2YZRA

Crystal structure of pyridoxine biosynthesis protein from methanocaldococcus jannaschii
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
309
structure length
307
Chain Sequence
b'TDLLKKGFAKMVKHGVVMDVTNVEQAQIAEEAGAVAVMALERVPADIRGGVARMSDPALIEEIMDAVSIPVMAKCRIGHTTEALVLEAIGVDMIDESEVLTQADPFFHIYKKKFNVPFVCGARNLGEAVRRIWEGAAMIRTKGEAGTGNIVEAVRHMRLMNEAIAQLQRMTDEEVYGVAKFYANRYAELAKTVREGMGLPATVLENEPIYEGFTLAEIIDGLYEVLLEVKKLGRLPVVNFAAGGVATPADAALMMQLGSDGVFVGSGIFKSENPLERARAIVEATYNYDKPDIVAEVSKNLGEAMKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pyridoxal biosynthesis lyase pdxS
publication title Crystal structure of pyridoxine biosynthesis protein from Methanocaldococcus jannaschii
rcsb
source organism Methanocaldococcus jannaschii
molecule tags Lyase
total genus 102
structure length 307
sequence length 309
chains with identical sequence B, C
ec nomenclature ec 4.3.3.6: Pyridoxal 5'-phosphate synthase (glutamine hydrolyzing).
pdb deposition date 2007-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01680 SOR_SNZ SOR/SNZ family
A PF05690 ThiG Thiazole biosynthesis protein ThiG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2yzrA00
2FB3A 3TSMA 2H6RA 3D0CA 3G1FA 1YPFA 3WK1A 2I14A 4WZHA 4PC8A 2V2HA 4AHOA 3W7EA 5LNWA 1I2OA 2VEMA 2EKCA 3NQEA 1XCFA 4AH7A 1LBLA 1VRDA 1OHLA 1NF0A 2QJHA 3U8GA 3WJXA 5D33A 1AG1O 4FHAA 2VEKA 4AXKA 4JICA 5LNSA 3W84A 4GBUA 5H91A 4TMBA 3CEUA 1HUVA 3HG4A 1RQEA 1XBXA 1PL9A 3C2RA 5KINA 1PVNA 5I3FA 1H61A 1TTPA 4QIUA 1DV7A 3ZFHA 3V75A 3RNDA 3GXTA 5FF0A 5F4XA 2E5DA 2TPSA 2CLOA 3W2JA 2J24A 2JKAA 3DHFA 1W5NA 3THAA 5HWNA 2FPYA 4S1FA 5G2IA 3L0NA 1PIIA 1H7RA 1LP6A 1N55A 4LVFA 4S2CA 3B0UX 5DXXA 4LVDA 3LTSA 3DFOA 2Z0IA 4IQLA 1AW5A 1R2RA 3G18A 1TMHA 2QCGA 4K38A 3RU6A 3RLUA 3BW2A 5E0KA 4LS2A 4QISA 3PULA 4RR4A 2C0AA 4IPJA 4IMDA 4AWUA 4EF8A 3B0VC 4MOZA 2V2DA 1B4KA 4YWIA 3MP4A 4QAIA 1K03A 1DQWA 2GPTA 4RV8A 5G1TA 3QRHA 1F05A 2C3ZA 2PURA 2QUUA 3WK2A 1WA3A 3SFKA 3SGZA 3G3MA 3W76A 4D2JA 3PVFA 1OFEA 5C5YA 3EWZA 4JTJA 1KM0A 4LTSA 1O5KA 3E02A 3Q2DA 2V0TA 3M5XA 2Z6JA 4G1KA 3STFA 4IJBA 4UIOA 2OT1A 1TIMA 1HG3A 3NQ8A 1VPXA 2Y70A 2BWGA 3C3NA 1QO5A 3TA6A 4DBEA 2V2CA 4N4PA 3W88A 3O1NA 1AMKA 1SW7A 5HULA 2Y85A 3CEPA 3BGGA 1CI1A 2GOUA 2QAFA 2FJKA 2ZZ5A 3DFNA 1S5VA 4E2BA 3HGJA 4X9SA 2J88A 4O50A 3C56A 4JTLA 4ZQNA 1T96A 1VYRA 4M6VA 4LRSA 1IIHA 4NXSA 5DCBA 2QR6A 4HNVA 2WPBA 1A5CA 3TQ0A 5LGXA 4QITA 1FWTA 1HFBA 4LOCA 5F2MA 5T26A 4ORIA 1GTEA 3O15A 3W75A 3B05A 4AHPA 3O6DA 4L4MA 4DF1A 4MVAA 3RMJA 3T7VA 2XFWA 2VOMA 1GVOA 1FWSA 4O52A 3P80A 4R33A 1VGAA 4TIMA 3OEXA 4M7TA 3GNDA 4NNCA 3PSWA 3NQ6A 2Y7FA 5D37A 3TC7A 5LNRA 4O19A 4ZQPA 4A2RA 2A5HA 1FQ0A 2JBMA 3DKLA 3M9YA 3M16A 4AB4A 4C1KA 1SO5A 3W7NA 4FX6M 4A29A 3VKJA 1P5BA 4IPIA 3JRKA 5AFDA 4LWWA 2RDWA 4O16A 3UD6A 3LLFA 1SZNA 3A24A 1CW2A 1TTJA 1MEIA 4Y8FA 5I3GA 4IUOA 2JGQA 5AYYA 1TPWA 4ORMA 1F2JA 3L0GA 3GB6A 4O1CA 3LRLA 1KM3A 4DF0A 3CIXA 3W72A 1SW3A 3TDFA 3TROA 1ZY9A 3LV5A 3USBA 2A4AA 4CQ9A 2RDTA 4UTKA 1EP2A 3C2VA 1WAUA 3M5YA 4MJZA 4N9CA 3LCWA 1LLWA 4HHPA 1ZENA 2V30A 1RR2A 3GXPA 1OK6A 4RXGA 2PE4A 3TC6A 3TW7A 4UTWC 1SZEA 2PRLA 5D32A 2PC4A 4OQVA 5G4EA 3QM3A 1KBIA 1JRCA 3ELFA 3P74A 2E09A 3BPWA 4O11A 3BO9A 3LHTA 4DPPA 1KM5A 1OX4B 5AHEA 1DORA 3LHYA 3HIJA 2CZ5A 3LI0A 4XWUA 1QNVA 1TRDA 3GLCA 3M5ZA 1TSIA 3HO8A 4FNQA 3L21A 4CQAA 3W7PA 2RKXA 4IMFA 3E96A 4C1LA 4TU1A 1WBHA 2BX7A 1W5MA 4PH6A 3G1DA 4JY8A 4N6FA 3W7KA 1ZNNA 1B57A 4CCEA 4LVAA 1VLWA 3NEVA 5C2XA 4Z1BA 4UMAA 3ZWSA 2TYSA 3YPIA 2WKJA 3MYOA 3M1ZA 3KX6A 3UXDA 1KTNA 1UB3A 5J5RA 1KA9F 1GWJA 4JTEA 3NZ1A 4Q33A 4N9EA 4AEOA 3W1PA 1NEYA 1K7FA 3RK8A 1VQTA 4ZQCA 2A2IA 3SR7A 3HMJG 2R14A 4PL2A 1QMLA 1LYXA 2X1SA 4LT9A 4O8RA 2G95A 2BSLA 2DZUA 4FXSA 5K9CA 1SU5A 3CTLA 4MJMA 1OFPA 4EIVA 2H3BA 3LCIA 1W5QA 4NZFA 3W1XA 3R13A 2QCNA 2G5WA 5D2YA 2Q3RA 5HWJA 1J5TA 1FXQA 3B04A 2CLHA 1KLYA 2QCMA 2QJIA 5F4WA 2X1UA 5DBUA 1KFCA 2QCHA 4KFNA 1DKWA 4X2RA 3HB9A 5EMUA 1LRQA 1K8ZA 3G22A 3PB0A 3M0ZA 4FNPA 1HO1A 5LNUA 4BI6A 1IIGA 4FX7A 1H51A 4Y90A 3VE9A 5DXYA 1H5YA 3G24A 3UNDA 1OYAA 1VJIA 1ZCOA 1LBFA 3LXAA 3TK7A 3H53A 3CM4A 1KLZA 4HNUA 4WXZA 5E93A 2A85A 3W86A 1I45A 1Q6LA 2LLEA 3TJXA 3W07A 1TCDA 3NPVA 3LERA 3W1TA 4Y96A 1ZALA 3TXVA 4U28A 3G1XA 1UUMA 3BW3A 1BEUA 3TH6A 2J9YA 5DCDA 2H3DA 1B4EA 3KXQA 3GR7A 4O28A 2PRHA 4W9TA 3JR2A 3N9RA 1GYLA 3PUDA 1TPEA 3F1QA 3UXAA 3PBYA 3TX9A 2DU2A 4ZQRA 4MY1A 3FYPA 2ZRZA 1XI3A 1ZFJA 2CU0A 5D2TA 5F4SA 3IGSA 4JR5A 2YPIA 4PTNA 3EWBX 1OYCA 2FTPA 3S6DA 3W1NA 3OG3A 5D30A 4RJEA 1FCBA 2C18A 3SI9A 3RF9A 2VENA 1DJQA 3S5NA 1T0OA 2ZRUA 2EAWA 4NJHA 4UFHA 1VHCA 6TIMA 1VS1A 2GJLA 4IXXA 3ABOA 1A5BA 1WQ5A 5F2IA 4AVFA 3M44A 5LHEA 3LXCA 3OVPA 2CWNA 4E0CA 4GXMA 5HJLA 2NUWA 4HPXA 2H8ZA 1S5TA 3DBPA 1I2QA 2NUXA 1S5WA 1EWDA 1SO4A 1W3IA 4OT7A 2VC6A 5L6UA 1NVMA 1LORA 4GRSA 1QDSA 3GYEA 3KAOA 5IBXC 5D05A 1GQNA 1OX5A 1F5ZA 2NV2A 4FB7A 4X3ZA 5F1VA 1LLZA 2YW3A 1JQXA 2PCQA 5AOUA 1KM2A 3ABQA 3S42A 2Q8ZA 4E2DA 1U83A 3N9SA 4PCFA 1BWKA 5LHFA 2QCDB 4WOQA 5FESA 1SZFA 4O57A 3O16A 4H6KA 4MLRA 5FEXA 2B7NA 3W23A 1PS9A 3OBKA 5BMWA 4NU7A 2JKPA 2V9DA 4M19A 2NXHA 1YYAA 4WQ6A 3N2XA 5F2LA 2ZYFA 3KOFA 1ZAJA 1LROA 2R91A 3TQKA 3IGUA 3DENA 5EA9A 3DU0A 3NZRA 3W7HA 3O8AA 1YADA 5D38A 2QCLA 2FFCA 1Q6RA 3M41A 3B8DA 4O18A 5HWMA 4IOTA 4QNWA 3S5YA 2A7NA 3DAQA 3G8EA 2NX3A 2CLMA 1QOPA 1GYNA 2YGYA 4GWEA 5D2VA 4FNUA 4IMEA 3NL3A 3ABRA 3BLFA 3M6YA 3H54A 3NM1A 3S1UA 3BG3A 3GAKA 1DJNA 3QPYA 3LCHA 4K7YA 1IXPA 1X1ZA 3T44A 3G1AA 2JKEA 3KRUA 1EP3A 2J6XA 3NM3A 1E51A 1XKYA 4UTUA 3L5AA 3L66A 1IF2A 2CLFA 1EA0A 1TPH1 5EKYA 3CC1A 5C54A 1XUZA 2Y7DA 3F4WA 3NQ2A 3DFPA 5D2XA 4XTIA 1KFEA 5FEWA 1GG0A 3MI6A 1FCUA 1R47A 1TPC1 3IRDA 4DEFA 7TIMA 3MP3A 4NJJA 3G1YA 3NPWA 3W7RA 3BV4A 2TSYA 3HBLA 1YXCA 3ZR4A 3N2MA 3CHVA 3TFXA 1H63A 3MHFA 4KFOA 3AO0A 4LU0A 5I3JA 1G4PA 2GQ8A 3NQCA 2ATSA 5K3VA 5K9DA 3G0SA 4FEZA 3CLMA 3W85A 3LHVA 4EVZA 4LNYA 3TIMA 1J2WA 3F4NA 2YZRA 3FFSA 3W71A 1QPOA 4K8EA 3CPRA 4DBDA 3LI1A 5AHMA 1K7XA 5G4WA 2HMCA 2DZTA 2Q8LA 4DQWA 1N8FA 2FPVA 3NXFA 4I7WA 4UTWA 3TCEA 4K37A 2G97A 4JYDA 3EXTA 3W7JA 4NJGA 3TMLA 1OF8A 3HPSA 4GFSA 5K9XA 3HGOA 3RFAA 5EBUA 4KWVA 1D3HA 1V7YA 1ZAHA 1OF6A 3O6YX 1YTEA 1KTBA 3C4UA 2GVGA 3G1VA 2NX9A 3GZ3A 3MBDA 1TQXA 4E38A 1OFOA 1W3NA 4BI7A 1GTHA 3HOJA 4NVTA 3HF3A 1VCGA 2QJGA 1QOQA 4JEQA 1QAPA 1W31A 5G5IA 1TV8A 3GDTA 1GVQA 3S5ZA 3NA8A 4WXYA 4PFMA 2WNZA 3GK0A 1EB3A 2V8ZA 1XUUA 1K7EA 1A5AA 1R30A 3NDOA 2E6AA 1XFBA 1FY6A 3NPXA 3W1UA 2WV8A 1QWGA 1A5SA 5U7SA 4OBTA 3G8RA 3MUXA 4LC8A 4JTGA 3BVJA 1KV8A 1Z48A 1N7KA 1SFJA 3O6CA 2Y7GA 1FXPA 5I3IA 3ZWTA 5DY2A 3TAKA 2DZXA 3G1HA 3EKLA 3DFQA 3IIVA 4K8HA 2V5LA 5C55A 5LZLA 3W3OA 1FWWA 4ML9A 5J5DA 4KKXA 2EF9A 1OX4A 4HSNA 1UASA 4IGHA 2F7FA 5AHLA 3CB8A 5LKYA 1Q3NA 1VR6A 4YCOA 5KTLA 3DFSA 3W7LA 3KHJA 4O4VA 5CKSA 3W1AA 3P67A 1YXDA 4ADUA 2CLKA 4Z1AA 5HINA 1G4EA 2ZBTA 1PHQA 1KV5A 1L6WA 3DKJA 2B7QA 3ZS4A 4UFKA 2FQIA 3HPXA 2RHGA 4TO8A 5HR7A 5AC8A 2XN2A 1K8YA 3LM7A 1W5PA 1LBMA 4M6QA 3PUOA 5DBTA 3A5VA 3KRSA 4QQ3A 4WUIA 3NL2A 2YDAA 1L9WA 3PBWA 1TTQA 4LV4A 3UWWA 1SSGA 1WBJA 3N19B 4RKAA 3GVGA 1TPDA 4OV4A 2YFOA 2C6QA 2VKZG 4AWSA 4PODA 3EWUA 1G4TA 3A9IA 4MZYA 5DCEA 1YDNA 5BRBA 3IIXA 3TJLA 4MYXA 4MZ1A 5BOOA 5TIMA 1MSSA 3NVTA 2OX1A 1GJPA 5AHNA 3P8JA 3W7MA 3C0JA 1YTKA 1GZGA 1T99A 3HGRA 4BWLC 4EWND 1F7BA 1P1XA 1TREA 1I2NA 5FF3A 3LBCA 3IIOA 3C61A 4IWWA 1KM6A 3QQ1A 1HTIA 4HNTA 5D2WA 4AF0B 2V82A 1EEPA 4ZZ9A 4EF9A 1B9BA 3QW4B 1QR7A 3P81A 3Q37A 3W70A 4AMAA 1GG1A 3QH2A 3MJYA 2ZZ6A 2WNNA 2WQPA 4H3DA 1KFLA 5IBXA 5CZJA 3TUUA 5HUOA 2QUTA 4CNNA 1KFKA 2CLLA 3NQVA 1JCJA 1ALDA 4FXRA 2WSYA 4O0KA 4A22A 3L2IA 1SFLA 2ZRXA 4TX9A 3I65A 3R89A 1S3HA 1H1YA 3FKKA 4UTLA 4R7JA 2NV1A 1H62A 3TQVA 2ZA2A 5H2ZA 1LRTA 2DJXA 4JYFA 3DZ1A 2TMDA 3PY2A 1EIXA 3STCA 3T55A 4QNEA 1KW1A 1ONRA 4KFPA 3MBFA 2VXNA 4Y9AA 1AK5A 2YR1A 4NJIA 3W73A 1O4UA 3M47A 4IMGA 3CIWA 2Z1BA 1LCOA 4JTHA 3QC3A 1L6SA 2OCZA 3NQDA 1I2PA 3PBUA 4UTTC 1W54A 5FF2A 3W7QA 5DY3A 1H7WA 1XDLA 2VFFA 2FB2A 1SQ7A 2ZRVA 3PR2A 4FF7A 2HS8A 2VFGA 1C8VA 2A6LA 3M7WA 1NF7A 1VC4A 4UR7A 3W74A 3VI2A 1H7XA 1QFEA 1G67A 2XN0A 1KTCA 2F84A 2A21A 4UXDA 4UNLA 4N6EA 1K3UA 3LTYA 4OGZA 2RFGA 3NL5A 3LLDA 2O7SA 1TPFA 3W9ZA 4FIQA 2QCEA 5KITA 3GDKA 4QM1A 2ZFAA 2ZQ0A 3W7IA 1JQVA 4LRTA 2ZCGA 2YXGA 3KRZA 1QPNA 3I7RA 3UWUA 2QCDA 1M7OA 2CFFA 1TQJA 1RVGA 3MW7A 3QMRA 1PCKA 3ANYA 5G2HA 2A7PA 1OFAA 3FIGA 4JX5A 3S8HA 3MI2A 4O14A 2XN1A 3OA3A 3QSRA 4JNMA 4Q32A 1LM1A 3L9CA 3UWVA 1THFD 2X30A 1XL9A 5EPDA 3SZ8A 3GDLA 1W8SA 1AL7A 3STGA 4QJ1A 1H7NA 5EL1A 1A50A 3W1RA 4JDBA 4NNAA 2ZA3A 3W1QA 1ZJIA 5FI8A 4LS1A 3UWZA 3W22A 4BK9A 1F74A 2Y61A 2ZZ2A 2J9ZA 2WSRA 1JJKA 2ZZ4A 3PAJA 3H55A 2NLIA 4XBKA 2X1RA 4A3UA 4XQ6A 5C6MA 1XM3A 3BG5A 1G4SA 3QPZA 1IXNA 1YPIA 2X16A 4UFMA 1W1ZA 2RDUA 4JX4A 1OABA 4UFIA 2ZZ1A 1L6YA 1Z42A 4HKPA 1I2RA 3W1LA 2E6YA 1M5WA 4YXGA 3S1VA 3P82A 4UMCA 3UQNA 3P62A 3G0XA 1ZHAA 3LHWA 1BWLA 1TYGA 1T8XA 3KVMA 1KM1A 2AAMA 1Y0EA 4DELA 1G69A 1WYIA 3MI3A 1PE1A 2E68A 4K7VA 3PB2A 4XTDA 1FDJA 3A5FA 3L0KA 3LCFA 4WX2A 1LOQA 2HS6A 2VFIA 3GAYA 3NQAA 4UTJA 4GUFA 1EPXA 5HR6A 3KVLA 1JULA 1ME8A 4ALDA 4CNOA 4DO4A 3MO7A 1JCLA 2E1DA 4A21A 1CX9A 1SW0A 3DI0A 2AQWA 1F6KA 1H60A 4IX0A 2ISVA 4O1BA 4AHQA 2AGKA 3NOEA 3P84A 1F76A 2C13A 2E6FA 3LRKA 2E77A 3R8RA 3TSDA 3P5YA 1X8FA 1DL3A 2VEPA 3QSTA 3W2NA 1VYPX 5SWUA 3HPZA 4DF2A 3R5EA 3F03K 4NJKA 3G3DA 3LCLA 1W56A 4MIMA 3QF0A 2C16A 3NQMA 3TAOA 2HTMA 4LW7A 5KZDA 2A7RA 3N14A 1FDYA 1PCWA 3B4UA 2X2GA 3NYZA 2ATMA 1RV8A 3QMSA 3AJXA 2VELA 4GUGA 3CQ0A 1OK4A 1TPUA 3GIYA 3HG2A 4N02A 2OZ0A 4KWWA 4UC5A 2R8WA 2R94A 1W37A 5CPLA 1WOBA 3U2OA 1IGSA 4CCDA 2E5CA 5D04C 1ML1A 5D02A 3NPUA 3UZJA 3LBMA 5F2GA 1TJPA 1OX6A 2VEIA 2E5BA 5AN7A 2BZNA 5D03A 4P2VA 3W87A 4CNPA 3P5ZA 1NSJA 4MUZA 3ABSA 1DQXA 2A1YA 4UNKA 5CGQA 3GR8A 1ICPA 5BMXA 1ADOA 3LHZA 2P1FA 3OIXA 2B7OA 3FYOA 3S5OA 2G96A 1K02A 2NZLA 1SO6A 1DBTA 3NL6A 5I3HA 3NAVA 3W7GA 1MEHA 1JCXA 4UMBA 2VFEA 3SW6A 1DVJA 4XKYB 5K4XA 3TSBA 1BTMA 3NQGA 1GPWA 1QPQA 3U6WA 2ZZ7A 3VCRA 1TV7A 3O05A 1GVRA 3QYQA 4HPJA 3N3MA 3TKFA 3W2KA 3DGRA 3ATYA 4L4LA 3E0IA 2WO5A 1LDCA 2B4GA 2JGYA 2QAPA 3VNDA 2C1HA 5K7JA 5FF7A 2V81A 4YMZA 4PL1A 5HMSA 3W7OA 4WY0B 3EWWA 1FX6A 2ZDRA 1EWEA 4NUWA 2YCEA 4O17A 5K2ZA 1R46A 4JYEA 4JDYA 4RLIA 3VFLA 2PRMA 4BWLA 1QO2A 3UYCA 3TE9A 1LOLA 1ME7A 4HSOA 4GUHA 3IVTA 5FEZA 4GNJA 5K4ZA 2Y6ZA 3QZEA 4YL2A 3WK0A 4UFLA 3IGXA 1UBSA 5CZSA 3PM6A 5AHFA 4JGDA 3UWYA 3SIZA 2DZPA 3S1XA 4M5PA 1SUXA 1G7UA 1YTDA 3KVJA 4NQ1A 3KFTA 1U5JA 3WJYA 1F6PA 2QDHA 3S0CA 5KZMA 3I6RA 2DORA 1TO3A 3BW4A 4CQ8A 1WDWA 3IEBA 2FPTA 3S1WA 5KSWA 5FEPA 2OJPA 4NZJA 4ZL1A 3JS3A 2GVJA 3BARA 4O1DA 2DJLA 4NNBA 3SECA 3IVSA 1OYBA 3QMTA 1OFBA 5G2WA 2BLEA 1A53A 4UUIA 1UUOA 2NWRA 3GX9A 5MHBA 5AYZA 1Z41A 2ZTKA 1OG0A 4Z0JA 5LSMA 3P60A 3LCXA 3LOTA 4LUJA 3O06A 1VZWA 3L5LA 4I7VA 5D09A 2FLIA 3PC0A 3EXSA 4JS3A 1GVFA 3I7QA 1V5XA 1OFDA 2P10A 1F73A 1L2UA 2Y88A 3FA5A 4RX0A 4UTTA 1H7PA 1KM4A 1O95A 4H4IA 5F1UA 1G6CA 3E9AA 4B5NA 4U4MA 4O10A 1RD5A 4OE7A 1O60A 3C2EA 3V1PA 2Y62A 4UTIA 3UWQA 5CG7A 2Z6IA 4AF0A 4UFJA 2I1OA 1JUBA 2CW6A 2IQTA 3HG3A 5HUPA 4ZMGA 4OHQA 1ICSA 2ALDA 3M5VA 3QW3A 5G1YA 4CCCA 3L68A 4GUIA 5GVJA 1C29A 1PV8A 4TR9A 1PHWA 2C15A 2DZVA 2P0OA 1G7VA 3EB2A 3QEZA 3S9YA 2CZEA 4UCGA 2OMAA 4HN4A 4LV9A 1W5OA 1JCNA 1W0MA 1X6UA 4MZ8A 3UY8A 3P8IA 4FNTA 1HO4A 5AB3A 3THQA 5ABTA 3SSJA 4O53A 2QDGA 3E12A 1XDMA 1FBAA 3C52A 4M6PA 4XZ9A 1FUYA 4Q4KA 1JVNA 3LB0A 3GXNA 2A0NA 1UCWA 3T40A 3DH7A 2UV8G 1JCMP 1TJRA 4PEKA 4UR8A 3CWOX 3T4CA 4NXKA 4JTUA 1VYSX 3TMQA 3TW6A 3A23A 4I9AA 3RLVA 2QKFA 1DOSA 3N34A 5HNRA 2B0MA 2VFHA 3ATZA 3LDVA 1IXOA 3T78A 3UZ5A 4QSHA 2ZZ3A 4J9JA 4LUIA 4ADTA 5DELA 2WJZA 4O4WA 3HQ1A 3LXBA 1FCQA 2QEZA 2CLEA 4P61A 4N9DA 2W0UA 4UTMA 2KZHA 3PG8A 3CT7A 4JTSA 4O0ZA 5E1QA 1B3OA 1BKSA 4RK8A 1D3GA 4ONVA 4DPQA 4AAJA 4I7UA 2DZWA 2Y7EA 1YDVA 1ICQA 1MO0A 2GQ9A 3FKRA 3EX4A 3W2UA 1JRBA 1P0NA 1TTIA 3P61A 1EUNA 4O1AA 4LY8A 3VE7A 2B7PA 3GKAA 4AWTA 3NO5A 2E6DA 4DO6A 3LV6A 3NNTA 4WD0A 3LRMA 2I9EA 2O7QA 1XBVA 3K30A 3O07A 5AC7A 1H50A 5CSRA 4O12A 3O63A 3NGJA 3INPA 2WOQA 2BXVA 2YFNA 3WJWA 1UJPA 4IMCA 3IVUA 5AHIA 4TMCA 2W6RA 2NWSA 3EWXA 4UTHA 4MFEA 3GDRA 3EX1A 3EXRA 2Y63A 2J27A 1WV2A 4A2SA 1Z44A 1RPXA 1GEQA 4HNNA 1EP1A 3TNOA 3UPWA 1TPB1 3PG9A 3BGJA 4OWGA 2ABBA 1YLVA 2GJNA 3FJ6A 3N73A 4JXCA 3STEA 1JUKA 1OFRA 1LZOA 3C2FA 1OJXA 3QFEA 4CLMA 3DXIA 3G0UA 3NG3A 3R12A 4PA8A 1JUEA 1SO3A 4DXVA 3EKZA 2ZRWA 4RCXA 1KFBA 5L9FA 3EX3A 2ISWA 5CZTA 2CZFA 5IM51 2YYUA 3WFAA 1SPQA 4Y6GA 4N4QA 3MHGA 2J9XA 3NQFA 5AYXA 1JR1A 3OVRA 1TRIA 2C14A 4WOZA 3HGSA 4IXHA 3C8FA 4EOUA 3LCGA 3MWAA 3L67A 4ICNA 4Z08A 5FF4A 3KVKA 4RZ6A 1Q6OA 4X22A 3W83A 5BW6A 4HT3A 4N2YA 3PBVA 1RQHA 3B03A 1YXYA 1HL2A 4FNRA 1IXQA 3W6YA 5I3KA 4NX0A 4FIRA 3LTPA 3W7CA 3PF3A 3BK0A 3B06A 4YCPA 1LTDA 5EY5A 4ZQOA 1NAL1 1I8JA 5LGZA 2TRSA 4K36A 2H8XA 4R53A 1K8XA 1O94A 4WY0F 3TR2A 4WJEA 3EX6A 1VHNA 4OV9A 4BR1A 1SSDA 3LHUA 1P0KA 3GKFA 1RZMA 1YDOA 3C2OA 3MMTA 4JTFA 4GC4A 3EEGA 3NQ7A 1WX0A 4JY9A 1X7FA 3LGEA 2NUYA 1H7OA 1MEWA 1Q6QA 4MPQA 3BLIA 3UY7A 2WSQA 2NXGA 4MY9A 3GNNA 1GT8A 3W2MA 1KFJA 3CWNA 1EUAA 1LRNA 2ZRYA 3QJAA 2EPHA 3PUEA 2A6NA 3Q58A 4MLJA 1ME9A 1P4CA 4DO5A 1WOAA 1RQBA 3CU2A 2FDSA 3SJ3A 2CLIA 2EGZA 3G1SA 3HG5A 3TXZA 4LVBA 1X1OA 3P7YA 4JTKA 2QCCA 3DFTA 1TV5A 3B0PA 2NXIA 3IIZA 5U4NA 3MYPA 2ZTJA 2D73A 1FWRA 2ISSA 2Y89A 1VH7A 4XKYA 3L5MA 4JD4A 5CPNA 4YLWA 1XXXA 1I4NA 5TBOA 2JK2A 3GDMA 1MZHA 2RH9A 3NR0A 5BNKA 2YX0A 4Z1DA 4O54A 3PS7A 3W7DA 1MXSA 3A21A 5CZ0A 1EX5A 5CPOA 4ZVJA 3SGUA 1DHPA 4BF9A 2YYTA 1Q45A 1OFQA 4WY0A 3TFCA 4POCA 3WJZA 1AL8A 1ZAIA 2V5BA 4XUGA 1QCWA 6ALDA 3EWYA 1R2SA 3HJZA 1M6JA 4S2BA 4RXFA 4OU1A 1GVSA 2HSAA 2Q3OA 1R2TA 2OT0A 4IX2A 2YW4A 3M43A 3I68A 3FLUA 1SR9A 4BFAA 3L65A 3WK3A 3TU9A 5AC6A 4N9BA 3E49A 3FJLA 5A5WA 4JIQA 2GVLA 1SZGA 4GJ1A 4Z1CA 3PWAA 3R2GA 2CZDA 5LNVA 3DHDA 5TQLA 1TPVA 5HQEA 1AW1A 4ZQMA 4ADSA 1LOSA 3IV3A 1QPRA 8TIMA 1NFBA 1XBYA 4O15A 1C9DA 1KBJA 3Q94A 3SY5A 3PSVA 1M7PA 2WNQA 4K39A 3BLEA 2Z2UA 1XC4A 4NT0A 4Z0SA 3BG9A 1O5XA 4JIPA 1VCVA 4O13A 4R34A 4JTIA 2DZSA 4RZ5A 1GOXA 5CPMA 3LX9A 4XBSA 4LS0A 4GUJA 2FIQA 1WXJA 2ABAA 3FS2A 2QUVA 1FCVA 3EX2A 4JTTA 4FNSA 1AW2A 5DN1A 3MP5A 2GUUA 1J4EA 2H90A 4JN6A 3W1MA 3OHIA 4BI5A 3QQ0A 2EHHA 5DLCA 1VCFA 4RZ4A 3UPBA 2YSWA 4MFDA 3C6CA 4K6AA 2VFDA 2W79A 4LVGA 5A8GA 1FWNA 3FEMA 3IIPA 1FDZA 4GE8A 4NX5A 5EYWA 3I7SA 1TB3A 1D9EA 3DI1A 5KMYA 2QF7A 3A22A 2ZA1A 2GQAA 1JCYA 1VLIA 2DP3A 4MY8A 4MKNA 1H1ZA 3OVQA 3FOKA 5KZEA 3WJSA 3TV8A 1OVDA 4FO4A 2C19A 2X1TA 4HIBA 5CSSA 2BTMA 3MHUA 4FX8A 4M7SA 4LC6A 2NX1A 4MYAA 4JX6A 1XBZA 1W3TA 3W2LA 2QCFA
chains in the Genus database with same CATH superfamily
2PFHA 2ACRA 2H6RA 1WNOA 1RLCL 3G1FA 4XG1A 2HZGA 2G3MA 1EOMA 3BZGA 3EZ4A 5EB8A 2W62A 4H9ZA 4AHOA 3W7EA 5LNWA 4XAPA 2VEMA 1XCFA 5J04A 2WMFA 4YS1A 2O4MA 1VRDA 3SDOA 3MSDA 5D33A 2XH2A 4BF5A 4AXKA 4ERIA 1E6XM 4Q8PA 4ZFMA 3MSRA 1UZHA 4IHCA 2OKTA 1C9WA 3CEUA 1HUVA 4OUEA 3I6TA 1PVNA 1H61A 1TTPA 2DQXA 4PBGA 1CLKA 3SQSA 5FF0A 3PZUA 3VOCA 1C90A 3KZPA 1AH4A 2GJPA 2CLOA 3EMZA 1EDGA 4DY1A 2J47A 5EU9A 4HCHA 5HWNA 3L0NA 3GNRA 2EEXA 3VIJA 2XJ7A 2A3HA 3QC0A 1W3HA 1A5KC 1AUSL 4UZSA 3RGTA 1IWAA 1AW5A 3MVTA 2R82A 1BQCA 1TMHA 2QCGA 2VYOA 1FH8A 1CXLA 1RP8A 3BW2A 3VGDA 3PULA 1TMLA 2Q09A 3MJMA 3VIGA 2FZ8A 4MOZA 2V2DA 1UP0A 4QAIA 1WKYA 1B3YA 1XYMA 4RV8A 4W86A 3VZYA 2XINA 1WA3A 1GHSA 1BWVA 3G3MA 4IIGA 4D2JA 5C5YA 1KM0A 4LTSA 3QBUA 3E02A 2DSZA 2JQXA 2NQHA 1PYFA 1IR1A 1R3YA 4LF1A 2OT1A 2DUZA 1B1YA 3IWPA 3TA6A 3DYPA 2V2CA 3OOQA 3PPGA 2OFJA 4UQ9A 3CEPA 3RM8A 4H9YA 2WXDM 3V16A 2GOUA 2XIOA 2D24A 3DFNA 1GOKA 3U5YA 2J88A 3WLSA 1IIHA 2QR6A 1KO0A 5LGXA 4FPSA 1HFBA 1EJTC 4ORIA 1ZJBA 4QX4A 1R0MA 3B05A 4AHPA 3LU2A 1BHGA 4L4MA 4NASA 4DF1A 4MVAA 3RMJA 1XQLA 1ITCA 2OEKA 1GQKA 4O52A 4KW2A 3GG8A 3SBFA 3OEXA 3GNDA 3QQWA 1XW8A 3NQ6A 1T8QA 3TC7A 4ZQPA 2A5HA 3HZ3A 2JBMA 3DKLA 3M9YA 4A29A 3VKJA 4DN1A 5CC3A 2O9OA 2E25A 1H5VA 3AS2A 3W24A 4PCPA 1DWFM 3LLFA 2R1KA 3VOGA 4XD3A 1F8IA 4W87A 1MEIA 2ESCA 5JH1A 1S38A 1JZ4A 5AYYA 1TPWA 4AY8A 4ORMA 1PTAA 5A6SA 4O1CA 1KM3A 4DF0A 2VRQA 5FA5A 3WMBA 4ZB2A 3CZ8A 5H1WA 1RBOB 9CGTA 1DIEA 4G7FA 3LV5A 1UR1A 4NILA 4WIWA 4GYPA 4EANA 4ZTXA 3NSXA 4MJZA 4Q3MA 1R9ZA 4HJWA 1ZENA 1M9HA 2V30A 3WLNA 1PKMA 1UBPC 4XISA 1HP4A 5I2UA 4W84A 4OTKA 4A8NA 1JGMA 2PRLA 4AXNA 3UFYA 2BG5A 3I3DA 2XVKA 1H09A 3ARZA 3KCJA 4C6EA 3VIHA 2J7CA 3ELFA 4O11A 3P74A 4M1RA 3BO9A 1ZP3A 5HNNA 4L5ZA 1KRCC 4HTBA 2XIQA 4DWDA 1OX4B 2PTXA 1DORA 3HIJA 1XP3A 1R5YA 3PJXA 1OZQA 4FXJA 1QNVA 1CXHA 4JCLA 3GLCA 2F6KA 3L21A 1G9HA 1JF6A 1S46A 2BX7A 2YCIX 4JN7A 2A3LA 4AZ6A 4AZ5A 3IUDA 3H22A 1VBHA 3G1DA 4JY8A 3AALA 5IFTA 4KGLA 3W27A 1QASA 1VLWA 3A9BA 2YBTA 3ZWSA 3KOZA 3WFLA 1OC5A 1YPXA 3BJFA 4AC7C 2ODOA 2V69A 1ZUAX 3MYOA 3M1ZA 3AIRA 4PR4A 5J5RA 1S2WA 1KA9F 4Q7NA 5CCZA 3NZ1A 1N82A 4F0KA 2AQOA 3U2EA 3FGCB 3SRKA 3SR7A 1QNRA 1DWHM 4LT9A 4O8RA 1OD8A 4FXSA 5JIWA 3THDA 2J7DA 1TJ0A 4U5IA 3WG6A 3LCIA 1XDJA 7TAAA 1RCXB 1LL6A 3SCQA 5HWJA 1FXQA 4HU3A 4RE0A 2QJIA 2X1UA 4DBUA 5EMUA 3K46A 1XPGA 4PMQA 4FNPA 4PMVA 2J6VA 1HO1A 5LNUA 4KS0A 4FX7A 4GINA 2Q02A 3VE9A 3AIVA 1H5YA 2RGLA 3LENA 4PBFA 5DXYA 1E15A 1JI2A 6ENLA 3UZZA 4ASTA 3GHSA 1UQYA 4XX6A 1Q6LA 1S1PA 3LERA 3SY8A 4GYFA 4Y96A 2ZUNA 1A3WA 1UUMA 3AYTA 8CGTA 1V3JA 1B4EA 3WLRA 3GR7A 1TA3B 1UD4A 1XIBA 5HJXA 1TPEA 3F1QA 3PBYA 5C8BB 3K5XA 1QW8A 2DUXA 5FAJA 1VIWA 2ZRZA 3M0YA 1FKXA 1TZ9A 5DANA 4X0NA 3N13A 3RJXA 1NTHA 2VENA 1Y5XA 1DJQA 3S5NA 4W5UA 1T0OA 2JEPA 4PBEA 1PIGA 4WR3A 1VHCA 4PCSA 4IXXA 1E43A 2NSOA 3DG7A 5LHEA 3OVPA 2CWNA 5J8LA 1EA9C 3VUSA 1ODUA 3S9ZA 3ES7A 2B31A 5IFPA 2NUXA 2Z26A 1WZKA 1SO4A 4I8DA 1W3IA 4OT7A 5L6UA 4D8LA 4OFCA 5IBXC 3UG5A 3L7RA 2XSBA 4L9XA 3SCRA 2OGYA 4FB7A 4X3ZA 1Z6KA 1ZCCA 2PCQA 1QI2A 2VCAA 4PMXA 3ABQA 3PJTA 5LHFA 2QCDB 5FESA 2CBJA 1WXZA 3MSGA 4O8AA 4MLRA 3BSMA 3VUPA 4H9MA 5BMWA 2WCSA 2BOFX 3BCFA 4DWSB 2V9DA 3VTRA 4QDMA 4WQ6A 7ODCA 2R91A 4DXKA 3TQKA 1O68A 2X1IA 3WBXA 5EA9A 3DU0A 3LGDA 1LLOA 5HWMA 3S5YA 1R3SA 3F5JA 3CV2A 2NX3A 3GWQA 3CV7A 4IPNB 2ZX6A 3NL3A 1QPKA 3CJPA 3S1UA 3MZ2A 4G6CA 3RO8A 3BG3A 2Y0FA 3AXIA 1HJVA 3OZMA 3G1AA 3FA4A 3KRUA 5BOEA 3H12A 3TWAA 4KCUA 5B80A 4L65A 3L5AA 5HA7A 1IF2A 1TPH1 2V6AA 1YHTA 1BYAA 3CC1A 2BGSA 3DFPA 4C6IA 3QY7A 1E1CB 2OQHA 1R9XA 1KFEA 3F4CA 4G9PA 1GG0A 1FCUA 3IRDA 7TIMA 3JW7A 4D6IA 2OG9A 2YBUA 4DWSC 3WF3A 3BV4A 4Y2WA 4XZNX 5A3HA 3HBLA 4DM2A 1BLIA 1EPVA 2YCLB 3GU2A 3MHFA 4KFOA 1FHUA 4LU0A 4Q4OA 1G4PA 5FAGA 5K9DA 1UC4A 4FEZA 4CEUC 1KGXA 1PTDA 1BSLA 3MCMA 4MAZA 5CBBA 3UG3A 4LNYA 3TIMA 3H2EA 3F4NA 2WMHA 1QPOA 1K7XA 1MDRA 4YYCA 1DTUA 4FLQA 4GD0A 1Q5MA 3TCEA 2OSXA 3JZUA 1CGYA 3W7JA 3TMLA 4E3TA 4PMRA 4J3WA 4GFSA 4Y7EA 4Q4MA 4GZJA 4JQ2A 1OF6A 3P6LA 2QV4A 3C4UA 2GVGA 2NX9A 3W25A 1W9DM 3KP0A 1W3NA 3HOJA 3HF3A 4ZO6A 1VCGA 3U48A 4LAKA 2PDBA 4ECLA 4OUIA 2DIEA 5I07A 2PSNA 2DT1A 2PBOA 1LL7A 2J7EA 1JFXA 5BXSA 2YXOA 1RALA 4CUCA 3RHGA 4UOQA 3VC5A 4XZWA 3GDTA 1WKFA 3NA8A 4WXYA 3S5ZA 1V6VA 3GK0A 2VDIA 1TVPA 3GFYA 4GHRA 2WV8A 1CEOA 2P76A 3GNOA 1ZJAA 4Q7BA 2NSXA 1KV8A 4I5XA 4D6CA 3ZJ6A 2PU0A 3TAKA 2CNCA 2V5LA 5LZLA 3W3OA 4H2HA 4PUDA 1NWSA 4ML9A 4QRNA 5J5DA 4HCDA 1UZDA 4KKXA 2CHOA 1OX4A 3B9DA 1UASA 4IGHA 1X6NA 1CXKA 1A80A 5KTLA 3DFSA 3KHJA 4O4VA 4D72A 1E1EA 1NWUA 3W1AA 4JHMA 1F6YA 1GOOA 4H9TA 2PDGA 2QPUA 1ENUA 5HINA 3TYZA 1PB0A 4NL1A 3UXIA 8XIMA 2GWGA 4UQBA 3ZS4A 3WQWA 2FQIA 1V77A 4M6QA 1W5PA 1LBMA 1N2VA 4Q6JA 4HOWA 2FDMA 3FGCA 2FYMA 1FHDA 1J6OA 4G5DA 4R9OA 4FLRA 1WBJA 3N19B 2L5HA 2GVEA 3E5PA 3ALFA 4R5EA 2C6QA 2VKZG 1EXPA 4CN4A 1PX8A 1G4TA 2XWEA 4MZYA 3B8UA 2E1WA 2OEJA 3T6CA 4MZ1A 3SIMA 5BOOA 3WENA 4NYYA 1UG6A 5B7ZA 2OX1A 1DYSA 5T8GA 4OBSA 4XUYA 2I5QA 5AHNA 4MM1A 3P8JA 2Z24A 2YBVA 3LPFA 3V4BA 1ISWA 4H7VA 1D2KA 4BF7A 4MWAE 3D46A 3S9IA 3PZMA 4IWWA 1OIFA 1KM6A 5A69A 4PMNA 5E6YA 4ZZ9A 4EF9A 1B9BA 3QW4B 3WFZA 1BVNP 1Z69A 3GVWA 4H3DA 5IBXA 4CNNA 4C6LA 1JCJA 1TA3A 2IXUA 3VNLA 4D6DA 3A47A 4FXRA 3CXOA 4O0KA 4C60A 2ZC8A 1SFLA 2WMKA 2VEFA 4UTLA 3BXWA 3T0CA 3TQVA 4I5UA 4LAZA 5H2ZA 2DJXA 3DZ1A 4KFPA 2FZMA 3W73A 3XINA 1GOIA 3CMJA 1KRBC 3L2MA 3MA8A 4FI4A 5BU6A 3DUGA 3M47A 1A5UA 4IMGA 3FJNA 3LK6A 1LCOA 4JTHA 3S47A 3PBUA 5FF2A 2QUNA 2C8NA 1H7WA 2VFFA 2XFYA 2GWNA 2VFGA 1NF7A 3W74A 1Y5WA 1TUXA 2QLYA 1BAGA 4AWEA 2VM8A 1PZ1A 4I3GA 2XN0A 4UXDA 1K3UA 3VC6A 2R6OA 3BOXA 2RFGA 3WQPA 5C9RA 2GVYA 3SFWA 4QM1A 2ZFAA 3W7IA 1JQVA 2YXGA 3KRZA 1VEMA 3I7RA 4UNIA 3N12A 2QCDA 2R9RA 2HISA 3V18A 2QGYA 1RVGA 3N3TA 2Y8UA 4QLJA 3SCWA 3ZVHB 3N15A 5E9AA 1LUCB 4DWSA 3WH7A 3MI2A 3OA3A 2UY4A 3QXBA 1THFD 3UWVA 3GDLA 2BOGX 2NQZA 2J74A 3BJSA 3WDRA 1CWYA 4NNAA 1LG1A 3KHDA 3BLOA 3WYZA 3KDOA 4BK9A 4RE2A 1JJKA 2PAJA 2PWHA 2EJAA 2VGIA 5C6MA 4J7RA 3KBMA 3QPZA 2MUCA 2RDUA 4JX4A 2ZZ1A 3POHA 4HKPA 1I2RA 5RUBA 3S1VA 3P62A 4GI4A 3LQGA 2BVYA 4FMVA 3LHWA 1Q7QA 3L4YA 1KM1A 4ZXOA 1WYIA 3LA4A 1E1CA 2E68A 1WO2A 3PB2A 4XTDA 1FDJA 3AU2A 2ZVIA 4WX2A 2HS6A 3GAYA 3NQAA 3WQEA 4HNCA 3LGGA 1EPXA 5HR6A 3CZLA 1MW1A 2E1DA 1QW9A 1SW0A 3GH7A 3E3HA 1H11A 3H4GA 1F6KA 2YCLA 2ZDSA 1DJIA 2ISVA 5JH2A 2Z7GA 2E6FA 2WNWA 3KOXA 3LRKA 1BYDA 3TSDA 4IPPA 4K68A 1X8FA 3ITCA 1DL3A 2VEPA 3HPZA 3VU2A 4HPGA 4ZEPA 2VC5A 1MW0A 1UKOA 2GDUA 1UH2A 1K9DA 5E9XA 2PWVA 4CN1A 3AS3A 1BPLB 1JL8A 3GW0A 3TZNA 2VELA 3A3WA 4GUGA 4A8LA 2J25A 5CLWA 1UZ1A 4MNLA 3LD5A 1XD0A 5CPLA 1YNYA 2DZBA 3QR3A 4Q4PA 1E4IA 1ML1A 3WX7A 4Z2JA 4Z1YA 3LBMA 5F2GA 1TJPA 1RH9A 3FA3A 3ZJKA 4KCTA 3PUGA 5HNTA 2WCAA 2NT1A 3W87A 4MHBA 1VEOA 3P5ZA 2A1YA 3UYIA 5CGQA 3GR8A 4RDWA 1D8CA 3LHZA 3W28A 1K02A 1OSEA 2BY1A 2NZLA 4NRSA 1ADSA 1RUSA 3NEHA 3NL6A 3PZVA 3QKZA 3QFWA 3NAVA 1JAEA 2HV5A 4UMBA 1JCXA 4H7ZA 3HV8A 2PGEA 3EDFA 1QPQA 3EOSA 5HK4A 2B81A 3L4TA 4DM1A 4RE3A 4B3ZA 3N3MA 3TKFA 3HU7A 4MG4A 2PDLA 1A4LA 2X8RA 2B4GA 3IS4A 2IPWA 3ZO9A 2C1HA 1AH0A 4I90A 4YMZA 1OWQA 3W7OA 3L4WA 1LWHA 3GBDA 1J0YA 4NUWA 5K2ZA 1GW1A 1R46A 1IZCA 1QO2A 3JZEA 4J3SA 3TE9A 4AD3A 2JEQA 3EDKA 3WK0A 3IGXA 2VWSA 1IWPA 2OEMA 2X40A 4JTDA 4GABA 3CUFA 1G7UA 1JF5A 2D0FA 4NQ1A 3KFTA 1F6PA 3GH5A 3R4IA 5CPTA 3CPGA 2CXGA 2OOFA 5A2CA 4GNVA 3VOHA 2OJPA 2XVGA 1XLGA 2FHBA 4EWJA 4O1DA 4PMUA 3GXMA 5G4HC 1EYWA 5G2WA 3RUBL 2BLEA 4UUIA 3WF4A 3VILA 3GX9A 3WUGA 5MHBA 5AYZA 3MUY1 2OWCA 4M56A 3ARPA 3B8VA 1OG0A 3KBNA 1US3A 4NG3A 4WDUA 2ZXAA 1EHNA 4LAOA 5D09A 2EG8A 3PC0A 4IQJA 1Z7AA 4G56A 4F0MA 4JS3A 5KETA 1K4GA 4BY3A 1F3TA 4OVXA 1QI3A 1EBHA 3N4AA 2Y5SA 1KM4A 2Z2BA 3ZT7A 1O60A 3KLLA 3C2EA 1ZTVA 4A3QA 4R9XA 3V5CA 3K1DA 3UWQA 4AD2A 4Y9OA 2OYKA 2I1OA 5HUPA 3O0FA 2WMGA 4ZMGA 2WZEA 3QW3A 4DNMA 4CCCA 1G5AA 3L68A 1ECEA 1Q63A 7ENLA 4TR9A 1KNWA 2P0OA 1G7VA 2OOGA 1W1IE 5I77A 4UCGA 2OMAA 1XLAA 1W5OA 1OZMA 3P8IA 2G41A 1XLKA 3OZOA 1QHPA 3ICJA 1HO4A 2QIIA 4BEUA 4HU0A 1FBAA 1RPKA 3EPMA 3B9EA 3ARUA 1TJRA 3PN8A 4PCNA 3T4CA 3NUKA 2YA2A 4NXKA 2VO5A 3VNZA 1VYSX 3TN5A 1LT7A 5E5CA 3AZTA 3RLHA 3I3EA 2B0MA 2D22A 2VFHA 2YZ5A 5FSEC 1DJZA 3T78A 3ZR5A 4QSHA 4LUIA 5CAHA 2TAAA 1QBAA 3HQ1A 2CLEA 2O55A 4S3DA 4N9DA 3UA3A 1MFUA 3PG8A 3CT7A 2BS9A 1WPCA 1HVQA 4J27A 2D3LA 2QJNA 4RK8A 2X42A 3LZ5A 4WEVX 3G6LA 1ICQA 4WDXA 2GQ9A 3AHXA 2Z1SA 3EX4A 3QV7A 4IISA 1JRBA 3TNBA 1W2VA 4GG9A 1EUNA 3BV7A 5ABGA 3KTXA 3TYAA 4ZO8A 2PUZA 1RJRA 1FHVA 2B7PA 1BFNA 3C0LA 3GKAA 3NO5A 4JFTA 2O9TA 3NNTA 3W53A 3ZVHA 2I9EA 1LUCA 1XBVA 3K30A 1H50A 3C0SA 2OZ3A 4O12A 4AX7A 1U5HA 3NGJA 3INPA 1TUFA 1XYCA 2J75A 1GUVA 4N7QA 2WOQA 2BXVA 4GI8A 4GACA 1B3VA 2NWSA 4DLMA 2VC9A 4GI9A 3T0AA 4UTHA 4GVIA 3UR8A 3IJQA 3GDRA 3EX1A 4CQCA 1EGMA 2J27A 4AZHA 2YDRA 4GBDA 4QJ4B 3AZSA 4S3FA 1TPB1 3LUTA 3DESA 2X0HA 1VFTA 1FWAC 1E5JA 1BKHA 3N73A 2FZNA 3STEA 1JUKA 1OFRA 1LZOA 1KQYA 3STPA 4QXIA 1FKWA 4WJXA 2YL9A 4E8GA 1WKEA 3OP2A 4Q8QA 1VF8A 4UWMA 2YKKA 4PA8A 1SO3A 3RRXA 4YTSA 4RCXA 4ZENA 2INZA 2DT2A 2ISWA 5I03A 2CZFA 3E0FA 3WLHA 3WQGA 4H8VA 4Y6GA 3ZQ9A 4KERA 3MHGA 3E74A 4DYEA 2J9XA 1W9UA 3KE0A 1SJCA 4FSAA 2GQ3A 4IXHA 3C8FA 2BNJA 1DEDA 3MC5A 3PNZA 4ZOBA 3MWAA 4I8YA 4ICNA 3EB3A 5BW6A 5A95A 3C0QA 2IPFA 1JYWA 3R58A 1YXYA 1HL2A 4CD8A 5I3KA 5EMMA 3SQLA 3AS0A 2F2HA 4NX0A 3OJGA 3W7CA 3PF3A 3T4WA 3ARYA 3WEOA 2E0PA 4DO7A 2CITA 1Z89A 1MXDA 6A3HA 4K36A 3I4EA 1XIJA 2H8XA 3AFBA 3ZMRA 3EX6A 2QS8A 2OKOA 3MKKA 1DTNA 1DP0A 5BXTA 4OOUA 2DVTA 3NQ7A 3A4WA 1WX0A 4NYUA 5T91A 1X7FA 1MEWA 4MPQA 1B3XA 3WLQA 3UY7A 1TV3A 4MY9A 3W2MA 4KWUA 1LRNA 3EWCA 3PUEA 2A6NA 1ME9A 1OY0A 3AIUA 3U5UA 3CQHA 1GPFA 1X1OA 3P7YA 4EPEC 4B16A 4NAEB 4ATDA 5D8WA 1G94A 3ITTA 2D73A 1VH7A 4Q8OA 1M04A 4AD1A 4JD4A 4ZBCA 1XXXA 1I4NA 3N6HA 5TBOA 2JK2A 3REQB 5ABHA 2D0HA 4RNJA 4E3VA 1HKVA 2P0IA 3GS6A 2YX0A 3WF1A 4S23A 4B9YA 4V15A 4P7RA 1VKFA 2Q71A 1UD3A 4LAUA 3GR4A 5CPQA 1OFQA 3TFCA 4POCA 3WJZA 1AL8A 3H2NA 2V5BA 1U5VA 4H6QA 3HJZA 1V79A 4OU1A 1GVSA 2Z25A 1F3WA 1R2TA 2OT0A 3URBA 3BCJA 1SR9A 4U2ZA 5AC6A 1K9TA 4FA3A 1QI5A 1ECQA 1W9BM 2ZWYA 3QN3A 4JIQA 2GVLA 1CGWA 2DH3A 1BYBA 1MQPA 1UKPA 4C6FA 5TQLA 2IKGA 4PTDA 1CCWB 3IV3A 2ZXDA 8TIMA 1B0IA 1NFBA 2JF7A 4GZ7A 3Q94A 3SM0A 3SY5A 1HQTA 1JDCA 2DV0A 2EJ1A 1JPIA 4GYJA 2Z2UA 4HHMA 3CMGA 1XC4A 4Z0SA 4IIDA 3T8LA 4O13A 1YIXA 3LX9A 4YVXA 3BUVA 3PBMA 4LS0A 4IL2A 1W9PA 1OCBA 5LIKX 4FNSA 1TWIA 3MP5A 3MMDA 5AKQA 4BCEA 2H90A 5JU6A 3KUMA 1XGZA 1VCFA 3UPBA 3O7UA 4HB7A 1WZLA 3FDKA 3VNJA 3R79A 3KP1A 4TTUA 1VBGA 4MKSA 3FEMA 3IIPA 4NX5A 1EGVA 3FAWA 1D9EA 2P88A 1VLIA 1Q6GA 1VBJA 3N6JA 1XH1A 3T9PA 4HIBA 3JU2A 4M7SA 1XBZA 1W3TA 3W2LA 3H2FA 4HA1A 1YPFA 4ZFCA 5LIUX 2WC4A 1M53A 3G2GA 1PZ3A 1REQB 1WB0A 1SR0A 3PFMA 3DEQA 1HL8A 4MB3A 4L64A 4AH7A 4NY2A 3TYBA 2PCEA 4H04A 1EJXC 1NF0A 2YDQA 1J9YA 4DHGA 3RX3A 3U8GA 4FHAA 1EJUC 3SRHA 2VEKA 4MADA 5LNSA 1HF6A 3W84A 2OPJA 4GBUA 4QG8A 2VRKA 1J12A 1XD1A 4TMBA 3S2MA 1G01A 1XIGA 1L8NA 3C2RA 3ZR6A 5DO8A 1UWUA 1ESWA 1P6WA 5I3FA 2QUMA 2J7BA 4HGXA 4Y8EA 3ZFHA 5HPOA 2E5DA 1XV8A 3AIEA 2EPLX 2CXEA 4LBSA 4P7QA 3B9AA 1XJBA 3DHFA 4IIHA 3BQ5A 4GCAA 1W5NA 4BZYA 1Y8BA 1X1NA 2FPYA 4LGXA 4S1FA 1LWIA 1V51A 4GISA 3V1HA 1MDLA 1LP6A 1N55A 2QDEA 2J66A 2IS7A 4ZO9A 4P8WA 1HNYA 3B0UX 4GY1A 3DFOA 1EC8A 1E0TA 2Z0IA 4R7WA 5KEZA 3RU6A 4K38A 5HANA 2NVCA 3LNPA 1UYQA 5E0KA 1F8MA 1M03A 2BHUA 2C0AA 4IPJA 4YWIA 3MP4A 1DQWA 2GPTA 2C3ZA 2PURA 3SFKA 3W76A 1AMYA 3PVFA 4J40A 3FYYA 4JHZA 1C8YA 2GFTA 3Q2DA 2V0TA 3M5XA 4A05A 4IJBA 4UIOA 3H7RA 1HG3A 3DECA 1VPXA 3NQ8A 2BWGA 4H6EA 4DBEA 4B92A 4N4PA 4CVUA 1AMKA 5A8OA 5HULA 1V02A 3BGGA 4GK8A 1CI1A 5AC4A 2QAFA 3VKDA 2FJKA 2ZZ5A 1S5VA 2I56A 3HGJA 1G1YA 4IICA 2YLAA 5ABFB 3HTWA 4O50A 3PZIA 4JTLA 4ZQNA 1RA5A 1W3JA 3MU7A 1KC7A 4LRSA 3TA9A 3WBEA 5C2CA 1A5CA 4AD5A 4CU6A 3CQJA 3UU0A 3VMOA 5AVNA 4XIMA 5T26A 1XCXA 2FH6A 2DQWA 3O15A 4ZOEA 3PZOA 4A4AA 3DGBA 4V27A 3IPWA 3T7VA 2FKPA 2XSXA 2VX6A 5DMLA 1GVOA 2W3ZA 1IR2A 4R33A 1VGAA 4M7TA 1JZ2A 3WQVA 1JNDA 1X97A 1XC6A 3T08A 4DZIA 3RDKA 4AB4A 1OGBA 2WMIA 4C1KA 2PU1A 2IUZA 3W7NA 4ZODA 1BF6A 4IPIA 5AFDA 2RDWA 3WDQA 3UD6A 1SZNA 3L23A 4QBXA 1V08A 4C6DA 3ZJ7A 2W5FA 1GK8A 3UA4A 1NDYA 4Y8FA 2JGQA 1F2JA 3L0GA 3V0SA 1T5AA 3LRLA 3AC0A 2CPUA 4XB3A 1RA0A 3KCOA 3W72A 3CBWA 3TROA 1FVPA 5D8ZA 4H9XA 5JQ9A 3ABXA 4QS6A 4UTKA 1BRLB 4CN6A 1EP2A 1WAUA 2AGTA 1KFWA 1XIFA 3B40A 1FHLA 5FJIA 4NAEA 4RNIA 3BLKA 1QRQA 4UQDA 4RXGA 1VJSA 4CU7A 3D5HA 4UTWC 3BH4A 2PC4A 3N18A 2CBIA 1PO9A 1E1FA 3WLJA 1KB3A 3REQA 3CHEA 1OBAA 4GQQA 1AD4A 2E09A 2ZUWA 4K1WA 1MUWA 3EWDA 4REQB 2OLHA 4YHEA 4XWUA 3H4WA 4I9JA 5FJOA 1TRDA 3E1F1 3IV8A 4TVCA 2RKXA 3E96A 2PC8A 1JYVA 3AJ7A 4MWAD 1H1NA 3MMUA 3WUFA 3LZ3A 1F3XA 4HMCA 4N6FA 4M81A 3W7KA 4ILSA 4LVAA 4PUEA 3NEVA 1E4NA 1EO5A 2PDFA 2VZOA 4UMAA 3RITA 4JIIX 3WH9A 3NFUA 3CZJA 3EKGA 1KTNA 1UB3A 4C6NA 3K13A 3UESA 5BWAA 1SMAA 3ZZ1A 1K7FA 2HQAA 1VQTA 2WJDA 2PTYA 4PL2A 4DI8A 1QMLA 4J1OA 1UP3A 2BSLA 4JOMA 4EIVA 3AXHA 3WN6A 3THCA 2IQDA 1PTGA 2GGIA 2XZ7A 3GIQA 4QTGA 4GIRA 5A8PA 4BQ4A 3MMWA 1KBKA 4ROQA 5CAKA 2Q3RA 2QCMA 5F4WA 4XKMA 2QCHA 3FN9A 3KS6A 3R7MA 2BDQA 1DE5A 4X2RA 3DBNA 4D6HA 2ZUTA 2F2KA 4B5UA 1HXJA 3DX5A 2A79A 3T2PA 8RUCA 3M0ZA 1EDQA 1VFSA 1IIGA 2Z2AA 4Y90A 1E73M 3G24A 4XVEA 3L2LA 3UNDA 4NZ3A 3LXAA 3TK7A 3H53A 3CM4A 4JFSA 1KLZA 3DC0A 4HNUA 3GUGA 4WXZA 5E93A 2A85A 2LLEA 3TJXA 1TCDA 3NPVA 1I60A 4A3RA 1JG9A 3TXVA 2YCJA 5FACA 4WKHA 1ZBVA 5A6LA 3DFYA 1GOQA 3PFRA 3AZRA 2PRHA 1TE1A 3UWEA 1X38A 3JR2A 5DMMA 4QROA 1GYLA 3PUDA 3EDJA 1MVYA 1X8CA 5A2BA 2DU2A 1WKDA 5M2FX 4GKTA 2YPIA 4QLKA 3EWBX 2E9MA 3OYZA 5D30A 1FCBA 1REQA 5EFFA 3RF9A 4IFOA 2PTDA 3VD9A 3RPTA 4UFHA 1VS1A 3ES8A 4LYRA 3H2OA 3KW3A 1A5BA 4FLOA 1WQ5A 4AVFA 5A8QA 3TYUA 1XKJA 4S3JA 3LXCA 1L0PA 5I24A 5A6TC 4B2DA 3N2CA 1ITUA 3FVDA 4LQ1A 3BC9A 4QR6A 2VVNA 4WVXA 2H8ZA 1I2QA 4UOJA 3QKEA 4BQ5A 2VC6A 2VX5A 3VYLA 1QDSA 3GYEA 1TKKA 3VM5A 1SGJA 1TWWA 3L4ZA 5LA1A 2HVMA 5XIAA 5HBFA 3M0VA 4LAMA 5AOUA 4FOKA 3S42A 3TR9A 1K6WA 3N9SA 3RILA 4GQRA 1FWBC 4H6KA 2GSHA 2B7NA 3DYMA 3OBKA 5LA2A 4NU7A 1CYGA 2JKPA 1UP2A 1J0HA 4M19A 2NXHA 2ZYFA 3FX4A 4M3PA 4GKLA 4E5TA 1C7TA 3A3HA 3NZRA 3W7HA 1QBBA 3RR1A 2VCBA 1V7AA 4DZAA 4O18A 1N8IA 4IOTA 3WLTA 4QNWA 4CNTA 3G8EA 2BVWA 2WSKA 1QOPA 5D9NA 2XWDA 2YGYA 1RK6A 4GWEA 4FNUA 1XIMA 3B0YA 3VFCA 3ABRA 3BLFA 3V5FA 3NM1A 4IM4A 2FGZA 3W4RA 1OCJA 1CNVA 3GAKA 3QPYA 3T44A 2GGEA 2JKEA 1EP3A 2J6XA 2QZRA 3NXLA 3R8GA 2VUYA 1E51A 2V68A 3WL0A 1US0A 3L66A 2R1NA 4MB5A 3WBYA 2UWFA 4B5SA 3NQ2A 1EHAA 4IT1A 3E2QA 2AKMA 5ABFA 4GOAA 4PUUA 1E6PA 1ZGDA 1UA3A 5H8MA 4NRRA 4JCMA 4K2SA 3G1YA 3I6EA 2BBFA 3USZA 4ZOCA 3PZTA 4LANA 5CPSA 4WLCA 2CBUA 2D23A 3CHVA 3TFXA 2VWTA 2IKHA 2I57A 4HMDA 2Y5EA 5CQ1A 4WDWA 4RW5A 3G0SA 3CLMA 3FCPA 1K6AA 2PF0A 3LHVA 4MB1A 4EVZA 4MDPA 1EL3A 1J2WA 4EE9A 2YZRA 3FFSA 3BAWA 2OVLA 1XLJA 4M80A 2DZTA 2Q8LA 1N8FA 3NXFA 4I7WA 4UTWA 3TOPA 2X7VA 4PTVA 3EPNA 4C7GA 2VVSA 2WHLA 3EXTA 4RDVA 4LH8A 2ZX7A 4IMAA 3HGOA 5EBUA 4KWVA 1D3HA 1V7YA 2O4QA 1U33A 1CGXA 2GUYA 3O6YX 1YTEA 1KTBA 3CL6A 3VCCA 1MI3A 3GZ3A 3MBDA 4J3ZA 4E38A 1SJDA 1OFOA 1ODZA 3CIVA 3SAZA 3R6IA 2QJGA 1QOQA 4JEQA 1YE4A 1QAPA 2PEVA 1W31A 3UW6A 3TEVA 4XO6A 4AD4A 4JAWA 4PFMA 1WE5A 1UMLA 1EB3A 4BQ3A 1XUUA 1BRLA 1W3LA 3H24A 1ZU8A 1PBGA 1QHZA 4PMZA 3NPXA 1OGSA 1QWGA 3GHTA 4PB5A 3WNNA 4LC8A 4LF2A 4HU4A 5BRPA 4W93A 1GORA 2UY5A 2FHCA 1SFJA 3O6CA 3UJRA 1FXPA 3VVGA 5I3IA 3BOFA 4HZMA 5DY2A 3IIVA 1JZ8A 4JL2A 4GQBA 4OKDA 5BYWA 2EF9A 4AIOA 4REQA 4HSNA 2F7FA 4OECA 2HE8A 3KBJA 4PSRA 1RK5A 3ZJ8A 3B8IA 3GC2A 5CKSA 4ADUA 2PDYA 3M0IA 3T2OA 2CLKA 4AQLA 3S2JA 3SCOA 4HYVA 4ATLA 4Z1AA 3WDJA 3A3XA 3WCZA 2DIKA 3GBEA 1G4EA 2VJXA 1KV5A 1QVBA 4UQEA 4UFKA 3MV11 2R1MA 4TO8A 2RHGA 3VX1A 5HR7A 1EZWA 2ZUUA 2XN2A 2D2HA 2ZX9A 3PUOA 5DBTA 3V35A 1YNQA 4G1NA 3T09A 3NL2A 2YDAA 1I0DA 3PBWA 1OT2A 1TTQA 3UWWA 1GNXA 1SSGA 1B2YA 5I23A 3GVGA 3MV01 1KRMA 4OV4A 3UJFA 2WBGA 3FK4A 1UD8A 5GPRA 3A9IA 4GZIA 1T41A 3B9NA 4LBRA 2OSWA 1XG4A 3W0KA 5CJ5A 2HE5A 1P43A 3GU1A 5TIMA 2X0YA 1MSSA 1L2QA 1GJPA 1GKRA 2OWWA 3W7MA 2OU4A 3C0JA 4HMEA 1YTKA 4TOQA 2G50A 4BWLC 3ARQA 2Z1VA 4EWND 1ZQ5A 5LYRA 1UHVA 1TREA 2ACUA 3LBCA 3HQPA 4LY4A 2HBXA 2E67A 1HKJA 4QE5A 4X63A 1HTIA 4HNTA 2PDXA 2OTDA 1FWEC 2WCGA 2V82A 2XH4A 3QH2A 2ZZ6A 2WNNA 4QE1A 3TUUA 3H21A 5CBIA 3ITXA 4D8AA 2CLLA 4LB3A 1XGDA 2OX4A 4YU1A 1U22A 1NY1A 2WB5A 4HK5A 4XAFA 4R7JA 2NV1A 1E4LA 2Y24A 2ZA2A 1LRTA 4JYFA 3PY2A 2VURA 3CH0A 3MBFA 4BHYA 2VXNA 3CZEA 1AK5A 4NJIA 2WYSA 2POTA 4V28A 2E8YA 2V67A 1JZ5A 3VDBA 1ONEA 3ITOA 3CIWA 2Y4SA 2Z1BA 3CT2A 3EOUA 1L6SA 4R7OA 3F2BA 1I2PA 4CGTA 2HBVA 3CLWA 2FB2A 1W32A 3T42A 1SQ7A 2E9LA 2QMKA 1FFQA 3PR2A 4ZR8A 2AKZA 4URIA 1H7XA 4QDPA 2A21A 3RRAA 4B15A 1O66A 5ECVA 4MAVA 1UD2A 3S2NA 3NL5A 1KCZA 1JDDA 3GDKA 2PDHA 3UGRA 1F07A 3TW9A 1JGIA 4US6A 5TD4A 2HK0A 4RPQA 5G2HA 5HMDA 2VX7A 2KX9A 3S8HA 2Z28A 3WMLA 4O14A 3ZXWA 3PZ9A 5CGMA 3F4DA 1V6UA 4JNMA 1LM1A 5EPDA 1W8SA 1V0LA 1R3QA 4QJ1A 4B5TA 1FWFC 3W1RA 3UWZA 3W22A 5GJPA 1F74A 1TJ1A 3VIMA 3W26A 2WSRA 2ZZ4A 3PAJA 4XBKA 4YNGA 4XQ6A 4KEZA 2FVLA 1XM3A 1BYCA 1YPIA 1Y5VA 4UFIA 2Z1WA 1XRVA 4ERAA 2WC7A 2VZTA 5I79A 3N1AA 3TN3A 4YXGA 3P82A 4UMCA 3H2AA 2YJQA 3G0XA 1SMDA 1FWIC 4PMDA 5E09A 4IGMA 1T8XA 3FSUA 4W85A 3OHMB 5A94A 4D8ZA 2GK1B 3U2CA 3BTNA 2QT3A 3M0XA 1PE1A 1F4AA 3EDEA 3L0KA 2D1ZA 1XLFA 4JTAA 3ITYA 3MDWA 1MNZA 3PTMA 3T05A 2FHFA 4ALDA 1JNEA 4XAZA 3MO7A 7CGTA 2QDDA 4A21A 3SN1A 3HM7A 3OGRA 4GI6A 2AQWA 5CSUA 4J3TA 2VQTA 4IX0A 2EG7A 4AIBA 5DF0A 1W1VA 4KRUA 1QI4A 3RR4A 5LIYX 3P5YA 3RXZA 4GIEA 1A0DA 1RP9A 4A3YA 3F03K 4NJKA 3G3DA 2EPMX 4INFA 3UGVA 1CPUA 2QVNA 2C16A 3UVAA 3RPDA 4AD0A 3VGBA 4WCJA 5KZDA 1YE6A 3N14A 4F66A 3GIPA 2E40A 4XSLA 2QIWA 3PTDA 3GIYA 4KWWA 4UC5A 2R94A 4YYFA 5BCAA 1L6GA 1WOBA 2Z00A 4S3EA 3IJ8A 2E5CA 3NPUA 4ACYA 3UZJA 4TV6A 4DJFD 4GPNA 3THUA 1OX6A 4P5UA 3CZKA 1VEPA 1W1B1 3PZGA 3FDGA 4MUZA 4E2OA 1ICPA 5BMXA 2DSUA 3DYOA 2VOTA 3OIXA 1NP2A 3VABA 3FYOA 2G96A 3AYSA 3P2VA 4YVPA 3B4YA 3GXIA 1SO6A 3NIYA 4UBPC 4QQUA 3W7GA 5FKYA 1J6PA 1D7KA 1I9CB 4XKYB 1BTMA 3T2QA 3NQGA 3R0KA 1FWGC 1XLMA 4I5RA 1TV7A 3U4FA 3O05A 5HMFA 1E0UA 4HPJA 2BVTA 3SCTA 3ATYA 2X41A 4L4LA 1PWLA 2ZUMA 3VNDA 2DDXA 5FJUA 1OGGA 1SVDA 1FX6A 4JKKA 1EWEA 6TAAA 5HMEA 4I9TA 2EKGA 2QHAA 4UQCA 5CSYA 1KGUA 3LEPA 4JDYA 2PRMA 4BWLA 3CASA 2MNRA 2VGGA 3NQBA 3WLMA 1LOLA 1ME7A 3KRBA 4HSOA 2Z4GA 5T9CE 3QZEA 2OB3A 4UFLA 1DIOA 5I00A 1IEQA 5CZSA 4CVWA 5AHFA 3LBOA 4JGDA 1UWQA 4UCFA 3SIZA 2DZPA 3S1XA 4J28A 3VDCA 4M1BA 3H7VA 4HVXA 3VKCA 3PPFA 3I6RA 1R85A 1Q2SA 5EMJA 2FPTA 3GXFA 3ZOAA 3ZLFA 4YTUA 2DSVA 2G0WA 4LFYA 1VP5A 4TVDA 3P14A 1A53A 3KL5A 2CYGA 1Z41A 2ZTKA 3UG4A 2OYMA 1R9YA 4Z0JA 2JFEX 4Z17A 4H6RA 3LOTA 1VZWA 3L5LA 1JDAA 3OTRA 5BOFA 2D20A 1GVFA 3WMSA 2WZHA 2VZSA 2DVUA 2R1PA 3GZAA 2P10A 1E9LA 1IYXA 4RX0A 1H7PA 1OB0A 2G3FA 1RD5A 2ISFA 2CKRA 3W81A 3R43A 4UFJA 5FJJA 5IDZA 2CW6A 2IQTA 3HG3A 4C7DA 4OHQA 4OOZA 4CQDA 3M5VA 5G1YA 4BA0A 5GVJA 3GSMA 1EC7A 2JALA 1PV8A 1PHWA 3S9YA 1UH3A 1JCNA 1QJWA 4GQGA 4PUWA 4FNTA 3VXGA 5A6BD 3Q65A 4NF7A 3W02A 3SRFA 1XIEA 4LXFA 1XR2A 3PZNA 4XZ9A 4L6DA 4NZ5A 4Q4KA 4DUVA 3LB0A 2QW5A 3DH7A 2UV8G 1VFUA 1ZL1A 1HJUA 4MKVA 2GGJA 3SN0A 4UR8A 1RCOB 1HN1A 1PXGA 4DLFA 4TX6A 1B3ZA 3CWOX 1Q8JA 4JQ4A 3TMQA 3TW6A 3NO3A 3NZPA 4I9AA 3RLVA 3N34A 5HNRA 4JEJA 3ATZA 1HIZA 2O0TA 4H8HA 3ITGA 3S1GA 3GHRA 3UZ5A 3UJEA 4Q8MA 3SCUA 4HNLA 3PP7A 3GVVA 2QEZA 1GZJA 3AXKA 4UTMA 1U30A 4NP7A 1HJQA 4O0ZA 1BKSA 1FOBA 3QZ6A 4B5WA 4DPQA 2PWEA 2PGWA 2Y7EA 1YDVA 1TFVA 3FKRA 4QE4A 3W2UA 1BF2A 1SJAA 1TTIA 3QV8A 3VE7A 4IQDA 4IF2A 4I9MA 3LV6A 3CB3A 1XLEA 4WD0A 1BGGA 2O7QA 3O07A 4GMEA 5CSRA 3UG8A 3O63A 2A3AA 2CHNA 4HD5A 1JI1A 4H8UA 3ORWA 1UJPA 3A4JA 3IVUA 4LYQA 1LWJA 3CUZA 3JUGA 4IZGA 2FMNA 5AC5A 4KPLA 3EXRA 2D69A 2Y63A 3AISA 3MB9A 1DIKA 2FZBA 3BMWA 3MSYA 1XYLA 3RN6A 1Q7MA 3NZGA 4HNNA 5E6ZA 4Q4RA 4OJYA 4X9YA 1SM9A 3PG9A 3IJ6A 4OWGA 3W29A 2ABBA 4HZ8A 1XLBA 1B31A 1XSJA 3GFZA 5G1MA 5I6SA 1YRRA 4ICMA 2GK1A 3G0UA 2HPIA 4A8IA 2EPNA 3R12A 3BMVA 3CAQA 3A12A 2GLKA 5CC5A 2XM1A 4DXVA 3EKZA 1KFBA 3RCNA 5AY7A 3WFAA 2SFPA 3ZT6A 3NQFA 5AYXA 2BY2A 3OVRA 2C14A 4EOUA 1Q4WA 3KEHA 2A3CA 1VRXA 4IQEA 1EJ7L 1E40A 2CIPA 3L67A 4P7OA 5BRQA 2BVDA 4RZ6A 1Q6OA 4YIWA 3T0BA 1KCXA 2CWXA 4N2YA 1PDYA 3B03A 3WUBA 2QNEA 3W6YA 5I5RA 1Q2RA 2V5KA 1H49A 1U1HA 3UZWA 2ZWZA 2CZVA 4PUNA 4EAMA 3LTPA 1KXHA 4YN5A 3HFYA 3B06A 3GHUA 1LTDA 4YCPA 2YLLA 1I8JA 1MWOA 1TZ7A 3PTKA 4JQAA 2I5IA 3AUJA 3GG7A 4OV9A 2BASA 1P0KA 4F0SA 1YDOA 4DBSA 4D1IA 3MMTA 4S3AA 1NFGA 4JTFA 3EEGA 4HOXA 1PDZA 2ONEA 3BLIA 2NXGA 3O3RA 1GT8A 4F48A 1KFJA 5I02A 3QJAA 2GJXB 3Q58A 3A64A 1D8WA 1Z32X 5FIPA 1WOAA 4M51A 4B91A 4F2UA 1TE6A 3AUOA 2C1IA 2XYLA 2WQDA 3TXZA 1US2A 4JTKA 1DJHA 1TV5A 9XIMA 3B0PA 3GVQA 4YWSA 2NXIA 3MYPA 2A3BA 2EPKX 3P0XA 1FWRA 3CTTA 2Y89A 4XKYA 3L5MA 4QJ3B 1PJ9A 1JPHA 5CPNA 4O1EA 1W1PA 2UY3A 2Z7KA 3N6QA 4MNMA 3GDMA 2ADAA 1WDDA 2ZOXA 3D6NA 1HL9A 3NR0A 4LB4A 4Z1DA 3PS7A 6PTDA 1MXSA 3PNUA 4GXWA 1ZAIA 5A6JA 4HPHA 4RXFA 5LIXX 2Q3OA 4IX2A 2WC3A 3M43A 3I68A 4XD4A 3VIOA 5MF5A 3WK3A 4JZ5A 3RG6A 3UT0A 5A5WA 3H6OA 3ENLA 4EP8C 3PWAA 1ISYA 3R2GA 5AZ0A 2D2OA 4ADSA 4IP5A 1ZBWA 1C8XA 2IKIA 1XBYA 4RDYA 1RD6A 4PB3A 1C9DA 3ID7A 3BLEA 2EXOA 5M17A 1VBUA 1TIWA 2BGNE 1O5XA 5LIWX 1VCVA 4R34A 5H6HA 5CPMA 4JTQA 4XBSA 4PULA 4CD7A 1ZLPA 4GUJA 5DT5A 4AZGA 1TV4A 2H9AB 2HRWA 2QUVA 5XINA 4B5VA 1FCVA 4JTTA 1PKNA 1AW2A 5DN1A 5C9UA 4NZ4A 2GZXA 1HKWA 4JN6A 3OHIA 3H26A 2EHHA 2GDVA 2PLCA 4MFDA 3CH9A 3C2YA 3WBAA 3MUZ1 1MZRA 2PWUA 3H8AA 2VT0A 1BXBA 4LUYA 1V93A 4GE8A 1IWBA 2PGRA 2HNHA 4QSFA 1M7XA 2WBKA 4AEFA 1SZRA 3OVQA 2OZ8A 1UWIA 3CUGA 5KZEA 2D2GA 4DZHA 1OVDA 3MCOA 2C19A 2QMJA 4H01A 3Q4DA 3SCPA 2ACSA 2QCFA 3TSMA 2J8GA 1GVYA 1XLIA 3AHZA 2G3NA 4DVOA 2J8FA 3DOPA 3GNPA 3WK1A 1OCNA 2I14A 4FS9A 3RYSA 2OWXA 1I2OA 1M65A 2EKCA 4AYSA 4QG9A 4JTRA 1KCLA 1LBLA 2QJHA 5BZAA 3BAJA 4H9VA 4C1NB 4J4KA 2WZIA 1JZ3A 4JICA 1ISXA 3RMEA 2QULA 1R86A 3VD3A 4Y9MA 5IXEA 3F5LA 1KQZA 4TQTA 3BLDA 1BTCA 5KINA 3F4VA 4QIUA 2QJJA 1DV7A 5F4XA 3SQMA 2TPSA 1OIMA 2J24A 1MRAA 2ON3A 3WH5A 1DWJM 2JKAA 3ITLA 1CBGA 2WHKA 5G2IA 4IFRA 3QGKC 5A8NA 2EBNA 4GC3A 4LVFA 4S2CA 1NOFA 5D9PA 3K8MA 5DXXA 4IQLA 3G18A 4CQBA 3VIFA 3RLUA 4QISA 2NLYA 3VZZA 3WBWA 3TN6A 4IMDA 4EF8A 1J0ZA 3B0VC 1B4KA 2WK2A 5XIMA 3QRHA 3MQTA 2NT0A 2VTFA 3ISIX 4S3BA 4AMCA 3WK2A 1OFEA 3LN3A 3EWZA 4JTJA 3SUUA 2XUCA 2Z6JA 4G1KA 1BQGA 1JD9A 3STFA 2XIBA 1GOWA 2Y70A 3VCNA 4F0HA 4YTTA 1KXQA 1QO5A 3C3NA 2XH0A 3O1NA 5HNUA 3WQ5A 1UPMB 3T07A 1XRFA 5FL0A 4JIEA 4E2BA 4X9SA 2F9RA 2CBVA 3C56A 1XRTA 1OQFA 1T96A 1VYRA 1AODA 3P0WA 1A3HA 3TP4A 3LS9A 3TTEA 4QITA 1FWTA 4RDZA 3S5SA 2W61A 4LOCA 4F2TA 5F2MA 1XSKA 4WSKA 1PYMA 3U3HA 2V5JA 5D4YA 3O6DA 1CLXA 4N42A 5C7HA 4IJRA 4KH2A 4U33A 2XGZA 1FWSA 3PAOA 1Q6CA 3U0HA 3P80A 1ISVA 2DH2A 1IHIA 4JKLA 3PSWA 2V3EA 4KWSA 2Y7FA 5D37A 5LNRA 4O19A 4A2RA 3IARA 1K70A 1FQ0A 1UOKA 1NQ6A 3M16A 4XAGA 3DIPA 3ME3A 3LLXA 1SO5A 3ONCA 2IXVA 3EDDA 4FX6M 4L4PA 1AZ1A 1P5BA 1E6QM 3JRKA 5CXPA 2OO0A 3UPMA 4LWWA 4ML4A 3ARSA 2XIMA 5HQLA 2FZDA 2FTYA 3A24A 1W91A 4S3GA 1CW2A 1U1JA 4Z2GA 3SO7A 4IUOA 3BGAA 2XFFA 3GB6A 3H23A 2CCRA 3FNDA 4EAYA 2GJXA 3B3DA 3WLKX 2G4FA 3USBA 2BHZA 4LCSA 2A4AA 5CLTA 4CQ9A 1V4YA 1S2AA 3AHYA 1CZ1A 3C2VA 3M5YA 4N9CA 2IMRA 1LLWA 4HHPA 4DJDD 2UBPC 1RR2A 2Z29A 2C71A 3GXPA 3QTGA 3PJUA 2XGBA 2XZ9A 1A5NC 4A35A 1E4MM 1SZEA 5D32A 4OQVA 1P6BA 1KBIA 4IUGA 4FZIA 1WP6A 1JRCA 3CPUA 1NU5A 2WVSA 1WZAA 4S38A 2C7FA 3LHYA 4OBRA 3NZQA 1UKSA 4V1YA 3V0UA 1A3XA 3HO8A 3KWSA 4NI3A 3WQ8A 4IMFA 2J13A 5I06A 4TU1A 1WBHA 1W5MA 3WKZA 3T0DA 3FXYA 3SB0A 1E3XA 4PH6A 3E0LA 1ZNNA 1A4MA 5FJPA 1B57A 4CCEA 3W01A 5C2XA 3GE7A 3YPIA 5IRPA 3UXDA 4DAFA 1GW9A 4JTEA 4Q33A 4N9EA 2FVMA 3NSNA 3W1PA 1NEYA 1UKQA 1PEZA 2A2IA 3TOYA 1LYXA 1UIPA 5K9CA 1SU5A 3CTLA 4DBWA 1R87A 1DXEA 1W5QA 4MNJA 3QHOA 3R13A 2QCNA 2G5WA 5D2YA 4A8RA 2CEQA 2VR2A 1KLYA 3UXKA 3SCVA 5DBUA 3C86A 4KFNA 3SJNA 5KZ6A 1W2PA 1DKWA 3R94A 2H9AA 2VEGA 3HB9A 4B3LA 1K8ZA 3G22A 4IGNA 4GFIA 3OPSA 2I7GA 4Z2LA 4BI6A 1H51A 3K4AA 2WLYA 1OYAA 1VJIA 1LBFA 1OC6A 4ZCWA 2VUNA 3BDKA 4PEEA 1VFHA 4Z2IA 4JL1A 1EGZA 1E5NA 3FSTA 3W1TA 3G1XA 5DCDA 3UERA 3KXQA 2QPSA 4AUBA 2CC0A 3CZGA 4H41A 4XD6A 3N9RA 1O5QA 4LCRA 2Y1HA 4CD4A 4MY1A 3P93A 3FYPA 4M0XA 1ZFJA 2CU0A 4K3ZA 3BE7A 3IGSA 4JR5A 2QQ6A 4PTNA 3S6DA 3W1NA 2P8BA 2I9UA 3K4DA 1YKWA 3SSZA 5LA0A 1B3WA 3UETA 3AWOA 2ZRUA 2EAWA 4QCEA 3T0TA 3EGJA 2QGHA 6TIMA 2GJLA 2WZTA 3U4AA 3BSHA 2QXWA 4C1NA 1ISZA 3M44A 3LSCA 3L4XA 4KEUA 3OGSA 2PDCA 1XIHA 4E0CA 5HJLA 5CJNA 2OR2A 3URNA 2NUWA 1E55A 4HPXA 1S5TA 3DBPA 1QNOA 3N25A 1S5WA 1LQ0A 2HEJA 3VPLA 1NVMA 1LORA 3C3UA 4GRSA 2FVKA 2C1GA 4NKCA 5D05A 1CB7B 1CXIA 1OX5A 1LQ2A 3WF2A 5F1VA 1LLZA 2OODA 2PDWA 1KM2A 2RJHA 3U57A 4D6JA 2Q8ZA 1U83A 3GD6A 4PCFA 4WOQA 2JF6A 4C6MA 5FEXA 4BS0A 3W23A 3VD5A 1KBBA 1PS9A 2GL5A 2D3NA 3N29A 1NQKA 5AZ1A 1PKLA 4LPCA 2WLZA 1YYAA 3QHMA 3N2XA 5F2LA 1TWZA 3KOFA 1ZAJA 1LROA 3V5OA 3QY8A 5LXEA 1CGUA 4LEQA 5BU9A 4WHBA 1YADA 5D38A 1Q6RA 1E71M 3WNKA 3WIJA 2ZE0A 2PTWA 1GYNA 5D2VA 4IMEA 1T40A 3U9IA 3WF0A 5JBDA 3H54A 4LUSB 2CESA 4DJED 4KT2A 3LCHA 2BMBA 4K7YA 1IXPA 1X1ZA 3GTXA 1S5MA 2UZ9A 1EQPA 5EKYA 3GU9A 2PDPA 1XS2A 4XTIA 3EYPA 1QNQA 1TWDA 2OQLA 3MI6A 4PRRA 3M07A 1R47A 1TPC1 3CL8A 4NJJA 4NAFB 3VKBA 1GGOA 1QUMA 3CNYA 3HURA 1W6TA 1R8LA 1IT0A 3AIBA 4RW3A 3KS5A 4XBJA 1P0DA 4AZIA 8XIAA 4EXQA 1GYMA 5A1AA 4J5NA 1FH7A 4BQ2A 2WAGA 1SYTA 2GQ8A 3UCCA 4HU8A 1R3TA 3RM4A 1K9EA 3SGGA 4MWAB 1IEVA 1O5RA 5HPCA 3W71A 1MQRA 4K8EA 3QZAA 5C9ZA 3CPRA 4DUXA 1LF1A 5AHMA 4C6PA 2HMCA 4DQWA 2FPVA 3E2VA 3UBPC 4UTFA 1OF8A 1A5LC 4ZA0A 3HPSA 5K9XA 3RFAA 4P7NA 1DJXA 1BG4A 1JYNA 1UOZA 4NVTA 1SFTA 4PGLA 3VMPA 3AHVA 1TVNA 4GVHA 1DWAM 1GZ1A 4WGHA 1EKOA 4LYKA 3D47A 2RUSA 1Q7ZA 5G5IA 1TV8A 3GW3A 3A4AA 4HCLA 2WNZA 1H41A 2V8ZA 3NDOA 1R30A 1OINA 2E6AA 3CQIA 4MWAC 1O1ZA 2DSKA 3E5BA 1FY6A 3W1UA 1C3FA 2V3GA 1C92A 2E3ZA 3MUXA 4JTGA 1V0KA 1CGVA 1Z48A 1N7KA 2VR4A 3E38A 4RL3A 1ZS2A 3EOLA 3ZWTA 4U3CA 3G1HA 4K8HA 3DFQA 2ACQA 1KCKA 5C55A 2Y8KA 1EBGA 4HK6A 3WLOA 3UCQA 3H2CA 4EKJA 1KXTA 3PZQA 3ALGA 1YNPA 4GQ0A 3HPFA 3CB8A 5LKYA 1Q3NA 1VR6A 2YB1A 3O2LA 1YXDA 1A0EA 4K8GA 3I3BA 2ZICA 4V1XA 3XIMA 1IEIA 5H8UA 4B5XA 3CV1A 5C7VA 2WKGA 1PX4A 1L6WA 3DKJA 2DSWA 3HPXA 4D6FA 1RAKA 5REQB 4QQ3A 1DJGA 3QOKA 2P5NA 3D3FA 3LM3A 2AOSA 1TPDA 1XLDA 5DMYA 4EPBC 4US5A 1TV2A 4B90A 1YBQB 3AYVA 4AWSA 4PODA 3EWUA 4IIFA 4W7VA 3LPGA 1TX2A 5BRBA 3OO2A 3TJLA 1E0XA 2DY3A 3MDUA 1MUCA 3NVTA 5B7YA 3XISA 4L6OA 2OGJA 1I0BA 1GZGA 1YW1A 1T99A 3HGRA 1CXEA 2FGBA 3N11A 1I2NA 3IIOA 3WMCA 3R11A 1ZRQA 2QYGA 4CEXC 5CC6A 3URAA 1KR1A 1EEPA 3P81A 3Q37A 3W70A 1GG1A 2WVUA 3EPOA 3I10A 3MJYA 4FALA 1KFLA 5CZJA 3CYVA 2QUTA 3EA1A 2F8QA 1ALDA 4H19A 4JTCA 3RCYA