4WSJA

Crystal structure of a bacterial fucodiase in complex with 1-((1r,2r,3r,4r,5r,6r)-2,3,4-trihydroxy-5-methyl-7-azabicyclo[4.1.0]heptan-7-yl)ethan-1-one
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
439
structure length
439
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-L-fucosidase
publication title In vitroandin vivocomparative and competitive activity-based protein profiling of GH29 alpha-l-fucosidases.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 158
structure length 439
sequence length 439
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-10-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4wsjA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4wsjA01
1JAEA 3MS8A 1ZB5A 1H0GA 5DEZA 5I2UA 3CZNA 1HF6A 2NT1A 5JBDA 1UR2A 5E9AA 1TQUA 3OGRA 4OUEA 1CECA 5CQ1A 1C7SA 4HP5A 1ECEA 2XFYA 1H4PA 3GM8A 3BLPX 2E3ZA 1V6UA 2C0HA 2WLYA 2VRKA 2WMIB 3D3AA 2D2OA 1HIZA 2FGLA 1ZJAA 4URIA 3RM4A 1W9UA 1XD1A 1OT2A 1BTCA 1DWGM 2D20A 1LF1A 1XSKA 4CU7A 1NOUA 4MNJA 4LGXA 4IPLA 1C7TA 2F2HA 3BAXA 2WHMA 4UNIA 2XSBA 4B9ZA 4BS0A 5E09A 1R47A 4AZIA 2J7EA 5DFAA 1HXKA 4PCTA 1NWTA 3OB8A 1PX3A 4TVCA 4GI9A 4E8DA 1U33A 4A3HA 2QPSA 3WQWA 3ZT6A 5BROA 4HPGA 1NH6A 2EQDA 3GH5A 2ZX8A 4QLKA 1M03A 4KRUA 1B3VA 1OIMA 3GNPA 1EHNA 3L4VA 1VBUA 1UR1A 4AIOA 1Q6DA 4JIEA 3ZOAA 3RILA 4MJ4A 1W9VA 4DM1A 1UH4A 3A4AA 2F1BA 1IV8A 2YL8A 4UFHA 5EMYA 2WC3A 3G6LA 2GVYA 1E72M 7TAAA 5E0CA 4GZEA 1H3GA 3QHOA 1VFOA 3K1DA 3OLGA 1MYRA 4NXSA 1QW8A 4U3CA 2ZUTA 1UD6A 3DX3A 1W91A 3WDRA 5BYWA 4JFWA 1GCYA 5ABFA 3OA5A 2VTFA 2YBTA 1AQHA 4W85A 4B15A 1UKPA 1JZ4A 4MTVA 3GTNA 1UD2A 5ECUA 1MVYA 2Z1SA 1VAHA 2X2YA 2FH6A 5M5DA 1UH2A 4GPNA 4KGJA 1GNXA 2A3EA 2WWCA 4ATLA 5A8OA 3WMCA 3PN8A 4D72A 4UQEA 1V3JA 2QF8A 1L0PA 1KXVA 4WIWA 4MDOA 2WKGA 3VGGA 4UR9A 4J3TA 1UZ1A 2WXDM 1MXDA 2RGMA 3N15A 3RJYA 3OLEA 2VVSA 1UR4A 3WQ5A 1IZJA 1SMAA 1GQIA 1XD0A 1GUVA 2FGZA 1TE1A 4RE4A 3SCNA 1JFXA 3VD9A 2XVKA 2WMIA 4UQDA 2QMJA 4DO5A 3AZRA 4HU8A 4QLLA 4OGZA 3EJSA 1XCWA 3UETA 4ZE4A 1OB0A 5I5RA 1AVAA 5DMYA 2DSUA 3I3BA 1HWWA 1ISYA 1GOKA 3EJTA 3WY2A 2GJRA 3OIHA 2PWFA 2J47A 3DYMA 3H55A 1G0CA 3BUDA 2X2HA 3W26A 1OSEA 1W9XA 3MI6A 4AIEA 3EJPA 1E0VA 3BXWA 1DWIM 1CGUA 3LRKA 3K4AA 4P7NA 3WDHA 4H8HA 4AISA 1TA3B 5IFPA 1CTNA 3BLKA 4F9JA 5M3WA 2WMGA 4GQRA 4Z2JA 2VCAA 1R8LA 3BMVA 2V38A 3L4ZA 2GJPA 4ZXLA 1BVZA 3KEHA 1VEPA 2ZUWA 1CXLA 1UUQA 2DSKA 2VOTA 2W66A 2O9OA 2EADA 2WANA 3KLKA 1ITXA 2X0YA 1R87A 3MUY1 4NF7A 1HKMA 2J7GA 4HMCA 4U2ZA 1OINA 1E73M 2FHFA 1IT0A 1JZ8A 3GH4A 5IDIA 1DTUA 1QNQA 2WHJA 4V27A 1QHZA 3S2CA 1CDGA 2FHBA 2EPKX 2CBVA 1AQ0A 1F4AA 3LPGA 2DT2A 4UFKA 1TQVA 3M07A 4M81A 2Z1KA 1ZL1A 1KXQA 3D50A 5JIWA 4ZENA 3AIWA 3B9EA 4PMXA 3L4YA 4NI3A 3WH5A 1WDRA 1KGUA 1W32A 3A23A 1CLXA 2E9BA 3QHNA 1TFVA 4TTUA 3WENA 4DWSA 1UHVA 3APGA 4EKJA 1X6LA 5AY7A 1XGZA 5I78A 3ARVA 1AQMA 2FH8A 3B8SA 1KQZA 3O9NA 5KEZA 1OM0A 1VFMA 2VNCA 2YA0A 3VDHA 3D4ZA 2YIHA 1V3KA 4WKFA 4CD5A 4XX6A 4HU0A 1A3HA 2YJQA 1BGGA 1H11A 5A6KA 3EDEA 4PMQA 3GXFA 1GONA 5F7UA 2FYVA 2PBOA 5ABGA 4WF7A 5JBFA 3WD1A 1MXGA 1QWUA 3CC1A 2EXOA 1GJUA 4FLSA 3WDIA 3HG3A 4W7UA 3DX0A 1JGIA 3NSXA 5CZKA 1EQCA 3L2MA 1US2A 3CMGA 3WUGA 3KLLA 4B9YA 3PZOA 4XZBA 4UFMA 3AIRA 3DX4A 3GYCA 1SZNA 2CIPA 3BAWA 2O9TA 3VM7A 3AHZA 3LPPA 1E6ZA 3N17A 2VX5A 3A4WA 3AHYA 3VUPA 1R7AA 2BXZA 1ISVA 3GXTA 2GUYA 3A4XA 4M8UA 3ZT7A 3AXXA 4DUVA 2CITA 2PI6A 1UR0A 4J3UA 1BYDA 3I3DA 3FW6A 3NJ3A 4JKMA 5CXPA 3VDBA 3LX9A 2WLZA 2A3CA 4EANA 4GO9A 2VRQA 1J18A 4TUFA 1EDGA 5C8BB 5I0DA 3VKKA 1HP5A 1FP8A 3S5YA 2OYKA 4NZFA 8A3HA 2VCBA 1BFNA 1GOOA 3AIQA 1V0NA 3AYRA 1KWGA 1ISXA 1PAMA 3ARXA 2D0HA 4GI6A 5EFDA 4BQ5A 3AMKA 4UQAA 3W25A 1TVNA 2J7DA 4CN6A 3WELA 1RP9A 1SYTA 3HG5A 3GBDA 1JYXA 4QP0A 1VFFA 4U2YA 1KWKA 4JHOA 1QWNA 3FNDA 1CXHA 1GZJA 3O2LA 1SFSA 1E5JA 4PMNA 3CO4A 3CPUA 3KL3A 4FNQA 2WMJA 2PWEA 3RM9A 3PZGA 4AD5A 3JUGA 3CMJA 1TQWA 4PBGA 4D6IA 3CIVA 1ESWA 3ZSSA 3AQUA 1ODUA 1Z32X 1R46A 3VILA 1E6PA 1R7OA 3RIKA 1FH9A 2G3MA 3IJ9A 1GOMA 1UG6A 2WNWA 2WHLA 1CNVA 2J74A 3CHDA 1KBBA 4AD3A 2FDMA 1V6WA 4FF5A 3WDPP 2PF0A 1QI4A 3B9AA 5LA1A 3ARYA 4NXKA 4WLCA 4Z2GA 4CU8A 3OLDA 4PMOA 5E1QA 4PTVA 1XSIA 3WH6A 3MSGA 1V6YA 4IPNB 3VMNA 2YL9A 1BVNP 4EAMA 2E8ZA 5A1AA 1JF5A 4EK7A 1AMYA 1N82A 2WK2A 2F7OA 1D7FA 3SCSA 3IK2A 3OGSA 3PTKA 4XUYA 2XIBA 3W38A 1J0KA 5E6ZA 7CGTA 3AHVA 3E1F1 3N11A 1MW3A 2J8FA 4W84A 1OGBA 1K9FA 3BH4A 3GXPA 1XH0A 1CYGA 3AS1A 3WD2A 1TVPA 2J7FA 3CZSA 3VGFA 1CIUA 4D1JA 3LRLA 1VIWA 3VVGA 3RM8A 1U2YA 1IZKA 4W88A 5HOSA 3WFZA 3WMSA 1V02A 3NYDA 4PMRA 2TAAA 3WNOA 3F5LA 3W28A 1Q6GA 2J7BA 4CCCA 1J0ZA 1E15A 2BY2A 4GO8A 4AEFA 4AZGA 1UR8A 2YOCA 3MUAA 3BVTA 5D9MA 3EDKA 1XV8A 1JYVA 3W53A 4NRSA 4U5IA 3T2PA 1US3A 2VZUA 1PS3A 1OWQA 5BCAA 1CGTA 1DWHM 2Y8VA 4QLJA 1VB9A 3MMUA 5E0FA 4UOZA 6TAAA 1LG1A 1LJYA 1W3HA 4AC1X 1TR1A 3N9KA 4X0NA 2V5DA 3VO0A 3F5KA 4WJXA 5E6YA 3UR8A 5A6LA 2J78A 4HOXA 4FNSA 1QOXA 2OSYA 3ARRA 4OOZA 2BY0A 4CD8A 5D9OA 3WEMA 3K8MA 5CLTA 1KQYA 1OGGA 3SCOA 4F9DA 4MDPA 3T2OA 1PJ9A 1E3XA 3W0KA 5BXTA 2CESA 4N0RA 2XGBA 3BUPA 4M29A 1JXJA 1UQZA 4W89A 3BVVA 5A8QA 2O92A 3SURA 4UOQA 3WL1A 1R86A 4KH2A 1JFHA 1GQJA 1K6AA 5I23A 1EOKA 2EACA 3SCQA 3ZSTA 2ZX7A 3W27A 2W4XA 3PTQA 3WQVA 4U33A 2ZXQA 2DSZA 4V28A 3BUBA 2WZHA 2WMKA 4NZJA 1V0KA 4PYSA 4H04A 1CGVA 1HN1A 2B31A 4HOWA 2YDQA 4B3LA 5IHSA 1QX1A 3AIEA 2VVNA 3RPMA 1O7DC 1WO2A 3L4XA 1TQSA 4P8XA 4MB5A 3U5UA 4JFTA 1C3FA 1V6VA 2J4GA 5GQBA 5IHRA 3MMDA 3A24A 4Z2LA 2QHAA 4JFUA 2J8GA 3SCUA 4JKLA 1CGYA 4PTMA 1W1YA 2A3BA 4BF7A 1QI2A 3PZMA 8CGTA 1FP9A 4D6CA 4PSRA 1V3IA 3BCDA 3AIVA 2X05A 3VD4A 3CUGA 2DT1A 1E0XA 2CPUA 1EXPA 1ZBWA 3VDAA 4AZ6A 3DDGA 2O9RA 4H2CA 4HPHA 4AZ7A 2XTKA 1PIFA 3RDKA 3UR7A 3SCPA 4B3KA 3WEOA 2JALA 3QOMA 3BCFA 1CXIA 1LL6A 4PRWA 2Y5EA 1YHTA 2F7RA 3NUKA 3GZAA 3W4RA 3DC0A 4D6EA 3MSDA 1LLOA 2C8NA 1E1EA 2GJXA 3ZIZA 4GQQA 2BFGA 3K4DA 4CVUA 4J3SA 2ZOXA 3WUBA 1QI5A 1L8NA 2MANA 3HG4A 3VIPA 3FN9A 4WKAA 2WCSA 1BGAA 1GQLA 4W8BA 2XWDA 2WAGA 4UZUA 1XH2A 1JAKA 1YQ2A 1PBGA 3VD5A 1E70M 1WDPA 3VIFA 1I1XA 3AJ7A 1ZBVA 2EPOA 3EJUA 1BLIA 2HISA 1B31A 4MNMA 4W87A 5JUVA 3WL0A 1B30A 1QNOA 3BUIA 3EJQA 1MWOA 1RPKA 1QNRA 3ZMRA 2EBNA 3ARSA 4TVDA 2BY3A 2EABA 3LPOA 2BXYA 3D52A 3WNLA 2XVPA 1WB0A 2OSXA 3PBGA 3VGEA 1HKKA 1W3KA 1QHPA 2OYMA 1J11A 2PBGA 3PZIA 4AMWA 2QMKA 1ZS2A 3SUUA 4RE2A 1W1VA 2VZOA 2WVVB 2V3DA 3A6OA 1PPIA 4OKDA 3FY1A 1UQYA 3AMLA 2VX7A 1JYWA 1E71M 4MAVA 1GOQA 3D5HA 5A95A 4AXNA 3AI0A 4A3YA 4CD7A 4PMYA 3HN3A 1XHGA 1CXKA 3VIOA 4D6FA 4D6DA 1WZAA 4RL3A 1J9YA 4GZJA 1WP6A 4ML4A 5D9NA 1NQ6A 2VI0A 1TG7A 4DUXA 3NIYA 3BLBA 4LYQA 2EAEA 5A6BA 1WZMA 1JDAA 3BVWA 2YDSA 2GK1B 4UFJA 1S46A 2VRJA 1FHLA 2C7FA 3OGVA 2DT3A 2GDUA 1UH3A 4GZIA 2ZX9A 5JIPA 2YFNA 5A8PA 3DYPA 3VPLA 5LA2A 1HKJA 4PUEA 4CU6A 1WE5A 2YDRA 3NSMA 1R33A 3EMCA 3OLIA 1VFUA 3VGBA 2WZEA 4LYRA 3WQ8A 4AEEA 1ODZA 4F8XA 4XB3A 5GNZA 2J25A 1H5VA 3MANA 2CBUA 3CLWA 1KB3A 3F4VA 5GNXA 1X1NA 2XUCA 2WVSA 5HNNA 1MQRA 2DIJA 3SCTA 3WIJA 2XM2A 3ARUA 1H0IA 3FAWA 4TVUA 5CGTA 4ZE5A 3ARZA 1GQKA 2XVLA 3SCWA 5FL1A 1PZ3A 4BZYA 4WK9A 1UWTA 1B9ZA 2G41A 2D1ZA 4NZCA 1JNEA 5ABEA 1W9DM 4NSBA 1E55A 3RO8A 2VMFA 4ATWA 4JHZA 5A2AA 3EBVA 3AXIA 2E9MA 2GFTA 3WH8A 3TTQA 3CUFA 1VEMA 2YBUA 2ZIDA 2XJ7A 4QFUA 2NT0A 1HL9A 3VD7A 4JAWA 5BRPA 2PWDA 2OYLA 2IXUA 1K9DA 3ARPA 2WKLA 4AD4A 3WMBA 4DWSD 1NM9A 2EPLX 5LYRA 4JCMA 4J27A 1B3ZA 4HMDA 1B3WA 4U5KA 2JF6A 4IUGA 4ACZB 3T0DA 4H8VA 4J3VA 1KBKA 4CN4A 3DDFA 1UD8A 2ALWA 1E4NA 3WF2A 4AYGA 4AD2A 4FNRA 1Y7VA 2JIEA 3T08A 2ZXDA 1JYNA 3UG5A 1XSJA 1WDQA 2JFEX 4P7LA 4XZWA 5A6MA 3ZJKA 4UTFA 1W2PA 2YKKA 3WQ4A 3W6MA 3N13A 1PIGA 2WVUA 2BVYA 2DGAA 3BMWA 5BXPA 2O9PA 1JNDA 2X8RA 5HPOA 2CBJA 4AW7A 1MFVA 5A94A 1E3ZA 1GHSA 3AHTA 4MADA 2D22A 2XWEA 4DM2A 6A3HA 1WCGA 3H53A 3ZO9A 3CHCA 1JZ3A 1W9PA 4PN2A 3AFBA 4OZOA 3W82A 3WD0A 1G5AA 3WY3A 3AZTA 1E4MM 1BHGA 1HVXA 3TA9A 2ZWYA 3W37A 3AISA 4TXEA 2CERA 1X6NA 4OBRA 3ECQA 1Q6EA 1TA3A 2A3AA 3PZVA 4F79A 4CUCA 1WAWA 1CENA 4W7VA 3WNNA 2ZUMA 3VIGA 5CJ5A 1NARA 2JEPA 1KGXA 5I3DA 4M80A 3AOFA 5TD4A 2V3FA 2OW7A 1B3XA 2EPNA 1QHOA 3A3HA 5CPSA 4AYSA 1W1PA 1C92A 3QR3A 1H41A 1OBAA 1HJVA 2W63A 3POHA 1C90A 2PWHA 1FH7A 1EO5A 5CPTA 1KFWA 4Z2HA 1UD3A 3N1AA 3IANA 4S3JA 3SUWA 2Y24A 2YL5A 1ZJBA 3MUIA 1VENA 1G01A 1ZU8A 3CBWA 2QV4A 2WPGA 4V2XA 1M53A 1JDCA 2DQXA 2W62A 2W92A 5A6SA 5LA0A 4FLQA 2DT0A 1CGWA 3M46A 3W6LA 1MW1A 3SIMA 3DHUA 1RP8A 5D9PA 1LL7A 3U7VA 4KMQA 4QAWA 2CYGA 1UWUA 4P8WA 1BPLB 3LXBA 1JG9A 3UESA 4OBSA 2UWFA 3OZPA 1HX0A 4J3WA 2PC8A 4D6JA 1V0LA 2FE0A 2D73A 1W1TA 4YPJA 1JL8A 4U3AA 2RGLA 1DHKA 4HOZA 3U5YA 4ACZA 2F1AA 3BAJA 4DWSC 1J10A 3HU7A 1JDDA 1K9TA 1JXKA 1DWAM 4PMUA 4GIAA 4BQ3A 4GKLA 4FMVA 2BV9A 3TONA 3MV11 3GBEA 3VX1A 2V5CA 1KXTA 3T0AA 4PCSA 4B16A 3TTSA 4LXFA 1PX8A 5DF0A 1NP2A 1T0OA 1ZBKA 2EPMX 5A2BA 1UWQA 2ZUSA 7A3HA 4X0VA 3RMEA 3NSNA 3VDCA 2D0FA 4FLRA 3VD3A 2J7HA 1RD6A 2XYLA 3AIBA 4M82A 2VZTA 1KGWA 1V3LA 1UKTA 1BQCA 2E0PA 2Y8KA 4W93A 2G8ZA 2XVGA 3MUZ1 4W7WA 4MB1A 5DT7A 1QNPA 4RE3A 1JZ5A 1H49A 2VO5A 3VIIA 4MNKA 1V03A 1VJZA 2AAAA 3EJRA 5EB8A 2F18A 1NP0A 4PMDA 2VZSA 1V08A 2J75A 3DYOA 3OG2A 3U7BA 3WF0A 1B2YA 1JF6A 2J77A 2UY3A 1GOWA 1A47A 5HBFA 5A8NA 3WQ6A 3KL0A 4AD0A 1WZLA 5FCZA 2W61A 4PEEA 2BVDA 3SUVA 3NDYA 1QI0A 3AIUA 4LPCA 3VNZA 3AZSA 5EFFA 1XYZA 4YN5A 4R5EA 2ZX5A 1LL4A 2WC4A 2OW6A 3WF4A 5HPCA 4D71A 1LG2A 1QW9A 3BVXA 1JZ6A 3M6DA 4KGLA 1GPFA 3ZJ8A 1FH8A 3CH9A 4MB3A 3FHQA 2WSKA 1QBBA 1UWIA 4JL1A 4BQ4A 4A4AA 2CNCA 3EMQA 4P7RA 4QCFA 3MV01 1Q6CA 1MQQA 3T2QA 3VU2A 1C8YA 3WKZA 1ISWA 1I75A 4CN1A 3VSTA 2YA2A 2D3LA 4TTGA 3CUHA 1EIBA 5IFTA 1H2JA 4AMCA 2Y4SA 3ZR5A 2V3EA 1WKYA 2HVMA 4S3KA 3DX1A 1E6RA 3AS2A 2VR4A 4M56A 1VEOA 2CHNA 4CCEA 3VOCA 3K8LA 2NW0A 2BHZA 4JFVA 4GINA 3U57A 4J3XA 1XC6A 4GXPA 1LQ0A 1UOKA 3CZ8A 4HZ7A 5HXMA 3WH9A 2EJ1A 2CBIA 2WW5A 3CZGA 4DO4A 1WNOA 2DPEA 4J28A 1CGXA 2VQTA 4E4PA 4OIFA 3L4UA 2WMHA 2J7CA 1M7XA 3L2LA 3UERA 5FKYA 4PSPA 1OD0A 1HJXA 5A6AA 3VIHA 4CD4A 1H09A 1E4IA 3S5ZA 2XSAA 1BAGA 1NWUA 4UFIA 4ATDA 1C91A 5GPRA 3EDFA 3HZ3A 2D3NA 1HJWA 4KWUA 2IXVA 1CWYA 4J7RA 1EH9A 2OWWA 1W9BM 2XN0A 4X9YA 2IGTA 4FNUA 1E9LA 1V6XA 4HZ6A 2Y2WA 1BSIA 4UOJA 1M01A 2VL4A 1FOBA 2BNJA 3MMWA 2JIWA 2WBKA 1XRVA 2CXGA 2F7PA 1E6SM 1SR0A 3H54A 1PZ2A 3VMPA 1G94A 1KCLA 3WH7A 2IUZA 3ZJ6A 1BF2A 3CZKA 3KZSA 4UZSA 3WF3A 4AIUA 3IJ8A 5M03A 1DP0A 3S6TA 5A8MA 3VTRA 3FAXA 3VGHA 2WWDA 2WZIA 3ARQA 1WPCA 1V3HA 3N18A 2WYSA 1EHAA 1C93A 1QVBA 3CHFA 1D3CA 1UKOA 2XFFA 2XVNA 5CSYA 1GVIA 3OZOA 3AROA 3PZUA 5FD0A 3SUSA 2OLHA 1EA9C 3W81A 1GW1A 2YL6A 4TX8A 2GDVA 3IAPA 1HL8A 3MO4A 3PHAA 5C70A 4LX4A 3ZT5A 4HA3A 1E5NA 3THCA 1KXHA 4DWSB 2QPUA 3SEPA 4TOQA 3TOPA 3ZJ7A 3J7HA 3LPFA 3DECA 5D4YA 4BCEA 3A22A 3F5JA 5A2CA 2JE8A 4U31A 3D4YA 1TCMA 4UFLA 4QCEA 4CCDA 2BS9A 5AC4A 5AYBA 4IM4A 2DEPA 3O6AA 5KZ6A 1UD5A 4MNLA 4C7FA 1JD9A 3KL5A 3IGUA 1XCXA 2VCCA 2X2JA 3NDZA 2ZUUA 3WD4A 3AMDA 4MAZA 3ALFA 1QBAA 1WZKA 3AYSA 2ZWZA 1PEZA 2EEXA 2FHCA 2JEQA 4CKQA 3FXYA 2BHUA 3CZEA 3AS3A 4C7GA 2A3HA 4FNTA 4UQBA 2XPKA 5IXEA 3CUJA 2X2IA 2J79A 2ZE0A 3WY4A 1R34A 5A6BD 1UKQA 3LXAA 2CCRA 5CPQA 5D8ZA 3A5VA 1FHDA 3WNKA 4Z2KA 3QGVA 3BC9A 1OGSA 2XN2A 2EO7A 1E6XM 1BYAA 1E40A 2CKRA 3KE0A 4HA1A 1TMQA 1E6NA 4JCLA 3AHXA 3HMCA 2XM1A 3LMYA 2CKSA 1D2KA 4YHGA 3N04A 2W5FA 2WMFA 1K9EA 3IJ7A 3WNPA 2E4TA 1QI3A 4M24A 3PZTA 1ITCA 2DDXA 1O6IA 3WUEA 3EYPA 2X1IA 2G3NA 4PMVA 3WNMA 3GNOA 1HJQA 3VSUA 3CZJA 5HDRA 1I1WA 3QHMA 1B1YA 1UASA 3GXMA 2J62A 3DX2A 3BGAA 3PZQA 4D1IA 2ZXAA 1KCKA 3BSGA 4UQ9A 3A47A 4E2OA 1KR1A 4P7QA 4Q22A 4WKHA 3VNYA 1NWRA 2X09A 3THDA 4D6HA 2AMGA 6CGTA 4P8UA 4OOUA 4HA4A 2OSWA 1VJSA 1EO7A 4MJ2A 3DHPA 2VX6A 1VRXA 3TTYA 1B0IA 3WD3A 4NRRA 2DSWA 3SCRA 4AD1A 2W67A 3MKKA 1CLVA 1HP4A 5FIPA 4PUDA 3WEZA 5I77A 1JZ2A 1J0JA 1JI2A 2WVVA 1W2VA 4LYPA 5I6SA 4BA0A 4ZXOA 3BSHA 5FOOA 1OD8A 2YLAA 1V02E 2PB1A 2WSPA 3GXIA 2X0HA 1EGZA 9CGTA 2ZUNA 3LRMA 2BVTA 3IAQA 5FL0A 4JL2A 4IISA 2OWCA 3CGTA 3VGDA 1UWSA 4MB4A 2QLYA 4P7OA 4W5ZA 3D51A 1W3JA 4AZCB 1BG9A 3AS0A 4C7DA 2WHKA 4H8UA 1HJUA 1FFRA 4XV0A 2BHYA 1PX4A 1TUXA 4MPKA 5ABHA 3ARWA 4FK9A 3B9DA 4L4OA 2BY1A 3PZNA 4K68A 5A3HA 1EDQA 3WY1A 3GDBA 1V3MA 2G3IA 1BG4A 1OT1A 4YHEA 2WM0A 2GK1A 1KTBA 1G9HA 1MW2A 2JF7A 3UG3A 2WC7A 1WDSA 1OCQA 2F7QA 2XHYA 5EBAA 1KR0A 1E43A 3M7SA 2WCGA 5JBEA 1G1YA 2VC9A 2VR5A 3BVUA 1UA3A 3VINA 3L4TA 3ZR6A 1MQPA 2VQUA 1EDTA 5CGMA 3W24A 5D8WA 4JKKA 3GH7A 1LWJA 2E40A 2UY4A 3GXDA 5I79A 3N12A 1BYBA 3POCA 4W8LA 1KTCA 3BAIA 3AICA 3CV5A 1JI1A 2D24A 2DH2A 1DEDA 3QOKA 3VM5A 5C71A 3VIMA 2VT0A 5BRQA 1MW0A 2WCAA 3ALGA 3UCQA 4HZ8A 5BXRA 4AMXA 1V0MA 1TQTA 4WSKA 5DO8A 4Z2IA 3T09A 4AY1A 4EE9A 1Q4NX 3L4WA 3BAKA 3AMGA 4QDMA 2ZX6A 4GI8A 1J0HA 3MU7A 5A6JA 4PMZA 3SUTA 1ISZA 2E9LA 2VX4A 3K8KA 2XFRA 1LWHA 4M1RA 2E8YA 3ARTA 1GVYA 4FNPA 2CHOA 3ZM8A 1EOMA 4KRTA 3NCOA 2G4FA 2VJXA 5M17A 2XIIA 4PTWA 4OJYA 3HJEA 1CEOA 5A69A 1HJSA 1B3YA 3LXCA 2PWGA 2NSXA 1NOFA 1CBGA 1CXFA 1XH1A 1E56A 2XG9A 2CEQA 3EDJA 2Q8XA 1U30A 2DIEA 2WVTA 4Q7NA 1E6QM 3BAYA 1MFUA 2DSVA 2YA1A 5AYIA 4ZEPA 1CZ1A 2F8QA 3PTMA 3VSVA 4Y7EA 1EQPA 1JIBA 4W8AA 1XYFA 1VF8A 2CETA 4H41A 1R75A 3W29A 2D0GA 3CZLA 3VMOA 3GXNA 3ZQ9A 4L4PA 2V3GA 3UEQA 4BQ2A 5CSUA 1VBRA 5GNYA 2YFOA 4AZ5A 2VURA 3WDQA 2DH3A 1CXEA 2WB5A 3TP4A 4AZCA 2UY5A 3RCNA 4TX6A 2YLLA 1GHRA 4N42A 4ZFMA 3WF1A 4NX0A 1H1NA 4AZHA 4DO6A 3TTOA 1UD4A 1GORA 4LQ1A 1E1FA 2D23A 2ZUVA 4JZ5A 3VIJA 1HVQA 3HG2A 4WSJA 1FA2A 3I3EA 3G6MA 2F61A 3T0BA 1JD7A 1M04A 3BUQA 4FLOA 4HMEA 3WBEA 3AXHA 1HKIA 2VUYA 3WBAA 1SMDA 3WFLA 2G3JA 1J0YA 1UR9A 4CVWA 5AC5A 4F66A 2OWXA 4UQCA 4R27A 1UYQA 4H7VA 3CUIA 3GNRA 4AZBA 2GSJA 3SCVA 1HXJA 2WBGA 4PTXA 2ZXBA 1HT6A 5CG0A 3WSUA 1BYCA 5BWFA 2W91A 1NWSA 3CTTA 3K46A 1DWFM 4CGTA 3FHAA 2GJXB 1GOIA 3PZ9A 1DWJM 1E0WA 4AWEA 1QPKA 4P8VA 3II1A 1P6WA 1Q6FA 1HTYA 5DT5A 1J12A 4ACYA 5E70A 1OIFA 5BXSA 2AOSA 1UKSA 5I24A 4W5UA 3VIKA 3A21A 3VX0A 1J0IA 1R85A 2ESCA 3OBAA 4HTYA 1B90A 4W86A 3KWXA 4CD6A 2ZICA 3WN6A 3TV8A 2VZVA 1E4LA 1O7AA 3WUFA 1UWRA 3AMCA 3EDDA 4D6GA 1FFQA 4JFSA 1C8QA 3UG4A 1W3LA 1UA7A 4UCFA 1J01A 1NOWA 5ABFB 2UY2A 4E8CA 1RH9A 2XN1A 3CHEA 1CPUA 5CLWA 2XGIA 1ZBCA 1C8XA 1HNYA 1F4HA 3RJXA 1QNSA 3EMZA 1TZ7A 3WDJA 4DUWA 1JZ7A 1UZ4A 1GJWA
chains in the Genus database with same CATH superfamily
1N59A 3SPHA 3MS8A 3N1FC 3RZCA 3LKOA 1K6QL 3IMBA 3RPBA 1SXCA 4GEJA 3TN4A 3BLPX 4A2LA 4YNGA 4K7VA 1DBBH 3WLJA 4PRIB 1DVQA 3G22A 4LCIL 2JKXA 1TJGL 3QUMH 3L3GA 4P4RA 2EC9T 2EVJA 3MNWB 4HCHA 3TAOA 5EU3B 3GVWA 2D20A 4JHWL 1NOUA 1WF5A 1TQBB 2ZSWA 5ID0A 1C7TA 2DMKA 2J7LA 2WHMA 1JFQH 3UG8A 5E09A 3VRLF 4EXKA 4L0YA 1IAII 1SR9A 4ODVH 1XISA 2WMPA 1OGAD 2KI6A 1MFAL 1QWGA 3PBUA 1QBMH 1D5XB 3WHXA 3KBPA 1NFPA 2ZVRA 1S7XB 3NABL 5MENA 4GSDH 4MJ4A 3MNVA 4OJEH 4WCJA 3OXSB 1IEAA 3LQGA 1GGCH 5E0CA 3TBVB 1DIOA 3NURA 4NQEE 5D7JB 1B3OA 2BVOA 2OMYA 5EO9A 3HBGA 2NY6D 4G9FD 2ZP9A 3O6LH 3HC0B 1PG7W 1UH2A 4I87A 2ADAA 4HJWA 1L0PA 2FQIA 2PW2B 3T65B 5HYSB 3AG4B 4J3TA 1MXDA 1XEDA 4CQBA 4DWDA 3GSWB 1CI5A 3Q37A 2F7FA 2WSYA 4LVOB 3C75A 4LEEA 5DMYA 1W8OA 1BBJA 1BAFH 3LNFA 3F7KA 3BTNA 1KV7A 2GGEA 2P5NA 3MI2A 3DYMA 4X8CA 3S83A 4X5XA 2XTJC 1E0VA 1PY9A 3SSGA 4H01A 2A9NH 5DJ8B 1TA3B 1ZVYA 5M3WA 2WMGA 4MXVE 5BO0D 4G6KH 4UOW1 2R2EA 3C12A 5DFVD 2WW8A 2ZUWA 1A5NC 4PRRA 2GJ6A 2C9VA 2X0YA 5F1IB 4XTDA 1SJBA 4HUCA 4TS6A 2CA4A 1EEZA 4WIQA 4JFDE 4N02A 4UNTA 5K59F 4DBEA 5JHMA 1EUUA 5IW1A 1JRHH 3FT0A 1NCUA 2C34A 4RZCA 3B9EA 3FF7A 1WICA 1O94A 1KGUA 4UNVA 4XCEA 4JGJA 3FUJA 4NO3B 2IPGA 1AD9B 1C12B 2JKLA 2HE5A 1W15A 4Z0XA 1G6RH 3KPMB 1OM0A 3RX9A 4JFQA 2KZBA 2BNRD 2IV9A 4OJFL 4MAYA 3M5YA 1I85A 3NEXA 1JZIA 2YD7A 1UBSA 2Y6ZA 3MZTA 4ZMGA 1YY8B 2QQLH 3URNA 3UIYA 2VDRB 3W2JA 2CUIA 3H6JA 4WF7A 2Z7GA 2ACUA 1KXTB 4KKCD 3V4PB 1LL1A 5E1GA 4NKOB 5F8RC 3GUFA 3X17A 1H61A 5EF1A 1OWWA 5K9KB 2X9ZA 1DE5A 1VYRA 3N73A 2B4CH 4H8QA 2CM6A 1LEIB 3P14A 4GX9A 5H37A 1NCAH 2YARA 4M8UA 3ZT7A 1E8WA 4IXXA 2ZRWA 1BYDA 1U4EA 1UWAA 2VRQA 2AERT 1FZOA 2BDQA 3MOAH 3HS8A 1VQTA 2XBDA 1U8HA 3F64A 3OVUB 5F7YC 3HPLA 5AVXB 1JYXA 4OF6A 1KM2A 3EO1B 4L4TB 4L4JA 1LO2H 3S1VA 2GTWB 4RX0A 3QHZH 1A6ZA 4MA1C 3MYPA 2ZDSA 5ANME 5F7FA 4BR1A 2QVHA 4Q32A 1E6PA 1R7OA 3PFUA 1KELL 3S0CA 3GSRB 4PODA 1KULA 5E8NA 4WJ5A 3NPVA 3LY6A 2CKBH 5K1JA 5IOPA 3SHSA 4O2FB 4F8PA 1Y5WA 1R3HA 2Y70A 4LUSA 2YAEA 2BM3A 5K93A 2F0CA 1MW3A 4PWFA 3F7VB 4Z7VF 4OCWL 5BS0D 2UV8G 1PXGA 4KKNA 4Y8AA 4AWTA 1AO7A 3GS7A 3DIDA 4KVNH 3GIVA 3B2DC 3V0SA 3GSOB 3F5LA 3BQUD 4AQOA 1GGTA 4HOMA 1XFPA 5D9MA 1D3HA 3W53A 1OGAB 3QG6B 1A5FL 1A8ZA 1QFWM 5B38B 2CIIB 4QLJA 4X8XA 4EUPH 3Q8CA 5JLZA 4IT1A 2YGVA 1QOXA 2OSYA 4K73A 3CHVA 3ZU8A 3NGJA 4L9DA 4C6LA 4I7WA 2O92A 3JZUA 3RFZC 5U7SA 3NQCA 1EOKA 4G9FB 1YDPA 3NIGE 3PTQA 4U33A 3Q67A 1Q2SA 2WMKA 4I9TA 5GIRB 1WH0A 1OAKL 2W0UA 1O7DC 3GIZL 3L9YA 1ME7A 2PPGA 2KKQA 1TQSA 3PWJA 2G75A 5D9SB 5EPDA 3UXDA 3KCPA 5CD3A 3H4XA 2Y61A 1CGYA 1W1YA 1DVUA 3BCDA 4KK9D 3VD4A 4PFHA 1OAJA 2NZ9C 1UB6B 5CUSH 4QKTA 3DDGA 4GY1A 4N25A 5GSVA 3GRBA 3VC5A 3G04A 3BUVA 5IW6B 2HRPH 4PRWA 3VACA 4W81A 1DHPA 4NQDE 4GQQA 4JBRA 5F71A 1PG7X 3LN4A 1E4JA 1UXSB 2PCFA 2P5ED 1I1XA 3V0EA 3AJ7A 1ZBVA 5E1HB 2MOVA 3MV7D 2HISA 5IHZA 5JUVA 5KSAA 1Y0LB 3UTSA 2ZOLA 3QFJD 3PHOA 3I7QA 4V2BA 1PG7L 1KCZA 4TQPA 4CQAA 2BTMA 4GUPA 4WO4D 4BI7A 3NZSA 3UCCA 1N2RA 5HNUA 1YECL 3BICA 1EAOA 1CQKA 2H32H 5AECA 2V3DA 2BNRB 3D85A 3WBYA 3WHE1 1U5VA 3KBFA 4LLDB 1SGJA 5LJYH 5FYKH 5BV7B 1MCKA 2X1OA 4RL3A 4M00A 5GS0L 1NC4A 3W7DA 3BLBA 3SDDB 2FYMA 3QFEA 1I7UB 3LZNA 4PC8A 3SDAD 4JTAA 4XTRC 5E2TH 3JTTB 2DT3A 5DRXA 3TE9A 5KSVB 2YFNA 4XCCH 3GTTA 5F1OB 5ESVB 3V5HA 2NXIA 1YNLH 3LB6C 1SJVA 5ICZB 3BESR 3TFBA 1ZXQA 1SM9A 2LU7A 3GJFK 4MS6A 4GAAA 4M4RA 1N6UA 3ARZA 3W7KA 1MFCH 1T0MB 2GGJA 2G41A 3RYMA 3IJHA 1P0KA 3FU0A 5DQ9A 4ERAA 4XMXA 2FFCA 4NZDA 4ATWA 3EYOA 3WH8A 3DHMA 2QS8A 4ZRGA 2P26A 1Y6KR 3CUFA 3RWIB 3BCJA 4P2QA 2XJ7A 1XXDC 5HMSA 1YMMA 2WKLA 3NJKA 1VGAA 4JTCA 4HMDA 1CBVL 2ALWA 4L8BA 1BZ8A 4ENEC 4U7MA 4XP4H 5JA8B 3G6JB 4OCYL 4XZWA 1UWGH 2R59A 1BZOA 5AN7A 4PLKC 2A4CA 4ZMNA 3N13A 3CSPA 5I1KH 4G82A 2MPVA 4GG6A 1K8DA 4TPRL 4YQXL 1MFVA 4FXLA 3QRLA 5IZ7A 1DL3A 5BS0B 1RPXA 3AHTA 4MADA 1Z9MA 2VYOA 4RCAA 1F05A 1SHMA 3BUYA 5IFAL 4KQ4L 3W84A 4OZOA 3Q58A 5D4QA 2VM8A 3TA9A 3BQUB 3ECQA 1X9LA 3CFCH 2A3AA 3X3FL 1T0NA 5DN1A 4QHMB 1CENA 3U2OA 3QUXD 1VR6A 4JR9H 4YSOA 4DAGH 4DJDA 4NJJA 3A3HA 4JTKA 2QGCA 5E99H 1UCWA 5EFIB 1L9NA 3WK3A 1U8JA 1ZLWK 3MLVH 4L4MA 1VENA 4JIPA 3FNKA 5G2HA 5AB1A 5C0EB 4C6BA 1NKRA 5E00A 2R39A 1ADOA 5A6SA 4MLRA 1MW1A 3UWQA 4DZHA 4QAWA 3RURA 3AUWB 4HEMA 3QXAA 4S2BA 3B8UA 2PP8A 1XF1A 4POUB 2W65A 2RDWA 3U6XS 1KTLB 4EE2A 1FFTB 4OVVA 1LD9A 4I8YA 4X5WB 4TNGA 4EWJA 3OF6A 2IKGA 3WIHL 3GSNL 3NZRA 1WWCA 2MNJB 1VPOL 5SX5H 5CHNA 1NVMA 4HV8B 1N8ZB 1H49A 3JVAA 1LO3L 2AAAA 3TA3A 1V08A 1A3LL 4GIYA 2V82A 2E5BA 1A47A 3QH3A 3WQ6A 4ERIA 2NDFA 4OT1H 3B37A 1UZGA 1WBZB 1XHHA 1XCFA 1WXZA 2EVHA 1QFWH 4DKEL 2A6JB 1LG2A 3DBXB 1P1VA 4NJAH 3DPDA 2P5EB 2ZKYA 4P7RA 1MQKL 3E0GA 5JHDA 3PDDA 2OZ4H 3MV7B 4Q8OA 3GO1H 3BE7A 2VP8A 4ILSA 4EN2A 3QFJB 4Z1AA 4A63A 2ZKMX 1LRNA 4GMTL 1RIUH 4A2HA 3C2AL 5IHUL 2D3LA 5BNXD 3CUHA 3TYAA 4WO4B 4AMCA 2G0WA 1NQKA 3OIXA 1AS6A 4LUYA 1PGRB 2FNBA 3IMTA 4WWPA 2LU4A 4NM4H 1QVOA 5TE4H 5EYWA 1NIDA 1KBWA 5M94B 5HXMA 5I1EH 5FGCE 3E2HB 2WW5A 1TJ0A 3FCBA 3N40F 2J7CA 5C7HA 3H2CA 4PSPA 1QRND 1D5IL 4G8FA 4PCKA 2V9TA 5DJXB 3IIVA 4WW2C 3SDAB 1HJWA 3KOFA 5I1AA 5HYSG 4HSOA 3L9RA 2IXVA 2OWWA 5HVHC 2IGTA 5IMMB 2X41A 4ELDA 3KLDA 4JS7A 4HZ6A 1V6XA 3VTAA 2EHHA 5E9DE 1IEBA 4N90D 1BF2A 3WFEL 4KJYB 4RNIA 2D31A 2WZIA 4YHML 1CF8L 4RBPH 3CHFA 2PWVA 4PTNA 2XFFA 4JZJA 4H5SA 3S9DB 2UY7B 1GZGA 5E5UB 4IBLT 5J1TC 2E46A 5HQMA 1TKKA 1Z9NA 3BP6B 5GZNA 2H9AA 1VHNA 4LEQA 4LLWB 4WOZA 3F85A 1DBBL 2WQWA 4XBJA 2XV0A 5TQ2H 3A22A 3UYCA 4O00A 1DQUA 1E8YA 4GH3A 3KAAA 4J8QA 4MNLA 1XTLA 4M1DL 3I75A 3G5YA 4BH8A 2AQ3A 1OFBA 1J79A 3UZVB 3PPFA 2APBA 2NV9A 2EDXA 2V7HA 1J86A 4HZLA 4IOTA 4ODVL 4I9WE 4KX7A 3HPZA 3RR4A 4DUOA 4DZAA 5DTFB 1QBML 5F3HA 5A6BD 3EYFA 4PBDA 1T3FA 3ABKB 5E8DL 2AGJL 1BIIB 2GUOB 4DYEA 5LXVA 2Y8UA 1JPGB 3KE0A 1TMQA 3UROR 4FI6A 3GR7A 5K39A 3THMH 3OVGA 4ZOAA 1NANI 2CKSA 4NUGH 3EYVB 3QUXB 1GGCL 5T3ZE 3S96A 3N1MC 1OF6A 2ITCB 4W68A 2A5UA 2ITDA 5I6PA 3GNOA 2RHGA 3VSUA 4MZ8A 5HDRA 4QF1A 1T22A 3TJLA 3SCMD 3O6LL 2DQCL 3P93A 3FJTA 4PLOB 4D6HA 4P8UA 4N0CD 4XB7A 4NRXA 2ADFH 3UPBA 5F3BA 4U3SB 3EKGA 5AHFA 1QRKA 2Z7KA 1PYWB 4WZHA 3MJ9A 1BX2B 1GHFL 3C5QA 3W2DH 2HJPA 4EPEC 1EVTC 2J5LB 3N4FA 4DP1X 5FOOA 1JE6A 5IFJA 1B4KA 4XMPH 4MA7H 4ROPA 4QITA 3GXIA 3IDJA 3MI3A 4KEZA 4MNGA 3PC0A 4BK4A 3LRMA 2CWRA 3S47A 1BAFL 4X6DB 2NOYA 3CH1B 3PQYA 4PV1C 1M65A 1AJ0A 5CBEA 2X6CA 3H4FA 4MF4A 2GEEA 2JB6B 4JVWA 4POYA 1T04A 1A22B 3BLFA 3D48R 3PB2A 3ARGD 4G6KL 4WO0A 4TTDC 4UNUA 3X13A 1EDQA 1V3MA 2G3IA 2Z00A 1E51A 3FO1B 4L4TE 2VH5H 5FGBA 4PJ6A 3PNUA 4W6WB 5DURD 3NN8B 4NQED 3BVUA 3RWFA 1D8CA 2Y3AA 5IR1A 3H1ZA 3VI4B 3ONBA 1M6OA 2F5BH 3ULUC 4HAFA 1FL6B 4Z0BL 3LCYA 4QOKA 3D4CA 1J5OL 3ZIYA 3AICA 4OI7A 5DRZA 1UVQA 2M8XA 1X7FA 5AHLA 3UMNA 2MSPA 4FFVD 3N0AA 4ADTA 4AMXA 1N5AA 4JQXA 4KV5F 4WV1C 2EEFA 2VISA 5DELA 2PR4H 4P46D 4ZR8A 4MX7A 4TUKH 5B38G 4Z17A 4PV9B 1AGCB 2G4FA 1FN4B 1MY7A 1ZSDB 2D8KA 2N7AA 5A69A 2NSXA 3DHDA 1F3EA 1U30A 3XIMA 1MEHA 3D08A 3KLHC 4AEHL 1XGTA 2B4CL 4W8AA 4EDXB 5ETUB 2VXVH 2ZP8A 4WKZB 1F4WH 2F54D 3LQZA 5D30A 3VGAB 1RCQA 2E27L 4HJTA 1AZ2A 1XLDA 1Y5VA 2YFOA 2F38A 3Q94A 4LAQL 2OK0L 1EP3A 4LQFH 1OGAE 1AD1A 1QRNB 1WC7A 4HUVA 1BMWA 1JV2B 3LB0A 3TGXA 4IU2A 3RMJA 4AGNA 2MTPA 3GW3A 4QYOA 2VUNA 4YDLC 5C0FB 3GB7B 2AXFA 1T4KB 4PG2A 4DIXA 4UUJA 4PVMA 2VUYA 1N8WA 3DROB 2MHAB 4X4KA 1LO2L 1FNSH 3SO5A 3BPNB 3QHZL 1Q9LA 3GNRA 2N4IA 5B3SB 4G9FE 4CC1A 3STLA 5BMFL 2NQ3A 1KBGH 1P6WA 4JJ5B 2NPLX 5AOKA 1NSNH 4QXTB 3RWDB 2VMEA 5I0WA 3IMUA 1GOHA 4LOFA 5CBJA 3LD8C 1RK7A 1SN5A 3LHTA 3O0RH 3OGOE 3WUFA 1HE7A 4KBXA 2CKBL 5A2JH 5HHOB 2X40A 3ZRSA 3X1FA 4Z8FH 3IETB 4L9LB 5EO0A 1ORQA 4W4QA 3RJXA 3EGDA 2C9PA 1DQJB 3U1SH 4RMTA 1JZ7A 4C60A 1MXSA 4KVNL 1ZB5A 4QSFA 2PDBA 1R5WB 1G1CA 3RUGF 4KO9A 1PZCA 4GSQA 3LKQA 5DR5H 2J3SA 4ILDA 3O4OB 3ELQA 4G1EB 3ZVHA 2FGLA 3QDJD 3IDNA 4URIA 2QSTA 5AVVB 1FCGA 2H0PA 2FJSA 3CK5A 3P0WA 1LQAA 3BAXA 3KOXA 1NDMA 1P1MA 4KIEA 1U92A 1Q2RA 4NYYA 2OXHB 4JFOB 2VFIA 5MI0B 4UR8A 1MHCB 3GUGA 1NQBA 4QLKA 5B4MC 3SCMB 3RHWK 2APXA 3FJLA 5H1WA 2FSEA 4MD4B 2XG4B 2PRHA 2X4TB 1UH4A 1YMYA 3COOA 2GVYA 3W72A 5LQBH 5GJNA 4M7JL 3OLGA 3WJJC 1QW8A 1H5BC 4QHNB 1GKRA 4JMNA 4LL1A 4BQ6A 2H2SD 5IJVB 5ECUA 4N1EA 2QCFA 4ZMWA 5CUSL 4YVVA 4JDTH 4ELMF 2HRPL 4WKXA 3VFRB 1A3WA 2IKHA 4HGWB 5K4ZA 2XQYA 3QR0A 4EI5A 2KC0A 4EN3A 2CGYA 2EKCA 2QMJA 5JO5B 5EZJA 2ZCHH 3X1EA 3M86A 3JT0A 4X22A 3IS1X 4IIBA 1MDTA 5DURB 1DVTA 3X1NA 4NQEB 4RKAA 3EOAA 5I66A 4ZUTB 1V4YA 5FF0A 5DS8B 3BV7A 4E9VA 4PRAA 1A6TB 1JPKA 4UTBA 1QPPA 1OP9A 1E28A 5IFPA 2OFQA 5JNYB 1RSFA 1JVKA 2R9HD 2WWMC 3OB0K 1Q94A 1A6WL 2ATPB 1BWLA 4JK0D 2BC4A 3UR2A 1BWMA 1RIVH 1PW3A 1ND0A 4WJEA 4K8RH 4K7PH 1WFIA 4XAGA 2Z91A 3F12A 4HDIB 4P46B 4PBWD 2ZZ5A 2YUVA 5FYKL 3QQDB 2IPJA 4N0YH 4I0CC 2I26N 1IBZA 5BS0E 3LUTA 4MZYA 1NCJA 2RTTA 3ULSA 5C08D 3D0AA 4FMKA 3BW9B 4LSQH 4FZ8H 4KS0A 5I78A 4PRPA 3ROOB 1VFMA 2FAUA 1LT7A 3VDHA 2RFXB 3VFWA 1MHEB 4NQDD 5E2TL 3MSRA 4X6EA 4KETA 2F54B 4KZCA 1R6VA 4PMQA 3GXFA 2PBOA 3W23A 1YRRA 3HTLX 1IXOA 3MJ9H 3RPIB 5BOFA 4LLVA 3LEYH 3D5OF 3CMGA 3NH7L 2YD9A 3FTUA 2HYMA 2ZRZA 1NC2D 3IVKB 4I5XA 2O9TA 1DE4A 2DP3A 1R3IH 1XF2A 3M5VA 2F74B 3M0HA 4M5PA 4DX3A 4N1CA 1MFCL 1YBQB 4JPWH 1WEJH 1JBJA 4CNUA 1CVSC 1N4XH 3VDBA 3VTMA 3PG9A 2R8SL 4BFEA 1CT8A 1LQBC 1UG9A 2DEYX 3MRMA 5HYEA 1BQ5A 3KHOA 1UXWB 3ARXA 3BZ4A 1PCWA 3PREA 3TEXA 1P6FA 3IJSA 2B7QA 2G37A 3QJTB 5DC0A 4Y89A 5EZOH 2EUVA 4U2YA 2RKXA 3KUMA 3QI9D 2QDHA 4QEGA 1X7QB 1UWGL 2FWUA 3SRFA 1H3TA 3EXJA 5BMXA 1OK8A 4L8SC 1E2WA 3EJZD 5I1KL 1TQXA 1I0DA 3HI5L 1EUTA 1VGEH 5E6UB 2BW5A 5CU9A 3KOYA 1UG6A 2WHLA 4OW6A 1LNUA 1CICA 4CVXB 3Q45A 3L6FB 1FUNA 3DKHA 4MYAA 4G1MA 4MS8C 1IE7C 5ICXB 4WNQB 2HCVA 2GVGA 4IPNB 1BVNP 2D03L 4IIGA 3CFCL 4WEUD 4JPIB 3PTKA 1WWBX 5IG7B 4F20A 4Q9RH 4JR9L 5FF3A 3RTQA 5F2LA 4DAGL 3QDJB 3QJOA 3MV7E 3BH4A 5ANMB 2C3VA 4M7LT 1W3IA 4YDKH 4D1JA 5HOSA 3MLVL 4XXCA 1PZ0A 3WMSA 3O8XA 3CQKA 4DKAA 4XMLH 5D04C 4YHZL 4GO8A 4PJEF 3QUYA 1XV8A 1JYVA 3SO3C 3BOVA 3TLLA 3S4SA 3UAJD 3HN8A 2ZOUA 5D2NA 2Q7YB 5BCAA 3GRGA 4AQLA 5CG7A 5EO1A 4LPXA 5TK2A 4OUUB 3F5KA 2C1PA 3AB0B 3DI2B 4HQVA 3L5JA 3NTCH 1RK1B 3UBPC 5F9WB 4A3RA 1T80A 1OC7A 1PJ9A 2AQSA 1E2ZA 2JJVA 2WQPA 4Q8VA 3D34A 5A8QA 1HFUA 3FYYA 3WL1A 2QDEA 4Y1AA 3ZSTA 1E8XA 3LG3A 2WXOA 3MGTB 4PYSA 5TF0A 2VLJA 3QUMA 3RWCB 5EN2B 1S1PA 4LV9A 4G6AD 2Z7UA 3NO1A 1XYMA 5C0DA 2VGBA 2NY2C 4OT1L 4N9GB 3PL6C 2J8GA 3RX3A 4JKLA 2GYSA 3TPUA 4FYTA 2DQTH 1QFWL 3HB3C 4GG8A 5F9JB 3MXVH 3QUZA 4X9HA 3MV9A 1P1ZA 4ZSUA 3H4GA 4AZ7A 3GO1L 4B3KA 1PE1A 2D9CA 4HJ0C 3QOMA 4UQ2B 1CXIA 3Q6FA 3TVMD 5JW4M 4U6XB 2DMGA 1TMHA 1RIUL 4XTIA 1X5IA 1FYHB 5JZ7D 1PUDA 1ZK5A 3TL5A 5EBUA 3VIPA 3I6SA 5BW7A 1BGAA 1KTKE 1FVEA 3LHPH 3RVXD 1PBGA 3JUYA 1IEXA 1ONQA 1X4YA 1L9WA 2DQJH 1FWJC 4V1DD 4G8GE 3BUIA 4XO5A 4UMSA 3I68A 4KROD 3B9NA 4Y4HA 1E5YA 2Z27A 3E3QE 3VGEA 2WBXA 4Y5XA 2XDHA 3TYEA 5C08B 4Z77B 1ZP3A 4NZ4A 4BFIB 3V16A 1P4IL 3AWNA 2BVPB 4JR5A 3QDHA 2YQGA 3ZDYF 1OCNA 4PCYA 4IQDA 2FGBA 1V6TA 4NQDB 2ZF8A 3L0NA 2NY4B 3S34H 4NZ1A 3BIBX 3AI0A 4A3YA 5DMJB 1H7RA 2R0WL 1F7BA 3C8HA 4WUUA 2Y7FA 4GMSH 3BT0A 1EGJH 4EOWL 2NZ1A 3B0VC 1NC2B 4RRPG 2YEVB 1K6WA 3K4ZA 1USQA 5AVWB 4PH6A 3L8QA 3P69A 2VRJA 2WOYA 3VXSD 3OGVA 4OUIA 1I7ZB 4X60A 4RQQA 2BOCB 4F4RA 4KMLB 5LA2A 3FU8A 2DKSA 3FQRA 1I1AC 5F0MB 5EPMB 2XBTA 3V75A 4UTCA 4PN6A 3C09B 3AQDA 3EYUH 2VMJA 3T3MF 1G9NL 5GNZA 1AH4A 5HY9B 3H9SD 1P69B 3H2AA 1S5MA 3CQPA 4G8AC 4KT2A 4JO2L 3V5KA 4Y5VC 1NCBL 1ZHBB 4WU5B 2HKFH 3A67H 1YC8A 3BVNB 2J6WA 4Y7MA 3QI9B 1OOAA 4WHYG 3Q43A 5TQ2L 2V2TB 1GZQB 3ZTNL 1G6RA 2MNWA 1JNEA 3R0MA 4J3OD 2BFVH 1O68A 2WQAA 3PTDA 4JBSA 2HX8A 4J12A 2YR1A 5E9DD 3MMEA 2FGWH 4JCMA 2W79A 4US5A 3DDFA 3VVVA 1W1IE 2GYIA 2KZHA 4RZ4A 2OL3B 4P7LA 2YJLA 5A6MA 1AI1H 4LVNB 5HGDA 3U25A 3W6MA 1PIGA 2NQCA 3SD2A 1P4BH 5C0BD 5FO9B 1AGBA 4WI2A 4AW7A 1QK0A 2OTDA 3QC5X 2XWEA 3GMOA 3WK2A 4L5FE 2FIRT 1SXZA 3W7RA 4HIQA 3UZEC 2ARJA 3S2MA 2C9AA 1BHGA 1U91A 2EDNA 3X12A 1ZJHA 2PA6A 4KPHL 3AU1B 4HU4A 2X4OA 2BS71 1SYVA 4B5NA 3Q6GH 5FB8A 3PZVA 4W6XB 1SOKA 3GTVA 2OLSA 2OU4A 1WA2X 3W2DL 5DUML 2EPNA 1U95B 1RVFH 1W1PA 3QLLA 4LCCA 2H3KA 5FA3A 4XMPL 4MA7L 4TOYH 5CPTA 1QMLA 4Z2HA 2HNHA 2ZOOA 4IKJA 3M5ZA 3PJXA 1M7IA 1E2VA 2HT3D 3KTXA 2HT4D 4LESA 3O3AA 3U7VA 3O7UA 2CWNA 1UWUA 2IAMD 4P8WA 2CKBA 3WK1A 2DY3A 3LXBA 4B4FA 3DSNA 1BMZA 4RGMC 4AFYA 4P2RD 1ITQA 1JL8A 2WKOA 4U3AA 2ANUA 2VH5L 4MVBC 4HOZA 4HBCH 3BAJA 4U49A 1J10A 5F9DC 3NGBB 4GAJH 4YFLI 4N90E 1KT2B 4GS7B 2F5BL 4X0VA 4WI0B 1K8YA 1ZJIA 4FFWC 4X99B 3C8KB 4YSTA 3VKBA 1UEYA 4MNKA 1W3TA 2AEPH 4PMDA 1DVSA 4Y8DC 5KW9H 3SKOB 5BZDA 5J1AA 4XNUL 1VCGA 4I9JA 2NW3B 1WZLA 5HHOE 3TVMB 4Q8UA 2VOMA 1N8OE 5AW0B 4WXYA 2WV3A 2JBMA 2Z64C 3UF9A 4L29B 3VI3F 3QYMA 3MCKA 3DRTA 3HGJA 3MO1A 1I1FB 3WLSA 5EMKA 2WSKA 1QAWA 4DGWC 4W9CC 1Q38A 1AZRA 2QR0A 4HEPG 4HYVA 4Z78A 4C6EA 4V1DB 2VXVL 2R1YA 4HIIB 1XAKA 4KROB 3NG5A 3N55A 1MCCA 4LQFL 4P23C 2BH0A 5FCSH 4JKPH 4RDWA 1G4EA 4S3KA 3LKRB 4M56A 1SFJA 4B5EA 1AQDB 1UOKA 3T4YB 3EWBX 1H7NA 1YN6B 5HGBA 4DO4A 4UIKH 1MQ8A 1BPVA 1BLNB 3C2EA 1TFHA 4QCIB 1FNSL 1FI8C 4Z1CA 4NJIA 4N6QA 3BKJL 3P11H 4PBVC 5IUCA 1TZGH 1E4IA 3HG1D 1YUHB 3LNHA 4FXGA 2NNFA 5DEGA 1NELA 3SKMB 3INOA 1HHKA 3VXSB 3BH8B 3HE7A 2CAKA 3KCLA 1SJHB 4AVHA 4UOJA 2JIWA 2BZNA 4YLCA 2WYIA 1TIMA 4P3WA 4XZUB 4LHUG 3G2GA 5FGCB 4GK8A 2BB0A 4YK4C 3H9SB 4H25A 3UJSA 1EAPA 2VQ1A 4Z8FL 2VSKB 2G9HB 4AIUA 4QIRA 5J8LA 3MDUA 2VCOA 2H32A 2WINA 4OGQC 3WXWH 3VYLA 1I1CA 1CLZH 2VLKA 3BIAX 3LCXA 2WTOA 2NR6C 3AACA 3S8WA 2QQ6A 4CEXC 2IH9A 2TMDA 4H26B 2OELA 5E8OB 5KSBA 1GW1A 5BUGA 3CFQA 3RUBL 2E67A 2ZKHH 1MREH 5E9DB 3CJJA 3TBWB 4MY9A 5HJBA 2WLJA 1U8CA 1NAMH 2PDNA 5F6IB 3VOIA 2HUHA 1PDKB 4E5TA 4FYRA 3V2AR 5C0JA 1BKSA 3RK8A 1Q0XH 5HDBE 2BCKA 4DBSA 3ALPA 5C0BB 3WD4A 2BGSA 1WZKA 5HDOA 3JV4B 5DMGC 3L3DB 1CDCA 2FHCA 4NUPA 2A3HA 1CMOA 3APCA 5IXEA 3FK4A 5AKVA 2FEDD 2X2IA 1WYJA 1UKQA 5C0GA 1E9QA 2AJZB 1P0SE 1EGVA 3L3KB 4OZFH 3GMQB 3QDMA 2F8OA 1BYAA 2KH2B 3QFDA 3Q1SH 2OJEB 2YCIX 3QCUH 1ZLUH 4WW2F 2W5FA 2AKRB 2W9DH 2DZXA 4B0MB 5LQBL 1WCBB 3ATFA 1WA0X 2WLIB 1QNZH 3ASNB 3MBEA 3NSCA 3GXMA 2F54E 4U1HA 3IJYA 4YL4A 3MYJB 2VITA 3QIUC 1ET5A 1KR1A 2OP4H 3ICJA 1S7QB 1XBYA 4RNFA 2O6DA 1FCCA 5CD5D 4RIRA 4JDTL 1H1YA 4U1GC 5CAHA 2IAMB 1MFMA 1LE9A 5HJGA 4P2RB 1W2VA 4KKBC 5J6GB 1S8DB 3PU7A 2EXYC 1FYTE 4KH9A 1GH7A 3EBAA 4I18A 2ZUNA 2BVTA 4JL2A 4E9LA 2OWCA 3VGDA 2KLTA 1OFOA 1H7XA 1UIOA 3IS4A 3VXOB 1A9EA 1RUPH 1HH6A 5EBGA 5EOTB 1TUXA 2O72A 4K7PX 5HGAB 1JERA 2WJFA 4MZ3A 2GSHA 1RIVL 2UZIH 1F8MA 4A8IA 1OP3H 3SDDD 3F04A 4JYEA 5MKGB 5L8JB 2XQ0A 5JBEA 4I9MA 4B3ZA 2BOBB 4TO8A 1CD0A 2P10A 3VWKC 1MQPA 4P5KB 5CGMA 4JG0L 5IMLA 5L88H 1GS8A 2W0FA 3GXDA 1MY5A 4IG2B 3K6FA 1THCA 4FHKA 3BH9A 5BRQA 3QORD 3EFDL 4LSQL 4FZ8L 2OZ8A 1F07A 4OF5A 1Q4NX 4F9LA 2IDTA 5LGXA 1A5LC 2N3JA 1YUKB 4PWGA 1NTDA 2E9LA 2QBWA 3FTVA 1NIEA 1KV3A 4DF2A 3FPXA 4FNPA 3ILQC 1W6TA 3MJ9L 4JHBA 4QRSB 4LRIC 3QDJE 3QULB 3LEYL 3ENLA 4QRTA 2DIEA 1X5MA 4M4PA 4TM9A 4YBHA 2QCLA 1TV7A 2R29H 3VSVA 2GQ3A 1X8CA 3AGVA 3E6FB 1R3IL 2Y1VA 2VDGA 2R6OA 2OX1A 3FF8A 2D0GA 5A2LH 3Q2DA 1P0EA 3L9EA 3UEQA 5GSRB 4YXLH 1WEJL 4XWGH 1N4XL 3P80A 5D7EA 1HNFA 4HETA 5E03A 5ICYB 2HJLA 3HG1B 4YVUA 4AZHA 4N2IA 1P0BA 4UT7H 5CKSA 2ON3A 4TSBH 2D23A 5AW3B 2VAAA 3MUJA 3MU3A 3BWUF 1GW6A 1G9MC 5JDSA 4NIYE 3N91A 5JPNA 2PN5A 2BNQA 2BSRA 5EZOL 4HJIA 5C6PB 2HVKA 1OD7A 5AC5A 3V0WH 2OZ4A 4NNCA 3FONA 1OL0A 5KAQF 2ZUYA 1V7AA 3K46A 1GOIA 1VGEL 3MVIA 2VABA 1CDBA 3V6ZB 4BWLA 3FVDA 4W5UA 2V2DA 1J0IA 4C4KT 4ABVA 4BHYA 3WFHB 4NL1A 2VZVA 5E6ID 1IKOP 3FGCA 4RW3A 5DT1H 43CAB 3OM3B 2DPKA 3EDDA 3GNNA 2ACRA 2PGEA 4IRSD 4JFSA 5FYKU 2EPHA 3T4AA 3L65A 3UGUA 2D4FA 4K8GA 1CPUA 1XAUA 3P74A 2ODHA 1SO4A 3QB7C 3FT9A 1D9EA 1HJCA 4DUWA 5I0YA 5BOEA 1FL3A 3HPJA 1JAEA 3CNKA 3B03A 4Q6KA 2OFJA 1XYAA 4EXQA 1UA6L 2WUCH 5LGJA 4ZUUB 4S11A 3SE3A 3V6OC 2D2OA 4YWGH 1BBDH 5HD8C 4FS9A 1MCOL 3WLLA 1BTCA 2AAVA 2E1WA 1F3DJ 5F7LB 2BSBA 5DZPA 4MNJA 4JUTA 1UR3M 1FSKB 4PTDA 4HU2A 4KFOA 3I4KA 5C08E 1IGYB 3QZLA 4RA3A 5D1ZD 1HYRC 3OR7B 5FDWB 2PKDA 4GI9A 4RFOH 3TC9A 3RG6A 3SGUA 2QPSA 1AW2A 1XLMA 1HO4A 3STPA 4JTEA 2W0KA 3VAEA 3T0EC 1KO0A 3L9CA 3RI5K 3CSFA 4IGBC 3JV0A 2P47B 1AS8A 1KLGB 1NDVA 1IC1A 3AREC 2F19L 3N5AA 1AL7A 5D33A 4NZRH 1TZIA 5FYJH 3VH8A 3PUDA 3WN5A 5CBAA 1KIPA 1A7QH 4ELKA 4Y9NA 4N87A 5ABFA 2VTFA 2YBTA 1XLFA 3BGMA 4D7BA 3GTNA 3ZUCA 1SXNA 4JPKH 4Q8MA 2Y3NA 5CPLA 2FH6A 3P1VA 1SBSH 1SOQA 2N59A 4P5UA 4DNLA 4RNRA 2WXDM 5AW1B 2BDNH 3WQ5A 4MDIA 3X14A 3VD9A 2AFNA 2V8ZA 5CC3A 4WI7A 4OGZA 1PYMA 1XCWA 3LHPL 2Q3ZA 1L2UA 3KPOA 4A6GA 4JNYA 2GJRA 1XXFC 3O45A 4PRNA 5EZIL 3OKKA 3DA0A 1RV8A 3QW3A 1VACA 4G7YH 3W2MA 3ZKQD 3CH8A 5BJTA 4C83B 3HV9A 3L4ZA 3MA8A 1D7BA 4H7ZA 4HUXB 4EVNB 5TDPB 3QORB 2HVJA 3EHBC 4ZMYA 1Z5HA 1PSCA 3U9WA 3MROB 1WAAF 4FULA 1OPGH 1QNQA 2CBVA 1AQ0A 2NXZC 2UY6B 4XBPB 1XR8B 1MNNA 4D8OA 3DO3A 3S34L 1DSYA 1XP3A 5JIWA 1N67A 4LVFA 3G18A 2XKNB 3W11D 2V5MA 3BWAA 3N1PC 4FRWA 2MCMA 1MLBB 4GMSL 3C9NB 3V8CA 5B7FA 1XGZA 5H4YA 3LCFA 4XAWH 1IKFH 1YEIH 4HU0A 3RX5A 1BRLB 1BGGA 4V1XA 1TWZA 4MD0A 3D06A 2Y72A 3WDIA 4WNSA 3P67A 3KPRA 2IIJA 3EYUL 2B0SH 3FKUS 3DFOA 4XNZC 4G8GD 3KZ8A 3R2GA 1SZNA 1BZ7B 3KG5A 4JY5H 3O41A 1FFPA 1UWXH 3GFUA 3A67L 3SQMA 2NY1C 4RAHA 4L1GA 3O81A 4D0DA 4UTBL 3E0WA 2G5RA 4ZX4A 1KIRA 4JMXA 2X4NB 3ARFC 2GK2A 1PKOA 1XL6A 2IALA 1V0NA 1ISXA 4AE1A 1R9ZA 3ZW3A 5CSRA 2I9TB 1IGIH 3NSFA 2HS6A 4OFVA 4HPOH 3GO2A 3IRPX 4L18A 2FGWL 2Q02A 3LGGA 5J06A 5I8KL 2R14A 1QNVA 4RCXA 3UYRL 5E6IB 1SFSA 3KLAA 3NZ8B 3TFXA 3KL3A 1AI1L 3PZGA 4H0GA 4IRSB 1KB9J 3ZE0F 4H2AA 4B6ZA 2ZWSA 1P4BL 1USZA 1ODUA 1R46A 4N68A 3E3HA 3VYNA 2FX7H 3JR2A 4QD2E 1V6WA 1GY2A 4ZFOA 4GRWH 1PKLA 5B3NA 4FF9A 2CR6A 3ZX1A 4NXKA 4NRZB 1BM3L 4PI2A 3L5LA 5C9WA 4PFEA 3JRKA 3QMTA 1TV5A 4R7XA 5KJ4A 3LKSB 3IK2A 1VPYA 5J5EA 3OGSA 1J0KA 7CGTA 4X2RA 4W84A 3DMMD 4S1RL 4V1DE 2Y5JA 2VDPB 3HKFA 3VGFA 2IH1B 2OT1A 2BCMA 2QFRA 3NYDA 1GVRA 3UJFA 3R8QA 1E15A 5D1ZB 3NP3A 2QADD 3BVTA 1GTHA 5KJ7E 1B0GB 3BO8B 5FWQA 1EJ8A 4QG8A 4Y6GA 5G1MA 4XAYA 4R4BA 3LH8A 1N0XL 1YKWA 5TH2B 1SJDA 3GU1A 1MUWA 3V5DB 3W1MA 4Y4FC 1KFJA 3FCTA 3P82A 3ATZA 2X5PA 5F44A 4HBCL 1R5IB 4YGVB 2ATAA 4OOZA 4MKMA 5C3IA 3RWHB 3VXQB 4K5NA 1LE5A 3RWJB 1JPSH 3NP4A 3GHBH 4M29A 4JQ4A 4W89A 4J3OG 3VXSE 4OD2B 2NYYD 3S6CA 4YIQB 2YWZA 4AV4A 2ZXGA 5EEYA 5T1MB 2AEPL 1NU5A 3QARA 1S9VB 5KW9L 1CGVA 2A1WL 4MMWA 1H6FA 5C0IA 1YA5A 5DC2A 3H9SE 1IKNC 4MPQA 3BQ6A 3ZHKA 2GY7B 3SE4C 5CMAB 5CJXA 3BSZH 4DK5A 1VZGA 3WCYA 4ZQNA 3BIKA 2ZCKH 5IIEB 5FOJA 3SW6A 4AYEC 1WHOA 5DQJB 1H51A 4GSUA 4N2NA 1QT1A 4C6IA 1RJZB 1B88A 5AB3A 3W9DB 1ZTXL 1S7WA 1UUMA 3MJMA 4J8RB 4GGHA 4O5LH 1PD6A 2OZ0A 3LTPA 4QSHA 4R7NA 4JKPL 1IC4L 3KPQB 1G7JB 4JYDA 4BD4A 1ICPA 1CE6B 2W95A 1ZGLA 4G7RB 1E70M 4KCTA 4LLYA 1S2WA 3J27A 3EJUA 1VADA 3ARBD 1TV4A 1HKLH 2NUPA 5F7DA 5C0BE 4LT7A 2KUTA 3S0PA 2DWEA 2Y36H 4PVLA 4CLMA 1TYGA 1U93A 2BXYA 4AU0A 1OLZA 1WB0A 1TJMA 4DP2X 5EU4B 3R19A 1NFDB 5FKPB 2PDIA 4F15C 1J11A 1FCQA 5HHOD 2IMNA 5DUPH 5T8GA 1DN0B 4DW2H 2IPUG 4Z3EA 2CWXA 3MLRH 2W9MA 3BI9X 3G0XA 3QUML 4NQTA 4O28A 1Q7ZA 1S7RB 1ZT1B 2JKWA 1AGEB 1HHHB 5KVEE 5K3VA 4PYGA 2I56A 4U1IB 3VFPB 5D9NA 1NQ6A 1JFQL 1M1SA 2Y7LA 4G8GB 1XF4B 1JQXA 3PSWA 4W4NA 2HP4A 1NMBH 4K7FB 2GQAA 4CSSA 1A6AA 5JH1A 3V9EA 3TN0C 2C7FA 1UH3A 3N3EA 1CLZL 2J8OA 5L6UA 2WNXA 2VSCA 4PJCA 4QRAA 4GSDL 2C1GA 4L1SA 3OLIA 4P9MH 4P2RE 2FZNA 2QDDA 2XVBA 3RL1B 3B9VA 1UFGA 2ZKHL 2C5DC 2X30A 1MREL 5KVDE 5FGRA 2E3VA 3MHZA 5CEYA 3O3EA 1XIWD 1Q9KB 5HYQA 1PZ3A 4BZYA 2MKLC 4CGUB 5E8EA 1XYBA 1JN6A 5D1QC 3RX2A 1DQQB 4PWHA 3AWEA 1IMHC 4OZHA 2WP3T 1W0VA 4WHTB 1GJIA 3NL2A 3R5EA 5I07A 4JHZA 1IYXA 2MCPH 5A2AA 5HWMA 1ZT7A 5J04A 2IEPA 4OTKA 3JVFC 4W9FC 4ZUWA 3W76A 3OG4B 2B1HH 2IXUA 4N4PA 4Q56A 2EPLX 3FU9A 1J1PH 3X2QB 1B3WA 3CQFA 2CDGA 1QUPA 2V5YA 5EZPA 3HPFA 1UOZA 4LPWA 3Q1SL 3V1HA 4C57C 3IGAB 3QCUL 3BW3A 2Z0BA 2DW6A 5LGHH 2A9NL 3GZ3A 1W72H 1OC6A 3DMMB 1PS9A 4PFMA 1P9MA 1JWMA 5DFTA 2RUSA 1F13A 2NUTA 1FFOB 4OQ1A 5FM5O 5LSMA 4A2GA 5G1TA 1DYZA 1B4TA 5JXAH 3W82A 5IVNA 1LTDA 2I5GA 3K72A 5CIPB 2ZWYA 4LHUD 2W94A 5B1CA 1YMHA 1ZDSA 2QADB 4IPJA 3WNNA 1EF2A 3VIGA 3DERA 2Y6SD 1JRHL 4XZMX 3AOFA 1XLHA 3LA4A 1YPZB 2OMWB 4XKYA 1RZKC 1TU2B 5CPMA 4AQ1C 5EEWA 3MYOA 4I88A 2JTYA 5DHXB 4Q6IA 2FYYB 1G6RL 5AW9B 3BEVB 1G01A 1ZU8A 4NSKB 1ZHNA 3HG1E 1BM7A 2QQLL 2Y0SA 2GVJA 2XX1A 3WIFA 2V8MA 1NLDH 1OFDA 1RUPL 2HJFA 5IDZA 4FHJA 3U3HA 2BMBA 2O55A 3OHXA 2YQ2A 2UZIL 1FORH 4TNWK 4NNYA 5GGUB 3MV8A 5F9OH 4F9PA 4UF7C 4U1KB 1FV1B 1NCAL 5T1KD 5HYFA 2EXSA 5AHNA 2OCFD 4BRVA 2HPOA 2OZTA 3B0YA 4Y2DC 3FFDB 1SLUA 4HIEA 4M5ZH 1PZUB 1BQCA 3MOAL 4G56A 5EU6A 4CNSA 3QZWA 2VO5A 2VZSA 3TOYA 4PJ5A 2C4XA 1JF6A 4Z1BA 1Z9PA 1VFTA 5JUEH 2R2BB 4MMZA 1QI0A 1FYTD 5BOPA 2OGJA 3UPRA 1LM1A 7PCYA 3Q7JA 3QA3B 3T0WA 1GMEA 3HQ1A 3WF4A 3LZOA 2BINA 4D71A 5I9QC 3QP3A 3HPAA 4HPNA 3HS0A 3LN9A 4HNTA 5B8CB 2R29L 3UJRA 3ARBB 3PWAA 5C9ZA 3MRKB 2PDMA 3F2BA 2HTLD 4YXLL 2DIBA 3VSTA 4TKWA 2YA2A 4XWGL 2XQYK 1E0TA 2R9RA 4RFNB 3KJ4B 1ADDA 4F7EA 2UUDK 3BD5A 3NESA 4N2EA 4V11A 4P61A 1RSCA 1AG0A 3NZHH 1B0RA 5DY3A 2GCYB 3FQWB 4GXPA 4Q6JA 2QHRH 2PDPA 1ZMYA 1NIBA 2IQ9H 2VUKA 3P9MA 3PWUA 3V0WL 4P57A 3AITA 4MXQD 1YY9D 1C16A 1EPVA 1YW1A 1M7XA 5FKYA 1DXFA 5CCJA 2XSAA 3MO7A 4LNYA 3WTUA 3HBZA 5IM7B 4DETA 1E9OB 3QWOA 4PJFB 2EIKB 3LAFA 1ZCCA 2WQ8A 4QS6A 1VFSA 5D7IE 1B4LA 3F7JA 1EH9A 3N9SA 3RVUD 1W9BM 4ZODA 5BXFA 3AGWA 2Y2WA 4TNFA 4MY8A 4DK6A 1WAPA 2VL4A 2E7LC 1BXUA 4YDVA 2Q8AH 3VNIA 5SWSE 4AKPA 2F7PA 2PC4A 3BAEH 2NZIA 4LPVA 4F48A 1PY0A 5LLIC 4C6PA 1JHLH 3UZJA 1CD1B 4LRSA 3R7RA 3T05A 3FAXA 4UM9D 1ECZA 1XIWB 4TLUA 1D8WA 4NAFA 5I02A 3B8VA 2XVNA 1IC5H 6PCYA 3OZOA 1OJXA 3SKJH 3V9FA 2HKHH 4CADB 2PYFA 5FO7B 4MJ6A 4XCFH 3VFTB 4FQ2H 4O1AA 2PDLA 5KZDA 3RPDA 1BD0A 1EGJA 5LB1A 5HR6A 1OW0A 3ABSA 3D4YA 3O6AA 3E6HA 4IJTA 5E94A 1DUYB 5LBVA 1R3LA 3F6JA 3NDZA 3RZCC 1IGSA 4MAZA 2PDKA 3AYSA 4PEKA 4ES9A 3VABA 2EP6A 1BP3B 4RFOL 3LBMA 3M16A 3WY4A 5K9OA 3KPPA 1AD0B 3SJVA 4BHUI 3DFNA 3Q44A 4B91A 3C2FA 1JF1B 3KNBA 4LHUB 1FO0H 4PMEA 2FJGB 4LEBA 3TZVA 1KBPA 1PZDA 4Z7WF 2DDXA 3H7UA 2G3NA 3DV4A 5HDBB 1A7QL 3VAVA 5M2FX 2O5YH 3MRJA 5FV1L 1JUFB 1B1YA 1N0LB 3WLTA 4Z0SA 1P4LA 4JPKL 5LKYA 4MG4A 3K13A 1MH5A 2ZA3A 4ZG1A 3ZHNA 4WU7A 1SBSL 3K30A 3T3PE 4GW5A 4PRDA 1I3RB 1MPAH 5HI5C 1G7QB 1ZHKA 1W6LA 4ZMTA 2I7OA 3FV9A 3WEZA 4JFHE 2YGOA 1IVTA 4Y8FA 3RFRA 1DJZA 3INPA 4KDWA 2DICA 3T5WA 3MC5A 1FXPA 4QT5A 2XPGB 4OJCA 3V0FA 4J6IA 1TPEA 3IAQA 2JJUA 1DVFA 3WJLA 4AGOA 3LRSB 3FUEA 5T1KB 1P2CB 2MMXA 5D7LA 2NY4D 5GGQH 1R3KA 1Z6JT 4XCCL 1G7IB 2BHYA 4G7YL 4FK9A 3D12B 2WTRB 2K9FB 1YNLL 4XVOA 1PFCA 5BOJA 3IXAA 3MLSH 3WEXB 4BQ8A 2WC7A 4DF9A 1JCVA 3P0GB 5KS9B 4CQCA 2KDYA 1AFSA 3ZR6A 4A2SA 2XTLA 1FYTB 4B3EA 2W80C 4RGND 4V15A 4KERA 3TWAA 1X8FA 3ALGA 4D2NA 5DO8A 4DF1A 3RVWC 1MDLA 4XAWL 3TMLA 3AMGA 1VFLA 5EEXA 3B5GA 4GBDA 1XLCA 2WOBA 3FYOA 2XFRA 3GIPA 4QRFA 1LEKA 1LOQA 3EA1A 1T99A 1RK6A 3V7PA 1RJRA 3QXDA 5F4WA 2INEA 4XP4L 2H3DA 3SGJC 1DTNA 1E56A 2Y7GA 4PRHD 6FABH 4AJ0A 4CDHA 4YR6B 1E6QM 1Q1PA 3QRGH 5CEZH 3MNMA 4M1GH 4AI7A 1KD0A 4JY5L 3W7QA 1OTTD 3FBQA 4H41A 4BV1A 4MAYC 5KSWA 3DVGA 3ABLB 1LO0H 4WDUA 1SYSA 2DH3A 3IRDA 3NIFF 3ETTA 4NU7A 3U2CA 2CMRH 1GSMA 2HMIC 1ZENA 3SYPA 1GORA 4FEZA 1E1FA 2HTKC 1G43A 2Y1YA 3IDYC 4HPOL 4OCSH 3L9BA 2ZTKA 3PAZA 2X4PB 4JDZB 4ZTXA 4J2XA 1TWSA 4CVWA 5E99L 2CIKB 1XG4A 4R27A 1OK0A 4U1JB 2W8CA 3NJIA 1LOLA 2GSJA 2HK0A 2X28A 3EYQC 2PSNA 1QFUH 2ICWI 2OMZA 2H6UA 2E7BA 4Y9BA 4S3FA 2POZA 4UM9B 3SZKC 4XIMA 3U6WA 1CW2A 1O6SB 4WENB 3V4BA 2DYRB 4CVZA 2ESCA 1P7KA 5AYXA 2E75C 3HAEH 3N9GH 1E4LA 3PV6A 4O0KA 3ARDA 4IKIA 4L3EE 4JFXA 2PTTA 5IQ7H 1CJYA 2B7PA 2FLBT 5CNHA 3U0PA 5ELIA 4G72B 2HEJA 4FXSA 4MLJA 1QSZA 2FMNA 5CC5A 1LDCA 1TZ7A 1HGWA 3C60A 1B5TA 4U6HB 2B77A 4G42B 4UB0H 3GZPA 4HIHB 6PAZA 3H3KA 2I17A 4OZ4B 4LJ3A 3FUFA 3WV0A 2B1AH 1TQUA 1CECA 2K1MA 4XNQB 4POZC 1V6UA 4ZQOA 1RJYB 1WFTA 1JJKA 3S6OA 5HINA 4NJAL 1G0XA 1OT2A 2J5WA 3DXAD 1KIQB 1D6VH 4C65A 4URKA 1BFVH 1SEQH 1TQJA 2IKIA 4H9XA 2OZ4L 3F05A 1NFDE 4B9ZA 1XB3A 5ACMA 4A6YH 1ZS8A 1ZV5A 5IHWA 3JSSA 3OB8A 1J1OH 1RZIB 3CXDH 3GHBL 1OX4A 3VXPB 1B3VA 3GNPA 4XOCA 3C0SA 1EBHA 4NM4L 5TE4L 1NAMA 1M71B 4YNYB 1P5UA 4M7KH 1NJJA 5BU6A 1M9HA 3U46B 5DK0B 5I1EL 3ZRCC 1U8LB 3L7RA 4JM2C 3PWVA 4AYFA 4EZLA 3BSZL 2HN7B 3GDLA 3MAWA 4PJ8D 4OLUH 2ZCKL 1UC5A 5CZXC 1W56A 2VXTH 3DIFA 3CFBA 1BQHA 1GVOA 4J3BA 1LMKA 1IBDA 4UQEA 4E9TA 4TV6A 4HHAB 5HULA 3W85A 4WIWA 4MDOA 4OZFA 1TPH1 3RY5A 4UMAA 1DIDA 3K5RA 3RJYA 4IHOA 3BLOA 4F0KA 4O5LL 4RE4A 2FGZA 1YE4A 2V5KA 3LSOB 2NY0C 2PODA 1AW5A 3KBNA 3I6KA 4A7GA 1O7SA 1X5YA 1R0AH 4DEUA 1BFOA 4KCUA 3KHQA 1GOKA 2WUBH 2Z25A 4XSMA 4NENB 3CC5A 4ONHB 4O02H 4LCSA 4RGNB 5HDWA 4GQRA 3SDXA 4ZXLA 1BVZA 1Z9AA 3H85A 4HH9A 3EJYD 1G9NC 2QEZA 1YSOA 4O4YH 2QAPA 2J7GA 3R10A 2Y7EA 1OINA 2B08A 4DW2L 2Z4QA 1H7WA 3IJLA 1FWHC 5EIVA 5DRIA 4ZSOE 3IKCB 4LBEB 5KSAC 2NNCA 3KTCA 2Y9RT 5RUBA 4HVXA 2EECA 2LLLA 3HMXH 1HK6A 4PRHB 4HNCA 1HHGA 1VESA 2UWEA 1KLUA 1UHVA 4P5SA 2DFAA 1NMBL 1HNGA 3DUSB 5C6WH 3ASOB 3WTWA 4YL2A 1G7PB 4GKZA 1BD2A 4BSVA 3CC1A 3FT3B 2CLPA 1YPZE 4JFPA 3THML 4P9ML 4TULH 1XR9B 3QISA 3C5ZC 3AIRA 4NUGL 3IDGA 3JW7A 4JG1H 4ANWA 3RLHA 3BDKA 2JKRM 2EDDA 2XXGA 4JFFD 4M93C 5AOMA 1RPUA 4E41A 3A4XA 4Q4QA 5I28A 4XVUD 1L5GA 4G5AA 3GXUB 2K6ZA 2B59B 4GO9A 2MCPL 1I4FA 2A7BA 9PCYA 2JKJA 2WNZA 8A3HA 2ADFL 2ROXA 3CVDA 4HZAA 5FUCC 4J5NA 3RL2A 4GI6A 2B1HL 1TTRA 3W25A 1TVNA 1SYTA 4WNJA 2WSQA 3V0IA 3CCHB 4PJHB 3HFYA 1W5OA 3HFFA 5I06A 2R29A 2HZGA 1DLHB 1TKWB 3APDA 2V8LA 3LYRA 3M1OA 3S1XA 3DENA 4RE0A 4AL8H 1GOFA 2LTQC 5I03A 1IXQA 1QFWI 3C6CA 5CWSA 4PJ9A 1D2OA 1I6NA 5FDYA 2J74A 1ERNA 2O1AA 2ITFA 4ZFGH 3CDYA 5E4EB 2PP7A 2J8UF 3WH6A 2MFNA 4OV4A 3FJ4A 4Q7IA 2D2CC 2VW4A 1EX1A 3LCGA 1ODAA 1ZA3B 1A53A 4Q14A 2NQLA 3K6OA 4NLHA 1T5WB 4XVTH 3OTTA 4NJHA 4NS0A 2O61A 1SFHA 3ZIMA 1LK3H 5C9JB 1XG3A 2J7FA 5EY5A 3DXAB 3LTSA 2BSTA 3VA6A 3GLEA 1U2YA 4R8WH 4HD5A 1GAFH 2PPCA 2JFCA 4PMRA 4JRXA 3QNYA 5IEHA 3A9BA 5DSCB 3U4EA 2G5WA 2PR4L 2B5IB 4TUKL 8FABA 2MNUA 4JRYA 5C8JB 4DBWA 1NLDL 1EJXC 4GJIA 4IJ3C 1F58H 1TO5A 1OXYA 3MQIA 2XI9A 4DJDC 3P84A 5HVWA 3AUJA 4DYJA 3UR8A 4FQPA 4F2EA 2C1IA 2CLLA 2CCVA 3DGCR 5D72H 1QSFD 1F4WL 1BJ1H 1E3XA 3CFEA 2L3BA 3RDTA 4PJFE 4FFYA 5L4JA 3CSYB 4P4KA 3LCWA 4PJ8B 4M5ZL 3W27A 4ZFOL 5J12B 3QHFH 1HILA 3R8BB 2PTVA 3IRSA 3GKAA 4NQCE 2OMTB 3GVGA 4DOHE 1HSBA 5JUEL 2QHAA 1ZCOA 3UDWA 4OLVH 5CN3A 4IM8A 4X6CB 1JVLA 1W0MA 2VDOH 2XH4A 2OJ1A 1MI5A 3PNWB 4ZX5A 1KBGL 2UZYB 2CPUA 1YTEA 4BCXA 4HPHA 1NSNL 1WAEA 2XTKA 3K2UH 1XGUB 3LHUA 3ABXA 3QRFM 3TA3C 2CO1A 5CR1A 2NSQA 3O0RL 3ESNA 3W4RA 1QFEA 1I7RA 4QRUB 4OV5A 3KS6A 4CVUA 4J3SA 4HB7A 4IFKB 3T77B 5JA9A 4AIZB 1KJ3H 2X3CA 1GQLA 2WAGA 3WLWD 3NZHL 3CFDA 1VFBA 3EOYG 1TCRA 2B0MA 4E68A 4BF9A 4X4YA