4CQAA

Plasmodium falciparum dihydroorotate dehydrogenase (dhodh) in complex with idi-6273
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
373
structure length
371
Chain Sequence
FFLYDIFLKFCLKYIDGEICHDLFLLLGKYNILPYDTSNDSIYACTNIKHLDFINPFGVAAGFDKNGVCIDSILKLGFSFIEIGTITPRGQTGNAKPRIFRDVESRSIINSCGFNNMGCDKVTENLILFRKRQEEDKLLSKHIVGVSIGKNKDTVNIVDDLKYCINKIGRYADYIAINVSSPNTPGLRDNQEAGKLKNIILSVKEEIDNLEKNNIMNFLWFNTTKKKPLVFVKLAPDLNQEQKKEIADVLLETNIDGMIISNTTTQINDIKSFENKKGGVSGAKLKDISTKFICEMYNYTNKQIPIIASGGIFSGLDALEKIEAGASVCQLYSCLVFNGMKSAVQIKRELNHLLYQRGYYNLKEAIGRKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords DIHYDROOROTATE DEHYDROGENASE
publication title In Vitro Resistance Selections for Plasmodium Falciparum Dihydroorotate Dehydrogenase Inhibitors Give Mutants with Multiple Point Mutations in the Drug-Binding Site and Altered Growth.
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 139
structure length 371
sequence length 373
chains with identical sequence B
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2014-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4cqaA00
3W3OA 5HWMA 1FUYA 2ZQ0A 2V5BA 3G1VA 4AVFA 4CLMA 5LNSA 2C18A 1DKWA 4QITA 1I2RA 4XBKA 3EWYA 1VJIA 4IMFA 3CU2A 3TSBA 3CQ0A 2E77A 4S2CA 3LXBA 4EOUA 5G2IA 2A2IA 1TYGA 3TAOA 1TPUA 5IM51 2C15A 4AWTA 3S8HA 4NJGA 4M6QA 2J9XA 5FF3A 3E96A 3LXAA 3STGA 1Y0EA 4NX5A 1ZJIA 4LTSA 3IVSA 3EWXA 4MUZA 1M6JA 3RLVA 1JRCA 2HMCA 4AMAA 3SW6A 3GDLA 1YTKA 3DFOA 1EB3A 2ZZ4A 3TSMA 4JTHA 1DJQA 1FQ0A 2GOUA 2NWSA 1WAUA 4HSNA 5C2XA 4OWGA 4JIQA 3QPZA 5DN1A 2FPYA 3GR8A 1XC4A 4MZ1A 5LHFA 3L21A 3KRUA 3NPVA 1JCNA 5G1TA 4BFAA 3PB0A 1VR6A 3G8RA 2RHGA 4LV4A 4JX6A 2DZPA 1DJNA 5KZDA 4H3DA 5FEPA 2QCFA 2ATMA 4RZ5A 1X8FA 4MIMA 1W5NA 4FF7A 4M7TA 4R33A 4UTTC 4UXDA 4XTIA 3TQVA 3LLFA 5AC6A 2YW4A 3LHTA 2PRHA 2B7PA 3W7HA 2VXNA 3DKJA 2NX9A 3L66A 3LBCA 1H51A 1R46A 4C1LA 2UV8G 4WX2A 2FB3A 4UTLA 3QEZA 5HULA 3LHZA 4Q33A 1JULA 4FX7A 3M47A 3B03A 4DBEA 3S1VA 2ZA1A 4A29A 3PF3A 4TR9A 4JX4A 3K30A 2ZDRA 5LGXA 3W1LA 3LCGA 1PVNA 3GAYA 3TIMA 1NF7A 1ZY9A 5F4XA 2VENA 1IF2A 4JN6A 1ONRA 4XUGA 3OA3A 1CI1A 4JNMA 2GQ8A 3FYPA 1GYNA 1JUBA 3G8EA 4X3ZA 2YX0A 3GXPA 1X6UA 3GXTA 4K39A 1L6SA 1LBLA 4WUIA 4IXHA 4NZFA 3LTYA 4N6FA 4UFMA 1GG1A 1CW2A 3W73A 3CEPA 3RLUA 3C2VA 4S2BA 1KBIA 3P67A 4D2JA 1Q6RA 2F7FA 4RR4A 3VI2A 1LOQA 3R5EA 2CFFA 2B7QA 4Y9AA 3PBVA 1DHPA 4IX2A 4LS1A 4RXFA 3GB6A 3BG9A 1JCYA 4ZQCA 3TQKA 3S5NA 2ZA3A 3TCEA 1TPVA 2NUYA 1DVJA 3GLCA 3HG4A 3Q37A 4LRTA 4BI6A 2VEMA 3NQ6A 3W1NA 3LXCA 1VLWA 2CWNA 4Z1DA 4NJHA 3QYQA 3P7YA 2A6LA 2Q8ZA 4PEKA 3ABSA 3W1MA 4GUGA 3T78A 3W1RA 3C2EA 3SJ3A 5AC8A 1TV7A 3EB2A 5C5YA 4N9DA 5CSRA 2PRLA 1OJXA 2YPIA 1GVFA 1OFAA 5DBUA 3TJXA 2O7QA 2FTPA 2X2GA 1H7OA 2BXVA 1VRDA 1PV8A 1A5BA 1TRIA 2A5HA 2ISWA 2J88A 3ANYA 3GDKA 1QDSA 3BGJA 3PR2A 3E02A 4I7VA 1S5VA 3NDOA 3O8AA 4CNOA 5U4NA 3WK1A 1H7XA 3W1UA 3PWAA 1FWSA 2Z2UA 5EMUA 3M0ZA 3NL5A 4UFHA 3W84A 1KM6A 3E12A 3I7SA 3N3MA 5LNRA 2ZYFA 2DU2A 4M19A 2R8WA 2JGQA 1O94A 3CC1A 2VEPA 3GVGA 3RF9A 1MEIA 3PUDA 2Y70A 1FDYA 3THAA 2C13A 2GQAA 3W2MA 5D33A 3SSJA 2NXGA 4JTEA 2QCGA 1Z41A 3STCA 1R2RA 4JY8A 4JY9A 2DZVA 1N7KA 6ALDA 1AL7A 4KFNA 1ME8A 2J27A 1VHNA 2CZEA 3INPA 3QRHA 3ZR4A 5G4WA 1UCWA 3CEUA 1ME7A 2QCCA 1KM1A 2NXHA 4E0CA 2Y7EA 3KVJA 1SZNA 2X1TA 5AHIA 3A5VA 1TPH1 3N9RA 3PBUA 4GE8A 1QPNA 1FX6A 1TV5A 5EYWA 4ADSA 1KTNA 2A85A 4PCFA 2YFOA 2ZRWA 1ZENA 4DPPA 4HPXA 3QM3A 2QR6A 3N34A 2R91A 4FNUA 2VFDA 3PVFA 2E6AA 1PS9A 4K7YA 3L67A 4QM1A 3S6DA 4P61A 3R2GA 4UTMA 4E2BA 4NXKA 2A7PA 3P81A 2ZZ5A 1FCQA 3NQEA 5G2WA 4JTIA 1ZAHA 1TTPA 2Y7DA 3IIZA 5HUPA 5K9XA 1HUVA 3UWWA 1NF0A 1D3GA 3TUUA 2RKXA 1GZGA 5LNVA 1OG0A 3FYOA 4A2SA 4NXSA 3W22A 4O16A 1X1ZA 2DORA 3KVKA 2WPBA 1JUKA 1YDOA 2EHHA 3NL3A 4ZQPA 4RLIA 5F2GA 1EA0A 1P5BA 1VPXA 4LVAA 1XUUA 4QQ3A 2Y7GA 2YFNA 1ADOA 2I9EA 4NNAA 5A5WA 2QAPA 3BG5A 3G3MA 1H5YA 2J9ZA 3NEVA 4DO5A 1JCJA 3NM1A 1T99A 5TQLA 5BMXA 1M5WA 4LT9A 3RFAA 4BR1A 3G0SA 3A9IA 4YMZA 2H3DA 3W71A 2X30A 2IQTA 2JK2A 2H8ZA 2ABBA 3GYEA 3NVTA 4GC4A 3F4WA 4GBUA 3BV4A 2CLMA 3LHUA 1XBXA 4Z1BA 1KTCA 3W7KA 4FNPA 3L0NA 1EUAA 4FB7A 3M7WA 1WV2A 4JTGA 1J4EA 5HWJA 3EXTA 1GOXA 4UNKA 1I2NA 1P0NA 1FWTA 5TIMA 3HMJG 1JQXA 1QPRA 3C4UA 2RDTA 3NQ2A 1YLVA 2WSRA 5HMSA 3AO0A 2Y85A 1W5MA 3WK3A 1OFRA 2QDHA 3W72A 4XQ6A 4N6EA 4O19A 4GUIA 1SZEA 4R34A 3TDFA 4JGDA 2OMAA 1Q6QA 2XN2A 3DFNA 2V2CA 1SFJA 3G3DA 3S5ZA 1OX4A 2H90A 1XDMA 5CKSA 3SFKA 2TYSA 5LNWA 1EX5A 2JKPA 3N73A 1OFBA 2VELA 5F4WA 4DBDA 4Q32A 3HOJA 4AH7A 3VE9A 3MHGA 1KBJA 5C54A 2EAWA 1VGAA 2BLEA 4UFJA 2Z1BA 1TJRA 1JVNA 3THQA 4JYFA 2OCZA 3L2IA 4LU0A 3W7EA 2YCEA 1AK5A 2R94A 2YYUA 1GPWA 5I3FA 4Z08A 4HN4A 3O1NA 3TR2A 1AG1O 2A21A 2R14A 1K8XA 1Z48A 3F03K 1O60A 1UBSA 3PG8A 3W7GA 3MP4A 4O54A 3E49A 4GRSA 3EX1A 3PB2A 4LNYA 5FEXA 4W9TA 3RK8A 2OJPA 1SW0A 3G0XA 3B0VC 3BLIA 3CT7A 2DJXA 4ZQRA 2PC4A 3W7PA 1VLIA 4ADUA 4WQ6A 1VH7A 3OVQA 1TPDA 1BTMA 4L4MA 3TMLA 3P5YA 5HR6A 1FWNA 4UIOA 2VC6A 3DH7A 1D3HA 2QUUA 1OF8A 5MHBA 1I8JA 5CZ0A 4BF9A 1IXOA 1KLYA 4MVAA 5DCEA 3W2NA 1TCDA 1JRBA 3B04A 4HT3A 3W7RA 2TPSA 4N02A 4DPQA 5LNUA 3U6WA 1OX6A 3FJ6A 5CGQA 4K38A 5T26A 2OX1A 2QDGA 4BI7A 4NX0A 4XWUA 3W23A 5FF2A 3T55A 3PM6A 4TMCA 4FX8A 3LCWA 2Q3RA 1LRNA 5EKYA 3L5LA 5AHNA 5DCDA 3UZJA 3LRKA 4ZZ9A 5AC7A 4AHQA 1LDCA 1K8YA 2E6FA 2QKFA 5D09A 4WOZA 1KM2A 4UR7A 3JR2A 3UD6A 2Y61A 2C19A 4O4WA 3GNNA 4Z0JA 4MYXA 3LRMA 1O4UA 4L4LA 4POCA 2E1DA 3SR7A 3W7NA 5I3KA 2I14A 4MLJA 4XKYB 4DF0A 4UFIA 4HNNA 4O52A 1KFKA 1QNVA 4WXYA 3W1AA 1JCMP 2C3ZA 1SZFA 4MOZA 4GUFA 3QSRA 3HBLA 4HKPA 1ICQA 2ZBTA 2FJKA 1KW1A 3NQCA 4U4MA 3UWUA 5LHEA 3S0CA 3T40A 2JBMA 4O1BA 4E2DA 3TQ0A 1ZCOA 4RZ6A 4O57A 1Q6LA 3F4NA 4EF9A 5D30A 4JTKA 2FB2A 2ZCGA 4RXGA 5H2ZA 4MY1A 1AW1A 4LC6A 1SW3A 2H6RA 2FFCA 4IMCA 4GUJA 4MFDA 3TH6A 1RVGA 3ABRA 3P8IA 4O4VA 2YR1A 1F5ZA 3EX3A 1FDJA 3C52A 5F2MA 4FXSA 1QMLA 1Q45A 4M5PA 2H3BA 1IXPA 3NQVA 1OYAA 4R7JA 1IIGA 1U83A 1OFOA 1I2PA 1UUOA 2ZA2A 4RJEA 1SUXA 4UTHA 4IQLA 4JDBA 1FDZA 4YL2A 5F2IA 1F73A 3S42A 1QO5A 1P1XA 3KAOA 5EY5A 1HFBA 1A5AA 5HR7A 3WK2A 1MEHA 2V30A 1B9BA 2RFGA 2VFEA 3CTLA 2GPTA 3N9SA 2HTMA 1F6KA 3O6DA 1OFQA 1V5XA 4NT0A 1LTDA 3MUXA 4Y90A 1W56A 2QCEA 4PA8A 1SSGA 3LLDA 2GVLA 4UC5A 2F84A 3W85A 2ZRYA 1THFD 5AB3A 2ZZ7A 1ALDA 1JCLA 2NWRA 4KWWA 1OK6A 4A22A 3LV5A 1F7BA 2Y7FA 3W7MA 1H1ZA 4UTIA 2ZTKA 1SO3A 1F74A 5DELA 3GXNA 2YXGA 2WQPA 3IIPA 1TJPA 1LCOA 1TPEA 3KXQA 1H62A 1B4KA 1DQWA 3W2UA 3M5ZA 2V82A 2Z0IA 5AYYA 3ZWTA 1PHQA 1W3IA 1W37A 4O13A 4GJ1A 3LX9A 2XFWA 3BO9A 1YDVA 3A22A 5KZEA 1X7FA 1R30A 3NAVA 1NAL1 1T0OA 4ICNA 1LZOA 3JS3A 5C6MA 2DZSA 2ABAA 4OV9A 4IPJA 1SO5A 3G1SA 1ZFJA 5KSWA 2RDUA 4RKAA 2DP3A 2CW6A 4NJKA 4CQAA 1G67A 1RPXA 1GYLA 4OGZA 3M1ZA 3VE7A 4FXRA 4K7VA 5J5DA 4HNVA 3M9YA 1LBFA 3DI0A 1ZNNA 1JR1A 4JICA 2A0NA 5GVJA 3UWYA 2P1FA 4NVTA 3LV6A 3I6RA 5ABTA 4M7SA 4CNPA 4N9CA 2ATSA 3FOKA 6TIMA 3TW7A 1OFPA 2YZRA 4AB4A 4ZQMA 3NA8A 3V75A 1J5TA 3W7IA 1TQXA 4MFEA 3OEXA 4UNLA 3A21A 1O95A 3GDTA 3MMTA 4LW7A 3QF0A 1IXNA 1LLWA 4JR5A 2HS8A 1SPQA 2A4AA 3P62A 3A23A 3GDRA 3N2MA 2D73A 3P80A 1K7EA 1C29A 3P5ZA 1IIHA 2ZZ6A 1C9DA 2V0TA 5EBUA 2W0UA 4FEZA 4K6AA 1YPFA 2QEZA 1VYPX 1AMKA 2CLKA 3NG3A 2QUVA 3UNDA 1HL2A 2CZ5A 1W5PA 2WOQA 1D9EA 4H6KA 3HGJA 4OT7A 1PHWA 2C6QA 3BW2A 5HNRA 1WQ5A 1TMHA 3IV3A 1A5SA 4QAIA 1L2UA 1EPXA 3EXRA 3LI0A 1GVOA 4O1AA 4JTFA 4XZ9A 4ORIA 3FS2A 1SZGA 4RX0A 5L9FA 3G18A 1UB3A 3O63A 5F1UA 1Z42A 5H91A 3QFEA 4X22A 4LY8A 1T96A 4WY0F 1ZHAA 2YGYA 3CWNA 4HNUA 2TSYA 2Q3OA 3W9ZA 3LTSA 4LOCA 3FA5A 2Z6IA 1P0KA 2XN1A 1ML1A 4FX6M 1YXCA 4UTTA 2ZTJA 4O0ZA 3WJZA 3HG3A 3W86A 1KM4A 3HJZA 3DFSA 1H1YA 3LI1A 4E38A 1UASA 4UTWC 4WJEA 4X2RA 4JYEA 5U7SA 3IRDA 2P0OA 2NUXA 4O1DA 8TIMA 1N55A 4DO6A 1O5XA 3MHFA 4MLRA 3A24A 2AAMA 2QUTA 2GJNA 3NYZA 3NQ7A 1L6YA 3FFSA 3R8RA 3ZFHA 4U28A 2BZNA 4CCDA 1F76A 1H63A 1VYSX 3LM7A 3SIZA 2GJLA 2JGYA 4K36A 2VKZG 1XUZA 3UWQA 3H55A 5CSSA 3MBFA 1F2JA 1GTEA 2EF9A 3TA6A 1P4CA 2P10A 5K4XA 3I7QA 5D05A 5D03A 4LUIA 1EIXA 3HF3A 2G96A 2QCLA 4HNTA 4MY9A 1HO4A 4B5NA 5CPLA 5G4EA 3DFPA 4MPQA 4P2VA 5CZTA 2E5BA 1DOSA 1TV8A 1GG0A 3GK0A 5CPMA 1KFCA 1VCGA 2A6NA 1UUMA 1G4TA 5DCBA 4N4PA 5BOOA 3ABQA 2A1YA 3EX2A 1S5WA 4J9JA 3PUOA 3W1QA 1M7OA 2EGZA 5D02A 4RZ4A 2QJIA 3YPIA 1YADA 1EEPA 4AF0A 1ZAJA 3IVTA 1GJPA 5AHFA 3HB9A 1SO4A 1AW5A 1OVDA 2BSLA 2VEKA 3KOFA 4UTJA 3MBDA 1W5QA 4WZHA 4IXXA 3LBMA 3NM3A 4M6PA 5F4SA 3GZ3A 4PODA 5DXXA 3W2KA 1NEYA 1GWJA 2FLIA 1OF6A 2DJLA 4CQ9A 1FWWA 4QJ1A 3Q58A 3CIXA 2WNQA 5CZJA 2BX7A 2WSQA 4UTKA 1DORA 3B06A 3FEMA 4YCPA 3GKFA 5I3IA 1KV5A 3SI9A 3DU0A 1C8VA 1WOBA 2EPHA 3NO5A 3NZRA 1K3UA 1GVQA 1MXSA 5EPDA 1AW2A 3RMJA 4O14A 3O15A 1EWEA 3IIVA 3UWVA 3EKLA 1RQHA 3C2OA 5KINA 1SFLA 3PG9A 2WSYA 4JIPA 3B4UA 1LP6A 2CZFA 3W7JA 2V9DA 4PTNA 1JQVA 5D32A 1XBVA 2QF7A 3WK0A 1H7NA 2V81A 3M43A 5CG7A 1XDLA 4Q4KA 1Q3NA 3QMSA 2ISSA 2QCHA 3VFLA 2RH9A 4OHQA 2VFIA 3W70A 5G2HA 3UYCA 3P74A 1VZWA 4RCXA 4IMEA 3QPYA 2B4GA 2A7RA 3DENA 2BTMA 3W2LA 2Z6JA 2WO5A 3FJLA 3P82A 3SGZA 1W3NA 3I68A 2WNZA 4EIVA 2QJGA 4GUHA 4ORMA 1B3OA 1QCWA 3M5XA 5L6UA 1OFEA 2TRSA 1G7VA 3HGRA 4TU1A 4IOTA 1WBHA 3STEA 5C55A 3SECA 1TTIA 2PCQA 4IMGA 5HJLA 3C2FA 3C2RA 1KV8A 4LVDA 2X1RA 4MJZA 1PE1A 2ISVA 3NQAA 1PCWA 4CCCA 2G97A 3S1WA 1YPIA 4UCGA 5CZSA 2WV8A 4KKXA 1QOQA 1WOAA 4UMBA 3HG2A 3JRKA 3CPRA 3NXFA 1W54A 1WYIA 3WJWA 4LVGA 4IUOA 3C61A 3TC6A 3KVLA 2AQWA 1XKYA 2LLEA 3KRSA 1DBTA 4M6VA 3O6YX 1TB3A 4JTUA 3LERA 4NJJA 2FDSA 1K8ZA 4QNWA 3TFCA 1M7PA 3G1AA 4H4IA 3TJLA 4AEOA 4ZQOA 4PL1A 1VC4A 1G7UA 1QPOA 3UXAA 4OE7A 3EEGA 5LGZA 3NR0A 1TPWA 1XXXA 1ICSA 3B0PA 3FKKA 1W8SA 3W7LA 3ZWSA 2CLHA 4JX5A 5AYZA 3EKZA 3G1YA 4G1KA 3T4CA 5IBXC 4N2YA 3NPWA 4ZVJA 1WDWA 3HPXA 4DF2A 3L65A 1IGSA 1VS1A 2BWGA 3I7RA 3MW7A 4JS3A 1ZAIA 3SGUA 1ME9A 4YWIA 4UFLA 4FIRA 3VKJA 3T44A 1FY6A 3IIXA 3KFTA 1OX4B 4O15A 4EVZA 4UR8A 4DXVA 1XBZA 5BRBA 4Y8FA 1NFBA 3FIGA 3EWZA 2V5LA 5DBTA 3MWAA 4Y6GA 1QO2A 5D38A 4CCEA 3DFTA 4O50A 4AWUA 3EX6A 3BLEA 4I9AA 1QAPA 4I7UA 4PC8A 4PH6A 3TC7A 1GTHA 2QCNA 1VHCA 3E0IA 2I1OA 3ATZA 3HO8A 3PAJA 4EF8A 3S1UA 4FO4A 3W7DA 1RQEA 1EUNA 4I7WA 4Z0SA 5EA9A 2HSAA 3C56A 5SWUA 4A21A 2GUUA 1LRTA 2OT0A 2Y6ZA 3W07A 3DHFA 3SZ8A 3BW3A 5K9CA 1KLZA 1YTDA 4WY0A 4LRSA 1KM0A 1FCVA 3DHDA 4O8RA 2FIQA 1H60A 1K03A 2YYTA 5FF4A 3U8GA 4O0KA 4GXMA 4BI5A 5FF0A 4X9SA 1G4SA 2ZZ1A 1PL9A 5D2YA 1B4EA 1TTJA 5DLCA 1R47A 3QQ0A 4NU7A 1GEQA 1DV7A 2Y88A 4HHPA 4FHAA 1TSIA 1VYRA 1FCBA 5K7JA 3O05A 1TRDA 3W76A 3B8DA 4JD4A 4JTJA 4O53A 3NL2A 2GQ9A 3GAKA 5AOUA 3DGRA 3NQMA 4ADTA 2ZFAA 2WJZA 4GFSA 1FBAA 2JKEA 3B0UX 3QQ1A 4TO8A 2OT1A 2E5DA 3GDMA 1OFDA 1V7YA 2DZXA 2V2DA 4IJBA 5LKYA 3T7VA 3OVRA 1OYBA 3LCLA 3HQ1A 3QZEA 5FEZA 3M44A 3UXDA 4LS2A 1QFEA 2DZUA 3EWBX 5D2XA 5KITA 2NUWA 3WFAA 2OZ0A 3E9AA 1A50A 1F05A 1YXYA 2W6RA 5AN7A 2QJHA 5K2ZA 3CLMA 5IBXA 4QNEA 4ML9A 4WOQA 4DELA 1WBJA 3ZS4A 1J2WA 3ATYA 3MYPA 4AHOA 3W1XA 4NNBA 3HPZA 1MO0A 3UZ5A 4K37A 2ZRXA 2HS6A 2PE4A 4DO4A 4ALDA 4RK8A 1YYAA 4NUWA 4DF1A 4PL2A 4WY0B 4GNJA 1W0MA 4UUIA 4TMBA 2AGKA 3QW4B 5E1QA 3W2JA 3FKRA 3MP5A 2Y62A 2CLLA 3CM4A 1Q6OA 4TX9A 1FCUA 2QCMA 5K3VA 3OBKA 3G1FA 3W83A 1ICPA 4BWLC 2B7OA 3W1PA 3OG3A 2E6YA 3L9CA 2G95A 5DY2A 4AXKA 3UPBA 1B57A 4LVFA 1FWRA 4FNSA 4LUJA 4HSOA 2X1SA 5I3GA 3NQDA 4JDYA 1H7RA 3ABOA 3M5VA 4PFMA 1EP1A 3PSVA 1L6WA 5AHMA 1DL3A 3H54A 1OYCA 1KTBA 1RQBA 1QWGA 4FNRA 2X16A 3LCHA 1HO1A 3NGJA 4CNNA 4A3UA 2B0MA 3Q2DA 3BLFA 4ZL1A 1FXPA 1LORA 4MYAA 2TMDA 2V8ZA 1W1ZA 2Y63A 3OHIA 4FNQA 5I3JA 3CHVA 3NQ8A 4MJMA 3IIOA 1LOLA 4O12A 2FQIA 3PULA 3NL6A 3LB0A 2YSWA 4EWND 3C0JA 3P8JA 7TIMA 4XBSA 1XCFA 3W6YA 3DFQA 4NZJA 4IPIA 3STFA 3TXZA 1WXJA 4N9BA 3B05A 3BPWA 3QW3A 4LV9A 2NX3A 3KVMA 1WA3A 4N9EA 3L5AA 5G5IA 1E51A 1YTEA 1OABA 5AYXA 5LSMA 3QMTA 2Y89A 2KZHA 3AJXA 3EXSA 3GX9A 3I65A 3GIYA 1TIMA 3MO7A 4O28A 3A5FA 4HIBA 5KTLA 3G22A 5EL1A 1LOSA 3M6YA 3IEBA 1PCKA 3R89A 1OHLA 3G1DA 4LVBA 1ZALA 2EKCA 5FI8A 1GVSA 1I2OA 4FNTA 4R53A 1H61A 2VOMA 3NZ1A 3OIXA 5HQEA 3PUEA 1QOPA 1S5TA 3TW6A 2J24A 1W31A 3LHVA 1RV8A 3NOEA 4Z1AA 3TSDA 1K02A 4MKNA 2C16A 3RU6A 5AHEA 4HPJA 3DI1A 3N19B 2B7NA 4UMAA 4LWWA 3C8FA 2FPTA 1A53A 4ONVA 3PSWA 3D0CA 1H50A 3LDVA 1MSSA 2E5CA 2YW3A 1FXQA 3PBYA 1LBMA 3UPWA 3EWWA 3TV8A 2CLOA 1EWDA 5FEWA 1R2TA 2E6DA 1I45A 5D37A 3NPUA 1SU5A 2JKAA 1NVMA 3LCXA 4A2RA 3F1QA 3O6CA 4OV4A 1LYXA 3MI6A 3MJYA 2VFHA 4IGHA 4IMDA 3LCIA 1KFLA 3G1XA 3BGGA 3W1TA 3R12A 2ZZ3A 4KFPA 5K4ZA 1BEUA 1H7WA 1XBYA 1HTIA 3UQNA 5K9DA 3GKAA 3TNOA 1OK4A 5FF7A 4BWLA 1GQNA 2FPVA 4JXCA 2V2HA 3FLUA 4CQ8A 5FESA 4NJIA 4KWVA 3KHJA 1SW7A 5E93A 4O1CA 2GVJA 1MZHA 4FIQA 3M41A 1TPB1 5KMYA 4JTTA 3W87A 4MZYA 4O10A 1JUEA 2PURA 4K8EA 3PC0A 2E09A 3EWUA 5AHLA 3M16A 1X1OA 2O7SA 4TIMA 1WX0A 3TFXA 1OX5A 5HUOA 2DZTA 1L9WA 3TXVA 2ZRZA 1Z44A 2ZZ2A 3TROA 1KM5A 2C14A 3G0UA 3P84A 4JEQA 1RZMA 3BG3A 3S9YA 4JTSA 3NQFA 5D2TA 3QC3A 3HIJA 1LM1A 3UWZA 2CLIA 1G69A 3CIWA 3W7QA 4IX0A 1G4PA 2NZLA 5I3HA 1YDNA 5BNKA 4YXGA 3QSTA 4DQWA 3S1XA 3W88A 1BWKA 3G24A 3PS7A 3V1PA 3DXIA 5BMWA 4UFKA 3P60A 4ZQNA 2Q8LA 2GVGA 1A5CA 1I2QA 3DBPA 1NSJA 3LTPA 4O18A 1KFJA 1JJKA 2NV1A 2ZRVA 1H7PA 3TAKA 2QCDA 4S1FA 1EP2A 3USBA 5F1VA 1YXDA 3BVJA 3PBWA 3HPSA 5J5RA 1DQXA 3BW4A 3MHUA 3U2OA 3TMQA 5E0KA 4IWWA 4JYDA 3L0KA 3NNTA 1W3TA 4QIUA 4UTWA 3IGUA 2H8XA 4K8HA 4YCOA 2QAFA 1TTQA 3DKLA 3HGSA 3DAQA 4UTUA 1S3HA 2NXIA 1XL9A 1G6CA 1RD5A 1SO6A 3DZ1A 3GR7A 3LHYA 4KFOA 2VEIA 2C1HA 2CLFA 1F6PA 2X1UA 1SSDA 1GT8A 3SY5A 1LROA 5G1YA 3LRLA 3IGXA 1HG3A 1O5KA 1GVRA 1JCXA 3O07A 1SQ7A 3QJAA 3MI2A 1BKSA 5D2WA 3W7OA 1QPQA 1PIIA 4Z1CA 1IXQA 2NV2A 2ALDA 3C3NA 3ELFA 3W75A 3O06A 4Y96A 3LCFA 1MEWA 4WD0A 2C0AA 3HGOA 2J9YA 4UMCA 4XKYA 3TE9A 1TPFA 1TREA 1LLZA 2ZRUA 5F2LA 5CPOA 5DY3A 4AF0B 3S5YA 4AHPA 3W74A 3CB8A 3M5YA 2WKJA 5AFDA 4O17A 1VCVA 2E68A 2J6XA 5DXYA 3CWOX 3WJSA 5CPNA 5A8GA 3L68A 5D2VA 4N4QA 4QSHA 4WXZA 1KFBA 1UJPA 3C6CA 1VQTA 4NNCA 4OU1A 3G1HA 1BWLA 1TO3A 1K7XA 4BK9A 4JTLA 1XFBA 3IVUA 2VFGA 3TU9A 1QR7A 3KX6A 4AWSA 4AAJA 1XI3A 3KRZA 3VNDA 3O16A 3TKFA 1W5OA 1K7FA 2NX1A 1G4EA 1VCFA 1TQJA 3GNDA 1R2SA 3LOTA 2QCDB 2RDWA 3Q94A 3NQGA 3LHWA 5TBOA 1TPC1 3W7CA 5KZMA 3RNDA 5HWNA 4YLWA 1T8XA 3L5MA 3H53A 3R13A 1RR2A 3HG5A 2PRMA 1XM3A 1N8FA 2DZWA 4LS0A 4O11A 1I4NA 2NLIA 3WJYA 2W79A 4MY8A 1AL8A 3WJXA 4GWEA 3MI3A 4OBTA 3S5OA 3VCRA 1KM3A 1KFEA 3N2XA 4MZ8A 2WNNA 1CX9A 1EP3A 4QISA 4LC8A 3NPXA 1LRQA 2CZDA 2VFFA 3P61A 5D04C 4XTDA 2A7NA 3EX4A 3MYOA 3BK0A 3LGEA 3IGSA 5LZLA 4OQVA 3N14A 5HINA 3BARA 4C1KA 3UY8A 1SR9A 3QH2A 3MP3A 2XN0A 2YDAA 5BW6A 3TX9A 4NQ1A 4RV8A 3UY7A 3L0GA 3QMRA 3OVPA 3PY2A 2G5WA 2CLEA 1KA9F 2CU0A 1U5JA 3TK7A 4DEFA 4ZMGA
chains in the Genus database with same CATH superfamily
5HWMA 2ZQ0A 5AZ1A 3G1VA 1E1CB 5IOBA 4H9ZA 1T7LA 4CQCA 1NDZA 2E77A 2VR2A 3AUJA 3RX2A 5A6LA 5IM51 5IDIA 3S8HA 4M6QA 5D8ZA 2J9XA 1HJVA 1JPDX 4LTSA 1J10A 3HQOA 3AXHA 4AMAA 1HVQA 3SW6A 3TTEA 1P7TA 4JIRA 3MMDA 2XH0A 4WRHA 2ZZ4A 3AMCA 4YPJA 1WAUA 1E55A 1W32A 4JIQA 5LHFA 4GZEA 3CV7A 1FWBC 3OZOA 4B3ZA 3NPVA 1JCNA 5G1TA 5HJYA 4BFAA 3G8RA 4JX6A 1Q7ZA 3BOXA 4L64A 5FEPA 4OZOA 2X7VA 2FHBA 5TD4A 1X8FA 4MIMA 3KW3A 4TXEA 4FF7A 3PWIA 1PTAA 1OD0A 5HDRA 3CPGA 4XTIA 2CXGA 4PMRA 2BGSA 4DRSA 3LHTA 1IEIA 3VKBA 2WC3A 1HP5A 1R46A 2HVOA 4GBDA 5HMFA 2FGLA 5HULA 1JULA 4FX7A 3S1VA 4DYKA 1YHTA 2PPGA 3PF3A 4HHMA 4GOAA 3MSYA 2QIWA 4DAFA 1WZKA 3TIMA 2ZADA 4H83A 4F0LA 4WEVX 3VIPA 1HJQA 2F61A 1IZCA 4WUIA 3MQTA 2OQLA 3IAPA 3SAZA 4UFMA 1HGYA 4WLCA 3VI2A 1UR8A 1K9EA 4MDPA 3IJDA 1V6UA 3BG9A 2WQDA 1J0JA 1JCYA 3TQKA 1E3XA 5C8BB 3GLCA 3HG4A 2JIEA 3AZRA 1LQAA 3WFLA 1VLWA 2CWNA 4YHEA 5HATA 1Z9AA 3P7YA 4PEKA 4GUGA 3W1RA 5AC8A 3EB2A 5C5YA 4N9DA 2WZTA 1OJXA 3U7BA 2YPIA 1GVFA 5XIAA 1OFAA 1WDPA 1MQQA 4DVOA 5C9RA 1PV8A 2OLHA 2A5HA 1TUFA 3ANYA 3GDKA 1QDSA 1Q6EA 4J2MA 5C9UA 3CL8A 3TZFA 3PR2A 3QY7A 4EX4A 4I7VA 1S5VA 2EKGA 3WLHA 5U4NA 4DXXA 1NU5A 1WPCA 4Q8TA 3FJNA 1VFLA 3IK4A 3W84A 1KM6A 4OJYA 1O94A 3FSUA 3GVGA 3RF9A 1MEIA 2RJHA 2TODA 1FDYA 4MSSA 3BJTA 3H21A 2C13A 2GQAA 3U48A 4AC1X 3SSJA 4KCUA 1BQGA 2QCGA 1Z41A 4JY8A 2DPEA 1YNPA 2QCCA 2O92A 3CO4A 1XFCA 3B97A 3CJPA 2X1TA 2PU1A 3OA5A 4PMUA 3WLKX 1TPH1 3S6OA 4GE8A 1QPNA 1FX6A 3WO8A 3E74A 2DT1A 2CBUA 4ADSA 4A3QA 4E6MA 4DN1A 1V3KA 2E25A 2ZRWA 2PDIA 2IPFA 4HPXA 2J8GA 3BQ5A 2VFDA 2CITA 1CZ1A 4JN7A 1R3WA 3L67A 3S6DA 4P61A 1MZRA 5FCZA 4NXKA 3P14A 3USZA 2HXUA 3LS9A 3FXYA 3JZEA 3MZ2A 4I6KA 4J5NA 5H8UA 3AUOA 1OBAA 3UJEA 3OLIA 3ES7A 2R1KA 1IEQA 3W22A 4NILA 1CB7B 1R3YA 4HB7A 3AS0A 3UG3A 4BZYA 1YDOA 2BODX 5DO8A 4GIEA 3URQA 3JZUA 4RLIA 1ADOA 4FPSA 3BG5A 4GJIA 3G3MA 2J9ZA 3NEVA 4DO5A 1W9UA 5BMXA 4LT9A 4HHLA 4BR1A 2PMQA 1VP5A 2WHMA 5LIUX 4Z1BA 1KTCA 3W7KA 4HZ8A 4FNPA 1N82A 4FB7A 3M7WA 2QIIA 4XZNX 4FZIA 4EACA 1XDJA 4LF2A 3MCOA 4HA4A 1RBLA 3HMJG 3C4UA 4NAEB 2C7FA 4JHZA 3HPAA 3AO0A 3TOPA 3WQEA 2Y85A 3N25A 2ZX6A 3N29A 5I3DA 1REQA 2Q02A 4O19A 1JYNA 4R34A 1M65A 1J6OA 3WQFA 2OMAA 4AY1A 1SFJA 5C71A 1QXLA 4IGNA 4RNHA 4PULA 1E43A 3N73A 5F4WA 4Q32A 2X7WA 1Q6DA 3HOJA 3M0KA 1BYCA 3O0FA 1KBJA 1DWHM 1UP2A 2D22A 1TJRA 1IT7A 3DYOA 4P8XA 1XSJA 4LXFA 1FH8A 3W7EA 4QJ5B 3TR2A 3VAVA 1D8CA 2JEQA 1AG1O 2V3EA 3F03K 5FJPA 1A3WA 3RK8A 6REQA 4HNCA 4RDWA 3UJFA 2IXUA 1VLIA 3JU2A 3EOEA 3TMLA 3WBEA 3K13A 4J3VA 4ZSTA 4BQ2A 3LYEA 3BWWA 3CMGA 1I8JA 3FCPA 3OJGA 1KLYA 2XZ7A 1UH4A 3RR1A 2WM1A 3B04A 4HT3A 3W7RA 1ECQA 1JNEA 2P76A 3E0WA 1T5AA 4GVFA 4MB1A 1OX6A 3FJ6A 2X0YA 3C0LA 5T26A 4E8CA 3T55A 1X6NA 1E9LA 3PM6A 1ZUAX 1UWAA 1XV8A 4IIBA 3UPMA 3EOLA 4IJCA 3VOHA 1QK0A 3C5QA 4L65A 5D09A 4WR3A 3T8QA 3UD6A 1UKQA 3IARA 3U7VA 2VC7A 1R5YA 3CAQA 1B0IA 1O4UA 2E1DA 1OCBA 4AX6A 4Q7BA 4UFIA 4L9ZA 5AYIA 2UWFA 2C3ZA 4MDOA 3NSNA 3V3WA 2F9RA 3DOPA 3MVTA 4F0KA 3BC9A 3WLRA 1ICQA 3SRKA 2FJKA 1KW1A 5CLWA 3NQCA 3E5BA 4GGBA 3N4EA 2A3BA 2VDGA 3K8LA 1TR9A 4O57A 4E3TA 3VXGA 4V27A 4JTKA 2FB2A 4RXGA 6REQB 5H2ZA 3TTQA 2H6RA 1O66A 1MFUA 3EX3A 3C52A 1UROA 5F2MA 1J6PA 4LAMA 3GS6A 2Z1VA 4LBUA 3B40A 4C6QA 3KOXA 3CNYA 2DSWA 3UW6A 1JFXA 3M46A 3SUSA 1FDZA 5A2AA 2UY2A 5F2IA 3WDIA 1C8YA 1KQYA 3SO7A 4Y7EA 1OGBA 4B2DA 3A4AA 3GR4A 5HR7A 1MEHA 2V30A 3DEQA 2QV4A 1MQPA 2JF7A 2Z24A 3I3EA 4AFYA 4HK5A 3N9SA 2EPKX 3T4WA 3VIOA 1UD6A 1E72M 4XZLX 3AQUA 1V5XA 2PD9A 1J0HA 3F7JA 3RIKA 3LLDA 2GVLA 2D2OA 4W7VA 3JVAA 2A3EA 4XZIA 3EMQA 4MGGA 2AGTA 2R9RA 1AQ0A 2ZZ7A 2DVUA 3LD5A 4KWWA 2Z7KA 3BOLA 3GFYA 4A22A 1VFFA 3LV5A 1C90A 3BZJA 2ZTKA 2W4XA 1F74A 5DELA 4DLFA 4LYRA 1DJWA 1LCOA 1YE6A 4A05A 1B4KA 3W2UA 1DWFM 2Z0IA 4K68A 3ZWTA 1K70A 4BQ3A 3ITOA 2C8NA 4C6FA 4IIEA 1LZOA 3JS3A 1CDGA 2ABAA 1TE6A 2ZIDA 1JDEA 5A8PA 2RDUA 2CW6A 1EPVA 2YLAA 5G1MA 3WELA 3WH5A 4HNVA 2PGWA 3DI0A 4JICA 1BVNP 4GO8A 2P1FA 3PZ9A 4REQB 4I5UA 1GOOA 1W3KA 5M5DA 3J7HA 3FOKA 4C60A 2QT3A 2YZRA 4ZQMA 5DMNA 3NA8A 4PMZA 1WDSA 3WLNA 1ZTVA 3VOFA 1JF5A 3A21A 3UXIA 5C2CA 2HNHA 3VD9A 3VIFA 2PLJA 3DGBA 4R7OA 4MWAE 4JHMA 3AHYA 3P80A 1K7EA 3P5ZA 3PFRA 2ZZ6A 2W0UA 4K6AA 1YPFA 4DUXA 4UQEA 1ZB5A 4FR1A 3UA4A 3NZQA 4ZO9A 1UQZA 3UNDA 2CZ5A 1W5PA 4H6KA 2CIPA 1C3FA 1PHWA 2C6QA 3BW2A 3AU6A 4OBRA 1TMHA 4QAIA 3KBMA 1L2UA 3N15A 3OYXA 4JFSA 3EXRA 1GVOA 3CUGA 3WF3A 4O1AA 3FS2A 2OSWA 5L9FA 1OEPA 2ALRA 1UB3A 5C7HA 3CAKA 4JKKA 3QFEA 4WY0F 2ACUA 3CWNA 2FYMA 4PR4A 1SM9A 2VD9A 1ML1A 4UTTA 1YXCA 2WC7A 1F3EA 3W86A 2VQUA 5LIKX 3T8LA 3ITLA 4CNUA 1H1YA 3DHUA 4KT2A 4S3DA 4PE8A 2PWUA 1KXTA 2OSXA 4JQ4A 1AJZA 3II1A 4DO6A 1H0GA 4PMOA 4B5UA 2DEPA 3A24A 4MLRA 4AZ5A 2GJNA 2YJQA 4K1WA 3NYZA 3AIWA 3U4AA 1Y65A 4GKLA 4ROPA 5FAJA 4CCDA 4AD2A 4B5TA 3SIZA 2VX7A 1KC7A 2VKZG 2P0IA 3URAA 1MDRA 4QDPA 2BASA 5I5RA 1T8QA 2VGFA 1F2JA 2PD5A 1GTEA 2EF9A 1YKWA 2E4TA 2OR2A 5K4XA 4MUPA 3T08A 4F3HA 1W1TA 5G4EA 3R8HA 2Z29A 4IL2A 3ZVHB 3B8UA 1DOSA 2O0TA 3GK0A 5CPMA 1CBGA 2XISA 1KKOA 2MUCA 4ACYA 3WUFA 2XZ9A 3AMKA 3ABQA 2A1YA 3VOIA 3EX2A 1F4HA 4W8BA 4J9JA 2JFEX 3DERA 1FHLA 1KB3A 3STPA 5MKGA 4PMQA 3GG1A 5D02A 4RZ4A 3BAYA 1H11A 2J13A 1XLMA 4AF0A 5FKYA 1QRQA 4PCNA 2VZOA 2MNRA 2P8BA 1HN1A 1OVDA 2VEKA 1E0WA 4G8TA 5FD0A 5XINA 1WUEA 1W5QA 2XUCA 4IXXA 3LBMA 4GYPA 4M6PA 4PODA 4QSFA 5DXXA 3W2KA 3CQIA 3H8AA 1Z8AA 3TOYA 1GWJA 4U3AA 4CQ9A 4DBUA 3EDDA 3D47A 1FWWA 3IJ6A 4UTKA 1XLHA 2EG7A 3OO2A 4G9PA 3T0DA 3UR2A 4YCPA 2V63A 5I3IA 1XYCA 9CGTA 1XLFA 3IWPA 3DU0A 3WIJA 1OWQA 3LLXA 5M1TA 3VGHA 1MXSA 1JZ3A 3UWVA 3EKLA 1D7KA 2WM0A 3PG9A 1XIGA 2CZFA 4AD3A 5FJRA 4GIAA 5HAOA 3TYAA 5D32A 4DWSA 2NW0A 5FSDC 2YL8A 5AYBA 4C6LA 3M43A 2DV0A 2DSZA 1FA2A 4Q4KA 1Q3NA 3KBSA 1NDYA 3VFLA 2RH9A 3SY8A 3N18A 3RO8A 5A6BD 5E09A 4Z17A 3GQYA 4DJDC 2BHYA 3QPYA 3VGDA 2A7RA 3DENA 3W2LA 1P1MA 4RZBA 2YB4A 3PNZA 4ORMA 4B5SA 1QCWA 3SGGA 1XRTA 2ADAA 3GXMA 1KR1A 1R85A 1OFEA 1G7VA 4OOUA 3SN4A 3UZWA 3HGRA 4TU1A 1PX8A 1WBHA 3NSXA 5MKGB 2I57A 1TTIA 4IMGA 3ARPA 3V5FA 2PDQA 4LVDA 3S2CA 2BY0A 1EJSC 2QUNA 2XGIA 1UD4A 5B80A 1F3XA 5CZSA 2HVMA 4GHRA 1WOAA 4UMBA 3VZXA 3ARZA 3HG2A 1K4GA 3WJWA 2ZE0A 1NIUA 3TC6A 4NY2A 3L4TA 1NP2A 3KVLA 2PP3A 3VNYA 3GY1A 3MKCA 1OT2A 3B8TA 1C9WA 4W7UA 4QNWA 1E9YB 5H8MA 3VNMA 2WNWA 4K8GA 1CGYA 1XIFA 4H04A 4ZQOA 4PL1A 2YBTA 3EEGA 3R8GA 1XXXA 2KX9A 2XH4A 1AUSL 3VGEA 2CLHA 3M4HA 4PMJA 5RUBA 3T4CA 1WDWA 3U4FA 3BAWA 3BAKA 3P6LA 5CCZA 3SGUA 3PP7A 4DWSB 3QHMA 5IHSA 1XR2A 2XSAA 4ZBCA 1DE5A 4G7EA 3IIXA 2OEMA 4EVZA 1Y8BA 4XD3A 4AYGA 3CIVA 1XBZA 4QX4A 1NFBA 5DBTA 1J5SA 5CAHA 2VVNA 4PUWA 3WQ5A 2WCSA 4O50A 1XF0A 1EO7A 4PC8A 2PTZA 1IHIA 4HTBA 3GC5A 3OBEA 3S1UA 4FSAA 3C0SA 4H41A 5LXEA 4I7WA 5EA9A 2O56A 4A21A 2EQDA 4HQVA 1LRTA 3LSCA 1FHDA 2NSXA 1KM0A 3A4XA 2W63A 1H4PA 5A8OA 1QI4A 4LX4A 3AMGA 1UPMB 4O0KA 3H2AA 1QHZA 4BI5A 3VTRA 2PDFA 2ZZ1A 4HU8A 3ZVIA 3VIHA 1GEQA 4B3KA 3O05A 4EPKA 3W76A 3UU0A 1EHAA 4WSJA 2GQ9A 3ITXA 2OWXA 3AHXA 5AOUA 3DGRA 4JBRA 2ZFAA 3T09A 1WO2A 3UZZA 4F2UA 4KCVA 3BDKA 1FBAA 3LQLA 5AZ0A 5T8GA 5LKYA 2WMJA 2CKRA 7TAAA 1RCXB 1MWOA 2FZDA 3PNUA 1OYBA 2FVLA 1R9ZA 2Z2AA 4EAMA 3AXKA 5FEZA 4F2TA 4G7EB 1RA0A 3UXDA 1QFEA 3EWBX 4Q4MA 2NUWA 4H19A 3SQLA 4GMEA 1VKFA 3C8NA 1ADDA 5A8MA 3L4XA 1A50A 1F05A 2D3NA 3VZZA 4YTQA 2QJHA 4ZEPA 3MDUA 2DY3A 1L0PA 5A69A 4WOQA 4LB3A 3VNIA 3S83A 3ZS4A 4IFKB 3ATYA 4ML4A 4M56A 4RE0A 3LPGA 3BCJA 1QHOA 3MYPA 3W1XA 2GUYA 4RL3A 1JCTA 1QW7A 4DO4A 4F0SA 1Q65A 3SUVA 1RY0A 4UZSA 1XD0A 3TN3A 3QFWA 3BAIA 5B7YA 5BWFA 4TMBA 4DX3A 3FKRA 3CM4A 2QCMA 3WH9A 3G1FA 1HZYA 1OIMA 3D3AA 1ICPA 3LMYA 2B7OA 4KWUA 1DXIA 1B54A 2G95A 4AXKA 2Y5JA 4GC3A 3CV1A 2G50A 4MNMA 1L8NA 5I78A 2X1SA 5I3GA 3NQDA 4R7WA 2VR4A 1EP1A 4P8WA 2V68A 2WVSA 1L6WA 5KEZA 4WF7A 2D0FA 3N6QA 4C6BA 2B81A 4FNRA 2X16A 3VIKA 5FJUA 1QNOA 4ZB5A 2Y63A 1W1ZA 5I3JA 1AH3A 5G4HC 1EA9C 2MANA 3GW3A 2FQIA 1R3QA 2BY2A 3C0JA 3B8WA 2XIIA 1DXFA 4W4QA 4NZJA 3TXZA 4N9BA 3QW3A 3KCOA 1K9DA 4LV9A 2IMRA 3M0MA 4MPKA 2VO5A 3KVMA 3E2VA 5G5IA 1OABA 3QC0A 5LSMA 3CL7A 3QMTA 4FMVA 4Z42C 3T05A 2Y89A 1G1YA 1Q8JA 2CYGA 2OELA 1G5AA 2Z25A 7A3HA 3M6YA 3GC4A 3IEBA 3VD4A 1PCKA 2BOEX 2OEKA 3KS5A 1A5UA 1J01A 4UOJA 4MKVA 4HOXA 1IT0A 2XDFA 2PWVA 4LUYA 4M29A 5JQ9A 1E4MM 3CAWA 4L1GA 3NZ1A 5HQEA 2RJGA 1S5TA 2J24A 1W31A 3LHVA 1WCGA 1WXYA 3TSDA 1WZAA 3EBVA 4ZE4A 1CPUA 4LWWA 3WYZA 4PEEA 3KL3A 3TV8A 1UKPA 3GG0A 1R2TA 5D37A 3NPUA 1SU5A 1NVMA 2VCCA 2EG6A 3W82A 3N11A 3PTQA 3MI6A 4IGHA 3LCIA 2X41A 3RN6A 4DJDD 1YX1A 3UGRA 2ZZ3A 2YL6A 2INFA 2PODA 3GKAA 3CH0A 1OC5A 3AHTA 1NWUA 1CLXA 5FESA 1ZQ5A 2P5NA 1SW7A 2D24A 5BZAA 1UZHA 5E93A 2EBNA 4O1CA 5FA5A 2ACSA 2GVJA 1MZHA 4AEEA 1JNDA 2J7BA 2PDJA 1CLKA 4MZYA 1VAHA 3OPSA 4K8EA 4F40A 3EWUA 4MADA 4C6NA 4R85A 3OTRA 1WX0A 1OX5A 1XPGA 2V38A 5HUOA 2DZTA 4JZ5A 3TXVA 4QTGA 3TC3A 3TROA 5E5CA 4MWAA 4JTSA 3QC3A 1RAKA 3ARSA 3UWZA 1UWQA 3SURA 1G69A 1KGXA 4B4FA 3L2MA 4D6IA 5I3HA 1RPKA 5FAGA 3S1XA 3G24A 1BWKA 1P0DA 3V1PA 3DXIA 3IJ9A 2ZUSA 1RLDA 4UFKA 4U2ZA 2Q8LA 5C9WA 1QVBA 2VRJA 1T40A 5A2BA 5GPRA 5J5RA 2EJAA 1CGUA 5CBJA 3AWOA 1ZJBA 2CNCA 2P8CA 4K8HA 4DLMA 1GK8A 1Z32X 3VGFA 3HGSA 1RD5A 1KRBC 4KFOA 2VEIA 2C1HA 2CLFA 2FZ9A 3SADA 2VMFA 3E6EA 2X1UA 3WX7A 1SSDA 1L2QA 3IGXA 1HG3A 2EG8A 1DWAM 1VBHA 1BKSA 1BKHA 5FIPA 3ELFA 3OQ8A 3O06A 4Y96A 1EDGA 1R6WA 3HFYA 4WD0A 2J9YA 4XKYA 3WMSA 4K2SA 3TE9A 4AZHA 2BVWA 3LNMA 3W01A 3RITA 4BF7A 2VM8A 2PGEA 3KOWA 4GNKB 5DY3A 3Q65A 3ZSTA 2WKJA 3WD0A 4W93A 8A3HA 3QZAA 1DIDA 3SCVA 2J6XA 1GJWA 3RCNA 1M04A 1TVNA 1XLIA 5CPNA 5D2VA 2WSKA 3CTTA 3EPOA 3VGGA 4MWAB 1QJWA 4HHHA 1KFBA 3LZ5A 2E7FA 3CQJA 3S4TA 4YU1A 4JCMA 1GEHA 3G1HA 1TO3A 1K7XA 1GORA 4AZIA 3QV9A 3NO3A 3WQCA 3SM0A 2VFGA 3WUBA 3TU9A 4CQDA 4AAJA 1XI3A 3TR9A 3KS6A 1XG4A 1QI0A 2NX1A 2P3ZA 5LA2A 2CZVA 2RDWA 1ZBVA 4CU6A 2J78A 2FVKA 1TPC1 1UC4A 1UD3A 3L5MA 2CHNA 3R13A 1RR2A 1MW0A 2GDQA 3RPMA 4LS0A 2PDUA 4HYWA 1I4NA 2NLIA 4QG6A 3H4XA 2I56A 1UYQA 3VCRA 2BMBA 1KM3A 4MZ8A 4BF5A 1EP3A 1TJ0A 3BSGA 3BK0A 2OGYA 3LGEA 3GFXA 3IGSA 3URNA 1GOMA 5HINA 2YDRA 1F3WA 1UH2A 2I17A 2A3AA 4ZFMA 3CZKA 3OVPA 4Q8MA 1QI2A 2OO0A 4XO7A 4IJRA 3TW9A 2CLEA 4FAMA 2CU0A 4MB5A 1U5JA 3TK7A 2V67A 2WYSA 1GOQA 1VENA 2V5BA 4CLMA 4C5ZA 1IT8A 4Q8VA 4QITA 3S9ZA 1YRRA 1VJIA 4QLJA 2J75A 4IMFA 4WVXA 3AS2A 4RNFA 2QZRA 2DH3A 4S2CA 8RUCA 4HGXA 4KERA 4AWTA 3K5XA 2JEPA 4NJGA 4Z2IA 1J11A 4WDTA 3G2GA 4EWJA 3TJIA 1NTHA 3LXAA 1Y0EA 4NX5A 1LG2A 2WZEA 4U3CA 3IVSA 3M7SA 3RLVA 3FY1A 2X8RA 3MUY1 4NASA 1S2TA 2XG9A 1EB3A 4JTHA 1UG6A 3T0CA 3IGHX 2NWSA 1IR2A 2FVMA 3QPZA 5DN1A 3O6AA 2HISA 2YL5A 3GR8A 4MZ1A 5I6SA 3L21A 3WQGA 1EYWA 1LUCA 5E9XA 1HNYA 2NVCA 1R3VA 2VQTA 1UKOA 2HPMA 1UWRA 4HNOA 3IUHA 4LSBA 4RZ5A 1PIGA 4UTTC 1XH0A 3TQVA 2PRHA 1JXJA 3EWDA 3L66A 4C1LA 4WX2A 2AL1A 2D1ZA 4KRZA 4UTLA 3ONCA 1EC9A 5I06A 3QEZA 2QDEA 3MS8A 2XIMA 3MMUA 4XZWA 3M47A 4AXNA 4DBEA 4JX4A 1E71M 5E0FA 3K30A 2HK0A 1US3A 2OFJA 4MB4A 4Q8OA 1J0IA 3GAYA 1W6TA 2PDYA 5F4XA 2L5HA 4JN6A 4P7NA 4JNMA 3AIVA 1JUBA 4RPQA 2YX0A 3P3BA 3WDQA 4FXFA 4UWMA 2X05A 4K39A 4L61A 3EMZA 3LTYA 4E2VA 4N6FA 3AAMA 3F4VA 4F79A 1CW2A 2INEA 3W73A 2PGRA 3RLUA 3JW7A 3P67A 1LOQA 3R5EA 3MC5A 3PBVA 4RXFA 3M6DA 2E8YA 3GB6A 1QNPA 3SUWA 2D2HA 4KEVA 3AHZA 1R9XA 5FJJA 2GJRA 1S2VA 3CYJA 4LRTA 4PBFA 2VEMA 3NQ6A 3VNKA 1J18A 3KOYA 3W1NA 4GY7A 4DYEA 2A6LA 2PF8A 1NWRA 1Y5XA 3W1MA 5HOSA 1JDFA 3C2EA 4R5EA 1TV7A 2ACQA 4Q4PA 3ME3A 4IMAA 5DBUA 2FTPA 1BVWA 3H26A 2BXVA 3AFBA 1VRDA 3W27A 1A5BA 3OOQA 1TRIA 1I6NA 3RM4A 2J7EA 2PDLA 2R24A 3BICA 4URIA 4K1GA 2OOGA 4CUCA 3LNPA 3NDOA 4CNOA 2WHLA 1G9HA 3WK1A 1H7XA 1SZRA 3O2LA 3NL5A 4QDWA 4GVHA 3E12A 1OQFA 3I7SA 1FKXA 1Y5VA 3N3MA 5LNRA 4PZVA 2ZYFA 4J3UA 4M19A 2RUSA 2Z00A 2XVPA 1HF6A 3CC1A 4I9MA 2VEPA 4PTWA 4DWSC 3IJLA 1V7AA 2PBOA 3L4UA 4Q8QA 5CLTA 3H22A 3QKEA 5GNYA 4KMQA 4GACA 2NLYA 3W2MA 4Q8NA 5D33A 1SFTA 2FZMA 2BV9A 2CPUA 4A6GA 4JTEA 3DIPA 2DZVA 1N7KA 1KCKA 2CLPA 2J27A 1VHNA 1GUVA 2P53A 1UCWA 1ME7A 2XPKA 4YWSA 1KRAC 2BNJA 3W6LA 4UR9A 2Y7EA 2BOFX 1BF2A 1XLBA 3KWSA 1SZNA 4LGXA 5DT5A 4Z2KA 3PBUA 1M41A 4HOWA 4C65A 5HXMA 5IRPA 1TX2A 4PCFA 4KCTA 4XISA 3PVFA 4G56A 3EDFA 1J79A 4UTMA 3FGCA 4GFIA 3H2EA 4E2BA 3WMBA 1BVZA 2A7PA 2ZZ5A 1FCQA 3P81A 3R79A 1ZAHA 4A8LA 4QCFA 1EO5A 2XSBA 5K9XA 1QW9A 2VGIA 4B5XA 1VEPA 4YYFA 1GZGA 3QR3A 2J79A 1KBBA 3N2BA 4A2SA 4O16A 2Q01A 4GINA 2WPBA 1JUKA 2Z28A 1T41A 2DDXA 3ZIZA 4ZOAA 2VNCA 3G6MA 3UCQA 1XIJA 4B9YA 3WQ8A 1P5BA 2HQAA 4O1EA 2YFNA 1XYMA 4KGLA 5A5WA 1V93A 1W1YA 1QHPA 1VF8A 4GY0A 3NM1A 3TN6A 2XJ7A 1UD2A 3SRHA 4C6MA 2VWSA 3RFAA 3XISA 2VZUA 1A0DA 3POCA 2JK2A 3UESA 3FN9A 2ABBA 5ABFA 5CC5A 4GC4A 5A6TC 3BV4A 4A3HA 3WL1A 1XBXA 1E0UA 5DX7A 2HPIA 3H7RA 4KRUA 4JTGA 4C6CA 3EXTA 3LSBA 1QW8A 4UNKA 3CH9A 2HRWA 5TIMA 2GZXA 1RBOB 2Z27A 1YLVA 5HMSA 4WSHA 1FOBA 1DIOA 3N2CA 1V4YA 3RM9A 2QDHA 2ODOA 4ZXOA 2XWDA 3TA9A 1SZEA 4GQQA 3TDFA 3IJ8A 3TYDA 1WAWA 2XN2A 4MG4A 3HV9A 3V36A 2NQHA 3G3DA 3S5ZA 3WF2A 1OX4A 2H90A 4AZ6A 5CKSA 2TYSA 2JKPA 2ZX8A 1ITCA 4PRTA 3MHGA 2BLEA 2Z1BA 1EQPA 3TP4A 3UJSA 2WMIB 1XSKA 2PBGA 5HNUA 4JYFA 3L2IA 1AK5A 2J25A 4CQBA 3ES8A 5EMYA 5I3FA 3KTSA 4HN4A 2A21A 1OD8A 2HBXA 3VD5A 3EPMA 3MP4A 4O54A 1H41A 3B4YA 4KGJA 1SW0A 3G0XA 3IJQA 2XM1A 2GK1A 2DJXA 5EB8A 4ZQRA 3IS4A 2PCEA 1ELSA 1NWTA 4WQ6A 1VH7A 5ABFB 1PEZA 1BTMA 1TPDA 1IYXA 3N1AA 3P5YA 5HR6A 4UIOA 1W8GA 2VC6A 5GJNA 1E6RA 1D3HA 2ICSA 4E8DA 3GSMA 4MVAA 4CN1A 5C9ZA 5DCEA 3NURA 1JRBA 2TPSA 4N02A 1QUMA 1CNVA 3WLTA 2QPXA 3GU2A 2PF0A 4KIRA 3AU2A 3Q45A 2GOKA 2QVHA 4NX0A 3W23A 4ERIA 3L4WA 4GX9A 1LRNA 2FDMA 3WNNA 3L5LA 1XD1A 2Q6ZA 5DCDA 2G41A 1MRQA 4PRRA 4CGTA 4AHQA 3FSTA 2WVVB 4Z2HA 2J74A 4UR7A 1UP3A 5J04A 4G6CA 3JR2A 2C71A 3WBAA 2G37A 3RRXA 4IIFA 1Q2RA 4D9PA 4Q3MA 3AIEA 3ITYA 5I3KA 1OCJA 4DF0A 3KLKA 4O52A 1KFKA 4HMCA 4XV0A 1QNVA 3VX0A 4DY1A 1BGAA 1JCMP 5BRPA 4GNVA 4MOZA 3QSRA 4HKPA 3MU7A 1W9PA 3CBWA 3EAUA 1ISVA 2XGZA 4AZGA 2CBVA 4U4MA 2FMOA 3T40A 5TF0A 4E2DA 3TQ0A 1ZCOA 3T2OA 1SYTA 3PZVA 1Q2SA 1Q6LA 5D9OA 1UR2A 4QEEA 1HKIA 3F4NA 1XG3A 7CGTA 1AW1A 4LC6A 1PTDA 1XQKA 2FFCA 4FK9A 2GK1B 3E2RA 5JUVA 3P8IA 2WVUA 4IPPA 4O4VA 4D8AA 3R43A 4YYCA 2HE8A 1FDJA 1I0BA 3ANUA 4NRSA 1CIUA 4KEMA 1A3HA 2H3BA 2O4QA 4ERGA 1OYAA 1ZBCA 3CZEA 4R7JA 1OFOA 4PUKA 1A47A 4CNTA 2BG5A 2EPMX 3TYUA 4X61A 1FTXA 4JCLA 1R8LA 1ZP4A 1BF6A 3W38A 1QO5A 4TX8A 3VO0A 2BHZA 3KAOA 1FP9A 4AD1A 1A5AA 2F6XA 4H8UA 1RJPA 2J7GA 4OTKA 2VFEA 4GA8A 3CTLA 2HTMA 3W02A 4ZO8A 1OFQA 5HNTA 4FLSA 3R0UA 5I24A 2VZVA 3N2OA 3LPOA 4Y90A 2O4MA 4PA8A 4UC5A 3VM7A 3VPLA 1MI3A 1NH6A 4B5WA 1F3TA 2ZRYA 4Y8EA 4A3YA 5LIXX 4F9JA 4PUUA 1ALDA 1BGGA 1KGWA 1YNQA 3L4ZA 3VABA 5I7GA 1O1ZA 1R86A 1F7BA 1H1ZA 2VCAA 3GXNA 3IIPA 3W24A 1TJPA 3PJWA 3WMLA 1DQWA 3M5ZA 3G5EA 1MRAA 2ISFA 1PHQA 1W3IA 4IM4A 1NQKA 4AY8A 4XB3A 3SCRA 2VZTA 2XFWA 1YDVA 2X1IA 3A22A 4B4HA 3NZPA 2NVAA 3LG3A 1R30A 3P0WA 3RILA 4KETA 5C6MA 1GPFA 2JIWA 4L6DA 4OV9A 1N8IA 4IPJA 3G1SA 3NDZA 5A6BA 1NM9A 5KSWA 4CD8A 3BURA 5D8WA 2DZBA 4CQAA 5DMMA 1RPXA 1GYLA 3OZYA 3VE7A 2DVTA 4H6EA 3SN1A 1ZNNA 3UWYA 1UMLA 3H2NA 2FTYA 4JTAA 1N8WA 3I6RA 4ROQA 4N9CA 2BS9A 4NKCA 4ZO6A 6TIMA 1FWEC 1DPMA 4XZHA 1X98A 3H12A 3V75A 1RD6A 1TQXA 2YOCA 4MFEA 5I00A 1P0EA 4DO7A 1O95A 3EPNA 3GDTA 1CXFA 4O1FA 3E2SA 1KCLA 1O7AA 3P62A 2I9UA 3CHCA 3ZO9A 3N2MA 3IUDA 3SJNA 3MO4A 4DM2A 1C9DA 1E5NA 2V0TA 2QEZA 3EDKA 2E3ZA 1M3UA 4MWAC 1HL2A 3AC0A 1GW9A 4GKTA 1IE7C 3M07A 4IQEA 2WOQA 4C6JA 3GRIA 3HGJA 4M1BA 4XAZA 3UYIA 1KBKA 1WQ5A 1A5SA 2IS7A 5GNZA 4U5IA 3ARTA 1EPXA 4DM1A 3LI0A 4XZ9A 3VK5A 4RX0A 1V6TA 1OT1A 5F1UA 4X22A 3GH4A 4NI8A 3W9ZA 4LOCA 3FA5A 2Z6IA 2ZOXA 4JN8A 3WJZA 4I8YA 3VDHA 2Y1HA 1UASA 4JYEA 2VDHA 3GZAA 2P0OA 2NUXA 4O1DA 4L4OA 1O5XA 4TTGA 2QUTA 1YPXA 2OYKA 1OZQA 3NQ7A 1L6YA 1E0TA 2DT3A 3FFSA 3R8RA 4N0RA 1VYSX 2VC9A 3LM7A 1YW1A 3LEPA 2GJLA 4K36A 1Q63A 3B8VA 3UWQA 2WMFA 2D3LA 5CSSA 3U2EA 1EGVA 3K1GA 3TA6A 4QJ3B 2P10A 2GGEA 1PZ3A 2XFFA 3BUVA 3E0FA 1NOFA 5A6MA 5D05A 1MNSA 4LUIA 1EIXA 1TWZA 3HF3A 1FFRA 6ENLA 1NWSA 1FVPA 2NVDA 3RMEA 3SCPA 4B5NA 3THDA 3GTIA 3LM3A 3DFPA 1VD6A 3GHRA 5CZTA 2E5BA 3OIHA 1GG0A 1UOZA 3S2NA 5I23A 3GFZA 2PZNA 1GZJA 5LA0A 2GGJA 3GO2A 2QJMA 3PUOA 2XIOA 3EWCA 3PBGA 1XHGA 3C86A 1M7OA 4E8GA 5HPCA 4C6PA 3VILA 3YPIA 4XX6A 1YADA 1EEPA 1GJPA 3EA3A 4RE2A 4EPEC 2BSLA 1HP4A 1I0DA 1FRBA 3HZ3A 3MBDA 3GZ3A 1A5OC 2NV9A 3F5JA 1OF6A 4GQRA 3B8SA 3CIXA 3WG6A 2VC5A 3B06A 3GKFA 1MXDA 1KV5A 1C8VA 5REQA 1HX0A 2EPHA 2UY5A 3NZRA 1JXKA 1K3UA 1GVQA 4GGHA 2NQ9A 1AW2A 1NDVA 3O15A 1PZ1A 3WLSA 3QOKA 1RQHA 1N2VA 1UUQA 3Q4DA 1LP6A 3CL6A 2J4GA 3I4KA 3NDYA 1XBVA 1GOKA 1ENUA 1A49A 2V81A 5H1WA 1RSCA 3H4GA 5CG7A 1XDLA 1J96A 1UQYA 4HVXA 3QMSA 4LALA 2FH8A 3S5SA 3WDRA 5BOFA 1PZ2A 3P74A 4RCXA 3TTOA 3AJ7A 4M24A 2B4GA 3SCTA 4HPNA 3UR8A 5AY7A 2J66A 2BTMA 2F2KA 3GNOA 2WO5A 3P82A 3KBWA 1QATA 4IISA 4XBJA 4AD0A 3NZGA 4GUHA 1MXGA 1DWGM 2EPLX 4XAGA 2ON3A 3STEA 3SECA 2INZA 5CC7A 2X1RA 4J2PA 1PE1A 1S3TC 3NQAA 1PCWA 2G97A 3O3RA 1L6FA 3KL0A 5BWAA 4FS9A 1IR1A 4LH8A 1QOQA 3F4CA 3JRKA 4Q4SA 3NXFA 1DP0A 4QRNA 3FNDA 4MM1A 4LVGA 4IUOA 4U5KA 1BXBA 3CHEA 2AQWA 5A2CA 1US2A 1F8IA 2LLEA 1RY8A 4CEUC 1TB3A 4JTUA 4NJJA 1TIWA 3IJ7A 3QR1A 3QV7A 4ZE5A 1PX3A 4NZ4A 4XO6A 3RPDA 1VC4A 1QPOA 4PMYA 1ZBWA 3NR0A 1GHSA 1VFUA 3FKKA 3W7LA 3ZWSA 2O9TA 3BSMA 4G1KA 1EOKA 5IBXC 4N2YA 3NPWA 4XAYA 4JTQA 4ZVJA 4AW7A 4PUDA 4L1WA 2CCRA 1TR1A 1QBBA 4PMNA 1KCZA 4JS3A 4ERAA 4BA0A 4M3PA 4YWIA 3LBOA 4UFLA 3SN0A 3HQNA 4FIRA 3T44A 4R9OA 3R4IA 3OBAA 3ZLGA 4UR8A 4WKFA 1FKWA 1GQLA 3FIGA 4IQDA 1E6PA 4GI6A 4CCEA 1QO2A 4I7UA 1KWGA 4PH6A 1VHCA 2I1OA 1Q66A 3ATZA 3HO8A 3PAJA 3VNLA 4EF8A 5TNVA 4FO4A 1RQEA 2PLCA 3DG6A 4LCQA 1GQKA 2Y6ZA 3DHFA 3SZ8A 3WN6A 1PDYA 1K6WA 4IIHA 5K9CA 4HBKA 2GVEA 4LB4A 3EOSA 3CK5A 4DJDA 3MA8A 1NP0A 2ZKMX 2FIQA 3L2LA 1K03A 2AL2A 2WJDA 3KRBA 1RA5A 5FF0A 2YA2A 1TE1A 1PL9A 1TTJA 5DLCA 1KR0A 2D0GA 1E0XA 1R47A 4IH3A 4FI4A 4HHPA 1TSIA 3MKKA 1FCBA 5K7JA 2GGHA 3T07A 3WQ4A 3WF4A 2QULA 2XVKA 3NL2A 3GAKA 4ADTA 1J2BA 4GFSA 1M01A 3QQ1A 4INFA 3GDMA 3EYPA 3CUIA 4PTDA 4QLKA 3I4EA 1V7YA 3H70A 3NUKA 1VPQA 3HU7A 3ERPA 3HQ1A 4MWAD 3QZEA 4OIFA 3AISA 8XIAA 4JIIX 4U33A 1ISZA 4LS2A 3BLLA 3HTWA 1E70M 3E9AA 2PTDA 1E6NA 3FVMA 3RCYA 1BTCA 1C7SA 4DZ5A 4M51A 4JNZA 4DELA 3R11A 1WBJA 1J2WA 2PU0A 4XZMX 3VKDA 4AHOA 4NNBA 4PCTA 1UR9A 3B9DA 3VMPA 2PDCA 1MVYA 4K37A 1UWIA 1IGWA 1YYAA 1FP8A 1ZS2A 4ZODA 2ZUMA 1NQ6A 3VIIA 3VIGA 3QW4B 1BXNA 5CEWA 2AL2B 1Q6OA 3V1HA 3DG3A 4D6GA 3W83A 4NG3A 4BWLC 2V6AA 3L9CA 3VKAA 4P8UA 4QJ4B 3F2DA 4HSOA 1D8WA 4PFMA 2V5JA 2QUMA 2GDVA 3CASA 3CGTA 4D8LA 1DL3A 1QWGA 3NGJA 1BYBA 4A3UA 3H7VA 3AIUA 1Z3NA 1FXPA 2D69A 4MYAA 1IEXA 4FNQA 1HIZA 3CHVA 3PULA 4GPNA 3I3DA 1Q6FA 3CZLA 1QASA 1XCFA 3LZ3A 3W6YA 3STFA 3LY0A 1WXJA 3BQ6A 3B05A 1X97A 1FWIC 1JAKA 1QI3A 4HU4A 2WW5A 4B90A 2BGQA 1YTEA 3T0AA 4Y2WA 3U57A 2KZHA 3EXSA 1F9CA 1QPKA 4QROA 3GIYA 3ARXA 4QEHA 1XCWA 4O28A 4J35A 3AXIA 3DHPA 3G22A 2PS2A 1HT6A 3CO8A 3VNJA 1W9BM 4H1ZA 4IP4A 3VYLA 4LVBA 3WNMA 4F8XA 3CUZA 1ZALA 5FI8A 1B90A 2Y5SA 1ECEA 3KTXA 4R53A 2G4JA 1XH1A 3PUEA 4QAWA 4HJFA 3VMOA 4ATDA 1TWDA 2ZUWA 4ZTXA 1R38A 3A9BA 3S47A 2ZXBA 3H2OA 2QJJA 4HMNA 3RU6A 3WKZA 2E8ZA 2IUZA 3DI1A 4AZBA 4WGHA 3N19B 2PWEA 3RDKA 3AIBA 4UMAA 4Q6XA 3C8FA 3QPEA 2TAAA 1A53A 3PSWA 3D0CA 4QCEA 1H50A 3LDVA 1FXQA 3PBYA 3UPWA 3ZQ9A 3FJ4A 2JKAA 2VWTA 2QV5A 3LCXA 4NAEA 2AMXA 3VINA 3QOMA 1QK2A 4MMWA 4YVPA 3FK4A 2YA0A 5ENLA 4C6KA 4AWEA 4WK9A 5K4ZA 1A80A 1HTIA 3TNOA 4ZCWA 1UA7A 1OK4A 3SIMA 2CEQA 3LK6A 4W87A 1U1JA 1GQNA 4R88A 4OVXA 3FLUA 3WQWA 3XIMA 4YIWA 4NL1A 2UBPC 4PRWA 1RVKA 4H9YA 1F61A 4P7QA 4FIQA 3EEZA 4LF1A 4FOJA 3LENA 3W87A 3W00A 3PC0A 4GO9A 2E09A 2O7SA 2W67A 3TFXA 1M53A 5DFAA 5JMUA 1L9WA 3QHOA 4ES4A 2ZZ2A 1UWTA 4Y9MA 4QS6A 2C14A 3G0UA 1XINA 4Q6JA 3S9YA 3NQFA 5D2TA 4AX7A 3O9NA 4J3ZA 1IV8A 1D7FA 2PSNA 4QXIA 4EAYA 1MFVA 1DJIA 3VD7A 2NZLA 3UF9A 5BNKA 4D71A 4DQWA 1YDYA 3CAVA 1XGEA 3W25A 5CQ1A 4ZQNA 2GVGA 2PDBA 1V0KA 3ZJ8A 4OKDA 3T0BA 3RG6A 1KFJA 1JJKA 1XC6A 2NV1A 3MB9A 3TAKA 4S1FA 2G3NA 3USBA 3PBWA 1YXDA 3BVJA 5I0DA 3BW4A 1QBAA 3MHUA 3SSZA 3FV9A 4X0NA 5E0KA 3L0KA 1VFOA 7ODCA 3MUAA 4UTWA 4YCOA 2W92A 2QAFA 3QBUA 2GGIA 3TEVA 3DKLA 1O12A 3AYSA 3DAQA 4QBXA 1S3HA 1XL9A 3ENLA 1SO6A 3FAXA 1EHNA 2DQWA 1J12A 3GTFA 3NXLA 1F6PA 1E9IA 1GVRA 3MCMA 2H9AA 1Q5MA 1PIIA 4Z1CA 2NV2A 3W75A 1EYEA 1ISXA 3LCFA 3HGOA 4UMCA 2XH2A 1S2WA 3BAXA 4IFOA 4PBEA 3TN4A 4C5YA 2XVLA 4MB3A 1A4LA 3UG8A 1TUXA 5F2LA 3PWGA 4H9MA 3W74A 2CERA 1U1HA 1EFZA 3WENA 3RHGA 2FHCA 1VCVA 5CJ5A 2WAGA 1HXJA 2DH2A 5DXYA 3CWOX 5I03A 3WJSA 1BQCA 4FF5A 1KNWA 4NAFA 3WH8A 4IHCA 4JOMA 4LJ3A 4NNCA 1UHVA 4W8AA 4GQBA 3ZLHA 4OU1A 1BWLA 3EOOA 4CU8A 5HQLA 4ASTA 5JH2A 1XFBA 2WCAA 3UJ2A 3W4RA 1QR7A 1XLCA 1CXIA 2WSPA 4AWSA 3QY8A 3TKFA 1W5OA 2J7CA 2C1IA 4Q7NA 3IPWA 3HPFA 5DRIA 3CV2A 4KS0A 5HMEA 3Q94A 2G8ZA 5HWNA 2BY3A 3WL0A 1PX4A 1XICA 3PK7A 4B16A 2OKTA 2OVLA 3SCNA 2DZWA 1V6WA 3TLLA 4ECLA 3V18A 4US5A 1FWAC 1OC6A 3VIMA 4MY8A 1AFSA 4PMDA 3S5OA 4CNSA 2WNNA 1CX9A 4QISA 1RCOB 2QQ6A 3L4VA 4LC8A 1LRQA 2VFFA 3P61A 5D04C 2XH7A 2A7NA 3MYOA 1MDLA 4XAPA 3LPPA 1Q6GA 4AC7C 2OYLA 3WQOA 1WXZA 3K8MA 1SR9A 2H9AB 3MP3A 2XN0A 1XLKA 2XIQA 1KFWA 4NQ1A 4RV8A 1C92A 4UNIA 3FA4A 1E56A 1WKFA 2E40A 1LL7A 3QMRA 1GKQA 4FA3A 5HK4A 4KRTA 4I5RA 1KA9F 3KP0A 1RJRA 1Q13A 3HN3A 1CTNA 2C18A 5AC5A 2W66A 3V35A 2PWDA 2CHRA 3BXWA 1I2RA 5I09A 1V02E 4C6IA 3GC2A 2NSOA 4NAFB 6TAAA 3KTCA 3CQ0A 1DQUA 4EOUA 5FL1A 1TPUA 2YDQA 1GVIA 3ZM8A 5FF3A 3E96A 4RW3A 3STGA 1ZJIA 3VA8A 1QU4A 1C7TA 4LNCA 2HWGA 1JRCA 2JQXA 3GDLA 3MWCA 4DJFC 4REQA 3WLOA 2OO6A 2IQDA 3DFOA 2QNEA 1GYMA 4JTDA 1V3MA 4LPCA 5C2XA 4OWGA 2VTFA 2FPYA 5BU9A 1XC4A 3KRUA 4DJEC 3ARYA 4XVEA 2PFHA 2VCBA 4LV4A 3N4AA 3GXIA 2DZPA 3WH6A 4GYKA 4V28A 4HYVA 1HJWA 3CYVA 2HDJA 2ATMA 3AS1A 1SMDA 3BH4A 4R33A 3VGBA 2VRQA 3HFTA 3RU8X 4UXDA 3LLFA 1W9VA 4D6HA 1PKYA 3TONA 2B7PA 3W7HA 1EDQA 3U2CA 3GVWA 3LBCA 1H51A 4YS1A 3KL5A 4OOZA 5HBFA 2FB3A 3WF0A 1JI1A 4GY1A 2R1MA 3SUUA 1BYAA 3WMCA 4A29A 4H9TA 5F7UA 2ZDRA 3W1LA 4GZ7A 2VR5A 3LCGA 4HCDA 1M9HA 3NQBA 5D9NA 1V3IA 2XSXA 1W9DM 1JIBA 3ALGA 4HK7A 4GVIA 3WQVA 2PDMA 1IF2A 1ONRA 4XUGA 4FR6A 4J4KA 1PYMA 4LYKA 3G8EA 2O9RA 4PTVA 3GXPA 1X6UA 3GXTA 1ZPTA 1L6SA 1LBLA 1EGZA 4S23A 1TZ7A 1DEDA 4B92A 4R3UA 1DJZA 4Q4QA 2C91A 3CEPA 4DNHA 4S3JA 4D2JA 1Q6RA 2DT0A 2QMKA 4RR4A 1O5QA 2B7QA 5DMYA 4Y9AA 1JI2A 1GKPA 1RXOB 1DHPA 4IX2A 4LS1A 5T9BG 3KP1A 5FJIA 4JNYA 4WJ8A 3S5NA 2Y2WA 2ONEA 2ZA3A 4CKQA 1C93A 1TPVA 2NUYA 1DVJA 2OX4A 3Q37A 2BXZA 4BI6A 1B30A 1R7OA 1HJUA 2PDKA 2OB3A 2Q8ZA 3ABSA 2FMNA 1ZJAA 1NFPA 1JG9A 3MV11 1UC5A 5CSRA 1HL8A 2PRLA 3NVDA 2OODA 3TJXA 1LQ0A 1WP6A 2POZA 2X2GA 1H7OA 3ZVHA 2GJXA 4NIRA 5HANA 1WDQA 2ISWA 4Q22A 2J88A 1AJ0A 3PHAA 4L9XA 3A47A 1DIEA 2ZC8A 1W3JA 3GTNA 3O8AA 3IACA 1O5RA 3PWAA 1FWSA 2Z2UA 5EMUA 4LEQA 5H6HA 4UFHA 1BFNA 3WLIA 4Z2JA 1XW8A 1PB0A 3TCSA 2DU2A 2NQLA 1R0MA 1QWKA 2R8WA 3F2CA 1B3XA 3PUDA 1X8CA 2Y70A 4CU7A 4AD4A 4CN6A 4MF4A 1LG1A 3THAA 2GYIA 2FGZA 2GSJA 4JFVA 2OQYA 5FSEC 3W28A 3CMJA 3LGDA 2ANUA 1XLGA 3S46A 6ALDA 4MKSA 1AL7A 3GW0A 4KFNA 1DYSA 3INPA 3QRHA 1US0A 2DT2A 3CEUA 1KM1A 4E0CA 3OB8A 1GOWA 4D8ZA 1EJRC 5FL0A 2ZWYA 4W8LA 4L80A 5EMJA 1W9XA 1XSIA 1VPYA 2OYMA 1TV5A 5EYWA 2A85A 2Z26A 4XG1A 2YFOA 3QM3A 5JBFA 2QR6A 3N34A 2R91A 4FNUA 3TJ4A 1S46A 2W62A 5CSYA 1UPPA 4IPLA 3QQWA 3BAJA 1VFSA 1EX1A 3NQEA 2RAGA 3FYYA 1LF1A 2OZTA 4KWOA 1VJZA 4JQ3A 5CPQA 2PWHA 4WDXA 5M17A 5IHRA 2Y7DA 4HCLA 3UWWA 4MAZA 3RYSA 1D3GA 2RKXA 2VI0A 4C7GA 1OG0A 1NELA 2X09A 1PBGA 1J93A 1TJ2A 2GJXB 4IT1A 1U2YA 1WB0A 4KH2A 2Y8UA 4QHRA 3KVKA 1GVEA 1J0KA 2WVTA 5EMMA 1DHKA 3NL3A 2F6KA 5F2GA 1EA0A 4LVAA 4QQ3A 2Y7GA 4NNAA 5HQMA 2QAPA 1NARA 3K8KA 1EL3A 3ZSSA 3A4JA 1ITXA 4BS0A 1H5YA 1JCJA 3OHMB 5TQLA 4F0RA 2CXEA 3SCUA 2X30A 9RUBA 3F4WA 4GBUA 5AVHA 1SJAA 4IUGA 5EU9A 4PBGA 5DRCA 1EUAA 5M3WA 5DT7A 1WV2A 5HWJA 1P0NA 1FWTA 2VX4A 3SY1A 1RP8A 5HNNA 3APYA 4PUNA 4TOQA 4AVOA 1ONWA 3RX3A 2NT1A 2XVNA 4FXJA 1RBAA 4DZHA 1W5MA 4L6OA 1OFRA 4NYUA 1E73M 2W27A 4PN2A 4N6EA 5LIWX 4V1YA 5JXQA 2YL9A 3GNPA 3FHAA 2W91A 2Z4GA 3VX1A 4LAUA 2XU2A 2V2CA 4G1NA 1FHUA 4EXBA 5LA1A 5LNWA 1EX5A 1EBGA 2O55A 4H2CA 2VELA 4QQUA 4B15A 4U31A 3CUXA 3VC6A 1M68A 1VGAA 2GFTA 1JVNA 1NOUA 1BG9A 3T1GA 3TNBA 3ZJ6A 1SVDA 2OCZA 4JTCA 4F4RA 2YCEA 4UQCA 2DVXA 2WK2A 3O1NA 2ZX7A 3A4WA 2FZBA 2R14A 1K8XA 4DI9A 1O60A 4Q4RA 3TYZA 1UBSA 5IFPA 3PG8A 3W7GA 1IEWA 3PTKA 4GD0A 3EX1A 3PB2A 2J6VA 3WBXA 2WC4A 3C2YA 1AZ2A 3B0VC 1E1EA 1V3JA 3CUJA 3CT7A 4UCFA 2UY4A 2PC4A 2J47A 2XFRA 2O9PA 3W7PA 4ADUA 4S39A 4RW5A 3WY1A 3LMZA 4DJFD 1FWNA 3DH7A 2XVGA 1EDTA 4M80A 4CVUA 4BF9A 3R25A 1B3YA 3W2NA 1TCDA 4DJED 3PTMA 4JFTA 4YN5A 3U6WA 4F0MA 4LAZA 5CGQA 2OX1A 2QDGA 1O6IA 4BI7A 3VUPA 4TMCA 1LL6A 5LIYX 3LCWA 3ABZA 5EKYA 4I9JA 4C1NA 1CXLA 5AHNA 1TMQA 5XIMA 3UZJA 4H9UA 2VOTA 4RE3A 3H2CA 3V7PA 3RUBL 4JKLA 1LDCA 1ZLPA 3ID7A 1I1WA 2QKFA 4QP0A 5M2FX 1V6YA 5IDZA 2Y61A 4A3RA 2C19A 3GNNA 1POKA 4MYXA 1KQZA 2SFPA 4POCA 4MNJA 4HNNA 1QTWA 1E0VA 5J8LA 1TV2A 4G7FA 2Y24A 2ACRA 4IFKA 4GUFA 1BHGA 5JIWA 4IIGA 3DC8A 2ZBTA 1S2UA 1GOIA 3UWUA 5ECVA 3MUIA 3VC5A 5LHEA 1XLJA 1U22A 3EB4A 4O1BA 5A6JA 3AMLA 4OECA 3GUWA 4RZ6A 1P6WA 1FWDC 4GQGA 2J77A 2OPJA 3AALA 4XIMA 4EF9A 5D30A 2ZCGA 4IF2A 3MUZ1 1SW3A 5H8PA 4LAOA 3B9OA 1RVGA 4GX8A 3ABRA 3VDAA 3U2ZA 1QMLA 4D1JA 1Q45A 1RLCL 4M5PA 1IXPA 3NQVA 3U5UA 1IIGA 1Y7VA 1I2PA 3DBNA 1UUOA 1SUXA 4HNLA 3BE7A 3FVDA 2QW5A 3BL3A 4XKMA 2BOGX 2NQ5A 3IK2A 3S42A 3KCJA 4DB7A 5CGMA 1Q6CA 1P1XA 2WBGA 1HFBA 4YNGA 1B1YA 4NZCA 4C90A 4KBXA 3WD4A 1Q4WA 4ZR8A 1XPYA 4XUYA 5CPTA 3O6DA 4WDUA 4C1NB 1TKKA 3DG7A 4AYSA 1LTDA 3UCCA 3MUXA 1W56A 3U5YA 2F84A 4J40A 1KRCC 3ITGA 3GTHA 4GI8A 2YIHA 3WNLA 2JE8A 3NJ3A 2DUAA 3NSMA 5CJNA 4GJJA 3WDHA 2HK1A 3CWHA 3DC0A 1JGIA 1ISYA 4UTIA 1SO3A 3QKZA 1J0ZA 2WQPA 3QTPA 2X42A 2DZAA 1BXCA 1H62A 2P3EA 2V82A 2UY3A 5AYYA 1W37A 4O13A 2YCJA 3ZZ1A 1PUDA 3PPHA 1EJVC 4AZ7A 3EGJA 1X7FA 1UD5A 3NAVA 3ZOAA 1Q7MA 1E6ZA 3A13A 1U5HA 1WKEA 4WCJA 1E1FA 1H49A 2DZSA 3NTYA 2PTYA 1PZ0A 2VEGA 1SO5A 1ZFJA 1QNRA 1W17A 4NJKA 2CKSA 3PAOA 3M1ZA 5I77A 5J5DA 3M9YA 3CUHA 1LBFA 4KEZA 2VGBA 1K9FA 1V0NA 1JR1A 2GJPA 1P7TB 5GVJA 3ZT5A 3LV6A 2Z1XA 3K4WA 5ABTA 4YTTA 1VBGA 4AB4A 1U33A 3FX4A 1DJHA 3VDGA 3OEXA 3QF0A 2PTXA 2J62A 2A4AA 2ZUNA 3A23A 4KPLA 3BOFA 1V02A 3ISIX 1C29A 1IIHA 1V0MA 5EBUA 3MSDA 3BLPX 4FEZA 3QGAC 5CC3A 1VYPX 1AMKA 2CLKA 1A0EA 3NG3A 4BKNA 3CXOA 1OB0A 3VUSA 2QUVA 3VU2A 3WLJA 1FWHC 1D9EA 1K1DA 1DE6A 1JPMA 1W3LA 1MW1A 2PLKA 1JYWA 3GVVA 4JTFA 4ORIA 2E28A 3SEPA 1OY0A 3WQPA 1Z42A 2QHAA 4FOUA 5H91A 4LY8A 3EB3A 1UZDA 2Q3OA 3LTSA 1VBRA 1O68A 4M82A 1P0KA 2XN1A 4FX6M 1OC7A 3FEQA 1R87A 3H2FA 3HG3A 4WKHA 4EPDC 1KM4A 1UBPC 3HJZA 3FHQA 3KCLA 4BEUA 4UTWC 4L4PA 4X2RA 2CC0A 4ZENA 5U7SA 3IRDA 4AISA 3WUEA 1N55A 1WKYA 2X40A 2PEVA 3KUMA 1UOKA 3ABXA 2HCVA 3ZFHA 3QXBA