4WSJA

Crystal structure of a bacterial fucodiase in complex with 1-((1r,2r,3r,4r,5r,6r)-2,3,4-trihydroxy-5-methyl-7-azabicyclo[4.1.0]heptan-7-yl)ethan-1-one
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
439
structure length
439
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-L-fucosidase
publication title In vitroandin vivocomparative and competitive activity-based protein profiling of GH29 alpha-l-fucosidases.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 158
structure length 439
sequence length 439
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-10-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4wsjA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4wsjA01
1QNOA 4TXEA 1J0YA 3A3HA 3GXIA 1PZ3A 4OBRA 3MUAA 1EHAA 4YN5A 1R34A 4K68A 1H1NA 1HJQA 3TP4A 4F66A 1R33A 4HMDA 3WH6A 5CGMA 1C92A 3VGDA 1UD2A 2EJ1A 3GNPA 3LXBA 4JFSA 4ZE5A 3HJEA 4Z2KA 2EPOA 4HPGA 1WPCA 1JFXA 2BHUA 1W9VA 2FHFA 5JBEA 4IUGA 2BHZA 5ECUA 2OYKA 1R87A 1ZBCA 4M81A 1GJWA 1OD0A 3MO4A 1V6XA 4PSRA 4DO4A 3CPUA 3PZQA 5AC5A 2YLAA 1MWOA 2VRKA 5BROA 4W86A 4TOQA 1VENA 5E09A 1R75A 3VMPA 4L4OA 1MYRA 2CETA 3EMZA 3CC1A 2X1IA 2BY1A 2CHOA 2VX4A 3RM4A 2CXGA 1HIZA 3SCRA 4CD6A 3ECQA 2YA0A 1V3LA 3LXAA 5KEZA 4PTVA 4YPJA 1QW8A 5FOOA 1CXHA 1PBGA 2O9RA 3GZAA 1W32A 4CCEA 3BSHA 4CN1A 3M7SA 1BGGA 3OB8A 1JXJA 2VUYA 2QLYA 3WDRA 3OGVA 1OWQA 5D4YA 3CZKA 3A5VA 4OIFA 2ZUVA 3LRLA 8A3HA 5D9OA 4OJYA 1EOKA 4P7LA 1B3WA 3BAYA 4FLRA 1LL6A 3F5LA 1C8YA 2BHYA 4HZ8A 2XN0A 2CEQA 4PBGA 1KGUA 3DHUA 5E9AA 2OSXA 3CZLA 3VDCA 3VSUA 1O7DC 1W9XA 3WQVA 5CSYA 2J8FA 4W85A 4AD3A 3AHTA 1OIMA 2ZX8A 2IXUA 1UWTA 4BQ2A 1C8XA 4ACZA 2VVSA 4AMCA 4W8LA 2ZXAA 2XVNA 1MW2A 4C7GA 1NOUA 3A6OA 3VGFA 1TR1A 3ZR5A 1VEMA 4DUXA 3WDQA 3WNLA 4GO9A 1H0GA 2YOCA 2X2IA 1BG9A 1V08A 3THCA 4QLJA 1BYAA 3CH9A 1BTCA 3CHCA 2TAAA 1I1XA 3WF3A 1B2YA 2PWFA 3SURA 3W38A 2A3BA 4JFWA 1KXQA 1BYDA 1DWAM 1DWFM 2BFGA 2WMJA 1CWYA 3PZUA 1BPLB 4M80A 3KL5A 3UESA 1VIWA 3U5UA 2DSZA 2CBUA 3EMCA 4C7DA 3QHNA 4M82A 3IK2A 3AS2A 3OGRA 4F8XA 2CKRA 3ZT5A 4HPHA 3M07A 1W3KA 3QGVA 5A3HA 3AYSA 1UKOA 4FLOA 1VFMA 2OWWA 3WBAA 2GK1B 4AZ5A 5HNNA 1W9UA 4Q7NA 3ALFA 4AZHA 1GOWA 1TA3A 2IUZA 1MW3A 4JKMA 2D23A 4BS0A 4EKJA 5DFAA 4FLQA 3AIVA 5JUVA 4AISA 3BVUA 3WQ5A 1AVAA 2HVMA 3HU7A 2WWCA 1HJVA 2XVLA 4HP5A 3VIOA 3W6LA 4J3SA 3ARYA 4UOQA 3T0BA 3VD9A 5A8QA 3BMVA 5BWFA 1HJSA 2D22A 1CDGA 2XGIA 4LQ1A 2QF8A 2V5DA 3J7HA 3AQUA 3L4VA 3WQ4A 2YL6A 2ZOXA 3WKZA 4HMCA 1NQ6A 1ISZA 4RE3A 4KH2A 4U3AA 3VGBA 5GNZA 4DWSA 1E0WA 4J27A 3H55A 2GJXA 4UQDA 5CQ1A 4TX8A 1L0PA 1K6AA 2NT1A 1V3KA 3KL0A 4DM2A 4AZGA 3D52A 2C0HA 1E6ZA 1EDTA 1OBAA 4A3HA 3ZSTA 1UHVA 2BS9A 1U2YA 3IANA 2VX6A 5A95A 4UOZA 4H2CA 1BF2A 1U33A 4D6IA 5LYRA 3CO4A 2D3NA 1SR0A 1UWQA 4AD4A 1LWHA 3HG5A 2WC3A 2O9OA 2BY0A 1KBBA 1E4IA 4PTWA 1PX3A 2W5FA 3AS3A 1SYTA 1JZ3A 4TVUA 1WDRA 2WK2A 3AROA 1E70M 2XG9A 2PBGA 3FHQA 4W7VA 5A1AA 3GH4A 2FYVA 3GH5A 4NSBA 1JNDA 3WEMA 4CD8A 1PS3A 2CNCA 4CU6A 4J7RA 4BZYA 3GXMA 5DO8A 1M01A 3VO0A 1J11A 1GHRA 1DP0A 2FHCA 3D51A 3KEHA 4KMQA 5IHSA 4IPLA 4AIEA 1G1YA 4AZ7A 1HVQA 3PZMA 4WKFA 5AY7A 4U31A 2F7RA 1HWWA 2WMIB 2V3FA 2WMFA 2F7QA 1WDSA 5DF0A 1UASA 3BLBA 1FOBA 1LL4A 2V3EA 1WAWA 4ZE4A 3PHAA 4U5IA 3AS1A 3CV5A 4D1JA 4W84A 4HOWA 2Y24A 1QI0A 2DIJA 4FK9A 5A8NA 3AMLA 4XUYA 1V3HA 3WN6A 1CBGA 5I2UA 1JIBA 3SUVA 4UOJA 1CNVA 3ZJ6A 2J74A 3M6DA 3OZPA 4FNQA 3CZ8A 3BVVA 7CGTA 2A3AA 2ZUUA 3WH9A 3T09A 2OW7A 2OWCA 3WF2A 4GI6A 2YLLA 1GOKA 2VTFA 1IZJA 1CECA 1H5VA 3OA5A 1RD6A 4ATWA 3DDGA 2OW6A 4UFIA 4ATDA 3A22A 3WD2A 4CVUA 3S5YA 4E8DA 1CPUA 3MKKA 2RGMA 1E0VA 3W81A 1ZJBA 1TVNA 4UFMA 4CCCA 3H53A 3PZOA 2NW0A 3RJXA 5JIPA 2XUCA 2JIEA 1B3VA 1QWUA 1UKSA 4GI9A 2PF0A 2W62A 1JNEA 1ISWA 3I3EA 4OKDA 1AQHA 5IFPA 3WUGA 1X6LA 5CLTA 1ISXA 3CGTA 3WSUA 1R86A 4JCMA 3NUKA 5CPQA 2PWGA 1LLOA 3WELA 3K4DA 1VEOA 2WMHA 3VILA 1OM0A 3VX0A 3SUWA 2VZUA 2GDVA 1E6PA 1CXIA 3SIMA 4UQEA 1TFVA 1QHOA 5BRQA 3GNRA 4JIEA 1QOXA 2CHNA 2W4XA 3VMOA 2WXDM 1CEOA 3CTTA 3AHXA 4QFUA 4CN6A 1OCQA 5M17A 1JI2A 2Q8XA 1WZKA 3N13A 3D3AA 1QBBA 2E0PA 1VF8A 3AXHA 2DEPA 1K9EA 3CHDA 2W63A 2W91A 2WB5A 1XC6A 2WANA 1BGAA 4U33A 5M3WA 2O92A 4TTUA 3LPGA 4GZEA 2CKSA 1V6VA 4FNSA 1UD8A 3BAJA 1WB0A 2XTKA 1BSIA 5A6SA 2NSXA 3S5ZA 5FL0A 4D6CA 4EANA 2A3HA 1NP2A 2XFRA 2J77A 4TX6A 3GBEA 1J0KA 2BXZA 4PMDA 3GXTA 2XM2A 1JD9A 2BY3A 1JZ8A 3EJUA 3WIJA 3WQ6A 1ESWA 1NOFA 1UZ1A 3DX0A 5CLWA 2EPMX 2WZEA 4CU7A 1HL9A 2JE8A 4TTGA 2VQTA 5FKYA 1GVYA 2WCSA 4P8WA 2PWDA 3WY4A 3AMGA 3K8KA 4BQ3A 4GINA 4PTMA 1GVIA 5EFDA 3FW6A 4AYGA 1E4LA 2XHYA 3NDYA 3TV8A 4GKLA 2X8RA 1IZKA 4Z2LA 2GSJA 3VTRA 4D71A 3SCOA 1H41A 1GQJA 4JAWA 2FH6A 3I3BA 3PZVA 2BNJA 2D24A 3SCNA 1Q6EA 1G5AA 1GW1A 1HP4A 3L4WA 4OZOA 1XCXA 2ZX6A 3FY1A 2J4GA 4JFVA 1E40A 3SCSA 4JHOA 5EBAA 1LG2A 3EJSA 4WK9A 4QLLA 3ARTA 3AYRA 5KZ6A 1UG6A 3POHA 4AMXA 3AS0A 3AICA 4W5UA 3VIKA 4AZCA 2FDMA 1E0XA 4NZFA 4PMQA 4H41A 1BVZA 3UERA 8CGTA 3QR3A 2PC8A 3CZSA 4UQCA 5EFFA 3AHZA 1UA3A 2QHAA 2CCRA 1J0ZA 4BQ5A 5AC4A 3DYPA 4ZFMA 1FH9A 1H11A 4MB5A 2WCGA 4CD7A 4CU8A 4DM1A 5CG0A 2E9BA 3K1DA 2CYGA 1B3XA 2EEXA 3N11A 2V3DA 2GFTA 2D73A 3BUIA 4PUDA 2WVTA 1W1PA 1TQTA 3WF1A 4UQBA 1GUVA 4LYPA 3NJ3A 1MQPA 1PIGA 2VR4A 2YDSA 2J7EA 2J7HA 3RMEA 2GDUA 3B9AA 4QLKA 5E6ZA 5A6BA 5EMYA 1GOMA 2E3ZA 1SMDA 4MDOA 5I23A 2PWEA 4AC1X 1UH2A 2OSWA 3WUEA 1JAEA 2VJXA 4H04A 4D1IA 3ZJ8A 1GQLA 5D9MA 1JD7A 3U5YA 2XPKA 3ZJ7A 4AXNA 3L4XA 3AIRA 4QAWA 4AZ6A 2GK1A 2VZOA 4NXSA 3ZT6A 3QOMA 4Z2HA 1NARA 1UR4A 4RL3A 3A4AA 4CVWA 4D6JA 3CMJA 3A21A 2ZUSA 1KXHA 1V0KA 1HKMA 2E40A 2BY2A 1UH4A 4W8AA 1E6RA 5A8PA 3FAWA 3WNPA 2C8NA 2ZUWA 1E15A 2J7GA 2JIWA 2PB1A 4JFTA 1UA7A 1BHGA 3VKKA 1DWIM 1HF6A 3EJTA 1BFNA 1E9LA 1KQZA 2EADA 1Q6DA 4NF7A 2WBKA 1K9TA 1LG1A 2F18A 2VX7A 4B16A 2WZIA 4CUCA 2VCAA 3MU7A 4PYSA 3VIIA 4NZJA 3WMBA 2JALA 4KGJA 3VNYA 1AQ0A 1UH3A 3CBWA 3VINA 2Z1KA 3GM8A 1EXPA 2J7DA 2OLHA 1Q6CA 5A6AA 4PCTA 1E73M 1QI4A 1LL7A 2PI6A 3FHAA 1WKYA 1CGWA 4C7FA 3AIWA 2YFNA 1KTBA 3NYDA 1E5NA 1JDCA 1ITXA 2XN1A 5CPTA 4MNJA 3FN9A 3THDA 4F9JA 1GORA 3A24A 2VX5A 1JZ2A 2WVUA 1QNRA 3UR8A 1UR9A 1RPKA 1XCWA 3VDHA 1E4NA 2X0YA 4B3LA 2F8QA 3DC0A 2A3CA 3CZGA 3W27A 2WHJA 1JYXA 1B0IA 3WF0A 4J3TA 1E43A 1UR0A 3EDEA 1HVXA 2AMGA 2YBTA 5A6LA 3SCWA 3WQ8A 3JUGA 3VDBA 3K46A 4M8UA 3MV01 1V0MA 2ALWA 3CZJA 5D8ZA 2F1AA 1VJSA 4GI8A 5A69A 1V03A 3H54A 3ZR6A 2FH8A 2WMIA 1IT0A 6A3HA 1PJ9A 4U2ZA 2VRJA 3ARWA 3WUBA 3BLPX 3L4TA 3LPPA 1D2KA 2VURA 3KL3A 2Y8KA 2D2OA 2GVYA 3VGHA 4S3KA 5JIWA 1NWRA 1GOIA 2WHKA 4XZWA 1G0CA 1G9HA 4KRTA 3ARXA 3VUPA 3VIJA 4MADA 4MDPA 3APGA 3SUUA 4FNTA 4HA4A 2EBNA 4AWEA 1GHSA 4L4PA 3DX4A 3FNDA 2EACA 2XVGA 5GNYA 1GQIA 1HXJA 1FH7A 1W2PA 1JYVA 3AOFA 2QPSA 5BXSA 2VNCA 1QBAA 4QCFA 3RILA 2DIEA 1OIFA 1XH1A 4LYQA 3OLIA 3MS8A 4LYRA 3UG5A 1V6YA 5ABGA 5I24A 3AXIA 1GONA 4U2YA 3L2LA 4MJ4A 3WH7A 1HJXA 2WPGA 1J9YA 2WSPA 9CGTA 3N1AA 1C7TA 1W9DM 3L4ZA 4QCEA 5A94A 1UOKA 1VB9A 1JG9A 2BVTA 5GPRA 2XGBA 4X0VA 4AZIA 4MPKA 1UR1A 1E72M 4UZSA 3N9KA 4PTXA 3B9DA 2DPEA 1XV8A 1CLXA 5CPSA 3SCVA 1XSKA 2UY4A 1V3MA 3MUY1 3TTYA 1GZJA 1MQQA 1J10A 3WDIA 1X1NA 2BV9A 5HPOA 4AD2A 2DGAA 3ARQA 3VD3A 1M53A 5A6BD 1JZ4A 4FNPA 5AYIA 1D7FA 1JAKA 3LMYA 2C7FA 4RE2A 1BAGA 1V02E 3KZSA 4PMRA 5A8MA 3WQWA 2Y4SA 1E3ZA 4URIA 3S6TA 5BXRA 5I78A 4AY1A 4EE9A 4EAMA 3BXWA 1S46A 4FNRA 1E6SM 1JDDA 2YA2A 2YL8A 4CCDA 1J12A 1C90A 3WBEA 4CD5A 4PMUA 2E8YA 4J3XA 1KR0A 1QI2A 3VM5A 3GBDA 4JFUA 2F61A 1PEZA 4DWSC 1VFFA 2XSBA 3TA9A 3RJYA 1HKJA 3ZT7A 2ZXBA 1CXFA 4H8UA 2VO5A 3QHOA 1K9FA 1NH6A 3SCQA 5BXPA 3AHYA 4W7UA 3GDBA 1QNQA 3T0AA 3KLLA 3EDDA 3QOKA 2XVPA 4ACZB 5IHRA 2O9PA 4GO8A 4MNLA 3BUBA 4F79A 3N18A 4TVCA 4UR9A 3T2PA 2ZX7A 3MV11 3VD7A 2DT3A 2D0HA 4OUEA 3G6LA 4R5EA 2RGLA 5C70A 1O7AA 5JBFA 3CMGA 2E4TA 1TVPA 3CHFA 2IGTA 2XWEA 3OZOA 2JF6A 2DSWA 3WDJA 2BXYA 3HN3A 3N04A 4FNUA 4WF7A 5ABEA 4NXKA 1MVYA 1GQKA 3EBVA 2X2YA 2F1BA 1MXGA 2UY2A 3GXNA 4E8CA 2V5CA 3SEPA 4D6HA 1LQ0A 3ARRA 1UYQA 3GTNA 3VDAA 2WVVB 1JFHA 3BC9A 5HOSA 2XWDA 1W2VA 3F4VA 3BVTA 4XB3A 4HZ6A 2CPUA 5D9NA 1UKTA 1E3XA 4NZCA 2OSYA 2CIPA 5ABFA 1W1TA 4PCSA 4AEEA 2EPKX 2DH2A 1OGBA 3I3DA 1PX8A 1K9DA 3PZGA 3NSMA 4M29A 5DT5A 4PMOA 1HTYA 1NWUA 3CZEA 3WDHA 2J62A 4J28A 1IV8A 3RIKA 5LA0A 4UFLA 4OGZA 1RP9A 3W29A 1MFVA 1TMQA 4DWSB 3MMWA 2GJXB 1EA9C 1P6WA 3UCQA 2JEPA 2FGLA 4HU0A 1EDGA 4P7OA 2XFFA 2WCAA 4YHEA 3UG4A 2VCCA 3K8MA 3VD4A 3N12A 4BF7A 1W1YA 2EPLX 2YIHA 1J01A 5CSUA 3SCPA 2D1ZA 4JL2A 2Z1SA 4BQ4A 1CLVA 3WF4A 1QVBA 1UWRA 1N82A 2WM0A 2G3IA 1HL8A 4IISA 2ZUTA 3DECA 3VIMA 4AD5A 4GZJA 2G3MA 1WO2A 4XZBA 1KGWA 5D8WA 1UR8A 4B3KA 3CIVA 3AFBA 3WNNA 4JKLA 3ZIZA 1O6IA 1TE1A 2YDQA 4CKQA 3HG2A 1W3HA 3EJQA 1PX4A 3SCTA 3UR7A 1JXKA 1Q6GA 3SUTA 4ZENA 7A3HA 1SFSA 1R47A 3PBGA 1HNYA 3VIHA 3EMQA 4HA3A 3UEQA 3SCUA 3WEOA 1ECEA 1EO7A 2EO7A 2OYMA 2UY3A 1UWSA 4MJ2A 4GIAA 1C7SA 5EB8A 3GNOA 1UD6A 3QHMA 4MNMA 3TTQA 1VBRA 5M03A 2V3GA 3GXFA 2DH3A 1KB3A 3BUQA 3W53A 3W28A 1TG7A 1AQMA 1J18A 3AISA 3CUJA 4NRSA 2QV4A 1J0HA 3D50A 2WNWA 4GQQA 1HP5A 3EDKA 3ALGA 3VMNA 2YFOA 1QWNA 4NRRA 1KQYA 4X0NA 3CLWA 2ZXQA 3AMDA 2ZIDA 1EO5A 2Y5EA 4P7RA 1ZL1A 4W89A 1HJWA 4Z2GA 1EHNA 2WAGA 4BA0A 1OD8A 4Y7EA 4XV0A 2VCBA 3WL1A 1A3HA 5A6JA 4AZBA 4AW7A 1E56A 5BYWA 3WENA 1BYCA 1HN1A 5I3DA 3OBAA 2W61A 1QNSA 1C91A 3BAIA 1XYZA 1QX1A 3L2MA 2EPNA 5M5DA 3B8SA 3PTMA 3ARVA 4AYSA 2ZX9A 5I5RA 1UKQA 3A23A 4HZ7A 2PBOA 5FL1A 5HDRA 3BCDA 1W9PA 3CHEA 4Z2IA 4ZEPA 2W92A 3RM9A 1QI5A 3OLDA 3DYOA 1TQUA 3VIFA 3AIQA 1CGYA 1C3FA 3F5JA 2YDRA 2J7CA 1BVNP 1R7AA 2VZTA 1HX0A 3VU2A 4MAVA 5FCZA 1WZMA 3OLEA 1BYBA 4P7NA 3AI0A 1LF1A 3K4AA 3RM8A 3AHVA 1KGXA 2XSAA 1AMYA 3WD3A 4V27A 4FMVA 2CERA 4CN4A 5FD0A 3MSDA 3WY2A 1L8NA 1WDQA 1Z32X 3ZMRA 5I0DA 3KLKA 1CENA 3MI6A 4NI3A 4MAZA 1HKIA 4PMNA 4R27A 5ABHA 3WH5A 1JDAA 2ZUNA 2FHBA 2WMGA 4AIUA 3GYCA 2WZHA 3OGSA 2BVYA 1D3CA 1B3YA 1RP8A 1CGXA 3W24A 4A4AA 3PZNA 3BCFA 5E0CA 1EGZA 3MSGA 2CBVA 4Q22A 3DX3A 2GUYA 2NT0A 4E4PA 4M56A 2AOSA 1J0JA 1WP6A 1UQZA 1NWSA 2J78A 1DHKA 3PZTA 1MQRA 3PN8A 1OSEA 2F7OA 1JL8A 4HMEA 4PSPA 2D20A 3RDKA 1VEPA 3K8LA 3WEZA 3VIGA 3CUGA 3TTSA 1V6WA 2D0FA 3ZOAA 1M03A 3A4XA 1J0IA 1LJYA 3GXPA 4UFKA 4P8UA 4GZIA 1B30A 2E9LA 2CESA 4FF5A 4JHZA 3O9NA 3WD4A 1PPIA 1M7XA 6CGTA 2J79A 5DMYA 1ZBVA 1EQCA 1W9BM 4TUFA 1E55A 3DHPA 4J3UA 3BAWA 3II1A 3POCA 2F7PA 5E6YA 3VNZA 1WCGA 1JI1A 4WKAA 2VZSA 4KWUA 2XN2A 1VFUA 3M46A 3BAXA 1XD1A 1WDPA 1CXLA 3KE0A 1VJZA 1W3JA 3WFZA 1CGUA 2FGZA 1TZ7A 2WC7A 1CGTA 1KCLA 2OWXA 2WHMA 1EIBA 3A4WA 4AIOA 5D9PA 5A2BA 7TAAA 3DYMA 5GNXA 1FFQA 2DT1A 1GOQA 2DSKA 1XH2A 1M04A 1YHTA 4QP0A 3W26A 3WH8A 4U3CA 1V6UA 2DT0A 3G6MA 5FIPA 4OOZA 2EABA 1US2A 1UWUA 4W93A 1DTUA 1CIUA 5A2AA 3IJ8A 1XH0A 1B3ZA 3U7VA 2ZUMA 3W6MA 3KWXA 3MUZ1 4W7WA 2EXOA 3PTQA 1E4MM 4D72A 3N15A 3W25A 3BAKA 3GH7A 4AZCB 1W91A 5A2CA 3EYPA 5A8OA 5I6SA 3EDFA 2W67A 3VX1A 2VZVA 3WD0A 5AYBA 1FA2A 3SUSA 1EOMA 3AZRA 2GJRA 1CXKA 3NDZA 4N0RA 4WSJA 4W8BA 2PWHA 3WNOA 3CZNA 4IPNB 1E6QM 2X05A 1JZ7A 3AIBA 1FHDA 1E1EA 1NOWA 2ESCA 1TQVA 1H49A 2CBIA 2ZE0A 4AD0A 1FFRA 1VAHA 1ZBWA 1ZB5A 2B31A 4AD1A 5A6MA 1KFWA 1KR1A 1GOOA 3O6AA 2VVNA 3U7BA 1B1YA 1H2JA 3CUHA 2VOTA 3NIYA 4WIWA 2J25A 4JZ5A 5C8BB 2HISA 1VFOA 4BCEA 3OLGA 3GXDA 1BLIA 2ZWZA 1DEDA 1R85A 4PUEA 2WYSA 3IAQA 2CBJA 2V38A 1PZ2A 4XX6A 2WVVA 4E2OA 4J3WA 4W88A 1XSJA 5CJ5A 1C93A 4HTYA 1F4AA 4UZUA 4JL1A 3HG4A 3HZ3A 3N17A 5A6KA 4TVDA 1Q4NX 1US3A 3BUPA 5IXEA 5HPCA 3WY1A 2IXVA 1TCMA 4ML4A 3W37A 1KTCA 2WLZA 1H4PA 1V02A 4PMYA 4P7QA 5CXPA 2ZWYA 1T0OA 3AIEA 4H8VA 2WMKA 1XHGA 1VBUA 4JCLA 1OGGA 4ATLA 2OYLA 1HXKA 3D4ZA 2F2HA 2WVSA 4LGXA 5LA1A 1OT1A 4X9YA 4PMZA 1TQSA 1JYNA 4H8HA 4D6GA 1XRVA 1WNOA 3IAPA 4Z2JA 3LRMA 2G8ZA 5BXTA 2EQDA 2G3JA 2D3LA 2MANA 1KWGA 4WKHA 1I75A 1OGSA 2E9MA 2D0GA 4MB3A 1KCKA 2EAEA 1ITCA 1WZLA 2J47A 1WE5A 4HOZA 1QPKA 5BCAA 1JF6A 2WBGA 4D6DA 2VC9A 1OINA 3AMKA 4OOUA 5E0FA 4DUWA 1C8QA 4ZXOA 2GJPA 4UTFA 3W82A 4UFJA 1E1FA 1QNPA 2VI0A 4ZXLA 1ISVA 1XD0A 2VQUA 3S2CA 4PMVA 5CGTA 1MXDA 3EJPA 1CZ1A 4D6FA 2CITA 4QDMA 1VRXA 3WMCA 1PIFA 4W5ZA 3BUDA 1UKPA 4GQRA 3VGGA 2QMJA 4HA1A 1E5JA 5GQBA 1HJUA 4GXPA 2Y2WA 2WW5A 1V3JA 2G4FA 3HMCA 4KGLA 3DX2A 2J75A 2ZXDA 2XJ7A 2WKLA 3AJ7A 3FXYA 1E6XM 3VSVA 4NX0A 2VR5A 4HOXA 2YJQA 1GCYA 2XFYA 3ARSA 3AIUA 1U30A 2DT2A 4KRUA 1KXVA 4MB4A 1UR2A 2DQXA 4N42A 1OB0A 2VMFA 3MMDA 3OG2A 1KXTA 3TOPA 3WDPP 2G41A 1GJUA 1FP8A 1FP9A 3BH4A 3VPLA 2FE0A 3LXCA 2YA1A 1KWKA 1UWIA 2JFEX 2WSKA 2YL9A 1CGVA 4M24A 2YKKA 4WSKA 1JGIA 1TA3B 3ZQ9A 4RE4A 2ZX5A 3LX9A 1F4HA 1UQYA 2X09A 2WWDA 1V0LA 1QHZA 1XSIA 3E1F1 3IJ7A 1JF5A 3BSGA 4V28A 1UD5A 1B31A 2J7FA 3DX1A 1TUXA 4PEEA 3L4YA 3T2OA 3EDJA 3BVXA 4YHGA 3AZSA 3WMSA 2QPUA 1FH8A 1BQCA 2A3EA 2WLYA 4LXFA 4J3VA 1RH9A 3WUFA 3RO8A 3B9EA 4PMXA 1E71M 1NM9A 3ARZA 1E6NA 3T08A 5BRPA 2JEQA 3VM7A 4B9ZA 1MW0A 4FLSA 4UCFA 4JKKA 3RPMA 4B9YA 4OBSA 1CYGA 1MFUA 4F9DA 3O2LA 1MW1A 5TD4A 4V2XA 2UY5A 3D4YA 4ACYA 2VRQA 4U5KA 1QI3A 3HG3A 1BG4A 2X2JA 3ARPA 3T2QA 3PZ9A 1TQWA 2WHLA 1DWHM 4UNIA 1H09A 5JBDA 4A3YA 1R46A 3W0KA 2X0HA 1ISYA 1SZNA 1G01A 5I77A 1G94A 1H0IA 4D6EA 3NCOA 2XIIA 4LPCA 1UZ4A 2E8ZA 1W3LA 1JZ5A 2XVKA 3AZTA 1R8LA 1B9ZA 2X2HA 1NP0A 1JYWA 4UQAA 5C71A 3PZIA 4LX4A 2YL5A 2YBUA 3VVGA 1HT6A 1JZ6A 5HBFA 2AAAA 3PTKA 3RCNA 1I1WA 4GPNA 5I79A 4P8XA 3ZJKA 4WJXA 1XYFA 3TTOA 4B15A 1UUQA 1DWJM 6TAAA 3CUFA 3MUIA 4MNKA 4AEFA 4DWSD 3ZO9A 1ZS2A 1ODZA 3WL0A 4HU8A 5E70A 3VD5A 5LA2A 3F5KA 2WKGA 5E1QA 4P8VA 2BVDA 3T0DA 3CUIA 3LPFA 3UETA 3W4RA 1XGZA 5DEZA 3VSTA 1EH9A 1EQPA 2VL4A 2J7BA 2UWFA 1ZJAA 3MMUA 4DUVA 3WD1A 1ODUA 3OIHA 1YQ2A 3EJRA 2ZICA 1X6NA 3AMCA 1UD3A 4H7VA 1Y7VA 4DO5A 2W66A 2WC4A 3NSXA 4WLCA 5F7UA 5IFTA 3NSNA 3IGUA 3AXXA 4W87A 1KBKA 1A47A 1CXEA 4UQ9A 1FHLA 1CTNA 2Y8VA 1WZAA 1ZBKA 4M1RA 5ABFB 4CGTA 1ZU8A 2QMKA 4AMWA 2JF7A 1V0NA 1DWGM 1NWTA 4PN2A 2DSVA 2DSUA 3BLKA 1OT2A 3BMWA 3ARUA 5HXMA 3VOCA 1W1VA 4CD4A 3VGEA 3ZSSA 1HKKA 1UD4A 1QHPA 2DDXA 2VT0A 2XM1A 1GNXA 3BGAA 4UFHA 1V3IA 1H3GA 3FAXA 2XIBA 1SMAA 4DO6A 1B90A 3ZM8A 3WY3A 3U57A 3WFLA 4MB1A 1EDQA 5IDIA 4MTVA 3L4UA 2XYLA 3D5HA 3UG3A 5CZKA 5DT7A 2O9TA 4S3JA 3BVWA 1LWJA 3LPOA 3A47A 2G3NA 3LRKA 3TONA 4IM4A 3WNMA 1Q6FA 4EK7A 1QW9A 1R7OA 3VIPA 3IJ9A 4PRWA 3MANA 1PAMA 1GPFA 2J8GA 3WNKA 3DDFA
chains in the Genus database with same CATH superfamily
3TMQA 5CJNA 3I84A 4Y1AD 1T0MB 4LVAA 1A1MA 2BSED 1AODA 1MUWA 1DYSA 3OTTA 5DWPA 4NZ1A 2AEOA 3C5ZB 2OQYA 4YIWA 3H2AA 1LO3H 2V7NA 1XGDA 3H3PH 4JFSA 4OD1H 2HE8A 1I4FB 1UXWB 3W1TA 3BPOC 4M81A 3T0CA 3T71A 1H7PA 3IMTA 3CPUA 4KX7A 3MRLB 4HUXB 1I1CA 5ILTL 3EMZA 4WU7A 2VEMA 2APBA 5I16A 1G6VK 3EIFA 1U8HA 1EFZA 1QW8A 5DDHB 5HGHB 1RUPH 4FABL 4MJ5B 4ODWB 1DJSA 3PIQA 1OWQA 5HWNA 4K7PH 5KSWA 1C8YA 2XN0A 4GKSA 4MYXA 1IAIM 2OP4L 1GSMA 2Z26A 3WQVA 2VDLB 5B3JE 5FFLA 5F9OL 1HWGB 5AUMA 4XNYL 4ZS7H 2PWVA 3ALPA 4YS4A 1GS7A 1N6QH 4AMCA 4HHWA 1CDJA 2OJEA 3VD1A 1IC1A 3FU0A 1RAKA 4FXKC 3GIQA 3BUTA 3DH7A 1A50A 2TAAA 2HZGA 2QAFA 1NDYA 4GI4A 1BYDA 2BFGA 3NL2A 5CMAA 3JWDC 4XD3A 4JFED 4OZIF 3BPOB 3VOJA 1UCWA 3ZT5A 1JPGA 5D4HA 1ZVHA 4WV1C 3B97A 3E49A 2P26A 5HNNA 4Q7NA 4HBCH 5CINH 4CVZA 4P23A 2XZQL 3ETSA 1BD0A 1S5WA 1VGAA 3QFGA 2VW6A 2Y61A 1XLJA 2XVLA 5HI3D 1CBVL 1A5FH 2EIBA 3QSKB 2BOCB 5FK9A 1KPUA 3HHSA 2CDGB 3Q1EA 2GZXA 2B15A 1ZALA 3WKZA 1EBPA 4HMCA 2NY6C 1E0WA 5BVJA 4J3OC 3T1FA 4OCWL 1V79A 3MWAA 5CCJA 2LTQC 4MJ6A 1JQVA 3W9DB 4BR1A 2WOYA 2OPJA 4LOUD 1P0SE 5FV2A 1DUZB 3C2FA 4FXKB 2QIWA 1WDRA 1JGUH 4NKDA 4NC2B 1FF5A 5J89A 4YCOA 2FT8A 1M42A 4G9FB 1K8XA 4NBZB 3LU2A 1QTPA 3H2CA 5HY9A 5I75C 5IHSA 1G1YA 3EH2A 2AZUA 4WV1B 4M6NL 4FN0A 3MJ9L 1CK0H 1YX1A 3RBSA 1AO7D 3NOIA 1P84K 4JR9L 2X6CA 1XIJA 3T6QC 4EIBA 3NSYA 1QI0A 2QXWA 5AOUA 1W0VA 2IAAC 2LLNA 1NDGB 1CR9H 3QPXH 4FQXC 4HJGA 1SJDA 3ORJA 3MLUH 4FOMA 3ZDZF 3LKRB 5CFHA 1EMTL 2OT0A 1GT8A 1KDJA 7CGTA 1WXYA 3LM7A 3RGTA 5I2IB 4KPHH 3D7PA 4RXGA 4GI6A 2LLGA 1GOKA 2VTFA 3E6FB 3RF9A 3IPBA 4L1TA 3MT1A 4LSUH 3DDGA 3EOLA 4KO6A 4X3ZA 5J5EA 4UFIA 2LTQB 3MHFA 1ZK9A 2EIZB 4GVIA 4BI6A 3V5DA 2XWCA 1XH3B 4LEQA 3MGTB 4IKIA 2F6XA 4B50A 2NW0A 4RAVB 1G7HA 2W62A 3ZL4L 4AGMA 4DUOA 3FUHA 3KH3A 1AQHA 4JG0H 4JY5H 1X6LA 2YAEA 2AV1B 3TLRA 2CG9X 3X3GH 1DR9A 2EILB 3MJ9A 5I75B 2B4CH 3QPQD 1UCBH 3ZFHA 2HXAA 3IXAA 1TV2A 2DUZA 1GW9A 5TH2B 3DENA 3P7YA 4F1SA 3Q65A 4R9OA 3GDKA 4OLZL 2PWUA 1L6ZA 2E68A 2CZEA 2CKBL 2DEPA 2F54D 2W63A 1DQLH 4FQXB 3GNMH 5DFVD 4U1GC 4Y90A 4TTUA 3LEVL 2PDWA 2WY3B 4X6CF 3LHVA 3UXIA 2E7DA 4UV4L 1ZE3H 3W88A 3MYJB 4KK5C 2B8OT 4D6CA 3UAFA 4ICXA 4LAZA 4LTSA 3GBEA 1JD9A 5LXXA 1X5GA 4GBXA 5I1AB 3DX0A 3DFSA 2IMMA 1F74A 1ZE3C 5L9FA 2ADFL 4GINA 4NGHH 4WGVB 5KTEH 2QSCH 5C9RA 1I2PA 3O2VL 4I0PC 4X7SL 1DJHA 2PLCA 3M0IA 2BNJA 1UXMA 4BE6A 4NDMB 1XDTT 3BPLC 4WDXA 1XCXA 2MWCA 4LL1A 1LG2A 3G3DA 3ARTA 3F2LA 2CKBA 2N1TE 4W5UA 4NZFA 3GDCA 5EC2A 2CLHA 3AHZA 3G1YA 3USZA 3W76A 3VFOA 4U1GB 1F58H 3LYRA 2I56A 4LF3B 4OVXA 3BUIA 5FF4A 4M6QA 2XRAH 1RHCA 4BCXA 2YDSA 1PE1A 5D2NC 3BMXA 2DP3A 3PFUA 3MDUA 2R1XB 3UTQA 4FFYL 4H04A 2YD6A 3C5JB 2EYRA 3SCMA 3D2UB 4YGAB 4PJ8D 5AVYB 1OP5H 5H1WA 3FQRA 3ZT6A 4M51A 2Q8ZA 2ZOTA 4D6JA 4GRLA 2XSKA 4XAKD 4I0PB 3IRDA 3T5WA 5FPIA 5KVDL 3BPLB 2GSHA 2ZUWA 3PWPE 3L95A 1UMLA 4CQDA 3VKKA 4WJG3 1AACA 2IIJA 5FJUA 4OU1A 5ESVB 3PNWA 2WZIA 4LBEB 5ICUA 1R38A 3VIIA 3WMBA 1EFXD 3RDTC 3E5BA 3C2OA 3UXDA 1SY6L 4JGMA 1U92A 1LL7A 3CFEA 1VFBA 1DUYA 1KTBA 5KVGH 3TW6A 1IR2A 5C07D 4ERGA 3QV7A 1G4SA 3F01A 3FN3A 4FFYA 4QNEA 2IDTA 3VVVA 2VMEA 3DC0A 5D2NB 1QAPA 1B3OA 3W27A 1Q6OA 1V7YA 1EWEA 3H6OA 1PYMA 1UGNA 5KYWB 2LV4A 2EE3A 1FNSL 4UTBH 2UV8G 1MDAA 4HHPA 1F3TA 1N2VA 3V0VB 4ZRGA 3BLPX 1D2KA 2BRQA 5HNTA 2HWGA 3CWNA 4H88H 5CP3A 1NWRA 1BBJA 5DMNA 3WFDH 1WG3A 2AK4B 4KRTA 5CHNA 3UYPA 1PDKB 4MDPA 4DX3A 3MRIB 3BP4A 3H2EA 2VR8A 3K2UH 4AWEA 3L2NA 3O0RL 5E2UH 2OLAA 4XR8C 3L3IA 1GQIA 1JYVA 1A6UL 5IBTL 1WEJL 2LOEA 3RDTB 1SY6A 5EGRA 4QCFA 5DC9B 4EAYA 1OWWA 1A02N 4Q8NA 4MD4A 1UWYA 5I24A 2LT9A 4N26A 4NQCD 3WH7A 1IGCL 4JTAA 9CGTA 3JBG7 4JRXE 1UENA 2UXVA 1MLBA 4MD5A 5LIYX 4YXKH 2Y06H 4UAOC 3FU9A 3B9DA 1OM3H 3PPCA 4KHTL 3MUY1 4GG9A 4MA3B 1XP3A 3GBML 3W11C 1JRHH 3LMYA 4E2VA 3PG8A 3NQGA 4KNTA 2ZONA 4B9FA 2F68X 5FYLE 5A8MA 3FU3A 4LPVA 3S6TA 4OWGA 4OGAC 5I78A 4NLAA 5I0WA 4LKCA 4FNRA 4QRTA 1J1XH 5IOBA 3STZB 3FTXA 2WYTA 3SCQA 4DBWA 2RQEA 3IXTB 3QR1A 1YBQA 4AC4A 1OC6A 2ZPKH 1NCWH 4IQHA 4BFIB 3T2PA 3V7MA 3EO0B 2G30A 1DBBL 2Y7QB 5JQ6H 2L04A 3QPEA 1WAAE 1K3ZA 5EN2A 1GS8A 1SVBA 2EH8H 1O6SB 1LO0H 3WDJA 4UAOB 3T0EA 4YN3A 3IDIB 3Q13A 5G4HC 4KNQA 4PODA 3LEYH 3HA0A 4ZMZA 4ZMLA 3HHRB 4IPJA 2VUKA 4UOW1 2Q2EB 5F1VA 2XWDA 4E41A 1IM9B 2IGFH 5L6YH 2OSYA 5K9JL 1W1TA 4J9JA 1AG6A 5IQ7L 1R9XA 1R5IB 4WQ6A 3KYMB 3UGRA 3AAMA 3CZEA 3WDHA 1DFBL 3BT2L 2GWNA 3MMWA 4JO1L 2J4WH 3J8F7 1LK3L 1K7XA 4PUNA 3W1LA 2DMCA 1N8WA 12E8L 4R88A 4U1HB 5E93A 3EWCA 2GGJA 5CH9A 4C56D 2WM0A 2YHGA 1KN2L 4AQAA 4ZFGH 1YQVL 1I1YA 2DLIA 3GDTA 1OHLA 5HJLA 1VGKB 3BP6A 3Q8FA 1QK0A 1PX4A 3FTUA 3G6AA 7FABL 3IJYB 3VRJB 2B7PA 2JKWA 1P2CA 5K59E 1LE9B 4QLRA 1CLZH 4MS8D 4XAZA 3EFFB 2GK0B 5FUZL 4P2AA 3HE6A 4LCUB 4G42A 4MNHB 3W53A 3SDDC 3V4LA 5HUPA 4ML9A 3LHYA 2WNWA 4G6KH 4FI6A 3KHQA 4Q4EA 4DP9X 1KBPA 4IBQA 2ZXQA 3DUUA 1LOLA 1EHNA 4S2BA 4RZBA 3T6WA 4HWZB 4L1BA 3WENA 5A3ID 2BVUA 1CZ8L 3BAIA 3JSSA 4ZMGA 4TNEA 3BCDA 3CHEA 4Z2IA 4PWGA 1MJ7L 1SJXA 3OLDA 4Z6AT 1XLCA 3F5JA 1C5DB 4OT1H 4JW3A 4MAVA 4GW1B 1CDCA 4OAWB 2N01B 2FPYA 4YSPA 2HS8A 1IFHL 3HB9A 5DSCB 1KYAA 3FB5B 2CERA 4MBRA 3ESNA 2XH2A 1YN7B 4Y9EA 3CFBB 2OZNA 1JHKH 2HJLA 3QJRB 4HC1L 2F5BH 5CEZE 5MF5A 2YQ3A 2A4ZA 3W2MA 5C0RL 4N5EC 2P49B 2WZHA 3E6HA 3OGSA 5HHOB 3FTWA 4ZXBD 4DH2A 2V5RA 3GLZA 2W94A 3SDDB 1T04B 4P07A 4H8WL 1XF2B 5L0QC 3E5PA 4HS8H 5KVEE 1SFTA 3QZOA 3PZTA 1I9RH 2VDHA 4YHKL 2FGWH 3NZUA 4PGDB 5KS9B 4MBOA 3TTSA 4A8NA 1FWWA 3R89A 4UFKA 2CCWA 3CNKA 3SBWA 2QGBA 1Y65A 4JJ5A 4GKOA 1I7ZB 1DCLA 3O9NA 5GJPA 5AKRA 4LS1A 3PP4H 1JZDC 3DHPA 4Y2DC 3RO6A 4OV5A 1PY0A 3BAXA 1ICQA 1XD1A 2P9RA 1JZIA 3G04B 1FBIH 4QE4A 1QFOA 5I8CA 3K72A 1EAPA 4G6AD 1M04A 2R27A 4WDTA 5FIPA 4HC1A 3QQDA 4ODSH 2XXFA 4MY1A 5A2AA 2O6FA 1S9WB 4OLWH 4Q2ZA 2P46B 5LKYA 3VJ6A 2EXOA 4OT7A 3CHRA 1KELL 4MWFA 5JPMC 4M1CD 1FDYA 4UTUA 1A8ZA 4XISA 3BDXA 4WFEE 3L65A 5A8OA 5BZDA 1BP3B 5L0QB 3QQXA 2E6PA 2E7CA 3ECVA 4D8PB 2JJVA 3MKVA 1IILE 4F57L 4UINH 4JZOA 1SN5A 1C5CH 3G5ZA 3VFTB 4POZC 5HGAA 4L0PB 2CJTA 2DWEA 2QTEA 3PJWA 3EKGA 3WD5L 3HMXH 3JZEA 2EVJA 2JKPA 4Z7QB 4Y2DB 4C1NB 3WFEL 1KBIA 4ABUA 1CU4L 3FH5A 1NDWA 1WIOA 3KS0H 2UUDK 1BLIA 3RWJA 3ZTJG 1P84J 3BPCA 1LOSA 3GK8L 2PW2B 2NY1D 4M1DH 1X3DA 2G4EA 5TDNB 4GYJA 3EO1B 4FLHA 4RPQA 5IXEA 3I6TA 4Z76A 1SJBA 4NJAH 4KRLB 1X7FA 5D9SB 1BV8A 3CUPA 1V02A 4P2QD 5FEBA 4US5A 1F3JA 4C4KT 2FVNA 4TL5A 5JPMB 1VBUA 4F7EB 4ATLA 1WAAF 1JFQL 1HXKA 4NZRH 5CCGE 3QEGL 5D1XD 2ADJA 3MX0B 3BZ5A 2AXGB 1N9PA 3NFUA 2YZ1A 3OTRA 2PCPB 2P24B 4IL0A 4PBDA 1KCKA 2GUUA 1WZLA 1ECYA 4HOZA 2W0LA 3AMKA 4AHQA 2NQCA 3NTCL 3WK3A 5C3TA 4HWUA 3O11A 1LQBC 1FRGH 5K1NA 4LC8A 4BSWA 4Y9NA 1FGVL 5AAPA 2KC0A 3EFOA 2WXRA 4HGWB 5J9PB 1CFMA 3B1TA 1JOIA 2WKLA 3C5SA 1AC0A 5EIVA 3EADA 3TH6A 1NF7A 3V6OA 2VR5A 4ZPTB 3MU3A 4AQ8C 4O17A 2MUCA 4TQIA 3QCUH 3CC5A 1C1EL 2JELH 1KXVA 1ZV9A 1L6YA 2PYEA 2Y7EA 3LD8C 1GYVA 3AZUA 1R6VA 1D5XA 2G41A 2OL3H 3VPLA 4L3FA 4GS7C 1KNOA 2YL9A 3TW7A 1U5JA 3DJ9A 2WSDA 2HFEB 1SYSB 1VGEH 3LX9A 4L9LA 2X1SA 1UADC 4AC7C 2F9BT 2MQCA 4HPJA 3MVSA 4JFFA 5CCKL 2J7FA 3M88A 4P5TA 4AM0B 3CWHA 1RZMA 4YHGA 4OZIB 5BVPH 2JJTC 1CI5A 5IUSA 1DLHA 4JTSA 1RH9A 4MWAD 3P4LA 1WRFA 5K59F 5BRPA 1FYTB 1SM3L 1MW0A 4KQNA 3OZKA 2FATL 4HCGA 3RPMA 3FFCE 1AQKH 1MFUA 5BMFH 5KW9H 4ACYA 1HSAB 4U5KA 1C08B 1CFQB 1UZ6E 4JTEA 4F7KA 4ONHA 4O2FB 2WO5A 1K03A 2XNAB 5CZXC 3T2QA 4Q9RH 4OHQA 1FN4B 4JPVL 3IBEA 3NFPB 3S35L 3NPSC 3W0KA 5EIIB 4D2JA 4BFOA 2AJYL 4G1MB 1RSCA 3NCOA 4HK6A 5FF0A 1U8MA 3LD8B 4XUGA 4D9QE 2X2HA 5DN1A 2DLFH 5C71A 4LX4A 3VTMA 3H9ZA 4KKZA 4DVBB 1VR6A 4GS7B 5J6GB 2G2RA 1YYMH 3KOXA 1DWJM 5LXGH 3U4FA 4U6HA 5C8JA 3CUFA 3U9PL 4YVVA 1BXVA 4UT9H 5E5RB 5SWQA 4KXDA 2BVDA 3FEMA 3UETA 1XGZA 2IS7A 5B22A 1V7MH 4HX1B 4LC6A 3O16A 1F18A 4TULH 1T0NA 4MJIE 4Y9OA 1S38A 5B1AB 1IEAA 2LU5A 1CTNA 4B5VA 3ZDZB 3KBJA 1Z3RA 2EG8A 3NPSB 4WAFA 3NNTA 5D1QE 4IGBC 5C0BD 1F90H 4NQVA 4OD3L 5F88A 5AVXB 1U5VA 3NABL 1HKKA 1MEIA 3V6BR 3FQWB 5TQ2L 4M03A 1JGVL 3SQBA 4LDEB 4OI7A 2Z3FA 3M8OH 4OZGE 3W57A 4F1ZA 2XYLA 4TNVF 2JB6A 3OJDB 3Q67A 3HHMA 5DD3L 4DKEL 5MHSD 2TODA 5ANMA 3O6KL 1QSEA 4HIEA 3MANA 1UT2A 2OOGA 4DAFA 1JHTB 2P48B 3V4PL 3FFCD 1RD5A 3F12B 3BYYA 3EXJA 2J57A 2OR2A 4M9PA 1IC5H 5DR5H 2EPOA 5DJ2A 1WPCA 3BJFA 3C2SA 5IV2A 1EZSA 5DY2A 2CM5A 2C3GA 5ENWA 2YQ2A 2E86A 5I28A 4LAKA 1DSWA 2WYHA 4X6CB 4U1JA 4LU5L 4N85A 2BCKA 2R1NA 2W9EH 3TW9A 4IGBB 3ECQA 4YPJA 1AAJA 1CXHA 2O9RA 2BSSB 3OB8A 2EKJA 2QLYA 3AU2A 3VKDA 1KEGL 2G4JA 2ZUVA 8A3HA 3EXTA 3BAYA 2CJUH 1UWGH 4DVOA 2WAQA 4RDWA 2V67A 4M6OL 4X63A 4KJWD 1FVDA 5C0EB 1NCCH 1SO5A 5I02A 1RBOB 2OX5B 3V4PA 1CWVA 4ZOAA 3RY6C 1QLRB 2VL5A 5E4AA 1AR1D 3CWOX 1TEYA 2DJMA 5C92A 4IBTA 5TE6L 2HVKB 4MJID 4AGQA 4QLJA 4GUQA 1HOEA 4MYWB 4APQC 1OFPA 3SRDA 4IEFB 1DBMH 1UJTA 3RI5K 1JP5A 3O0LA 3QFDB 1II4E 4XVTL 4GEJA 4XCYA 1PCKA 3R1GH 2P5EA 5E2WL 1R4XA 3RIAF 3KWVA 4LS2A 3MFFA 5LWYL 4NN7C 1QU4A 4FYTA 4L48A 4KI5D 5KJRH 1A7OL 1OAJA 3WQ5A 1HJVA 5JOPE 1QO3A 3X14A 2H41A 5CUSL 4HK3N 2XGIA 3CIAA 4HHHA 4Z7NE 4U1LB 4GKNA 5A5WA 2TSBA 2ENJA 8TIMA 3H3BC 3H55A 4XODA 5GJTL 2CBPA 3N1GC 5HDBE 3S6OA 4FYQA 1GYMA 2BS9A 4TV6A 2OMTB 3GEFA 5LYRA 4PJCA 4AH2A 4TSCL 1G0YR 1W0MA 1E4IA 3GTVA 4UTCA 5D04C 4P04A 1FFPB 2HTMA 1L6XA 5AHLA 3AROA 1E70M 1DSFL 4APQB 3U0TA 1HKWA 3LN4A 3CSPA 1U9KA 1JNDA 5IM7B 1F13A 3MA9H 1M01A 1GHRA 3WFCL 1IVTA 5GRVK 5JW4M 4G43B 3WIHL 3P14A 5EF1A 3ZGIA 4AL8H 4QJ5B 4NN7B 3IJSB 3IAGC 1UJQA 1VBGA 5HUOA 2O5XH 3A5FA 5LNRA 5C5YA 2MH4A 1D7DA 3BO8A 3HCVA 1MXSA 1Y1UA 4AG4L 3VTAA 5HSFA 1CB2A 2KI6A 4AL8C 5LDSA 3JWNG 4XP9H 3QFJA 1UZ6F 3RN6A 4I3SL 2OMYA 3SKJH 5FB8B 5DHMC 1AXIB 1LEKA 3WNJA 1H5VA 1IEXA 4D94A 2OW6A 1ENUA 3WBWA 3WD2A 2EUVA 3HVDA 3PHQB 1D6VH 3DIFB 3CE1A 4QR7A 3EYVB 3DGDA 5IOPA 3TN0C 3BDBA 4M6MH 2AI0H 1JNEA 5D72H 3WIHA 3B83A 3MRHB 4JQ3A 5CPQA 3AREC 3O6LH 4JNMA 3IBOA 3HZKB 3X1FA 4XHQA 4U1IB 5DYOB 3RU8L 1QHOA 4GYFA 4Z7OF 5JOPD 3LN3A 4ZUTA 1H0DA 3VMOA 1S7VB 2BZ7A 5EA0L 3D3AA 1QBBA 4XVEA 5JLZB 5DK0B 1DLFH 4JM2C 5EF0A 4L5FE 4WEVX 2O6EA 4WKZA 2Q87A 3CXDH 5K39B 3T05A 4ZNEE 3DTUB 5IFJB 4XX5A 3DSFH 1JXDA 3ZS4A 4MX7A 5BS0D 3Q5YA 2XM2A 2BY3A 1JCLA 1NOFA 3L9RA 5EOTB 5F0LB 1YYCA 2HMCA 4YAQB 4EXAA 5BZWB 1XIFA 5HHXL 5FKYA 3TN0B 2ZOLA 3FB7B 4S2SA 3MZ2A 3GRWL 4URKA 1LYQA 2EPHA 4ASTA 3VTRA 3QAQA 2YAFA 5ITBH 3TIEB 1JCVA 3AREB 2JCWA 3SCNA 1YRRA 4PUBH 1DVTA 4OZOA 4IUOA 3I2CH 1A8JH 3SJVE 2GT9B 4HUWB 1TREA 1U3HA 3POHA 1RJYB 1GWJA 3NZ8B 5DTFA 3AS0A 4YOKA 3IKCB 4GIEA 4BI7A 3P77B 2R14A 1CE1H 4AIZA 1UA3A 4LB8A 2W80C 4JM2B 3HZVA 1MHHA 4IRSD 4TVSa 4TYUA 3HTWA 4ZTXA 1WDDA 4W4NA 5J3HD 4PLOB 2DW7A 1G4RA 5ECVA 2GITA 2WWOA 1N59A 1MQPA 1MJUL 3TFKC 2GDUA 1VFLA 2B7QA 1DJNA 1H7RA 2D2GA 1SMDA 1I1AD 1M2OA 3WUEA 5DT1L 5EU9A 4P2RE 3GRWA 3IS4A 5L8LB 3NFNA 1WBZA 4HPYH 1HIMH 1RLBA 2NCEA 4FTVA 3HUJA 4XO9A 1C12B 5E08L 3FRPB 1YLVA 1TPC1 5J57B 1SF3A 5FO2A 1KIUA 5I6LA 4PL1A 1FWXA 5EORL 3Q06A 5IROD 4PEKA 1SVDA 5ICXB 3APTA 1CFTB 1K9TA 4NIRA 3FT2B 1HHJA 3KS5A 4HH8A 5INCB 1FZMA 4NKMB 4GVHA 1TR9A 2P53A 5E8NA 5T1LB 3VFMA 2XKUA 4UZGA 1BZQK 1ITXA 2XN1A 2PDJA 1GORA 3MGAA 5DURB 2ZCHL 1TSRA 1DQML 4LY8A 5L2JA 2NZIA 1MAML 1E4NA 4YWGH 1JGLH 3MV8D 2A3CA 1RUAH 5A2IH 1F73A 2EVIA 5KSUB 3JUGA 1A6VH 1V0MA 3M7OA 5DYFA 1V03A 1PLGH 3H54A 1NBZA 1RIHH 3QW4B 3ITOA 2YO3A 1AP2A 4GMSL 3EEZA 2PRHA 2V6AA 2VURA 1OWRM 3L5AA 2ISSA 5HDBF 2PMZA 4S3KA 1A1OA 4XZWA 5EU6A 1SOXA 3GDLA 5LN4A 1ETZB 5HYSG 3BH9B 3PWPB 3KRBA 3FQTA 3QNZA 5HHQA 4UB0L 1E8WA 2YBGA 4X9BA 5I8OL 2B81A 4UWQB 3A4DA 5CU9A 1GC1H 4NRXB 1UM4H 4OM0L 4YDKL 5EOQL 3KZPA 4UR7A 3AUJA 4CQBA 3P69A 2F19H 1AIZA 2CLOA 5DBUA 2PP0A 3AG4B 4IHCA 5A94A 4IM8A 4R4ND 1DORA 4PIBA 2Z8SA 4KWSA 4YXHL 3ATZA 4Y1SA 2FZNA 1BVWA 4GGHA 2UY4A 1M56B 1JPST 4O9HH 3UNDA 3LNFA 1XTMA 3VD3A 4LT9A 5A6BD 2CUHA 2CLZA 5JHDA 4ICCX 1JGEB 1ZHBB 4YNYA 5EMLA 1XF5B 2BFVL 5EF3A 3BXWA 6REQA 1IBGL 3DFNA 3ZPDA 4A7TA 4XAWL 2A99A 1MCNA 3W3BA 3TA3C 4Z5RB 3W00A 5JH2A 5DZJA 3T0AA 4IF2A 4H00A 3QOKA 4UTTA 2ICWB 3PWLB 4Z8FL 1JXGA 4OUEA 2FL5B 3G6LA 5I1JL 4IIZA 5A3IC 2DQEL 1AL8A 1JVOA 1MQKL 4KZDL 4ZVJA 1E5AA 2VFDA 1IGFH 1SOKA 3HN3A 4JRXB 3NRQA 5I17A 2ZP9A 3WJYA 4F8PA 2F1BA 2P0OA 1Q7QA 1XGYH 3QXVA 4D9PA 3P5ZA 3U4EA 2Y5JA 3Q2CA 5IK3B 3V0IA 2NQ5A 5IVZA 5KWYC 2OQJB 3IDMB 4IFKB 3NMEA 3MNVA 2J8HA 4G7EA 2IWEA 3BQUA 3C8DA 2EDQA 3H1ZA 3LTYA 6TIMA 2EJAA 3NSMA 1SEQH 1NMCC 3LV5A 1IAIL 2GYSA 4ZXBC 2GUOB 4IIBA 2R0WH 1NWUA 4Z23A 4J1OA 2PXYA 1RIUL 1JNHB 4B5XA 2NX1A 3W29A 2BG5A 4OSUH 3WXVL 4Y1AE 3TA3B 3D18A 4D9LH 3RTQD 4HT3A 2DDQH 5EO9B 4ZAKA 3H2FA 3HBGA 5FR3A 4JL2A 2BIHA 1WVZA 2HE5A 4YSEA 1WFTA 1WO2A 3TEUA 3HPFA 5DK2B 3EAUA 3WNNA 2ZKMX 4LHUG 1RUQL 2KT6A 3HG2A 4FFWD 5CIPH 2FIKB 3WLMA 1QFWM 5F9JB 5TFSH 3D3VB 1IGSA 3NZGA 3C3UA 3QNFA 1UWSA 3GNOA 2X2UA 1FWSA 5E8EB 3P4NA 1XRTA 3RWEB 4WXZA 1TZOA 1XGQA 1WISA 4RMQA 1J0HA 4Z1BA 2CO6A 3HV9A 4EIZC 1K5NB 3KAAA 1NMCB 1N7MH 3V6ZB 3MROB 2P8MB 2Y5EA 3IN2A 3NEEA 4Z2GA 1BQRA 3REQB 2DN7A 1TNNA 1TU2B 3K91A 4Y7EA 3DO4A 3MRMA 1VYRA 1RH8A 2N7BA 3G1HA 4AZBA 3V8CA 3IEBA 1P1ZA 3GC3A 3R58A 1YKWA 3UZJA 5I03A 1XYZA 4LASH 2DORA 3ARVA 4GOSA 5I5RA 3ASNB 2H9AB 3PUUA 4YX2H 4S3BA 4LRIC 5ACLA 5DUPL 2BDNH 5DHXB 1WIUA 4JFEE 2YLHA 5DHYA 2KKQA 2YDRA 1U8NA 1BVNP 4FHBD 3S4TA 3MTWA 5DJDA 4Z7QF 4FMVA 3CCHB 1EPXA 2CR3A 3FT0A 4R27A 4MAZA 3GVGA 2VDLH 4P46A 4RNHA 3BOXA 2FHBA 4TNWF 4Z7WE 2YRLA 2VXUH 4Y9GA 1PZSA 1EWHA 2DL2A 3L5LA 2DBJA 5EBLB 3CSGA 4LBUA 1FWJC 1DHKA 2XQYG 4FG2A 1T4KA 1P4UA 3X1NA 3A4XA 3I10A 1TMCB 2P8CA 3MRFA 2F1EA 2ZXCA 3WJJA 4L4VD 2DM2A 1YMHB 5D2LE 2HA1A 1P1XA 3IN0A 5E94B 1TLKA 4J3UA 3G6JA 4WI0A 2Y23A 1J5SA 4ISVB 3BURA 3G1FA 4AKPA 3FT9A 3HC3L 3KE0A 1O9VA 4XBPB 3JV0A 3TWAA 1YEJH 4HJEA 3KRUA 3QRLA 7TAAA 5AOKA 2DT1A 1OAYH 1TZIA 2A0LC 3ZRSA 4U3CA 4ELKB 1OW0C 3CTLA 1YEDA 1DTUA 2X1XR 3QXUA 2YD5A 1AO7E 4YR6B 1U58B 4IDJH 2E9WA 2ED9A 4WCYL 2KMWA 3TA4D 5GRJL 3RY5A 2AVGA 2ISVA 1NMAH 5B80A 4DPCX 3CMOH 4BUQA 1I8JA 3MO1B 2GJJA 1FKXA 5EDSA 2ADGB 3RWDB 3FCTB 2VB5A 2W9DL 4Q7IA 2ZCLL 2X05A 4JPWL 3JWDH 4PRIA 5SWZA 4E5XG 4LSQL 4FZEH 1MRDL 3PJNA 3F03K 5HAOA 4Q97A 5IEHA 2G5BB 1L7IL 4FXJA 3VKBA 1I7UB 4R90H 3KJ6H 1FL5A 3NR0A 4BKTC 1SUXA 2HJFA 4M7LT 1BXNA 4UYPA 1XBVA 2DKSA 3ZLGA 3VH8A 1NWPA 4UTJA 3MRQB 2GJ6A 4E9YA 4B5UA 4F80A 2X1RA 4G5AA 1QEWB 4XX6A 1NMBL 4R7WA 2OVLA 4NZUH 2FJFB 6ENLA 3TCLB 4QTIH 4HF5L 2YYTA 3BUPA 4J3OH 4HHMA 2IXVA 1U8KA 1W0WB 3WK1A 2EE6A 3W37A 1SBBA 1AZ2A 1QLEH 2PO6C 5LVEA 1PEWA 2DLEA 4H8VA 5IEKB 4M43H 2F54E 9XIMA 5ELIA 1OF0A 4LSRH 2QVNA 1YTEA 3SKMA 4KROD 1SVCP 1TV5A 1P9MA 1WNOA 4H0GA 3LS5L 2EAEA 4HIQA 3N06B 2NV1A 4F5CA 1P6BA 1KGIA 2ZT9C 2UXGA 2EIJB 4S0SD 3BH8A 2E5DA 1CFSB 1GK8A 4QDMA 3EBAA 1PIFA 4RZ5A 4W5ZA 2YAQA 1NLDL 3EYFB 4J2QA 2QMJA 2GQAA 4Y8FA 1DBJL 3HRZC 3I50L 2Q09A 2A79A 2J75A 2QFRA 1OCRB 4PI0A 4XI5D 2PE4A 2P7TA 3FSWA 1J6OA 1INDH 2YJQA 3WMLA 3AIUA 1PQZA 1U30A 2DT2A 3KWWB 5BW7A 1S7XA 4N42A 5IMLA 4X4XA 3WS6A 1UP2A 2XG5B 1YXCA 2PO6B 5AKVA 3TOPA 3LTSA 3AXMA 4N2BA 4QRBA 3LXCA 1KWKA 1N55A 3C9NA 3HNVL 4ZMVA 1XW8A 2FSDA 1LMKA 4YL9A 1CGVA 1HNFA 1RZFL 2DB8A 1CICD 3OAZH 4DEFA 3C8KB 2NY6B 3R18A 4X5WA 2NNAA 2JLPA 3E1F1 4PS4L 1UC5A 2XTLA 1QLEB 3V10A 4RA0C 3SDCD 1DQDH 1AH1A 1HZLA 4QJ1A 3OO2A 3MNZB 2R0ZL 4HIIA 3AZSA 4C47A 2CWRA 3WUFA 5T1MA 5F7DB 4L9DA 3QHZL 2APSA 1WTLA 3FUFA 2ZUYA 3ULVL 1ZTVA 4E0CA 1BEUA 4F9DA 3GHEL 2RJGA 5AYZA 3TAOA 4XAKE 5FA3B 3HRZB 3VDGA 4FQ1L 1MWAL 4D8LA 1DWHM 1RU9L 4XT1C 1XF1A 5T3XD 5IB2B 1H6FA 5JQIB 3V5KA 2RR3A 3ZMNA 2IDQA 3PV6A 4HD9A 1QNZL 1XL6A 1YECH 2VC2B 3S46A 3PZIA 3ETBF 1FL3A 4OCLC 4AT6B 4QSHA 1BXBA 1MUMA 9RUBA 3W0WA 3O8XA 4XBEH 2ZTBA 1MFCH 4P9HL 1ZAJA 1MZZA 3NCYP 5C07E 4C8XA 2A7BA 4DW2H 1RLDA 3SGJC 3UTSD 3HV8A 15C8H 1E6JL 4C1KA 1IC4H 4GH7B 4QTFA 4EI6A 3GSUB 3EJZC 4H4NA 3SYCA 4ZFCA 5FV1L 3PDOB 5D2TA 3TC3A 2OTWB 2FUTA 4WY7H 1MWAA 4WLCA 3FQNA 5D1ZA 2IFFH 3IT8D 3WIAA 3AGVA 2FLIA 1RXLA 3PXLA 3VXPA 4CGTA 1JWSA 1ZOXA 3TYGL 1NWTA 2OR9L 3HI1B 1O5KA 1FUYA 1DE4A 1L0QA 4JFPA 5D2LF 5LAXA 3UIZA 5D1QC 2WLJA 3QG6A 4LSVH 3O3DA 2PA6A 1ANUA 2R29H 1H3TA 1TOXA 2QL1A 4UM9B 3SKNB 1TSHA 4MB1A 4NQCE 3VXGA 3G1RA 4MTVA 1NSJA 4AMKL 4KKRA 5DJYB 1AXSB 4Q6XA 3T9PA 2WIMA 2I16A 2FD6L 1ZHKA 1O4UA 1ZLSL 3D69A 1JV2B 1PAMA 2ZXGA 3W2DL 4KNSA 2XQYK 3D87B 4FOJA 1O12A 2UVFA 2JJSA 1JPSL 2VISA 1Q38A 3ABZA 3RKDC 4Z7OB 3UIYA 2DVTA 3GMMA 4C6IA 4KTDL 5FJOA 2WSQA 1ZSDB 5EF2A 4PHXA 5B3JF 3BISA 2QKSA 5T1KA 4P5KA 2AKRA 3MRPA 3W1ZA 5EWIL 1KLYA 1IVLA 4LCSA 2Z9TA 5E09A 2EC9U 3CC1A 4I77H 1X7IA 1JCKA 3DOIA 2YA0A 4PLJD 5D1QB 3IVKB 5DD6A 3MSPA 3QA3B 4WDWA 5GZOC 1MFBL 4W9CC 1O5RA 4N4QA 1OM9A 4L7ZA 1ZT1A 3KPRE 5C0DB 2R1KA 4OZGB 3HR5A 1WUNT 4LNCA 1AQFA 4PTTB 2NTFB 1CD1B 3KPPB 3L3OA 4YSCA 1XLGA 1FNLA 3RHGA 5CSBA 5IMKB 4LEBA 3NCFB 4RQQB 3I9GL 3MAWA 2ZSWA 1JPTH 4BSVA 1BYAA 3A6BH 5GJSH 3H23A 3BG3A 5KG9B 2DSZA 3TK7A 4ZMAT 4UTKA 3CSBA 3O6ML 5FCUL 5I1DB 3B8WA 3SE8L 3T77A 3GMQA 3STGA 1W2KT 4PJAA 4FLQA 5JUVA 5E2JA 1HEZB 3IF1A 1Z5LA 2XACC 5CBEA 1ZT4A 1V05A 3EOBB 3VD9A 4MS6A 3VFWA 5TDPA 2C9QA 4C56E 3WI9A 4GMTL 3QQ0A 4KKNA 2HTLC 4PR5A 4J1UB 3GBNH 1UR3M 1QFPA 1R19A 1F4YH 4ZD3L 2OXHA 1ZLDA 1QWGA 4JB9H 4ZX3A 3NSDA 2IO5A 5AZUA 1O9ZA 1UWQA 3IWUA 1HAWA 5IBLD 2NZ9C 5I30H 4AK2A 4TVUA 2R9HD 3W01A 5GS1C 4C1LA 1IBYA 2FYVA 2WW8A 3F7VA 3USBA 1PYWB 4XPTH 1KCSL 3ZKXC 4PFEA 3QORA 2EKSA 4RJEA 4IIDA 5FFOA 3GKWH 4KTEL 4KPLA 5ACZB 2BIMA 4TPRH 2ZWSA 3DVNB 4FMKA 2DTML 4OFCA 1XYBA 4HKXA 4IRJC 3CV5A 4D1JA 3FT4B 2VWTA 5JXEC 4CADB 3WL9B 3KPRD 3DKLA 1CNVA 2RAGA 2AXWA 4N6RB 1XIMA 4Z7NB 2WCPA 3WF2A 1M7IA 4RMTA 2YLLA 3ZW3A 1E4KA 3ERXA 4JM2F 5HDBB 4O57A 4OV9A 2YUWA 1PZDA 4MSWB 5J3HC 5JMRA 5AC7A 2F53D 1Z9MA 5GS1B 2JIXA 4A3RA 2KQMA 3WSUA 3QDJD 4DN3L 1WWCA 5G4OA 4KKAD 4XNMA 1E6PA 3RB5A 3T0VA 1KJ3L 3K6NA 2H2PD 4GFIA 3OKOA 2W4XA 4NNYB 4KCVA 3MV9D 4IRJB 4L8SC 1G1OA 3IUHA 4LPWA 2WB5A 2WANA 2OX1A 1T5WA 2E76C 5CILL 1WB0A 1DBTA 5DEFA 3KCJA 4WFGD 3BCJA 5FKPA 1A80A 4I3RL 1QEXA 1VZGA 3ZVHB 1P6CA 5KYUB 3K7UA 1Q0EA 5B7EA 2R2EA 2WZEA 4X8CA 2QYGA 5ICYB 2P47B 4F58L 4PTMA 4HH9A 4AYGA 2XHYA 3APCA 3Q44A 1EJXC 4GKLA 2X8RA 3CN4A 4Z2LA 2BVOB 5E00A 4JR5A 3I3BA 3QIBD 1EEXA 1G5AA 2R7EA 4F0KA 4HZLB 1EAOA 3OKKB 3FU7A 2PW1B 5EUOA 5LGHL 1OSZB 1M3UA 3EX2A 2G75A 1S78D 4HCIA 3PJUA 4EBQH 4N6FA 1BVZA 5JW4N 3QR3A 4KXAA 4OJEH 4L8SB 3O3EA 1XF3B 3OJMB 4KZCA 1E9OA 5BRZA 3UACA 3CL8A 2BS8A 3BIAX 4M7LL 3QCTL 4CD7A 1X4XA 5CG0A 2E9BA 4KZEL 1BQKA 1NDMA 3DRTA 2WVTA 2QFPA 2WWKO 1LO5A 5D09A 1LD9A 4UT6L 3NJ3A 1HKLL 3FO9A 2YDAA 1S1RA 2A77L 1Y6MR 1JGMA 4P2QE 1X38A 3OAUH 1J5CA 1N19A 4XP6L 3UPRB 4ZMQA 1MH5A 5C9UA 3SECA 3QUKA 5GS0L 2EIMB 5C2BL 1NCJA 5D1XE 4PP2A 2RACA 1V0KA 4JN1L 5IHUL 4C6QA 3FAWA 1RALA 4P57A 3BKCH 3VFPA 2JIWA 4Z7VE 3BQ6A 4GQ9L 1X7QB 5JW3H 3SJVB 1ZA3A 1N8ZA 5IVXA 4B16A 1RURH 2X41A 3KDMB 1MJ8H 5IMMA 3LZPA 4GLRH 5IQLA 1SQ7A 3QG7L 2Z1KA 2PDGA 2JCCA 4HQQL 3JT0A 1X5ZA 4KRZA 2ADAA 2BMKB 1WICA 1KGYE 3QUYA 5JA9A 4N2AA 4O2CA 1VKXA 4PAZA 4UT6A 3HGSA 3K6OA 4U7SA 1IQ8A 3ITVA 2PDPA 3VXQA 2VLRA 1HFUA 1XCWA 2QADC 3EGSB 2X0YA 5F4XA 5GJNA 3UJIH 4WHTB 1M4KA 4U7KA 1S5IL 3IMWA 4FCAA 4Y7OC 3IFNH 2P43B 4M8UA 2W60B 1LTDA 4P2RB 3C61A 1MKFA 3WKMH 4MKTA 3HG1A 2YEQA 3GBLA 5IBUG 3X13B 1NIDA 1TUPA 2OEJA 2GVYA 1IBHA 3JV6A 4QTHA 2IG2H 4CVXA 2C15A 3VUPA 4EWJA 3OVGA 4PRBB 2NQ9A 4MWAE 4FQJL 3BOVA 4WGXA 2UZXA 4XAYA 2B7OA 1U91A 3O41B 2VJ8A 1LEIB 1XH1A 5LGJA 2OZTA 3L81A 4G83A 1SSGA 9PCYA 3EOUA 1RZ7H 3LQMA 3QM3A 3RTQC 4G56A 5DZVA 5F3HA 4NVTA 4JTLA 1G7PA 4FIRA 1W9DM 1FAIL 1VB9A 2BVTA 2EDJA 4ABQA 4X0VA 1LO4H 1NC2B 2ONEA 4XPGH 4XP4H 2QADB 3RVTD 5AVNA 4RISH 1XV8A 3FU6A 4AVNA 1ZHLB 3B1UA 3B3IB 4HEPG 2N7SA 1F6PA 4JKWA 1OCOB 2VDQB 4RZCB 4AD2A 1F3WA 3BWAB 5CLZA 2F0CA 1XG3A 1NIUA 2QSTA 2C7UA 4AGNA 4O28A 2JGQA 1QZNA 4XH2A 2JF1A 1G1CA 4U1NA 1UACH 1XMEB 4A7QA 4EE9A 4CCDA 5D7SL 3NJVA 2ZRZA 1ZAHA 1PEZA 3FXGA 2CRZA 3HQNA 2J1WA 5BXPA 3UZEA 1C16A 4FF9A 4P8QA 2NSQA 3WFHA 3VG0H 3EDDA 1SZEA 2XVPA 5IWLC 3SGDH 2AJZA 4YFLF 1U93B 2ZX7A 4C5YA 3VD7A 4K3JH 2XIMA 2D7TL 1T21A 4KBXA 1ZENA 1ICTA 3C2YA 1EJFA 1IGML 1OCZB 1OE1A 1Y5VA 1QNIA 3EGXA 2UY2A 4DN1A 5C0BE 1Z8AA 4OV6F 4NNBA 4LPTA 1WLHA 1AE6L 4K8RC 3W5NA 3QQ3B 4F37F 1UUOA 3QDGA 4IHOA 2A85A 4PV8B 2VFHA 1KRCC 5HHME 1CDIA 2WBJA 4NM8L 1OJXA 5DMKA 1MCRA 1QQDA 4JHAL 2H32H 2W65A 4DAGH 4F0LA 5EU5B 1GS6X 4ACPA 4FZ8L 5MHSE 4PJDE 1AZ1A 3VXMA 4ODXA 3S2LA 4BF5A 4WO4D 1EA9C 3E0FA 7ODCA 1R2RA 1TE6A 4PRDB 1ZLUK 1CGSL 4HU0A 3PVFA 4WUUD 3JTTB 4JX0A 2WQRA 1X8FA 3QHTC 1R3LB 2DWYA 4Y2NA 4K39A 2Z1SA 1FO0L 1CLVA 3UXKA 5B1JA 3FYOA 1N82A 4X60A 2ISWA 4H5SB 7REQA 4B3KA 3AFBA 1U41A 5DMIH 3SN0A 4CKQA 1W3HA 2AEIT 4HB7A 3SUTA 4Q8TA 4ZENA 2WB1A 3VIHA 5IMOA 1NAML 2VDGA 1YEGH 3HJ0A 4AYMC 2GAZB 3E0GA 4MNMA 5MERB 4X2UA 5E24E 2EXYD 2HRGA 3N6JA 3OQ3B 3WQOA 3BFQG 4OLXH 3KPSA 5E2VL 1AR2A 4R7JA 4K2SA 3GZPA 2H2SD 2VCBA 2EEDA 2H32B 1XYCA 4Q8VA 4E42B 1OIOA 1ZY9A 2W61A 1RQBA 1FO0A 4JY9A 3OBEA 4Y1AB 3D25A 4M62L 4QYOB 2EPNA 2BLFA 4ADTA 1UKQA 1R3YA 3U46A 1S7WB 4PGZA 1KFAL 4XN9A 2FIRT 1JWUA 2OMZB 2VZTA 2B0SL 4AENA 2BWIA 1HILB 1NAMA 3FMGH 4V27A 4MCYA 3ZMRA 3NA4A 4KI5E 4INFA 5T8GA 2QCFA 4WY0B 2HRPL 2XZCL 5HHMD 1XKJA 2BVYA 3QRBA 1ME8A 1OF2A 2I27N 4QE5A 3H7BA 1R0AL 5HI3C 3NACL 3MODL 4GQBA 2CO1A 4KRPD 4PC8A 5GISL 4BKNA 1Y0LA 5EUKA 3N41F 2GGHA 3ZWTA 4KROC 1MMFA 1JUFB 2CESA 4BYHA 2ZZ2A 1M7XA 43C9A 3EX1A 6CGTA 3CHOA 2IBZY 2DZXA 3EJJX 1GGBL 4LOUC 4K3HA 4PJXE 3UPAA 2E6JA 5ITFA 5AVQB 2Z6JA 4WI7A 2OPCA 4JFEB 1XYLA 5GNXA 3RPIB 5I06A 4K3EL 1UPPA 4S0TD 4KWVA 3QJFB 3PYCA 2RDXA 1LK2B 1I3UA 4XI5C 1G4TA 4ICMA 4JTIA 1E4MM 1CE6B 4N9GA 2OMBA 3INPA 3OVQA 3WD0A 1I9IL 1KJ2L 3GVRA 2XSXA 3NFSH 1IXNA 2KZ1B 3P02A 1CICC 2VC6A 4O14A 4A8RA 4G11A 3R4RA 4KUCD 8XIMA 5D7JD 4YHNB 1IIKA 2QJJA 5FA4A 1BFOA 5F8QC 4MXWH 1QR4A 5D2LB 4Q52A 3LNDA 2ACSA 2VN7A 4ZQKA 1H7NA 2DQDH 4NQEA 2DWDB 1GAFH 3D8MA 3LAFA 4BK9A 2O5NA 3TASA 2G2PA 2ZP0T 2WXOA 2HRWA 3TUUA 1MFAH 4TSBH 3L3GB 3LQGA 4UCGA 1KLUB 3QPQC 5GSRB 1K7FA 3WFBL 1Q4NX 5DQ9B 5H37H 1E28B 4M48H 1TCMA 2QGEA 4QHPA 2WLZA 1F3EA 1AO7B 2ZWYA 1U8QB 4OUUA 5E2TL 4NHCH 1KJ2A 4IBLT 3VXUD 3DROA 4LVFA 3GMNB 1XYAA 1SFJA 4Q4MA 4PMZA 4JDTL 5DFVC 4S3FA 1ONRA 4ES8A 3U7YH 5EU4A 2J8TA 2MANA 4ZFOL 3CIXA 4ONGH 3ZYZA 5BS0E 4IOIB 1KTLA 3W82A 4UFJA 2X12A 2E5BA 2PURA 1MXDA 4F2TA 3HFFA 1VRXA 5E0KA 1W8NA 3NZHL 1EDHA 4Y5XA 4HA1A 4HS3B 1HJUA 3KGSA 1NUDA 1S7UB 4QRPE 4PJDF 2O5ZH 3QGKC 2G0KA 3LOWA 4XCCL 1T5KA 1J8HD 2IDFA 3ARSA 2J66A 3OKMA 1RMFH 4XN4A 5I1EL 4UBPC 4TIMA 2ERJC 2AJUH 1NWOA 2DQXA 4R96A 3PGFH 3MNMA 2XFWA 3I02B 4Y4KA 3KPOA 1QRND 4L3CA 3PULA 3G77A 3STLA 5JW4R 2F54B 4KCWA 3W74A 1ZGLA 4LSDA 4ZFOA 2RB8A 1B31A 4X0KB 3ZWSA 1PZ5A 1T5XB 2D03H 4F9PA 2AMXA 3MZGB 4H1ZA 4YO0A 1ZVNA 2A3EA 4ZOEA 2WLYA 4G7VL 1ME7A 2TRSA 4Y5VA 1E71M 1E6NA 3PUEA 1PWMA 2NSOA 2CHZA 1ET7A 1L4IA 3U1SL 4G82A 4IMFA 1UUSA 1USZA 4MMZA 4L8DA 1A0CA 4LRSA 3MR9B 1CYGA 4FFZH 4PJ8C 3L1EA 1WOBA 4N4YB 3S3GA 4MLRA 1RA0A 4NO0D 5DRIA 5H2BB 4XKYA 4KRNA 5D5ME 4CW1A 2FT6A 1AW1A 1R46A 4GE8A 2POTA 1QYGH 2CO4A 1WCQA 2KBGA 2TRYA 1MF2H 3SGKC 1B4TA 4M7JH 3CU7A 4K5NA 2CR0A 3UDWA 4O51A 1OCBA 2EYSB 2ERJB 2CLVB 1WT5C 3F64A 4XGZB 2GY7B 2WZMA 2FNWA 3FCGA 1ORQB 1IFGA 1GZPB 3F7PC 1I1WA 1SN0A 2WZ0A 4OJCA 4TV5A 2BSBA 1NBVH 4K7VA 2V5KA 3ESPA 3UCDA 2ZFAA 4AXWA 4NFCA 2X7WA 3MBED 3T2LA 4XZUA 3WOVA 3ZO9A 4HHLA 3ASOB 1ZTXL 1L7TL 5LA2A 4AQ1C 3MV8E 3CFUA 3LPFA 4MJJA 1X5KA 1Q1JH 3AQZA 2YXOA 4OZGF 3X1GA 3EJRA 4DXXA 3AMCA 3WQCA 2WZTA 4QRPD 1S9XA 4PJ8B 3G0XA 2A6DB 4L37B 2A9BA 4AZ8B 3QHFH 5BOOA 2CBQA 1LE5B 5HGDA 4F7PA 4ZO9A 3BJTA 1VESA 1Q9KB 4M19A 5D70L 3ZKSD 1S3KH 2X70A 1LP9E 5EHFA 5DJXB 3CYVA 4XMLL 4OGYH 4Q4PA 3P0WA 4PJXF 1EFXB 3MUXA 3OB0K 3AY4C 4BEUA 1GVRA 2XIBA 2NUTB 2BK8A 4KVPA 4JN7A 3CD4A 3UG3A 4HJ0D 5L2KA 2VLMD 4JM4H 4IM4A 1HAUA 3SADA 4GUJA 3SDXA 5C07B 4DP4X 1FFTB 1NFPA 3SQMA 1GPFA 1IM3A 4TXEA 3GXIA 3AUWB 3ZHNA 4XZHA 2GBAA 5KYYA 1B0GB 5EPMA 4U6VL 3FB8B 1R24A 1G7MB 4R2GD 5J6HB 4HSAC 2HT3D 4TVPD 1FKWA 2WP3T 3FA4A 1PWLA 1IB5A 3TAKA 4X5XA 2WXPA 2INEA 2OYKA 4R26L 4IQEA 1GJWA 3BX7C 2QJIA 2DFAA 3FQXA 5LCVH 2YPVL 1VENA 2WNGA 3N3MA 1IO4C 4EF8A 5IB3B 3L3DA 1DE5A 3N29A 4JQ4A 4PRHD 4BWLC 5C9JA 5E4OA 5LIWX 5C7HA 1B3WA 3HZMA 2RH0A 4PBGA 1A0EA 4NQCB 2R56L 3TBTB 3FUMA 3CZLA 1MZYA 3P30H 4N22A 3R7QA 4XBSA 3S3SA 3U4BH 4CNTA 4M8VA 4FXGA 3KRSA 2ITCB 2UWEE 3GSVA 1QFWL 3HVNA 5DWUH 1UWEL 5A2LH 4Z7NF 4HK3J 1CMOA 5BO1L 2VD8A 2CC0A 1I8UA 1LQ2A 2YXMA 1UTDA 2V5MA 1YYLL 1W1IE 5F0MB 3VQMA 4LVHC 1CL7I 2YPVA 3TH4T 4S38A 5I18H 3V35A 4C6BA 2Q8BL 4F20A 2VM8A 4BHYA 4OECA 3EGJA 5AB9A 3SE4A 2WWCA 1PHWA 2QV2A 1ERNA 1F4XH 1WUZA 2H2PC 3CLFH 2DQGL 5ALCL 3QB7C 2ZSVB 3GI8L 4LL9A 3I75A 3I9IA 5EY5A 3HPZA 2C0HA 4EZMA 1TJMA 5JUEH 4FQIL 1ADOA 4XIMA 1CO1A 4NJKA 3IANA 5FYLH 1WIPA 3HLKA 1JUBA 1SR0A 4DT2A 1ZQ5A 2Z35B 4FS9A 3C0LA 4CLMA 1PX3A 4AJWA 3UXLA 4NO3B 2XG9A 4CEXC 3GH4A 4FEMA 4MS8C 3U7WL 1X5XA 1D2PA 5CD3A 2HG5A 4A2DA 3MP4A 3ITYA 5AY7A 2V0AA 4PS7A 1HWWA 1E27A 3ILPA 3QIBC 3PWGA 4P2OA 2C3VB 3E8VA 1WFMA 1POJA 4HOWA 3AMLA 4BFNA 2B20A 1NCBH 5CN2A 1CQYA 3OZPA 4JJHA 4GJJA 3PBYA 1IKFH 2ZUUA 3T09A 1IC7L 2VEIA 2OW7A 4I18C 4C56B 2JQMA 4WU5A 5K9XA 2ZBTA 2WM1A 3FGCA 1E0OB 3MRDB 3RZCA 4ATDA 4CVUA 4U1MA 4HHAB 4ORGA 1IX2A 2CGYA 3GTFA 4YHYC 4LLUA 1ACYH 5I1HH 4GI9A 2PF0A 4E3TA 3I3EA 3MLPA 5IFPA 2UZ9A 5GSVA 5A16B 3DLQR 3EWWA 1KC5L 3AITA 3SW6A 5BQ7B 2DLGA 4NM4H 5FO9B 1GZHC 2VQ1A 3ZRFC 3KTSA 2YAOA 3RIFF 2AANA 4NU7A 4Y0GA 2WINB 3W7RA 3GNRA 4QWWD 3IUIA 4L4VE 3CTTA 4UMAA 5KAQF 3N13A 1X39A 3MLTB 5KYNA 4P23D 5F7AA 2W91A 5I6OA 4GXVL 1KIPB 2XI9A 3NCEB 3RB7A 4XHJD 4QTGA 2AZAA 4D0DA 4LU0A 2AXJA 5A6SA 3I68A 4I18B 5FL0A 1J9RA 4WDIA 1T6VN 4UDUB 3M1ZA 1LEGA 3PFRA 1OEZW 3QUML 4G6AC 4LF1A 4BF9A 4QRQB 3WN5C 3SKUD 4NN6C 1GVYA 2ITDB 4YHYB 3WSQL 3IJEA 3QZWB 5EFDA 3MO7A 3QH2A 1VFAB 3FO2A 2ZTKA 1PD0A 4Z3EA 4PTUB 5AVZB 2VSKB 4M1CC 3QMRA 4XG1A 1H41A 1XZ0B 3DC8A 4ZXBB 4B5TA 3PZVA 5DHVA 4B27A 1ZT7B 3IV3A 3WJMA 1PZBA 4OLYL 4WK9A 4PJGE 3QZPA 4DXKA 3S34L 2VGIA 3G1XA 1QR1A 1E0XA 1NPUA 1UZHA 1H50A 4R0LC 1AGBA 3E8UH 1YNPA 1J0ZA 5TQ0H 4WJEA 2Y36H 3IRSA 2ZOKA 1WCBB 1M7OA 4MB5A 4DM1A 3D9AL 3RR1A 1O95A 5CEZH 2EEXA 3QUMA 1V55B 2D73A 4DKAA 4JIRA 2V33A 4IOSD 5C7XH 2NY1C 5DK3A 1B9BA 5KVEH 1KBVA 1RJLA 4HUUA 3WN5B 4B60A 2AK1H 3EGDB 4NN6B 2VSCA 2VR2A 1IKNC 4PJHE 3FOLB 1WV2A 1Z3GL 2F7IA 2BASA 4JZJA 4BK8A 3A4AA 3CMJA 3LKNA 2ZUSA 2IH1B 3BXNA 4YMPA 1BZ7A 2VR9A 3DU0A 5D1XC 1NGXB 3WNPA 5SWUA 1PHQA 4MZIA 4JFTA 4PJFA 1EL3A 3I6EA 3EJTA 3P6LA 4Q9QL 1S3RA 1T1XA 2HVBA 3GE7A 1U8OB 4LLVB 1YEEL 2QCHA 4K7FA 3KTCA 2IPUG 3V79C 3N1FC 1WF5A 3ROOA 4CA4A 2JALA 1DANT 3RLHA 5I0ZA 4R0LB 1BJ1J 4J2XA 4JD4A 1T2JA 1SOSA 4PCTA 5IF0B 2OQHA 3CFJB 4MMXC 1SUHA 2Z31A 1EXUB 3FN9A 4BD4A 4KMLB 2VX5A 3PWNA 4BUGA 5DRXA 2Q3XA 2NWRA 3TT1H 4G70B 4LLWB 2NY1B 3O3AB 4G6JH 3KFTA 5D6DA 2WSYA 2WQWA 1UR0A 5KBDA 1ZHNB 4GBXD 4UT7L 4I6KA 2X9WA 2SEBA 4P2QB 3VD2A