4CQAA

Plasmodium falciparum dihydroorotate dehydrogenase (dhodh) in complex with idi-6273
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
373
structure length
371
Chain Sequence
FFLYDIFLKFCLKYIDGEICHDLFLLLGKYNILPYDTSNDSIYACTNIKHLDFINPFGVAAGFDKNGVCIDSILKLGFSFIEIGTITPRGQTGNAKPRIFRDVESRSIINSCGFNNMGCDKVTENLILFRKRQEEDKLLSKHIVGVSIGKNKDTVNIVDDLKYCINKIGRYADYIAINVSSPNTPGLRDNQEAGKLKNIILSVKEEIDNLEKNNIMNFLWFNTTKKKPLVFVKLAPDLNQEQKKEIADVLLETNIDGMIISNTTTQINDIKSFENKKGGVSGAKLKDISTKFICEMYNYTNKQIPIIASGGIFSGLDALEKIEAGASVCQLYSCLVFNGMKSAVQIKRELNHLLYQRGYYNLKEAIGRKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title In Vitro Resistance Selections for Plasmodium Falciparum Dihydroorotate Dehydrogenase Inhibitors Give Mutants with Multiple Point Mutations in the Drug-Binding Site and Altered Growth.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
molecule keywords DIHYDROOROTATE DEHYDROGENASE
total genus 139
structure length 371
sequence length 373
chains with identical sequence B
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2014-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4cqaA00
2E1DA 5K2ZA 3TJLA 4MKNA 5I3JA 3MW7A 2YZRA 1JCLA 4UTTC 3M41A 1LRQA 3W72A 2ZQ0A 5G4WA 5H2ZA 2X1SA 3AJXA 3TIMA 1FWSA 1JRBA 4HNUA 2B0MA 1PV8A 3EX6A 5J5DA 5EL1A 3DZ1A 4R33A 2NLIA 1W54A 3E49A 4NX5A 1XUUA 3GAYA 4GUJA 1Z42A 4MJZA 3THAA 2A7NA 4DQWA 1FWNA 4UR7A 4DF1A 1O95A 2GUUA 1JCXA 3FKRA 1TCDA 3PB2A 1DQXA 3O8AA 4FX6M 3DKLA 1W5MA 2X1UA 2FPTA 4IPJA 3W2LA 1SO6A 2QCEA 1AL8A 3O6CA 4RXGA 2KZHA 5T26A 2H8XA 2Y62A 1RV8A 3QPYA 4S2BA 2QEZA 3DFSA 3O63A 3P82A 1ADOA 3TC7A 1R47A 4N02A 2QKFA 6ALDA 5TQLA 4M19A 2ISSA 3G24A 4DEFA 1ME8A 3QW3A 2XN1A 1QNVA 2QUTA 2QUVA 4E2BA 3PSWA 1YXDA 4P61A 3TH6A 4RK8A 1H62A 3HJZA 4Z0SA 1OFDA 1ZCOA 3NL3A 4PH6A 4LS1A 3C4UA 3DAQA 4A22A 1TPEA 3R2GA 5HULA 5HWNA 1Z48A 2V9DA 3QC3A 1BWLA 3L0KA 4WQ6A 1WBJA 3IV3A 3W7NA 3IEBA 2Q8LA 2A21A 1FCVA 3NQVA 1K8YA 3MWAA 3TSDA 3GX9A 4TMCA 1OFEA 3I7QA 2JKPA 1OX5A 3W2MA 3UXAA 1EIXA 3M9YA 1X7FA 1WV2A 4UFIA 4UTMA 1G4SA 3CQ0A 3NR0A 3HGRA 3BARA 1NF7A 2ISVA 5I3HA 5FF7A 3W22A 1JRCA 4X3ZA 4E0CA 4ONVA 1LROA 2HS8A 5AHIA 3UD6A 3GB6A 4HNTA 1EPXA 4HPJA 1LORA 1OX6A 3I68A 1IGSA 3DFQA 3NPWA 3HGOA 3W7PA 4O0KA 4AVFA 1TPC1 2G95A 1AK5A 3HPSA 1K8ZA 1F6PA 1U5JA 1OK4A 3H55A 4AF0A 1GVOA 3S5OA 3A5FA 4FX7A 3V75A 1OX4A 3P5YA 4O53A 3ABSA 5AYXA 1HL2A 2RKXA 1BEUA 3C61A 4JTUA 5ABTA 2H8ZA 4OV4A 3W84A 1TV7A 4MFDA 2H90A 5U4NA 5D2XA 1LZOA 1OFOA 3LV6A 3MUXA 2TMDA 3N3MA 1DOSA 4CCEA 2DZSA 1Q45A 3TDFA 3CWNA 3BGGA 2I14A 3LBMA 3EX3A 3NEVA 3W7JA 1VH7A 3HPXA 3HGJA 4NZFA 4I7VA 3IRDA 1SSGA 1SZFA 1B4EA 3TK7A 1JCYA 3W1MA 1PCKA 4W9TA 4FO4A 1YXCA 4FIRA 2DJLA 4NJGA 2P0OA 4GE8A 2JBMA 1H7WA 2AAMA 4C1LA 2C19A 4CQ9A 3S8HA 5D05A 4GBUA 3KOFA 3FS2A 1Q6RA 2WPBA 5LHEA 3B04A 1MEHA 4MJMA 4JTHA 1T8XA 2FTPA 2V81A 4YXGA 4UR8A 1O60A 3PBWA 3NGJA 2QCCA 1V7YA 3L0GA 3FYPA 2J88A 3HGSA 1AMKA 1GT8A 3NQ6A 5A8GA 1JQVA 2VXNA 3QRHA 2RDTA 3W7HA 3KX6A 2P1FA 5DY3A 1J5TA 4NXKA 4CNNA 1I8JA 1TV5A 1VCGA 4JX4A 3TU9A 4RZ4A 5F1VA 4CQ8A 3LCGA 4ORIA 3O1NA 5HMSA 1WOBA 5DN1A 3T55A 5FEXA 3LHYA 3C2EA 5I3FA 5C5YA 2FPYA 3W7MA 4LOCA 1OVDA 1ZFJA 3VFLA 5F1UA 1O4UA 4QJ1A 3G22A 1G7VA 4HKPA 4IMDA 5I3GA 2V0TA 5C54A 1CW2A 4BF9A 3LLDA 2BZNA 5F4XA 2PE4A 3HG3A 1TIMA 1HFBA 3M7WA 3YPIA 5D03A 1XFBA 3CHVA 1OFPA 3MI3A 3QFEA 2GQ9A 3SFKA 4IX2A 3UWWA 5FEWA 1MZHA 4PC8A 2BTMA 1ZAIA 4BWLC 3QF0A 3M43A 3NAVA 3BG5A 1Z41A 5AYYA 3QJAA 2VFEA 3LCHA 5CPOA 3TFCA 2A7RA 3UYCA 4KKXA 3Q58A 4H3DA 4NVTA 4A29A 1FXPA 1QOPA 3W83A 4NJHA 3GXNA 4N2YA 3BG9A 4ZQOA 4PEKA 4TX9A 4X9SA 3MP4A 3PG9A 1EWDA 4POCA 3TSBA 1SO3A 1GG0A 4EF9A 3L5AA 4XBKA 4RX0A 4FHAA 4IX0A 4I9AA 3ZS4A 1HO4A 3DI1A 3TR2A 3DGRA 1GJPA 4OGZA 4GUGA 5K4XA 4A21A 1QO2A 3LXBA 5G1TA 1SZNA 4JIPA 1H7PA 2VEMA 3LLFA 4M5PA 1FWWA 1RZMA 4FX8A 1RQHA 3DKJA 5F4SA 1VLIA 4PL1A 4WY0A 4K8EA 3S1VA 4Z1AA 4O15A 1O5KA 5F2MA 5AYZA 1FDJA 3M5ZA 2VELA 3M6YA 2ATMA 4Y96A 2NUWA 2EKCA 1FQ0A 4LTSA 5EMUA 1XDMA 3NQAA 3P61A 3W75A 5KITA 2A1YA 5SWUA 2JKAA 1JCNA 1H5YA 2PC4A 3EWXA 1LP6A 1GVSA 1W3NA 2ZA2A 3NPVA 2Y88A 2G97A 1TMHA 2NWSA 5HWJA 4MFEA 2NX9A 4O50A 4MVAA 1LLWA 5CPLA 1A5BA 2QF7A 2EPHA 4RCXA 1YTKA 2YR1A 3MBFA 1KV8A 2X2GA 3EB2A 1W31A 1KFCA 4FNUA 2HTMA 1I2RA 3ABRA 1S5TA 3KVMA 2B7QA 1UJPA 3W85A 2DP3A 3T78A 4JDBA 4QAIA 2W79A 3HG4A 5G4EA 5DLCA 4O54A 2E6FA 5G2WA 1B57A 3M47A 1F05A 4JNMA 3BV4A 5AC7A 3FYOA 5BMWA 1SR9A 2QUUA 3G3MA 1KFLA 1SZEA 2CLHA 1T99A 3G3DA 4UTJA 4UFMA 4NNAA 1W0MA 2OMAA 3E9AA 2DZPA 4JYDA 1H61A 2ZZ3A 3TCEA 1TTIA 2FFCA 3GDRA 2ATSA 4LC8A 3GDMA 4DO6A 3BLEA 4FB7A 3HMJG 1E51A 3LHUA 2FJKA 3L5LA 1W1ZA 2CZFA 1GTHA 1TPB1 4ZQPA 1TPVA 3S1WA 4O11A 1HTIA 1OG0A 3LCIA 4JTJA 3KRSA 1QPQA 3TFXA 2YCEA 1VHNA 4IMCA 3L21A 2A7PA 1C9DA 4C1KA 2VENA 3LCXA 3R12A 4YCPA 3RU6A 1W37A 2VFGA 5AHNA 2CFFA 5E93A 3NO5A 5D30A 3P62A 4E2DA 2ZYFA 1H51A 1LOSA 3S6DA 3IIXA 2NWRA 1W5OA 3F4NA 3BGJA 2YW4A 2ABAA 4UUIA 1QMLA 5D2TA 1EP1A 3S1XA 2C15A 1EP3A 3W7GA 3HF3A 1XXXA 1QAPA 2PURA 3W2NA 3FFSA 5L6UA 1W56A 2CLKA 3SI9A 4YMZA 3OBKA 4JIQA 3G8EA 5DCEA 1DORA 3Q2DA 3FJ6A 4ADSA 5DBTA 1OFQA 3F1QA 3TKFA 2QJHA 5BMXA 2GQAA 3TA6A 3CTLA 5AN7A 1SW0A 3EEGA 1IXOA 1H7RA 4WD0A 1WYIA 4LY8A 3MHUA 1XM3A 1G67A 3P60A 3LOTA 1AL7A 3WK3A 1BTMA 4YLWA 2NX1A 2ZRZA 4NXSA 3TAOA 1T96A 4NT0A 3QH2A 2QR6A 3B0UX 4JTIA 3R13A 4O19A 3P74A 3N73A 2NXIA 2XN2A 5CZTA 7TIMA 2PCQA 1X1OA 5DBUA 1QPNA 4S1FA 1QPOA 4XWUA 1F5ZA 1G6CA 4NX0A 2QCNA 5FESA 2V5LA 3TXZA 2WJZA 2QCGA 1TPFA 2B4GA 2QCHA 3LCFA 1LRNA 1KM4A 2Y63A 3UWQA 5GVJA 3ATYA 1VQTA 4HSNA 3ABQA 3PUEA 1BKSA 4BFAA 1N8FA 1TV8A 4LT9A 2ZTJA 4Y6GA 4UFHA 3MI6A 3B4UA 1XCFA 4QQ3A 1TREA 1WXJA 4XZ9A 4WY0B 1FCBA 1ZAHA 3MI2A 3GYEA 1ML1A 1TTPA 4ZQMA 4LVDA 2ALDA 4XTIA 4IUOA 4UTWA 4LV4A 2RHGA 4N4PA 4IXXA 1HG3A 1C8VA 2BSLA 1EB3A 1NFBA 1M7PA 3LI0A 3MP3A 3DHDA 3L65A 4AAJA 2OT0A 3DI0A 4J9JA 4JY8A 5MHBA 4AF0B 1BWKA 2GJNA 5C6MA 5LNWA 1TJPA 2WNQA 3W86A 4CQAA 4UNLA 1GYLA 3PUOA 4Z08A 4CLMA 4RR4A 5D32A 4MLJA 5G5IA 2YYUA 2A85A 4LVGA 4MYXA 3BW4A 4DF0A 3T40A 3RLVA 1LLZA 4N9DA 3UPWA 3W7RA 3INPA 3LRKA 4IMGA 2ZZ4A 1VCVA 1RPXA 3LX9A 1KBJA 1DBTA 2WNNA 1TPDA 2JGYA 1YADA 4M6PA 4JY9A 4OT7A 3LM7A 3DBPA 4KWWA 5FEZA 4I7UA 3HPZA 3O07A 1YDOA 3OHIA 2CLFA 2Q8ZA 3LTPA 3GR7A 3N2XA 1KFKA 3E02A 4AH7A 3B03A 1HO1A 5K9XA 3NQGA 5HNRA 4DPQA 1FCQA 1TJRA 1EUAA 1YDNA 1KM2A 2CLLA 3BG3A 4PFMA 2GJLA 3JRKA 4FEZA 3CEUA 1ME9A 4DBDA 2FQIA 3DH7A 5F2GA 5G1YA 3F4WA 4LRTA 1K3UA 4JICA 3SGZA 4K7VA 3TXVA 3VI2A 3DFTA 2J6XA 2WKJA 2A6LA 1GEQA 4WXZA 4UMBA 1LBMA 3S0CA 3QPZA 4CCDA 3SZ8A 2R14A 3SIZA 4MYAA 2B7NA 3GAKA 3WJXA 2WSYA 2AQWA 3NPUA 3R5EA 1SUXA 3PG8A 4UFLA 3RMJA 4FXRA 1ZALA 3IIZA 1VHCA 4LNYA 2ZRYA 4LV9A 3A5VA 4TIMA 2ABBA 3W7IA 1K7XA 4MZYA 2FB3A 2QAFA 1EX5A 1XBVA 4AWUA 3TV8A 1Z44A 3TQ0A 2LLEA 4MLRA 3W7OA 1H1ZA 4ZQCA 1DV7A 3LB0A 2G96A 2FB2A 3GKAA 2GVJA 1ALDA 4K36A 1P0NA 3O6DA 1K03A 5FF0A 2CLIA 1EUNA 4R7JA 1Y0EA 3NM1A 1H50A 4YL2A 3GIYA 2V82A 3C56A 3G1FA 2V30A 4O1BA 2V8ZA 1L6WA 3C8FA 3NG3A 3FJLA 4EIVA 4UTIA 4Z1CA 3C0JA 3W1RA 2ZDRA 3DENA 2UV8G 4Q4KA 4JYFA 2CLEA 3WJZA 4RJEA 1OYCA 4BI5A 3L0NA 2GVGA 3BLIA 1MO0A 5DCBA 3PS7A 3KVKA 4O18A 1KTBA 2NXGA 1TYGA 4O1AA 1L6YA 2ZA3A 4OQVA 5EYWA 3CLMA 4EF8A 3IIPA 3OIXA 2QDGA 4Y8FA 1OYBA 1FCUA 3FKKA 1VYPX 1RD5A 3LTYA 3UWUA 1RQEA 5CKSA 1FY6A 1NEYA 3NA8A 4QNEA 4JTFA 2V2DA 3PB0A 1DJQA 1I4NA 5D02A 4H6KA 1MEWA 5H91A 4UTLA 3TNOA 4LVBA 3M0ZA 3N9SA 3NQ7A 4JXCA 3LCWA 1LYXA 4UMCA 5D2YA 1TB3A 4NU7A 1GZGA 2QDHA 3W7KA 3W70A 3GVGA 3L2IA 3S5ZA 1KA9F 4WJEA 4I7WA 3FOKA 5K3VA 3G1YA 1YDVA 5E0KA 5HJLA 4O13A 4UTWC 3KRZA 1IF2A 3TQVA 4JDYA 3LHWA 1P5BA 2V2HA 1ME7A 1ZY9A 3OG3A 3UNDA 1F6KA 2E77A 4O14A 3JS3A 4NUWA 3CEPA 3FIGA 4OBTA 5CZ0A 1OK6A 4RXFA 1I2OA 5G2IA 4UNKA 3W74A 2EF9A 2OZ0A 3LV5A 1TRIA 8TIMA 3IGXA 4NQ1A 3DFNA 3UWZA 5HWMA 2CLOA 3W7CA 3EWYA 5D38A 2Y7GA 3C2RA 1O94A 1EA0A 2VOMA 4HT3A 2WSQA 5KSWA 2Z2UA 4GUIA 1YPIA 4Y90A 5LGZA 3O15A 4GFSA 4N4QA 1W5PA 3LCLA 5AC8A 1VC4A 5C55A 4JR5A 3UPBA 1ICSA 4ZQNA 3SW6A 1P4CA 3TC6A 3QSRA 2VFFA 1Q6OA 4LS0A 1KTCA 2P10A 3VE9A 1D9EA 3SECA 3UWVA 4PA8A 1DQWA 4XTDA 5F2IA 1YTDA 4UTUA 3UZJA 3N34A 3BO9A 4BR1A 3KVLA 2Z6IA 5I3KA 3S1UA 3HG5A 3QQ1A 3W2KA 4LVAA 5AC6A 2XFWA 4JN6A 3ELFA 4MPQA 1KM0A 2YW3A 3TX9A 3EX4A 4IJBA 3MYPA 3O16A 3WJWA 2I1OA 2QCFA 1IXQA 3A21A 3IIVA 3SJ3A 1SFLA 1X8FA 1DJNA 5IM51 1A50A 1PVNA 4NNCA 5KZDA 4UFKA 1G4PA 1AW5A 1SW7A 1QWGA 4O4VA 4MOZA 3LERA 3RK8A 1YLVA 4D2JA 1I2NA 1XBXA 2NUXA 2NZLA 3EXRA 1UBSA 3NPXA 4LWWA 5FI8A 4MY1A 5KTLA 2E5BA 3N9RA 3C6CA 3LRMA 1M6JA 2FLIA 1VZWA 4NJJA 1JCMP 4O17A 1H60A 4LU0A 4IXHA 2Z6JA 3W1QA 1JUEA 2O7SA 3G1XA 4DO5A 3EX1A 2WOQA 3BLFA 2E5CA 4E38A 3WK1A 4ML9A 4FNSA 4OV9A 2C1HA 5HR7A 3E96A 4IMEA 2FDSA 5DELA 2H3BA 2DU2A 2QCMA 2E6YA 5IBXC 3TUUA 3P81A 4O0ZA 1FBAA 2F7FA 2Y89A 3HBLA 5LSMA 1S5VA 4WXYA 3CU2A 4DXVA 1RR2A 4UXDA 3P67A 5HINA 3W3OA 2TRSA 3F03K 4PTNA 2H3DA 3W2UA 3OVPA 3K30A 3NXFA 2DJXA 3OA3A 1R2RA 2ZZ7A 5CZSA 2X30A 1X1ZA 1D3HA 2FIQA 5K4ZA 2C0AA 2VFIA 1XKYA 3ZWTA 3L67A 1LBFA 2ZZ1A 2YX0A 1LOQA 2TYSA 2ZTKA 3GDTA 1JR1A 5I3IA 2E6AA 2DZUA 3O6YX 1KV5A 4IPIA 2QCLA 4AWTA 2J9XA 1FX6A 4AXKA 4M6VA 1Q6QA 1RVGA 4YCOA 5K9CA 2GVLA 3PSVA 3CIWA 4A2SA 2Q3OA 4A3UA 2WSRA 3W07A 1IIGA 1LM1A 4TU1A 4BI6A 1NF0A 3NL5A 4ORMA 5AHFA 4UTKA 4M7TA 1KBIA 3PC0A 1GVFA 1L6SA 1EWEA 3IIOA 1IXPA 5F2LA 1TQXA 3TE9A 2HS6A 2TSYA 2CZ5A 2J9YA 3KVJA 3M16A 3NL2A 5BRBA 2C13A 4MZ8A 3PY2A 1UB3A 4GNJA 1SU5A 4K6AA 1LRTA 2DZXA 5D2WA 2QAPA 2C16A 4JTSA 1I45A 1R2TA 3GK0A 2PRHA 3LHVA 1DVJA 4IGHA 1K8XA 4JX6A 1XBZA 2Y61A 3FA5A 3P80A 2VFHA 2NV2A 2E09A 4QNWA 3Q94A 5AB3A 2OX1A 1VR6A 4TR9A 3CT7A 3NZ1A 3R89A 4O12A 1YTEA 2ZRWA 3MO7A 2A0NA 4N9BA 1WOAA 4JTLA 2WO5A 1JUBA 3QYQA 5LNRA 3W6YA 4FNRA 1JUKA 3UQNA 3QW4B 3GLCA 4AB4A 1XI3A 3EWZA 4GRSA 3WK2A 3BVJA 5CSRA 5IBXA 3T7VA 3GKFA 4Z1BA 2RDWA 3MJYA 1GTEA 3U2OA 1H63A 2NX3A 4L4LA 1NAL1 1P0KA 1G4TA 3T4CA 5LKYA 3QSTA 2A6NA 2FPVA 3NL6A 2HMCA 2JK2A 2BLEA 3W1UA 4AHOA 1A53A 5HUOA 1QO5A 1OF8A 2NUYA 2XN0A 2ZFAA 2ISWA 3Q37A 3CB8A 1LTDA 3NNTA 3MYOA 2DZWA 2QJGA 2J24A 3BK0A 1WA3A 3GDKA 4LUJA 1KM1A 3AO0A 4ADTA 4KFNA 1JQXA 4N6EA 4XKYA 4ZL1A 3UY7A 4X2RA 4QM1A 1J4EA 3DFPA 3EXSA 2AGKA 2Y6ZA 1EEPA 2E68A 1A5SA 4NNBA 1SZGA 3PM6A 2Q3RA 3W2JA 5KINA 3B0PA 4DBEA 1FDZA 4K7YA 3PBYA 4R53A 2IQTA 2Z0IA 3PVFA 4XQ6A 3MBDA 3USBA 1R30A 3UWYA 4JD4A 2TPSA 4UCGA 1ONRA 1QR7A 2YDAA 4K37A 4PODA 4GUFA 3W9ZA 1X6UA 4XKYB 3W1XA 1PS9A 3NQMA 3W71A 3I7SA 4JS3A 4Z0JA 3LXAA 1GG1A 3PULA 3C2OA 1KLYA 3W1TA 4JEQA 3IGUA 1XC4A 1K7FA 3G0SA 3M1ZA 4LVFA 3CC1A 1OABA 4DO4A 5HUPA 4U28A 1VYRA 2YPIA 2R8WA 1R46A 4N9EA 2JGQA 5FF3A 1GPWA 2ZRVA 1XL9A 3IVTA 1AW2A 2A5HA 2BX7A 3W23A 3PR2A 2OJPA 1O5XA 5L9FA 1P1XA 3VKJA 3RNDA 5FF2A 2Y70A 3R8RA 1UASA 4ALDA 3WJSA 2HSAA 1ICPA 3V1PA 3KAOA 2GOUA 3B8DA 3C52A 1G69A 1EP2A 3HG2A 1I2PA 1SO4A 4K38A 1PHWA 3BPWA 3MP5A 4BWLA 3UY8A 1PL9A 2G5WA 3LBCA 3NDOA 3M5VA 3U6WA 1S5WA 2ZRUA 5CSSA 2ZA1A 3B05A 1DL3A 4RZ5A 1W3TA 5EKYA 2WQPA 5K9DA 2RFGA 5LZLA 1B4KA 1ZJIA 3P8IA 3RF9A 2J27A 4O10A 3EWBX 3LGEA 4MY9A 3WJYA 4EVZA 1H7NA 4G1KA 3P8JA 3N2MA 1TTJA 5DY2A 1N55A 2F84A 5BW6A 3QMSA 3G8RA 4Q33A 4TO8A 5TBOA 3MMTA 3STCA 5KZMA 4QITA 2VC6A 3PF3A 4JTKA 3EKZA 5DCDA 1VRDA 5AHEA 4UIOA 3NQ8A 3DXIA 3A22A 5CG7A 4UFJA 1LCOA 3I65A 3TW7A 4O57A 5K7JA 3TJXA 2DORA 5BNKA 3G18A 3L66A 3P84A 5AFDA 3B06A 3U8GA 3IGSA 2YSWA 1FXQA 1FDYA 4LRSA 1FUYA 3W7LA 1XBYA 4Q32A 4UTHA 4AHQA 3DU0A 3NQ2A 3CPRA 1SPQA 2C6QA 3LRLA 3G1HA 2VFDA 3EKLA 2J9ZA 3M44A 1F73A 3WK0A 4N9CA 4GC4A 4O8RA 2WNZA 4GWEA 3A9IA 4S2CA 1M7OA 3S5NA 3TAKA 1L9WA 5BOOA 1VS1A 1DHPA 1YXYA 3HIJA 6TIMA 3MHFA 1GQNA 2CLMA 2V5BA 3KRUA 2RDUA 4XBSA 3HB9A 4O1CA 2PRLA 4M6QA 5DXXA 1OJXA 5EBUA 1F76A 3HO8A 3W1PA 1C29A 1YPFA 3QZEA 4NJIA 5D04C 4GJ1A 4FF7A 1OYAA 1OFAA 4JX5A 4MY8A 4ZVJA 1VLWA 4DF2A 3DHFA 1NVMA 4IMFA 3H53A 1GYNA 4WZHA 4UC5A 2EAWA 3S9YA 1F74A 1GVRA 2QJIA 1J2WA 4MUZA 5U7SA 1OFRA 4FIQA 4X22A 3GZ3A 5HR6A 1W5QA 3I6RA 5CGQA 4ZZ9A 2W6RA 4JTTA 2I9EA 4IWWA 1IXNA 1YYAA 3SR7A 1ZAJA 4AEOA 4HSOA 4DELA 5KZEA 4HNVA 1GWJA 3STGA 4M7SA 3C3NA 1B3OA 3M5YA 1FWTA 3O05A 4HIBA 4PL2A 3RLUA 3KXQA 1QPRA 1JVNA 1N7KA 3E12A 4NZJA 1I2QA 3FLUA 3NZRA 5KMYA 1JJKA 4AMAA 1VGAA 4P2VA 5CPMA 1XUZA 1ZHAA 3QMRA 3A23A 4O1DA 3L5MA 4Y9AA 1KM5A 3L9CA 3L68A 3W87A 3CM4A 5LNVA 5D2VA 1QOQA 2C3ZA 3SSJA 3WFAA 1SO5A 2YFNA 1JCJA 4LUIA 5CPNA 3M5XA 1LBLA 4OHQA 1D3GA 1KW1A 3H54A 1WBHA 1R2SA 1KFEA 2ZBTA 3PAJA 5A5WA 1A5CA 1LDCA 1DKWA 1KFJA 1T0OA 4MIMA 1GOXA 1VCFA 1AW1A 1PHQA 3GDLA 3STFA 2OT1A 1TSIA 4Z1DA 5HQEA 3ABOA 4H4IA 3GXTA 2EHHA 3TMLA 5F4WA 2Z1BA 4EOUA 4N6FA 4TMBA 1A5AA 3NQDA 4K8HA 2D73A 3NYZA 5DXYA 1ICQA 1IIHA 2X16A 2ZZ6A 3IVUA 1F2JA 4R34A 3OEXA 5CZJA 3W1NA 2GPTA 2W0UA 1CX9A 3LDVA 1K02A 3D0CA 4CCCA 3VE7A 1PE1A 4JTEA 1NSJA 4ADUA 2B7PA 1LOLA 2ZZ5A 4WUIA 4FNPA 5FF4A 3KHJA 2X1RA 3KFTA 1L2UA 4O4WA 2C18A 3SY5A 3G1VA 5E1QA 4UTTA 1KFBA 3I7RA 5TIMA 4CNOA 4OWGA 1SSDA 1QFEA 1TRDA 2E6DA 2ZRXA 4IQLA 4RLIA 3EWWA 1WX0A 2A2IA 1SQ7A 2GQ8A 1RQBA 2A4AA 4ZQRA 3W88A 5AHLA 3RFAA 3EXTA 1W3IA 3MHGA 3HQ1A 3NOEA 1OFBA 4RZ6A 3IVSA 3N19B 1MSSA 2V2CA 3UZ5A 3ANYA 1VJIA 1KM6A 1TPH1 1VYSX 2H6RA 2Y7DA 2YFOA 1HUVA 1TO3A 4WOZA 2QCDA 1OHLA 3QQ0A 4HPXA 3TROA 4ZMGA 2ZZ2A 4DPPA 2R91A 1TTQA 3PBVA 4GXMA 1KTNA 1FWRA 4OU1A 4RKAA 1S3HA 5J5RA 4K39A 3OVRA 3LHZA 1PCWA 5EA9A 2Y85A 1G7UA 3ZWSA 3GNDA 5C2XA 3ZR4A 1K7EA 1H7OA 1AG1O 5G2HA 3GNNA 3W1AA 1CI1A 4OE7A 1B9BA 4KFOA 4O16A 4LW7A 2C14A 1WQ5A 1XDLA 1JULA 4QISA 5LNSA 3EWUA 2OCZA 3B0VC 1H7XA 3PWAA 1V5XA 3VCRA 1ZNNA 2BXVA 3LI1A 4RV8A 3T44A 4AWSA 3W1LA 1ZENA 3W7EA 3G1AA 3C2FA 3SGUA 3EX2A 2JKEA 2X1TA 3PBUA 3S42A 4WX2A 2E5DA 1WDWA 5FEPA 1F7BA 1UUOA 4HNNA 5D33A 1M5WA 1MXSA 5D37A 3S5YA 2DZTA 3GXPA 3STEA 5EY5A 4O52A 4JTGA 1TPWA 3NQFA 1QDSA 5EPDA 4CNPA 1W8SA 3CIXA 1TPUA 5LGXA 4A2RA 4L4MA 4QIUA 2EGZA 2Y7FA 3THQA 3W73A 1KM3A 3GR8A 4IOTA 4FNQA 5D09A 3N14A 1WAUA 4KWVA 3BW3A 3DFOA 5AOUA 1U83A 1TQJA 1THFD 2YGYA 1OF6A 2DZVA 4U4MA 2VEKA 3O06A 3UXDA 1KLZA 3HOJA 1UUMA 2RH9A 5LHFA 4LC6A 3CWOX 1H1YA 4YWIA 3G1SA 3E0IA 4XUGA 4HN4A 4EWND 1QCWA 1UCWA 3TQKA 1G4EA 4BK9A 3LTSA 1W5NA 2R94A 3NQEA 3ZFHA 3W7QA 2YXGA 3OVQA 4QSHA 4WY0F 2WV8A 3FEMA 4JYEA 1GVQA 3BW2A 1Q6LA 2QCDB 3TMQA 2CW6A 3G1DA 4FNTA 2VKZG 3QM3A 1Q3NA 3NVTA 3A24A 4JGDA 2CZDA 3VNDA 2CZEA 1VPXA 4FXSA 4AHPA 3NQCA 3C2VA 1MEIA 1SFJA 2Y7EA 4B5NA 2BWGA 5LNUA 2VEPA 3P5ZA 3QEZA 4BI7A 3ATZA 3W76A 3LXCA 3JR2A 1SW3A 3TSMA 4KFPA 3LHTA 4WOQA 4UMAA 3QMTA 3TW6A 2CU0A 2CWNA 3PUDA 4ICNA 3P7YA 2YYTA 3G0UA 2ZCGA 3W7DA 1OX4B 4GUHA 3NM3A 4LS2A 2B7OA 1PIIA 4O28A 4HHPA 4NJKA 2NXHA 3G0XA 4PCFA 2PRMA 2NV1A 2VEIA 2O7QA 4MZ1A 5AHMA
chains in the Genus database with same CATH superfamily
4LAOA 4ERGA 2E1DA 1A49A 3TJLA 1XICA 5BXRA 4MKNA 3ITCA 4V1YA 1U5VA 1PYMA 2YZRA 4NG3A 5FOOA 2OX4A 1ISYA 4NYUA 4DNHA 7TAAA 1D8CA 3TIMA 1CWYA 1FWSA 3SCWA 4A8IA 3KE0A 3TYBA 3LZ5A 3THAA 2RJGA 3I4EA 3WF0A 1Q66A 2GUUA 4NYYA 3FKRA 4ZR8A 4L1WA 4FXJA 3W2LA 4KRTA 3SN0A 1VRXA 2ZXQA 2W62A 3K46A 3OLIA 3PZVA 5T26A 4IP4A 2DGAA 1RV8A 4P7NA 3PWIA 3QPYA 4XAYA 4S2BA 3URAA 3EYPA 3TC7A 1R47A 2QKFA 1GQLA 3A4JA 4M19A 3G24A 1VIWA 4AZCA 4DEFA 3GUGA 1TWSA 1VFSA 1YXDA 3BLOA 1H62A 1EO5A 3HJZA 1Z8AA 3H2EA 1OFDA 4QE1A 2WVSA 4JL2A 4PH6A 4LS1A 4ML4A 3M0XA 2XDFA 4LAUA 2INEA 4PSRA 3ALGA 3L0KA 1R85A 2WCGA 2Q8LA 1K8YA 3OBAA 3TSDA 1CT5A 3BURA 3GH5A 2PAJA 4MG4A 1WV2A 4PSPA 3WBAA 4YPJA 4DJDA 4PCSA 3HGRA 4EAYA 5LXXA 2YBTA 1UKPA 5I3HA 3V3WA 5CXPA 1KGXA 1XH1A 1SJBA 2OQLA 2Y4SA 4ONVA 1Z7AA 5A6MA 1BG4A 3SDOA 3GB6A 4ROQA 4MM1A 5FL0A 5CBBA 4WDUA 4AVFA 1QI3A 3CBWA 3UR8A 3W29A 4AF0A 4UBPC 3A5FA 2VYOA 3HJEA 3OVGA 3P5YA 1TR9A 1E1CB 3G77A 4PB5A 1BEUA 6A3HA 2GZXA 4GQQA 4ZCWA 4WJ8A 5ABTA 2H8ZA 3WQ8A 3RO8A 3ZO9A 3KBWA 1TV7A 1K70A 2H90A 4YHEA 2TMDA 3MUZ1 1DOSA 2ICSA 2BGNE 4CCEA 2DZSA 1Q45A 1EA9C 1F3TA 3RN6A 1Z69A 3GU1A 3FAWA 1HN1A 4QJ5B 3EX3A 4DN1A 3EDEA 4I7VA 2V67A 1SZFA 1MFVA 3KBJA 1PJ9A 3VDGA 2PUZA 3W1MA 3B8IA 4FO4A 4QG8A 2OWXA 2E8YA 2P0OA 2BXZA 2JBMA 2AAMA 3EDDA 9CGTA 2C19A 3MC5A 3KOFA 2PWDA 2WPBA 2WWDA 4J3UA 1H4PA 4KS0A 3A64A 3CUIA 1WO2A 5CPTA 1NDZA 4PUDA 1O60A 3PBWA 3SCNA 5BZAA 3L0GA 3FYPA 5FJIA 1AMKA 1HJUA 2HJPA 5BOEA 3N2OA 3LLXA 3UZXA 3N4AA 2R1KA 3W7HA 1UP0A 1B3YA 2TAAA 4OOUA 3AUJA 2DIEA 4NXKA 3ZQ9A 2FZBA 1XIEA 3TU9A 4RZ4A 2XH4A 4ORIA 3SN4A 4I5RA 4IQDA 4AZ6A 4B5XA 4D8ZA 3HQOA 3NSMA 1OVDA 4LAKA 4XO7A 1RP9A 2HVNA 4QJ1A 3TTOA 3CHEA 4IMDA 5DFAA 4FLSA 3LLDA 3M07A 3HFTA 5F4XA 2OR2A 5LYRA 1OADA 3VINA 1ZPTA 1ZJBA 3UGRA 3MI3A 2YCJA 3EDKA 3WLMA 3ARZA 2F6UA 4Q4QA 4Z2LA 2CEQA 1ZAIA 5HMFA 3RRXA 4QX4A 4XVEA 2BDQA 2QNEA 1UQYA 2A7RA 2J7HA 3DFYA 4A29A 2NT0A 2X7VA 4X9SA 3PG9A 1EWDA 3MMWA 2OTDA 1HT6A 1DQUA 2HE5A 3WH7A 4AISA 1GG0A 1XIMA 1F8IA 3CQIA 4AFYA 3JZEA 3DGRA 1I60A 1AA1B 4JHZA 4OGZA 2V63A 1QO2A 5G1TA 3GNOA 4PCNA 3A12A 3OGSA 4WY0A 4K8EA 3S1VA 4O15A 3L4ZA 4RDZA 2GGGA 3AMDA 3M5ZA 2VELA 2NUWA 4EANA 4LTSA 1XDMA 1ZLPA 2Z25A 2GSEA 4C6JA 1QNOA 5SWUA 1V8EA 1W91A 4JFSA 3H4WA 3AHXA 5DANA 1T6MA 1RCQA 1E4NA 4GZ7A 2G97A 2NWSA 5HWJA 3ICJA 4MFEA 1XIBA 2BODX 1LL4A 1DJXA 2H9AB 3ARWA 2YR1A 2X2GA 3UF9A 1XW8A 2HTMA 1I2RA 4OOZA 4JDBA 4F8XA 4R7WA 5H8UA 5G2WA 4DZIA 2ZIDA 3BV4A 3O2LA 5AC7A 3FYOA 2QUUA 1KFLA 4DZ5A 2ALRA 1T99A 1XGDA 4UTJA 3AIRA 4C6FA 4NNAA 1O5RA 4RDVA 3QZ6A 1Q2SA 5HBFA 4IFKB 4Q8MA 2ZWYA 3SRFA 2PCEA 4G2DA 1R7OA 4MTVA 2JF7A 2ATSA 3M0KA 4DJFA 2YXOA 2O0TA 3BLEA 1LWIA 4FB7A 3HMJG 3LHUA 2FJKA 2CZFA 1TPB1 4ZQPA 1TPVA 5HJXA 1Z6KA 3KZSA 4O11A 3KRSA 5C7VA 1PKNA 4B4FA 3H2AA 1D7KA 1V6YA 4IMCA 4M29A 4C1KA 2PBOA 3LCXA 4LB4A 1J5SA 2EKGA 2OWWA 4E2DA 2ZYFA 1H51A 1LOSA 5JIPA 2YW4A 3SJNA 1RJQA 2JEQA 3WZ0E 3W7GA 2GGIA 3HF3A 1XXXA 3MSYA 3W2NA 3BAJA 4P7QA 2R9RA 1K8CA 4U3CA 2P8CA 1M01A 2CLKA 4GPNA 1CNVA 3Q2DA 2VQTA 3FJ6A 4B16A 4AU0A 4GYPC 3F1QA 1AFSA 1XYCA 4IGNA 4MPKA 4B5WA 2GQAA 3CTLA 2O56A 4IIEA 5AN7A 3TOPA 3WBXA 4HNCA 3MHUA 1G67A 2ZRZA 3CNYA 4Q3MA 4QXIA 4ZE5A 3NFUA 5CZTA 5GNYA 3M64A 1E15A 1PXGA 1QPNA 5JUVA 1QPOA 3VXGA 1G6CA 3ITYA 5J04A 4HP5A 1KC7A 3REQA 2DT3A 2WJZA 1JI2A 2QCHA 1LRNA 1KM4A 3KW3A 1UZ1A 4W88A 2XUCA 4A4AA 2DT0A 1EF3A 4HSNA 3ABQA 1L0PA 1DIEA 1HJQA 1TV8A 4ZO6A 2Z2AA 2HPIA 3AWNA 4UFHA 2QMJA 3MI6A 1V6TA 1UP2A 4QQ3A 4WY0B 1FCBA 1W9BM 1XIGA 3PFMA 5FKYA 4E5TA 1U1JA 5E9XA 1TTPA 4JTCA 3I6EA 2ALDA 4GJIA 4WKFA 2WZHA 4TQTA 4N4PA 3EA3A 2WCSA 3GNXA 2ACQA 3VIPA 4AW7A 4QRNA 2OT0A 3DI0A 4JY8A 1UZHA 1BWKA 2WZTA 4GA8A 4GC3A 1VFOA 2DIKA 4H7VA 5LNWA 2WNQA 2XFFA 5I24A 2AL2A 4RR4A 2MANA 2A85A 2YL5A 4MYXA 4DF0A 5EU9A 3T40A 3QHOA 4WRHA 3UPWA 3INPA 3ENLA 2ZZ4A 2G3FA 2WNNA 5JBEA 1YADA 3AS0A 1C7SA 4O8AA 4MWAE 2FZMA 3T8QA 4R5EA 2FHBA 3LUTA 1EQPA 5AY7A 1JPKA 2OEJA 1SR0A 2FGBA 1JGIA 5E70A 3CHDA 4AH7A 3B03A 3VNLA 5IOBA 4DPQA 1FCQA 3TTSA 1TJRA 7ODCA 1KM2A 1S2UA 3BG3A 4PFMA 2GVYA 4X63A 2GJLA 3JRKA 1PX8A 4BCEA 1ME9A 5F2GA 3R1ZA 1DWFM 5G1YA 2VEGA 4M51A 9XIMA 4PMXA 4ZXLA 1K3UA 2PDUA 4JICA 1BFNA 3IJ8A 1IZKA 1EEXA 2J6XA 2A6LA 1GEQA 5I78A 3S0CA 3R6IA 4CCDA 4PMJA 3SIZA 3HFYA 4G8TA 4D6JA 3A4AA 1Q4NX 1Z3NA 2HNHA 3BOFA 1M7JA 1F3WA 3CL6A 3NPUA 3R5EA 1TR1A 5DX7A 1ZALA 4QCEA 4ATLA 3CZLA 4KT2A 3A5VA 3SRKA 4IF2A 3W7IA 2Y24A 2PTWA 2HXTA 3K1DA 2AQOA 3H22A 4RE0A 4ZQCA 2FTYA 5DT7A 2C79A 1ALDA 2OLSA 2B31A 1P0NA 1GVEA 1E4LA 3EEZA 2V82A 3G1FA 2E28A 2V8ZA 1L6WA 3C8FA 3FJLA 4QDPA 4Z1CA 3W1RA 4Q4KA 3T4WA 2V3GA 2OWCA 3BLIA 3LA4A 4FR6A 4QS5A 2IKHA 3IK4A 3HQPA 2MNRA 3QLLA 5EYWA 4OQVA 1AJ2A 5BU6A 4QE4A 3OIXA 4F40A 2QDGA 5BWAA 3U48A 2D22A 4ZOBA 3FKKA 1VYPX 3TTQA 1RQEA 5CKSA 4QNEA 1E6RA 2GL5A 4IPLA 1IR1A 5HAOA 1GK8A 2R1LA 4LVBA 3M0ZA 4UMCA 3LCWA 1A0EA 1R3RA 1GZGA 3WF2A 4AZHA 1V3IA 2QDHA 3WF3A 5AVNA 3GVGA 1LUCB 3L2IA 4QLKA 1Q65A 1KA9F 2GGJA 3GBDA 2PF0A 1E6ZA 1QVBA 4M6UA 5E0KA 4DLFA 4I9JA 4UTWC 3L23A 4PUMA 4LB3A 3DC0A 1CCWB 2XINA 2D2JA 3UNDA 4O14A 1C92A 2NVAA 2OKOA 5CZ0A 3DBNA 2PGFA 1OK6A 2OKTA 5FJPA 3CAWA 4UNKA 3O0KA 1SVDA 4HYVA 3W74A 3AYSA 2WMKA 4F2UA 1TRIA 2JIWA 3IGXA 4NQ1A 1E5NA 1K9FA 3W7CA 4PRTA 3O3RA 5BWFA 1A5MC 1XGZA 1MNZA 1YPIA 4Y90A 3PBGA 1TUFA 4KPLA 5LGZA 4N4QA 1XR2A 3O0FA 3UPBA 1A5UA 4ZQNA 1P4CA 3VYLA 4HU4A 3TC6A 1B5TA 4A05A 3GM8A 1Q6OA 3SECA 4PA8A 1DQWA 1YTDA 4NSBA 5I3KA 5ABGA 3S1UA 4HMCA 5HQLA 3QPEA 5AC6A 3IAQA 4MPQA 3WDIA 1JXJA 4R85A 2I1OA 2Z1KA 3P93A 1ZUAX 3SJ3A 5CC5A 4ENLA 3CZKA 1X8FA 2YXXA 2WXDM 3PHAA 5IM51 1REQA 4NNCA 1XFCA 1G4PA 3C5QA 1QWGA 4MOZA 2P8BA 4D2JA 1XBXA 4PN2A 2NUXA 2NZLA 3TN5A 3VKKA 3WLLA 4LWWA 5FI8A 4MHBA 5KTLA 3C6CA 3LRMA 3KS5A 1AZ1A 1VZWA 3CL7A 1JCMP 4O17A 1H60A 2R1NA 4LU0A 4GYFA 4DO5A 3EX1A 1TVLA 2FZDA 2C1HA 1RBAA 5H6HA 2FDSA 3PPGA 1VBHA 1JF6A 3M0VA 4H7CA 1MDLA 5DELA 2H3BA 2XU2A 3IJ6A 8CGTA 5IBXC 1V0NA 3BJFA 4TX8A 3TWAA 1R87A 3U7BA 1XPYA 1S5VA 4C6IA 1NP2A 5DRIA 1R3QA 1DYSA 4UXDA 3W0KA 2TRSA 3WYZA 4GXWA 3F03K 2H3DA 3W2UA 4G7EB 3OVPA 2ACUA 1EO7A 3WLQA 2BHYA 3GD6A 1W2PA 2ZZ7A 3E0WA 1X1ZA 1FH7A 2FIQA 5T9BG 2PFHA 2HCVA 2VFIA 1XKYA 3L67A 1LOQA 4W8BA 3OBEA 1AD1A 2ZTKA 1JR1A 5I3IA 5REQA 3O6YX 1DJWA 1ZJAA 3MKKA 3NCOA 5AZ0A 2J9XA 2VUYA 3K8LA 5EMKA 1Q6QA 1RVGA 5K9CA 3PSVA 3CIWA 3V35A 4L5ZA 1E6XM 3VGEA 4LBSA 3NL5A 1AD4A 1ITUA 4ORMA 1RVKA 4XZIA 4HU0A 4DWSD 3WQ6A 1GVFA 4HA1A 5CLTA 1L6SA 4KGLA 3FXGA 4GI8A 1PIGA 2YB4A 4HSHA 1GKQA 3TE9A 5FAJA 1RJPA 4LYPA 2ODOA 3KVJA 3NL2A 2IPGA 2IKIA 3ZVHA 1WDQA 3TVAA 3PY2A 1SU5A 4K6AA 4HB7A 2DZXA 2XJ7A 1H2JA 5J8LA 2GDQA 5EMJA 1R2TA 4AY1A 3H7RA 1K8XA 4CUCA 4QQUA 3WD3A 3SCTA 5A8QA 2NV2A 2E09A 3Q94A 3WQWA 3WX7A 5AB3A 4H19A 1E56A 4TR9A 3NZ1A 1YTEA 3MO7A 2A0NA 4N9BA 1RLDA 1JUBA 3UJRA 3QYQA 5LNRA 2BY0A 4FNRA 1X97A 3BZJA 3GLCA 4KQNA 4D6CA 1T41A 3GHSA 3ZSTA 3USZA 2PDKA 3GKFA 1B3ZA 2GSHA 4J27A 3D3FA 1GTEA 4PTDA 1GZJA 3TWBA 4NZCA 4L4LA 1P0KA 2VD8A 1G4TA 3T4CA 5LKYA 2A6NA 4JIEA 2HMCA 5E6YA 5I06A 3FSUA 1A53A 1MUMA 2DDXA 2NUYA 2XN0A 2ISWA 4DWSB 3DESA 1PAMA 3P2VA 3GDKA 1GONA 4LUJA 3R8HA 3VOHA 4MGGA 4KFNA 4TX6A 4LXFA 3FNDA 1JQXA 2UZ9A 4ZL1A 3UY7A 3KS6A 2WYSA 2PLJA 3EXSA 1EEPA 2PI6A 1JYNA 3UA4A 3PTQA 5EGRA 4ZSTA 2YDRA 1P7TB 3U9IA 1AUSL 3W2JA 3WEOA 5CH9A 4XQ6A 1CBGA 2EXOA 3MBDA 4H00A 3RPTA 1R30A 1CYGA 3UWYA 1YMYA 2IPWA 2V38A 2PS2A 2TPSA 4JD4A 2YA2A 3EOOA 4DI9A 1BXNA 3PN8A 2JF6A 3NQMA 8XIMA 3W71A 3I7SA 3K13A 4JEQA 1XQKA 3IGUA 1DIOA 3M1ZA 4LVFA 3CC1A 1OABA 1FWCC 3FGCA 1JZ6A 4GVIA 1VYRA 4F0KA 3PZ9A 1R46A 3HZ3A 1KFWA 1XLAA 3U5YA 4BQ2A 1AW2A 3W23A 1ISXA 3BMVA 1BXBA 3RR1A 4UWMA 4D8LA 4QLJA 1TJ0A 3CLWA 5FF2A 3HN3A 3R8RA 4YTRA 3PFRA 3VNZA 1G69A 3EGJA 1MI3A 1PL9A 3NDOA 3M5VA 3RG6A 1S5WA 3ONBA 3AWOA 5RUBA 2QVNA 1GOKA 1IEXA 1E4IA 2RFGA 1B4KA 3DEQA 3RF9A 3ARRA 3ZXWA 3EWBX 4REQA 3N2MA 1TVPA 2QDEA 1FHUA 1N55A 3H2FA 3WQ4A 2IW0A 3QMSA 4Q33A 4C91A 1IT7A 3STCA 5KZMA 1MNSA 2VC6A 1EPVA 3PF3A 3VX1A 5LIXX 3T42A 4JTKA 1JZ3A 5DCDA 4HK6A 1VRDA 2FVMA 3NQ8A 3A22A 3E2SA 2XGIA 4UFJA 1SGJA 2NSXA 3WLKX 3TW7A 5E6ZA 3RITA 4OUIA 3CJPA 3CUFA 4UOJA 3GXFA 3UESA 1B9ZA 3DG3A 3G18A 3L66A 2QQ6A 1MQRA 3B06A 3IGSA 5I7GA 1POJA 1FXQA 4H04A 4LRSA 4DBSA 4KIEA 1OG6A 2I57A 1CLXA 2C6QA 1C8YA 3LRLA 3G1HA 4IIHA 3BH4A 2W91A 2J9ZA 2QUMA 1F73A 3EBVA 2DEPA 2P76A 2WNZA 4ZSUA 3LN3A 3TP4A 4BJHA 3BLDA 1VS1A 5BOOA 2ZDSA 4G1NA 4XBSA 4LUTA 1OGSA 5DXXA 3A9BA 2GWNA 5EBUA 3VD9A 1F76A 1O1ZA 4IL2A 1U1HA 1OIFA 4BY3A 2XYLA 1GYMA 1OYAA 1LQ0A 4BQ5A 1VLWA 3TYUA 4DF2A 2QT3A 4K3ZA 3H53A 4UC5A 8XIAA 4HZ7A 5A6KA 1J2WA 4MUZA 4DHGA 4K68A 1XPGA 4X22A 3GZ3A 4C7FA 4CN1A 1JDEA 4AWEA 4P7OA 5CGQA 9RUBA 2NQLA 4JTTA 2I9EA 1ZBWA 2ZXBA 1EH9A 3BL3A 1YYAA 3OZYA 1WZLA 4YTUA 2DSUA 4DELA 1XQLA 4HNVA 3STGA 2GVEA 3VKCA 4HK7A 3O9NA 3LMYA 3NDZA 4MADA 5M1TA 2HXUA 3C3NA 1R8LA 1GQIA 1B3OA 4Q6XA 1FWTA 4HIBA 3MCNA 2OB3A 2CHRA 2YL6A 2WBKA 3GC2A 1QPRA 3RRAA 1N7KA 5E0FA 1T5AA 4Q8PA 1HKWA 3VOFA 5KMYA 3RAOA 5CPMA 4AMAA 1ZHAA 2CESA 1QI0A 4BHYA 2PDMA 3L5MA 4Y9AA 3L9CA 2AMGA 2VT0A 3GXMA 1QOQA 2R82A 3CUHA 1T40A 3FDGA 4U5KA 3C8NA 4PBFA 3CV7A 3GWQA 1D3GA 2BY3A 2FZ8A 1R2SA 4XD6A 1XINA 2X0HA 1LDCA 4I6KA 1Q7ZA 3L4UA 1MYRA 2XHYA 2PU0A 1GOXA 1VCFA 1AW1A 3FCPA 1P48A 2DZAA 1TSIA 5BYWA 3H70A 4QG9A 4U2ZA 4FOUA 3GXTA 1CXKA 1AH3A 4N6FA 1VAHA 4K8HA 5DXYA 4EPKA 4X2PA 3CQKA 2X16A 4Q8VA 2ZZ6A 3IVUA 3RCNA 3OLDA 1UD5A 3WLTA 1CX9A 4JCLA 3LDVA 3BANA 3HURA 3E74A 2RUSA 1LWHA 1G01A 2PB1A 1PE1A 1E9ZB 1BVZA 3KFTA 4W5ZA 2C18A 3G1VA 1H49A 5E1QA 2OGJA 1KFBA 2BS9A 1QFEA 1TRDA 4NHVA 1XYMA 3ITGA 1BQGA 2EG6A 4E3VA 3KBVA 1WX0A 3GG1A 3QR1A 1OBAA 2XSXA 4DY1A 5FA5A 3W88A 2WZEA 5AHLA 4F0SA 3RPDA 3EXTA 4IISA 3MHGA 4PBGA 3CH0A 4RZ6A 1MSSA 2V2CA 1Q6DA 4EXQA 2TODA 2PWGA 1A0DA 4UQBA 1S2TA 4HPXA 2ZZ2A 4DPPA 3BOXA 1KTNA 1S3HA 3EKGA 3H4GA 1VPQA 4K39A 1QHZA 3HU7A 1PCWA 2Y85A 1XIFA 5C2XA 5M17A 3GNNA 5B7YA 1CI1A 3R94A 1B9BA 4LW7A 3UVIA 3I6TA 3PK7A 4QISA 4EE9A 3KCJA 1XD0A 4UZSA 1V5XA 6REQA 2Z00A 3IUDA 4TV5A 2XSBA 3VGFA 3WLIA 3DUGA 3SGUA 2X1TA 3T81A 4P5UA 1W32A 3GVRA 3KOZA 1UUOA 5D33A 2DZTA 4XSLA 5EY5A 4D6DA 1H3GA 5EPDA 2ZKMX 1W8SA 2BOGX 2QPXA 5LGXA 2GWGA 1NM9A 4MUPA 2EG8A 5JXQA 3DIPA 4GX9A 1N8WA 4FNQA 4FAMA 1XLBA 1WAUA 4KWVA 1GOQA 3BW3A 1JD7A 3RJYA 5AOUA 4WDXA 4NASA 2DZVA 2KAUC 1KO0A 4N7QA 1QATA 2RH9A 5LHFA 4LC6A 2DQXA 2VMFA 3RX2A 3NYDA 4P8XA 2FVKA 4CKQA 4ZOAA 1UR2A 5C8BB 3GU2A 1QCWA 4GQRA 1W5NA 2R94A 4ZO8A 3H12A 3LZ3A 2WV8A 2VO5A 3CAKA 4XZWA 1DWHM 1TZ9A 4IGMA 2QCDB 1E6QM 1GOOA 3V18A 2W3ZA 3G1DA 4TOQA 3VOJA 1WKDA 3A24A 4E3TA 2G3NA 1S39A 1FHLA 3RLHA 1RH9A 4HGXA 3BJSA 3OIHA 4AHPA 3C2VA 3IAPA 1JDCA 5CQ1A 3LBOA 3P5ZA 3QEZA 4YTQA 4BI7A 2X40A 1SYTA 3QZAA 3JR2A 1SW3A 1S5MA 4KFPA 1DWJM 4GINA 1OQFA 3F2DA 1OINA 3BQ6A 3PUDA 1S1PA 4HA0A 2YYTA 3K5XA 3ARYA 4GUHA 3TA9A 4O28A 3G0XA 2DH3A 2PRMA 4B3LA 4D1IA 1Q7MA 5T8GA 5LIWX 3B8SA 4QTGA 4L7ZA 1PB0A 3WQDA 4A8LA 1X98A 5I3JA 4UTTC 2ZQ0A 4OBRA 4N0RA 3VC5A 5G4WA 2X1SA 3FV9A 2VUNA 2X09A 2IMRA 2C7FA 2B0MA 1PV8A 4ZB2A 4HHHA 2PSNA 4H1ZA 2VHLA 1XUUA 4H83A 4GUJA 2C8NA 1KD0A 4KCWA 4MJZA 5A6SA 1OCNA 1VP5A 1FWNA 4UR7A 2VGIA 3WLRA 1O95A 2QZRA 1ISVA 1JCXA 2G4FA 1AODA 4JFWA 1DQXA 2CHNA 4FX6M 1W5MA 1DWGM 3GRIA 3M7SA 4HYWA 2X0SA 3WG6A 1SO6A 2Y5SA 3M6DA 2OZ8A 4PUNA 2QCEA 1AL8A 2AKZA 1R3TA 4RXGA 1W1IE 3GYCA 3EMZA 3XIMA 1KXHA 4C60A 4JN7A 1UA3A 4GY7A 1JYWA 2WK2A 3DFSA 3P82A 1A3HA 3ZOAA 2OELA 6ALDA 5CGMA 5TQLA 3AXMA 2ISSA 3F2BA 1ME8A 3QW3A 3PSWA 4KRZA 3TH6A 3FHAA 3E5BA 3BUVA 3ONCA 4Z0SA 2YLLA 4HMEA 1ZCOA 3C4UA 4A22A 1TPEA 3R2GA 5HULA 5HWNA 1Z48A 3IV3A 5JH1A 1OCJA 4B5UA 3IEBA 3SQMA 2EPMX 4AZBA 2A21A 3B9OA 3CYVA 3NQVA 1VFLA 1CXLA 4PZVA 4S3KA 3GX9A 4TMCA 1OFEA 4GNVA 1OX5A 2WWCA 4BA0A 1ITQA 3NSNA 1EDTA 4UFIA 1V0KA 4ACZA 1E5JA 1NF7A 1DTNA 4PTWA 2DH2A 3WQEA 4RNJA 5FF7A 1CTNA 4I90A 3W22A 3WFZA 1A3XA 4L6DA 1LROA 2HS8A 1AJ0A 1EGMA 3UD6A 5PTDA 4HNTA 4NRSA 4X9YA 4LUTB 1W9XA 1IGSA 3DFQA 1X7IA 4IP7A 3HGOA 4HZ8A 4J2PA 1TPC1 3THDA 1AK5A 3HPSA 1S2AA 1F6PA 3TN6A 1U5JA 1OK4A 1XLDA 4AD0A 4ZE4A 4CD8A 3BLPX 3S5OA 1OX4A 1XS2A 3OZOA 2RGMA 4F0LA 3ABSA 5EFFA 3UA3A 3KDNA 4DJFC 2ZUUA 4ROPA 2PDFA 3TTEA 3C61A 4JTUA 4PMUA 4OV4A 4BEUA 1YBQB 1EJSC 4MFDA 2OSXA 1LZOA 3MUXA 1VPYA 1KKRA 1J8VA 4ZGYA 3OG2A 1DXEA 3SSZA 3TDFA 5ABFA 3LBMA 1QBAA 4HMDA 1PKYA 2NVDA 4NZFA 2V5JA 3IRDA 1SSGA 3ALFA 3L4TA 3TK7A 1JCYA 4V15A 1V02A 1P0BA 1YXCA 3T2QA 3J7HA 4Q8WA 1GZ1A 3FSTA 1GQJA 3WUEA 3T09A 3UU0A 4C1LA 3VDAA 4CQ9A 2A3HA 4GBUA 1LT7A 4DJEA 3WQOA 4GQGA 3GDBA 1UWQA 4DBUA 5LHEA 2JEPA 4JTHA 1T8XA 3VKAA 2FTPA 1FWFC 3POCA 3CT2A 4YXGA 3VCCA 3MS8A 1Q6GA 1V08A 2QPUA 3MMDA 3UCCA 3SQSA 4FP1A 3ORWA 1JQVA 3GC4A 1PDZA 2VXNA 3CYJA 3WNNA 3SEPA 3DFHA 1ZZMA 3VNJA 2P1FA 2YBVA 1ZBVA 4MNKA 1C91A 4R3UA 1I8JA 2ASHA 1VCGA 4JX4A 3T0BA 4NAEA 5F1VA 3RR4A 3C0SA 4CQ8A 4MMWA 5CBJA 3S9IA 2PP0A 5DN1A 5FEXA 4UQDA 1ZSXA 4CD5A 3W7MA 1FWEC 2V3FA 4LOCA 3VFLA 1HGYA 3QOMA 1G7VA 3UXLA 1NJJA 2V0TA 1KXVA 4BF9A 2XZ9A 2BZNA 3VGGA 2Y8VA 1IZCA 2PE4A 2Y5EA 4F9JA 1I1XA 1TIMA 1XFBA 3QFEA 2WSKA 3SFKA 1H0GA 1VD6A 3N6JA 3ZM8A 1E0XA 4C6PA 3U2ZA 4XVDA 2BTMA 4BWLC 3CO8A 4XSMA 2VFEA 3TOYA 2IXUA 4NVTA 5BU9A 3W83A 3ZR5A 1E73M 5CPSA 1ITXA 4Y8EA 3GXNA 3V1HA 3BG9A 4ZQOA 1RHCA 3VIFA 1SO3A 4EF9A 4F0MA 2OYMA 4RX0A 4FHAA 4IX0A 4I9AA 3ZS4A 1ZP3A 2WBGA 1FWGC 4GUGA 1SZNA 2VEMA 3WSUA 4LY4A 1FWWA 1RZMA 1V77A 2BBFA 5F4SA 1VLIA 5IFTA 4Z1AA 2J77A 4JL1A 3EPMA 5F2MA 5CC3A 1EOKA 2ATMA 2PDXA 3TQPA 4NZ4A 4AY7A 3B8VA 3NQAA 4GNKB 3P61A 7XIMA 2JKAA 1BTCA 4FALA 3ITVA 2E9MA 2Y0FA 3WEZA 5ABEA 1GVSA 1V6WA 1W3NA 4I5XA 2ZA2A 5A2CA 3NPVA 5I03A 2Y88A 1J10A 3CK5A 1GVYA 1KR1A 3KBSA 1C8QA 1TMHA 1KBLA 3V36A 2NX9A 5EMLA 4L1XA 1UOKA 3KCLA 2FH6A 2QF7A 4RCXA 3VDHA 3MBFA 2E40A 2I5IA 1KRBC 1V03A 1W31A 1PZ2A 2WSPA 4MKVA 3UZWA 2B7QA 3W85A 4PCTA 2DP3A 4QAIA 2E6FA 2XVPA 2VM8A 1B57A 1F05A 2YDQA 3M47A 5BMWA 3G3MA 2CBUA 2CLHA 3IJIA 4GZJA 5FSDC 3TCEA 1WKEA 1OC7A 4KRUA 3VD3A 3L5LA 3ZJKA 1GTHA 3UT0A 2CPUA 3LCIA 1B31A 2VDIA 4JTJA 2P5NA 3EWDA 1EOMA 3U2EA 4EXAA 3TFXA 2PDQA 4ICMA 2C91A 1C9DA 5BXSA 1PTDA 1W37A 1GJWA 3EOEA 4D8AA 1XCXA 1EDGA 4E2OA 3VOGA 3MUAA 3P62A 1P6WA 3AI0A 3IIXA 2DSVA 2NWRA 1W5OA 3F4NA 3BGJA 2BFGA 1UJQA 1U2YA 5D2TA 1EP1A 2F6KA 2C15A 1EP3A 2DW7A 3RHGA 2XWDA 3WIJA 2PURA 4AD2A 1P7TA 3OLGA 4MJ4A 1W56A 2WKLA 1V0LA 1VEMA 2PDHA 4GYJA 1N82A 1OGBA 3TKFA 3WUGA 4JZ5A 2QJHA 3LENA 4YVVA 3EEGA 1IXOA 1H7RA 4HCHA 1WYIA 2FGLA 1X96A 4LY8A 2EJAA 1AL7A 3WK3A 1BTMA 2VI0A 1MW0A 3B0UX 4JTIA 1FWDC 3S5SA 3N73A 1SFTA 3CIVA 1UPMB 2NXIA 2XN2A 2PCQA 4WGHA 1J0HA 2HISA 3MJMA 2VQUA 1F5ZA 4NX0A 4R9XA 4WGXA 1TE1A 3CASA 1F6YA 4LYQA 4ZO7A 4A8NA 1EKOA 1TPFA 2B4GA 3A4WA 4NRRA 1JZ5A 2Y63A 3UWQA 3AIEA 5GVJA 2WLYA 1BKSA 4F9DA 1N8FA 4LT9A 4FS9A 2PF8A 3MV11 5C9WA 2WZMA 4XZ9A 1RLCL 3MVIA 2VC7A 5XIAA 3MI2A 3GYEA 3NSXA 1ML1A 1F4AA 4NIRA 4UTWA 4LV4A 4JTQA 3ZZ1A 2VEFA 1M7PA 3HTWA 3DHDA 2PWHA 3W28A 1ADDA 2YL9A 3CHFA 4AZGA 5D9NA 5LIKX 3GTNA 5C2GA 2OXNA 1GHRA 2QJMA 4DLMA 3AFBA 3DDMA 3CUGA 3MANA 4UNLA 4Z08A 4CLMA 1V7AA 4PUJA 5G5IA 2YYUA 4Q4OA 3W27A 2J74A 3RLVA 1H0IA 1XHGA 3LRKA 4IMGA 1VCVA 1RPXA 1TELA 1DBTA 2JGYA 1KQYA 3R58A 4MAZA 4JY9A 4OT7A 4KWOA 3DBPA 5FEZA 2ZX6A 2D20A 2FHFA 3UJEA 2Q8ZA 3LTPA 3GR7A 3UNTA 1A4MA 3AMGA 4D9PA 2VJXA 4S3BA 4M3PA 4LAZA 4WIWA 1E40A 2DUAA 5AYBA 1HO1A 4ZA0A 2PTZA 5HNRA 1JIBA 4ZB5A 2E8ZA 2CLLA 2GJPA 2BGSA 4XV0A 4GVHA 3WD1A 4Q8QA 3IANA 4DBDA 1ELSA 3DH7A 3R0DA 4W89A 4Z2GA 3F4WA 3ITXA 3OTRA 4LRTA 2D0FA 2BXYA 3FA3A 4Q8NA 3TXVA 1J0YA 3VI2A 4RV3A 4UMBA 1LBMA 2OO6A 4UB9A 3SZ8A 1CDGA 3IJQA 1XYLA 3DYPA 1GVIA 4GY1A 3WDRA 2EPKX 4JTRA 5TAOA 3V0UA 3PPFA 4IIBA 1EBHA 3V4BA 2AQWA 1OY0A 3ZLHA 1SUXA 3PG8A 4XAGA 5I6SA 3F4CA 2Z27A 4QGCA 1J0KA 2WW5A 4LNYA 2ABBA 4MZYA 4N42A 2FB3A 1X6NA 4V33A 4GACA 4W85A 4C1NB 1F4HA 3TV8A 2FYMA 3TQ0A 1KBBA 4HCLA 1J0JA 1NTHA 1TIWA 1NFGA 1A4LA 5F7UA 3LB0A 2FB2A 3GKAA 1QW7A 4K36A 3O6DA 1K03A 1XRFA 2P88A 2X1IA 5FF0A 2VRQA 1H50A 2V30A 4NP7A 2GYIA 3EOUA 4C6DA 3NG3A 5B7ZA 4B3KA 4Q6JA 2UV8G 2O9PA 4JYFA 4LEFA 4BI5A 3L0NA 2GVGA 4GQ0A 2EJ1A 3WUBA 1MO0A 4HK5A 3KM8A 4IL0A 1NFPA 2NXGA 3OODA 1TYGA 4O1AA 4MNLA 3LY0A 1TZ7A 4B91A 1NWTA 4EF8A 3IIPA 4QDWA 1FCUA 1RD5A 2XPKA 2Z7GA 2QV4A 3M0IA 4JTFA 4BF7A 1DJQA 1I4NA 4XG1A 4F66A 4O1FA 5H91A 1W3KA 3GIQA 3N9SA 3BTNA 4IIFA 1SJAA 1QK2A 3SY1A 1YW1A 4CD4A 3F5KA 1CLKA 1XIDA 2GDVA 1HQTA 3OP2A 1TMLA 1YDVA 3URQA 4O13A 3IV8A 3TYZA 1IF2A 4JDYA 3LHWA 1P5BA 4CU6A 2NVCA 1JNDA 2VURA 1ZY9A 5FSEC 3BDKA 2QF8A 1F6KA 1NQ6A 4OBTA 3QBUA 4WVXA 5C71A 2AOSA 5G2IA 2PDLA 2EF9A 2OZ0A 1M1BA 3LV5A 1TG7A 4TTGA 4WSHA 4WKHA 1WKYA 3H7VA 1CGXA 2CLOA 1EA0A 1O94A 2VOMA 2WSQA 1X39A 1QWKA 3EMQA 4GCXA 5TF0A 2HK0A 1NELA 4U3AA 4GFSA 5AC8A 1VC4A 5D8ZA 4B2DA 1ICSA 3G1RA 4V27A 5KZ6A 2WMIA 3QR3A 3QSRA 5I23A 2PTDA 2VFFA 2P10A 3VE9A 1JNEA 1BGAA 2ZUWA 2BP1A 3AS1A 3IJLA 4IFRA 3QV8A 3UZJA 3AU6A 3N13A 2I9UA 5CGTA 2XFWA 4WJXA 2VX6A 4D6HA 3M0YA 2YW3A 1KCLA 3TX9A 4IJBA 2WMFA 1W3JA 3S2JA 3A21A 3FYYA 1Q8AA 1TE6A 1SFLA 2CKSA 2CXEA 1DJNA 2NSOA 4I5UA 5KZDA 1AW5A 4L6OA 1BD0A 1YLVA 4QLLA 3WNKA 4MY1A 2E5BA 2OSWA 4HQVA 4DJDD 4O1EA 4Z17A 1M6JA 4I8YA 2PWUA 2G3IA 4FLOA 3T0AA 4GXPA 1CPUA 5CSUA 1BAGA 1JUEA 2J7GA 4K8GA 3G1XA 4GABA 3GNPA 4M24A 2WOQA 1TA3A 4AUBA 4E38A 2GDUA 1NQKA 3TEVA 4GQBA 3DG7A 3WELA 4CQBA 4OTKA 4MJ2A 4IM4A 1M9HA 3VIJA 1UIOA 1QXLA 2QCMA 3KBNA 4Z2IA 4Q7NA 4IJRA 2DT1A 2PP1A 1X38A 6CGTA 3BSGA 2SFPA 4XIAA 3VNIA 1FBAA 3MDWA 4NI3A 5LSMA 3M0LA 2NQZA 3CU2A 3MCMA 1KXQA 4L64A 1XX1A 3R79A 5HINA 3K4AA 4PTNA 3POHA 1P0DA 2ZX5A 3B9NA 2O55A 3NXFA 1Q7QA 2NLYA 3OA3A 4GIEA 1R2RA 4CNUA 2X30A 3NDYA 3ZWTA 2Q02A 4KWUA 2YX0A 4P8WA 1OC5A 3OZMA 2DZUA 2ZX7A 4IPIA 1HJSA 4PB4A 1DIDA 4HHMA 4ZFCA 5IHRA 4D6FA 3WUFA 2ZADA 3UJFA 4QAWA 1VFHA 3GSMA 4YCOA 1FWAC 2GVLA 2AAAA 2Q3OA 2XH7A 2WSRA 4L1GA 4YVPA 1CGVA 4UOZA 4TU1A 1M3UA 1XLIA 5I00A 5AHFA 1ISWA 1KBIA 3PC0A 3BCDA 2ZICA 3IIOA 1XLCA 1E70M 4ZFMA 1RBLA 4IQEA 4YIWA 1ODUA 1GGOA 2QW5A 1BPLB 2VZSA 2POTA 4LYKA 3KL0A 3MSRA 2C13A 4MZ8A 1UB3A 1LRTA 3ES7A 3GBEA 2X05A 4JIRA 2QAPA 1Y5XA 4GG9A 4ZODA 1AQFA 3LHVA 3N6QA 4JX6A 2HWGA 3W01A 1UMLA 4QNWA 3ZT5A 2OX1A 3R89A 4JKLA 2ZRWA 4LF1A 3PTDA 6REQB 3ITLA 1DWAM 4E6MA 1WOAA 4JTLA 3E0FA 3N25A 4JKKA 3CHCA 3VABA 1MUWA 1JUKA 2WVTA 4H8UA 4AB4A 2PTYA 2J78A 3BVJA 6XIMA 4Z1BA 2RDWA 3WH9A 3MJYA 4W5UA 2NX3A 4W84A 1XLFA 1R3WA 4OIFA 5A6BD 1JDDA 3VZYA 2BLEA 4AHOA 5HUOA 2XVGA 4H2HA 3CB8A 1LTDA 2WHMA 4BQ4A 2DZWA 2ZX9A 3BK0A 2E3ZA 1WA3A 1G9HA 1ZTVA 1Y5VA 2VGBA 4L61A 1PWMA 1BYBA 1IEWA 1EBGA 1FOBA 3EPOA 3ARPA 4N6EA 4XKYA 1FH9A 1BF2A 4X2RA 3BICA 3THCA 7REQA 3NVDA 4H9XA 1TV2A 3HQNA 1W9PA 2AGKA 2WNWA 2QS8A 1A5SA 1Z9AA 4DYKA 3M4HA 2Z1WA 3GQYA 1SZGA 1VKFA 2D0HA 2Q3RA 1XWYA 1Q13A 3B0PA 4KESA 4R53A 2Z0IA 3VC6A 5E9AA 3USBA 5I0DA 2QUNA 2YDAA 1G0CA 1SFSA 3LXAA 1GG1A 4WDTA 3UCDA 4C6EA 3ANUA 1KLYA 4GI9A 4U5IA 2DVXA 1IE7C 3G0SA 4X61A 3S9ZA 1KCKA 4QG6A 4FOKA 3RMEA 4J28A 1RK5A 1E71M 3K8KA 4MWAB 4X0VA 3G6MA 2JGQA 4JPGA 2BNJA 4OUEA 4XX6A 5D9MA 1T7LA 1XL9A 3IVTA 2A5HA 2A79A 3LMZA 3BAIA 4HJFA 2Q8XA 5L9FA 1P1XA 1RSCA 1ZL1A 1DJIA 3VKJA 2Y70A 4OKDA 4PMNA 3N18A 4PUKA 3B8DA 1W3LA 3H2OA 2I5QA 1SMDA 3E0VA 3KBMA 3HG2A 4K38A 1PHWA 1DJZA 4ZEPA 4BWLA 3UY8A 1KWKA 1EJUC 3QKZA 3TN3A 2ZRUA 5CSSA 2ZA1A 1DL3A 4AYSA 4RZ5A 5EKYA 2WQPA 3VO0A 4EVZA 1H7NA 3P8JA 3UG5A 2FTWA 1EC7A 5DY2A 1VJZA 1GOIA 3APYA 2VGGA 3GR4A 3FJNA 2JIEA 3A3WA 4QITA 2XIOA 3GC5A 5EMMA 3GVQA 2CITA 2W61A 2QDDA 2XFYA 3DXIA 2D0GA 1E0TA 3UG3A 1Q6FA 6PTDA 2XFRA 2CNCA 4UCFA 1K9DA 3P3BA 3P84A 3IJDA 3UW6A 3U8GA 3WQVA 2L5HA 1FDYA 4AD5A 3QC0A 1VFUA 1AQMA 1XBYA 4GBDA 1K9EA 2ZVRA 1O7AA 2J7CA 3TYEA 2ONEA 1ITCA 3WK0A 4N9CA 4O8RA 1UZ4A 4GWEA 3A9IA 4S2CA 3TAKA 3V5FA 3NXLA 1YXYA 1IZJA 2CLMA 4OJYA 2RDUA 4EP8C 4LCQA 2PRLA 1OJXA 1HXJA 2Z28A 1YPFA 4NJIA 2ISFA 4PB3A 5D04C 1RCOB 2IS7A 1GPFA 2F38A 1A80A 2EEXA 2UY5A 4QHRA 3DHFA 4PTMA 4R7OA 5HANA 1GVRA 2QJIA 2NV9A 3RDKA 4B9ZA 1Q6CA 4IHCA 2J8GA 1DXFA 3I6RA 1UOZA 1KGWA 3FHQA 4ZZ9A 2FMNA 1W1VA 1OWQA 3SR7A 3G2GA 4AEOA 3U4AA 3SURA 5KZEA 1GW9A 1XISA 2QIWA 3RCYA 4M7SA 2GK1A 3MTWA 2FDMA 3VMOA 3XISA 2JE8A 3IJ7A 4NAFA 4GD0A 1UWAA 4H8NA 1JVNA 3S2CA 2VZVA 1I2QA 2Y8UA 4GI6A 3N9KA 5HPCA 3QMRA 3LSBA 1KM5A 1HJWA 4L9XA 1JPMA 4UQCA 5IDIA 4UOQA 4A3RA 2OOFA 3WFAA 3C0QA 1WDSA 1JAKA 1R9YA 1SO5A 1JCJA 3MV01 5CPNA 1WBHA 1KFEA 3PAJA 3ARVA 3NGFA 1KFJA 3S4TA 4YTSA 4MIMA 1V3HA 1DXIA 1RBOB 3WNPA 1VBGA 4A3YA 2J75A 1VFTA 4JKMA 4H4IA 3AOFA 3KOYA 2EHHA 2PDBA 4C6KA 4ZBCA 4KH2A 3QY6A 1ICQA 1IIHA 1VBUA 4RW3A 3CPUA 4MKSA 4QEHA 1F2JA 4OBSA 1EHNA 3NZGA 4H6EA 5ECVA 3LS9A 4REQB 5M03A 2VVSA 3L4YA 1S3TC 4ADUA 4HZMA 3MMUA 2B7PA 2WPGA 1LOLA 5FF4A 3HV8A 2WC4A 1L2UA 2PBGA 4S3GA 4UTTA 1TX2A 3KTCA 1C3FA 3PZGA 4OWGA 4MDOA 2FZ9A 4IQLA 2PLKA 3VM5A 3P6LA 3SRHA 3RUBL 1PO9A 4J5NA 3UXKA 3HMCA 1US3A 3RFAA 4TTUA 3HQ1A 1XG3A 3KCOA 3IVSA 2IKJA 2D23A 3E5PA 3VPLA 3NWRA 3FGCB 1WZAA 2H6RA 3ARUA 2Y1HA 1WP6A 2I17A 2QCDA 1MQQA 1XYFA 3BSHA 3BXWA 3WF1A 1CZ1A 4FPSA 1CGWA 3GG0A 3PBVA 1JCTA 3KP1A 4OU1A 5A69A 2ZC8A 2XG9A 4QS6A 5EB8A 5HQMA 3RIKA 1G7UA 3ZWSA 1AG1O 3W1AA 4ACZB 4AMCA 1A5OC 1JULA 3BLLA 5DMYA 2HE8A 3ANVA 3EWUA 3B0VC 5CEWA 3VCRA 2BXVA 4RV8A 1H09A 1OD8A 3VNKA 5DMMA 3AXHA 3C2FA 3HA1A 3EX2A 1XLEA 3S42A 3DC8A 1AMYA 5BXPA 4HNNA 3I3EA 1MXSA 3EWCA 5A6JA 2BOFX 3TZNA 1EFZA 4F48A 4O52A 1Z32X 1TPWA 4CNPA 2Q01A 3EPNA 1TUXA 1JFHA 1TPUA 4DNMA 4A2RA 3H2NA 3OJGA 4L4MA 1J79A 4QIUA 1W9VA 4NZ3A 2EGZA 4S38A 2WJFA 4JQ1A 4IOTA 5D09A 3CPGA 1U83A 3QOKA 1TQJA 1THFD 2DFAA 1OF6A 3T0DA 4OVXA 3HOJA 1UUMA 2CBVA 5AC4A 3RGTA 3LU2A 4GIYA 5DT5A 2V6AA 4INFA 4S3FA 2Y2WA 1N2VA 1QU4A 3WBWA 4EWND 3TQKA 1R6WA 1G4EA 3MSGA 3SUVA 2GJRA 3LTSA 4NL1A 3NQEA 4W93A 2YXGA 3CUXA 1UC5A 1GVQA 2VKZG 2VCBA 3KOWA 2Z1XA 4AD4A 3NVTA 4HA4A 4I3GA 2V5DA 4IICA 3VNDA 4LH8A 3QR0A 1MEIA 2Y7EA 2QIIA 3LPPA 2VEPA 5I79A 2F8QA 4H41A 4AX6A 4IFKA 1HP5A 3WLSA 2VWTA 3TW6A 4EX4A 7CGTA 3R7MA 2ZCGA 1OX4B 4LS2A 1K1DA 2BVWA 4IIGA 5LIYX 4PCFA 2NV1A 3AHTA 3NZQA 2VEIA 2O7QA 4FMVA 5AHMA 5A1AA 2OEMA 3OOQA 3MZNA 1GUVA 4IT1A 3MW7A 1JCLA 1GHSA 3W72A 4Q4SA 4X60A 5XINA 1E43A 4HNUA 4W8LA 2HV5A 2VR5A 3T0TA 4R33A 3UJ2A 1W54A 2VRKA 4DYJA 2QLYA 4HCDA 4NAEB 3E49A 4NX5A 2O92A 3GAYA 1PPIA 3VU2A 5M5DA 2A7NA 2XIBA 3D3AA 4DF1A 1TWZA 3COTA 3WLPA 1UUQA 1XRVA 4HVXA 2XIMA 3PJXA 3O8AA 1BLIA 2X1UA 2FPTA 2F61A 4IPJA 4AEFA 4ATWA 1W1YA 2OODA 3VOCA 3W53A 3M0JA 2CWXA 2Y62A 2J79A 5BXTA 1HKJA 4YWSA 3O63A 4N02A 4TVCA 1TCMA 5G1MA 2IPFA 4XD5A 2XN1A 1FFRA 1QNVA 4RK8A 1UKQA 5CAHA 3BMWA 1RJRA 4U33A 1L6GA 3LNMA 3NL3A 3DAQA 2J47A 3VUSA 2W67A 3AICA 4H9MA 1TJ1A 3WO8A 2V9DA 5CLWA 4JTDA 4WQ6A 1WBJA 1A3WA 3W7NA 4DXKA 3DOPA 4KWSA 3D47A 3WD4A 1F9CA 3MWAA 3I7QA 1IWAA 2JKPA 3W2MA 4F0RA 3UXAA 1X7FA 5CG0A 1JZ2A 2CLPA 4UTMA 1G4SA 3CQ0A 1NOFA 3EZ4A 4K2SA 1A0CA 4X3ZA 1FFQA 3CV6A 5AHIA 1EX1A 3B8WA 5GJMA 3PBMA 4HPJA 1LORA 4IFOA 1OX6A 3AALA 1MMFA 1UR9A 4O0KA 3UR5A 5HNTA 4KEVA 4KEUA 3P14A 1ZU8A 4O53A 1HL2A 4XZMX 1KR0A 3FN9A 2RKXA 1IEQA 4QJ3B 4J3XA 4GIAA 3S2MA 3A13A 1Q8JA 3QXBA 1O66A 3L2MA 3W84A 4A3HA 2V5KA 2E9LA 3B9DA 5D2XA 1OFOA 1YE6A 3N3MA 1DWIM 4F2BA 2OZ3A 3CWNA 4CEUC 1W9DM 3GVVA 3NJ3A 3ARTA 1UD2A 3NEVA 3LQLA 3W7JA 1RD6A 1VH7A 3CUZA 4E2VA 2OGYA 3HGJA 1QPKA 1B4EA 2YB1A 4W4QA 4YHGA 2ZXAA 4W9TA 4DWSC 4FIRA 1NDYA 2DJLA 4NY2A 4NJGA 1J6OA 4GE8A 1YNYA 3WMCA 3JW7A 3S8HA 5D05A 4BZYA 3GXIA 1JYXA 3FS2A 2CXGA 2BASA 3KDOA 4YTTA 3FEQA 1XLGA 3B04A 1MEHA 4MJMA 4KGJA 4HU3A 4P7RA 3H23A 2E67A 1PKLA 2V81A 5EBAA 3NGJA 2J88A 3EB4A 1GT8A 1E4MM 3QRHA 2RDTA 5FJRA 3WN6A 3T0CA 3LCGA 2J7DA 2VX4A 3O1NA 5HMSA 1WOBA 1J96A 1MVYA 3LHYA 3QN3A 5C5YA 1BRLB 4DJDC 1ZFJA 3BJTA 1O4UA 1JPHA 4HKPA 5I3GA 3LSCA 2OG9A 2DSZA 3N2BA 5JQ9A 3CGTA 1CGUA 5JU6A 2G41A 5D03A 3E0LA 3WL1A 4RL3A 2P53A 5FEWA 1MZHA 3B8TA 3U2CA 3DG6A 1KRAC 1OC6A 4WK9A 3EDFA 4ZB0A 1A47A 3M43A 3NAVA 4GMEA 3BG5A 3WMBA 1EZWA 3CWHA 3QJAA 3LCHA 3AISA 4KKXA 3Q58A 2MUCA 2ZWZA 1QOPA 4QE5A 3GHUA 4M56A 4LANA 3V7PA 4NJHA 3MT1A 4N2YA 4C6OA 4IPNB 2DSWA 4H7ZA 5JIWA 1P6CA 2ADAA 2PDNA 1UD4A 5LA1A 1LT8A 1IEVA 1PSCA 3DI1A 3SUSA 4RPPA 7PTDA 1E9YB 1GJPA 3V0SA 4A21A 4AEEA 1H7PA 3LLFA 1JXKA 3RM4A 2HEJA 4M5PA 4FX8A 1UROA 1RQHA 4GYPA 5FIPA 5BRPA 2DZBA 2D24A 4TUFA 2REQA 2VZOA 1DHKA 1WDRA 3NTYA 1O5KA 5AYZA 1E55A 3WMSA 1HP4A 4Y96A 1FQ0A 4ZENA 5EMUA 2X42A 3AZSA 3W75A 5BROA 2A1YA 5A6BA 1OEPA 3EWXA 1LP6A 3QQWA 1EGZA 3W38A 2WJEA 1V02E 4QROA 4O50A 3CB3A 1LLWA 2ZE3A 1A5BA 1RY8A 2EPHA 1YTKA 3AS3A 1KV8A 2J7EA 1KFCA 4FNUA 4PMDA 1J12A 3KVMA 3KWSA 2W79A 4GISA 5IHSA 1OM0A 4O54A 4TVUA 2J66A 4WEVX 5AKQA 5FL1A 4KW2A 1SR9A 2HROA 1SZEA 3G3DA 3BAKA 1UQZA 4UFMA 5A94A 3E9AA 4NF7A 1FH8A 4JYDA 1H61A 1I6NA 3V16A 1ECEA 1TTIA 2FFCA 3GDRA 4OECA 4LC8A 3GDMA 4DO6A 1W1ZA 3WLJA 3QV6A 1ZB5A 1M41A 2YZ5A 3VMNA 1AH0A 2YCEA 4U31A 3L21A 3R10A 2VENA 5AECA 3RU6A 1MWOA 4Q4PA 2VFGA 5AHNA 2CFFA 5E93A 3NO5A 1Y5WA 4YYCA 1B3WA 2DQWA 2PMQA 3TYAA 1BGGA 4WLCA 3S6DA 2Z7KA 1DJGA 2ABAA 4IZGA 1QMLA 2O9RA 2O9TA 3S1XA 4AD3A 1M03A 2JQXA 2OZTA 1QAPA 1XLMA 2CHOA 1TMQA 2PD9A 3WDPP 3OW1A 3SM0A 3SI9A 4JIQA 5DCEA 5A3HA 1UR3M 2ZUMA 5EFDA 4HOZA 1MW3A 5DBTA 3SQLA 1R9XA 4QP0A 3TA6A 1SW0A 4RPQA 2C71A 1XM3A 3LOTA 4WCJA 2NX1A 3TAOA 4NT0A 1W8GA 2QR6A 3V5OA 4O19A 3P74A 4GVGA 7TIMA 3LPFA 3T07A 4HJWA 5FJTA 5FESA 2V5LA 4XZNX 5BCAA 1UC4A 4R88A 2Z29A 3OLEA 3BZGA 3VD4A 1HNYA 4PRRA 3ATYA 5HMDA 1VQTA 1NP0A 3PUEA 2RJHA 4BFAA 2A3LA 1B3VA 4B15A 1FWBC 1PDYA 2G37A 4MB3A 2QYGA 3B4UA 1WXJA 1OT1A 4JAWA 2ESCA 3GU9A 1ZAHA 4E8DA 4AC1X 3L4WA 4ZQMA 4IUOA 4BF5A 1JG9A 5FD0A 4IXXA 4Y9MA 3MPGA 1C8VA 1FKXA 1EB3A 1NFBA 2BSLA 3LI0A 3MP3A 4WSKA 4AAJA 3AIWA 1RCXB 5MHBA 3VIMA 2Z4GA 4AVOA 4AF0B 3L12A 3PTMA 3M46A 4DAIA 2GJNA 5C6MA 1EL3A 1TJPA 3VZZA 3W86A 4CQAA 2CETA 1IWBA 1GYLA 1UR8A 3PUOA 4C1NA 2PDYA 3VTRA 1BVWA 2VGFA 5DF0A 4LVGA 1OSEA 2VTFA 2O4MA 4N9DA 3SCPA 4J3SA 4GYKA 3LX9A 4GHRA 1TPDA 1ZBCA 3S6TA 4M6PA 4CD6A 1J9YA 3SUWA 2F6XA 4KWWA 2VR4A 1U1UA 4I7UA 3WDHA 3O07A 1YDOA 3OHIA 4C6MA 4JBRA 1BF6A 4CNSA 3E02A 5K9XA 1POKA 4V1XA 1HVXA 5C2CA 4QFUA 1EUAA 1YDNA 2DVTA 3LPOA 3SCVA 5CC7A 4L6HA 3CEUA 4M80A 2VDGA 3NEHA 1W6TA 3UBPC 1R5YA 3SGZA 5DO8A 4DI8A 3DFTA 3GTXA 2XSAA 3DERA 4LQ1A 5A8NA 2R14A 1SMAA 1A5KC 4MYAA 2VCCA 2B7NA 2C1GA 4IGSA 2OU4A 1BQCA 3GTFA 3IRSA 2QPSA 3U5UA 1TJ2A 2X7WA 2YCKX 3RMJA 1S2CA 4FXRA 3W81A 3IIZA 1VHCA 2PDJA 4TIMA 1RALA 2QAFA 1EX5A 4A3QA 4AWUA 2AL2B 1EJRC 2WHKA 1YPXA 1W1A1 1H1ZA 1BYCA 1KCZA 3AXIA 4MNJA 1J18A 2GVJA 1FRBA 1EUNA 1Q85A 1Y0EA 1IWPA 4O1BA 4US5D 1UR4A 1YDYA 4EIVA 1B2YA 3C0JA 3DENA 2CLEA 3WJZA 4WHBA 1S2WA 1CXHA 1OYCA 3MY9A 3TZFA 1EDQA 5DCBA 3PS7A 3KVKA 1GJUA 1KTBA 3H2CA 3VCNA 1GKRA 1L8NA 2W66A 4FLQA 3EOSA 3QY7A 1JYVA 3CLMA 2OEKA 4Y8FA 4FF5A 2V69A 1QUMA 3UWUA 1WKFA 3I10A 2V2DA 1HKMA 2X41A 3PB0A 3UR2A 4GOAA 5D02A 2Z2BA 1MW1A 3FAXA 1CIUA 3TNOA 2ZX8A 5GNZA 5D2YA 1LYXA 3TYDA 1TB3A 4NU7A 4ZTXA