1H7OA

Schiff-base complex of yeast 5-aminolaevulinic acid dehydratase with 5-aminolaevulinic acid at 1.7 a resolution
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
341
structure length
341
Chain Sequence
b'MHTAEFLETEPTEISSVLAGGYNHPLLRQWQSERQLTKNMLIFPLFISDNPDDFTEIDSLPNINRIGVNRLKDYLKPLVAKGLRSVILFGVPLIPGTKDPVGTAADDPAGPVIQGIKFIREYFPELYIICDVCLCEYTSHGHCGVLYDDGTINRERSVSRLAAVAVNYAKAGAHCVAPSDMIDGRIRDIKRGLINANLAHKTFVLSYAAKFSGNLYGPFRDAACSAPSNGDRKCYQLPPAGRGLARRALERDMSEGADGIIVKPSTFYLDIMRDASEICKDLPICAYHVSGEYAMLHAAAEKGVVDLKTIAFESHQGFLRAGARLIITYLAPEFLDWLDEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5-AMINOLAEVULINIC ACID DEHYDRATASE
molecule tags Dehydratase
source organism Saccharomyces cerevisiae
publication title The X-Ray Structure of Yeast 5-Aminolaevulinic Acid Dehydratase Complexed with Substrate and Three Inhibitors
pubmed doi rcsb
total genus 115
structure length 341
sequence length 341
ec nomenclature ec 4.2.1.24: Porphobilinogen synthase.
pdb deposition date 2001-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00490 ALAD Delta-aminolevulinic acid dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1h7oA00
2W6RA 1H7XA 2WNQA 3D0CA 5FF0A 1KTNA 4XQ6A 3LLDA 1NF0A 2ALDA 3BG3A 1JQVA 1SW7A 1EP3A 3A24A 4UFHA 3M5VA 3FFSA 3LRMA 2CLKA 2YW3A 3M41A 3UWQA 3SGUA 2CLIA 4K38A 2ZZ2A 1EEPA 4NQ1A 4JIQA 5G2IA 3W7DA 1XUUA 4CQ9A 3HOJA 4NT0A 3DH7A 5DBUA 2WQPA 3QMRA 1A5SA 4GUFA 3SZ8A 3MYOA 2J9YA 2OT0A 4N9EA 4H3DA 3W76A 5AHFA 4TU1A 2Q8LA 1W3IA 3TSBA 2P10A 4MYXA 4RX0A 3UNDA 3P67A 1TPEA 1HTIA 3O6DA 3BPWA 4N9BA 1KLYA 1PV8A 2YFOA 2HS6A 1F6KA 2YXGA 1V5XA 3KRSA 4ZQMA 3I6RA 3USBA 4B5NA 2X1SA 2FQIA 4HNNA 5T26A 3EX1A 2NXHA 3QW4B 4OGZA 4A22A 4FNRA 3UYCA 3ZFHA 3GKFA 1AG1O 2CLEA 3PBYA 1I4NA 3O07A 4X3ZA 1DJQA 3GNDA 2NX1A 5BMWA 1LRQA 2WJZA 2VC6A 4RCXA 2FB3A 3G1XA 3FOKA 2E6AA 2YZRA 5CGQA 3TJLA 3W87A 3EX4A 1NAL1 1Q6RA 4WXZA 1OYCA 3CEPA 3HGOA 2ISSA 3DFSA 3BLFA 5D33A 4YMZA 3PUOA 1G4EA 1TJRA 1TTJA 5C54A 4UTKA 3QSRA 4R33A 5EKYA 1U83A 4P61A 1O95A 2Z6IA 3CU2A 1NEYA 2WKJA 2X30A 4JX6A 1SUXA 2W0UA 4TR9A 4X22A 4AAJA 4BK9A 3NYZA 3HIJA 2QCDA 1MSSA 2NV1A 4BWLC 2AAMA 3QSTA 3L21A 1F73A 1EUNA 2VOMA 1IXQA 2DP3A 1FWRA 3B04A 1I2RA 2F7FA 1H7WA 4S2CA 2H8ZA 4RV8A 3HBLA 2Y63A 3NQVA 1H7PA 3SFKA 1QFEA 2QUUA 1ML1A 1J2WA 5HUOA 3EXTA 3W71A 3DBPA 4Q33A 2ZA1A 5D09A 1JUBA 3NEVA 3T7VA 3KVLA 1ME8A 1K8YA 4OQVA 2NV2A 1LLWA 2Y70A 2YW4A 2V0TA 3OVQA 1FX6A 1O94A 1OFBA 3TQVA 5F4WA 3M47A 1W37A 4CCDA 3MI2A 3KVKA 1Q3NA 5LNWA 3NQ7A 1KBIA 1T0OA 1S3HA 1WAUA 3LCXA 4MJZA 4UTTA 5I3HA 2E09A 3LOTA 2E6DA 4AB4A 4ADUA 4NJIA 3L68A 1TTPA 1RZMA 3G0SA 3PBUA 3W1XA 4MY1A 1ME7A 1TPFA 4LS0A 1VCGA 2TPSA 4UNLA 4JDYA 1MO0A 3LI1A 1ALDA 3B0VC 3OEXA 2JKEA 3PB0A 2QJHA 2Z0IA 1TJPA 3UWUA 3W7EA 4PEKA 1L6YA 3TQKA 3SIZA 3LX9A 2TMDA 2HTMA 2ATSA 1SSGA 4LVFA 1RD5A 1TTIA 5D38A 5KSWA 5LGZA 3MUXA 4WD0A 4ZQPA 3UWYA 2C15A 4UTIA 4HN4A 4AVFA 4ML9A 1ZAJA 3UD6A 1R2TA 1ZFJA 2ZA2A 3FLUA 4O50A 3U6WA 1KFLA 2QCHA 1AMKA 4TMCA 2VKZG 1DOSA 2CLHA 4IXHA 3C56A 3C0JA 2GOUA 4GXMA 3YPIA 2YPIA 2Y7EA 2CZDA 4NZFA 3STGA 4OU1A 1K3UA 5CSSA 3GDKA 4Y8FA 1LOQA 1W5OA 3UY8A 3M16A 4LNYA 5AHIA 4HNVA 4I9AA 3IIXA 3LHVA 2DZSA 1RPXA 4GWEA 4M6QA 3B03A 1AW1A 1QO5A 1H60A 3P81A 1W56A 4NX5A 5HQEA 3CLMA 1HO1A 1J5TA 1F05A 1QPRA 2E77A 2GPTA 4NXSA 4XKYB 1PL9A 5I3KA 1O60A 4MLJA 3EX3A 1H51A 5FEZA 3UPWA 3IIOA 3GR8A 3THAA 3MP3A 3A9IA 4AHOA 4D2JA 5D2WA 2EF9A 1H61A 4IMCA 1M7PA 4BFAA 3ABRA 3LCGA 1JCJA 4LU0A 1C9DA 4KWVA 4XKYA 3BW2A 4LT9A 4ZQRA 2GVGA 3MBFA 1SO3A 2G5WA 4IMGA 2QCFA 3ZR4A 3IVTA 1QO2A 3JR2A 3TJXA 1KFBA 1OG0A 4UIOA 3GLCA 1ZAHA 1UB3A 2ZBTA 4MZ8A 1RQBA 3W7CA 1OK6A 3TDFA 3GKAA 1JRCA 2TYSA 5AYZA 1LCOA 3DI1A 5F2IA 3L5AA 1XI3A 2QCEA 1SR9A 3L0KA 5L6UA 1VPXA 3LXCA 4QISA 1W5PA 3TIMA 1VYRA 3HF3A 5CPOA 2NX9A 4HKPA 3FJ6A 4FX7A 3HGSA 1PVNA 3G0UA 3EWWA 4QSHA 3ATZA 2ZTKA 1VJIA 4JGDA 2Y89A 5LSMA 2B7PA 3BG5A 3KRUA 3NQMA 4JTUA 1QOPA 4MKNA 3EWBX 3QH2A 1XM3A 3S42A 5HWNA 3W1UA 2VFGA 2B0MA 5HUPA 2B7QA 2BWGA 3E96A 1A5CA 3KAOA 5HINA 5G1TA 3W7LA 3FYOA 5AC6A 3CPRA 1FDJA 3HO8A 1U5JA 4TIMA 2H90A 3IIVA 2QCNA 3TMLA 4PFMA 3NQ6A 3TKFA 4QIUA 5LZLA 1IXNA 4OE7A 1YXYA 3OBKA 1XCFA 3L5MA 3MMTA 4UFLA 4FF7A 1HFBA 2X1TA 3TAOA 2V30A 4FNQA 3MYPA 3TA6A 4GFSA 1P0NA 1OX4B 3QMSA 4L4LA 2XFWA 5J5RA 1W54A 2X1RA 4ZVJA 4Z1AA 5C6MA 1JCMP 1XL9A 4TX9A 2CWNA 3PG9A 3NA8A 4RXFA 1EIXA 2PRMA 1LZOA 2O7QA 4N9DA 1XXXA 5EYWA 3TFXA 1SW0A 4K8EA 3UXDA 1SQ7A 3CQ0A 5G2WA 1N55A 4DBDA 5CPLA 3S5NA 3O05A 3LDVA 4W9TA 1B57A 4H6KA 3M5XA 3W83A 1ONRA 3NOEA 2ZZ1A 2HMCA 5HWMA 3W22A 1I2NA 3W7PA 3PC0A 3NAVA 3KVJA 2EKCA 5K2ZA 4KFOA 4NZJA 5I3IA 5LNUA 5HULA 3W1RA 3TAKA 1NF7A 4JNMA 3NPUA 5CZTA 4JYDA 4BR1A 5KINA 3O8AA 3TCEA 4TMBA 2A7RA 1DVJA 2CZFA 1C29A 1VLIA 4MFEA 2RH9A 3AJXA 3QPYA 5CZJA 4O1BA 1YADA 3LGEA 3W1TA 1M7OA 4ICNA 3QFEA 4XBKA 2QJGA 5LNVA 4IMEA 5DCBA 2CW6A 1RR2A 2B7NA 3TK7A 4JYFA 3NZRA 1H7RA 1KM4A 4FB7A 1CI1A 4HNTA 3QM3A 3W6YA 4O28A 3EWYA 1B4EA 4Y6GA 3W2LA 3KX6A 4PTNA 2CFFA 4O16A 3W75A 1YTDA 3SI9A 3W84A 1PS9A 4PH6A 2WSQA 2I1OA 4Q32A 3C3NA 1JCXA 1X6UA 2YR1A 4XBSA 5F2LA 5FF4A 1QPNA 2DZTA 3O16A 2A21A 3VNDA 2YDAA 2CLMA 3LHWA 3N19B 4ZZ9A 4JEQA 1GVSA 4PL1A 1GPWA 1VYPX 5D2TA 5BW6A 1QOQA 3GAKA 1DL3A 3O1NA 8TIMA 1I2OA 4JTHA 3W3OA 1QR7A 3LHUA 5DLCA 3QRHA 1TCDA 5BOOA 3R89A 3NPVA 4GC4A 4YXGA 1R2RA 1YDNA 3NQAA 3HG3A 3TROA 1FWNA 5K9CA 4WQ6A 1VYSX 1Q6OA 2CLFA 1TPB1 2HS8A 2I9EA 3NVTA 3QPZA 3STFA 2NLIA 2V81A 5HJLA 2DJXA 1Z48A 2QUVA 4LV9A 4UXDA 3EWZA 1EP1A 1SSDA 2QEZA 3R8RA 2RDWA 3DKJA 3VFLA 1H1ZA 4O19A 4A3UA 3P80A 3LCWA 1FWSA 1ZCOA 4UTHA 1LBLA 5AYXA 4PC8A 2G95A 1GG0A 5G4WA 4HPXA 4HSOA 1BEUA 1ZAIA 1O4UA 3QMTA 2H8XA 1W0MA 1XBZA 4P2VA 1JCNA 4CQAA 4S2BA 3LTSA 4N6FA 2ZRUA 1EA0A 2ZRZA 4WX2A 1F2JA 4JX5A 1K7FA 3G1HA 3KXQA 3S6DA 1VHNA 3M9YA 3N2MA 3THQA 2ZRXA 4JTLA 1TIMA 1RQEA 3E0IA 1F76A 1LTDA 4GUHA 1SO4A 1WBHA 4IXXA 3UWVA 4WOQA 3T78A 4JY9A 2WV8A 4UFIA 3KFTA 5E0KA 2C3ZA 1YPFA 2NX3A 5D37A 3BGJA 2VFDA 2LLEA 4I7UA 4E2DA 4DF2A 3LXAA 4DELA 1QAPA 3L0GA 4LOCA 1M6JA 1SZFA 4QM1A 4LUJA 5D04C 2F84A 2GUUA 4LS2A 3TR2A 4OT7A 3W23A 1FDZA 4UMAA 1YTEA 3L65A 1SFJA 3F1QA 5J5DA 3I68A 3BVJA 2NWSA 4EF9A 3BARA 3TE9A 4C1KA 3L5LA 1EWDA 1H7NA 1NVMA 1OK4A 1YXCA 1UCWA 4O17A 4EWND 3O63A 1SZGA 1KTCA 4LC8A 2H6RA 1OYBA 1AW2A 3S0CA 4O1CA 3GYEA 3M7WA 3L0NA 4HT3A 1L6SA 4O1AA 4O52A 3OVRA 3PG8A 2IQTA 4ALDA 4AF0A 1K02A 3LV6A 1L2UA 2GVLA 3K30A 4YCPA 2DU2A 2V82A 2GJNA 3RK8A 2A85A 3TC7A 3LHZA 1I2QA 4CNOA 5AB3A 2G97A 2VFFA 1FCQA 2PURA 3HQ1A 3Q2DA 3ABSA 1W3TA 3VCRA 1P4CA 4LVDA 4N9CA 4FO4A 3W86A 2XN1A 1OHLA 3P82A 1R47A 3W9ZA 5AHLA 1WA3A 2A0NA 3G8EA 3MJYA 2Y85A 2B7OA 3LRKA 1XC4A 1FDYA 3MW7A 5C55A 1SO6A 3PR2A 4UR8A 5KMYA 3BW4A 3GXNA 4RZ4A 1YTKA 2FJKA 3P7YA 2VEMA 4R34A 5K9XA 2H3BA 2ZZ6A 4Y9AA 2FB2A 4DBEA 4JYEA 3CIXA 1LRNA 3HPZA 5CZ0A 2OX1A 3UQNA 3PAJA 4NU7A 2E68A 1OFDA 5G1YA 2FFCA 3EWUA 1AW5A 2YSWA 1EX5A 4NNBA 1F6PA 5G4EA 2PCQA 3C2EA 3WJSA 1K7EA 1JR1A 5KZDA 3CHVA 3NO5A 4BI6A 5AC7A 2GQAA 1NFBA 2JKAA 3RFAA 3JS3A 3NQFA 3NR0A 1ICQA 2WOQA 1Q45A 4O57A 3P74A 3GDMA 5K3VA 5SWUA 4HSNA 3M6YA 1WV2A 1YYAA 2ZRYA 5F4SA 2ZRVA 5C5YA 4LW7A 5H2ZA 1A5AA 2JGQA 2QJIA 3RLUA 3LLFA 3IGSA 3WK2A 3A21A 3SSJA 2DZUA 4JIPA 1UJPA 4U4MA 4O13A 5BNKA 5K4ZA 5K7JA 1TPC1 5AHNA 2ZRWA 6ALDA 3GNNA 2V2CA 4DQWA 5DXXA 3MHGA 1GQNA 4N4PA 5D05A 4DF1A 2JK2A 3WJYA 4MY9A 3DENA 3KRZA 4QQ3A 3R2GA 3PF3A 3S5YA 4AEOA 5A5WA 1GG1A 1CW2A 1SO5A 3DFPA 3W7OA 3DAQA 3W85A 1GOXA 4O1DA 3GAYA 1QPQA 1PE1A 3MI3A 3G1DA 3R12A 4E38A 3EXRA 4C1LA 3B0PA 4N02A 3IIZA 4IMFA 4Y90A 4Z0JA 2JBMA 1T99A 3E02A 2Y61A 4K8HA 3W7HA 4NJKA 1K03A 1MEIA 1VC4A 1MZHA 2V2HA 5C2XA 3NQ8A 4UCGA 3NQ2A 4MUZA 4UTTC 4I7VA 3S1VA 1FUYA 1TYGA 4DO5A 1LBMA 3STCA 1DORA 2A7NA 3CT7A 3G3MA 5EMUA 2QKFA 3QF0A 5AC8A 2J6XA 1HO4A 5DY2A 4RLIA 5CPNA 1OABA 5AHMA 2ZZ5A 1HL2A 3B8DA 2C1HA 1OFOA 4OV4A 1LDCA 2QCGA 3G18A 5E93A 2Y62A 3Q94A 2RFGA 4WY0F 5TQLA 1SPQA 1WOAA 4I7WA 4M19A 1A50A 1LBFA 3LCLA 2RKXA 4CCEA 1OX6A 4UC5A 1I2PA 1OYAA 4MPQA 3W2UA 2A2IA 4QNEA 3DFQA 2AQWA 2A7PA 3S1WA 3R13A 3WFAA 1ICPA 1LYXA 1P0KA 3RMJA 4LY8A 1R46A 3OVPA 1WQ5A 4A29A 3B05A 2FPYA 5G2HA 1SFLA 3QW3A 3LBCA 3HB9A 3N14A 2WNNA 4LRTA 3W88A 4KFPA 2ISWA 2QCDB 2Z2UA 4EOUA 3SW6A 3N9RA 4WOZA 1B3OA 5EPDA 2NXGA 2P0OA 4O0ZA 1XDLA 1BTMA 5G5IA 4ADSA 1KFCA 3AO0A 7TIMA 2FIQA 3NM1A 3DFNA 2VEPA 1QNVA 4IUOA 3S8HA 1OFRA 3GXTA 1WX0A 2VEIA 5FEXA 3C8FA 5D2XA 3HJZA 1Q6LA 3C52A 3W7QA 4FNPA 4RZ5A 3U2OA 3MBDA 3F4WA 4R7JA 4M7TA 3P62A 3LHTA 4LV4A 2V2DA 1KA9F 3W7MA 1LROA 1KW1A 1ZY9A 3PSVA 3RNDA 4MVAA 1W5NA 2NXIA 4LC6A 4DF0A 3TC6A 1XDMA 2NWRA 1W5QA 3ZS4A 4DXVA 3GDTA 3S9YA 4QNWA 1DQXA 3WK1A 5DXYA 1GTEA 1G4PA 4JDBA 2EHHA 2QF7A 5CKSA 2AGKA 3A23A 4PL2A 3PSWA 4M6VA 4A21A 1Q6QA 2E5CA 5DCDA 1TV7A 2O7SA 3MHFA 4RXGA 2EGZA 3LI0A 1KBJA 3G1YA 2A4AA 3W2NA 3MWAA 1MXSA 1OF8A 1WYIA 3P5ZA 2QCLA 2QR6A 1JUEA 2DZXA 4ORMA 3C2RA 4UTWA 3BLEA 3TV8A 3O15A 3LB0A 1X1OA 1KFEA 1R2SA 4DO4A 2WNZA 2ZDRA 1XKYA 2ZYFA 5GVJA 2EAWA 3G3DA 5HWJA 1TTQA 2EPHA 4LVAA 4S1FA 3P5YA 3WJXA 1ZENA 3ABQA 3UWZA 1G67A 5AYYA 4GRSA 5L9FA 3MI6A 3QC3A 4POCA 4JN6A 4XTIA 4LVGA 3LTPA 1BKSA 2D73A 2YFNA 1CX9A 3P8IA 1TREA 3NQGA 4CQ8A 4MZ1A 4JR5A 1C8VA 4K7VA 4NNAA 1X7FA 4K36A 1TRDA 1K8ZA 5LHFA 2DORA 1KLZA 3GVGA 4ZQOA 1OJXA 2C18A 1GVQA 1GZGA 1BWLA 3S5ZA 1VS1A 2Q8ZA 3G0XA 1H63A 2R94A 1VCFA 4GE8A 3T55A 2R91A 4NJHA 3UY7A 4KKXA 1LP6A 3W7RA 2Q3OA 1ZHAA 4PCFA 4K39A 4IX0A 2YYTA 3PY2A 4FEZA 3WK0A 4AWUA 2ZCGA 1A5BA 3HG5A 4ZQCA 3NL2A 5U4NA 5F2MA 5H91A 3MHUA 3TSDA 5DELA 3N3MA 4KFNA 1KFKA 4WY0A 2R14A 4JTTA 2A6LA 3S1UA 5FEWA 1TV5A 2ZZ7A 3EXSA 3BK0A 3FEMA 4MY8A 2DJLA 3PBVA 1EB3A 4JTKA 3DI0A 3TU9A 2E5DA 1T8XA 1W31A 1FCBA 1LOSA 3O06A 4ONVA 2VXNA 3TXVA 4WY0B 3ZWSA 2X2GA 3LHYA 2I14A 5CPMA 4DPQA 2BX7A 1LORA 2QCCA 2PRHA 2YCEA 4FIQA 4MJMA 1RQHA 1JQXA 2JKPA 3NM3A 6TIMA 2C16A 1VRDA 3QQ0A 4NNCA 5FF7A 1HUVA 2QAPA 1D3GA 3PULA 1UUMA 4JS3A 4UUIA 1FXQA 4R53A 1VQTA 2PE4A 3N34A 5LNRA 1Z41A 4FHAA 2GVJA 1YDOA 5D32A 3WK3A 4O0KA 1GVOA 1DKWA 2OMAA 2E6FA 4K7YA 1OFAA 2OCZA 3HG2A 3NG3A 4GBUA 4DEFA 3QEZA 4RKAA 4GNJA 1TPUA 2BZNA 5LKYA 3SGZA 3U8GA 2B4GA 1IXOA 3L67A 5U7SA 3W1PA 4UTMA 3NQCA 4K6AA 4NUWA 4JY8A 3NZ1A 1FCUA 3G1SA 1H7OA 3W74A 2J88A 3KVMA 1VLWA 4N4QA 1IF2A 3IVSA 3M44A 1B4KA 2DZPA 3A5FA 1KM5A 1O5XA 4GJ1A 3HGRA 3V1PA 4E0CA 4UFKA 3DU0A 2QCMA 1M5WA 3CB8A 4FX8A 5K9DA 3EB2A 3TUUA 3NL6A 3C61A 2Y6ZA 3UPBA 5EY5A 3P8JA 5D2VA 4MIMA 3C2FA 3EKLA 1JJKA 2VENA 4IMDA 1AL8A 1LOLA 3TX9A 2ZQ0A 2GQ8A 3PS7A 1KV8A 3CIWA 1SZNA 3ZWTA 3QZEA 3DGRA 3TXZA 1H50A 1FWWA 3RLVA 3FS2A 4LRSA 2ZA3A 2BXVA 3I7RA 1WOBA 4OV9A 3TMQA 3NQDA 2QUTA 3SY5A 2C6QA 3PM6A 1JCYA 1S5TA 4YWIA 4EVZA 4RZ6A 4JTGA 4ORIA 4IPJA 3W73A 2FPTA 3TW6A 1SU5A 3MP4A 3VE7A 4IX2A 1DJNA 4LWWA 4RJEA 3G1VA 2W79A 5D02A 3MP5A 4N2YA 1SZEA 3I7SA 4H4IA 1X1ZA 3OHIA 3B4UA 5IBXA 5K4XA 3I65A 1J4EA 3EX6A 2C13A 4RR4A 1PCWA 4FX6M 3LRLA 4WXYA 4MLRA 4E2BA 2VEKA 1N8FA 2NUYA 2TRSA 1E51A 4K37A 2OJPA 5F2GA 1JCLA 2Y88A 2XN0A 1IXPA 3HG4A 1GTHA 1THFD 5AN7A 3W2JA 4UMCA 2OT1A 1UUOA 1VHCA 3JRKA 2YX0A 4U28A 4UR7A 5IM51 4BI5A 4O15A 2JGYA 4UNKA 2KZHA 2OZ0A 4FXRA 3QJAA 3TFCA 3BO9A 4OWGA 1EP2A 3EEGA 1DHPA 2G96A 4Z08A 3S5OA 4AH7A 1TV8A 1KM0A 4GUIA 1TSIA 1FCVA 2NZLA 3C4UA 1TPWA 5FF2A 3LV5A 2VFIA 3SJ3A 3BLIA 2RHGA 1K7XA 1QCWA 2ZTJA 3C2OA 3I7QA 5HMSA 3GIYA 5HR7A 3IGXA 2X16A 1H62A 5IBXC 1OFPA 4O12A 1GWJA 5BMXA 1IIGA 4GUGA 2ABBA 3UXAA 1IGSA 1HG3A 4X9SA 3FA5A 3LTYA 3EKZA 1WBJA 1MEHA 2DZWA 5KZMA 2NUXA 2FLIA 2H3DA 3DFOA 4EIVA 1OFQA 3W7GA 2CZ5A 4DO6A 1S5WA 3CWOX 3IVUA 3UWWA 1FBAA 1XFBA 3UZ5A 2CU0A 1G4SA 3GDRA 4EF8A 2R8WA 3HPSA 4LVBA 5BRBA 5FF3A 3L9CA 3PB2A 1GT8A 2FDSA 1G7VA 3N2XA 3NL5A 4Z1DA 4JTSA 2DZVA 4HPJA 4NX0A 4ZMGA 4HIBA 5DY3A 1B9BA 3L66A 4Q4KA 3INPA 1PHQA 2UV8G 4FNUA 1AL7A 5AOUA 1YPIA 3CWNA 1UBSA 2ATMA 3BV4A 1TPH1 1TQJA 3CEUA 3CM4A 5HR6A 3OIXA 3QYQA 1V7YA 3PBWA 3T40A 5EL1A 1I45A 5D2YA 1JVNA 3KHJA 2VFEA 3M5YA 3B06A 3GB6A 4LS1A 3NQEA 4IOTA 4Z0SA 1PIIA 1XBYA 5CSRA 3RF9A 1L9WA 1W5MA 1XUZA 3IRDA 4FNTA 3GX9A 4JICA 3N73A 2RDUA 1JUKA 1R30A 3G1FA 4O54A 1VR6A 3LCFA 1T96A 3VE9A 4AXKA 5FEPA 1ZALA 2C19A 2Z6JA 1OX4A 2V9DA 4PA8A 4YLWA 3SECA 2CZEA 3STEA 3G24A 1YXDA 1X8FA 3Q37A 3VI2A 4BI7A 4CNPA 3PUDA 3IGUA 1KM1A 4BWLA 5EA9A 1LLZA 2WPBA 1KM3A 1DV7A 4JTJA 3P60A 1H1YA 4OHQA 3E9AA 1IIHA 1YDVA 4O8RA 4DPPA 5DN1A 5MHBA 4UTUA 3P84A 5E1QA 1S5VA 1JULA 4UMBA 1VH7A 2V8ZA 2ZZ3A 4MYAA 1TB3A 2C0AA 4JTFA 5TIMA 3P61A 1P1XA 3BG9A 1QWGA 4IQLA 5HNRA 5TBOA 5I3JA 1KFJA 2CLLA 1G6CA 1KM6A 3W7JA 1UASA 4IPIA 2ZZ4A 4L4MA 5LGXA 2A1YA 5EBUA 1GJPA 3FKRA 4RK8A 2Y7DA 3TSMA 3DHDA 3L2IA 1AK5A 4JX4A 1F5ZA 5AFDA 1GYNA 1H5YA 3T4CA 4AWTA 3M5ZA 3LBMA 1TPDA 4XZ9A 4A2SA 1OX5A 3GR7A 2GJLA 5F4XA 1G4TA 3W07A 4NVTA 2J9XA 3NGJA 4O18A 2WO5A 3NPXA 5I3GA 3DFTA 3IV3A 4JXCA 2HSAA 1PCKA 4QITA 1GYLA 3ABOA 3C6CA 4Y96A 3G1AA 3WJZA 3SR7A 3N9SA 1TMHA 2V5LA 3FYPA 1FQ0A 2E5BA 4IJBA 4IWWA 3A5VA 1ZJIA 3DZ1A 4M6PA 3EWXA 4MZYA 3VKJA 4NJJA 1D3HA 3NNTA 4JD4A 1KM2A 2NUWA 4XWUA 1WXJA 3G8RA 5CZSA 3ANYA 3A22A 4HNUA 4TO8A 3FKKA 1NSJA 3DHFA 1A53A 4O10A 4AWSA 4O4WA 3BGGA 3LERA 4PODA 1LRTA 4YL2A 1KV5A 1XBVA 3FJLA 1Z42A 4MFDA 1FWTA 5DBTA 5LNSA 1ME9A 4G1KA 4UFMA 2A6NA 2FTPA 5DCEA 3GDLA 3QQ1A 2ISVA 4Z1BA 3W1NA 5D30A 4OBTA 2QDGA 1Z44A 4UTJA 1P5BA 3CTLA 5KTLA 4FXSA 3O6CA 2J27A 3C2VA 4KWWA 3V75A 3E12A 4AMAA 4HHPA 4YCOA 4O11A 2QDHA 4WJEA 2BTMA 3F4NA 3IEBA 4ADTA 1BWKA 2VFHA 3W7NA 1JRBA 4CLMA 1VCVA 2WSYA 2PC4A 2P1FA 3S1XA 2ZFAA 3ATYA 5I3FA 4WUIA 4QAIA 3R5EA 3H53A 3W1MA 4O4VA 3TNOA 4FIRA 1YLVA 2YYUA 4UFJA 1TRIA 4BF9A 5ABTA 5FESA 1N7KA 1W8SA 1SW3A 2CLOA 2Z1BA 1TO3A 2TSYA 3O6YX 2XN2A 2J24A 4JTEA 1VZWA 1F74A 3T44A 4CCCA 4FNSA 4GUJA 4JTIA 4LTSA 1RV8A 1Y0EA 3GZ3A 5FI8A 3PUEA 3GXPA 2BSLA 1VGAA 3OA3A 1DBTA 3H55A 3HGJA 3NPWA 1W1ZA 3TH6A 2QAFA 3MO7A 3NDOA 3HPXA 4QJ1A 3W1LA 4NXKA 1TQXA 1D9EA 2RDTA 3DXIA 4AF0B 2Q3RA 2Y7GA 2GQ9A 5A8GA 3RU6A 3NXFA 4CNNA 3M1ZA 4O53A 2VELA 1G69A 1W3NA 1LM1A 3FIGA 4Z1CA 3WJWA 4J9JA 2Y7FA 3H54A 3LM7A 4A2RA 1EPXA 3HMJG 2ABAA 1GEQA 1K8XA 1KTBA 1I8JA 5F1UA 1G7UA 3NL3A 2C14A 1FXPA 1MEWA 2E1DA 3W7KA 1RVGA 5LHEA 2PRLA 1GVFA 1ZNNA 2BLEA 4M7SA 1TPVA 4AHQA 1GVRA 4NJGA 5CG7A 1ICSA 3G22A 3M43A 3M0ZA 3EX2A 2FPVA 3TQ0A 1O5KA 3B0UX 1QPOA 1OFEA 4UTLA 5KITA 2J9ZA 5F1VA 4UTWC 3W2MA 4XTDA 4IGHA 2A5HA 3W2KA 1QDSA 1EWEA 2V5BA 3PVFA 1OF6A 2WSRA 3W7IA 3OG3A 4WZHA 4M5PA 5KZEA 3Q58A 3TW7A 2X1UA 4AHPA 3PWAA 3ELFA 3LCIA 3BW3A 4MOZA 3W70A 3E49A 3W1AA 1WDWA 4XUGA 4ZQNA 3DKLA 1L6WA 3IIPA 4LUIA 3F03K 3LXBA 1DQWA 1ADOA 3CC1A 2E6YA 4N6EA 3KOFA 3W72A 1F7BA 1QMLA 1XBXA 3GK0A 4O14A 5D03A 4ZL1A 3UZJA 1OVDA 1PHWA 2YGYA 3W1QA 5AHEA 3LCHA 4X2RA 1FY6A 1EUAA
chains in the Genus database with same CATH superfamily
2CESA 4PEEA 4EPEC 2PI6A 3FAWA 4XQ6A 1XLHA 1KGUA 3VIMA 1JQVA 1SW7A 1ISWA 3CHEA 2V63A 3ANUA 3UWQA 3SGUA 3L4YA 3RITA 2E1WA 4K38A 1EGVA 2FKPA 3KZSA 2O4MA 3W7DA 4PCPA 2WQPA 1A5SA 2XZ9A 3UXKA 3CPGA 2J9YA 2IPJA 2OT0A 4H3DA 3W76A 1XLFA 1S2TA 2WMKA 3TSBA 2P10A 4MYXA 3MANA 3AZTA 3UNDA 4XD3A 1GHRA 3SCVA 3I6RA 3TYAA 2FQIA 4HNNA 2WVUA 5T26A 3RPMA 4FLOA 3EX1A 2NXHA 4A22A 3ITLA 1BFNA 4LCQA 3WMCA 2X8RA 3PBYA 5AYIA 3H26A 3C0SA 3O07A 3VCCA 1GW9A 1DWGM 2A3HA 1Q6FA 2WJZA 1EJUC 2C1GA 2J7DA 2E6AA 3VXGA 1UKQA 3EOEA 1Q6RA 3CEPA 4E4PA 3DFSA 1G4EA 1TJRA 4B3KA 3BJSA 3VOGA 1U83A 4P61A 2Z27A 4GISA 2Z6IA 1Q6EA 4ERAA 1SUXA 1AQ0A 1AMYA 4TR9A 4X22A 2G4FA 2IXUA 4BWLC 3QSTA 1E9ZB 2G50A 4RPQA 2OSYA 1VIWA 2F7FA 1UWQA 1ZUAX 4RV8A 3HBLA 3NQVA 1QFEA 3C0QA 2XM1A 1ML1A 1JD7A 5AKQA 5HUOA 3K8MA 2ZA1A 1BRLA 3T7VA 3KVLA 1K8YA 4C6QA 2JF7A 4QJ5B 3OVQA 5BXRA 4W5UA 3OG2A 3TQVA 3XISA 4J7RA 2P76A 5IRPA 1U22A 1UD4A 1B3ZA 2ON3A 3E2VA 4MJZA 3B9AA 1A5LC 4I6KA 3LOTA 2QZRA 3PJXA 4CQCA 5DQPA 1I1XA 1TTPA 3G0SA 3SCSA 3UZZA 2OYLA 4MY1A 1TPFA 3V16A 4PULA 3LI1A 3ZT5A 3DECA 2JKEA 2QJHA 4JPGA 1L6YA 3SIZA 3F2CA 5HJXA 1XCXA 4R85A 2G0WA 4LVFA 1XSKA 2CWXA 1XIJA 2HISA 2QT3A 3VGEA 1R2TA 3VNIA 3JVAA 1ZFJA 4Q8NA 3MCNA 3CL7A 3W28A 5I24A 4PUEA 5REQA 4AY7A 1DOSA 1EL3A 1P6CA 3CMGA 4C7GA 5FJUA 2GOUA 4D6DA 1ITCA 3F5KA 5TAOA 1LT8A 2QGYA 2YPIA 3DN5A 3UETA 5I09A 4ACYA 3DYMA 2MANA 1J96A 2YXXA 4GWEA 1F61A 1QI3A 5I07A 4DUVA 2RJGA 4PUJA 4NX5A 1WKEA 2DW6A 3SN0A 3CLMA 4EP8C 1F05A 1O6IA 3N2CA 3WD3A 4XV0A 3P0WA 4OJYA 2PODA 3BCFA 1BPLB 3EDDA 2PWUA 5FEZA 4QS6A 4X0NA 3A9IA 4C65A 4PTMA 2PGRA 2EF9A 3I10A 4IMCA 1M7PA 3LCGA 1JCJA 1XQLA 4KWVA 4XKYA 3BW2A 3CIVA 4ZQRA 5EU9A 2PSNA 3TYUA 3NFUA 5I00A 1T40A 5CC7A 1SO3A 3ITYA 3TTEA 5C71A 1BD0A 1EJWC 4MNLA 3AYRA 2PDMA 3JR2A 1W9UA 2PLKA 3R1ZA 5JBFA 3QR3A 2Z4GA 3W7CA 3U7BA 4FPSA 2BV9A 3GKAA 2RDXA 2TYSA 1T8QA 1XI3A 4J2PA 3H2MA 3L0KA 1HJVA 3U57A 3D3AA 1W5PA 4Q7IA 4IG2A 3HF3A 2NX9A 2Z28A 4HKPA 3FJ6A 5A8MA 2QJMA 3PAOA 3ZT6A 2QMJA 4DRSA 3EWWA 4QSHA 2Y89A 2WB5A 2B7PA 1XIFA 3NQMA 4JTUA 3WUEA 1QBAA 1KBBA 2XU2A 3S42A 5BWFA 2VFGA 4GVGA 4KCWA 5HUPA 1OT2A 1C91A 5AC6A 3HO8A 3ZLGA 2Z00A 1U5JA 3TMLA 1XKJA 1JZ5A 3I3DA 3QYSA 4AU0A 2DT3A 1W3LA 1IXNA 4I5RA 3UPMA 1U1HA 1W1PA 2GDUA 3L5MA 4W8BA 4FF7A 2CZVA 4CGTA 3CZ8A 1OX4B 4L4OA 1F8IA 3WENA 1TJ1A 3U4AA 1GZJA 4JFUA 2X1RA 3UCCA 2F6KA 1F3EA 3PZIA 1YNYA 2CWNA 4QEEA 1H41A 3WUGA 7ENLA 1EIXA 4N9DA 1JG9A 3TFXA 4K8EA 5G2WA 5A8NA 1AH0A 1M7JA 4GZIA 2AMXA 2E28A 5CAHA 4DLFA 2GK1A 3N18A 1XC6A 4H6KA 2P0IA 3W83A 2G8ZA 2HMCA 1EZWA 3CH9A 4PB3A 4KFOA 1HQTA 3QHOA 1XINA 5HULA 3W1RA 3RM9A 1M7XA 3QGVA 4JNMA 1VBGA 3BJFA 4LEQA 4JYDA 3PZTA 4BR1A 3TCEA 4TMBA 5XIMA 1C29A 4D71A 1R9ZA 1W1VA 3AJXA 5CZJA 3GH7A 4ICNA 3QFEA 3T42A 2CIPA 1PKLA 1RBOB 4Q7BA 4A8IA 3VOFA 1LJYA 2C79A 2QJNA 3V5OA 4JKKA 4JL1A 2PDWA 2E9LA 4C91A 4FB7A 3V4BA 2PDJA 3S2CA 1O7AA 3W6YA 1B4EA 2CFFA 3W75A 3SI9A 1BYAA 4PH6A 1FWHC 3POHA 4EXBA 3GRIA 2PDFA 4Q32A 3C3NA 2E0PA 5LYRA 1AJ2A 1PYMA 1Y65A 5F2LA 2ZICA 1QPNA 5C9RA 1EX1A 2YDAA 3NSNA 2CLMA 1O66A 3H21A 3N19B 1TWIA 3O1NA 3PNUA 1QR7A 4NRSA 1GUVA 1E9YB 2ZXDA 4PUUA 3R89A 4HU0A 4IGNA 4J3SA 4YXGA 4IPPA 4DM2A 3NQAA 3VOIA 1FWNA 4WIWA 4DNHA 1Q6OA 4HU4A 5C70A 1L6FA 1AUSL 1JDEA 1K9TA 4PZVA 2I9EA 3N17A 5ABFA 3N12A 4FLSA 1XLAA 1Z48A 4W93A 3ZQ9A 2QUVA 4LV9A 3L12A 1SVDA 3ITXA 2Q01A 4O19A 3OZYA 3P80A 4AVNA 4QXIA 2PP1A 3LCWA 2GQ3A 3WH5A 2AL2A 4WSJA 4GYPC 1FHLA 1RP9A 5AYXA 4PC8A 2G95A 5CBIA 1GG0A 3DERA 5I0DA 4HPXA 4HNCA 4HSOA 1BEUA 1ZAIA 3M0LA 3D5HA 2PTZA 3AYSA 4S2BA 4N6FA 4UQCA 2ZRUA 2ZRZA 3QV6A 4BJHA 4WX2A 4PMQA 1K7FA 3KXQA 4L6DA 3M4HA 4QG6A 1A3HA 3E0IA 1F76A 3AHZA 3IRSA 3UWVA 4LSBA 3WQCA 1O1ZA 2OX4A 2C3ZA 2NX3A 4IM4A 3BGJA 3LXAA 3OIHA 4UQAA 3ECQA 2FGBA 4FSAA 3R43A 3K5XA 1XRFA 1M6JA 4LCSA 1SZFA 3SCQA 2F84A 1KBLA 3TR2A 5A2CA 3SURA 1RCOB 4MHBA 4B3ZA 1FDZA 3IPWA 2NQ5A 1UQZA 3AHXA 4R27A 4J3UA 3L65A 3F1QA 3W01A 3I68A 4YN5A 2YLLA 3WYZA 4C1KA 1VAHA 2XINA 3S9ZA 4K3ZA 1PZ2A 3VTRA 5J8LA 4O17A 3GBEA 2YBUA 4AC1X 1R7AA 5EMYA 4LC8A 5HMFA 3GYEA 3M7WA 3RM8A 1US2A 4OIFA 4LUSA 3LV6A 1DHKA 1IWAA 2F8QA 3PUGA 2A85A 3LHZA 1I2QA 5AB3A 2VFFA 4LYKA 1FCQA 3Q2DA 3ABSA 2VZUA 1FKXA 3VCRA 4FO4A 3W86A 1OHLA 3P82A 1Q5MA 1SMDA 3W9ZA 2V3GA 2A0NA 3MJYA 3MUY1 2XH0A 5TNVA 3MW7A 3VIKA 4UR8A 5KMYA 2YCIX 3GXNA 5K9XA 3I6EA 2FB2A 4AIEA 3CIXA 3GIQA 5FAJA 3R79A 3PAJA 1HGYA 3PHAA 1R3QA 3HV9A 3OLEA 2XVGA 2YSWA 1JXKA 3CHDA 4H01A 3LQGA 7A3HA 1F6PA 5KZDA 4C7DA 3CHVA 2GQAA 1JFXA 4E2OA 3KCJA 4D72A 1XH0A 4H9TA 3VVGA 3MKCA 4O57A 4X60A 3GDMA 5K3VA 3WMSA 3GYCA 3M6YA 2VCAA 2VZOA 1WV2A 2ZIDA 2DH3A 4LW7A 1ZTVA 1J2BA 2G41A 1XIMA 1ZJBA 3A21A 3F4CA 3SSJA 1ZP4A 4K8GA 3JW7A 1PZ0A 2ZRWA 1JPDX 1S1RA 3GNNA 3QHNA 4CU6A 1M3UA 1OEPA 4MY9A 3WJYA 3MY9A 1R3TA 4US5D 3R2GA 3PF3A 4MM1A 2DQWA 5A5WA 4JFTA 1SO5A 1LUCB 4HD5A 3W7OA 4GX9A 3VUPA 1TKKA 4WEVX 1E15A 1QPQA 1PE1A 3G1DA 3E0LA 3EDEA 3IJ6A 3AOFA 4XX6A 1H4PA 4K8HA 4W84A 3W7HA 2YA2A 1MEIA 1VC4A 1MZHA 2V2HA 4L9ZA 2GFTA 4UCGA 2X09A 4UTTC 4I7VA 4I8YA 4KMQA 1AQHA 3GS6A 3CT7A 1B3YA 3QF0A 2EG6A 1K4GA 4JHZA 5DY2A 2ZZ5A 1HL2A 1T5AA 2PTWA 1E1FA 4QE4A 4ZR8A 1QASA 4OV4A 1ZGDA 1LDCA 1Z6KA 5AVHA 1D8CA 3R4IA 4LPCA 1JGMA 3V36A 4DJDD 2I5QA 2VEFA 2OEKA 4WY0F 3STPA 1A50A 1LBFA 4XUYA 4CCEA 1FH8A 1Q63A 5JQ9A 4QNEA 3DFQA 2AQWA 3RX4A 3AIRA 1ICPA 3WCZA 1B3XA 5LIKX 4JQ2A 3RMJA 4LFYA 3K4WA 5BU6A 2FPYA 3KHDA 4H2HA 5BCAA 3GM8A 3LBCA 3N14A 4Q8VA 4YVXA 3W88A 4KFPA 2XM2A 2ISWA 1RXOB 2PDYA 4ZE5A 3A12A 1UIPA 3GSMA 3VYLA 2GGGA 1E6QM 2Z2BA 1E3XA 1KFCA 3T9PA 2XH4A 1BLIA 3UWEA 4AMCA 3UJSA 2VEPA 3CZEA 2XVKA 1B1YA 1SGJA 2VEIA 1CWYA 1BRLB 5FEXA 2TAAA 2CEQA 1Q7MA 3RCNA 4KIEA 2ZUSA 3UR2A 3RPDA 4IL0A 4KT2A 4FNPA 1QU4A 3EOLA 3SCRA 3F4WA 3IJIA 3VDCA 3MSGA 3SCPA 3WQPA 1WDSA 3MV11 4LV4A 2V2DA 3W7MA 1LROA 2GDVA 4V1YA 4M6UA 4F2TA 2NXIA 1HJUA 3W4RA 4H41A 2NWRA 3ZS4A 1QHPA 4MB1A 2WM1A 4QNWA 3WK1A 2VUNA 1MRQA 4EXQA 1RY0A 4O1FA 3PNZA 1DWIM 3ZOAA 4DWSD 2ALRA 5CPTA 1NH6A 2QF7A 5CKSA 4PE8A 2E5CA 4JQ3A 3KW3A 2EGZA 3LI0A 3LNMA 2E9BA 1E71M 3NDZA 2QJJA 2QR6A 1JUEA 3C2RA 3J7HA 2Q02A 1X1OA 1R2SA 2HJPA 1UR2A 1BSLA 1KRMA 1XKYA 3MA8A 4Z2HA 1AQFA 4S1FA 4FZIA 1KR0A 3P5YA 3LMYA 1ZENA 3S3GA 3SRDA 5AYYA 4GRSA 3MDWA 5L9FA 1M41A 5HOSA 4JN6A 3GD6A 3ZSSA 4K68A 1AH3A 1BKSA 1CX9A 5IXEA 3HMCA 1TREA 3NQGA 4H6QA 3DC8A 1C8VA 4RV3A 3GNXA 1ECQA 4K36A 2VD8A 4E6MA 1K8ZA 3EA2A 1KLZA 3GVGA 4HYWA 2C18A 1F3XA 1BWLA 3NJ3A 3S5ZA 4ZB0A 3G0XA 1H63A 3W6MA 1QBBA 4NJHA 1Q4WA 2WQDA 3L4TA 1JL8A 4NL1A 3W7RA 2Q3OA 2CNCA 3CO8A 4ZXLA 4F4RA 2YL9A 1QNQA 5U4NA 3MHUA 1OZQA 3N29A 1OBAA 3N3MA 4IHCA 1C9WA 5FEWA 4IIBA 3FEMA 3URBA 4JTKA 3LPFA 2DW7A 3MKVA 1K4HA 3KEHA 3BWWA 1VIZA 5A8OA 5I78A 3CUIA 1CGYA 3MTWA 3T2PA 3QVQA 1BQGA 1TV4A 2WZTA 3EB3A 1MXDA 1PEZA 5CPMA 1VJSA 4DPQA 3RCYA 3SGGA 3V5CA 1Q2SA 4JTRA 3F2BA 4FR6A 2C16A 1XLIA 5FF7A 2B31A 2QAPA 3VD9A 3FXYA 4JS3A 4UUIA 5CC5A 4R53A 1VQTA 4Y7EA 1J01A 1Z41A 2GVJA 2ZOXA 3CS2A 3QOMA 4DLMA 1GVOA 4I5XA 2GJPA 1DKWA 3V5FA 2OWWA 2OMAA 2VI0A 2BHZA 3NG3A 4RKAA 1E40A 3KTCA 4F79A 2B4GA 3CUGA 3L67A 5U7SA 4UTMA 3R8HA 4K6AA 4NUWA 1KB3A 1JZ3A 1UMLA 4N4QA 3WH6A 1IF2A 3IVSA 3M44A 2PGWA 5C9ZA 4MWAD 1GJUA 4PMYA 1O5XA 2OLSA 3H12A 4FX8A 5ECUA 4G7FA 5A3HA 2HZGA 2Y6ZA 3GVWA 3UPBA 1EH9A 5D2VA 3R58A 3HPFA 1GNXA 4XO7A 3EKLA 2D3NA 1JJKA 2VENA 1J9YA 4IMDA 1LOLA 2WZIA 2ZQ0A 3DHPA 4FXFA 4E3TA 4PTXA 1A4LA 5AC5A 3DGRA 3TXZA 3FS2A 3MS8A 1FFQA 4OV9A 4GKLA 3PM6A 3TONA 4YWIA 3AXKA 5CJMA 1TWDA 4IPJA 3NZGA 3CQKA 3TW6A 1ITXA 1KXTA 3WF3A 4LWWA 4RJEA 2W79A 2NVDA 5D02A 3AS0A 1B3WA 2PPGA 4GQGA 1KWGA 1J4EA 2XFYA 5B7YA 2YXOA 4PMXA 1IV8A 2C13A 2ZUTA 4FX6M 3LRLA 1F4AA 3OQEA 1AD1A 3MKKA 4XVEA 1N8FA 3GG1A 9RUBA 3V35A 3WDHA 1W8GA 1CLKA 1JF5A 4D6IA 3ERPA 1UUOA 3JRKA 2PDCA 4UR7A 3ANVA 4F0SA 3ITVA 2IMRA 1LLOA 1L8NA 4O15A 4JTDA 2KZHA 2PWGA 4GJJA 3BO9A 4YWSA 2CLPA 1HJQA 1WPCA 3BXWA 4EPKA 1DHPA 5A8QA 4KGJA 3R7MA 2I56A 3IJ9A 5FD0A 4GUIA 4DWSA 4EXAA 3AMDA 4Z2JA 1TSIA 3C4UA 1TPWA 2W5FA 1UP2A 1Z69A 3VDHA 3BLIA 1K7XA 3HM7A 1QCWA 2ZTJA 2BODX 3C2OA 1WUFA 1EFZA 3DC0A 1V3JA 5EMLA 1OFPA 3FHQA 4O12A 1G5AA 4A6GA 2ABBA 4W7VA 2Z29A 1R3RA 4FALA 3UA3A 1EC7A 1WUEA 3DDMA 2DZWA 1P0EA 5KZMA 1UH2A 2CXEA 4DO6A 3IVUA 3SRKA 1JEZA 1HJXA 1XD0A 1FBAA 3P6LA 1V3IA 4JEJA 3Q4DA 1QWKA 2FZ9A 5KETA 3WQ5A 2R8WA 4WGHA 1E55A 4LAMA 4Z1DA 2FDSA 2QPXA 1ZU8A 3QZAA 4XG1A 4IIDA 2VZSA 4NX0A 2PDLA 5BYWA 5DY3A 4AD0A 2ZXQA 5HNNA 4FNUA 1AL7A 5AOUA 1TUXA 3FX4A 1EIBA 3UGRA 3BV4A 1TQJA 3OIXA 3PBWA 4M0XA 3T40A 3V0UA 1HZYA 2FGZA 5EL1A 3UXIA 1EJTC 2O92A 2W66A 4AD5A 3L4XA 2Y0FA 2NQLA 3M5YA 3B06A 3GB6A 3KLKA 2BVYA 5CSRA 1KR1A 3NZPA 3RF9A 2IKIA 3GXFA 4LF2A 3W29A 6XIAA 3IRDA 4FNTA 4XBJA 4M81A 5A1AA 6ENLA 4O54A 1DJHA 2I5IA 1T96A 4M51A 1XFCA 3VE9A 3AIEA 4HJFA 4GGHA 2V9DA 2POTA 3SUWA 3Q37A 1ZCCA 2VRKA 3PUDA 3RAOA 4BWLA 2WPBA 3B8TA 4JBRA 1KM3A 3WQWA 3LS9A 1CB7B 3VO0A 1GOIA 1YDVA 2PGEA 3SM0A 1UR8A 7PTDA 2OODA 5MHBA 4UTUA 3P84A 1QHZA 2EG8A 1A5KC 2D1ZA 5E1QA 9XIMA 2ZVRA 2V8ZA 2NQ9A 4LUSB 4H6RA 3BL3A 3BG9A 1PTAA 2FYMA 3UG4A 5HNRA 3LY0A 3ZJKA 1O12A 5M03A 2ZZ4A 5EBUA 2PWDA 2Y7DA 3DHDA 3L2IA 1AK5A 3BZJA 4A8RA 1F5ZA 1GYNA 1H5YA 2FH8A 3KCOA 4XZ9A 5F4XA 3HJEA 3W07A 1ZS2A 1W2PA 4NVTA 4F2UA 1Q4NX 2WO5A 4AUBA 3KBVA 2JQXA 1AODA 1FWFC 3ARUA 4GO9A 4XD5A 6PTDA 5DMNA 3NSMA 3M0XA 1JD9A 1PCKA 4IT1A 4Y96A 4KEUA 3OP2A 3WJZA 3G2GA 3SR7A 4OUEA 2DUZA 5LXXA 4IWWA 3A5VA 5T9CE 2IW0A 4NJJA 1D3HA 4GVIA 4AYSA 1EEXA 4XISA 4FLRA 2VMFA 4W88A 4TO8A 1NSJA 1XV8A 3N13A 3DHFA 3MMUA 1UKOA 3BGGA 4PODA 2J7FA 4H9ZA 1RALA 3WLTA 1LRTA 1TA3B 4HP5A 1I75A 3FJLA 1Z42A 5GNYA 1W32A 3CZKA 2WWCA 5ABFB 3L2LA 3GDLA 3QQ1A 3PPCA 2YB4A 4Z1BA 1DJZA 2YCLA 2PS2A 4OBTA 2DGAA 3NCOA 1H11A 1W9VA 3LSCA 3GH5A 1I6NA 4KWWA 5DEZA 3AIUA 2EKGA 2FVMA 2XZ7A 1NWUA 3S1GA 3CASA 2XFRA 2YL5A 3F4NA 4P8XA 4H1ZA 1MUCA 2ONEA 1EO5A 4W7UA 2YCLB 3QV7A 5HK4A 4JNZA 1JRBA 1QNOA 3QZ6A 3K4AA 4PYSA 5J04A 1QTWA 5I3FA 4WUIA 4QAIA 3H53A 1XYCA 3T0AA 1EGMA 4QCEA 3WBEA 1E0XA 4HU3A 4O4VA 4FIRA 3WEOA 2YYUA 3FYYA 4PMDA 3AROA 2WXDM 3E38A 3T81A 2Z1BA 5HA7A 2YBVA 3PWGA 4W85A 3T44A 4F0HA 4CCCA 1ADSA 1RV8A 1NIUA 3GZ3A 2QXWA 2OSWA 4O0QA 1RK6A 1CXKA 3PUEA 3T1GA 4W87A 3IARA 1J18A 3OA3A 1V3LA 1DBTA 1A80A 5A94A 3TW9A 2J8GA 3HGJA 4DJED 3KL3A 3UCQA 3WUBA 8RUCA 3QHMA 4B15A 1GEHA 1D9EA 1VEMA 2RDTA 3DXIA 3G77A 2Y7GA 4IQJA 1S46A 3T8QA 5I02A 1V6WA 2UY4A 1WCGA 4I9TA 2YL8A 5IHRA 1LM1A 4J9JA 2ZUMA 3FK4A 4BQ4A 3LM7A 3MT1A 4XZLX 1K8XA 5F1UA 1I8JA 2C14A 1HX0A 5JVLA 4C6KA 2Z7GA 3MVIA 5LA2A 4HOWA 2PRLA 4LB4A 3HA1A 4HSHA 2BLEA 3TTSA 1SJDA 1TPVA 4AHQA 1GVRA 2BXYA 4TXEA 3M0ZA 5XIAA 2V68A 4R88A 4FAMA 1UKSA 3B0UX 4Q8PA 1Z3NA 2OEMA 1F3WA 3NSXA 1G01A 1K9DA 2PWEA 5FIPA 1DIKA 4GI4A 5B7ZA 1A0CA 4YU1A 1A5NC 4NAEA 4AHPA 3LCIA 5CG0A 8A3HA 3GC4A 4MOZA 4QJ3B 3VGBA 3W70A 5HMEA 1E4LA 1PKMA 1WDWA 1IWPA 4ZQNA 3DKLA 3FA4A 1YHTA 3IIPA 3F03K 2WJFA 1ADOA 4JKLA 3Q65A 4N6EA 1XPGA 2GL5A 3W72A 3AIVA 3CUXA 4O14A 5LA1A 3UZJA 2YGYA 2BY2A 3W1QA 4HQVA 1H7XA 3WLPA 3VILA 3M6DA 1M68A 4GNVA 1NF0A 2ALDA 3BG3A 4UFHA 2OZ8A 1NDVA 4H7CA 3M41A 2CLIA 4I3GA 2ZZ2A 4NQ1A 3NDYA 4KESA 1XUUA 1RJPA 3QN3A 4NT0A 4OKDA 4QCFA 4W8LA 3OGVA 4TV6A 5HANA 1Q13A 2J74A 3SN1A 1MQQA 3H22A 1W3IA 1TPEA 1HTIA 3BSMA 3O6DA 1A3XA 3OA5A 1V5XA 4ZQMA 2DT0A 1MRAA 4CEXC 5A69A 1RJRA 2CHNA 3U5YA 4GCXA 4DYKA 2OWCA 4DZIA 4WJXA 3GNDA 1BF2A 2NX1A 1XWYA 1OIFA 1U5HA 4BHYA 2UY2A 2IQ0A 4KIRA 1OT1A 3G1XA 2WCAA 4CQDA 1LL4A 3B8IA 5A2BA 2YZRA 4G5DA 3TJLA 3W87A 3EX4A 4YMZA 1LL7A 3HGOA 1J0KA 5D33A 3PUOA 1HP4A 1V0KA 1P0DA 1V6VA 3B8UA 3CU2A 3EB4A 4IPLA 4OOZA 4J3XA 2BG5A 1ONWA 4AAJA 4AWEA 4BK9A 3NYZA 2NV1A 4S3CA 3CV2A 3M0MA 2PU1A 1F73A 2HPIA 1EUNA 2VOMA 1VP5A 5CPSA 3ORWA 1CXHA 1XYMA 1FVPA 2HWGA 4GH1A 4F8XA 1H7PA 3DGBA 3N6JA 1J2WA 4Q8OA 3C2YA 1V3KA 2DVXA 5D09A 1JUBA 5CPQA 3NEVA 2NV2A 3IAPA 2YW4A 1Z7AA 2HV5A 4UZUA 4GYPA 1OZMA 3PK7A 3USZA 3VDGA 3M0YA 3URQA 2OR2A 5F4WA 3A64A 2PF0A 1W37A 4CCDA 3MI2A 3KVKA 5HNTA 1KBIA 2J7BA 3IK2A 3AS2A 1S2UA 3VDAA 4AB4A 3ZZ1A 3L68A 1XYAA 3AS3A 1R9YA 1RZMA 3NXLA 3W1XA 3RRAA 1OINA 4HA1A 1BYCA 5CBJA 2Y4SA 4UNLA 4JDYA 1WKYA 4B16A 3B0VC 3PB0A 2Z0IA 2IPFA 3OTRA 1FH7A 2QIIA 4PEKA 3TQKA 3VOCA 1GK8A 2TMDA 2HTMA 2FGLA 4H04A 2ZX8A 1XR2A 3WLSA 5IFTA 5LGZA 1GW1A 2VGFA 3MUXA 3EAUA 3WNLA 3UWYA 4L1WA 2ZA2A 1C8YA 4TQTA 4JTCA 1E0UA 4D6JA 1QNSA 1RLDA 2VKZG 1M9HA 3EMZA 1QI0A 3C0JA 5AY7A 4DB7A 4GVHA 1DQUA 1DEDA 1Q7ZA 4NZFA 3STGA 2Z26A 3NO1A 5M17A 3DIPA 1W9BM 1LOQA 5C9WA 3M16A 4L1XA 5AHIA 4I9AA 1Q65A 2IPGA 3GW0A 3B03A 3PTDA 1QO5A 2EEXA 5HQEA 1QPRA 2GPTA 4XKYB 1PL9A 2CKSA 1O60A 1UWTA 4MLJA 1B54A 1XPYA 3MSRA 4L65A 3UPWA 4DWSB 2OZTA 4DXXA 2J7EA 2D0HA 4KGLA 1QATA 1H61A 3UESA 4GI9A 3ABRA 4V27A 1H1NA 4KRTA 1V93A 4LT9A 5HPCA 3CPUA 2GVGA 3CHFA 2G5WA 2FFIA 2QCFA 4IG2B 3ZR4A 3A4AA 1TFVA 1KFBA 5G1MA 1ZAHA 3LU2A 1RQBA 1OK6A 3TDFA 1K9EA 4XO6A 1JRCA 2JEQA 3E3HA 3DI1A 5F2IA 3L5AA 1VPXA 4QQUA 1AD4A 3OGRA 2R9RA 3LXCA 4QISA 1PIGA 2A3LA 5CPOA 3UBPC 3S2NA 1QI5A 1KKRA 3HGSA 1VJIA 3P93A 4GI6A 1XRVA 3QGAC 2CHOA 3BG5A 3SDOA 4B5VA 1W3HA 3QH2A 3WL0A 4DZAA 5GNZA 5HMDA 1A5CA 5CH9A 5G1TA 2F38A 3N15A 1XLEA 5C2GA 4ACZB 4TIMA 1JZ2A 4PFMA 3AI0A 5CCZA 3NQ6A 3EOSA 4QIUA 3NEHA 3UA4A 4OE7A 1WDDA 3OBKA 1XCFA 4GINA 4UFLA 4AD4A 1HFBA 2F2KA 3TAOA 2V30A 3TA6A 3QMSA 3WIJA 5ABHA 3WQ4A 3SFWA 5J5RA 2X0SA 4H8HA 3NA8A 1FA2A 4RXFA 1JDFA 1DTUA 2PRMA 2O7QA 1XXXA 1BVZA 1SW0A 3FSUA 1SQ7A 1N55A 2RJHA 1S2CA 2J6VA 2IPWA 2CPUA 1EJSC 1XIDA 1ONRA 3GDBA 3RMEA 2QVNA 2BVTA 3CUHA 5HWMA 1L8PA 3W22A 3W7PA 3NAVA 4PUMA 3KVJA 4NZJA 3T07A 1JZ4A 1NF7A 3VNLA 5CZTA 4Q8MA 4PMNA 3H7UA 3O8AA 2CZFA 4KH2A 4Q4PA 1VLIA 2GK1B 4MFEA 1YADA 3LGEA 4XBKA 2QJGA 1XX1A 4IMEA 2CW6A 4L1GA 1AVAA 1RR2A 2B7NA 3S83A 4TX8A 2F6UA 4GYKA 4TX6A 1QNRA 3GO2A 3ZR6A 1DJIA 4O28A 5BRQA 2WMHA 4F2BA 1MW0A 2A3EA 1UD3A 4O16A 2OO6A 3IJ7A 3W84A 4XIAA 2I1OA 3SCNA 1X6UA 4PTDA 2VCBA 5FF4A 4A05A 2DZTA 3O16A 2QLYA 4PUWA 4AFYA 3LHWA 1GVSA 4REQB 4JKMA 5D2TA 4JFVA 4IFKA 9CGTA 2WVVA 1QOQA 2OVLA 5DMLA 8TIMA 4JTHA 3LHUA 2C91A 3E1F1 4JQ4A 2E9MA 3QRHA 1TCDA 3EDJA 3NPVA 4HNOA 5T9BG 1EZ2A 1EGZA 4KW2A 5K9CA 4WQ6A 3K1GA 2J77A 1GYMA 1XLDA 4QROA 2NLIA 4OZOA 3BLOA 2Y8UA 3ONCA 4PFHA 3RR4A 1XW8A 2DZAA 4BZYA 1EP1A 1SSDA 3R8RA 2RDWA 2QV5A 1JDCA 4A3UA 1MW2A 1EDGA 1FWSA 4DJDC 3UERA 4KEVA 4KETA 2PEVA 3SEPA 3AHTA 2O9RA 3ENLA 1C7TA 3BLLA 4Y9MA 1ITQA 4DWSC 4YVVA 1W0MA 1XBZA 4DJEA 1JCNA 3LTSA 1EA0A 4JX5A 3M9YA 4GKTA 3N2MA 3THQA 2O0TA 4GUHA 3WLMA 2WHMA 1EYEA 3L7RA 4JY9A 1KQYA 5F7UA 4CU7A 3KFTA 3OW1A 5E0KA 3UU0A 3ARPA 3LLXA 4LYQA 1MZRA 2VFDA 2LLEA 3DX5A 2J47A 3MB9A 1ZBVA 4DELA 4GZJA 3URAA 2VC9A 4GMEA 1XIGA 4LS2A 4GABA 4UMAA 3APTA 2TODA 4E4UA 1YTEA 3WLJA 1SFJA 1XRSA 3BVJA 2NWSA 3BARA 3TE9A 3L5LA 4QDMA 3CZGA 2VGIA 2GSJA 3BAJA 2QVHA 2VNCA 2H6RA 3S0CA 1AW2A 1GPFA 1PZ1A 1BF6A 3FW6A 2IQTA 1K02A 2YDSA 2GVLA 4YCPA 2EPNA 2DU2A 2NT0A 3M46A 2GJNA 1Y7VA 2XJ7A 3N2TA 1W3TA 4UQDA 1P4CA 4N9CA 3H2OA 5JBDA 1IYXA 1R47A 5FJRA 2C7FA 1SJBA 1FDYA 5C55A 1SO6A 4C6IA 4CD8A 4ATLA 7ODCA 2BGNE 2VEMA 4EACA 1E0VA 2J79A 3RX3A 4DBEA 3E2RA 3N4EA 1M04A 3EPNA 3LBOA 4N7QA 1FH9A 2OOGA 2OX1A 2NV9A 1UWRA 2HBVA 2FFCA 1SFSA 1EX5A 2BOFX 4FOKA 3HU7A 5G4EA 2PCQA 3C2EA 3WJSA 1K7EA 1C7SA 2UY5A 3NO5A 5AC7A 3VZYA 3WF4A 1NFBA 1VEOA 1F6YA 3RFAA 3JS3A 3NQFA 1MFVA 1F07A 2WOQA 1ESWA 2W9MA 3P74A 3CL6A 5SWUA 5M5DA 1JIBA 4FLQA 4ZE4A 2PDGA 2ZRYA 6A3HA 1UKTA 1WDPA 2JGQA 3C0LA 6REQA 1HJSA 5BOEA 1KRCC 4W8AA 5CAKA 1IR2A 3LLFA 5JBEA 1E1EA 3IGSA 4ZFCA 2VGGA 4AISA 3IJDA 1UJPA 1HGWA 1TPC1 5AHNA 4LJ3A 6ALDA 1GQNA 4MWAC 4BEUA 4QBXA 1V3MA 3RX2A 3KRZA 3S5YA 3A4WA 3L4WA 4A3HA 5JIWA 1GG1A 4B2DD 3L4UA 1GVYA 2E67A 1IEQA 3DFPA 3BAYA 4I90A 3W85A 3WF0A 1GOXA 4R9OA 5BU9A 4O1DA 3GAYA 4HMNA 4ATDA 2GWGA 4Q8QA 3MI3A 5I06A 4E38A 4S3AA 2XWEA 3ISIX 1JAKA 3IIZA 4Y90A 3BURA 5FL0A 3E02A 2Y61A 3OZPA 2BY3A 1PX4A 3SBFA 3U2ZA 2V3FA 1YX1A 4DO5A 1LBMA 3STCA 1MXGA 3WD2A 1JPKA 3G3MA 3ZYZA 5AC8A 1X1NA 4LF1A 4HA3A 4WDTA 3WG6A 1OABA 3S2LA 3GTXA 5AHMA 5D9OA 2V5KA 1OFOA 2DUXA 2HE5A 2QCGA 3REQA 5CJNA 4P7RA 3BV7A 1S39A 2RFGA 5TQLA 3ARTA 4M19A 2FTYA 3LCLA 3OJGA 4JL2A 4UC5A 1I2PA 1OYAA 2Z1XA 3W27A 3QKEA 4YHGA 2VURA 2C8NA 2REQB 1QXLA 1P0KA 1R3SA 4IQEA 1R46A 3OVPA 4P8UA 1WQ5A 1CEOA 1SFLA 3QW3A 5EFDA 4Q4RA 2AAAA 3CK5A 3HB9A 5DT5A 2QCDB 5I6SA 3SW6A 4WOZA 1AZ2A 1SR0A 4LBSA 3C8NA 3O6AA 2REQA 4C6CA 5D8ZA 2G3IA 2Y5EA 2PZ0A 3KTXA 4BF5A 3QBUA 1JF6A 1J10A 1QNVA 3S9IA 4HPHA 4IUOA 1OFRA 1WX0A 5C2CA 3KOXA 3I3EA 3RM4A 2JF6A 3C8FA 4Y8EA 4PB5A 5D2XA 3W7QA 4ERIA 3U2OA 3MBDA 3VIJA 3ITOA 3W6LA 2YDQA 3LHTA 4M1BA 3A47A 3NQBA 1ZY9A 2PP0A 3RNDA 4LC6A 4XB3A 3S9YA 1DQXA 4HK7A 1TIWA 3WZ0E 1P6BA 1GTEA 2ZADA 4RE0A 3GTNA 1MUMA 2AGKA 2F9RA 3BMVA 4M6VA 2WZEA 1HVQA 4MSSA 1KBJA 3G1YA 5DX7A 3LM3A 2DSZA 3RN6A 3MWAA 1MXSA 3P5ZA 2DZXA 2XIJA 4ORMA 2AMGA 3AXHA 4UTWA 4NF7A 1OADA 2R82A 3LB0A 4BF7A 1KFEA 4OECA 2ZYFA 2EAWA 3G3DA 4AZ7A 3L2MA 1NWSA 2ZDSA 1E3ZA 4POCA 3WLKX 1CLVA 1EOKA 4I6VA 2D73A 5A6BD 2VVNA 3VX1A 2EPLX 4QR6A 3V0TA 4MZ1A 4YYCA 4RDYA 3DUGA 1X7FA 3EWCA 3LA4A 5LHFA 2WPGA 2V69A 4YHEA 1BVWA 4ZB2A 1VS1A 2Q8ZA 2X41A 3T55A 2R91A 1DTNA 1FWDC 3MUIA 2BB0A 4IX0A 2YZ5A 1P7TA 4PMJA 4GQ0A 2ZCGA 1A5BA 1E4NA 1V02E 5BZAA 3TSDA 5DELA 4GIEA 4KFNA 4WY0A 1KFKA 2DSWA 3TN6A 2A6LA 3S1UA 1WZKA 1TV5A 1O5RA 2ZZ7A 3BSHA 1EBGA 3LENA 1B5TA 3BK0A 3SADA 2GSHA 2R24A 3M64A 3PBVA 3KBNA 4WGXA 3VIPA 3T05A 2E5DA 4J5NA 1FCBA 1TX2A 3TXVA 4WY0B 2WHKA 4LYPA 4P7NA 4AC7C 3CZLA 2HROA 1EYWA 1B90A 2BX7A 3MV01 3H4XA 3AYTA 4MJMA 1RQHA 2NLYA 2PLCA 2JKPA 6TIMA 5TD4A 1DWFM 1FHVA 3QQ0A 1XGEA 4NNCA 3Q45A 3W25A 3PULA 1UUMA 1FXQA 3KOYA 1CB2A 1ZB5A 7REQB 4NZ5A 1YDOA 2R6OA 3ID7A 1ENUA 3WK3A 1QW8A 2WMIA 4C6OA 3HG2A 1RH9A 4GBUA 3HFTA 4DEFA 3O2LA 1J12A 4GNJA 1TWWA 3SGZA 5LKYA 5FJOA 3U8GA 3W1PA 3NQCA 1ISYA 3NZ1A 1BXCA 2W63A 1EKOA 3W74A 3GVRA 2BMBA 2XIIA 1KM5A 1A5OC 4OBRA 4AQLA 1KGWA 4NSBA 4ML4A 1M5WA 1VPQA 3HPAA 3EOOA 4IH3A 1S2WA 3NL6A 1JCTA 3C61A 4L4PA 1YE4A 2E3ZA 1RHCA 5EY5A 3JZUA 3RJXA 2QMKA 4L6HA 1RVKA 2OGJA 5BXTA 1FHDA 1X98A 3U5UA 3L23A 3TX9A 2GQ8A 4AZCA 2XIMA 3CIWA 1SZNA 1R3YA 3QZEA 2C0HA 1H50A 4H6EA 1FWWA 2DT2A 4ICCX 4DAIA 1KRBC 1S5TA 1WZLA 4EVZA 4ZODA 1XIHA 1VFFA 4JTGA 5A6AA 2V3EA 3AXIA 5T91A 3WNOA 1SU5A 3VE7A 1DJNA 3NO3A 3G1VA 2FVLA 3MP5A 1FWGC 3I7SA 4TUFA 3SUTA 2E8ZA 5IBXA 3B4UA 3S4TA 4F3HA 2Y1HA 1WAWA 4AX6A 2VDGA 2Y8VA 3PFRA 3NURA 3WDJA 1J79A 4WXYA 4E2BA 3WFZA 2NUYA 4GIRA 1JYWA 3APGA 2Y88A 2XN0A 3HG4A 4GQQA 4GACA 1THFD 4UMCA 4X2PA 2YX0A 5FL1A 4UR9A 4RNHA 2ASHA 4U28A 2F2HA 4ZB5A 3DHUA 4IICA 2OZ0A 4FXRA 3TFCA 1UA7A 5BXSA 4NILA 1QPKA 1EP2A 1I0BA 4JHMA 1R3WA 3FXGA 2G96A 2ADAA 3BSGA 3VCNA 4X61A 5D4YA 1D7KA 3T8LA 4H9YA 3TN5A 1REQA 4E4FA 2PB1A 3CUFA 3U4FA 4HMEA 2VFIA 3WF2A 4UQEA 3SJ3A 4MNJA 4MB4A 3PANA 1GKPA 5A8PA 3IGXA 3KS5A 1ZP3A 2X16A 1W3KA 5BMXA 1IIGA 3BOLA 3ONBA 1ZBWA 3UXAA 1IGSA 1HG3A 4B4HA 3WDPP 1UIOA 3LZ5A 4ENLA 4JN8A 4J3WA 4GVFA 4KEMA 4XAPA 2YA0A 1WBJA 1MEHA 3CV1A 4PN2A 3TJ4A 3LG3A 2NUXA 4ES4A 4FS9A 1X6LA 4IP7A 4EIVA 4CD5A 1J93A 2CZ5A 1AQMA 3UWWA 5M3WA 4ZO7A 3WD0A 3UZ5A 2CU0A 1G4SA 3V0SA 1NDYA 4FA3A 3BUVA 3AJ7A 5BRBA 3N2XA 4ZMGA 1PX3A 4P7LA 1XYLA 4C90A 4Q4KA 1PHQA 3VZXA 1YPIA 3CWNA 3UJRA 2Q09A 3VOJA 2QPUA 1UBSA 5HR6A 1US3A 3AHVA 3WLOA 3EMCA 5C0QA 4ZSUA 2QS8A 1JVNA 2VFEA 1V77A 4LS1A 3WO8A 1XBYA 3ZJ8A 5CC3A 1L9WA 3GX9A 1FWCC 4JICA 4IISA 2PZNA 2RDUA 3MWCA 3AZSA 3PPFA 4H9UA 3LZ3A 4PA8A 2HK1A 3G24A 3QC0A 4LXFA 1E4MM 3H4GA 4CVUA 4CNPA 4BI7A 4YTTA 3IGUA 1KM1A 4NYUA 1YPXA 3CTTA 1SFTA 3BANA 1RLCL 3FDKA 7XIMA 4DPPA 5DN1A 4FP1A 1MDRA 2INFA 4J4KA 1C8XA 1AZ1A 4C6DA 3B97A 5IFPA 1EJRC 3C5QA 3H24A 3WQVA 1HKIA 3BH4A 1TB3A 1XYBA 4TTGA 5TIMA 4JIRA 5I3JA 2X05A 1G6CA 1KM6A 4F0RA 2XUCA 4L4MA 1FRBA 2PDXA 4C6FA 1JFHA 3FKRA 3TSMA 3KL5A 3T4CA 3VIGA 3SJNA 3GTFA 1TPDA 5ABGA 3MCOA 3QQWA 2FTWA 3RO6A 4Q3MA 3NGJA 3WNPA 2VGBA 1OD0A 1J6PA 4DBWA 3O0FA 3CUZA 3DFTA 4IIHA 2J8FA 4JXCA 1WB0A 3GU1A 4CN4A 1GYLA 2XGBA 3ABOA 2FDMA 1TMHA 3KBSA 3FYPA 1FQ0A 3TC3A 1V08A 3EWDA 3ABZA 1OQFA 1ZJIA 3DZ1A 4M6PA 3PTKA 2I17A 3NNTA 2NUWA 5CZSA 3G8RA 4DO7A 4IUGA 5IDIA 3ANYA 3SCUA 5EBAA 3A22A 4HNUA 2J25A 5GQBA 1PIFA 4Q4SA 4NG3A 4ROPA 3T0DA 3NUKA 4INFA 5I5RA 3PTQA 1UP3A 4WR3A 1ZZMA 3MC5A 1UUQA 3EGJA 2QPSA 3N3TA 2A6NA 1POJA 5DCEA 2NSOA 3UG8A 3W1NA 1CENA 5D30A 1UR9A 4UTJA 3EBVA 1P5BA 5KTLA 3O6CA 2F6XA 3N4FA 3C2VA 1XLGA 1LL6A 3T4WA 1EPVA 1AFSA 4O11A 2E25A 2BTMA 3MMWA 8XIMA 4ADTA 2AQVA 4PTWA 1BWKA 2FZBA 1H49A 4M82A 1JI2A 1ZBKA 4N0RA 2AGTA 2PC4A 1JPHA 2ZFAA 2CBIA 4NP7A 4MWAE 2O9TA 1JDDA 1KCXA 3R5EA 2HE8A 1UROA 4PB4A 4MMWA 3W24A 3TNOA 2PDBA 2Z25A 1KQZA 3VKAA 3KLLA 3PPGA 3FNDA 5FESA 3IV8A 3GHUA 1NELA 1F9CA 1EOMA 1TO3A 4OTKA 2O9OA 1JDAA 1PX8A 4RDZA 2XN2A 1TZ7A 4JTEA 3QY8A 1DIEA 4FNSA 4JTIA 1Y0EA 3SY1A 4CVWA 4R7OA 4QSFA 1Y5VA 1CPUA 1UZDA 3GXPA 2HK0A 2J78A 4B3LA 4ZGYA 4ZEPA 4Q4OA 3H55A 3MUCA 3CH0A 1VFTA 1VFUA 4ECLA 1PSCA 3WFLA 3TJIA 3BAIA 4AF0B 2PTXA 2PDIA 1Z8AA 3RU6A 1HKKA 5DT7A 3NXFA 4U2ZA 3CQIA 3M1ZA 4R3UA 1HW6A 3ZIZA 2WC3A 4O53A 2VELA 1JYVA 2QYGA 4MKSA 3FIGA 4DY1A 2YCJA 3H54A 2XDFA 3HMJG 2ABAA 5T8GA 1GEQA 4RDWA 1KTBA 1G7UA 1Y8BA 3G5EA 2YCKX 3F7JA 1MNSA 3KUMA 2FZMA 1GVFA 3V3WA 1ZNNA 3THCA 3VU2A 2P8CA 4OVXA 1GVIA 4NJGA 4E8CA 2GVEA 2BASA 3EX2A 3WX7A 1FOBA 3PBGA 2Z24A 4P5UA 2FPVA 2BOGX 3UW6A 1O5KA 3AXXA 2G3FA 1N82A 2DSUA 3T08A 1GHSA 4UTLA 1H3GA 2KX9A 4O1EA 3TYBA 3W2MA 4XTDA 4IGHA 1WXYA 1EWEA 4Z2KA 3AXMA 3B9EA 1OF6A 4GBDA 3W7IA 5FKYA 5KZEA 3S2JA 3Q58A 3TW7A 3ELFA 3CT2A 4GI8A 1S5MA 3BW3A 4YTQA 4PMUA 3AIBA 3XINA 2DIEA 3W02A 3E49A 1DXEA 3W1AA 4XUGA 4U5IA 1L6WA 4B92A 3GG7A 3LXBA 1DQWA 3KOFA 1SYTA 2XGZA 4CNSA 1XBXA 3BLKA 3GK0A 5D03A 1IE7C 4MAZA 4IF2A 1VBRA 1EJ7L 1UD5A 1GQKA 4E8GA 3GC2A 2ZXAA 6TAAA 1Q85A 3M5VA 4ZOBA 2YW3A 4QTGA 4L56A 3VGHA 1Z9AA 5JMUA 4KWUA 1EEPA 1Q8AA 2PF8A 4JIQA 2WJDA 4L7ZA 4HPGA 3CAWA 5DBUA 3QMRA 2PDKA 5HBFA 3N4AA 1W2VA 2Q8LA 4TU1A 4DJFC 1WZAA 4RX0A 2WK2A 3P67A 4HOXA 3VKCA 2W61A 2PMQA 1PJ9A 1P7TB 1F6KA 3GH4A 4RE2A 4B5NA 1XSIA 2WAGA 2ZE3A 3QW4B 4OGZA 3TTOA 1XHGA 2CLEA 3F5LA 2Y5JA 1TR1A 3MZ2A 2PBOA 4D6EA 3DG7A 3E5PA 5BMWA 1V8EA 4HJWA 3AMLA 3FOKA 1BQCA 4XK2A 5CGQA 3R94A 2V38A 4WXZA 3FN9A 3BLFA 1LQ0A 4DJFA 4IQDA 4B5WA 1TTJA 5C54A 4UTKA 5EKYA 5FA5A 1NP2A 2X30A 4JX6A 2NQJA 1WXZA 1YIXA 4C6BA 3HIJA 3E5BA 2QCDA 3POCA 2AAMA 3AHYA 1FWRA 3B04A 2WMFA 4UOJA 4S2CA 3ARQA 4UTFA 2H8ZA 1BG9A 2OLHA 1J0HA 2QUUA 4AZGA 1GOMA 2OLAA 2J7HA 4HPNA 1JXJA 3W71A 4NZ3A 4UB9A 1A0EA 4Q33A 2PCEA 1CTNA 1ME8A 2NQZA 2MNRA 2V0TA 5GJMA 4DN1A 5CSYA 1B31A 3MUAA 4U3AA 4UOZA 1YMYA 1FX6A 3G6LA 1O94A 1OC7A 5DFAA 2BBFA 1Q3NA 4AEEA 2PDHA 3NQ7A 4DJEC 1T0OA 3RUBL 1S3HA 1WAUA 3LCXA 4CNTA 2ISDA 2HDJA 4NJIA 2XYLA 1ISXA 3WLRA 1M1BA 1ME7A 1VCGA 1ZRQA 1MO0A 3CBWA 5B80A 1TJPA 3UWUA 4AX7A 4JTAA 1YNPA 2ATSA 1XDJA 4UQBA 1SSGA 1TTIA 5D38A 3R0DA 5GJPA 4WD0A 2J8TA 4ZQPA 4DNMA 4J1OA 4HN4A 4ML9A 4V1XA 2ZX6A 1ZAJA 3UD6A 4MG4A 1R85A 1K1DA 4UNIA 3DFYA 2QCHA 1AMKA 2G37A 1UWIA 4NZCA 3U6WA 4TMCA 1OCBA 3B8VA 4IXHA 3C56A 1P0BA 1V6XA 4PCNA 1ONEA 4U10A 3AUOA 3YPIA 2A3CA 3F4VA 4RUBA 2Y7EA 9XIAA 2XISA 2CZDA 3BQ5A 1QOXA 4OU1A 1K3UA 1VPYA 5CSSA 1E56A 2E8YA 2I57A 2ODOA 1S5NA 1W5OA 3UY8A 2RGLA 1D8WA 5A6MA 3LHVA 3UF9A 1RPXA 3H7VA 1AW1A 5LA0A 1XCWA 1HO1A 1F4HA 1J5TA 3OLGA 2E77A 5I3KA 1CGXA 5FACA 5H8UA 2ICSA 3CGTA 4MUPA 5GNXA 3EX3A 3WLHA 1H51A 4MGGA 1T41A 3THAA 3OGSA 3AUJA 1WO2A 5FJJA 4HZMA 3S5SA 4C60A 4D2JA 5D2WA 4HVXA 3AS1A 5C9XA 1OG6A 3GFXA 2WANA 1E6SM 3ARXA 8CGTA 5BOFA 1PWMA 4FOJA 1PYFA 4BQ3A 3MBFA 3ES8A 4WLCA 3H6OA 2WNWA 4H8NA 1HT6A 1QO2A 1DXFA 3WBAA 2Q71A 2OOFA 2WZHA 1I60A 1QI2A 1UB3A 4MZ8A 3HQNA 1XF0A 2PUZA 4YVPA 1LCOA 2E4TA 1SR9A 5JXQA 1EC9A 5L6UA 2HPMA 2P88A 3TIMA 5BXPA 2VX7A 1FP8A 2A3BA 2CXGA 1UZ4A 3G0UA 3ATZA 4JGDA 5LSMA 2FZDA 3KRUA 3B4YA 4MKNA 3EWBX 5HWNA 5G4HC 4PMRA 1CZ1A 5KZ6A 4A8LA 2BWGA 3KAOA 1TMQA 3W38A 4YTRA 1FDJA 3SQLA 3GNRA 3BCJA 2BNJA 3IIVA 2QCNA 2DQXA 2G3MA 2GJRA 4GO8A 3TKFA 4LUYA 1CGVA 2D69A 4Q8TA 4BKNA 1GKRA 5M2FX 4US5A 4ZXOA 1SJAA 3NZQA 4GFSA 1PXGA 2VJXA 1P0NA 3U2EA 1XRTA 3PN8A 4CN6A 1U1UA 4FI4A 4ZVJA 4Z1AA 5C6MA 3GY1A 1UWSA 1CGUA 3QFWA 2WLZA 2EBNA 2QF8A 1TVPA 3CV7A 1OM0A 3KE0A 3VABA 5EYWA 1LZOA 1HKMA 2PTYA 3CQ0A 3WNNA 3IUDA 5I79A 3W37A 3S5NA 1WDQA 2DZBA 2RGMA 2O9PA 3M5XA 1IT8A 5BWAA 4LGXA 4B5SA 3TOPA 3R0UA 2EKCA 1ODUA 5K2ZA 2DIKA 5LNUA 4CNUA 3ITCA 3TAKA 3SO7A 2OWXA 3NPUA 2ACQA 3OVGA 2A7RA 1VFLA 4J28A 4GG9A 1TG7A 2RH9A 1X38A 3QPYA 1CXEA 3W1TA 1YEYA 1M7OA 3HN3A 1TMLA 3D3FA 4JYFA 5E09A 5DANA 3N1AA 3NZRA 1KM4A 4HNTA 1CI1A 3QM3A 3EWYA 3KX6A 4A8NA 1FFRA 1NFGA 1PKYA 1Z32X 3S6OA 3TN4A 1RCQA 1JCXA 4JHOA 3TYEA 3EDKA 1NOUA 3OYXA 3I4EA 4O8AA 4ZZ9A 3AALA 4IZGA 4PL1A 3TVAA 1GPWA 1TUFA 1V0NA 1VYPX 4ILSA 3MU7A 1ONXA 2VYOA 3CQJA 4Z2GA 3GAKA 1DL3A 3GG0A 4Q6XA 4ZCWA 3W3OA 1JPMA 1VFMA 3OHMB 4QG9A 4GC4A 2NQHA 4A35A 3TROA 1XIEA 3ARSA 5D8WA 2ZX7A 4G7EB 3Q67A 2CLFA 2HS8A 4HMDA 3QPZA 2PD9A 2V81A 2YA1A 1EXPA 5HJLA 2DJXA 4CCZA 1MNZA 3GE7A 3EWZA 3DKJA 3GU9A 2X7VA 5HJYA 3OB8A 1H1ZA 1V0MA 1Q8JA 3PJUA 1LBLA 4L64A 1YDYA 1KCKA 3MSDA 3RHGA 1YBQA 4GHRA 4C6PA 4A3RA 3QMTA 4D8AA 1E0TA 4P2VA 4X0VA 5JIPA 1J0JA 2NSXA 3VAVA 1F2JA 1NQ6A 3S6DA 1VHNA 1TIMA 1RQEA 1LTDA 2ZKMX 1BXNA 3UG5A 3T78A 4XAGA 2WV8A 1E6XM 4UFIA 1YPFA 3TN3A 5D37A 3E0WA 4I7UA 4E2DA 4F66A 1XIIA 4DWDA 3L0GA 2PLJA 4LOCA 5FSDC 4QM1A 5D04C 2GUUA 4OT7A 3W23A 1H5VA 4LH8A 3TLLA 1I0DA 3WH9A 5J5DA 1A5MC 1U5VA 4LUTA 2VEGA 1E6ZA 1MYRA 2VRJA 2XH7A 1NVMA 1OK4A 4Q8WA 5FJPA 4EWND 3O63A 1C90A 3TA9A 1UA3A 3PP7A 1OYBA 3GUWA 4TVCA 4HT3A 3L0NA 3OYZA 3CAKA 1L6SA 2IUZA 4I9MA 8XIAA 4RNFA 4AF0A 4UQ9A 4JTQA 4PCSA 4NASA 3AFBA 2V82A 3RK8A 3TC7A 4CNOA 2PURA 3HQ1A 2V5JA 4M1RA 4HB7A 4W86A 3FDGA 1DWAM 3ZVIA 2BVDA 2XN1A 3AU2A 2DH2A 3H2EA 2VHLA 3VMPA 4ERGA 1WA3A 3G8EA 3WN6A 1XG4A 5JH2A 2B7OA 3LRKA 2GGJA 4AXNA 3PR2A 3BW4A 4RZ4A 3WDIA 1YTKA 2FJKA 3GUGA 4GCAA 3AMCA 3AAMA 4Y9AA 2PBGA 3JU2A 4ZO9A 1BTCA 3RJYA 2PD5A 1LRNA 3HPZA 3G1RA 3LN3A 5CZ0A 1MVYA 3UQNA 4Y9NA 3ARWA 3SQSA 4RE4A 4S39A 4EKJA 5G1YA 2DY3A 3EWUA 3VNJA 1AW5A 5D9NA 4NNBA 3H2AA 2INEA 1X6NA 3FV9A 4W7WA 5DRCA 1DXIA 1JR1A 1L6GA 1M65A 2JKAA 2OU4A 3NR0A 2Y8KA 3AICA 1Q45A 3SCOA 4H9VA 1XP3A 4CU8A 1YYAA 1F8MA 2DVTA 3GU2A 2QJIA 4H8UA 2D22A 2W27A 3RLUA 1PDYA 1J0ZA 1PTGA 4IMAA 1H0IA 2YOCA 1J6OA 4U4MA 4RNJA 1OY0A 4O13A 2YLAA 5BNKA 5K7JA 4G9PA 4IGMA 3FGCB 2XFFA 5CGMA 3GHSA 4UWMA 2VO5A 5IDZA 1POKA 6REQB 1OCJA 4S3KA 4JZ5A 2XIBA 2IKGA 5MKGA 4H9XA 3QTPA 1ZSXA 4ZOEA 4CD6A 4YJ5A 2GWNA 1E1CA 5LIXX 4Z0JA 1E73M 2JBMA 1T99A 4GYFA 1MI3A 4U5KA 3ABXA 1K03A 4J3VA 3WMBA 3VUSA 1SZRA 5C2XA 1RBLA 3NQ2A 4QEHA 1S2VA 1ECEA 1TYGA 1RAKA 2J75A 1DORA 2A7NA 1RK5A 3B9OA 2QKFA 4DZ5A 4XZNX 2I7GA 1HO4A 4CEUC 4Q8UA 1D2KA 4RLIA 5CPNA 1XJBA 4M29A 2BGQA 1HKJA 5XINA 2C1HA 3WQOA 4F0LA 4BEQA 4EPBC 2NW0A 5A6SA 3G18A 5E93A 1RD6A 4QDWA 1F3TA 4HZ8A 1UD2A 2XGIA 5A95A 1OX6A 4GA8A