 3UU0A 1TRIA 1KR1A 3EMCA 4EPKA 3KOZA 5CLTA 3T0CA 3UZ5A 3NSMA 4R34A 4F0RA 2IKGA 1OD0A 4HPXA 1VEMA 5F4XA 4X2RA 1T8XA 3C3UA 2O55A 4P7NA 4UNIA 1GVOA 3DFQA 1S2CA 1YTKA 4CU6A 1OX4A 4B5WA 2GUYA 4FEZA 2NLYA 5F2GA 5EFFA 4ZZ9A 1JNDA 1NVMA 2BGSA 1H7RA 3DHDA 3GDTA 3HIJA 4C6LA 2P8BA 1C29A 3K30A 2KZHA 3RPMA 1SM9A 5K3VA 4I7VA 2IMRA 3TW7A 4Z0SA 3G1HA 1V6XA 3WLQA 1XW8A 1KCXA 1D9EA 1IT0A 4JTSA 1XLGA 4B92A 1LUCA 2YZRA 1TJRA 4PMVA 1F6KA 4IFKA 1CB7B 5KITA 2NWSA 1DJYA 3HPSA 3M5YA 3TKFA 3A3HA 4MNMA 3W85A 2XN1A 2ZX9A 3SURA 3WNLA 1CDGA 3RRXA 2XM1A 4LS0A 4R53A 4P61A 4DUWA 3E5PA 3P3BA 5I3KA 4DBSA 3B9AA 4KF1A 1SMDA 4AC7C 3SCQA 3QLDA 4XZMX 3DC0A 4Y96A 5A1AA 1RBOB 2E7FA 1MFUA 4YVVA 4H00A 3BJSA 3G1AA 3ZWTA 4CD5A 3TC3A 2ZADA 1KFJA 4AZ6A 3KFTA 3N29A 1Q66A 4NSBA 2BVDA 2HSAA 1XLMA 3WF3A 1X8CA 1HKJA 4FNTA 5EA9A 3SSJA 4BCEA 2KX9A 3O15A 2F6XA 1AG1O 3HPAA 4HYRA 4KCTA 5CPOA 4E4FA 1BWLA 4GQBA 4X0NA 3CS2A 2HNEA 2QAPA 3QV9A 4AMAA 3MT1A 2JKPA 2RJGA 2G3FA 3C8NA 1X7FA 2WWDA 3LNPA 4GYPA 1F5ZA 5EPDA 4ADSA 4KCUA 4XVDA 2BY1A 2YYTA 2XFYA 1V6UA 2PLCA 4JHOA 3MVTA 2BGQA 3NL5A 1VBUA 5D02A 3CL7A 3RG6A 4O4WA 1TV3A 1X96A 3F4DA 3GXPA 1RVGA 2E25A 3D3AA 1TV8A 1NFBA 2V68A 1E0VA 2PZ0A 1UWRA 5K9DA 1BSIA 3SFWA 4JKLA 4L6DA 5FJRA 5EMUA 1TUFA 5JUVA 3KX6A 4Q4QA 1ISWA 2VZSA 1WPCA 4NJJA 3CQIA 4XV0A 5AOUA 3AIWA 4RW3A 3IS4A 1QTWA 1B5TA 3DXIA 3P60A 4XIAA 3BICA 2Q3RA 4GZEA 3OLIA 5LIUX 1KBBA 1Q6QA 2B0MA 1RCOB 5EY5A 1YDYA 5HNRA 3C3NA 3TU9A 1ZFJA 4U3AA 1V3KA 4EF9A 3B8UA 3PBUA 4LOCA 1AODA 5C2CA 4UQCA 1F4AA 3UZWA 2R6OA 3T08A 1UZ4A 4FLOA 3VKAA 4L9YA 5I79A 5HPCA 3W81A 1E51A 3KRSA 1ZTVA 3IGHX 4XBSA 3F4VA 4MZ8A 3U5UA 4DAFA 1I45A 1Z48A 1F73A 3PSWA 5EBAA 3TC7A 5HAOA 5C71A 5EGRA 3WJSA 1A4LA 3VI2A 2YIHA 1DIKA 1H2JA 2C0HA 3BQ5A 1OT2A 4JEQA 1JCTA 3JUGA 5DMMA 4QDWA 3ELFA 5JXQA 4V1YA 4H7VA 2B31A 7REQB 2WSPA 5BRQA 1IWAA 2A7PA 1KM6A 2DU2A 1F76A 2OG9A 4E3VA 5I3HA 3WFZA 4DO4A 5FL0A 1FKWA 4AX6A 3TSDA 4O1AA 4AD1A 3U2OA 5ABHA 1P43A 1TQJA 4IMCA 3QPZA 3S5ZA 1TPB1 1I6NA 2IPGA 1VF8A 4FXFA 2CEQA 5CG0A 3CZJA 4W87A 3DDMA 1GQJA 4PUUA 4A6GA 3CQ0A 4MFEA 4DI8A 2YLLA 1GTEA 5D2VA 3VIGA 1VIZA 3LQGA 4QTGA 5DT5A 1V6WA 2OB3A 3W38A 5C6MA 1X97A 3VE9A 1J79A 2PWFA 3BG5A 2GK1B 2RDXA 3CC1A 1VEPA 3XISA 1DIOA 1A5AA 2QS8A 3KL5A 3CIWA 4MB1A 2V0TA 2C8NA 1SQ7A 3GB6A 5C9XA 2Y63A 2FHCA 4GJIA 3RCMA 2QCFA 2FLIA 4JCMA 4UTJA 1RSCA 3GW3A 2ZZ7A 4O11A 2QEZA 5LNUA 3UF9A 4BQ2A 4H8HA 2JGYA 1FWIC 4MWAA 3P5YA 1VYRA 3GR4A 4FHAA 2X40A 2VC7A 1BKHA 2PCQA 1WX0A 4EACA 3ZO9A 4CU7A 2VFHA 2O56A 4QNEA 3B0PA 3OLGA 4DY1A 2OOFA 3WLIA 1L0PA 4H9ZA 3CZKA 1R87A 1OFBA 1LCOA 4XSLA 3FW6A 3TX9A 3B3DA 4KT2A 2A85A 1WKFA 3P7YA 1LRTA 3WYZA 2GGGA 1R2RA 4FI4A 1HN1A 2QVHA 3S1XA 2QIWA 2PDYA 3NQ8A 3G5EA 4ECLA 5CSUA 2IXVA 3UR7A 2PDUA 1TJ2A 4GZJA 5HMSA 1ZSXA 1JRBA 2P0OA 1K4HA 4OJYA 3U4FA 1RP8A 3GTIA 1I8JA 1BQGA 3GXNA 4HN8A 4CQ8A 4KEMA 1OFEA 3OQEA 3WNKA 4B4FA 4C6JA 1LT7A 1VQTA 1A3WA 4P2VA 4AWTA 1KKRA 4HMDA 4DQWA 1Q6FA 5IFPA 3G24A 3SCOA 3AFBA 2BODX 2HXTA 3MPGA 1HIZA 5DANA 4ZBCA 3G18A 3AYRA 4LAZA 3SECA 4YTTA 1QNVA 3TV8A 4CN1A 3B8SA 4B91A 3GNNA 1B3ZA 3EDEA 3AU6A 5C55A 3DBNA 3W7HA 4UTTC 3AALA 4JQ4A 1UIPA 4DNMA 2Z7GA 2ZZ1A 2JEPA 1XLAA 3TONA 1P1XA 2G37A 3E38A 1IIGA 5HQEA 8TIMA 4MWAD 3ZWSA 1NOUA 2A6NA 3CWHA 3S1WA 3UCQA 1EC8A 3M64A 3QHMA 1HKWA 4YS1A 3C2OA 3NQAA 1JAKA 1UPPA 1FCBA 2J13A 6XIAA 1KWGA 1MW2A 1JZ6A 1C8XA 2VOTA 4MJ4A 1UQZA 2QUTA 4MIMA 3A9IA 1XPYA 3CO8A 2EG7A 4GKTA 4J3XA 3PULA 1OJXA 4ACZB 4E8DA 1OX6A 1C7TA 4S3EA 4J1OA 1JD7A 2CNCA 4JD4A 1VHNA 4D6EA 1D8WA 2L5HA 1XM3A 3CMFA 2OVLA 3PZGA 5IHRA 1JGMA 1UR2A 2VTFA 3GZAA 1VYPX 2PDNA 3E12A 3O8AA 1OEPA 3ITGA 3M0MA 4HB7A 4WK9A 4O57A 1R6WA 4U2ZA 2O92A 4U3CA 3SQLA 1XP3A 3F5KA 4HMEA 4Q8NA 1TTIA 3E02A 4E2DA 3LHTA 3TYBA 4MFDA 3OHIA 1NU5A 1JXJA 3OQ8A 5I3IA 3ECQA 2DZVA 1FVPA 1CENA 1U2YA 3G3DA 3Q58A 4HGXA 3WQ6A 4AVFA 3TCEA 1PKYA 4BK9A 4C1KA 4F2UA 1XIJA 2YL8A 1SGJA 4Q8PA 3S46A 4FSAA 8XIMA 4MJZA 3UJRA 1HO4A 4ZVJA 1T0OA 5CEWA 4QG8A 1H1NA 3QYQA 3WLHA 5HMDA 4QE5A 1LRQA 2VOMA 1QOQA 4F79A 1DJQA 5C9UA 1G4PA 2YCJA 1MW1A 2OGJA 3VOFA 4YCOA 4MNKA 1JUBA 3AIRA 3GUGA 1MO0A 2F38A 2OOGA 1RJQA 4S3GA 4LUJA 3WLTA 1LL6A 4QGCA 4QXIA 2X1UA 1VFUA 3HA1A 4RPPA 5IBXC 3AO0A 1GKQA 1R3QA 4XK2A 2DH3A 1QBBA 3LMZA 5C70A 3SCVA 1GTHA 3KBWA 3LN3A 1OGSA 1EBHA 1CX9A 3SADA 2OZ3A 1ENUA 3IRDA 5BOOA 3TXZA 3LA4A 3U8GA 1WA3A 2CHRA 1E56A 2C14A 3CHCA 4Z08A 5JMUA 4C7FA 4ZXLA 3DENA 5ECUA 5EB8A 3VIJA 4UFMA 4UXDA 4FB7A 1DJZA 1G01A 2QQ6A 2YDSA 1S2UA 3V0SA 1BWKA 4IX0A 3PAJA 1C91A 3I65A 3WMLA 1H1YA 4M82A 1XI3A 3GDKA 3U2EA 3GNRA 4PRWA 3VOCA 3PZUA 1O1ZA 3NZ1A 3W76A 3KBJA 3MYOA 4ZMGA 4UR8A 4C1NA 3DGRA 4DYJA 1PV8A 3MY9A 4C6OA 1UIOA 1ZGDA 3AIVA 3CEPA 5K7JA 1RK5A 1XSJA 4LWWA 3SGUA 5A2AA 1XUZA 2YXOA 5ECVA 4FXRA 1NIUA 1ICPA 2EHHA 3W2MA 5DXXA 2ACSA 4YL2A 3OG2A 2VT0A 1E0WA 2EQDA 4YWSA 2VP8A 3T42A 4Y8FA 3DFYA 1V08A 3BW2A 4IIGA 2XH7A 2DV0A 2XHYA 3GR8A 1DQUA 1BAGA 4RZ5A 5BCAA 2VZTA 3TLLA 1YX1A 3KS6A 3MBFA 2E3ZA 1TUXA 1QBAA 1CI1A 3CTTA 4JFUA 3K13A 1BQCA 2YFOA 1F61A 2R1NA 4LYRA 1S2TA 2VEGA 3IUHA 3WQWA 3AMLA 1WXJA 2BB0A 5FKYA 2OYLA 4B3KA 4F0KA 2WHLA 2XIBA 4UUIA 1ZP4A 4KGLA 3TNOA 1SJDA 1QT1A 3URAA 1B3XA 1FCUA 2VX7A 1OK6A 4C90A 1B31A 2BASA 1EO7A 2ZZ2A 2NVDA 3SAZA 1QU4A 4LRTA 1JNEA 3G1SA 1XLFA 1XCXA 3RPTA 1PTAA 3A4WA 4I8DA 3UG3A 3PB0A 3GG7A 1L6FA 1W31A 2WVTA 2P1FA 1GVYA 2HE8A 2YR1A 3BSGA 1CXIA 1F3XA 2IW0A 4TVDA 3GDBA 3TZFA 3LEPA 2ZA3A 1E6ZA 1KC7A 1XIBA 1GOMA 3PTDA 4JL1A 3THDA 1H50A 1BF6A 3ZVHB 1P0KA 1TO3A 4GABA 1VZWA 3AHTA 1DIEA 1Q13A 1X8FA 1UW9A 3GG8A 4P8UA 1Q4NX 3VXGA 3KZSA 4S3AA 4AB4A 2VFGA 2VGIA 3QQ1A 2J24A 4KEZA 4HU4A 1N2VA 5DEZA 3UZZA 4C1LA 4OT7A 1HVXA 1QK0A 3HGOA 4WOQA 4OFCA 3H4GA 4Q8WA 1UUQA 2Q71A 4PUEA 4HNUA 3GG1A 2WMKA 3UVIA 2YW4A 3W37A 1NY1A 1WYIA 3NZGA 2NSXA 3KLLA 1JUEA 1NDWA 1TPC1 3M5XA 4PL2A 1EUAA 3WDIA 2VGGA 3TYZA 3HV8A 3F7JA 4JCLA 3LX9A 3WQDA 3C2RA 5K4XA 3S0CA 1E1CB 1EPXA 2JF6A 4BI5A 1H60A 2XTKA 4UTUA 3VKBA 3VC5A 1A5KC 1EWDA 3MV01 3WK1A 3BDKA 4HZ6A 2PCEA 5A8MA 2FGBA 2CZVA 1XXXA 3MMUA 1NF7A 3VCRA 4QE1A 5IM51 3VC6A 4W7VA 3GNPA 1LTDA 2WVVB 3MP3A 3SY5A 1J10A 4G56A 1V4YA 4UFIA 5D2YA 1K9DA 3RLUA 4DLMA 4F48A 3NL2A 1FH8A 1MMFA 1M53A 3NOEA 5HJYA 1C9WA 2I5QA 2YL6A 1W1A1 3FYPA 3CQKA 4XAZA 1W9DM 2V63A 3OGSA 1I75A 5AHNA 1SW0A 5HOSA 4CNOA 3H21A 1W17A 3OZPA 2B7OA 5GVJA 4FNSA 1XLBA 3LM3A 3TTOA 3CUGA 3UPWA 1EGZA 2V3DA 1SJCA 1DBTA 5FEXA 1UHVA 2W6RA 4K8GA 2WVSA 4GXWA 4LUTB 2VWTA 1YHTA 3OVGA 5FF0A 2VR2A 2OZTA 2PGWA 3EPMA 3KBSA 4NG3A 4IICA 1ME7A 4AWUA 3MMTA 3IVUA 4WY0A 3B4YA 1QNSA 3K2GA 2VMFA 1T7LA 5D2WA 2SFPA 4AISA 2R8WA 1J01A 2DQXA 1SO4A 4W8BA 1AFSA 3RDKA 4WKAA 4O0KA 3VD4A 1B9ZA 1TWIA 1T5AA 3EPOA 1ECEA 3WJXA 3M9YA 3C4UA 2OEJA 1TV2A 3R2GA 4BR1A 2PE4A 1HJQA 1DJNA 1PDYA 4IF2A 1Y8BA 2HBXA 3QW3A 1GVIA 2W92A 1X1OA 4J9JA 3C6CA 3CIVA 3ICJA 1M68A 1GCYA 2C13A 2D2HA 2EKCA 1CZ1A 4IG2B 2OO0A 3FYOA 1OX4B 3WDJA 4X22A 1WBJA 2OQHA 3WH9A 4D6JA 1DIDA 3RO6A 2X7WA 2P3ZA 5FIPA 4PMNA 3UZYA 3DYOA 3UCDA 5AZ0A 2XSBA 2QPSA 2QUUA 3R89A 1DWHM 2C1HA 3RRAA 3S2LA 4CQ9A 5FOOA 3G6LA 3FEMA 5FD0A 1H1ZA 4JDYA 2J7FA 1V51A 2P8CA 1JF5A 1LUCB 4K2SA 1AH0A 3BXWA 2ZC8A 2J88A 1EH9A 4O1DA 3MO4A 2X09A 4QDMA 3TN4A 2DZBA 5E93A 1XIIA 4Y7EA 1DPMA 4QAWA 2QMJA 2PDKA 4AG0A 4B90A 3G2GA 1L6SA 2W9MA 1OK4A 4DWDA 3NDOA 1TX0A 1W8GA 3H7VA 3QGKC 1WDWA 3C56A 4LGXA 4QBXA 4GA8A 1ZUAX 4J7RA 4JFTA 1GONA 3W6YA 2IQDA 2VI0A 4XB3A 4FXSA 4GI6A 1PKNA 1E1EA 2EJAA 3KBVA 3OZMA 4EKJA 4TTGA 3KHJA 4J27A 1VFTA 3EA1A 1PBGA 3M0VA 1MDLA 4HN4A 3EB3A 4AU0A 3TFXA 1E0TA 3BV7A 3KTXA 1E72M 4J3WA 3BWWA 1XC4A 2WSYA 3ATZA 4GQQA 2DP3A 2YXGA 3WUFA 2OLSA 2XFWA 5AHFA 1Z8AA 2X8RA 4ZE5A 3RAOA 2ZXQA 3C2FA 3MYPA 5D9PA 1XIGA 3B0YA 3SCPA 3H2CA 4D1JA 1ZBKA 1BLIA 3L4ZA 3A22A 4B3LA 1XIMA 3QOMA 1XGDA 4AIEA 4ICCX 3BQ6A 7PTDA 3VTRA 1Q2SA 3FVMA 3LRKA 2QCEA 2JK2A 2B7QA 3R13A 4HA3A 1ME9A 1P4CA 3E0IA 4OHQA 2FYMA 3V36A 1R9ZA 4M6PA 2OX4A 3FJLA 4B5UA 4E8GA 5CH9A 1NFGA 3A3XA 5CPTA 3EPNA 1OCBA 4JEJA 3ITTA 3RJYA 3SUTA 2F2KA 3IJLA 1ALDA 3QR0A 2O4QA 4NL1A 2C71A 1A3HA 2GL5A 2QUVA 3S5YA 4G6CA 4NAEA 3GFXA 3W01A 2D73A 4PBGA 2FTPA 4Q8MA 4MF4A 3ZOAA 2GSHA 4WDTA 3WFLA 4IQEA 3UCCA 2INEA 1NOWA 3ARVA 2WO5A 2ZRUA 4I7UA 3PBYA 1TTJA 3GG0A 1KFLA 1GORA 1KRCC 3OZOA 5CJMA 4HA0A 4PYSA 1ISZA 4LVAA 5DX7A 3IANA 4HYWA 1DEDA 1J0ZA 3GWQA 2JF7A 4L1GA 1W91A 2PTZA 4PL1A 4NJHA 1JPMA 2DT3A 2PWHA 3PPCA 3LBOA 1TWSA 2WMFA 4M6UA 1PE1A 1RQEA 4QSFA 3VD7A 2Q8XA 2JE8A 2O9PA 3R58A 1PIGA 3OLEA 3TWBA 3TN6A 2OX1A 4GRSA 4AFYA 3TDFA 1GYMA 4JL2A 3B9EA 4KEUA 2Q6ZA 3RMJA 3H7UA 5CJNA 4DF1A 1G94A 1JUKA 2QXWA 4MB5A 4A2RA 3OVPA 3QRHA 4C91A 3SN4A 1UWTA 2V5DA 4LB4A 3S4TA 4AYGA 4QLLA 4MHBA 3HO8A 1SU5A 2W5FA 9CGTA 1UPMB 1GOQA 4PRRA 4QROA 3T9PA 2XIMA 4N4QA 3PWAA 4Y9MA 4JIRA 4IPPA 1KRAC 4AIUA 1E9LA 3I3BA 4TXEA 3ZR6A 1KTBA 3A5FA 4E2BA 1W3KA 3MMWA 2MUCA 3CL8A 1C92A 4GUIA 3A4AA 2VFFA 4MKVA 1UBPC 1X98A 3O6CA 3PNUA 1XDLA 1XYFA 3WLKX 3ZT6A 1P5BA 2PP3A 4O8AA 2CHOA 1A53A 4ZQCA 4E4UA 2WM0A 3FEQA 4MWAB 3ZXWA 2YJQA 3MDUA 1KXHA 3LCGA 4H9VA 2WB5A 3R8HA 4GPNA 1VCGA 2IPWA 4E2VA 2OQYA 2OLAA 2VZOA 2YYUA 3AJ7A 4GIYA 4JX6A 6REQB 2QLYA 3ABRA 3NCOA 3VNJA 4HMCA 1RJRA 5H8MA 1E1FA 2V82A 3VIHA 2NVCA 5JBFA 4PEKA 5CPQA 4GY7A 1Q6OA 2RHGA 3VAVA 4O28A 4F66A 2PLMA 4BZYA 1R86A 3BO9A 2EO7A 4V15A 4JTIA 3H12A 4TO8A 3N4FA 3PS7A 1DE6A 4MYAA 4CNTA 2UY4A 3OLDA 5HNNA 2XH4A 4WOZA 2ON3A 1BEUA 4HCDA 2J77A 4XG1A 4ERIA 3O07A 2QNEA 3EEZA 3MUIA 3W26A 3VCNA 1E4NA 3RF9A 2YL5A 5BROA 1YTDA 2EPLX 1AJ0A 3W1AA 3SGGA 3AYSA 1OF8A 4GVGA 1GG1A 1GOXA 3OGVA 2D20A 2INFA 2Z00A 4U28A 5HDRA 3LCWA 1DV7A 1VJZA 4Q4SA 1EJRC 4C6PA 4M24A 3TR9A 5CQ1A 5CXPA 5HJXA 3N12A 3SM0A 5HA7A 1VC4A 2NT1A 4WXYA 1K1DA 2PD9A 4MB4A 2V2HA 1XH0A 1I2QA 3TJIA 4BF5A 6A3HA 2FKPA 2BSLA 1QOXA 1OG6A 1DXIA 1DE5A 3RU6A 1I2PA 3FJNA 1UR1A 1XG3A 4JTEA 2VX6A 4JTUA 3HM7A 4M81A 4C6IA 4W5ZA 3FY1A 1AK5A 2Y0FA 3FAWA 1PZ1A 3BW3A 4PH6A 3WD3A 3S9YA 5I3JA 2INZA 4JQ1A 3RHGA 5BXPA 1CXLA 3PUOA 2ACRA 3TYEA 2QKFA 3I7QA 5A8QA 3FSUA 4GHRA 1C7SA 1YW1A 3G1VA 2FH6A 1EHNA 4QEEA 5HPOA 3URNA 4MGGA 3DBPA 4ORMA 4H83A 2Z26A 5CBJA 4GVFA 3HZ3A 2TODA 3VOIA 3VNZA 1REQA 3CPGA 3IIPA 3WLSA 1JCJA 2BBFA 4AH7A 3LHYA 1CYGA 1VJSA 4H8UA 1WOBA 3T0AA 3R5EA 2C79A 1Y0EA 5A95A 3WNMA 4Z42C 3VINA 4K1WA 2D2JA 6ENLA 3GTFA 4B2DA 3T78A 1HGYA 5G1YA 1JEZA 4GZ7A 2J7EA 3VX0A 4CN4A 2QCHA 1E9YB 4ATWA 3TTEA 3M5VA 1S1PA 3PPFA 1QPOA 5ENLA 4W8AA 1UKPA 3A9BA 4GUGA 3WCZA 3U57A 3WLNA 3FSTA 1EQPA 1K4GA 2BGNE 2Z29A 1VAHA 1Q7MA 2FPTA 3QKEA 4ZOEA 1QWKA 4ZEPA 2EAWA 4GIRA 3EZ4A 1BYCA 3S6DA 1L2UA 1H4PA 1WXYA 4NQ1A 3CYJA 4PCSA 5MKGA 4RXGA 3V16A 1OZQA 4DJED 1IXOA 3WNOA 4Q8TA 3BLFA 3M0LA 3B8WA 3DFSA 2XZ7A 1HXJA 4S39A 3STFA 3P0WA 4NZ5A 3QYSA 1HNYA 1JFXA 4CVUA 1OT1A 2C19A 3BL3A 3SBFA 2OFJA 3M44A 3T7VA 3TXVA 2PTXA 1SO5A 1UA7A 3M0KA 1PKMA 3O06A 3OOQA 4L80A 4JIEA 2X1TA 2GJNA 4FF7A 5E0FA 4HVXA 1J0JA 3O0KA 3ARXA 2HVNA 4J2MA 3SCWA 1B3YA 4C1NB 1OCNA 2Z1XA 2BOFX 5D33A 4DXVA 2IKJA 4D6DA 3ARSA 3VMPA 1QHOA 3QN3A 2OELA 2PWVA 4US6A 3CMGA 2PGEA 3SCUA 4CN6A 4FOKA 1MRAA 4UTIA 3WD0A 4G2DA 5FA5A 3STEA 2NQHA 1MEIA 3H53A 1L8PA 1H41A 2ALDA 2QVNA 3PUEA 2FHBA 1AD4A 4JXCA 3HGJA 3BC9A 5KSWA 5LXXA 3C2EA 3DHUA 3EOLA 2WNNA 1B57A 1P0BA 4DO7A 2X41A 3KP0A 1WDRA 2RFGA 4PTVA 2PSNA 4F2TA 4YYCA 3F2BA 5I02A 5KZEA 4CUCA 3M43A 3ARYA 1ZZMA 1HJUA 1TWWA 2BXVA 3AIBA 3UJ2A 1QCWA 4DXXA 5BMWA 2OSWA 3QTPA 4C6BA 3S42A 4MZ1A 4HK6A 1EKOA 4FX6M 2R82A 2R1PA 3GDRA 2GWNA 2AGKA 8RUCA 1ZJBA 3RU8X 1MUWA 3AMKA 4Q6XA 1XF0A 2WM1A 2E5CA 4JR5A 1VKFA 2EPHA 4YLWA 3PZNA 5HULA 3MV11 5DXYA 4JX4A 4R9XA 2VEPA 3CH9A 3CQHA 4NHVA 3S9IA 3EKZA 2FPVA 4R9OA 4DWSA 3WH8A 4XKYA 3NQEA 4MTVA 4FF5A 2GQ8A 3UR8A 5HMFA 3B9OA 4PA8A 3PJUA 4MY1A 4G1KA 2DVTA 3QMRA 1FXPA 1O5KA 3AICA 4KQNA 1V3LA 1W3TA 3AMCA 4L4PA 1F74A 2YCEA 3NPXA 1HL8A 4ZGYA 1RPKA 3L0NA 3FAXA 3WQGA 1WQ5A 1QXLA 4ZB5A 2ZUMA 1JCXA 2X05A 4PBEA 1AH3A 2Y62A 3W72A 4GQRA 2PLJA 3KOFA 3UWEA 1ITUA 4AZ5A 3TMQA 1I2NA 1HF6A 5BOEA 4ZOAA 1L9WA 4JNMA 4LH8A 1FWFC 1MW3A 1DYSA 3VUSA 2G3MA 5TD4A 1TTPA 1GKRA 1W9VA 3LPPA 1SO3A 4AWSA 1AQ0A 5M1TA 4C6NA 3DG7A 1V6VA 5FAGA 3RIKA 2NQJA 1YEYA 2ZX6A 1UD6A 3TJLA 5G2IA 3BV4A 5EMKA 2CLHA 3B9NA 2VRKA 2NX1A 2HNHA 3CHEA 1V02A 4L4LA 5M2FX 1YXCA 1E5NA 1XIDA 4O52A 4YPJA 1NEYA 4L4OA 4CCZA 4LUYA 3BLDA 5JIWA 1UZHA 3P5ZA 2CKSA 2UY5A 4O0ZA 3IARA 1RALA 1LM1A 3IWPA 1FRBA 3IGSA 1QAPA 1PYFA 3FA5A 2FFCA 1G1YA 2W27A 2DQWA 5FESA 3AYTA 3BGAA 3RX3A 5GJPA 1TRDA 2XIJA 4Z1CA 4DXKA 1XHGA 1LOQA 1YBQB 1NAL1 4A8LA 4DWSD 2QW5A 4DVOA 3TC6A 2CZ5A 5LIYX 2E5BA 5IBXA 4L65A 1KQYA 3ERPA 1UH4A 2ESCA 3NEHA 3PFRA 4GUHA 4NIRA 3RX4A 3M6YA 1GGOA 3FVDA 2CWNA 4EPEC 3AS0A 2W62A 1IEXA 3IJDA 3THCA 2ZTKA 3MI2A 3PN8A 4JQ3A 3WEOA 4LT9A 3BG3A 3EXRA 3ZJ7A 2PTDA 4HKPA 3MUAA 7ODCA 4M56A 3RLGA 2E8YA 3N19B 3VKKA 1JDDA 2XM2A 2H90A 4UFLA 2BNJA 3WIJA 3ALFA 4W7WA 5CC7A 4ZTXA 2GDQA 4LEQA 2FVKA 3TCSA 2J7CA 3NL3A 5KZMA 4A21A 2WVUA 3B04A 2ANUA 2W0UA 2GVYA 3KEHA 3R10A 2A4AA 3N1AA 4UQAA 1YPIA 3T07A 1QK2A 2XU2A 2A5HA 3NA8A 1I9CB 3MZNA 1QOPA 2EPMX 5A8GA 3WDHA 1H49A 2H8ZA 4XBKA 4D8LA 1SO6A 1RD5A 4WY0B 1BG9A 1FFQA 2ZDRA 3UESA 2D0GA 1CGVA 1RH9A 4JQ2A 3I10A 4FO4A 3M41A 1ZJHA 3NNTA 4GBUA 2X0HA 5I07A 1IZJA 4XZHA 4KMQA 4NY2A 1DTUA 3BZGA 1KGUA 3VMOA 3EWZA 4J5NA 2HDJA 2QDEA 2J27A 1OC7A 1B54A 4X9SA 1EP1A 2WQDA 3V35A 1HJXA 2CBJA 3G1FA 5D9OA 4L6HA 3RITA 1FWCC 3SN1A 5HNUA 3N2CA 5JQ9A 4JAWA 3IAPA 2E9MA 5DBTA 1FOBA 3EKLA 3MJMA 1K8YA 1MNZA 2O9TA 3WLLA 3NPUA 1TIWA 4EXAA 4AIOA 2Y6ZA 4KRZA 5AYIA 3ENLA 3NQDA 3CWOX 4V33A 1PZ2A 1H0GA 3G1RA 2A7NA 5D09A 1TPDA 1E5JA 3ZSTA 3NQFA 4IIDA 4IP7A 5J04A 1WDPA 4IGHA 4K1GA 4DJDA 4BQ4A 4AHPA 3ALGA 3BGJA 1WE5A 2FGLA 3K8LA 2DDXA 2ZZ5A 3KRBA 2QDGA 1AL8A 4KIEA 4DIAA 1TKKA 1U83A 1EZ2A 4DM2A 1UR9A 3TROA 2PWEA 3RFAA 3ARQA 3PPGA 3W74A 2Q3OA 1TPEA 3WLOA 3PWIA 2C3ZA 3SW6A 2E9BA 2BHUA 1B1YA 3PBMA 1ADOA 3CZGA 3CUZA 2A3LA 4US5D 1GOKA 3WELA 3LTPA 2WWCA 3UA4A 1SR9A 1JZ7A 3WG6A 1RA5A 3TYAA 4DPQA 4AZHA 5LA2A 3NQ2A 2Z4GA 3HG3A 2XIOA 2G4JA 4J3ZA 1ONRA 4EWJA 2CBVA 3P82A 3VGFA 1LLZA 4GMEA 4AEOA 4MY9A 1T99A 1SZRA 4IJCA 2H9AB 1XYZA 1GWJA 4O14A 7XIMA 4HPGA 4UZSA 1XBYA 1LL7A 4OE7A 3PPHA 2CLOA 4YCPA 2NXHA 2ATSA 3WY1A 2WSQA 3V1PA 4NI3A 1EF2A 1DWJM 2Z1KA 1IEIA 1K9FA 4D6CA 4F2BA 1UOZA 5REQA 4FNPA 5SWUA 2ZZ3A 3NVTA 4GISA 2Z2UA 2J9XA 4DJDD 4W84A 4URIA 5HQLA 1J0YA 4GLEA 1IWPA 1QDSA 4LJ3A 4JDBA 1LL4A 3KWXA 3INPA 3WQ4A 4CQBA 1R7OA 4RE4A 1HZYA 4ZB2A 5G2WA 3EWWA 3GH4A 3U9IA 3GKAA 4WSJA 3KLKA 2QR6A 4OWGA 4LFYA 3M0JA 2EG6A 4IUOA 1R3RA 3GTHA 1J0IA 4LTSA 3APGA 5F7UA 1CWYA 6XIMA 1A5NC 5I6SA 4B5VA 2QCGA 1S2VA 3I6RA 3LI1A 3UT0A 4GXMA 3HJZA 1KM1A 4TQTA 5DLCA 4O1EA 3GD6A 4D6GA 3MSYA 1D2KA 1MXSA 4LF2A 4R7JA 3ISIX 5CZSA 2OLHA 1TR1A 4Q4KA 4ATDA 5TBOA 1NARA 2AQWA 1WV2A 5I3DA 1WZAA 3SEPA 2QUMA 3U6WA 1R3WA 4RX0A 3E6EA 1W54A 1JR1A 4CVWA 3VZXA 5E0CA 1RHCA 3T1GA 2FPYA 3B0UX 1F8MA 2BVYA 1UH3A 3ATYA 3AIQA 2YCLA 3T81A 3HOJA 5E6ZA 2BOEX 5E9AA 1J11A 1E43A 4GY0A 4BY3A 3B8IA 2D1ZA 3GLCA 1S2WA 5E0KA 3DIPA 5CPLA 4MB3A 3MKCA 1MQQA 2W4XA 1RXOB 3S6OA 4J3VA 4I6KA 3ZT5A 1SFTA 5C5YA 1I1XA 3L7RA 3ZLGA 1K9EA 2IXUA 1VBGA 4H8NA 1LQ2A 1S5NA 4L1XA 1KCLA 3REQA 3H2MA 1FWGC 4JBRA 2VO5A 4XISA 1P6CA 3WEZA 4DBWA 2CLKA 2PURA 1V0MA 4LBRA 1GEHA 2RDUA 5GNYA 4AW7A 4UOJA 3GDMA 3BE7A 3LGDA 3GNDA 2RUSA 1V6YA 3MUY1 3HURA 1VBJA 1PCKA 1W3IA 4I9JA 4HU8A 3VD5A 4QHRA 1SJBA 2QPXA 4CEXC 3MKVA 5LGZA 1OZMA 5FJIA 1C90A 1KNWA 1SSGA 3IEBA 1EO5A 4O0QA 3ARPA 3QR3A 4CD6A 2XPKA 4N6FA 2PU0A 1K77A 4XZLX 4G9PA 3WDPP 4KRTA 3GE7A 1QATA 4GOAA 3M7WA 4JTGA 4FXJA 3KCOA 2YB1A 1O4UA 4ZCWA 3IACA 1EB3A 3URBA 5BWAA 3AWNA 4LCRA 1SFLA 3KRZA 2OJPA 3CHFA 3LG3A 5BRBA 2QJHA 1QHPA 3MMDA 3L4YA 4DBEA 5KZDA 4N7QA 2Z6JA 2VM8A 2OCZA 4NI8A 1TTQA 4K39A 4CCEA 1QI4A 3SIMA 3UNTA 2TYSA 3K1GA 1P0DA 1UC4A 3ANUA 5DMLA 1YPXA 1DWAM 4X3ZA 1WDSA 3YPIA 7TIMA 1BYAA 5I7GA 3EWUA 1YMYA 3F2DA 4W9TA 5CGMA 2O0TA 1E6SM 3H7RA 4D6FA 5BYWA 4D71A 2YXXA 3W7MA 1RPXA 2OEKA 1XS2A 4R88A 4F0LA 5JH1A 7TAAA 2VEIA 4Q4MA 2I17A 3JZEA 4MJMA 3UXIA 3GC4A 4CLMA 2J8GA 3H2FA 4IWWA 3DH7A 4ZQRA 2DIKA 3WQVA 4AY1A 1TZ9A 3VGDA 3G8EA 4FNUA 1US0A 4XBJA 1E55A 4D6HA 4LV4A 4IOTA 4L61A 2PA6A 5CGQA 3IRSA 5FI8A 3T0BA 1GNXA 3VE7A 1SR0A 2ZXBA 2ZA2A 4MDOA 3CU2A 2XZ9A 3ZJ6A 1JYNA 2E4TA 4MUZA 1JPDX 2CCRA 3EX4A 3A12A 1Z32X 2OT0A 5IXEA 3W1RA 1RCQA 2IPJA 4OECA 3AUJA 1VRDA 2VCAA 4IGMA 3SO7A 2WZEA 3RJXA 2PB1A 1K8XA 1IXQA 3PSVA 1BFNA 3AS3A 2GJLA 3CV1A 1B3WA 2X30A 5TAOA 1XISA 3L23A 3H54A 5LNRA 4QJ3B 2ISWA 3NYZA 4UBPC 1J4EA 4ORIA 3IPWA 3B8DA 3WF4A 1J93A 4R85A 4RLIA 1IXPA 3QV7A 5EL1A 4W89A 4GD0A 3W84A 2E68A 4RCXA 3IIXA 1UR8A 2I9UA 5FSDC 1H7WA 3M6DA 1Z6KA 2F84A 4F0SA 4NAFA 1H63A 1OINA 1REQB 3EX3A 5FF3A 1YDNA 3NVDA 5HWNA 1BG4A 1GZ1A 2OEMA 4ZOCA 5DQPA 1Z69A 2HRWA 4DZHA 2FDSA 3OODA 4D8AA 1H62A 1WKDA 4PTXA 4HA1A 2WCSA 1T96A 2R1MA 1UWSA 5K4ZA 4RNFA 3N9SA 4W86A 2IS7A 2XWEA 4Z2IA 3XIMA 2Z7KA 3LD5A 4ZFCA 1JFHA 2ACQA 4BJHA 4KWWA 4WUIA 1XD0A 3H22A 2F6KA 2QF8A 3W2NA 1EXPA 3OZYA 1ZHAA 3IIVA 3H6OA 2CZDA 2XN2A 2OT1A 4MAVA 5LNVA 2WK2A 2EBNA 2ZBTA 4I8YA 5D04C 1KGWA 8CGTA 4WF7A 5MKGB 1QI5A 4TX8A 4UNKA 2HS8A 4H01A 3AUOA 1JDFA 3PZTA 1ISVA 3PZQA 4A8RA 1NF0A 3UW6A 3EA2A 3LCXA 1V77A 2GVGA 2PWUA 3VGHA 3EWCA 4GXPA 1E40A 2RAGA 5LGXA 3PTMA 1ME8A 4RUBA 3BTNA 3NQVA 5CZKA 3LU2A 3NWRA 1ZBWA 1RBAA 1TV4A 2ZICA 3IJ9A 3N6JA 2WMIA 2VGFA 2HROA 1ZBCA 1G9HA 4H8VA 4LBSA 3N25A 5ABEA 2VD9A 2I14A 1UWAA 3K4AA 5MHBA 2WOQA 1KXTA 1UBSA 2Z1BA 3OU8A 4L9ZA 1CECA 1FP8A 1Q45A 2ALRA 4CGTA 1ZLPA 1HJSA 4F4RA 1DWIM 3L21A 1QJWA 4XUGA 3NO5A 4EK7A 1MZHA 2F8QA 3WX7A 1EJ7L 4GGBA 3E5BA 1JYVA 1VJIA 3RPDA 2YSWA 2ZX7A 3RN6A 4UCGA 2CETA 3SRDA 1UP3A 2E77A 4PBFA 3DFTA 3IJ6A 2QV4A 3WLPA 3DERA 2UV8G 1BXBA 4NNCA 3VPLA 3LYEA 2J7HA 1CW2A 2YGYA 4IH3A 1UKTA 1FWEC 3LXCA 4H7ZA 1VD6A 3K5XA 2R1KA 3WQFA 1XLIA 2WCGA 2XN0A 2OWCA 4O17A 4C6QA 2VX5A 1ZB5A 4J2PA 4KESA 4C6EA 2PEVA 3MQTA 3L0KA 4JKKA 3NZQA 4F0HA 3EX2A 1CEOA 2Z2BA 1XIEA 3CT7A 1J6OA 3FX4A 4JIQA 4M6QA 1CTNA 3CJPA 4MM1A 3HPZA 1I0BA 5D8ZA 2J9YA 4TX6A 2PDXA 4DWSB 4XKYB 1NH6A 5LIKX 3U4AA 3VD9A 3W00A 3C0JA 1NWSA 1IEQA 2XSXA 1ITQA 2VFIA 4IG2A 1R7AA 1AL7A 3LNMA 3GIQA 4UR7A 4DO5A 1MQPA 4HNLA 1KRBC 1J2WA 3E0FA 1LQ0A 4KW2A 3W73A 1E6PA 3WNNA 4BFAA 4QDPA 4GIAA 4IMEA 2G4FA 3R0KA 2D24A 3VCCA 1ITCA 3ABSA 1UMLA 2ZRWA 2G95A 3SZ8A 1XYAA 4BQ5A 1Q8JA 1MEWA 3QVQA 4WZHA 1ESWA 3B0VC 3U3HA 3PBGA 2D22A 4N02A 3MI3A 3N9KA 3CZEA 1BD0A 1J5SA 4LRSA 2XYLA 2GGEA 2Y8VA 1YTEA 4HMNA 5AYXA 3W1UA 2UY3A 2HZGA 3VNIA 1LQAA 4P8XA 2XUCA 5KINA 3W24A 1IHIA 3MC5A 2E6DA 1SZFA 3KE0A 4U31A 3BAWA 1B4KA 1A0CA 5A6MA 4REQA 1ODUA 2CBUA 3AMGA 4JX5A 3S1UA 3OA3A 2XVPA 1LDCA 1BTCA 3GR7A 3H26A 3N2BA 3ARWA 1UH2A 3GRIA 4LC6A 2OWWA 1WUFA 2XSAA 4FX8A 1W1PA 4G7EA 4POCA 5T9CE 3VGGA 4GK8A 1TQXA 3NPVA 1RZMA 2VCCA 4PMYA 2HV5A 1O1HA 3APTA 1QR7A 1QW9A 3AZTA 4HCHA 4Z1BA 3W1MA 1VLWA 4I9TA 1GQIA 3KWSA 3OA5A 3HG4A 4DNHA 3VDGA 1R2SA 3CUIA 3ZMRA 1S5MA 3B06A 3BLOA 3W7LA 4P7RA 4ZO6A 3VNYA 1TMLA 4OZOA 3STPA 2VDGA 3NR0A 4B3ZA 4NZCA 3FA4A 1SZGA 4DO6A 1EJWC 1ZALA 1BVWA 1K7EA 1GPWA 1ONXA 4QJ5B 2R14A 4RDZA 3FJ4A 4MLRA 2A6LA 1JGIA 1PPIA 5AC6A 2BY2A 4LYKA 3KTSA 4WDUA 5G4EA 2GYIA 2ZX8A 4QAIA 5A94A 2YBTA 3IIOA 3UG5A 4RXFA 1KBJA 1F3TA 1XBZA 4C5YA 2DSVA 5I23A 1FWJC 4XZNX 4QLKA 3NEVA 5LXEA 4LF1A 1TE1A 2V5LA 1KBKA 4G8TA 2O7QA 1C9DA 4M3PA 2AAMA 4ZA0A 1R0MA 3GX9A 2GVEA 3PC0A 1S38A 3Q67A 4YTUA 3LERA 1C8VA 3VD3A 4G7FA 3VIPA 1PTDA 3WMSA 2QYGA 4JN8A 3R25A 3WJZA 1F4HA 1KV5A 1JPHA 4NZFA 3GK0A 1JULA 4QG9A 4CQCA 4UMAA 1TPVA 2FZDA 3NYDA 4KRUA 3PHAA 4MAZA 3QHOA 1NQ6A 2WSKA 4BEUA 2JFEX 1FHDA 2Q8LA 2QULA 2W61A 1IGWA 1F7BA 4L7ZA 3V4BA 1D8CA 2PMQA 1WZLA 2NWRA 2WBKA 5EMMA 1H0IA 3A24A 4PB3A 4GO8A 5LHEA 2BOGX 2J74A 4O4VA 1R3SA 3GXIA 4K7YA 1EJUC 3FIGA 3WKZA 4WSHA 5CZTA 4A8IA 4LVGA 4DJEC 5KTLA 4CNUA 1TV7A 3WUEA 3B05A 1YIXA 1ZJIA 4RV8A 3E9AA 3O0FA 4XQ6A 4I5UA 1GW1A 1FWAC 3CH0A 1M03A 1UOKA 3W2JA 5TF0A 4MKNA 1K8ZA 2QAFA 3WLJA 2ZUUA 1BXNA 4Z17A 2WZTA 2W66A 5AVHA 1QW7A 3STCA 2VVSA 3AXIA 3AI0A 2A7RA 4O13A 1M6JA 3AWOA 2OWXA 4Y90A 1JZ5A 5HK4A 1F8IA 3GFZA 4OBSA 2UBPC 1ZL1A 2WKJA 1TIMA 3IJ7A 2FVMA 5AHIA 1V0NA 2PBGA 2HWGA 3KBMA 4M5PA 4A4AA 3F4WA 2GUBA 2V5BA 3PM6A 4ML4A 2AQOA 4S2CA 4U2YA 4OGZA 1WUEA 5FF2A 3W7NA 5JU6A 3MBDA 1U1HA 3F5LA 3LV5A 2POZA 1L8NA 3VOJA 1EYEA 4JTHA 1YKWA 3ZYZA 3SUUA 5HUPA 2VEKA 4I3GA 1J6PA 3Q37A 2NV1A 3HTWA 1YDOA 1FHLA 4J4KA 4XX6A 4QM1A 4ZSUA 1EF3A 3WQOA 2V5KA 2PDGA 5IRPA 3KVLA 4D2JA 4GBDA 5L6UA 4O10A 1UMYA 2OYKA 1A47A 4QNWA 4DLFA 2LLEA 4JNYA 2ZVRA 1M7PA 2BWGA 3BJTA 5HJLA 4HIBA 3VOHA 3SRKA 2WZMA 1B90A 1DXFA 3T40A 4XAFA 3UNDA 4H41A 3KVMA 2BP1A 1OWQA 3QJAA 5DF0A 1JAEA 1R5YA 1KD0A 3KXQA 3ITYA 3SCNA 3QKZA 4QCFA 3LXBA 4PUDA 5TQLA 6REQA 2A3BA 3CEUA 5C7VA 4FLSA 1FHVA 3UGRA 4FIRA 3QGAC 1FFRA 4G1NA 1AD1A 2V2DA 4FK9A 4N2YA 3QC0A 1ZAHA 3WUGA 2HJPA 3QC3A 1A5UA 3I4EA 2YLAA 3OP2A 4KBXA 3UXKA 2H6RA 4ALDA 4HTYA 5REQB 4Q32A 3AZRA 1AJ2A 4UQEA 1THFD 2NVAA 2PRLA 5HR6A 4CQDA 2A3AA 2FMNA 4AEFA 1X6UA 4YU1A 5FEZA 1K03A 1GQKA 4HHMA 1A5CA 2Y7DA 4J40A 3MHUA 3K4WA 5JBEA 1QUMA 2GGJA 3OHMB 1XLEA 7A3HA 4WSKA 4X9YA 2NX3A 3G6MA 1UUOA 3WD1A 3Q94A 3SFKA 5E09A 3CWNA 4EF8A 3UJFA 1IT7A 5MF5A 1SW3A 1R46A 4B4HA 4IM4A 1JIBA 4YHGA 5DN1A 4TU1A 2FZ8A 3QY8A 4IIEA 3DYMA 3L4XA 4RPQA 1AW1A 3BCJA 1OFQA 1W5OA 1EX1A 4ACYA 2BHYA 3TMLA 4EP8C 2OO6A 3PF3A 1CLKA 4CD7A 1HT6A 4IJRA 3M1ZA 4H9UA 1UD4A 2XH2A 1B4EA 1RP9A 4PCPA 4DWSC 3BAKA 3M07A 1K7XA 4HTBA 1XRFA 4PMRA 4X60A 4NUWA 1YRRA 2BTMA 2HVMA 3CPUA 3R43A 4JFWA 1F2JA 1WO2A 4AF0A 3NDYA 3VKJA 4A3YA 2V5JA 4M1RA 4GINA 2YCLB 3FHAA 4TR9A 1Z41A 3QV8A 2BXYA 4FIQA 3ZJ8A 4AMCA 3EOSA 3DZ1A 1V3MA 3RYSA 1QFEA 2FTYA 1AZ1A 3W7OA 1SSDA 1XRSA 2PP1A 2NQ5A 1I60A 2Y70A 3LLFA 2VL4A 1Q6EA 3CLWA 2QZRA 3M7SA 5CJ5A 1XJBA 1ELSA 2RGLA 4ZENA 4UFKA 3V1HA 1VLIA 3L66A 4L56A 3REQB 4P8WA 1UUMA 3UG4A 4XD4A 4ASTA 1JZ4A 4O54A 5K9XA 5E9XA 1J5TA 5IDIA 2BZNA 2WJDA 1QI2A 1QO5A 1N7KA 1FY6A 1IZKA 2ABBA 4HA4A 3WO8A 1V03A 1EP3A 4Y9NA 5I03A 4C6KA 3DN5A 4F9DA 2PDBA 4AYSA 3S3GA 3WD4A 5AHLA 1YE6A 2PDFA 3AMDA 3MWAA 4C6CA 1FX6A 4PMQA 3A3WA 1KFEA 2XGBA 3LK6A 1MW0A 3E0WA 1VH7A 1TJ0A 4QE4A 1QHZA 4XAYA 4AZGA 2QV5A 3OEXA 5A8OA 3BK0A 3SGZA 4MPKA 4WX2A 3D0CA 3GXDA 3O2LA 3VUPA 3WJWA 1TSIA 3SDOA 1VPQA 2WXDM 5BRPA 3MHFA 3TYUA 2OKOA 4GI8A 2HTMA 3FKKA 3BSHA 2FDMA 4GY1A 3WK3A 3P62A 4H2CA 4MLJA 3AHVA 4RL3A 3BAIA 3RMEA 3L5MA 2B7PA 4DJFA 2PDMA 1FWRA 1QNPA 2VUYA 3CHVA 3NURA 3HV9A 2WJFA 3PBVA 5C9ZA 4JYDA 4B16A 2DZUA 2HEJA 1FHUA 3MB9A 3CUJA 2VRJA 4Y9AA 1KBIA 3VKDA 1V3HA 1JCLA 4LUIA 3NG3A 3T4CA 1UWQA 2WBGA 4QS5A 3T09A 1UR4A 3W7RA 3KL3A 4PEEA 3TA6A 1WZMA 4A2SA 3DFHA 1IZCA 1GW9A 1PWLA 4HK7A 2RGMA 1NDVA 4MJ2A 1W0MA 2ZRYA 4RR4A 5A3HA 1KRMA 1LROA 3AQUA 1I4NA 1JDCA 1RK6A 4E4PA 3R11A 1FWNA 3JU2A 1X6NA 2JIEA 4O1BA 2WMJA 2GZXA 3HMJG 1DWGM 1ODZA 3SCRA 3SUVA 4MADA 1P1MA 5LYRA 3GBDA 4DZAA 4HQVA 1UA3A 5JVLA 3N2OA 3ZR4A 4ZQOA 5A6SA 2HPMA 2VD8A 2J7DA 2Z28A 3P2VA 4QP0A 1EJXC 1XGZA 3RUBL 3OTRA 1VS1A 1NFPA 5DELA 1LLWA 4CNNA 1IEWA 4IJBA 3USZA 4Q33A 1J0KA 1V0KA 5EYWA 1AZ2A 4KWOA 3LSBA 2GOUA 2PDIA 2WC7A 1XG4A 3GHSA 1XCFA 3A5VA 2DVXA 1GVRA 2QMKA 4JS3A 3W4RA 2HQAA 3BLPX 4RE3A 1C3FA 1AVAA 4KFPA 4DJFD 1Q6DA 1W1YA 3OB8A 3VIMA 1Q65A 1XL9A 1JYXA 1NELA 1GVEA 4GACA 3ITOA 1XX1A 4JTJA 4LW7A 3HMCA 4BWLA 1U1UA 4LU0A 3QSRA 3S1VA 4E2OA 2GLKA 1PEZA 2FH8A 4IFRA 4BA0A 1S3TC 3R79A 5GPRA 3GAKA 3DESA 3VU2A 1R30A 1UQYA 4FMVA 4LAUA 2DUZA 3FCPA 3F4CA 1SFSA 4IXXA 4WGXA 4PUWA 2PF8A 1M3UA 2XINA 4DJDC 4AXNA 1S5VA 2CXGA 1MVYA 3TQPA 1IR2A 3D47A 4NAFB 2F6UA 4ZR8A 4O1FA 4LCSA 1X38A 3AXMA 5CKSA 2VQUA 1ZBVA 1UWIA 1OFPA 2YOCA 2YA2A 3CBWA 4CKQA 1V3JA 2Y88A 3FGCA 1NSJA 4M29A 1OQFA 1KB3A 1XH2A 4GVHA 3CLMA 2JGQA 4KFOA 3SB0A 1G67A 2GWGA 3D3FA 4UTLA 1X6LA 2CXEA 4L6OA 1W5MA 4WGHA 4LBUA 2Y7GA 1Y5WA 2ASHA 2Y8UA 1UP2A 4JIHA 4M7SA 4KEVA 2G41A 3H4XA 3I68A 4X0VA 1EGVA 3LTYA 4YMZA 1LP6A 1ZP3A 3AROA 4O15A 1UKOA 3W7DA 1HKKA 2PDLA 1K6WA 2OSYA 3E49A 2PAJA 4PRTA 4BI6A 1VYSX 4NILA 3NQMA 1OFRA 3WMBA 3UVAA 2J62A 5CBBA 5D2XA 5A5WA 4ENLA 3CQJA 3S5NA 3NO3A 4HK5A 4TV5A 3RR4A 3W7CA 2PS2A 4RJEA 1FQ0A 3P67A 1O5XA 5U7SA 5AC5A 4DYEA 1JI1A 1M7OA 3VX1A 1YBQA 1MFVA 2GPTA 2DGAA 1IWBA 1C8YA 1P0EA 3WK2A 4JTCA 3BAJA 4GFIA 2WZIA 3NZPA 3BH4A 3W82A 3IJQA 3UWWA 1FBAA 7CGTA 1VENA 2WHJA 1Y65A 4OKDA 4LNCA 5A6BA 1TB3A 3AHYA 3LHZA 2WMIB 3TP4A 1FUYA 3ARZA 5AN7A 3A23A 4CD4A 3UR2A 3NM3A 3IGUA 4XO7A 5XINA 3N13A 4BHYA 1S5WA 4XUYA 3LCIA 3VZYA 3CPRA 1LOLA 2IKIA 3QV6A 2WPBA 2WC3A 5AC7A 4OV4A 1XFCA 3DHFA 4QR6A 3NO1A 4NXSA 3FHQA 5D2TA 1NWTA 2JBMA 4GUJA 4ADTA 4W5UA 1RAKA 8A3HA 2I7GA 1DTNA 3BOXA 3MP4A 5B80A 3TFCA 3H55A 4GCXA 5C7HA 2GGIA 3GYEA 1KCZA 1E3ZA 2PTWA 3BCDA 3H8AA 4DPPA 2DZWA 5A6LA 1KLYA 4A35A 3UWZA 1HX0A 2WNQA 3WBWA 2J78A 3T8LA 1FA2A 4PTMA 3KP1A 3L9CA 3A13A 3CV2A 3KZPA 2VC9A 3MU7A 2CIPA 1WOAA 3OBAA 1A80A 1W9XA 3VDHA 4F40A 2V67A 4QIUA 3A4JA 3M4HA 3UD6A 3IK2A 1BGAA 4S1FA 3VDCA 2NQZA 3DCPA 3L5LA 3UBPC 2EPNA 1SZNA 2PPGA 3MS8A 1NWUA 5A69A 4OOZA 2BG5A 5M5DA 1PYMA 3V5CA 3E2VA 3SY8A 4RE0A 1WAWA