4WSJA

Crystal structure of a bacterial fucodiase in complex with 1-((1r,2r,3r,4r,5r,6r)-2,3,4-trihydroxy-5-methyl-7-azabicyclo[4.1.0]heptan-7-yl)ethan-1-one
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
439
structure length
439
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title In vitroandin vivocomparative and competitive activity-based protein profiling of GH29 alpha-l-fucosidases.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords Alpha-L-fucosidase
total genus 158
structure length 439
sequence length 439
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-10-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4wsjA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4wsjA01
1CBGA 1XH0A 3BLKA 4ATDA 3DX2A 4FLSA 3M07A 1UKPA 3VTRA 4JFUA 3OZPA 3WMSA 3N1AA 1MYRA 5ABEA 4U3CA 1WDQA 3MSGA 4JFTA 4F66A 1QHOA 1B3ZA 5IXEA 1MQRA 1W3HA 2ZIDA 3IAQA 2DSZA 4HOWA 2PWHA 2DEPA 3GH5A 3IGUA 4PTXA 1EA9C 2ZWYA 2J78A 1XYFA 4QLKA 1X1NA 3A47A 4UQAA 1T0OA 2O9TA 5JUVA 3M46A 4E4PA 3BCDA 1OT1A 3AZTA 1UOKA 4L4OA 4N0RA 3SUTA 3D4ZA 5A95A 1UKQA 4PRWA 3W24A 3K8LA 3WNKA 4ZE4A 1JZ8A 1L0PA 3TP4A 2F1AA 4AZ5A 4AMXA 5A69A 4WSKA 4OBSA 2OYLA 1H09A 3MO4A 1FP9A 5M17A 4H41A 5EFDA 1GCYA 2D0FA 4RE2A 5C71A 1XSKA 1UR1A 3UERA 4PMNA 4M8UA 1J0ZA 3WFLA 4H8HA 4U33A 4UFLA 1UD2A 1E1EA 2OSYA 3AI0A 5I5RA 2AOSA 4KRUA 2WMIA 2WZEA 4UFMA 1EO7A 1K9FA 2YBTA 1B9ZA 1CXHA 3RO8A 3OLIA 1FH9A 3OIHA 4JL2A 4D6HA 4D6GA 4WJXA 3MUIA 1W1YA 3SEPA 1BHGA 3CC1A 4GIAA 4MNKA 4CU7A 1XV8A 1HL8A 3GTNA 1ODZA 1VAHA 1J10A 1GHSA 3HZ3A 1JIBA 4NF7A 3BLPX 4AD5A 3VGFA 5A6AA 2XSAA 1TE1A 4TTUA 3T2PA 1Q6DA 3PZGA 1JYXA 1KXVA 4CGTA 1CGTA 5D9MA 1XHGA 1ODUA 4U5IA 1CPUA 4TOQA 1HKMA 1HKIA 1QBAA 5E0CA 3THCA 4CUCA 3K8MA 1LG2A 2WANA 2XVGA 2E9MA 2WYSA 3D50A 1E55A 1CXFA 3WH7A 3WEZA 3VX0A 5A6MA 3BAKA 3CLWA 1J9YA 3PZQA 2IUZA 4AD2A 3QOMA 3WMBA 1UWTA 1WB0A 1F4HA 3EDJA 5BXSA 3GH7A 2WCGA 1MVYA 4U2YA 3AFBA 1HJVA 3ARYA 4AZ7A 4AISA 1JD9A 4D6IA 4U3AA 5I78A 1EO5A 4BF7A 5FIPA 3B9DA 1R85A 2J7GA 1EH9A 3A24A 1JL8A 4UZSA 1FA2A 4F9JA 3WF3A 4PMXA 4XZBA 3BAYA 3WF4A 3D3AA 1Q6EA 5DT5A 4ACYA 4P8XA 2J7FA 2E40A 1QOXA 2BHZA 3HG5A 2V3FA 2ZXBA 4J27A 3DX4A 4PCSA 2J62A 4J3TA 3TONA 1JAKA 4QDMA 3AICA 4W5UA 4AIEA 2DH2A 4JCMA 3BUDA 2XN1A 1RD6A 1EGZA 3VNZA 2WWDA 5ABFB 1CLVA 1JDCA 3UR7A 2BY0A 2PWGA 1ITCA 1PX4A 4JKLA 4TVDA 8A3HA 6TAAA 1GQKA 4WK9A 4FNUA 1VEPA 4MNMA 1CXLA 4MNLA 1OD8A 4P7NA 3PZNA 4D6EA 4UCFA 4ZENA 1ECEA 1W2VA 2WMJA 4W86A 4JKMA 1VFUA 2Q8XA 4AIOA 3GXDA 3BVVA 1OIMA 4B9ZA 5E6YA 3APGA 2WAGA 4UOZA 2WVUA 1QHZA 3WNNA 2FHCA 2VRJA 3OGSA 1OBAA 4MAZA 4MB3A 1B0IA 3RJYA 5IFTA 3VDAA 1UWQA 3DHPA 3VIHA 4J3SA 3CZKA 4D6JA 4NX0A 2ZXAA 1FP8A 3IAPA 5HBFA 4H04A 3W37A 5CSUA 1SFSA 1I75A 4GZJA 4CVUA 1XCXA 9CGTA 1LWHA 2YL5A 1ISZA 3AJ7A 3O9NA 2FYVA 2GJRA 4ACZB 4U31A 3UG3A 4YN5A 2W91A 5BRQA 5AC5A 3H53A 1E6SM 2O9OA 4W89A 3VIIA 2FGLA 3MKKA 3WD2A 5GNZA 2FHFA 1UR9A 2EPKX 2VX5A 2XN2A 2ZUMA 1UKSA 3AZSA 3DYPA 1WAWA 4D1IA 4E2OA 1P6WA 1B3YA 2WXDM 3KL5A 1HKKA 2WPGA 1V6WA 2D73A 1UR4A 1CLXA 2BY1A 4AW7A 1BPLB 1ISWA 2YFNA 1BQCA 5E70A 3GZAA 2D1ZA 4CVWA 3SUSA 5I77A 3O6AA 1PIGA 4JHOA 3DYMA 4ZE5A 1HXKA 1HVQA 4GO8A 4H8VA 1E5NA 3ARUA 1IV8A 5KEZA 3VD5A 4D72A 4H8UA 7A3HA 3O2LA 3AHXA 4U5KA 1CXIA 3AS3A 1QPKA 3SUUA 4ATWA 2QF8A 1RH9A 2WHJA 1CGXA 1B3WA 2X0YA 3EMQA 3BMVA 3SUVA 5A3HA 4YPJA 4GPNA 1G01A 4EK7A 1J0JA 2YFOA 1CTNA 1ZB5A 3W4RA 1V02A 1XD1A 2ESCA 4NRSA 2Y8KA 3WH9A 3NUKA 3W29A 3AIRA 3WNOA 2EQDA 3GNOA 3MU7A 4HTYA 3CHCA 3UG5A 1NWSA 2F7QA 2DT3A 4S3KA 3MUY1 5CZKA 3VKKA 2GJPA 4HU0A 3VGDA 2PB1A 3RDKA 3L4UA 1OSEA 4LYPA 1KR1A 2CKSA 1XRVA 1W3LA 1M7XA 4CD5A 2WC4A 2XHYA 2E9BA 3I3EA 1DTUA 3WY4A 4J3XA 3HN3A 1GOKA 5FL0A 3WSUA 3LPFA 4RL3A 3L2LA 2GDUA 2WKLA 3TTYA 3WBAA 4M81A 3LPGA 1BLIA 1LG1A 3K46A 1GW1A 1VEMA 5BCAA 1EDQA 2DDXA 3ARVA 1OINA 4PMVA 2WHLA 1W9BM 3PHAA 3ARSA 1UWIA 1UG6A 5FOOA 1JZ3A 5LA0A 2XSBA 2XM1A 3ECQA 2VRQA 3SCWA 3ARZA 3K1DA 3ZSSA 1JXJA 3CUHA 2V38A 1H4PA 3QHOA 4MAVA 3SCNA 3UR8A 3A22A 5LA1A 4AZHA 1L8NA 3IANA 4ATLA 1HL9A 2VCBA 2XFYA 4BZYA 2PC8A 3WDIA 3GBEA 2D2OA 3GH4A 3CHDA 2XFRA 3CZNA 3VSTA 1V02E 2G4FA 1B90A 1JXKA 3GNRA 1IZJA 2IGTA 3AXXA 3BCFA 2X2YA 3BAJA 1BYAA 6CGTA 4C7GA 2DSVA 4MJ2A 1JYNA 2ALWA 1E56A 3GXIA 1TA3B 4Q22A 3VIOA 4IPNB 3VIGA 1QX1A 3S6TA 1GJWA 4AMWA 1ZJAA 3EJUA 4PMZA 1E6PA 4FLQA 3WUFA 4Y7EA 5I23A 2WBGA 2Y2WA 2X0HA 3DECA 3D4YA 2IXVA 4IPLA 1J01A 5CGMA 1R87A 4KMQA 5DO8A 2GK1A 5BXRA 2UWFA 1GHRA 1W9VA 1M04A 4D1JA 5AC4A 4XB3A 5ECUA 4WKHA 3VIPA 3VSVA 1SZNA 3VD9A 2J7BA 3AYSA 1ISVA 2QV4A 3HG3A 4PMYA 5C70A 1KTBA 2ZX5A 3L4WA 1XC6A 2ZUWA 3N9KA 4P8UA 3TA9A 2JIEA 3LXCA 1VENA 1WZKA 1HJSA 5CLTA 2ZUUA 3F5JA 2YA2A 2WLYA 2WVTA 3ARWA 1VFMA 3BVUA 2VTFA 3U5YA 1UZ1A 3CZEA 4KRTA 4FF5A 2XVLA 1E6RA 2F18A 3OZOA 4CD8A 1PZ2A 2VCAA 1TQVA 2A3HA 2A3EA 1CXEA 1PZ3A 2RGMA 4JCLA 3WH8A 5JBDA 1HN1A 3T2OA 3ZOAA 4MB1A 2HVMA 1WCGA 1XH2A 3NDYA 3ZR5A 1UR8A 2GDVA 1MW1A 4W7WA 3ARPA 3WNLA 3SCTA 3KL3A 3L2MA 2J47A 1KCLA 1V3HA 1VBUA 4C7FA 1B2YA 1HP4A 4W93A 1HWWA 1C92A 3AQUA 5LYRA 2YDRA 4JZ5A 3N13A 1DWFM 4AD0A 1EXPA 1CECA 1MQPA 4CD6A 3PBGA 4W88A 4TVCA 2BFGA 4Z2JA 2WHKA 4PSPA 4V27A 2FGZA 4QCEA 4FNPA 2OYMA 2PI6A 2XPKA 2DGAA 5D9OA 3ALGA 3VD3A 4KH2A 2W62A 2QMJA 2YL8A 4KWUA 4DWSD 2DSUA 4DO4A 5ABGA 1PS3A 3CZLA 3CHEA 5CPTA 4U2ZA 2XGIA 1PX8A 1E6ZA 1JI1A 3W82A 1AVAA 4DM1A 4PCTA 3G6MA 1UD8A 4QLJA 3VIFA 2ZICA 4P7LA 2A3AA 1KGWA 2OSXA 3WD3A 5D4YA 2VCCA 3VMNA 4XX6A 3NSXA 2WVSA 3GXMA 3AXHA 4MDOA 2MANA 1LL6A 3NSNA 3EDFA 2XFFA 1KWGA 1E70M 1A3HA 2F1BA 4DO6A 2JE8A 2Y8VA 1QNQA 2ZX6A 2E3ZA 2A3CA 1UD6A 3VNYA 4YHEA 5AYIA 4UQEA 1FHDA 5ABFA 2EEXA 1E0XA 3CH9A 3N17A 4OGZA 1C7TA 1UQZA 1LQ0A 2XTKA 3N12A 5A8QA 1SYTA 4P7OA 2BHUA 1ZS2A 3W6LA 4LPCA 3WY2A 4TX8A 4HMDA 1PX3A 3BUQA 4AWEA 1E5JA 5CQ1A 2EADA 2CBVA 4QLLA 3PZTA 1GZJA 3CIVA 2EABA 4RE3A 1E0VA 1VBRA 5I24A 2WMGA 1UUQA 3ZJ6A 2WMKA 1JAEA 5BXPA 4JAWA 4MNJA 1R7OA 1X6NA 4W85A 1E0WA 1CIUA 2QHAA 1R34A 1XYZA 4DUVA 3MUAA 2E4TA 1E6QM 3WUBA 4BS0A 3UG4A 3CGTA 1BGGA 5A6BA 2VRKA 3NCOA 3AMLA 1XGZA 2PWEA 1C3FA 1UA3A 1OCQA 3GXPA 1D2KA 4QFUA 3U57A 4GI8A 1GORA 4W8LA 3N18A 2J7DA 3SUWA 4D71A 1GVIA 3A4XA 3GDBA 4LYQA 1G9HA 3SCPA 1TQUA 1R33A 1B1YA 4J3UA 2Y5EA 1ZJBA 3T2QA 3GM8A 4AZCB 1KGXA 1GOWA 1JF6A 2VNCA 5E0FA 1G94A 5IDIA 4D6CA 2WKGA 5GNXA 1M01A 4R27A 3AOFA 4BQ3A 1OGSA 5A8MA 2E0PA 3LMYA 5BROA 5HXMA 3WQVA 3BAIA 2VX4A 2UY5A 4HA1A 5A2AA 4CU6A 1BVZA 1FFRA 2V5CA 2VX6A 4MADA 4ZEPA 2PF0A 1QI0A 1R86A 3FN9A 3RIKA 4KGLA 1W9DM 1TFVA 1C93A 1WNOA 5C8BB 5FL1A 4CD7A 3WF0A 1JYVA 2DIJA 1PJ9A 4AZCA 4PYSA 2J77A 3VSUA 1V0MA 1H1NA 2D24A 3UETA 5EB8A 1KXQA 3SCUA 1LWJA 3LX9A 1CENA 1E73M 1JF5A 2J74A 1V03A 3T0BA 4CU8A 1N82A 1EDTA 2VZOA 4JFVA 2WVVB 1QWNA 1TVNA 5E1QA 5CPQA 1W9UA 1HX0A 1UH3A 1C8XA 1UWRA 1WDPA 2NT1A 2G41A 2W63A 1JZ6A 2BY2A 5DFAA 4A3YA 2BXZA 4GXPA 4UFKA 1U33A 1KTCA 3DDGA 1NOUA 3LXBA 4MPKA 2GJXA 5D9PA 2VMFA 4IM4A 5JBFA 2EXOA 2WC3A 3AMDA 4LQ1A 5A8OA 4AZBA 4UZUA 2BVDA 3I3BA 2D22A 2VZTA 1NWRA 3IJ7A 1FFQA 5A1AA 1TMQA 3CPUA 2XVKA 2OWXA 3KLKA 4UQBA 3PTKA 1SR0A 4Q7NA 3VMPA 2WZHA 3FAWA 1ZL1A 3THDA 2ZX7A 2DH3A 3WF2A 1MFVA 1LJYA 2JF7A 4P8VA 3MV11 1GONA 4EAMA 5FD0A 3VDBA 3SIMA 2ZWZA 1Q4NX 2BXYA 4GQRA 3W28A 3AIVA 4F79A 3UESA 3WUGA 3EJQA 2WNWA 1EQPA 4UR9A 5I79A 4H2CA 2QMKA 1BVNP 3AHVA 1IT0A 2PBOA 4P7QA 1CWYA 1UYQA 1HJXA 3WKZA 2G3NA 2XJ7A 3KL0A 1CGUA 3CBWA 2F7PA 3VILA 4P8WA 2W61A 5A8NA 1EQCA 4FNSA 4GINA 7CGTA 4NZJA 1HVXA 1QW8A 2CKRA 4LXFA 1HNYA 1ZBWA 2OW7A 4UTFA 1MXGA 4J3WA 1Q6CA 3BGAA 1JNEA 4HU8A 1ISXA 3GXTA 1J0YA 1V3KA 2CITA 3M6DA 4XZWA 3VUPA 1UKOA 4JIEA 1BG4A 2YOCA 4OOZA 2WC7A 1UD5A 1AMYA 1K9TA 3AMCA 4B15A 4Z2KA 1TUXA 1ITXA 3VIKA 5A6JA 3B8SA 1PPIA 2CIPA 2XG9A 3CZ8A 2WW5A 4BCEA 3GXNA 3LRKA 3AS0A 1UKTA 2VX7A 1JZ2A 1ISYA 4HPGA 1O7AA 1JDDA 3HU7A 3FW6A 5M3WA 2F61A 4HPHA 3BSGA 1OGGA 4HZ6A 2ZUSA 4A4AA 2VZSA 2YA0A 3WEOA 4CCDA 3BC9A 3G6LA 4OOUA 5CJ5A 1TA3A 1OWQA 5CG0A 4PUEA 3LRLA 3N11A 4DUWA 5D9NA 1OD0A 1M53A 4UQDA 1R8LA 2C8NA 1F4AA 5AYBA 4GI9A 2YL6A 3KLLA 2GFTA 2YIHA 4CN1A 1KQZA 3VPLA 2FE0A 1ZBVA 5JIWA 2JFEX 1V6VA 4AIUA 2XN0A 4AXNA 3RM9A 3BUIA 4DWSA 2ZX8A 4Z2HA 3A6OA 1K9DA 1NM9A 1WKYA 3F5KA 4GZIA 1BF2A 2XGBA 4HOZA 3DC0A 4FNQA 1KBBA 2O9RA 1UZ4A 1X6LA 2EBNA 3ZO9A 4FMVA 4L4PA 2EPMX 1NARA 3PTMA 3NSMA 2G3JA 3AS2A 3AHYA 1V0LA 2OWCA 2WSPA 4M56A 3K4AA 4MDPA 1DEDA 3A4WA 5E09A 3VIMA 1BAGA 1ZU8A 3KZSA 2C0HA 3NYDA 3DX0A 1KCKA 4M1RA 3BAXA 5FCZA 1GQIA 2CPUA 1NP2A 4PSRA 5A2BA 4YHGA 1CNVA 1EOMA 1WZMA 3RILA 1GQLA 1V3JA 1I1WA 4GQQA 4M82A 1VFFA 2X1IA 1C8QA 4Z2GA 1BFNA 1V6YA 1R47A 3AIWA 3RCNA 2Y4SA 5BXTA 3VIJA 1WZLA 3VMOA 1W3JA 2J79A 2YDSA 3AXIA 3ZSTA 1H5VA 1GNXA 2PBGA 3FNDA 2DPEA 1Z32X 3DDFA 3VINA 1H3GA 4JHZA 3CUJA 3SCRA 2DQXA 3WENA 2OLHA 1HKJA 1BYDA 1C90A 1V6XA 5E9AA 4HMEA 3CMJA 5GPRA 4PN2A 2YJQA 2WLZA 4OJYA 2E8YA 1JDAA 4X9YA 2VVNA 4BQ5A 2JF6A 2J7EA 3EMZA 1J11A 3WELA 1VRXA 1B31A 1HF6A 3ZT6A 2EACA 4DWSC 2Y24A 5HDRA 1UWUA 3VGGA 3WMCA 1JFXA 1O6IA 2CEQA 2VQTA 4QP0A 1NH6A 4AD1A 2DT2A 2VURA 3WFZA 4PTWA 3B9EA 1UH4A 1GOMA 4F8XA 3TTQA 2BHYA 3KE0A 3CZJA 3VM5A 4C7DA 3GBDA 4HA4A 2J25A 1E15A 1J0HA 1E6NA 1GVYA 1QW9A 4OUEA 5BWFA 1MWOA 4EANA 1HP5A 1E4LA 1VF8A 3N15A 4N42A 3WQ4A 1TVPA 3ZJ8A 1KXHA 1JI2A 1D3CA 1WZAA 5EBAA 2X05A 1DWJM 2X2IA 2CXGA 2Z1SA 5A6LA 5A2CA 4OBRA 3RJXA 1W1TA 1E1FA 4UFJA 1WPCA 2G3IA 1MQQA 1QI2A 3U5UA 3GNPA 1TQWA 3IJ9A 3L4ZA 2UY2A 5HPOA 3T0DA 3IK2A 1W2PA 2EJ1A 3I3DA 4AD3A 1FHLA 2XWDA 3ZQ9A 2X2JA 4BQ2A 4XV0A 5DEZA 3F4VA 4NRRA 2WVVA 4HZ8A 1E4IA 1KXTA 1RP8A 1DP0A 3MANA 1WDSA 3VDCA 1B3XA 4W84A 4RE4A 1GOIA 1A47A 3POCA 3LPPA 3TTSA 4JL1A 2FH8A 3SURA 4AYSA 3WD4A 1H41A 4R5EA 3WH5A 2VZVA 2EAEA 3SCVA 3S2CA 3WD1A 2W5FA 1QWUA 1YHTA 3WNMA 2J8GA 3W6MA 3BSHA 1TZ7A 1QI4A 2B31A 4TUFA 3OGVA 2J8FA 3QHMA 3UCQA 1CDGA 2X09A 4AY1A 1UD4A 4MB4A 2TAAA 2WSKA 1TQSA 1UWSA 3AIEA 1CGVA 2W92A 1AQMA 1VIWA 1LF1A 2V5DA 4S3JA 2AMGA 3K8KA 3ZIZA 3WN6A 4ZFMA 4WKAA 2V3GA 1WP6A 3ZT7A 3VVGA 3HG4A 3WDRA 1W32A 4J7RA 3VDHA 4GO9A 2CCRA 4BA0A 1DHKA 1KQYA 3W53A 3WNPA 2JIWA 3OB8A 2BS9A 1D7FA 3M7SA 5M03A 3CV5A 3L4XA 3W38A 1E3XA 1NOFA 1CGWA 4W7VA 3ZR6A 2FH6A 1QVBA 1JZ5A 3FAXA 2NSXA 1UASA 4ZXLA 3H54A 4F9DA 2VOTA 3L4VA 4BQ4A 4CD4A 5I6SA 4QAWA 2W4XA 5HOSA 3TV8A 4TVUA 1CYGA 2Z1KA 3POHA 3BUBA 1UH2A 3ZJ7A 4UNIA 1HIZA 1G1YA 3IJ8A 4URIA 2VR5A 3WY3A 4UOQA 3ZM8A 1DWHM 3EJPA 2QPSA 3QOKA 2YA1A 3BUPA 1DWGM 2XYLA 3AIBA 1TG7A 3D52A 4IISA 3WQ5A 3DX1A 2CESA 1C91A 3U7VA 3QR3A 1QNSA 2WWCA 2XM2A 3WDJA 1R75A 1H11A 2E9LA 2XVNA 4PMUA 3WL0A 3II1A 4GI6A 4E8CA 1OIFA 1R46A 2CHOA 1NWUA 4B9YA 3WL1A 5TD4A 1E40A 4ACZA 3PZIA 5IFPA 3D51A 3AS1A 4M80A 4A3HA 4UFIA 1KR0A 4AYGA 5BYWA 1VFOA 2WHMA 3RM4A 3NJ3A 4Z2LA 1LL4A 1J0KA 5A8PA 3SCOA 3CHFA 3N04A 4FK9A 3WQ6A 1E71M 1US2A 3ZMRA 3ARRA 4W5ZA 2XWEA 3AISA 3JUGA 2FHBA 3WQWA 2CBIA 2DT0A 4MB5A 5CPSA 2VL4A 1H0IA 2JEPA 1IZKA 4W8AA 3EDDA 3BVTA 1WO2A 2E8ZA 3W81A 3WUEA 3AMKA 3A23A 4CCCA 3FXYA 5IHSA 1CZ1A 1J0IA 5BRPA 3L4TA 2ZXQA 5I2UA 1JZ4A 2QPUA 3EJTA 3KEHA 4PTVA 1OGBA 3W25A 1HTYA 5DMYA 4PTMA 2VVSA 1E3ZA 2OWWA 3EMCA 1JYWA 4MTVA 3A4AA 4NI3A 1MW2A 4WLCA 5KZ6A 3FHAA 3PZOA 3LXAA 1HJQA 5GNYA 3SCSA 2G8ZA 4GZEA 2NW0A 8CGTA 3OLGA 3PZUA 3OBAA 4CCEA 1XCWA 2D23A 3A5VA 1R7AA 1S46A 4EE9A 1SMDA 1Q6GA 3K4DA 1VJSA 1GOQA 2WMFA 2A3BA 3BXWA 5F7UA 4B3KA 1XSJA 5A6BD 4HMCA 1HT6A 1O7DC 3WDQA 1CGYA 1GOOA 3FHQA 2GVYA 3NDZA 3CZSA 1FH8A 2O9PA 2WM0A 1NQ6A 1KB3A 1HJUA 4AZGA 1QI3A 3E1F1 4OZOA 3EYPA 2WMHA 2WK2A 4UOJA 2X8RA 2VO5A 1UD3A 2J75A 4WIWA 4WSJA 1XH1A 4CN4A 1BYBA 1V6UA 1KWKA 4J3VA 4NSBA 1QNOA 3OLDA 3CUIA 2BVTA 2D20A 4B16A 1BYCA 3RM8A 2YDQA 2CBUA 1QBBA 3T0AA 2G3MA 3MS8A 3WBEA 2V3EA 1VB9A 1PBGA 3EDEA 2PWFA 4MJ4A 4FLRA 1W9PA 5I3DA 3PZ9A 2VZUA 3L4YA 2OSWA 3KWXA 3EJRA 2IXUA 3BAWA 3SCQA 4CN6A 2F7RA 1WDRA 5CXPA 4HZ7A 3BH4A 5IHRA 3W26A 1V0NA 3HMCA 3EDKA 2GJXB 1FH7A 3VD7A 1OB0A 2WCSA 3VU2A 4FNRA 4KGJA 1H49A 1V08A 3WQ8A 1UHVA 5EMYA 3TOPA 4NZFA 2YL9A 1W3KA 1YQ2A 3WH6A 5A6SA 3WD0A 4X0NA 4EKJA 2EPLX 2C7FA 1ZBKA 3MI6A 3BLBA 2RGLA 1E43A 1RPKA 3CUFA 2YLLA 3AIQA 3ARTA 1K9EA 4LYRA 1Q6FA 1U30A 3AZRA 1E72M 1MFUA 4HOXA 1TR1A 3H55A 3S5ZA 1LL7A 2VQUA 1W91A 5LA2A 5CSYA 2CETA 1K6AA 1PEZA 3QGVA 2CYGA 3MUZ1 1JD7A 3VGEA 2J7CA 3AMGA 4PMQA 2ZE0A 1PIFA 4DO5A 3ALFA 3PTQA 2F7OA 4WF7A 4K68A 4ML4A 4AMCA 2X2HA 3MMDA 1EHAA 1G5AA 4TTGA 5D8ZA 3DYOA 2D3NA 1I1XA 2CHNA 3AROA 1ZBCA 1GJUA 3VGHA 4JFWA 4JFSA 2VI0A 4D6DA 4WKFA 1NP0A 1KGUA 5E6ZA 2J4GA 3OG2A 2UY3A 5CLWA 2CBJA 4AC1X 5A6KA 1B3VA 2GSJA 2BNJA 5HNNA 1B30A 2JEQA 5JBEA 3VX1A 2ZUVA 3PN8A 3GYCA 2EO7A 3CZGA 4M29A 4PEEA 2XVPA 2DSWA 3AYRA 3OLEA 7TAAA 1EOKA 2J7HA 3VM7A 4FNTA 1OM0A 1XSIA 1PAMA 2DIEA 4FLOA 2ZOXA 5ABHA 1CXKA 4JKKA 1HXJA 3CMGA 1J18A 1ESWA 1AQHA 1MW0A 4UFHA 3VOCA 4GKLA 3ARXA 1V3LA 2V3DA 1C7SA 1TQTA 2PWDA 1BGAA 1E4MM 5M5DA 3VO0A 1JG9A 3S5YA 2OYKA 3AHZA 2D0GA 4AEEA 3WIJA 4P7RA 1FOBA 4NZCA 3WF1A 4TX6A 1NOWA 4ZXOA 4AZIA 3FY1A 4M24A 3EJSA 3VGBA 3U7BA 4CKQA 1G0CA 3DX3A 2UY4A 3CO4A 1E4NA 2QLYA 3DHUA 1RP9A 2O92A 3W27A 2WMIB 2BY3A 2JALA 4V28A 3CUGA 4DM2A 5DF0A 4X0VA 1W1VA 2F8QA 2ZX9A 1V3IA 5EFFA 3OGRA 2W66A 3T08A 2EPNA 3EBVA 3ZJKA 4Z2IA 2GK1B 3NIYA 3ZT5A 2YLAA 3WY1A 3MV01 3MMWA 3RMEA 3RPMA 1SMAA 3BVXA 5FKYA 3BMWA 1UR0A 3GXFA 3VD4A 3T09A 2WCAA 2NT0A 2DSKA 3UEQA 3D5HA 2D0HA 3TTOA 5A94A 3J7HA 1US3A 1JFHA 5HPCA 4HP5A 3AHTA 2F2HA 2YBUA 3AIUA 3F5LA 4NXSA 2VC9A 4UQCA 1HJWA 2YKKA 1JNDA 2CERA 5JIPA 4TXEA 1GQJA 5I0DA 1H0GA 1U2YA 4H7VA 5CGTA 1KBKA 1AQ0A 5DT7A 1QHPA 1V3MA 4J28A 1J12A 1QNRA 4D6FA 3HJEA 1BSIA 2AAAA 4E8DA 2CNCA 3LRMA 1EHNA 2XIIA 2VT0A 1XD0A 1UQYA 1BG9A 4PBGA 1OT2A 4AEFA 3A21A 1MXDA 3ARQA 4PUDA 1KFWA 1GPFA 1BTCA 4PMRA 1V0KA 4HA3A 3WDPP 4LX4A 3W0KA 1Y7VA 2WB5A 3HG2A 1E9LA 1JGIA 2ZXDA 2ZUTA 4OKDA 4UQ9A 3BVWA 5D8WA 3LPOA 2VUYA 4IUGA 3PZMA 4DWSB 1CEOA 1W1PA 1W9XA 2BV9A 1EDGA 1EIBA 4B3LA 4OIFA 1C8YA 3QHNA 2GUYA 1MW3A 2DT1A 4W8BA 2XUCA 1JZ7A 2FDMA 4XUYA 4LGXA 1H2JA 1DWAM 2HISA 4AD4A 3MSDA 2WZIA 4DUXA 1WE5A 1VEOA 2EPOA 2W67A 1UA7A 1VJZA 1LLOA 1UR2A 1QI5A 5GQBA 4PMOA 6A3HA 3A3HA 2XIBA 4W87A 3PZVA 1M03A 1DWIM 3WEMA 3OA5A 2VJXA 3MMUA 4V2XA 1E6XM 2ZUNA 4W7UA 1QNPA 2D3LA 3CTTA 4PMDA 2VR4A 1TCMA 2WBKA 4NXKA 2BVYA 2OW6A 3B9AA 5AY7A 4QCFA 3WDHA 1GUVA 4AZ6A 1NWTA
chains in the Genus database with same CATH superfamily
4L8CA 5JHLA 2KPWA 5E93A 2V2TB 1XH0A 4JW3A 2AHIA 2AGJL 4KO5A 3BLKA 3CAFA 4DBWA 4FLSA 5CO1A 1J05B 1BWVA 3QYSA 3DSNA 4JFUA 3IGAA 3WIAA 2CHWA 3OZPA 3FKKA 3V1HA 2ENQA 4FMKA 3N1AA 1DL7L 1Q9KB 3KGSA 5EUOE 3TVMA 3RMJA 4TLTA 2JWYA 1MYRA 3BG5A 4U3CA 1WDQA 4ELKB 1PQZB 1GGBL 2NQZA 1XR8A 4F66A 1AO7E 2F74B 2BM3A 5D1XC 5IXEA 1MQRA 4LARL 1OFOA 1ZT4A 4I3GA 4QRRE 2WJZA 3WS3A 1XBRA 3PFQA 2PU1A 2GVGA 1KN2H 3D2UB 4RJEA 3DG7A 2ED6A 4B5NA 4ENED 1HW6A 5J7CC 4UWQB 5HJ3B 4OTKA 1Q6QA 3T8LA 4EI5C 1T0OA 3KAAA 1Q5MA 3W2KA 2DW6A 2RJGA 3MLXL 1A6ZA 2CBOA 4MPQA 1M3IA 1Y5WA 4DRSA 4LLUB 1BZ9A 1ROCA 4RGMB 2A5UA 4JBSA 3D4ZA 4LNRA 1GL4B 3EYVA 2BRRH 4IL2A 3TR9A 1SBSL 3GSNB 1HE8A 3WNKA 3B7SA 5IHHA 4OLWH 5CSZA 3PWUB 1V27A 2H0EA 4XPAL 1EF3A 2BNRA 2ORBH 2HXUA 4AMXA 3LBMA 5JQ6L 5FJOA 4AEIH 3O2DH 4LL9A 5C0ND 2H1XA 2H5UA 2YD4A 3DHFA 3Q8BA 4JDTL 5C8JA 4PJ5E 1CI1A 3JBG7 2GGJA 4J5VA 2X7WA 3QN3A 1U8KB 2OYLA 1S5HB 5JMRA 3FT1A 5AW9B 4QRRD 1FP9A 2QR6A 4RKAA 4F4RA 3HVNA 3TJHC 5CR1A 4IOSD 5M17A 1QEXA 4N20A 4OF6A 3CBRA 1XIWD 3UYRH 3CT2A 1SJMA 4FXGC 4LLQB 5C07B 4I9WD 2D0FA 5EFDA 2A1YA 2ZXEB 4BI5A 1DANU 3C87A 3UAEA 3FFDB 4P57B 2OFJA 2J43A 4AZUA 3GRGA 4PODA 1FFPB 4H9YA 1GVOA 1JF1A 1UR1A 4AX7A 4NO2A 3IKCA 3HNSL 2CO6A 3P40A 4M8UA 2DZUA 1DQUA 2ZCLH 5AG9A 4U33A 3V18A 2EDEA 4D9QD 4XPGH 1UXLA 1ICTA 4IBTA 4HVBA 3O6MH 3AI0A 3E12A 5ITFA 3GIZL 3M7WA 2DDQL 3DMMD 4AJWA 1KTJA 3MRNB 4QJ4B 4BE5A 3UJRA 5LNWA 1PWMA 3B37A 4XNBA 1BM3L 4PHZA 5F3BA 2D03H 3WLWC 4OLYL 3IXAA 1CCZA 3ZL4L 2NR6D 2BXVA 1QFOA 2R69A 1MPAL 4XUGA 1LDPL 4G8FB 3IJYA 1SPQA 3ULUC 3OLIA 4TUJA 1FH9A 3OIHA 3QRHA 4JL2A 4LPTA 2QCNA 4UWMA 4AJYV 1AODA 4P2YA 5D1XD 4R5TA 1XC4A 3KDMA 1W1YA 1S2CA 3MOBH 4TVPL 1N0LA 3EH2A 1WUEA 4WUUA 4EIUA 2WQUA 3WG6A 2WZPD 3VFOA 4YSSA 3HMWH 4TKWA 4LOCA 5K33A 1A0DA 1U8IB 4YHMH 3V95A 4MNKA 1B57A 2PDNA 5F3FA 4X50A 4CC0A 3W7DA 4OGYL 1GHSA 4ADSA 4FERA 3KVDD 3VKBA 1AKJD 3DKHA 3NL6A 1ZZMA 2EE3A 2XSAA 5JDJA 4AM0B 4MJMA 4X5WB 2BSLA 1YAIA 4RUBA 4RLIA 5AC5A 4ADTA 5I6KA 4CGTA 5D9MA 5DCCA 1HHGB 2N59A 1CPUA 2DLFH 4PGCB 4WZ9A 1FIGH 3M0YA 4YBLB 3BZFB 4ZBCA 2JKNA 4N2LA 1UYWL 2VSKB 4CUCA 1JJKA 2VGIA 5E0CA 4V1DA 2OLDA 4HUXA 1GMIA 3HE7C 4H20L 2AJSL 2VEFA 2WNZA 2XVGA 1G1KA 2JV6A 3TMLA 4KO6A 3WJWA 3G7TA 4N3UA 2E9MA 3OKKB 4HUWA 3QZWA 1RUAH 2EIJB 4DKAA 1VH7A 1BXNA 5A2IH 3KXFE 2ZC8A 1HNFA 3VFWB 3ZHDA 3GU2A 1KBWA 3E9TA 1V7MH 2R1WA 5GGTL 1HIML 5A6MA 4LUSA 3PUOA 4LCIL 2PO6A 4PG2C 3IDMA 3TIDB 3V0TA 5LGJB 4AD2A 1GYCA 3QO1B 2FJHA 1ITUA 5IB3B 2QGBA 4XBGB 3WMBA 1INDH 2JCWA 1WB0A 3P0XA 4IFKB 2MJWA 4YO0B 3EDJA 2YD2A 1BOGB 3U4BL 5I19L 2P88A 5BMWA 2N0MA 3W3OA 3MI2A 2R7EB 1INQA 4DGYH 3GH7A 2WCGA 2XZAL 5H37H 1MVYA 5E6ID 4AK1A 2XZ9A 4U2YA 3SODB 4M5SA 1ZGLB 1PCXA 3LHAA 4ELMA 4MD0A 4XMVA 3UWQA 4UT6A 5I78A 1EO5A 5EU6E 3G2GA 5EPMA 3MCKB 3WTVA 4O28A 2YO3A 3V7MA 2AQVA 1BD2D 4JN1L 3PJXA 2ROYA 4KK9C 4L3CB 1LJYA 2P7TA 1JL8A 4UZSA 2PCFA 1R9XA 3E1ZA 3N4AA 4ZFFB 3B1UA 3WF3A 1OF2B 3BAYA 3DI2B 4G43B 4TVPH 5MEOB 2FZMA 3X14B 3F64A 1Q6EA 3L2IA 4LAMA 1FO0A 2XH4A 5JXEA 3X11B 3KYNB 1I8AA 1SJCA 3RWHA 2J7FA 4P8XA 4KK6D 3M1OA 2E40A 4KWSA 1QOXA 2BHZA 2YQGA 4DKEH 3K74B 4ADIA 2E67A 3S9ZA 4Y2LA 1CD0A 2OMZB 2X1TA 3HG5A 3U1QA 3OC8A 1ETZA 1N64H 1N59A 4IOFC 3DBNA 2UWEF 3BJLA 3DX4A 3JWNG 3LQAH 4PCSA 3SB3A 1HAUA 4J3TA 3TONA 2IAND 1IUZA 1PL3A 1TVHA 2J62A 3AICA 3KS6A 5I1JL 3UWEA 1A1OA 2AJUL 5CJ8A 1DQQA 3HZYB 4U6YB 3EOBA 1OVDA 3ZUCA 4ZXBA 2XN1A 1RD6A 4KAQL 3NQMA 3P4NA 3Q0HA 2RBLA 3DNKA 1IE7C 2OO6A 1ZPLA 1B0WA 1HG3A 2Z1VA 3N19B 2OMUB 1RV6X 4R5XA 4EI5A 3SY1A 4NLHA 3AU1A 4ZW6A 12E8H 1CLVA 1JDCA 1FDLH 3UJSA 1CFMA 5F2FA 2AJSH 3ZE0F 1RY8A 1ITCA 4PJ9D 1RPUA 1LDSA 1Z44A 2PCFB 1ME8A 3OGCB 4L4TD 2YQ3A 4BCYA 3CPRA 3V0WH 3MRBB 5K5YA 1U2CA 1HYSD 3S5SA 1TNNA 5E51A 4GYJA 1D5XA 2XN9E 3RU6A 4P7NA 2DD8L 4V11A 2PW1A 3B5TA 4KH9A 4C83A 1DBAH 2VXQL 3TBWA 3L13A 3F4CA 4LC6A 4I77H 2CJSA 3PFUA 4NQCD 3B1TA 1W2VA 2OMTB 1F3DJ 2CRIA 2Y7OA 3FQRB 3KPMB 4JUTA 4JKMA 5IQ7H 4XTDA 1VFUA 5FKAB 1D3GA 1FL6B 3QDMD 1A7QL 1CVSC 2NNRA 4JEGB 3B3BA 3LSCA 1ACYL 3GXDA 3OX8A 5IHBA 2CLHA 3EWBX 3BVJA 2Y06L 4YSRA 3OL2A 1GGCH 4BKSC 1BYNA 2W81C 4GUHA 1QRKA 1RLCL 5J12C 2B7QA 3GJFB 1CDUA 5EMUA 4ZQPA 3TYEA 3X13B 3QZ6A 3M45A 3G9AB 5KBKA 3STZB 4IHOA 3F05A 4H13C 5ICUA 2UUDK 3T6ZA 5HDQL 3SFWA 3H9YA 1UW9A 1WS7A 4J4PC 3KFTA 3TEVA 2W9DL 2UZIH 5EU4B 3UEZA 5B39G 1OBAA 3M0VA 2G37A 3TA3B 3VFVA 3KLHD 1AACA 1XLFA 3ECUA 3BE1L 5AQ0A 4Q8NA 4ACZB 2VAAB 3ZY7A 4M6NH 3RVWC 1OFEA 1T1WB 4HT1L 4M1GL 4MASA 3MRLB 3NXLA 2ZNWA 3RUGA 3D0AA 4JGDA 1GCFA 3TJIA 3VIHA 1FAIH 4J3SA 3S46A 3QJTB 2ZUYA 4JFED 4N8VA 2CIIA 2O6CA 3FTZA 4HV8A 1FP8A 4NP7A 3IAPA 2ADGA 2FBJL 2IDFA 4AC7C 4DJFC 5CSUA 3H70A 4GUGA 1I75A 1MCLA 5EZIH 5JORB 1XL9A 4CVUA 1OXYA 3H2WA 3NCWA 3SGUA 4DQAA 3IE9A 3RA7H 3GSXA 5DHYA 2QIWA 3LD8B 1KB5A 3AJ7A 4L37B 1M9SA 4O2EB 4WV1B 1I31A 4XVJH 5C08D 1X39A 5JH2A 2GJRA 3APTA 3HHMA 3DFTA 3MRPA 4Z7OF 1UC5A 3PUGA 3MRJA 1MDLA 1XYMA 1B88A 1RHHB 2XWBB 1J5OL 3FO2A 4CEXC 1WDDA 3L1EA 3GC3A 1OCCB 3MBEB 4NUJA 5FA4A 2AABL 1G6CA 4K2SA 5F9WB 3N4FA 3H53A 2O72A 1MCFA 3OIXA 2P8PA 2O9OA 3FSTA 4ZCWA 3LH2L 5TDOB 3DBPA 5I1KL 2FGLA 2Z7WA 3MRGA 3SCMD 2MFNA 5ISZD 2JGQA 4LBRA 2FHFA 2HVKB 3VFMB 4WEUD 5INCA 8TIMA 3P0GB 2HPOA 3EF4A 3R7MA 4GNJA 2NX5A 1ODAA 2D69A 4W4NA 5DD6A 3U36B 1IWBA 2WN2A 1MUWA 2CDFA 1ZMYA 4NYUA 3BDYL 5DDHA 3V7AG 3AZSA 3FJNA 4GCXA 3DYPA 4JKWA 5LBSH 1WAWA 4D1IA 1TZGH 4DQWA 4E2OA 1I8KA 1P6WA 1QATA 1TLKA 2ZZUT 2L04A 2QVTA 3IVKA 2ZZ1A 4ZVJA 3UZJA 4KY1L 2W9DH 1VFBA 3KL5A 4RRPG 1HKKA 4S2CA 1EEZA 1RZKH 2D7MA 2K9FB 2XPGA 4IS6B 4NAMA 2TMDA 1G43A 2ACQA 1CLXA 2MEJB 3T9WA 4LH8A 1PEWA 1N9PA 3V2AR 4RDVA 1J86A 4LCUA 1HO4A 4KUZL 3NZPA 3U2ZA 3RFRA 4ONHA 1F4YH 4MYXA 3QMRA 3TZVD 4PJEA 2PDMA 3HC2A 5IM7A 2GUBA 5D7LE 3TCXA 4KQ0A 1YQVH 3SUSA 3LCWA 2BP8B 3Q2CA 3B7RL 2VXVL 4GEJA 1MI5B 4P46B 3O6AA 3BH9B 3H0TB 4DLFA 2KL6A 3FH5A 1LO3H 4L4TE 4M00A 1VD6A 2IOIA 4TM9A 4J3OG 4GO8A 4PJDE 2FQEA 2OXHA 1K3UA 1JPGA 4PRHB 1UATA 1GR7A 2DWTA 4JX5A 4D72A 1P4IL 3P9LB 4H8UA 4BY3A 3MFFA 3GKWH 2A2IA 5ISZE 1FH5H 4DP5X 4O16A 5D8JL 3U7YH 5C0BD 3V5FA 4HAGA 1MZYA 3KOXA 1KLGA 4C65A 4P59H 3L48A 3RFAA 1K02A 1T7ZA 5DJCA 2WTOA 1MIEH 2Y72A 2VDMB 3DX7A 3OWEA 3GLEA 4MCYB 5JHLH 4M48H 2IXQB 3RWEB 1RUPH 1V54B 2P1FA 4J2PA 3N1GC 3VGAC 2NUTB 4GPNA 2H32H 2IAMC 3QORA 3LLXA 1F61A 3W70A 1ZB5A 4KVCL 1BQHA 1T20B 3SBPA 3LKOB 1E0OB 4MNHA 4AQAA 2FO1A 1V02A 4TRPL 1G1OA 2BSDA 4NNPH 4XE5B 2IQDA 2Y8KA 3TBVA 3IJ6A 2C3VA 3NUKA 1G7HA 3SDXB 3P82A 1ZHNB 3GNOA 1EL3A 3W29A 1NOLA 4KQ3H 4YJZL 3U82B 3FGCB 1D7CA 4ZTEA 4GLRH 2VISB 1EUTA 1SYSA 2IOOA 1W0WB 2CZVA 3R89A 4CEUC 2GJPA 3ZHFA 3VGDA 3HUJB 4JO2L 1JGEA 2DEYX 3VH8G 4HUWB 2V2TA 4JS3A 1FC2D 2AF2A 1NC2A 2J20A 3WKYA 4WWKD 4QWWC 4ZSOE 2CKSA 1NCAH 3F85A 4PP1C 4B3ZA 5DS1A 4YAQB 2OZ4H 2UZYA 4GW1A 4XO3A 5D7JD 1OP5K 3ZL2A 1MG2C 1NDGA 4IW4C 1ZGLP 2KZKA 2V2HA 3ES8A 5G2WA 5D05A 3N2BA 1BEXA 1DTUA 3ZZQA 2HN7A 4X6DE 3N41B 5E5UB 4L23A 3O2DA 1C5DA 1UOVA 2R0ZH 4RBPH 4Y90A 2R0LL 2VB5A 4RNIA 4ENLA 1KXQE 2BVEA 3LPFA 4QS6A 4RL3A 4PRHD 5A40E 3TO4D 2P24B 4GIYA 2HE8A 4E41A 1E65A 3QUKA 1YPZB 4QYAA 5BZWA 3SGJC 2MH4A 3W0WA 4GC3A 3WBAA 2PR9A 2YXMA 2N3JA 5JXEC 2XQBH 3TZNA 1J5CA 3LPGA 1EYWA 2WIMA 3QYQA 3W00A 2HRPH 4JG5A 4NUGH 3C8HA 2VYRE 1OCZB 3RZCB 4OZIE 1XJBA 1OAJA 3QHMA 1YNTA 5F4WA 1ZA6B 2QTEA 2ZFAA 2WP3O 4GXFA 4MWFB 2APSA 2WXPA 1KUMA 3B4NA 5D7IB 1KJ2L 1W9BM 5ACMA 2JBMA 1ZT1B 2E77A 3PB2A 1JVLA 2IMMA 4OM0H 3QCUL 4RMTA 2WLIB 2ZKXA 1FBAA 4UDTA 4JNMA 1BRLA 3FH8A 1T8QA 3BUVA 4G8AC 1KTRL 4LSQL 3PHAA 3FFCE 5E6UB 5A6KA 3OAUH 1OWWA 3FB6A 3T5WA 4JO2H 4IJ3C 1AG6A 1ZLEA 1EJTC 4XPFH 5EO0A 1FIGL 1TKKA 3FFDA 2WOQA 4ZTXA 5T3XD 4IU3B 1SW3A 3C6CA 4R0LB 3ECQA 5FO9A 3QR1A 3OJMB 4ASTA 3DG6A 3LZFL 5LGZA 3ARZA 4P5TA 2QUUA 5HATA 3VCLB 4O02A 1YPZE 3K1DA 1CFSB 2NY0D 4P2OD 4F33B 5C6TL 3FX4A 5D7JB 5CWSB 5TGBA 3DLQR 1OEPA 1WXJA 2VKZG 4MAVA 4A3RA 4WJ5A 3WTXA 1I2RA 1S1RA 1REQA 4PCNA 3KYKH 2FDSA 1OHQA 1CB7B 5CJQH 1SFLA 4IIGA 3UXDA 3IIOA 4K3JH 1U42A 3ABOA 4ATLA 2Y8VA 4ZAKA 2G30A 2YXGA 3SQBB 4LEFA 3RB7A 4BZYA 2DQCH 5K9KA 3WDIA 3ALWA 3K5RA 2GSIA 2XFRA 3CZNA 1V02E 1KJ3L 3SE6A 5GRJH 2I16A 4W6YB 1B90A 1R3KA 2K6YA 3PNZA 3IDXL 2BLEA 4CQ9A 3NH7L 5M1TA 2YXWA 5F0JB 1FY6A 3WIFA 4EI6A 1MH5B 4AXWB 5IEKB 4F2FA 2LQRA 3CQJA 4O9HH 1BVKA 2PGFA 3NAVA 1PCKA 3S3DB 5CEXA 4N24A 4Q58C 5KBLA 5T91A 1MCPL 4LUTA 3LN9A 3N1PC 4OF8A 1CLKA 3EYOA 4NRZA 4LQFH 3QJVB 4IDLA 2E27L 4MJ2A 5AEAA 3CDCA 4F2MB 2ALWA 1OB1A 3DA0A 2B1HL 2CK0H 2V7NB 1W1B1 3MPGA 3IE4A 4C59B 3SY8A 1ZAHA 3VG9B 3GRWH 4MMZC 4F37K 4MA8L 3GXUB 1JNLH 3JWNC 4HLEA 1HZYA 1QX1A 2E74C 1K2DA 2V17L 4AMWA 1ZJHA 5IHWA 1ZJAA 3EJUA 3M5ZA 3ARFB 1OFBA 5E6SB 5GJMA 3TH3T 1L3NA 4P2OA 1GZQA 3RLSA 3X2QB 4F7MA 1MAML 1KLFA 4Y7EA 4IJTA 4PIRF 4AOFA 1XI3A 5C0QA 5L2JB 3SRFA 4KC3B 4DGIL 3EWYA 3GI9H 4XBPB 2DQTH 3L9CA 5EN2B 2V7HB 5LO7A 1FDZA 3D4YA 4PWKA 2AJXL 5KYXB 4ZS7L 1J01A 3QDHA 3UBXI 5CGMA 1I60A 3WHE1 1U8JA 1JRBA 3FFCA 5HDOA 5BXRA 4NKIH 4K5NA 3CZFA 1AC0A 2P26A 5ID0B 5JQ6H 5GGRA 2ZXCA 1RXLA 3OHMB 1ZOXA 4KDWA 5TQ0H 5HWNA 4YSUA 1I4NA 1TFHA 3B2UC 1KM0A 4RXFA 2FQIA 2ENJA 1NIUA 3CXFA 4PZVA 5ECUA 5FAGA 3VIPA 4CD4A 5IF0A 1GOFA 3KPOA 3M41A 2BS8A 3HN8A 1SOXA 3NZHH 3PUCA 5L4MA 4IQDA 2BOLA 2IV9A 3ESVF 4HWZB 3OZ9H 3QXAB 2J7BA 3GR7A 4NZ5A 1GHFL 3BGFB 5CF3A 4OZGA 2ARJQ 3CFNA 5B38B 3R10A 5TE4L 1AL8A 2GJ6E 4JIHA 3TN0C 5C70A 3TDFA 3L4WA 4EN3C 3AY4C 2VIRB 4XCCL 2TODA 4DYEA 2Z8SA 3UZQA 3SGGA 3A4EA 1FBIH 2COVD 3KVPA 4UU9A 2AI0H 5D5ME 4C56A 3KZ8A 3WK0A 2REQB 5EO9B 4BBWA 4X4XA 4NBXB 1AH0A 5I09A 4E2VA 1ZT7A 2X12A 3N40F 1G7MB 1NGWA 1VENA 3NQEA 3BKYH 1WZKA 4US6A 4PB9L 5CLTA 1YC8A 2IQTA 3QZNA 4OIIH 1JVOA 1R4XA 2EXYC 4XPBL 5CUSH 5ID1B 3N3MA 3BVUA 4UANA 1UZ1A 2FTWA 2QQNL 3D85B 4JPWH 4PGLA 1GSMA 2XVLA 7PAZA 2F18A 2NX5E 3P4OA 1Q85A 3OZOA 1JWUA 1WWAX 3LKNB 4ZB2A 3TFKD 3PLYA 5IF0B 4YHLL 1WQ5A 3CQ0A 1A6TB 1OT4A 5BO0D 1LP9B 4QKTA 3UFIA 3KPPB 3VXMA 3ZQWA 1TJ0A 2A3HA 3O6CA 3RX5A 5I26A 5DUML 4D7BA 2D9CA 1A14L 3TN0D 5REQB 2F84A 5I66B 1XDLA 3OAZK 4QROA 4E38A 4BUQA 4JNZA 3MOAL 5LN8A 3WH8A 1UB3A 1ELSA 2RACA 2QJMA 2M1KA 1PG7H 2YPLE 5FYLL 3T0EA 2XT1B 2VN4A 4MB1A 1DQML 5L2KE 1JGVH 2QJHA 2BVQA 4JY4A 4X9FA 5E4EC 4O8AA 1CF8H 1RZPA 4PYGA 1UR8A 5I75B 1P9MC 5DVMA 4Z76A 1IMHC 1I8UA 2X3BA 2FQFA 3VXUA 1LZOA 1XM3A 1J8HD 5ICXB 3TCLB 3B2UD 5HI5C 2DY3A 4G8GB 3V7AE 2IKHA 1TJXA 4UBPC 1GYNA 4JN8A 5IJVB 2FGWH 5CEWA 1PG7X 4JGJA 5I15L 1JV5B 3O6YX 3HI1A 1ME7A 1BJ1J 2DMBA 3P11H 4R7NB 2VGBA 2J47A 2BCMA 4RQQB 4CMHC 5AVNA 1A5OC 4W4QA 3EB2A 1ZLVK 3SKNA 1MSPA 1B2YA 1BQKA 3KGRA 4OFQA 5IVXB 4C7FA 2H2SD 3MYZA 1V5JA 2KLSA 1HWWA 4AV0A 3C9NA 1WDAA 2WLKA 3FYEB 4FG2A 2MOQA 2H7WA 4FXGB 2IPUK 3IEAA 4PCYA 4I3SL 5E8PA 3GPSA 4Y16B 4R85A 5LYRA 4Z3GA 3GTTA 5G4OA 2NQCA 3NNTA 1CK0L 2BWIA 2VMCA 3N13A 1GYLA 3UG8A 2OJ1A 1DWFM 3TSDA 3GBNL 3OB0H 2N1KA 5KSAD 2EIZA 2GHZA 5H94A 4XX6A 3ZYOA 1H15A 2FX9L 1EXPA 4Y4HD 1YKWA 4G9FD 2YPLB 4BUHA 2Z8RA 4WENB 3UPRB 3CWHA 5LGKA 3PBGA 1U8HB 4XX1E 4JB9L 3H9SB 4YFEA 1I7TB 1GC1L 3CAVA 4UTTA 4BKTC 3T4CA 5KS9A 4PSPA 1G7VA 2ITCB 5CJOL 1D2PA 1FHNA 3F5WB 1B6DA 4QCEA 4FNPA 4DHLA 2D7PA 4G83A 2PI6A 2XPKA 2DGAA 3FULA 5JOEA 2XZCH 5IG7B 3RVVD 5C92A 2VSCA 3MNMA 4DKTA 2EG7A 1RZJL 1C5DB 4ODVL 2OR2A 4FFZA 1AGCB 3S9DB 4HPXA 3SD5A 3L95A 2QMJA 2KAUC 3QEUA 4YXHL 2YL8A 1Q9OB 3NK4A 4RZCA 1O60A 1KLUB 1XICA 3N25A 4APQB 1EJUC 3P61A 1EO8H 2C1GA 4DWSD 4DO4A 5ABGA 4UT7H 4L1HA 3R1GH 5KZDA 4GA8A 3VXME 3LHYA 4EXBA 5CPTA 2H8PB 4U2ZA 4NYYA 1E6ZA 4GD0A 4KV5F 1PZ1A 2ACRA 1MZRA 3W82A 5B39A 3NP3A 4ERSL 2BC4B 2B7PA 3BYYA 3B04A 4DM1A 2KLRA 2X4RB 4BQ9A 4DOHE 3FUJA 3LU2A 3VIFA 3BH8B 3LEXA 1TQBC 1RJPA 2EKSA 4F0LA 4ZFFA 3QJQB 2BZNA 4Q4MA 1B4TA 4H1LA 2C1PB 4TSAL 1IT8A 2BIIA 1SO5A 3TNOA 1FFNA 2VLKA 2FO4A 4HJIA 1LT8A 1T6BX 4WI5A 1YYLL 4GCAA 2E1DA 1IILE 3V4BA 4FXTA 4APXA 5TDNB 1AQKL 5HHXL 1FN4A 4MVBC 4HJ0D 1JFQL 1KCUL 3D8MA 4MZ8A 4N9OB 3NSNA 2PDGA 2DJUA 3QG6A 2E7HA 2XFFA 1KWGA 1PG7W 2BVOA 3TCTA 1WAAF 4I0PA 2OTDA 1AS6A 3BT0A 3I02B 3F2DA 3CIQA 3QEUB 3TFBA 3V4PL 3HPZA 1DUYB 4I13B 1E5AA 1FH2A 2ODHA 2VJ8A 2OMVA 4O02H 3THML 3LEYL 1XYCA 1RIVL 2CZNA 4FFWD 2QSCL 3FOMB 5IWLA 2ADYA 1HKWA 2IKGA 1PTGA 4FA7B 1UD6A 3G1XA 1E9OB 1Y1DA 4UM9B 4WU5B 3Q8CA 4TVPD 3RDTC 1CCWB 4QIUA 1WBYB 3TZFA 1LEIB 1E0XA 2J72A 4YIQB 1JUFB 3WBDA 2W65A 4K7FA 1DBJH 4IRSB 5DD5L 1RZKL 2G60H 1JUKA 1H1ZA 4AQZA 1C7TA 3C0SA 1F90H 3VA2C 1S5HA 1LQ0A 1UQZA 1HEZA 1FWGC 3KRBA 3N12A 2OMYA 1DIEA 2MCPL 4P7OA 4PJ8D 3O4OC 4UF7C 3OO2A 1S8DB 4P99A 3MLUH 4YUEH 4F15B 4TX8A 3CUPA 1YTEA 3FO1A 4ONFH 2CQVA 5FV1L 2CCWA 3SPGA 1A49A 1UZHA 2Z35B 3BUQA 3V6ZB 1FUYA 4XPTH 2I25N 1E5JA 2EADA 2J9XA 4GAFB 2CO6B 3BKCH 4NN5C 4AITA 1ZS8A 4KTDH 5GZNC 3JR2A 4UDUA 4RE3A 1G6RL 1YBQB 4P5UA 4Y6GA 1H3PH 2C3GA 4NO5B 4YVNA 1R9ZA 4EWND 2WMGA 3AB0B 1YMMB 1IGJB 5FF0A 4IBSA 2B8OT 3CXHJ 1NC4B 4RFOL 5C0IB 4C1NA 1CB4A 2UUDH 5BW7C 1URIA 4N8VG 1XBZA 4W85A 3STFA 1WBYA 4IP5A 4RX0A 4PB0H 2Y5TA 1CIUA 3BLDA 4ZUTA 1XYZA 4Y9AA 2WKOA 3IF1B 4DUVA 3Q5YA 1E4HA 5DXWA 3MUAA 3WUBA 1T0NB 1E1CA 4OCSH 3CGTA 2CC0A 4QRUA 4ZO7A 5A3ID 1CLYH 1ZKAA 3EZJB 3V4VB 3WN5A 1WBJA 3O06A 1NSJA 2XI9A 4Y5XC 1DJIA 3S4TA 3NIFE 4WI6A 3KM1A 3QQ4A 4I0CC 3GVVA 3MBED 3W2JA 1K5NA 2OR9H 1QBML 3TLRA 4KVPA 4Z0XA 4YXLH 5D7LA 1D2KA 2N7AA 1EX1A 5IW6B 1SQ7A 2O4QA 2BNQD 4XP4H 3SN4A 7TIMA 3GRBA 4PJ8A 3P3SA 2E9GA 2MTPA 2VDOB 3QP3A 4ACPA 4GI8A 1GORA 4QFUA 3N18A 2VE6B 4AMAA 4C5YA 1M1XA 4JY6A 1OK6A 2X6MA 7ENLA 1BD2B 4FULA 4HJEA 2FEEL 3GK0A 4CC4C 1G9HA 3UTTE 5DMMA 2YK1H 5TH2B 4KJQC 4HAKA 1FVEA 3I6LE 2Q8ZA 3S4SA 3U0TB 4DN1A 2DZBA 1IFRA 5GHWH 4J3UA 3W0WD 2Q10A 1O66A 5I0YA 4K38A 3T2QA 2DQDH 4WEMB 4E3TA 2J9YA 3BPOC 3SDAC 2G2NA 4PLKD 4WDTA 1JF6A 3LRSA 3IFLH 4XI5D 5E0FA 2NX1A 3NL2A 4PIBA 4UIKH 3HAEG 4JM2B 4CADA 4WHCA 1UWXK 2PUZA 1NKRA 1TZHA 1I8IB 4ZFZA 3QPZA 4N9CA 4RDBA 3RVXD 2APVA 4RIRB 5DMKA 3VFNB 1M01A 3ABRA 3CX5J 1F4XL 2F7FA 4BQ3A 1F3JB 1OGSA 4P3DA 4YDZA 2E0PA 5AVUB 1TTQA 3V35A 1P5UA 1XL4A 4WWKC 2YMTA 3TPUA 1Z7JA 4IQEA 3KBEA 4F0MA 3CVCA 3UACA 2PTTA 3U0PB 2MCG1 3C61A 3UOAB 1X5LA 5IHZB 3M0KA 2LU3A 3LBCA 2HH0L 5CGYD 3NCCB 4QD2E 4ZEPA 1I4FA 1QSED 2PF0A 4DH2A 3BQ5A 3TQ0A 3L1OH 3RIKA 1J8KA 3VSQA 3BO8B 1X5IA 1W9DM 3KPPA 4M1DL 5TNVA 2OMWA 3M8OL 5I1HH 4AH2B 4IKLA 2AKZA 2HNHA 1UBPC 4GG9A 3SDOA 1U41A 4IOFD 5C8BB 5LDSA 4C4UA 3WF0A 4KJPC 3AYVA 3WI9A 3KS0H 4H1LH 3TN5A 3JZUA 1PD0A 3BPLB 3MRDB 5LB1A 1U8KA 4JO1H 3KDPB 3R18A 2D24A 3KPRB 1VZHA 4BFIA 1SLXA 2D9QB 5F4XA 1XGYH 4PY7A 1TJGL 1BBDH 1UXWA 4Q4RA 4LE8A 2FATH 1CENA 3GZQA 3K5SA 3DKJA 1ICSA 4A22A 3T0BA 1V03A 1V6TA 2PNDA 2IH9A 4JQVC 4X5LA 3WGUB 4CU8A 1KBLA 2L3BA 1AHKA 2VZOA 2MKLC 1EDTA 1M9WA 3Q2LA 2WVVB 4QRAA 2AK4E 3F6JA 4FFVC 3LZOA 4FE9A 5DURD 2F54B 3X11A 1XF2A 2GG1A 1HS6A 1FC1A 1I4FB 4H25B 5I7GA 1UOZA 3QJFA 2QR0A 1PYWA 3BLFA 1L9TA 1EERB 2ETWA 1HQ4B 5CIPH 2CU9A 2X38A 2YK1L 1AD9B 3WLWD 3WIFB 2BY2A 1VQTA 1EJWC 1T4KB 4PRIE 4PVBA 1NFDE 4WRLA 4ZUUA 5GGQL 3H4WA 4JK0D 3FRPB 1XEDA 2RALA 3MRHB 4NZ1A 1U33A 3FN3A 1G9MC 3DDGA 5F70A 4EXQA 3NH7H 4JGUA 4JKPH 1XZWA 4D9LL 4TQTA 3NJMA 3NZGA 2H0FA 1R5WB 2BGSA 4RISL 4DWDA 3FCBA 1TTRA 2VMFA 4W9DC 2H0JA 5KYWB 4YXLL 2B4GA 4J6RH 2X40A 3DI0A 2KC0A 1OB1B 2V7NA 1GXEA 3NZRA 3FUMA 1Z9SB 4HXAH 3RUGE 3S42A 3FQXA 1NLBL 1SJHA 5E9DE 5ICYB 3AALA 3DIPA 2QSQA 2CH8A 2QGDA 4P4RA 1IEHA 3JV4A 3CPUA 3IFPB 5EIIB 3KYKL 3C0QA 2YD5A 4S1SL 2E7FA 2QUTA 4IJRA 1M7DB 3ME0B 1BFVL 3VFUA 3APYA 3PTKA 1SR0A 4BEQA 2PETA 2EECA 3BZDA 3KLAA 3VMPA 4JTIA 4J1UB 1ID5I 4NRYB 4LVHB 4TSAH 4ZGYA 1WBHA 4TS6A 3NZUA 4XBPA 3VNKA 1ND0A 6FABL 5CSSA 1EZLA 4U3XA 2DH3A 4ZTOH 1FZOA 5C97A 1KTLB 1Q94A 3KPRD 1KIQB 4H44C 4XXDB 4ZK8A 4K36A 2ZP8A 4L8SA 2JF7A 4KX7A 4PV9B 4GKNA 4ZXBC 1SUHA 3QIBB 1U1JA 2PA6A 4WUUE 3JWDL 4KXDA 3VDBA 2DUAA 3CASA 5FD0A 4EAMA 4M4RA 1XF4A 2CDEB 1QR4A 4ZTPL 1P0KA 2Y6TE 5HDBB 4I87A 3W28A 3LERA 4NUQA 4X7FC 3TYGL 3AIVA 2B39A 1E6JH 2PKDA 4F79A 5TDPB 3ZKND 3I6GB 4MMWA 4LBAA 4Y4FA 3PWGA 5DELA 5BJTB 3WUGA 3PFMA 3C75A 2WNWA 4WHTB 1UCBL 1S5NA 2IG2L 1DQXA 4DJFD 2DQIL 1YY8A 4M5TA 4OZGB 1HINL 3GNML 1VGKB 4YPGB 5B38A 1NDMB 2ZUXA 3QKEA 1JTTA 1FF5A 1MFEL 3CJJA 4Y0GA 2PODA 3K72B 4LRTA 1JPEA 3QWOB 4U49A 4P7QA 2QGCA 1CFNB 4Z7VE 4NASA 3IDYC 5AWNH 4C4KO 1T1YB 4D8PA 3EH4B 1CE6A 4HZLA 4MY8A 4HSQA 5BMFH 2F7PA 3VILA 1BOYA 1AJ0A 2EE9A 1J1PL 4LHQB 5DR5L 1OCJA 4XKMA 1MI5D 4FNSA 4N4PA 1QU4A 2R0WH 4NZJA 1BM3H 5B1BB 3ZIMA 2OMVB 5IVNA 5C0AA 1S38A 2CKRA 3I6EA 4LXFA 4XT1C 3DO7A 2BVWA 3QZAA 4QDWA 2OW7A 1MEIA 1RIVH 2EIEA 1Q6CA 3MDWA 1JNEA 4Y9GA 3KBWA 1R3QA 3Q2NA 3MWAA 3FXGA 3US1A 1FSKC 3E2HB 1J0YA 4N90E 2CITA 1DTNA 2ZCHH 4X6CF 2OT1A 3VUPA 1JRHI 3WTWA 2FIKA 4CC1A 1XH3A 5DS2A 1ECYA 3VXRD 4JIEA 1BG4A 5F96L 2YOCA 1IEVA 4O1FA 1LP9A 1HEZB 4OOZA 2WC7A 1UD5A 3NK3A 3FYIB 4LDLB 1NMCB 3TO4B 3UP6A 1FWBC 1KO0A 3ZFHA 5KMYA 1NU5A 2ZAGA 5TDOA 1TUXA 3L3GB 2IADA 3HC0A 5IY5B 4YXGA 1T04B 5BZDB 3B8SA 5XIAA 4GFSA 2PP7A 1RFDH 5CZVH 3UQNA 3W3BA 4XN8A 5HYEA 1CFVL 3HA0A 3MBWB 4K7PX 4QXIA 4GS7B 2ZZ7A 4WJEA 5I9QC 2XDFA 2X87A 1T2JA 1RZ8A 3AS0A 3LRKA 4DEPC 4DJFA 1QWKA 2E7CA 2VX7A 3DV6B 4A2DA 2ZF8A 1ONXA 5DHMC 4LLQA 4HD9A 4DBEA 1JDDA 1CQKA 2IQ9H 1QLFB 2DD8H 4DN3H 1MFNA 2OTUA 4JTTA 5C0AB 3G3MA 2DIAA 2OR9L 3L17A 4N1HB 4EUPA 3CK0H 4CSPA 3D25B 2X4QB 4HYVA 3PGFL 5EBMB 3QIWA 2WLMA 5EOCJ 5HMSA 5DFTA 4RQQA 4PJAF 4H6QA 5IROA 1LCOA 3OOQA 4CCDA 3G6LA 4OOUA 2EO9A 3GNNA 4C6LA 1G9NC 2V8ZA 2BSSB 4DUWA 3N11A 3KYOA 3V75A 5FUOH 4LHJB 1OD0A 3O6LH 2VM8A 2ERJC 4A21A 3DJ9A 4Y89A 3HKZA 4L3AA 3S2JA 3EEZA 3MA8A 1FZJB 2YL6A 3KLLA 2POTA 3MR9B 4B6ZA 2UY6B 4LS0A 1PHWA 2G0WA 1BQGA 2FE0A 1ZBVA 3FF8A 1EDYA 3GD1C 3HG1D 4AIUA 2QUNA 1YQVL 4U6VH 2XN0A 3WO4B 3DX7B 3ZRSA 3H12A 3BSMA 4YVPA 4WDXA 5FM4A 2H6UA 3WXWH 1KLGB 3U3HA 6PAZA 4I48B 3TW7A 4P4KC 3A6OA 1NLDL 3VB8A 3GQYA 4AQAB 4E41E 4IMGA 1GT8A 1SW7A 4YE4L 2BDNL 4K94H 1WF5A 1F8MA 2VCOA 4IGBA 2NUTA 1LK2B 1U8LA 1L9RA 5ETUA 4FNQA 4LS2A 4CL7A 4KROC 5AOLA 3RG6A 2DQJL 3SKJH 1KBBA 3TZVA 1SFDA 5K2ZA 2O9RA 4MDIA 5IBXA 2J44A 4MMZA 1JGEB 4I9XA 3DUUB 3MMEA 4MMXB 1TE6A 4AIBA 4LNYA 4KK8C 3FZUC 3X3FL 3C6EA 1SYSB 3UZQB 2P50A 1LBMA 1GZHC 4Q7IA 1UQSB 2OI9B 4GXVL 1ROWA 5EMLA 3NSMA 2OCJA 3QEQB 4NN6C 1IAOB 1SMOA 4N3TA 4MDPA 2OJEA 1W72A 3QDGB 1IGYB 2WCPA 1XCTB 2PPAA 1MIML 3AAZA 4PJXE 4TL5A 3APCA 5IESL 3WKML 4B97A 1MEHA 1AG0A 3CPGA 3ZUNC 3H2FA 2FT6A 3IGXA 3URAA 1AXSB 2J56A 5G2NA 2M26A 1XIWB 3KZSA 2QFPA 5I82A 1HCFX 4AH2A 1U5HA 4G8GD 4OLXL 1A1MA 3KBNA 4NO3A 5LNVA 4MY9A 3Q5TA 1FL3A 5FCZA 4K55A 3VI2A 4BSVB 3ELAT 1ILSA 4OLZL 4A7UA 3GO2A 4NQSA 3LVEA 1H19A 5E99H 1NP2A 4FOUA 3H3PH 3FU3A 4JTHA 2DQGH 4IYKA 3DXAD 4AGQA 1CNVA 5JH1A 1QWHA 1NL0H 3QEZA 1EOMA 3C5ZB 4JDBA 1WZMA 3T0EB 3KTCA 3AUVA 4BZ2L 1MCBA 1GQLA 1I2QA 4L6HA 1GIGH 3L3DA 3Q9PA 4UTAA 4RCXA 4IRSC 4CBZA 4QE1A 3AIWA 3GG1A 2PDJA 2RH0A 3VXUB 5EU5A 1MG3C 2NUYA 1WZLA 3IDXH 1OM3L 2DTMH 4NWUL 2Y5QA 3VMOA 3L66A 1W3JA 3T04D 3L3KA 3T3PE 1P1ZB 3ASOB 3MDJA 4KMTL 2YDSA 1QNPA 4DVBA 2WTRA 4TV3A 2NX9A 3NZSA 2H1PL 3PPFA 4X4MA 3AXIA 3THAA 4H25A 5AD0A 2NZ9C 3FU0A 4NKDA 2EE2A 2IC2A 4I18A 1H5VA 3S0CA 2C1IA 4HWNA 2KHAA 5HYFA 2BJMH 3MV7B 1C29A 4FFYA 2CLKA 5F7EH 2DPEA 4RPQA 3DDFA 3LVTA 1QKZL 3ATBA 3FFOA 2XG5B 4GQ9L 2CR3A 3CUJA 3E38A 5D1ZI 4AGOA 4PJCF 4CC4A 3D3VA 4RMUA 4U1LB 5LVEA 2UZXB 4OT1L 1KFEA 2OLHA 5DS8A 1R5WA 1F00I 2CLPA 2YDAA 1KGIA 1KTNA 4HVXA 1G7PB 4O02L 2NW3B 4A39A 4B3EA 4OQ1A 4ZXBB 1T6VN 2CKBL 5IMOB 1K5WA 4F33A 3ULVH 1C9DA 3CLEL 1PB0A 3CMJA 5GPRA 1FO0B 5F7MC 3Q67A 3FQXB 2E8YA 4BQ5A 5FGRA 5GJSH 1F41A 4KDVA 3PGDB 2YXFA 5DJ8B 5HHQA 4MJJA 4R26L 2VDKB 4BR1A 5I30L 3MLVL 3QY8A 2YAOA 1IXQA 4X6BA 1PNDA 1RKRA 4AI7A 4MJHA 5C3TA 3FRPG 3V0VA 1GZPA 1VRXA 3WBXA 4JRLA 5DD0L 5DN1A 1KMGA 2KX9A 4IPPA 6XIAA 3TV3H 3N2MA 1SM3H 5E08L 3QDJD 2VLRA 4UUJB 4AHQA 2HKHL 3NA9L 2CZEA 1B31A 5F3HB 3E0VA 5F89B 4BH7B 3ZJAA 3US0A 2N56A 4Z8FH 4TLSA 4APQA 1NCNA 4R33A 3AU6A 2EACA 1NANI 5JW5A 2Y24A 3CVHA 2WIIA 3FQNA 3US9A 1H7RA 3TMQA 3VE7A 4NSKB 5AAMC 2DWYA 4WUKL 4LUTB 4F24A 1JFXA 4Q6JA 4RMRA 3O07A 1NH6A 3OSVA 4HSCX 2NW3A 4F2EA 5EWIL 4IX2A 4QP0A 1K2DB 2Q2LA 4X83A 4YDJB 1S2EA 1XVSA 5KN5B 3LOTA 4B60A 5IB5A 2VURA 4FKKA 1U3ZA 3WFZA 2LGNA 2OL3L 1UH4A 3B9EA 5J8OA 3B9NA 4PTWA 4AJVA 4RXGA 4F8XA 2VW6A 4Z7AA 5L2JA 2FJFA 2BHYA 1A4KA 3S34H 2ZA3A 5D6CA 1PLAA 2PPFA 3L7EA 3NIGF 4XVUC 3QFEA 5EH1A 3OKDB 1J0HA 1OAQH 3O0RL 5HGAA 4GBDA 3GS4A 4GYKA 4RZBA 2YBVA 3EGJA 4B9KC 4IRSD 1GVYA 1W0VA 4QISA 5H2BA 4OUEA 3K6IA 3QG6B 4PB9H 2HX8A 1UTDA 3TPUB 3O3AA 2ED7A 4ZXBD 1E4LA 3F4NA 3UBPC 3ETBF 3DX8B 4E5XA 4PVLA 4GACA 3KXFB 2EDYA 2E86A 5CP3A 5HGGS 1YEKH 3HC4H 1PSCA 3EZ8A 5EBAA 3ULUF 1OAXL 1DWJM 4P48A 1A3ZA 4PE8A 3Q06A 2A7NA 3QQ3A 1IXPA 1TV5A 1VLXA 2Z1SA 1TETH 4TQEL 2FK9A 4PUBL 3LUTA 4HPJA 2A4EA 4DAIA 1E8XA 1RA0A 1AXTL 2G3IA 2QAPA 1JTPA 2J8TA 4I5XA 5D7IA 5KTEH 4GX9A 4JRYA 1QI2A 3H2PA 1KJ2H 5JHLL 2H3NB 4O4YH 3CH1B 4QKXB 3CEPA 3FQUB 2E6PA 4UXDA 4AWUA 3QDMA 3A6BH 4PCKA 1F76A 4WI3A 3I3DA 4LBSA 4ZI8A 5IIEB 3QQDB 3VGAB 1FHLA 2XWDA 1N8WA 2GK0A 4XMKH 4IGHA 3ZQ9A 2X2JA 3ETTA 5ID1A 1OX4B 2W6RA 3H2MA 4BWLC 1WCQA 5F9OH 1FNFA 3W2DL 1UWAA 3AACA 5HJ3A 4H9UA 5DEZA 4DAGL 1ZS8B 2ZJSL 3V4VL 4R7DA 2WVVA 4HZ8A 4C6BA 1OJXA 1HGYA 1LK3H 1LMKA 4HS8H 3PWPA 1ZANH 5DC9B 1MEWA 1WV2A 3HPFA 1KXTA 3A12A 4C6CA 1KCVH 1RP8A 4W9GC 4MLRA 3GMOB 3CFDA 5DCEA 2Y89A 4MQXD 4PRAB 4N25A 1INQB 3KYMA 4K8RD 3VDCA 1TVBB 4GRWE 3EF7A 1CS6A 2B1AL 5JIQA 1RY0A 4JHMA 4FQLL 4LSRH 4PL1A 3ZVIA 1PU0A 5AB3A 3ETBJ 1BAFH 2WMPB 3LPPA 5DUBA 1FWJC 3U2CA 2BMKA 4Y2DA 2GBTA 1DJQA 3PHQA 3B0PA 5EKYA 1D6VL 2J1KA 2Y1YA 4WTQA 3UBXG 3MLRL 4N0UA 4U1NB 3JWNE 4AYSA 1S2TA 5F6HJ 1DVJA 4KKCC 2OCZA 4G59C 2F2KA 3PP3K 2R8WA 3SCVA 4DIXA 1XLGA 1O1HA 1LD9A 2IPKA 3SDCA 2YN3A 3C56A 2JK5B 1SF5A 1QWUA 3RVTD 1FWNA 4V1DD 2J8GA 1ECQA 3BSHA 1MUCA 5FESA 1R3TA 1KM2A 3FUNA 2B31A 2BERA 4IRZH 3C2VA 3C52A 5FUCE 4TUFA 1XF5B 1XCQB 3MV9D 4MKNA 3HAEA 4JGNA 1CDGA 2NXYB 1EQWA 2V2XB 3MA9H 4O0QA 1EANA 1K4DB 1KB9J 3W7RA 1BJ1H 3PJLA 3QV9A 2WSKA 4FX8A 3NPWA 1JTOA 2HLFD 3MRQA 4WKZA 3VOHA 3AIEA 2Y0FA 3F01A 4YWGH 4Z7UB 3CYVA 5DMJB 1WX0A 1AKJA 2W92A 4Q6IB 5IUSA 3R8QA 1AQMA 2ZTBA 1XAKA 3D1MC 3NGBB 4K3HA 4LZKA 5EA0L 5I6PA 3K8KA 5FR3A 4FX6M 1NIDA 3L2NA 9XIAA 2CCLA 4FN0A 3W9DB 2AQTA 5T1KD 1YEIL 4ZFGL 1CB2A 1OF6A 1UJ3B 5KAQG 3UZZA 1YYCA 4WTZA 2OYPA 3OM3B 4YSOA 4DZHA 2OLSA 3GBML 5B1KA 4J7RA 3LY6A 3P9LA 4GO9A 1I7TA 3O0LA 5F3BB 3CXHK 4RA3A 1DHKA 2F54D 4BA0A 3CC5B 2YWYA 1CFBA 2HT3C 4TULL 4NP4H 1XB6A 4GMTH 3M7SA 3CN3A 4G8TA 1WC7A 4PJIB 3I6GA 5D93B 4DJEA 1W72L 5FUZL 4DF2A 1NOFA 4DGIH 4Y96A 1CGWA 1DE4A 1J8RA 3ZR6A 2XC8A 1QVBA 2EVJA 5DTFA 1DVFD 1EX5A 2H6PB 1XCQA 4L8BA 4ZXLA 3HPAA 3LH9A 2QF7A 4DKFH 4J35A 4F9DA 1AGCA 3P30H 3AAMA 3ILDA 2VOTA 3L4VA 1VFSA 3MRCA 2JCCA 2F8XC 1MJ8L 2W4XA 4XPTL 4UB9A 1D5BA 2VR7A 3PV7A 5IG7A 2QZRA 1E5ZA 4TVUA 4DPRA 4H01A 4PEKA 3WQCA 3LRGA 2Z1KA 1WFJA 2CNYA 3POHA 2B1HH 1MCHA 1Z3RA 2CK0L 3WQFA 4IH3A 3F62A 3K6SB 5ICZB 4LUJA 3FGCA 2DJXA 1TYJA 3KVKA 4D9QE 2FYYA 2ZP9A 1DWHM 3P73A 1X5MA 5IFHL 4FFWC 1ZWIB 1MCKA 2PLTA 3GMPB 5KANG 1EP1A 2D2HA 5DD5H 4K9EL 4GKOA 2VENA 4YS1A 3BUPA 4C6MA 3RR4A 2NY7L 2C1PA 4MYWB 3BZFA 3G5ZB 5D70H 5C3IA 5CZRA 3XISA 2Y88A 1BX2A 5XINA 3WQ5A 5C0RL 4NQED 4IDJH 2JB6A 4NAFB 1IT7A 2VDPH 4PJCA 3WSQH 2NPLX 4KOCA 3SDCC 3MACL 1B2WL 3QEGL 3O8XA 4F9PA 2YAMA 4Q33A 1SXNA 4Z7WF 5BMXA 4PWIA 1A4JA 4FYTA 5T1LA 1J4EA 3B83A 3P4OB 4M93B 1EJFA 2MIZA 3UTTD 3WL0A 4IJCA 2XRAL 1XCFA 2BHFA 4HQVA 1ZXQA 1JWMB 3PJSB 2ICWB 1NWUA 3JWDC 2YUZA 3ZYZA 1IEXA 2BINA 5EO0B 4B9YA 3P11L 5GIRB 3N1MC 4DP4X 1MREL 3MCKA 4AT6B 5LNDA 2QHRL 4DT2A 4ACZA 4ZQTA 5IFPA 3NZ8A 1JPMA 3VFRA 4F5CE 3KYAA 4GISA 5FSDC 4M80A 1EJSC 4H1ZA 3G08A 2V6AA 4UFIA 4MXWL 2XN9A 2YRZA 1JUFA 3UIZA 2EUWA 4WDWA 5BYWA 5CCZA 1TNMA 2JXMA 1I8JA 3TURA 2B14A 1X5GA 2HFFA 2DWDA 3WO3B 4XN1A 1J0KA 2A7RA 3B9KD 2FL5B 3FYPA 4PRRA 1U92B 2Z4TA 3Q3GA 2Y69B 1E71M 3AWGA 3MCOA 2J8UF 3QFJD 3ZMRA 1U91A 1EJRC 2X0UA 3BQ6A 2H9GB 4G6AD 2XWEA 4YXHH 4O53A 3MGOB 2AGKA 4NKQB 5E5MA 2GWNA 2Z28A 2OP4H 1BXAA 2OR8A 5GS1A 4XMWA 2A9NH 3OSKA 1SEQH 4G9DB 1XIHA 3WQWA 3WQOA 1QO5A 3HO8A 5LG6A 5HAOA 2CGYA 4XNQB 5DRNA 1N7MH 2EINB 4ETQB 2DQWA 3LQZB 4GUFA 3MCNA 3FBQA 2KQMA 1ADSA 4XXDA 4L29B 4XMTA 3LZPA 3W81A 5KSAC 1TZ8A 5J6GA 2CLIA 3WUEA 1W3TA 4QSHA 5H1WA 2WSDA 4KT2A 4JHWH 2XDHA 2FWOA 2PF6A 1CZ1A 3KOZA 3W7PA 1RK0A 4LNRB 3AU1B 4YL9A 3VFRB 3DPBA 4Y16C 2I14A 5B4MC 4WO4A 1Q7ZA 5FF3A 4E8GA 1SEBA 3ZLGA 5J5RA 5CLZA 5C8JB 1D5XB 3CFKB 3EJTA 3TZVB 5GS0L 3SBQA 3WYZA 2X3CA 1N55A 1LMIA 3M9YA 3W25A 1E7VA 4HYTB 4L5FL 4Z7UF 4CJ1A 3QFWA 1N6VA 2D2CC 3C60C 3QIBC 4BFKA 3ORWA 3QHTC 2ZZ6A 5DMNA 1IC0A 2J55A 4PJ8B 3EMCA 2VDML 4ADGA 5I8CA 5D1ZD 5MP6H 4MZRA 1UEMA 2R2EB 1MHCA 3BQUD 5GGTA 4QXGL 3HUJE 3OX8B 2EYTA 4NI3A 1K4CA 4XBEH 3WHXB 3ZE2E 2IBZX 3B0YA 3M0MA 3NPUA 4Q8OA 1TVDA 3LXAA 4Y9FA 4HKBB 4O10A 5GNYA 4GZEA 4P5TC 2ALRA 1DQIA 2P3YA 8CGTA 3KWSA 3WZ0E 4AVOA 3QDGA 3AITA 4QRPE 2YGVA 2D7TL 3PZUA 3W7LA 2WPBA 2IANB 3DX6A 1NF7A 1PS9A 4L1GA 1NSNL 4QHKI 3C08H 3BPWA 1WFNA 4CCEA 3CVBA 3RP1A 4P23C 2GABA 5DRZA 3VWKB 3PBYA 3W75A 2A9BA 4ZQKA 3T3PF 4ZFZB 4JFYB 1X8CA 4PH6A 3G6AB 1G7LA 3O9WB 1SMDA 1Q6GA 3QIBD 1VJSA 2I5QA 4B3KA 1LXMA 3BXWA 3DJTA 3UDWA 1KM5A 1KDJA 2YD0A 3NABL 3GTHA 3P3RA 1XSJA 4H26A 4P23B 1AD1A 4AEOA 1XGRA 1PW3A 1YPFA 4U6TA 3PQYA 4N2DA 1I3GL 3K3QA 4LVOC 5JOPE 4FA8A 1T03H 4MA8H 2Y7EA 4JQAA 1CGYA 3LLDA 1OEZW 3WDQA 1LEKB 2GVYA 3T3MB 4K5MA 4WCJA 4OZIB 3GU1A 3SBWA 4CMMA 1XGTB 1W8OA 1BAFL 1QSFE 3RX8A 3U6XS 1ONQA 1U21A 1N70A 4G7EB 4GAAA 5B80A 4OZOA 2ZPKL 3QUZA 2AEPH 2WMHA 3T77B 2VO5A 5JORA 1OF8A 4GABA 4U10A 3UGRA 3KVJA 2G3XA 4PJ8C 1YDYA 4M6NL 1WG3A 2P3ZA 4WIWA 4WSJA 1WBZA 1XH1A 4PV1C 5HVHC 5IR1B 1FCCA 3BOVA 1KYOK 1XIFA 3STLB 2ZP0T 1ZEAL 4J3VA 1QNOA 2WXFA 4EE2A 1N4XL 3GZPA 4I5RA 1G5GA 3PXLA 4N0UB 4U1NA 2INEA 1G7LB 3NGBC 4L4LA 5EU9A 3G04A 5G2IA 2BVTA 3JYBA 4G6AC 1WGOA 2K9UA 3K0YA 1G4PA 3QMSA 4R2GC 3U4EA 2EJAA 3PP7A 1M6OA 3FT0A 3G5VB 2DZSA 2ENSA 3T44A 1BYCA 3W1AA 4YEEA 2O61A 1M6UA 1ZTXE 3QCVH 2DLIA 4ECLA 1JQVA 4KWWA 4JJ5A 4B5EA 3TJEL 4OFPA 4P2VA 3GDCA 4NGHH 3LZ5A 3WBEA 2Y06H 4KMLB 3GTVA 4M6PA 4JG1H 1TETL 1Q13A 4PH8A 1DQDL 4L1DA 3FONB 4QRPD 5T1JA 1HC1A 3UCRA 3DETC 4AKPA 3C8KB 3FSVA 4FLRA 5HVGB 5I3DA 2Y61A 5HJXA 4Z7UA 2B59B 4G7YL 3GAKA 4IIBA 3SE8H 3L4YA 4AQ8A 5AHNA 1A6UL 4JHUA 3W1RA 2NXZD 1QFWH 1S9WA 3KWXA 2XZZA 3NEOA 1R5VA 5KSBF 1P2CA 2VEGA 3R1ZA 5TE6H 5D55A 1MAMH 3BAWA 1J1OH 3S6DA 4J2QA 1NGPL 3LIZH 5HI3C 1PZCA 4CN6A 3JWOH 3RGVC 1A6AB 1BPVA 2F7RA 1PFCA 1DE6A 4DNMA 5I71B 3BD3A 4R7OA 5CXPA 5H91A 4JZJB 2PP1A 1CFSA 3W26A 3CSPA 1V0NA 4EZJA 1U4FA 2PCYA 2ZAIA 3EDKA 3QSKB 2MUCA 5G4NA 3KG5A 3S8GB 2NYZA 5DK2A 3E0GA 3N1FC 4MA7L 1KOAA 3VD7A 1FH7A 2QKIB 2JJTC 4FP1A 3MROA 4GRSA 4FYSA 1RBLA 1WAAE 3S6CA 1XTLA 3AXMA 4QYOB 2Z7GA 3TW6A 2UX7A 4XC3H 3TCEA 3SKOA 3WQ8A 1KPRA 3TOPA 3KCPB 4DZBA 3LB6D 2AK4D 4NCDA 4OFYD 1AW2A 4JOMA