4WSJA

Crystal structure of a bacterial fucodiase in complex with 1-((1r,2r,3r,4r,5r,6r)-2,3,4-trihydroxy-5-methyl-7-azabicyclo[4.1.0]heptan-7-yl)ethan-1-one
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
439
structure length
439
Chain Sequence
b'EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-L-fucosidase
publication title In vitroandin vivocomparative and competitive activity-based protein profiling of GH29 alpha-l-fucosidases.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 158
structure length 439
sequence length 439
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-10-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4wsjA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4wsjA01
4J3XA 3TTOA 3H55A 1UKSA 1TQWA 4U33A 1MXDA 1W3LA 1X1NA 1FH7A 5BRQA 2O9TA 3RJXA 2A3HA 4PRWA 5AC4A 2WMJA 3ZT6A 4GZJA 3WH7A 1E3ZA 3VIFA 4OOZA 2Y5EA 3BLBA 2F7RA 1HXJA 3AIQA 1H2JA 1EQPA 3DECA 3THCA 2X2IA 1NOFA 2D0GA 4LPCA 1OWQA 3HG3A 2W5FA 1UD4A 4CD7A 3MANA 3CTTA 3WY2A 1G1YA 2X1IA 3VO0A 4URIA 4ZXLA 3RPMA 2PWHA 2WWDA 2X0HA 2XVNA 1QI2A 2XVLA 3WDRA 3LXCA 8CGTA 3BVUA 1CIUA 1W9VA 2VZUA 4Z2JA 3BUDA 3TV8A 1W1YA 3VX1A 1LL4A 4CD6A 3SCQA 5EFDA 3ARXA 5A6LA 3N04A 3LPOA 2DSWA 1OGBA 2BVYA 1XH1A 1BG4A 4H7VA 4QLLA 4UOQA 1HNYA 1MXGA 3SUSA 4J3UA 4BQ5A 2F61A 4H04A 3PZIA 3EJTA 3WBAA 1W9BM 3VD5A 1XD1A 4F9JA 1TR1A 4IUGA 2TAAA 4TVCA 4ACZA 3VIHA 3LRLA 3EDEA 3CHFA 3VGGA 2BXZA 1XD0A 4PYSA 3VIPA 4P8XA 2OSXA 3CPUA 3GXIA 2D20A 3A24A 1BFNA 3EDJA 2UWFA 2VZTA 1QI0A 3OGVA 3WIJA 2X0YA 2VURA 4TTGA 4AEEA 3RM8A 1JYVA 2XN1A 2J7EA 2WB5A 2D2OA 3NJ3A 4PMRA 1CXHA 3D50A 4NI3A 1UQYA 4KGJA 1R7OA 3CV5A 4D72A 2YIHA 2QV4A 3DYOA 2JEQA 1NARA 2ZX6A 2FH8A 4AEFA 3EMCA 3OA5A 1AMYA 3LXBA 3W6MA 2DDXA 3CZLA 3ARZA 3JUGA 3ZIZA 1NOUA 3L4WA 3DX2A 2W67A 2Y4SA 4PEEA 4RE2A 2OW7A 1E43A 3IAQA 1DTUA 2D73A 2ZWZA 1PZ3A 3GXFA 4U3AA 2UY3A 3WL0A 4HOWA 2F1AA 2EPKX 3PZUA 1V6VA 2EPLX 4NXKA 3ALGA 2XYLA 2OSWA 5BXSA 5CSUA 4K68A 2CIPA 2V3EA 5A2CA 3CLWA 4GIAA 1IV8A 3AISA 2OLHA 3VIMA 1TQUA 2X8RA 2QPSA 3K8MA 1EOMA 3RIKA 1TQVA 1KB3A 4R5EA 4LYPA 2CBJA 3ARSA 1JI2A 4U2YA 1SMAA 1RPKA 1EDTA 4LYQA 2Y8VA 4CKQA 4QDMA 2ZXDA 3VIGA 5GNZA 4U3CA 2X2JA 1HL8A 4W8AA 2VR5A 1ISXA 5I3DA 4A4AA 4F66A 1E5JA 5BXRA 3W0KA 3RO8A 3FW6A 4AZBA 4QFUA 3SCOA 1F4AA 3CUGA 4CCEA 3ZT5A 1SYTA 4UTFA 1E0XA 1B3YA 3AIEA 3ARPA 2GJPA 3WUBA 4J3VA 1U2YA 4MNKA 6A3HA 4OBRA 4UZSA 1Q6FA 2C0HA 2BNJA 1EOKA 4XUYA 4WF7A 3WDQA 2E9MA 4F79A 3FHAA 3HU7A 2XHYA 3WF2A 6CGTA 1TG7A 1SFSA 1US2A 4X0NA 4A3HA 3UG5A 3BCFA 3BSHA 2D3NA 2WWCA 3ZO9A 2WZIA 3ARWA 1UWUA 3VD4A 1E0WA 2V3GA 2WMFA 1CGVA 4W84A 3PZMA 1VEOA 1PZ2A 3EJQA 1F4HA 2XSBA 4QAWA 5D9MA 2Q8XA 3WDPP 4JZ5A 1Q6GA 3A5VA 1L8NA 1OBAA 3M7SA 1PS3A 5E1QA 1JNEA 4W5UA 2BS9A 3VVGA 1FOBA 2EO7A 1ZBKA 1KGXA 5I0DA 1JNDA 5JBEA 4DM2A 3VINA 2ZWYA 2WMIA 5HXMA 2WVUA 1DWAM 3PZGA 3NSNA 2X05A 5I24A 5CG0A 3CIVA 4PMZA 2ZXAA 4MNMA 5DO8A 1UYQA 2OWCA 2Z1SA 1BPLB 1EO7A 3N13A 3GNOA 2HVMA 4TUFA 1E71M 4W7WA 1BVZA 3MSDA 3VX0A 1E1FA 1H09A 5DF0A 1WDQA 3ZR6A 3GXPA 4PMDA 4WK9A 1B3XA 3MSGA 3VMOA 1ISVA 5BYWA 2FHBA 1NP2A 1E0VA 4GO8A 4DUVA 3CZJA 4FNSA 1E3XA 4GPNA 2W4XA 2VJXA 1C8QA 3D5HA 2J79A 3LPPA 1BGAA 3S6TA 1VFUA 2WC7A 1JD7A 5JBDA 4YHGA 4Z2HA 3J7HA 2QMKA 4MAZA 3CZSA 4FLSA 1LWHA 3BUPA 1OIMA 1WDPA 4TXEA 1ISZA 4W93A 2CBUA 3CZ8A 2CCRA 2YA2A 4FMVA 4QCFA 1UA3A 3VGFA 2PC8A 3A6OA 4H41A 1W3KA 3PBGA 2EQDA 1JZ8A 4V2XA 4DO4A 2PF0A 3QHMA 2DSUA 4UR9A 1H4PA 4P7OA 1OIFA 4JFVA 1P6WA 4AMCA 1QNOA 1R34A 2F18A 3RJYA 1BTCA 3AIVA 1WZKA 2F7QA 3PZOA 2EEXA 5LYRA 1YHTA 5A6BD 1HJUA 5C71A 4AC1X 1XH2A 3WH9A 1XC6A 1UH2A 1W1TA 1BQCA 2WMKA 2GJXB 1FH8A 3WNOA 2WZHA 2CITA 3K8LA 2Y8KA 1JYXA 4OJYA 4XX6A 2G8ZA 3CZKA 2J25A 3BUBA 1UH3A 4NX0A 3CHEA 3WUGA 2XWDA 4D6IA 3BMVA 1ESWA 4M81A 3VUPA 5A94A 4MADA 3A47A 4Q7NA 5A6BA 2VZSA 4WKFA 1QX1A 3DYPA 5I5RA 1GCYA 4BCEA 1MFUA 3W25A 2ZE0A 3D3AA 5ABFB 3GBDA 1WDRA 3CZNA 1CECA 4HU8A 3K1DA 4PSRA 2ZXBA 1TE1A 1WZLA 4PMOA 3T2QA 1WZMA 1EGZA 2CKRA 1US3A 3W28A 3QOMA 1L0PA 3UR7A 2BY3A 2GJXA 3TTSA 5CPSA 1SR0A 5D4YA 3AMGA 2E0PA 1QOXA 3SCPA 1JZ3A 2NSXA 1WKYA 5DT5A 5BCAA 3VSTA 4M1RA 1W9DM 4GQRA 5GNXA 3VNYA 1B3ZA 3KWXA 4AZ6A 4CCCA 3T2OA 2VQTA 3ZM8A 3SCTA 2A3CA 2J8GA 1R7AA 4OUEA 1E55A 8A3HA 1JF6A 3QHNA 2W62A 1UWRA 2J7FA 2WM0A 1CXIA 5EMYA 1FP9A 2WVSA 1XGZA 5KEZA 3MUZ1 4D1IA 5E0CA 3B8SA 1QHOA 2PWEA 1UWTA 3EJPA 5HPCA 1KXTA 2HISA 4W89A 4CU7A 2D24A 3WMBA 1D7FA 5I79A 4QP0A 1MVYA 2CBVA 4E8DA 4AZGA 3GXMA 1NWSA 5I77A 1JGIA 1LL6A 4FNUA 4C7DA 3II1A 1LG2A 4CUCA 2ZX7A 1G9HA 1I1XA 1NQ6A 3A3HA 4EANA 2ZUSA 3TTYA 4JAWA 1HKKA 4H8VA 2BV9A 4PUDA 2VMFA 1KTBA 1H49A 1UD3A 3WQVA 2CKSA 2OWWA 4JHZA 5IFTA 2D22A 1CBGA 4KRUA 1V3HA 4D6EA 3SUWA 3AI0A 3RILA 3IAPA 4AW7A 1RD6A 4PUEA 1CGTA 5I78A 3WQ4A 2XFYA 3WEZA 2X2YA 1UR8A 2VVSA 1K9TA 1V3IA 3LPFA 4BQ2A 3L4ZA 2OYLA 5LA1A 3SEPA 1OT1A 1Q6DA 3HN3A 1J01A 3WN6A 4UFMA 4AYGA 4PCTA 3ZQ9A 3GH5A 4KRTA 4DO6A 1FHLA 1RP9A 3K4DA 3EYPA 2VNCA 3DHPA 1E56A 1HJSA 3AICA 3LRKA 1ZBCA 5C8BB 2UY5A 1QWNA 4JL1A 2C7FA 3VOCA 1B9ZA 1Q6EA 2WAGA 2GFTA 1HTYA 4KGLA 3K8KA 3BH4A 3WD2A 4OGZA 2QF8A 4F8XA 3BLPX 3BVXA 1GUVA 2VL4A 3F5JA 2WHJA 4UQ9A 3WKZA 2FYVA 1K9DA 1R86A 3WD3A 5JIPA 5A6AA 5CXPA 1WNOA 2W92A 1JZ7A 3WUEA 4AZHA 1OCQA 3VIJA 3TONA 3FAXA 4N42A 3WQ5A 1KQYA 4MNLA 3N15A 2WYSA 5D9NA 1CNVA 2DSZA 3PN8A 1KR1A 2WZEA 2WMGA 2J4GA 5FD0A 3WBEA 1WAWA 1E73M 5JIWA 3EDFA 5E70A 4EKJA 1VEPA 1J9YA 4B3KA 4IPLA 1GQKA 3BVTA 3AIRA 4FNTA 2WLYA 2W66A 1OB0A 3BVWA 3VD3A 1BYBA 1X6NA 2WVVB 2ALWA 1B30A 3L2MA 3BMWA 3AS3A 4D6DA 2XVPA 2CESA 5BRPA 1DP0A 2V38A 1JDAA 1GQLA 1XH0A 1E6QM 2YDQA 4P8VA 4MJ2A 1UZ4A 1J0IA 5BROA 4AIUA 2PWGA 1V0LA 4AZCB 3UCQA 4AD3A 3WNPA 1EDGA 2WPGA 2XN0A 4L4PA 2G3NA 1BHGA 3UERA 1KXHA 4BS0A 1D2KA 4CD8A 1R87A 3EBVA 1U30A 2ZUVA 4UFIA 1XSKA 3W6LA 2XIBA 1E1EA 4AZ5A 3N12A 1M7XA 1CGYA 4S3KA 1WB0A 3ARRA 5A8PA 4FNQA 2GVYA 4GZEA 1VENA 2PWDA 1JZ5A 2WVVA 3MI6A 2PBOA 2D0FA 1B3WA 5GNYA 1J0ZA 2DSKA 4AD2A 4IISA 4LXFA 1GOQA 4J7RA 3WSUA 2X09A 2VRKA 3GH7A 3CUJA 4GI9A 2YA0A 3FY1A 5DFAA 2XPKA 5A95A 4LQ1A 1JAEA 1GOKA 1BYDA 3GXTA 4M8UA 3AROA 2CBIA 4AZCA 1V3JA 3ZOAA 4XZWA 1ZBWA 1C8XA 4YPJA 5CZKA 3AMLA 1FFRA 4V28A 3W27A 1FA2A 3TOPA 1V3LA 3MO4A 3UG4A 1TVPA 2OYKA 1UKOA 2MANA 3DC0A 1BGGA 4WIWA 4XZBA 5A1AA 1UZ1A 2V3FA 2GK1B 3ZJKA 1HKJA 2XFRA 3MUIA 4W8LA 1UKTA 1XYFA 3T0BA 1V0MA 5FL1A 4JFSA 3PZVA 1JFHA 1V6WA 3NIYA 1GW1A 1DWHM 2WKGA 3AZSA 1V6UA 1W9UA 4JHOA 2VO5A 3GTNA 3GNPA 1OD0A 4W7VA 2DIJA 3L4UA 4NZJA 3DX1A 5IHRA 3AHZA 1J0YA 1PAMA 2IUZA 1EA9C 4UZUA 2J7HA 4JFTA 2BXYA 1QI4A 4Z2GA 1WZAA 1VBRA 1JAKA 3N9KA 4OOUA 1UD8A 1JDCA 1BVNP 3OLIA 1E6SM 2J62A 3VIOA 4HOZA 3WDJA 1ZL1A 3VSUA 1JZ4A 3SUVA 1SZNA 2FGLA 2Y24A 2RGLA 3O6AA 1XCWA 1KQZA 3BAYA 5D9OA 1MW3A 2XVGA 3WEMA 5A8MA 2VX4A 4Z2KA 2BHYA 4B9ZA 4DWSB 4MDPA 3WD4A 3CUHA 4MB4A 2VVNA 2G41A 2VCBA 3N18A 2PBGA 4GQQA 3ALFA 5M17A 4MAVA 2WMHA 2ZIDA 1QBAA 4HU0A 2DPEA 2CEQA 4WJXA 3DDFA 4D6HA 1GOMA 1M03A 2F8QA 3D51A 2G3MA 4JFWA 1KWKA 3NYDA 4FK9A 4HP5A 4B9YA 1GJWA 1ZB5A 2YLLA 5KZ6A 4PMVA 4JCLA 4YHEA 3E1F1 4GO9A 3W38A 3WD1A 3ARTA 5E0FA 1V02E 3SCUA 3DDGA 5M5DA 4CGTA 1GNXA 3VD9A 4M82A 3ZSSA 3W26A 3D4YA 2CETA 1IT0A 5EBAA 5IDIA 3SUTA 2NT0A 1VB9A 2XTKA 1HJXA 3HG4A 2JFEX 3ZR5A 5I6SA 1E15A 2WNWA 2A3EA 1UR1A 2XFFA 1C91A 4CN1A 1JI1A 2XGIA 5A6JA 3KL3A 2G3JA 4JKKA 1V03A 1XSJA 1YQ2A 2VZVA 3WNMA 2NT1A 5FL0A 3SUUA 2O9OA 3UESA 2WLZA 1LLOA 4JKLA 3CHDA 2W91A 2BVDA 2ZUTA 3T0AA 3QGVA 2QHAA 4B3LA 1NP0A 4P8WA 1JZ6A 1V6XA 1NWTA 3VGBA 1FH9A 1B0IA 1RH9A 4NRSA 3KLLA 4TOQA 2XSAA 1R75A 2C8NA 6TAAA 1MQRA 3IK2A 2ZX5A 1OGSA 1VFFA 4HZ8A 4MTVA 3VMNA 2YFOA 1NH6A 1EHNA 2CYGA 2PWFA 2VRJA 2DQXA 2GUYA 4MB3A 1CYGA 2VX5A 3HMCA 2XUCA 1N82A 2J7GA 1H0IA 1ZBVA 3A4WA 4H8HA 5ABHA 1UWSA 2J8FA 2PI6A 3ZSTA 1H11A 4S3JA 3WMCA 1BYAA 3CHCA 3AHVA 4A3YA 1DWJM 1E6RA 3U57A 4U2ZA 4CN6A 4TVUA 3MMUA 2WHLA 5EFFA 4W5ZA 3U7BA 1HVQA 2V5DA 2XM1A 4HA1A 4OBSA 2WC3A 4ZENA 2XGBA 1HJWA 3KE0A 1MQQA 4MJ4A 3CZEA 5JUVA 1E70M 4D6CA 1TQTA 1GONA 7CGTA 2W61A 4FNPA 4Q22A 3WNNA 2D3LA 2J7CA 3QOKA 4U5IA 3MU7A 1C93A 1V6YA 1AQ0A 1R8LA 4PMXA 5GQBA 1WDSA 1R47A 3IJ9A 3A21A 4HOXA 1EH9A 1WP6A 3MMDA 4UOZA 4CCDA 3L2LA 2A3BA 2DEPA 3PTMA 3AHYA 4E2OA 1WPCA 2XJ7A 4AMXA 4IPNB 1V08A 5CGTA 1PX8A 4H8UA 1OGGA 2F7PA 4V27A 1VEMA 2DT3A 2AAAA 3KL0A 2WK2A 3D4ZA 1BG9A 1ZU8A 3VDCA 2VZOA 1MW0A 1C7TA 4NXSA 4B16A 2DIEA 3DX4A 3VGEA 4P8UA 3UETA 3CUIA 1C90A 3G6MA 5CJ5A 2B31A 5CSYA 1AQHA 4UFLA 1QHPA 3WY4A 3WELA 2V5CA 3ARQA 4W7UA 1SMDA 2EXOA 1J0KA 1UQZA 3IANA 3EMZA 3BUQA 3A23A 1VF8A 3ARYA 3AJ7A 1KCLA 1V02A 3KZSA 2WSKA 1JF5A 1UR2A 1CGWA 3NDZA 4W8BA 1UR4A 4C7FA 3VSVA 3OB8A 1PX3A 4M29A 2VQUA 1UASA 2DT1A 1HWWA 1GOOA 4KH2A 1KTCA 5BXTA 4DUWA 1UWQA 2CHOA 4UQDA 2EAEA 4AYSA 3NCOA 1PJ9A 4FNRA 5ABFA 3CH9A 1HL9A 1QNPA 1ITCA 5CPQA 1KBBA 1KWGA 3DX3A 4UOJA 1UKQA 1TFVA 1M01A 1GQJA 2E8YA 1TMQA 4RE3A 1ISWA 1CPUA 2J7BA 1BSIA 3KL5A 1MW2A 3RCNA 3PZTA 4Y7EA 1KCKA 2BVTA 2XN2A 4GINA 2UY2A 3A4AA 4X0VA 4AXNA 4P7RA 1I1WA 3OG2A 3WH5A 1IZJA 1TCMA 3HG5A 2JF6A 3VPLA 4MPKA 3IJ7A 1C3FA 1K9FA 1Y7VA 1H5VA 2GJRA 3B9DA 1UOKA 4PCSA 2EABA 2EPMX 4D71A 4D6FA 3CMGA 3QR3A 3LPGA 1CWYA 3EJRA 1PBGA 5ECUA 4LX4A 1X6LA 3BAJA 1I75A 4H2CA 2QPUA 3LX9A 4U5KA 4NF7A 1HP5A 1KBKA 1VJSA 3VKKA 2BFGA 5A2AA 2VX7A 4JL2A 3DHUA 2WHKA 3OZOA 1GVYA 1R85A 3OLGA 4YN5A 2YL5A 5C70A 3WF0A 2J74A 3WQ8A 2OWXA 3DX0A 4AMWA 1KXQA 4JKMA 1BAGA 3NUKA 1E6PA 1LL7A 2VTFA 3MV11 4J27A 2JEPA 1CXFA 3EJSA 2O92A 3WF3A 2D1ZA 2E4TA 1RP8A 3BCDA 2E8ZA 1B31A 1EHAA 4UQCA 2IXVA 4QLKA 1V3KA 4PTMA 5ABEA 3NSMA 1NM9A 2CNCA 1W1VA 2J47A 3FNDA 1XHGA 1HJVA 2EACA 5E6ZA 1GPFA 1QI3A 3RM4A 2V3DA 3AXIA 5BWFA 1QW8A 1QHZA 3THDA 4CN4A 5BXPA 1JYNA 1VRXA 3DYMA 3CC1A 2FH6A 2ZUNA 3ARUA 1FHDA 4EAMA 2WVTA 5TD4A 3WUFA 4J3WA 1W9XA 2WANA 3GYCA 1UUQA 3WFLA 2G3IA 4HMCA 1QNSA 3VDBA 3W81A 1GVIA 3VNZA 3FN9A 1ZJBA 1QW9A 3RM9A 3TA9A 1J11A 4FLOA 1JXJA 1K9EA 1CXKA 3WF4A 3AZRA 3N11A 2J77A 5A8QA 2OYMA 3OZPA 1W2PA 1NOWA 4AD1A 5E6YA 4P7NA 1O7DC 3BLKA 3GBEA 3F5LA 1PX4A 2BY2A 3WNKA 5HBFA 2F1BA 3AZTA 1ECEA 3WEOA 1CGUA 1OM0A 2CHNA 2JE8A 3T09A 5A69A 1PIGA 5CGMA 3B9AA 1CTNA 3SCRA 3NSXA 4AIOA 2YJQA 4RE4A 4PBGA 1JXKA 1GQIA 4D1JA 3POCA 3RDKA 2XIIA 3UG3A 9CGTA 1VFMA 4ACZB 3UR8A 1OT2A 3AMKA 3G6LA 5IXEA 1DEDA 2PB1A 1OD8A 1DWFM 1E4LA 1QPKA 4F9DA 1ITXA 5A6MA 1V0NA 1UD2A 4UCFA 1H1NA 2OSYA 7TAAA 4AIEA 3SIMA 2JIEA 3VM7A 4PTVA 4WSKA 4HPHA 1G0CA 4WKHA 4ATLA 1GHSA 1UD5A 4GZIA 4DUXA 5A6KA 4HPGA 3ZJ6A 2JF7A 2BY1A 3SCNA 1XYZA 5HNNA 4XV0A 4X9YA 1JL8A 5GPRA 4DWSC 1MQPA 4HTYA 4C7GA 3SCWA 3LMYA 2ZOXA 1LQ0A 2D0HA 3AQUA 4PSPA 1CLXA 1GHRA 3I3EA 2VCAA 1BLIA 3GM8A 3N1AA 1U33A 4OZOA 3BUIA 1Q6CA 1E6XM 3ZT7A 4LGXA 2O9RA 1E4NA 2VRQA 3OGSA 4UNIA 4P7LA 1H3GA 2ESCA 3FXYA 1WO2A 5LA0A 3OBAA 1TUXA 4WKAA 3W37A 3A4XA 3AYRA 4PTWA 3WENA 1JIBA 1B90A 1MYRA 4TTUA 4ML4A 1QVBA 4L4OA 3ECQA 4OKDA 4ZEPA 4W88A 1JZ2A 4ATWA 3AIBA 4P7QA 4D6GA 2CERA 3GDBA 3WDIA 1E4MM 2JALA 3VGHA 3GNRA 1PEZA 2E9LA 2GDVA 3W53A 3H53A 3VDAA 3WQWA 3AHTA 5A8OA 1W1PA 1JDDA 3ZMRA 4XB3A 1JYWA 1UR0A 3AFBA 2ZX9A 1EXPA 4DM1A 5CPTA 3O2LA 4UFHA 2EPNA 1QNRA 3QHOA 1XV8A 5FIPA 1NWUA 5AC5A 5HPOA 3WY1A 5ABGA 5IHSA 2WXDM 4ATDA 3APGA 3AXXA 3WNLA 4PMNA 1S46A 1UHVA 3MUAA 5M03A 1M04A 1IZKA 2ZUMA 2DGAA 2JIWA 1CDGA 3MKKA 3UEQA 3BC9A 1JG9A 1E6NA 1O6IA 3WF1A 3L4VA 2GK1A 3BAWA 2VOTA 4TX8A 2E40A 2O9PA 1J0JA 4ZXOA 3BAKA 2VT0A 3B9EA 3CO4A 4PN2A 1GZJA 1JFXA 2YL9A 1EDQA 5AYIA 2XM2A 5JBFA 3TP4A 1W91A 2VX6A 1VFOA 3U5UA 5FKYA 2EADA 4GXPA 1KGWA 4UQEA 1W9PA 1G5AA 4FLRA 5HDRA 1UR9A 1M53A 3HJEA 2FHFA 4HZ7A 4DWSD 2WSPA 2WMIB 3FAWA 2FDMA 3W4RA 1EO5A 3U5YA 4IM4A 3BGAA 1UH4A 3LXAA 4AISA 1TQSA 3T0DA 3EMQA 1HT6A 4ZE4A 4ACYA 1AVAA 3AOFA 2E9BA 2CPUA 3BVVA 2ZXQA 4GI8A 1WCGA 3VIKA 3AS0A 1GOWA 3CMJA 3BAXA 4LYRA 1CZ1A 4PMUA 3WFZA 4DWSA 5FOOA 2OW6A 2DSVA 4CD5A 2YA1A 1C7SA 3PTKA 3N17A 3AYSA 3CZGA 3M6DA 4QCEA 3BSGA 3IJ8A 5LA2A 4AZIA 3PHAA 5D9PA 1DHKA 4NZFA 5HOSA 3EJUA 1HVXA 3VTRA 2J75A 3VM5A 4M56A 3L4XA 4ZFMA 3S2CA 1MW1A 1QNQA 5IFPA 3VDHA 5CLWA 2G4FA 2YLAA 4N0RA 3AMDA 4U31A 1K6AA 1G94A 3H54A 1CEOA 3S5ZA 4WSJA 3L4TA 1GORA 1E6ZA 1VAHA 3SURA 3LRMA 4HZ6A 3W24A 3VD7A 1W3HA 3WQ6A 1E4IA 4BQ3A 1FFQA 5AY7A 5E9AA 2A3AA 3PZ9A 4AY1A 1HKMA 2VUYA 2IXUA 1B2YA 1E9LA 7A3HA 1W32A 3VU2A 1HXKA 2XVKA 4JIEA 1HP4A 3VILA 2DH3A 2ZUWA 1B1YA 3CGTA 1QI5A 4PMQA 1XCXA 4NSBA 3AXHA 3WL1A 1H0GA 2WBGA 3ZJ7A 5A8NA 1Q4NX 1OINA 3AS1A 2J7DA 3AHXA 4BZYA 1DWGM 3OGRA 4CVUA 3EDDA 3GXNA 5A6SA 4HMEA 1QWUA 2GDUA 4E4PA 3HG2A 2E3ZA 4MB5A 4AZ7A 3TTQA 2BHUA 3GZAA 3KEHA 5CQ1A 1E72M 4AWEA 1D3CA 4W87A 1QBBA 2DT2A 1VIWA 4JFUA 3BXWA 5EB8A 2VC9A 4MDOA 2W63A 3FHQA 4W85A 1W3JA 1HN1A 4CU6A 3L4YA 3MV01 1LJYA 4W86A 1TVNA 2EJ1A 4ZE5A 4BA0A 1LF1A 4KMQA 1UKPA 1CLVA 3AMCA 1BYCA 3AS2A 1C8YA 2J78A 3MMWA 4UQBA 3WY3A 3NDYA 5M3WA 4J28A 2FE0A 3IGUA 1V0KA 3SCVA 4FLQA 3K4AA 4J3SA 1UD6A 5I2UA 1TA3B 4Z2LA 3EDKA 3W82A 5I23A 4FF5A 3OIHA 1CGXA 1HIZA 3T2PA 3HZ3A 2BY0A 4NRRA 4J3TA 1XSIA 3AIWA 2Z1KA 3MS8A 4AD4A 4GI6A 4EK7A 2QMJA 4OIFA 4R27A 1V3MA 3U7VA 3PZNA 1EIBA 1O7AA 2BHZA 4CVWA 3WMSA 2YDSA 1UWIA 2DH2A 1JD9A 1B3VA 4HMDA 1J18A 2EBNA 1R33A 3VIIA 4AD0A 4E8CA 4PTXA 4B15A 2F2HA 1HJQA 3VGDA 1MFVA 3OLDA 1XRVA 4CU8A 3A22A 3K46A 2EPOA 3F5KA 1TA3A 2D23A 2YFNA 2Y2WA 2ZICA 2FHCA 1G01A 4NZCA 5AYBA 4MNJA 2XG9A 2YOCA 3WDHA 2AOSA 3POHA 4WLCA 2WBKA 3O9NA 4BF7A 5E09A 2NW0A 1WE5A 2RGMA 1PIFA 5DMYA 4MB1A 1J12A 3D52A 4HA3A 3VMPA 1ZJAA 4M24A 1UA7A 1H41A 2AMGA 1GJUA 2WKLA 1E40A 2YBUA 1A3HA 2VI0A 3PTQA 4GKLA 2WCSA 1E5NA 1OSEA 3ARVA 4D6JA 2QLYA 5A3HA 3WH8A 2YBTA 1A47A 2UY4A 1CENA 3F4VA 4RL3A 1PPIA 4M80A 1MWOA 2WCGA 3GXDA 5F7UA 3RMEA 2IGTA 2ZUUA 2WHMA 3PZQA 1CXLA 2VCCA 1DWIM 3I3BA 3CUFA 1J10A 2FGZA 1C92A 5FCZA 3M07A 4KWUA 4UQAA 3BAIA 4DO5A 4JCMA 4UFJA 2WW5A 1BF2A 1R46A 1HKIA 4AD5A 2YKKA 1Z32X 1ODUA 1FP8A 1ISYA 2DT0A 5A2BA 1W2VA 3T08A 1ZS2A 2YDRA 1KXVA 3MUY1 2YL8A 5D8WA 1J0HA 3W29A 1VJZA 4Z2IA 1KGUA 2GSJA 4EE9A 3WH6A 2WCAA 2YL6A 1KR0A 3S5YA 2VR4A 5CLTA 3OLEA 3CBWA 5D8ZA 1HX0A 1NWRA 4CD4A 4UFKA 2X2HA 1T0OA 2F7OA 1KFWA 5DT7A 3WD0A 3SCSA 4QLJA 1UG6A 4HA4A 1LWJA 3AIUA 2XWEA 3M46A 1CXEA 3GH4A 4TX6A 1LG1A 2CXGA 3ZJ8A 2WC4A 3I3DA 4PMYA 4BQ4A 3KLKA 1EQCA 1TZ7A 2ZX8A 4TVDA 1ODZA 1AQMA 1HF6A 1GOIA 5DEZA 1VBUA
chains in the Genus database with same CATH superfamily
3TTOA 1KNWA 2BCMA 4Q74A 3P5YA 4R2GD 4A2HA 2PYEE 1BZ7B 2Y5EA 3AIQA 1DIKA 2P53A 1IEBA 3QDGE 4LVNB 4NQEA 3TLLA 4GRWB 1G1YA 5C07A 5T1MA 1W5MA 2X1IA 4MWFA 3HRZB 4OECA 4AEIH 3BEVA 5M1TA 5IOBA 3BN3B 2D7TL 4XXDB 3VX1A 1RK1A 3ML8A 1U41A 3NAAH 1AACA 3RY6C 5I73B 4IYKA 4PJHA 1KTRL 5J6SA 1MVFA 2OMUB 1J8HE 3IN0A 3VD5A 1LQSR 2CZFA 3FUKA 5C09D 3T3ME 4BI5A 3UBXB 5KZMA 1R3RA 1QLEL 3IU4L 3HIJA 1IXPA 1BPVA 2YD7A 1QI0A 5C86A 1XW8A 4D72A 3MY9A 2ZOUA 2QV4A 4J23A 4CNTA 3ALXA 3GSVA 1TPB1 3UO8B 1IU1A 4G1NA 4V1DA 4PEEA 2OW7A 1TCDA 2Y06L 3OHMB 4CQBA 1FHNA 4TTDC 3G08A 4HOWA 2P44B 4R96B 1HL4A 1V6VA 2EPLX 4NXKA 2VXTH 4BUHA 1DBJH 3CFIC 1OM3H 4E9VA 4PRPE 5HULA 3C2SA 4R85A 4HQVA 2OLHA 5E56A 2R4SL 1M71A 3QDGD 1OQFA 1RPKA 4LYQA 4QMEA 3VIGA 4K8HA 2EZ0D 4LNCA 5K9KA 5GJTL 3T2NH 4WIQA 3R06A 1BEXA 2JJWA 5HHOB 2H6UA 2C5DC 3B37A 1IC5H 4JKWA 2LHAA 2FLIA 4LEOA 1EOKA 1SZEA 4P0DA 1J8HD 3PHOA 4MYAA 3VQ2C 3LKQB 2YXVA 1BZDA 4QTFA 1QQDB 3MBEB 3APYA 1NINA 2PN5A 1VEOA 4LCVA 4YFLF 3EJQA 1MCWM 4HC1H 4OQTH 5F71A 2HRPH 1Q6GA 1AIFA 3LTPA 3SDDA 4I2XA 3DGGB 2E46A 2OELA 4BSJA 2CO6A 4HHAB 2A7BA 1T5WB 5D93C 3PXJA 2AQOA 1G6RL 4XMTA 2P5EE 1BPLB 4LLUB 2D7PA 2DIBA 3S6CA 3ZR6A 3ZHLA 2Y36L 2DLEA 4DF2A 1Q2SA 4XBPB 3WIHL 1W6WA 3KBSA 4PN6A 4L37B 2DWYA 4LSQH 2ALRA 2YKLH 5GGSY 4Z2HA 1VQTA 1NCTA 1O66A 5F1NA 2ENSA 2CCRA 2HVKA 3GKAA 4S39A 1W3KA 1XCFA 1SYVB 2IPKA 1IXNA 1LWRA 4LU5H 1AGCB 3FT4B 3DTUB 4XCEA 1AXTH 3AIVA 1H15B 5LYRA 5F7BA 1M05B 4JPWL 1RLBA 4OQTA 3UTOA 2J25A 4NX0A 4ZSOA 4HCRH 3VOJA 2YEZA 2CA4A 3MFFB 1JDEA 4TYUA 3VUPA 3HGSA 3KNBA 2IF7A 1DQDL 4PTDA 2E7CA 1U58B 1WA2X 4G9FB 5EEXA 3TBYB 2ENJA 1BMZA 1XX1A 1KIPB 3K1DA 1TE1A 3QEGL 1E5UI 2KZBA 3IFNL 4K8RH 2HJLA 3UBHA 5DT5A 4ZQCA 3R89A 4YQXL 1YEDB 3LVTA 1A64A 1QSED 4HZLA 1UWRA 43CAA 1I2QA 3GG8A 1FQ0A 4L8BB 3CN0A 1YY9C 3LHUA 3V9CA 3PGFH 2V67A 2PWEA 5GZND 2ENQA 3V0VA 3WYZA 4CU7A 4Z76A 2XXCB 4R4FL 2W95A 4QP0A 1MVYA 1OK0A 3RVXD 5EUOB 1JXGA 4LLDB 4Y1SA 2C9SA 4RSYA 4D0DB 1ZDQA 1GOXA 1RUPL 4UT9L 1FJ1A 1MHPL 2X16A 4PUDA 2N1KA 2Q3XA 3SDCA 1UD3A 4DIAA 1QOQA 3I6LE 4OVVA 3EF7A 5KYYB 3UZEA 4AW7A 3TJIA 4TQTA 2HKFL 4HQQL 4F9PC 4RWYL 2DJMA 2IW0A 5AB1A 4KC3B 5FC9A 1Y0EA 1K9TA 1L6XA 3TWCL 4QO1A 2W80C 2XG5B 4NQXB 3LZ5A 4YDLC 5DVKA 5TQ0L 4NZDA 4K7PX 3P54A 2GLKA 2C7FA 4ZFZA 1Q6EA 4LLVB 2FQDA 4BKSC 5GGVL 3WD2A 4PLNC 3MV8D 3KH3A 3BLPX 4AZUA 3GVGA 2W81C 1QK0A 3MRNA 4Q6KA 4WI3A 3PV7A 5MENE 3DXAE 5CXPA 1F8TL 2BP3A 1AY1H 3M1BB 3DETC 4R3SA 5IKCB 5KSBE 5C0FA 2HH0L 4OSUH 3STGA 4YFEA 3BTNA 1BWVA 2LVCA 3NL3A 4JEGB 1US0A 3R8GA 2OV0A 2WLYA 4JTTA 3NVTA 1XEUA 3FCPA 4D6DA 4RDZA 4PTNA 5BRPA 1DP0A 3ABLB 1GTHA 2FX7H 4MNHB 5BVPL 1AFSA 1FBIH 1OARL 1LLWA 1LO2L 3K0YA 1V0LA 3NZ8A 3S6DA 4JS7A 4U3SB 5HVHB 4PGBB 4G8GD 4UM9B 5DD5H 1CGYA 4PJIF 2FWSA 1R4XA 3V4PA 1PL9A 5IR1A 3F62A 3MCNA 3OKLB 1XLJA 1S2AA 5KW9L 5L2JB 1T1XB 2BGNE 5AVWB 3KM2A 3A5FA 1XYCA 3GMOA 1W6TA 2R4RL 1GMIA 4DKTA 3TSBA 5D02A 1V3JA 1FG2A 1PU0A 2Z1WA 3AMLA 3TBBA 4ODBD 5C0AA 2Q1EA 3CPLA 5I17A 3W2DL 1I8KA 1KFJA 5MEND 1HINL 5A1AA 2FATL 1UZ1A 2MH4A 5XINA 5LAXB 2P48B 3P69A 3KLAB 3JSSA 2ERJC 2NLYA 2HLEB 4KMLB 4DOHB 2CCLA 4NHCH 3IFLL 4UTTA 5EIQA 3GI8H 1GW1A 1DWHM 2VW6A 5HMDA 4JJ5B 2YARA 2DIJA 3L4UA 1LE9A 1VPOH 5GGQH 5AOMA 1K3ZA 3M0KA 2MRYA 1QUNA 2GTQA 2H2SD 3MRMA 4XP5L 1JDCA 1HWHB 2HG5A 3OLIA 2EXYC 3GEWB 1AG0A 3M0IA 5T26A 5DD0L 1L9SA 5IVZA 4U6YA 3N6QA 4YHZL 4UV4H 1YHPA 1ZLWH 1GCFA 2F8XC 4LGPB 3FB8A 2WW8A 2QTEA 5DD1H 1M03A 3O0KA 5EGRA 5EU6A 3LEXB 1LD9A 4DGYL 4Z42C 4HDIB 2YLLA 2IANE 2WLJA 4HGWA 1AZUA 3AG1B 2BLFA 2OLSA 1TWZA 3E1F1 3BG3A 5FI8A 1G6RB 5AB0A 4P59L 4AJWA 1IT0A 3BQ5A 4LSTH 4LDCA 3GHTA 4DK6A 1C91A 1S7SB 1P1MA 2PF8A 1PNCA 1U8LA 1H5BB 3B2PA 5CSZB 1R3VA 3P0YH 3FCTA 2RDXA 1HGWA 2QL1A 2LU3A 2OP4H 4RKAA 2L5HA 3ZX1A 4IKJA 1P69B 2GJ6E 2WIIB 4UIOA 4S23A 3MA9L 5J89A 5C8JA 2YFOA 1W0VB 2VRJA 4HSAC 4NUPA 2F6AA 3QXAB 5J13C 2DLGA 5FPIA 2CGYA 3NG5A 1P4CA 3OQ3B 1YPZE 5ABHA 3M44A 2H1PL 4XCFL 4PJIA 1KB5H 3AREB 3AHVA 4ZYKA 1F8MA 3JYBA 4N0YH 4NQSB 4HA1A 1VADA 4RGNE 4YNYA 4YS1A 2WNKA 1HCVA 4OD1L 1NPJA 2IG2H 3CZEA 3DI3B 1FRGH 5DJYA 5H35B 1OQOA 5E6IB 1A6ZB 4WFEE 4FNPA 4HJWA 4HMNA 2J7CA 1IBZA 3VFLA 3G6JF 4UU9B 1R47A 5JW5A 3DSFL 4ZR8A 1NSJA 1Q0YL 1F6AB 1UEMA 2IAND 2E6DA 4K15A 5JZ7D 1ZLWK 2F7PA 2AAAA 1A7NL 3TO4C 4A3QA 4S2BA 4B16A 4DLMA 3LN4A 3CD4A 3IDGA 4Q8UA 2PYFA 5CJ5A 3MRLA 2R1MA 4LVEA 4X8GA 4X3ZA 5DDHA 3WY4A 1ZE3H 2DYSB 4TV3A 4H0LC 3LEYL 4QRRB 2COQA 2E9GA 3DKHA 4HUXB 3VSVA 3C0LA 1CQKA 1PX3A 4OGYH 1I8JA 1IEWA 2NY3C 3I2CH 1G7IA 5ICZA 1BJ1J 2BSRA 1UXMA 5D1ZB 1HL9A 4OCRH 4AFYA 1P5BA 2E25A 1TMQA 4DVOA 3KL5A 1MW2A 1KB5A 3TCXA 2CLVB 4M6ML 3WI9A 2CA3A 2C4FT 2HJFA 1MJJA 5EU4A 1I1WA 4ZTOL 3CB8A 4WUUE 4D9PA 4PCSA 1U6AH 3V1HA 3HS9A 1PBGA 4ZAKA 2A2QT 3CFCL 3MGOB 1I75A 5CN2A 3D34A 4NF7A 5F7KC 4OR1A 4TRPL 4LW7A 3CVIL 1QTWA 4WFED 2YL5A 2I9TB 4HHLA 1QRQA 4KXDA 1CC3A 4M6AA 4FXTA 1W2KT 3AABA 2D1ZA 3WIIL 2IQAB 2PCFB 4TUUA 3TQ0A 5SWQB 4A7GF 4O19A 1W1VA 4MKTA 1EEQA 4JZNB 1GPFA 2WJ5A 3QDJD 1KT2A 1TO4A 3MLXL 2KKQA 1JHTA 4ELDA 5HVWA 1SJHA 3VNZA 4WHYH 5GGRB 1K4DA 3RX4A 4TSAL 4QD2E 1W2PA 3ZDYE 4L0YA 1FGVH 3VXSA 1H51A 1OM0A 2UZYA 3WKMH 3TW7A 4A38A 4LE8A 4U10A 4G7EB 4HKZB 4RE4A 3VWJC 3KS5A 3GSOA 1H8OA 1N4XL 4NO2B 9CGTA 5L9DL 4ACZB 1UB3A 3M0XA 4QHNA 4HLZG 4F9LA 5L2KA 1J5IA 1KFCA 2H6PB 3WG7B 4MWAD 1AZZC 5LZLA 4WUKH 1F4XH 3VM7A 1YECL 4JLRB 4ALDA 1G0CA 4PP1D 4D0BB 4PTTB 4WU7A 5FF0A 3DC8A 3FO1A 3DBNA 2YGYA 4YHMH 2N4IA 5E99H 4UT7L 4WWKA 1CWVA 1P0BA 1D7DA 4JRWA 4AC4A 4A6YL 1JNLL 2YXXA 1EJOL 1U3NA 4YHYC 3OKEA 4NWUL 4Y5XC 1NBVL 3H2EA 4DJEA 3FULA 1Q6CA 5E4IA 4AUUA 1JCTA 1SOQA 3CFBB 4GOSA 2CK2A 3B9KD 3HE6A 3W37A 3V5KA 3F58H 5C0BE 2PTWA 5DHEA 4FABL 1Q9KB 4W88A 2RJMA 3QR1A 4P7QA 4XT1C 1Y0LB 1PAZA 5D1XB 3O11B 3W7CA 5A8OA 2Z91A 1RAMA 4O1DA 2AV7B 1OK8A 2APBA 4QT5A 1JMXA 1J6PA 4MA1B 3VXMA 4ATDA 5AL0A 1XCQB 3WNLA 4IEFB 4E2VA 2N7BA 3O9WD 4XVTL 2QCDB 2QQNH 3UEQA 2NUTA 4KIEA 3BAWA 4QHLB 4YDKL 3BZDA 1E6JL 3BVNA 4LMQI 3IYLW 3EA1A 1IX2A 5HQEA 4YFLI 3T8QA 4A7GA 5H8MA 2BSTA 3ULVF 2ICWB 2A9MH 4WO4C 3GKFA 1I3GH 3CDCA 2WMIB 5IMOB 3S9IA 2ZFAA 1HH6B 2WQ8A 3G0SA 1LM1A 5FF6A 3EG9A 2OR9L 2YSSA 3BIAX 3AALA 4AJVA 2ATSA 1D6EB 1IGYA 1Z42A 2WP3T 1GXEA 4TSCH 2F74B 3XIMA 2WJZA 3KGTA 3WE6A 3AYSA 3HC0B 3IJ6A 3H2QA 1T7ZA 5HOSA 1SYSA 3LHWA 4FX5A 1U83A 1W72L 4PGCB 4Z3JA 4U31A 4BRVA 1M42A 1S7TB 4PUWA 3SURA 1HI6B 3CXFA 3V9EA 1AXSB 2WLLA 2F19L 3JZ7A 1WYJA 1QFOA 1AAJA 1U8OB 4BFFA 1HJCA 1SO3A 5JOFA 1JRHI 2DZAA 4PMQA 3T2LA 4WENB 2WBGA 3ZJ7A 2Q10A 4HG4K 4EF3A 3QO1A 4XNZB 4LHJB 5F3FA 5CJQH 3ULVH 4OZIB 3N40F 4R7WA 2CDEB 4J4PD 3M47A 1PKLA 2J88L 4JFZL 4ZE5A 2VLME 2PLTA 4XP4L 2V5TA 3MJMA 3AS2A 1T89C 5D5MA 3GB6A 3LS4H 3MRHA 5GRXG 3IXAA 1SXBA 2WN2A 3CHVA 4E42B 3PYCA 3T2PA 3HZ3A 2J4WH 1IC0A 4IRZA 4XMUA 1PZCA 3MS8A 2E67A 2HXAA 4CNUA 5B22A 3QLDA 4X9BA 5JH2A 2PKDA 1O7AA 3B56A 4E8GA 1BEUA 2EBNA 3MCYA 4R97C 3E6HB 2WSQA 5ALBL 3WTTA 1I1AD 3QFWA 4BHUA 3ATZA 2APVA 4DAGH 1G01A 3AT0A 3S9YA 2F58L 4EF8A 2VLJE 3T05A 1VIZA 3POHA 3XISA 1W0YT 1ZD6A 1KB9J 3U6RA 3MU3A 2X88A 1R3LB 3QCTL 3TJ4A 1Z3RA 4PJCE 4ZMWA 4PB3A 3C5ZC 4HA3A 3VMPA 5K33A 2YX0A 3PTQA 4L23A 4F93B 1ZLVH 4L1HA 7XIMA 2UY4A 1CENA 3BZ4B 2NY1B 2V5LA 2P1YA 4M8QB 2NY4C 1F6LL 1DJWA 4GRLB 4GBXB 4XMVA 5LG1A 2JGQA 1FXPA 5EU7C 4PJ7A 3CU7A 5ANMA 3MXWL 3FONB 1PYWA 5EBMB 2OU4A 3MA7B 3GSUB 3MJ9A 2CLPA 1UFUA 3SDAC 2LE9A 2JKNA 1J0HA 3RDTB 3LYRA 2J8OA 3RP1A 5HR7A 1CJYA 3EPMA 2UZXB 2NZ9D 2VLKD 4A8RA 3NJIA 3AVEA 2RDTA 1FVDA 1AZ2A 2ESVB 1EXBA 5IT2L 3R58A 3UTSE 4I3SH 2A7NA 3M46A 1XQLA 5JO5B 1JZDC 4ZS6C 4O0KA 5FYLH 4PMYA 3W1NA 4QITA 2XWTB 5ITBH 4EAEA 4NRXB 4XMPH 1TQWA 1EXHA 1PGRB 3ANVA 5L6YL 4LV9A 2O9TA 3HG1A 3VKBA 1JK8A 5REQA 2GTWA 4GS7C 1YX1A 2D9CA 3BLBA 2F7RA 1NF0A 1WCBA 1YQVL 5F6HJ 2DQIL 4ZMQA 5DQJA 1C29A 3U0PB 3HFTA 2WWOA 5C0CE 4RV8A 2PR4H 2EECA 1KLYA 3IIOA 4O51B 4ZXLA 1BM3H 4IP5A 3TV8A 4A6YB 3W39B 3OJDB 1TEGA 1PKQB 1BG4A 1DANT 4LY8A 4RMRA 4GP5B 2WNQA 2Q3OA 3D2UA 2GJZA 4XMZA 1AMXA 3ITLA 4OLUL 1ETB1 1ZLVK 4NT0A 3KDMA 3KVKA 2TAAA 1RZGA 5KSUB 5T3ZD 4I13B 4D9LL 4R6UA 1GAFL 3FCUB 4EXKA 5TH2B 2ED6A 3RM8A 3U2IA 2IBBA 1QFWH 3RU8H 1CXHA 2OI9B 3QEHA 5E8DH 2PFHA 1DVFC 4DXKA 1RUAL 1PY9A 4XN2A 4AEFA 1AMYA 3MSYA 3UTSD 4NQDD 4IX2A 5I0VA 3UJEA 2W67A 5CEYB 2VM4A 3GGWA 3HZMB 2GYIA 1LBLA 4AW4A 2EP6A 5DXXA 4MYXA 1N70A 2XJLA 1E8YA 2PCPB 2WNNA 3Q2VA 5HGHB 5K9JL 4PIRF 5DVPA 4RRPA 3OAUH 1HCYA 4M7LL 4XZUB 2ZZ2A 3AISA 5HYSG 1AG1O 3BQUD 3TA6A 3IRZA 4MDJB 4IW4C 3QQ0A 2G3FA 5CC7A 3QIBC 4Y2OA 4LDEB 2EE2A 4CMHB 5C0CD 5GNZA 2WO2B 4RMTA 1B6DA 1TPEA 1J88A 3GBNH 4U1GC 3WTYA 4QFUA 1NEZG 4HHPA 4GH3A 3T1FA 3B05A 5JORA 4NKDB 2C0HA 2O6DA 4F79A 3FHAA 4RW3A 3QXTA 1S7XA 5T8GA 1M2VA 2HP4A 3L3OC 1ZGLM 4LASH 3BQ6A 3BSHA 2HVJB 4KQ4L 2ZP8A 2G5UA 5CCKL 4KUCF 3CMOL 3ZTNL 1S5WA 3WK3A 2UUDH 5L4IA 4QYAA 4MLJA 5GJNA 3QZMA 1XR8B 2A7PA 4FERA 1YMHA 3QZLA 2HFFA 1OP5H 4CSSA 5D96B 2H32H 1WYIA 4IP4A 4ZZ9A 1IVTA 1IT7A 4J8QA 1HS6A 4MNMA 3CUZA 1IXQA 4BFIA 2V0TA 3ASOB 3KWUA 3ORWA 3PAJA 3GXPA 2PTVA 1OZQA 3VMOA 5I1KL 1YMMB 1E0TA 1P1XA 4MPQA 1A7RH 2CO7B 2Q3AA 4U1MB 3BV4A 4B96A 4NL1A 3L9EA 4ES8A 1LBMA 4YBLB 4ZMLA 1DBML 3ISRA 3UABA 1IAKA 4NQCD 3PFUA 2YA2A 3LQAH 3KAAA 3PHQA 3IDXL 2GBAA 5FLUA 3FDWA 4GGBA 5LNRA 1ZVHA 4R26H 3OKDB 4RA0C 1WZKA 1C1EL 2EEXA 1XIFA 5C0IA 1ZANH 4KK5D 4AC1X 5DZOA 5EF0A 1XH2A 1BQCA 3WNOA 4FQ2L 4E9LA 1UH3A 3H9SE 3TYUA 4WTZA 1LOLA 4WO4A 3ZE0E 4KMTH 3M1ZA 5IMLA 1CLYL 1WT5A 2LVEA 4LVOC 1IXOA 2E77A 5E5MB 1W3NA 3LI1A 3M7FB 2A3LA 2ZE0A 4MNGB 1E9YB 5AYUH 3G5XB 4DN4H 2QFRA 3URAA 1RUKH 2UUDK 3PHSA 2HKHL 2XG4B 4L8DB 5EFIB 2AJUL 4MD5B 3L54A 4HS3A 3B0YA 1QUPA 4FL4C 1AH1A 1F11A 2EDBA 3N43B 5C07E 3SCTA 3VB9A 1OP5K 3IDNA 1S7UB 1EZVX 3L0KA 3OX8B 1GTEA 3FQNA 1J87A 1Q7MA 3FN0H 4XPAH 5ACZB 3CE1A 5CGYD 1UWTA 4PJHE 3MUHL 3KTSA 1QA9A 4ECLA 1F3RB 1TV3A 1ID5I 1VBJA 4IKKA 1NWSA 1JGIA 2WQDA 1FHGA 3U9WA 3II1A 4S3EA 2QYGA 3BJLA 2K6ZA 5DHMC 4ENEC 4FHKA 2VMFA 4UWMA 1ONQB 4NQTA 1E5BA 1TTUA 3K2UL 5ABDE 3KCOA 4FTVB 3H9SD 5CEZL 5BOOA 3L1OL 3Q48A 3SQOH 5KBPA 4X98B 4C6QA 3D9AL 1TU2A 3Q1SH 1T1ZB 3IU3B 2CDFB 2OZ4L 3LY6A 5LXVA 2XH0A 4MHHI 5TF1H 1JULA 4N2MA 2VNCA 2XKUA 2F7IA 1HJSA 3LRKA 5T1LA 1BM7A 1PZSA 3CJJA 1KLUB 3EO1B 2CJUH 1KIUA 4WCYL 3EYQD 1KW1A 1XIEA 3R8BB 3HMXH 3HI5H 5HTSA 2NYZA 4G6AC 3ARBB 5AWNH 1R86A 4KO9A 1WNOA 4GRSA 4S2SA 3CDYA 4H9TA 3N15A 3NJMA 2DSZA 5DHXB 4MZRA 4NUQA 3TXAA 4PRAB 2ZUQB 3EGSB 4IRSA 4JM2B 1SHWA 3BVTA 1YYAA 1BIIB 1H1YA 4M93B 4AIZB 1B30A 1I2NA 5IESH 4HWBH 4HSQA 1COBA 1A0CA 1XXFC 3K6FA 5BO1H 3PDGA 4AYFA 3ZTCC 2W5PA 4MJ2A 1T7VA 4Y16D 3HB3C 1D5IL 4JFEE 4S3AA 1X7QB 3WNPA 4HLJA 3THML 2VISA 5DFVD 5B1AB 3NQFA 1NSNL 1VGEL 1U30A 3MACH 4FG2A 2COVD 4DESA 4LAMA 3LZQA 4V11A 1OSZA 2JQZA 4W6XB 4P5TB 4A6GA 3P81A 3LKSA 3WSUA 4ZMYA 3HMXA 2BO0A 5JIKA 3SKJH 1RVFH 5I07A 3DN5A 1FWNA 4A37A 2DLFL 4ODUB 1TJGL 2YC1B 3VNIA 1V3LA 4M62H 3OC5A 4G71B 2V17L 1TR7A 1Z3NA 4JMNA 5DWUH 4BFKA 2FZ9A 1NBQA 2WXOA 3QSKB 3L5LA 5I1JH 3IGKA 2XPGA 3EH2A 3SKOB 4HK7A 1OGAE 3AZSA 3DTXB 3RB7A 3QORB 2ZOTA 2IMNA 4NNYB 4BHUI 1E90A 3DX1A 4PY7A 5ISZA 2BFVL 2XRAH 3DARA 5EIIA 1FNGB 5CBIA 4P5MB 3OC8A 5DZJA 2ITDB 3BWWA 5DK2B 1FNSH 3LB6D 1U1UA 5DHVB 4ZSOE 1LP9A 3VGAB 4IG2A 1XCTA 3GHUA 1I2RA 3Q44A 3UZ5A 1AD9A 3UZWA 1T22B 2WXFA 2BHYA 5JW3H 4MDPA 3CT7A 3N18A 3Q6GL 4HAGA 2J2ZA 3U2OA 4Z7NF 3NZSA 4M8VA 3H3KA 3AG2B 1MFBL 4UV7H 3IMSA 4AKQA 2BVWA 2P8BA 4X7TB 1OCWH 4B5NA 4JCLA 3GJEA 3V5HA 3ARTA 2BIOA 4JKPL 4ANKA 5ESVB 2BK8A 3QZAA 1OQXA 3ZR5A 3C60B 3VKDA 2WP3O 1XF0A 5IVXB 1LQ2A 2O72A 4DW2L 3LHVA 3MZNA 5GZOD 1ETZB 2F2KA 1CIDA 1DVFA 5CEXB 3UESA 3CXHK 2WBJD 5DVLA 1GZGA 4OLWH 4GLEA 3LKPA 3B5HA 1KN2H 3PBMA 4LUYA 1NWTA 4HPYL 4OFQA 4JY4A 8FABA 2IKJA 1OGAD 2ADIB 1TJ0A 5KJRH 4JX0A 1AL7A 1WFJA 2G3XA 1DN0A 1MJ7H 1B9KA 3BPWA 2VX5A 1RZPA 2AJZB 1JGVL 4HTBA 1LZOA 1XEDA 1PG7X 3GY1A 3CHCA 3H4GA 1O5RA 3Q3GA 2OMZB 5I76B 3QIBA 3RWHB 4OBSA 5IFHL 4TF4A 4D6CA 3HJ0A 4PR5B 1D7BA 4U5IA 3EOBA 2WZAA 4HCLA 5F88B 2X0SA 2LU4A 2DQFB 2A3BA 2X6VA 2Q87A 4GIEA 3KPRB 5M2FX 1DCLA 3UF9A 2DT3A 3SQRA 5T3XH 2BMBA 1Y1DA 3T6VA 4QRTA 3BSMA 4PS8A 3BW9B 3KPMA 3L16A 5KSAB 3CUIA 1BRLB 3RA7H 3G5ZA 4RZKA 1AR1C 2PDGA 4BXVA 1LDPH 1X5ZA 3E9TA 3RGVD 4ZXBD 4PMJA 3THAA 5AZUA 4Y19E 3P0VH 5DFWH 5DJZB 3L7RA 4XR8C 5IW6B 5KINA 4AVKA 4Q14A 3Q45A 4XAWH 2XH7A 1GOOA 4P23B 3MGTA 1PMYA 5EB9A 5ABFA 4HWNA 1QNPA 5EA0L 4N5EC 4PR4A 3MRJB 5K1NA 3JVAA 4RFNB 3M0JA 3PZTA 3T77B 3A9BA 2AEPL 3NABH 4GPVA 3UG8A 1S2EA 1PBYA 4N87A 4R0LC 1ZVSB 4X6FA 5DR5H 5J06A 3NDOA 3B9DA 3PWLB 2EABA 1Q1JH 3QPQD 4Y7OC 3U2SB 3LPGA 4XCNA 5C0DB 4U5KA 4TS6A 3U4BL 4JRXD 1NUGA 5IROD 2O5YL 1JUFB 3SQSA 1IWPA 2YPIA 2QJMA 4YN5A 5C70A 2ZXEB 4FQXD 2CM5A 2HN7A 1QYGL 3N50A 4DBSA 3EFDH 3NUKA 3VCLA 3D25A 4P2VA 4C6MA 3RGHA 4OCXH 4L9LB 4G7SB 4R53A 2YJLA 3KCPA 3FQWA 3C5JB 3B43A 1RCYA 4Z3GA 4B90A 3NOYA 4U0RB 1I8MA 4Y19D 4JPKL 1KNOB 5E08L 4YE0A 1V7MH 1J5TA 1F13A 1JTPA 1K6QL 2CLZA 4QAIA 2VC7A 5DSCA 3EOUA 1ENUA 3QC6X 3BPCA 3WNKA 3O06A 2MQGA 3Q2LA 2ZSWA 3UTTD 1ECEA 1S3TC 1KN4H 4RDQG 5E03A 1QSZA 4GJ1A 3SY1A 3QV6A 4M6NH 2X1QA 5AOZA 3FUFA 3POCA 1I7TA 1H1ZA 3CX5K 4Z8FL 2ZKXA 1PKYA 3KW8A 4P9HC 5EU6E 5EZJB 4DKEL 4AIEA 4APXA 5DJDA 3TR9A 2YBRB 3RVWD 4WSKA 2H26B 3WN5B 2DLHA 1KTJA 3QUKB 4R3UA 3U6XA 1WZ1H 4DEFA 2JB6B 5D33A 1XYZA 3EX4A 3DX8A 1FN4A 3REWA 1IKNC 2GT9B 1NC4B 4DWSC 4EZMA 2XFXB 3N1QC 3IIZA 5LGHH 4W4NA 5I28A 3JW7A 2P5WA 2DBJA 4XVOA 4KFOA 1IVLA 1AGDB 5FIEA 2NR6D 4FFVC 4FFWD 4QWWC 3A4XA 1JGEA 4YTQA 3WENA 1MEWA 4AZ8A 3H23A 4ML4A 4JTGA 1SJEB 5CP3A 3EAKA 3FZUD 3GDBA 1ZGLP 2BSBA 4OV5A 4WZ9A 4MY1A 3H53A 5AALA 1YKWA 2WXNA 4PJIE 1FE8H 1SFHA 4AJ0A 3LLFA 1FNLA 4LUJA 1QNRA 43C9A 4Q4KA 3D3VE 3EOSA 1GW0A 2Y1ZA 2FT8A 1ACYL 4BSWA 2PZNA 3ZLFA 2PYED 2L3BA 4UTCA 5CILL 3GTXA 4OGAC 3F03K 2ZUMA 2X1UA 3E8UL 5JMRA 1OP9A 3WO3B 4WJ5B 4AF0A 1O6IA 4HIPA 3W70A 4ZXOA 1C5DB 3LNPA 1GZJA 2YL9A 5EKYA 4AQEB 4TN9A 5AYXA 4LCWB 1B4JL 1W54A 2VR3A 1MREL 1AKJD 1R9FA 1KGWA 4UQEA 3LV5A 3TROA 3LIZH 3SJVB 4CNOA 2FHFA 5DMJB 4ILDA 3CV7A 3BGAA 4A55A 2BASA 3E12A 4HIIB 5FUZL 2FZ3A 1TJRA 4DPPA 2DMKA 3OR6A 4G43A 2R56L 5EEVA 2Z7ZA 1T5AA 2PDIA 2QF7A 5F1IA 3UD6A 1LT7A 3VW3L 2Z64C 4ZGYA 1HZHH 1LEKA 2DN7A 4B92A 2C9VA 4F57H 3I6RA 3UBXG 1PY0A 4DNLA 3BPOC 5C0ND 5E2VL 4P4KB 5FJOA 4B3EA 2H1LM 2Q8AH 2XBZA 1FLTX 1A4LA 5I3JA 4PWKA 4PCFA 4ZFMA 3WLWC 5IFPA 3L1FA 2HX7A 2IPUG 4W4OA 4HNUA 1N5YH 1E7UA 1MHCB 2R0WL 4K94L 5E2WL 4C6PA 5HINA 3AWOA 3D3VD 3RLGA 1E9LA 3IVSA 2CWNA 4PRPD 1PLAA 4G2AA 3DFPA 4RZ4A 3NCFB 1B1YA 4FALA 4FJZA 5BS0E 3WL1A 1VLXA 4I0PD 4M61A 4UNVA 4CVUA 1F3EA 3C0JA 1INEH 1B3OA 2DBLH 1XGUB 3EOYG 2B2XH 2DQJL 1S7WA 1ZKAA 2W0FB 3LIZA 1JZGA 5D2TA 1NMAH 3JV6A 1J7VR 1L7IL 2ODHA 3OAZH 3C8FA 4O14A 3FX4A 3GSQA 4Y4KC 4B60A 4O50A 4PW3A 1V5JA 1E6OL 2OX5B 2OXHA 4I87A 1KV3A 3UIZA 3SFKA 4QHKI 3QZNA 2Z7UA 3NCBB 3WY3A 1FV1B 5H6HA 5IGXH 4B27A 2O6FA 1B0WA 2UZIH 3FFCA 1OAXH 2NSOA 5F8QC 1CGXA 4NRRA 1ADSA 1RIUH 2QMJA 4R27A 4LNRB 3SBRA 1YNKH 4IMKA 2FLRT 3CK0H 1NDWA 2P5ED 4KO6A 4E8CA 3G6JE 5L2KE 5EZOH 1XRVA 3ITGA 3A22A 2X2GA 5CG7A 4ODWA 3F5KA 1PW3A 3WSQH 1TVDA 1DXEA 2FHCA 5ENWB 4TQHA 2XG9A 1EFXA 5BS0D 2VXSH 4GFXA 4EZLA 5DJ8B 1PLBA 4HU2A 3KPOB 3CSFA 1BXCA 3Q05A 4ONOA 1JRHH 5FKAB 2OSLB 2XZAH 4QG8A 1QNZH 2R8SL 3WFCL 4ICMA 3HZKA 5FOBA 4EUPB 2EDTA 2VCCA 1H63A 1K3UA 4DF1A 4KPHH 4GIRA 4NDMA 4WGXA 2X4TA 3TJEL 1FFTB 3VI3B 3I6TA 2VLRA 3P30L 1K8IA 1W2VA 3OAZK 2HLFC 2BSEA 2PURA 4HBCL 2IV9A 3HE7B 1F4WL 3D7PA 3OLEA 4O9HH 1EJ6A 1NWRA 2DF3A 2EIKB 1UP3A 4APQB 3CS2A 3MMEB 3V4PH 3WD0A 2XV3A 5K9CA 2P8MA 2JCCB 3LKOB 3EBIA 3QRLA 3VXME 5F9JB 3ECWA 2YCLA 2AQ1A 4HHGA 4S3FA 1AYOA 2YGQA 4ZBJA 4GEJA 4A66A 1RUQH 4UUJA 1OB1B 5EN2A 3QPZA 2NNAA 4ZPVA 3QAZC 1GVEA 5FV1L 1KGCE 1Q4WA 1ESOA 5E1GA 4NCC2 2B9BA 4N4QA 4GZJA 4K3HA 4OOZA 3E1ZA 1XGTA 3GSRA 3WKNA 1P48A 1UQSA 4QRBA 4NNCA 4JG1H 3P3BA 4XC1H 3AWEA 3ZVHA 1XB3A 3GK0A 1LO3L 2I57A 4C1KA 4E4UA 1DBTA 4U49A 4S3CA 2P28B 4JX6A 3GMRA 3KVLA 1PTAA 1XH1A 2X3CA 4PCYA 1MHHA 4GA8A 4NZRL 3SUSA 1U8JB 4JHWH 5HYIA 2PGEA 1LBFA 4D8PA 2ATKB 5EC2B 5GS0C 1A1OA 3CSGA 3BLIA 4NUGH 3I6LD 1VKXA 3B4NA 1AJ2A 3EDEA 3KBFA 3CDFA 3GMMA 1DSWA 3CMFA 3VIPA 1AMKA 3KR3L 4K3JL 2EHHA 4ZSTA 4M1DL 4NT6B 5DZLA 3IDIB 3D50A 2CHRA 3MROA 3VZYA 1JK9A 3TMLA 4NZUL 1A6AA 4EKXA 4BDVA 2DDXA 4YTRA 3ARZA 3ZIZA 1A3RL 2Y4SA 1TCRA 4IGBD 4YSRA 2XVBA 4ZZFA 3GC5A 2QSCH 3X3FH 1NCDL 5CD5D 1RQHA 2F1AA 3MLTA 2KH2B 4L29A 3PAVA 3DXAD 4A68A 4MQXC 3N44F 5JMOC 3A4DA 3LV3B 1KGCD 4JHMA 1AODA 5BUGA 1TQVA 1X4ZA 1JI2A 3IUDA 4XVDA 2Y3NA 4J5NA 2WYTA 3ZTEA 3M5YA 1D9KB 4TMBA 3FSTA 3ESVF 2A2IA 3OXSB 3GB7B 3V7AE 3M17A 2Z8SA 1SBSH 2X1XR 2V4LA 1RALA 4O1BA 2P8LB 2PXYC 5GGSA 4ODSL 3U48A 4X0NA 3E2QA 1SJAA 3S98A 1UWUA 3DKLA 3RY6A 1KBPA 4PJ8D 3S42A 1YEKL 3RWCA 3MLRH 2Z6JA 3PB0A 3ATYA 3TN0C 1EZWA 3F5WA 4BK8A 1IKNA 5LN8A 4GAGL 4K07A 4FJYA 3ZE1B 3MKCA 1L8NA 2JJUA 3KBJA 4HNOA 2CD0A 3HGJA 3GHEL 4RZ5A 1ZBKA 1M7DB 3O4OB 3VCRA 2WVUA 4KTEH 2X05A 3WS3B 3QS2A 4YC2B 1H8NA 1QWKA 3ULVE 5I1AB 1VYRA 3ZIYA 1NCWH 3IJSB 2I1OA 2FHBA 4GO8A 4YCPA 1VPYA 2BWDA 3RLVA 3PJTA 4QHUA 1GR7A 2FLBT 1KGYE 1TTCA 4BRJA 4PJXE 1ZV5A 2VDNL 2VITB 2JIXB 3NIGB 3PRZA 1D3GA 2DYPB 4E9QA 5B1KA 1X5YA 3PP4L 4NZ5A 5LNUA 5JHMA 3SBQA 2GCYA 1CURA 1ZXKA 1L0XA 1NCJA 2GJXB 4MS8C 3RKPA 4BELD 3NRFA 1CW2A 3JWDH 2X9ZA 4YTTA 4QHMB 3FSUA 1HHGA 1AO7E 1ECZA 3A47A 3VOGA 3MZGB 2YR3A 3HHSA 4XCCH 4L80A 5TAOA 1UADC 1YNPA 5AVQB 4Q52A 4MNQE 3UJIL 2CKRA 3W2JA 1MRFL 3UR7A 2GBUA 1SR0A 1XR9B 3II3A 3VFUB 1KFEA 2Z8VC 3BRGC 1T5XB 3QXVA 4OB5L 1JCLA 1PCWA 5FJRA 3VNYA 3KWXA 5EC1B 3T2OA 5DD6A 2QZRA 1Q38A 4NSKA 4LF3A 5GS2H 1EDHA 5IB4A 4IKLA 3W73A 3H2AA 4OE7A 3THUA 4D1IA 4LY4A 4FI4A 2GJ6D 2I5YH 2F5AL 1OM9A 3FFSA 5J04A 5F7HA 4FADA 3PUEA 2PW1A 4HS8H 4JNYA 3EKCA 2FJFB 3SI9A 3KOWA 5L4MA 4JIRA 5H8UA 2ROYA 4C5YA 1NDGA 2VMEA 1TXKA 4RGND 4IDLA 3Q65A 4ADGA 2EDLA 1AGBB 3FB7B 3MA8A 4AI7A 4KZ0A 4HHWA 5I0WA 4IH3A 3F84A 3UAJC 3AI0A 2CKBA 1L4IA 2FYMA 3S1WA 2YR1A 3AUVA 2ZCKH 4BH7B 3RL2A 1MI5A 3D18B 4BQ2A 1AO7D 3F7KA 4TNFA 1J01A 1AQ8A 1MN4A 4UFMA 4JN2B 5F6IB 1PLGL 1FHLA 4F7TA 3DFTA 4CBPA 4EMZA 2OG9A 3L3KB 4MNQD 4RE0A 4GABA 4GKSB 3EEZA 4BE5A 5AZEH 5J3HD 1HHKB 3ZL4H 1W3IA 4FB7A 4P06A 3G1AA 3H2CA 3WLHA 2WMPA 4MSWB 4TSBH 3S8FB 4FOMA 1GY2A 1WWBX 4C6LA 4JZOA 3T4YB 4KV5F 4MA3A 1BWMA 4NO0A 5CPOA 3BRFA 4YHIA 1VCAA 4NNPL 3B7YA 4WRHA 1O9VA 1T6WA 5TE7H 3C9NA 1J9YA 4B3KA 4IIBA 2BNRB 5BU6A 4HEMA 4MVBC 4OV6F 4ZUVB 3PWJA 2VDLH 4WUUD 1SEBA 2PZ0A 2ZOLB 4GLRI 3D06A 2X4OA 4ODHH 2JKWA 4QGTA 1ETA1 3M0ZA 5LHEA 1PSKH 2FECL 4L4PA 5LBGA 1KXHA 3TVMD 4CBZA 4XCYB 1I9JH 4Y89A 4MA7H 1ICQA 4AZ5A 2GITA 3UTZB 2NY0B 5I06A 3C6LD 2X9YA 2GVYA 5TFSH 3W2UA 3D39E 5L4JA 1P6AB 3MI6A 3MBEC 4OVXA 2DJLA 6REQB 4GFIA 2HJKB 4MFEA 1RSCA 4O28A 2X4UB 2R94A 4YBQD 3UFYA 3CPRA 4F9PA 1WOBA 5J1SC 4HV8A 3GBLA 3LBMA 3LS5L 3MJ7A 3UGRA 3JTSA 4F92B 4PBFA 1DVJA 5L8LB 3UPWA 1MUJB 1UKOA 5D5MF 2FD6H 1SVCP 2V3FA 1EP3A 3N55A 5EZIH 2GK1B 5I09A 3CCHA 1RZMA 5EYWA 2VXNA 1XL9A 4X6DB 2ATPB 2R23A 1M1BA 3AQDA 3QPYA 3W6YA 3QXWA 4HWUA 5D7KE 4ZUSB 2IFFL 4TQPA 1SPQA 2J7HA 3TK7A 3QUYB 2YRPA 1U2HA 3BURA 4B9GA 4IFKB 4Z2GA 3KXFE 4TUOA 1TNNA 2GZXA 1HH9B 1D7KA 4IJ3C 3I02B 1U8NA 2JTYA 5B3SB 3OMIB 5TQ2L 3RLSA 4NKOA 3VYNA 3SUVA 3T65B 2EINB 4DZBB 1PD0A 3G9AB 5E2TH 2IALA 3CUHA 3JXAA 4GQQA 1N0XH 1UJ3C 1AP2A 1Y07A 1Q9LB 4M1CC 2F8QA 1HIMH 4JG0H 5JXAH 3D39D 3KUMA 4HK3J 4L3AA 3LM7A 4YHEA 1XLHA 3WD1A 3O7UA 1TVLA 1YC8A 2MNJB 4AU0A 2LOEA 4DZ5A 4N8CH 1XVSA 1ZCOA 1DIEA 1UZDA 1RHFA 4PGDA 1XRSA 2AJSL 3DO7B 1CVRA 5GRZA 5C0BD 4PJ7F 4IU3A 5FJPA 1JI1A 1T04B 4G3YL 4CC0A 2O5XH 3KOXA 1YY8A 4PREA 4FNLL 1DO5A 4WI9A 3VDGA 4KVNL 5DQ9A 3SUUA 3EBGA 1QR7A 5KTLA 4IRZH 5EF1A 1KCUH 3UACA 3QHFH 2BDNL 3GHPA 1RR2A 1MEXL 2VDNB 2A6IB 1L6ZA 3P93A 1TJIL 4PFMA 1J2BA 6TAAA 5FO9A 4HUCA 3DIFB 3SQMA 2JQMA 1IAMA 3AWFA 1YSOA 4O58L 4WW2B 4C1LA 3GHBL 3MDUA 3BMXA 5C0JA 3ZJAA 1L9QA 5LIWX 4PEKA 1KFGA 5H1WA 2O93L 2XGBA 1G1KA 1DJZA 3WIFA 2DQUL 1ZOXA 3ELQA 1H7RA 4F7MA 3TNMB 4K23L 3WD5H 4KY1L 3MU7A 3QUHA 4XVSH 3GS6A 4P2CG 4XNUH 4CCDA 3ISWA 3G1RA 5MP6L 5HVGB 2ZRVA 3NSYA 4UANA 4H8UA 4X5WA 2SEBB 2BIHA 3ULUC 2P7TA 1UENA 2WK2A 3QB7C 5T33H 5C0GB 3TN0A 1IGJB 3LKRA 3MJ9H 1TV8A 1QACA 4I48A 4UQ3B 5E00B 5GHWL 3IANA 4NQ1A 1IQDB 4HG4J 5L88H 1UR2A 3H6JA 2IDSA 3OR7B 1R5WB 2XKSA 3NSDA 3KPQB 3LD8C 4JYFA 5GIRA 4M43H 3P3YA 3QYMA 1HWWA 4MKMA 1J79A 3L3DA 4WWOA 4LBUA 3FT3B 3MRPA 4KKAD 1PY4A 3EHBB 1TFVA 4A05A 4IQLA 3ZHFA 1ISWA 4I90A 3ISIX 1ROCA 3RCNA 3RUGA 3MODL 5I1DB 2AMXA 4LQFL 3DMMC 3CN2A 4JM4L 1Q7ZA 2YHGA 3VPLA 3EWUA 2YRZA 4D71A 4IXHA 5IFJB 1FCVA 1TQCB 4F33A 4JPIB 2Q6ZA 2QADB 3LX9A 3VB8A 1VJSA 3QJZA 4R7OA 5DJXA 5HI5C 1BXBA 3OLGA 5A16A 3V1PA 1G7MB 2JKAA 1S3KH 5IK3B 1KG0B 5IEHB 2VLMD 3T6QC 3FA4A 1DQVA 2HJPA 4C6OA 3QZWB 1UM6L 1E5AA 2XWBB 3FNDA 5LIYX 3GRGA 2J13A 4DAFA 1RL1A 2FH6A 2IQ9H 4ZUUA 4XRCA 1AD0B 3DROA 1T03H 4DTGH 2ISSA 2WANA 3WFLA 3GVRA 2NY6B 3K7UA 3AJXA 2KYIA 3TO4A 1JXJA 1Q45A 3WEXA 2XIMA 2F6UA 3B3IA 3WF4A 1S9YA 3OZPA 4AD1A 3S96A 2J43A 3W5MA 2JK5A 4GUPB 1GYWA 3WEOA 3G5YA 1FL6B 1P84K 2EXWC 4JANA 1GYLA 4YEEA 1A3WA 5JIHA 2VLJD 5FUCE 4R8WL 4MYWB 1IF2A 4JY6A 3JTTB 3EWBX 1VFMA 3N6JA 3XINA 5E0KA 1OT2A 3G6LA 1HG3A 2Q8ZA 1OD8A 1E4LA 3QT2A 4YHLL 3QCUH 3MI3A 4Y4HD 3CAKA 5I8KH 3FS2A 2G4EA 4PUJA 1UGNA 4WKHA 3VXUA 2PDFA 3GW0A 5AVUB 3SCNA 2EDFA 4ILSA 4HXAL 3MWCA 3FRUA 2OR2A 3U4FA 2JBMA 3V35A 3SRFA 3U2JA 1U5JA 4DNMA 5KUKA 1EBPA 3GTIA 3IDMA 3GDMA 5GRUL 3UAJA 2QPEB 5K9QG 4P2QB 1EF2A 1MVUB 4RDYA 4R4BA 4P8QA 3DUHA 3GMLB 3REVB 4WQ6A 4N6RA 3LQMA 4ZEPA 4M1GL 2XQYG 3ZKND 5D1QE 1GZ1A 2W38A 4J3OG 3QIUC 1E4MM 3QZWG 3L21A 1C16A 2Z93B 3TCLB 2IPTH 1W1PA 2ZX9A 2R1WB 3CL8A 4KKLD 2F53A 3O2LA 2EPNA 3SW6A 1WXJA 1XGPA 1IGIH 2WWMD 2XA8H 2DZWA 1CBVL 2N01B 4PMNA 2WCPA 3QKZA 3MLSH 3LQLA 5HK4A 4XNMA 1OTTD 3UVAA 2OKOA 2FAUA 3CFKA 4P07A 4CVXB 4QY8B 5AB2A 3MRDA 4LT7A 1REQA 3VWJA 1QPPA 3L3GA 3KYKH 2Z4QA 6PTDA 4R4ND 3ZQWA 4Q9CA 3DO3A 3KWWB 4NAMA 3QDMA 4DY1A 2YUWA 1ZSDA 1QT1A 3WJLC 4BQ8A 3DK2A 2UV8G 4E41E 1BJ8A 3LXAA 5E6IC 5FO7B 4U0QB 4E68A 3TYBA 3TH4T 3CJPA 1N2RB 3SN6N 35C8L 1GOWA 3FT2A 4HWEL 4L8CA 1BQRA 5J12C 1BIHA 4AVFA 4QCEA 1BBJA 4KXCA 3MPCA 3SOBL 1F42A 1NMBH 4Y5XA 2WXQA 4EEEA 3H4WA 3VTRA 3QQ3A 3VM5A 5D1QD 2V5KA 4ODTL 4P2OD 4KETA 5DLML 4N0RA 2X7LA 4Z7NE 5I6KA 2OJZL 3QE5A 2R6OA 4DBWA 3UX9B 2BP8B 1T1WA 2VYOA 1FIGH 2YOAA 1NJ9B 3VXPA 3LK6A 2RTTA 3LDBC 3IEBA 4DZIA 1XCXA 2YLHA 1OD7A 2QUUA 3CASA 3RWFA 4X80L 5T3XE 4ZFFA 1HYSC 1XX9C 3BZFA 3VFMA 3O6DA 1YNLL 1WTGT 3WLKX 4JO4H 4Z0SA 3FQRA 1LMIA 3NEEA 5MERB 2YQ3A 4HK6A 2R8WA 2EE9A 1OX4A 3QTGA 1FC1A 5C3IA 3LTSA 1LJYA 4E41D 3OWEA 1R3IL 4HFUL 1NGYA 5CPNA 3GAYA 3IVUA 3IGUA 3NIFB 4O2EB 2YAOA 3UTQA 1XGYH 1JCJA 4KJPC 4QROA 5I2UA 3W1MA 1IBYA 4W9IC 2DMBA 4Z2LA 3C5QA 3W1TA 1KACB 4F2ME 3FCSA 4INFA 3RAOA 3BZEB 3AIWA 1TZGL 3I7RA 4OIFA 2XY2A 1ZPLA 1V3MA 3U7VA 1U5HA 3KVMA 2BTMA 5D2VA 4CJ0A 2AJVL 3MUXA 3ATEA 3MO7A 2PEVA 4JRFA 2CZDA 3LCIA 3VIIA 3Q0HA 4NQEE 4AYMC 5HD8C 1U8PA 4BF9A 2PCEA 4C90A 2XWJB 2K8QA 3OYXA 1L6FA 2E86A 3RYMA 1CGSL 5HJLA 3GSXA 3UR2A 3TFKC 4RNRB 2FJHB 4BF7A 2QUTA 5LDUA 3TZFA 2FQGA 1J12A 3GUGA 3DURA 3VFTA 1EO8L 2WCSA 1A25A 1PV8A 3VD2A 4M80A 1JNNL 5A2LH 5J57B 1OADA 4KRLB 1J10A 4W68A 1CI5A 1R46A 2CCWA 1LP9F 3KPLA 2VW7A 4V1DE 3NA4A 3IMRA 3GRWA 5JIDA 4XMLL 1P7QB 1YA5A 4PJEB 4R7LA 4EVNB 3TH6A 1U93A 5BOJA 1A5SA 4G8IA 4B5ZA 1T89A 3EX1A 1YYLL 2F7OA 1ZHKA 1WGOA 2ASHA 4QLJA 5KWYC 4FPSA 3ETBF 1LWJA 1SUHA 1OE1A 4MMZC 1LG1A 2CXGA 4ERSL 3CWNA 3WJJC 4GYJA 5J8OA 2IH3A 4IBWA 4NQED 1VBUA 5C07D 4UB0L 3H55A 4K2UL 5BMXA 3TSMA 3GSWA 1A7OH 1S1PA 1MJ8L 5C3LD 2EYRA 2OTWA 4Q7DA 3THCA 4PLKD 4RA3A 1OAQL 4NY2A 1BMGA 4ZODA 5INDB 2YMOA 3WY2A 4MA1C 3U25A 4LUSA 1HSBA 1FWGC 3QYQA 2WTRB 3VO0A 1T99A 2BC4A 2PWHA 4R5XA 8CGTA 2MHAA 1W1YA 1I9IL 2X4PB 3P8JA 1FC2D 4WEVX 1DQUA 5SWZA 4LOFA 5IF0A 2GJNA 1HNYA 2VDKH 3C5ZA 1UB6B 1F61A 4I2XE 4N2OA 1RY7B 2L8AA 3TWAA 4H13C 2AQ2A 2MPAH 2VR9A 5GGVY 1WHOA 1XD0A 1G7QA 4V1DD 5F9OL 4JTEA 2UWFA 1ASPA 2I26N 1FZOA 4HU3A 1QZ1A 1CDBA 1OALA 4HBQA 2D2OA 3WNJA 4J12A 4XWOD 3IDYB 5EBLA 3T42A 5E8NB 1FWRA 2DQCL 3SDAA 3ZKXC 2GK0A 5CWSA 4GT7A 3NZHL 4GO6B 1DTUA 1XPYA 3O3UN 2Q76B 2DM2A 1PZ3A 1S9VA 4IRJB 3PZUA 5AKTA 5FK9A 3LMZA 3STZA 4IXXA 4E3VA 3CLWA 2V2CA 3QMSA 8TIMA 3RIKA 2RA1A 4OVUA 3B3BA 1SZGA 4S1SL 4AENB 2VGLM 1JFQL 2VR5A 4IS6A 1JS4A 1FXQA 3MCLH 1EJFA 1E5JA 3VA6A 5CZRA 2C71A 4OTKA 2HT3C 2PWUA 3K6NA 3OU8A 5CBEB 1TG8A 4LKXB 3MX0A 4ACPA 3DG7A 3DWTA 4LCSA 3ABZA 3GKZA 3SDDD 2TODA 4JFED 1G9NL 2DLIA 4H25B 2ED9A 2NX9A 1Y1UA 2A6LA 2YXOA 3K2GA 2HLAB 5C6PB 3PWUA 4XNYH 1HSAB 5DCBA 1H61A 2YEVB 4ZDHA 5IHZB 5HSFA 5F2FA 3VVGA 5G4OA 2ISVA 3TBTA 4XNXH 1UPMB 1WDDA 2EEBA 2DY2A 4K9EH 4Z17A 2IWEA 3VFVA 3E6FA 5ID1A 4OFIA 4ZMVA 4IOTA 2G2PA 2ARJQ 1DOSA 1E3XA 4LMQE 2J1YA 3EGDA 3D05A 4BCYA 4NC2B 4KVCH 4TO8A 2FGWL 3PJSB 5GGUB 4NASA 3I7SA 1AS6A 4P3WA 2YMXL 3QUZC 2BSSA 4UR8A 3S8HA 1RBLA 4P7OA 4AMCA 2F18A 2OMYA 2DMGA 3PZOA 3KOFA 4X8JA 3N34A 3WJMA 5FESA 3K8LA 2Y8KA 2FMNA 1JYXA 2HTLC 4KJQD 4PB0L 3QRHA 3HMJG 1H7WA 4Y8AA 1Z41A 2YAFA 4W9TA 4CILA 12E8L 4BJHA 2VXVL 2DB8A 3WJLA 3EOAB 5DC4B 3L3OA 4OLVL 4F7EA 5KBDA 3A67L 1WDRA 5D9SB 4XO9A 1EGZA 1TZIA 3DSNA 3MJ6A 5D4YA 3O8XC 1DQJA 1EFQA 1KFKA 5HQMA 1T8XA 5I71B 2O6PA 4H2HA 2JELL 2PP7A 2E6QA 4H4NA 4FEIA 4U4BA 4GNVA 2DMHA 4W6WB 1ML0A 4Q0XH 5KEZA 1RURH 2PPDA 3ZGHA 3EJPA 4F0SA 3MLZH 4F5CA 4JS3A 4OCWL 4UTKA 1CICC 3SDCD 3CSTA 4B6ZA 1JN6A 2GPTA 4BQCA 4L1GA 3BWSA 1SEQL 4X6EB 1G9HA 4MX7A 2AJ3B 1I1XA 2AL2B 5E8EB 1ZTXL 4MRBA 4XP1L 2J8UB 2EG6A 1F1DA 1VFAB 4JNMA 4K8RD 1GS8A 2ZA1A 5IHUL 5IFTA 1AYRA 1S39A 4LCUB 1IRAY 3GKWH 4J1OA 4JUTA 2GTZB 4R90H 4AQOA 4X2UA 5MEQA 1ZTVA 4H26B 3HN3A 4HPOH 1RV6X 2UZ9A 1QLFB 3N6YA 3VFSA 3LNHA 4AYGA 5C0AE 3QUMH 3UW6A 5FHAL 3QN3A 2RIKA 3W7PA 3DHPA 3BOXA 4KROC 1CR9L 1FYTB 5DN1A 1HTYA 5TBOA 4GSXA 1MAKA 3JYCA 3VVWA 3NCJL 4BY3A 3WKZA 1C9SA 3TW6A 1UOLA 3ZXAC 1J8VA 3BKML 3RR1A 3DLQR 4O5LL 1OPGL 5ELIA 5CP3H 3H8NA 3T4AB 4X9FA 4TKWA 5D9NA 2Q2EB 1QO3B 5FFLA 3QG6B 3EDFA 5F7EH 2YB1A 4NRZB 1YN7A 3D0VA 3GSNA 3C2EA 1Z9SB 4BUGA 4QUOA 2K8MA 1BZ9B 1L9PA 3NACH 2AS5M 2CXKA 4CRPA 2A6JB 4K0OA 4N2YA 1SJVA 1RZJC 1BHGA 4JFYB 2BVPA 2VDMH 4F2UA 3FO2A 3O2VL 4IZGA 2AXFA 3QUMA 5H8PA 4XTDA 5IBUB 4RNIA 4N0UA 3MUGA 2PGFA 2PWDA 4QR7A 1KD0A 3SHSA 5C0AD 3LN5A 1A5NC 4ICWA 4IISA 2Z0IA 3S37L 2H7WA 5LIKX 2DQEL 5GXBB 1SUJA 4TXVB 4UYPA 5LO7A 4IMLB 4M8UA 3LH9A 1RD5A 3HLKA 2WZ6A 4JD4A 4V28A 3BD4A 3NN8A 3CX5J 3TOPA 2CLEA 2OYKA 5D96C 4FXFA 1ET8A 2PO6B 3PIQB 1MCPL 3FGCA 4ZNCD 1UA6H 4MMZA 2UBPC 4NENB 2BMKB 3Q58A 3PAZA 2B1HL 5E4OA 4P3DA 1T20A 2HE8A 4IQJA 4UTWC 3QUXB 2ZZ3A 5FGCB 1RU9L 1DQML 4OGQC 4WV1C 3ZKQD 3PL6B 2DP3A 1FCQA 4OZ4A 3NQVA 4Q58C 1RXOB 2XXMB 3B04A 3EJZC 4F7CA 5A2IH 3F6JA 5FGSA 5EU6D 4HT1H 1Q0EA 3DFHA 1FLRH 4M3HA 2VVNA 3SQBB 2G41A 2OPJA 1QASA 4EX4A 4I9AA