2YZRA

Crystal structure of pyridoxine biosynthesis protein from methanocaldococcus jannaschii
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
309
structure length
307
Chain Sequence
b'TDLLKKGFAKMVKHGVVMDVTNVEQAQIAEEAGAVAVMALERVPADIRGGVARMSDPALIEEIMDAVSIPVMAKCRIGHTTEALVLEAIGVDMIDESEVLTQADPFFHIYKKKFNVPFVCGARNLGEAVRRIWEGAAMIRTKGEAGTGNIVEAVRHMRLMNEAIAQLQRMTDEEVYGVAKFYANRYAELAKTVREGMGLPATVLENEPIYEGFTLAEIIDGLYEVLLEVKKLGRLPVVNFAAGGVATPADAALMMQLGSDGVFVGSGIFKSENPLERARAIVEATYNYDKPDIVAEVSKNLGEAMKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pyridoxal biosynthesis lyase pdxS
molecule tags Lyase
source organism Methanocaldococcus jannaschii
publication title Crystal structure of pyridoxine biosynthesis protein from Methanocaldococcus jannaschii
rcsb
total genus 102
structure length 307
sequence length 309
chains with identical sequence B, C
ec nomenclature ec 4.3.3.6: Pyridoxal 5'-phosphate synthase (glutamine hydrolyzing).
pdb deposition date 2007-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01680 SOR_SNZ SOR/SNZ family
A PF05690 ThiG Thiazole biosynthesis protein ThiG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2yzrA00
4FNQA 5FF0A 5G4EA 3ABQA 4RV8A 3N34A 3NL6A 4N2YA 4NZJA 4O50A 3W73A 3ZWSA 2A21A 1VLWA 2P0OA 1G4TA 1LDCA 3PB0A 2V0TA 1TJPA 4UTKA 3LTYA 3G0SA 4ORMA 4JYFA 5K2ZA 4LU0A 3P84A 4YMZA 3LBCA 1I2QA 2CU0A 3SR7A 4LWWA 3STEA 3HPXA 4JTHA 1O5XA 4K36A 5AHFA 3FFSA 1G69A 4NJJA 4H4IA 4RX0A 1K7FA 1KTBA 5AHNA 3KXQA 1OFDA 4HNTA 3QZEA 1OYBA 3GVGA 4UMAA 3GZ3A 3S5ZA 4RLIA 3W1PA 1QPQA 2CZEA 2FLIA 1CI1A 3RF9A 4AEOA 1J5TA 1QNVA 4LS1A 1THFD 3NO5A 3WJWA 3CM4A 3N2MA 4XZ9A 1OJXA 3L21A 3STFA 1U83A 2BSLA 2YCEA 1I45A 2YW3A 3W7DA 5EMUA 1KM5A 2E5CA 1LBLA 3DI1A 1QO5A 3L5LA 3DH7A 4LVDA 4FNSA 3W84A 1K3UA 1T99A 3MUXA 3LCFA 1F6PA 4IMFA 5F2GA 5LNVA 2V9DA 4N6EA 1TPVA 4DXVA 4JR5A 4JTGA 1AG1O 1H7RA 4ORIA 3ZS4A 2C3ZA 1GG0A 8TIMA 3GK0A 3L0KA 3MYPA 3DXIA 3THQA 3V1PA 3VI2A 3LHYA 4UUIA 1CW2A 1LRTA 4RR4A 1TQXA 2GQ9A 1LBFA 4UTTA 2V2DA 1KFCA 2FFCA 2YW4A 1RPXA 1L6WA 4EOUA 4CLMA 1XI3A 3TCEA 1W3TA 4NZFA 4GUIA 1XCFA 4MY8A 1LM1A 1ZHAA 4PTNA 3S1UA 2ZZ6A 1DV7A 4O13A 4ADUA 3S0CA 3HG5A 3ZFHA 1OF6A 2A7NA 3O63A 4BI6A 5F4WA 3L68A 2C13A 3T78A 4Y96A 3PUOA 2ZRWA 4UMCA 3EKLA 5KMYA 1H63A 4XBKA 3BLEA 4O0KA 2ZYFA 4N4PA 4CCCA 3UZJA 5D02A 3LRKA 1IXQA 2FTPA 3PBUA 3W1NA 4O12A 3P5YA 3S9YA 3C8FA 4ONVA 1W0MA 3IIZA 3M5VA 3PWAA 4BK9A 5I3IA 2CLFA 3A23A 3NQFA 3IIOA 3C2RA 2GVLA 4AWTA 5EA9A 3UWWA 1AK5A 1MEWA 1L6SA 2Y7DA 2OX1A 4HNNA 5FEPA 1VYRA 2QCDA 2C16A 3LTSA 2FQIA 3VE7A 3EX6A 3UD6A 3FKRA 1IIGA 6ALDA 1SZNA 3B0UX 3P5ZA 3N14A 2NLIA 2QAFA 2Y63A 5D2VA 1KV5A 1C9DA 1FDYA 2C14A 2PE4A 1TPDA 1W5NA 1JQVA 2G97A 3T55A 2PC4A 2EKCA 2HSAA 3P67A 5L6UA 2FB3A 3M5ZA 5DY3A 2NX1A 4FX6M 2CZFA 1WBJA 1FWTA 1EUAA 3E12A 1S5WA 2W0UA 3DFTA 3T7VA 1FY6A 2ISSA 3QEZA 1SW3A 2ZZ7A 1ICSA 1H7XA 3LI1A 4UTTC 4MKNA 2ZRXA 1IXOA 4EF9A 4M7TA 3W88A 4ZMGA 3BGJA 2VEIA 3I7SA 2QCDB 1W5OA 1WOAA 3TFXA 4C1LA 3UNDA 3MO7A 4FNPA 1KM2A 4IX0A 3TROA 3M0ZA 5TIMA 5C6MA 4GWEA 3ABSA 3TIMA 4RJEA 2WQPA 3B0PA 4DBEA 2BLEA 1D9EA 1EIXA 5DELA 3RLUA 5J5RA 1XM3A 2OMAA 3W76A 4E2BA 1W31A 3MI2A 3TSBA 3ANYA 3OBKA 2CLIA 2Z6JA 4M19A 1ZAIA 3N9RA 1X6UA 2J9ZA 4IPJA 2ZRVA 1JUKA 1G4PA 2H8ZA 4PL2A 3LCLA 5EBUA 1ZFJA 3P60A 3SGUA 3HGSA 4DPQA 2J88A 1RQHA 3W1AA 3KRZA 4FNRA 3KVLA 4I7WA 1H7PA 4ICNA 2XN0A 3HB9A 4Y6GA 3WJXA 1HO1A 1O4UA 5HULA 4A22A 2JGYA 4K8EA 4TX9A 1QFEA 4O28A 3NM1A 3CPRA 2GJLA 3F4NA 5F2MA 3LX9A 4PL1A 5AN7A 3ATYA 1HG3A 3UXDA 2V81A 2C15A 1NSJA 3W2KA 1EWEA 5GVJA 5KZEA 1OFQA 1U5JA 1LOQA 1O94A 4O57A 3PS7A 3DZ1A 3MHGA 4JN6A 5D03A 3W9ZA 3QPYA 4WD0A 1NVMA 2YZRA 3O15A 3C3NA 1FWWA 1F74A 1CX9A 2ZTKA 4EWND 3DKJA 1VC4A 4N6FA 1F5ZA 4EVZA 3QW4B 5U7SA 3IGUA 2H90A 5EL1A 3LM7A 1OF8A 2D73A 2FPYA 4LUIA 3JS3A 2FPVA 5CGQA 5DN1A 3BG9A 4MOZA 3UY7A 1GZGA 1VCGA 4JEQA 1JRBA 5E93A 1FCQA 4KFPA 1SZGA 3FIGA 1DVJA 3MHUA 3TMQA 4YXGA 3QQ1A 5A5WA 2GUUA 3THAA 4MIMA 4Y8FA 4BWLC 1MSSA 3JRKA 1F05A 3U6WA 1JCJA 1PVNA 3W86A 2ZZ2A 1TTJA 3M5YA 4MJZA 1XBXA 3GR8A 5EY5A 1A5AA 4O16A 4NNAA 4Y90A 1K7XA 3NM3A 1FXQA 4UTUA 1L6YA 4LV9A 2P1FA 4O54A 5BOOA 3IIVA 3LLDA 3W22A 3PSVA 2RHGA 3NYZA 1KTNA 1JRCA 3FYOA 1WDWA 4U28A 3KAOA 3BPWA 1Z42A 4D2JA 5FF3A 1JCNA 4LY8A 3USBA 3R12A 2YXGA 2ZRYA 2XFWA 3EWYA 3QC3A 2QCLA 1NAL1 3W1LA 2DJXA 1C8VA 2V8ZA 2BWGA 3B04A 3FLUA 3IVSA 4TR9A 3CEPA 1LCOA 1MO0A 1DOSA 1VHCA 3W1RA 3BV4A 3G1XA 3G3MA 1AL8A 4FB7A 2PRLA 3N9SA 1MZHA 4R7JA 1DQXA 3S42A 3G8RA 1QWGA 3VE9A 3MI6A 2ATSA 4IMCA 4LC8A 5C2XA 4HNUA 4LRTA 4S2CA 1GVSA 3EX3A 1JJKA 1TTPA 3HOJA 5AHMA 4CQAA 1LBMA 1FBAA 3MP3A 4OU1A 3PVFA 3L9CA 4GNJA 5CPMA 1XL9A 1OFEA 2ZA2A 3AO0A 3FS2A 4MZYA 1GYLA 1A5BA 1M6JA 3QFEA 2X1RA 3LRMA 2H6RA 2VEMA 4OBTA 4Q32A 2QR6A 3A21A 3EWWA 5DCDA 3R2GA 3EWXA 4DO4A 2IQTA 3S8HA 3WJZA 3PUEA 2WSRA 4DF0A 1FUYA 1VRDA 2AQWA 5FEWA 5F2LA 1IIHA 3HBLA 3BO9A 3IVTA 4UTIA 5T26A 3WK2A 4LV4A 4RK8A 3MMTA 4IQLA 4XKYA 3C4UA 4K7YA 2F84A 5G1YA 2E6FA 1JUBA 2O7SA 1RVGA 3T44A 3W85A 3LCIA 2E5DA 4ZQPA 1VR6A 3QYQA 1XDMA 1WYIA 3M7WA 3M6YA 3TFCA 3TQKA 2V5LA 4I7VA 2WV8A 5TQLA 2CZ5A 3LHWA 4TU1A 4WXYA 1BWLA 2A6LA 3DFPA 3E0IA 2TSYA 5K9CA 2JKEA 1SSDA 5CZTA 4E38A 3G8EA 4IGHA 2CFFA 5I3JA 1KFBA 1OHLA 4PA8A 4WY0B 1KM6A 5FEXA 2WJZA 4ZQNA 5CG7A 1OFPA 4EIVA 5AC8A 2FDSA 2VFEA 2XN1A 1DKWA 2GQ8A 2VOMA 1UJPA 1N8FA 1YDVA 3AJXA 4A2RA 2PRMA 3S1WA 4K39A 1JVNA 5KSWA 1B9BA 5K7JA 4NNBA 4JTKA 3DFNA 1LTDA 1FCVA 5FESA 3FYPA 2R94A 3HGRA 2NXHA 4UXDA 5CPNA 2W79A 1KW1A 2TPSA 3UWUA 2NXIA 4JTLA 3W2UA 1W5MA 1LRQA 4XTIA 1SU5A 3TSDA 3ZR4A 1TTQA 4LVAA 1OABA 3C61A 3VNDA 5K4ZA 4Z1DA 3HG4A 4K8HA 4P2VA 3HGOA 4HSOA 1GVQA 1TPC1 1YXDA 1LLWA 3NL3A 3O1NA 3LGEA 5HWMA 4N9BA 4MUZA 5HNRA 4H6KA 3MBDA 3BW3A 4QSHA 3N19B 1Z44A 1FCUA 5LNRA 3PUDA 2R8WA 4FX8A 3SGZA 3EXSA 2R14A 1SFJA 5E0KA 3W70A 4DO6A 3S5NA 1XFBA 1HFBA 2W6RA 1RR2A 3UPWA 2NUYA 2VFDA 3M16A 2GOUA 4M5PA 1YDOA 2BX7A 2Z1BA 3M43A 3LERA 2C19A 3O07A 4GUGA 1OK4A 1N7KA 1KLYA 3G1SA 1ZENA 1TPH1 1FDJA 4UNKA 3SSJA 4JNMA 1R2TA 3HPSA 1X1OA 4QNWA 1WQ5A 1FX6A 5E1QA 3LV6A 3PSWA 4WJEA 1GWJA 3E9AA 3CB8A 5HMSA 1R47A 2GJNA 1OFBA 3TW7A 5DXYA 4M6PA 4Y9AA 3P8JA 3NL5A 3TQVA 5G2HA 2ZBTA 2C18A 4O18A 4AF0B 4JTJA 4ML9A 5H2ZA 1P0NA 2YFNA 4RXFA 1K02A 4UR8A 4MLJA 2YR1A 3C6CA 2DU2A 4MZ1A 4UFKA 1LOSA 3I7QA 3C52A 2QCEA 4KWWA 1DJNA 2A4AA 2XN2A 3BGGA 3MP4A 2OZ0A 2DZXA 3KHJA 3EB2A 1Q6QA 2ZRUA 4JDBA 1G7VA 1GTHA 3EXTA 2GVGA 4O4WA 4DELA 3TSMA 3W74A 5D2TA 3UWQA 5HUOA 1YXCA 2E6DA 3CEUA 5FF2A 3L0NA 4GUFA 1TPEA 4IXHA 5F4SA 3KVJA 3P81A 4JDYA 3NQ6A 1P1XA 4MJMA 4JTSA 5LZLA 1UBSA 2A85A 1W37A 5LKYA 1OVDA 1ZAJA 2Y7GA 3PM6A 4CCDA 2JKAA 1WOBA 1H51A 1RQEA 1JCMP 3RK8A 3TW6A 1NEYA 2QUUA 1H62A 2YDAA 4NJHA 2X1SA 1F7BA 2V5BA 4UR7A 1OG0A 1T96A 4GFSA 3INPA 3PBWA 4OWGA 1QDSA 1R2SA 5AOUA 3EEGA 2J9XA 1S3HA 1I2NA 4AHOA 3TH6A 5LGZA 4A2SA 1O5KA 4O0ZA 3FEMA 1P5BA 4M7SA 1IF2A 4XTDA 3P61A 4MY1A 1ZCOA 1S5VA 3W7QA 3NXFA 2QUVA 5K3VA 4O1AA 4HT3A 3DU0A 1HTIA 2WSQA 1Z48A 1PCWA 2Q8ZA 1H5YA 2V2HA 4HKPA 3EWBX 4C1KA 1RQBA 3N3MA 3WJSA 4IUOA 1KM3A 2WOQA 1H61A 2YX0A 3HO8A 5AYZA 3W2NA 3F4WA 5CPLA 1YXYA 4DEFA 5DBUA 1TJRA 1K8XA 3O06A 1V7YA 4FXSA 3QMRA 1FWNA 3G1HA 3LHUA 3OG3A 4JXCA 1EA0A 3YPIA 4LNYA 2FPTA 2OT1A 3G1VA 3STCA 2Y6ZA 1JUEA 3Q58A 1KLZA 2RKXA 4PFMA 4UC5A 1QPRA 3GB6A 4GRSA 4FXRA 5AFDA 3A9IA 3BLIA 1LP6A 3LXAA 2PRHA 3TMLA 1G4SA 1SUXA 3WK1A 4LRSA 4GE8A 1YTKA 4LT9A 2E68A 1GVOA 4NT0A 3ZWTA 5D30A 3OVQA 3W87A 1IGSA 2QCFA 1ZNNA 3GDLA 1FDZA 1E51A 1TB3A 2QAPA 3E49A 3O05A 1OK6A 2Y70A 4CNOA 3GXNA 2WNQA 1NF0A 4LS0A 3L67A 3R8RA 4LTSA 5ABTA 2A7PA 1ME7A 4J9JA 3GAYA 4HSNA 4GJ1A 3PG9A 3NQAA 4RXGA 1JCXA 4O8RA 1RZMA 5G5IA 4AHPA 3HG3A 3WK3A 2J27A 1P4CA 6TIMA 1YTDA 2JGQA 2C6QA 5D2WA 2CLKA 3U2OA 1TPFA 1GTEA 2VXNA 2X1TA 1YLVA 2WPBA 5F2IA 4B5NA 1B3OA 1TCDA 3TQ0A 2TRSA 1XBYA 5EYWA 3NNTA 2ZQ0A 4ZVJA 3Q94A 3LXBA 3S5OA 1ZY9A 1G6CA 3L5MA 1M7PA 1QOPA 2Z0IA 3H53A 1VJIA 3CIXA 4OQVA 4IWWA 5F1UA 2AAMA 1B57A 5HJLA 1TPUA 4FIQA 3PB2A 1GG1A 3QMTA 2RDWA 4UNLA 5HUPA 1Y0EA 1PHWA 4BR1A 4GUJA 1F2JA 4N02A 1ML1A 3EWZA 2OCZA 3RNDA 4IXXA 2HS8A 4AXKA 3TX9A 4QNEA 2QCHA 1VZWA 4UFJA 3IIXA 2QCGA 4XQ6A 2O7QA 3L0GA 4AF0A 4OE7A 5A8GA 2Y62A 2GVJA 3LCXA 1JCLA 5D33A 1R30A 5CPOA 1QMLA 1TRIA 3NL2A 1WA3A 4WXZA 3W1QA 2E77A 1D3GA 2QCNA 3W7GA 5KITA 3OA3A 4GUHA 2VFFA 2KZHA 1G67A 4IMDA 1EP1A 1OFOA 2VFGA 1UASA 5HR6A 3P82A 3PG8A 1MEHA 2J24A 3N73A 2CLMA 3R5EA 3LTPA 2B0MA 1LYXA 2LLEA 4FNUA 4OGZA 5FEZA 3P7YA 4JIPA 1TPWA 3LHTA 4O1CA 1DORA 2CLLA 4JICA 4DBDA 4IX2A 1K7EA 3W83A 3TV8A 3HGJA 4BF9A 3NQ8A 5BMWA 4HPXA 3HF3A 3LXCA 3P8IA 1FWSA 2V2CA 1X7FA 4PEKA 3NQGA 2WO5A 2NX9A 2E1DA 3TA6A 3W1MA 4IPIA 4JTTA 3DGRA 2A7RA 4R34A 2ZA3A 5G2IA 3Q37A 1W5QA 3BARA 1YTEA 4NXKA 3FA5A 5AC7A 1BEUA 3P74A 2H3BA 3H55A 4FO4A 4KFOA 1R46A 3O8AA 1BTMA 1UCWA 2RFGA 2OT0A 4AB4A 3G1AA 3TU9A 3DFSA 1A53A 3RMJA 1WAUA 3C2FA 3IIPA 5D04C 5G1TA 4Q4KA 2ABAA 2VELA 3LV5A 3L2IA 3G1YA 2BZNA 2Q3RA 3LBMA 3T4CA 1TMHA 5K4XA 4Z0JA 2AGKA 5I3GA 3UXAA 1TQJA 1OFAA 1QO2A 2BTMA 1VLIA 3BG3A 3KFTA 3W7PA 5AHIA 2QKFA 4O10A 3STGA 3E02A 4AVFA 3G1DA 4AMAA 2UV8G 1I2RA 2CLEA 4Z1BA 3ATZA 3ELFA 2E5BA 1H7OA 3BG5A 3P80A 1KBIA 4QQ3A 2ISVA 3B0VC 1F6KA 3TAKA 5AYYA 3JR2A 4AHQA 2R91A 3B06A 1YYAA 2B7NA 4XKYB 5I3KA 2NUXA 4G1KA 3DHFA 1AL7A 4WX2A 5AHLA 1VPXA 4NJGA 5C54A 1SPQA 4DPPA 5FF7A 3TAOA 1M5WA 2QF7A 2QDGA 3IV3A 1GOXA 4BFAA 1H7NA 1QOQA 2DJLA 3B4UA 3IGSA 1Q6RA 4FEZA 4X3ZA 3QM3A 1TV5A 3BW4A 3VCRA 3W7CA 5C5YA 3G0UA 1SQ7A 3H54A 2DZUA 3T40A 5D2YA 3NZRA 4O4VA 2ABBA 2X1UA 1DJQA 1NFBA 5IBXA 4UTWC 4MZ8A 1SR9A 4NJKA 2ZZ5A 5LNWA 4L4MA 3Q2DA 3M41A 3QJAA 4OHQA 4KKXA 3N2XA 1UUMA 4M6VA 4O52A 3PULA 4W9TA 2J6XA 4NXSA 5SWUA 4AH7A 1EEPA 1HUVA 3TKFA 1H7WA 4R53A 3GLCA 4N4QA 5D2XA 3C2VA 3NPXA 1VHNA 3W7IA 1A5SA 5KZDA 3W23A 2X2GA 4ADTA 3KVMA 1VYPX 2QUTA 3GNDA 5LGXA 4WY0F 2YYUA 5I3HA 2ZZ4A 3A5VA 2X16A 4YLWA 4IMGA 3TC6A 3NDOA 4JTFA 1XKYA 3MWAA 1EWDA 2ZCGA 4UTMA 2VEKA 4WZHA 3MJYA 3DFOA 3L5AA 4RZ4A 4H3DA 4X22A 4S1FA 2F7FA 3NPUA 4P61A 4UFIA 3QMSA 3S5YA 3C56A 4YL2A 5CZJA 3BW2A 5AB3A 2BXVA 2GQAA 2HS6A 3D0CA 3G24A 1KM4A 3DFQA 4RZ6A 2ZFAA 3NOEA 5DCEA 3GIYA 4O53A 4S2BA 3W1UA 4K37A 1I2OA 4POCA 1LZOA 3G22A 5HINA 1XUZA 4TIMA 1OYAA 1NF7A 3LHVA 1TSIA 1B4KA 3DKLA 3GDRA 1HO4A 4N9DA 4N9EA 1GVFA 1Q6LA 2QCCA 1UB3A 4O1BA 1FCBA 2QDHA 3O6CA 2A6NA 5FI8A 3SECA 2VENA 3UY8A 4XBSA 5MHBA 1I2PA 4NX0A 3M47A 4K38A 3B05A 4JD4A 3CC1A 1WV2A 4UFHA 2RDUA 4M6QA 3EKZA 2QJIA 1VCVA 4LS2A 1ZJIA 4DF2A 3HG2A 5LSMA 1R2RA 4MYAA 1ADOA 3TR2A 4JIQA 1LOLA 5EKYA 1W54A 3QF0A 1G7UA 1W5PA 1ZAHA 3DHDA 1K03A 3CLMA 1O95A 3WFAA 4NNCA 3GDMA 1TV7A 2CW6A 2DZPA 4AWSA 1V5XA 3P62A 4CQ8A 3I68A 3SIZA 4WOZA 4O17A 4A3UA 1O60A 2NWSA 4NQ1A 1KA9F 1VCFA 3MP5A 2WSYA 3GR7A 3MW7A 3LCWA 4RZ5A 3PR2A 1TIMA 3W1TA 1ALDA 2E6AA 2PURA 3DBPA 1AMKA 1XBVA 4TMCA 4Q33A 1H60A 3RFAA 4MYXA 4PH6A 4JTEA 2Y7EA 3C2EA 3DAQA 3MYOA 3BLFA 4NX5A 1OYCA 3MI3A 2DZSA 3KVKA 1A50A 3QQ0A 4HIBA 1I4NA 4LW7A 4WY0A 4RKAA 4BI7A 2G96A 3NPWA 2NZLA 5K9XA 7TIMA 1D3HA 4X2RA 1KM0A 3PBYA 1L9WA 4JS3A 2TMDA 4RCXA 5DLCA 3QSRA 3O16A 1SW0A 3LOTA 3CHVA 4WOQA 1L2UA 1W3NA 1EP3A 3CTLA 5F1VA 2JBMA 3NVTA 2YYTA 1QCWA 1W56A 5BW6A 4UTJA 4Z1CA 1AW2A 1OX4A 4GXMA 1KFEA 2CLHA 1YADA 2G5WA 5CZSA 4IOTA 3NR0A 4NVTA 4A21A 1JULA 5DBTA 1K8ZA 3PBVA 4LVGA 4QJ1A 4PC8A 5AC6A 1TPB1 3KRSA 3NQDA 4UCGA 4ZQMA 2ZA1A 3NQ2A 2H3DA 2YPIA 4LOCA 3QH2A 3NQCA 3QRHA 1GQNA 1SSGA 3A22A 1I8JA 4IJBA 1ME8A 1ME9A 5D37A 3KOFA 3QSTA 3W7EA 2B7PA 4ADSA 2RH9A 1H50A 4ZQOA 4ZQRA 2NV1A 4O19A 4UFLA 4CNPA 5G2WA 3R89A 5I3FA 3W71A 4AWUA 3FJ6A 2HTMA 4JYEA 4NU7A 4FF7A 4MLRA 4LUJA 4DQWA 1KBJA 1M7OA 3KX6A 2B7OA 3GKAA 2TYSA 3G1FA 4U4MA 4JTIA 4LVBA 3M5XA 1KM1A 2VKZG 1KV8A 1ONRA 1IXPA 3NQVA 1ZALA 1EP2A 4JTUA 1EPXA 3U8GA 1ICQA 2OJPA 2V30A 3IRDA 3W6YA 4O14A 5AHEA 5IBXC 4CNNA 3M44A 3TUUA 2A2IA 4FNTA 2Q3OA 3S1XA 1JCYA 3TDFA 1Z41A 2EF9A 4LC6A 2V82A 1PV8A 1TREA 3CWNA 3OVPA 5C55A 4JX6A 3HQ1A 4MVAA 4OV4A 1SO4A 5D38A 1A5CA 1GEQA 1XUUA 3HIJA 3RLVA 1QR7A 4ZZ9A 3QPZA 4OV9A 2EGZA 1W3IA 3MBFA 2WKJA 5BMXA 1AW5A 3M9YA 2GPTA 3V75A 3FJLA 1F73A 3TJLA 4UIOA 1PCKA 3GDKA 3LI0A 4HPJA 3TK7A 3I6RA 3GX9A 5EPDA 2I14A 2YFOA 3SY5A 1FQ0A 1KFJA 4OT7A 1H1YA 1VGAA 3GDTA 4TMBA 3UQNA 3SI9A 3LCHA 4UTHA 4JYDA 3OEXA 4Z1AA 3S1VA 5KINA 3SJ3A 4DF1A 1X8FA 4L4LA 3UWVA 2CZDA 4GBUA 2DZVA 3UPBA 1KFLA 3MHFA 3W3OA 3W2LA 1DQWA 2P10A 3E96A 4JX5A 3EX4A 2A5HA 1GT8A 1RV8A 4MPQA 1PS9A 2ZTJA 4ZL1A 4UFMA 1VS1A 5D32A 4Z0SA 2JKPA 2Q8LA 5LHFA 2C0AA 1VH7A 3HPZA 5U4NA 3HJZA 3R13A 1YPFA 1OX4B 2Z2UA 1SO3A 3W2JA 5DXXA 3TJXA 3NG3A 2I9EA 3VFLA 3CIWA 3L65A 2Y7FA 4CQ9A 2CWNA 2ALDA 1PE1A 3UYCA 1TYGA 4O15A 4WQ6A 3W2MA 1QAPA 3CQ0A 2DZWA 1BKSA 4XWUA 1UUOA 5LNUA 3CU2A 2X30A 1ICPA 1K8YA 2E09A 3G3DA 3NQEA 4UTLA 3EX2A 3I7RA 1PIIA 3DI0A 3GXTA 2FB2A 3OVRA 3UZ5A 3WK0A 1X1ZA 3ABRA 5BNKA 2B4GA 5CKSA 5AYXA 4N9CA 3C0JA 3NPVA 2C1HA 2B7QA 3W7OA 1Q45A 5DY2A 3W1XA 2FJKA 1Q3NA 3SZ8A 2QCMA 2WNZA 4EF8A 3ABOA 3UWYA 3SFKA 5LHEA 3OIXA 2NWRA 3G18A 2Y61A 3IEBA 3PAJA 3TNOA 1XC4A 1N55A 2VC6A 5K9DA 2CLOA 4QITA 1S5TA 4YWIA 4O1DA 3W7RA 2NV2A 1SO5A 2I1OA 3W7NA 5IM51 1P0KA 1XXXA 1BWKA 3CWOX 2YSWA 3M1ZA 4PCFA 3HMJG 3W7MA 1WBHA 4JY8A 3TC7A 2A0NA 2Y88A 1LROA 4KFNA 3S6DA 1MXSA 4JX4A 1GVRA 4WUIA 5HWNA 3I65A 1OFRA 4FHAA 4I9AA 2VEPA 2A1YA 2HMCA 2Z6IA 4I7UA 3OHIA 4A29A 5LNSA 1LORA 1PL9A 1EB3A 4HHPA 2G95A 4O11A 3UWZA 4K7VA 3K30A 1B4EA 2VFIA 4FIRA 1TV8A 1F76A 1DBTA 1JR1A 1WXJA 1T0OA 4QIUA 5CSRA 3G0XA 5J5DA 3GYEA 4PODA 1OX5A 2RDTA 3NQ7A 1DL3A 2FIQA 1XBZA 1DHPA 4HN4A 4DO5A 3GKFA 4R33A 3LLFA 4IMEA 4BI5A 1W8SA 3NAVA 4E2DA 3W75A 4TO8A 5KTLA 1YPIA 3L66A 5KZMA 1GPWA 1H1ZA 3EX1A 1HL2A 3B8DA 3IVUA 5G4WA 1GJPA 3NEVA 4BWLA 2J9YA 5F4XA 1TTIA 2QJGA 4E0CA 5L9FA 2ZDRA 1SZFA 3W7KA 2ZZ3A 2E6YA 1YDNA 3FOKA 4Z08A 1EX5A 4GC4A 2JK2A 2ZZ1A 4MY9A 1XDLA 2Y89A 2WNNA 3NZ1A 3FKKA 1RD5A 3O6YX 4JGDA 3F03K 3LCGA 1FXPA 1VQTA 4ZQCA 3GXPA 2PCQA 3C2OA 1Q6OA 1W1ZA 1QPNA 1T8XA 2EHHA 4YCOA 2YGYA 4K6AA 3VKJA 1FWRA 2NX3A 2ISWA 4AAJA 2QEZA 2DORA 4NUWA 2EAWA 4ALDA 3RU6A 1TRDA 5HR7A 4YCPA 4XUGA 4HNVA 3KRUA 3BK0A 3PF3A 3TXZA 3A5FA 5BRBA 3B03A 1EUNA 1G4EA 5CZ0A 1IXNA 2H8XA 1GYNA 2ZRZA 4UMBA 1J2WA 3W7HA 1LRNA 4NJIA 3GAKA 3TE9A 1OX6A 5CSSA 1JQXA 2NUWA 3CT7A 1QPOA 2EPHA 4QISA 1LLZA 2ATMA 1C29A 1SO6A 3NA8A 3TXVA 2QJHA 4LVFA 3GNNA 1VYSX 3A24A 3F1QA 1WX0A 3NQMA 5D05A 2NXGA 3NGJA 1TO3A 3PC0A 3LB0A 3QW3A 4MFDA 3BVJA 3WJYA 2VFHA 3O6DA 3SW6A 3W7JA 4JY9A 1SFLA 2Y85A 5HQEA 1AW1A 5DCBA 5FF4A 5D09A 4KWVA 5H91A 3W07A 3W72A 1PHQA 3IGXA 2DZTA 3LRLA 1KFKA 3PY2A 4MFEA 4UTWA 3EWUA 1SZEA 4CCEA 4QAIA 2DP3A 1SW7A 4QM1A 4X9SA 1MEIA 3LDVA 4FX7A 3W7LA 5TBOA 1J4EA 1KTCA 3LHZA 5HWJA 3EXRA 3DENA
chains in the Genus database with same CATH superfamily
1TX0A 4FNQA 5G4EA 4J3TA 4E8DA 3ZXWA 1KNWA 4TUFA 3S83A 6XIAA 4JQ4A 3NL6A 4NZJA 1XF0A 3H2OA 3WL1A 3MV11 1NP2A 4M80A 4B2DA 1W2VA 1RXOB 3A4WA 1TJPA 3OBAA 2YBVA 4JYFA 1CENA 2QIWA 1CXKA 3H2FA 5EMKA 2CU0A 3HPXA 1SJAA 3LZ3A 1W2PA 1O5XA 2P5NA 4H4IA 4RX0A 1KTBA 3KXQA 1OFDA 4L9ZA 3VILA 3PPCA 4KRTA 3S5ZA 3W1PA 1CI1A 3IS4A 2VTFA 2EXOA 2HK1A 3MT1A 2W92A 4LS1A 3N2MA 3H2CA 1UWTA 3GIPA 1UKSA 3W7DA 3ISIX 2E5CA 1KXHA 3MVIA 4A8LA 3DH7A 3CV2A 9XIAA 2H9AA 5F2GA 4XZLX 4N6EA 4DXVA 3B8WA 4JR5A 2O56A 1XG3A 1W9VA 1H7RA 3ZS4A 2ADAA 3GG7A 4HK6A 3O6AA 4IH3A 3V1PA 1O1HA 4UUIA 3WUBA 1CW2A 1TQXA 3S46A 5A6TC 3IJ9A 1C9WA 3W82A 4NASA 1UKPA 3GU2A 1B54A 4NZFA 3WF1A 1LM1A 3LMYA 4Q8PA 3S1UA 3R0DA 2YB4A 3RX4A 3ZFHA 4A8IA 1KB3A 1JFXA 2BVWA 4ZOCA 5F4WA 5I06A 1GVYA 2PLMA 3WLJA 3GVVA 4UMCA 5A2CA 3AYTA 1E9IA 4G7EA 3EKLA 3HV8A 4F3HA 1JZ4A 3M7SA 3TYBA 3A3HA 5TAOA 1Q6CA 2ZYFA 1IR1A 1AQ0A 3WLNA 4XD5A 5LXEA 3WQ5A 4ONVA 3M5VA 3PWAA 2OTDA 2CLFA 4KH2A 2DIJA 3UWWA 3WUGA 4DZ5A 3OYZA 1B3VA 3Q4DA 1VYRA 1V3LA 1XIHA 4E6MA 2ACUA 2FQIA 3VE7A 1O5QA 3D5HA 1XW8A 4KEZA 4KQNA 1IIGA 6ALDA 4UBPC 1SZNA 3A64A 4CU6A 3N14A 4HYVA 2QAFA 2X40A 5LA2A 2VYOA 3UXKA 2OLSA 1KV5A 4KF1A 3LY0A 2YDQA 4D8ZA 2C14A 3GXMA 3F2BA 2DV0A 2JFEX 1V0KA 3GS6A 2G41A 3W38A 1TVLA 2OOFA 3VZYA 3P67A 5DY3A 3M5ZA 2GGHA 3B9EA 3W29A 2G3JA 1FWTA 4QS5A 2W0UA 1H11A 3T7VA 5CJ5A 1SGJA 4KCUA 1F9CA 1PEZA 3AS0A 4F9JA 1WPCA 1ICSA 2X2YA 2G4JA 3ALGA 3OG2A 2REQA 3ZSSA 4UTTC 4MKNA 3QQWA 4V28A 3QKZA 3W88A 1E3ZA 3I7SA 4GZJA 1UP3A 1WOAA 1J9YA 1KO0A 3TFXA 3VYLA 4C6IA 2UZ9A 3SUUA 1KM2A 1NQKA 3WDHA 3SCRA 2QZRA 2VJXA 4GWEA 1F4HA 2PMQA 3HU7A 4DBEA 2BLEA 1D9EA 1E6NA 3FGCB 5DELA 4NZ1A 5AKQA 3ZT6A 1BQGA 2HXUA 1XM3A 1W31A 1V02E 1J2BA 3TSBA 1K6WA 2D22A 3OBKA 4CQBA 2CLIA 4EPEC 2DSUA 3K2GA 3MSGA 2PTXA 2ZRVA 3FNDA 1H5VA 1S5NA 4PL2A 3LCLA 5HANA 3ARVA 3CYJA 4D1JA 1V6UA 3P60A 1Q8AA 3GC4A 1HJUA 4DPQA 5HBFA 3BAXA 6A3HA 2OQLA 1WZKA 1R86A 3W1AA 1JAEA 3KVLA 4HU3A 4HZ6A 4HJFA 1H7PA 4F8XA 2CBIA 4Y6GA 2WZEA 1HO1A 4A22A 2YCIX 2V63A 1XISA 3NM1A 2VGFA 4JIEA 4K8GA 2GJLA 2ALRA 1MDLA 2ZUVA 4QCFA 3LX9A 5EU9A 3PTDA 3ATYA 1OG6A 1Q6GA 1EDGA 2P88A 1AQMA 4XZNX 4LX4A 3W2KA 3ECQA 2W61A 1O94A 3DZ1A 3M0VA 3MHGA 1EJ7L 3W9ZA 2V6AA 5ABGA 1JGMA 5GQBA 4P7LA 5LXXA 3WBXA 3C3NA 4LAUA 4DBSA 4D6HA 4NI3A 3DKJA 5HMFA 4GXPA 1GKQA 4NI8A 4EVZA 1TV3A 3IGUA 2H90A 5EL1A 3K13A 2FPYA 3JS3A 2FPVA 5DN1A 3VZZA 1RALA 3UY7A 1HX0A 1JRBA 4FK9A 2WZHA 3GTIA 4IFKA 4MKVA 1SZGA 1ISZA 4XZBA 1A47A 4XO6A 1DVJA 5ABHA 4R88A 4RPPA 3TMQA 1GQLA 4MIMA 3UERA 4BWLC 3VNKA 1PVNA 4S3DA 4AZCB 3GR8A 2XU2A 4QR6A 3NCOA 5EY5A 5JBEA 4O16A 1ZU8A 1HJWA 4UTUA 1L6YA 1XGZA 4WR3A 4O54A 7TAAA 1JYNA 3LLDA 3W22A 1KTNA 4HJWA 1NARA 4IJRA 3H23A 4Q3MA 4U28A 3BE7A 3BPWA 4D2JA 1JI1A 1JCNA 4LY8A 5C9XA 1C8XA 1UKOA 3NSXA 2AOSA 3QC3A 1NAL1 4XV0A 1UA3A 4TR9A 2V8ZA 3B04A 2GJPA 2B81A 1VHCA 3W1RA 4PMQA 3O0FA 5FSEC 3OLIA 1MNZA 4DXKA 3LZ5A 1EEXA 4HNUA 1CDGA 1EJTC 3WD1A 2F38A 3CTTA 4GIEA 1Q4NX 3NTYA 3WLIA 4CQAA 2JIWA 3FVMA 1FBAA 4B9ZA 3PVFA 3L9CA 4GNJA 1XL9A 1ITQA 3AO0A 4L4PA 3FS2A 4DLMA 4MZYA 1GYLA 3QFEA 1UR9A 2OWXA 2QR6A 1N2VA 2DT1A 5DCDA 1AFSA 2WZIA 2IQTA 1RUSA 5E0CA 3PUEA 1VRDA 2AQWA 2CKRA 5FEWA 3WK2A 5T26A 2GGEA 4QS6A 2WVVB 3C4UA 4K7YA 1L0PA 3GG1A 2E6FA 3H21A 4KESA 2OZ3A 2PDLA 4I7VA 4KPLA 2PDPA 1BWLA 4CU7A 2A6LA 5ECVA 3E0IA 2WANA 4E38A 3G8EA 4QE5A 1KFBA 5CG7A 1OFPA 5AC8A 2QJNA 4WEVX 3OBEA 1RJRA 3PANA 4K39A 4Z2GA 1JVNA 1B9BA 1KWKA 5TF0A 4DYJA 4JTKA 1V79A 1LTDA 3POHA 3AMCA 2R94A 3TYAA 4UXDA 4GBDA 2PP0A 2BVYA 4JTLA 3L4YA 4DUOA 1W5MA 1H41A 2A3AA 4XTIA 4B5VA 5CSYA 1OABA 2HQAA 3C61A 4K8HA 4DZAA 4NZ5A 3GNXA 4DI8A 1L8PA 3LGEA 1HP5A 4ZXLA 4YS1A 2ZUWA 1NM9A 4JFVA 4PUDA 1Z44A 2Q71A 1U30A 5LNRA 3PUDA 1CEOA 1VPYA 1BTCA 3VIMA 3EXSA 1UR2A 1AQFA 1DIDA 1UZ4A 4YTSA 1FWAC 2V69A 1FWJC 3W70A 4JKMA 2W6RA 1Y8BA 4AD3A 1RK5A 1BYCA 2NUYA 1I6NA 4F2BA 2Z1BA 4DJED 4F2UA 3LERA 1QHOA 3FHQA 4LCQA 4WIWA 3GTNA 3ZO9A 3WBWA 4PUJA 4JNMA 1X1OA 3SIMA 3WD2A 4QNWA 3MCMA 2HDJA 3BJFA 3E9AA 1GCYA 1R47A 1EZWA 2GJNA 3WQWA 4HHMA 4M6PA 4GCAA 1Z9AA 3USZA 5A94A 4QP0A 1QK2A 3TQVA 2PDFA 2ZBTA 2J8FA 1V7AA 2QGHA 4JTJA 5H2ZA 4Q8NA 4HA0A 1GOIA 4P8WA 1TE6A 3CAQA 3C52A 1XICA 4KWWA 1DJNA 1DJIA 1P7TA 3BUVA 2DZXA 2Z00A 4GYPA 3EB2A 4Z2LA 1Q2SA 2GVGA 3VDHA 2OODA 5D2TA 3UWQA 1YXCA 1QT1A 3BDKA 3PZNA 3IARA 3BZGA 2CYGA 3AXHA 3KVJA 3ZSTA 4JDYA 4LBSA 2ZC8A 1DEDA 1RAKA 4JTSA 3M6DA 4MJMA 3K5XA 5LZLA 1ZAJA 3EDJA 2Z4GA 3KZPA 1MVYA 4MTVA 1XIMA 4AMCA 5E6ZA 1IYXA 1PYFA 2OO6A 4NJHA 2X1SA 3OQ8A 2VNCA 1T96A 3S2LA 4GFSA 1OEPA 3WMBA 3PBWA 4OWGA 5AOUA 3EEGA 3MQTA 4AHOA 1Q4WA 5LGZA 3CHDA 3B9NA 3GTFA 4O0ZA 3FEMA 2CPUA 2BOFX 3P61A 1CT5A 1ZCOA 1FWHC 3W7QA 3NXFA 2QUVA 4O1AA 4HT3A 1F8IA 3GH5A 3KRBA 4IP4A 4HKPA 4C1KA 3T05A 3N3MA 3WJSA 1XS2A 1OCNA 3HO8A 3PFMA 5CPLA 1TJRA 1XLAA 2X05A 2XIJA 5LIKX 5BROA 1WP6A 1V7YA 4HD5A 4WDTA 1SZRA 3LHUA 2FZ8A 5XINA 4M81A 1B3WA 3H6OA 3YPIA 2FPTA 3KBSA 2SFPA 3VIOA 3STCA 5HJYA 4X60A 4GVGA 2RKXA 5CBBA 2INEA 6PTDA 1TJ2A 3SSZA 3BLIA 2PRHA 3CL7A 1SUXA 1YNYA 4LUSA 3L2LA 2V5DA 4LT9A 5DANA 2OSWA 3W87A 1IGSA 3FW6A 3SGGA 2QCFA 1ZNNA 2JF7A 3GDLA 1DXEA 1E51A 4INFA 4CU8A 1OK6A 3O05A 1CB7B 1GJUA 2XZ7A 3GXNA 1ZL1A 4AIUA 5HAOA 1EBHA 3GD6A 2E28A 1V3IA 1RPKA 1J96A 1YQ2A 3GVRA 1R3TA 2C6QA 2CLKA 3U2OA 4YIWA 4GMEA 1SMAA 2WPBA 3WQ4A 1VJSA 3AIEA 1B3OA 1RH9A 2XIBA 1S3TC 2BV9A 3LG3A 2V3FA 1G9HA 3HFTA 4L6OA 3NNTA 3OQEA 2CXGA 3ENLA 3IAQA 3BLDA 4JNZA 1KBKA 2VCAA 1M7PA 1QOPA 2Z0IA 1KQZA 3UT0A 4OQVA 3VNYA 4A4AA 1O1ZA 3PFRA 4M6UA 1Y0EA 1PHWA 4Q4RA 2ACSA 4GUJA 1F2JA 4N02A 4QG6A 1ML1A 4P7NA 4C6NA 4I90A 1QI5A 2OCZA 3EWZA 3RRAA 1WUEA 4IXXA 2HS8A 4AZIA 3MS8A 4Y7EA 4QNEA 1QASA 1C8YA 3IIXA 2BOEX 2QCGA 4JHZA 1XC6A 5DMNA 1AH0A 2FHCA 1EXBA 5I02A 1XIJA 1UD3A 3NL2A 3R58A 4WXZA 2GGIA 1AH3A 2E77A 2ZX5A 4CQCA 3D3AA 4IMDA 1EP1A 2BVTA 3P82A 3NVDA 4WDXA 3I6EA 6ENLA 2B0MA 1REQA 4OGZA 4FNUA 3MTWA 4ZB2A 3P7YA 4JIPA 4GI8A 1POJA 1TPWA 2CLLA 4JICA 2WCGA 2D20A 4GK8A 1SMDA 1BSLA 1O66A 3W83A 1JEZA 3RCNA 3CAWA 3CGTA 3WY1A 1X7FA 4Q7BA 2WO5A 3AUOA 2W91A 4ZSTA 4J3VA 1S38A 2F6UA 2W67A 3TA6A 3W1MA 2YDSA 3DGRA 2VCBA 2ZA3A 2WK2A 2WW5A 1W5QA 4QX4A 1YTEA 3FA5A 4XB3A 5AC7A 3P74A 2H3BA 3UW6A 2AQOA 3H55A 1Z89A 4FO4A 1R46A 1FWFC 3RJYA 2CHRA 2QDEA 3DFSA 3WQVA 4GCXA 5D04C 4XISA 2ABAA 4ZB0A 3V18A 5K4XA 1WKEA 1TQJA 4H2HA 3N1AA 4W8BA 5BCAA 3WQPA 4LBRA 2E25A 4L9XA 4K68A 1CPUA 4KMQA 1CIUA 4A3HA 4TX8A 4C6KA 2CLEA 4Z1BA 3ELFA 2YXXA 3GSMA 1FWDC 3WYZA 1F3TA 5JH2A 2I17A 3TAKA 5AYYA 1CNVA 5HPOA 3B06A 4FR1A 4BKNA 1D8WA 4NAEA 4G1KA 1AZ2A 4H8NA 4WX2A 5AHLA 1RA0A 3BAYA 4NJGA 5C54A 1M5WA 3EMZA 3EGJA 4BA0A 4ENLA 4CD6A 1BFNA 3WX7A 1H7NA 2NQHA 3HJEA 4H19A 4B5SA 3XISA 4NZ3A 3IGSA 2CLPA 4JZ5A 4F0LA 2GDQA 3TTEA 4HQVA 3G0UA 1XIGA 2ABBA 4O4VA 4H7ZA 5EMYA 3T6CA 5IBXA 2NT0A 4MZ8A 2PF0A 4H9XA 1BGGA 1C90A 4DJDA 1I0BA 4L4MA 3Q2DA 4ERAA 1S1RA 2ZDSA 3OA5A 4KKXA 3N2XA 1UUMA 3PULA 4MJ2A 2Z1XA 3KL0A 4NXSA 3LQGA 4RZBA 1HUVA 4R53A 3GLCA 5D2XA 1F6YA 4H04A 2XFRA 4PR4A 5KZDA 1P43A 2D0HA 1XLCA 2YL8A 1PKLA 4QAWA 5LGXA 5ABFB 1LG1A 4WY0F 2YYUA 2HWGA 5I3HA 1KRCC 4P7QA 3A5VA 1DE6A 1Q63A 3CPUA 1OB0A 3VKBA 3D6NA 4R7WA 4PCTA 5JIPA 3N2OA 2WHKA 3LA4A 3MJYA 1TUXA 5H8UA 3UF9A 3H2NA 5D9OA 5A8OA 4M24A 2O4MA 4JTCA 3AMLA 7XIMA 1R9YA 3BW2A 1K4HA 1NFPA 1VP5A 3IV8A 8XIMA 1IEIA 1GZ1A 1EBGA 4R3UA 4CUCA 1CBGA 5DCEA 4KT2A 1CGUA 3QOKA 3GIYA 3B8IA 4RDWA 4W7WA 1XUZA 2VGBA 1OYAA 1NF7A 3U7BA 4ZGYA 2C1IA 1LT8A 4LB3A 4DX3A 3TWAA 3F5JA 1UWAA 3SB0A 2G50A 3L4XA 1FCBA 2QDHA 3O6CA 2A6NA 1NDVA 4GISA 1VEOA 3H7VA 4XBSA 5MHBA 4K38A 1HKWA 4O1EA 3LUTA 1S2AA 2EJ1A 3ARRA 1I1XA 1OT1A 1R2RA 1GPFA 3SURA 1ADOA 5BXSA 4JIQA 1OIMA 5EKYA 3WQDA 1B9ZA 3NYDA 1A0EA 4E5TA 4D9PA 4HZ8A 4MNJA 1ITUA 1HT6A 3TTSA 4H1ZA 2DZPA 4CQ8A 1V5XA 3I68A 2Z24A 4ZR8A 2GUYA 1JG9A 4J3ZA 1KXVA 4RZ5A 2BDQA 4X61A 3PTMA 1QI3A 1W1YA 3DC8A 2D3NA 1BKHA 3RFAA 4PH6A 3GNPA 3VKDA 3DAQA 3MYOA 4NX5A 4A3RA 3KVKA 1HJQA 3VO0A 3QQ0A 1XSIA 4HIBA 3W24A 2Z7KA 1I4NA 4LW7A 4RKAA 2VDGA 3AIUA 4X2RA 1RD6A 2KAUC 2W9MA 2TMDA 4RCXA 1QU4A 1TWIA 3QSRA 3UP8A 4W4QA 1W3NA 1EP3A 3CZEA 3NVTA 2G8ZA 5BW6A 3BAKA 4NG3A 4MB1A 4HMEA 1KFEA 1POKA 3NQBA 3NR0A 4F66A 5DBTA 4PCSA 3PBVA 1E9ZB 4QJ1A 1BGAA 1TPB1 3KRSA 2E67A 4ZQMA 4NZ4A 2HE5A 2D2GA 1UOKA 1JPKA 5DX7A 3CNYA 4EAYA 3OPSA 2YPIA 4LOCA 3NQCA 4WKAA 2PDQA 1ME8A 1ME9A 5D37A 1V02A 1W8GA 3W7EA 4W88A 4XD4A 1YX1A 2B7PA 2OYLA 2RH9A 4DJFC 2WVSA 1RBAA 3TCSA 3R94A 4ZQRA 2ESCA 1D7FA 2D3LA 4CNPA 5G2WA 1KCLA 3ZJKA 3W71A 5I3FA 4DQWA 1KBJA 3KX6A 4AXNA 3GKAA 4B15A 2TYSA 4U4MA 4AUBA 1PO9A 4LVBA 1QUMA 1KV8A 4DWDA 1IXPA 3NQVA 1EP2A 4B5TA 3PWGA 5AHEA 1XLBA 4CNNA 4AU0A 3TUUA 4JQ2A 5REQA 3S1XA 2VVNA 1T6MA 3BLKA 3PJWA 2WCAA 4JHOA 1PV8A 1TREA 2FKPA 1X1NA 3P14A 3MA8A 2W66A 1SO4A 4J4KA 1GEQA 1O7AA 3FEQA 3RLVA 1QR7A 3VGEA 4IIGA 2WKJA 3M9YA 3OGRA 3TJLA 3B0YA 1B3YA 1PCKA 3HQOA 3WKZA 3CAVA 3GX9A 5EPDA 2V3GA 1RJQA 1FQ0A 5CPQA 3EPOA 3GDTA 3UQNA 2GVEA 3SI9A 4K1GA 4Q8TA 1R87A 3OEXA 4F0MA 4L4LA 2WMIB 3VKAA 3CQKA 4D6DA 2C7FA 1DQWA 2J62A 3ARQA 3BCJA 3EX4A 4ICCX 4EPDC 2XJ7A 3RILA 4MPQA 5JMUA 2CCRA 1VS1A 4GIRA 1GJWA 1TA3B 3WN6A 3HPZA 4GG9A 2Z2UA 3E5BA 5CGTA 5DXXA 3TJXA 3B8SA 4A8NA 2CWNA 2J77A 3UYCA 1J0KA 1XGEA 2G3FA 3W2MA 4PRTA 3ITVA 2BP1A 5E6YA 2JIEA 5LNUA 5CH9A 4UTLA 1UH2A 4MNKA 3GXTA 4QTGA 5AC4A 5CKSA 5AYXA 3C0JA 3PUGA 3NPVA 1UW9A 3SZ8A 2WNZA 2VI0A 3P6LA 4BQ4A 3SFKA 5M03A 5A3HA 3Q67A 1IWPA 4UZSA 1TKKA 3G18A 4DBUA 4XAGA 1PAMA 2DZBA 2GK1B 2CBUA 4ZODA 4R5EA 2J78A 2OKTA 1WO2A 2YJQA 2FZDA 1SM9A 3DYMA 4UQAA 2VC6A 5K9DA 3L23A 5IXEA 2XH0A 2AL2A 1UD2A 5KETA 5CLTA 1TWSA 5EBAA 3W7RA 2AKZA 4V1YA 4H6QA 4D6IA 1DWFM 1CYGA 1P0KA 3ARPA 1H1NA 1S46A 3CWOX 4MF4A 2YSWA 1ZTVA 1M53A 2QMKA 2G3IA 4JY8A 3TC7A 1LROA 5C9UA 3S6DA 3DUGA 1NOFA 4JX4A 3EPNA 1OFRA 1VFMA 3LS9A 4I9AA 2A1YA 4U31A 2HMCA 2Z6IA 4I7UA 4PMOA 4A29A 3A13A 4M1BA 4IICA 3UR5A 3ARXA 3UR8A 3UWZA 3K30A 2VFIA 1EGMA 1XIBA 1J0HA 2X7WA 1PSCA 2WKGA 3F5LA 5E70A 3E5PA 4MPKA 2AL1A 3U2CA 1WKYA 3VOCA 3THDA 2FIQA 3GKFA 4IMEA 4TO8A 1NTHA 5KTLA 1HGWA 2FZMA 3L66A 1V3HA 5C8BB 3VKCA 1H1ZA 3UR2A 4MG4A 1GJPA 2KX9A 3NEVA 2J9YA 4MWAC 2QJGA 4E0CA 5C70A 2ZZ3A 2PUZA 3QV6A 2D2OA 3BLOA 4GC4A 3OZPA 2ZZ1A 3GQYA 1XDLA 1RD5A 5D4YA 1FTXA 5LIXX 1VQTA 1E15A 4ZQCA 3KWXA 1QPNA 4YCOA 1R5YA 2YCLB 2YL9A 4OTKA 3VKJA 2NX3A 1X6LA 5LA0A 2R9RA 4NUWA 2Z29A 2CBVA 2EEXA 1TRDA 5HR7A 5BRBA 3QFWA 3THCA 1FHLA 2PWHA 1IXNA 1GYNA 1RVKA 3AI0A 4NJIA 1U2YA 3H8AA 2NUWA 1JQXA 2EBNA 1UBPC 3H24A 4FXJA 5HDRA 3DIPA 4P8UA 4BF5A 4QISA 1SO6A 5CPSA 2QJHA 4WSKA 3I4EA 2BY3A 3QPEA 1VYSX 1WDRA 3F1QA 3H2EA 3M0HA 2NLYA 2XFYA 1E0WA 1WX0A 4YTQA 1Q6DA 1TO3A 1WZMA 4GQGA 1NU5A 1UH3A 3LB0A 3QW3A 4YHEA 2OWCA 4MFDA 4P5UA 1V6WA 1HL8A 1IEQA 3SW6A 2WJFA 4W86A 4JY9A 2BGNE 3AIVA 1SFLA 2Y85A 2PI6A 5HQEA 2OKOA 2VL4A 3CL6A 3II1A 5D09A 5H91A 3W07A 3AXXA 4HNLA 4D8LA 3RCYA 2DT0A 3URNA 3UETA 4L56A 2CNCA 4P7RA 4PMDA 4A8RA 5FAGA 1SZEA 4CCEA 4ZENA 1W17A 3AHTA 1SW7A 3LDVA 1ZB5A 1Q7ZA 1HL9A 5HWJA 3CQIA 4AZ5A 3DENA 3O2LA 2ZXAA 3RHGA 3GU1A 1ODZA 5FJPA 1U5HA 2Z1WA 4GKTA 2HPMA 4B16A 4N2YA 1VLWA 3NFUA 3PB0A 5CG0A 5GNYA 5CC3A 3KS5A 4UTKA 1Q5MA 1KC7A 3PZVA 3G0SA 1SR0A 4XKMA 3OOQA 4LU0A 4YMZA 1I2QA 4AEEA 4LWWA 5I6SA 3F7JA 1G69A 1NDZA 5AHNA 1A5LC 4GVHA 4JTDA 5A8MA 3T0TA 1OYBA 1B90A 3GVGA 4V1XA 1QPQA 3MWCA 2POZA 3BH4A 4TV6A 4ICMA 2UY4A 4PTDA 4DI9A 3T8LA 3BSHA 3L21A 2BGSA 3STFA 2YBUA 4WK9A 2CZVA 3IUDA 3ICJA 3VA8A 3L5LA 1PBGA 4LVDA 2OOGA 1K3UA 1T99A 4IMFA 4IFRA 1M1BA 4JTGA 1AG1O 4ORIA 5FJJA 4AD0A 2C3ZA 1GG0A 5A6AA 3PTQA 3GK0A 3MYPA 4F79A 2YA0A 3TNBA 2DUXA 3LHYA 4TVUA 3WLPA 1LRTA 2R1PA 2IQDA 2GQ9A 1GW1A 1TVNA 1KFCA 3SDOA 1RPXA 5GJMA 2HNEA 4CLMA 1XI3A 3TCEA 2A3HA 4GUIA 4MY8A 4QE4A 2BXZA 3CUIA 4O13A 4ADUA 1CGVA 3GHSA 4GQBA 3L68A 1R3RA 1GVEA 2ZRWA 3EA2A 1H63A 4PZVA 1KRBC 1UD4A 4HNCA 1W1IE 3BLEA 2FH6A 4O0KA 4N4PA 2W5FA 3LRKA 5F7UA 1IXQA 3PBUA 3VUPA 4O12A 3C8FA 5PTDA 1U33A 4DWSB 3IIZA 5I3IA 2PLCA 1FKXA 3NQFA 3IIOA 3C2RA 1EJXC 1L6SA 3NDYA 4OOZA 4GIYA 4V15A 4EXAA 3N6HA 5FL1A 1ZBKA 3UVAA 3FAWA 1AD4A 4W87A 1U1JA 2RGMA 2WXDM 3B0UX 3ZJ6A 1KRMA 5D2VA 4C6QA 2PDKA 1EO7A 1BSIA 2ISDA 2QNEA 3N18A 3KEHA 1JQVA 5AY7A 2PC4A 4PMVA 2EKCA 4AWEA 4LANA 5L6UA 2FB3A 5J8LA 4FI4A 4GACA 4BY3A 3RCMA 1WBJA 1EUAA 3E12A 1S5WA 4HPHA 3THUA 2HCVA 3SO7A 3OGVA 2ISSA 3QEZA 4DYKA 3SN0A 3AU6A 4ZE4A 1X39A 3LI1A 1UIOA 2ZRXA 3EWDA 5I77A 4G6CA 3DFHA 4EF9A 4Q8VA 4KIRA 2VEIA 3UG8A 2QYGA 4S39A 4C1LA 4MNMA 1R3QA 2XIOA 3UNDA 4DO7A 4A05A 3T0BA 3MO7A 3Q65A 4FNPA 4IX0A 2ZWYA 4TV5A 2J8TA 3SEPA 1E6QM 3TIMA 4RJEA 3I3EA 1PTGA 3SCUA 1EIXA 3RLUA 4LY4A 4J7RA 2P3EA 4LF1A 2OFJA 3W76A 2J7EA 3WFLA 3MI2A 3PBMA 1NDYA 3ANYA 4DJDD 3GM8A 5CEWA 1RCXB 1Q6FA 1BG4A 4I9TA 1JZ5A 3CO4A 3LPFA 3H4XA 5I23A 5EBUA 4B2DD 1MXGA 3IJ8A 3UZWA 4C60A 1IWBA 1LJYA 3R8GA 8XIAA 4IF2A 3U2ZA 4L6HA 1RQHA 3KRZA 3TQPA 4ZO9A 4I7WA 4LBUA 4JQAA 4ICNA 5HULA 3KOYA 2DH3A 4IIFA 4TX9A 2QJJA 4O28A 1VIWA 3CPRA 1MQPA 1AUSL 1KGXA 4AD1A 4ATLA 2DEPA 4AZCA 2D0GA 1BRLA 2VC5A 4US5A 2BS9A 5GVJA 4C6PA 1U5JA 4O57A 5HA7A 4JN6A 3ABXA 4IZGA 1ONEA 3CMFA 1W32A 5KEZA 2PU0A 3VIHA 1F74A 1CCWB 2ZTKA 1W1PA 2JF6A 3EPMA 4N6FA 4WSHA 3LM7A 3U9IA 2D73A 1EGVA 3URQA 3BG9A 3GBDA 3WF0A 1EHAA 1B30A 1VCGA 5FJIA 1Q7QA 3CUXA 2XSAA 3FIGA 1TMQA 4NRRA 3CUGA 5BXPA 4YXGA 4IMAA 3JRKA 3B3DA 1F05A 4JCLA 3M5YA 4MJZA 1OBAA 5ABFA 3R8HA 2PGWA 1BPLB 3RAOA 1K7XA 3NM3A 1UOZA 2DSWA 4LV9A 1C7SA 4Z2KA 3WBYA 5BOOA 3T2OA 2NV9A 3PSVA 2RHGA 3NYZA 1JRCA 3FYOA 1WDWA 1XRTA 2PSNA 3KAOA 1LLOA 1Z42A 5FF3A 1UA7A 1GOKA 3AQUA 4BS0A 9CGTA 4GI9A 2YXGA 3CYVA 6CGTA 2ZRYA 4I5UA 3LYEA 5CCZA 1DOSA 3BV4A 3T2QA 3G1XA 3G3MA 2UY2A 1WDQA 4FB7A 1D3CA 2O92A 1QWGA 3VE9A 2ATSA 4IMCA 4LC8A 5C2XA 4LRTA 2WPGA 2BXYA 4C90A 3MZ2A 5J04A 4BQ3A 3EOEA 4HTYA 3EDKA 4OZOA 2PZ0A 2Q09A 4X0NA 3VD7A 1E6SM 1KCKA 2X1RA 3LRMA 3SCPA 2VEMA 2BHUA 3EWXA 2NQ9A 3DG7A 3S8HA 3AXKA 3NIYA 4G8TA 4W7UA 2A79A 1FUYA 3NUKA 2XIIA 2XVPA 2FVLA 3IVTA 4UTIA 3UG3A 3GHRA 3GYCA 3BLPX 3F2DA 4V33A 2YA1A 1JUBA 3LPGA 3OZMA 3B4YA 4V2XA 1VR6A 1XDMA 3QYQA 3M7WA 4JEJA 3TFCA 3TQKA 2EQDA 4XBJA 5TQLA 3SM0A 5C9ZA 3DFPA 5K9CA 2XISA 3EMCA 5CZTA 3ABZA 2IPGA 1OHLA 4W85A 2GJXA 2WJZA 4ZQNA 2FDSA 2XN1A 1DKWA 1PTAA 4GYKA 5MKGA 4C1NA 1YDVA 4A2RA 3S1WA 5KSWA 1ITXA 5K7JA 3EA3A 4EP8C 1JZ6A 4M0XA 5FESA 2RAGA 3FYPA 4HU8A 1QTWA 2BY2A 1S2VA 3GVQA 5CPNA 1DJXA 2GUBA 3N29A 4NYUA 4X9YA 5CZKA 1B5TA 2PS2A 2GLKA 4Z1DA 3HG4A 3KDOA 1W1A1 3HGOA 4Y8EA 1YXDA 2MANA 1LLWA 4Q8WA 3O1NA 4FLOA 3HN3A 1GW9A 5I03A 1R3YA 4H6KA 1WCGA 2PWEA 4QSHA 2R8WA 2YXOA 1XGDA 1SFJA 3FK4A 2INZA 1L2QA 3ARYA 4ZE5A 2IXUA 4XSMA 3GR4A 3HTWA 5HQLA 3UGRA 3CB3A 2VFDA 4H41A 3UG5A 4DBWA 4URIA 2E0PA 3DC0A 3M43A 4GUGA 3O07A 2D1ZA 5JBFA 3SSJA 3GO2A 3U4FA 3VNIA 1W3JA 1VFTA 3CB8A 2TODA 1OFBA 1W91A 1KBBA 5B80A 3BCDA 3SRDA 2A3BA 4W93A 1T41A 3S9ZA 4O18A 4I5RA 4ML9A 2WHLA 5LA1A 2YFNA 2ZWZA 1K02A 4CEUC 5A6MA 3BMWA 1GOWA 2PD9A 2YZ5A 4KCTA 3GZAA 4OUEA 3I7QA 3CK5A 2QCEA 3MCNA 2F2HA 1OADA 4I8DA 2OZ0A 2VWTA 2ZRUA 1GTHA 2WM0A 3B8TA 1DWAM 1WUFA 1VPQA 4U33A 1TPEA 1J5SA 2V67A 1ONXA 4PBEA 3KBVA 3ES7A 5HJXA 3SJNA 1WZAA 1D7KA 2NSOA 3LM3A 5A6BA 1UBSA 2A85A 1W37A 3WO8A 1T8QA 3E2RA 3AIBA 3V5CA 1NH6A 4GVFA 4J2PA 2XSBA 1WOBA 1RQEA 2PTDA 3RK8A 3TW6A 1ZBVA 2QUUA 5EMLA 1H62A 4UCFA 2HBVA 3SUVA 3VNJA 4NAFB 1CGWA 5A6SA 1QDSA 1R2SA 2DIEA 4LCRA 2J9XA 3QYSA 4Q6XA 1PX8A 5BOEA 4QE1A 4B92A 1UHVA 4A2SA 3BSMA 2CETA 4MY1A 3KDNA 1S5VA 1MFUA 1HTIA 2X42A 2WSQA 1PCWA 4WSJA 1UWQA 3FXGA 2QJMA 2PDJA 3VK5A 3CUJA 3W2NA 2ZX9A 2DVTA 4DEFA 3KM8A 3SCVA 1K8XA 3AIQA 1JDCA 3D47A 3O06A 1PX4A 3KTCA 3QMRA 4WLCA 3G1HA 1UC4A 3S6OA 4MB5A 3AISA 1EA0A 2R6OA 5CC6A 3SAZA 4FS9A 4QRNA 2OT1A 1JDFA 3Q58A 1KLZA 4H00A 4PFMA 2D0FA 3V7PA 2Q02A 1B3XA 3MO4A 5AFDA 2AGTA 3A9IA 4XVEA 1XLFA 3TMLA 1G4SA 3BJSA 3H22A 1A0CA 3W6LA 3WK1A 1YTKA 2E68A 3WLRA 4ERIA 4XAPA 3AS2A 3WBEA 4WKHA 4CNOA 2VX7A 1NF0A 2PDCA 3QHMA 4C6CA 4IG2A 5BYWA 1J0YA 3E0WA 3NQAA 1XLMA 2WVTA 1RZMA 2HPIA 5G5IA 4AHPA 3HG3A 3WK3A 2J27A 5C71A 5IHRA 2PLKA 1XYFA 4DHGA 1TPFA 5HNTA 4FLRA 1A3WA 2X1TA 1EOKA 1HKJA 1YLVA 3AU2A 4B5NA 1Z8AA 2Z28A 3GW0A 3TQ0A 2R1MA 4ZVJA 3Q94A 3LXBA 2GYIA 1ZY9A 1G6CA 1OT2A 1LL4A 4QJ5B 2IXVA 1FOBA 3CIXA 2FVKA 5C2GA 1DXFA 1OGSA 4Z2IA 1TPUA 3PB2A 2PCEA 3QMTA 1UKQA 3QR3A 1JIBA 1O68A 2PU1A 1XX1A 1UD5A 1VZWA 4PRWA 2DVXA 2YCJA 4LH8A 4XQ6A 3UJRA 2O7QA 3L0GA 3N2CA 4OE7A 5A8GA 4B5WA 3ARUA 1WA3A 2EPOA 3W1QA 2XIMA 2YDRA 3SADA 4A3YA 3IAPA 1Z32X 3TLQA 4QEEA 3KHDA 4KWUA 3N17A 4OJYA 3E0VA 4QLLA 3RM8A 3R5EA 4JQ1A 3REQB 4ATWA 2XYLA 2LLEA 4CNUA 1XLEA 2ONEA 1TG7A 5A1AA 3DYPA 3W53A 3BQ6A 1DORA 3CUHA 4DAFA 1FP9A 1GORA 1QNOA 3B0XA 4BF9A 2PA6A 5BMWA 3LXCA 4JFUA 4L65A 3VD4A 1FWSA 2A3LA 4PEKA 2V38A 3NQGA 1DYSA 1E1CA 2HBXA 1TELA 4JTTA 2A7RA 3JVAA 4R34A 1XLIA 1X8CA 3QY8A 4MWAA 3BARA 2NQJA 1A0DA 2FGZA 3VXGA 1OZQA 4KFOA 3OODA 1BTMA 1I9CB 3NJ3A 3VD5A 2RFGA 4AB4A 3G1AA 3TU9A 1A53A 1WAUA 2PD5A 3AICA 5MF5A 3OYXA 4Q4KA 3LV5A 3L2IA 3ES8A 3NXLA 3G1YA 2BZNA 2QIIA 4XD3A 3T4CA 1QVBA 2OSXA 4PMUA 5H6HA 2BTMA 5IOBA 1VLIA 1EGZA 3W7PA 2FVMA 3AIRA 2AMXA 4MJ4A 4CD7A 3U5YA 2J6VA 3EYPA 3ZLHA 2VR5A 2GGJA 3GXIA 3UESA 2E5BA 3BG5A 4KS0A 1ZBWA 3VGDA 3M4HA 4WRHA 3MKKA 4AHQA 2R91A 1YYAA 4UNIA 1IHIA 5TD4A 2NUXA 3DHFA 1V6VA 1AL7A 1QHPA 1W9UA 4DPPA 2VM8A 4BFAA 1GOXA 1QOQA 4YJ5A 5BU6A 4PE8A 4X3ZA 3BW4A 3T08A 3VCRA 1TFVA 3W7CA 2VZTA 5C5YA 2XHYA 1SQ7A 3ZVHA 3T40A 3NZRA 4ZOAA 4KGJA 1NFBA 3VZXA 3W01A 2Z25A 1SR9A 2WMHA 2ZZ5A 2G0WA 5LNWA 4A35A 1UR0A 2WMFA 1N8WA 4JOMA 3SUSA 1MUMA 3EAUA 4UOJA 4W9TA 4EK7A 4JTRA 4AIEA 5SWUA 3BSGA 3UG4A 4X0VA 3TKFA 1H7WA 4N4QA 1W6TA 3C2VA 2ZUTA 1ZCCA 2VUYA 1EOMA 1IWAA 3ZT5A 3DOPA 1VYPX 1X38A 2QUTA 3ONCA 3TTQA 2ZZ4A 3EDEA 1M41A 4YLWA 4GYJA 3HM7A 4I3GA 4JTFA 4D6EA 1XKYA 3MWAA 1EWDA 4LAZA 3TN3A 2D23A 2ZCGA 3EB3A 3DFOA 3L5AA 4RZ4A 4FF5A 3GU9A 3S2JA 3WF4A 3VGHA 1I1WA 1RCOB 3NPUA 4HA4A 3C56A 4NL1A 4I9MA 4L80A 1NP0A 3LNMA 4LUTB 3M46A 2X0HA 3G24A 3TOPA 4S3CA 4ZO8A 3C86A 5JU6A 1M7JA 4O53A 3W1UA 4K37A 1M7XA 5HINA 4RPQA 1ISYA 4TIMA 3VOFA 3LHVA 4A6GA 1DWIM 2RJHA 4DJFA 1B4KA 2WMIA 3GDRA 2HISA 1ZPTA 4N9EA 1GVFA 1Q6LA 4QDWA 2GSJA 1UB3A 3L4VA 1WB0A 4O1BA 3U5UA 3W00A 1J0JA 1GZJA 3LPPA 4NX0A 3N04A 3M47A 1Q85A 4JD4A 3CC1A 1TWDA 4U5IA 4UFHA 1WV2A 4HMNA 2RDUA 4M6QA 3EKZA 2QJIA 1KWGA 4DF2A 3H26A 4LEFA 3AXIA 1RA5A 1S2CA 1EQCA 2HVOA 1LOLA 1R38A 4W89A 4DM1A 3CZ8A 1A5NC 1UQYA 1PZ3A 1XIIA 3DHDA 3PZGA 4EANA 3GDMA 3WH8A 4S3AA 2BFGA 3SIZA 4O17A 4U3CA 5JBDA 4DNMA 3MP5A 2WSYA 1E5JA 2ACRA 3GR7A 1E9YB 4GY7A 2IMRA 5B7YA 2YB1A 1NWUA 1XPGA 3IK2A 2GOKA 3DBPA 2JEQA 1WAWA 1AMKA 1W3KA 4GZ7A 1QATA 4JTEA 2Y7EA 3C2EA 3HPAA 1CXIA 5G1MA 2JALA 2V3EA 4LUSB 2WC4A 3VIIA 3DN5A 3VDCA 4HOXA 5HXMA 2G96A 1AVAA 2NZLA 2C71A 1XYLA 1K1DA 4JPGA 3K46A 4JS3A 3TJ4A 1H4PA 3AOFA 1SW0A 2ZE0A 4WOQA 2DIKA 5F1VA 1U1HA 4HZMA 5IFPA 1QCWA 1PTDA 1OCQA 4GXMA 1XFCA 1ZJBA 3J7HA 2G5WA 2QXWA 4IOTA 3NZGA 4A21A 1GQIA 1UZ1A 1W1TA 4PC8A 3AAMA 3B9AA 3FCPA 4UCGA 3E2QA 2WHJA 1OM0A 2VURA 3QH2A 1SSGA 3A22A 2IKIA 4IJBA 3LD5A 1EJRC 1C8QA 3VU2A 4QFUA 2O9RA 3QSTA 4ADSA 4HYRA 4LYRA 4TXEA 2FZNA 3SQSA 1G0CA 3BMVA 2J8GA 4AZ6A 1FA2A 3W0KA 2YLAA 3FA3A 2OGYA 3GFYA 1A3XA 2HTMA 1HVXA 2BY1A 3UVIA 3WMCA 4ATDA 3WLMA 1FWCC 2VKZG 5FJUA 1ONRA 4GYFA 4B5XA 3N15A 1ZALA 4JTUA 3WQOA 4QLJA 5IBXC 4JTAA 3M44A 2VX6A 2EF9A 2EPNA 4JIHA 1FH8A 2QV5A 1IGWA 1XLDA 4JX6A 2UBPC 4OV4A 2VVSA 1VEPA 2BMBA 1XUUA 4FAMA 3HIJA 1U1UA 4XVDA 3DHPA 1M3UA 3QPZA 4OV9A 5BMXA 2EKGA 1AW5A 4W7VA 4UIOA 1MW1A 3DBNA 3GDKA 3L2MA 3LI0A 3I6RA 3RR1A 4XX6A 4DJEC 1H1YA 1VGAA 3TZNA 2F6KA 5BXRA 4Q4SA 2ZVRA 3KCOA 1K9DA 4KBXA 4JYDA 4S3KA 2O55A 2VDIA 3DDMA 1X8FA 4GBUA 4EE9A 4D6JA 3W3OA 4PCNA 2NVDA 3W2LA 4JX5A 3E96A 4QJ3B 1K70A 4MAVA 2MUCA 2A5HA 1MRAA 1PS9A 2R24A 4ZL1A 1E6XM 3WLTA 2Q8LA 3H70A 4LQ1A 5LHFA 2C0AA 1VH7A 3HJZA 2WSKA 1SO3A 3MY9A 3NG3A 2I9EA 2X0SA 3L65A 4H9ZA 2AL2B 4KEUA 4L6DA 1PE1A 1VD6A 3QC0A 4GQQA 4NZCA 4O15A 4WQ6A 1QAPA 2DZWA 3ZYZA 4OIFA 3LMZA 3T81A 1UUOA 2EG7A 4UQDA 2PEVA 4S3FA 4JN7A 3VC6A 1PIIA 3DI0A 1XP3A 2DPEA 3B8UA 4AY7A 3QTPA 1VBRA 4RNIA 2B7QA 5GNXA 3W7OA 3JUGA 5DY2A 3W1XA 1Q3NA 2QCMA 2VEGA 2QHAA 4EF8A 3ABOA 3R79A 3PZTA 2NWRA 1CXFA 3UJFA 4PB4A 2Y61A 3VGBA 4PTWA 4P8XA 3PAJA 4KEVA 3TNOA 1XC4A 4J28A 1N55A 1FFQA 1GK8A 3BLLA 1H0GA 4YWIA 3N3TA 3OLDA 1SYTA 1IT8A 3L4UA 5GNZA 1M01A 1XXXA 5IM51 3IACA 5I2UA 3ARWA 1TA3A 4ZA0A 2UY5A 5A8PA 3WQ6A 4C7FA 2Y88A 3TN6A 1XYCA 1BF2A 5HWNA 2OR2A 1VRXA 4IGSA 1TUFA 4Q4PA 1LG2A 5I0DA 4PEEA 4E3VA 1PL9A 1EB3A 2G95A 4O11A 4K7VA 3RG6A 1EXPA 3S47A 3OZYA 1J01A 4XZHA 4QIUA 3WLSA 3UJ2A 2YL5A 1EDQA 3ANUA 4JKKA 1CGYA 3CV7A 3K1DA 1JZ8A 2HVNA 3SRFA 2VGIA 2WWCA 4HP5A 1DHPA 3S2CA 1E1FA 3ZLFA 1W8SA 3NAVA 4E2DA 5BXTA 4IIDA 1LT7A 2E7FA 2DUAA 4DAIA 5KZMA 2GVYA 4C91A 4OFCA 3IVUA 4REQB 4AVNA 2OU4A 1K6AA 1TTIA 2E6YA 4Z08A 3I10A 2XGBA 2YCKX 2J4GA 2Y89A 1OC7A 2IKHA 3NZ1A 4EPKA 4M29A 3F4DA 4JGDA 3F03K 3LCGA 2GJXB 1RCQA 2PCQA 3C2OA 1Q6OA 2Y24A 3MZNA 4Q4MA 3A3WA 1W1ZA 3E2VA 3RUBL 3LGDA 4K6AA 3A4XA 4KWOA 3QV8A 4AAJA 3VOIA 2OSYA 2XIQA 2Z1VA 2XVKA 2VOTA 4ALDA 4YCPA 3S2NA 1VF8A 1U22A 2XZ9A 4HNVA 1CLXA 1J18A 3TXZA 4D6CA 4HU4A 3B03A 1EUNA 1G4EA 3UGVA 2H8XA 4UMBA 1XLGA 1D8CA 1DJHA 2QVNA 3TE9A 1OX6A 1FH9A 5A6LA 3GH4A 3QV9A 3TTYA 4YVPA 1ISVA 1GEHA 3ARZA 1YE6A 3TXVA 3VNLA 4LVFA 1OY0A 5DO8A 5T91A 3D3FA 2CBJA 3A24A 2F6XA 1ZSXA 3G6LA 3NQMA 2GWGA 2NXGA 3W4RA 1GVIA 1NY1A 1GONA 1NOUA 4GQRA 3TYUA 3WEZA 3GHTA 1MMFA 3H4WA 3W7JA 1XINA 4LYKA 4PGLA 1AW1A 4CN6A 1RLCL 2UWFA 1XJBA 1TWWA 1OGBA 2EG6A 4KWVA 2QUNA 1H2JA 3SY8A 3VDAA 1XYAA 3ZQ9A 4AYGA 3IGXA 3VX0A 3LRLA 1KFKA 3PY2A 4M82A 1V3JA 2WM1A 3IK4A 4Q6JA 2DGAA 1U5VA 2V5JA 3HFYA 4L4OA 1J4EA 1KTCA 3LHZA 3OLGA 4KRZA 5FF0A 4C7GA 4I6VA 2VZOA 4YTRA 5ABEA 3W73A 4O50A 2WKLA 1XIDA 4C6EA 2P0OA 3D46A 1LDCA 1QI0A 2Z27A 4ORMA 2NT1A 1PKMA 1P7TB 2HVMA 3BICA 4QXIA 2VZVA 5K2ZA 3SR7A 2Y1HA 2XVLA 4F0RA 4JTHA 3AHYA 3MU7A 3HURA 5AHFA 4K36A 5ENLA 3FFSA 4LUTA 3S5SA 3RPDA 3BAWA 4RLIA 3BTNA 2CZEA 4FPSA 4AEOA 2ZC1A 3XIMA 3NO5A 4YYFA 3WJWA 4XZ9A 3WQFA 1HW6A 1U83A 2BSLA 2YCEA 1I45A 3SCNA 3SUTA 1KM5A 3DI1A 1QO5A 4O1FA 3KP1A 3W84A 1IZKA 5CPTA 2EPMX 2QS8A 3MUXA 3AFBA 3BWWA 5LNVA 1XCWA 2V9DA 1J79A 1Y65A 1V8EA 2AAAA 4PN2A 2WMKA 1QBAA 8TIMA 1HF6A 1RBLA 3DXIA 1VFOA 3VI2A 1T7LA 4Y2WA 3TTOA 3PJXA 2X09A 4IM4A 4UB9A 1LBFA 4UTTA 2V2DA 1FWIC 1V0MA 2YW4A 1L6WA 5CAKA 2YIHA 2ZUUA 2ZZ6A 2OG9A 1J93A 1K4GA 4A3QA 1FKWA 1OF6A 2A7NA 3O63A 4BI6A 3CH0A 1S2WA 4F0KA 3ZZ1A 4HHLA 4RW3A 2C13A 3T78A 4Y96A 3NEHA 3KWSA 2J7FA 4AC1X 3N6QA 2Q01A 3QLDA 3UZJA 5D02A 4HSHA 3P5YA 3S9YA 4L61A 1YPXA 3WDRA 4ZCWA 3UZYA 2O9PA 4MADA 2CXEA 4FP1A 3A23A 1XRSA 4Q4QA 2GVLA 5EA9A 3MV01 1AK5A 1NIUA 1MEWA 2OO0A 4HNNA 3JW7A 2HRWA 3ZJ7A 2C16A 3WUFA 5GJPA 3E0LA 4EX4A 2OWWA 2PDUA 1ECEA 3UD6A 1A5UA 5DEZA 3KL3A 1QNSA 1A5MC 4LAOA 1BG9A 2NLIA 2PDBA 2YCLA 4Y9PA 5IDZA 1A5KC 5CBIA 3W81A 4D8AA 2PE4A 2DW6A 1GNXA 1TPDA 1W5NA 4YYCA 2G97A 3ITLA 3AHVA 4LCSA 1VFLA 5AVHA 2HSAA 1BLIA 1KGWA 2V5CA 2NX1A 4FX6M 4IQJA 1EDTA 2CZFA 5E9AA 3EZ4A 3U4AA 1DIEA 1UYQA 3ZIZA 3B9DA 3ITXA 1H7XA 1B31A 5DMYA 1T5AA 5JIWA 1HNYA 1IXOA 4PCPA 3C2YA 3O3RA 4NF7A 3DX5A 4ZMGA 3BGJA 4OBRA 2QCDB 5CQ1A 1J6OA 1MNSA 3SRHA 3WCZA 3IJ6A 1US0A 4MGGA 1AA1B 3M0ZA 5TIMA 3CS2A 4GO8A 3R6IA 1XLLA 5I3DA 4C1NB 3B0PA 1ZP3A 3HPFA 4E2VA 1W9DM 5J5RA 2RDXA 1H09A 1RHCA 4E2BA 1TWZA 1OD8A 2J47A 4TTGA 2VX4A 4AD4A 3N9RA 1JUKA 1G4PA 2H8ZA 4ZFCA 4PYSA 3WENA 3KCJA 1CGTA 3RRXA 1PDZA 2F61A 1BXBA 4UQBA 4WKFA 3O7UA 5AYBA 3REQA 2J88A 2ODOA 4HYWA 2I57A 6REQB 4FNRA 1EPVA 1ZRQA 4UOQA 3UA4A 2XN0A 3CIVA 3HB9A 3PPGA 3WJXA 1O4UA 2XINA 1QFEA 5DRIA 1J12A 4B9YA 3I3BA 1REQB 1LF1A 5M17A 5F2MA 2BVDA 1WKDA 1QW7A 3UXDA 1B0IA 2V81A 2C15A 2DSKA 2WVUA 2IKJA 3MANA 1NSJA 1CZ1A 2Y5SA 1EKOA 1EWEA 1TMLA 3VVGA 3QPYA 1LQ2A 4GLEA 2PGEA 4MNLA 3WDIA 2EJAA 1NQ6A 1NVMA 3CZKA 1FWWA 1CX9A 3R43A 4D1IA 4MB3A 3UXIA 3QW4B 2IW0A 3OB8A 4HNOA 5CGQA 4H8HA 3E6EA 3OU8A 1HKMA 3MCOA 5REQB 1FVPA 1PWLA 1GZGA 2QF8A 4JEQA 5C7HA 3CUZA 2NVCA 3OW1A 4LFYA 3MHUA 1VFSA 3OIHA 5A5WA 3WH7A 3S9IA 2GUUA 3THAA 1VFHA 4Y8FA 2EPKX 3O9NA 3U6WA 3W86A 3T42A 1UG6A 5D9PA 1XBXA 1CECA 1A5AA 1ZS2A 4H9YA 4NNAA 4Y90A 4XD6A 3FXYA 1GHSA 4PSRA 3SN1A 4DZHA 5FJTA 5E0FA 3FJ4A 1PPIA 4NAFA 3CHFA 6TAAA 4W5ZA 1YKWA 1EZ2A 1WDPA 4JFSA 3USBA 3R12A 1MW0A 2ZXDA 3EWYA 2IS7A 2QCLA 3W1LA 2DJXA 3IVSA 2BWGA 1QNQA 1MO0A 2VZSA 3H7UA 5CJNA 1AL8A 4M3PA 4QSFA 1MZHA 3AZSA 1DQXA 3H2MA 4J3SA 3S42A 1MI3A 4WDWA 2REQB 5CBJA 4CNSA 3SUWA 3FX4A 3SFWA 1V3KA 3UPMA 1EL3A 4QQUA 1UWSA 1JJKA 1C93A 1D2KA 3HOJA 1UQZA 4MB4A 1E0XA 1IR2A 4OU1A 2P8BA 1RP8A 5CPMA 1OFEA 2ZA2A 3T0CA 1X98A 2ZKMX 4RNHA 2VRJA 1A5BA 4S3GA 4PUMA 1UJQA 4Q32A 1UD8A 3A21A 3EWWA 3R2GA 4DO4A 3FJNA 3E1F1 5AYIA 2WSRA 2TAAA 4GFIA 1A4LA 4IP5A 3UCQA 3JZUA 2I16A 5D9MA 5F2LA 3AXMA 1IIHA 3HBLA 4JHMA 3BO9A 3I4KA 4RK8A 1DWHM 1S5MA 4KWSA 4Q4OA 3WNKA 4IQLA 1V77A 3WELA 3V5OA 3T1GA 2Z1KA 3W27A 2ACQA 1RVGA 3W85A 3LCIA 4GZIA 1O12A 3M6YA 3PAOA 2V5LA 4R9XA 4AFYA 1YHTA 2CZ5A 3LHWA 3SCOA 3APYA 2Z2BA 1X97A 1HJSA 1FH7A 5EMJA 3A4AA 2JKEA 2A3CA 4IGHA 2QV4A 5I3JA 4WY0B 1EIBA 5DMLA 3T0DA 5FEXA 2VOMA 1UJPA 3CQJA 3NURA 1GGOA 4BZYA 4J27A 2I5IA 3DFNA 1FCVA 1XH1A 3HGRA 3FAXA 4LJ3A 5T9BG 1ISXA 2GL5A 3UWUA 4J2MA 2DSZA 3M0MA 4PB5A 1LRQA 2OELA 1SU5A 3G6MA 4HPNA 5M1TA 1LWHA 4M56A 2YKKA 3VNDA 1G94A 2OEJA 4H7VA 4HSOA 1TPC1 4YHGA 3VM5A 3NL3A 2NVAA 5HWMA 4MUZA 3L4ZA 7ODCA 1EFZA 3U2EA 3N19B 1FCUA 2XUCA 3SGZA 3S3GA 2I9UA 5E0KA 1JXJA 4DO6A 4F0SA 3MMWA 2GZXA 2BB0A 4N7QA 1RR2A 1RY8A 2AMGA 4M5PA 1YDOA 5D8ZA 7REQB 1OK4A 3AHXA 3G1SA 1ZENA 1W1VA 4OVXA 1TPH1 1FDJA 3I6TA 2Z2AA 1R2TA 1PKNA 4NRSA 1E73M 1FX6A 4LAMA 1KGUA 3LV6A 3V1HA 3PSWA 1J8VA 4P8VA 1WZLA 3L7RA 2XVNA 5HMSA 4NIRA 2F9RA 4NY2A 4JCMA 1Y5VA 4GJJA 2GGGA 4XIMA 5D8WA 3T2PA 5AVNA 3P8JA 3P2VA 5G2HA 3VPLA 4JAWA 4AF0B 3C0LA 1J0ZA 1XIEA 1P0NA 4UR8A 3C6CA 1QNPA 2DU2A 3KBWA 3R0KA 4MZ1A 4DWSA 2BBFA 4PFHA 4NSBA 3MP4A 4H9TA 3EDDA 4D6GA 3KHJA 2BNJA 1Q6QA 2VRKA 2O4QA 3GVWA 3EMQA 4DELA 3MUZ1 2EPLX 5HUOA 4L1XA 2E6DA 5AZ0A 1UWUA 3GE7A 4GUFA 4HA1A 2DDXA 3IRSA 4IXHA 1C3FA 5F4SA 4KETA 4ZSUA 5EFDA 4E8CA 5LKYA 1OVDA 4DUXA 3PM6A 5LIYX 1VB9A 2ON3A 3W02A 3GWQA 5EGRA 5CLWA 1Q8JA 3WD3A 1F7BA 3H2AA 1OG0A 3PZIA 3CUFA 3SBFA 4IJCA 2E3ZA 1J10A 4CN4A 2MNRA 1S3HA 1BXNA 3N4EA 1I2NA 2QGYA 3TH6A 1OC5A 4HOZA 1P5BA 3CBWA 4M7SA 1IF2A 4XTDA 1QXLA 3VCCA 2QW5A 4F2TA 1UH4A 2Q8ZA 4ACZB 3MDWA 2V2HA 3EWBX 1MW2A 1RQBA 4IUOA 1H61A 2C1GA 4UTFA 5AYZA 4UQEA 3SCQA 1YXYA 4B90A 2OXNA 2CESA 2D24A 4Z1YA 1FWGC 2UY3A 3ORWA 1HZYA 1FWNA 1PUDA 3OG3A 4JXCA 2GJRA 3G1VA 1JUEA 3AJ7A 3EOUA 4UC5A 2FZ9A 1QPRA 3GB6A 1WXZA 3GUWA 3LXAA 2OQHA 3ZR5A 3AYRA 4GE8A 1GVOA 2PWDA 1W3LA 2I56A 3U3HA 1R7AA 3OVQA 5IDIA 3U57A 1VFFA 1DHKA 4V27A 1FDZA 2VQUA 1TB3A 7A3HA 2Y70A 3R8RA 5ABTA 1TZ7A 4IIBA 1BRLB 1ME7A 2A7PA 6XIMA 3GAYA 3E2SA 2G37A 4GJ1A 3W26A 3PG9A