2YZRA

Crystal structure of pyridoxine biosynthesis protein from methanocaldococcus jannaschii
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
309
structure length
307
Chain Sequence
TDLLKKGFAKMVKHGVVMDVTNVEQAQIAEEAGAVAVMALERVPADIRGGVARMSDPALIEEIMDAVSIPVMAKCRIGHTTEALVLEAIGVDMIDESEVLTQADPFFHIYKKKFNVPFVCGARNLGEAVRRIWEGAAMIRTKGEAGTGNIVEAVRHMRLMNEAIAQLQRMTDEEVYGVAKFYANRYAELAKTVREGMGLPATVLENEPIYEGFTLAEIIDGLYEVLLEVKKLGRLPVVNFAAGGVATPADAALMMQLGSDGVFVGSGIFKSENPLERARAIVEATYNYDKPDIVAEVSKNLGEAMKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Pyridoxal biosynthesis lyase pdxS
publication title Crystal structure of pyridoxine biosynthesis protein from Methanocaldococcus jannaschii
rcsb
source organism Methanocaldococcus jannaschii
total genus 102
structure length 307
sequence length 309
chains with identical sequence B, C
ec nomenclature ec 4.3.3.6: Pyridoxal 5'-phosphate synthase (glutamine hydrolyzing).
pdb deposition date 2007-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01680 SOR_SNZ SOR/SNZ family
A PF05690 ThiG Thiazole biosynthesis protein ThiG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2yzrA00
3S1WA 3QW3A 1PIIA 2WOQA 1TO3A 4J9JA 2VXNA 4AWUA 5BW6A 4UFLA 1W5MA 2R94A 3BW2A 5C2XA 4RZ5A 1WBHA 1P0NA 1IIGA 2EHHA 1J4EA 3NA8A 5HWJA 2HS8A 1EWDA 3I68A 2HTMA 1F73A 1K03A 4MIMA 2B4GA 1GTHA 1XBVA 4QIUA 2UV8G 1O60A 4UTWC 4IQLA 1SPQA 4O0ZA 4X22A 1Q45A 3IIZA 2Q8ZA 5EKYA 1QCWA 3TSDA 1PCKA 4OE7A 4Y6GA 1RD5A 4O19A 2A7PA 1L6YA 3GXNA 4CCCA 2ISVA 2H8XA 3R2GA 1GZGA 3W3OA 5D2XA 5EMUA 1MXSA 1P4CA 2GJLA 1WQ5A 3P80A 3IV3A 1OFAA 3SY5A 3DH7A 2ABAA 2QCHA 1ME8A 4OV4A 1U83A 2A7RA 1S3HA 2FB2A 1RQEA 3NG3A 1F05A 5D32A 1VZWA 5F1VA 2HSAA 1FDZA 4JGDA 1DOSA 1JQXA 4FXRA 5EY5A 2WKJA 3BG3A 2BXVA 3M5YA 4MUZA 4UMCA 1EPXA 2NX1A 1EP1A 1QPRA 5IBXC 2J24A 2GQ8A 4I7UA 3FKRA 2GQ9A 3TSMA 3NM1A 4IX0A 4MZ8A 3G1DA 3W7NA 1XL9A 2A6LA 1CX9A 4JTGA 1QDSA 5ABTA 4WZHA 3PSVA 3G24A 3W76A 1G4PA 3OVPA 5J5RA 1WDWA 4UFKA 2QJHA 3W74A 1OHLA 3N9SA 5DY3A 4LUJA 3RNDA 3P82A 4DBDA 1EUNA 3MHGA 3ZS4A 1VYPX 3EWXA 3PVFA 3NQVA 3ZWTA 3S1XA 3N14A 2Z1BA 3W9ZA 3SIZA 3MMTA 2I14A 4JTJA 1TTPA 3P8IA 3W1QA 1IXQA 3KRUA 3TH6A 4UMBA 1W5QA 1LBFA 4FX8A 4KFNA 3R89A 2ZZ7A 1F74A 1B4KA 4FNQA 4LVDA 3MWAA 4CCEA 2V8ZA 3W85A 5G2HA 3HG2A 5K9DA 1JRCA 4S2BA 4U4MA 1B3OA 5AHNA 1H7RA 3S9YA 3TK7A 4DF2A 3UY8A 4JTLA 2WSQA 4KFOA 1OX4B 1C29A 4X9SA 3LXAA 4LVBA 4MVAA 2BTMA 3W1TA 1B4EA 4LV9A 1D9EA 1SW3A 4XUGA 3DFPA 5D33A 2GVLA 3MHUA 3E9AA 2FQIA 4LVGA 3THQA 1KBIA 4CNNA 1W3IA 3TFXA 4MPQA 1FDYA 4Z0JA 3M9YA 2VEPA 3UQNA 1MO0A 4E0CA 3L0KA 1VHNA 4CCDA 3IEBA 3PBYA 3LI1A 4FHAA 4FXSA 4Q33A 2ZTJA 3W07A 5IM51 4XBSA 4S2CA 4IGHA 3QPZA 1SO6A 3B06A 4GRSA 3W7HA 1QOQA 1TPEA 2A7NA 2O7QA 5H2ZA 1UBSA 4DO4A 3VI2A 1UUMA 3QH2A 3W7RA 4PEKA 3EXTA 3UYCA 1BWKA 3QC3A 1H7PA 1WOBA 1TIMA 1GOXA 4FIQA 2X16A 4O17A 1TPUA 1TJRA 4XKYB 3SW6A 4HNTA 1EX5A 1OFPA 1K7EA 3BGJA 3VNDA 4IPIA 1W3TA 4O50A 2VFFA 1Q6RA 2G5WA 4AF0A 3O63A 5HWNA 4Z1BA 3QMTA 2JK2A 4K8HA 3W22A 3KFTA 4ZQCA 4EIVA 2QCDA 3FOKA 3LCIA 1Z48A 4JNMA 4QNEA 3QEZA 4UFHA 1DHPA 2DU2A 3L5MA 3DKJA 1JCLA 3MI6A 2PURA 3W73A 3EWWA 5HNRA 3O6CA 1KM2A 1QR7A 1A5CA 3C8FA 2HMCA 5AC8A 1QWGA 5G2WA 4N9CA 2DZWA 3S5YA 3W1LA 3E96A 3QZEA 3C0JA 5HJLA 2BSLA 4UIOA 1WV2A 4R53A 7TIMA 2DZXA 1Q6LA 3I7RA 2A2IA 3VKJA 3KHJA 3M44A 1KLYA 1LOLA 4UCGA 1R46A 4E38A 3U6WA 1W31A 2AGKA 3O07A 4HPJA 4LC8A 1PCWA 3W72A 2CZEA 2C6QA 2J27A 4UMAA 5DELA 1KA9F 3BO9A 1NF7A 3GYEA 1LP6A 4HSOA 1YDOA 2B7NA 1TRIA 3PR2A 1W54A 1OFEA 3UWQA 3HGJA 1T0OA 4OBTA 4TO8A 4HSNA 2TRSA 2QDHA 3LCLA 5DCDA 2PC4A 5K4ZA 3UWYA 4RXFA 1IXOA 1FXPA 5AFDA 4EWND 1TTJA 3FIGA 3HBLA 3UPBA 2ABBA 1H1YA 1TJPA 2WV8A 1C9DA 4O11A 1VYSX 4EF8A 2PRHA 3W7KA 2C19A 3LCXA 3LX9A 3EX3A 3GXTA 5LNRA 3P62A 5F2LA 2TMDA 2C13A 5LNSA 2Q3RA 5BOOA 5CPLA 3ATYA 4IMGA 2WO5A 1ZHAA 4KWVA 3RU6A 1OK6A 3U2OA 4NZFA 2KZHA 1NSJA 3ATZA 1LLWA 1YLVA 1THFD 2QUTA 4UC5A 1SUXA 3BW4A 3B0PA 3ANYA 4LWWA 1GVRA 4LS0A 3P81A 2DJLA 3CT7A 4O16A 3O16A 2A21A 2WQPA 3TA6A 3M6YA 2WJZA 3RMJA 2FPYA 3GNDA 4N02A 3PM6A 4JIQA 5AYXA 1YYAA 1X7FA 3DENA 4HNUA 1JJKA 1H63A 3GXPA 5G2IA 3W2KA 5AC6A 2A85A 3MUXA 1Q6QA 4WD0A 4NXKA 5BNKA 3C52A 5I3JA 3MJYA 3FYPA 1GVFA 4K36A 1L9WA 3WJYA 2WPBA 3W1AA 1UJPA 5AN7A 1R2RA 3HF3A 5I3KA 5TQLA 1BEUA 5U4NA 4UNKA 3TAKA 1K02A 4HN4A 1SZGA 3TC6A 3JS3A 4UTTA 3W2LA 2ZZ5A 1QO5A 4UUIA 3UZ5A 2FIQA 2H8ZA 4FNUA 4OGZA 1XI3A 1DKWA 4EOUA 2NLIA 5CGQA 4ZZ9A 4ADUA 3LHUA 5EL1A 1TPFA 4IOTA 3W7IA 2VFGA 1GG0A 2CLMA 1QPNA 4TMCA 2ATSA 3P60A 1KFLA 4NJHA 4RLIA 1FWWA 4UNLA 2QKFA 3NZ1A 4FF7A 2QAFA 2VFEA 1LRTA 1G4TA 4AWSA 3UNDA 4I7WA 2C14A 3G8RA 2ZCGA 1H1ZA 3HJZA 3W1UA 1G69A 3GR8A 2RFGA 1DORA 4O1DA 4WXYA 3NL2A 3CIXA 2E5CA 4M19A 1G4EA 2ZRYA 1SO3A 4JICA 1PHQA 1N8FA 4N9BA 3G1FA 2NV1A 3LHYA 3HMJG 1KFKA 3PF3A 5CZSA 1LRNA 4ORMA 3SI9A 3O1NA 4UTWA 2CFFA 1DQWA 2NXGA 5E1QA 4WY0B 1W56A 4MJMA 4ICNA 3C3NA 2A6NA 2H6RA 1Y0EA 3WJWA 3HQ1A 1SFLA 4BWLA 3LI0A 1HTIA 3GDRA 2TPSA 1BWLA 1KV5A 2QCEA 3O06A 1TPH1 3N9RA 1JVNA 3S1VA 2YCEA 4GWEA 1I4NA 3Q58A 2CLFA 3BLFA 1ZFJA 3NQMA 3T44A 4XZ9A 1F7BA 1AL8A 2P1FA 4GFSA 2ZA2A 4KKXA 2QJGA 3F1QA 1A50A 3MYPA 1LLZA 3HPXA 3LLFA 1W1ZA 2LLEA 1TQJA 3NPWA 1KBJA 5AHEA 1JCMP 3SFKA 5IBXA 1TTIA 1FQ0A 4O4VA 4ALDA 2TYSA 4GJ1A 2J9YA 3A9IA 1L2UA 1P0KA 2ZBTA 3KVMA 3QQ0A 3IRDA 4LUIA 1S5VA 2FTPA 4LS1A 4BI5A 4Y9AA 3QF0A 4R33A 4YWIA 5CZTA 1OYAA 2XFWA 3T7VA 3F03K 1XCFA 3O15A 1EIXA 1OYBA 1FWSA 2V5BA 3M0ZA 3F4NA 3P5YA 3G0XA 1B9BA 5DLCA 3W84A 3DFOA 1K8XA 5EYWA 3PG9A 2CZDA 2Y63A 5AC7A 3G1XA 1ML1A 3L21A 2W79A 1VLIA 3HGSA 1ICPA 1G7VA 1WA3A 4BF9A 3G3MA 1JCYA 3C2VA 3W83A 4LRSA 2YGYA 1YXCA 4YMZA 1FCBA 2BWGA 5LHEA 2VOMA 1SFJA 1QAPA 4OT7A 1FWRA 3DI1A 5FEPA 3DKLA 3HPSA 3YPIA 4JX5A 1PL9A 4GE8A 3F4WA 4GBUA 4JX4A 1T8XA 2GQAA 3WFAA 1H7OA 1SW7A 1H51A 2QCFA 1OVDA 4NZJA 3S5NA 4YL2A 1I8JA 2QUUA 5G5IA 4JEQA 3LCGA 3HIJA 2G96A 3VFLA 4YXGA 1TYGA 3NQAA 2QDGA 2OZ0A 3LBCA 6TIMA 1TPVA 1Q6OA 1KM6A 3I7QA 2JBMA 5D30A 1GJPA 4QNWA 1YDNA 3RFAA 4DELA 4UFIA 2QR6A 1FUYA 4HNVA 1C8VA 2B7PA 5F1UA 3WJZA 4JY9A 4IMFA 1SU5A 2VEMA 4TR9A 1AG1O 2CLKA 1F76A 3T78A 4IMCA 5AYYA 2ALDA 3RLUA 3NZRA 4LVAA 4Y90A 2QCLA 1NAL1 2JKPA 2NX3A 3N3MA 2WSYA 5BMXA 1XBZA 1GYLA 4JTTA 3H54A 1G6CA 1TREA 3NEVA 1XKYA 3EX1A 3P5ZA 4POCA 3LHZA 4O0KA 2E68A 3Q2DA 2RDWA 2YW3A 1EP2A 1O94A 3R8RA 3SZ8A 1EA0A 1K8YA 1GPWA 4L4LA 4Q32A 4FNTA 1K7FA 3NAVA 1I45A 4Z0SA 1EEPA 3AJXA 1OF6A 1QOPA 3GZ3A 4I7VA 3MBFA 4WX2A 3G1AA 1NVMA 1H7NA 2VELA 2Y7DA 3DAQA 3M7WA 3TFCA 2WNZA 2VKZG 4QITA 5I3GA 4ADTA 3SSJA 3NQFA 2I1OA 4YLWA 5CSRA 2C16A 3LCHA 1ME9A 3NL3A 2VENA 3UY7A 1VCVA 3DZ1A 3N2XA 5K9CA 3MP3A 3LXBA 3GAYA 5D04C 5HUPA 3S5ZA 2XN2A 5DY2A 4P61A 3MW7A 4PTNA 3GIYA 1PV8A 2Z6IA 5EBUA 1KLZA 3RLVA 4RR4A 3UWUA 2QCNA 5G4EA 2G95A 1ICSA 3LHTA 1K7XA 3KVLA 1OK4A 1GVOA 2DZUA 4MOZA 3CHVA 4NNCA 3GAKA 1NEYA 2Y88A 1S5WA 2B0MA 1M7OA 4O1AA 4IUOA 3EX2A 1ADOA 1TPDA 5I3IA 3W6YA 4AHOA 5TBOA 3WK1A 1VC4A 2ISSA 1S5TA 1F5ZA 1M6JA 2JGYA 4G1KA 3DBPA 3UWZA 3VE9A 2V9DA 3IIPA 4GUHA 4RX0A 3LB0A 4JDYA 1TB3A 5SWUA 3L66A 1GEQA 2E6YA 1KM3A 3QJAA 1HO4A 2CLOA 2R14A 5L6UA 2G97A 5D2YA 5F2MA 4H3DA 5E0KA 4XBKA 3TQVA 4HHPA 3ABSA 3LHWA 1KFCA 1VR6A 2ZRWA 3TROA 4LC6A 5DXYA 3NVTA 2ZZ6A 4MZ1A 4H6KA 3OHIA 3V75A 1QNVA 1J5TA 2FDSA 4XTDA 4MY9A 5AHIA 1W0MA 2AQWA 3K30A 2Y7EA 1FY6A 4PH6A 3EWBX 3G1HA 4UR7A 1LOQA 3PBWA 4LY8A 3DHFA 3I65A 1VLWA 1OFRA 2E5BA 3NL6A 2C0AA 3MHFA 2VEIA 3M16A 1OG0A 4XTIA 1E51A 3BK0A 1TPB1 3DFNA 2H3DA 2R91A 2Y62A 2X1RA 4O10A 1RZMA 1TCDA 2V2CA 4PCFA 4JR5A 2VFHA 4K39A 2NXHA 1FX6A 3HGRA 4LTSA 3W71A 3LV6A 2GPTA 2YYUA 4RV8A 2IQTA 3M5ZA 1YXYA 1L6WA 4RZ6A 2GOUA 1F6KA 1QFEA 1KV8A 4GC4A 4MY1A 4WUIA 3C2EA 3ZR4A 2ZTKA 4AEOA 1SR9A 4DPPA 1H62A 5D37A 4CNOA 2ZRXA 3IGUA 2V5LA 1JUEA 5G4WA 5F4WA 3FYOA 4HNNA 2CZFA 1PHWA 3T40A 1Q3NA 3IVTA 2FJKA 3H53A 5F4XA 4JD4A 2NUYA 3KVJA 2QCGA 3CTLA 4Y96A 3C6CA 5FESA 5BMWA 3A21A 2P10A 1KM4A 2Y6ZA 4RK8A 1BTMA 1QPQA 5LZLA 3TE9A 4PC8A 1Z42A 1WYIA 2X30A 2RH9A 4TIMA 2ZZ1A 2Y85A 2RDTA 1XUUA 3TJXA 5HULA 3S0CA 1IGSA 3GVGA 3M47A 3NQGA 1QPOA 3R13A 3S1UA 4JDBA 3FKKA 2YW4A 1ZAIA 2FLIA 5AHFA 2B7QA 3W7QA 3OIXA 3Q37A 3BARA 3UPWA 1FBAA 5A8GA 2W0UA 3QYQA 4O8RA 4GXMA 1ONRA 3LBMA 4CQ8A 3M5VA 3BW3A 3Q94A 5KZMA 3FJLA 4LT9A 5K4XA 4O4WA 3P7YA 4NNAA 3W87A 4AF0B 3H55A 5KITA 3HG3A 1LCOA 1JRBA 2ZRUA 4A2SA 2QCDB 1XDMA 5CPNA 2J88A 2X1SA 1QMLA 1KM5A 5AB3A 1ZAJA 1VHCA 3D0CA 3MBDA 1WOAA 4N4QA 4Z1AA 4WJEA 4JN6A 3NPVA 3UWVA 3QW4B 2YR1A 1LBLA 3CU2A 2C1HA 2JGQA 4FX6M 2CLEA 1PS9A 2EF9A 2XN0A 4AWTA 3EB2A 5MHBA 4BFAA 2VEKA 3I6RA 1FCVA 3GKFA 1OJXA 4AXKA 4QSHA 5FF4A 4YCPA 1FWNA 3FFSA 3USBA 3IVSA 2BLEA 3W7GA 4JYDA 2Z6JA 1LZOA 3STCA 2YFOA 4B5NA 3ELFA 2NWSA 3M41A 3TV8A 1XDLA 2DZPA 3NM3A 1SQ7A 3EWZA 3ZWSA 1HO1A 2ATMA 3G0UA 5D02A 2C15A 3GNNA 3PB0A 1H7WA 1M7PA 1RPXA 2QUVA 5HR6A 1D3GA 5LSMA 1UASA 3T55A 1A5AA 3SECA 4DF1A 3HG5A 2YX0A 3LGEA 1GG1A 2GUUA 4LRTA 3SGUA 3CIWA 3B03A 4ZL1A 2JKEA 1KTBA 5H91A 4UTUA 3N19B 1P1XA 4JYEA 4OQVA 3EX4A 1OFOA 3MI3A 1TV5A 3TXZA 1JQVA 1D3HA 4MYAA 5G1TA 5KMYA 1A5SA 2X2GA 1TPWA 5E93A 4LS2A 2NZLA 4O57A 1P5BA 2FPTA 2NV2A 3TQKA 2QCMA 3DXIA 2TSYA 4NJJA 2DJXA 2PRMA 5KSWA 1SO5A 1W5PA 3LHVA 4XQ6A 4YCOA 2Y61A 3PC0A 5C6MA 3PUDA 2E5DA 3GDLA 3L68A 3OA3A 3TDFA 5D05A 3QSTA 4O18A 2EGZA 1AK5A 1YPFA 3W2MA 2NUXA 1VYRA 4N6EA 3P84A 2EAWA 1FDJA 3G0SA 3CWOX 4JTEA 3BG9A 3THAA 4NJKA 1V5XA 3LCFA 3LRKA 4FEZA 4Q4KA 4MFDA 1G7UA 1H50A 3S6DA 2FPVA 1LROA 4DO6A 1I2RA 5FI8A 1GYNA 4A22A 3W2JA 1IXPA 3KVKA 4NX5A 1JULA 2Q8LA 1GVSA 2EKCA 5BRBA 3FA5A 4NXSA 4UFMA 3LTPA 4X3ZA 1FXQA 1VPXA 4N2YA 4M6QA 3EWUA 1W8SA 3QM3A 3WK3A 1H7XA 3STGA 1HG3A 1RQHA 3QFEA 3B0VC 1JUBA 2V2HA 2XN1A 4OU1A 1O4UA 5LNWA 4MLRA 1DVJA 3TSBA 2OT0A 5U7SA 2OMAA 4PA8A 2A1YA 3C2FA 4N9DA 3OEXA 1AW5A 3B8DA 3GK0A 4MZYA 3G1VA 1SZFA 1DL3A 4M7SA 5HMSA 3A24A 4NJIA 3LOTA 3KOFA 3N2MA 4JYFA 2C3ZA 4EVZA 1K3UA 3IIOA 4E2BA 1X8FA 1H61A 2YFNA 3BLEA 1SW0A 5DCEA 1TQXA 3E02A 1O5XA 2E09A 2QAPA 5AHMA 3C56A 3W23A 1OF8A 5DBTA 5FEXA 5FF7A 1U5JA 4ZVJA 3AO0A 3E49A 1YXDA 3TIMA 1W5OA 4LNYA 4K7VA 4O13A 1MEIA 2YDAA 3QMRA 5HUOA 1I2QA 1YDVA 3TNOA 1Z44A 2Z2UA 3GB6A 1I2OA 8TIMA 1A5BA 1VS1A 4IX2A 2RHGA 3W1NA 3HPZA 5CKSA 1MEHA 3BLIA 4RZ4A 4MFEA 5F2GA 5FF0A 2CWNA 2BZNA 3VE7A 4P2VA 1W37A 3B4UA 1SSDA 5D2TA 3SR7A 3KX6A 3W7PA 1GWJA 4EF9A 1JCXA 1G4SA 5LNVA 3W88A 2RDUA 3BG5A 1ZALA 4TU1A 3PSWA 4LU0A 5TIMA 3V1PA 4LOCA 4U28A 3DFQA 3ABOA 1W3NA 1EP3A 2E6DA 1F6PA 2YZRA 2JKAA 1XC4A 1HL2A 5C5YA 2NX9A 2H3BA 4LW7A 5FF2A 2E1DA 3PBVA 5LGZA 3M43A 4BWLC 5CZ0A 4IXHA 4FIRA 1VGAA 4NQ1A 4E2DA 1QO2A 3EWYA 4OHQA 3OVRA 4M6VA 5CPMA 3GX9A 3PG8A 3GLCA 4QJ1A 3PUOA 3LTSA 2ZRZA 2O7SA 1GVQA 4DQWA 1SZEA 4GUIA 1OX4A 3CPRA 3EXRA 3G1SA 1L6SA 2NUWA 2QEZA 1ME7A 1LM1A 4NNBA 2WSRA 3L5LA 1SSGA 1LORA 3W7EA 3A22A 3NQ8A 5AYZA 3LTYA 4BI7A 4PFMA 4PODA 1IXNA 1I2NA 1KTNA 3C4UA 3EEGA 5GVJA 4N6FA 4NT0A 1ZJIA 3INPA 4K38A 3UD6A 2DZTA 4NUWA 3W75A 4A3UA 2OJPA 3KRSA 5I3FA 1NF0A 3RF9A 3P8JA 3QSRA 3N73A 4NJGA 3EKZA 5CSSA 4CLMA 4IMDA 4JTKA 4NX0A 4AVFA 2GVJA 2V30A 5HR7A 4K6AA 4UTHA 4ORIA 3NOEA 5CZJA 5DCBA 5FEWA 3LRLA 3PY2A 4AAJA 5K2ZA 3OVQA 3NXFA 5LHFA 5D09A 4BI6A 3CEUA 3SJ3A 4RKAA 3O8AA 4XKYA 3UZJA 3VCRA 1KW1A 4ZQPA 3MYOA 3E12A 1N55A 4GUFA 4X2RA 3DHDA 4W9TA 1IF2A 4O1BA 5A5WA 3G3DA 1XBYA 4D2JA 3A23A 3I7SA 3RK8A 2HS6A 3C61A 4A2RA 1ZCOA 3BPWA 3R5EA 3FEMA 1UCWA 5HINA 2CW6A 4AMAA 3LXCA 1VJIA 6ALDA 4UTJA 5KTLA 1XUZA 3GDTA 2FB3A 5KZEA 3W7LA 3CB8A 1MZHA 4DF0A 2AAMA 2PRLA 3W70A 3EXSA 4A29A 4PL2A 4Z1DA 3UWWA 4Y8FA 1GT8A 2CLLA 2PE4A 1RVGA 1BKSA 1NFBA 4JIPA 3W2NA 3JRKA 4MKNA 2ZA3A 4KFPA 4MYXA 1N7KA 3WJSA 5HWMA 2CLIA 3L65A 5J5DA 4FNSA 3NR0A 5AOUA 3NQDA 1CI1A 3L0GA 4Z08A 1GQNA 2H90A 3DU0A 3N34A 5EA9A 3E0IA 3PAJA 1AW2A 1OX5A 1RR2A 3OBKA 1SZNA 3CM4A 4NU7A 3A5FA 4ONVA 2V81A 2ISWA 4UTLA 1J2WA 4ADSA 2GJNA 4JTUA 3CWNA 3TCEA 3G1YA 1H60A 1KFEA 2J9XA 3CEPA 1JR1A 3NYZA 3IVUA 2GVGA 3W7JA 1XBXA 1F2JA 3TR2A 3WK0A 1A53A 3WK2A 2C18A 3TX9A 1FCQA 1YTKA 4MJZA 2WNNA 3BV4A 3KXQA 4S1FA 3TAOA 2PCQA 1OFBA 4JS3A 4LVFA 2ZZ2A 4C1LA 4JY8A 1R2TA 3PULA 4K7YA 1JCNA 1OX6A 1UB3A 3W7CA 2X1TA 3DI0A 4WQ6A 2QF7A 3B04A 5CPOA 3TQ0A 4FX7A 4TX9A 1UUOA 2R8WA 3TMLA 1TSIA 3HOJA 4IMEA 3ABQA 1KFBA 4WXZA 2ZDRA 1EUAA 1VRDA 3NQCA 3P61A 1XFBA 2YSWA 1YTDA 1SO4A 3LDVA 3GDKA 3W1XA 3S8HA 3LRMA 3TU9A 1R30A 3L5AA 1M5WA 1VCGA 3M5XA 1K8ZA 4ZQOA 2E6FA 1DV7A 1B57A 2A4AA 3MO7A 3O05A 4DEFA 3NL5A 4R34A 4R7JA 5D38A 3CLMA 4DXVA 1W5NA 2X1UA 3W1MA 2CLHA 1I2PA 1X6UA 4O12A 1DBTA 4JX6A 5L9FA 2DP3A 1CW2A 3EX6A 5D03A 3ABRA 4MLJA 3BGGA 4AHQA 3TW7A 4IXXA 4JTHA 5F2IA 4K37A 2OCZA 4FNPA 4UR8A 5FF3A 4CQAA 3TXVA 1WXJA 3L2IA 2RKXA 1VH7A 3IIVA 4FNRA 1HUVA 3SGZA 2V0TA 4N9EA 3PUEA 2Y89A 3GKAA 4O15A 3TW6A 5C54A 3NQEA 4O14A 4IJBA 2YYTA 4QQ3A 3R12A 4RCXA 2B7OA 3L9CA 3PWAA 2D73A 2F84A 2NXIA 3TC7A 2Y7GA 1AL7A 5LKYA 3CC1A 3A5VA 4IWWA 2ZYFA 2V2DA 4QISA 4XWUA 2J6XA 1JCJA 1FWTA 2W6RA 3MI2A 3NDOA 2A5HA 3M1ZA 2ZZ3A 3IGXA 1XM3A 1EWEA 1ZENA 2CZ5A 4WOQA 1TTQA 3DFTA 3EKLA 4BK9A 3S5OA 5FEZA 1R47A 2YXGA 4RJEA 4HKPA 1HFBA 3O6DA 3B0UX 3C2RA 3HO8A 1ZNNA 4M6PA 3TKFA 3NQ6A 4WY0A 1G67A 1O95A 2E6AA 4UTKA 1EB3A 1TPC1 3LM7A 4UXDA 4AHPA 2F7FA 4O54A 2QJIA 3UXDA 1OFQA 2WNQA 3CQ0A 2J9ZA 3STEA 4FO4A 2VFIA 1ICQA 4GUJA 1Z41A 3IGSA 1MSSA 4UTMA 3T4CA 2QCCA 5K9XA 5C55A 3LERA 4Z1CA 4QAIA 3WJXA 4MY8A 5HQEA 3QRHA 2Q3OA 4ZMGA 3QMSA 3GR7A 1LDCA 4DPQA 5DXXA 1JUKA 3HGOA 3TJLA 2YPIA 3NO5A 4BR1A 4O53A 1TMHA 3NGJA 3NPUA 4I9AA 2FFCA 5G1YA 1WBJA 4DO5A 1RV8A 3B05A 1V7YA 4GUGA 3HB9A 1YPIA 2A0NA 3OG3A 2V82A 3G22A 5LGXA 3TMQA 1MEWA 1PE1A 4WY0F 1LBMA 1LTDA 5D2WA 1VCFA 1LRQA 3P67A 3KAOA 1KFJA 4OWGA 2ZZ4A 4O1CA 3W1PA 5KZDA 3G8EA 3HG4A 3IIXA 5DBUA 3MP5A 2DZSA 1ALDA 4H4IA 3PB2A 1TV7A 4UFJA 2ZQ0A 3DFSA 3JR2A 2ZRVA 3W86A 1R2SA 2OT1A 1T99A 2E77A 3PS7A 5I3HA 4A21A 5F4SA 1T96A 2OX1A 2Z0IA 3LCWA 3W1RA 2ZFAA 4K8EA 1IIHA 4UTIA 4ZQRA 4ZQMA 3S42A 1YTEA 5K3VA 4OV9A 2I9EA 1YADA 4IPJA 2NWRA 3NQ7A 1X1OA 5T26A 2Y70A 5DN1A 3FLUA 4RXGA 4N4PA 1PVNA 1WAUA 4ML9A 4QM1A 2DZVA 1AW1A 4PL1A 3L67A 1AMKA 1LOSA 1TRDA 2BX7A 5LNUA 3LLDA 4HIBA 3STFA 4O28A 2CU0A 5EPDA 3NPXA 4O52A 2Y7FA 4NVTA 2EPHA 3L0NA 1LYXA 5CG7A 1OFDA 1ZY9A 3LV5A 4WOZA 4AH7A 4GNJA 3W7DA 4ZQNA 1KM0A 3DGRA 4HT3A 3TUUA 1XXXA 3W7OA 3FS2A 3PBUA 4CNPA 3MP4A 4HPXA 4DBEA 4L4MA 3QPYA 1O5KA 4UTTC 2VFDA 1DQXA 1DJQA 1VQTA 4M7TA 5KINA 3UXAA 3P74A 1GTEA 2DORA 4LV4A 4TMBA 3U8GA 4AB4A 3GDMA 3G18A 3FJ6A 1OABA 5D2VA 3W2UA 1X1ZA 2ZA1A 1OYCA 4KWWA 3BVJA 3O6YX 5K7JA 2P0OA 3NQ2A 1WX0A 3KRZA 4FB7A 1KTCA 2VC6A 1RQBA 3NNTA 3W7MA 1ZAHA 5AHLA 1H5YA 4JXCA 1KM1A 1DJNA 3ZFHA 1TV8A 1FCUA 4CQ9A 3QQ1A 4M5PA 4C1KA 4JTIA 3C2OA 4JTSA 4JTFA
chains in the Genus database with same CATH superfamily
2OSXA 1CLXA 4J9JA 3GH5A 3NXLA 1Z89A 1MFVA 4AWUA 3VC6A 3BW2A 1P0NA 1IIGA 3B9OA 2EHHA 4Q3MA 1EWDA 3I68A 2HTMA 1F73A 4YNGA 2JALA 1K03A 3GUGA 2XIMA 2AKMA 1I0DA 1W3KA 1SJCA 1KD0A 1TA3B 4Y6GA 3RO8A 2D24A 1OQFA 3EWDA 4WEVX 2QULA 3R2GA 4PCNA 3NOYA 5D2XA 3ARUA 3RCMA 4ZXLA 3AOFA 2GJLA 3NZQA 4HCLA 9CGTA 2VOTA 2FDMA 2GL5A 4OOZA 3SY5A 3R0KA 2VEGA 3IJDA 4MUPA 4CNTA 1RQEA 1UP0A 3NG3A 4H00A 3NSMA 3UG4A 2EG6A 1DOSA 5LYRA 2XUCA 3IJ6A 4MDPA 1EPXA 3CMFA 2J24A 2GQ8A 1E56A 1JCTA 1G5AA 2GQ9A 3VIOA 3SO7A 2BV9A 4UQDA 1QDSA 2DZAA 3BMWA 3PSVA 3A3HA 2BOFX 4HK5A 2WLYA 3U7BA 1H5VA 3P82A 1EUNA 3ZS4A 3BGAA 1CGTA 1CIUA 1VYPX 4NASA 3PVFA 3NQVA 3CNYA 5HQMA 5FOOA 3BC9A 5CC5A 4JZ5A 2I14A 4DY1A 3TH6A 3VGHA 1Z8AA 5CJMA 1LBFA 1QHZA 4W5ZA 1E6NA 4XZHA 3WQPA 4FNQA 4XZLX 3PZOA 3MWAA 1HF6A 2Y5EA 5I09A 3W85A 5G2HA 2QMKA 5K9DA 4PEEA 1H7RA 3OBEA 4JTLA 2WSQA 4KFOA 4HJWA 3DC0A 2VNCA 4MVAA 1MXDA 3W1TA 2YIHA 2V5DA 4LV9A 4KS0A 4LF1A 4XUGA 4GQRA 2GVLA 1E9YB 4V1XA 2VCAA 2VRJA 1KB3A 3TJ4A 3VNLA 3GH4A 4OECA 2VC7A 4J2MA 4NF7A 3W00A 2I17A 2JFEX 4FHAA 4L4OA 5RUBA 1VFTA 4FXJA 1VIZA 7ODCA 2ZTJA 3W07A 5CLWA 4IGHA 3QPZA 4GRSA 3W7HA 1TPEA 3KZSA 2V38A 4B16A 3QH2A 4PEKA 1DWGM 1JD9A 3EXTA 1FWJC 2XM2A 1TIMA 4E6MA 4IGMA 3THUA 2PDCA 2X16A 4PB4A 4LUYA 4O17A 1TPUA 1TJRA 1E3ZA 3SW6A 2DT3A 1A80A 3U0HA 1YW1A 1ZP3A 4NAFB 1LG1A 1J0HA 5E70A 2BGQA 3U5YA 4QNEA 4RW5A 3T09A 1UZ1A 3GNOA 3VOGA 1JZ5A 4J3ZA 1UWQA 2DU2A 3K4DA 3BLPX 2DIKA 1E3XA 4Z1YA 1PBGA 4X61A 1A5CA 3H23A 5CLTA 2HMCA 3QYSA 3UCDA 4D6JA 2OLHA 3VD5A 3E96A 1GHRA 1W9DM 1X6LA 4TTUA 4A6GA 3UW6A 7TIMA 1Q6LA 1EOKA 4IP4A 3W26A 1IWPA 2AGKA 2CZEA 2J27A 1NF7A 3GYEA 3SUVA 4QSFA 4HSOA 1K9DA 1JYXA 4ATDA 3PR2A 5M1TA 1OFEA 2XIQA 3L4UA 4NYUA 2OPJA 4HSNA 2ZUSA 2VJXA 3UWYA 3AHYA 1IXOA 2QV4A 4DJDC 1UYQA 3HFTA 1R3WA 4L1WA 2WV8A 6CGTA 2XVPA 4PBGA 2UWFA 1F6YA 3G5EA 5LNSA 2Q3RA 5BOOA 3N9KA 5CPLA 4E4FA 4YS1A 3GHUA 4KWVA 3RU6A 1HL8A 1XLBA 1IGWA 3U2OA 3ATZA 1THFD 2QUTA 4UC5A 4RNJA 3BLOA 1SUXA 1RP9A 5T91A 4LWWA 1TVPA 2OO0A 2BS9A 4GIYA 4ZEPA 3CT7A 3QBUA 3RJYA 3O16A 4V1YA 1WNOA 2A21A 2WQPA 5D8ZA 3JU2A 2QF8A 4C6KA 2VGIA 1E71M 1A4MA 5BWAA 4G7FA 5AYXA 1YYAA 1X7FA 1JJKA 3GXPA 3LSCA 4PGLA 1OBAA 2W61A 4JOMA 2DSVA 4NXKA 2R6OA 3AJ7A 3MDUA 5IOBA 3VOHA 3CUGA 2VX4A 3ES7A 4P8WA 3WJYA 2W3ZA 1UZ4A 5I3KA 2YL5A 5TQLA 3TAKA 1Y7VA 1XG3A 3JS3A 5HMEA 3OQ8A 4K1GA 4WLCA 1B90A 5I07A 3ZMRA 1DKWA 4EOUA 1XH2A 3FSTA 1WZMA 4ZZ9A 4ADUA 1W8GA 5FSEC 3ITCA 2DPEA 4FPSA 3CPUA 3VDCA 4B2DD 1BYDA 4IFRA 5EL1A 1W1PA 1TPFA 5H6HA 4TX6A 3C3UA 3BJFA 4MB1A 4TMCA 2R1KA 1C8XA 1WZLA 2G3MA 4UNLA 2QKFA 4FF7A 2VFEA 2VZVA 2EJ1A 4DYEA 3TEVA 2ZCGA 3QLLA 2OQHA 1U2YA 4D6GA 3GR8A 2RFGA 4UB9A 5BU6A 4O1DA 4F48A 2ZRYA 1Q7ZA 4JICA 3EMQA 1N8FA 3UPMA 3LM3A 1ISWA 2NV1A 1LUCA 3MVIA 3HMJG 1CXEA 2QIWA 1YQ2A 1W2PA 1MQPA 2CFFA 1KCXA 3AWOA 1BXNA 3C3NA 2A6NA 1KXTA 1FWAC 2HPIA 2WM0A 3E5PA 3LI0A 1QNPA 1EXBA 1XLKA 2TPSA 3LENA 2Z1VA 1BWLA 4UWMA 1TPH1 4XG1A 2X7VA 4H9MA 2SFPA 3C5QA 3IJ9A 1ZFJA 2KX9A 1HKVA 1XLAA 4GFSA 4A8IA 4E2OA 3GIQA 2QJGA 1MFUA 1EYWA 2FZDA 2PMQA 1MUMA 3NPWA 1DJZA 1PKNA 3OLGA 4ZOCA 5IBXA 4GJ1A 3S9IA 1P0KA 2ZE3A 4U10A 2XGZA 3BLDA 4P8XA 3IRDA 1ONXA 3W0KA 3B8IA 1OCQA 4Y9AA 3GNXA 4R33A 2PLJA 4YWIA 1G01A 3GFZA 2XIOA 1OYAA 1V6VA 3T0CA 1FWSA 2HISA 3P5YA 1B9BA 1E5JA 8CGTA 3VO0A 3DFOA 1U33A 2PUZA 4PRWA 5AC7A 1ZP4A 3G1XA 3ZVHB 3UZYA 2FVKA 2W79A 1KCKA 3WBWA 3HGSA 2DSKA 3QHNA 1G7VA 5I00A 2VUNA 4ZB5A 4QHRA 1YXCA 4YMZA 3WMBA 3R58A 2XPKA 1CCWB 1VBGA 2BWGA 4GO9A 4L65A 4HZ6A 3ITXA 2VOMA 1TX0A 3ZJ8A 3HPSA 3RUBL 4R3UA 1PL9A 2W9MA 3WDHA 4JX4A 4GBUA 3VZZA 1H7OA 3VIPA 4NZJA 3KUMA 4MM1A 4E5TA 1I8JA 2ZKMX 1US0A 2HROA 2VGGA 1U1HA 3OQEA 2OZ0A 1KM6A 3MV01 4CD6A 2JBMA 5D30A 4QNWA 3RFAA 2UY2A 1FUYA 3GU2A 2G3IA 3B9AA 1VRXA 1WKFA 3TN6A 1L0PA 3VIFA 4A3RA 1VBJA 2ZUVA 1F76A 1GYMA 4IMCA 1EHNA 1TR9A 4NZ3A 4LVAA 2P8BA 4S38A 3PZUA 1JYVA 4HN8A 2NX3A 1UKOA 3CK5A 1N8IA 3NEVA 1WAWA 4Q8MA 5BU9A 4WVXA 3P5ZA 4POCA 3LHZA 3SQMA 1EP2A 1ZJAA 2BOGX 4N42A 3DFYA 3V36A 3NAVA 1I45A 3AJXA 4GGHA 3GZ3A 1EGMA 4WX2A 1NVMA 3ZT6A 2VELA 2ZXDA 1UD3A 3DAQA 5CAKA 1E0VA 2WZTA 3AYRA 3PJWA 1GQKA 1QI5A 3WH9A 4H19A 4URIA 4F40A 5BYWA 1V6YA 3LCHA 5DX7A 3GG0A 3IV8A 1E0TA 3B8SA 1RJQA 3W24A 3T2PA 3MP3A 1F07A 1KRAC 1EC9A 4FAMA 1NFGA 5D04C 5HUPA 1OC6A 1UHVA 4P61A 1I75A 1AH0A 3MW7A 4Q6XA 3B9NA 3GIYA 1HT6A 3WNPA 2J7BA 3UWUA 1MUWA 3QV9A 1OK4A 1GVOA 3GAKA 1NEYA 2Y88A 1XRFA 3LPGA 4C7DA 4AY8A 1K4GA 1TPDA 3UETA 1XC6A 1F5ZA 3SN4A 1RALA 5A1AA 4G1KA 3UWZA 4AQLA 3IIPA 1LF1A 2VL4A 4QROA 5LIYX 1MXGA 4M1RA 5BRPA 5H1WA 3L66A 2VDHA 5C9RA 2E6YA 1KM3A 3QJAA 1HO4A 2DV0A 3AIEA 5L6UA 2AQVA 5ABFB 5F2MA 4H3DA 3E74A 3TQVA 3PZNA 1VR6A 5DXYA 5D8WA 4RW3A 4GY0A 3OHIA 2O9RA 2AMGA 1V7AA 4XTDA 5JH1A 1R38A 5ECUA 3CL7A 3CMGA 2Y7EA 2XSAA 3G1HA 4UR7A 4GK8A 1LOQA 2OYMA 5HBFA 3DHFA 3I65A 1VLWA 1OFRA 2BVDA 2PF0A 1RK5A 1VFMA 3EGJA 4FP1A 1CLKA 1OG0A 1E51A 1TPB1 4FOKA 2V2CA 3MB9A 4JQ4A 4AEFA 3KWSA 4DIAA 3ZT5A 2YB1A 2YCLB 2YYUA 1YXYA 1L6WA 2F2KA 4FLOA 1F6KA 1QFEA 1Z6KA 1QHOA 5E9AA 3H4XA 1RXOB 1EPVA 1NDZA 4KF1A 5A8QA 1EBHA 1H62A 1S39A 1J0JA 4ZA0A 2E9LA 2V5LA 5GJPA 1JUEA 3MZ2A 1JDFA 2CZFA 4DI9A 2BXZA 4JD4A 4AY7A 6A3HA 1JD7A 2OKOA 3CTLA 1V6TA 9XIMA 3C6CA 1AUSL 1UQZA 3J7HA 5BMWA 3QHMA 2Y6ZA 2NQ9A 1IV8A 3QY7A 1EL3A 5LZLA 2XDFA 4RE0A 2FYMA 5F7UA 2Y8VA 2X30A 3GHRA 2AKZA 5AECA 5HULA 4IIFA 1C8QA 1AFSA 3IUIA 3L4VA 2I9UA 4JDBA 5KZ6A 3FKKA 3ANUA 2YW4A 1ZAIA 2B7QA 4GD0A 3EOLA 1H0IA 3Q37A 3BARA 3VZYA 2FGLA 2BY1A 2F6UA 4O8RA 4GXMA 3BW3A 4J35A 5IXEA 4LT9A 3P7YA 3HG3A 3W27A 1ZBWA 3PPHA 2QCDB 2J88A 2X1SA 4FK9A 1UZDA 1ZAJA 3ARQA 4W86A 3RPTA 3MBDA 3UR5A 1GGOA 3T08A 3NPVA 3H7VA 3WUBA 1DJIA 3AU2A 1LBLA 4ZO7A 2WWCA 4B2DA 2CLEA 2XN0A 3LPPA 4Q6JA 7A3HA 4W84A 2JF7A 2OODA 3OZMA 3GZAA 1V77A 4WHBA 1XH1A 4J5NA 2BLEA 4JYDA 2Z6JA 1LZOA 3ELFA 3M41A 3GDBA 3NM3A 1SQ7A 1UUQA 4PUMA 2E8YA 2C15A 4C5YA 3V1HA 1IZJA 4M29A 2XFYA 1M7PA 1RPXA 1JPMA 5HR6A 1DWIM 1D3GA 4LCQA 1C93A 4LUTB 1UASA 1A5AA 2W62A 2DUAA 3WQ5A 4DRSA 2WSPA 4C91A 1GG1A 2PZNA 2GUUA 4GABA 2H9AA 3IK2A 3ZIZA 5HMDA 1W1IE 3N19B 5JIWA 4NIRA 2Q71A 3R43A 2OZTA 4YHEA 9RUBA 1A5SA 4BQ2A 2VUYA 2X2GA 1TJ2A 1JPKA 3P3BA 1S3TC 1XPGA 3R8GA 3RM9A 5A6SA 1CECA 1AH4A 1Z9AA 1EYEA 2PRMA 4YCOA 1A49A 2A3BA 2V63A 3RM4A 4QLLA 1O7AA 2E5DA 1NARA 4JTRA 3CV1A 3L68A 1MW0A 3OA3A 2NVDA 4A3QA 3RO6A 2OX4A 5D05A 3W2MA 1VYRA 3G0SA 3BG9A 4GHRA 1NM9A 4NJKA 1H50A 2FPVA 1LROA 1I2RA 3NUKA 2CIPA 3N29A 1GYNA 1JZ7A 4DWSA 3PNUA 2CYGA 2Q8LA 1KXQA 1MMFA 2PWVA 2EKCA 2AL2A 4Z2GA 3UVIA 1NOUA 2CBJA 3EPNA 4UFMA 4L1GA 3SCVA 4U5KA 4GI8A 3EWUA 4ASTA 1AZ2A 1W8SA 3QM3A 3AIWA 1H7XA 3N4AA 1I6NA 1HG3A 3QFEA 1JUBA 2D3NA 5GNZA 1BSLA 3GY1A 2GVYA 1RHCA 2HE8A 3LQGA 1PEZA 5U7SA 2G3FA 2J78A 2FZBA 2ZXQA 4P7RA 4MZYA 3GK0A 3G1VA 1SZFA 4M7SA 2VR5A 5HMSA 3A24A 2JE8A 3SCTA 2C3ZA 2E4TA 1K3UA 4GMEA 3BCFA 4JEJA 4DJFD 2ACQA 3RYSA 1DQUA 4S3BA 2E09A 2QAPA 3MMDA 1YIXA 2PP0A 3W23A 5FEXA 1JAKA 1U5JA 3AO0A 3E49A 1W5OA 2ZX8A 1YE6A 1CDGA 5LA1A 2YDAA 3PZVA 1BXBA 1I2QA 4U31A 3TNOA 1Z44A 9XIAA 3GW0A 3GB6A 8TIMA 1GPFA 4IX2A 1H41A 4FSAA 2O4MA 4RZ4A 2VVNA 3EA1A 2P50A 3WDIA 3ME3A 3VE7A 3K1DA 3AXKA 4S3CA 3E2SA 3KX6A 4L9XA 1GWJA 2C0HA 4EF9A 2CBIA 1FA2A 2RDUA 1ZALA 5TIMA 3DFQA 3OOQA 3GVRA 3QFWA 4C5ZA 1XC4A 1HL2A 1QBAA 1EKOA 2PSNA 2H3BA 4LW7A 5FF2A 4ERIA 2XTKA 3V4BA 1CPUA 4E2DA 2E3ZA 4GI6A 3GWQA 4Q7NA 3UXIA 3OVRA 3MV11 3W82A 4M6VA 2CPUA 5CPMA 1A5MC 3GO2A 3BLKA 3PTKA 4R7WA 3KBMA 3BSGA 4KWSA 3VD4A 3DFHA 3SCPA 5I3DA 3RR4A 3LS9A 3CTTA 1SFSA 4MADA 2NUWA 2QEZA 4LCRA 3GTXA 3KCOA 4NNBA 2WANA 3TONA 3T0TA 3L5LA 2YKKA 2J25A 1XCXA 2BHYA 3NQ8A 4A35A 4D6IA 1KTNA 2A3CA 4NT0A 3INPA 3UD6A 4ECLA 4KEMA 1EC8A 3W75A 4A3UA 4Z42C 3RF9A 4JHMA 3P8JA 3QSRA 1UD2A 1BFNA 5CSSA 4AVFA 3W28A 4CNUA 1W6TA 3AROA 3ISIX 3PY2A 1O1HA 2CBUA 3COTA 1LL7A 5K2ZA 5D09A 3U4FA 4L56A 1UA7A 1XIHA 3U57A 1VFUA 2X0SA 1VFOA 4ZQPA 1B3VA 2ON3A 3MYOA 1IR2A 4AX7A 1EJTC 3V0TA 4DYKA 1ZTVA 1IF2A 4X2PA 3SCNA 4D2JA 1L2QA 3C61A 1WP6A 3B97A 1TG7A 1UCWA 5HINA 4XZNX 4R88A 4AMAA 3LXCA 1VJIA 4IL0A 4UTJA 4B90A 1PWLA 1GZJA 3W7LA 3CB8A 2EEXA 1R87A 2PPGA 4BS0A 2J66A 3W70A 2IS7A 3GUWA 1CLVA 3UWWA 4Y8FA 5BOEA 3UA4A 1ZUAX 1NFBA 1GK8A 3JRKA 3E38A 4ICCX 2VQTA 4G5DA 1Z32X 4KFPA 4MYXA 2GUBA 4MPKA 5REQB 5AOUA 3LN3A 2BHZA 1G9HA 1XYLA 1DE6A 1ITQA 4F0RA 5D9NA 3N34A 1AW2A 4UCFA 1LWIA 1Q13A 2F38A 3A5FA 3CAKA 4ONVA 1BYCA 4ADSA 2EXOA 2GJNA 4JTUA 3CWNA 1I1WA 1H60A 4OBSA 5IHRA 1JR1A 1E1EA 4NYYA 4S3GA 3AISA 4LBRA 3CYVA 1EBGA 3WQCA 3O7UA 2G4FA 1H4PA 2PTDA 1Y5VA 2C18A 1W1TA 1A5LC 4MJZA 4MB5A 4S1FA 1ZBCA 2PTWA 3TYAA 1OFBA 3N2BA 1UMLA 4JS3A 4C1LA 1OX6A 4JCMA 1IEVA 1QOXA 2ZX6A 1MUCA 4GI9A 3UG3A 1E1CB 3S6TA 1Z7AA 2ZDRA 3L4XA 1EUAA 4NP7A 1XSKA 3NQCA 4BA0A 1K70A 3NJ3A 4V28A 1K77A 4Y9OA 3S83A 3W1XA 3AU6A 3L5AA 4CQBA 3M5XA 2WZHA 3V0SA 3RN6A 2BY3A 2A4AA 4IPNB 3Q67A 4R34A 3IJIA 2OR2A 5D38A 3WDJA 4BY3A 3W1MA 4NRRA 2QDDA 4V27A 4IMAA 2DP3A 1EX1A 1JZ6A 4F2TA 3FDGA 2D20A 4MLJA 3BGGA 3WEMA 3KDOA 3BWWA 2QNEA 1UWIA 4KBXA 4JTHA 1W9VA 4FNPA 1A47A 2PDNA 1DTUA 3TXVA 1JEZA 2V67A 3IIVA 4JHZA 3U2CA 2ZXBA 3LNMA 4FNRA 1HUVA 3UCCA 4WK9A 2Q8XA 4N9EA 3NQEA 4O14A 4QQ3A 3R12A 4RCXA 2B7OA 2D73A 5I03A 4R7OA 2QGHA 2QJNA 1XLEA 3N2TA 1AL7A 5LKYA 3A5VA 4IWWA 3PFRA 4XAZA 1K6WA 2FTWA 5LIWX 4XWUA 1UR1A 4JN8A 1S2UA 4L5ZA 4QEEA 2WHKA 2ZZ3A 3GD6A 3AAMA 2CKSA 3EKLA 3S5OA 4E4PA 1R47A 1XIDA 2QV5A 4RJEA 5FJOA 1H2JA 1HFBA 3BDKA 3B0UX 2PGWA 1QNQA 2O0TA 3HO8A 1ZNNA 4NZ4A 1HL9A 5FJIA 2D2JA 3TNBA 2PDXA 1EB3A 1TPC1 3LM7A 4UXDA 3UJRA 3STEA 4HZ8A 1Z41A 3SIMA 4JFUA 4MAVA 3T4CA 2QCCA 4PCTA 4QAWA 2WVTA 2ZX7A 4YVPA 3CUXA 3QRHA 1JAEA 2Q3OA 4CU8A 4ZMGA 3CH0A 2RUSA 3GR7A 2Z27A 4H6QA 3VA8A 1JUKA 2Y24A 3ARSA 4ZFCA 1TMHA 3GTNA 3NGJA 1IR1A 3LGDA 4CQCA 3W25A 1VFFA 5G1YA 4DO5A 3B05A 1V93A 2BY0A 3D5HA 2BODX 1V7YA 1A5NC 1YPIA 1N2VA 1HGYA 3O2LA 4BHYA 1UKTA 2VCBA 3SJNA 3TMQA 1PE1A 1LBMA 1LRQA 2CXGA 3KAOA 4XSLA 5KEZA 2ZZ4A 3DYMA 3FY1A 3WD4A 4KESA 2P3EA 4G56A 3G8EA 3EWCA 4JFWA 1BGAA 1ALDA 4EE9A 4GKLA 1M7XA 2ZQ0A 6REQA 4A21A 3AHTA 5F4SA 3U3HA 1T96A 3QR1A 2D3LA 3W1RA 1R0MA 4B3LA 3MS8A 4ZQMA 3S42A 3KBNA 4ZSUA 5T26A 2Y70A 2PDJA 3D6NA 5I0DA 4QM1A 4JNZA 1LOSA 4GJJA 3AS1A 4UQBA 2BX7A 4AD4A 4YYFA 3GNRA 3ZYZA 4O28A 4E8CA 5FL0A 4LYPA 4HA4A 3QXBA 4XISA 3GQYA 3NIYA 3WYZA 7REQA 4DUVA 3W7OA 4GY1A 2QUMA 3LZ3A 2IXUA 3CT2A 3MP4A 4DBEA 2WPGA 1O5KA 2VFDA 4XAYA 3SY1A 1VQTA 4M7TA 1FFRA 4DZ5A 2DGAA 1GTEA 4LV4A 4NY2A 4TMBA 3GDMA 3TYZA 3SGGA 2OWCA 4JCLA 1X1ZA 2BFGA 1MQRA 4KWWA 3MWCA 4I9TA 1TELA 1BQGA 1WX0A 4PUUA 1KTCA 3CLWA 3AS2A 3NNTA 1H5YA 1YKWA 2OWWA 1W3HA 2J8TA 3QQ1A 4QDWA 3S1WA 5HNNA 2WOQA 1TO3A 1J12A 3IWPA 5CQ1A 2DW7A 4TTGA 8A3HA 5C2XA 4HYVA 1WBHA 2PDKA 5C0QA 3NA8A 3IPWA 4H9XA 4BQ3A 1J01A 1K9EA 3CAQA 4XAFA 1JG9A 2JQXA 1WDSA 1ZZMA 3O0KA 5AVHA 4IQLA 1RD6A 4O0ZA 3WNMA 4X22A 3WY1A 2Q8ZA 3BAJA 2OYLA 3TSDA 4JIHA 3RCNA 4L6HA 1JZ3A 3Q45A 1L6YA 3SUTA 4WDWA 2R1MA 1TV4A 1MXSA 3TN5A 1P4CA 2V5JA 2XSXA 4BF7A 1PKMA 2HBVA 4KQNA 3BAKA 2ABAA 4DJED 4GVGA 3VOJA 4AZBA 3N3TA 5LA0A 1P6CA 3UR2A 4MB4A 1VZWA 5IFTA 4FXRA 5EY5A 2VMFA 2BXVA 2IW0A 2BNJA 1LG2A 3RLHA 4P5UA 3AXMA 1PTDA 3AXXA 4W93A 2BGNE 3FKRA 2WMIB 2QMJA 3B40A 3WIJA 4KETA 3RM8A 4MZ8A 3G1DA 3W7NA 2A6LA 1V0KA 4O8AA 3M0XA 4WZHA 1UH2A 1G4PA 3I6TA 3I6EA 3T0AA 2C8NA 1XGEA 3KP1A 1WDWA 2XZ9A 4IQEA 3W74A 1OHLA 1XLDA 5DY3A 4LUJA 3RNDA 3MHGA 3WF0A 3PZ9A 2OU4A 3CIVA 1U5VA 4IJCA 1UR2A 1E43A 2GJPA 3LUTA 3DBNA 4A3YA 4AIEA 1V03A 3W1QA 3EAUA 1JXJA 3BOLA 4FX8A 4KFNA 1KRMA 2O9TA 4LVDA 5BXRA 4CCEA 2V8ZA 4S2BA 3MU7A 1FKXA 1UBPC 2E25A 3UY8A 3SRDA 1OX4B 1PSCA 4QFUA 1ONEA 3SQLA 1LQ0A 3L7RA 4S3EA 2POZA 4PZVA 1ODUA 1D9EA 2VI0A 3DFPA 1GQLA 3HURA 3H26A 2FQIA 3THQA 1KBIA 1GORA 2GQ3A 2VEPA 3L0KA 4CCDA 4M80A 4KEVA 3IEBA 4C1NB 4FXSA 3MJMA 4LGXA 4AUBA 4AIUA 1U1UA 4QJ3B 2CHRA 4TOQA 1SO6A 3B06A 3Q4DA 3WQ6A 4ACZA 2YXXA 1E0UA 3KM8A 1UUMA 3W7RA 1BWKA 3QC3A 4KCWA 2MANA 1TV2A 1WOBA 1GOXA 4FIQA 3PPGA 4NAEB 3DIPA 4MJ2A 1BKHA 3CV6A 4UR9A 4U2ZA 4XKYB 2HVOA 2ISFA 3ZLFA 1OFPA 4CVWA 3CV2A 3UU0A 4O50A 2VFFA 2CBVA 5HAOA 4REQB 4IQJA 4K8HA 5I5RA 2FMNA 4EIVA 3JUGA 3FOKA 3LCIA 1Z48A 4JNMA 1IZCA 5CAHA 4QE4A 1V02A 4UFHA 4RZBA 3L5MA 4DO7A 3G6MA 1JCLA 1Q5MA 2PURA 3ZO9A 1KM2A 4AVOA 5G2WA 4N9CA 3GXMA 2DZWA 1J18A 3K8KA 3S5YA 3C0JA 3CWHA 3ZXWA 1WV2A 2DZXA 2A3HA 3DERA 4P8VA 3H2MA 3WMLA 1UWRA 1DWHM 5GNYA 1LOLA 3C0SA 4U33A 4C7GA 3W72A 3CHDA 1ZJBA 3KL0A 1KA9F 1Q63A 3BO9A 1NY1A 3RGTA 1W54A 3UWQA 1S2TA 4GINA 2WKGA 4CD4A 1V08A 1O1ZA 2QDHA 4JTAA 5DCDA 3F7JA 1FXPA 1WB0A 4Q7IA 4EWND 1D8WA 4MGGA 1AJ2A 4QBXA 1GQIA 3FIGA 3CS2A 3CYJA 2ABBA 4HGXA 4XZMX 1C9DA 4O11A 1VYSX 3E1F1 4EF8A 1XLJA 2PRHA 2C19A 5LNRA 1GVEA 3MCOA 1BXCA 2PWEA 4BZYA 3STPA 4MWAA 3ARZA 2PD5A 4HA0A 3EDKA 3ANYA 3TYUA 1BAGA 4LUSB 3P81A 2DJLA 1YNQA 3DEQA 4QEHA 1MW3A 1CXKA 3M6YA 4K3ZA 3RMJA 2FPYA 3DDMA 2QYGA 1GVIA 1QT1A 4Y8EA 4M56A 2D2HA 2NSXA 3WX7A 1HKWA 5G2IA 4AZGA 2VURA 5AC6A 3H6OA 3MUXA 4QS6A 1EQCA 3CAVA 3UBPC 1TV3A 4GIEA 5IFPA 3MJYA 4HTYA 1N82A 4DZHA 1ITUA 1BRLA 1UJPA 4AZ6A 3HQNA 1B30A 2YB4A 3USZA 1R2RA 2CHNA 5U4NA 1CTNA 3L4WA 1SZGA 4JNYA 1NU5A 5EBAA 3TC6A 4UTTA 3AMLA 3W2LA 5B7YA 3EMZA 2D2GA 3KOXA 2R1LA 3S2JA 5JIPA 3UZ5A 3VUSA 4OGZA 2P0IA 1JYWA 4HYWA 2QW5A 3M0LA 2E0PA 3SN1A 1BSIA 2WVVB 5C7HA 4IOTA 4K2SA 3W7IA 3BZGA 1KFLA 3XINA 3ARVA 3VIMA 1LRTA 1K1DA 2FJUB 4WDTA 3PZIA 1UD5A 3UNDA 2X2YA 3HJZA 2WZMA 1E9ZB 2E5CA 4KCUA 1G4EA 1SO3A 2IXVA 4WRHA 1F3XA 1KQZA 5CBJA 3P6LA 1EJWC 4WSHA 3G1FA 4E3VA 3N12A 4ML4A 3S2LA 3PF3A 1Y5WA 2J4GA 3TTOA 4ZE5A 3O1NA 3ZR6A 5E1QA 1W56A 4MJMA 4ICNA 5DRCA 4ES4A 5PTDA 3VINA 1Y0EA 2HZGA 4BWLA 3AYTA 1PYMA 1YHTA 3QR3A 3WENA 4S3FA 4Q4OA 2X7WA 3ERPA 4D8ZA 4LQ1A 3Q58A 1F3WA 3BLFA 4G7EA 3ITTA 3CPGA 3T44A 4XZ9A 3BICA 5CH9A 1YE4A 1AL8A 2HQAA 4X9YA 3F1QA 4JHOA 4Q8PA 1A50A 2O9OA 1VIWA 1XLHA 2PEVA 5DFAA 1M53A 3HPXA 3LLFA 1W1ZA 1UC4A 2LLEA 2VZOA 1TQJA 1HX0A 5C9ZA 1KBJA 3AZTA 1JCMP 5BROA 3I4EA 5ECVA 2Y5JA 1HKIA 1TTIA 4ALDA 2TYSA 3AIQA 3LD5A 5CSYA 1S2AA 1XKJA 5A6JA 4LUIA 1KWKA 1UROA 1WZAA 4DX3A 5CZTA 2J77A 2VZSA 3T7VA 4RL3A 3F03K 2YDQA 1OYBA 3KWXA 1SGJA 2G8ZA 1FH7A 1IEXA 2GGIA 4CKQA 2B31A 1K8XA 5EYWA 1FVPA 5GPRA 3VCNA 3S1GA 1KR0A 1W3LA 3KBSA 1Q7QA 4CNSA 1LL4A 1XRSA 3G3MA 1JCYA 3WSUA 4LRSA 4AZ5A 1EFZA 4C6OA 5LHEA 1R8LA 4OTKA 3RMEA 2IPFA 4ATLA 4V33A 3XIMA 3OHMB 5FEPA 4F0MA 1J0KA 3RIKA 3IJ7A 4GE8A 5I02A 3WLNA 2XSBA 2IPJA 5CCZA 3RITA 1MVYA 4H7VA 2QDEA 3MMUA 4MAZA 2QCFA 1ZU8A 2AAAA 3MKCA 3S5NA 4DJFC 2PGFA 1MYRA 4TXEA 3MSGA 2G96A 4YXGA 4TV6A 3NQAA 2E67A 3CUFA 3LBCA 1P7TB 2ZC8A 1Q6OA 1WXYA 1V3MA 3REQA 1YX1A 4MKSA 2V69A 4HNVA 1HW6A 3TYCA 2B7PA 4KCVA 4LNCA 3EDEA 3P93A 4B4FA 2VEMA 3AS3A 2CLKA 2Z7KA 4UQAA 4DNHA 3UXKA 3ZJ6A 5ABHA 1XYZA 4OBRA 3SFWA 4M24A 3KE0A 3S2MA 4INFA 2XGBA 1EQPA 1KRBC 1US2A 3N3MA 3NZPA 4M0XA 1CGVA 3UJFA 5BMXA 1XBZA 3GG7A 4JTTA 3H54A 1G6CA 5E5CA 1TREA 1D8CA 1XKYA 2XISA 2FKPA 2O9PA 3W6MA 1K8CA 3MSYA 2ZADA 3BQ5A 4GQBA 2YW3A 3RAOA 1PUDA 4GYKA 3SZ8A 1GPWA 5BOFA 4Z0SA 1EEPA 1OF6A 4GC3A 4I7VA 2J75A 3MBFA 3BCJA 3R1ZA 4QR6A 2OB3A 2CESA 3TFCA 1DWJM 4QITA 4F66A 5I3GA 5A95A 3O9NA 4YLWA 5CSRA 1V3IA 2C16A 1ME9A 2OLAA 3NL3A 4Q8QA 3DZ1A 3GSMA 2GK1A 3GAYA 3FK4A 2XN2A 1P0BA 2HV5A 5DY2A 1DIEA 3OJGA 4MNLA 3RR1A 3IUHA 5JVLA 2G95A 3H7RA 3ZM8A 4MOZA 2Y5SA 4NNCA 1S5WA 2P3ZA 1NIUA 4IUOA 5JMUA 5I3IA 4AHOA 5TBOA 3W02A 1IQ8A 5DMNA 1FHVA 3WK1A 4AEEA 2Z1KA 1EC7A 3AIVA 2V9DA 3LB0A 3VX0A 1BVNP 1GEQA 3LY0A 1RLCL 4YYCA 5D2YA 1TWWA 3UEQA 5E0KA 1XIIA 4XBKA 4LBUA 4GISA 2Z26A 3GYCA 5T9BG 3L2MA 4XKMA 4Y9MA 3K46A 4OKDA 1TWIA 4CN4A 1DJYA 4MZ1A 1XF0A 2YJQA 4J28A 3V75A 3LMYA 1QNVA 1J5TA 2EPMX 4P7QA 3EOSA 2AQWA 4D71A 4HJFA 2DSUA 1S2WA 2ESCA 1FY6A 1NOWA 2OVLA 3PBWA 3EA3A 1XIFA 1H49A 3QVQA 2F6XA 4XTIA 1M04A 2XIJA 3BK0A 1TWSA 3IUDA 3B9DA 2H3DA 4O10A 1RZMA 3W6LA 3MCMA 4PCFA 4JR5A 4LTSA 2UZ9A 3HGRA 1QW9A 3MC5A 2GPTA 1F3EA 1FWHC 3QGVA 4ZENA 1KV8A 1GNXA 3ZR4A 1JGMA 1NP2A 1M9HA 4HB7A 1FWFC 1IT7A 5FA5A 3GFYA 1ITCA 3IGUA 2PA6A 2OLSA 5F4WA 3SDOA 2PDLA 4PMXA 4UZUA 3T40A 6TAAA 3VNIA 1V3HA 3KVJA 4F3HA 2OFJA 3A21A 2P10A 4HU0A 1KM4A 3ZQ9A 3SRFA 1QPQA 3GC2A 1TX2A 3F5KA 1WYIA 2XYLA 4JAWA 2RH9A 4TIMA 3QOKA 3TJXA 3RG6A 5HNUA 1IGSA 3SSZA 1TCMA 4W88A 3S1UA 5HDRA 2QJMA 2IKJA 3LNPA 1R7OA 1JNDA 3BAIA 3KP0A 2CETA 4DXXA 2W0UA 3QYQA 1GEHA 4CQ8A 3M5VA 3WLRA 5LXXA 3DHPA 3K8LA 1PJ9A 1XGZA 4KWOA 4O4WA 2PC8A 4L4PA 5AYBA 1LCOA 2ZRUA 3WD0A 4A2SA 3QHOA 4LFYA 2J6VA 3WH8A 1F4AA 1W32A 1BLIA 3D0CA 1XLFA 4N4QA 4Z1AA 3F2CA 4XAPA 4WJEA 4JN6A 5M3WA 3UWVA 4W5UA 2YR1A 4ZOEA 1RBOB 3EDDA 4C6NA 1FWGC 3V0UA 3VIHA 5MHBA 4NI8A 3ZZ1A 4AXKA 5FF4A 4GH3A 2VM8A 3IVSA 1NQKA 4PBFA 3QZ6A 3STCA 1VF8A 2WQDA 2V68A 2YFOA 4B5NA 3LMZA 1Q7MA 2YL6A 2PTZA 1NJJA 4J3SA 3ZWSA 2ATMA 3CZJA 2WM1A 3GNNA 3UERA 4US5D 4H9UA 2HVNA 1UD4A 2HEJA 3KL5A 4W7UA 5EU9A 3T55A 2INFA 3AICA 1VFSA 2Q09A 3SGUA 3CIWA 1VFLA 4NSBA 4ZL1A 2HNHA 2JKEA 1KTBA 4UTUA 3VIKA 3MUAA 3MI3A 1OFOA 1TV5A 4WSJA 1JQVA 3T0BA 1XYBA 3C86A 3RU8X 1TFVA 2WMHA 1B9ZA 1MRAA 3TN4A 4GOAA 1CENA 4QG6A 4PMRA 2W91A 3MSDA 4O57A 4PUWA 4D1JA 4HNCA 2FPTA 4PTMA 1MRQA 4QG8A 2TSYA 1WKDA 4AXNA 4XQ6A 4CD8A 4Q8TA 3PC0A 3H70A 3AIUA 4G8TA 3TCSA 3GDLA 1QATA 3TDFA 4W8LA 3QSTA 4O18A 3OODA 1YPFA 3AIBA 1AQFA 5CJ5A 3CWOX 2YBUA 2DIJA 3TW9A 5FAGA 1CBGA 4QCEA 3POHA 2V3EA 1GKPA 4DO6A 3OZPA 3KVKA 3H2EA 1HJSA 1C91A 1ZJHA 5BRBA 1EJXC 1EO5A 4NXSA 1XQLA 2X41A 4X3ZA 1VPXA 2YDSA 1G0CA 3B0VC 4GCXA 1G1YA 2YL8A 2A79A 5I24A 2PDQA 4GPNA 1XRTA 4ZO8A 4MLRA 3ITYA 1JDAA 4AZ7A 4LB4A 4GX8A 1FWDC 3B8DA 4Q8WA 4HVXA 1DL3A 5TD4A 1UWSA 4R85A 4UOJA 3KOFA 1XCWA 3VNKA 4EVZA 4E2BA 5C2GA 1H61A 3BLEA 1DTNA 2FGBA 3VKAA 3E02A 3WDQA 4AD1A 1O5XA 4QG9A 1OF8A 5FF7A 2W92A 5DEZA 3VMOA 3TIMA 2HDJA 4K7VA 3WNKA 1OM0A 4O13A 1LUCB 4H8VA 5HUOA 3S9ZA 1YDVA 7ENLA 2EJAA 2Y1HA 1Q6GA 3OVGA 3L4YA 1A5BA 2CZVA 2EBNA 2ZOXA 2CWNA 2BZNA 1W37A 4LAMA 5A8NA 4MG4A 4AG0A 1G4SA 1E5NA 2D0FA 4GYFA 3VM5A 3M0YA 5LNVA 1QUMA 4ATWA 4LU0A 3V5OA 2AOSA 2GJXA 1KGWA 2CKRA 2E6DA 1F6PA 2JKAA 3T81A 5A6TC 3VOIA 1R9YA 2E1DA 4NHVA 3WCZA 5CGTA 3LYEA 4BWLC 3T6CA 4CN6A 4FIRA 4ENLA 1P6BA 1E6PA 1GKRA 1L8PA 3ALFA 3T8QA 4B5VA 3QGAC 4J7RA 2D0GA 2YCJA 4MKVA 1CXIA 2ZRZA 7TAAA 4QCFA 3CAWA 3KCLA 3HPFA 4ZOBA 3CPRA 1W9UA 2WHMA 1LM1A 3AI0A 4PBEA 3QR0A 2WSRA 3T05A 4GNKB 3NO3A 2I57A 1IXNA 4MB3A 3WLOA 3FXYA 2C1IA 1QNRA 4IICA 5GVJA 4N6FA 1ZJIA 3GU9A 3GTFA 3SAZA 3DG3A 4NUWA 1OCBA 2OJPA 3KRSA 2ADAA 3PJXA 4CEUC 4GQGA 1VPYA 4PMYA 4XVDA 4DWDA 2V30A 4K6AA 4UTHA 4B5TA 4LBSA 3GXFA 5CBBA 2E9BA 4PN2A 3W01A 5JUVA 2XZ7A 1C9WA 3G2GA 3OVQA 4LAUA 5LHFA 4A8LA 4BI6A 2WBKA 4PRRA 3ORWA 3CEUA 4RKAA 3LGGA 1OGGA 1KW1A 3VCRA 3TOPA 3E12A 4DJEC 4X2RA 4X63A 4W9TA 2V3DA 4M8UA 4O1BA 2PDWA 4E8DA 3A23A 1OIMA 2W67A 4AC1X 2HS6A 1XP3A 1UIOA 3BPWA 3R5EA 3RXZA 1RUSA 3LPOA 4QDPA 4ZTXA 1DYSA 2TAAA 3EKGA 4QE1A 2EPKX 2YXOA 1E1CA 3EDFA 1ZQ5A 3RX2A 1XUZA 3GDTA 2FB3A 4TV5A 3SCWA 1F8IA 2VRKA 3WLQA 3PANA 4G9PA 3EXSA 5D4YA 1GT8A 1R9ZA 2CLLA 1K6AA 1BKSA 3PWGA 4JIPA 1W9PA 4MKNA 2V5KA 2GDVA 1EA9C 1XLIA 2IPGA 3PHAA 1N7KA 3S2NA 1U22A 4FNSA 5LA2A 3NQDA 4XVEA 1A5OC 3N2CA 1NP0A 2H90A 4HOXA 2EPOA 3E0IA 1RR2A 1CNVA 1KBKA 2V81A 2XINA 3O0FA 4IJRA 4C6BA 3URQA 1XQKA 3TCEA 2J9XA 3QY8A 3NYZA 2GVGA 2PWUA 3IACA 1P0DA 1QNSA 3CZLA 4ICMA 3B8TA 4DJDD 3OO2A 3N2OA 1PZ2A 3WK2A 5AC4A 1EF2A 2FZ8A 1FCQA 1YTKA 2XFRA 1KCZA 3E6EA 4LVFA 4LXFA 2ZZ2A 5HJXA 1TE6A 1EXPA 1XIEA 3AHZA 4CD5A 2QF7A 3B04A 3FGCA 3T9PA 4TVUA 2O4QA 4FX7A 2R8WA 4OIFA 4H83A 3HOJA 5TAOA 1GZ1A 3WD2A 3CL6A 4L9ZA 1FP9A 1YTDA 4K68A 4L1XA 3LRMA 3ANVA 4D8AA 1R30A 1CEOA 4AYGA 2BP1A 1VCGA 4KEZA 2YOCA 1U1JA 2REQA 4B9ZA 1CZ1A 1HQTA 3MO7A 1M68A 5H8PA 3AMCA 3OYXA 2ZUWA 2VD8A 4E8GA 3WD1A 1VP5A 2XGIA 1EH9A 1NWSA 2X1UA 1I2PA 3S4TA 1X6UA 4O12A 1DBTA 3F4CA 2OSWA 4L61A 2WB5A 2Y0FA 3ABRA 4XD5A 4AHQA 5ABEA 4PMQA 4IXXA 5XIMA 4DB7A 3HV9A 4J40A 2PU1A 1T5AA 5TF0A 1WXJA 4ZR8A 1QRQA 1UKQA 5EMKA 3GVWA 4AY1A 3E2VA 1O68A 3PUEA 5HK4A 4IJBA 2YYTA 1DWAM 4J3TA 4EXQA 4KEUA 3L9CA 3OG2A 3H2CA 5AY7A 4CN1A 3E0LA 4US5A 2ZVRA 1HXJA 1EEXA 3EOEA 4DAFA 3NDOA 4WDXA 1ZENA 2CZ5A 3BH4A 2KAUC 2Q6ZA 4BK9A 5FEZA 2YXGA 3SEPA 1WPCA 1BWVA 1LQAA 3V3WA 3SUUA 4JKKA 5BWFA 5BXTA 3NQ6A 4WY0A 5EMJA 1G67A 3RPDA 4UTKA 1ECQA 1CGWA 4GO8A 3UWEA 1Q8JA 1OC7A 3VD3A 2F7FA 4O54A 3UXDA 1XPYA 4QJ4B 1EDTA 1JF6A 1JZ2A 1VEPA 1ICQA 4JKLA 1PPIA 3IGSA 4FOJA 3A4JA 3A3WA 4HNLA 4A8RA 3WUFA 5HJYA 4Z1CA 2Z24A 1WKEA 4AYSA 1V3LA 1T41A 4HOWA 3VC5A 3TJLA 1UD8A 3SCRA 3NPUA 2FFCA 4TX8A 3BV7A 2ONEA 4YHGA 4N7QA 1R6WA 3WUEA 3R79A 1OCJA 4GUGA 5DMMA 1R3RA 3BL3A 2WCSA 3OG3A 2VC9A 4XAGA 5LGXA 2VD9A 4WY0F 2PWFA 2YBTA 1VCFA 3P67A 2G50A 2GDUA 5AVNA 3WG6A 1X1NA 1KFJA 4OWGA 1DWFM 4D6CA 1GHSA 5KZDA 5DBUA 1GVYA 1ISZA 4W4QA 2OO6A 2JF6A 4H4IA 4UFJA 1WDDA 3JR2A 2ZRVA 3PS7A 1T99A 2E77A 5I3HA 2DSWA 2Z0IA 2GGHA 4C6MA 3NCOA 4IGSA 5K3VA 2I9EA 1YADA 4IPJA 1UD6A 4LX4A 1X1OA 1E4LA 4KWUA 5B80A 5DN1A 3FLUA 4RXGA 4N4PA 5E0FA 3VK5A 1PVNA 3IJ8A 1WAUA 1IT0A 4IG2A 1AW1A 2WMGA 3DHUA 1OINA 4K8GA 4HIBA 1R85A 4J27A 2CU0A 5EPDA 4O52A 1NOFA 3HQOA 4NVTA 3HA1A 2H9AB 2QPUA 1OFDA 1ZY9A 4GVIA 2J8GA 4WOZA 1E73M 4ZE4A 4HT3A 2P8CA 3WF3A 3TUUA 1M03A 1MNSA 1Q66A 3FS2A 1U30A 4CNPA 4J1OA 3AFBA 4D6HA 1CGXA 4I6KA 3MSRA 2DORA 3U8GA 5JU6A 1R5YA 3W38A 3MPGA 1TVLA 1REQA 1UPPA 1AQHA 3FHQA 2E8ZA 1EGZA 3TN3A 4AD0A 4TVDA 3KRZA 4XZIA 4H9ZA 3MANA 4LJ3A 2VC6A 3W7MA 1KM1A 4H04A 1SJDA 2BASA 3ZFHA 1TV8A 1FCUA 2PGEA 4MNMA 3I4KA 3TVAA 3VCCA 1W1VA 4JIRA 4CQ9A 4C1KA 2C91A 3AS0A 5A6AA 2ZUMA 2X40A 1YBQA 3U2EA 2GWNA 3QW3A 3WKZA 2ANUA 1XIBA 1W5MA 2QT3A 3AMDA 3WLKX 4LPCA 4DWSB 1J4EA 2JEQA 5JBFA 2AL2B 3E0WA 2D23A 3KOWA 4MIMA 4KRUA 1XBVA 4QIUA 1JFHA 2UV8G 4UTWC 3V7PA 2GFTA 1WZKA 5EMLA 1Q45A 3IIZA 5EKYA 4X60A 2J79A 2PDGA 4IH3A 4RUBA 4A3HA 2WKLA 4O19A 1S1RA 4FF5A 4CCCA 2ISVA 3VUPA 4YVXA 2AL1A 3WD3A 5EMUA 3V5FA 3NEHA 1WQ5A 3T8LA 1AD1A 3KZPA 3DH7A 3WBEA 2QCHA 4OV4A 2Z1XA 3FCPA 2A7RA 2W66A 2V5CA 1S3HA 1PKYA 1XLLA 4DBUA 4Z2IA 3EOOA 5D32A 2JIEA 3C0LA 2E1WA 4I8YA 2HSAA 1W17A 4JGDA 1JQXA 5JQ9A 2WKJA 4MUZA 4UMCA 3M5YA 4AD2A 2J62A 4C6JA 2ICSA 1F4HA 1C8YA 3O3RA 4OUIA 3TSMA 3PJUA 4D8LA 3NWRA 3A9BA 1PXGA 1CX9A 4RDYA 3W37A 4HA1A 2HVMA 3OVPA 3FNDA 4ZB0A 3S6OA 2QJHA 5JBDA 3H4GA 2FZNA 3VTRA 2GDQA 4MNJA 3F2BA 3UF9A 2XVLA 1XGDA 3S1XA 5DF0A 2A3EA 3MMTA 4K1WA 2ZUUA 4UMBA 3R89A 1B4KA 3HV8A 4W7WA 1QI4A 1G94A 1EJUC 1RY8A 2WMKA 4QLKA 3VNMA 4U4MA 4LEQA 1IE7C 5AHNA 2L5HA 4XB3A 4CGTA 3UNTA 4X9SA 3LXAA 5DMLA 3LK6A 3WLHA 1L6GA 4Z2LA 1OG6A 2ACUA 1KNWA 3MHUA 2PDFA 8XIAA 1W3IA 2C1GA 4MPQA 2B81A 4Z0JA 4LEFA 3M9YA 1MO0A 4E0CA 2ODOA 3PBYA 3LI1A 3VGDA 1F8MA 4UOQA 2OG9A 1I0BA 2VGBA 4XK2A 2IKGA 5IM51 4XBSA 4S2CA 3UESA 4HSHA 2TODA 1QOQA 2I16A 2O7QA 4YTSA 2ZX9A 3GC5A 4D6EA 4DO4A 3I3DA 2Z1SA 3AXHA 1M1BA 3UYCA 3OBAA 1H7PA 3SCOA 1EOMA 1F9CA 1JI1A 4RDWA 4C6IA 4UOZA 1FRBA 1DE5A 1K7EA 2R9RA 3BGJA 4RDVA 4EX4A 1T8QA 1JZ8A 1Q6RA 4AF0A 3O63A 5HWNA 4Z1BA 3DN5A 1R3TA 2JK2A 3W22A 4B91A 3KFTA 4PB5A 1J93A 3TWBA 3QEZA 4R5EA 5CPQA 4PTWA 4HMDA 3VGBA 3DKJA 1YPXA 5J8LA 3W73A 2F6KA 2P88A 3EWWA 3QKEA 4JN7A 3C8FA 1QWGA 3GH7A 2VWSA 2NVAA 2YLAA 3CUHA 1JDCA 3QZEA 3ABXA 1UPMB 4H9VA 1I60A 2BSLA 3PBGA 4UIOA 5HANA 3QOMA 1M01A 3VIGA 1HKMA 2RAGA 2A2IA 4BEUA 3VKJA 2Z2BA 3KHJA 3L23A 5E9XA 1QBBA 1RBAA 4UCGA 1R46A 3U6WA 1W31A 3WNLA 2GOKA 1XD0A 1X97A 2J7EA 3K2GA 2NLYA 4OBTA 2WJDA 4TUFA 2QPXA 4ZCWA 2TRSA 3CHFA 3WBYA 3THCA 1UR0A 2WC3A 1XLCA 3OGVA 5AFDA 1E4MM 1B5TA 4YU1A 1XLGA 4IIEA 3UPBA 1FHDA 1TJPA 3ARRA 5A2BA 3LX9A 3GXTA 3P62A 5BXSA 1Z3NA 4HHHA 3CH9A 3ATYA 2OQYA 3BTNA 1ZHAA 4PSPA 2KZHA 4ZGYA 1NSJA 4AZCA 3IAQA 1YLVA 3B0PA 1GVRA 4LS0A 5EMMA 4V2XA 5CC6A 1D2KA 3TA6A 3SM0A 4PCSA 1KGUA 3GNDA 4N02A 4F2UA 3PM6A 1OCNA 3KS5A 4JIQA 3DENA 1H63A 1FFQA 2VP8A 3W2KA 2A85A 4HCHA 4DBWA 3NTYA 3M0JA 1E55A 1RVKA 4GGBA 3A4XA 7PTDA 3PUGA 3FYPA 1GVFA 4K36A 4WR3A 3HN3A 1KGXA 2WPBA 3W1AA 5AN7A 1ZRQA 5EB8A 3OU8A 4UNKA 3M0HA 1IWBA 4C6PA 1K02A 4HN4A 4UNIA 3D46A 2ZZ5A 1DJXA 4GJIA 4UUIA 2FIQA 2H8ZA 3MCNA 1XI3A 3BXWA 2NLIA 5CGQA 5CBIA 3CQIA 2VQUA 1P1MA 1UH4A 3LHUA 4PUKA 2VFGA 1GG0A 2CLMA 4QXIA 4IPPA 2INZA 4DUWA 1FWWA 1OADA 1KQYA 3NZ1A 5CJNA 1KWGA 2QAFA 3BQ6A 4AWSA 4I7WA 4WKHA 1H1ZA 3TA9A 3GC4A 1G69A 1VJZA 4QDMA 1ZB5A 4WDUA 3TR9A 1DORA 4HP5A 3AUJA 3TTEA 1A3WA 5J04A 3T2QA 2XHYA 2PGRA 4N9BA 1KBBA 2BB0A 4DUOA 2I7GA 3LHYA 3B4YA 1GCYA 4B5XA 5CZSA 3WEZA 2GLKA 4OUEA 5C71A 3SI9A 1PZ0A 2NXGA 4I9JA 4JFTA 3HQ1A 1R3SA 4BQ5A 3I3EA 2A3LA 3KEHA 1HTIA 1TMQA 5MF5A 3O06A 2F9RA 3H12A 2YCEA 4GWEA 2CLFA 3IJLA 1BPLB 3NQMA 3WMSA 1LWHA 4OZOA 5HPOA 3EPMA 4GH1A 4V15A 2INEA 2P1FA 2ZA2A 3KLLA 4F0HA 4KGJA 1TVNA 4MSSA 2ASHA 3SBFA 5B7ZA 3AZRA 3IAPA 1XICA 3MYPA 1LLZA 1D7KA 1P7TA 1Y5XA 2W5FA 2DH2A 1XSIA 4D6FA 1FQ0A 4J3XA 4F0LA 2J9YA 1L2UA 1VB9A 3KBVA 1GQJA 1S5VA 2QJJA 4TQTA 2FTPA 1PTAA 4LS1A 3BAXA 3QF0A 3BANA 2XH2A 4E4UA 1E70M 2XFWA 3O15A 4D72A 1EIXA 1TZ9A 1S2VA 3U9IA 6REQB 2VTFA 4HU8A 5DLCA 1DIDA 3WH7A 1ISXA 2DUXA 3ENLA 4XZWA 2WK2A 3PG9A 2CZDA 2VDIA 4FLSA 5AC5A 1R7AA 3HMCA 4HK7A 1FP8A 3EDJA 3WLMA 1ICPA 4QJ5B 1TKKA 4HMCA 3C2VA 3W83A 3T07A 2YGYA 2RDXA 1FCBA 4IQDA 2JIWA 4B3ZA 3PK7A 5D9OA 4IIBA 1QAPA 4OT7A 2XU2A 1FWRA 3DI1A 2XM1A 3DKLA 2D0HA 2F2HA 2GQAA 3GM8A 3VVGA 3E2QA 4ILSA 2NQ5A 4F0KA 1OVDA 7REQB 4R9XA 1HP4A 1EIBA 1XRVA 3N6HA 4IPLA 1GJPA 1YDNA 2WJFA 4DELA 4UFIA 1WO2A 3RJXA 3OIHA 3GE7A 4IMFA 1SU5A 4TR9A 4ZO6A 2ALDA 2C79A 4GZJA 1NAL1 3M4HA 2FHBA 3K1GA 2WSYA 4ZTYA 3H24A 3WQOA 4RV3A 3EX1A 2ALRA 4J3WA 5LIKX 3TYEA 1B0IA 4O0KA 1UR4A 3BLLA 3E0VA 4S3JA 3Q2DA 4KCTA 3URNA 3HFYA 1O94A 2Z1WA 3R8RA 1K8YA 4AX6A 1WCGA 3CGTA 4Q32A 3P2VA 2WZIA 1H7NA 2Y7DA 3M7WA 5H8UA 2WNZA 2VT0A 4F0SA 2V6AA 3GTIA 3HQPA 4EANA 2I1OA 3ES8A 4JPGA 1RCOB 3MUIA 3UY7A 2PCEA 1VCVA 1E40A 2VX6A 4LF2A 3WF4A 2R1NA 5KETA 2X8RA 1TZZA 1ZSXA 3S5ZA 1VENA 5HMFA 3VILA 3AQUA 4PTNA 1PV8A 1KLZA 4YPJA 5G4EA 4AD5A 3LHTA 3KVLA 1X38A 2B0MA 2FVLA 4O1AA 1HP5A 4W7VA 3W6YA 4HU4A 3XISA 2P53A 3VPLA 1WDRA 2ISSA 1S5TA 1M6JA 4RE3A 3DBPA 2BXYA 4GUHA 4RX0A 1IEIA 4JDYA 1TB3A 1T40A 5C70A 2CLOA 2R14A 2G97A 2DZBA 4IL2A 3QTPA 4C60A 4IFOA 1J0YA 1KFCA 5JXQA 2ZRWA 3ITGA 3TROA 5E09A 1J0ZA 3MVTA 2VRQA 4H6KA 2FDSA 1NWTA 3K5XA 5DT5A 1IHIA 1RPKA 3EWBX 4AFYA 2HE5A 4LY8A 4HZMA 2NQJA 2VEIA 3URAA 4HD5A 3ZOAA 2Y62A 3WMCA 1TCDA 2NQZA 1XIJA 2VFHA 2NXHA 2QUNA 3W71A 1C92A 3LV6A 4H6EA 4ACYA 3W53A 4RV8A 1V6UA 4RZ6A 2GOUA 5AYIA 4GC4A 3N18A 4DBSA 4AD3A 4AEOA 3MKVA 3SQSA 2DIEA 1UZHA 4H9YA 6PTDA 1UR9A 1PO9A 5FJUA 4KERA 5G4WA 3FYOA 4HNNA 1KXHA 1PHWA 4HHMA 3AC0A 1Q3NA 1E0XA 2Z29A 3IVTA 2FJKA 2NUYA 3OA5A 4B4HA 3VXGA 2QCGA 1O5QA 4Y96A 4F2BA 3VFCA 2BDQA 3UR8A 1BTMA 3JZEA 2ZX5A 4PC8A 4IT1A 3OLEA 3IRSA 4ACZB 2GGEA 2Y85A 2RDTA 1XUUA 3S0CA 2AQOA 2Y4SA 3N15A 3M47A 3NQGA 1QPOA 3R13A 3U5UA 3CO4A 3WQFA 2FLIA 5HXMA 2ACRA 1X96A 3W7QA 3OIXA 1W1YA 3UPWA 5A8GA 3UZXA 3FVMA 4GXPA 4S3KA 1ONRA 3LBMA 5EFDA 4RPP