4CQAA

Plasmodium falciparum dihydroorotate dehydrogenase (dhodh) in complex with idi-6273
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
373
structure length
371
Chain Sequence
b'FFLYDIFLKFCLKYIDGEICHDLFLLLGKYNILPYDTSNDSIYACTNIKHLDFINPFGVAAGFDKNGVCIDSILKLGFSFIEIGTITPRGQTGNAKPRIFRDVESRSIINSCGFNNMGCDKVTENLILFRKRQEEDKLLSKHIVGVSIGKNKDTVNIVDDLKYCINKIGRYADYIAINVSSPNTPGLRDNQEAGKLKNIILSVKEEIDNLEKNNIMNFLWFNTTKKKPLVFVKLAPDLNQEQKKEIADVLLETNIDGMIISNTTTQINDIKSFENKKGGVSGAKLKDISTKFICEMYNYTNKQIPIIASGGIFSGLDALEKIEAGASVCQLYSCLVFNGMKSAVQIKRELNHLLYQRGYYNLKEAIGRKHS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIHYDROOROTATE DEHYDROGENASE
molecule tags Oxidoreductase
source organism Plasmodium falciparum
publication title In Vitro Resistance Selections for Plasmodium Falciparum Dihydroorotate Dehydrogenase Inhibitors Give Mutants with Multiple Point Mutations in the Drug-Binding Site and Altered Growth.
pubmed doi rcsb
total genus 139
structure length 371
sequence length 373
chains with identical sequence B
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2014-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4cqaA00
4A2SA 2QJIA 1M5WA 2CLEA 3QPZA 1SFJA 2GVGA 1V7YA 3S5OA 5I3JA 2QDHA 1QPQA 3LHZA 4NZFA 1B4EA 1F74A 1FX6A 3B8DA 1H7RA 2A6LA 1FBAA 3LHTA 3GNDA 3NR0A 4BF9A 3S9YA 3PSVA 2B7OA 3NQ6A 5LNSA 3U2OA 2ZA3A 3F03K 2BZNA 1Q6OA 2UV8G 5J5RA 4GE8A 1ZHAA 1FUYA 4JDBA 5EYWA 5AYZA 1JUEA 3PUDA 2VEKA 2X1TA 2CZEA 4PTNA 4QNWA 3DBPA 4DXVA 1GZGA 2QCGA 1NSJA 2CLIA 1SUXA 3OVPA 5AYYA 1LDCA 3N73A 4EF9A 1W5PA 4DPPA 3NDOA 4PH6A 1O94A 3PBVA 4HIBA 3N9SA 1GTHA 3KVJA 2D73A 1R46A 3L65A 3MHUA 4E2BA 4IJBA 4FXRA 4RZ6A 3E96A 4KKXA 3GR7A 3S0CA 3MUXA 4PFMA 4IMGA 4GUFA 1KA9F 1G67A 1TV5A 3O6YX 1YXDA 2C16A 4HSNA 3W71A 1H7OA 1YTEA 1G7VA 2AGKA 1NAL1 4YCOA 4MY9A 3W1QA 3IIOA 4CCDA 3LRKA 4TMCA 1YADA 2IQTA 4QJ1A 3HBLA 1KM0A 2G95A 2FTPA 2NZLA 4IWWA 4OE7A 1ICQA 4M6QA 5C2XA 3W9ZA 3O1NA 3Q58A 3TQKA 3STGA 5EMUA 2GQ9A 3LCGA 4M5PA 2A85A 3YPIA 3I7SA 1UJPA 4K7YA 1SZEA 4O8RA 3LI0A 4RZ5A 1L6YA 1WA3A 4FXSA 3EKZA 3M41A 4FNSA 4GJ1A 1TO3A 1QMLA 2Q3OA 1M7PA 3B0UX 4NNBA 4CNOA 1BKSA 3EWZA 1EP3A 5DBUA 3PVFA 1ONRA 1LOQA 4NNCA 3TA6A 3M0ZA 1XBYA 1HO1A 4POCA 5D2WA 4DBEA 2AQWA 2ALDA 2VC6A 4CLMA 3MW7A 1P0KA 4FO4A 3PR2A 3L66A 1QWGA 4QQ3A 4BR1A 3QW3A 4KFOA 4HT3A 1QOPA 3SZ8A 3O16A 3SY5A 4FB7A 3EX2A 1OK6A 1FCBA 3C0JA 3DU0A 4MZYA 1RZMA 3M5YA 4RX0A 3W7RA 1LBMA 1A53A 3TMLA 2QDGA 1LP6A 3V1PA 5LZLA 2XN0A 4RXFA 3UY7A 4FNUA 2C3ZA 3DI1A 4K7VA 3VE9A 1H7NA 3MJYA 2DZPA 2WNNA 1SU5A 5D37A 1GVOA 2YDAA 3A22A 3NQFA 3MI3A 4OU1A 3QRHA 3OIXA 3NL6A 5LNWA 5FF4A 2WSRA 3TX9A 3TIMA 2VFDA 3P84A 3TCEA 4IMFA 6ALDA 1E51A 3TC6A 4O1DA 4MJZA 4JTUA 1H63A 4DBDA 3WK0A 2VKZG 3CWOX 3RF9A 4OV9A 1W54A 3W7JA 5KITA 2JKPA 3W22A 2ZRZA 3W1MA 2J6XA 1NF7A 2E6AA 2J24A 4HNNA 1IXOA 2ZRYA 3L21A 5DN1A 3O6CA 5HULA 4UTJA 3VE7A 3DI0A 2VEIA 3USBA 3CWNA 1LRNA 4JIPA 3BG3A 1QO5A 1W37A 5F2LA 3UWVA 4GRSA 2VFEA 3LTPA 3N2MA 2NX9A 2I14A 1VLWA 5K9CA 1SR9A 2W6RA 3TJXA 1YTDA 3CT7A 1W1ZA 1ZJIA 2OMAA 2H6RA 3TFCA 1LYXA 4Y90A 4ZVJA 1GVRA 1DORA 1OX5A 2O7QA 4XWUA 5F4WA 5D33A 5AHFA 3TH6A 3MMTA 3MHGA 3I65A 3NEVA 5K7JA 5DXXA 1T0OA 3HIJA 3GDMA 5FEZA 3PSWA 4H3DA 4LC6A 1JVNA 5KZMA 4NQ1A 1ME7A 3FLUA 3QSRA 3SGUA 4RK8A 3W73A 2F7FA 1TPEA 1R2SA 5K4ZA 1H62A 2NUWA 4PEKA 3C52A 4FNQA 2X16A 3H54A 3MI2A 3WFAA 2G96A 4TU1A 1OF8A 3NQ2A 2ZRXA 2FJKA 1TQXA 1W5QA 2BTMA 3NPWA 3R12A 1UUMA 1TPWA 5DXYA 1O5XA 4UTWC 1ZALA 1NFBA 3O8AA 4O0KA 2JBMA 5EBUA 4YL2A 1XFBA 1GYNA 4MZ8A 3SGZA 2JKAA 2NUYA 1JUBA 3FJ6A 5D38A 3W7IA 1RR2A 1K8YA 1Q3NA 4FIRA 5AN7A 1TPDA 2NWSA 3IIZA 4JTEA 5D2TA 3P8IA 1LCOA 1TV8A 4Z1AA 4UTTA 1XBVA 3C8FA 2WJZA 3HQ1A 5AC8A 1L2UA 2ZYFA 2Y88A 3HMJG 1GT8A 3G1SA 4JR5A 4RLIA 1YXYA 4X3ZA 2A21A 2NV2A 1SZNA 1KM6A 3OA3A 1WX0A 1ZY9A 4LT9A 1TPB1 4CQ8A 3ABSA 3S8HA 1VS1A 5FF7A 3UNDA 1Z44A 3R2GA 1PIIA 4D2JA 3GX9A 5I3FA 4MZ1A 4X2RA 1G7UA 3NQCA 3QEZA 3G1YA 2DU2A 3BGGA 5K4XA 3W6YA 1EP2A 2WQPA 1VR6A 8TIMA 5EL1A 4MYAA 3DFTA 5KSWA 4O14A 3W1XA 3NM1A 2ZCGA 3BGJA 3S5NA 5U4NA 1F6KA 3E02A 4X22A 1F73A 2B4GA 2QAFA 4U28A 3W74A 1S3HA 1H50A 3HG2A 1A5AA 1DJQA 3GKFA 1EPXA 1GG0A 1XKYA 4CCEA 2Z6JA 1HUVA 1DQXA 3ANYA 4G1KA 3Q37A 5BRBA 3G0UA 4AWTA 4C1KA 1MEWA 3HPZA 4JX4A 4LTSA 5MHBA 4R34A 4FEZA 3UWYA 1VYSX 2Y61A 3S6DA 2OZ0A 2B7NA 4UTWA 4K39A 4P2VA 3S5YA 1S5WA 4XKYB 5AHNA 4JY8A 1XI3A 3R8RA 3T4CA 1VYRA 4X9SA 2CZDA 3LHVA 4WD0A 2EGZA 3W75A 1PS9A 4TX9A 4UFHA 2R14A 5D03A 2DJLA 1JR1A 3KRZA 4O16A 4XTDA 4IPJA 3B06A 1R2RA 1PL9A 5E93A 3NQDA 3M5ZA 2YCEA 3GK0A 3PWAA 2PC4A 2V0TA 4DO4A 4R53A 2G5WA 3P5ZA 1OFRA 1PV8A 2EAWA 2Y7EA 2FQIA 1OK4A 3PBWA 4LV4A 1JCYA 4DF1A 1FCVA 1K02A 1FY6A 4NZJA 2A1YA 2H8ZA 2Y7DA 1TSIA 2VELA 3DHDA 3W7QA 1K3UA 4QAIA 1LTDA 3L0GA 4LVGA 1KFBA 1LRTA 1RV8A 1JUKA 2E09A 2CLLA 4AF0B 2DORA 4PCFA 3GB6A 3QW4B 4ADSA 4IMDA 4O1BA 4R7JA 2EHHA 3PB0A 3P60A 1YDVA 1ME9A 4HSOA 4AXKA 3WJXA 3LCIA 1JRCA 4GWEA 4LVDA 2FDSA 3L5LA 3EEGA 1DKWA 4JTFA 4O11A 2YPIA 3OG3A 3HF3A 2E5BA 3W07A 2B7PA 2V82A 2OJPA 1XDLA 3NXFA 1KM3A 3NNTA 3ELFA 1UB3A 3TK7A 3H53A 3TQVA 2QCLA 3CIXA 2ZRUA 1L6SA 4WXZA 3CHVA 4I7UA 3LRLA 5AC7A 2HS8A 1RQEA 3HG3A 2JGYA 1FDYA 4QIUA 1KFCA 1ZNNA 1TTPA 3QFEA 4C1LA 3LXCA 5DCEA 4BFAA 3GVGA 5DCDA 3DGRA 3NO5A 3PS7A 3LV5A 5K3VA 4A29A 4KWWA 1J5TA 3S42A 4O28A 1KBJA 3NL2A 2X1UA 2VFGA 4O54A 2VFHA 3MO7A 1MO0A 2CWNA 4KWVA 4IMCA 3RFAA 3QZEA 2TMDA 1B4KA 3UZ5A 2EF9A 3TJLA 3CU2A 3C2OA 4YLWA 4MJMA 4UCGA 3THAA 1I2OA 3T7VA 4IXHA 3L68A 3S1WA 3NOEA 4MYXA 1TV7A 1B3OA 3FEMA 2ZFAA 1H5YA 3W87A 1KFJA 4JYFA 4UTIA 3FOKA 2YZRA 5IBXC 2E6FA 4N2YA 1ZAHA 3OVRA 1D3GA 3W2JA 4Z1DA 1GEQA 4LWWA 2V5BA 3AJXA 2ZBTA 4Q4KA 2NV1A 1W31A 3HGOA 1C29A 3LBCA 3EX1A 3G1XA 4MIMA 5CZTA 3WK3A 1TPUA 2BX7A 5H2ZA 1P1XA 3VNDA 3G3DA 3QM3A 2OT1A 4Y9AA 1UUOA 3GNNA 1GJPA 4A3UA 1VH7A 2AAMA 3C6CA 3EKLA 2E68A 3TQ0A 5BW6A 2WKJA 2V2CA 4HNVA 1K7XA 3RLVA 1T96A 2ZZ4A 3CQ0A 3QH2A 3A9IA 1XBZA 3FS2A 4O52A 5EPDA 4IXXA 1TTJA 1SSDA 3TSDA 1TPC1 3W7HA 4JTGA 1TRDA 3HGJA 2OCZA 1FWSA 3NQEA 3T78A 4NT0A 3P80A 5HWJA 1JJKA 4MFDA 1ZAIA 1A5CA 3M44A 4MVAA 5AYXA 3BG9A 2ZRWA 2FPVA 3LXAA 3RK8A 1OF6A 1NVMA 4QM1A 2ZZ2A 1AMKA 4DQWA 1VPXA 5F2GA 3ZS4A 1VCFA 1S5TA 4O19A 1IIGA 3NPUA 3W2MA 3QF0A 3B0PA 4MOZA 2HTMA 2XFWA 1TRIA 2W0UA 3ATYA 1KLZA 1OHLA 2RDTA 2CLKA 3OEXA 2WO5A 3GDTA 3BPWA 1TREA 3B4UA 4W9TA 4LRSA 1FDZA 1SO4A 3BO9A 1SSGA 3W2NA 1FQ0A 4QISA 1VYPX 1LOSA 2GOUA 2Y63A 2X1SA 4IGHA 1G6CA 1S5VA 3QPYA 1QFEA 4Z08A 4AEOA 3BK0A 2TYSA 2E6YA 2BLEA 4UR7A 1TTQA 2YW4A 4AMAA 1M6JA 4O4VA 4UFJA 2HSAA 1FCUA 4I7WA 4ZQRA 3U8GA 3M43A 1EUNA 4J9JA 3W7EA 3QQ1A 4TIMA 3GZ3A 1Q6RA 4K38A 3LHWA 3G0XA 4UNLA 3KAOA 3M6YA 5CGQA 3SI9A 5CPMA 4LV9A 4XZ9A 4WQ6A 1TQJA 5HJLA 2ZZ5A 3WK2A 3PB2A 1XCFA 3M16A 1UCWA 2P10A 1FWRA 4GBUA 3SIZA 2C13A 3TC7A 1DVJA 5LSMA 5D05A 5D30A 4UTLA 4NNAA 3GYEA 4JTJA 1ZAJA 3WJSA 4FX6M 3SSJA 3W7DA 4M6VA 4N02A 1SQ7A 2ABBA 2Y85A 4UR8A 3O6DA 3VI2A 1K7EA 5HINA 1VQTA 1QDSA 3O07A 2Y70A 4PA8A 2J88A 2NXHA 1OFQA 1AG1O 1LROA 3LV6A 4IPIA 2QR6A 4AF0A 5FEWA 4YCPA 2CLFA 1DJNA 4JICA 3W70A 4A2RA 1G4SA 3W84A 2E77A 2ZA1A 4K8EA 1JCMP 1FDJA 3JR2A 1LM1A 3N2XA 1RQBA 5DELA 1V5XA 3A5FA 4BK9A 3CM4A 2BXVA 3RU6A 1IGSA 3P5YA 3L9CA 2I9EA 3HOJA 3W2LA 2YW3A 4S1FA 5AHIA 4NUWA 4UMBA 4PODA 3KRSA 5GVJA 1JULA 2VFIA 1OX4B 1SO5A 2QUUA 4B5NA 4MKNA 5CPLA 3W83A 1U5JA 1KM5A 4LU0A 2C0AA 4AVFA 4HPXA 4AB4A 2QCDB 2A7NA 3GLCA 5CPNA 2E5CA 4ZQPA 4U4MA 2Z2UA 1W5OA 3M5XA 5U7SA 2ISWA 3SR7A 3LLFA 3MBDA 1TTIA 4M19A 4LUJA 4PL2A 3GXNA 3W1UA 1X1ZA 2FFCA 3FYPA 1H61A 1OYAA 2R91A 3STCA 1R2TA 1NF0A 1ML1A 4ADTA 4UFIA 4O13A 2YX0A 4WOZA 3BW2A 4FIQA 5H91A 3OVQA 3Q2DA 4GFSA 3S5ZA 1F6PA 3EX6A 5FF3A 1EIXA 4N9BA 3LTYA 1Q6LA 4NX5A 4O12A 5K9DA 1VZWA 3NZRA 4LVAA 3MWAA 4WUIA 1F76A 4LW7A 4UNKA 5IBXA 3FKKA 4OT7A 4JEQA 1BWKA 2W79A 5C5YA 4FNPA 3B05A 4Q33A 4DELA 3HGRA 4ORMA 4LRTA 2GJLA 3IVUA 3IIXA 3NPVA 3A23A 3NQ7A 4IUOA 4K37A 1W3NA 2PCQA 3PUEA 1Q45A 3DFNA 3K30A 3S1UA 3UD6A 5J5DA 3G0SA 3STFA 3PBUA 3PG9A 4MLRA 1RQHA 4RR4A 1U83A 2ABAA 4K8HA 5ABTA 3E0IA 4M7TA 1YTKA 3N14A 1GYLA 1LZOA 4RCXA 2P1FA 1MXSA 5HMSA 1VLIA 3F4NA 1SW7A 4OBTA 2FLIA 3DKJA 1K8XA 1W5MA 1SO6A 1YYAA 2Y6ZA 3EXSA 4O1AA 4Y6GA 4UXDA 1R30A 3EX4A 4DEFA 2TPSA 1DV7A 3L2IA 1GPWA 4YXGA 3LHUA 4LVBA 3KHJA 1WBHA 3CPRA 3PULA 2Z1BA 3I7QA 2FB2A 3A21A 3NPXA 3GAKA 4NXKA 1I8JA 3ZR4A 1YPFA 4IX2A 1DBTA 4ZQOA 5CZSA 4IMEA 5KTLA 5I3KA 3HG4A 1LBLA 5TQLA 1RD5A 1VCVA 1JCXA 3T44A 3TKFA 2VEMA 3N34A 1HTIA 3GXPA 3TAKA 2V81A 4NXSA 4BWLA 4WOQA 2ZZ7A 5HUOA 1AK5A 1J2WA 4N6EA 5BNKA 3N3MA 3ZFHA 2ZZ6A 5F1UA 1RPXA 5CG7A 4BWLC 3NYZA 3LCXA 3TE9A 2YFOA 2G97A 2CU0A 2PURA 5TBOA 4JTTA 4LUIA 5G2IA 1CW2A 4ALDA 1XUZA 3ATZA 1LLWA 4E0CA 1N8FA 1OFAA 1JQVA 2A7PA 1AL8A 5D2YA 2RDUA 2TSYA 3IIPA 3KOFA 4L4LA 4UMCA 4O18A 4NJGA 4E2DA 1DQWA 2HMCA 3LOTA 4NJKA 2X30A 4LY8A 4O53A 4ML9A 3P62A 1OVDA 1KFEA 2YSWA 1H7PA 4Z0JA 2ZA2A 2ISVA 5HQEA 1OFPA 5SWUA 2FB3A 1W56A 2ZTJA 3MYPA 3LGEA 3IIVA 4M7SA 1JCJA 4FF7A 4ADUA 1WDWA 2GVJA 5D2VA 3W72A 5BMWA 3TR2A 4I7VA 3C2VA 3QQ0A 4NJJA 2H8XA 4H6KA 5F4XA 1QOQA 3EWYA 3G24A 1XDMA 5G2HA 4DO5A 1H1YA 1Z42A 2R8WA 3I68A 1YXCA 5KZDA 5FF0A 3C3NA 5FESA 1KW1A 1DL3A 4WJEA 4NJHA 4FHAA 4IOTA 3RLUA 1WXJA 3N19B 3LX9A 3UXAA 3GKAA 2E1DA 3EB2A 1TPH1 3PBYA 3KVLA 4JNMA 4JTLA 3PUOA 1T99A 5E0KA 1F05A 4RXGA 1G4TA 1H1ZA 2H3BA 2VXNA 3DENA 4UFLA 2J9XA 2XN2A 3LI1A 2V5LA 3D0CA 3LXBA 1HL2A 2HS6A 2A4AA 3INPA 3FYOA 2VFFA 2H3DA 3STEA 3KFTA 1AW2A 1VGAA 4DF2A 3LCLA 4NVTA 4AHPA 2PRHA 3W7CA 1T8XA 3C56A 5AOUA 1IF2A 1OFEA 4JGDA 4N4PA 5KINA 1W0MA 4EWND 3LLDA 4YWIA 4S2CA 1QR7A 3JS3A 5FEPA 1TPVA 3LHYA 2E6DA 3AO0A 3IGSA 3HO8A 2ISSA 2QF7A 1AW5A 4UFKA 2VENA 3TAOA 4RKAA 4K36A 1ICPA 3DKLA 3TSBA 4RJEA 3CB8A 4AHQA 5HWNA 2GVLA 1UBSA 3NQMA 4R33A 4JN6A 3GDRA 3E49A 5EA9A 3EWXA 4AHOA 1TJPA 2Z0IA 3FA5A 3ABOA 3L5AA 4JYEA 5F2IA 3C2RA 5BMXA 3PG8A 4KFNA 2YR1A 3SW6A 4M6PA 4UIOA 4O15A 1ADOA 4OWGA 4O4WA 2FPTA 3DZ1A 1KM4A 3DXIA 3QC3A 3LBMA 4UTUA 1ZCOA 4LS2A 4Z1BA 3O63A 1KM2A 3W3OA 5LNVA 1AL7A 1C9DA 3R13A 3W2UA 3NM3A 3P74A 2FPYA 2ZTKA 2NXGA 2QJHA 5LHFA 3IGXA 4O10A 3UWZA 2X2GA 1EUAA 1ME8A 1A5SA 4EF8A 7TIMA 1F2JA 4WY0B 1EP1A 5D2XA 5CKSA 3TW7A 3NZ1A 2Y62A 4N6FA 5A5WA 2DZVA 2QCMA 4EIVA 5C6MA 4GNJA 1D9EA 2ZQ0A 1DOSA 4NX0A 5DY3A 3ZWSA 1ZFJA 2V2DA 4JDYA 1QAPA 1WYIA 3W76A 4AWSA 3EXRA 1SFLA 1PCKA 3MP4A 1B9BA 5T26A 1FXPA 1O5KA 2ATSA 1MEHA 3EXTA 2A7RA 1ZENA 1BEUA 4DPQA 3M5VA 4ONVA 5I3GA 3C2EA 3CLMA 5D32A 4EOUA 1XXXA 1H7XA 4XBKA 3BVJA 3OHIA 4GUHA 4OGZA 1F7BA 1VHNA 4P61A 5L9FA 3GXTA 1SW3A 2WOQA 5C54A 3DAQA 2NXIA 5EKYA 1TIMA 2NUXA 2OX1A 2ATMA 4A22A 3IRDA 5HR6A 1SO3A 1I4NA 2EPHA 3IV3A 3S1XA 2V30A 4ICNA 3P61A 1N7KA 3UQNA 1YPIA 2ZZ3A 4NJIA 3TSMA 3TDFA 3W88A 4GC4A 3VKJA 3HJZA 4O1CA 3A5VA 1XUUA 2Y7FA 4K6AA 1H51A 4HPJA 4WXYA 3EWWA 1THFD 2YXGA 1VRDA 4UTHA 4EVZA 3TROA 3CC1A 2DJXA 3KRUA 3MBFA 3KVMA 3I7RA 1NEYA 2P0OA 2Q8ZA 4LS0A 2QAPA 3DFQA 4NU7A 1QPNA 3B0VC 1P4CA 4JTIA 3W2KA 5D09A 3SECA 2WV8A 3W1TA 3DHFA 3O15A 5IM51 1PE1A 3M7WA 3TV8A 3WJYA 3BW4A 1YDOA 3LERA 1VC4A 4ZQCA 1A50A 4MY8A 3ABRA 1VCGA 2TRSA 3JRKA 3M9YA 3BARA 3IEBA 3MI6A 5D02A 2CW6A 5A8GA 4JY9A 4UUIA 4OV4A 3VFLA 2VOMA 1TJRA 5FEXA 4JXCA 3TFXA 3NVTA 3TMQA 1KV5A 3DFPA 3TXVA 4N9CA 1I2QA 1TYGA 4FNRA 1BWLA 3W7PA 4AAJA 5LNRA 1IXNA 1LOLA 3IGUA 3EWUA 4Q32A 5CPOA 4CQAA 1OFOA 5CZJA 2QJGA 3F1QA 5DCBA 3RMJA 6TIMA 1OABA 2CZFA 4JTSA 4TR9A 1I45A 3WK1A 1A5BA 1CX9A 4OQVA 4QSHA 2QCFA 1HFBA 5LGXA 4JTHA 3W1NA 2C14A 3FFSA 1JRBA 5D04C 1MSSA 3CIWA 3BW3A 4O0ZA 5AB3A 5I3HA 4O17A 1O95A 2QUVA 3L5MA 1EA0A 3TUUA 3PC0A 3W7MA 3LRMA 4ZQNA 1QPOA 2NLIA 4FNTA 3BLFA 3W7NA 3EWBX 4S2BA 3N9RA 5G1YA 3LCHA 3T55A 2RH9A 2A0NA 2JK2A 1KTCA 1IIHA 2V8ZA 1G4EA 1N55A 3E9AA 2QCDA 2YFNA 5KZEA 3QMTA 1R47A 1YDNA 2C15A 5LGZA 1X7FA 2C19A 4ZMGA 3WJZA 1OX4A 3MP5A 3HB9A 3NL3A 4JD4A 3W1PA 4MFEA 5LNUA 2B0MA 2QCEA 3KX6A 3OBKA 1X1OA 1WBJA 1SZGA 4JS3A 4WX2A 3G1HA 3M47A 4RV8A 4GUJA 1EB3A 4HKPA 4KFPA 2WPBA 2KZHA 3FJLA 2WNZA 1RVGA 3DFOA 2RFGA 5AFDA 1B57A 2C6QA 4HNTA 4O50A 3QYQA 3UWQA 3HPXA 3W1LA 1GQNA 1GVSA 4JIQA 3HG5A 3BLIA 4GXMA 4JTKA 4JX6A 4LVFA 2FIQA 5F4SA 2ZDRA 1EEPA 1HO4A 1IXPA 1M7OA 4AWUA 4PC8A 3W1AA 3W23A 1EX5A 1JCNA 2GUUA 2QKFA 4L4MA 2WSYA 2XN1A 1WAUA 3SFKA 2ZZ1A 1GTEA 1F5ZA 3PAJA 3O05A 4MY1A 4UMAA 2YYUA 4UFMA 3QMRA 2O7SA 3KXQA 3MHFA 3W1RA 3C2FA 3W85A 3RNDA 2GQ8A 3P7YA 1JQXA 5G1TA 2A6NA 1I2RA 3DH7A 1XL9A 4BI5A 3GIYA 1OFBA 2Y89A 1K03A 5K9XA 1I2PA 3R5EA 3G8RA 1G69A 3NQVA 3SJ3A 3L67A 3G1FA 2EKCA 4CNNA 5G4EA 1KLYA 3GR8A 5LHEA 2GQAA 4ORIA 3F4WA 1WV2A 2Y7GA 4AH7A 4E38A 3BV4A 1KFKA 4WZHA 4GUGA 4Z1CA 4UTTC 4ZZ9A 1UASA 2CLMA 1FCQA 3UYCA 1FWTA 3VCRA 4OHQA 1X8FA 3UPWA 3TXZA 5DY2A 5DBTA 1X6UA 3LCFA 1PCWA 5HUPA 1FXQA 2RKXA 2BWGA 3UWWA 2DZWA 2DZTA 2H90A 2A2IA 2QUTA 1P5BA 4JX5A 3UPBA 2C1HA 2J9ZA 4Y96A 4UC5A 2WNQA 2YYTA 5CSRA 2Q3RA 1CI1A 2V9DA 3S1VA 5E1QA 4RZ4A 1BTMA 5EY5A 2GJNA 2YGYA 3KVKA 1MZHA 5CZ0A 5AHLA 4N4QA 5FI8A 1EWEA 2CFFA 1P0NA 4DF0A 2Z6IA 4XBSA 1Q6QA 1H7WA 4DO6A 1TCDA 4Y8FA 2C18A 2BSLA 1GVQA 1W5NA 2I1OA 1KFLA 1TB3A 1KM1A 3IVSA 3W7KA 3P8JA 3GDLA 3MP3A 4IX0A 2QCNA 3QMSA 4TMBA 1KTNA 3G18A 2OT0A 3LCWA 1QCWA 3UZJA 2R94A 4HNUA 4LOCA 1OYCA 2A5HA 3G1VA 1ALDA 4O57A 2Q8LA 2DP3A 1VJIA 1KV8A 4PL1A 3HGSA 3H55A 3NQ8A 4FX7A 3W86A 3GDKA 1QPRA 1KTBA 5AHEA 4QITA 1Z48A 3QJAA 4MPQA 2J27A 3FKRA 3TW6A 1C8VA 1L9WA 1QO2A 3IVTA 3Q94A 2PE4A 2QEZA 5I3IA 1HG3A 3CEUA 1GOXA 5L6UA 2CLOA 1GG1A 1SPQA 3WJWA 2CZ5A 3G8EA 3V75A 5AC6A 3PF3A 3LTSA 1LLZA 3DFSA 2RDWA 1I2NA 1PHWA 1SW0A 1ICSA 1K8ZA 1Y0EA 4H4IA 3QSTA 3TNOA 1MEIA 1OYBA 4LNYA 3P82A 4I9AA 4N9EA 2F84A 3UXDA 5K2ZA 2DZUA 1GVFA 3C61A 3THQA 3L0NA 1FWNA 5HWMA 5G4WA 4XQ6A 1LRQA 5LKYA 1O60A 4XTIA 2CLHA 3G1AA 2JGQA 2DZXA 3P67A 4GUIA 3W7LA 4LS1A 3W7GA 4HN4A 3O06A 1VHCA 3NGJA 3NG3A 3G3MA 1KBIA 3M1ZA 3B03A 2QCCA 1G4PA 3CTLA 1LORA 5TIMA 2QCHA 4MUZA 1OJXA 5DLCA 3TU9A 1AW1A 3NQGA 2JKEA 1LBFA 1TPFA 4TO8A 1XBXA 3EX3A 4BI6A 2NX3A 4LC8A 1WOBA 3BLEA 3ABQA 1EWDA 1JCLA 2ZRVA 3I6RA 3NA8A 5G2WA 2WSQA 2VEPA 3ZWTA 3HPSA 2GPTA 4CQ9A 2B7QA 5HR7A 3UWUA 3BG5A 1O4UA 1OX6A 4JYDA 1SZFA 4BI7A 4ZL1A 4XKYA 5FF2A 1FWWA 3CEPA 1WOAA 1K7FA 2RHGA 1DHPA 1OFDA 4WY0A 4XUGA 1XM3A 3LDVA 2J9YA 3B04A 3E12A 2LLEA 5BOOA 3A24A 5KMYA 2NX1A 2PRLA 4CNPA 2NWRA 4Z0SA 2X1RA 3C4UA 4WY0F 5AHMA 1W3TA 3U6WA 3NAVA 1J4EA 3G1DA 1W3IA 3LB0A 1PVNA 1TMHA 1XC4A 5C55A 1WQ5A 4A21A 3GAYA 4UTKA 5CSSA 5F2MA 2V2HA 3UY8A 3P81A 4QNEA 3LM7A 4IQLA 1PHQA 1OG0A 1QNVA 1W8SA 2DZSA 4YMZA 4UTMA 4MLJA 1L6WA 3PM6A 3FIGA 5F1VA 1Z41A 3G22A 3MYOA 3T40A 1YLVA 3NL5A 4CCCA 5HNRA 3NQAA 2PRMA 4FX8A 5G5IA 1GWJA 3L0KA 1D3HA 1IXQA 1H60A 3W7OA 2E5DA 4ZQMA 3R89A 4N9DA 4HHPA 3PY2A
chains in the Genus database with same CATH superfamily
2QJIA 1E1CB 1M5WA 1IWPA 1SFJA 3BLDA 2OX4A 5I3JA 1J5SA 1B4EA 1FHDA 1MUWA 1FX6A 5EB8A 2A6LA 3EAUA 3M0VA 1FBAA 2NV9A 2XIQA 2B7OA 4PCTA 4HB7A 3MDWA 2IPWA 3VINA 2BZNA 1JDFA 1EEXA 3QLDA 4HZ6A 1QJWA 4O1EA 1FUYA 3DHPA 4LYRA 4LAKA 5HXMA 2CZEA 5CZKA 3KS5A 1X6LA 5AYIA 4QDMA 3WDQA 1CWYA 3BH4A 3JUGA 1SUXA 1EBHA 3UU0A 2WJFA 1LDCA 2GJXA 4XAPA 4H2CA 4BQ4A 5I06A 3WMSA 4HIBA 5GJPA 4E8CA 1GTHA 4QE4A 3KWSA 3W29A 1R46A 4BS0A 4E2BA 4IJBA 3E96A 4KKXA 4GUFA 4JKKA 4I9JA 3LG3A 1YXDA 2QQ6A 1LG2A 2VVSA 2WMJA 3K1DA 3PZGA 1RHCA 3QFWA 2AGKA 1NAL1 3CQKA 4IL0A 4I5XA 3CPUA 3W1QA 5DX7A 3IIOA 4H00A 4OTKA 1BSLA 1CCWB 3LRKA 3N15A 4C6JA 4U2ZA 1KM0A 2FTPA 1M3UA 4CD4A 3HURA 3VDAA 3TQKA 4AQLA 1V6YA 4IIDA 4W7UA 3KZSA 3CQJA 1UJPA 4Z2GA 1JDEA 4FXSA 3EKZA 3TN5A 1KBLA 1J93A 1HJSA 4GBDA 1ONRA 4LBUA 5FAJA 1LOQA 4NNCA 4PTVA 4CD8A 3H2CA 3TA6A 1AQHA 4DZ5A 2PWEA 3AIBA 3WF4A 1E0XA 1NDVA 4POCA 2OEKA 4RDWA 4GIAA 2VURA 3PR2A 2NSXA 4YHGA 4MKVA 3SZ8A 3O16A 1XFCA 1UWTA 3UVIA 1FCBA 4MZYA 1QASA 1JZ2A 2YCIX 5T91A 4BZYA 2OSXA 3SDOA 2B31A 5LZLA 4RXFA 2ZVRA 4FNUA 2C3ZA 1JCTA 3DI1A 4GVIA 4IMAA 4BF5A 1ITUA 3AMKA 2W27A 4AZCB 2DZPA 4M29A 5CSUA 3A22A 1REQA 4OU1A 4JN8A 4MG4A 4NKCA 2VFDA 3NWRA 4ROQA 4IMFA 1B3ZA 1DIEA 3MJMA 2D3NA 4B5XA 4DBDA 3FN9A 5KITA 2HNEA 1U5HA 2JKPA 4XUYA 2ZRZA 1NF7A 3GU9A 5M2FX 1JPDX 2Q02A 2NQZA 3JU2A 3SCRA 1H4PA 3CWNA 1UD6A 4QDPA 2XSXA 3AUJA 4LAOA 1R8LA 3LTPA 1HX0A 2X2YA 2I14A 1VLWA 5A6LA 1SR9A 4MWAE 5I78A 2OMAA 2JE8A 1LYXA 2O7QA 3TH6A 4HMCA 3MHGA 3I65A 1EGVA 1OC6A 3BV7A 1JI2A 2J66A 3GDMA 3T0BA 3CB3A 5FEZA 4CU6A 2YCKX 4GPNA 3VOHA 2TODA 4UQ9A 1IZCA 3H2EA 3W81A 4C7FA 3QOMA 3MUIA 3MUCA 5I2UA 5KZMA 1ME7A 3QSRA 4LQ1A 4RK8A 5A6KA 4LUTA 2AMGA 1R2SA 4YWSA 1VFOA 4R27A 3ITCA 3FGCB 2NUWA 3C52A 1J2BA 4FNQA 3KCLA 5CJMA 4TU1A 3CZJA 4Y7EA 1QI4A 3ARUA 3NGFA 2VZSA 1E9IA 2NT1A 4XZWA 1ZALA 5FL0A 1NFBA 4O0KA 2F9RA 3CO4A 5EBUA 4ZOBA 3FK4A 3FJ6A 5D9PA 5AN7A 4Z1AA 3CIVA 3VD3A 1L2UA 2PC8A 5M17A 3RRAA 2YIHA 3N18A 4WHBA 4IQDA 4RLIA 5T9BG 4ZSTA 1U1UA 1TPB1 3S8HA 1OIFA 3UNDA 3UGVA 2PDHA 1EHAA 1PIIA 1K70A 3W27A 4X2RA 3G1YA 2DU2A 3BGGA 4OBRA 5K4XA 1EP2A 2ZVIA 1B3WA 5EL1A 4M1BA 5KSWA 3RM4A 4O14A 1R3WA 9RUBA 3D46A 5U4NA 4I6VA 1F6KA 1F73A 2B4GA 1S3HA 2BXZA 1EGZA 2JF7A 2DT1A 5REQA 3UPMA 1HUVA 1KXHA 4DZHA 2OLAA 1CECA 4FLOA 5ABFA 2PDWA 2XVNA 1P6BA 4Q8MA 2YA1A 4WR3A 2BOFX 2PODA 1IR2A 2Y61A 1J8VA 1PKNA 1R3RA 2XYLA 4JY8A 1EJRC 5HMEA 3R8RA 5EMYA 2CZDA 3LHVA 2EGZA 1B3XA 2CBIA 4TX9A 4DZIA 1RPKA 2P0IA 4RUBA 3WNMA 3T2PA 4NAFB 2XHYA 3PANA 3KRZA 1KFWA 2WAGA 4IPJA 1PWLA 3AIEA 1PL9A 4FI4A 1GQKA 2YL9A 1AA1B 2PC4A 4X9YA 3S2MA 2G5WA 3P5ZA 1YNQA 2Y7EA 1OK4A 3PBWA 2YBVA 3KDNA 2QYGA 1JCYA 4QXIA 5M1TA 3GIQA 3L4VA 4ZO8A 4YYCA 3DHDA 3URAA 3APYA 3L0GA 1KFBA 2PDGA 1QHPA 2E09A 2CLLA 4S23A 1H49A 3FX4A 4LUSA 1J10A 3GB6A 3QW4B 4ADSA 1CENA 4IMDA 4R7JA 1EO7A 2VM8A 3WJXA 3LCIA 1JRCA 2VRQA 1XIMA 1DKWA 3GDBA 3WO8A 2YPIA 5CPTA 3V36A 3S3GA 2ASHA 1K6WA 2J8FA 2OJPA 3UNTA 3NXFA 3NNTA 1OM0A 1WKFA 1UB3A 1JNEA 3H53A 4US5A 4D6DA 2PGFA 4WXZA 3CHVA 3M0XA 2A3AA 3GH7A 1B1YA 3QR1A 4ZFCA 5LXEA 1YEYA 2HS8A 1RQEA 1WKYA 3S2JA 1OINA 2ZICA 2VX4A 2O9TA 1Z3NA 5DCEA 4DY1A 2Z26A 4S3DA 1XYLA 2ZXQA 1QT1A 4DJDD 3DGRA 2W66A 4D6GA 3LV5A 5K3VA 1PIFA 1VFUA 3NL2A 3MSDA 4EAMA 4RDVA 1ZTVA 4O54A 2CWNA 4IPNB 4IMCA 1E0TA 3WLKX 3UZ5A 4YLWA 3WLLA 1XSKA 4N7QA 3MUZ1 3ME3A 4MWAB 8XIAA 1ZQ5A 3GG8A 4C6KA 3NOEA 4MYXA 1B3OA 4IICA 2WC3A 1KFJA 4UTIA 4N2YA 2O4MA 3E74A 1CLKA 4DJFD 3MY9A 3KHDA 3PPHA 1CNVA 3HGOA 3V35A 1JAEA 3EX1A 3G1XA 1V6TA 4G9PA 2VZUA 3VIHA 1PZ1A 1UUOA 2ZUNA 1TJ0A 3V0SA 1E0VA 4LUSB 5JU6A 2CHNA 2NQ5A 2FYMA 4F0KA 2PGEA 4JFSA 3UEQA 3KL3A 4IIBA 3ZQ9A 4DJFA 1K7XA 3RLVA 2ZX9A 1T96A 4WRHA 2ZZ4A 4O52A 2PA6A 3FS2A 3T07A 4F2TA 3LK6A 1TTJA 3CH0A 4J2MA 1TPC1 4HJWA 3T2QA 2OCZA 3FSUA 5GNZA 1AJ0A 1KGUA 4AU0A 4MFDA 4L7ZA 4QCFA 3B8IA 2FPVA 3REQA 1NVMA 1AMKA 4DQWA 5LA0A 4RE0A 1FP9A 4JQAA 4MOZA 2HTMA 2JEQA 4J35A 5E09A 1XIIA 2RDTA 3CZGA 4U10A 2WMHA 4FSAA 3GDTA 3BPWA 2ICSA 5TNVA 2CXGA 1W3JA 2OFJA 4LRSA 2FHFA 3LGGA 3W2NA 3VGBA 1XH2A 2YLLA 1VYPX 2GOUA 2Y63A 2E1WA 1IZKA 4BEQA 3L4WA 5BWAA 1S5VA 1V79A 2QHAA 3PBMA 3H24A 4KQNA 3C0SA 4QLLA 1RJRA 4N42A 4AMAA 5AKQA 3WLPA 3SIMA 3AI0A 4GGHA 3UFYA 4FXFA 4ZQRA 1PTAA 3M43A 1P7TA 2CIPA 2PDMA 4Q22A 3VIPA 4TIMA 4K38A 3U2CA 2Q8XA 5C9ZA 1ITQA 4UNLA 3SI9A 3SSZA 4CQBA 3C0QA 3ITYA 2NVDA 1G5AA 3S4TA 3RGTA 2WCGA 4QDWA 1UCWA 2P10A 5XIAA 3MA8A 4KMQA 3SUUA 4D1JA 1FWRA 3SIZA 4GI6A 1DVJA 1G01A 5D05A 4UTLA 3GYEA 2XG9A 4JTJA 1ZAJA 3WJSA 3WLIA 1SQ7A 3ZJ6A 3VOFA 1E4LA 2WM0A 3ENLA 1XD0A 3IK4A 3THDA 5HINA 1QDSA 3O07A 4L9XA 4UQDA 3GG7A 2NXHA 3PBGA 1OFQA 1AG1O 1DWIM 3LV6A 2O92A 1P1MA 1G4SA 4JPGA 2G3IA 2IMRA 2ZA1A 4K8EA 1JCMP 3IJ7A 5DELA 1RCQA 3DG7A 2V6AA 1H11A 3RU6A 1X97A 1KCLA 3GBDA 3L9CA 2UY5A 5AHIA 1XCXA 4PTXA 2QUUA 3T9PA 4NYUA 5CPLA 1Q65A 1F9CA 5HNTA 1FWAC 2UBPC 3QR0A 3N2BA 5C9WA 4ZQPA 4U4MA 2D0HA 2ISWA 4Q4OA 1MRQA 3MBDA 1TTIA 5CC5A 2FTWA 5KEZA 4LUJA 4IH3A 3TW9A 3FYPA 2EPMX 4DBUA 3BDKA 4DJEA 4ZOCA 2IPJA 2BVTA 3B8UA 1R2TA 3CAVA 4UFIA 4WOZA 3GVVA 3OVQA 1NU5A 3VUPA 1JPKA 1F76A 1L0PA 3N2OA 1V3MA 5DANA 3GS6A 3WQDA 3KZPA 1K9FA 3HGRA 4ORMA 2XZ7A 4ZEPA 2PLJA 2V5DA 7REQB 3QTPA 4DJFC 1W1TA 2P8CA 4K37A 1MRAA 4D6HA 1JYXA 5D9OA 4FOJA 3RX4A 3S1UA 3G0SA 3STFA 4NZCA 4ZA0A 2D1ZA 1CYGA 1AFSA 5I07A 4KT2A 4NI3A 5DFAA 2XVLA 4H6QA 1LZOA 1E1CA 5DMMA 4D71A 1G94A 1AH3A 1VLIA 3IAQA 5FJTA 3DKJA 1K8XA 4Y6GA 2J74A 3K4DA 3EX4A 3N25A 4A3YA 1TWZA 3AZSA 2XJ7A 1US0A 1JXKA 2PCEA 2ON3A 2GYIA 3I7QA 1R9ZA 4JCMA 4HOXA 3GAKA 1U33A 1YPFA 1BYDA 4J27A 4HP5A 2HVOA 4K8GA 3RIKA 3MPGA 4P7NA 3TKFA 1KBKA 4BWLA 4H8VA 1C9WA 4E4PA 4N6EA 3BGAA 6CGTA 3ZFHA 1RPXA 2RJGA 1JDAA 2E67A 4JOMA 2CU0A 2PURA 1F3WA 3F5LA 3URQA 4ALDA 2QGYA 4MMWA 1DWAM 4E0CA 1N8FA 1OFAA 4LAMA 2V5KA 4KEZA 1XIBA 3ZJKA 1IHIA 3C86A 2YBTA 1TR1A 2RDUA 4B2DD 3IIPA 1V6XA 4L4LA 3KOWA 3R79A 2HMCA 2JFEX 3RCYA 4EPDC 3L7RA 4NASA 2RUSA 4LSBA 3P62A 1OVDA 3GD6A 2YSWA 2BFGA 2ZA2A 5I6SA 4A8RA 1W56A 3TN3A 2ZTJA 4AIEA 2V67A 4IG2B 3CUHA 3EB4A 3PPFA 1JCJA 1JPMA 2YL5A 5D2VA 4S3CA 1O12A 5FAGA 5BMWA 3C2VA 4NJJA 1FWGC 1Q7MA 2V3GA 1XDMA 1Z42A 5I5RA 4UQCA 1W8GA 5FF0A 1TE1A 4JIRA 1V03A 1V08A 1KW1A 1DL3A 4HK7A 4WJEA 4NJHA 4FHAA 4IOTA 1WXJA 3N19B 3H7RA 1XYBA 1RLDA 3EB2A 4H2HA 5BZAA 3KVLA 4JNMA 4Y9PA 5E0KA 4W7VA 1H1ZA 4LH8A 3VNLA 2XN2A 4FZIA 3LI1A 3D47A 4H41A 2OELA 2HS6A 2A4AA 3FYOA 3O7UA 2VFFA 2H3DA 3STEA 1AW2A 3D3AA 3SY8A 2YBUA 5E5CA 4NVTA 1OFEA 1YBQB 5KINA 3A3HA 1LQ2A 3LLDA 4YWIA 1TPVA 2DH2A 3IGSA 4KRUA 1R85A 3WQGA 4UFKA 3DKLA 3I4EA 2O4QA 3G6MA 4G6CA 5HWNA 1UBSA 2YB1A 5A6BD 1XYAA 2ZE3A 3BCJA 4JN6A 3GDRA 1PPIA 1MZRA 3EWXA 5I7GA 4AHOA 3L5AA 3ABOA 5BMXA 3C2RA 3HFYA 3SW6A 4M6PA 1ADOA 2VL4A 2ALRA 1QNQA 3AHVA 4LGXA 1KM4A 5H8UA 1H0IA 4W8AA 1BQCA 4ERIA 4UTUA 1XYCA 1X7IA 4C6LA 1ESWA 1AL7A 1C9DA 3LN3A 2ZTKA 4IJRA 3VFCA 2NXGA 4MNLA 3UWZA 2PP3A 2X2GA 2I5GA 4EKJA 1D8CA 3G2GA 1GNXA 2XGIA 1A5SA 4AX6A 1SMAA 1EP1A 1KXQA 3NZ1A 2Y62A 1XLDA 1LG1A 4EIVA 1Q4NX 5EMMA 4NX0A 2QUMA 1V0MA 1I0DA 3MANA 1JEZA 1WYIA 2AQVA 1OC5A 3W76A 1TA3A 1OT2A 1ONWA 1PCKA 3MP4A 1B9BA 1O5KA 3AROA 2A7RA 2GDUA 4ONVA 3ITGA 3HTWA 2FMOA 1WO2A 2VD9A 3IUIA 4QJ3B 3CUIA 4C7GA 1M53A 1F7BA 2G3FA 3R25A 4HZMA 5L9FA 2DPEA 1SW3A 1J0YA 3TEVA 2OZTA 2NXIA 1ADSA 1YNYA 3VKCA 4I9TA 1C8QA 5I0DA 4XG1A 2UY2A 4GYPA 3IV3A 5JBFA 4EPBC 1TVLA 2QT3A 3P61A 3W88A 3TSMA 3TDFA 3HJZA 4AZBA 3A5VA 2XDFA 4J3XA 2CERA 3B8SA 4WXYA 3EWWA 4UTHA 4GIYA 1E5JA 4EVZA 4DM1A 1MVYA 3WYZA 2P0OA 3AJ7A 4LS0A 2QAPA 4GZIA 1PKYA 3LPPA 4PMRA 2WWDA 4DXXA 3AICA 2DVUA 4KS0A 4MY8A 2BHYA 4C1NB 6REQA 5DF0A 4WGHA 2Y8UA 2BOEX 5D02A 4D72A 3A64A 4YYFA 4GJJA 3I6EA 4N9CA 1GOQA 2HK1A 2E25A 1WDRA 1IXNA 4H6EA 3IGUA 3A4JA 3OVGA 3UVAA 3SCVA 5DCBA 2VCAA 4DWSC 2CZFA 4DRSA 2ZC1A 2WHJA 2ANUA 2NT0A 1PYFA 3ZR5A 2WNWA 4PCPA 2FDMA 4E8GA 1XRFA 3W1NA 2AKMA 3W00A 3MMDA 5D04C 4R7WA 5AB3A 1HJXA 5I3HA 1EA0A 3ZLFA 4W88A 4ZQNA 3BLFA 3EWBX 1B54A 4S2BA 1NWRA 2CLPA 2A0NA 1AJ2A 4NRSA 4ZR8A 4RNHA 2EBNA 1G4EA 4HK6A 4MADA 2YFNA 4XD4A 4WK9A 1B2YA 2SFPA 1X7FA 3LMYA 4Z2JA 1W3KA 1IT8A 2XISA 1ZJHA 2QCEA 3KX6A 3OBKA 4LJ3A 2OQHA 1J18A 4NHVA 2F2KA 2YA2A 3ES8A 4RV8A 1AJZA 4U31A 2EG7A 2WNZA 2RFGA 3WH9A 4IFKA 2AL1A 2C6QA 4GABA 3LGDA 4O50A 1TMLA 1LJYA 3HPXA 3RILA 1J96A 1GQNA 4CGTA 4UQEA 2E4TA 1Q6EA 2PDPA 4GXMA 3G77A 4LVFA 4HMDA 1M7OA 4XD6A 3VTRA 2WSYA 2DVTA 2CHOA 4EK7A 4UMAA 2YYUA 3KXQA 2I9UA 2PS2A 2DUAA 3FEQA 1DJWA 3C2FA 4DI9A 4PCNA 1TR9A 2A6NA 1I2RA 3GXMA 1FWCC 1DXFA 1XL9A 3AYSA 4A8LA 4BI5A 4GK8A 3TYCA 3A3XA 5K9XA 1I2PA 3OLEA 4UQAA 2PTZA 3R5EA 4OJYA 3G8RA 3NQVA 3SJ3A 5ABFB 3SJNA 4XZNX 1BYAA 4XVDA 2O56A 3BV4A 1KFKA 1AD4A 3ARSA 1MW2A 4Z1CA 1UASA 2CLMA 1YHTA 4KW2A 4EANA 3WBEA 5DY2A 1DIOA 3U57A 3LCFA 2OOFA 2BWGA 3UWWA 4C6QA 2A2IA 4JX5A 1P5BA 5IFPA 3W24A 3UPBA 3UW6A 4P7OA 4LB3A 2HDJA 4I9MA 2YYTA 1SJCA 1CDGA 3BZJA 2V9DA 4URIA 5E1QA 5IDIA 3W02A 2WVTA 5EY5A 1MZHA 1K4GA 3OYXA 4Y9NA 5FI8A 2G37A 1E5NA 4W86A 3WDRA 4GMEA 3A3WA 2Z6IA 4XBSA 1Q6QA 5CBIA 2X41A 2Q6ZA 4DO6A 2Z2AA 3AS0A 4L1GA 2BSLA 1GVQA 1Y5XA 3CT2A 3ZOAA 1KFLA 1TB3A 1KM1A 4G8TA 3W7KA 3GDLA 3P8JA 3NXLA 3QMSA 1UWSA 1KTNA 5HPOA 3G18A 4GIRA 2A5HA 4H9VA 3G1VA 5CAKA 1JZ7A 3U7VA 3H55A 3GDKA 1KTBA 3H12A 4QITA 3QJAA 3NFUA 3H70A 4WKAA 5I3IA 1EDQA 3V75A 3UJSA 5AC6A 2D2GA 1EF3A 3KP1A 1TG7A 3VMOA 2RDWA 1XRSA 1I2NA 3VDCA 1SW0A 1Y0EA 2YL8A 3QSTA 1J0ZA 4HVXA 3E2QA 4HPGA 5JH2A 4FR1A 1LWIA 4RW3A 2REQA 2OG9A 3CPGA 3WCZA 1V4YA 4U33A 1E72M 2F84A 1VFFA 4XAFA 2DZUA 3C61A 1J0HA 4RZBA 2X05A 1LRQA 3BAKA 2DZXA 2HZGA 1UR1A 4LS1A 2HWGA 4F48A 1VPYA 4GXWA 2ZWZA 3G3MA 1KBIA 2BNJA 3B03A 2QCCA 1E6XM 2I17A 2XSBA 3LEPA 2QCHA 4HGXA 1UWAA 1TZ9A 4MUZA 3VKKA 3GW0A 1BFNA 1O5QA 1A5OC 3DOPA 3GU1A 1MMFA 5CJ5A 3WELA 3A4XA 3BSHA 4BI6A 4LC8A 1ADDA 3NSNA 3TLQA 1JCLA 4UOQA 3I6RA 3W0KA 3WQ4A 1UOZA 5G2WA 3QV9A 5GNXA 1FKXA 4CQ9A 3ARXA 4IQJA 1O4UA 1OX6A 4JYDA 4XKYA 3AMGA 3V16A 4I8DA 3E0VA 3E2SA 3RM9A 3UA4A 1WB0A 3ARTA 1K7FA 1TA3B 4HU8A 5E0CA 1WUEA 3PJUA 1XM3A 4BEUA 1QPKA 1TZ7A 3DDMA 3GHRA 3GTNA 5KMYA 2NX1A 3KCJA 1W9DM 2PRLA 1Z7AA 4CNPA 3OQ8A 2X1RA 3DESA 4JFVA 4WKHA 1W3TA 2PLMA 2VUNA 4LCRA 1PVNA 1UR4A 4H8UA 1LWJA 4R7OA 4L1XA 4GQBA 4G7FA 2ACQA 4I6KA 3NQBA 3KBVA 1OEPA 3P81A 3MZ2A 3DECA 4LF2A 3KOXA 3M64A 1OG0A 2DZSA 3ERPA 1E73M 1OGBA 3VGFA 1G1YA 1E70M 5F1VA 3VC5A 3KBMA 3PZVA 3MYOA 3WD4A 3AYRA 1R3SA 3NL5A 4V28A 2VX6A 1PX8A 1W1VA 1PEZA 2PTDA 3W7OA 2QXWA 3BLLA 4R3UA 3N6HA 3O0KA 4YVXA 3VIFA 3SM0A 1JL8A 1OG6A 2GVGA 1V7YA 4AZCA 4NZFA 1L2QA 3I3EA 1R9XA 3QPEA 3B8DA 3THUA 4AUBA 3S9YA 1E3XA 3PZNA 2ZA3A 2FGBA 3CUXA 2F6KA 1Q6OA 1GVYA 1Q7ZA 3R6IA 5C7VA 3MV01 4JDBA 5AYZA 3WNNA 4PB3A 3DBPA 4PN2A 2QCGA 3WQWA 3LSCA 1NSJA 2O9RA 4AZ5A 3BWWA 3URBA 3NDOA 1O94A 3HU7A 2INEA 3U5YA 3KVJA 2D73A 5AZ1A 1EZWA 1VEPA 3QC0A 4FXRA 4RZ6A 2D2HA 4PFMA 1KA9F 1MFUA 1PTDA 2E0PA 3IJ6A 3W71A 4KRTA 1G7VA 2RDXA 1R3YA 1AH4A 4QP0A 2NQHA 4FOUA 2BASA 4CCDA 2OO6A 1RVKA 4QJ1A 5IXEA 2G95A 2NZLA 4M6UA 1V3JA 1ICQA 3PN8A 5ECUA 1UP0A 3Q58A 2VRKA 3STGA 4I3GA 5RUBA 3PJTA 4M5PA 4K7YA 1YRRA 4FA3A 1X1NA 4O8RA 3TLLA 2R82A 4DAFA 4RZ5A 1L6YA 1RBLA 1V0KA 3M41A 4FNSA 4C6OA 5F7UA 2BGSA 2VZOA 3A4AA 4TQTA 3NVDA 1UJQA 3B0UX 2WZTA 1EP3A 1ISZA 2PF8A 3EPMA 3PVFA 5E9XA 1UIOA 5D2WA 2XH4A 2AQWA 1V6VA 4XZBA 4FO4A 5IFTA 2JIWA 1FWFC 3NSXA 1QWGA 2WMGA 1V51A 4Q6XA 3DFYA 2ISDA 4BQ2A 3EX2A 1OK6A 1TWWA 4GXPA 1BRLB 3DU0A 3L4YA 1KRAC 2PWUA 2BOGX 5CEWA 3TTEA 3W7RA 1LBMA 4G7EA 2YZ5A 1A53A 3TMLA 2QDGA 1LP6A 4ZOEA 4PMUA 2XN0A 4E6MA 5ECVA 3UY7A 3TJ4A 4JHOA 5EFDA 1SU5A 2Y4SA 3B3DA 3MI3A 3TX9A 2MNRA 3P84A 3TCEA 3AYVA 4HTBA 1R6WA 3CWOX 3HM7A 3R10A 1GZJA 1CGXA 3W22A 3I3BA 2R24A 1PIGA 2E6AA 3FVMA 1S3TC 2ZRYA 3MU7A 4FLSA 3UT0A 2OODA 2HVMA 4AIUA 3O6CA 3AU2A 5HULA 2B81A 3DI0A 3USBA 2QV4A 1W37A 1GJUA 3GVQA 3WDPP 2POTA 3KTXA 2NX9A 5K9CA 4JAWA 1Q66A 4R88A 2V63A 3CT7A 1ZJIA 5BXTA 4CKQA 1DORA 3IWPA 4XWUA 5F4WA 3F2DA 1FWDC 3MSYA 5D33A 4ICCX 3UESA 1UMLA 4GYFA 4IPPA 3RXZA 4BHYA 1BGAA 3ZT7A 4JKLA 2I56A 3UERA 1NTHA 2W61A 1W9PA 3PSWA 3E1F1 4MNMA 1IE7C 1JVNA 3WLMA 2X1IA 5A2CA 3HV9A 3FLUA 3U0HA 1EL3A 4R9OA 4U3CA 1KCZA 4J40A 2CPUA 5K4ZA 2IKHA 1R7OA 3ARYA 1UOKA 4PEKA 3H54A 1KD0A 2HE5A 3SCSA 2FZMA 2QULA 1OF8A 4WSHA 1GJWA 3GNPA 2BTMA 3R12A 4H8HA 4LYQA 1UUMA 3CUJA 1H3GA 1TWDA 5ABGA 2YDSA 1GYNA 5AVHA 3SGZA 4Z1YA 2EPOA 5D38A 4S3EA 1ZB5A 1VBUA 3KBWA 2QV5A 1UHVA 1AQ0A 2NWSA 3IIZA 1XBVA 3C8FA 2WJZA 3LLXA 4L61A 2HPIA 2DSWA 1XGDA 4V2XA 5HPCA 1GT8A 5KZ6A 3QZAA 1DWHM 4X3ZA 5C0QA 2NV2A 5FJRA 2XGZA 2OQLA 3MCOA 3ABSA 3MC5A 1A5UA 5FF7A 1VBGA 3N12A 3R2GA 5I3FA 3I10A 1DWJM 1BG4A 1G7UA 2ZXDA 3QEZA 2O0TA 7ENLA 3W6YA 1XR2A 3L4ZA 1VR6A 4QE1A 3RCNA 3B0YA 1VBHA 4B16A 4GQRA 3E02A 4X22A 1FVPA 3P2VA 2E7FA 1H50A 3GU2A 2ACUA 1GG0A 1BF2A 1TCMA 3TONA 3ONBA 4QRNA 4PUUA 3WEMA 4HCLA 1U22A 2QJMA 3Q37A 4G1KA 5BRBA 3G0UA 4AWTA 4C1KA 1MEWA 5BYWA 2XVKA 3HPZA 4JX4A 5MHBA 1V02E 1O6IA 4KWOA 4EXQA 3GNOA 1UYQA 2OZ0A 4UTWA 5FA5A 1F3XA 4P2VA 3S5YA 3CBWA 4C6BA 3CAQA 1XI3A 2HCVA 3T4CA 3IJIA 4DJDA 4X9SA 5I23A 2C8NA 1E0UA 3WQVA 1RY8A 4CQCA 3W75A 3FNDA 3B97A 3AWOA 4B3KA 3L2LA 4FK9A 4WSKA 1T41A 1OD0A 1K4HA 1EBGA 4O16A 3MS8A 4XTDA 2P76A 3LBOA 2YCEA 3PWAA 1NDWA 2Y8KA 2BVWA 4R53A 4TX8A 3GFZA 4ACYA 2EJAA 1PV8A 2EAWA 2FQIA 3CZEA 3GH4A 1ZJBA 4JFTA 3F4CA 3TOPA 3DC8A 5EGRA 4V33A 3HZ3A 4XO7A 1TSIA 2VELA 4J28A 3BJFA 1GONA 1JUKA 4AF0B 4XVEA 1UA7A 1PAMA 2VR2A 1YE6A 1TELA 1VKFA 4O1BA 3PB0A 1YDVA 3GW3A 4LVDA 3L5LA 3EEGA 4O11A 4ZOAA 4LX4A 3WNPA 3HF3A 2G3NA 2DT3A 3W07A 2B7PA 2V82A 3PFMA 2Z1SA 1HGYA 3CV1A 3NUKA 5CPQA 2VGFA 3N2TA 1AODA 2QCLA 1VP5A 3CIXA 1L6SA 4I7UA 5GPRA 4NL1A 3SCNA 3VPLA 5TF0A 2JGYA 3NDZA 3H22A 2J8TA 1ZNNA 1DIKA 1JXJA 3LUTA 4LBRA 2DUXA 5DCDA 1H1NA 2GL5A 3I4KA 4A29A 3CS2A 4KWWA 1E43A 4I90A 3PNUA 3S42A 2X1UA 1QI2A 2GZXA 2VFHA 3GNXA 4PTDA 2VZVA 1XPGA 2TMDA 1F3TA 3NJ3A 4MJMA 3CUZA 2VO5A 3H4GA 3T7VA 4FLQA 4IXHA 3S2NA 3M0KA 4GY1A 3AS2A 3ITLA 5CJNA 1MUCA 1MW1A 4JYFA 4WVXA 4Q8TA 1XLKA 1OT1A 1BKHA 1GEQA 2V5BA 3AJXA 4XX6A 2OOGA 2NV1A 3KLLA 1P1XA 4MB1A 3G3DA 1E1EA 2PMQA 5CGMA 4Y9AA 4BCEA 4A3UA 2ZWYA 3R7MA 1F8IA 4CU8A 1GOMA 2Y0FA 3C6CA 3TQ0A 4RE2A 3MVTA 1XLJA 1V0LA 2WYSA 3K8LA 3ZT6A 4BF7A 3QH2A 4PUWA 4X63A 3MO4A 1F8MA 4Q4MA 5HBFA 3SN0A 3E6EA 3W7HA 1TRDA 3AIVA 1I1XA 1QUMA 3NQEA 3T78A 4NT0A 1BF6A 5HWJA 1JJKA 4L9YA 1ZAIA 1FTXA 1A5CA 1JZ6A 1A0DA 1CBGA 4MJ4A 2ZZ2A 1GUVA 1VPXA 3UG8A 4P5UA 1XX1A 3K4AA 3ZS4A 4EP8C 1S5TA 3VO0A 3QF0A 2WPGA 1CXKA 3R0KA 2QLYA 4Q7BA 2XFWA 3AFBA 2W0UA 4TTGA 4YTUA 5GJMA 4DX3A 1MDRA 1KLZA 1OHLA 4GC3A 2WO5A 1PO9A 5H1WA 3B4UA 1S39A 4QISA 1EOMA 2W67A 1LOSA 4PMYA 1UC5A 2X1SA 5T8GA 1G6CA 3WMBA 1C3FA 3PZIA 2XGBA 4PFHA 1DTNA 1TWIA 1AZ2A 1KQYA 1JG9A 7REQA 5FSDC 4UFJA 4KGJA 3U8GA 3T6CA 1BD0A 3W7EA 3QQ1A 3W38A 2XWEA 2PU1A 3CHFA 1J11A 1Q6RA 3LHWA 3G0XA 1JZ5A 1Q85A 1XLCA 2QF8A 3M6YA 5CGQA 5CPMA 1HIZA 1W3LA 4WQ6A 5HJLA 1GPFA 3PB2A 1XCFA 2HVNA 3M16A 4ML4A 2WMIB 2I7GA 2C13A 5DT5A 1QW9A 4NNAA 3E0WA 2IKGA 4LB4A 4FX6M 3SSJA 1FP8A 1J0IA 3RDKA 3TTOA 3WUBA 2Y85A 1KC7A 5JIWA 1SJAA 4UR8A 4XSLA 3VI2A 1K7EA 3OZYA 1GOKA 1QNPA 1ZRQA 5DMYA 4TVUA 4ZGYA 2QR6A 4YCPA 1DJNA 4A2RA 2VWTA 4EACA 1WDPA 4RDYA 3IJLA 4NYYA 5A8OA 1NWTA 2QVHA 2VI0A 3M0LA 2J13A 1HKKA 6A3HA 4AD0A 3S83A 4S1FA 2XM1A 1P0EA 2BGNE 4PODA 1Q8JA 3GTFA 2FVMA 1EYEA 1JULA 2VFIA 3CMFA 1SO5A 3USZA 2D20A 4MWAC 4WSJA 4B5NA 4FAMA 3H2FA 1KM5A 1Y5VA 4AVFA 4HPXA 4AB4A 4NZ5A 3WFLA 3GLCA 3V18A 2E5CA 4H8NA 2Z2UA 3AXXA 3M5XA 1UQYA 3SR7A 3LLFA 4M19A 2A79A 4GX8A 4PL2A 1BXNA 1X1ZA 4J3ZA 1OYAA 1EC7A 5I03A 2W92A 4FLRA 4O13A 1X96A 4KRZA 2P88A 3JVAA 8XIMA 4GFSA 4F8XA 3TQPA 2PDNA 4B5SA 3SCOA 4AYSA 4O12A 5K9DA 3WD1A 4E2OA 3QZ6A 2R1PA 2PDQA 1XIJA 4WUIA 1P0BA 4RNFA 1JYVA 4UNKA 2AL2A 4NAEB 4DXKA 2DGAA 4JEQA 5CC3A 1BWKA 4OFCA 3BURA 4EWJA 2GK1A 3RM8A 2GJLA 1V93A 1KB3A 2PCQA 3EGJA 3RU8X 3K30A 1FFRA 2ZUVA 1KRCC 3UD6A 4PGLA 4PMDA 4C6CA 4U5KA 3PBUA 4ASTA 1XLHA 3KM8A 4JFWA 4XIAA 3E0IA 1C8YA 1M7JA 3F4NA 3ZXWA 1SW7A 3K5XA 1G9HA 4HA0A 2FLIA 4HU3A 4O1AA 2X7WA 4UXDA 3MMUA 4DEFA 2GDQA 2TPSA 4YXGA 3CZKA 1M04A 4LVBA 1WBHA 3CPRA 2XVGA 3PULA 2X0SA 1S1PA 4W85A 3NPXA 5MF5A 1ODZA 1I8JA 3ZR4A 3VZYA 4QS6A 4JQ2A 1DBTA 3RO8A 5CZSA 1UZ4A 5I3KA 3HG4A 1LBLA 2Z1VA 3T44A 3GXPA 3TAKA 2V81A 4HNCA 2G4JA 4HN8A 3WUFA 4GI9A 2GVYA 4J4KA 4WOQA 2FH8A 4HA3A 1J2WA 2DH3A 4MDPA 4DIAA 5CG7A 3NYZA 3UG5A 3VUSA 4H04A 2GJPA 5G2IA 1VD6A 3ATZA 3CASA 1V8EA 4QG9A 4UZSA 3HA1A 3HQNA 1HVXA 1IEQA 3VGHA 1JQVA 3EA2A 4WDWA 3F4DA 6REQB 2TSYA 3KOFA 4QJ4B 9CGTA 2VX7A 3LOTA 3QOKA 3CYVA 3SO7A 2X30A 5A2AA 1H7PA 4M1RA 2ISVA 2YOCA 2WVVA 1OFPA 5HQEA 1RY0A 5SWUA 2FB3A 3K13A 4G2DA 4F9JA 4M7SA 1U1JA 2OKOA 4UWMA 3EWCA 4D1IA 1TKKA 3OW1A 3UJEA 2PZ0A 4H6KA 3QVQA 3EWYA 4QE5A 2R8WA 4H9TA 1LL4A 3POHA 1YXCA 4L6DA 3PFRA 3FDGA 2DDXA 2E9MA 3UF9A 3R94A 5BOFA 5HAOA 4FALA 1F05A 2EG8A 4F4RA 1G4TA 4R85A 4DJEC 2IUZA 3LXBA 1HL2A 3SY1A 1QK2A 3ARWA 3INPA 4M51A 1IQ8A 2W4XA 1VGAA 2RJHA 2VVNA 4AHPA 4HYRA 2OSWA 4B5WA 4N4PA 4S2CA 1QR7A 2Z1WA 1EHNA 2ISSA 2QF7A 3EPNA 3IUHA 3KS6A 1UR2A 3SQSA 1EX1A 1UG6A 3TAOA 4AY7A 1ICPA 2PWVA 4RJEA 4PULA 3VDGA 3R8HA 2GVLA 4IISA 1E9ZB 1XYFA 4KIRA 2W3ZA 3NQMA 4YN5A 3BOLA 5EA9A 3RITA 5CC6A 1ZZMA 3FA5A 4JYEA 1JGIA 1DXEA 4WDXA 4KFNA 4ZO6A 2FPTA 1KBBA 3WLJA 4ATLA 4D8AA 2BHUA 3N3TA 1KQZA 4QQUA 3ANUA 3GVWA 1EJ7L 3W2UA 3NM3A 2PDIA 4B3ZA 1T6MA 2G3JA 4KCVA 1EUAA 1F2JA 1FOBA 4KEVA 4XK2A 3SQMA 4PUMA 5CKSA 2Z28A 3DFHA 4N6FA 3SCQA 2DZVA 2MUCA 4M3PA 3GY1A 2QCMA 4GNJA 2PD5A 5DY3A 1NM9A 4EPEC 5JH1A 1BAGA 2BY0A 4M56A 3C8NA 2PAJA 2GJRA 3VMNA 2PDBA 3ZO9A 2FHBA 1UIPA 4PCSA 1M41A 5I3GA 4YTRA 3C2EA 5JIPA 4Z2IA 4NZ1A 5D32A 1KCXA 1CB2A 1XXXA 1H7XA 4XBKA 2XIBA 1VFLA 5T9CE 1IV8A 4L9ZA 4P61A 4GGBA 2W63A 3GXTA 3AZTA 3KOYA 3UZXA 1CT5A 1X38A 2CYGA 5EKYA 1TIMA 3QGKC 3ZMRA 2OX1A 3BLKA 3V5CA 2GSHA 3H23A 1CGVA 3S1XA 2RAGA 4ICNA 1EGMA 3UQNA 4NJIA 4MWAD 4O1CA 1J12A 4GISA 1OBAA 3WQCA 1XLLA 3TROA 3CC1A 3KRUA 3MBFA 4ZB0A 1BXCA 3KVMA 2OTDA 1NEYA 3R0DA 1QPNA 1P4CA 3W2KA 5D09A 4E4UA 3W1TA 3KBJA 5IM51 4AD2A 1V6UA 3M7WA 3WJYA 3IS4A 4J3VA 1YDOA 3LERA 1VC4A 1A50A 5C70A 3ABRA 5B7YA 4AC1X 4Q7NA 3WEZA 2XUCA 4Q8WA 5HJYA 3BARA 1XDJA 2OGYA 3TWAA 3IEBA 4PEEA 5A8QA 3MI6A 3MMWA 3AWNA 5A8GA 2OYKA 4JY9A 4GD0A 4Q8VA 1OADA 2VOMA 4KWUA 3BAWA 3TFXA 5FKYA 3PZUA 5CXPA 5A95A 1VAHA 2X7VA 1A0EA 3BCDA 3H7UA 1TYGA 1BWLA 4CD7A 1JPIA 3MWCA 3WNKA 1TV2A 5CPOA 4CQAA 1OFOA 3VOJA 3F1QA 4XAZA 3GTXA 4F79A 1I45A 4AVOA 1CX9A 1S46A 3GR4A 3CH9A 3PAOA 2BVDA 4ZB5A 3FFSA 3C0LA 3LSBA 1KRBC 3F2BA 4D6FA 1WDSA 3SCUA 1O1ZA 2F38A 3TUUA 3PC0A 3Q65A 1W6TA 3LRMA 3W7NA 1NDZA 3O0FA 4GZJA 3LCHA 3M0JA 1NOFA 3FAWA 2JK2A 1KTCA 1IIHA 2V8ZA 4UOJA 2PLKA 2P50A 1W1A1 3TYBA 3QMTA 3CV2A 1AUSL 2C15A 5LGZA 3S6OA 2C19A 1YW1A 2DFAA 3WJZA 3ARZA 3HB9A 3WBAA 4JD4A 5LNUA 4E2VA 5I00A 1RA5A 3V0TA 4JHZA 1X1OA 1SZGA 4AISA 3Q45A 1YE4A 1RJQA 4F9DA 4KFPA 5AZ0A 4GCXA 2WHKA 3FJLA 4H9ZA 1RAKA 5AFDA 1O68A 3VCNA 3LQLA 4HNTA 3UWQA 3W1LA 5HQMA 3WL0A 1MQRA 4JIQA 3GFXA 2XH0A 3HG5A 3BLIA 4DN1A 4CU7A 5A6AA 4JX6A 1ELSA 1NJJA 6XIAA 2V68A 1HO4A 1RD6A 2QDEA 3W23A 1GKQA 1JCNA 2GUUA 3B9NA 3WBWA 1F5ZA 1XHGA 1QI0A 4MY1A 3LZ3A 1UC4A 4UFMA 2O7SA 4CVUA 4GZEA 3MHFA 2GQ8A 3L12A 1EA9C 2IKIA 1E6NA 1Q13A 4MF4A 3P6LA 4PZVA 2GVEA 1T40A 5C9XA 3DBNA 2Y89A 1K03A 4JKMA 1JD7A 1NFPA 3GXDA 5G4EA 2PBGA 1LQAA 2OYMA 4P7RA 1BRLA 3GR8A 2Z1XA 3F4WA 1VFMA 9XIAA 2W5FA 1ZSXA 4ZODA 1WV2A 4H9XA 1RCOB 4E38A 4HCHA 1WZLA 3RJXA 3VNJA 4UTTC 2KX9A 4C6DA 4R9XA 3UPWA 1X8FA 3RRXA 3TXZA 1H2JA 3ZSSA 2PSNA 4IIFA 5HUPA 2RKXA 4F66A 2DZTA 2H90A 3ISIX 3SRDA 1EJWC 3CAKA 4LUTB 2CESA 1UWQA 2W91A 5A6BA 1AZ1A 5BRQA 1CI1A 5A8PA 3S1VA 3VM5A 1S5MA 1BTMA 2GJNA 3A9BA 3W82A 1C92A 3GO2A 5AHLA 3UR8A 1UD5A 2R6OA 2WCAA 3XIMA 4DF0A 3BOFA 4AX7A 4HTYA 2QPXA 2I1OA 2XSAA 2Y5SA 2ZUMA 3L4XA 1V3KA 3EOSA 2QCNA 4ZFMA 3KE0A 1NIUA 2OZ3A 2OT0A 3LCWA 4LOCA 1OYCA 1ZCCA 4O57A 2Q8LA 1J6OA 1DJZA 2PWFA 4PL1A 1B3VA 4FX7A 2ACRA 5AHEA 4PMXA 1JF5A 3U48A 5CCZA 3QLLA 2D69A 5FSEC 1QO2A 3IVTA 2QEZA 1HG3A 1XW8A 1MWOA 3WJWA 3G8EA 4IGMA 4A3RA 1DYSA 2Z2BA 3PF3A 1CB7B 2Z7GA 3MKCA 3N1AA 1PHWA 3AXIA 3TNOA 4I5RA 1OYBA 3P82A 1EQPA 3BTNA 3VDBA 4TV6A 1Q63A 1BVZA 4DWSB 4XD3A 2E9LA 5JMUA 1RALA 2HBXA 2REQB 4GX9A 1FWNA 2GUBA 4MB5A 4HYVA 1M7XA 3BANA 5HNNA 4XQ6A 4JQ3A 2CLHA 2JGQA 3VD5A 4HA1A 2INFA 3W7GA 2UWFA 3VX0A 3W28A 1B31A 4HSHA 3AYTA 4H7CA 2GGEA 4DLMA 4L56A 3T0AA 1OJXA 2ZADA 1UH4A 4ILSA 2WC7A 1A3WA 4E3TA 5DLCA 3K8KA 3NQGA 1OIMA 4NRRA 4TO8A 1XBXA 3EX3A 3WY1A 3BLEA 2A3LA 1PX4A 1UD4A 4PMQA 1E0WA 1F61A 4IM4A 4CVWA 2WSQA 2PU0A 4AZ6A 2FZNA 2GPTA 2J75A 4PMZA 4O1FA 1TV3A 2WWCA 1R9YA 3ITXA 1ZGDA 4ZL1A 4MUPA 4KPLA 1FWWA 4GH3A 1WOAA 1UW9A 1OFDA 1OY0A 4XUGA 5AY7A 2BS9A 4RPQA 4K1WA 5A1AA 2OB3A 2J9YA 5BOOA 5C71A 4LFYA 3A12A 1S2VA 3A24A 1J9YA 2YCLA 3RAOA 4AIBA 1XGZA 1C8XA 4HMNA 3RR1A 4Z0SA 1K9EA 5J04A 1CXLA 4W89A 1ZU8A 4WIWA 3TZFA 5FIPA 3WH5A 2R1NA 4F2BA 4B5UA 1V3IA 1TMHA 2VYOA 5IHSA 1WQ5A 3RN6A 1XIGA 3GAYA 4A21A 3VIOA 5F2MA 2VC5A 2V2HA 3UY8A 4BY3A 5GJNA 3LM7A 4G56A 4IQLA 4MM1A 1QNVA 2A3BA 2WMKA 4UTMA 1P6WA 4MLJA 3PM6A 3FIGA 4ZSUA 3G22A 3GSMA 2J7CA 2AAAA 5DT7A 4KETA 1GWJA 1D3HA 2OU4A 3R89A 4N9DA 1R7AA 4HHPA 3PY2A 3AIUA 2O9PA 3QPZA 4M8UA 2L5HA 4L80A 4DO7A 2QDHA 2WLZA 1H7RA 4BF9A 3GNDA 3PSVA 4F0HA 1KWGA 1HKVA 4GE8A 4K3ZA 1ZHAA 1QOXA 5EYWA 1PDYA 3WF2A 1JUEA 4QNWA 2VEKA 4PTNA 1OGGA 1I9CB 2IQ0A 2VGBA 2FZBA 4QLJA 2DIKA 3VAVA 3PNZA 4GINA 2PGRA 3OVPA 4EF9A 2PBOA 3QXBA 3SUVA 1W5PA 4DPPA 2IPFA 2CHRA 4GI4A 3CK5A 2E3ZA 3N9SA 4W8BA 3FXYA 2CCRA 4L4OA 1UKOA 1XLIA 3TTYA 3GR7A 1PYMA 3S0CA 3MUXA 4IMGA 4DM2A 1DWGM 1G67A 1TV5A 1NARA 4IFRA 2C16A 4HSNA 4J2PA 1EOKA 4ZE4A 1EH9A 3V5OA 3B40A 4YCOA 3OBAA 1UZ1A 4TVDA 2P53A 4JEJA 1YKWA 3VIKA 2NW0A 1YADA 2IQTA 4GO8A 4ZB2A 4A8NA 4IWWA 1K6AA 4OE7A 1J0JA 4LAZA 4M6QA 1J79A 5C2XA 3W9ZA 3O1NA 1UKTA 5D8WA 3BOXA 5EMUA 2GQ9A 3LCGA 3U5UA 5CBJA 2A85A 1UR8A 3YPIA 3I7SA 2PTXA 1SZEA 3PZMA 1W1IE 5REQB 2IPGA 4HU4A 4GJ1A 1TO3A 4HYWA 1BKSA 5DBUA 4NZ4A 4KESA 2QNEA 1H5VA 3M0IA 4Y9MA 2F6UA 3N13A 4YVVA 4IIHA 1XBYA 1HO1A 2AOSA 2ALDA 4CLMA 4C6EA 1P0KA 3C5QA 3VOIA 3KWXA 4QQ3A 1RCXB 1VFTA 2PP0A 4MPKA 3RX2A 3SY5A 4FB7A 3C0JA 1BGGA 4JFUA 7ODCA 2G50A 4A4AA 5LA1A 2PEVA 4RX0A 2JEPA 2WKLA 4WKFA 3HPFA 4K7VA 1H7NA 4XAGA 2ZUTA 1PX3A 2VC7A 3KCOA 4KCTA 2HRWA 5D37A 2INZA 2WXDM 2YDAA 3NQFA 3GVRA 4H83A 3NL6A 5LNWA 5FF4A 5LXXA 3AHYA 4F40A 1CXIA 2OPJA 1ECEA 1CLVA 1E51A 3TC6A 4MJZA 1H63A 3GHTA 2VKZG 4K68A 4OV9A 4WEVX 3SQLA 3QV7A 2CITA 2F6XA 3GYCA 3W1MA 2J6XA 1NQ6A 1KGWA 4WDUA 3L21A 5DN1A 3AMLA 3VNYA 3VVGA 1XJBA 4JIPA 4ZE5A 3AXKA 2PUZA 1QO5A 5F2LA 3UWVA 5PTDA 4GRSA 4UCFA 5BROA 2PFHA 3N2MA 1PKMA 1YTDA 1W1ZA 4L1WA 4OBSA 3LENA 4O8AA 4OVXA 4ZVJA 4HNOA 1GVRA 4EX4A 2J7HA 1TV4A 4AD1A 5AHFA 4MJ2A 3T0TA 3NEVA 5DXXA 1T0OA 3H2AA 3T1GA 3HIJA 4GNKB 4MNKA 1XKJA 3TWBA 3KTCA 4XD5A 4WF7A 1D7KA 4IGSA 3ARPA 4LC6A 4G7EB 1WDDA 3T2OA 4DWDA 2VC9A 5LIUX 4NQ1A 3SGUA 1WP6A 3W73A 3H2OA 1C90A 2ZUUA 1WZAA 1Z89A 1CIUA 1H62A 4AZHA 4PUEA 4HPHA 2X16A 2G96A 4NF7A 2VDHA 3T42A 2CETA 1Z69A 3FVDA 4X60A 1TQXA 4N0RA 3WLQA 1KNWA 3GQYA 3ZJ7A 4Z2HA 4Q8NA 4J7RA 3WX7A 5B80A 2PDJA 4GLEA 1XFBA 1HVQA 4MZ8A 2JKAA 2NUYA 1JUBA 3GTHA 2GSEA 4AEFA 3FY1A 4PSPA 5C9RA 1AH0A 1DHKA 1VBRA 1K8YA 1RR2A 1TPDA 2D3LA 5D2TA 1EC9A 4D6JA 1LCOA 1TV8A 1L6FA 1DJIA 3E5PA 4NP7A 4UTTA 3HQ1A 2Z7KA 3U7BA 5AC8A 3D5HA 4D9PA 2RGLA 2Z27A 2Y88A 3HMJG 2WHMA 1ISWA 3PZ9A 1RP9A 1SZNA 1J01A 1KM6A 1SJDA 4LT9A 3AHTA 1Z44A 4TOQA 1HKMA 2VJXA 4LYKA 4D2JA 3GX9A 4C6FA 4MZ1A 1EO5A 4H7VA 1EJXC 2BODX 1HL9A 5EU9A 3CL8A 1TVPA 3CMJA 6XIMA 2WQPA 4XV0A 8TIMA 4H01A 3WH8A 1CTNA 3NZGA 1KO0A 2DSVA 3DFTA 1B0IA 3ZM8A 3NM1A 2ZCGA 3BGJA 3VKDA 4LPCA 5D9NA 4MDOA 3H26A 3BJSA 3GBEA 2QAFA 4P8XA 3VK5A 3HG2A 1A5AA 2YDQA 2GK1B 3GKFA 1EPXA 3KTSA 2DSKA 4CCEA 1VBJA 2Z6JA 3ANYA 2AMXA 2AL2B 4FPSA 4NAEA 1XC6A 1Q7QA 3WF0A 1YDYA 2F2HA 1E55A 5C8BB 8RUCA 1F07A 3SBFA 3UWYA 4QG6A 3S6DA 2B7NA 4K39A 1A5LC 1CXEA 1L8NA 3V7PA 1XIEA 1VYRA 2E40A 2R1LA 1DPMA 1V7AA 3T0CA 2ZIDA 3UR7A 1HT6A 1KWKA 5D03A 1ZP4A 2ZXBA 3CNYA 2DJLA 1BG9A 4ZO9A 1POKA 3FHAA 1LLOA 3B06A 2BY1A 4QLKA 1R2RA 2OEJA 2WW5A 3GK0A 1B30A 4P7QA 5M03A 1SFSA 3UXLA 2AKZA 1HZYA 5FJPA 1OFRA 4XSMA 3SB0A 3R58A 5HMFA 1RH9A 4YS1A 4LV4A 4DF1A 1FY6A 1QWKA 1TJ1A 1XIDA 4NZJA 4ZENA 1XLMA 5GNYA 3LNMA 3L2MA 4J5NA 3QBUA 3U2ZA 3W7QA 1K3UA 2AGTA 3BJTA 1LTDA 4QAIA 1LRTA 5XIMA 3ZVHB 2DORA 1W1YA 4C6IA 1EXBA 4PCFA 1MYRA 3VC6A 3ID7A 3RCMA 1LT8A 2W9MA 4AEEA 3T09A 1JD9A 4HSOA 5GQBA 1ME9A 4AXKA 1FH9A 4JNYA 4JTFA 1BQGA 3OG3A 3UCDA 1MQQA 2D0GA 3OA5A 1AQFA 2E5BA 3FAXA 3EDKA 3OTRA 2UZ9A 3ELFA 1N8IA 3TK7A 5CG0A 1SZRA 1P7TB 1R3QA 1IEXA 4A8IA 3TVAA 4I5UA 2VTFA 4D8ZA 3HG3A 1DE5A 3S1GA 1QW7A 4QIUA 3N6JA 3ALGA 4S3BA 1KFCA 4A6GA 1TTPA 3QFEA 3WKZA 3LXCA 3E2VA 3SUSA 3GVGA 3EEZA 3WUGA 1Q5MA 1HQTA 1J5TA 4RW5A 3OPSA 3I3DA 2VFGA 4DUWA 3MO7A 4JBRA 1MO0A 2WQDA 2H9AA 4KWVA 2GWGA 3TJLA 3CU2A 3C2OA 4B4FA 4J3WA 3V5FA 5CAHA 1I2OA 3SURA 3EDDA 3L68A 4S3FA 3S1WA 4IG2A 3FEMA 3W87A 1UR3M 1PKLA 2VNCA 2E6FA 1QXLA 4DYEA 3OVRA 3UZYA 1XH0A 1IYXA 1UD3A 4Q4KA 1C29A 4MHBA 3LBCA 4BQ3A 4MIMA 3WK3A 3WD0A 1TPUA 2J7FA 2J8GA 3J7HA 3VMPA 2ZKMX 3QM3A 2OT1A 3SADA 5FL1A 3GNNA 3EKLA 2E68A 4DNMA 1HL8A 4TTUA 2WKJA 1VEMA 1JF6A 2V2CA 1TZZA 5JBEA 2D2JA 3CQ0A 1RLCL 5EPDA 1WXZA 1SSDA 3TSDA 3A13A 3WH7A 4US6A 1QBAA 4GZ7A 4B91A 1V3HA 5A8MA 3AC0A 4W5UA 3WQ5A 5AYXA 1JZ4A 1EYWA 2ZRWA 3LXAA 3RK8A 1OF6A 3XISA 4QM1A 4IF2A 4GO9A 1VCFA 4O19A 4CEUC 1IIGA 3W2MA 4RV3A 5G1MA 3B0PA 1UKSA 1B3YA 4IZGA 3A47A 3MT1A 1DJGA 3VNZA 1UWRA 2PDFA 2CLKA 3OEXA 2VR4A 4W9TA 2EO7A 3BO9A 4H6RA 1WZMA 4Q6JA 2BDQA 3RG6A 1FQ0A 1FH8A 4QEHA 3AXMA 1Y8BA 2ZX7A 4IGHA 3VIGA 2PZNA 2QUNA 4JN7A 4IQEA 2E8ZA 3QPYA 4OOUA 3TYAA 5HOSA 1FWIC 4Z08A 4AEOA 3BK0A 2E6YA 1IWBA 1NFGA 2X42A 5FJJA 2PTWA 3U9IA 1M6JA 3MSRA 3IK2A 3UETA 3AUOA 3EDEA 2HSAA 1EUNA 3KUMA 3K2GA 4PUDA 1CGWA 2YXOA 2EEXA 1A0CA 1DIDA 1PJ9A 3ECQA 1GW9A 1N2VA 3CHCA 2Y5EA 3KAOA 4LV9A 1TQJA 2ZZ5A 5CH9A 2GLKA 2VCCA 3WK2A 1XWYA 1S2TA 4K2SA 4QFUA 3TC7A 3UR5A 5LSMA 4PUKA 3QY8A 1DJHA 1Z32X 4M6VA 3GXIA 4REQA 4PR4A 2HROA 2WKGA 1NQKA 1VQTA 3D3FA 4FS9A 4PA8A 4AXNA 3REQB 4HMEA 1OD8A 2ZUSA 4AF0A 4CEXC 1DJXA 3W70A 3WLTA 2EG6A 3WF1A 2E77A 1FDJA 1TX0A 3JR2A 3N2XA 2WJDA 1RQBA 4LF1A 1A3XA 2WSKA 3A5FA 2R1KA 3CM4A 2FGZA 2BXVA 3NZPA 4C60A 4H9YA 2A3HA 1UP3A 4Y2WA 2I9EA 3HOJA 4HBKA 5XINA 4AIOA 4NUWA 4UMBA 4U2YA 1D7FA 3KRSA 1R5YA 4GG9A 1U5JA 2CEQA 3W26A 4HOWA 3U2EA 3EOOA 2QCDB 2A7NA 1V3LA 5A6JA 1W5OA 5DMLA 4KF1A 3WBYA 2QJNA 1BTCA 1VEOA 2HJPA 3GXNA 5JQ9A 2FFCA 3GNRA 2ZDSA 4IL2A 4H9MA 4IFOA 4L6OA 1ML1A 4ADTA 2YX0A 2V3EA 3Q2DA 1XQKA 3EX6A 5FF3A 4YIWA 4CD6A 1CGYA 3MUAA 3LTYA 3WQFA 3AS1A 1VZWA 3DERA 5IRPA 3CL6A 4LVAA 3MWAA 1X6NA 5HNUA 2G3MA 2GGJA 1CGTA 5C2GA 1JGMA 5IBXA 2J79A 4OT7A 1S2CA 1JNDA 3II1A 4H7ZA 4FNPA 3B05A 4Q33A