4CQAA

Plasmodium falciparum dihydroorotate dehydrogenase (dhodh) in complex with idi-6273
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
373
structure length
371
Chain Sequence
FFLYDIFLKFCLKYIDGEICHDLFLLLGKYNILPYDTSNDSIYACTNIKHLDFINPFGVAAGFDKNGVCIDSILKLGFSFIEIGTITPRGQTGNAKPRIFRDVESRSIINSCGFNNMGCDKVTENLILFRKRQEEDKLLSKHIVGVSIGKNKDTVNIVDDLKYCINKIGRYADYIAINVSSPNTPGLRDNQEAGKLKNIILSVKEEIDNLEKNNIMNFLWFNTTKKKPLVFVKLAPDLNQEQKKEIADVLLETNIDGMIISNTTTQINDIKSFENKKGGVSGAKLKDISTKFICEMYNYTNKQIPIIASGGIFSGLDALEKIEAGASVCQLYSCLVFNGMKSAVQIKRELNHLLYQRGYYNLKEAIGRKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIHYDROOROTATE DEHYDROGENASE
publication title In Vitro Resistance Selections for Plasmodium Falciparum Dihydroorotate Dehydrogenase Inhibitors Give Mutants with Multiple Point Mutations in the Drug-Binding Site and Altered Growth.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
total genus 139
structure length 371
sequence length 373
chains with identical sequence B
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2014-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4cqaA00
1YTDA 2NZLA 3S5ZA 3BLFA 3HMJG 4TX9A 5FEPA 3SI9A 3NZRA 1UCWA 1ONRA 3BG9A 1DVJA 3R12A 1G4SA 3PAJA 3TW7A 1XUUA 1U83A 2C3ZA 5G4EA 2ZA3A 3O6DA 5U4NA 3CTLA 2DJXA 1KLZA 3LRKA 3W1NA 4NNAA 1SO3A 3HJZA 1QNVA 1TMHA 5I3GA 4N4QA 3M5VA 4MIMA 4JD4A 3KVKA 3F1QA 5DBTA 5I3KA 4OV4A 5K9XA 3TC6A 2VEMA 5EL1A 3KVMA 4QJ1A 4NJIA 3T4CA 1VRDA 4O12A 5D03A 2B7OA 4FF7A 5BW6A 1R2SA 2WV8A 3HPSA 3C3NA 4BWLC 4Q4KA 1VPXA 1DOSA 3TJXA 3C2OA 3EWWA 4BWLA 1XI3A 1WOBA 3KOFA 4MZ8A 3RMJA 4AWTA 3VI2A 2NV1A 3THAA 3PSVA 3SGUA 4LC6A 1SUXA 3HGOA 1VCFA 3BW4A 1YDNA 2RH9A 2CW6A 3DBPA 5TBOA 2ZFAA 4AEOA 1W8SA 3WJSA 4DEFA 2X1RA 3EXSA 5D32A 1W0MA 1KTCA 3MHGA 3OA3A 3TW6A 2VEPA 1NEYA 1GPWA 2VFHA 3TNOA 2ISSA 4K7YA 1SPQA 1W5QA 3C52A 3W3OA 4HKPA 4MVAA 4X2RA 4TU1A 1AW1A 3DH7A 5G4WA 1QR7A 3NQEA 4AWSA 3M43A 3TV8A 3TXVA 1S3HA 2J6XA 1PHQA 4TR9A 1YXCA 3W7CA 1DORA 1XFBA 1B4KA 4M6VA 2A7PA 3LCXA 1PS9A 4O1BA 4AF0A 3TU9A 2CLFA 2ABBA 4IX0A 2V5BA 3UQNA 1A5BA 1A50A 1THFD 4NNBA 2Y6ZA 1H62A 2EAWA 3ANYA 3TKFA 1Z42A 4MYAA 4IJBA 3MI2A 4JTJA 4CNOA 3EX2A 3I7QA 2JKPA 4O50A 4G1KA 1SFJA 1TQXA 5IM51 5KZEA 2ZZ1A 1YADA 4UTLA 1FDYA 2E6DA 3S42A 1FWNA 3GXTA 4UMBA 1I2NA 5EYWA 5K3VA 2RDWA 1HL2A 3LTPA 1YXYA 3FJ6A 1XM3A 4IWWA 3OVPA 1RQBA 2NX9A 5BMXA 3MO7A 2V9DA 2C14A 1FDZA 3FEMA 2Y63A 1TPUA 2E1DA 3E02A 4RXFA 4KFOA 3W7OA 4A29A 2CZFA 3NQDA 4MFDA 4XKYA 3W23A 4ADTA 1W5MA 3NDOA 1XC4A 4LV4A 2HSAA 3IGSA 1Q3NA 1OX4B 5L9FA 4S1FA 3G1XA 4N02A 5EKYA 5KITA 1ME9A 3L21A 3P7YA 4JTIA 1X7FA 2OMAA 4BF9A 3MP3A 1FWWA 4OT7A 3LRMA 4K8HA 3I68A 1KM3A 2AGKA 1JQVA 1EP3A 3W2MA 3W7JA 3G0SA 1GTEA 5D09A 3NPWA 4WY0F 1PV8A 5F2GA 4CLMA 1KA9F 5ABTA 1VC4A 3CIWA 2ZCGA 3FIGA 3LXCA 3ATZA 4AWUA 3KRZA 4FO4A 4NX5A 3N3MA 3R8RA 5KZMA 4RKAA 5K4XA 1VJIA 2GVJA 4KKXA 1QPRA 3W1UA 1MEHA 2ATMA 4UTJA 3C2EA 3H53A 1TPEA 2Z2UA 4UFIA 2YW3A 3QQ1A 4HHPA 5EBUA 2BSLA 4UIOA 2BTMA 4C1KA 5F4WA 5K7JA 2VFIA 3FKRA 2QUTA 3A22A 1KFJA 1IXQA 3PUOA 1K8YA 1LLZA 3LCGA 1SR9A 1KFBA 1LCOA 1BWKA 4CNNA 1RR2A 4LVGA 2GJLA 1OX5A 1QDSA 3H55A 1P0KA 2ZA2A 1GOXA 4FXSA 2TYSA 4N4PA 3DI0A 5KMYA 4HT3A 1O5XA 4NT0A 1VYSX 1WXJA 7TIMA 4UTMA 2BWGA 4A2RA 2JBMA 1TQJA 3WK3A 2ZTKA 3HG4A 3S9YA 3YPIA 4LW7A 1M7PA 4LNYA 3DFPA 1LDCA 3K30A 4LRSA 5D2TA 4I9AA 1P0NA 4UNKA 4O28A 2DZVA 4BI7A 3NVTA 3W7MA 1Z44A 1LP6A 2YPIA 3M5XA 2P0OA 3NQ2A 3NQVA 4AHQA 2FJKA 1ZALA 2FLIA 1YDOA 2DJLA 3M9YA 2QCEA 2OX1A 4AB4A 3GIYA 3KAOA 1LROA 4R34A 1G67A 3QSRA 2I1OA 4I7UA 3G8EA 3NQAA 1NF7A 5HMSA 3E0IA 5DCBA 1FBAA 5G2IA 4CNPA 1AW2A 1SO6A 5CPOA 3FKKA 4LUJA 3TUUA 2CLHA 3TSDA 4UTUA 5DXXA 3QQ0A 4LVBA 3JS3A 1QO2A 2A1YA 4OWGA 1O94A 2PRHA 2VFGA 4CQ9A 1VLIA 1FXPA 1SO4A 3MI6A 1FCQA 4MLRA 4JX6A 1VCVA 1HG3A 3L2IA 4JGDA 3QW3A 3W6YA 2DZUA 2NXIA 1Z41A 3BV4A 1LRTA 4O18A 3G22A 1JCLA 2NXGA 2OCZA 4JTEA 1Q45A 1ME8A 3F4WA 3TE9A 2R94A 1S5VA 4MJMA 3GK0A 3GNDA 1R47A 5CSSA 5D37A 3NEVA 1MZHA 1JR1A 3UD6A 4MY9A 3GDLA 5I3FA 4KWVA 4NJKA 4NXKA 5FEXA 5FEWA 3F03K 3WJZA 2ZYFA 3HO8A 4M6PA 3P60A 3NZ1A 1TV7A 4MY8A 3GXPA 3P61A 2FQIA 1PL9A 1XKYA 1ZENA 5HR7A 1CW2A 4RX0A 3VCRA 3B0UX 1W5PA 1B9BA 3BLIA 1GWJA 3VKJA 3W2NA 2DZXA 3MMTA 3GR7A 1OX4A 4FB7A 4PC8A 4UTWA 5FF3A 3W7RA 3ZR4A 5F1UA 2J24A 1D3GA 3P74A 1TREA 4DQWA 1JULA 4LVFA 1FWSA 3CLMA 4NVTA 1VHCA 1CI1A 1YTEA 3GR8A 1LOSA 2FB2A 3NM3A 3U2OA 3W85A 4K37A 2Q8LA 3DZ1A 3G3MA 4O11A 2C18A 4Z1DA 1KBIA 3Q58A 1O60A 3L5LA 4ZQPA 4IXXA 1B4EA 4UTIA 2ISVA 2OT0A 1C8VA 1UUOA 4UXDA 5K9CA 4GC4A 5FF4A 3TSBA 2ZRVA 2I9EA 2WSQA 3BGGA 4R33A 5AYZA 4EF8A 5D2XA 2OJPA 2NLIA 1F76A 5K9DA 4UCGA 3B8DA 3QMSA 1ZHAA 2QCDB 5FI8A 4MOZA 1DJNA 3PB0A 2NWSA 3P81A 3MBFA 4O0KA 1BWLA 3QZEA 1C29A 2TMDA 1G7UA 4Y6GA 1EIXA 2ALDA 3BPWA 4X3ZA 2ZRYA 3P80A 1L6WA 1YLVA 3W2LA 8TIMA 5H2ZA 3IVUA 1OFRA 3HB9A 2CZEA 3OEXA 4M5PA 4QM1A 1W5OA 2CLIA 5CZ0A 1TPVA 3L65A 3Q94A 3IRDA 2QF7A 1D9EA 1FWRA 3W7PA 4N9EA 4NNCA 5G1TA 3W7IA 1IXOA 4RCXA 5F4XA 4Q32A 3HF3A 2H8XA 1NFBA 3RU6A 2A4AA 4ZL1A 2B7QA 3JR2A 4TO8A 2V2HA 2ATSA 3W87A 1NVMA 3B03A 4L4MA 4JICA 1DKWA 5DBUA 2A7RA 3GAYA 4MYXA 1TB3A 1G4PA 3RNDA 3DKJA 1FXQA 3W22A 2FDSA 3TFXA 3JRKA 1EUAA 4JY8A 4O14A 5D2YA 2Q8ZA 1H61A 1EX5A 1H1YA 1QAPA 1V7YA 1OFAA 1A53A 5C54A 1UUMA 4QIUA 1SQ7A 2V0TA 4WOZA 3HPXA 4K38A 2EHHA 3NAVA 3A21A 2G95A 3LCWA 3NL3A 1SZNA 3ABQA 3CHVA 2Y7DA 1L6YA 4J9JA 3W7LA 5HWMA 4BK9A 4GNJA 3W07A 3PSWA 2KZHA 4ADUA 1M5WA 4E2BA 3I7SA 1TPWA 2TPSA 4O1DA 3QSTA 3GYEA 4MFEA 2CZ5A 3E96A 3TK7A 4DF1A 2G96A 5G2HA 3WJWA 3ABOA 1O95A 3A24A 2VKZG 1EB3A 3UNDA 3MUXA 1DV7A 3QRHA 4JIPA 3FFSA 5TIMA 3LB0A 1OFQA 1W37A 3S1UA 2C0AA 1QOPA 1EUNA 1G69A 2B0MA 4RR4A 2Y70A 1FCUA 3G18A 1KM1A 3C0JA 3HGRA 2DZWA 4RV8A 3DKLA 3M41A 4FXRA 4XBSA 3HG2A 2BX7A 2WO5A 3W2KA 2YZRA 2XN0A 4LOCA 1YDVA 2AAMA 3A5VA 4K8EA 1JJKA 3W2JA 3W1PA 3DGRA 3DFOA 4ONVA 1DQXA 1SW7A 1YXDA 4HSNA 4WQ6A 5D33A 5BOOA 1VCGA 3DFQA 3HIJA 1T96A 2GQ9A 5EPDA 3W2UA 3B04A 5DY3A 1LTDA 1NF0A 3IV3A 2ZZ2A 3IIZA 1L6SA 4NU7A 1AMKA 2PURA 3PB2A 5DELA 1T8XA 1ML1A 4MZ1A 3IEBA 4AH7A 3C8FA 4JNMA 3A5FA 3FYOA 1EP1A 1T0OA 3INPA 4GFSA 3BLEA 4P61A 3CWNA 3TMLA 3PR2A 1GZGA 3PULA 1SU5A 4JTKA 3LCHA 3W1TA 3L0KA 3ZFHA 5K2ZA 1X1ZA 3C6CA 4C1LA 1RQEA 1T99A 1P1XA 4LRTA 3EXRA 3CEPA 2H3DA 2A7NA 3QFEA 3M44A 3NPVA 2QCDA 5F2MA 4E38A 4ZQOA 1W1ZA 1O5KA 3KX6A 1LBLA 3S8HA 1TJPA 4L4LA 1FY6A 4LTSA 4CCEA 1G4EA 4LY8A 3N34A 3SSJA 4WX2A 3W7GA 1H7OA 3E49A 3W7DA 1Y0EA 2C16A 1MEWA 1KM5A 4K7VA 1VYRA 3GDTA 3P5YA 5D05A 5TQLA 1GT8A 1FCVA 4FHAA 3PBVA 4UFMA 1EEPA 4FX8A 3W74A 2D73A 3EX4A 4RZ6A 2A21A 2WOQA 2E68A 2NV2A 3LLDA 2QCLA 1VZWA 2V82A 1EWEA 3GAKA 1W54A 4UMAA 1JUBA 4IX2A 1TYGA 4RZ5A 1YYAA 4UC5A 3N14A 3N2XA 2B7NA 2CLMA 4JX4A 5HQEA 3PG8A 1AL8A 3NQ6A 2GVLA 4M19A 1F7BA 1SSGA 3MI3A 2GVGA 3ELFA 3LDVA 1R2TA 3GDMA 3P84A 4YWIA 3LHZA 2ZZ6A 1UB3A 4CQAA 4AAJA 2C13A 5AHIA 1LZOA 2FPYA 1V5XA 3WJXA 3WFAA 4R7JA 2J9YA 1EA0A 1LOLA 4DF2A 4OQVA 5HULA 3LTYA 2VEKA 3MJYA 4DF0A 3W9ZA 4DO4A 1GVRA 2HTMA 4FNRA 2NWRA 3G1YA 5AFDA 2AQWA 1R46A 4POCA 2X1UA 2C15A 1IIGA 1NAL1 2E6YA 5DN1A 1JCYA 1I2OA 2F84A 4FNSA 4X9SA 5CPMA 5AC6A 2CLOA 1QMLA 1W3IA 3OVQA 3SZ8A 3ZS4A 4A21A 1GQNA 1B3OA 2A85A 2J88A 3EB2A 3MYOA 3T55A 1SSDA 4K36A 1OVDA 4HNNA 4MY1A 1ZY9A 2VXNA 1JUKA 1OFEA 5C6MA 1TRDA 4S2BA 1FX6A 2YFNA 1PHWA 3QH2A 2DORA 3CQ0A 4RK8A 1TO3A 4DPQA 4YCOA 3PS7A 3LHTA 2JGQA 4UTHA 4IPJA 4N2YA 3M47A 3QEZA 5LGZA 1PE1A 4YLWA 5L6UA 1EP2A 1SW3A 3KVJA 3TAKA 3ZWTA 4CCCA 4S2CA 1F5ZA 1WYIA 3EWYA 3NQFA 3PM6A 1FWTA 1VLWA 3CEUA 3CC1A 3H54A 4Y90A 4UMCA 5AN7A 1QPNA 4RXGA 1ALDA 3LI0A 1XUZA 1XBVA 2DU2A 2WSRA 4JTFA 2LLEA 5BMWA 3QPYA 1I2QA 1HO1A 1TSIA 3BVJA 1S5WA 2X1TA 2XFWA 4ALDA 3FYPA 1LRNA 4QAIA 3O07A 4M7TA 4WD0A 4PODA 5C55A 3LX9A 1H7PA 1R2RA 4Z0SA 4ZMGA 2OZ0A 1SZGA 4ADSA 3W7QA 1IIHA 2PE4A 4PEKA 3NQGA 4NJHA 4AVFA 3ABSA 3O1NA 3R5EA 3NO5A 3QW4B 3EWUA 1KFCA 1OFOA 3Q37A 3OHIA 1LM1A 1WOAA 4EWND 1FQ0A 3BARA 3MWAA 3UWVA 5CPNA 3QC3A 4LV9A 1TPB1 5KZDA 4FNQA 2FFCA 2QEZA 1JQXA 1TTQA 3G1HA 2QAFA 3M5YA 1J5TA 1PCWA 4HPXA 5C5YA 3NL6A 1ZAIA 4IMDA 2DZPA 1TTPA 1P4CA 3SECA 3G0XA 3LCFA 3TFCA 3N9RA 3VFLA 3SGZA 3NPXA 2Q3OA 5DCEA 4JR5A 3VE9A 1LYXA 3TIMA 1OF6A 2EF9A 2NUYA 4Z1BA 3CPRA 3DFSA 3L67A 5J5RA 2DP3A 3GXNA 4ZQMA 4BFAA 5KTLA 3DU0A 1ADOA 1KTBA 5FF2A 5D30A 5GVJA 4H6KA 1WAUA 3FJLA 4YCPA 5LNUA 3S1VA 3L68A 3HGSA 1BKSA 3LM7A 4P2VA 2GPTA 3O05A 4LC8A 4OBTA 1D3HA 1G7VA 3I65A 1OG0A 3NQ8A 4GWEA 4ZQRA 2CLLA 4E2DA 4LVDA 1LBMA 5KSWA 2QR6A 4UTKA 3G0UA 3UXAA 3A23A 4JDYA 5CZSA 4O17A 2QJHA 4UTTC 1TPC1 4PA8A 4PL2A 4AMAA 4UTWC 4Z1CA 3W7KA 4A22A 1F2JA 4UTTA 2BXVA 5CKSA 4KFNA 2Z6IA 2WJZA 3EWXA 1QPOA 2R91A 3N9SA 3WK2A 3RLUA 3M6YA 5D04C 5AYXA 1TPDA 2DZTA 5K4ZA 4ICNA 1U5JA 3USBA 4UFHA 3QYQA 3HG3A 3N2MA 3LI1A 3TDFA 1KFLA 1ICSA 2QDHA 4GUGA 4UUIA 4O16A 4B5NA 2QKFA 2P10A 1J2WA 3W70A 1OJXA 4TMBA 3QM3A 3QMRA 3M1ZA 1CX9A 3NQMA 3LHWA 3P5ZA 4JS3A 1KM0A 2V2DA 2QCFA 3STFA 4UFLA 5LNVA 4M6QA 3BW2A 3L66A 4JTGA 2WSYA 4NJGA 3EX3A 3C4UA 3B06A 1J4EA 4LS2A 2GJNA 1TCDA 4ZZ9A 4A2SA 1K8XA 1I4NA 1LLWA 5LNRA 4TIMA 3F4NA 4QISA 3P8JA 3RF9A 2W0UA 1M7OA 3EWZA 4RZ4A 3PC0A 4FX7A 1BTMA 1JCXA 2ZZ4A 3TROA 4HNVA 4JEQA 4FNUA 1XL9A 1H7XA 1KLYA 4AXKA 5SWUA 3B05A 2H90A 1FCBA 5HNRA 6TIMA 3W86A 3I6RA 3EKZA 4K6AA 2E5CA 1WX0A 1I8JA 4OU1A 3M5ZA 3GLCA 1JCJA 1H7NA 4XBKA 1OYAA 2A6NA 4ZVJA 1GG0A 4FIQA 4FNTA 4GRSA 4WUIA 2PRMA 3QPZA 1XDLA 1K03A 2EKCA 1YPIA 2PRLA 4GUFA 4HSOA 2YW4A 1ME7A 3P62A 3BG5A 3UWWA 1K7EA 2Y7GA 3TH6A 1MSSA 1QCWA 4QITA 1KM2A 4UR8A 4H3DA 3P67A 3C56A 4HPJA 2YX0A 3STCA 3V75A 4WXZA 3NQCA 2C1HA 3PVFA 4IMGA 4JX5A 1KBJA 4DBDA 1TTIA 4O8RA 2C6QA 4DBEA 4NZJA 3C2FA 1TPH1 1TJRA 1HUVA 5DXYA 5HJLA 5FEZA 2B4GA 1FDJA 1I2PA 1OFPA 4IXHA 3HGJA 2NX3A 4JTLA 2ZQ0A 2FB3A 5BNKA 1SZEA 2E5BA 1VH7A 1W56A 4JY9A 4PFMA 4EIVA 3HBLA 1YTKA 3I7RA 1DHPA 4A3UA 2V81A 4YMZA 3NOEA 1RPXA 1GJPA 3LXAA 2ZA1A 3TX9A 3W7HA 5FESA 2XN2A 3UXDA 3LHVA 3PY2A 3KHJA 1RVGA 2ZRWA 4KWWA 1KV8A 2A6LA 4NXSA 1R30A 4N9CA 4O52A 3MP4A 4O19A 2RHGA 3BG3A 2JGYA 3QJAA 1DL3A 5T26A 4K39A 4O13A 2RKXA 3STGA 4OHQA 3PBUA 5C2XA 1QPQA 4N6EA 2UV8G 5D38A 1DJQA 5CGQA 1IXPA 1AK5A 3CM4A 1ZCOA 4MUZA 4CCDA 3DHDA 4OV9A 1TV8A 2Y88A 2ZTJA 3NR0A 4IGHA 4QNWA 4BR1A 4DXVA 4RJEA 1F6PA 1Q6OA 5CG7A 3AJXA 4D2JA 5HUOA 4EVZA 3PG9A 4O54A 3GVGA 3W7NA 1I2RA 2Q3RA 1H7RA 2ISWA 4EOUA 1N7KA 3W7EA 3GDRA 3L0NA 2GQAA 2WNNA 5G5IA 3DHFA 4NUWA 2CLEA 1F6KA 1KW1A 3T78A 4ZQCA 2A0NA 5LNWA 3THQA 1DBTA 4Y8FA 2J9ZA 1VQTA 1B57A 4LWWA 2J9XA 1ZJIA 3TXZA 1F05A 3O15A 5I3IA 2WKJA 1WV2A 3L5AA 5MHBA 3L5MA 4MPQA 1AL7A 1K3UA 4QNEA 2WQPA 4PL1A 1SO5A 5EY5A 5DLCA 1HFBA 3LCIA 4ZQNA 1YPFA 2ABAA 3G3DA 1IGSA 3UWUA 3IIPA 2CU0A 2X1SA 3E9AA 1W31A 4GE8A 3PUDA 4PTNA 1H60A 5LGXA 4O1CA 1I45A 4EF9A 3L9CA 3NPUA 2NUWA 2BLEA 1PCKA 5DY2A 3S5OA 2A5HA 3TQKA 3CT7A 5LHFA 2J27A 3WK0A 1X1OA 3KXQA 4IPIA 4IMEA 2X2GA 2FPTA 1EWDA 2X16A 5A8GA 3LHYA 2E09A 3TR2A 3SIZA 3DENA 4U28A 3KVLA 3U6WA 2Y61A 1OK6A 5HWJA 3W1RA 4BI6A 2CZDA 4I7VA 1G4TA 4JYFA 2ZBTA 3A9IA 3HPZA 1H1ZA 3UWQA 3S1XA 2OT1A 4O0ZA 3W1LA 2QUUA 1QWGA 4GJ1A 5LSMA 2CLKA 3W75A 4Z0JA 3S1WA 4E0CA 2VC6A 4WJEA 5FF0A 4LS0A 3UZ5A 1GVOA 1Q6LA 4YL2A 1OK4A 1ZFJA 5LKYA 3TC7A 5E1QA 2PC4A 3O8AA 3W71A 1DQWA 1EPXA 3DAQA 1GYLA 3W76A 4HNTA 1OFDA 1UASA 2EPHA 3UY7A 3W1MA 3FLUA 2Y7FA 5IBXC 3LXBA 3C61A 3UZJA 4FNPA 1VS1A 4XWUA 5IBXA 3M16A 1H63A 3OIXA 3RLVA 5LZLA 1OYBA 4CQ8A 2GQ8A 1KFEA 4UNLA 4O1AA 3ATYA 2V8ZA 4JIQA 1A5AA 3KFTA 1W3NA 2H3BA 1ZAHA 3RFAA 1HTIA 1VYPX 4XTDA 4N6FA 4JYDA 1ICPA 3PWAA 3TMQA 3R2GA 1AG1O 1OX6A 2YYTA 3DI1A 2ZZ7A 2NX1A 3E12A 3G8RA 3PUEA 3N73A 4IUOA 5F2LA 2QCGA 1K8ZA 4GBUA 1P5BA 2ZRZA 1LORA 4WY0B 5CZJA 1QO5A 3SFKA 3PBWA 3DFNA 3NL2A 1UBSA 2VENA 3OVRA 2VFDA 3HOJA 3TAOA 3EEGA 1RD5A 4XUGA 3O6YX 1S5TA 1HO4A 1M6JA 3O06A 3BW3A 1IF2A 3EX6A 3W88A 2YYUA 1L9WA 2VEIA 3S0CA 1ZAJA 4WXYA 2QJIA 4MKNA 3LBCA 1K02A 3LRLA 3GX9A 3W84A 2R8WA 1KTNA 4Y9AA 3MYPA 1PIIA 2BZNA 2PCQA 3B4UA 2JK2A 4O57A 2VOMA 5BRBA 1WBHA 1GYNA 3UWZA 3GDKA 2Y62A 3TJLA 5I3JA 4PH6A 2B7PA 1TV5A 3ABRA 1GVQA 4TMCA 5AHLA 1FUYA 3QF0A 4O4VA 3IGXA 2V5LA 3IIVA 5HINA 4NQ1A 1OF8A 1SW0A 3W83A 1UJPA 2V2CA 3G1VA 5EA9A 5AYYA 5HUPA 3HG5A 1GTHA 2VFFA 2RFGA 4YXGA 4GUIA 1SFLA 3LCLA 1QOQA 4DO6A 2RDTA 1MO0A 3LTSA 3LBMA 2QCHA 3RK8A 1K7XA 3UY8A 3IGUA 4WZHA 4Y96A 3UYCA 3FS2A 1F74A 1XBZA 4HN4A 2GOUA 4IQLA 2WPBA 3NXFA 4JTTA 1W3TA 4LUIA 2ZDRA 2P1FA 4JN6A 2G5WA 4O4WA 3NQ7A 3W1QA 3SY5A 3O63A 2VFEA 4AHPA 4MZYA 1WDWA 3R13A 3W1AA 1H7WA 2JKAA 5FF7A 1KFKA 1OFBA 2YGYA 1TIMA 5E93A 3G1FA 3W72A 1QFEA 1IXNA 3CWOX 5EMUA 2O7SA 1RQHA 1JCNA 2HS6A 1WBJA 3T40A 2HS8A 3L0GA 4HIBA 4OGZA 5F4SA 5E0KA 2Z1BA 4NJJA 1H51A 1Z48A 3SR7A 1JRCA 1TRIA 4IMFA 3TCEA 3IVSA 5D2VA 3O6CA 1L2UA 3DXIA 1K7FA 1MXSA 5AHEA 1N55A 1N8FA 2JKEA 2Y89A 1JVNA 3B0PA 4FX6M 3QMTA 5CSRA 2O7QA 3BGJA 1XBYA 3NYZA 2FPVA 4FIRA 3GB6A 1TPFA 5G2WA 4DPPA 3KRUA 3W73A 5A5WA 1RZMA 2CFFA 2Z0IA 1LRQA 4NZFA 3AO0A 3HQ1A 4W9TA 3LV6A 1MEIA 2YCEA 4AHOA 2YXGA 5G1YA 5H91A 1GEQA 5AC7A 3S6DA 2Y85A 5F2IA 2E77A 2I14A 2A2IA 4Q33A 2CWNA 4GUHA 4HNUA 1JRBA 4PCFA 3U8GA 2ZRXA 4ORMA 3OG3A 3CB8A 5D2WA 1PVNA 3MP5A 4O53A 3GNNA 4WY0A 2W79A 3D0CA 4M7SA 2Y7EA 3M0ZA 3UWYA 5I3HA 4DELA 4OE7A 4LVAA 1OYCA 3NM1A 3O16A 3T44A 3V1PA 5HWNA 3G1SA 2VELA 1XBXA 4WOQA 1XDMA 4LS1A 3LV5A 5LHEA 5D02A 3IIOA 4JDBA 1GVFA 3G1AA 1TTJA 1G6CA 3MW7A 2FTPA 2QJGA 3G24A 4JTHA 3MBDA 4I7WA 3WK1A 3G1DA 1OABA 3C2VA 2TRSA 3GZ3A 2NUXA 4JTSA 5U7SA 2H6RA 4O15A 2YDAA 1LBFA 4U4MA 2EGZA 1H50A 5F1VA 2E6AA 5J5DA 4LU0A 1WA3A 3Q2DA 3GKFA 5CZTA 4N9DA 1A5SA 3LHUA 3MHUA 2ZZ3A 5KINA 3SW6A 2XN1A 4GUJA 3T7VA 4XZ9A 1WQ5A 3GKAA 3TA6A 6ALDA 4ML9A 3NG3A 2NXHA 2FIQA 4FEZA 3LGEA 2GUUA 3PBYA 4UFJA 1GVSA 3FA5A 3EXTA 4KFPA 4ORIA 4R53A 1W5NA 2R14A 3NGJA 2DZSA 4N9BA 3NL5A 4AF0B 5AB3A 5DCDA 1X6UA 2Z6JA 2WNZA 1X8FA 4X22A 3OBKA 1ICQA 4O10A 1JCMP 3R89A 5AC8A 3ZWSA 3BK0A 3CIXA 4GXMA 2WNQA 2QCNA 2HMCA 4Z08A 3EWBX 4IMCA 1LOQA 4XQ6A 3STEA 3B0VC 1XXXA 3EX1A 4IOTA 3SJ3A 3M7WA 1RV8A 3VE7A 2QUVA 4NX0A 1H5YA 3NNTA 1Q6RA 4UFKA 2YFOA 3UPBA 2E5DA 2H8ZA 2ZRUA 4JXCA 3IIXA 1KM6A 3W1XA 3DFTA 3NA8A 3IVTA 1XCFA 2QCMA 3MHFA 3LOTA 4MLJA 5AHFA 2IQTA 1VGAA 1OHLA 4QQ3A 3P8IA 2YR1A 4H4IA 2ZZ5A 5LNSA 4DO5A 2G97A 2QCCA 2QAPA 2F7FA 3FOKA 3S5NA 2YSWA 3TQVA 2C19A 3N19B 1SZFA 3PF3A 4MJZA 1C9DA 3CU2A 4UR7A 5AOUA 4XTIA 4XKYB 5AHNA 3TQ0A 1A5CA 1VR6A 3P82A 1KV5A 3KRSA 4Z1AA 3VNDA 1AW5A 5AHMA 1ZNNA 1NSJA 3UPWA 4BI5A 4JYEA 2QDGA 1JUEA 2E6FA 2W6RA 1Q6QA 3WJYA 2X30A 4LT9A 1E51A 2V30A 2RDUA 1KM4A 3BO9A 5HR6A 2TSYA 1GG1A 1O4UA 3EKLA 5CPLA 4QSHA 1VHNA 4JTUA 4RLIA 1F73A 3S5YA 3C2RA 3TSMA 3LLFA 3LERA 1BEUA
chains in the Genus database with same CATH superfamily
1A80A 2NZLA 3S5ZA 2X7WA 1WDRA 3RHGA 1Q2RA 4IF2A 3NZRA 3GG0A 3QC0A 1ONRA 1XSJA 1EL3A 3N18A 1O68A 4DJDA 4Q4MA 4UR9A 1XUUA 2C3ZA 4GZEA 1G5AA 2Z24A 5HOSA 4ZSUA 3UP8A 2BB0A 2DJXA 1X1NA 1KLZA 3LRKA 3W1NA 1T8QA 3EA3A 2YIHA 2GDQA 4HNCA 4HMDA 1TMHA 4EACA 5I03A 3WKZA 1Z89A 1US2A 3ARQA 3F1QA 4AZ7A 4OV4A 5K9XA 3TC6A 2VEMA 5EL1A 3KVMA 4QJ1A 2QUMA 4S39A 3VX0A 1VRDA 4EPKA 4Q4QA 2B7OA 2V5CA 1SFSA 1FWFC 4C90A 1R2SA 2CBJA 1ESWA 1A5OC 1AH0A 2YXXA 3POCA 2R1LA 4LYKA 3F4DA 4JQ1A 1WOBA 1J0KA 3KOFA 4MZ8A 4NAFB 3RMJA 4AWTA 1Y7VA 1F8MA 3MDWA 3VD7A 5JH2A 1U1HA 3RM9A 1YDNA 4JQ4A 3EXSA 4RNIA 4F2BA 2IPGA 3IJ9A 1W0MA 3KRBA 3TW6A 4H04A 1Q5MA 3TNOA 3S2CA 2ISSA 3PTQA 4K7YA 4HPNA 4MUPA 2W92A 1AW1A 3DH7A 4D8AA 1QR7A 2D22A 4AWSA 3M43A 3TV8A 3TXVA 2ZICA 2J6XA 4BEQA 1CB2A 2W67A 3FHQA 3WZ0E 5C9ZA 1AQMA 1XFBA 3I4EA 2RGLA 4C60A 1A5BA 3M7SA 4MAZA 4JAWA 4NNBA 1F07A 1OGSA 3ANYA 1GKQA 2ZC1A 1Z42A 1CGUA 3MI2A 1Z3NA 4JTJA 4ZO6A 3QZ6A 2OEMA 4G1KA 5IM51 7PTDA 2ZZ1A 1YADA 4A8LA 3CL8A 2GSJA 5I6SA 2E6DA 4M6UA 3S42A 1FWNA 3GXTA 4I9TA 5LIWX 5K3VA 1XD0A 3PHAA 4IWWA 1XM3A 4AD3A 1M7JA 1TMLA 1RQBA 4P7NA 1US0A 2V9DA 2OKOA 4F2TA 2C14A 3U7VA 3WD1A 2NQJA 4A29A 4G1NA 4OECA 1YBQB 4TV5A 4ADTA 4JIEA 4S3AA 3GH4A 4J2PA 1PDYA 3HFTA 2G4JA 1QHZA 4HTBA 4S1FA 2PDQA 4N02A 2EBNA 3T4WA 3L21A 3P7YA 1X7FA 4ICMA 3WBWA 2FZBA 3I68A 1YDYA 1HP5A 2WKGA 3W7JA 5GNYA 1GTEA 4UTFA 3QLDA 2ZCGA 3FIGA 2OOGA 2GGIA 3N3MA 5KZMA 1Q8AA 5K4XA 2YB1A 2GVJA 1RLDA 1F4AA 4NHVA 2XVNA 2ATMA 1HJSA 3C2EA 1TPEA 4UFIA 2AMGA 2PS2A 5CC3A 1BTCA 1CXKA 4C1KA 3CZ8A 4HZMA 1KFJA 1IXQA 3LCGA 1MQRA 1EC9A 4CNNA 3WF2A 4LVGA 2GJLA 1OX5A 4NF7A 1P0KA 1UKOA 3BAJA 4FXSA 2OQYA 2FVKA 4JN7A 1TV2A 3KTSA 3NO3A 4FR6A 1LWJA 3DI0A 5KMYA 1B3YA 4NT0A 1VYSX 1WXJA 2NT1A 4UTMA 2JBMA 2PGRA 4B5SA 3HG4A 3YPIA 5J8LA 1M7PA 3E5PA 3LGDA 4LRSA 3S2LA 1E43A 3QGVA 1Z44A 3RJYA 2BVYA 2W62A 4B2DA 3M5XA 3WL1A 2QPUA 3IACA 4AHQA 1PTAA 3M9YA 3VIMA 3KAOA 1G67A 3H6OA 2I1OA 2R1KA 4HU8A 4D6GA 3NQAA 3GBEA 1FBAA 1TX0A 5G2IA 1ZUAX 4BEUA 1SO6A 1ZQ5A 2PDBA 1HJUA 4LVBA 1KWKA 2VEGA 1EA9C 3KW3A 2A1YA 3B0YA 1UC4A 1GHSA 3O7UA 1VLIA 4U3AA 4ZBCA 5DRIA 4QTGA 3CZLA 4CGTA 3I3DA 4RE0A 3QTPA 3BV4A 3RAOA 3CYVA 1W3LA 1JCLA 2Z00A 5CC7A 1IT0A 2A3EA 2NXGA 2KX9A 3H2AA 1Q45A 1XYCA 2XGIA 2IPJA 3GK0A 3GNDA 1FRBA 3CXOA 4PMOA 4LCRA 3NEVA 1MZHA 4NJKA 4NXKA 3N2BA 3DECA 1X7IA 2ACQA 4PMXA 2ZYFA 2PDYA 2XH0A 1TV7A 2VGFA 1CGWA 5HR7A 1D8WA 4JQAA 4RX0A 3VCRA 1B9BA 4RUBA 1T7LA 3AXKA 1GWJA 3VKJA 4FB7A 4B2DD 4PRWA 1FWCC 3W7RA 2WMIB 1DIOA 4J3UA 3ZR4A 4GH1A 4IPNB 4PEEA 2J24A 1DWHM 1M68A 3TA9A 2PLCA 4IH3A 1XGZA 1VJSA 1QTWA 4NVTA 4NSBA 1LOSA 2VD8A 1P0DA 3IUDA 2FB2A 2OG9A 1PXGA 3W85A 1CLXA 1HVQA 3LD5A 1O60A 3L5LA 4E8GA 2WWCA 2ISVA 3M4HA 1JAEA 2PGEA 1KR0A 4JFTA 4UXDA 5K9CA 4HK5A 3PPGA 3TSBA 3KL3A 4PZVA 3CHFA 1XLGA 3WLJA 1MVYA 5AC4A 1FFRA 1UR0A 4UCGA 3LBOA 3QMSA 4MNLA 4HBKA 4CD4A 6CGTA 1W9UA 4MOZA 1RHCA 2NWSA 3P81A 4O0KA 1OZMA 2TMDA 3SCQA 3WNOA 1AD4A 1QNQA 4AXNA 1WKDA 4X3ZA 5D8ZA 1PUDA 1L6WA 5H2ZA 4QEHA 4AD4A 1ELSA 2CZEA 4I9JA 5CZ0A 1TPVA 4FOUA 1BG9A 3VCNA 1O1HA 3W7PA 5G1TA 4ZO7A 4J5NA 4Q32A 3HF3A 2H8XA 1MI3A 3RU6A 2A4AA 4JCLA 1NVMA 4L4MA 4PBGA 3WNKA 1UWAA 3C5QA 2I5GA 1FOBA 1QT1A 3V0UA 2A7RA 1O12A 2VJXA 2GDUA 1G4PA 4S38A 3RNDA 3DKJA 3TCSA 3W28A 2QMKA 4JY8A 2FVMA 4WSHA 4M24A 2X1IA 1Q6CA 5CJMA 5H6HA 2AAAA 1WXYA 1UUMA 2FGLA 4QJ4B 4GQBA 4K38A 3A21A 3LCWA 3NL3A 4IMAA 3T2PA 1GOMA 4NAEA 3T05A 1SZNA 1UW9A 1REQB 4HA1A 1KKOA 3NXLA 4AQLA 1L6YA 1YKWA 3W7LA 2MANA 4JCMA 2KZHA 3GQYA 1M5WA 1WZMA 4E2BA 2CIPA 1UROA 4KEZA 1PKYA 2G3IA 1CLKA 2DSVA 3OHMB 1O95A 3A24A 1EYWA 4C6NA 3LMZA 3CL6A 5RUBA 1H0IA 3QRHA 2D3NA 1OFQA 5M5DA 2B0MA 2J79A 4Q8PA 1KM1A 2DZWA 2J7CA 3DKLA 3M41A 4H9VA 3HG2A 3OA5A 5BROA 1IWAA 2AAMA 2FH6A 1DYSA 3DFOA 4QRNA 1DQXA 2CHRA 4WQ6A 1S2AA 5BOOA 3SN4A 3M6DA 2GQ9A 5EPDA 4HPGA 3B04A 2XG9A 2DT1A 1LTDA 3NSMA 3LQLA 1Q7ZA 3IIZA 1NWRA 4IIHA 5REQA 1AMKA 2P5NA 2R24A 3UXKA 1JF5A 3IEBA 4AH7A 2EG6A 4KGLA 3W00A 2DT2A 3IAPA 4HNOA 3FYOA 1ZRQA 1X38A 2XISA 4GFSA 3BLEA 4JIHA 3VABA 4B92A 2F2HA 3RCYA 3WNNA 3TMLA 3OO2A 5IDIA 3PULA 3JZUA 1SU5A 3S5SA 3W1TA 2PD5A 2YLAA 3S2JA 3ZFHA 5K2ZA 4C1LA 1RQEA 1T99A 4Y2WA 3M0IA 4IIBA 2CPUA 2WCAA 3NPVA 4JFSA 1EOMA 4W5UA 1GOWA 2XIOA 3S8HA 1BRLA 1TJPA 4WK9A 4L4LA 1B54A 1QI3A 1E6XM 1G4EA 3KDNA 1OSEA 4H2CA 4WX2A 4Z2GA 5FJIA 2VX7A 3W7DA 2C16A 3P5YA 3F4CA 4FHAA 3IS4A 2A21A 4LBSA 1J0HA 2P88A 1JUBA 5JBEA 1F3WA 4RZ5A 4HU4A 1YYAA 3QR3A 3N2XA 3W82A 4JX4A 5HQEA 1PBGA 4PTDA 2GVLA 3AMCA 1B3WA 4Q8NA 1QNSA 2GVGA 1ISYA 2ACSA 4IFKA 2J7HA 1F8IA 1TA3A 3SCNA 3USZA 3ZJ6A 3GG1A 4ZSTA 4YWIA 3D5HA 3LHZA 2QJJA 1GQIA 4OFCA 2VQTA 4PRRA 4FS9A 3T1GA 4OBSA 3K1DA 5FD0A 4D6FA 1Z7AA 1UZDA 4DWDA 3CV7A 3K13A 4DF2A 1B9ZA 4DF0A 4DX3A 2HZGA 2HTMA 4FNRA 4ZO9A 1A3WA 1E6RA 3G1YA 2AQWA 3L12A 3W29A 5AFDA 1R46A 2Q09A 2X1UA 2OYLA 4P8UA 3ABZA 4QS6A 1I2OA 2F84A 4MF4A 5I06A 1DWIM 1JZ8A 2CLOA 3OVQA 3SZ8A 1GQNA 1TZ9A 3EB2A 2J88A 1LT7A 3MYOA 3T55A 1SSDA 4HCLA 1KRMA 1VFFA 3AALA 1U22A 3LPPA 3SADA 1NDWA 1EGMA 1IZJA 2GJPA 4HNNA 3S46A 1ZY9A 4DJED 1OD8A 3F5KA 1OFEA 3TN5A 5CPSA 3UCDA 3UGRA 2DORA 4QG9A 4RK8A 4DPQA 4UTHA 4JN8A 3QEZA 4J3XA 5LA2A 5L6UA 2NVCA 2ADAA 3PTDA 2VZTA 1F5ZA 5CJNA 1S2VA 1WYIA 1OQFA 3NQFA 1BVNP 1TWZA 4B3LA 3UERA 3H54A 4Y90A 1ONXA 4RXGA 1ALDA 3LI0A 3P6LA 2DU2A 4D6HA 3PBMA 3BVJA 1S5WA 4U5IA 3UETA 1RY0A 1W1B1 3WLPA 3IPWA 4GHRA 1ZJAA 1PSCA 1GHRA 4KWOA 3RPDA 5I09A 3K4WA 4PODA 3U2ZA 1JYWA 4AW7A 4GXWA 2OQLA 4OKDA 5DANA 4GCXA 1VEPA 3ABSA 5T8GA 5DMYA 3OZYA 3EWUA 4RDYA 3CMFA 3OHIA 3Q37A 4UNIA 1WUFA 4R9XA 2WVTA 3MWAA 4OUEA 3HQNA 2R6OA 1R3SA 3T8LA 3THUA 2DH3A 3S1GA 3MUCA 4DLFA 1GCYA 1UKPA 1RP8A 1J5TA 4US5D 5EFDA 1TTPA 3HURA 4L6OA 2YBVA 3CQJA 2HPMA 1W8GA 3E2QA 3SGZA 3NPXA 3VXGA 1KXTA 3OTRA 3AMGA 1LYXA 7A3HA 1OF6A 2EF9A 2F61A 2AQVA 2WMHA 3RRAA 3GXNA 4ATDA 4BFAA 1EF2A 4AFYA 4FLQA 1TVNA 5GVJA 1XPGA 2PP1A 1WAUA 5LNUA 4FR1A 4NP7A 4I90A 4IIEA 4TQTA 1JDFA 1BKSA 1HJXA 2Z26A 4P2VA 4PMVA 2GPTA 1D3HA 1G7VA 2OSYA 3GW3A 5KSWA 2O4MA 2QR6A 4UTKA 2EEXA 3UXAA 1A5NC 2ALRA 2QJHA 4P8VA 1Y65A 3W7KA 4PUUA 3O6AA 1F2JA 4KFNA 5ABHA 2VGBA 1XIIA 2WJZA 3ICJA 3WK2A 3M6YA 5AYXA 2DZTA 3W37A 2GGHA 3MUAA 4UFHA 2P8BA 4LEFA 1BYCA 1OCQA 3VINA 4DN1A 4J7RA 4JZ5A 3W70A 3QM3A 2I57A 3UJ2A 5C9UA 3M1ZA 4QDWA 2QVHA 1CX9A 3MZ2A 4GOAA 1BYDA 4PMDA 2HK0A 3H70A 4PUWA 4QCEA 4ZOEA 3NIYA 5LNVA 3VGGA 1ZB5A 2X0SA 2XFRA 4M6QA 3UA4A 3LGGA 3HMCA 3EX3A 4ZZ9A 4A2SA 9RUBA 4GC3A 1I4NA 1B90A 1IGWA 4R5EA 3N11A 1OIMA 3JVAA 1DJGA 3RF9A 4AUBA 3EWZA 2ESCA 4Y9OA 3CUXA 4FX7A 1BTMA 2CKRA 3TROA 3P2VA 3BAXA 2UY3A 1KLYA 5SWUA 3B05A 3RG6A 2H90A 1UR4A 3GC5A 4NI8A 1EJWC 8A3HA 5M17A 4K6AA 1YX1A 4BJHA 1WX0A 1B1YA 3GLCA 2PTWA 5HANA 3WLRA 3GH5A 4ZVJA 4FIQA 3UG8A 2V5KA 3CHEA 2PZ0A 3S2MA 3K8KA 1YPIA 2EO7A 1XFCA 4HSOA 1VBGA 1K7EA 1MSSA 4BKNA 1KM2A 4UR8A 4H3DA 3P67A 4LYQA 2GUBA 2YX0A 2OEJA 1CYGA 3T0AA 3PVFA 1B0IA 4JX5A 3VD5A 2X42A 1L8PA 2C6QA 4NZJA 4YN5A 1TJRA 1K9EA 2W4XA 2J7FA 5FEZA 2BVTA 2DW7A 4C6IA 3AQUA 2DZBA 2J7GA 3SQLA 4JTLA 3H4GA 1VH7A 1W56A 4PFMA 5HJXA 4UOQA 2Z29A 4RDZA 1YTKA 3I7RA 3IJ7A 4A3UA 4RV3A 4AU0A 2BGNE 3BJTA 1RPXA 1GJPA 3LXAA 3TX9A 5FESA 4S3KA 1JNDA 2C0HA 3PY2A 3KHJA 2ISFA 1RVGA 1KV8A 1JL8A 4NXSA 3KP0A 3GDBA 3UZXA 1M01A 4FF5A 2BDQA 1GOKA 3RCNA 2PDKA 5T26A 4K39A 3SRHA 3L23A 2PWHA 3CQHA 4O13A 2QXWA 5A2BA 5C2XA 1DJQA 1M7XA 4WDWA 4CEXC 2V3GA 4OV9A 2F8QA 3MMWA 3NYDA 1AQFA 1XYZA 5CG7A 3E38A 3WMSA 4EVZA 1QI2A 2BHYA 3IANA 5IHSA 2CZVA 2WWDA 3LN3A 1N7KA 4TUFA 3H2NA 4PUNA 2WNNA 4F0RA 4U31A 3PZVA 3AHTA 2PI6A 3DHFA 4PSRA 5A2CA 2VQUA 1KW1A 3THQA 4DWSD 3A4WA 4Y8FA 1B57A 2J9XA 3AS3A 3BCJA 1U5VA 1DIDA 3O15A 4CKQA 3N4FA 4BCEA 4LBUA 3L5AA 1CECA 4IL2A 4MPQA 2WQPA 4PTXA 2BHUA 2OODA 4PL1A 2DFAA 3BZJA 3LCIA 3CTTA 4ZQNA 4GE8A 5LGXA 7CGTA 4FK9A 4RZBA 2P3EA 1I45A 4EF9A 3KOXA 3EDKA 3KZSA 2BLEA 1PCKA 4Q4PA 3LU2A 4YVPA 2J27A 3WK0A 3EOUA 4IPIA 2PUZA 1H41A 1KCZA 2DGAA 1EWDA 3CO8A 2W9MA 5JH1A 3SIZA 3DENA 3T0DA 2CZDA 1G4TA 2IKHA 4JYFA 2ZBTA 4OTKA 4D6IA 3PNUA 3A9IA 4L9ZA 1CT5A 1QOXA 3E1F1 4FZIA 1SMAA 4GJ1A 1OG6A 2GK1B 4DJFC 3LK6A 1W3JA 4L1WA 5ABGA 1PAMA 5LKYA 3TC7A 4EXAA 2WCGA 5BWAA 3ECQA 3DAQA 4P8WA 1OFDA 4HD5A 1XPYA 3W1MA 2Y7FA 2VM8A 1YNPA 3LXBA 3M64A 3C61A 2DY3A 1D8CA 4B5UA 2QULA 3R0DA 3M16A 3CGTA 1D3CA 1NELA 3H12A 4UNLA 2V8ZA 3GG8A 5I77A 3DYOA 1UP0A 2QUNA 1HTIA 1AH4A 1TE6A 2OLAA 3M0JA 4JYDA 1VFLA 2E0PA 3R2GA 1EBGA 1AG1O 1EHNA 4JHMA 4KCUA 1W9DM 3GXDA 3PUEA 3N73A 1JAKA 1K8ZA 3AICA 2ZRZA 1NARA 5A2AA 4IQJA 1KXVA 2F9RA 5I0DA 4OUIA 4MWAC 1GVEA 2VFDA 1QW9A 3SFWA 4J4KA 1RD5A 2VURA 3O6YX 1S5TA 3CUFA 4D8ZA 3V0SA 4IUGA 2HBXA 2YYUA 4GMEA 4G9PA 3GG7A 3B4YA 4H6EA 4MKNA 4ML4A 3LBCA 2GOKA 3OZPA 3H7UA 4D72A 3MC5A 1WZAA 1HN1A 1QHOA 2VOMA 3KBSA 2BFGA 1DXFA 3F2BA 2SFPA 3KBJA 3WF0A 1SJCA 3GDKA 4HVXA 4Z2IA 7TAAA 2Y62A 4KRTA 2B7PA 2GGJA 4TMCA 1FUYA 1PKNA 2R1NA 2YL9A 3URBA 2Y24A 1M65A 3EDDA 4RPPA 1GVIA 4HSHA 2ZC8A 3OW1A 4B4HA 3G1VA 3HG5A 1JD9A 2RFGA 9XIAA 1SFLA 1WXZA 4DO6A 1ITUA 3TEVA 2RDTA 5JBFA 5JBDA 1GZJA 4WVXA 3RK8A 1X96A 5B80A 3SAZA 3UY8A 3IGUA 4WZHA 4Y96A 4F0MA 4S3GA 2PU1A 1F74A 1TJ2A 4HN4A 2GOUA 2XDFA 1W3TA 1VFMA 3GFZA 4LUIA 4KGJA 2WZHA 4JN6A 4QXIA 3CZEA 3MU7A 2G5WA 4C6KA 2A3HA 4DXKA 3NQ7A 1B30A 3NSNA 4G56A 4CEUC 4AHPA 3F2CA 5EB8A 2NSOA 1H7WA 2UY5A 4XZHA 1CGXA 5FF7A 3FN9A 1KFKA 1OFBA 2YGYA 4GYKA 1DTUA 5E93A 3VZYA 4Q8WA 1QFEA 1Q8JA 1IXNA 3CLWA 1X39A 4YYFA 1IEIA 3BAWA 1AMYA 4NJJA 4WKHA 3Q65A 2D0FA 1Z48A 1RY8A 4BQ5A 1QASA 1BYAA 3IVSA 5CH9A 5LIXX 3O6CA 3W02A 1HJWA 2Q02A 3EDEA 5AHEA 5A1AA 1AQHA 3M0HA 3TN4A 1SYTA 4WJXA 1W1A1 3B0PA 4KWUA 5CSRA 3BGJA 3NYZA 7ENLA 3RDKA 3EZ4A 1UJQA 4DPPA 1VAHA 3KRUA 3W73A 5A5WA 1RZMA 2OZ3A 4UQAA 3WDHA 4H00A 5FA5A 1ZSXA 2X0YA 3LV6A 3LUTA 2NV9A 4A8NA 2FMNA 2IQDA 1R7AA 2E77A 3E2RA 4XISA 2HWGA 1QI4A 2A2IA 3O0KA 4HNUA 3H21A 1JRBA 4PCFA 2ZUTA 4CU8A 4O53A 4WY0A 1VPQA 4L61A 2GSHA 3D0CA 1E15A 5HNUA 1R0MA 2XIIA 3MTWA 3UWYA 5BU9A 4TVCA 3S9ZA 1N82A 2BVWA 3T44A 4AD2A 3G1SA 4GQ0A 5C71A 1XDMA 2XUCA 3EDJA 4UCFA 4YNGA 3NCOA 5LHEA 1PX4A 5D02A 3QQWA 3BMVA 1GVFA 3G1AA 4PUDA 2Q8XA 4WKFA 1TWIA 3MW7A 4PULA 2QJGA 2VCAA 1UR9A 3BSGA 3MBDA 3SCPA 2ZUNA 3EA2A 3ARSA 4ENLA 5FAGA 1UOZA 5U7SA 2H6RA 2VR2A 1ZBWA 5DEZA 3VD9A 4HP5A 4U4MA 1UPPA 5F1VA 1S1PA 5J5DA 3UU0A 1YQ2A 3GKFA 3SN0A 3W53A 3S47A 4N9DA 1A5SA 5BYWA 3SW6A 3T7VA 2EJAA 1BXCA 4CU7A 3DFYA 6ALDA 5T9CE 2NXHA 2FIQA 3E0VA 3VA8A 3PBYA 3KEHA 3ZSTA 1GVSA 3FA5A 3ARPA 4ORIA 1W5NA 4N9BA 4W84A 1BF2A 4LNCA 4ROQA 1X8FA 3U57A 2DW6A 2X2YA 1XG3A 4O10A 5AC8A 4GXMA 2WNQA 1YNQA 3I6EA 3EWBX 1LOQA 1XXXA 3WX7A 3SJ3A 2AOSA 1RV8A 3VE7A 1H5YA 1Q6RA 3UPBA 1BSLA 1AZ2A 6TAAA 3DFTA 2ZXAA 1XCFA 3IVTA 3LOTA 4MLJA 3VNIA 5AHFA 2IQTA 1VENA 4F0HA 4GQRA 3AU2A 4H4IA 2F7FA 3IGHX 3KCJA 1EBHA 1E1EA 3N19B 3GM8A 3PZMA 1SZFA 4XZMX 3PF3A 4LY4A 4YJ5A 2PODA 5AECA 3S2NA 4XTIA 3W6MA 1YRRA 2XGZA 1A5CA 3GSMA 2CYGA 3KRSA 4Z1AA 4GY7A 1AW5A 5A8NA 3PZGA 4UQEA 4BI5A 1V6WA 2QDGA 2XHYA 3N6JA 2P76A 3WJYA 2X30A 3URAA 2V3FA 3KS5A 2IXVA 5XIAA 3R1ZA 4GBDA 4H7VA 3PPHA 3VX1A 1O4UA 2Y5JA 3GFXA 4L64A 1F73A 3LLFA 4QE5A 3LERA 1YTDA 4GCAA 1UR3M 5GJPA 3HMJG 1K4HA 1UCWA 3BG9A 2AL2A 3QPEA 1UIPA 3PAJA 3RYSA 3TW7A 2ZA3A 1VIWA 1PPIA 3K5XA 3O6DA 3NZQA 5U4NA 4F2UA 3GTHA 3PJXA 1TJ1A 4E8DA 1SO3A 4NZ5A 3PJTA 4TTGA 1QNVA 3UR2A 4WDUA 2QV4A 3KVKA 5AZ1A 5E5CA 1E9IA 1NOWA 2JFEX 4NJIA 4GH3A 3E0LA 5EMMA 3TYBA 1UH2A 4O12A 3QN3A 2PDWA 2R1MA 5BW6A 3HPSA 1C93A 2EG8A 2O56A 3TYAA 2PDMA 1BXNA 3N3TA 3ONBA 4LC6A 4AX6A 1VCFA 3BW4A 5C7HA 2RH9A 1D2KA 3TWBA 3DBPA 2VGIA 2J6VA 2ZADA 3RO6A 3OLIA 4GQGA 3WJSA 2X1RA 4IIFA 1XIHA 2VRKA 3NZGA 1FWEC 2VEPA 3PZ9A 1GPWA 2VFHA 5IRPA 6REQB 3C52A 5FCZA 2OWXA 3IAQA 4MVAA 3SJNA 5AVNA 3UW6A 3B9NA 3O2LA 2I17A 5A6SA 1S3HA 1BLIA 1PHQA 1YXCA 3W7CA 4LPCA 3TTSA 1B4KA 1K9DA 4M6VA 4AF0A 4O1BA 4HK6A 1EZWA 4IX0A 3WDIA 2HK1A 1Q2SA 1TMQA 2EAWA 3TTEA 2W63A 3CUGA 3V7PA 3GH7A 4EP8C 2WC4A 2Z27A 4MYAA 4IJBA 3VYLA 5DF0A 3I7QA 4O50A 2JKPA 4MADA 4N0RA 4UMBA 4C6DA 2BY1A 4ZOCA 1U33A 3E0FA 1Q65A 3VOJA 4Q7NA 2XINA 3MO7A 1BHGA 2E1DA 3S3GA 4RXFA 1I60A 3FAXA 3WH6A 4KFOA 4X0NA 4QLLA 4XKMA 3FY1A 3NQDA 3OBEA 1C8QA 4XKYA 3W23A 5T9BG 1UMLA 4YTRA 3AIUA 4GYJA 2Z7KA 1UD2A 1Q3NA 3A4JA 2FZ8A 2REQA 4GA8A 3G1XA 4GXPA 4KF1A 1MWOA 2J47A 3PJUA 1RBOB 2WW5A 2GJXA 3AHYA 2WNWA 1XDJA 1LL7A 3QY6A 4BF9A 3EYPA 1FWWA 3WNLA 4GVFA 3MUIA 3AHVA 1KM3A 3VD3A 4B90A 1POJA 3KTXA 3W2MA 1SGJA 4GKTA 1VC4A 3MSGA 1Z9AA 4XZBA 3B8SA 5EMLA 4BF5A 3VAVA 4RKAA 1CLVA 1MEHA 2CERA 4UTJA 5M03A 3H53A 3GVWA 1A0CA 2Z2UA 2XIQA 4IJRA 1WDSA 3QQ1A 4HHPA 2BSLA 1AD1A 4XIAA 4PMUA 3FKRA 1RH9A 3R11A 3BV7A 1XINA 1LLZA 3EGJA 1LCOA 4HU3A 3WLTA 3HV8A 4PB4A 1JNEA 1QDSA 3H55A 1LQ2A 3DN5A 2PDLA 2PDUA 7TIMA 7ODCA 2BWGA 4LGXA 4HPHA 2IKJA 3GXMA 2ZTKA 4MAVA 5A8MA 3VOFA 4LW7A 2ZXDA 3DFPA 3QKEA 1LDCA 4NAFA 1PEZA 2YA1A 4IPPA 5E0CA 4I9AA 3NFUA 4UNKA 3L4UA 4BI7A 4PYSA 2Z1XA 2XPKA 2YPIA 3ITTA 2P0OA 1KGXA 1V77A 1SR0A 4AZ5A 5IFPA 3LSCA 1QXLA 1EHAA 4AB4A 4R34A 1TG7A 3UJFA 1EFZA 3FSTA 2AMXA 4CNPA 4Q4OA 3CH0A 1BVZA 3FKKA 3KS6A 4TV6A 1R8LA 4DWSB 3TSDA 5DXXA 4YYCA 3OGRA 1QO2A 4LUSB 1P43A 4MNJA 4QDMA 3UR5A 3VNMA 4OWGA 1O94A 1OT1A 2PRHA 4DIAA 4C5YA 1SO4A 4MLRA 1EIBA 1HG3A 3L2IA 3QW3A 4KT2A 4XD6A 2NXIA 4JKMA 1LRTA 1C8YA 3ZJ8A 4GY0A 5CSYA 2V38A 2HVNA 2OCZA 4S3DA 4K8GA 3F4WA 4ERAA 4FP1A 5T91A 1V3HA 3ZT7A 5C2CA 5D37A 2AQOA 4MY9A 3QZAA 3GDLA 2DH2A 4RL3A 3VMOA 4WDTA 5FEXA 3IUIA 3F03K 1NP0A 3WJZA 3UESA 3LEPA 3ITGA 4F0KA 2OELA 3EWDA 3NZ1A 1FWBC 4MDPA 3GXPA 2FQIA 3AS0A 1YBQA 2DPEA 1XKYA 1A0EA 1W5PA 3E74A 5KETA 1Y5XA 4D6DA 2DZXA 3MMTA 2CEQA 4PC8A 5FF3A 3VIGA 4PCPA 3SEPA 2BOEX 3C86A 1D3GA 1GQJA 1U2YA 3GXFA 4DQWA 1JULA 3BLOA 4LVFA 1FWSA 3U5YA 5A95A 4JTAA 1C92A 3TJ4A 1KQZA 3DZ1A 4L9YA 3RO8A 2J8FA 4IXXA 4LX4A 5EFFA 4Q7IA 2KAUC 2OSXA 3DFHA 2BHZA 1UYQA 3UJEA 4X2PA 5CZKA 4D1JA 1UQZA 5GJNA 2ZX6A 2I9EA 3GHRA 4R33A 1RP9A 5AYZA 3P93A 2BVDA 4EF8A 2OJPA 3B8DA 4H6QA 2YL5A 3VKKA 1TVLA 1ZHAA 5FI8A 1XLAA 3DC0A 2VDHA 1W9PA 1BWLA 4W7UA 5JU6A 4LAUA 1ISWA 1UD8A 1UBPC 1YLVA 3W2LA 3UEQA 3IVUA 1OFRA 1XKJA 4M5PA 4NYYA 1CNVA 1EEXA 3AYRA 2QF7A 3SO7A 4W8BA 4N9EA 4P7RA 3VNYA 3VKCA 2UBPC 3R43A 1WDDA 2B7QA 3JR2A 4TO8A 5EU9A 3B03A 4JPGA 2Q6ZA 3AIBA 1DKWA 1H5VA 1WNOA 4PUMA 3A47A 4I5RA 3BMXA 3N2CA 1TB3A 4JKLA 3OVGA 4LQ1A 2GJRA 3TFXA 1NU5A 1EUAA 1H61A 3WD3A 3L4XA 1GJUA 5TD4A 1EX5A 1QAPA 1V7YA 4WRHA 4S23A 1SQ7A 3U5UA 3OJGA 1I0DA 4K68A 3NAVA 2VNCA 3UXIA 5H1WA 2VZUA 3AJ7A 1FA2A 2V3DA 2Y7DA 2ZX7A 5HWMA 4BK9A 3SCSA 4ADUA 4C1NB 4BF7A 2TPSA 1SJBA 1MRQA 3IJ8A 3WDQA 5G2HA 3RX2A 4HK7A 4K1WA 1OM0A 1DV7A 3FFSA 2C0AA 4UWMA 2Y70A 1FCUA 4Q8OA 1MXDA 4KCWA 1UA3A 2RUSA 4EX4A 2YJQA 5TAOA 2ZE0A 2OEKA 2BX7A 2WO5A 2HVOA 3W2KA 3DUGA 3WF4A 4BHYA 4LOCA 1YDVA 2VCBA 3ZSSA 3W1PA 3D46A 3EWCA 1P0EA 4ONVA 2OZTA 3UR7A 3DFQA 3GVVA 1B31A 1KKRA 4IQDA 1HQTA 1MUCA 2I16A 4HMCA 4AVNA 5CG0A 1NF0A 1TV3A 6A3HA 4B4FA 2WMIA 3EPMA 1Q6EA 4F48A 2VT0A 3PB2A 1T8XA 1Z69A 1ML1A 1WP6A 2G3FA 3C8FA 3UJSA 2NLYA 3A5FA 1HT6A 1XYLA 4AZGA 1EP1A 4P61A 2Z28A 4H9XA 1S2CA 5E6ZA 3WH9A 1GZGA 4JTKA 1Q63A 3C6CA 3AWNA 3UR8A 3SURA 2F6UA 3OU8A 4LRTA 3CUZA 1C8XA 2H3DA 2R9RA 4HA0A 3VUSA 2O55A 1OGBA 3BLKA 3M44A 3VIPA 3FGCB 2PP0A 3GC4A 3KX6A 4OOUA 1FY6A 4CNUA 4LY8A 4J28A 3SSJA 3DBNA 1XCXA 5D9PA 3W7GA 2V6AA 1H7OA 3E49A 4RNHA 1UR2A 1MEWA 5C70A 1OC5A 5TQLA 1M1BA 1TX2A 2GSEA 3QBUA 4Z2KA 1EEPA 4FX8A 3W74A 3WD4A 3MWCA 2E68A 2NV2A 3LLDA 4BY3A 3MVIA 3FW6A 2PDFA 1EWEA 4UMAA 4D6EA 1S1RA 1TYGA 5LXEA 4UC5A 2B7NA 3N4EA 3RIKA 3PG8A 1AL8A 4C6BA 1F7BA 3BH4A 1HIZA 1FWGC 5HMFA 4ZOBA 3R0UA 1E71M 2B81A 2P8CA 4DJFA 4GIRA 1MXGA 1PJ9A 1S5MA 3AZSA 1QJWA 3QR0A 5CPQA 4ERIA 3ISIX 2INZA 4I9MA 5F7UA 4AAJA 3CV6A 4KPLA 3VNKA 3UG5A 3AXMA 1AVAA 2FPYA 1V6YA 2OZ8A 3F4VA 2CHOA 3G6LA 3LTYA 1E73M 2VEKA 3AUOA 2FH8A 3GRIA 2C15A 1IIGA 2E6YA 4ICCX 1BQGA 1LL6A 4C7DA 1W3IA 3ZS4A 2A85A 3H7VA 4K36A 1W3KA 1AQ0A 3ZZ1A 1QNRA 1OY0A 3MKVA 3T09A 2VXNA 2XH4A 1TRDA 1FX6A 2VR4A 1PHWA 4J3ZA 3QH2A 2WM0A 1TO3A 2HE8A 2O9TA 1F4HA 1S5NA 4YCOA 4AWEA 2ZXBA 3GC2A 3RRXA 4IPJA 1NFGA 3M47A 4E3VA 2PWUA 3N2TA 4YLWA 1EP2A 3KVJA 3TAKA 4CCCA 4KCVA 4S2CA 1AODA 5CBIA 3T6CA 4PCSA 1UWQA 3CEUA 3CC1A 4UMCA 5A6JA 3MUZ1 1XUZA 1UD3A 2O9PA 3BJSA 5BMWA 3QPYA 4UQDA 3BLLA 2XSXA 1TSIA 1XC6A 1JXKA 4TVUA 2OGYA 2XFWA 4ALDA 3HQPA 3IUHA 2VC7A 4QG8A 2I56A 1LRNA 4QE4A 1U1JA 2HROA 3PTMA 1V02E 5C55A 3KP1A 3VIKA 4QBXA 4Z0SA 4DAFA 1SZGA 2XWDA 4ADSA 5I78A 1IWBA 4MNMA 4PEKA 4ES4A 4GG9A 3QW4B 1GYMA 1UG6A 2ZX5A 4EWND 1FQ0A 3WQEA 4PB3A 2BMBA 1RALA 4ATWA 3UWVA 5CPNA 3QC3A 3WQOA 5KZDA 3B8UA 4FNQA 1ZU8A 1FH9A 3GY1A 4HGXA 1EC7A 3G1HA 1XH1A 3M5YA 1PCWA 1T40A 4DNMA 1ZAIA 2DUAA 4V27A 3N6QA 2DZPA 2VZOA 4A6GA 4QROA 3G0XA 3VIJA 1MZRA 3FV9A 3N9RA 3ZYZA 4XD4A 2Q3OA 1DPMA 1OINA 3TIMA 1WKFA 2XYLA 1EJXC 1ZPTA 2CC0A 4RE3A 5J5RA 3R8HA 1UIOA 1UPMB 2GWGA 1HVXA 1KTBA 2V69A 5PTDA 1RSCA 1VFTA 3GW0A 3N4AA 3MT1A 4H6KA 1GW9A 3FJLA 3FEQA 3L68A 4U2YA 1YE4A 4PN2A 1J0YA 3HGSA 1WAWA 1EJRC 2VHLA 3A13A 3V1HA 5FJRA 1MYRA 4LC8A 4XD5A 4L1GA 3I65A 4ZQRA 3NQ8A 1UD4A 2G3NA 4E2DA 1LBMA 1JG9A 5A6BD 3K8MA 4X0VA 2XH7A 4O17A 1TPC1 4PA8A 4AMAA 3UVAA 1XSKA 3KOWA 5CKSA 1E1FA 1ODUA 3EWXA 2J7DA 3ZXWA 1QPOA 4XAZA 3SUTA 2R91A 3RLUA 5D04C 4HNLA 1LJYA 4HOXA 4LFYA 3USBA 4G6CA 3TDFA 2IKGA 1ICSA 3WLSA 3M0MA 3VM7A 4Q22A 3VGDA 1XLJA 6PTDA 2QKFA 2XSAA 4DYEA 1IEWA 5A8OA 4S3CA 3MV01 4Z17A 5DRCA 1KM0A 1MW0A 2V2DA 2HE5A 3BW2A 4JTGA 1NOFA 3BCFA 5DMNA 3ZVHB 5CGMA 3B06A 1K6WA 2VR5A 3ARYA 2BGSA 4HOZA 1K8XA 1LLWA 5LNRA 4TIMA 4CCZA 3AMDA 2FHFA 1M7OA 2BG5A 2O92A 3PC0A 2ZZ4A 4JEQA 1NDVA 4IICA 5H8MA 1SMDA 2QIWA 4J3WA 4WSKA 1FCBA 3RPTA 3URNA 5HNRA 3I6RA 2E5CA 4OU1A 1JPIA 1O1ZA 3UPMA 1H7NA 1OYAA 1TR1A 4QE1A 1XDLA 1Y5WA 1K03A 1N8IA 2PRLA 1O7AA 5HQMA 4Q6XA 1ME7A 1G94A 3WDPP 2DUXA 4E3TA 4XZIA 3C56A 1FWJC 4HPJA 4ZXLA 3V75A 1J18A 4WXZA 3NQCA 4KS0A 4HN8A 1R86A 4O8RA 3EAUA 4RE2A 4DBEA 3C2FA 1TPH1 5DXYA 2J25A 2ZXQA 3JZEA 1TV4A 1OFPA 4IXHA 2FGZA 1EJVC 2ZQ0A 5BNKA 1EXBA 4EIVA 4EKJA 4YMZA 1HL8A 3W7HA 2ZA1A 4FSAA 3UA3A 1XR2A 2WZEA 4KWWA 5JIPA 1E70M 4N9CA 3MP4A 4O19A 2ZUMA 5ENLA 2RKXA 3STGA 4OHQA 1KCXA 4X63A 3VGBA 2UV8G 5CGQA 2QNEA 1P6WA 3NQBA 1FWHC 1BQCA 1ZCOA 1V0MA 3B9AA 1TV8A 5CAHA 3AHXA 3NR0A 1FKWA 1V08A 2I9UA 4IGHA 4BR1A 4DXVA 4RJEA 1Q6OA 2D1ZA 3JU2A 2GL5A 2PWGA 1E40A 4M1RA 1UWUA 3GVGA 4KBXA 2Q3RA 4U33A 4Q8VA 3BANA 5FIPA 4EOUA 4NUWA 3RR1A 3T78A 2A0NA 3WLMA 2QV5A 3RX4A 2ZX9A 2FJUB 2J9ZA 1VQTA 3TXZA 1ZJIA 1F05A 3SB0A 5I3IA 2WKJA 4AY8A 3REQB 4C7FA 4F40A 3VU2A 3ONCA 1K3UA 5ABFB 5LXXA 4QNEA 5EY5A 3PP7A 1E4IA 5JMUA 3G3DA 1IGSA 3UWUA 1W31A 2L5HA 1XRTA 3PUDA 1H60A 4L6DA 4AIOA 3H2CA 4LUYA 2WSPA 3WQFA 3S5OA 2G41A 4NILA 3TQKA 5LIYX 2VGGA 1DJIA 2ANUA 1X1OA 3KXQA 4MSSA 4IJCA 3HFYA 1A4MA 2RJGA 1TZ7A 4EE9A 4YWSA 5A8GA 1LLOA 2E09A 3OQEA 1IEXA 5CGTA 3KVLA 3WQWA 4Z2JA 5DT7A 3W1RA 4BI6A 1DIKA 4L56A 1GKRA 3T0CA 3N17A 1JYXA 3HPZA 1KRAC 1H1ZA 1WB0A 3R6IA 3S1XA 2PWVA 2QUUA 1QWGA 3OPSA 2CLKA 3W75A 2VC6A 5FF0A 4LS0A 3UZ5A 1EJ7L 1Q6LA 1R9ZA 5E1QA 4E4PA 3D6NA 1DQWA 1EPXA 1UASA 3UY7A 1Q4NX 1W1IE 3WF1A 2NVDA 2JE8A 4FNPA 1VS1A 1GK8A 2CCRA 3NO1A 3FDKA 4MG4A 3RLVA 3WDRA 4QR6A 3CMJA 4QQUA 3DOPA 5FSDC 4JIQA 1W3NA 1JDAA 2BOFX 3GXIA 1ZTVA 1OC6A 1TWSA 4QLJA 1EGZA 1WZLA 2G8ZA 3VMPA 4HYRA 4L5ZA 3PAOA 4H9UA 3E12A 1QK0A 4IUOA 2QCGA 4GBUA 2DT0A 1ZS2A 2WLYA 3BGAA 4HYWA 1US3A 3W81A 3TW9A 3PBWA 5HXMA 2QPSA 3DFNA 1UBSA 2VENA 4GYPA 3HOJA 1VBJA 2ZIDA 2ICSA 4MPKA 3EEGA 4XUGA 3AUJA 5GNXA 4REQB 1K1DA 3VIIA 5GPRA 3BSHA 3W88A 1L9WA 3SRDA 4XV0A 2VEIA 4B5TA 5MKGB 5C7VA 5FSEC 4WXYA 4WLCA 3LRLA 2C91A 1L0PA 4LAKA 1KTNA 1M53A 3MYPA 1PIIA 2BZNA 2YDRA 1OIFA 4O57A 1DE6A 1WBHA 1GYNA 1PYFA 3CUHA 4PUJA 1KRBC 2QHAA 1GVQA 2J62A 3IGXA 4UZUA 1MRAA 2VL4A 5I79A 2OX4A 3WD0A 3GZAA 4NQ1A 2NQHA 2V2CA 4TTUA 4YXGA 4GUIA 1P7TB 1ZBCA 1QWKA 4P8XA 3ABXA 1EDTA 4W89A 1K7XA 3MPGA 1NDZA 3MSRA 4WSJA 3UYCA 1IZKA 4OVXA 1SJAA 1V02A 2WPBA 2OPJA 1XYAA 4KEMA 3RITA 2XVLA 2ZDRA 1J0JA 3W4RA 3T2OA 4O4WA 4ZE5A 4DNHA 1UH3A 2GYIA 3APGA 3OLGA 4M0XA 3B40A 2VFEA 3E2VA 4MZYA 1AH3A 3R13A 1KFWA 1RA0A 3N29A 1TIMA 3G1FA 1MW3A 3CWOX 1GONA 3B9OA 1WBJA 3RJXA 2BS9A 2GK1A 4HIBA 5E0KA 1CZ1A 2OFJA 3FVMA 3I3BA 4IMFA 3TCEA 3CAKA 2AGTA 5CBJA 2W61A 5D2VA 1R5YA 1R3RA 3DXIA 1MXSA 2W5FA 2Y89A 1JVNA 4X9YA 1F9CA 4YTQA 3BLDA 1LUCB 3VGFA 4FIRA 3GB6A 1MFVA 3J7HA 4GQQA 3NSXA 5EBAA 4NRSA 2WVVB 2TODA 2Z0IA 1LRQA 3VMNA 1XLFA 1HW6A 2CHNA 1VFUA 3HQ1A 4LYPA 4W9TA 1PWLA 1NM9A 4AHOA 1KCLA 1GEQA 3CK5A 1CDGA 3MUY1 3U8GA 2X09A 3SM0A 3ZMRA 3OG3A 1PVNA 3C2YA 3WD2A 3MP5A 2JIWA 3CASA 1PTGA 2W79A 2Y7EA 3M0ZA 1XW8A 3B3DA 4OE7A 2XFYA 4DYJA 3AZRA 4LVAA 1L2QA 1OYCA 3O16A 1ISVA 4WOQA 2FHBA 7XIMA 4QP0A 4JDBA 2OLHA 3Q4DA 4DUXA 3OBAA 4QX4A 4KESA 3NEHA 2FTPA 4WIWA 4JTHA 3G1DA 1E6NA 2BGQA 1TKKA 3GZ3A 4C6JA 1S2UA 2VYOA 2POTA 4C6MA 4O15A 3RM8A 3U4FA 4CD5A 3DG7A 2YDAA 3U0HA 2E6AA 4C6OA 1WA3A 1UA7A 1UC5A 1WDPA 3WNPA 2X40A 3WYZA 4Z42C 3EBVA 5KINA 2Y4SA 2BNJA 5M1TA 1X98A 1WQ5A 3TJIA 2EPKX 3GKAA 5E6YA 4ML9A 3NG3A 1G01A 5HDRA 4FEZA 1AA1B 2GUUA 3EXTA 4KFPA 1HJQA 4O1FA 3EA1A 2QJNA 1RJQA 4GACA 4EANA 2Z6JA 1VJZA 3OBKA 3GWQA 4JFUA 1ICQA 4HA3A 1W1VA 2IPFA 4P5UA 3BK0A 3CIXA 5HA7A 2WSKA 2HMCA 4Z08A 4S3JA 3VDBA 1H4PA 4X60A 1I0BA 4GD0A 3LM3A 4LF2A 3M7WA 2DSUA 3A4AA 4UFKA 2E5DA 4ZB0A 3VO0A 7REQB 3IIXA 5GJMA 3GUWA 5DT5A 2D2HA 1XG4A 3QLLA 3GNOA 2DVXA 3GTNA 4BA0A 5LNSA 3QY8A 4FLSA 3U4AA 3TQVA 1RJRA 4NYUA 4TX6A 5AYIA 5D9NA 3UXLA 1C9DA 1QU4A 3TNBA 3QYSA 3SUWA 5CXPA 3FCPA 4PMQA 3P82A 1PWMA 4D71A 4K2SA 3PJWA 2AKMA 1NSJA 3JUGA 2E6FA 1Q6QA 1BF6A 4HB7A 3RMEA 4L6HA 4CQDA 1UMYA 2CWXA 2I7GA 4TX8A 5HR6A 1UKQA 4QSHA 1VHNA 1LQAA 4IP7A 1SZRA 1JCYA 4IPLA 4Q4SA 4HHHA 1XYBA 4TX9A 5FEPA 1XIGA 4DBUA 3CHCA 2F6KA 1GPFA 1DVJA 3C8NA 1U83A 1XIMA 4FLRA 5G4EA 4L7ZA 4AMCA 5CLWA 2FGBA 3L2LA 3I3EA 4JQ2A 4AZHA 4AIUA 1JZ2A 3M5VA 1BFNA 1E0XA 1VFOA 5DBTA 4GIAA 3R0KA 2BOGX 4JIIX 2OOFA 3T0BA 1FKXA 3T4CA 5D03A 2QW5A 2WV8A 4Y8EA 4C6QA 3WMCA 3LYEA 1VPXA 3TJXA 3C2OA 2WJEA 3BL3A 1XSIA 4GI4A 1E0TA 4C6FA 3EWWA 4BWLA 1DP0A 1A5KC 1PX3A 1QBBA 2NV1A 1V3MA 3SGUA 3JW7A 3HGOA 4CN4A 1DJZA 2WJDA 1K9FA 1UZ4A 3WEOA 1UWRA 3HQOA 2CXEA 1W1YA 3CUJA 5D32A 2FHCA 4MGGA 3OA3A 5I2UA 4W4QA 1NEYA 1AJ2A 1JGIA 4G7EB 4Q3MA 1SPQA 3ENLA 4HKPA 4X2RA 4DJEA 3NQEA 2P53A 4G7FA 2IS7A 1H3GA 4B91A 1NJJA 2A7PA 1PS9A 3TU9A 1V6UA 2V5BA 1MNZA 3WH5A 3EKGA 1THFD 2JIEA 2FZDA 3GIPA 2Y6ZA 1H62A 1W2PA 3OP2A 2A3BA 3ARVA 2EJ1A 4AY7A 3MS8A 5JIWA 5MF5A 1KGUA 1TQXA 5KZEA 1MDLA 3ALGA 4UTLA 1FDYA 2ZVIA 3UWEA 4FAMA 3ARXA 3H4XA 2IW0A 4GJIA 5KZ6A 2RDWA 1HL2A 1YXYA 1GW1A 3OVPA 2NX9A 1FDZA 2DDXA 3B97A 3FEMA 1TPUA 3W7OA 1U30A 3AAMA 1R7OA 4IGNA 4Z2HA 1W1PA 3QOKA 2WPGA 1W5MA 3HJEA 3B0XA 1V3JA 1XC4A 2XIJA 4YHGA 4EAYA 5A69A 4LV4A 4GFIA 3IGSA 2VD9A 1OX4B 3FX4A 1SJDA 5EKYA 1AZ1A 4JTIA 2YL6A 5A6KA 1OCJA 4R27A 3O0FA 3K1GA 3ITOA 4A35A 2J78A 4OT7A 3A64A 2AGKA 1JQVA 5AKQA 3QHNA 3ARRA 3DG3A 4PUEA 3NPWA 4US5A 4IFRA 1LG2A 1KA9F 3WO8A 3CIWA 3ATZA 4AWUA 3KRZA 4CU6A 4FO4A 4NX5A 2NQ9A 3R8RA 4ECLA 2J74A 1VJIA 3QTGA 4KKXA 3W1UA 1E0WA 2Y5SA 3T2QA 1P0BA 2YW3A 3EOEA 3W01A 1YPXA 2EPMX 4OIFA 4QGCA 4UIOA 4ACZB 5A8PA 3PZQA 1DEDA 4C6EA 5F4WA 4RE4A 5K7JA 4KIRA 2W66A 3A22A 4A3RA 1TUXA 3SCWA 1DJXA 1S2WA 3PUOA 4GZIA 4S3EA 1BWKA 4QJ3B 3CZJA 1HZYA 2ZA2A 1GOXA 4I8YA 3FA3A 1DWGM 2O0TA 1PIFA 4R85A 3GNPA 1TQJA 3WK3A 4NASA 3GYCA 3S9YA 4IL0A 4LNYA 3AC0A 1P0NA 4XB3A 2J66A 2JEPA 3W26A 1LP6A 2DQWA 5FJUA 5EMYA 3NQ2A 3NQVA 2FJKA 1ZALA 3OLDA 4NZ1A 4O1EA 1YDOA 2DJLA 2QCEA 4PMZA 4MWAD 3RPMA 4I7UA 1NF7A 5HMSA 3E0IA 5DCBA 6REQA 2YBUA 2G3MA 1AW2A 5CPOA 4LUJA 4JTRA 3ZLHA 3GR4A 1A3HA 1IR1A 4UTUA 3QQ0A 4ZO8A 3JS3A 4QFUA 1UR1A 1C7TA 1Z32X 2PC8A 1H1NA 4FLOA 1V6TA 1FXPA 4J40A 3L4WA 3BOFA 4JX6A 1VCVA 4JGDA 3U2CA 5CCZA 1LG1A 3W6YA 4E4FA 3T07A 1UZ1A 4ATLA 3NURA 3RILA 4M8UA 1Z41A 3NVDA 4MHBA 4V2XA 4O18A 1I9CB 5G4HC 4WDXA 2CETA 4JTEA 2HNEA 3TE9A 2R94A 2O9RA 3G77A 4WHBA 2YDQA 1JR1A 3UD6A 1F6YA 3AYSA 2Z7GA 3V35A 4Q8UA 1Q66A 2HXTA 5D9MA 1LWHA 4PB5A 1DHKA 3SUSA 3II1A 2INFA 4UOJA 2GVEA 1O5RA 1DWJM 2CLPA 3P61A 4XG1A 3CAVA 4ZOAA 1PL9A 1ZENA 4M80A 4XO7A 1CW2A 3EEZA 2OO6A 1W17A 1VKFA 3W2NA 3GR7A 1F3EA 2WZIA 2Z1WA 4DBWA 4A3YA 1UH4A 2CITA 3CLMA 1TCMA 3TQPA 1VHCA 2IUZA 1YTEA 3GR8A 4GYFA 4PMRA 3WN6A 2OWCA 2D23A 3U2OA 1V03A 3WQ5A 4MM1A 3FK4A 5JQ9A 1EJTC 4Z1DA 5I3DA 1RUSA 1UWTA 2OT0A 1C8VA 4M1BA 3N15A 4GC4A 5FF4A 1W32A 2WSQA 3BGGA 3F5LA 2G3JA 1ECQA 5D2XA 2NLIA 5LA1A 2QCDB 5BOFA 2DT3A 3PNZA 1DJNA 3PB0A 2PB1A 1G7UA 3PBGA 3OGVA 4Y6GA 3BPWA 1YEYA 3APTA 4JL2A 3P80A 3TVAA 8TIMA 1L6GA 1KBKA 3HB9A 3OEXA 1XYMA 5FOOA 4B3KA 3Q94A 3L65A 4L65A 1XLCA 1KO0A 4NNCA 3W7IA 1IXOA 2WLZA 4MJ2A 4RCXA 2BY3A 4R88A 3AMKA 1H09A 2GVYA 1NFBA 5I07A 1BAGA 4ZL1A 2ACUA 2V2HA 2YCKX 2ATSA 2MUCA 4GZJA 4XAGA 3PWIA 1QW8A 4OOZA 5DBUA 2VMFA 1X97A 4MYXA 1JI1A 1OCBA 1FXQA 2HCVA 3W22A 4HJFA 1BGAA 2FDSA 2VC5A 4LUTB 3JRKA 3ITXA 4PMJA 3LZ5A 4O14A 2ON3A 5HNNA 3G5EA 1R3YA 1OFAA 3KM8A 3PTKA 4QIUA 4WOZA 3HPXA 3DHPA 1BGGA 1W9XA 1HKWA 2EHHA 2G95A 4ZTYA 4DWSA 1UKTA 2PDJA 5C2GA 2PD9A 2Y5EA 4YHEA 1R3WA 4IP5A 4LUSA 4J9JA 4GNJA 3BJFA 3W07A 3PSWA 3UJRA 1YNYA 3I7SA 1TPWA 3QSTA 4MFEA 2YL8A 2CZ5A 1RXOB 3TK7A 4I5XA 1SVDA 1ECEA 1PDZA 3MSDA 3UNDA 4W7WA 4JIPA 5TIMA 3BOXA 2OYKA 1QOPA 3IJQA 4RR4A 3GVRA 3RU8X 3G18A 4D1IA 5KEZA 3C0JA 1P6BA 3H24A 1QVBA 2Q01A 1XGDA 3APYA 3S4TA 1A0DA 3RUBL 1A47A 3ES8A 3DERA 4INFA 3A5VA 3RM4A 1JJKA 3W2JA 1XRVA 2PGFA 2QJMA 3KOYA 1YXDA 5D33A 4IIGA 4E8CA 3WQ4A 4YPJA 1ITQA 5E70A 4F0LA 1JZ7A 3PZIA 3VOHA 3IV3A 3AMLA 1MQQA 2E9BA 1VFHA 4YVXA 3HZ3A 2VX4A 2PURA 5DELA 4XZNX 3A3WA 3BAKA 1M3UA 3PFRA 2EPNA 1XLBA 4E2OA 2ACRA 5IHRA 3THCA 3C3UA 4HU0A 4JNMA 1CPUA 2ZX8A 3M0YA 3WCZA 2H9AB 1RCOB 1T0OA 4OZOA 3H8AA 3CWNA 3ES7A 2PWFA 2W3ZA 3ZLGA 3AROA 4PBFA 3LCHA 1CGTA 4XSMA 1X1ZA 1WZKA 4DZAA 1OEPA 3CEPA 3GU2A 1NWUA 3QFEA 1UP3A 3F2DA 3SCRA 1JPMA 4ZQOA 1W1ZA 1O5KA 1AJ0A 4PRTA 2ZDSA 2HISA 2D2OA 1E9YB 2PZNA 4AZBA 4KIEA 1VFSA 1K77A 3G6MA 1Y0EA 4Z1YA 1KM5A 4K7VA 5M3WA 5D05A 3KLKA 1VP5A 3P0WA 3W6LA 3P3BA 4DJDD 4NG3A 2D73A 3EX4A 1I6NA 2QCLA 3A9BA 1LF1A 3SUVA 1V3KA 1VZWA 3GAKA 4W88A 2YOCA 4IX2A 2JF7A 4KEVA 4R9OA 1T6MA 4HMEA 2D2JA 3WL0A 5I23A 2GDVA 3SUUA 1JPHA 1V51A 3CH9A 4Y9NA 2OWWA 4AD1A 1QHPA 3LDVA 5C8BB 2Z2AA 2DUZA 1R2TA 2XIBA 2EQDA 5ECUA 1B5TA 2ZZ6A 1UB3A 4PTWA 2YCLB 1HL9A 1Q13A 4AZIA 1LZOA 2ZUWA 1E6QM 4R7JA 3QGAC 4FA3A 1CCWB 1EA0A 1LOLA 4UZSA 4OQVA 4I5UA 1QUMA 4QG6A 2DIEA 3ARWA 3D47A 4D8LA 4DHGA 2ZUSA 3TYUA 3MJYA 4C1NA 4DO4A 1FP8A 1DQUA 1OZQA 2NWRA 1EJUC 1FP9A 2GLKA 4IM4A 4R3UA 5TF0A 4FNSA 3WDJA 5AC6A 3WLQA 1QMLA 4UBPC 2YA0A 1JYVA 4HZ7A 4K3ZA 1PZ3A 2YXOA 1E9LA 1KXQA 1OVDA 3DHUA 1OADA 4G5DA 3UF9A 4OBRA 1JPKA 1JUKA 1GOOA 4J3TA 1E4MM 2PDGA 3GU9A 2E4TA 2WJFA 3PS7A 2C1IA 5LGZA 1PE1A 1ZJBA 4HQVA 3KWSA 3GTXA 1T41A 4LJ3A 3PM6A 2E1WA 2J7EA 4H8NA