4WSJA

Crystal structure of a bacterial fucodiase in complex with 1-((1r,2r,3r,4r,5r,6r)-2,3,4-trihydroxy-5-methyl-7-azabicyclo[4.1.0]heptan-7-yl)ethan-1-one
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
439
structure length
439
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title In vitroandin vivocomparative and competitive activity-based protein profiling of GH29 alpha-l-fucosidases.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords Alpha-L-fucosidase
total genus 158
structure length 439
sequence length 439
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-10-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4wsjA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4wsjA01
2CYGA 2WZEA 1E73M 1NWSA 5CPQA 3VGHA 3GXTA 1E1EA 3PZNA 4D6FA 3ZIZA 1VAHA 4B15A 2GUYA 1QI0A 3AIRA 4D6JA 1K9DA 2GJXA 3DDGA 1G9HA 3VGDA 1BAGA 3VX0A 1JD9A 2F61A 3VU2A 3WUBA 4DUWA 4AZ6A 5I3DA 3GZAA 3LPFA 3SCSA 1WAWA 3PZVA 1OIMA 2DEPA 3WH8A 1KBKA 4TVCA 1EOKA 1JAKA 2JEPA 5CG0A 4LYRA 2QPSA 5FKYA 1JD7A 2ZE0A 3A5VA 3CHCA 2VRKA 1PIFA 5E9AA 4QCEA 5DEZA 5JBFA 2CPUA 2PI6A 2J74A 5EFDA 3VNYA 2ESCA 5ABHA 4HOXA 5HNNA 3BAYA 3RM4A 3TTSA 1UG6A 1UWTA 2D3NA 5LYRA 1QI3A 1D7FA 3RPMA 1NOFA 3FAWA 4HPGA 2J7FA 2NT1A 3WSUA 4YN5A 4U2ZA 3BVVA 4PCTA 2JF7A 4GIAA 2WZIA 5C70A 1CXHA 2VRQA 4NI3A 3WEOA 1VBUA 3QOMA 5M5DA 1UD4A 4WK9A 1PJ9A 1UWSA 4PMYA 2J7BA 2AAAA 5D9NA 7A3HA 4UCFA 3NIYA 3CTTA 4CGTA 1K9TA 3ECQA 4V27A 1LWJA 5IDIA 2VVSA 1CXFA 2C7FA 1V3JA 1MVYA 3ZM8A 4MNJA 1VEPA 3U5UA 4NXKA 4MAZA 1CXIA 3AMDA 2XM2A 1V0NA 4PN2A 3QHNA 3ZJ6A 3AIBA 3RO8A 1WZAA 1VB9A 1C8XA 1JNDA 4B3LA 3VGBA 1NWUA 3WUGA 3WF3A 2XPKA 4HPHA 1AQ0A 4ACZA 2PBGA 2E3ZA 5HOSA 3BUDA 2D24A 1KGUA 3AHVA 2FGZA 3TOPA 1KXTA 5CZKA 3I3BA 3AMCA 2EPMX 3SCRA 2YA2A 1TE1A 2F1BA 4B16A 2ZX6A 4GKLA 2VRJA 4HP5A 3B9EA 2OWWA 2ZUVA 4HA1A 3WD4A 1GPFA 2D1ZA 4AZBA 2BXYA 2OWXA 1ZBVA 1GJUA 4W88A 3RM8A 4DWSB 1CENA 1ZJAA 2IUZA 1DWAM 3CHDA 1CLXA 3DC0A 3D52A 3CZKA 1DWIM 4HU0A 2PWEA 2WVVA 4NRSA 4AMXA 1GQIA 2ZUMA 2XGBA 1KXQA 4A3HA 1UUQA 4J3TA 2EO7A 3AYSA 3VM7A 1UQYA 1W2PA 4UQAA 2WYSA 2FE0A 4JFTA 4AIEA 2BHYA 1C91A 1OCQA 1E4IA 3VINA 1W2VA 4QLJA 2BY3A 1E1FA 1UHVA 3GBEA 1VRXA 2WMFA 3KLKA 4CD4A 1GVYA 1D3CA 1ZBCA 2YL9A 1UQZA 1H09A 4M24A 2YL5A 1TA3B 3ZO9A 3GYCA 5I78A 1WDSA 4UOJA 1C8YA 3LX9A 1HJQA 1QWNA 1E0XA 1OT2A 3BVTA 2VUYA 4IPLA 4KH2A 3AS3A 3VGGA 1JZ2A 4DO5A 1E6RA 4Z2KA 3WQVA 4PMQA 3VIFA 3DDFA 1GQLA 3VIHA 1GZJA 2WKLA 1QPKA 4W85A 2J75A 3IJ9A 4NXSA 1JZ6A 1UWUA 4GQRA 1VBRA 3MMDA 3CV5A 1R85A 1R7OA 2WNWA 1UR1A 4HOWA 4UTFA 2Y24A 3L4TA 4U31A 4FLOA 4DM1A 3QR3A 3AS0A 1ZBKA 3SCUA 2WKGA 1MW3A 1VENA 3HJEA 1DWJM 2EPLX 3AIQA 3K8KA 2WVVB 3N9KA 2WVSA 4AYSA 1NH6A 3N1AA 1UASA 1UKQA 3UERA 2VR4A 2B31A 1M7XA 3D3AA 2CEQA 2V38A 1EXPA 3GXMA 4JKLA 1KGXA 2FH6A 2WVTA 4JKMA 2QMJA 3GTNA 2WHMA 1YHTA 4D1IA 5A94A 2DT3A 3SCVA 2EBNA 4N0RA 1QNSA 1NM9A 1R8LA 3MUZ1 5A6KA 4TX8A 1MW2A 5KZ6A 3U7VA 3KLLA 3BXWA 3IANA 3POHA 1DTUA 3W53A 4J3UA 4J3VA 3G6MA 4S3KA 1V6VA 5CQ1A 4M80A 1C7TA 4W87A 4S3JA 5AYIA 2D0FA 5AC5A 3NDYA 4PTXA 4WSKA 1FH7A 3O6AA 1GOWA 2J25A 5I6SA 2BNJA 3F4VA 3VIOA 1TCMA 3EMQA 1R75A 2BY1A 3IK2A 4UFIA 2CNCA 3BUQA 4MNMA 2G4FA 3CO4A 5D9MA 2O92A 4WSJA 1XSJA 1OWQA 2WSPA 2WM0A 1OINA 1QNPA 2VX5A 1IV8A 2QHAA 4CN1A 2GJRA 5IFPA 4X0NA 1CGXA 4OJYA 1JG9A 1GNXA 4P7NA 2J4GA 5KEZA 3EJRA 1O6IA 4GPNA 4CU6A 1KR0A 4IM4A 4PMXA 2A3AA 2GVYA 1G01A 2ZXBA 2OW7A 4QCFA 4AMCA 5E6YA 1RPKA 4GI6A 3WH7A 2WZHA 3VD5A 4MADA 1WDRA 1TZ7A 4FK9A 1CXEA 1A47A 4OIFA 2JIEA 2X05A 1XV8A 3OBAA 1XYFA 1W1VA 3WD3A 1JF6A 1C7SA 3SCNA 1FP8A 2V5CA 4F66A 1BTCA 4JHZA 2YBTA 1QWUA 1TQSA 1H4PA 3VMOA 4AIOA 4QFUA 2OYKA 4YHGA 3D4YA 3TV8A 1CGUA 5A2BA 3WDRA 1KCKA 1V3KA 3SIMA 2WC3A 3PTMA 5EB8A 5ABGA 4Z2IA 1CBGA 1LG2A 4FLQA 1HN1A 1VFFA 4AD5A 3HU7A 3LRKA 3ZSTA 4PMRA 1PEZA 3GH7A 5A8MA 5I5RA 4ATLA 2A3CA 1OD0A 3AIUA 4DWSC 4U2YA 4PTMA 4Q22A 2BV9A 2DT0A 3RM9A 2HISA 1BFNA 3WDQA 4D6HA 1J9YA 6A3HA 1H1NA 1X6LA 5BROA 3A21A 3VIMA 3VTRA 4GI8A 1W1YA 3MV11 4TOQA 2W92A 4LYPA 3ARXA 1E3ZA 3AROA 2V3GA 4Z2HA 3WDJA 4J3WA 1CGVA 3UEQA 1Q6DA 3RDKA 4E2OA 4H8VA 4AC1X 1R87A 4AMWA 4N42A 1US2A 4HZ7A 3ARYA 2WANA 2W4XA 3K8MA 1FH8A 2PBOA 1FH9A 1W9BM 1NP0A 5CXPA 1KXHA 2Q8XA 3FHAA 1IZKA 3LMYA 1FHLA 1JFXA 3W4RA 5BRQA 1V3MA 2FH8A 1KWKA 4B9ZA 3W27A 1JYNA 1G94A 5E6ZA 3ZOAA 1BYAA 2XTKA 2ZUNA 1OBAA 4C7DA 3W26A 1CLVA 2CHNA 5GPRA 3W28A 5GQBA 4Q7NA 1NOUA 4MDPA 1H2JA 3WNLA 1K9FA 3KL5A 5CLWA 4FLSA 4H7VA 2UWFA 2VZUA 4R5EA 4FF5A 4FNTA 3BLPX 2QV4A 2Z1SA 2A3HA 3AICA 1CYGA 2YA0A 4AEFA 2MANA 4W7VA 4KWUA 3ARQA 4XB3A 3DYPA 4MNLA 4TTUA 4LX4A 3WQ6A 3VD7A 1BVZA 3CMGA 2WC4A 3WBAA 1MFVA 1SZNA 1JZ7A 3WENA 4UFMA 4C7FA 3N13A 2ZX7A 3CUJA 4PMOA 1EDTA 3VGFA 3WKZA 1U2YA 4AEEA 2WCAA 2RGMA 3VMNA 4WKHA 2AOSA 5A6AA 3GXNA 2DPEA 4GQQA 1ITXA 3APGA 1EQCA 2XIIA 1H3GA 5A95A 3BAXA 4UQDA 4PMVA 1O7DC 1FFQA 4CUCA 4M8UA 4FNQA 3AS1A 2ZUWA 3WQ8A 1A3HA 3WY2A 1WZLA 1DWFM 1BSIA 2EQDA 2WBGA 3U5YA 1CGYA 3LXCA 3VDCA 1V6XA 1FOBA 4IPNB 1UH4A 1CWYA 3LPOA 4UFKA 5A2AA 1UA7A 2VT0A 1OGGA 1V03A 1QHZA 2D20A 2JE8A 2VC9A 4HA3A 4A4AA 3UESA 4UFLA 3W81A 1L0PA 4UQ9A 2WXDM 2OYLA 3M46A 1KB3A 1RP9A 4GZIA 1WKYA 4JL2A 4P8WA 3F5LA 3WD2A 3AIEA 2CESA 3WMBA 3OLDA 2BHUA 3B9AA 3VILA 3VDAA 4UOQA 1LL4A 2FYVA 1EA9C 1CZ1A 3AHYA 3ARTA 1EDGA 2EACA 1B2YA 2WMIB 1HL9A 3AIVA 3IAQA 1Y7VA 5JBEA 1P6WA 1HTYA 1E40A 2WVUA 1SFSA 1RP8A 3AXHA 1Q4NX 3BLKA 5HPOA 3MMWA 3ZSSA 2YL8A 2HVMA 2DH3A 5IHSA 2G41A 3N17A 3OLGA 3CHEA 3GXPA 1ZL1A 3VSTA 2VURA 4BQ5A 3L2MA 2OWCA 4QLKA 3BUIA 3F5JA 3VIJA 1UH2A 1J0KA 4W5UA 1JZ3A 2Y2WA 1TR1A 1MYRA 1VF8A 2UY5A 3CUGA 1G5AA 2CBUA 4GZEA 3EMCA 1E71M 2VX7A 1AQHA 4D1JA 1NWTA 3W6LA 2VQUA 3T0AA 3SUSA 5D9OA 1WPCA 4CN6A 1E5NA 1B31A 3CPUA 1VFMA 1JI2A 1SYTA 2VCBA 5A6MA 1UH3A 2BFGA 4DO4A 2VCAA 1M03A 1EO5A 1R7AA 3HZ3A 1XYZA 2VX6A 4W84A 4MB3A 1J0ZA 1V6WA 2G3NA 3AFBA 1PZ3A 4FNRA 4QDMA 5D8ZA 4E8CA 3VD4A 2OW6A 4XUYA 1JZ8A 3S2CA 1XSIA 1ISXA 3CGTA 4FMVA 1C3FA 1E55A 4AD4A 3T0DA 1E43A 1CGTA 2ZOXA 2XN0A 1H11A 4CD6A 3NDZA 5F7UA 4W7WA 4D6GA 2J7CA 3GXFA 2JEQA 4M29A 2J47A 3HN3A 5HBFA 5LA0A 3OLIA 3A6OA 2W91A 3OLEA 1GCYA 3VDHA 1IZJA 2PF0A 5E0FA 5C8BB 3WN6A 4CCCA 5A1AA 3IJ8A 3WF1A 3TONA 1HX0A 4DWSD 2W61A 3ZJ7A 1V0KA 4HTYA 5BRPA 3VKKA 3AYRA 4AZIA 4JZ5A 3CZNA 3ARUA 4CD8A 3NUKA 7TAAA 1QW8A 1HXKA 1WP6A 3L4VA 1E70M 2XVPA 2QPUA 3WELA 3LPGA 4NSBA 3WUFA 2EABA 1IT0A 2J8GA 5EBAA 4ZEPA 3DHPA 1W3KA 4DM2A 2VX4A 2XFYA 4ZXLA 3AHTA 4OZOA 3MUAA 2YOCA 4A3YA 4AW7A 1E0WA 1MQPA 3A3HA 3II1A 2DT2A 1H5VA 1E3XA 1VJZA 2CCRA 2AMGA 1UD5A 4PUDA 1E6SM 3PZUA 1VEOA 2W63A 4PUEA 3H54A 5E09A 1GUVA 2X09A 1QVBA 2CKRA 2GFTA 3WNMA 5GNXA 3EJQA 2E40A 3OB8A 1PX4A 3W38A 4L4PA 2W5FA 4P8UA 2XJ7A 4ZXOA 4F9JA 3NSNA 4DUXA 1C90A 3D4ZA 1X6NA 5FL1A 2O9TA 5CPSA 4D6EA 3ZJKA 3A22A 4Z2GA 2YL6A 3GDBA 3KL3A 2VR5A 1HJWA 4AY1A 5D4YA 2D73A 3OA5A 5FL0A 3OGRA 2X8RA 3SCPA 4ZENA 1H0IA 1CNVA 2GK1B 1CTNA 3EBVA 2IXVA 1B3VA 1CECA 1U33A 3BVWA 1W9UA 1BHGA 2VZSA 3L2LA 5LA2A 4YPJA 4NZFA 4NF7A 2BVYA 3S5YA 3EJTA 1V3LA 2OLHA 4GXPA 3SCTA 1EHNA 2YDSA 3W6MA 4ACYA 2VJXA 2EPNA 1W91A 3BGAA 4GO8A 1B9ZA 4CN4A 1MFUA 3W37A 2ZUSA 4JIEA 1WO2A 5BXTA 3BLBA 2WB5A 1XGZA 2GJPA 1B3ZA 4W5ZA 3ARWA 5I79A 3WEMA 3THDA 4D72A 5C71A 3CC1A 2CIPA 6CGTA 3OGVA 4FNUA 4W8AA 1JDCA 1QHOA 2Y8KA 2EADA 3BCFA 4CD7A 1PPIA 1XRVA 3ZJ8A 1XH0A 1CEOA 4UQEA 1F4HA 3AISA 1HVXA 1TG7A 5FD0A 3VVGA 2V3DA 2ZUTA 2WMHA 4W8BA 2E0PA 5EMYA 2E9MA 2A3EA 1MW0A 3EJSA 1JXJA 3MUY1 5CGMA 1ZB5A 1B3WA 4W93A 3K4AA 5E70A 4KRUA 1HNYA 8A3HA 2J7EA 1XD1A 2IGTA 2XIBA 3A4XA 2VL4A 3SUUA 1V08A 4TVUA 4KGLA 3WQWA 1TQVA 4ATDA 2QLYA 2D0GA 1DEDA 4U5KA 1XCXA 2XN1A 3WFLA 1M53A 4W8LA 3TTYA 2F8QA 3ARSA 2WBKA 1W1PA 2V3EA 4H2CA 1E9LA 1R86A 2J79A 2XHYA 3TTQA 1QOXA 3QGVA 2ZX5A 2CBIA 1GORA 2JALA 4V2XA 4ATWA 3EDFA 4PCSA 4L4OA 3BAIA 3G6LA 4XV0A 2FGLA 4DUVA 2XFRA 4M82A 1JZ5A 1J0HA 3MV01 2WK2A 1GVIA 3SUTA 3BVXA 1W3HA 4CCEA 3UETA 2G8ZA 5GNYA 3ZMRA 8CGTA 3LRLA 5D9PA 3CLWA 2O9OA 1DWGM 4LXFA 3GBDA 1UR0A 1EIBA 1GQJA 3K4DA 5TD4A 1R46A 3J7HA 1JIBA 4W86A 2D2OA 3WY3A 2FDMA 1M04A 2F7QA 4CKQA 1BGAA 3DHUA 2E8YA 3VGEA 3VD3A 1J01A 2BY0A 3VIPA 4NZCA 4XZWA 1UR8A 2PC8A 3WMCA 1QNQA 4EE9A 1LG1A 2NW0A 5D8WA 1JDAA 2F7OA 1GHSA 4AZCA 3GXDA 2WMGA 1XH2A 1ISZA 3RILA 5BXSA 1E6NA 2F7RA 5CSUA 5A69A 3T08A 3WDPP 3WQ5A 1W9VA 2ZXAA 4BCEA 1EHAA 1CXKA 1GJWA 1UD2A 1V0MA 3CIVA 1VFUA 2GDUA 3OGSA 1KTCA 1V6YA 4CU7A 1TVNA 4OUEA 3S6TA 1BF2A 1JXKA 2O9RA 2VO5A 4BA0A 5JIWA 1WB0A 5FIPA 3LXBA 5A6BA 1Z32X 1BLIA 5E0CA 2BHZA 1E6ZA 2GJXB 1W9PA 2ZUUA 5A8PA 2PWDA 1QBAA 4LPCA 3W0KA 3K1DA 1XSKA 3BH4A 3DYMA 4CVWA 3W29A 3KEHA 2UY3A 1TQWA 5ABFB 1TVPA 4XZBA 1UD6A 1C93A 2NT0A 6TAAA 4JFWA 4JKKA 4P7QA 1QX1A 1OGBA 3WEZA 3UG4A 1Q6CA 3GH4A 1V0LA 1V3IA 1UZ1A 1HKKA 5FCZA 2VZTA 2JIWA 1K6AA 3EJUA 3CMJA 3PTKA 2PWGA 1HF6A 1VJSA 2JF6A 5I2UA 2XSAA 2VCCA 3AS2A 4MJ4A 3LRMA 4GI9A 3L4WA 3POCA 4EANA 3SCQA 5JBDA 2J7GA 1HKIA 5A6SA 4PTWA 4JAWA 4FNPA 1KWGA 4P7RA 4C7GA 3BSHA 3D50A 3DECA 4TVDA 1PIGA 1QNRA 2GDVA 5A6JA 2DSUA 3IGUA 3DYOA 3B9DA 2CETA 1KTBA 3BUPA 3BMWA 4BQ2A 1F4AA 1Q6EA 1EDQA 3A4WA 2UY4A 3A23A 3WD0A 2YDRA 3OZOA 4KRTA 4MB1A 1ITCA 4PMNA 4WJXA 1EO7A 3WH5A 4WIWA 4J3SA 1NWRA 4E4PA 4PMUA 1E4NA 3W24A 2WHJA 4URIA 2DIJA 1DWHM 1KFWA 2J77A 1TMQA 3M7SA 4H8UA 3ARZA 1LF1A 4H04A 2J62A 3AZRA 3RCNA 1J10A 2EPOA 5AYBA 3MSGA 1OB0A 1CPUA 4ZE4A 1PZ2A 4AYGA 5DT7A 4RE2A 3SCWA 4J28A 1Q6GA 2DQXA 4K68A 1RH9A 2WWCA 2WHLA 4P7OA 3T2OA 2V3FA 4MNKA 1LL6A 1H0GA 2VVNA 3CZLA 3SUWA 3VIGA 4QAWA 3FNDA 3RJXA 5I77A 1FA2A 3D51A 1LL7A 3S5ZA 1JZ4A 2E9LA 2PB1A 2XVKA 2XFFA 1V02A 1XC6A 1GOQA 4CCDA 1HP5A 3BUBA 2TAAA 3VOCA 2ZX8A 3VDBA 5A3HA 3NSMA 2ZXQA 4D6IA 1N82A 3UR7A 4AD3A 1GOIA 5BYWA 3PBGA 4PYSA 3LPPA 1HJVA 1UKSA 1WE5A 2BVDA 3THCA 2OSYA 2YFOA 1UZ4A 3AZTA 3L4UA 2Y4SA 5CPTA 4UOZA 4AD2A 3AMLA 1VEMA 3KWXA 3PZQA 3MANA 4WLCA 4U3CA 2X0YA 3CUIA 4BQ4A 3CZEA 3UR8A 3TP4A 3ARPA 4TX6A 1UA3A 3ZT5A 1ZJBA 1ZU8A 4TXEA 3F5KA 5AC4A 1C92A 3ARRA 1ESWA 3I3DA 4LQ1A 3NCOA 1KR1A 3PN8A 1E56A 3VD9A 4PBGA 1MXDA 2YLLA 3AI0A 4EKJA 2WPGA 3M07A 1E15A 3T2PA 2ZWYA 2D23A 2XVGA 3OG2A 5JIPA 1BQCA 4P8XA 3UCQA 1C8QA 1FHDA 2DDXA 1JDDA 3A47A 2IXUA 2QF8A 1HWWA 1WZKA 1B90A 1H41A 3RMEA 1GW1A 3WD1A 2WMKA 3O2LA 3PZMA 3HG5A 1MQQA 4MJ2A 1TUXA 1MQRA 3A24A 3EDJA 2XVLA 5HDRA 3WIJA 4GO9A 3B8SA 2ZX9A 4UNIA 5I23A 2CBVA 4KGJA 2WCSA 5GNZA 3MU7A 4Z2JA 1CGWA 2DSVA 2JFEX 3CZSA 3WQ4A 3AMKA 3FY1A 3FW6A 3JUGA 3CH9A 3NYDA 4MPKA 3MS8A 3HG3A 4CD5A 4F9DA 4JL1A 1L8NA 2BXZA 1T0OA 4X9YA 1EGZA 1E0VA 2WAGA 2BY2A 1SR0A 5M03A 5IFTA 3SEPA 2YA1A 1US3A 3FN9A 2VQTA 1PAMA 1WNOA 4IUGA 3ARVA 3FAXA 1X1NA 3PZ9A 1J12A 3HMCA 4UFHA 3DX1A 2G3JA 3E1F1 1XD0A 4HOZA 2X1IA 4NX0A 4D6DA 4JCMA 2W66A 1CIUA 4XX6A 2F18A 1OT1A 3VX1A 2A3BA 1BG4A 1HIZA 2F1AA 4P7LA 3ZR6A 4MB5A 2Y5EA 1V3HA 2CHOA 3EDDA 3WY1A 3I3EA 2C0HA 4HMCA 4PMZA 3SCOA 2QMKA 1LQ0A 4PSRA 2YIHA 4OBRA 4LYQA 5IHRA 3ZT6A 1UKTA 2DIEA 4EK7A 1E6XM 3H53A 3VO0A 3GNPA 1XHGA 3AXXA 2X2JA 1W32A 4RE3A 5A6LA 5JUVA 4OBSA 4ML4A 1W9XA 1QI5A 2W62A 4MTVA 1JL8A 1ODUA 5FOOA 1R34A 1KQZA 2EAEA 2WMIA 4TUFA 4IISA 2X2YA 1QBBA 4ZE5A 1KXVA 4JHOA 4JCLA 2EJ1A 1UWQA 4U33A 4F8XA 5AY7A 2VTFA 4D6CA 1UD8A 2EEXA 3L4ZA 4J3XA 3WUEA 2CITA 2X2HA 1HT6A 1GOMA 1Q6FA 4JFVA 3ZQ9A 3O9NA 4CVUA 3UG3A 4AWEA 2YKKA 4MB4A 3N12A 3NSXA 1I1XA 1W3JA 3AIWA 4AZGA 1VFOA 2D0HA 3VM5A 1B1YA 4AXNA 3PZIA 1QI2A 3WDIA 4H41A 2XN2A 1ZS2A 3GH5A 2DSKA 2WLYA 5BXPA 2PWFA 1W9DM 4ACZB 1BG9A 1KQYA 5HPCA 1J0YA 3CUFA 3FXYA 2XUCA 4UR9A 4OOZA 3WF2A 1PBGA 4B3KA 2E9BA 1PS3A 1I1WA 1HKJA 3U7BA 3WFZA 3DX0A 1OM0A 3FHQA 4Y7EA 2OSWA 1J11A 3GXIA 3N18A 3CBWA 3KE0A 3W25A 4M56A 1WDPA 3AHZA 1E6PA 1AVAA 4MDOA 3T09A 2YDQA 3WF0A 3QHOA 2YBUA 3WL0A 4U3AA 1UWIA 3BSGA 2XGIA 5M3WA 1GOOA 3AQUA 1BGGA 5A8NA 4E8DA 2FHCA 1HKMA 2G3MA 3WMSA 1XH1A 4WF7A 3IJ7A 2C8NA 3AXIA 2D22A 3GNOA 3MSDA 4W7UA 1NARA 1FFRA 1GQKA 3DX3A 4H8HA 1EQPA 1UWRA 4RL3A 3EMZA 3AMGA 2X2IA 3PHAA 1B3YA 1SMAA 5IXEA 3T0BA 1OSEA 5DO8A 3AHXA 3RJYA 1JGIA 1ISYA 1NP2A 5CSYA 4UFJA 4UQBA 2OYMA 1SMDA 3BCDA 1KBBA 5LA1A 3K46A 5ABEA 1I75A 1R33A 1MXGA 3WL1A 1FP9A 3VSUA 3WDHA 1B30A 3PZGA 4NRRA 5A8OA 1JYWA 2VOTA 3N04A 1LJYA 3ALFA 3VIKA 3OZPA 3ZT7A 3RIKA 2XG9A 1J0IA 1OIFA 2CERA 3SURA 3EYPA 4HA4A 4QP0A 1BVNP 3LXAA 4M1RA 2F2HA 1YQ2A 2XWDA 3ALGA 1LWHA 3WH6A 1EOMA 3WH9A 1UR2A 2ZIDA 1JF5A 1HJSA 4HZ8A 2E4TA 4LGXA 1UR4A 4YHEA 1TQUA 4DO6A 4PEEA 4EAMA 2RGLA 4HMDA 5BXRA 2CXGA 1UYQA 2DGAA 3ZR5A 2DSZA 3KL0A 5A6BD 3HG2A 3DX4A 2ZXDA 1QW9A 5E1QA 4P8VA 4OGZA 5ECUA 2WW5A 2XM1A 5EFFA 2YLAA 4AZ5A 3UG5A 1W3LA 3BAKA 3HG4A 2FHFA 2XWEA 2DSWA 3N15A 2VNCA 3K8LA 1O7AA 3AJ7A 1WDQA 1XCWA 2V5DA 1AQMA 3BAJA 3IAPA 1JNEA 2Z1KA 1MW1A 3OIHA 1PX8A 5DT5A 4AD1A 1E5JA 3BVUA 3BAWA 1QI4A 2DT1A 5I24A 4CU8A 1W1TA 1M01A 1DHKA 2J7DA 4AIUA 4AZCB 3KZSA 3A4AA 2UY2A 3D5HA 1HJXA 5I0DA 4UQCA 2VZOA 2XYLA 1CXLA 3M6DA 4AD0A 3MMUA 3CZGA 2X0HA 1CDGA 4AISA 3PTQA 4FLRA 1ISVA 2WMJA 4V28A 1UR9A 1H49A 4W89A 4U5IA 1G0CA 3DX2A 1VIWA 4UZSA 3EJPA 1V6UA 4QLLA 1G1YA 2FHBA 3VNZA 1B3XA 1S46A 2WLZA 2YJQA 1E4MM 3WNOA 3U57A 1ECEA 4M81A 4NZJA 5M17A 2G3IA 2DH2A 5DFAA 1E6QM 1E4LA 3EDEA 4UZUA 1ODZA 3VPLA 4KMQA 2W67A 1NOWA 3BMVA 1TA3A 1UKOA 2OSXA 3WNKA 3BC9A 5ABFA 3WNNA 1AMYA 4AZ7A 3PZTA 5A2CA 3N11A 1GHRA 3SUVA 3AOFA 4BF7A 1B0IA 1JYXA 1HL8A 3TTOA 4PSPA 4B9YA 2YFNA 4GZJA 1WZMA 4J7RA 1ZBWA 4D71A 1JYVA 2XVNA 3QHMA 4OKDA 4ZFMA 4F79A 3VSVA 2PWHA 4MAVA 1RD6A 1J18A 1QNOA 2BVTA 3QOKA 1UOKA 2F7PA 4J27A 1OD8A 5CJ5A 1J0JA 1GOKA 2J7HA 3PZOA 2NSXA 1K9EA 2WSKA 1NQ6A 3H55A 1JFHA 1QHPA 4OOUA 3NJ3A 5A8QA 2XSBA 4PTVA 1HXJA 2WHKA 1E72M 4RE4A 4BS0A 5BWFA 3VIIA 1PX3A 2VZVA 1R47A 4R27A 3AZSA 3TA9A 1KGWA 1JAEA 4FNSA 1LLOA 1TFVA 2WWDA 1MWOA 2ALWA 1GONA 4X0VA 2GSJA 4WKFA 2ZWZA 4AZHA 4Z2LA 2VI0A 1BPLB 1D2KA 1UKPA 5CLTA 3VMPA 1KCLA 3CZJA 1HJUA 3WY4A 5HXMA 2GK1A 2E8ZA 2EXOA 3MUIA 4PRWA 3CHFA 4PMDA 1WCGA 3GM8A 3W82A 4TTGA 4HU8A 1DP0A 5DMYA 3VUPA 4BQ3A 1OGSA 3MKKA 4WKAA 3MI6A 2VMFA 4HMEA 4BZYA 4GINA 2CKSA 1BYCA 4JFSA 1V02E 2J8FA 1BYBA 2WCGA 5CGTA 3WF4A 1BYDA 2Y8VA 3CUHA 4HZ6A 1HVQA 3EDKA 3L4XA 2EPKX 3GNRA 2D3LA 2O9PA 1UD3A 5DF0A 2J78A 1JI1A 4JFUA 3CZ8A 1ISWA 1HP4A 7CGTA 3WBEA 9CGTA 1EH9A 3MO4A 3L4YA 2ZICA 1TQTA 4DWSA 5BCAA 2WC7A 2BS9A 3WNPA 2CBJA 3T2QA 1U30A
chains in the Genus database with same CATH superfamily
2CYGA 2WZEA 3SYAA 2ZCHH 1A7PH 3MGOB 3W1XA 1A7PL 2VWTA 1O5DT 2BS8A 4K7PX 4F15C 3MV7A 4XCEA 2Y07H 3ZIZA 1VAHA 2XWCA 4QTHB 4Q8NA 2XZAL 5DUML 2GI7A 1DSFH 3BZEA 3SKMA 4P49A 1X7IA 4XBKA 4B15A 3MMEA 1WISA 1QI0A 2UWEE 3MUUA 4ZO8A 5HHXH 5TE6L 4I4WB 4D6JA 2QSVA 2D03H 1M05B 2IADA 1BAGA 3KYAA 3HPLB 3VGDA 3VX0A 4P57B 3VU2A 4GH7B 3T9PA 3BQUA 4F15B 3PPSA 1ME7A 3HQNA 5FI8A 1J86A 5DQDH 3O6MH 1R3SA 1UOLA 1JPDX 3HRZA 1F8IA 3GZAA 5K2ZA 3ZTJH 4OZIF 1SJEB 3IKKA 4BWUA 2NVDA 4UTHA 1W80A 1X7QA 2Y88A 3IVSA 4QG9A 3WH8A 4JHVA 1P6AB 4UQ2A 4XCNB 3VFMA 1EOKA 3CIWA 3L5JA 2Y7QB 2IPKA 2JEPA 2AITA 2XLLA 1LEGB 2CGRL 4PCKA 4LYRA 4PR4A 4J5NA 2QPSA 2YEQA 1YUHB 2NLJA 4U05A 1GH7A 4F2FA 4KVCL 2PP9A 1VKXB 2ZVIA 4RDQG 1PIFA 4JBSA 3L7FB 4YSAA 3L3DA 1P1XA 4HGWA 4C6OA 2Y7SA 1XBXA 4YCPA 4LQFH 4ZCWA 2E5DA 2PI6A 4NO0A 3KPQB 2ESCA 3HUJA 3U30C 1ZTXE 2DQCL 3RAJL 3VFUB 1WWWX 5CP7B 4FR6A 3IJYA 1UG6A 3CLMA 2ICWI 2NUWA 4PZVA 4PW3A 4AY8A 3GSWB 3RPMA 3LQZA 1HIMH 1MEHA 2ORBH 4HUVA 3FAWA 4HW6A 2HQAA 2J7FA 4AU0A 1JGVL 4U2ZA 2IH3A 1BX2B 4HFWA 4I6VA 1P1ZB 3ZE1E 4NG3A 4UMGA 2JF7A 2Y2YA 5IY5B 3GJFK 2F5AH 1ZCOA 5BVPL 2VP8A 4L23A 5DTFB 4OI8A 3B2XA 5C70A 5F71A 3C08H 1Q4WA 1AGBB 4EN2A 1BF6A 4M1BA 1CXHA 4FQXA 1V77A 1XAUA 3O9WA 5HYSG 1JPTH 3FBKA 4LHQB 3H0TB 4OFKA 4E68A 3ABOA 3D47A 4QF1B 2VMEA 3W11D 1SO4A 4LLYA 5M5DA 4XMXA 4NAMA 5CIPH 4DKDC 3FSAA 5IF0B 4PJAF 3D85D 1RHCA 5LKNA 3SN6N 5K59F 4BSVA 5DS8B 5IJKA 5D9NA 4S2SA 4CSZA 3A6CH 4B2DD 3HNTH 4C5YA 2BODX 4JX5A 2VLKE 5EL1A 4UTBA 3N41B 4NJHA 1KELH 1HU8A 4MNQD 1P0BA 4B5WA 5G4HC 4N2FA 4UCFA 2AXFB 2ATKB 1G7HB 3IMTA 5MENB 5FESA 2G0LA 1E4KA 1A4JA 3SDCA 2B4CC 1A4MA 2CZFA 1TV3A 3CTTA 2VLME 4PJ8D 4CGTA 4V27A 2DMCA 1K7XA 1R3JA 3S2NA 1H3UA 5FV1L 4JG5A 1X5FA 5FDWA 2P76A 2QNEA 2MJWA 2CK0H 2W9DH 1QU4A 4MVAA 5SX5K 2MIZA 3KPNA 1PE1A 5IGXH 4GHRA 2RGSA 2X1RA 2JK5A 3U5UA 4NFCA 5F7LB 3DFQA 1E5UI 2FLMA 1S78C 2CJ3A 1FO0L 4LLVA 2BFVL 4CQ9A 5IB4A 4IH3A 4KHXL 3TH6A 3B1TA 1XSOA 1L9RA 3FTGB 4WKZA 3SQOH 4S3GA 2PDGA 1XLCA 4OT7A 4HUXB 5IT2L 1YYCA 3RO8A 3SKNA 1WZAA 3LHPH 1YIXA 2GVEA 4BF9A 3RNQA 1RK0B 3QZPA 1JNDA 1XWYA 4B3LA 2F6KA 1MNUL 4PJ7E 1BRLB 3OPZH 2IH1B 4POUB 5F6IB 4M4RB 3SQSA 3QFDB 5IM51 2CLVA 4Y9FA 5LNUA 1SW0A 4QE5A 3FSWA 3MA9H 2NX5D 4HEPA 3EA2A 5C09E 2VXQL 3AXLB 1P7QB 2J24A 3D30A 3DO7B 2DJ4A 1KGUA 1KCUL 4FTVE 1I7ZB 3PSVA 1B0GB 2WXPA 4V1DB 4PB9L 5MP6H 3LCFA 3T4AA 3APTA 1KN2H 3GRGA 2Z27A 4JTEA 3ZLQC 3LCYA 1TE1A 1KRMA 2F1BA 1YMME 3W2DH 4B16A 5F2GA 4GKLA 3I7RA 3L7FA 3TN4A 1QD0A 3IGXA 2VRJA 4ZQKB 4HP5A 4GH1A 2HSAA 4Y1AA 2J4WH 2H26A 2ZUVA 3VXSD 3QXBA 2WLJA 2F54D 3T1FB 3UJTH 2Y07L 4LL9A 1WK0A 4U4MA 1Q94A 3Q9PA 3N6QA 1VZGA 3VXUA 2ROXA 2QCHA 2ED8A 4AZBA 2OZ4H 3MBWA 4U1KB 1EHLL 4XP1L 1JVLA 4KZDL 3FKRA 1NFDA 5JVLA 4XKYB 1T04B 3QHFL 3H2FA 5U4NA 3K0YA 2ICEC 1GJUA 3OWRA 2FECL 3RM8A 3GNMH 1CLZL 2C9QA 5A2LH 3T0EA 1CENA 5AB2A 3CHDA 3LEPA 4DWSB 5JO5B 2YD9A 4K8RL 4YDZA 3QK0A 1CLXA 1A6UL 4FFTA 4KRMB 3C56A 2EE3A 3O81A 1YNTA 1S3KH 2MMXA 4R26L 4J4PD 4GRWH 3LV3A 4C6QA 5SWSB 1ZD6A 5C9RA 2QZ5A 5GGSA 1A02N 5D2VA 1KZYA 3UNTA 2GCYB 3FSUA 4I7UA 4A3HA 1V7ML 4LF1A 1FG9C 3SE9H 2QUUA 4LESA 3F4DA 3UPMA 3BEWB 4AQ1B 3QG6A 2GKIA 4X60A 1GIGL 3HC0B 3NL6A 5I76B 1JEZA 1W2PA 3VZZA 3V6ZA 5H6HA 1JK8B 3D2UD 1R5IA 2R1XB 3GPEA 3L4CA 4UQAA 2AQOA 1KJVB 2EXWD 3FCTB 1EFXD 3FTZA 2Y61A 3IEBA 2FE0A 1PJWA 4HJUA 4JM2D 4JFTA 4KAQL 3VXMD 4DEWA 3LKSA 3PJSA 5F2MA 4D8LA 3N1PC 3T2NH 5DD5L 5HYJD 4K94H 2KPWA 5IROA 2OELA 2OKOA 1XZWA 4G56A 5EBMB 2BY3A 4POYA 2XWXA 3CMFA 3QKEA 1N26A 5LHFA 5ICZA 3N1MC 3HC4H 1X5LA 3QIWD 1S7XA 2PDYA 4U10A 3WS3A 2ILLA 1GVYA 4ANVA 1G7QB 4EN3D 4GFSA 2JJTC 2VZ1A 4UNVA 2YL9A 1F6KA 3U2SB 1QQDB 1H09A 3TBBA 4KVPA 4KCUA 3IFOB 4BZ1A 4YE4L 2NV9A 3CHOA 2YXGA 1TA3B 2ZOTA 1O5KA 3HS8A 4UT6A 4RDVA 2B4GA 3GW3A 2R39A 1KYDA 4MZ2A 1RXLA 5FYJU 1I2PA 1EAPB 1OT2A 2CJTA 4XVSH 3BVTA 2CD0A 3FQNB 1N8FA 1TJHL 4ZOCA 3R11A 3OR7A 3FN0H 4LVFA 2V5TA 4LUSB 1UWFA 3RPDA 3Q6GL 3TS8A 4XBGA 3WLKX 4QNPF 5LBSH 5FECB 3QF0A 4ZQCA 3EYOA 3G9AB 4PJIE 2NWSA 4S23A 5MKGB 1IL1A 1KIPA 4XWGL 5F3FA 3WQVA 4GQBA 3WLNA 3S5LG 3B5TA 1UR3M 1H3VA 1M1XB 3MYJB 4KRPC 2VDOB 3HHRB 2G3ZA 1MFCH 1N2RA 3U9UA 3F2LA 1CI5A 3BGFB 4O1CA 3OAWA 4IFRA 1WAEA 1NCNA 4OLXH 1DQDL 1RK1B 1TTUA 1LLWA 1TQXA 2HROA 3P0XA 4NXSA 4X63A 5CPLA 1AKJD 3ME0A 4MRBA 2X4PB 3C9NA 4X99A 1SM9A 2J8UA 3MMDA 1AKJB 4OZIA 2VD9A 5HAOA 4G1MB 1G4PA 2NTFA 2YN5A 5JW4N 1R85A 4O02L 1BD0A 2PCXA 2WNWA 5BZWA 1UR1A 3L3JA 1W17A 2AGKA 4N4YB 2A5UA 4WJG3 1BF5A 2Q8ZA 4Q8WA 3T40A 4UTFA 1LO2H 1NFDE 2MNWA 4GS7B 5ITFA 3I10A 3AUWB 1FTXA 3GHBH 3GI8L 1PQZB 3AAMA 1IC4L 3RJDA 3WG6A 4DHGA 3AS0A 3C8DA 3FQYA 4MQXD 4P99A 2WLLB 1MW3A 2BMKA 4AGQA 5L8LB 2OPJA 3PJWA 4R7LA 3HJEA 3UYCA 2MTPA 3DK2A 2NQDA 1OF2A 1ACYL 4GJTB 4UNTA 3MRCA 4BSVB 1DWJM 4GSUA 3PHOB 4J12A 4BH8B 3ULVE 4NT6A 3QYQA 1E5CA 3CN4A 1GSKA 5DJAA 4LAKA 4ANWA 1NH6A 2QV2A 3CFNA 1XLKA 2DIAA 5FXCH 2BOEX 4QQUA 3JZUA 3U2IA 1TVDA 3NTCL 5EO9A 1XF4A 3TPUB 3J07A 2VR4A 2Q01A 1IVTA 3TTEA 1N3NA 3B34A 2IOIA 1B4LA 4AW4A 3HOGA 3SO3C 2VDIA 3QZEA 1EXPA 2B4CH 3PWUA 4W9IC 4WWPA 4AZ8B 3EYQD 1OYBA 5C6TH 3B9NA 3DFOA 3IJLA 5HULA 3MRPA 2XFXA 3GJFA 2I16A 4D2NA 5ABAA 1L6PA 4XKMA 4KESA 2UX7A 5FKAA 3ESPA 1M7DB 2UZIL 3BVNB 4PL1A 2R2HA 3NJLA 2NOYA 2X6VA 2C0AA 1YHTA 3NQVA 1RZ8B 2PWUA 3FTGA 4WQOA 2Q8AL 1VCGA 3BW4A 3SCVA 3ULAB 1W72B 2P28B 1WWBX 4N0RA 1BD2A 3BLOA 3UVIA 3MUZ1 1ZIBA 2FFIA 5A6KA 2P8BA 5C0AE 7REQB 2H9GA 3P9MA 4G9FB 5KZ6A 3OKMB 3KX6A 2OCCB 1YUHA 2NLJB 1ZVNA 4YAQB 4NQSB 3PPCA 3G5VB 3TYGL 5F9JB 3W6YA 2NR6C 2OMWB 3UTZA 1YEEH 3O3EB 3POHA 2UVEA 5IQ9B 3LDBC 4J3UA 3JV5A 1Z89A 3WV0A 4PYGA 3RLHA 3DX9A 3K6NA 3MRJA 1C7TA 4ZZKA 1D9EA 3OPSA 3ZE2B 4TM9A 2Z25A 3QFJA 4AX7A 5FM5M 5L0QB 4X9BA 4PTXA 4L0PB 5T1LB 5FYKE 2HG5A 5D1XC 3M0XA 3O6AA 1I8MA 4PJAB 3SSGA 2CLIA 5J3HC 1GOWA 3TO4C 4LUJA 1KLFA 2Z8SA 2CBTA 4ORGA 1UG9A 1R75A 2BY1A 3A64A 3DOPA 4DEUA 3IK2A 3KEDA 4NZUL 2ZPKL 3OXSB 3U7YH 4DKFH 1GMEA 1XIFA 3DU0A 3IMSA 5C08A 3SADA 3NIFE 3SDAC 3CD4A 1OTUC 3MRFA 4G7YH 3CH8A 1QNIA 3A4EA 3MHFA 1ORQA 3IDUA 4B9JA 5KZMA 3W7GA 1AGFB 3RRQA 1T03L 4LSTL 5I1AA 2O92A 4WSJA 3WN5B 1XSJA 2CC0A 1OWQA 4ADUA 4Z0SA 2WSPA 2GPTA 2J57A 2PYEB 3KYNB 3DMMD 4WU5A 5JUEH 1QNPA 2GTWB 4GQ0A 4XO6A 3HNSH 1K6WA 4MAUH 4G8GD 5T1MA 4F20A 3P73A 1ZWIB 4JRXA 2DP3A 1M6OA 2GJRA 4LSUL 4MZRA 3ZDYB 3FRPG 5LGJA 2GK1B 2I57A 1ZRUA 4HCLA 1N59A 3MV7B 2F68X 4N2CA 4Z7QF 2INZA 1KBWA 1G7HA 5MENA 4QXUH 1MRAA 2OGYA 3ISIX 3P8IA 2ZNXA 5FYLE 1RUQL 1O5QA 2HG0A 5EBWB 3CL6A 5KEZA 3EJRA 1O6IA 4PP2B 3P0VL 3Q01A 4WFEE 4CU6A 1QFWH 2WXMA 2Q7NA 3FONA 4IOSA 1KR0A 3QQDA 2AL1A 1YNLL 2V63A 2VLMD 4IM4A 2WBJB 2GVYA 2NUYA 4IQHA 2EKGA 3MXVL 1NFAA 4CDHA 5HWNA 3GO1L 1JNLL 5D1QD 1WFUA 2W88A 1JFQL 4WV1A 4QCFA 4ENED 2X1UA 2VM4A 3HMXA 5E6YA 4GI6A 5I8KH 1I2QA 3QXAB 4Z6AT 2WZHA 1DBMH 1T8QA 3TZVD 5IP4A 3M1ZA 1GYCA 1FL5B 1I82A 2X3CA 2AK4E 1IGYB 2PF6A 4HWEL 4AX6A 2IAMC 4Y8AA 5EIIA 5I0WA 5HANA 1E65A 2QQLH 1M3JA 3MBEB 5E8PA 2XWRA 2MKLC 3PFMA 4WFGE 5DR5L 5AB3A 2BP8A 1JF6A 4QXGH 5IG7B 4HPOH 2X1WL 4OZHE 5EFIB 1T7XA 3A3WA 5GRVL 3STLA 1IXPA 1P84J 1Q6QA 2UZPA 3QUML 3S2AA 1Y1DA 3V0WH 2E46A 3R19A 1AJ2A 1R3QA 2ALAA 1FWIC 4E8CA 2KAUC 2DTMH 2K8QA 1QWUA 3QZWA 4IMKA 2Z31B 1XB6A 5ANME 3RWGB 4AVIA 3ZW3A 5KYYB 4Z8FH 4AIOA 3DRTB 4WSGA 4JPKL 1AD9B 4QRTB 1M1XA 2VE6A 3FUJA 3W0WD 4DFHA 1ZAIA 4TX6A 3HC4L 3HW7A 5L2KB 2WHVA 2EDBA 4JDZA 1BQHG 2OZ0A 3MV9B 1UM5H 3N6HA 1EJRC 4UIMA 4BHUA 1TIMA 1S9XB 4RRPA 1N64H 7PAZA 5E2WL 4L05A 1JJUA 3O4LA 5JHDE 1SF3A 3E9UA 3LRKA 3LEXB 4PU2A 3B8DA 3T0CA 1WGVA 1SW3A 3OBKA 2EUXA 4PMRA 1D5IH 3UGXA 1XQLA 2WD0A 1Q66A 3TU9A 1GIGH 1L7IH 1Z3RA 1WBXA 4M19A 5J1AA 4RZ4A 3BT2L 1MNZA 5I28A 3S2LA 4Q22A 3MLXH 2Z91A 1I8LC 4OZHF 4ZW6A 3C2YA 2QDWA 4LHJB 2I69A 4X6FB 1M2VB 4BFGA 1JUKA 3N34A 4ZQNA 4YS1A 2BMKB 2MHAB 4OIBA 2YAHA 3T2LA 6A3HA 1LYQA 2IBBA 4PFMA 3VTAA 4BGDA 2BM3A 4FX6M 3V0HA 4H6KA 2R59A 2YW4A 1A9BB 5AYYA 4ZUTB 2W92A 4TOQA 3QUYA 3Q94A 4LYPA 3ARXA 5EZLB 2YBGA 4RQQA 5A16B 3PS7A 3EXRA 5CAKA 3FYEB 2V3GA 4PGBA 4Z2HA 4XHJD 3ITLA 3FB8B 2WY3B 1FWEC 2YBRB 3COTA 2E6FA 1YTDA 5ISZB 5DA4A 5DJYA 3MLTA 4E41B 1S7WA 5AVNA 2EYRA 3PG8A 3D9AH 1TJGH 2WXRA 5IKCB 5D1QB 1R87A 2NTSP 3CVHL 1EF2A 4N42A 2BP0B 4HHMA 1US2A 2K70A 4UR8A 5L9FA 1NSNH 4HGMA 1A7RL 4ATTA 3LH2L 2HFFB 3UCRA 2FZ9A 3EBIA 2I7GA 3K8MA 4GG8B 4LRIC 2D2JA 4X80L 1TMLA 5KMYA 2CXKA 4YQXH 1ZTVA 3C2AL 4MDRA 4OZ4A 2QCDA 4DEPC 1YPIA 4KQ3L 3L65A 1UJTA 2LW3A 4ETYA 1CE1L 1ZLUK 3OO2A 4QRRB 2N7SA 3LMYA 4KTEH 3OQ3B 2I07B 5D2NA 2GZXA 1N19A 5ALCH 1G1OA 2F15A 2CRIA 1P7QA 2Z8WC 2FH8A 3MRLA 5FCSH 3TPKA 1EAPA 2XQYA 4EUPH 3MBWB 4U1KA 3SD2A 3K5SA 4KHTH 4US6A 3U2CA 5DWUL 5FAJA 1MNUH 3RWJB 4EPKA 5E6ZA 4R3SA 3GO2A 3HV8A 2XTKA 2FZNA 4D9RD 2HJLB 4UI2A 1R5YA 1ET8A 4BF5A 5EFIA 3SDXF 5TH2B 3QEGH 3EO0B 1AANA 3ETBJ 4N86A 1EUUA 1GGBL 1Q9KA 2J44A 1N55A 2QGHA 5TF1L 3V6BR 3KJ6H 4WI9A 3G6JE 3O3DB 2CHNA 3HE7D 5T3ZL 4DZBB 3QCTH 3QSTA 3WJLA 3UZXA 4QUOA 2B5IB 4PB0L 4ZUVA 3CFDA 5AG8A 1BEYH 5IGXL 2BSDA 1JCJA 3FTYA 3G8EA 4KXZI 4Q7NA 1ZV9A 2VSCA 4GSDH 4MDPA 5HMFA 3L0GA 3TN0D 1UP0A 1NCWH 5DHDA 2X4NA 1P7KA 3BH8A 2X6CA 3ZTNL 4OU1A 2QTEA 4ZS7H 1ADDA 2X6BA 1HNFA 1P2CB 1NCOA 3H2QA 4UT9L 1Y0EA 3S3SA 1W0WA 1WLHA 3D69B 4FL4C 3Q3GA 3SGKA 3D2TA 4AKOA 1XDLA 1BOGA 4ZPTB 4NVTA 2HRLA 4P06A 3MNMA 3ZR4A 4C6JA 3QO1B 4HSCX 3WLPA 3CAKA 3VZXA 4XB3A 1A7OL 1SFHA 2WP3T 1CLKA 4ZSOE 3TT1H 4Q89A 2F8XC 3WQ6A 3ISRA 1LHZA 3QG6B 1V8EA 4XI5D 4FFYA 1UA6H 3VACA 3WIAA 1YA5A 3VD7A 4PGJA 3CMGA 3UNDA 1DQVA 3FSTA 2HZHA 1KM0A 4K94C 1M2VA 1FXPA 1MFVA 3ZHKA 5I9QC 5IFHH 1DIEA 1FWGC 1TR9A 3CPGA 4FHBD 3E9AA 5B80A 5TGBB 3WENA 1MY7A 4F33A 1Y6NR 1L8PA 1OP5H 3CUJA 2XA8H 3N13A 4PMOA 5EUOA 4OCWL 3BLEA 2JGQA 2TYSA 1MI5D 3M43A 3VMNA 4PP2A 1XLGA 1GYMA 1XTMA 3P9LA 3SCMC 2MCG1 3H9ZA 1ITXA 1XGQA 5DMGC 1H0DA 2XIIA 1EQCA 4H8WH 4M1DL 3Q1EA 2N7AA 1LQSR 5A95A 1YECH 3BFQG 3GRWH 1FI8C 3H7BB 5B38G 5ILTH 3W1UA 5C0BD 4OLEA 1NTDA 1DKWA 1PKLA 1OX4A 1XLDA 2CALA 1O7DC 4CUCA 3LU2A 4M8UA 1FJ1B 3AS1A 1MXSA 4IICA 1XGRB 2Y6ZA 5T9CE 3WJYA 3WY2A 4K3JH 3MCYA 2ENPA 2IQAA 1WIUA 3KHOA 2X4SB 2Y36H 2X42A 2EVHA 2E67A 2V67A 3OBEA 3TN3A 4U1SA 3TNMA 4NO2A 5C0EB 3GDLA 4UFKA 5I16A 3VD2A 4DW2L 3PE9A 5E5CA 1UA7A 3M17A 3HVNA 3ES7A 1OGGA 1CF8L 2AXHA 3K13A 4KUCF 3UZWA 4NZRH 1V03A 1QHZA 3N9GH 2D20A 3N42F 3MRRB 5JW4R 3IK4A 5DHXB 4X6BA 4ZDHB 4L18A 4UT7H 4GMSL 3T0EE 3W11C 4UFLA 4R9OA 5DZNA 3W81A 4AYID 2E5BA 2ZG3A 5KVEE 1N68A 3LB6D 4HJJH 2E47A 1G9NH 2WIIA 4X6EA 3CHCA 4AG4L 1LILA 1UC5A 1MQKL 1O5PA 1ZA3B 2CBQA 5TE6H 2EUWA 1KCXA 3FTSA 4RSYA 4LPUA 4Y5XC 3W7RA 5T5FH 1GGIL 5KZEA 2EE6A 2AQ2A 2E9GA 1J05A 3ZDYF 3GMQA 2ADJB 4S1SH 3LNFA 1KCZA 4GZIA 5E0KA 3SBWC 3TL5A 3AIEA 4Q97A 3XIMA 4G43B 3B05A 3SY6A 2R2EB 1L9SA 1DLHA 3G2GA 1DQIA 2Y6SC 2DMBA 4YDLB 4Y4HB 3SKJH 3OM3B 3VD0A 1LBMA 5CZVL 3QN3A 2VLRB 3LTVA 3LZQA 3GG8A 2WZ6A 4ZTOL 2PYEA 1L9MA 3KYNA 4WU5B 3RIAF 2HMCA 4UILH 2YDAA 3PWGA 4DCQB 3AIVA 4IP4A 1KA9F 4AIXA 3ULUL 2CBMA 4AY7A 1E40A 2EIDA 4XVTL 5HHNB 1LEIA 1FGVH 1H8OA 2JXMB 3OC5A 3E6HB 4QYOB 4WI7A 1S3HA 4R96A 3TPUA 4DZ8B 5HPOA 4IRZH 5H8PA 1MI5B 2PODA 3EH4B 2IDCA 1X9UA 4OR1A 1P4IL 2HVMA 4O14A 1PGRB 1GJIA 1NJ9A 2HN7B 2G41A 4MNGE 1FZOB 5JQHC 1E0UA 3S37L 3IGAB 7TIMA 4RH4A 4Z7OB 3QQDB 3CH0A 2EXSA 2PDUA 1W15A 4PRTA 3V7AG 4BQ5A 2CO3A 3MXWL 2O26U 3G5XB 3BUIA 1ZLSL 5C0RL 3F5JA 3VIJA 1UH2A 4F9PA 4O1DA 2FT6A 1JWUA 1JZ3A 3KCOA 3X11A 2F9RA 1KULA 3TLLA 2F58L 2RFGA 3LSBA 2UY5A 1YPZA 3P2VA 2VEIA 4GB9A 2O4MA 4JAMB 1MJJA 4IU3A 2GBAA 3P11H 5C92A 2DJLA 2GYSA 1F90H 4MQ7B 4XC3H 2DUAA 4A2SA 2VX7A 2F54A 2XKSA 3NSCA 4ONFL 5KVEH 2CLRB 4MX7A 3VH8B 1SBSH 3QJUB 2X2GA 4RXGA 4LLUB 4F7PA 2XGZA 1YEDA 5HYFA 3V18A 4H2AA 1F9CA 3K1GA 2VITB 4PV9B 2HSIA 4HUWA 3R1GH 4RLDA 3UZYA 2HYMA 5ECGA 4CW1B 3P0YL 1VIZA 3JV4B 3I6LE 3CPUA 1B31A 5AHFA 4LNCA 3HE7C 3U0HA 1JI2A 4A7GF 4XX1E 5HVHB 1SYTA 1T4WA 2JCWA 3DFPA 1TMCB 2AJXL 4RAVB 2AEPH 3NQCA 4LCUB 1Z9PA 2CCLA 4Y5XB 3SPIA 5J5EA 1OJXA 4PMJA 2QQNL 3Q43A 5LAXB 4PJAA 4YXLL 2BFGA 4OFIA 4DO4A 1GKRA 1VPQA 2O5XH 4JY6B 3AREB 1QNZH 4IOIA 3V10A 5KVFL 3RNKB 3OAUH 1FFNB 3T1WA 2ESVE 3H1ZA 3HZ3A 4NUJB 3PDOA 4WK2B 3ZKSD 5B8CB 2HVNA 5FS5A 2XJKA 4MB3A 5EHFA 2JKPA 2VX6A 2DQUL 3DJTA 1TPXC 3DUHA 4RR4A 4U6TA 5LWYH 4QDMA 4WQ6A 5E93A 5D8ZA 5CINL 1GYNA 2PDMA 2OW6A 2W94A 5KJ4A 4HQQL 4XUYA 5DY2A 5KSAB 1XSIA 2Y1VA 3FYIB 2P1YA 4JEQA 3S2MA 1CI3M 1OF0A 1FORH 4FMVA 1C3FA 4LKCB 3N85L 5KVDH 1KIUB 1XXDC 4W68A 1R3IH 3T0DA 4LEFA 4Y9OA 5HNUA 1BOGB 4B5NA 1LT7A 3TF4A 1F3TA 2Z7GA 2CPCA 4C56D 2XN0A 3NPUA 1VCFA 1H11A 2APXA 5IVXA 2H1XA 5CWSA 3HMWL 4ICWA 4NHCH 1VYPX 1NCUA 3KVJA 3BWAB 1JMXA 3V52H 5KVGE 1I6NA 5G55A 3MQTA 2J7CA 1QP1A 3GXFA 1XF5A 2MQGA 3IIZA 3BAEL 4MJIA 1KCRL 4JQ1A 4MMWA 4M29A 1IKNC 5FW6A 4WV1C 4EPDC 2P5ED 4XXDB 2J47A 2AW2A 5AW1B 5HTSA 3MGAA 3WG7B 5LA0A 3MJ9A 1L6WA 4MLJA 4K7VA 3OLEA 5D7JC 4Q56A 2N0MA 3NNTA 5FUOH 4X6DE 5HDOA 3G0SA 1A5NC 2BC4A 3T1GA 2NNAB 2PF0A 3E2QA 3GDTA 1B4JL 2IV9A 1HCFX 3BO8A 1WTGT 4QCIA 4WO4B 4DP2X 5F3HA 5I17A 4H44C 3ULVC 3SQBA 3QWOB 3QUXB 4BK5A 1P4LB 3QZWB 3KGUA 2OI9B 2EILB 5KTEH 3DGGA 3WF1A 1AACA 3W7DA 1HSBB 8TIMA 4PJ8B 5K39B 4AQLA 2DLHA 3KPPA 4OZ4B 2A99A 2QCDB 2P8LA 3VKKA 1R0MA 3MUXA 2YSSB 3CZNA 1I4FA 3FQTB 4CD8A 4PHZA 3NUKA 5LBVA 4NJKA 3GMLA 1X5GA 4BUGA 5LXGH 4JICA 3DV4B 4KEUA 4Q9QH 1XF2A 2QPUA 4IBTA 1ZFJA 3SOTA 3L2IA 1E90A 2Y1YA 2YD2A 3BFOA 1EXHA 4BV1A 4PRBA 5C9ZA 4Y5YB 4G7EB 1OAJA 1NCHA 2Q3XA 4JQXC 2PRHA 3DHPA 2JKRM 4WNQA 4MUZA 4RMWA 2VX4A 1F86A 1FKXA 1TU2A 3H9SA 4MYPA 3AHTA 3QPEA 1F18A 5TDNB 3VNDA 4A3YA 1MWAA 1YPXA 4Q6YA 1DQKA 4HWZA 5GRUH 5AZEL 5DJ0A 1IXQA 2HLAA 4XN9A 3A3HA 3QCTL 2DBJA 2DT2A 3IJDA 1QRNB 3RAOA 5TF1H 2NNFA 2ODOA 4GUHA 4PUDA 4PUMA 3HG1D 2AS5M 1AL8A 4IIEA 2W63A 4C6MA 1QSFA 5E09A 1CI1A 1I9RL 2ZSVB 3PULA 3MCLH 4JY6A 3MJ8A 4JZJB 3GSQB 3S35H 5C0BA 5F2LA 2X09A 5KSVB 2CKRA 1P2CA 2CMRH 2RA1A 3EJQA 4KHTL 4NUJA 4OD3L 1SGKA 2A6JA 2JIXD 5F9WB 3D3VD 2XTLA 3TGXA 3MB9A 3SDXE 1CFNA 4QX4A 4IBYA 2L3BA 5ALCL 2Y63A 3NO1A 3KRSA 3AWOA 2XJ7A 4WI3A 1WD8A 1BD2D 2EZ0C 4JO3H 2WKOF 3KPMB 2EH8H 3BSZH 3D4ZA 4AWJC 1F0LA 4DUXA 5JW3L 2OK0H 2VXTH 1FCGA 3ECWA 5TE4L 1K7EA 4I3SL 4NKDB 4Z7UF 5DHEA 3B1UA 5HGGS 1UTDA 2BLEA 1FQ9C 4YX2L 4DEPB 1IWAA 4J1OA 5LG1A 2GK0B 4PGBB 3SDYH 2XFGB 2OMVB 2JB6A 5HHNA 3ZGHA 1XM3A 1TCRA 5EU3B 5C0DB 2VERA 5DJYB 4E41A 3G8RA 3N40F 3ARFA 4UTTA 1MHPL 4GT0A 3OTRA 1YN7A 4WTQA 4GG6E 4XBPA 3SPHA 3WK2A 4Z3JA 2AZUA 4F9LA 1MFNA 3AWFA 2X70A 3A6BH 3CLFH 3SKNB 4UTAA 5AAWC 3OA5A 5B8CC 2B77A 1REQA 3MCKB 3WIFA 4QRUB 4NN7C 2YUWA 3VI3A 2R4RH 1CE6A 1I1FB 3DX9B 3L5WB 1SXNA 1HQRA 4P23B 1CICA 3DOHA 4UB0H 4R2GB 3B7YA 2B2XL 2IXVA 4OZGE 2A3LA 4UV4L 3EB2A 4JPIA 5F70A 1MCDA 5B3JE 4LNYA 1U33A 2VDLH 4LVNB 4RZ5A 3P62A 3DROB 2EDFA 2EKSB 4KI5F 2WUCL 3BVWA 3QCUL 4GX8A 3FT1A 4AVKA 3VXPB 4HYWA 4YTUA 1MJJB 2KMWA 4YPJA 2XG4B 4WI8A 4A2EA 4D0CB 2PDBA 4A35A 5AW8B 2ZNWA 1DQLH 2Z7ZA 1WA2X 1WSST 4HUMB 3TO4D 2ZYFA 1LEKB 4HFWB 4P9ML 3F83A 4ZUWA 1BWLA 2GGIA 5JHDA 2X7LA 5CEWA 3OJDB 4Q58C 4N2OA 4RGOH 1GEQA 5AZ2H 4GXPA 1EHNA 3D0LB 2DTSA 4D9LL 2VJXA 4TOYH 2YDSA 3VK5A 3W6MA 2H6PB 3W0WB 5K5YA 1NUDA 4W9GC 1XEDA 1BXAA 2IMNA 3GIZH 1SLVA 4ZG1A 4HJ0C 3NRFA 3OEXA 3I50L 3NCBB 4Z3TA 3MLPA 2CR6A 1SY6A 3LRGA 3QEQB 3W37A 3PBMA 4A8RA 4M61A 1L2QA 5AAMC 2EVGA 5J89A 4GUJA 4UBDD 2A79A 3SM0A 3QIBD 1XGZA 1I8UA 1B3ZA 1RV8A 1QG3A 1QBLH 1OC7A 4R8WH 4CCZA 4D72A 3WEMA 2Y25A 3M16A 2QCFA 1U3HA 3TVMA 2CIPA 1FFOB 4HYVA 4ECNA 4MY9A 1FYTA 3CSYA 2P45B 5DRXB 2DZUA 1OCNA 3GK8L 2NMSA 4ONGH 2IWGA 1KXVC 2AK4D 4MOZA 5FFOA 1HCYA 3VIKA 4HWEH 3P60A 1I3GL 2HRPH 4MA7H 3IUIA 4W4QA 5CBJA 1XBDA 4GQ9H 4ZL1A 1PKQB 1XH0A 2NXIA 3KOYA 2ZDSA 2VWSA 3UADA 4IQJA 3JTBA 1IAMA 4G6KL 4IKKA 3UYRH 3BQUD 4GJJA 2FWOA 4PTUB 2V3DA 4YHMH 4KITB 1M1BA 4A2DA 2PE4A 1PCKA 4MLIA 4WKZB 2E0PA 2Y22A 1NCTA 1G9EA 2A3EA 2ZTJA 1BXCA 3BW2A 1NGQH 3MXVH 2J6EA 1YY8B 3V95A 3EPNA 4Y9MA 4XNZB 3ARBD 3RIFF 3GKAA 1II4E 2X4SA 3VFGH 3FUIA 1JXJA 5D2LA 4XN8A 1B3WA 3ZE0F 4ES4A 1DBKL 3B9KA 1GVEA 4BFIB 1WUFA 3LA4A 2OLSA 2PA6A 1XD1A 4DGVL 1R24B 5BVJB 3O3UN 3SUUA 4PJCA 3NBNA 4PJGE 2QLYA 2QADC 4NSKB 3GZ3A 2WO2B 4BFKA 4C6LA 4Z7IA 5B38B 4HYTB 1QNVA 3UO1L 4QHLA 3WFCH 1XCXA 2XN1A 3KYOB 5D7SH 4AMKH 5HGBA 3HPZA 5E23A 3O63A 4MS8C 4PRNB 5EO1A 1J48A 4FSAA 3EWDA 1V51A 1M53A 1JRBA 1AG1O 4EXKA 5I2IB 4LBAA 2J1ZA 4ZTYA 2QIIA 3M0JA 2F8QA 4LIQL 3A13A 2Y7OA 4HHAB 4LBEB 2WBKA 5GZOA 3OU8A 4FS9A 4MY1A 1E9OA 1W1PA 3T0EC 1KBGH 4LSPL 2VEPA 3OZLA 3ZRSA 3AU0A 5D70L 3PFQA 1AQDA 1R86A 1BQRA 3KHQA 4I2XE 2P8MA 5DJDB 2EE2A 5EU5A 1JHKL 2P24B 1DJWA 3QGVA 3HAEB 1A5FH 1MAJA 3MCLL 4GKSA 1I9RH 1X5KA 2FWSA 3N55A 3ZL1A 4PCSA 4ATWA 4DN3H 4PTDA 4XMTA 4U1IA 4RGMB 1BWMA 3CNYA 4AFYA 2FGLA 3DBXB 1YNTF 1T83A 4OFDA 2ICWB 3M86A 2H0EA 4M48L 4QHUA 5F7EL 5KBPA 1ZLVK 1VCBC 1IXOA 5CEXB 4ZXBB 5IESH 5EU6A 1A4LA 1B54A 1F61A 2FQIA 1GVIA 5LQBL 2ZSVA 2REQB 4NJIA 4Q32A 3VXME 4E4UA 3JWNE 4FYQA 4F8PA 2R4SH 2OMXB 5FLVA 3GB7B 4KERA 4CCEA 4R5XA 3FO1B 1F74A 4JQIA 4M1CD 5KINA 4JBRA 1AYOA 4XPAH 2HTLC 3B83A 1XGEA 3M0IA 4EPBC 3LIZL 3SPJA 1OAYL 2I5GA 3FDKA 3CLWA 2O9OA 4JRXE 1NGZB 4WEUD 4RZ6A 3GEFA 3UR5A 3FUFA 3PXLA 1K70A 1P7TB 3J2PA 2ACSA 4GY0A 1EWDA 4JANA 5IBLD 1B3IA 1XF5B 12E8H 2Q2LA 4AF0B 3N3MA 3S34L 4N2IA 1R46A 5FKAB 1X38A 1GGCL 3WY3A 2YPVA 1ZLUH 2DB8A 4JHWL 4LRTA 3RWCA 4JM2B 2X4RA 3DH7A 3ITYA 5JPMA 5B22A 1AW2A 4DN4H 3BOVA 1U8CA 4KC3B 2BC4B 4WHCA 1Q63A 4UAOC 3CSPA 5TH2A 4GY4A 4HAGA 3WIFB 3GGWB 1UWGL 3EHBB 2E6PA 4WO4A 2JJTA 2D7MA 5H35B 3CFEB 2H3KA 2QXWA 3H4GA 4O12A 5FHAH 3P5ZA 4I5XA 3VU1A 1B0GA 3VIPA 1HNGA 2LQRA 4O2FB 2YAFA 4HUCA 1L9WA 4I0PB 3MO7A 1MG3C 5AD0A 3LBMA 3QIWC 3QRLA 5DT1L 3KPLA 3GSRB 4B97A 1ZT1A 5EIVA 5CFAA 1O12A 3MYPA 2P8LB 2QDEA 1ET5A 1EJVC 3V1HA 5FEXA 3U4KA 1JDAA 2F7OA 4R4NC 2HWZL 4AZCA 4DZHA 4DLMA 2A6IA 3F64A 5HHPB 3NJGA 3PLYA 3MODH 2RDTA 1KFGA 4D0CA 3LPWA 4L8SB 3KAOA 3VFSB 5AUMB 3EX6A 4UC5A 5DELA 1TPH1 4AIBA 4F2UA 4BFEA 4FQXC 2X4PA 3C9NB 4X99B 3FJ6A 1R3IL 2GG1A 1E30A 4PRBB 3T08A 4XKYA 1LP9E 4Y19A 4JFXA 5E9DD 4TL4A 5C07D 1BWVA 2VIRA 3PU7A 2I9UA 4JTRA 4BCEA 4F40A 1OGAA 2A38A 1GZQA 4DRSA 4H7CA 4PJEB 4XAWL 2K6YA 2BXVA 3NXLA 4QTGA 5C2CA 2Q1EA 1CXKA 2Q8BL 4WUUD 4GVGA 1V0MA 1FX6A 4HG4J 4DJMA 2CJUH 1EB3A 4XPGL 3SYOA 3KCLA 4IWWA 2R1KA 1D7KA 3VUSA 2DLTA 1MI5E 3PP3H 4KU1A 4MJJA 3DHMA 4Q74A 5TK4A 2Y0SA 5ID0A 2F6XA 1KTCA 3G1FA 3LQAH 4Z18A 3ECBB 4CU7A 5FJTA 4PG2A 3NQKA 1TQJA 1QNZL 3BLFA 3U9IA 5D30A 3THUA 3TA3C 3S4SG 2Y7FA 4Y0GA 4Q8QA 4PWGA 4NQXA 3TYZA 2QQNH 4F7EB 3NQ6A 5LBSL 2AJVL 4BA0A 4KNQA 5IB2B 2DMKA 1SDDB 1Z9AA 4XZUB 3FA3A 3F65A 3X1NA 4HHGA 1E6ZA 1UVQA 2GJXB 4EIUA 5FYLD 1W9PA 1EVTC 1KV5A 1FPTH 3RGVA 4BE5A 1SO5A 1ZAJA 2YW3A 4K7FB 4NJ9H 5A8PA 4EN3B 3K6IA 1QBAA 4UMBA 3HB3C 4NP7A 1MFDH 3WEBA 3QXDA 3U2JA 4FEIA 2PPDA 3MO1A 2C1PB 3V4VL 2LAAA 3D0VA 2L4OA 5GISL 4GIEA 4ONFH 1IC5L 4N0YL 4CVWA 5C9XA 1PZ5B 4HCHA 4NU7A 3W29A 1OQXA 2PU0A 4R3UA 4XXWC 3V5OA 1TQWA 5LXXA 1V05A 4DT2A 1XF3B 4P4RA 4APQD 1ZHAA 3HFFA 1NGZA 1EX0A 2IH1A 4GUIA 1UD6A 3BYTA 2J8UF 5AWNH 2F58H 1BVWA 3U7AA 4F8QA 3Q67A 1I4FB 3HG1A 1TPB1 1HKLH 2BVQB 5D2XA 1QR1B 1WKEA 4TX9A 1HWGB 4U1GB 3VKBA 2VW4A 1N6VA 1EJUC 5ABHA 5DQ9A 1CLOH 5JHBA 1UB6A 2FGWH 4G6KH 4JGMA 3WEZA 1E50A 3EO9L 3CDFA 4XVOA 5EU6D 5IHZB 3RWCB 2O6EA 3FSVA 2WNQA 3EGSB 4QRSB 2V9RA 4FFWD 4PLOB 1HXYA 1NSJA 2OJZH 3PP3K 3KYKH 1WAAE 5TDNA 4GK8A 4ESKA 4O8RA 2CZVA 1AHWC 4KTGA 4AQ1C 1UWYA 1BVLA 2VM3A 1ETZA 5CGYD 5FYKD 2JIWA 3H2NA 1S7QA 5HDWA 4JFDD 1JCTA 2OP4H 5PAZA 2HT2C 5E2VL 1NC4D 4HK3N 4G6AD 4L7ZA 3NPSC 1M7OA 1HEZB 5FUZH 3WIHL 3KW7A 3W39B 1F6AA 1C5BH 1XMEB 4CC4A 5L6YH 4NQCD 1W1ZA 1XW8A 3PTKA 4JY9A 3MN8A 2YSWA 5CZVH 4LOFA 5IW1B 3PGCB 2SEBB 3LLDA 1E9OB 1G0YR 2X1SA 1YAZA 5E1IA 1TYRA 3C60D 5CAYB 2EC8A 3GHPA 4A3RA 4BA8A 5ESAB 3BPNB 4GI9A 1TPFA 1NCDL 5EU5B 3L4WA 3POCA 1TTCA 4R7XA 4AK1A 4K15A 1NFPA 2QBWA 5T5FL 3VKDA 3QDGE 1DJHA 4GKSB 4GXUM 1AO7D 3CDYA 5C2GA 2JXMA 4QYOA 3O3AB 4I5BA 4PLJD 5A6SA 3U36A 3OKEA 5EF0A 3LMZA 1PNDA 1ROCA 2RCSL 3FH7A 3GRWA 3W2DL 1NQKA 4PTWA 3P2BA 4P23D 1P0SE 1KWGA 3UGRA 2I60L 2GBTA 3FL7A 1DQJB 3VAEA 1LP6A 4FQ2L 1EXBA 4DK6A 1MCLA 1YY9C 3H2EA 1FZOA 4HPNA 5IXEA 2GVLA 1P9MC 5GS0H 2H2PD 2P5PA 4XOBA 3HI5L 3QCUH 1ENUA 4XP5H 3ARDD 2FB2A 4QIUA 3GB7A 3UJIL 4R84A 4MCYB 3ILDA 1KLZA 1RHHA 4JJOA 4RFNC 4RDQF 4WIQA 1T1ZA 3ZYZA 3OPZL 1QNRA 1MAKA 1S7UB 4LPVA 1E51A 3X11B 3NK3A 1GTFA 3FO9B 3T44A 3OX8A 1UATA 4UB0L 5BOPA 1HYSD 4QRPE 3ZE0B 4YGAB 5IT2H 4UT6L 3BUPA 3PYCA 4YZFE 4FFYH 3LLXA 5EEYA 1EUTA 2MSPA 3MKCA 3MMEB 1EDQA 2E7FA 2BFVH 2UY4A 4JFOB 1C08B 1EZ2A 5LKYA 2HJFB 2YDRA 4MJZA 1UT9A 3T65B 3HPLA 1MJ8H 4MB1A 3KWSA 1W72A 4L8SC 1XL4A 3GRWL 2DQFB 1U58B 5D6DA 4W70A 2DQ6A 4LK4A 4WVRA 4OCXL 4H25B 1YRKA 3DN5A 1FP5A 4KI5C 4BM7A 4J3SA 5E6ID 5HR7A 1U3HD 3TVMD 4LV4A 2WQRA 5KOVC 3HG1B 2VCOA 3WFEH 5FB8A 2NXZC 4PMUA 4HBKA 3O2WH 1PYMA 2DIJA 4D2JA 1YDYA 3MRIA 4WI0B 3T3PF 3FUNA 4CNTA 2XA8L 2PO6B 3IDNB 1XGPB 1TZ9A 3HNTL 3M7SA 2BIHA 5CCKL 2PLKA 4RLIA 1FWRA 2A83A 3UIYA 1LF1A 4KROC 4RX0A 3SN0A 3MLWL 3Q2CA 3OQ8A 3WCZA 1Q65A 3B7SA 1E6OH 2JGYA 5IZ7A 4G8GE 4DSYA 1G7VA 1NDVA 3LB6C 3TNBA 1JPGA 1TQBC 4K3HA 4LALA 2DM2A 4MXWH 1EX5A 1PZ2A 4EI5C 2C5DC 3G5YB 3SCWA 1HEZA 1VP5A 4J28A 4U4BA 4Z3HA 5MI0B 2H6OA 2DQXA 3LHVA 2XNAB 1EMTH 5GRUL 3H24A 5FOJA 3ABXA 4PBEA 2ZC1A 3SJVA 1P1ZA 2HT2D 2RFXA 3T2OA 3VYOA 4M61B 1H0GA 3DAQA 3MP5A 3RU6A 3JUZA 1LOLA 1RUAH 2YK1H 4CNIB 5DSCB 4PIRF 2VVNA 3GLDA 5ESVB 4I1PA 2GQ8A 5CZJA 3FNDA 4CVZA 3W9ZA 5I77A 1BEYL 1BZOA 4YHIA 5DJAB 3S5ZA 5GXBB 2E9LA 2VR6A 4O18A 2VLLB 1V02A 1XC6A 3H0TA 4OTKA 2CDEB 3N50A 4BKNA 1OFOA 1TKWB 2DWEA 4CCDA 3W87A 3QC0A 4ZXBC 1TWIA 2Q20A 4KVCH 2NSOA 3NABL 4FXGA 4ZQPA 4E6MA 2UWEA 4FZ8L 1ZLEA 1NEZG 3VI4B 3DJSA 2PZ0A 4KKCC 4XWOC 3KBSA 3MLTB 3BDKA 4EN3A 5FM5O 4X8CA 3HR5B 1IGCL 2GTZA 1OAUH 1UBSA 2EDXA 5I6KA 1IYXA 3EX1A 4ZQRA 4BKLB 3GUTB 3ZDYE 1S7SB 3VE0B 2GJ6A 3D0VB 3L4UA 2Y4SA 4O0KA 1RZFL 5CPTA 3QV6A 1KPRA 4UOZA 4AD2A 1OY3B 1H5BA 4L5FL 6REQB 2NY4D 3TBVB 3MANA 2P0IA 1CQKA 2WWNA 3EJYC 5MEOB 5T5NF 4Q2ZB 1AP2B 2X7WA 3G77A 3BZFB 3H7BA 4TYUA 4Y4FD 5G4WA 2F74A 4DETA 2J6EH 4JO2H 3O3BA 5BOZG 1FVEA 4AITA 5AVRB 2TRSA 1QR1A 4WUUB 5DUMH 1O7DE 3D34A 3PNUA 5JPMB 1YKWA 3PUEA 3TESA 5AC4A 5C0FB 3ARRA 1LTXA 1Z5YD 1S7RA 1Q85A 3D9AL 2P47B 2YD8A 1CUOA 5IMLB 3OODA 3HUJE 3VD9A 4DKTA 3FUMA 1ZE3C 3ASNB 1TELA 1N10A 1ICSA 2X9YA 1E15A 3T2PA 2PTTA 3C6LD 2UX6A 3EO0A 3WLWC 2WSYA 1T1WB 3M17B 1Y6KR 2FZ3A 4P8XA 1LK2A 3UCQA 4BH7B 5K9QG 1JDDA 4JKNA 1FAKT 1N2VA 1MH5B 2QF8A 1HWWA 2X4TB 3MRBA 3BN9D 3TWAA 3C5JA 3MGTB 4I0PD 4O17A 4NCC2 3TCLA 1MQ8A 4Y7OC 3D39A 1MQQA 2UVFA 3CFUA 2O5XL 1TUXA 1XAKA 3CSGA 1W2KT 4NN5C 4HNNA 5HDRA 2JKTM 4NQDA 2AV1A 3VXRE 2IPUG 1IEHA 1U5JA 4JX0A 3QHZH 5CLYA 1W0WB 5I1JL 2JKJA 1SJDA 4JO1H 1V4YA 2WLNA 5FEBA 2O5ZH 4ZUUA 4JFED 3VH8G 3WL1A 5EMLA 4WW2C 4G1EB 3MU7A 2H3NA 3MOQA 2CHRA 5H4YA 2NY3B 1GPOH 4C6FA 1X4YA 4Z7VE 4DAGH 3NIDF 4FULA 5ERWB 3AUJA 4YDKL 3FFCB 4E9QA 5LVEA 5PCYA 2HLFC 3FY1A 4J39A 1MO0A 1S5TA 3UAJC 1YN7B 2W07B 1IEAA 3KS0H 1EJ7L 4CD5A 3W2NA 3NZPA 3QORB 3PQYE 4JMXA 3S3DB 4F9DA 3WFDH 4KTYA 1WRFA 1FN4B 1IGFH 1U8HB 1GYUA 2BPBA 4X9YA 4L3CB 3VG0H 5E08H 1E0VA 1J9RA 2FWLB 2HVBA 5ISZA 4FQ1H 5ICXB 1B0RB 2PURA 4XX5A 2KQNA 1ASOA 1RQHA 2W0FA 3WQDA 1L5GA 2ADGA 4P2RD 5DLML 1LYXA 3L3GA 4XAGA 2NZ1A 4G7RB 4JFPA 4S1RH 5F4WA 4JZOB 1PAMA 3KR3L 2XQYK 1CVRA 4Y9CA 4AB4A 3UZEA 5GZNA 1J12A 2EXTA 2FUQA 3O2DH 3RKDC 3I6TA 4XCCH 4A6YL 5FEPA 1W0VA 3HMCA 3ULVF 5JORB 4Z3GA 1DBML 4PJ7A 3SCUA 1XGUB 3FC8A 3GYEA 2K3TA 4PRID 5BUPA 5K9JL 1QMUA 4OZFB 5I66A 1U22A 3GI9L 2V2TB 2W66A 3VYLA 1Z6JT 4RAHA 1GS8A 4XVTH 4LEQA 4OSUH 1AOZA 4O5LH 4OFQA 4NUMA 1FSKC 4Q2ZA 5AUMA 3NSFA 3VX1A 3HZKB 3ZTJG 1U93A 4DERA 1DBAL 4Q4EA 3W57A 1HIZA 1XGDA 2JF1A 2VEMA 1NM4A 3N40P 4OJDH 4XSLA 3RDTB 1FRGL 4Y2DB 1B9BA 2OL3H 3RG6A 2HFGL 1GCFA 2VFHA 2DQGL 3WY1A 3MP3A 1SVDA 4NPYA 3UTSE 5JOFA 5F9DC 2X28A 3C5ZA 4IMLA 4HMCA 4ZW3A 4L3FA 3DURA 4B4FA 2HNHA 2BX7A 3UZQA 3FCSA 3ZHDA 1BAFH 4P2QE 4DNLA 4I3RL 5FGBA 1XIMA 4Z77A 2PTTB 2YIHA 3GSWA 4G6FB 4L48A 3X3FL 1QTWA 1PKNA 3U5YA 1U42A 2ZCLH 4JPVH 2DWYA 4YDMA 5DHYB 1MJUL 4XAPA 4H1LH 3H53A 3VO0A 3AREA 2PXYC 5GGRY 2Z92A 2E7LA 4XGZA 1S2CA 3T4WA 2ZZ1A 2XG5B 4WUKH 3VA8A 2L04A 4X4XB 2ADJA 4UINL 4ADIA 1X96A 3AXXA 1J9QA 1JK9B 1EZUA 2NW2B 4GP4B 1FNGA 1MCWM 2M2DA 2X2JA 1W32A 5A6LA 4OBSA 4G42B 4ML4A 1NGYB 4EVNB 2VAAB 1R3LB 2W62A 4IHBA 5EO0A 5LIXX 4UDUA 5SV4A 2ZAGA 2DWSA 4QF1A 2Z9TA 3ZKXB 2FJGA 1S78D 4W6YB 3TWCL 2IDQA 2Y1HA 2P80D 3SGDH 1IKOP 4EZLA 2NZLA 3MFGB 2X6MA 5BW7A 1QDSA 1REIA 1WV2A 4M7LL 4FFZA 5I6LA 2X2YA 5GJSL 3KDNA 5D7HA 3WI9A 3II3A 3WD5H 4OZFG 3QIWB 2FR4A 1KXVA 4S1QL 5DD0H 2XZQL 1E5YA 3S5LB 4QRRE 4JCLA 1EEZA 4OLVL 5FM8A 2IPTH 4ABVA 2IANB 1I4NA 3RMJA 4ZO6A 2P5EE 1A0EA 1YE4A 3CT7A 2V5YA 5F7YC 5CLZA 5JQIB 2OR8A 2R8WA 1WT5C 3R0UA 4UM9A 5FFLA 4IKJA 5ILTL 3DVNB 3PUOA 3F12A 4LSVH 4OT1L 3FGCB 4YNYB 1HT6A 4QBXA 2ZXCA 5AOLA 4JFVA 3ZQ9A 1YX1A 2W3ZA 1ME9A 1NAMB 2QJJA 3O9NA 1QYGH 4YSOA 3WEAA 2EUZA 1UZDA 4XPBL 2HXTA 2ZA3A 3TBTA 3UG3A 1HC1A 2YKKA 4DP0X 3TFKD 4AWEA 3A9IA 1I1XA 1W3JA 1BBJB 4YHLL 4F3FB 4HF5H 3LH9A 3L3OB 4HUXA 3UA3A 4QDPA 3CHRA 1BBDL 3U1QA 3IMUA 2WO5A 2FIQA 2OL3A 1XIHA 3H26A 3TN6A 1U58A 1VADB 4RGNB 4Z0XB 4Z7UE 2R2HB 3KGTA 3TIEB 5K9KB 1YEHL 2HUHA 2UXVA 4RNFA 2HT3C 3PZIA 2ZZ3A 4NZ4A 1TSHA 1YEDB 4N2BA 5I3HA 1F1AA 1U4FA 4NO2B 5B7EA 2WLYA 4ZI8A 1P1MA 3INUH 4HV8A 5LCVL 5M7QA 1M7JA 2ZCGA 3DFHA 3GFXA 1J0YA 1TPC1 5XINA 5TFSH 3HGRA 3MRIB 4NFBA 4UR9A 3HZVB 4XP4L 4OOZA 4B3KA 4NPKA 5GGSY 5JXEC 2B15A 4JTIA 2E9BA 2VQ1A 2Y3NA 4YLBA 1L6GA 4M6UA 1AIFA 1G4RA 5IQNA 3I9GH 4G5ZL 4FR1A 3T77A 5JNYB 2RDXA 3SDDC 3U7BA 2N4IA 1OM0A 3HO8A 5G5IA 3WMQA 2OSWA 1GVQA 3CBWA 5GS1C 3RJQB 1RZGA 4M56A 3P02A 1SJCA 2IPFA 3PBUA 1LOSA 1ZLVH 2GY5A 5C8JB 4LUIA 3C0SA 4P3CH 3AHZA 5CO1A 5E2TL 5KSBF 2A7NA 5I5MA 4Q8TA 1TYJA 4MDOA 5JW5B 5FUCE 3QJFB 1AR1B 2QL1A 3SDCB 2P88A 4NKCA 3MZGB 5DCCA 4FQCL 4C1NA 2X4QB 2YBUA 1E8XA 1VD6A 1QUPA 1UUSA 2XGIA 3MCMA 2KERA 5M3WA 1MPAH 3SKMB 1X98A 1CDIA 3DSFL 2NV1A 1O94A 3V0TA 4ELME 3VI4F 4HIJA 3USBA 5HJYA 2WCPA 3UACA 2NY1D 2G2NA 5HGAA 3RTQB 3FU3A 4A7QA 3MRFB 4AH2A 1OFDA 2FHCA 2CW6A 3BQUB 2WJEA 1GKEA 5HUPA 4LLAA 2YGOA 1Z48A 3IJ7A 1P5BA 5KSAC 2D22A 4N87A 3PWJA 3PAZA 5BRZB 5F89A 2DQEH 4RZBA 2DQEL 3MSDA 4GUGA 1TPUA 4IIDA 4A7GA 4OCLC 3NFSL 4OFVA 4R96B 2MCMA 1GQKA 1SXZA 1NARA 3BW3A 4X2PA 3DX3A 4HCIA 1RZIA 1UWRA 1Z9MA 5AC8A 1A5OC 5HPMB 4LCWA 3HE6D 3AMGA 4Q4SA 2DZSA 3L21A 3Q6GH 1NF7A 1U6AH 4ODSL 5MENE 5CCZA 5EU3A 2F08A 3S5LA 5KS9B 4H4IA 1OSEA 4O1FA 1CB4A 2HUEA 3LH2H 4GY7A 2W0FB 5DO8A 1C1EL 4NAFB 2Y5QA 1EL3A 1G6CA 2Z29A 1OX4B 4HS3A 1TVLA 1QOPA 1AXSB 1BZ9A 2FX8H 4OCMC 1M7PA 5CAHA 1AGDA 2Y0FA 4HGKC 3ABQA 5CSYA 4UFJA 1D6VH 4J2PA 3ULUC 1XBVA 5H8UA 2AQQA 1LLZA 1XR8B 5DZPA 3KBNA 3SY5A 4J8RA 5BW6A 3DPDA 1V93A 2AEWA 4PJBF 4MNGB 1KDIA 5ICYB 4GX9A 1ACZA 5FO7A 3EYSH 3NJKA