4WSJA

Crystal structure of a bacterial fucodiase in complex with 1-((1r,2r,3r,4r,5r,6r)-2,3,4-trihydroxy-5-methyl-7-azabicyclo[4.1.0]heptan-7-yl)ethan-1-one
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
439
structure length
439
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Alpha-L-fucosidase
publication title In vitroandin vivocomparative and competitive activity-based protein profiling of GH29 alpha-l-fucosidases.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
total genus 158
structure length 439
sequence length 439
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-10-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4wsjA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4wsjA01
4MJ2A 1B90A 5CPSA 1UYQA 3VIMA 3UETA 1C92A 1BGAA 1QVBA 3ZJ6A 3B9EA 4HP5A 5A1AA 1CIUA 4V27A 5JBFA 1HT6A 5A94A 5E6ZA 4ATLA 4BQ4A 3ARXA 1AQ0A 1NP2A 3T08A 3WF3A 1G5AA 3GXFA 1R86A 3EJRA 4HMCA 4R5EA 2VL4A 4NX0A 2WVTA 1I75A 3II1A 1BGGA 4W8BA 2ZIDA 3WNMA 4M29A 3ARUA 2DDXA 5FL1A 1GQIA 4B15A 5IFTA 2F1BA 4JHOA 1HP4A 3ZQ9A 1JNEA 3AS0A 1J0YA 4KRUA 1CXKA 3OZPA 3HG2A 1NWSA 1CPUA 2CEQA 2YA2A 3BVVA 5LA2A 1OGSA 2X2YA 2ZWZA 4HPGA 3WNNA 2DT2A 5FKYA 1ZB5A 1W3JA 4IM4A 2F7PA 1W9PA 3WBEA 2UY5A 2F8QA 3VDHA 1QI5A 4UZSA 2GVYA 2V3FA 4P8UA 3OIHA 4GPNA 4A3YA 4PMUA 1HN1A 5D9MA 1JI1A 3DECA 4M24A 1UD8A 2V3DA 3CC1A 4MNLA 4BQ5A 1BYAA 1XCXA 2X2IA 4AD2A 2O9PA 1UH3A 2DSKA 2XIIA 1H5VA 3A4AA 1R75A 3VGEA 1OM0A 5DT5A 1B3XA 1WZAA 3AXXA 3D50A 3WKZA 5I6SA 1X6LA 1HL9A 4JFTA 3T0AA 1PPIA 3CUGA 2VURA 2VT0A 3EMZA 1MVYA 1XC6A 4URIA 1HNYA 4ZXLA 1FH9A 1EA9C 2VX7A 1NOWA 2DSWA 1UD6A 1XH1A 3RMEA 1JZ5A 1TMQA 5AYIA 1V02E 4JFUA 1XD0A 3GH5A 1JZ8A 2WC3A 1MXGA 1UZ4A 4CCDA 5DF0A 5E9AA 4HOWA 3RJYA 4AZHA 2DGAA 4XUYA 3VM5A 2DH3A 3AROA 3QR3A 1J0ZA 2CCRA 2GUYA 4JL1A 4UOQA 4MB5A 3BAYA 4GZEA 3BAKA 2WSKA 1RP8A 1UWIA 1SMDA 1GQJA 3UESA 5LYRA 2G3IA 1E3XA 4H8UA 1OGGA 3SURA 1KR1A 2AOSA 1J10A 1UKTA 2QPUA 1VEMA 4AISA 4QLLA 1VEOA 4HA4A 2WYSA 1QW8A 3W24A 1J11A 2VQUA 5HXMA 4EKJA 1K9TA 2WCGA 4UNIA 1JG9A 3N18A 1MXDA 4PMDA 1J0JA 3LPPA 2YDSA 1H11A 2IGTA 1BLIA 3AISA 3RPMA 2IUZA 3WD2A 2B31A 1O6IA 1T0OA 5KZ6A 3WD1A 4QAWA 2ZXAA 3NYDA 1M7XA 4D6JA 3BUIA 3ZOAA 4AD1A 1E6PA 2VC9A 5CSYA 1VEPA 1S46A 4W87A 4U33A 4F8XA 3WFLA 4HU8A 2PWEA 3DX0A 2J62A 2Y2WA 4U2YA 3SIMA 1HJUA 2PWGA 2F7QA 1H2JA 2V38A 4D1JA 3MI6A 3WMBA 1QI0A 3WY4A 3DX3A 4ML4A 1JIBA 4ACYA 1HKJA 4NF7A 1XSKA 3MUY1 1W9VA 2EJ1A 3BAWA 4QFUA 1YQ2A 1LF1A 3FW6A 3NSXA 4Z2KA 3CZJA 4P7QA 4XZWA 3FHQA 2WVSA 4CD4A 2VCCA 3BSGA 3MMWA 1KTBA 4U3AA 2EO7A 1SFSA 5I77A 1PX4A 1VFUA 1JDDA 1C3FA 3VX0A 2JFEX 4PMXA 1QHZA 3ZJKA 4HTYA 3AIUA 5C8BB 2X09A 1SYTA 4J3WA 3PZUA 4J3VA 2ZUTA 5ECUA 1GJUA 4TOQA 1VBRA 1ZL1A 1JL8A 1E6SM 2CETA 1EDGA 1HKMA 4U3CA 1DHKA 4P8WA 3L4XA 1J9YA 5JIPA 4UCFA 2D3LA 2D0GA 1UH4A 1Z32X 4F9DA 3A4XA 2JF6A 3CHEA 1PS3A 3DHPA 4AZBA 2WK2A 1E1FA 2F7OA 1B1YA 3RJXA 4NRRA 2FGZA 7CGTA 1DEDA 1UD5A 3AHVA 3IJ8A 4H41A 3ZJ8A 4CN6A 1OWQA 3WNPA 1WZLA 1BYCA 3POHA 4TX6A 2ZUVA 3SCQA 4DUWA 2FDMA 1XYFA 3CZKA 3RCNA 3AXIA 2ZUSA 1ESWA 3A5VA 1W91A 1GHRA 4BQ2A 1OT1A 6TAAA 1CNVA 4GZIA 1FHLA 5LA0A 1JD7A 4W89A 4FNSA 3OG2A 1LWHA 1VRXA 1G9HA 3ZSSA 1BAGA 3EDEA 3POCA 2VR4A 4MAZA 5IXEA 2OLHA 4UQEA 1GOWA 4BQ3A 3AYSA 4MNKA 5A2CA 2RGMA 3VSUA 2DQXA 2YA1A 5I78A 3L2LA 2YDQA 4Q22A 2O92A 2VZVA 2JIEA 1CXIA 3ARYA 2EPOA 4GZJA 3A23A 1JZ7A 1Q6FA 2WAGA 1B3ZA 3VILA 5HNNA 4PTMA 3AMLA 1KGXA 3WL1A 2JEPA 2VRJA 1TVNA 3EDFA 1TUXA 2XVLA 3WDJA 2FH8A 1PX8A 3GNOA 4DO5A 4GI9A 4CCCA 1GQKA 1W9DM 2EPLX 2FHFA 2BVTA 3GM8A 2CBUA 3LRMA 4W88A 5D9PA 3A6OA 2J4GA 2OWCA 1WDPA 5A95A 4PBGA 4ZXOA 3W25A 2EADA 2X2HA 1VJSA 2D0FA 3N12A 2J74A 1BSIA 2X0HA 5A6BD 3ZSTA 2JF7A 5EFDA 4FLSA 1TA3A 2D23A 1KBKA 4B9ZA 4JFWA 1CGUA 3A24A 3VGHA 1JF6A 3IAQA 1G94A 3CUIA 2YLLA 2FH6A 1KB3A 2XIBA 4HZ6A 2XJ7A 3KLKA 4AZCA 1W2VA 4WJXA 4YHEA 2WHJA 1UKPA 4HMEA 1R7AA 4AZIA 3OLDA 3MANA 3GH4A 3RIKA 3AFBA 2J7GA 4WF7A 4P7RA 1JYVA 3CHFA 1MW0A 2Z1SA 5CQ1A 5IFPA 1W1TA 4CD8A 4D72A 3IJ7A 3UERA 3WY1A 3SCTA 5CLWA 2A3HA 4DO6A 1V3IA 3D4ZA 3QHOA 4CD5A 4LYRA 1HL8A 2QHAA 1QNPA 3DC0A 3ZT5A 4S3JA 4F66A 3VNYA 4QCFA 4AMXA 3BC9A 3ARWA 1SMAA 3AOFA 3CH9A 1XD1A 3D52A 1US3A 1H09A 3I3DA 1EDTA 1B2YA 4MJ4A 1NP0A 2AMGA 2VTFA 1U33A 1GOQA 2D73A 1MQQA 3DYOA 1E4NA 4PTVA 4UFLA 1HXJA 1CZ1A 4B3KA 2E0PA 2VZTA 2CHNA 1WAWA 3WDQA 3BMVA 2PB1A 3WH8A 1FOBA 4E2OA 3BUBA 2VJXA 3PTMA 2BHZA 5ABEA 2QMKA 1MFUA 1EQPA 4OOZA 2YA0A 4MB1A 4XX6A 4OUEA 1TCMA 4AZ7A 1TA3B 3AMKA 5D4YA 3T2PA 1EOKA 1XH0A 3VIIA 4W8AA 3JUGA 4XB3A 4S3KA 3IAPA 3NDYA 4YHGA 3N1AA 2ZUWA 2A3CA 1V0KA 1A47A 3HG5A 4OGZA 3OGSA 2XG9A 4F9JA 3WN6A 1R47A 5CJ5A 2OWXA 3L4VA 4AZCB 3WDHA 2E4TA 1TE1A 1W1PA 1F4AA 1FP9A 2CERA 3GNRA 5JUVA 1VJZA 3DX4A 1CDGA 1U30A 1CTNA 4PEEA 1EHNA 3MKKA 3A47A 3QOKA 1J01A 1XSIA 1G1YA 2XVGA 1C8QA 3VD7A 3OB8A 2E3ZA 2UWFA 2DEPA 1JAKA 2WB5A 2E8YA 4MB3A 2YLAA 2VMFA 3ARTA 1MWOA 4GQRA 4JFVA 1E73M 4UQ9A 3CBWA 5FD0A 3OZOA 4CU7A 5A8PA 4UTFA 2C8NA 3ZIZA 3U57A 5A69A 3KE0A 2X0YA 1E6ZA 1M03A 4M82A 1W1YA 3S2CA 3SCNA 2J75A 1V3LA 3WEOA 3MO4A 4E8DA 3GBDA 4Q7NA 1WZKA 1E4MM 5FOOA 2VI0A 3HU7A 1AMYA 1VB9A 4H2CA 1JZ4A 2W4XA 2GSJA 5F7UA 5CGMA 1TQVA 2ZX5A 3IANA 5CPQA 3BUQA 1UKOA 3GYCA 2WCAA 4JCMA 4UFHA 1GVIA 3EDKA 1NH6A 2X05A 1DTUA 3WDIA 1UA7A 5E1QA 5IHRA 1CGVA 4U2ZA 4CGTA 4C7DA 3ALGA 1E6RA 1NWUA 3WF0A 1H0GA 1FH8A 5BXTA 3SUWA 3L4ZA 4MNMA 4TVDA 1EQCA 3K8LA 3AHTA 1JXJA 2VX4A 1JI2A 1WNOA 3WH9A 4K68A 2VZOA 4OKDA 1JZ3A 3GDBA 3W28A 1EXPA 3ARVA 4ATWA 2D20A 2OYKA 5C70A 1E6XM 1H41A 1GZJA 2FHBA 4B3LA 2XPKA 3O6AA 4JZ5A 2YJQA 2BY2A 3WDRA 1X1NA 3OGRA 1LWJA 4PTWA 2O9RA 2WCSA 3SUVA 2DSUA 3WBAA 1QNSA 1OD0A 1E6QM 4B9YA 4CD6A 2FYVA 1J0IA 4TUFA 1QPKA 7A3HA 5BROA 1MW1A 1Y7VA 4D71A 4L4PA 4E4PA 2CESA 3ZJ7A 1E15A 1CYGA 5BRPA 1ODUA 3K8KA 2WXDM 1QBAA 4PRWA 3CLWA 1PX3A 2XSBA 1KXTA 1PBGA 2A3BA 1OB0A 3HN3A 3MU7A 1BVNP 1QHOA 3VVGA 3A3HA 1C90A 4MDOA 1B3VA 1R46A 1XSJA 4FLQA 1GW1A 2G41A 2ZICA 1BVZA 1HJWA 2Y24A 2OW6A 3VOCA 1NWTA 3B9AA 2WVVA 2PC8A 3SCVA 2VCBA 3GXPA 3WY2A 4HZ7A 2J8GA 3M07A 4N42A 2VR5A 4M56A 3VU2A 3PZTA 1BHGA 1QX1A 3ZMRA 3WELA 1HJVA 3H54A 1US2A 5BWFA 3CMGA 2XGBA 3CHCA 1ZS2A 1GORA 1KTCA 1NWRA 3NJ3A 1BTCA 3KL3A 4UQDA 3D51A 1E0WA 4Z2GA 5A8QA 1E3ZA 4AIUA 3LRKA 1CGTA 4ZENA 1RPKA 4OIFA 1R87A 5D9NA 5FCZA 2WC7A 4EK7A 3BVTA 3WF4A 3W81A 4DWSD 3AI0A 1UD3A 4PMQA 3KL5A 3LPFA 1HVXA 3DX2A 1N82A 4FNPA 3FAWA 3AZRA 1VIWA 1B9ZA 1E43A 1V6VA 4DWSC 4WKFA 3W38A 3K1DA 5I2UA 4C7GA 1LG1A 5TD4A 2WWDA 1HVQA 4EE9A 1XCWA 1PZ2A 2GDVA 3VIKA 4JHZA 1WPCA 3NUKA 2GJXA 3N04A 3E1F1 1BF2A 1H49A 1MQPA 3W0KA 3WNOA 3WEZA 2ZOXA 2BNJA 1G0CA 1W32A 3WD0A 3ZT7A 4PCSA 1V6YA 1ITXA 2BHUA 2HVMA 4AIOA 4W93A 1P6WA 2WVVB 4H8HA 4D6FA 5A6SA 2IXVA 4CUCA 4AD3A 2J7DA 1NQ6A 1JF5A 2BVDA 1W3HA 5A6LA 1FFQA 2C0HA 3WF1A 1HF6A 3EMCA 1GOMA 2W5FA 3QHMA 1CXEA 4GI6A 3HJEA 3VM7A 3FNDA 3BAXA 2UY2A 4H04A 3VSVA 4NZCA 1ISZA 3RO8A 1Q6EA 4ATDA 1M01A 3OGVA 5GPRA 5IDIA 2VO5A 1BG9A 3KEHA 1KFWA 2OYLA 4YN5A 1AQMA 1BFNA 4GIAA 2EEXA 3IK2A 1HKKA 1XHGA 3WF2A 2VZUA 1E0XA 4NRSA 2ZWYA 4UOZA 5HBFA 1LL6A 4H7VA 3BGAA 1KXQA 4W8LA 1W1VA 2GFTA 3MV01 1ECEA 1ZJBA 4CU8A 3FXYA 1UKSA 2TAAA 2Z1KA 2GJXB 4FLOA 1TFVA 3BLBA 2XWEA 3UEQA 1WZMA 3GH7A 2BXZA 2V5DA 3VIOA 4LQ1A 1XH2A 4CVUA 4M80A 4EAMA 4JKMA 1V3JA 3DYPA 1ISWA 2Y4SA 5E6YA 2J25A 1HWWA 1VFFA 4LGXA 2JE8A 4NXSA 1V3KA 4ZE4A 5C71A 5AC4A 5A8NA 4LPCA 3BCDA 4D6IA 3A22A 1EH9A 4BF7A 2XFFA 1CXLA 4A3HA 4MDPA 1H1NA 1DWHM 2XVNA 2V5CA 4BCEA 2EPMX 2W66A 1KXHA 5BCAA 1UD2A 2DH2A 3J7HA 3AIBA 3SCOA 2WKGA 4JCLA 3SUUA 5LA1A 3BVUA 2YBTA 1GCYA 3W6MA 3N17A 2Y8VA 4ZE5A 4AZGA 1RP9A 3WQ6A 2BV9A 4PUDA 3AZSA 4CN1A 1HP5A 3AS3A 3FHAA 1ITCA 4ZEPA 1H0IA 3GXMA 3PZMA 4PMVA 1E72M 5CG0A 1V3MA 1PZ3A 1UR4A 2JEQA 3VD9A 4AD0A 4Z2LA 1TQUA 2JALA 2NSXA 2CKRA 1FFRA 3SEPA 3MMDA 2OW7A 4AC1X 5KEZA 3AJ7A 5ABHA 2J7BA 4DUVA 5I3DA 4PCTA 4P7OA 1DWAM 3SCSA 2E9MA 1QI3A 4ACZA 3BCFA 1JAEA 1TR1A 2Y5EA 4H8VA 3T09A 1MYRA 4F79A 2VRQA 3ZR5A 3PZGA 2XWDA 2DT0A 4J7RA 3GXTA 4RL3A 1KGUA 3W53A 4J28A 2J7EA 4GO8A 4D6CA 4UQCA 3VPLA 3RDKA 4JKLA 4JAWA 2D1ZA 3WUFA 3EDJA 4FNRA 5A3HA 1LL4A 1VBUA 3BAJA 4W85A 2YDRA 2E8ZA 3RM4A 1JNDA 1JDCA 1FA2A 8CGTA 2W61A 3DDGA 4AZ6A 1EO5A 2CHOA 3TP4A 1RH9A 1D7FA 4JIEA 1E55A 1V3HA 1MW2A 2CITA 4WK9A 2BXYA 3LXCA 2NT0A 3AMGA 3BUDA 3GXNA 2G4FA 5GQBA 3FAXA 4KMQA 4Z2HA 5A6BA 1OGBA 4C7FA 3M7SA 1VF8A 5BXRA 3FY1A 4OZOA 3AIVA 1GOOA 3EJTA 4J3UA 1ZU8A 4P7NA 1V0LA 3LX9A 4CKQA 5A2BA 3WH7A 1W9XA 2CIPA 2YKKA 4WLCA 2WW5A 3KWXA 4FMVA 3DYMA 1QWNA 4CCEA 1JD9A 3VGFA 3AIEA 2XFYA 4OOUA 4W7UA 3WMSA 1UWSA 5E09A 3AMCA 4OBSA 2J77A 1WO2A 2PI6A 2FE0A 1QNQA 4W86A 1EOMA 1GHSA 2J7CA 4UFJA 4QCEA 1E9LA 3VIFA 3WL0A 4HA1A 4ACZB 3ALFA 3AS1A 5CGTA 1H3GA 1NM9A 2J7HA 1TQTA 2GK1A 4UR9A 3PZOA 1PEZA 1GPFA 4PMRA 1PIGA 4BA0A 1VFOA 2GJPA 5JBDA 4PN2A 3DX1A 1ISVA 5I23A 2D3NA 3TOPA 4GQQA 4MB4A 4KGJA 2YL8A 1ZBKA 4FLRA 4MNJA 1UR1A 2ZXDA 1WCGA 2XVPA 1CGYA 1BYDA 3WH5A 3U5UA 2OSYA 1ODZA 3QHNA 5ABFA 3O2LA 3OLGA 5BRQA 1R8LA 2QMJA 1D2KA 3GBEA 1UR0A 5GNZA 5A6AA 4W5ZA 4TTUA 4NSBA 1QNOA 3M46A 1W3KA 2F7RA 2WZHA 3AXHA 2WMKA 1ISXA 2C7FA 3EJSA 2XVKA 1C8XA 1FP8A 1M53A 2EPNA 5DFAA 8A3HA 2BFGA 1E4LA 2WHKA 3UG5A 1ZBVA 1QHPA 4X0NA 1HJQA 4PUEA 3THCA 3CZLA 5E0FA 3VGGA 1UWQA 1XGZA 3ZT6A 3LPOA 1NARA 2CNCA 4P8XA 1DWFM 3CUFA 3TTSA 3BSHA 3TTYA 1OSEA 4MTVA 4KH2A 1D3CA 3KL0A 3N15A 2PF0A 1QBBA 3WUGA 4PYSA 2GK1B 2HISA 3G6LA 3CIVA 4HOZA 2ZX6A 3WH6A 2F1AA 4D6EA 3VGDA 1I1XA 3WSUA 3ARSA 4AY1A 3TV8A 5EBAA 3DHUA 2XUCA 2RGLA 1TG7A 2QV4A 1M04A 3RILA 4AMCA 2W63A 3UG3A 1E0VA 4DM1A 3VINA 4NZFA 1GUVA 3D4YA 5I79A 3BLKA 5ABFB 1UHVA 1HX0A 3PZ9A 3PZQA 1KWGA 1UWUA 4WIWA 5CZKA 3ARQA 3BVWA 4HPHA 2V3GA 3MV11 2VRKA 1TVPA 3U7BA 4FNTA 2YL9A 3VKKA 1KBBA 1V6XA 4E8CA 1UUQA 1MQRA 2QF8A 4TXEA 1UQZA 1B31A 1JFXA 3W82A 3NIYA 4DO4A 2UY4A 3W4RA 4GI8A 1IT0A 2VCAA 2XN1A 4PMZA 4RE4A 4FF5A 3T2QA 2EPKX 1VAHA 2WBKA 2XM2A 5AY7A 3T2OA 2XYLA 4A4AA 3VO0A 4J3XA 1E70M 1UOKA 1LJYA 2Y8KA 3WD3A 1KGWA 3S5ZA 2UY3A 4IUGA 5GNXA 1KCLA 3PZIA 1O7DC 2YIHA 2BY1A 2XSAA 4KRTA 3D3AA 3AS2A 3CV5A 3AIQA 3UR7A 4J3TA 4LYPA 2YOCA 4AW7A 1C91A 3F5JA 5DO8A 3AICA 3N11A 2CBJA 3OLIA 1K9DA 3VMPA 2WSPA 2WC4A 9CGTA 1CBGA 3ZR6A 1CLVA 3WDPP 2ZE0A 4JFSA 4Z2JA 1R34A 4W7VA 1GOIA 3SCPA 2CBVA 1HIZA 1PAMA 3EJPA 3MMUA 5AC5A 4MADA 3VTRA 2W67A 1UWRA 1OINA 4IPLA 3VIPA 4AYSA 5EB8A 4FNUA 1O7AA 1K9EA 1U2YA 4AXNA 3K8MA 5I0DA 1NOUA 1E6NA 4XV0A 3OA5A 4JKKA 1Q6GA 1E5JA 2WMGA 2GDUA 3APGA 3VUPA 3EDDA 1CECA 4CD7A 4WKHA 3VD5A 3SCRA 3PTKA 2WMIA 3NSNA 4WSKA 4QP0A 2NT1A 2VX5A 1CGXA 1Q6CA 4MAVA 2WVUA 1LLOA 2FHCA 3ECQA 3PBGA 4AMWA 2E40A 2XM1A 4Z2IA 4RE3A 3KLLA 1BQCA 1E71M 5M17A 2ZUMA 1JGIA 2XHYA 3VDBA 4J27A 1J0KA 3B9DA 2FGLA 4UQAA 5IHSA 4LX4A 1WKYA 2X8RA 2E9BA 3U7VA 4N0RA 1B3YA 3ARZA 3WQ5A 2XN0A 3CPUA 1UR9A 2WKLA 3BH4A 2J78A 4AZ5A 4OBRA 4PSRA 3EMQA 4DWSA 1UWTA 2W91A 2OSXA 4HOXA 1LQ0A 5A6MA 1CENA 2WM0A 3VD4A 1JYWA 1YHTA 2VQTA 3CZEA 1XYZA 3WMCA 2QLYA 1IZJA 2VZSA 3WY3A 1E56A 1K6AA 5BYWA 1FHDA 1OIFA 3ARPA 2YL5A 1GJWA 2DIEA 2J7FA 3THDA 1TQSA 4IISA 4DUXA 2F61A 3MUIA 4HZ8A 3NSMA 3AMDA 2G3MA 1UH2A 4WSJA 2Q8XA 3DDFA 4Y7EA 1BYBA 2F2HA 2X1IA 4KWUA 2O9OA 2WBGA 5FL0A 2EQDA 2D0HA 3PZVA 1QI2A 5AYBA 1R85A 3MSDA 3F5LA 2F18A 2W62A 2BY0A 2VNCA 3QOMA 3CZNA 2WMIB 1R33A 2W92A 4NZJA 2IXUA 2PWDA 2VUYA 1TQWA 1KWKA 4YPJA 1OCQA 3L4TA 3VMNA 1GONA 1HTYA 2WWCA 4DM2A 3F4VA 1I1WA 5HPCA 1Q4NX 1XRVA 2ZX7A 1WE5A 3VX1A 2WMHA 2NW0A 1ZBWA 2G3NA 4GO9A 6CGTA 1W2PA 5HDRA 3WQ4A 3U5YA 1UD4A 2EABA 3W26A 2OSWA 1OD8A 4AD5A 1E1EA 2WZIA 3AIWA 3HG3A 2WNWA 1FH7A 2PBOA 3GNPA 3OBAA 2DIJA 4U5KA 4DWSB 1WP6A 5M03A 4V2XA 1ZJAA 3VNZA 1UR8A 4U31A 3GXDA 4D6GA 4UFIA 1DWJM 3CZGA 1E5NA 4AD4A 3VD3A 3BMWA 1HXKA 5DT7A 1EGZA 1A3HA 4ZFMA 3VIGA 2ALWA 3LRLA 2DT3A 2VVNA 3WENA 3WQVA 1DWIM 2XTKA 3OLEA 3PN8A 5HPOA 3AIRA 1QWUA 2PWFA 4D6HA 3O9NA 4WKAA 1HJSA 3W29A 1HKIA 5DEZA 1V03A 1J12A 2OWWA 3UG4A 1PJ9A 2YL6A 4D1IA 2A3AA 1GOKA 2E9LA 3AQUA 5EMYA 4TTGA 1CXHA 1V02A 3G6MA 1BG4A 3UR8A 3F5KA 2WPGA 5BXSA 5D8ZA 1MFVA 1GNXA 2OYMA 3L4UA 5I5RA 1UG6A 2YBUA 5A6KA 4M81A 3WQ8A 4PMOA 1KCKA 4P8VA 4V28A 1W3LA 3H53A 1EIBA 3W37A 1AVAA 5D8WA 3GTNA 5M5DA 2WZEA 4QDMA 5CSUA 3D5HA 3K4DA 3LXAA 1CLXA 2VX6A 3GXIA 1E4IA 1CWYA 4FNQA 2WLYA 2WMJA 3AHZA 1W9UA 3H55A 2J79A 3WUEA 1C7SA 4P7LA 5A8OA 4W84A 4M8UA 4GXPA 3VGBA 3K4AA 3AHYA 2QPSA 3LMYA 2A3EA 1CEOA 3WEMA 3K46A 5A8MA 2MANA 3WD4A 2BY3A 2GJRA 1TZ7A 4GKLA 1W9BM 4PTXA 1V08A 4BZYA 3AZTA 2WMFA 3KZSA 1QW9A 4TX8A 3PHAA 3ZM8A 5ABGA 4OJYA 4B16A 2O9TA 3IJ9A 1LL7A 5A6JA 3HMCA 4QLKA 3CZ8A 3N13A 4HA3A 3VIHA 1JZ6A 3CTTA 2G3JA 2DSZA 1JYXA 1VFMA 3CO4A 3SCUA 2ZX9A 4AIEA 5CXPA 3W6LA 3EJUA 4GINA 1BPLB 4L4OA 1Q6DA 1QOXA 1RD6A 1V6UA 3WNLA 5I24A 1SR0A 3MUZ1 1K9FA 2PBGA 4AEFA 5DMYA 3ZO9A 1ISYA 3S5YA 3BVXA 1EHAA 1JFHA 1AQHA 2DT1A 3I3EA 4UOJA 3HZ3A 3CUHA 3L4WA 2YFOA 1DWGM 2J8FA 2YFNA 5M3WA 2WLZA 3AHXA 5BXPA 3EJQA 4KGLA 2DSVA 4NI3A 1UQYA 4FK9A 4W7WA 4D6DA 3BAIA 1JDAA 2ZXQA 4AWEA 4PMNA 1KR0A 1QNRA 4UQBA 4MPKA 1V0MA 4LXFA 2V3EA 3WQWA 1VENA 1PIFA 1E40A 1UR2A 1NOFA 1WB0A 2JIWA 3FN9A 2ZUUA 5D9OA 4NXKA 2D2OA 3WIJA 1KQYA 3HG4A 4TVUA 3SCWA 2D24A 2DPEA 3VSTA 1B3WA 3GZAA 4PSPA 3WUBA 1UASA 1XV8A 1WDQA 1OT2A 1QI4A 1DP0A 3N9KA 5E70A 1WDRA 2BVYA 3LXBA 3EYPA 3TA9A 3UCQA 1KXVA 3VMOA 2ZXBA 4W5UA 2EAEA 4UFMA 4CN4A 1J0HA 4HMDA 2ESCA 1C93A 1UZ1A 2EXOA 1EDQA 5HOSA 4U5IA 2G8ZA 4X0VA 4AEEA 3WNKA 1JXKA 2J47A 2WHMA 3CGTA 1LG2A 5EFFA 4PMYA 1G01A 3RM9A 4TVCA 3A21A 2VVSA 5E0CA 3TONA 1UKQA 1EO7A 1J18A 1JZ2A 3EBVA 4R27A 1KQZA 4XZBA 2XN2A 4X9YA 3PTQA 2X2JA 3VIJA 1JYNA 3L2MA 3A4WA 2AAAA 2D22A 3VDAA 2ZX8A 2BS9A 1IV8A 2EACA 5JIWA 1H4PA 3PZNA 4J3SA 3L4YA 4AYGA 1L8NA 3CZSA 1HJXA 5A2AA 4JL2A 4EANA 1CXFA 1R7OA 1F4HA 1GQLA 2CYGA 1SZNA 1C7TA 3IGUA 3I3BA 3S6TA 3CUJA 2ZUNA 2VOTA 5CLTA 3BLPX 4BS0A 1V0NA 1V6WA 1CGWA 3W27A 2CBIA 3RM8A 1C8YA 3QGVA 2EBNA 1UA3A 1IZKA 1MW3A 3NCOA 3BUPA 4RE2A 2BHYA 1OBAA 1L0PA 5GNYA 2XGIA 4UFKA 1OIMA 3MS8A 3M6DA 3TTQA 3TTOA 2CXGA 5CPTA 3ARRA 4UZUA 3T0BA 2WANA 3AYRA 7TAAA 3CMJA 3B8SA 5FIPA 3CHDA 2WHLA 3NDZA 2XFRA 1X6NA 3BXWA 4CVWA 3MUAA 1B0IA 1WDSA 3MSGA 4HU0A 5JBEA 3LPGA 3T0DA 2CPUA 4QLJA 2PWHA 2CKSA 3SUTA 4CU6A 1B30A 6A3HA 1ZBCA 3VDCA 1GVYA 4LYQA 4M1RA 3WFZA 4IPNB 3SUSA
chains in the Genus database with same CATH superfamily
2PW1B 3L1EA 3DROB 1WD8A 5E2UH 1TU2B 5C08E 1BGAA 4XPTL 1R17A 3P1VA 4H2AA 1QEXA 5EZJA 3DTXB 1A3LH 2GY5A 4ZFOA 5DMNA 3VXMB 1JXFA 5FA3B 1S5IL 2RTTA 2VL4A 1SVBA 5CBEB 1P7QB 3ZQWA 3UTTE 2FSEA 4G7YL 3W1PA 1M1XA 1EK3A 1TVBB 4YHNA 5EGRA 3SJNA 2OCZA 1FZKA 3E2RA 1U58A 4AX3A 5G1MA 3HZKA 3FFCB 2WLNA 3UVIA 5FKYA 3L4CA 4LVOC 3GHRA 2ZUXA 4NUJA 5HNUA 2V3FA 3G1VA 4M24A 3N4FA 1IHIA 4DQAA 2VC5A 3VCNA 1UP2A 2PTVA 4AD2A 1M7UA 3VOJA 1MRCL 4PJ8D 1H5VA 1OM0A 3AXXA 1QOKA 3T0AA 2VURA 1WT5C 1MRFH 1MDTA 2DJSA 5L8KB 3LLFA 2Q76B 1MFEL 1CB2A 1TTAA 2WMPB 5C0QA 4IX2A 1F6AB 4HOWA 5DQJA 5F0MB 5AD0A 3RUGA 2NZ1A 1WCQA 2W81C 5PAZA 2X53A 3N85L 2JI1A 2WBJC 2Y6ZA 3NABH 1M56B 4JPGA 3PWJB 2Z1PA 1UKTA 4QLLA 5BZWA 1Z9OA 1MCWW 4Q4EA 3H3PL 4FGMA 5JR1H 2ZRXA 1MUJB 5K39A 1DQUA 3KVDD 2IUZA 4UBDC 4O19A 1U8KB 2DW6A 4UM8A 2H0EA 4JAMB 3C3UA 1T99A 5JDSB 2A77L 3BJLA 4U33A 4O58L 5DJCB 4A2EA 4RAHA 2GVEA 2OAAA 4K7FB 4M1GH 3NP4A 4KKZA 2ZG2A 3DSFH 4NENA 2VQ1A 3DX3A 3RTQB 4QSHA 3H9ZA 2DLHA 1M9HA 2ZCLL 3CFJA 3CB3A 2A9BA 2ZYFA 2Z7KA 2HRHA 4AY0A 4JOMA 5TPWL 4Z0JA 4KDVA 2J1ZA 4LEBA 4OM1H 2E1WA 1QDSA 2YQ2A 4L18A 5I18L 1ZTMA 4Z76A 1FCQA 1XBZA 1DO6A 1JJUA 3LEVH 1RCOB 1BEYL 4FQXA 1E1FA 3RJXA 1MAJA 2BVQA 1FV1B 2R0ZL 5IB5B 1N0LB 1FC1A 3H7UA 3GSRA 1VCVA 4WUUA 3WNPA 1BYCA 2ATKB 2FDMA 1UWXK 3BISA 3V52H 3AU2A 3ULUC 4BQ2A 1A25A 5IBXA 4YC2B 3IMUA 5D7LE 4B2DA 3V0TA 4Y5VC 1VCBC 5CBAA 2BBFA 2Q10A 2X10A 1A22B 4F37K 2YA1A 2G97A 1D5XB 3QFJD 2R1LA 4GBDA 3QHZL 4PJHF 1F3JB 5FEPA 4AH7A 1U83A 4FF9A 3FL7A 1HIML 3VXPB 3TYUA 4Z23A 4CCCA 5DUMH 1V8EA 2EPLX 1PZ5A 4FYSA 3E96A 2DWDA 4NQSB 4FXGB 4OV5B 2BZCA 4Z8FH 3KBJA 5HGDA 5I3HA 2E5EA 3VKBA 3HBPA 4ZFFA 3N6HA 3KW8A 5B1KA 2OJ1A 3T77A 3S6OA 4L1DA 5GS0H 2R1YB 3KLKA 5B8CB 1FDLH 4K9EH 3A4EA 4N8UA 7PAZA 4OF0A 3WFEH 2Z1SA 1W1TA 5IMOB 3D39D 4NNYB 4YTRA 5A3IC 3VFOB 4QCFA 3MLRH 3JTBA 2BWDA 4L80A 1KRBC 1H7XA 1F11A 1YPFA 2RB8A 5IMMA 4GG6F 3P0VH 4M5TA 1YY9D 4DWDA 5DANA 2Q6WB 2BNQB 5KSBE 2X40A 3LKQB 3MV8B 3VA8A 3AG3B 5LGHL 2QMKA 5D2WA 1L8PA 3WEXB 3A13A 3HPZA 3CFBB 3IAPA 3KPRE 4LAOA 3N2CA 4R3UA 3UO1H 3WDHA 2E4TA 5B80A 1VJZA 1P0BA 3HC0A 5D37A 2VLKD 4ILDA 4F0HA 2FO8A 2UX6A 2WB5A 4HH9A 4G6AD 4GQRA 4U6HB 4AVFA 3Q45A 4HK3N 3NACL 3CYJA 3ZDYB 3COTA 3QJZA 3WEOA 1A7QH 3SQBB 4E8DA 4FHKA 4ZTXA 4BFKA 3SIKA 2NV1A 3AXLA 3DJRA 2BHFA 2PO6D 1FZJB 2W27A 4O11A 1XB6A 2P43B 3WH9A 1ES0B 4GIPD 2YSSA 4OKDA 3AY4C 1Y6MR 3T3ME 2CO7B 4FA8A 4FG6D 4RSVA 1FCCA 1ZALA 2HH0L 1AR1B 4H8QA 1N6QL 5TDOB 1I1FA 1Q6RA 4B3LA 5D8JL 3MRPA 4L3CB 4EI5B 3WEAA 3DVNB 2O9RA 3FSAA 4FULA 3T65B 5JQ6L 2NY4B 2OLDA 2FT8A 4ZB5A 5TDPB 3MV9D 1CYGA 1E0TA 2VDPL 1RIVL 1R6WA 2YB4A 4OZGB 4P61A 2HSIA 1PBGA 3QH3B 1OCJA 1QSFA 1TTRA 2VKXA 4FLQA 3V4UH 3GS0A 3QQ4B 2R27A 3S35H 1D3HA 2ZUQC 4N42A 3EX2A 1PCWA 4U1MB 4H4IA 5CJXC 2ITCA 4O17A 1BTCA 1ZGLB 2ZC1A 4FEIA 1FXPA 4AW4A 2YCLA 1TJIL 1E0WA 3T8QA 2CDEA 2J6WA 2D7TL 4UR8A 1ZIBA 1EX5A 4JPIA 1LHZA 4LRNL 4JFFD 4GG8B 2WBJD 3F04A 2O5XH 3DX2A 3T05A 4YHML 4AEIL 4PJDB 1M05B 3OZMA 1DO5A 1IEWA 2VEKA 1EIXA 3TJLA 5I2UA 2OMXA 3NZQA 1HVQA 4A37A 5JHLA 3RWJA 1A5CA 4QJ4B 1JHLH 4PRIE 4OT7A 2DZUA 4OF5A 1QNIA 4A8LA 1VGEH 2XWTA 3B8VA 1WA0X 1KGJA 3QIBA 3GTVA 1SSGA 1NQ6A 2EKSA 3UWVA 1WEJH 1L3NA 4G1NA 2G3XA 4S1RH 3FMGL 5ESAA 3RVTC 3GSQB 1JTTA 3VM7A 1MI5A 3NPWA 2UY2A 3BZJA 3THML 1J8KA 2VDRB 3KHDA 1X3DA 2X3CA 3WLWD 1M01A 3ZRFC 1G4TA 4A3RA 1AQMA 1CFNB 2GGHA 2EEXA 2Z7GA 2K6WA 4P2AA 3VI3A 1UWFA 2JKSA 4YR6B 5D1QC 2B3IA 4GXUM 1LL6A 4ZW6A 3SDXA 4PJGA 1MCLA 2ZA1A 3O6LL 3REQB 2V2XB 2EYRB 4ZODA 2X7LB 2E6PA 4YXKH 3GH7A 2BIIA 4Q74A 4CVUA 2WM1A 4QO1A 1I7TB 3CEUA 4QS5A 5BRZD 4QOKD 3ILDA 3SY5A 2DMKA 3TN4A 3IAGC 2JB6A 2NY3B 3G5YA 2LOEA 1Y0EA 3ZVHB 1H1NA 2DJMA 4N9EA 1X5ZA 4M6VA 2MJWA 5FA4A 4HYVA 4UTJA 4R7DB 4P4RB 1TV2A 3O4LB 2NNXA 5K7JA 1NEZA 1UCWA 4I6VA 2UV3A 1H0IA 1ZLSL 1GMIA 4Z1CA 3NZSA 4KI1A 5C2XA 4DK5A 1HYRC 3W1LA 3N14A 5AOLA 4QDPA 2E25A 4XCNB 4IYKA 3ZZLA 4HCRH 2B59A 3EX6A 2VRQA 4YL4A 1FIEA 2EUZA 5CD3A 4J28A 1E28A 4R26H 1UACL 1CICA 4F40A 4TQIA 4NRXA 3G9VA 8CGTA 3MBDA 1DE5A 4AZ6A 4PE8A 5F6HI 4WW2C 5IMLA 4AYEC 4PODA 4Q6XA 2PP7A 4OFVA 3WHE0 3STCA 3RJDA 1HEZB 4ZTPL 5A3ID 2R29A 4AQOA 3ERPA 2H7WA 1OGBA 5H37H 3JTSB 1EMTH 4L29A 2WB7A 5FGCE 4CKQA 3W39A 3DHDA 1PKNA 1GKPA 1RZJH 1QWNA 3T71A 3GC2A 2VKWA 4A6YH 5E09A 4FX7A 1DQWA 1KXVC 4RDQF 5HBBA 1H3PL 4W86A 4GBXD 2ZZ2A 2VYRE 2KC0A 1TQTA 1DQJA 2PS2A 3VOGA 4QPEA 2WIMA 2IIJA 4XNYH 4OZHB 4HT1L 2ZAGA 1S5NA 1U8CB 3JR2A 2GTZB 1F90H 5DJ8B 3WIHL 4AQZA 1ZWIB 1A5UA 4QHKI 2XJLA 1I9EA 3IDYB 3RX9A 4W5ZA 4NKDB 2WKJA 2X4RB 1U95B 1PYFA 1K4DB 3QUZD 3R8RA 3FCTB 5I74B 3RCYA 1GMEA 8A3HA 4PGDB 4P5SA 4TV3A 4TV6A 3B7UX 5C2UB 4X63A 4YHZH 5AHEA 3CZLA 4PTTB 2RBLA 3QUXC 1TNMA 1G9MH 1XGZA 3D69B 1DWFM 4S2SA 4XVJL 4LPVA 4KX9A 1GXEA 3N15A 4DBEA 1P7HL 1IEQA 2EC9T 5DJ2B 3BG3A 3VSQA 2OKMA 1LE5B 2LE9A 2F53E 4JFZH 2RD0A 3CL7A 1M04A 4AMCA 5C2BH 2P46B 1A7OH 2AV1A 1NMBL 5I79A 4IPJA 4YDVB 2R23A 2XG5B 4YOKA 4MAUH 2V3GA 2VRKA 4IGMA 4HFUL 3PC0A 3HPXA 5DMGD 2Y7QB 4GI8A 1KBGH 5BVJA 4PVMA 1QBLL 2EIDA 2NX5D 1W8SA 4AM0Q 2Z8VC 3Q05A 3WMPA 2OKTA 1LO0H 3QB7C 3GHEL 3O3AB 1RJYB 4ZG1A 3P82A 3ZMNA 4X5XB 5AG8A 3I50L 3VMPA 1XYAA 4JFSA 4Q58C 3TF7C 3E12A 3BW2A 4XSLA 1Z48A 4JQ2A 1I9JH 1SZFA 3V6OA 4KIEA 1B0RA 4MADA 1U4EA 2CR6A 4ZYKA 3IS4A 3BK0A 5AKSA 2YSTA 3H9HA 3SW6A 2WLIA 1Q6GA 4KI5E 4K3DH 2WMGA 4PS4L 1CECA 4HJGA 1U8QB 3PF3A 4WKHA 4I8DA 4Z0XA 4F7EA 4ZW8A 3R0DA 2B4GA 4WFFE 2VX5A 1XS2A 4DVBA 2XTJD 2FHCA 3E74A 2E40A 3IFNL 2BP0A 5JPMA 3KLLA 4ZX3A 2XZQL 2H6PA 2ZUMA 3ECUA 3E9UA 5XIMA 4J27A 2FGLA 5JNYB 4LLQA 4NS0A 1EAQA 3QPZA 3ZYZA 1VBJA 4HCRA 2PABA 4AZ5A 3W7CA 3OKNA 1VSCA 3MLWH 1VZIA 5TQ0H 1THAA 3ROOA 3WKPA 5K1VA 4O51B 3LIZH 5CR8A 4M5YL 3OJ2C 4JRFA 4LOCA 4X2UA 3N42F 1T1XB 4J3BA 1NDYA 3ZS4A 3LA4A 4PJIF 3ITLA 5AWNL 4YDNA 5E2VL 5AYBA 1R85A 3BP4A 4M6OL 2W62A 3CZNA 2W0FB 2R94A 3C5JA 2FD6L 3N43B 5H37A 2C1OB 1A1OA 4YTTA 3Q9PA 2NXZB 1BZQK 4M48H 3BAEL 5FDWB 3NQIA 3DKLA 3SJVD 1NCIA 3CFUA 1W0YT 3QDAA 4IIBA 4PG9A 3HG3A 4GB9A 2K9FB 4KK8D 1W8NA 3WS3A 4FTVB 4FI7A 3EGSA 5JW3H 4U31A 1ET5A 2HT2D 1OX5A 2K6ZA 3X14A 3W3OA 1HXKA 3K6IA 3MRIA 5GS2H 3GBNH 4GP5B 2XTKA 2Z31A 3GPSA 5MP6H 3TZNA 2O55A 1QTPA 5DUPH 4LFHD 3O9NA 1V03A 2M2DA 4WXZA 2YCJA 3IXTA 1RUPH 3OZKA 2FR4B 3O2WH 3I7QA 4WVXA 3QUKA 1QLEL 2WPGA 1J1OL 2EIMB 5GS1C 3VFVB 1ZTXL 4N4PA 1R5YA 3GXIA 1OG0A 3PGCA 1VHPA 2H3NB 4XVEA 4NO5A 4Z0BH 4Q9QH 3MZTA 4NCDA 2YEVB 1HFUA 2B3RA 5D7JA 2GC4C 3BLFA 1GVFA 3LDBB 5J1SC 1QW9A 5ABGA 2O9TA 1UB5A 3IJ9A 1RURL 2OLAA 3HMCA 3NO3A 3WIIH 3CTTA 3E9AA 2PCFA 3CDYA 4XCCH 4PCFA 5HGBB 4E5XA 1IIKA 4FQQB 3OD3A 5E51A 2FJHB 4Q8WA 2VXSL 3QAZC 2H6UA 2UVFA 2BIQA 3VKJA 1WWBX 2F6AA 3C3NA 5J3HC 1X7FA 4XC3H 3VG9B 4X9HA 2CGZA 2FIQA 1HTIA 4Y9EA 4I1NB 3Q2LA 3C56A 1MHPH 5E6ID 1LUCA 2D24A 4Y2DA 1WDQA 4JM2F 3M0YA 3WXWH 1ZMYA 1XUZA 3OHXA 5FJIA 5CCGE 4JTRA 2IADA 4NNBA 3UZEC 4LP5A 4AEEA 4DCQB 1IRAY 2OMYB 5F1IA 4GBUA 4QXTB 3D07A 4F8LA 5DS2A 2A2IA 1DBMH 3KDNA 4JN1H 1A7RL 3PTQA 4J5NA 2J71A 3HMWH 3IUIA 1CDUA 2J13A 2BS9A 1IV8A 1NL0H 4NN6B 3V4PL 5JIWA 2KS0A 4L9DA 2A74A 3Q2WA 1W1ZA 3QUXD 1ANUA 3JYCA 5A2AA 3FQWA 1R7OA 3UWQA 4XE0A 1DJNA 2ZCHH 3FO0H 1Z3GL 3IGUA 3FTGB 4I18B 3S6TA 3CUJA 4XBJA 3JWNE 2VJ8A 2DIKA 4Y4FD 1NIEA 1WAEA 3NSCA 3E0FA 3NCJL 5JUEH 3IS0X 1PNCA 4NZ5A 1IGMH 4RCXA 2XGIA 4ZUSA 3X3FL 2DORA 1QZ1A 1RLDA 2XFRA 4ERAA 3F4WA 4HU0A 4GY1A 5HDLA 2CKSA 1L9WA 4FCHA 4A38A 4M61B 2BSSB 3B3IA 2AV7A 2ZXEB 3JWOL 3ULSB 4DP8X 4IPNB 2FVMA 2YGPA 3ZJ6A 4BELD 1CIUA 5JBFA 2UWEE 4UOW0 5C0AB 1PF3A 3EKGA 5E5MB 1AHWB 3HC3L 2KZHA 3O7UA 1P7TA 3ARXA 1NP2A 2XACC 1S5TA 4MWAB 1FL3B 1G5AA 3GRWL 2QFRA 4LEXL 4Q2ZB 4ZW7A 5E2WL 4WV1B 3ARDA 2J7LA 3VI4E 1W80A 5EBWB 3RAJL 2BSTB 4H9YA 4QYOB 5CO1A 1I7UB 2EH8L 4JKNA 1QWHA 5EOTB 2YA2A 4F15C 1QSEB 1QRNB 1TNNA 4A68A 2DT2A 4JRXD 3T1FA 2QR6A 1MO0A 3IKCA 4PMUA 5A6IA 1KIPA 3BOLA 3CC1A 4PV9B 4RDWA 3M5VA 1KGIA 1UH3A 1AQFA 3ZXAC 2XIIA 1N8FA 4HF5H 3QZWB 1SOKA 3LTPA 1L6GA 1EUAA 4NI6A 5DQDH 4ZAKA 2B5IC 1FH9A 5F4WA 1D5BB 2ZC8A 3QFDB 4X5QA 5EUOF 4KHXH 3GAKA 4KJWC 1XJBA 5C5YA 1BQSA 4XP6H 1QKZH 2XA8H 2BDQA 4LASL 8PAZA 4FZIA 3QXAA 3K6DA 2CCRA 1MJJB 3VWJD 3VXSE 4H9VA 3RZCB 4HC1H 2IQAA 3QDJE 3F7LA 5TFSH 4H8UA 3ZMEA 3FKKA 1YUHB 1PNDA 3DU0A 4DN3H 1AKPA 3QWOA 4X4KA 4LPXA 3RPMA 3PHSA 4KK6C 3GTXA 3GUTA 4HNNA 5FJRA 5E5UB 1SZGA 4N4QA 1B4TA 5EU9A 3RVUD 1DBBL 4YSUA 3NQKA 5K3VA 4ORGB 4X8GA 4H4NA 2REQA 5DSCA 1H2JA 1OFEA 3EOTL 5G5DA 2XFWA 2DIAA 4G3YL 1C8PA 1W16A 1EPVA 3LQLA 5KVGL 3HLAB 3MJ7B 2D9CA 3T4WA 2JFEX 1F6YA 1GY2A 1YPZF 4YSSA 1QLRB 4K8EA 5MERB 4GIRA 3KRUA 1JCXA 5F93C 2WZTA 1DDHA 1E5CA 1EO8L 4DAFA 2AABL 4P8WA 4R5VA 2HNHA 1PS3A 2V7NA 2K7PA 4H25B 3MGTB 3ARGB 3VYLA 5D9SB 4MXWH 4G8IA 1UD5A 3IJ8A 4JIPA 4NQXB 5KYYB 5EZLB 2N1TE 5ECVA 4E0RB 5FYLH 3UEZA 5B22A 1QNVA 2O5YL 1NAL1 4QRPB 5D71H 1ZHBB 1WA3A 2VMJA 3BN9D 5DGRA 1OT1A 1KEMH 5FIEA 4GZIA 2NTFB 5I8CA 4W89A 5HD8C 3U1PA 4LU5L 4O54A 2VR4A 4LOEA 3AY2A 4F8PA 3SRFA 1SY6L 4W9GC 4CMHB 2PDQA 2JCCF 4QEGA 4YMZA 4BK5A 3ZR4A 4ONFH 5GIRA 1IUZA 2ZAIA 4NZTL 3ARYA 3QP3A 4U3SB 3WLQA 4I5RA 1MFBH 4QR7A 2YBGA 2Y61A 2ZKHL 1B4JH 3R0MA 2FB4L 1E1CA 2XDHA 4Q8MA 5CCHE 2R59A 3CLEH 5D2LF 1W9DM 3MCNA 2G0LA 3NJIA 4PGEB 2ARJQ 3DO3A 4INFA 1WDPA 2JK5A 5H2BA 3F05A 1Z2KA 1LM8V 1YEHL 3RVWD 1VJSA 4XVDA 3ZSTA 4DP7X 4XQ6A 1X7QA 4DKEH 4LP4A 2AK4B 4HMNA 4F24A 2QFPA 4PJFE 1K5NB 3CZUB 1FCUA 2FH6A 5J3HD 1G9EA 3EH3B 3LNPA 4ZQKB 3USZA 1QBML 4PRDB 1XGQA 3LVTA 4HWEH 1FYTE 5DZLA 5CQ1A 5ID1A 1F8TL 3HN8A 1KRCC 3IMWA 4JRYA 3RWCB 3RGVC 2H9AA 5EA0L 3X12B 2F9BT 4HCGA 5GZND 1PE1A 2VISA 4G8EA 1NP0A 1NOAA 3TFCA 3IJEA 1E42A 1HKLH 3IK4A 3EEZA 1N5YH 3GI8H 2WNNA 2HFEB 4X5WB 1KCSL 2VJXA 4L05A 5B21A 3RNQA 4S3KA 4P49A 3GHTA 1F18A 3UBXI 5L6UA 2ZUWA 2VXVH 2XG9A 3PY2A 1R47A 5E9DA 3L3OA 3DBPA 2QDEA 1W1PA 1TRIA 2XQBL 1CTNA 3QORD 3E3QC 1U36A 2VDKL 1MMFA 2DL2A 3CN0A 1H9VA 4JQ1A 2X4PA 2DI8A 4HC1A 1KJ2L 2K0RA 1QFUH 3CO8A 1E6ZA 2SODB 4XMPL 1TTCA 1WZKA 4OZFB 4MYXA 4FI6A 4HGWB 4X8JB 4O02B 3RGHA 4HSNA 4MA1C 3IANA 2G9HB 2R69H 3FU7B 2WCAA 1TF4A 4JCMA 1OQXA 3XISA 3M1BB 3BQUB 1MLBB 3FGCA 3C5SB 4H83A 3AHTA 3T8XB 1WNOA 3F7VB 1WSST 5B7ZA 1EJXC 1X1ZA 1MCPL 4F7MB 4TN9A 2D2CC 2BG5A 3GIVA 1EYWA 1RZ8B 5DXWA 3CLFL 4BEUA 2OQJB 3SJ3A 1DN0A 1MFCH 4TVPH 4O0KA 3DIFB 4G42B 3A4FA 1HJBC 3EOAA 3QGAC 4U05A 2BZNA 1E5YA 2Z0BA 1E15A 3M9YA 3RPBA 2EYSA 2ZWKA 2WXDM 3R0NA 5HJLA 2QPXA 1WAAE 5DGQA 3SE3A 1JUFB 4MNQE 1B3VA 3CG8A 1ADQH 3ZLGA 1JCLA 4QR6A 4NQED 4DAGL 2QTVA 4JFDE 3SCVA 4D7BA 4XTRD 4N90D 2XGBA 4KY1L 1ZS8B 4JPWL 1IR2A 2EO9A 4NQCA 4JFEB 1XL4A 3MXWL 3V36A 4C6BA 4E3TA 3BG5A 2E5DA 3HNSH 1GQNA 5J6SA 3BPCA 1A3RH 1RK0B 2VZ3A 2PEVA 3UY8A 1UD3A 4PCPA 5DVNA 4U1GC 1TFHA 5FO8B 2A6KA 4QNPE 6ENLA 4GSUA 2F84A 4DWSC 1G0YR 3V0DA 3A3WA 3GSNH 4YCPA 3K1DA 4PJCE 4C7GA 5DHMC 5A16B 5HAOA 4N28A 1TMLA 4LARH 2H32A 4MS6A 3UZJA 5BMFH 4AT6A 4WO0A 4HNUA 1CYXA 2XQYK 1CI1A 2YD3A 1FVEB 1X5LA 5IQMA 4O4VA 3L48A 5JIHA 5GSVA 4CUCA 3TROA 4JO4L 1JF5A 2DQFA 2BVDA 3VFTB 4OGYH 4O4YH 2UY7B 3SGDI 4ODBD 4YK4C 1WFJA 4Y9GA 1JZIA 1U93A 3Q8FA 3EWWA 2G0KA 4DH2A 4QT5A 5EWIL 4LZKA 3LZNA 4KUCF 1Q6EA 3SPVB 5DJZA 2FO1A 1DIDA 2A83A 4YXHL 2XPZA 3LKRB 2PYEE 3ME0B 2X9ZA 5HBFA 1S2EA 4DZ8A 2YYTA 1FGNL 1NDGA 4B5WA 3N9GH 1K77A 2PW2A 4W6XB 4IRSD 4F7PA 3KPTA 3M7OA 3ZJAA 1TZOA 3DMMC 2PDNA 1AR2A 4L6DA 3CNKA 2D7OA 2ANUA 1N59A 3L3GB 2EZ0C 1SFTA 4LPUA 4BF7A 2JIXB 3O6ML 3S1UA 5I0XA 4CCZA 1CXLA 2IVFC 3B4NA 1T21A 4MDIB 3VXRB 1TG8A 4OF3A 1NWOA 3KW3A 3FT2B 1R3LA 1ITCA 4KQ3H 2ALAA 1ZLWH 3EYSL 3MUJA 3U4EB 4CC4C 1SJXA 1G9NL 3MMDA 4GJ1A 1CFSA 1Q5MA 3LQAL 2J7BA 1GZGA 1AZVA 3GMNA 2R0WL 3BLEA 1DWAM 5ESQA 1UFGA 2BLEA 5FWRA 2JJWA 4L0YA 1JAEA 1L0QA 5AVTB 4NERA 1WQVT 4DZHA 2XH4A 2R0KH 1J9CT 5EU6B 2AC0A 2C15A 2J7EA 1PDKA 2XZAH 15C8H 4JG1L 4OZIA 1YNTB 4XXDB 4A7SA 3OJGA 4YGVA 2FZMA 3MWCA 3P67A 3LBCA 3GPEA 1UJ3B 1R0AH 1NIDA 4WO4A 1DANT 4UMGA 3RGVD 3WJMA 4RK8A 1FCGA 3U6RA 1VF8A 3FY1A 2GKIA 3GR7A 2YCIX 2JKAA 1A02N 3TW6A 4GY7A 3QC0A 2VRAA 4ZX6A 4O8AA 4DZAA 5CUSL 2FE0A 3W1QA 1Z9AA 4BWUA 1IWPA 4HA1A 1OTSC 1YJDC 1X5HA 2GK1A 4L1XA 4JYFA 4U28A 3PZOA 3MCOA 3NGBC 4KMLB 3KBNA 2CA3A 4PCNA 3GTTA 1A4MA 1CBVL 5I1DA 1JTOA 3CVIH 1ZVHA 5I23A 4NT0A 2G5RA 2E09A 1M9WA 1MY5A 4LL9A 3ET9F 3FYOA 1TOXA 5F0LB 4E41A 1OE1A 2PDPA 1WCBB 1PG7L 1CFTA 5JHDB 3TAOA 1IGWA 1A5NC 1A5LC 5C6MA 3F7QA 3M46A 3C8NA 3L7EA 4L1WA 3KVPA 4EDWL 3GKZA 1M53A 3WN5B 4MJIB 1M1SA 1H3TA 5C92A 4HJFA 4K94H 5C9KA 4WI7A 1XUUA 5EORL 3GSNA 5L2KA 1FFNA 2HVNA 2OODA 4Q8VA 3LHYA 3TTYA 3CV7A 1A6VL 3HG1D 2PF0A 4EP8C 4QTIH 4HS6B 2L5HA 4MXVE 4JDEB 2K8QA 2BK8A 4ODHH 3HUJE 3D3VB 4RZBA 3CZFA 4LGSB 2C9AA 3ZDXB 4KNQA 1DQDH 3L8QA 2NVDA 2NQZA 3B97A 1U8NA 2VUNA 1TWZA 3USBA 3D0AA 1R3KB 1S5MA 1J93A 4DYJA 1E4HA 1TQBB 2DEXX 3V75A 3RU6A 2H6OA 2FX9L 1KBBA 3EF4A 3U4BL 1JFXA 2WWKO 5JW5A 1I9RL 3QO1A 3NA4A 3T2OA 3DTDA 4ZSOA 1UOKA 4Y19E 4TOYL 4APQC 1RUSA 4ZFGL 5FO9A 4KRTA 3D3AA 2ISWA 1JPSL 1A6UH 4KRLB 3F5JA 4S1QH 3SHSA 4ETQB 2WSPA 5TH2B 4OD3H 4C1LA 1S7TB 4O8RA 4FABL 1OINA 1X96A 3QUMH 3BW9B 1TZIA 3DO4A 5HI5C 5IROD 2EG7A 5B38B 1XGDA 1YEEH 2JJUA 2FZ3A 3FVDA 1ZPUA 2D7NA 3W11C 4JB9L 1CDIA 3RTQC 5F3HA 4U49A 4GNKB 3EH5B 4G9FA 3CXHK 1W8OA 2E6QA 1J5DA 4PD4K 4AX7A 3OG6B 3HRPA 2G5BA 2DVTA 4BFIA 1INQA 2C71A 2XFXA 4A6GA 2MFNA 5A6MA 3FQRA 1NA8A 2QCDB 2J8TA 4JDVA 3IWPA 3MYZA 1IAII 3WG7B 2YR1A 4PB4A 4HKZB 3S6CA 4OGXL 1IM9A 1UEYA 2VYOA 5I3GA 1NCWL 1I3GH 4QITA 1GL4B 4R9HA 2FEDD 4JQVA 1FNSL 4YC2C 5H8UA 3UYPA 3H9SA 3WFHB 1A0DA 5EOQH 4NZJA 3SDCA 4HG4K 3EFFB 2PWDA 5JTWA 4TUOA 2WWCA 3QXDB 3F4VA 3RURA 1SMOA 2HWZH 2Z0UA 1KB5A 3STPA 1H6FA 4U6VH 3DGBA 1Z69A 3R0KA 5CGQA 1DJHA 5D6DC 2NZ9D 3GRIA 1BQKA 5D1XB 2QHRH 2J8UB 4K8RC 4ZL1A 3O3DA 1BXNA 5TDNB 4WRHA 4TLUA 5A2JH 3KPOB 4AGLA 3GG8A 1A4KB 4X4ME 3GXDA 5BV7B 3X11B 2VDNB 4JTSA 1DWJM 2QUNA 1VZGA 3KPMA 3QRBA 4FXGC 3RP1A 2VVNA 4YQXL 3QXWA 4XISA 4Y2LA 5DEZA 3MREA 3H2QA 1YDYA 4D1IA 1OIOA 4B9JA 4Y2OB 1SFHA 1JPTL 2HV5A 2YBUA 2AJYH 3CK5A 1JVNA 1WUZA 4P04A 1JBJA 3H4GA 2YMXH 3PFQA 3N91A 3TPKA 4PJ5E 3WJWA 4LF3A 3D5HA 2FYYA 1KENL 2P24A 4JVPA 2KH2B 1P1XA 2V5BA 1A4AA 3V18A 4WY0A 3UJTL 2JKNA 1A5FH 2I57A 1LQBC 4Z3IA 3RWHA 4X6CA 5ISZA 1J86A 1NPUA 4ZFZB 4TX8A 1AI1L 4B16A 4AX6A 4TUKL 2DZWA 2VDLB 5JMRA 3PJSB 3VIHA 3KLAA 1HL2A 1NCBH 4Z7VE 3WFBH 3WQOA 1AIZA 3VJ6A 4A7GF 1R30A 3UT0A 1FL5A 1H5BB 4M8VA 3WTTA 1S9WB 3D3FA 3E6HB 3PXLA 3TAKA 1KTDA 1BMGA 4PRPB 5T5NF 3FFSA 3H6OA 1SXCA 1JCVA 1JDAA 4PMNA 4JR5A 4MM1A 4Y8FA 1OFAA 4F2EA 3VKAA 1LQSR 2WD0A 1AGCA 2VLJE 5TQLA 1AKJA 5ADPH 2KL6A 4YHYB 1PKQA 5IMKB 2O61A 5BOFA 1VLIA 1DQMH 1FNEB 5J04A 3TH4T 5DFWH 3W2NA 1G6RB 3MNVA 4P5KA 4PW4A 3OXRA 1XSOA 5GGRA 3LN5B 3CGTA 2WWKT 1B6DA 4LVAA 1UKQA 2OR9H 1YKWA 3VCCA 2AQQA 4OGAC 2DW7A 2MQCA 1H7WA 4X9YA 5DCEA 1F4YH 3TKFA 1JYNA 1AR1C 3A4WA 3U8GA 3VIJA 4LQFH 1DQKA 3RQ3A 3D85B 5D38A 2BIPA 4EI5C 1AFSA 4AYGA 4BYHA 3GHUA 3E2SA 2BVPA 4ZQNA 1R2TA 2JXMA 3FOMA 4Z7OF 4TQPA 3FYYA 2XT1B 4LSPH 3R43A 4JO5A 2CO6B 4AXWA 3W7RA 1S8DA 1FHUA 4DY1A 1EAJA 3QGVA 1XDMA 2KERA 3NCEB 2J9ZA 3NCOA 3DSNA 1NFDA 3PUOA 4JY6B 1VFAA 3WYRA 3AG4B 2QR0A 1MDAA 2WHVA 3M6DA 3RPTA 4AEOA 3CHDA 1EGMA 5LIYX 3C6LA 2BP3A 3UPMA 1WDSA 4WJG3 4YDMA 3L9YA 2B2XH 2P5WD 2HKFH 4XB8A 3S9DB 4KDTA 2J4WL 3EX3A 1AQ8A 3KG5A 4D3CH 5HJ3B 4HYTB 5FCSH 4P0DA 4KZDL 5A94A 4RV8A 5ESVA 4APQD 5E8OB 4OM0H 1W56A 2OMTB 5FJJA 2OP4L 3VFMA 1BWMA 1OE2A 2WVTA 4NZ3A 4NWUL 1AFVH 4W8BA 2OXHB 3ARUA 3OJVC 3VFWA 3ABSA 1GQIA 4YHLH 4NIKB 1R3TA 3ELQA 3TYGL 4MHBA 2X87A 1H7RA 5K9CA 4AG0A 4J35A 2XN9A 4OLXL 2X2YA 3DG6A 4DX3A 5IV2B 2JGQA 1EXUA 1J9SA 4OTKA 1WG3A 3O16A 3PWUA 5I5IA 5HI5D 3HCVB 2Z29A 3LTSA 2V3DA 1VPXA 1ERNA 1IGFL 5ABDE 2JB5H 4MNHA 2VC2H 1Y0LB 2CZFA 3FJTA 3PGDB 3A4AA 2Y2YA 1OQOA 3VUAA 2GTWB 2E28A 1HNYA 4K71B 4DKTA 1F74A 1G0DA 4UV4L 4RFEA 1MHEB 1XPYA 5AYIA 1PY4A 2IPGA 2CRYA 3NZRA 2R9HC 3CIQA 1EF2A 1N55A 4JL1A 3TBTA 3TBWB 3OAUH 2PTTB 4JHMA 3GT6A 5INCA 1SMDA 1M71B 2ZSWB 1ZUAX 1WX0A 4IOIB 1MVUA 1XBXA 1VEMA 1J87A 3REVA 1NIFA 4V1DD 4HA4A 4MAYA 4UBDD 2WP3T 1SW7A 3N18A 2PYFB 2BOGX 4D0BB 4DRSA 3HF3A 4HIHB 3U7YH 2NY3C 1T0OA 1A53A 4I88A 4BM7A 2OQYA 5FFGA 3M5YA 3WFLA 4X80L 1T7XA 1TEGA 4YS4A 3MLTA 4TS6A 3BJSA 4ZTOH 2PWGA 1T03H 3WCZA 1LQAA 1K70A 4ML4A 4HD9A 2FJFB 1TB3A 3ABRA 5J4MA 4QFUA 1IBDA 4ISVA 3HPLA 1D2OA 1VFUA 2QT6A 3WO8A 1L7TH 4E36A 2PRHA 5IOPA 3NN8B 4ODXA 2I69A 1XIDA 5KVMC 5FYJE 1E6SM 3B0XA 2J2ZB 4JHVA 4H1LB 5JIPA 1I8IA 1Z32X 3A5FA 1O9WA 2X0WA 1GG0A 1RZGB 2MOGA 3NA9H 2FGZA 3DXAB 2BDNL 3ULUD 1M7PA 4G8TA 3PHQB 3POHA 4PL1A 2PD5A 1FWDC 1V8HA 4GW5B 1E9ZB 1IIGA 3MLXH 4C8XA 2OMWA 2K7QA 3WIFA 2WJDA 3KPQB 3AYSA 3QC6X 3AADB 1T0NB 1A6ZB 1XYMA 3BGJA 4XWGL 4LNCA 1BG1A 3L2LA 2PMZA 5FCUL 4QDGA 4L4TA 1V77A 1ENUA 4PTMA 2X41A 4J3OH 2JEPA 1AD0B 4OB5H 2FBJL 1P6AB 2KHAA 3O3BA 2FBRA 1NANH 4NZRH 1LO3L 1X9QA 2W9EH 5CZJA 1UMLA 2IPWA 3W87A 4GY0A 1CCZA 5D7KD 3RLSA 2CRMA 2YD7A 1VDGA 2G5WA 1FVPA 4LVBA 5AW4B 4Y1AD 1HKWA 1V6TA 4MCYB 1BSIA 4F58L 1US0A 4X6EA 3WKYA 1WIOA 2W0UA 5BS0D 1LILA 3S48A 3IDYC 4NVTA 1JF6A 3KR3L 4P23B 3BZ4B 4YBHA 5HYFA 1I82A 3S35X 4N2MA 4EXKA 3D25A 3GH4A 3AFBA 1E8YA 2CMRH 5I74C 3P3BA 5LBSL 5ANHA 5IVXF 4AM0B 3P3TA 3AM8C 4XB7A 4Q56A 5FUCE 4LYRA 1KBWA 3FONA 3EA2A 4KEMA 3I84A 3HQOA 3G08B 3EWBX 1W1B1 2EDTA 3CQJA 2YK1H 2WQXA 5FF6B 4NAEA 3EBHA 3LN4B 5E4AA 1RZ7H 3APFA 4JG5A 3BD3A 2R91A 1J05B 1WKDA 4CKVX 1PGRB 1PQZB 4JQXC 5GGUB 4GRMB 5D7LA 4IICA 4S1FA 2VJ0A 2QCCA 1JGUL 4OOZA 4ZZFA 4KDWA 2A4EA 2V4LA 3RFRA 5B1JA 3QY7A 3EGXA 3UIZA 2AS5M 1A47A 5HI4C 1Z0NA 4PYGA 3OVQA 3P11H 1LWRA 3LERA 3A47A 1SJHB 3C5ZB 3OB8A 1SDAB 1E9IA 1U8MB 3OF6A 1PBYA 3BP6B 3H9YA 3RFZB 1WJ3A 4ZMAT 2EHHA 3EH1A 5EPMB 5FD0A 1K1DA 4Y16B 2C8NA 1KIRB 2VITA 5C3TA 5JA8B 1M6UA 3LH9A 1KLGB 5T33L 2X0YA 2OXGA 3QJVB 4HWBH 1VKXA 4NT6B 3GBDA 1HILB 1RI8A 4Q7NA 1P9MA 4Z95H 4MNGB 2J21A 1JZ4A 1KN2H 3Q6GL 3LN3A 2EDMA 4HBQA 5EU4A 2FL5A 1Z41A 1UJQA 2FLRT 4UFHA 2Y5SA 3PABB 5J5RA 4N1EA 5J6GB 1PTZA 2AZAA 3QTPA 3T0XA 3VK5A 2AAVA 4GW1B 4TVDA 3GQFA 2EDJA 3LNEA 4C1KA 3IJYA 3HI1B 3I9IA 1S38A 1QEWB 2UYLA 5I1HH 3FOKA 4TSBH 4L6HA 4XXWA 1T4KA 5T1DH 3MRDB 4QCIA 4IBTA 4QIRA 2PA6A 4WU7B 3KS0H 5KYNA 5C9UA 5I71B 4XUGA 3D9AL 5IBUB 1TV3A 3O6AA 2FRGP 3GDLA 3OGRA 4RFOH 2PDGA 2KLSA 2N0MA 5HDQL 3MLUL 1AS6A 1QPKA 2JKXA 4D71A 5KSBA 3FYIB 4E4PA 4RBPH 4JTCA 1JJKA 3GAYA 5I8OL 5HA7A 3S2JA 2OA9A 1G7QB 3BPNB 1P1ZA 1WBYB 1LK3H 1UQSB 3KPRA 4XN4A 4G9DA 3DX7B 2B7PA 3QG7L 2OW6A 4YE0A 3VOCA 1NWTA 1WUEA 2Y5TB 3QO0A 3BT0A 5IK3A 4FQLH 2ED9A 3K72B 3C09B 3ZVVA 1S5HB 2V37A 2Q7AA 4TNVK 3WXVL 1ZS2A 3NJ3A 4TLTA 5EULV 5MEND 4CSZA 4D9RD 5DZAA 3D51A 3LRKA 4KKCC 2PXYA 3SGKA 1JCNA 1MJ8L 2BZ7A 5KS9F 3URQA 4MLJA 4K7PL 1HVXA 4Y4KA 3ARBB 4BK4A 3RGTA 1UWGH 3ICJA 4C6FA 5FYKE 3RNKB 2NY5L 1KIQA 2E5BA 3QDGE 4HHGA 1H49A 4JPVH 1MQPA 1KYUA 1GIGH 5JQIB 5CIPH 3NMEA 1D7DA 1ONQB 1QFHA 1U3YA 3MROB 2JKEA 3Q4DA 3S1XA 3KHOA 3BPOB 1CU4H 1IAKB 3RVTD 3U0TA 5L2JA 4US5A 5E9NA 2J7DA 1D5ZA 1S7WA 2YAEA 4QY8B 2F6KA 3GSWA 4OLVH 5EBUA 3FNDA 4JTHA 3DPBA 3WTVA 3HS8A 5IJVA 3CPLA 5D1QD 3OJDA 2NXYB 2YWYA 1ICSA 4K1GA 4B53A 4TQEL 4A6YA 4L9YA 4BFNA 4P3DA 2Y8UA 3AXKA 4Z77B 2GIYA 5JHBA 5EIQA 4L3EE 5AFDA 1BZ7A 1ZJBA 3LDBC 2OX4A 1D5MA 5IQNA 3C9NA 3COOA 5A6TC 4NUMA 4JTIA 5HYJB 4NIRA 1XH2A 4H9MA 3ULUF 3DBXB 5I15L 1P5BA 4HIXH 2C1PB 3X1NA 5C09B 1V3KA 3WS6A 3Q8AA 1TEFA 5LJYH 5TE7L 3QPKA 4LPCA 5E24E 1XC4A 2NR6C 3P0YL 1DDTA 3UTZA 5B1BB 4LUTB 4FI4A 5HDBE 3G6JB 1XH3B 1GWJA 4K3GA 3HPJB 1A5OC 5AC8A 3V1PA 4LSVH 4IH3A 4ELMB 5B7EA 1GCYA 5FKPB 3N73A 4M19A 3Q5OA 2CJUL 3C6SA 3VG9C 5F9JB 1O4UA 4AUBA 4ZEPA 2IH8A 1RULL 5ETUB 1CD9B 3MI2A 4R85A 4WKZA 1PZ3A 1V7YA 1UR4A 1TR7A 2G2RA 2YO3A 1BQLH 4N2CA 3AJ7A 3FTUA 4IEFB 4DUVA 4OCMC 4BFBD 3QPQC 4PCTA 4QUOA 2D4FA 3O2VH 2IH1A 5FXCH 4EUPB 2R4SH 4XZUA 4JE4B 1T2QH 2DQMA 2PD9A 5EBGA 1TQJA 1VGKA 4HLZH 1VBUA 1W6WA 1XLJA 3KPPA 2I07B 3B1UA 4Z7NB 5LGKA 1EO5A 2ENYA 2CHOA 2IJ0C 2HVKB 2E27H 2YAFA 5CF3A 4YSCA 4AIZB 5GQBA 4KMQA 4X7SL 2VN7A 3GY1A 1HCVA 1CZ8H 1BDYA 1EWDA 3CXHJ 4I18C 2DUZA 2NQJA 5AZ2H 1YN6B 4G6FD 1LORA 4HJJH 4X98B 4AGNA 5C0GB 1K72A 5JW4N 4MVBC 1WIPA 1OSYA 2EIZA 1C12A 1FY6A 4IU2B 1BXAA 1H3GA 4AAJA 5KW9H 3R94A 3VNJA 1PL9A 1PEZA 4DOHE 2CWNA 4HKJA 1IC5L 4K73A 5D1ZB 2B0SH 2ED7A 3QUGA 1GC1C 2NUTA 4OSUL 1TTBA 4N8VB 5AW9B 2E86A 2RFXB 1HGWA 1N8OE 4CSSA 4JLRA 5IP4A 3QIWB 1AY1H 4Q4QA 1AHWC 4AV4A 4Q6IB 5T1LD 4MHHG 1F86A 3BIKA 1TV4A 1IC7L 3KPNA 1TYEB 5AW5B 4WV1C 1S9XB 2GGJA 2QLVB 3SDAA 4D2JA 4UNKA 2CSPA 4IGBB 2BFGA 4ZMTA 3FCSB 3DFOA 1M7OA 4IBLT 1G7VA 2AJ3B 1H15B 2HYMA 4IBVA 3F65A 1Y18A 4X22A 4MLIA 3NTYA 4KH2A 3OMIB 5CIPA 1QBBA 1A7NH 1A9BB 1S7QA 5EF1A 1IYXA 1CLYH 2ZPKL 4OI8A 2RCSH 4ZOBA 5F6HJ 3LIZA 3WSUA 1R3HB 4DN1A 3UG3A 1WC7B 1TENA 2H3KA 3NEVA 4YBLB 1JWSB 1UHVA 4MZ3A 4AG4H 2IDSA 3APDA 1HE8A 4L3FA 5CZKA 3QWRD 5EC1B 1NFAA 1R3IH 1BJ1H 2HE8A 4Q4OA 4KEUA 3TMQA 4JJ5A 4LEOA 3QXVA 1B31A 3NIYA 2H1PL 1Q8MA 3RZCC 1KPVB 4C90A 3OX8B 4TM9A 4YAQB 2Y7GA 2HFFA 4YHIA 1SEQL 1A9EA 2EEBA 5FECA 3MY9A 4QTGA 1IFRA 2XSXA 2O6FA 1O94A 4M62H 5I07A 2JK2A 5D55A 3N11A 3B06A 3ITVA 5LHFA 3SYPA 5GGVH 3D6GA 4HIQA 3K30A 4DJEC 3G5XA 4DJDC 3MMUA 3W1ZA 1K8ZA 3VIPA 2C91A 2HAZA 4IFOA 3K8MA 3E0VA 3FQXA 3UTSD 4Y2NA 4XV0A 4M7LT 3VUPA 4XBEL 1A14L 2VDOH 4ZPVB 2I7GA 4NN7B 2PDUA 3V5HA 1F6KA 5LNVA 3OYZA 1AO7A 3UAFA 1P1MA 1Q2RA 3B2PA 4JHBA 4LS2A 3TEWA 1UADC 3ILQC 3GYEA 2P5EB 3LKOA 2G4EA 4HHAB 2NW2A 2G4GA 1PFCA 3MCG1 2PP3A 2QJGA 5GRJL 3BD4A 3MO1B 2PKDA 3UGUA 2PZ0A 2E9GA 1MI3A 3BPWA 3L5IA 3H2NA 1JHTB 2WNKA 2ARJB 1XYZA 3GBMH 4JEQA 3TMLA 3ARGC 4EBQL 1MF2H 1IZJA 4MQ7A 5BYWA 3X1GA 5DD0L 1BEXA 5IG7A 1FA4A 2J7FA 3PG2A 1EHLH 4WI0A 3DESA 3KPSA 2R8SH 4DVRH 4Y7EA 2DKSA 4N0UE 3MSDA 4GLRI 4WDTA 1T1WB 1OLLA 1S3RA 1LP6A 2WMIB 4WWKB 3W2DL 2IXUA 1OSZA 4YPJA 2CZDA 4WHTB 4CMHC 3EO1B 3KXFA 2EINB 1BKHA 2DYSB 4GO9A 6CGTA 3LLDA 1IGJB 4IMDA 4U6XB 3QISA 2YPLD 1FE8L 4O2FA 2FEJA 8RUCA 3OKOA 3MHGA 2DRUA 1OOWA 4N6FA 3EWDA 1E5NA 5DJ0A 4LKXB 3Q13A 1R3WA 3VXOA 2HVJB 4BSVA 4YO0B 1SOXA 4OD1H 3EYFB 4ADJA 1QLFA 4BCZA 2E7LA 4PJ7F 3A6BH 3LKNA 2PWFA 3UW6A 3EUUA 1Q0XH 1MNUL 3G1DA 2HRPH 2A3AA 4BI6A 2E9LA 1S78C 2Q8BH 4AF0B 1L9SA 1BG4A 4HVXA 4HU2A 3ID7A 1LTXA 4OFIA 4LY8A 1UYWL 3IWUA 5D4IA 3N0AA 3TSMA 4F91B 1AVAA 3GTNA 4L0PB 3W7EA 3JWNH 3D0VB 2BRRH 5FFLA 2GJNA 4AGPA 4FNQA 4FS0A 3QPQD 3UVAA 3SR7A 5DK0B 2VW4A 3RVVC 4F2BA 3FRPB 4QRRD 3HBLA 1YYLH 1NBQA 5RUBA 4MBOA 2GCYA 4G7VL 2DYPA 1GW6A 1S2TA 2GJRA 3ARFA 4E42A 4I2XE 4BA8A 3LZPA 4WW2F 1V08A 3LH2L 3U9UA 2N56A 3TA4D 1IEVA 3L5AA 3N13A 2IMRA 2JELH 4X6DE 6XIAA 4XZIA 3W6LA 3K3QA 3ULVE 3UA4A 3EYUL 2BVOB 4WDWA 1KTJA 1P0KA 5DMYA 3ZO9A 2DPKA 4L1TA 2IANE 2DQJH 3ZTJH 4UOJA 5ILTH 3VNKA 1FWGC 4XPAH 5LBVA 3KUMA 1AODA 3NAVA 5BXPA 2DSVA 2I5IA 1BV8A 2ZYRA 4FK9A 4BKLA 3MJ9L 4C57C 1SVDA 3KYMA 4BCXA 3EZ4A 1A0QL 4LCWB 1OT2A 3AUVA 2PPGA 2CJ3A 3GJFH 4FA6A 1BVKA 2CBPA 1XGYL 5D7SH 1KEGL 2Z25A 4X0VA 3WNKA 3KP0A 2EXWC 2VVSA 4F3HA 5IR1B 1BAWA 3AAMA 4WTQA 1JWMB 3BO8B 2CDGA 3L2MA 3P0WA 4PBEA 1LBMA 1T5XA 3DARA 2QYGA 4DGYH 4OFQA 1VR6A 4PI2A 3EAUA 3D2UD 3G1FA 1SZNA 4F37F 4XP1H 4B9IA 4GE8A 2B1HH 2NY7L 1EKOA 5DD5L 1LXMA 1UM4H 1N9PA 1GS6X 4M8QA 2F0CA 1LP9F 4ZFCA 5INDB 4Z7WE 5E6UB 3DVGA 4ELKB 4RE2A 2GITA 2CA4A 5HHOB 4X2PA 2PDCA 2CXGA 5JXAH 6REQB 1IGCL 1X6NA 2TRHA 3WHXB 1NGPL 1MIML 4WIQA 3CDGB 1GVYA 5F1NA 4PJBF 1J2WA 3QQDA 3SKNB 3B9EA 4J3OG 4V27A 2H1LM 5HDOA 3CMFA 3REWA 5I73B 1OAUL 3QCVL 3CK0H 3F58L 1CURA 4G8FA 3EJRA 3FCPA 3H1ZA 2ZIDA 1I7RA 2DDXA 5FL1A 4PRHB 5IFTA 4Z7QE 1KB9K 3SB3A 1XDJA 3ZQ9A 3FZUC 3IMTA 2TMDA 1JN6B 3IWVA 3MCKA 4L4VA 5EB9A 2FDSA 4DJDD 2QIIA 1XF5B 3H4HA 2QAFA 1TPH1 3F85A 1XTMA 3V7AE 4FXKA 5T8GA 4YTUA 4IKIA 2JKJA 4M4RB 1ZA3A 2X3AA 1A6TA 2C5DC 1VCGA 2LHAA 3UJIL 5I1KL 2VDQL 1SJCA 1CDYA 3WKZA 2Q86A 4EN3C 1QU4A 4PS7A 1MVYA 4HUVA 2QEJA 3IFLH 5ELIA 3ONBA 2GJ6B 4KJWD 3CDFA 4AEHL 4ZW3A 4XK2A 2XH2A 3MV7E 1JZ5A 1PZBA 3TASA 4CNSA 4WI5A 1BVLB 3UGEA 3BJFA 3SDDB 3HMXL 3DCPA 2CKBH 4E9LA 2DGAA 4XUYA 4AMKH 3A9IA 1RJQA 1PYWA 1J0ZA 2NYZA 3I9AA 4LVHC 5SWSA 4PRNA 1FWCC 4YPGB 1BZ8A 4JZOB 4C6OA 1UXMA 1UWIA 1HSBA 2XKNB 2Q7NA 1RVFL 3FCBA 3F5WB 3ULVH 2IAMA 2HXAA 2AK1L 1CGSH 2QPUA 2IOMA 2UZPA 2Z6IA 2WYSA 1QW8A 1U0QA 4KK6D 1MXDA 4LUIA 2GJZA 4NNXB 4KWOA 2UWEA 3MRLB 3NQMA 3ZX1A 3AISA 4RISL 4QJ3B 4OAWA 3MKCA 5F7YC 2NVAA 4R7OA 1SBSL 1MCNA 1XRFA 1E6PA 5DS8A 5BU6A 4W87A 4K5OA 4HPYH 4OECA 4TX9A 4HFWA 3V0EA 2R9RA 4H26B 4L7ZA 3HAEB 4RWHA 2OB3A 3O9WA 5BW7A 2D03L 4MQSB 1CE1L 4BD4A 1FFPA 1LF1A 3NSXA 3TIMA 5DD6A 3GW0A 1QD0A 3RB5A 5D7IB 1DBKL 1D5IH 1BMZA 4R4BA 2ZTBA 1THFD 4XZHA 5DA0B 1XF2B 1BWKA 1WA2X 4M1CC 1EBPA 1YDPA 1HH9A 2PDJA 5E5RB 3WFCH 3MRCB 1V93A 2YXVA 4Z3FA 3KM1A 4KFPA 1UJ3C 5HD8D 5IFAL 1XYFA 3B7RL 3CZKA 1UWAA 4NQDE 4PB3A 3P0GB 4TQHA 1UGKA 3GNNA 1JHKL 3EOLA 3PNUA 3PWVB 4LLVA 2XYBA 4G6MH 3VXSA 4KOCA 2YOAA 3DDMA 3QDJA 4MAZA 5EEVA 3BDXA 4Y89A 3IDUA 1PMYA 4EVZA 4OCRL 4OUOA 2IH3A 5I78A 3VFPA 5IKCB 2ZVIA 4D8PB 5ENWB 2OFQA 4D9LL 1NLDH 5EO1A 1N18A 1PLGL 3NFSL 2EVJA 5FOBB 2VRJA 2WUBH 1DL7H 1PHQA 2RR3A 5D5MB 4HPJA 3PL6C 1CT8A 1L9PA 4GW4B 2R69A 2EDXA 2FX7L 2BVTA 1G69A 2WYHA 3CHVA 4F0KA 4YIWA 4M1BA 3LRGA 3TU6A 2YPVH 2TSBA 1AG1O 5D2NB 3Q01A 3W0WD 5I0VA 2H8PA 4XBGA 1XGUB 3PWPB 4AENA 3VXTB 5EPDA 1V4YA 4ODUB 3CAFA 3V4VB 1GGCH 4MXQC 3JVGC 4AZCA 3WN5C 3F12A 3DFQA 3W2JA 3LSOA 4QF1A 4GQ9L 1PJWA 3WY1A 4I7UA 2YC1A 4ZGYA 1VBGA 3D4ZA 3C60B 4HYRA 3F6LA 3H23A 1SM9A 2IDCA 3EO0B 3AOFA 3CH9A 4PGLA 1EDTA 1MIEH 3KNBB 2VEIA 4HJIA 4MJ4A 1Z9SA 2ODHA 3FT4A 4G8AC 1MQQA 1E4NA 3W7NA 3S37X 2EXWD 4XP4L 1ADQA 1HCFX 3B03A 5FUZH 1FOBA 1Q9LA 1ZXQA 1MFUA 5BOJA 3OKMA 4AZ7A 5IOBA 1HQ4A 4W8AA 1W15A 3ABQA 1TQBC 4OGZA 5J0BA 2GABA 3V0VA 4ZUTB 4QXUH 2OMNA 5KZDA 4MMXB 1J01A 3QDMD 2B81A 5EIVA 2OTUA 3A3YB 2QQKH 3IJSB 4XCYB 5DEGA 5CHNA 2HPIA 4JFVA 5JOFB 4CU7A 4DPRA 2E7MA 1EAPA 4E4FA 3UXKA 3VFSA 3URAA 1IAIL 4NC1C 1X7TA 2DEYX 3KYNA 1M03A 4UM9D 4M82A 5IQLA 3S2CA 4PV1C 1SM3L 1QRQA 3IDNB 4KX8A 1OCOB 4QTFA 2JJSC 4RQQA 3RU8H 3RJOA 2KZKA 1PFOA 1D6VH 3H0TA 1DLFH 2ZX5A 3BUQA 4QXWA 3EDKA 2QGHA 3ULUL 5E1QA 1J5SA 3ALGA 3WKQA 5HJBA 3IJHB 3Q06A 5CP7B 3L5WA 1A3WA 1JZ3A 1G7UA 1P4IH 5DQ9B 1EXPA 1EP1A 4ATWA 4RSYA 2YCKX 1OSPH 5FPIA 5EN2A 1XIFA 2Z7UA 1MHCA 2CIKA 4JZ5A 3W7LA 1VYRA 2WCSA 4XKYB 4W9JC 4HLZG 2GZXA 2GL5A 5H4YA 3J8F7 3FTVA 3PWNA 4L4PA 2ATPB 1UMYA 4AY8A 4UTBH 3ESPA 4NO0A 3TYCA 1I9IH 1QYGL 1OFOA 5CU5A 1GGBH 5L88H 3TN6A 2UZXA 1A3ZA 1BVNP 2E9WA 2B1AL 4RNRA 1QUNB 3Q3GA 2QDHA 1NBYA 1QNZL 4EN3D 1KGCD 2JBMA 3JVFC 4G72B 2UZYB 2BVUA 3QSKB 4XCEB 5DS1A 4B3EA 3L3JB 1LK2B 4IGSA 4JKPH 4AQ8A 4QNEA 1T7WA 2P8LA 4FQCH 2DQCL 1NWRA 1Q90A 2HN7B 2OTWB 3ITCA 1F2JA 2JQZA 3GDCA 3NPZB 5IFHH 1Z5YD 5ECJE 1OJXA 2HTLC 2PGFA 4DWSD 4PMQA 3FB5A 2ENSA 1AMKA 5D1XC 2R7EA 1FZKB 1U58B 3AZRA 1E43A 4PYHA 4WNSA 1E4WH 1Z66A 1NCHA 5AOUA 4LALA 5BV7C 4GT0A 4JHZA 1R5WB 5KITA 3BLLA 4QHLA 4QX4A 3S34L 1DVFB 1NBZB 1GYWA 1A9VA</