1H7OA

Schiff-base complex of yeast 5-aminolaevulinic acid dehydratase with 5-aminolaevulinic acid at 1.7 a resolution
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
341
structure length
341
Chain Sequence
MHTAEFLETEPTEISSVLAGGYNHPLLRQWQSERQLTKNMLIFPLFISDNPDDFTEIDSLPNINRIGVNRLKDYLKPLVAKGLRSVILFGVPLIPGTKDPVGTAADDPAGPVIQGIKFIREYFPELYIICDVCLCEYTSHGHCGVLYDDGTINRERSVSRLAAVAVNYAKAGAHCVAPSDMIDGRIRDIKRGLINANLAHKTFVLSYAAKFSGNLYGPFRDAACSAPSNGDRKCYQLPPAGRGLARRALERDMSEGADGIIVKPSTFYLDIMRDASEICKDLPICAYHVSGEYAMLHAAAEKGVVDLKTIAFESHQGFLRAGARLIITYLAPEFLDWLDEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dehydratase
molecule keywords 5-AMINOLAEVULINIC ACID DEHYDRATASE
publication title The X-Ray Structure of Yeast 5-Aminolaevulinic Acid Dehydratase Complexed with Substrate and Three Inhibitors
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 115
structure length 341
sequence length 341
ec nomenclature ec 4.2.1.24: Porphobilinogen synthase.
pdb deposition date 2001-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00490 ALAD Delta-aminolevulinic acid dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1h7oA00
5AYZA 3S8HA 1LLWA 4ONVA 4ADTA 3DU0A 2QCEA 3PS7A 5D33A 1ZY9A 4MJMA 1CI1A 1TJPA 3TMLA 1TPWA 2DU2A 1K3UA 3B03A 4MZYA 1W54A 1OFRA 4UTMA 2HTMA 4O1DA 1OFPA 3PBWA 3OVQA 4JDYA 3PR2A 3S5OA 3N2MA 4YWIA 5MHBA 3W23A 1KM6A 1XKYA 2OZ0A 3E9AA 3LLFA 4N9BA 3N14A 3S1UA 4CQ8A 3U8GA 2P0OA 1K7EA 4CNPA 1DJNA 5AYXA 1H51A 3R2GA 3WK3A 1Z48A 2E6DA 1KM3A 4JIPA 4NXKA 3W72A 2X1TA 4DEFA 4IMEA 4M6QA 3LHZA 1VCFA 4N6FA 3UQNA 3KRZA 3SSJA 4FNUA 4UMBA 3W9ZA 4UIOA 4YXGA 1UCWA 4O1AA 4Z1AA 1GVFA 4LY8A 2D73A 3N9SA 3O6YX 5D05A 3I6RA 3L65A 2V2CA 4UFHA 2QUUA 3HPXA 3MJYA 4I7VA 1XI3A 3CPRA 1W56A 1R2TA 3HGRA 3UZJA 1VLIA 1NF7A 1GT8A 3CT7A 3KVLA 3GXNA 4BFAA 2ZZ2A 4Y96A 4YCPA 1L9WA 2FPVA 4OV9A 4RR4A 3I68A 1G4TA 5TBOA 4LS0A 1GPWA 1QO5A 3DBPA 1M7PA 2I1OA 1YDOA 4QQ3A 1KM1A 2JKAA 4IXHA 4NX0A 4JTKA 3QC3A 1PS9A 2YPIA 1XUUA 1KLYA 2B7OA 5F2IA 2NXHA 4UC5A 3DHFA 5K7JA 1X8FA 3P7YA 1MZHA 1I4NA 4K7VA 4MJZA 2Y89A 4J9JA 4UUIA 3W22A 1JUBA 1M5WA 1F76A 2G95A 1YYAA 4UTLA 3QM3A 4DXVA 1SZGA 2E6FA 4O52A 1UBSA 3T55A 3QQ0A 5LGXA 4LC8A 4PTNA 3WJWA 1ZAIA 4ZQMA 2V2DA 1W5NA 3H55A 4LOCA 1EPXA 5D03A 5DY3A 5K9CA 4M7SA 5ABTA 1GG0A 3LOTA 3HIJA 4O4VA 3W83A 1WA3A 1T99A 4LW7A 1UUMA 5KZEA 4IOTA 3Q94A 3KVMA 4IQLA 5DBTA 1SSGA 4ML9A 5KTLA 3LERA 3WJYA 2V2HA 4U28A 3THQA 4JTEA 3KX6A 2NUYA 5G2HA 1WBHA 3C4UA 1X1ZA 3I7RA 2GJNA 3P84A 1QNVA 1EP3A 4AHOA 2E6AA 1K7FA 3TW7A 1KW1A 1E51A 3TROA 4G1KA 1WYIA 3IIVA 4EOUA 4CQAA 3LCHA 2RHGA 3NQCA 5AHEA 2Z2UA 5CPNA 5CPOA 5D09A 1O5KA 2WJZA 1DV7A 2YYUA 2WSYA 1VCVA 5KMYA 4NZJA 4WOZA 3UZ5A 2EGZA 2Z1BA 1KBIA 1LZOA 2E6YA 4UFKA 2GQ8A 4UR8A 3C61A 4E2BA 3ZFHA 4RXFA 3NL3A 1PVNA 4B5NA 4UTWC 3QW4B 2A4AA 3PC0A 3L5AA 4JR5A 4HNNA 1OF8A 3PY2A 4N9EA 2GJLA 3TUUA 2EAWA 3Q2DA 1AL8A 4JNMA 4ZQOA 1SFLA 4O19A 3GKFA 5G4EA 2R91A 4Q33A 1X1OA 1SO6A 3GAYA 3QZEA 5FEZA 1W3IA 5C5YA 1NFBA 3C2OA 3EX3A 4QSHA 2WKJA 4N4QA 1XL9A 4RKAA 1LOSA 2CU0A 3IGXA 2BLEA 4GUIA 3U2OA 1VR6A 4FIQA 4X22A 3LM7A 2WSQA 5EPDA 3C3NA 3NQGA 3GB6A 1XUZA 3W7KA 3W2NA 3GVGA 2E09A 2RH9A 3RF9A 4LUJA 1GQNA 4GC4A 2R14A 1TSIA 4GUFA 4JY9A 4QJ1A 4DBEA 1OYCA 3LHTA 1XBZA 4TMBA 3HO8A 4UNLA 3FIGA 3G3DA 1ML1A 1EA0A 1GVQA 3DFSA 5G2IA 3IIOA 1FWWA 3LLDA 3PUOA 1W31A 2O7SA 3JR2A 2R8WA 2V30A 4GE8A 3W7HA 3LHYA 1P0NA 2QCCA 3IVUA 3CHVA 3UPWA 1L6WA 3NQMA 1I2OA 5LKYA 4H6KA 5D2TA 1TTQA 4MLJA 3JRKA 4NZFA 3NQ2A 3S5YA 1TMHA 3L68A 2FDSA 1BTMA 3UPBA 1FCQA 3QFEA 2QDGA 4AWTA 1GWJA 1LRNA 1F05A 2I14A 3NQEA 1ZALA 2WPBA 4JS3A 5CZJA 4EVZA 4K38A 1ZJIA 4NUWA 4MZ1A 1M7OA 2LLEA 3T78A 3QPYA 3SGZA 3TQVA 1KFEA 3O07A 1ADOA 2E68A 3DH7A 4WJEA 5I3KA 5H91A 3UY8A 2VEKA 3SW6A 3TNOA 1FCVA 1O60A 3OVPA 4UFIA 4NVTA 3NQVA 2H8XA 2VKZG 4L4MA 4N9DA 3UNDA 3DZ1A 5K9DA 5I3HA 3HPZA 1FXPA 4ZQPA 5HQEA 1JRCA 3DKJA 1EUNA 5E0KA 3CTLA 2PC4A 2CLOA 3KAOA 5K4XA 2PE4A 1QPRA 4LV4A 5KITA 1NVMA 1R2RA 3E49A 1XC4A 4JEQA 4O16A 1Q6OA 4O17A 3S5NA 3TQKA 3E0IA 1WX0A 4QISA 1NEYA 4Z0SA 1ONRA 3NQ8A 4MKNA 3NDOA 3QMTA 3EWXA 2V82A 3OG3A 3G1YA 3HGOA 3FKRA 4H4IA 1KM5A 4LRSA 3RU6A 1AW2A 4O15A 3B06A 3QMRA 4K7YA 1DQWA 4UNKA 5DXYA 4TO8A 3S9YA 1OYBA 1H1YA 2R94A 3W1QA 1ZAHA 3GX9A 2Q8ZA 2NLIA 4LVFA 5LHFA 4BI5A 3MBDA 1S5WA 1DHPA 2C1HA 3I65A 2B7QA 2QCFA 3IGSA 5HWMA 2C6QA 5FEWA 5KZDA 2V81A 2Y7EA 3W1UA 1P4CA 3WK2A 3NPXA 4XZ9A 3M5VA 1VHNA 2WNQA 3EB2A 3ANYA 3VNDA 1SZEA 2CZFA 3O8AA 3NQDA 3NQAA 1X6UA 3TU9A 2FFCA 1TIMA 4Z1DA 3DHDA 2ZZ1A 1LM1A 2BXVA 4LRTA 4DO4A 4IGHA 1KTNA 2J24A 2ABAA 1W5MA 2A6LA 1Q3NA 1MEHA 4LV9A 2GQ9A 2OT0A 4WXZA 4CQ9A 3F1QA 2JK2A 1TTJA 3NL6A 1SR9A 3QRHA 1DQXA 3DFTA 2Y70A 4JDBA 3QSRA 1VZWA 1GVSA 3T7VA 2NV1A 1RZMA 1AW5A 4UMAA 1H62A 3S42A 1D3HA 3UXDA 1OFOA 3TE9A 1RVGA 2C14A 3G8EA 4I7UA 1TB3A 1ZCOA 3G1VA 3W7IA 1AG1O 3M7WA 1Q6RA 3L0NA 3LB0A 1XBYA 4NJHA 4CCCA 2ZZ5A 2VFGA 4EWND 3MI6A 4Y6GA 4DF0A 3CWNA 4RK8A 1DOSA 1UJPA 1SFJA 5CGQA 4JTTA 2YYTA 5DLCA 5K4ZA 1YXCA 2YXGA 3MBFA 5D2XA 1SZNA 3LCXA 1RD5A 1YTDA 2CWNA 5FEXA 2DZXA 2NX3A 1XXXA 3EX1A 4H3DA 1LP6A 3LTSA 3IRDA 1H7NA 2WNZA 2NX1A 1Y0EA 3GDTA 1Z41A 3MP4A 3MMTA 5BMWA 5C2XA 2YR1A 2DORA 1GTHA 1SW7A 3HQ1A 3TSMA 2JBMA 4GNJA 4LNYA 3LDVA 4ALDA 3O6CA 2J27A 3CEPA 4FF7A 4OWGA 4O14A 1LORA 4RZ5A 1F73A 1FWRA 3GDLA 1JCYA 1AW1A 1KA9F 3P62A 5AHNA 3WK1A 5LZLA 4LT9A 2EF9A 4IJBA 4JTSA 2X1UA 4JYFA 1QWGA 5AHIA 3W2MA 3B8DA 5EYWA 5A5WA 3QJAA 1OHLA 3WK0A 1TTPA 1VCGA 2ZDRA 1W1ZA 5L6UA 1QOQA 1QAPA 4JX5A 4O4WA 3O05A 2VFHA 1LRTA 3RMJA 4Z08A 4C1KA 1WBJA 1EX5A 3W71A 4HSNA 4LWWA 3TAOA 2AAMA 3CM4A 3M1ZA 3UWYA 3M0ZA 1UB3A 3KVJA 3UXAA 2Q3RA 5F1VA 1OJXA 1KM4A 1OFDA 4O10A 3IIXA 3ELFA 3GDRA 3CLMA 2ABBA 2JGQA 3W2LA 1W5OA 4AB4A 1J4EA 1BWKA 4OQVA 3A23A 5AC6A 3BV4A 3ATZA 4RV8A 1OABA 4MLRA 4E38A 3W85A 5G5IA 2QCGA 2Z0IA 4DELA 1OG0A 3RLUA 3PUDA 3BW2A 1O94A 2Y85A 3BGJA 2HS6A 3NYZA 5D2WA 3W1TA 1TCDA 5F2LA 4QNEA 5DN1A 1OK4A 3DAQA 4WX2A 2YGYA 1FY6A 4QIUA 4PA8A 1ICPA 3KRUA 4IUOA 2FJKA 1QO2A 4A29A 1EB3A 3EWYA 3PBVA 1R47A 2FLIA 2QEZA 2W0UA 2ISWA 2YSWA 5DCBA 4TR9A 3BPWA 1KLZA 5IBXA 3OBKA 2NZLA 4Q32A 3W7EA 2O7QA 1VYRA 3O6DA 2ZA3A 2VOMA 3IIPA 3TKFA 5KZMA 3NXFA 1VQTA 1KFCA 3LRMA 3W1AA 2X1RA 4BWLA 4FX8A 1N55A 1B9BA 1KFLA 2OJPA 4GUJA 1QCWA 1UUOA 3TJLA 2AGKA 4O0KA 2Z6JA 2ZZ7A 3L0KA 3RNDA 2Y88A 3HOJA 2C15A 2WV8A 3TW6A 3N73A 2H3DA 3UYCA 3QH2A 4ORIA 1MEWA 2J88A 2JKPA 4ZMGA 1M6JA 1H7WA 1GYLA 1T96A 3TMQA 2Q3OA 4JX6A 3HJZA 1VLWA 1RQHA 4HNVA 4U4MA 2BWGA 1K02A 1TYGA 3CIWA 1SZFA 4RXGA 1JQVA 3PF3A 5TQLA 5F2GA 3W07A 4IXXA 1IXNA 1G6CA 3R5EA 5KSWA 3LBMA 1K8XA 4UTIA 5AN7A 2VXNA 3FS2A 3FOKA 3QSTA 8TIMA 4IX2A 2DJXA 2F7FA 2BTMA 4MPQA 2PURA 3L0GA 1QPQA 3R13A 2OT1A 1VS1A 3K30A 3NZRA 1OX4A 4AEOA 1HG3A 5CPLA 2PRHA 2ZZ3A 3M41A 4OU1A 4JICA 2ZRYA 3EXSA 4FHAA 3W7CA 2TPSA 3DFOA 3ZR4A 5F4XA 3TFXA 3N3MA 3W74A 1P0KA 4QITA 4LUIA 2Y63A 3MHGA 2YCEA 1KTBA 3EWBX 3GNNA 5F1UA 1RQEA 5L9FA 4HN4A 2YW4A 4FIRA 3W2JA 5FEPA 2WNNA 4ZQRA 2FTPA 4FO4A 2DJLA 4Y90A 4HNUA 5F4SA 3SFKA 2G97A 3C0JA 1L6SA 1G67A 1K8YA 5BOOA 2H8ZA 5BW6A 1MSSA 4N9CA 3UWVA 1C9DA 4A2RA 4UTHA 3N19B 1PHWA 1ZHAA 3LTPA 1P1XA 4LS1A 1LCOA 3FFSA 2Q8LA 5H2ZA 1G4PA 3FYOA 1I45A 3ATYA 2EPHA 5HR6A 3EEGA 1EIXA 4DF1A 4WD0A 3BG3A 2TMDA 3N9RA 4WZHA 3C8FA 3LX9A 3NR0A 2B0MA 3G1XA 2FPTA 4WOQA 3STGA 5EL1A 5K9XA 3W84A 4IPIA 5I3IA 2A21A 3P60A 2P10A 5CPMA 1XM3A 3L21A 3W1NA 3LGEA 4ZZ9A 3SR7A 1UASA 2JGYA 1OX4B 4HPJA 3HB9A 3M16A 3TV8A 1ME8A 1TPDA 3PVFA 1H7PA 3GR7A 3EWUA 4TX9A 4POCA 4LS2A 1VRDA 2VFIA 1TV7A 2HSAA 3CC1A 5D32A 2X16A 3HG3A 1KV5A 1FUYA 1VYPX 1JCXA 3G22A 1CX9A 4NNCA 1XBXA 2NXGA 5FF4A 2WO5A 3GYEA 3BLEA 4IWWA 4ADSA 1IGSA 2CZEA 3GLCA 4A3UA 4OE7A 1MXSA 4K8EA 1TV5A 1LOQA 1XDLA 2VC6A 3UWUA 3IVTA 3PBUA 4E2DA 1F6PA 3N34A 5DXXA 2G96A 3S1XA 3EWWA 4GUGA 2FIQA 1PL9A 3I7QA 5CSRA 3DFPA 4PFMA 2BZNA 2FB2A 1VH7A 4UTUA 1VGAA 4R33A 3BGGA 4BI7A 1VHCA 2QF7A 1H5YA 3MWAA 2RDTA 3TC7A 4AMAA 3B0VC 4RCXA 3BLFA 5C54A 5BMXA 2GOUA 3W76A 2YZRA 3PWAA 1LBFA 4FXRA 2ZCGA 1THFD 2GUUA 3VFLA 3G1FA 3UWZA 4JTLA 4O1BA 2CLHA 3G24A 2VFFA 2H6RA 1OX5A 3D0CA 4NNBA 4FNQA 1HL2A 1TQXA 2IQTA 4WY0F 3DFQA 1DBTA 1KFKA 3KVKA 3STEA 1K03A 4UTKA 4JTIA 3W7RA 4O18A 4O13A 1EP1A 3NVTA 4O57A 4A22A 4OGZA 2XFWA 5LNRA 2CZDA 1H1ZA 2X2GA 3NQFA 1B57A 1LYXA 3EKZA 4JTUA 3IIZA 5AHLA 3W75A 5DELA 1IXQA 5K2ZA 5AC8A 3PG9A 4N6EA 4S2CA 1V5XA 4MYAA 3PAJA 5J5DA 4CCEA 1SO3A 5CZ0A 1C8VA 3GDKA 1TRDA 1N8FA 4MY8A 3HG4A 3SI9A 3CEUA 3ZS4A 4A2SA 3G18A 1JJKA 1W3TA 3NPWA 4DO6A 4NJKA 2GPTA 3UWWA 3DGRA 4NJIA 3A22A 3M6YA 1LOLA 1SSDA 2C3ZA 1QFEA 3S0CA 3VKJA 2QAFA 4FB7A 1TPEA 4NJJA 4FNPA 1G4EA 1TPC1 2CW6A 1H63A 3V75A 1NAL1 1SO5A 4YCOA 1JCJA 4QNWA 4Z0JA 4CLMA 4PODA 3C56A 5T26A 1YDNA 3FEMA 1J2WA 2QDHA 2QJIA 5FI8A 1OVDA 3VI2A 4KKXA 5D37A 4UTTA 4XBSA 1FCUA 2ZFAA 3MYOA 5U4NA 2J9XA 5LNSA 3C2RA 1JCNA 4S2BA 1DL3A 3PG8A 4EF8A 4LU0A 2GVLA 4GBUA 1GYNA 5HULA 1W8SA 3HG2A 3CQ0A 5EMUA 2C19A 1H61A 3P80A 5DCEA 5DY2A 1JUKA 1EWDA 2P1FA 2QCMA 1VJIA 5DBUA 3MI3A 3SIZA 3ABSA 4NJGA 1GG1A 3L66A 2ISSA 1QMLA 2ZTKA 4AH7A 4BF9A 4LTSA 1PV8A 4O53A 3PUEA 4DPPA 4MFEA 1FDJA 1T0OA 1TPUA 4R53A 3S1VA 3GKAA 1TJRA 6ALDA 1SUXA 1SO4A 4GRSA 5EA9A 4N02A 2OCZA 4JY8A 3PULA 4MY1A 2DZUA 3ZWTA 1G4SA 1B4KA 3SZ8A 3LHWA 1WAUA 1IIGA 3HG5A 3MHFA 5FESA 1LLZA 3ABOA 4N2YA 3QQ1A 3OA3A 4IPJA 2GQAA 3TC6A 2DZTA 3FKKA 5KINA 1H7OA 4R7JA 3TJXA 1TPFA 4UR7A 3C2EA 4QAIA 4HT3A 1OX6A 2QCLA 3OVRA 1A5AA 4S1FA 3W87A 3MYPA 2W6RA 4PEKA 3M44A 1GVOA 1H7RA 3TK7A 1C29A 1DORA 2HS8A 3NEVA 3O1NA 2DZPA 2BSLA 3DI1A 2Y7DA 3EXRA 5G1YA 3P5ZA 5HINA 2E5CA 1MEIA 2CLFA 2A7NA 1XCFA 2A0NA 4K36A 3EWZA 4DQWA 4LVDA 5AFDA 1VPXA 4AF0A 3T44A 5CSSA 1FCBA 1OK6A 2CLMA 4FNSA 5TIMA 4BR1A 3C2VA 2NUWA 2VEIA 1PCWA 3W2UA 5I3JA 3V1PA 3W88A 1O95A 3M47A 3FA5A 3OIXA 3P67A 1Z42A 3MW7A 1YXYA 4OV4A 3L2IA 5LNWA 5FF3A 3W6YA 2HMCA 1SW3A 1KFJA 2A5HA 2CFFA 3C6CA 4Z1CA 2Y6ZA 2V8ZA 2OX1A 4BK9A 3W86A 1HTIA 3E96A 3H53A 3TAKA 4X9SA 3DKLA 3L5MA 4K39A 1K7XA 4WXYA 2AQWA 3G0UA 1FX6A 2FPYA 2QAPA 3UY7A 4JYDA 3G0XA 4MVAA 4JGDA 2RKXA 3TA6A 3M5YA 4GWEA 1L6YA 3E12A 2WOQA 1BEUA 5DCDA 5HMSA 3P81A 1BKSA 1HUVA 3EX2A 4FNRA 4CCDA 2C18A 3T4CA 4NXSA 3HF3A 4GUHA 5D2YA 4KFPA 3PSWA 2J9ZA 3CU2A 3C52A 3VE9A 4AWUA 4NQ1A 4PH6A 2TSYA 1DKWA 3W7NA 1XFBA 1ZENA 2CLLA 3LXCA 2XN2A 4PL2A 4IMGA 3Q37A 1HO4A 1I2NA 2VEPA 3TSBA 4MIMA 3P61A 3LV5A 4AF0B 5E1QA 1AMKA 1F6KA 3MI2A 3MUXA 3W1MA 2J9YA 3QYQA 1G7VA 1L2UA 2NUXA 5CZSA 1RQBA 2ZZ4A 3G1HA 4UFMA 2A6NA 4R34A 1GJPA 4NX5A 1TTIA 4GFSA 1ALDA 4CNNA 4AAJA 1FWTA 5IBXC 2QCNA 2CLKA 3W7PA 3GK0A 1X7FA 3RLVA 3WJXA 4BWLC 3LHVA 5BRBA 4XTIA 2ZRVA 2B7PA 2A1YA 3NZ1A 3IGUA 4E0CA 3R12A 3TH6A 3SECA 3BVJA 4X3ZA 3EX6A 2YW3A 3W7MA 5AHMA 3P5YA 3UD6A 1GZGA 1KM2A 5EBUA 3S5ZA 1ZNNA 3LRLA 4P2VA 1YXDA 2VFEA 2G5WA 3B05A 3L5LA 2WSRA 4KFOA 1U83A 2ZA1A 3KXQA 1G69A 4IMFA 3INPA 5F2MA 3NOEA 4JX4A 3NQ6A 4Q4KA 3P8IA 2ZRZA 4IMCA 4TU1A 3P82A 1KBJA 1S5TA 4LVAA 3PM6A 5FF0A 3KOFA 2XN0A 3TXVA 4TIMA 3G1SA 3HGJA 1KM0A 3R8RA 1LTDA 1W0MA 1T8XA 1W37A 2OMAA 4CNOA 3YPIA 4XBKA 5U7SA 5G1TA 2V0TA 3BW3A 3W1PA 4HIBA 4OHQA 3GXPA 1QPOA 1N7KA 4FNTA 3PSVA 4AWSA 2NWSA 4AHPA 1VC4A 3MP3A 1H60A 1ZAJA 1A53A 4ORMA 5I3FA 4Z1BA 1GEQA 4JD4A 4O12A 1FQ0A 1YTKA 1J5TA 3G0SA 3HGSA 2TYSA 3HPSA 2A7RA 1S5VA 4LVBA 1JRBA 1WOBA 3STFA 3NGJA 1Z44A 2Z6IA 4UMCA 1A5SA 1HO1A 1NSJA 1ICQA 1R46A 1I2QA 1TREA 1D9EA 4M7TA 4WY0A 2TRSA 2H3BA 2YX0A 3SY5A 4MOZA 3TIMA 4K8HA 4UXDA 3LCLA 3ZWSA 3BG5A 3A24A 3MO7A 5AHFA 1QOPA 2FQIA 1FXQA 2ZBTA 5C55A 4L4LA 4P61A 1JCLA 4KWVA 1JVNA 4DPQA 3W1RA 4ZL1A 2CLIA 3KRSA 4RZ6A 5D38A 2X30A 1QDSA 3AJXA 5G2WA 5CG7A 1F7BA 2FB3A 2BX7A 4O50A 2DZWA 2E5BA 1A5BA 1WV2A 5HUOA 4M6VA 3TSDA 3C2FA 4ZQCA 4UFJA 3O63A 2XN1A 3RK8A 3DXIA 4EIVA 2C0AA 3AO0A 4MY9A 4XKYA 2E1DA 3QEZA 5SWUA 2Y62A 3WJZA 1LBLA 3MP5A 1OYAA 3GR8A 4UTJA 3IEBA 3N2XA 3SJ3A 1O4UA 5K3VA 1JULA 2PCQA 3Q58A 5LHEA 4UTWA 2B4GA 3QW3A 4PC8A 3TXZA 3F03K 4D2JA 3NQ7A 4RZ4A 3NM3A 4LC6A 4O8RA 1JQXA 4W9TA 3MHUA 4EF9A 7TIMA 2YFOA 4TMCA 5LNUA 3W73A 4JIQA 1AL7A 3I7SA 5E93A 2PRLA 3IV3A 1BWLA 4WY0B 3W3OA 2QCHA 4GJ1A 3TDFA 3BLIA 1PCKA 1QPNA 4MZ8A 1RR2A 3BW4A 5HWJA 3GXTA 1NF0A 1W5PA 1KV8A 1IF2A 1TRIA 2C13A 1XDMA 2DZSA 4M19A 4ADUA 4KFNA 4O0ZA 2UV8G 2QUTA 3GDMA 2Y7GA 3H54A 3NA8A 3USBA 2J6XA 2VEMA 4O11A 1TPH1 4I9AA 1ME9A 1FBAA 3PB0A 1PIIA 4M6PA 1OFBA 2NV2A 3M43A 1FWNA 3B0PA 1A50A 1ICSA 1HFBA 3B0UX 3JS3A 4FX6M 1H50A 1F5ZA 3A5FA 3G1DA 1OFEA 3ABRA 4YMZA 3NG3A 4HPXA 1W5QA 2ZA2A 4XKYB 1DJQA 3IVSA 5CZTA 2ZRUA 4DO5A 1U5JA 3NL2A 3U6WA 5D30A 3WJSA 3W7LA 3M5XA 1Q6LA 3NAVA 3TQ0A 1H7XA 3GIYA 1K8ZA 2ATSA 1MO0A 1LROA 1WXJA 2VENA 1RV8A 3W7GA 3LXBA 3VCRA 4DF2A 3EX4A 1TV8A 1YTEA 3TFCA 3LTYA 1I2PA 4XWUA 3EXTA 1B3OA 2QUVA 3UWQA 3M9YA 4BI6A 1GVRA 1VYSX 5I3GA 3HBLA 5HUPA 4FEZA 2V5BA 3LV6A 2ZRXA 2ZRWA 4N4PA 3DENA 1D3GA 4AHQA 2KZHA 1LBMA 2CZ5A 3GNDA 1ZFJA 3WFAA 1RPXA 3DI0A 1FDYA 1TO3A 1A5CA 3FJLA 3S6DA 5D2VA 5AOUA 5EKYA 4AVFA 1YADA 3P8JA 2ISVA 2E5DA 3TCEA 5FF2A 2E77A 2QKFA 2GVGA 3W2KA 3CIXA 4YLWA 1SQ7A 3GZ3A 3LCWA 5A8GA 3CB8A 3W7QA 4AXKA 4HSOA 1B4EA 2A85A 4MYXA 2NXIA 2ATMA 5J5RA 1EWEA 5AC7A 4UCGA 1W3NA 5F4WA 1O5XA 4RJEA 2QJGA 3GAKA 1FWSA 3BARA 5AYYA 4C1LA 2DP3A 3RFAA 5HJLA 1WQ5A 3BO9A 4LVGA 4O1CA 1OF6A 3CWOX 4UTTC 3FJ6A 1DVJA 5D02A 3BK0A 3E02A 3QF0A 4K6AA 3L67A 3O16A 2I9EA 5HR7A 5HWNA 3NM1A 1TPB1 2QCDA 1LDCA 4IMDA 3DFNA 1KTCA 1R30A 4Y9AA 4NNAA 4KWWA 2CLEA 4O28A 4FXSA 3OHIA 4Y8FA 3W7DA 1GTEA 5D04C 2ALDA 4IX0A 1F74A 4O54A 4JYEA 5LGZA 4XUGA 1TPVA 2PRMA 2QJHA 5LSMA 1Q6QA 4NU7A 1JR1A 4HNTA 3LHUA 1TQJA 3QPZA 3LI0A 2W79A 3STCA 2V9DA 1YDVA 4HHPA 4WQ6A 2NWRA 3A9IA 3W1XA 1OFQA 5BNKA 3LCFA 4ICNA 1AK5A 1IXOA 1GOXA 5G4WA 4JTHA 5FF7A 1IXPA 3F4WA 1EUAA 3A21A 3TR2A 1LRQA 1XBVA 3LRKA 4JTJA 3T40A 4UFLA 2EHHA 3NL5A 3O06A 1OFAA 3KHJA 3FLUA 4PCFA 3W1LA 2V5LA 4JTFA 3A5VA 4XTDA 3NPUA 1ME7A 4YL2A 5CKSA 1SU5A 1IIHA 4M5PA 2QR6A 4PL1A 3W7OA 3NO5A 2ZZ6A 1YPFA 1QR7A 1WDWA 1CW2A 2C16A 3VE7A 3KFTA 2ZQ0A 4MFDA 3LBCA 1EP2A 3LCIA 2ZTJA 2NX9A 1WOAA 4OT7A 1I8JA 1KFBA 2X1SA 4NT0A 2Y7FA 5GVJA 3G3MA 3THAA 1I2RA 2QCDB 4JXCA 3PB2A 3G1AA 4JTGA 5IM51 4XQ6A 3G8RA 5LNVA 3W70A 1V7YA 6TIMA 2H90A 1SPQA 2DZVA 4WUIA 1R2SA 4QM1A 3B04A 1YPIA 4RX0A 4GXMA 2Y61A 3NPVA 1PE1A 2YFNA 2GVJA 5EY5A 1S3HA 4ZQNA 3EKLA 2EKCA 2RDUA 3W7JA 1P5BA 4FX7A 1F2JA 4K37A 3LXAA 3FYPA 1EEPA 2B7NA 1PHQA 4HKPA 1FDZA 3LCGA 4X2RA 3B4UA 2F84A 5C6MA 2RDWA 1JCMP 3LI1A 2JKEA 2RFGA 1SW0A 3HMJG 3QMSA 4DBDA 2VELA 3M5ZA 4ZVJA 2WQPA 5HNRA 1YLVA 3OEXA 4JN6A 3S1WA 3O15A 3PBYA 4A21A 3BG9A 4MUZA 2VFDA 3NNTA 3F4NA 3ABQA 2A7PA 4I7WA 3TX9A 1G7UA 4OBTA 1Q45A 3L9CA 4RLIA 5AB3A 2YDAA 2A2IA 1JUEA 2ZYFA 3SGUA 3R89A 3P74A
chains in the Genus database with same CATH superfamily
4W5ZA 6REQA 4ADTA 2QCEA 3PS7A 5D33A 3LSCA 3J7HA 3CL7A 2HTMA 5HJYA 4LY4A 3N2MA 3V0UA 1FP9A 3ZVHA 1XH1A 2WJFA 1KBKA 5CSUA 3CS2A 2OZ0A 3LLFA 1BSLA 2PTXA 3N14A 4N9BA 3S1UA 1EOKA 4CQ8A 3N2TA 1J0IA 3U8GA 4MGGA 1K7EA 4X9YA 3R2GA 3QZ6A 3BQ6A 3VDAA 5CCZA 3EOEA 1TG7A 3GWQA 2X1TA 3B4YA 2XPKA 4ACYA 3MO4A 4G7EB 4LNCA 1VAHA 3SSJA 1JXKA 2QJMA 1CGXA 1MI3A 3AJ7A 4NZ4A 1EDQA 3EPMA 4O1AA 1AODA 2QUUA 3MJYA 4I7VA 2AMGA 4E8DA 3F2CA 4HA0A 3UZJA 4DM1A 1V0NA 1E0WA 3VKAA 1TWDA 1A5OC 1V3IA 2ZZ2A 1L9WA 2FTWA 3T07A 5TBOA 1E4LA 4KWUA 4RNIA 1J10A 2BP1A 2JKAA 4Q8UA 3BSHA 3M07A 2OLSA 1PS9A 2YPIA 1XUUA 1K1DA 2XGBA 5F2IA 3EPOA 2NXHA 3WH5A 1X8FA 4W87A 2QLYA 1Z7AA 1QU4A 2VGIA 3AIWA 3UW6A 3T2QA 1JUBA 4O52A 1UBSA 2NLYA 1V0KA 2ZWYA 4LC8A 3WJWA 3N3TA 1ZAIA 2GGIA 5D03A 5DY3A 1NWRA 4LJ3A 5CSYA 4H6RA 3W83A 1T99A 5GJMA 5DBTA 2XJ7A 4ML9A 3WDPP 1LL6A 1XJBA 2PDYA 1MQRA 3B3DA 3WJYA 3S9ZA 3K4WA 2VI0A 4U28A 2BDQA 1HL9A 2NUYA 3E5PA 3I7RA 2VJXA 1PPIA 3U4FA 4IGNA 3WH7A 2VR2A 2FH8A 2R9RA 3P84A 4TTUA 4L61A 5AVNA 1EP3A 2E6AA 1K7FA 2L5HA 2O55A 3ZM8A 4RDVA 4GZIA 1R86A 3AWNA 1WYIA 2ZXAA 3WLRA 4AISA 4F9JA 2VX5A 2VWSA 4AIUA 2I56A 2WSYA 1H11A 1VCVA 5KMYA 3BLLA 2VEFA 2Z1BA 2YXOA 4UFKA 1CWYA 3SUVA 3MSYA 3QPEA 1O66A 3IUDA 3C61A 4E2BA 1V0MA 4B5NA 4FOKA 4QG9A 1GOOA 1QUMA 3L5AA 1E1CB 4BQ2A 4N9EA 2VDIA 3PY2A 1UKOA 4DWDA 5CGTA 3EOSA 3NSNA 3ITCA 3VOJA 2VX7A 3DERA 4O19A 1CBGA 4Q33A 3QZEA 1W3IA 3D3FA 3C2OA 3KBJA 1HGWA 3WLIA 4AUBA 4RKAA 1PZ3A 3DESA 4PE8A 3ISIX 3WBYA 4GUIA 2QDEA 4FIQA 2BHUA 3K46A 3LM7A 2WSQA 5EPDA 3L4TA 3C3NA 4Y9OA 1CECA 1XUZA 3W7KA 3ZMRA 2RH9A 4PB4A 2A3CA 3EB4A 4GUFA 3KW3A 4QJ1A 4GABA 3EA3A 3LHTA 4C90A 2BBFA 2DVUA 2SFPA 1UWRA 4DY1A 1GVQA 1PKNA 2PWUA 3ARPA 1BXBA 1HQTA 2G8ZA 2PWHA 3GE7A 2R8WA 3NXLA 4JKLA 4A8NA 2ACSA 3W7HA 3MWCA 3VIGA 1I2OA 1RJQA 3V36A 4H6KA 4C6OA 1F3XA 5D2TA 5FAGA 4MWAD 3A13A 4OFCA 3SN1A 3CL6A 2ZUNA 3S5YA 1WAWA 1IEWA 1TMHA 1QT1A 1DPMA 2FDSA 5JUVA 4E8CA 3UG5A 4DO7A 3UEQA 3DFHA 1UQZA 1WKDA 4PCNA 2I14A 4QCEA 2WPBA 4JS3A 5CZJA 4EVZA 4NUWA 4MZ1A 3T78A 3QPYA 2VHLA 3O07A 2CHOA 4WJEA 2E3ZA 5H91A 2GFTA 4M8UA 1D7FA 2W4XA 4DVOA 1ISVA 1OGSA 3BLOA 3V5CA 3RX3A 4NVTA 5KETA 3HJEA 2H8XA 2VKZG 3DZ1A 1XLKA 5K9DA 1JRCA 3DKJA 4B5VA 2VGGA 1EEXA 5K4XA 3NSMA 3F2DA 3UZWA 1PZ1A 2J8GA 4YWSA 1FWAC 3N29A 1IHIA 4CD8A 1UR1A 2ZX8A 4XVDA 1Q6OA 4WVXA 1WX0A 1NEYA 2DQXA 4Y9NA 4MKNA 3NDOA 1KRBC 5GNXA 2V82A 1M41A 4ZE4A 1TKKA 3TYZA 3HGOA 1VFSA 3RU6A 1AW2A 5C9XA 4O15A 2BY3A 3QMRA 1O12A 4UNKA 3ARVA 4LF2A 5I00A 3OTRA 3GX9A 4KEUA 1DHPA 3WQWA 2V5CA 3LPGA 4YVXA 3TEVA 1OY0A 1FOBA 2C6QA 4L56A 5KZDA 2V81A 3WBWA 4Q22A 3ARTA 1UKPA 2GL5A 3NPXA 4Y8EA 4O0QA 7TAAA 2ZICA 3EB2A 4GVGA 3CJPA 4KT2A 1CXFA 3O8AA 3AIBA 2J8TA 4HZMA 3WQPA 4DO4A 3BOXA 4NF7A 2J24A 1B3ZA 2O9RA 1SYTA 1JPKA 1Q3NA 2DUXA 1MEHA 2GQ9A 2OT0A 4JCMA 3F1QA 3VO0A 1XLFA 3GTXA 3ONBA 3QSRA 4L1XA 1GVSA 1OB0A 4PBEA 3KL3A 2PDBA 4H9VA 1ZPTA 4UMAA 2CHRA 1RVGA 2C14A 4P7NA 4XBJA 1DP0A 1P6BA 4GGHA 2ISDA 3MB9A 4M3PA 3ZJ6A 3W0KA 2DW7A 3LB0A 3OLIA 2OOGA 1YDYA 2XFFA 3QV7A 1R7AA 3AALA 1UOKA 2PWFA 3LZ5A 3CWNA 5FJUA 3GNPA 2YYTA 3B8UA 5JBFA 1YX1A 1OINA 4Q7BA 3ABXA 3MMDA 3LCXA 1RD5A 3UT0A 5I23A 3LA4A 2O56A 2X0HA 3GDTA 2WK2A 1Z41A 4C6IA 3MMTA 3OO2A 2PDKA 1JGIA 3TWBA 1ITCA 5BMWA 3VC6A 1K9EA 2DORA 1NARA 1GTHA 3KL5A 4P7LA 1GJWA 4TUFA 3HQ1A 3TSMA 4GNJA 1UZ4A 3CO4A 3O6CA 4G7EA 3KRBA 4OWGA 4P8XA 3T0AA 1LORA 4JFSA 3GDLA 1AW1A 6XIMA 5LZLA 3LSBA 3U4AA 4IJBA 2Q02A 4GX9A 4JYFA 1QWGA 3W2MA 3B8DA 5GJNA 1D8WA 1KKRA 1QTWA 1OC6A 3RJYA 4LAUA 1TTPA 5TF0A 4BEUA 5ABEA 3UG8A 3CZ8A 1KGWA 4DJEA 4NZ5A 4JX5A 4MADA 3SY1A 5RUBA 1PEZA 3V0TA 1LRTA 5D9PA 4Z08A 1EX5A 1KCXA 1OJXA 1XGZA 4CD5A 4HNCA 3ELFA 3CLMA 4CU8A 3W2LA 3WQFA 1V02E 3W27A 2MNRA 1FWGC 3LNMA 2YB4A 3PPGA 1OABA 3IUIA 4IMAA 4Z2LA 5G5IA 1GQLA 3P93A 3PUDA 3BW2A 1O94A 2Y85A 3A9BA 1WZKA 5A3HA 2ZUMA 2A79A 3IPWA 3B40A 1TCDA 1C9WA 3EMZA 4QNEA 1TA3B 4J1OA 2PI6A 1SFTA 2YGYA 4LGXA 5DX7A 3B8WA 4IUOA 1A4LA 4D8LA 3PBVA 2FLIA 2OZTA 2EXOA 1GPFA 1I0BA 5DCBA 4W4QA 3HN3A 2OEKA 3BPWA 1ZUAX 3U7VA 1IQ8A 4PTVA 4B5XA 3B9EA 3PZUA 1NY1A 3WF4A 3TKFA 5KZMA 3NXFA 1ITUA 2JQXA 2OQHA 5C9WA 1B9BA 1I0DA 2HNEA 1EZWA 4GUJA 1UUOA 3IJ6A 3M0MA 1FWFC 1GW1A 5EMYA 2AGKA 4XAGA 1PDZA 2OYLA 2W3ZA 4CUCA 3WY1A 4TOQA 1DE6A 5FIPA 2Z6JA 2C15A 2WV8A 1M04A 4I8YA 1Q8AA 3GVWA 5DMNA 1B9ZA 3N73A 3UYCA 3QH2A 4ORIA 2J88A 3BXWA 4J5NA 4ZMGA 1M6JA 3GYCA 2ICSA 1GYLA 1H2JA 3WD2A 1T96A 3TMQA 1VLWA 3RCNA 3OIHA 4QDMA 1J18A 1TYGA 3CIWA 1SZFA 1OIFA 5J04A 4AZCB 2QNEA 1G6CA 4O1FA 1AUSL 1K8XA 2DSWA 2VXNA 1J79A 3FS2A 3M0LA 4IX2A 4MPQA 2PURA 1LQ2A 2CYGA 4E8GA 3L0GA 3R13A 3RU8X 5IRPA 3NVDA 3QTPA 1K77A 4J27A 4G2DA 1E56A 2BGNE 1BWVA 5CPLA 5C2CA 2PRHA 2XU2A 4JICA 1NM9A 2ZRYA 1ZU8A 1W3KA 4Q3MA 1XRFA 3DFOA 1P0KA 4LUIA 2W67A 4LBUA 2Z00A 3BOFA 4HN4A 1UC5A 5BYWA 2YW4A 2WNNA 2I5QA 4ZQRA 3C0JA 5PTDA 1C7TA 3VGBA 3U48A 3VUSA 5XINA 2J6VA 4UTHA 1ZHAA 4LS1A 1LCOA 2Q8LA 1ONEA 2EPHA 1UQYA 1OC7A 3VDCA 3H70A 3LX9A 3BJSA 3IUHA 4V28A 5BWAA 4QDPA 3G6LA 4F79A 5JU6A 2R82A 2VUNA 5I3IA 2A21A 1QI4A 3AIRA 5AYBA 5CPMA 1XM3A 3APTA 4ZZ9A 5A6KA 3SR7A 2V67A 3N2OA 3BL3A 4HPJA 1OX4B 5A6TC 1RA0A 1GOWA 1K8CA 3PVFA 3VKKA 3JZUA 4URIA 3DX5A 4GYJA 4Z2IA 2V3FA 4TX9A 4POCA 4LS2A 1GOKA 1TV7A 3LPOA 4NAFB 2CXGA 2NQZA 2VYOA 4C6FA 2CKRA 3WZ0E 2CETA 2VC7A 4ADSA 4U2YA 1W1YA 3UWUA 3XINA 3S47A 3NSXA 4AY1A 4FF5A 5DXXA 5CAKA 3WQ5A 3S1XA 1PL9A 7XIMA 1Q66A 4PFMA 3BGGA 4BI7A 4GXWA 3TC7A 4I3GA 4AMAA 4DBWA 3KCLA 5BXRA 2PWDA 2J62A 1XYAA 3VGGA 2YZRA 2X40A 1THFD 3MDWA 2Z27A 3FEQA 5I78A 2VFFA 1OX5A 3IJ9A 4NNBA 4FNQA 1HL2A 1TQXA 1MWOA 1KFKA 3OVGA 3PZVA 1UP2A 4O13A 3PZIA 3CV7A 1VJZA 1F61A 3IACA 1X39A 5A6SA 3REQB 5LIYX 2XFWA 4ZE5A 5LNRA 3M7SA 2QS8A 1TZZA 3NQFA 3W6LA 4RDWA 1KGXA 1S46A 2QUMA 4UQDA 3KLKA 5AHLA 5HOSA 5DELA 5K2ZA 3V1HA 5C7HA 2Q6ZA 4XZHA 4REQB 4HNLA 4MYAA 3U3HA 2P3EA 5J5DA 1C8VA 2FVKA 1N8FA 4MY8A 1WO2A 3SI9A 3ZS4A 2G3IA 5GPRA 3QGAC 4D6DA 5IFPA 3NPWA 4MUPA 4DLFA 3DGRA 1J0KA 2IMRA 4LAMA 1TZ9A 4FNPA 1G4EA 1AQ0A 4LCRA 3SCUA 1SO5A 4YCOA 5JIPA 3GTHA 4AX7A 4XB3A 4JL1A 4GCXA 2QJIA 4MNJA 4KKXA 4UTTA 4X63A 2G37A 2ZFAA 3MYOA 5U4NA 1XYFA 5I09A 1WKEA 4M1BA 1HW6A 4QE4A 5HANA 5HULA 1W32A 3WYZA 3IJDA 5KZ6A 4W93A 1E9YB 2WMIA 3H2FA 2NVAA 2QCMA 1UWAA 3MI3A 5B7ZA 1TJ0A 2AAAA 1VIZA 1E9LA 4GOAA 3AIUA 4FZIA 3APGA 1IWBA 4MMWA 3PUEA 1FDJA 1TPUA 3OOQA 4S3CA 2XIMA 1AFSA 4WGHA 3ALGA 2D69A 3I4KA 3VOIA 3OBEA 4HU8A 4LX4A 3M64A 5EA9A 3S2CA 3SCNA 2OCZA 2Z1VA 1E40A 4JY8A 3ZWTA 3TYBA 1B4KA 1TJ2A 3CGTA 4IQDA 4RV3A 3ES8A 1WAUA 3WSUA 4N2YA 3QQ1A 3HU7A 4EXAA 4X0NA 4RNHA 2DZTA 1R85A 4GBDA 3E1F1 1L6FA 1R9YA 1EQPA 1TPFA 4OVXA 3QTGA 2NQLA 4MF4A 3RCYA 4P5UA 1DJIA 4GINA 4QAIA 3WNOA 1UOZA 3F4DA 1PUDA 3MYPA 4MB1A 3N9KA 4PEKA 1GVOA 1J5SA 4MJ4A 3TK7A 1C29A 4C6CA 3S2JA 2BSLA 3DI1A 2RJHA 5G1YA 3NGFA 2FMNA 5HINA 3VX0A 1MEIA 2CLFA 4I5XA 4WDXA 4YIWA 2VP8A 2Y8VA 4F0HA 4K36A 4B15A 1TA3A 4BEQA 4AF0A 1FCBA 2I17A 2CLMA 2VUYA 4FNSA 2HBVA 2NUWA 1PCWA 3SADA 1UWIA 2VEGA 5A8MA 1DIEA 3FA5A 2WWDA 3MW7A 1I6NA 4CCZA 1HJVA 4PMOA 2OZ3A 3LMZA 3ARWA 1FRBA 3C6CA 1ZLPA 2IQ0A 4BK9A 2GDUA 2PDPA 3E96A 4X9SA 1QI3A 3L5MA 1POJA 3VIHA 1C7SA 1IEQA 1TZ7A 3CYVA 2ZX6A 4MVAA 5A8PA 1UC4A 5BXSA 1O1HA 3P81A 4YS1A 4FNRA 1RA5A 1V3KA 3ZXWA 4CCDA 3T4CA 1ISXA 2Z29A 1V03A 4KFPA 3S2LA 3MUZ1 2ASHA 2ZVRA 4G8TA 3VE9A 1NU5A 4H9ZA 3B97A 3W7NA 2CLLA 4KPLA 2P0IA 5C9UA 2VEPA 4MIMA 1YKWA 3LV5A 1ZSXA 3MUXA 1EL3A 3DGBA 1L2UA 2ANUA 3OQ8A 5C71A 1VBUA 2ZZ4A 1LL7A 4R34A 3GVRA 2V5KA 3W6MA 4B3KA 2QCNA 2PAJA 3RR1A 1GOIA 2CLKA 1CZ1A 2Z1KA 3W7PA 3GK0A 2DT2A 4ROQA 4ICMA 4QEHA 3RLVA 1U2YA 1M3UA 5CEWA 1M9HA 1OGBA 4AIOA 3ITLA 3WG6A 4BWLC 4W84A 2C1GA 4RE3A 3KBWA 1YBQB 3NZ1A 4XD3A 4C6DA 4NG3A 3SECA 3GFXA 2YW3A 1EJVC 3LMYA 1EDTA 1GZGA 2VZTA 1KM2A 4ERIA 3LRLA 1YXDA 2VFEA 3B05A 4KFOA 1U83A 2ZA1A 4I9MA 5F2MA 2ZRZA 1CB7B 1S5TA 1HP5A 2REQB 5E70A 3KOFA 1WDQA 4RUBA 3R8RA 5HBFA 3UGVA 3YPIA 4XBKA 5U7SA 3W1PA 1XRSA 3GXPA 1N7KA 3QR0A 4AWSA 2NWSA 4IGMA 1XINA 4J3VA 5LIUX 5DO8A 1ZAJA 4HOWA 4US6A 1GEQA 4WLCA 3G0SA 3H4GA 1PTGA 2V5DA 5CJ5A 3ITXA 3STFA 1BD0A 3A64A 1I2QA 1Z6KA 4DRSA 4WY0A 1G1YA 2UY5A 3SY5A 2PS2A 4K8HA 1GKQA 4EP8C 2Z2BA 4QCFA 4NAFA 4BQ3A 4DAIA 4P61A 4GI9A 4A4AA 1WE5A 5KEZA 1S2TA 2OQYA 2V3DA 4GZJA 4JKMA 1XLMA 3K4AA 4QROA 4YYFA 2BS9A 4ZB0A 1A5BA 2D2JA 5DANA 4XO6A 3WN6A 3ZSSA 3R0UA 1R3YA 2RAGA 1X6LA 4KRTA 4OIFA 4D6FA 1EC7A 2CZVA 4AEEA 3O63A 2XN1A 3AO0A 5CBIA 3QEZA 3ZOAA 4CD4A 1VENA 3MP5A 3GQYA 1OYAA 3IS4A 4YYCA 3PK7A 1J8VA 3NUKA 1EHNA 4HHMA 3Q58A 1QNPA 2GJXA 2B4GA 3AXKA 2BGQA 3G2GA 1FA2A 1GORA 2DSZA 3UVAA 2IPGA 4O8RA 5CLWA 3QKEA 7TIMA 4JIQA 4Q4MA 3V4BA 3P6LA 3I7SA 1LG2A 3T0DA 3W3OA 4KIEA 3NIYA 2GVEA 1JAEA 2VVSA 2P8CA 4PULA 1RR2A 1UKTA 1NF0A 1P48A 1S2CA 1V7AA 1KV8A 3PZTA 2DZSA 1EHAA 3TOYA 3GDMA 4LUSA 2J6XA 2HJPA 2Y0FA 4HCDA 1CXHA 4WDWA 1E6NA 4HTYA 2XVKA 1F4AA 2R1LA 1HFBA 5TD4A 5BCAA 1HKKA 2WVUA 1H50A 2V68A 3ITYA 2QV5A 2F6UA 4IG2B 1ZL1A 4Z17A 2DUAA 3NG3A 3EOLA 4JBRA 4D9PA 1S2VA 2QJNA 3H2AA 7ENLA 1FHUA 3NL2A 5EFDA 3L4ZA 2POZA 3U6WA 5D30A 3GZAA 1Q6LA 3NAVA 3TQ0A 3GIYA 4GNKB 4C5YA 2HBXA 1PIGA 3GG0A 1CCWB 2VENA 2OODA 1P1MA 1NFPA 3VCRA 2Z28A 4GJIA 3LTYA 4Q7NA 1I2PA 3UPMA 4XWUA 2NT1A 1ZP3A 4OTKA 3UWQA 4YVPA 3M9YA 4DI9A 4BA0A 5FL1A 1IZKA 4BI6A 3VOCA 4C6PA 2D20A 5C9RA 5D9OA 5A95A 4X60A 2XIOA 3T2PA 3GNDA 1ZFJA 5A1AA 3M46A 2VZVA 3AUJA 1TO3A 1TE6A 2VX4A 1YADA 4C6JA 5AVHA 3FJNA 4OJYA 4S3EA 3W2KA 1A3HA 5EFFA 1SQ7A 2PBOA 3UFYA 3W7QA 4F3HA 4UQCA 2CIPA 2A85A 3HV9A 2BXYA 4U3AA 5J5RA 4GD0A 1EWEA 5A6JA 3KTCA 1W3NA 4UCGA 2BVWA 2QJGA 3K1GA 1TMLA 3USZA 4WSKA 1T5AA 1E6XM 1KD0A 5AYYA 4C1LA 2DP3A 5HJLA 1TX0A 3SCTA 4GC3A 4Z2JA 4PEEA 4KBXA 5TAOA 3D46A 3E02A 4QAWA 3O16A 2I9EA 3HPFA 2GK1A 1KTCA 4JZ5A 4C1NB 1KGUA 4IM4A 4KCVA 4GQQA 4Y8FA 3TTSA 3W7DA 1GTEA 1BRLB 4AIEA 3CZJA 1F74A 5FAJA 4JYEA 2QJHA 3GG7A 5I77A 2VL4A 2VGBA 5MKGB 1UR0A 3BGAA 3STCA 1YDVA 3LCFA 3FGCA 4Z1YA 3BWWA 4J2MA 4AZGA 3R94A 2GSJA 1A5KC 1C91A 2TAAA 4UTFA 5FF7A 3VNZA 3QBUA 3TR2A 3A21A 2YA0A 1XBVA 3T40A 1UBPC 2EG6A 1OSEA 2P53A 2Z7GA 1UWUA 4JTFA 3A5VA 4M5PA 3EBVA 4GVFA 4PL1A 2GSHA 2VD9A 4D6IA 1JD7A 1QR7A 1WDWA 3TVAA 2VZUA 4MB4A 1OCNA 2C16A 3RUBL 3H7VA 3LCIA 4OT7A 2PP3A 4F8XA 1Z9AA 4I6KA 3G3MA 1CGWA 2QCDB 2CBJA 3PB2A 4H9TA 5LNVA 4ZB2A 1V7YA 6TIMA 1JDAA 2DZVA 1I75A 4FR1A 3RX4A 1R0MA 1R2SA 4QM1A 4S23A 2PD9A 3H4WA 2Y24A 4F4RA 2Y61A 5G4HC 1EBHA 2CWXA 4ZQNA 1DTUA 2EKCA 3W7JA 3TYEA 3CUZA 3HFYA 4K37A 4WRHA 3OZYA 4B5TA 4HKPA 4QLJA 3LCGA 3N18A 4C65A 2G0WA 1XCXA 4X2RA 2F84A 2XISA 2RDWA 1JCMP 2JKEA 4EXQA 2RFGA 1JFXA 1ADSA 1KWGA 3HMJG 2OYKA 4GQBA 1YLVA 2PZNA 2QGYA 1U1HA 3MSDA 3F4NA 3ABQA 4I7WA 2H9AB 1G7UA 5I2UA 2YJQA 1Q45A 2NQHA 3L9CA 5E5CA 2EJAA 2A2IA 4GK8A 1JUEA 2OO6A 4IIGA 4PMJA 1HN1A 3P74A 3R4IA 2ZX5A 1UWSA 3SCOA 2XDFA 2WBGA 3GFZA 1O1ZA 5JIWA 5CQ1A 2YB1A 1TPWA 4UQEA 2DU2A 1REQA 3HQNA 4MZYA 1BXCA 2VDGA 1Q4WA 1OFRA 4JDYA 3FNDA 2XM1A 4KMQA 2HE5A 4MB5A 3S5OA 4R9XA 2X1IA 5MHBA 4S39A 1KQZA 2F8QA 4D6CA 5DT7A 1V77A 1MDLA 4GIEA 4CNPA 1EOMA 4B90A 1DJNA 5AYXA 6A3HA 1BAGA 1Z48A 2E6DA 5C0QA 1ZRQA 5LYRA 1NP2A 1KM3A 3IJIA 1WDDA 2G3MA 5HNTA 4R27A 3W72A 3WLPA 4H6QA 3KOYA 3PJUA 4KEMA 2FGZA 3UQNA 5FJOA 4AU0A 1W9DM 1Y8BA 1XGDA 4Q8OA 2D73A 3MV11 3N9SA 5D05A 1PB0A 3I6RA 2V2CA 2O9TA 2NQJA 4E5TA 1R2TA 4XD4A 1VLIA 1FTXA 4H8NA 4XAFA 3UJRA 3R79A 3KVLA 4EAMA 5FA5A 3B8IA 4W86A 4YCPA 3VMNA 2XG9A 4QS5A 2WANA 4QSFA 3DBPA 1ZB5A 3FXGA 3QLDA 5TNVA 1ZBKA 2I57A 2IS7A 4IXHA 1RJPA 4NX0A 4JTKA 2YA1A 1LG1A 4F40A 1UJQA 3LK6A 1A5MC 2B7OA 4YTTA 4UQAA 3VD7A 2XWEA 2XH0A 1M65A 3DHFA 5K7JA 2Y8KA 2YDRA 3N2BA 1I4NA 4K7VA 5LXXA 1P6WA 3LQGA 2IPJA 4UUIA 3QM3A 1M53A 3BAKA 2YCLB 3QQ0A 5LGXA 3UZZA 4QDWA 4ZQMA 4EACA 2WLYA 3AAMA 4LOCA 2PUZA 1LWJA 1B1YA 1GG0A 1CYGA 1KCZA 2PP1A 3XIMA 3IJ8A 4IOTA 3Q94A 1FVPA 5KZEA 5KTLA 1MRQA 1QBBA 4V27A 5I79A 4YN5A 1FHDA 1MDRA 5G2HA 1WBHA 1IWPA 3KOXA 4KIRA 4L80A 1CPUA 1UIPA 1BF2A 2QMJA 2Z2AA 2DGAA 4CN6A 1QNVA 2F61A 2QHAA 4QEEA 2CBVA 1K9FA 1KW1A 3WLOA 1QPKA 3TROA 4G1KA 1IEIA 5A69A 4IG2A 3KL0A 4YTUA 3NQCA 5AHEA 1DXIA 4TTGA 1U5VA 5CPOA 1K4GA 3QXBA 3KZPA 2WJZA 4ZOBA 3VDGA 2YYUA 4IL0A 4QP0A 4WOZA 1NP0A 1JPHA 4EWJA 2GVYA 1KBIA 1Y5WA 2E6YA 3NTYA 4I9JA 1XS2A 2GQ8A 4ZSUA 3CV1A 4JIHA 4RXFA 5XIAA 4UTWC 1UWTA 1JG9A 2ESCA 1HVQA 3IWPA 3URBA 5FJPA 5CH9A 1M03A 1TIWA 3WF2A 1AL8A 4ZQOA 2V6AA 5G4EA 3MMUA 4HMNA 3WENA 1SO6A 3GAYA 4CNSA 5FEZA 5DF0A 5C5YA 4ACZA 2NVCA 1UH2A 2IKHA 3EX3A 4N4QA 4HMEA 3WNLA 1BG4A 2XVPA 1BLIA 1VFMA 2CU0A 4JL2A 1F9CA 3LLXA 3N4EA 3UCDA 1OZQA 2ZDSA 3KEHA 3NQGA 3GVGA 3RF9A 2J8FA 2J13A 2XSXA 3KM8A 4DBEA 1XBZA 4TMBA 3HO8A 4UNLA 3G3DA 2C0HA 2WZHA 3T81A 1FHLA 1FWWA 2I5IA 1W31A 3JR2A 3W00A 1ZQ5A 4WDTA 3R6IA 2V30A 4MPKA 2OFJA 4GE8A 1A3WA 3LHYA 3AROA 3VM7A 3CHVA 3ARXA 2VQTA 5DRCA 5C7VA 4N42A 1TTQA 2VRKA 4MLJA 3ZO9A 4MWAC 4NZFA 4PMDA 3AU2A 3TYDA 3L68A 4DJDD 1AZ1A 4C1NA 1FCQA 3QFEA 3E3HA 3LD5A 3PZNA 1GWJA 4E4UA 1ZALA 3F4VA 3VIOA 4K38A 4WSJA 3CWHA 3ITVA 1M7OA 2WZTA 5MKGA 3DH7A 2I7GA 3U57A 1RK5A 2P50A 3SW6A 2WLZA 1FCVA 2WZMA 3BSGA 3VCNA 2Y5JA 2CBUA 4LBRA 4L4MA 5M3WA 1HKJA 3HPZA 1FXPA 4GMEA 3CTLA 4JKKA 2CLOA 3GW3A 3KAOA 3OLGA 4YNGA 1L6GA 2PE4A 3WH9A 5KITA 1NVMA 2PF8A 1R2RA 2MUCA 5HPOA 2WKGA 4JEQA 4AIBA 4ML4A 4Z0SA 5ECUA 2FHFA 2CERA 3WEMA 1DJWA 3TP4A 3CAVA 2FZ9A 1WKFA 3FKRA 4H4IA 1KM5A 3I6TA 3B06A 1DQWA 3S9YA 1H1YA 4IQJA 1BF6A 3I4EA 5B80A 4FLQA 3K8KA 3TJ4A 2B7QA 3IGSA 3VTRA 5CJNA 1IT7A 5HWMA 2Y7EA 4B4HA 3MUIA 1T6MA 1EJUC 3ARYA 4XZ9A 4DIAA 3WF1A 2WNQA 4XVEA 1XLEA 1XH0A 3DG7A 3PZQA 3NQAA 1X6UA 1TIMA 3H12A 4Z1DA 3NCOA 4A8RA 3SCSA 4IGHA 1XLGA 2ABAA 3VOGA 4C6QA 4XZLX 4LV9A 3WMBA 3NL6A 4FMVA 3TWAA 1SR9A 5HNUA 1CGVA 4B92A 1EGZA 1QJWA 5GNYA 2H9AA 4QS6A 3UJSA 2NV1A 4PRTA 1RZMA 2V63A 2ZUVA 1H62A 3S42A 3ZQ9A 3C0LA 1HJWA 4YTQA 3GH7A 1W3LA 3PN8A 2PDJA 3BZJA 2OXNA 4GQ0A 5AC4A 4JCLA 1RY8A 3M7WA 1E73M 1Q6RA 4JIIX 2XIQA 4DJFC 4NJHA 4LBSA 4CCCA 2ZZ5A 2AKMA 4EWND 3MI6A 1W1IE 1DOSA 1AJ0A 1CNVA 4JTTA 4S3BA 1US0A 4KS0A 3IANA 1PZ2A 2HQAA 3SN4A 3CMJA 2YXGA 3MBFA 4RZBA 1SZNA 5FEXA 3DDMA 1V3MA 1B5TA 4H3DA 1LP6A 2IXUA 2Y2WA 3LTSA 1H7NA 5HQLA 4AMCA 2OGYA 1CGUA 1XYZA 3GC5A 2GDQA 5C2XA 1WP6A 1FWHC 3OP2A 2OSWA 3LDVA 4ALDA 1R3WA 4FF7A 1AH3A 1P43A 4PB3A 4KF1A 1FWRA 4HK5A 5AHNA 5B7YA 2EF9A 3QKZA 3IAPA 3A4JA 1JPIA 1CLXA 1OIMA 4DYEA 1OHLA 2R1NA 2F9RA 3MVTA 2XGIA 1BGGA 1LUCB 1W1ZA 4S3FA 3UETA 4GHRA 5HK4A 4O4WA 2QZRA 2VFHA 3RMJA 3CZGA 1L8NA 3W71A 3IJQA 4HK6A 3QHOA 2VZSA 4MWAE 3M0ZA 3UXAA 3QV9A 5F1VA 4FR6A 1VBRA 4ZFMA 1R3SA 4BY3A 3WL0A 2AKZA 3WKZA 2ABBA 3PANA 4AB4A 5CG0A 4HMDA 3U7BA 3U0HA 2HK1A 1J0ZA 3A23A 3BV4A 1Q6CA 4E38A 1GKPA 1Q6DA 2D0FA 3RLUA 4EAYA 2FMOA 3EZ4A 4GGBA 1GZ1A 5D2WA 3WQCA 3CAQA 4GO9A 3W1TA 4XZBA 3E0LA 5F2LA 3DAQA 3VIJA 3VOHA 2FJKA 4JFVA 3KS6A 4A29A 4AD4A 1EB3A 1Q7QA 2BV9A 2QW5A 2YSWA 4GH1A 4DI8A 2HDJA 3SCQA 5IBXA 2QXWA 1IE7C 2WHJA 1WDRA 3W53A 1JYNA 2NZLA 4Q32A 3W82A 1JZ4A 3PZGA 3VIPA 3VILA 2A3LA 2J74A 1JYXA 1MW1A 3LRMA 4WF7A 5I24A 1RVKA 1J12A 2GWNA 5DQPA 3L12A 1KO0A 3UJEA 4UQBA 4ZTXA 1BYDA 4C60A 3E2QA 4AYGA 4FOUA 3TW6A 2XZ7A 2VM8A 5BXPA 1LL4A 3WNPA 4ATDA 4HSHA 1H7WA 4HMCA 1XRVA 1DHKA 3TA9A 1RQHA 1MVYA 3IK2A 4HB7A 3TJIA 1VFHA 5IFTA 1CDGA 2GGJA 3PF3A 2YDSA 1IXNA 3QFWA 4DNHA 3T42A 5AN7A 1W2PA 2Z4GA 3FOKA 3BQ5A 2QJJA 4FSAA 2VMFA 3PFMA 1YE6A 3VD9A 4LAKA 4OU1A 3SY8A 4XK2A 2ZXDA 4PUDA 3EXSA 1VIWA 1IEVA 1TX2A 4UCFA 3GSMA 3W7CA 1DJGA 2XTKA 3ZR4A 4NRSA 3TFXA 3W74A 4EANA 1V0LA 5JVLA 3MHGA 2YCEA 3EWBX 2BHZA 3ZZ1A 2FTPA 4Y90A 3SFKA 4K68A 3V35A 4GQRA 5CJMA 4N9CA 1C9DA 1G01A 1NOFA 1EFZA 3R1ZA 5F7UA 3LTPA 3UG4A 5H2ZA 1F6YA 5HR6A 1EIXA 2JEQA 1HKMA 2TMDA 3C8FA 1KNWA 2B0MA 3URQA 3URNA 2KX9A 1QASA 1B0IA 5HAOA 3STGA 5BU9A 5EL1A 5K9XA 3GFYA 1MUMA 3P60A 2P10A 2XHYA 3L21A 3LGEA 1GVIA 3VX1A 1XIJA 1UASA 3GR4A 4H83A 3TV8A 4BS0A 3HB9A 1TPDA 2VX6A 4US5D 1B3WA 4M81A 3N4AA 3GR7A 2VFIA 1NWTA 5D32A 2X16A 3F5JA 3HG3A 1FUYA 3QR1A 3GXIA 1XLCA 3HZ3A 1JCXA 1M7JA 1CX9A 4NNCA 2NXGA 1IWAA 5T91A 4M6UA 1MXSA 4K8EA 1XDLA 1XPGA 4IP4A 1TUFA 1S2WA 2G96A 4GUGA 4Q6XA 4X0VA 3DFPA 3KDNA 3MANA 1VGAA 2DVXA 2QF7A 1U30A 4R7WA 2NV9A 2E4TA 4JTCA 1VFOA 5BMXA 3FN9A 2J7HA 1X7IA 2FH6A 5CPSA 1JDFA 2ZCGA 2AL1A 1RCQA 3UWZA 4JTLA 4PSPA 2H6RA 3CASA 3D0CA 4GYPA 3KWXA 2XZ9A 1OCQA 4C6BA 3DFQA 4NIRA 3STEA 1KR0A 3LY0A 3L2LA 3ARRA 4JTIA 3PZOA 1EP1A 2VC5A 3NVTA 4OGZA 4DJDA 2CZDA 1B57A 1LYXA 3EA2A 4JTUA 4M56A 3IIZA 3V0SA 1HKIA 3PBGA 2BHYA 3W75A 3KS5A 5AC8A 3E0FA 3PG9A 5I03A 1AH0A 1B3XA 4QTGA 4RNFA 4LAZA 4CCEA 1SO3A 1Z32X 4QG8A 3HG4A 3CEUA 4A2SA 2D3LA 4JQ1A 1XIMA 4DO6A 2GPTA 2WYSA 1IR1A 5CLTA 3F2BA 3A22A 1LOLA 3UWEA 3WLMA 4NJJA 2CW6A 4JFTA 1NAL1 3LNPA 4Z0JA 3CTTA 2A3AA 2WW5A 5T26A 3WLTA 1YDNA 3MDUA 3HQPA 3VI2A 3KBVA 5D37A 3KHDA 3BAWA 4Y2WA 2ACQA 1FCUA 1V8EA 1JGMA 2OWXA 1JCNA 3BANA 4KGJA 4S2BA 3RRAA 3CT2A 3HQOA 1DL3A 1DWAM 1ZZMA 5DFAA 3F5KA 1W8SA 1VEOA 3CQ0A 3WLSA 5EMUA 3W25A 3V5OA 5E0FA 4MJ2A 2J75A 2PDIA 3SIZA 4NJGA 1JPDX 2AL2B 4MSSA 2ISSA 4W8LA 5DT5A 3VD3A 7REQA 4AH7A 1PV8A 2X05A 1RPKA 4H9XA 4JTQA 4ZO9A 7PTDA 3S1VA 5D9MA 5I3DA 1TJRA 4E6MA 1SO4A 4GRSA 1OT2A 2HPIA 1LWIA 4R7OA 3WH6A 4XD5A 4GI8A 1XX1A 2OSXA 4MNKA 1G4SA 5T8GA 3LHWA 4JFWA 1F07A 2CHNA 3NQBA 5A6LA 4RDYA 1LLZA 1A5UA 4TVDA 5BRQA 3OA3A 1H5VA 4IPJA 2GQAA 5KINA 4R7JA 1EO7A 3TJXA 4JHZA 4KCTA 4J3ZA 2F6KA 4HT3A 1Z69A 5A6AA 2VO5A 3UU0A 3B0XA 3UZYA 4JPGA 2HS8A 4D8ZA 5BOFA 2DZPA 3L7RA 1XIBA 2XUCA 3IK4A 2E5CA 1PWLA 1EPVA 3JU2A 1XCFA 4J28A 4MKVA 1OCJA 4LVDA 5AFDA 4B3LA 1OK6A 3C2VA 2VEIA 1P7TB 9CGTA 4E2VA 5I3JA 3V1PA 3W88A 4NKCA 1VFFA 1J0YA 2HEJA 3NZPA 3OIXA 2OSYA 2PC8A 1Z42A 3L2IA 4HTBA 3HV8A 5FF3A 3W6YA 1UKSA 1R3VA 1SW3A 3MT1A 4DJED 1XG3A 3W86A 2BB0A 3KBMA 3DKLA 4Q4RA 1K7XA 2AQWA 3H2NA 3G0UA 1BHGA 2WB5A 2FPYA 3GM8A 4G9PA 3G0XA 1NIUA 3WEOA 4IISA 3UR2A 1X97A 4NYYA 3E12A 4D6JA 1NJJA 2W61A 2EPOA 4U10A 5HMSA 2A3EA 5HQMA 4XAYA 3ZSTA 5A2CA 1H0IA 1XLDA 3WX7A 4GUHA 4LFYA 1GK8A 4L1GA 3WBXA 1Q8JA 1Y5XA 4AWUA 2TSYA 3R8HA 1ZENA 4PL2A 4UBPC 4J2PA 3Q37A 1I2NA 3PPCA 4H2CA 1XIIA 2YLLA 5E1QA 5H1WA 2D0HA 3W1MA 3QHNA 1QNSA 2NUXA 5CZSA 1RQBA 3G1HA 4WDUA 1TWSA 2XVNA 1GJPA 1R3RA 4AAJA 2V3GA 4S3DA 1NQKA 1UROA 1UD8A 1GQKA 1XKJA 3T09A 4Q8PA 4AD0A 2X42A 4CD7A 5BRBA 2WHMA 2RUSA 3CHFA 2OQLA 1N8IA 4XISA 3CHDA 3UR5A 3B0YA 3T8LA 3BVJA 3BAXA 3EX6A 1FWDC 1ZTVA 3SRHA 3P5YA 3RLHA 1XLLA 4H6EA 3UD6A 4P2VA 2BY0A 2G5WA 2WSRA 1XG4A 3KXQA 3DC0A 3INPA 3NQ6A 3C3UA 1O5RA 4TU1A 3P82A 4RW5A 4H7VA 1KBJA 2G3JA 3H8AA 1KXHA 1PO9A 4TIMA 1W37A 1DIOA 2OWWA 3WQEA 4PZVA 5G1TA 3BW3A 1JDDA 4HIBA 2BFGA 1QPOA 1S1PA 4FNTA 4A3QA 1VC4A 8RUCA 1V3JA 3O9NA 4U2ZA 4F66A 3KCJA 3G6MA 3Q45A 1FQ0A 2DQWA 4JAWA 1YTKA 1HT6A 2TYSA 3FVMA 1S5VA 3ECQA 2BXZA 1E15A 4DZIA 4FK9A 4UMCA 1ZP4A 2TRSA 3CQKA 3FW6A 4UXDA 3LCLA 2XIBA 4GJJA 1M01A 3I3BA 3A24A 4GY1A 1Q4NX 1QOPA 2FQIA 4G7FA 1FXQA 3C0QA 1SJBA 1JCLA 4KWVA 1JVNA 3KRSA 5D38A 2X30A 3VFCA 1O7AA 3LG3A 4MAVA 3AJXA 5G2WA 5CG7A 3RO6A 4AVNA 4L9YA 3EKGA 2FB3A 2FHCA 1MW0A 1ZJAA 5FSEC 2E1WA 4YTRA 1QNQA 3KBNA 1F3EA 3TSDA 1T40A 2OEJA 1QI0A 4P7QA 4HYWA 2OZ8A 3BSMA 3WLJA 3RK8A 4EIVA 4IZGA 4MY9A 4XKYA 3CL8A 3HA1A 2Y62A 3MKVA 3WJZA 2OGJA 1OC5A 4YJ5A 3VZZA 3GR8A 1IT0A 3BJFA 3WUFA 2IKIA 5LHEA 1TVNA 4PC8A 3F03K 4D2JA 3NYDA 2C91A 3NM3A 4ZBCA 2PLJA 2YIHA 4LC6A 1UR3M 4TMCA 1XPYA 3W73A 3CUIA 4NASA 5E93A 2YBUA 4MDPA 1DJZA 3KTSA 4GISA 1V79A 4W89A 1E6SM 3TDFA 3BLIA 5FL0A 1PCKA 5HWJA 3BW4A 4BCEA 1W5PA 4I5RA 1IF2A 3AYSA 4KFNA 4O0ZA 4AZ7A 1PAMA 2QUTA 3H54A 1X38A 3QY6A 4Z2HA 2VEMA 4O11A 4P8VA 3EDDA 4I9AA 3PB0A 3LENA 4US5A 1E1FA 5REQB 3CNYA 3CUHA 1PIIA 4M6PA 3BE7A 4ZXLA 1OFBA 5ABFB 3M43A 3GVQA 1UR8A 3B0PA 7CGTA 3WUBA 2HWGA 4FX6M 4E3VA 1HNYA 1WCGA 3I3EA 3G1DA 1PKLA 1D7KA 4YMZA 3MKCA 3UR7A 2Y5EA 4GYKA 3CYJA 1JD9A 4CN1A 1U1UA 3PTKA 3L4WA 3VPLA 3GO2A 3RR4A 1TJ1A 2ZRUA 2E8YA 1H7XA 2DW6A 1K8ZA 4LB3A 1PKMA 2ATSA 2GLKA 1LROA 4OKDA 1IZCA 4DB7A 3LXBA 3T8QA 4WK9A 4AWEA 4DF2A 1XYBA 1YHTA 3WL1A 1YTEA 3TFCA 3GRIA 5C2GA 1NOWA 1B3OA 1W6TA 3AZTA 5HPCA 3QV8A 3IAQA 3BOLA 1V02A 4W5UA 5HUPA 2ZRXA 1JZ3A 1D3GA 1AMYA 2KZHA 1LBMA 5HMDA 2CZ5A 3WFAA 2WSPA 1XQLA 2AL2A 1FDYA 2FFIA 3QZAA 3NDZA 3FJLA 3S6DA 5AOUA 3U9IA 2GWGA 1MXGA 2C8NA 4JN8A 2E5DA 3TCEA 2GVGA 3CIXA 4YLWA 3N1AA 3QVQA 3H7UA 1LQ0A 3GZ3A 2NW0A 3LCWA 1HF6A 3CB8A 4AXKA 4HSOA 1W1B1 4MYXA 3JUGA 1V93A 2XSAA 1KRCC 1RLDA 4AFYA 3PBMA 3SEPA 1FWSA 4QQUA 3BARA 1WQ5A 3BO9A 2YCJA 4CQBA 3CWOX 4NZ1A 5E9XA 3TTOA 8CGTA 1W9VA 3OHMB 4P7RA 1OD8A 4K6AA 2VNCA 5HR7A 3NM1A 2XIIA 4UOQA 2UBPC 2WMJA 4IFKB 3TTQA 4Y9AA 3OJGA 2CNCA 3QGKC 4EK7A 3AIVA 2CLEA 1WB0A 5C8BB 3WLNA 2I5GA 1Q85A 1A49A 5LGZA 3R7MA 1QNRA 1C3FA 1TQJA 3QPZA 2W79A 3DEQA 2V9DA 4HHPA 4WQ6A 2NWRA 5BNKA 4ES4A 5JH2A 1C8XA 3M0YA 3WQ8A 2DH3A 2BVYA 3F4WA 3LRKA 4DWSC 1A0CA 4JTJA 4UFLA 3NL5A 1H41A 1I9CB 1OFAA 4MAZA 4NI8A 2PLMA 4PCFA 2V5LA 4IPLA 1F8MA 1TR1A 1IIHA 1K6AA 2VRQA 1US3A 4K3ZA 1CIUA 1BQCA 4AC1X 1HJUA 2X7WA 1RHCA 3VE7A 4XSMA 5E9AA 2ZQ0A 2ZTJA 4DM2A 2VTFA 2NQ9A 2Y5SA 2QVNA 3THAA 3CK5A 4B9YA 4JTGA 1WKYA 2PTDA 1R5YA 4BKNA 3FJ4A 4WKAA 3W70A 2H90A 1SPQA 3WELA 1NQ6A 1DEDA 4RX0A 4LUTB 3AMKA 4GXMA 3NPVA 1PE1A 1S3HA 2X7VA 2VDHA 4DN1A 2CESA 2CXEA 1F2JA 5EBAA 4K2SA 3VNIA 3LXAA 3CUGA 3FYPA 2B7NA 1U33A 1FDZA 3VIIA 2F2KA 2ZOXA 4HVXA 3OZPA 4GY7A 5C6MA 4K1GA 3W02A 3GVVA 3QMSA 2VELA 3M5ZA 3BMVA 3OYZA 5HNRA 3OEXA 4JN6A 3S1WA 3Q65A 1CEOA 3BG9A 5BOEA 2VFDA 3NNTA 2PDHA 1GW9A 3SSZA 3R58A 2DT1A 4OBTA 4RLIA 3AIQA 2CBIA 1UYQA 3BCDA 4PBGA 3R89A 3UA3A 3S8HA 4BQ5A 4JEJA 3GNRA 3DU0A 1KCLA 1XSIA 1ZY9A 2GGGA 1CI1A 1TJPA 1S39A 3F7JA 1EC9A 1JNEA 4Q4SA 1K3UA 3B03A 5EMMA 2YL9A 5FACA 4R3UA 1Q6EA 2CC0A 1RLCL 3KCOA 4O1DA 1OFPA 3PBWA 2QGHA 3UXLA 1HL8A 3AYVA 3RM8A 1Z3NA 1D3CA 4C6EA 4J40A 3W23A 3WLKX 3VGDA 4Q8TA 1KM6A 3GDBA 3ANUA 4ZCWA 1POKA 3PPFA 2QT3A 1QHZA 5E0CA 2HZGA 1D2KA 1H51A 2Y1HA 2QPUA 2C7FA 4JIPA 1E71M 4NXKA 4CEUC 4FS9A 2O9OA 4N0RA 1S5MA 3PZMA 4M6QA 4XZNX 3KRZA 4FNUA 1B90A 4UMBA 4LYQA 4YXGA 1TFVA 1XIDA 1GVFA 2WQDA 4LY8A 5LIWX 4S3AA 3L65A 3SCRA 3VABA 4BHYA 3NZGA 4JTAA 1F4HA 3CPRA 1W56A 4WJ8A 5A2BA 3CAKA 3HGRA 4JNYA 1NF7A 3HPAA 4HJWA 1GT8A 4PBFA 3AISA 1FP8A 4F0RA 6REQB 3GXNA 2WSKA 5HJXA 4BFAA 2UY2A 3GUGA 1UA7A 1A3XA 3WLHA 2W27A 2FPVA 3S1GA 3I68A 5E09A 4F0KA 1OG6A 4LS0A 1GPWA 1QO5A 3A12A 1M7PA 2I1OA 4QQ3A 1KM1A 1HXJA 3RG6A 1KLYA 3ZVHB 3E0WA 3P7YA 5DMYA 4MJZA 2Y89A 4J9JA 1PX3A 2Z1SA 2IPWA 3W22A 1M5WA 2EG8A 1E1CA 4UTLA 4DXVA 1SZGA 2E6FA 2MANA 1JZ7A 1B54A 4Q4PA 2DIKA 4DYJA 4NL1A 4PTNA 2DT0A 4FXFA 2V2DA 2R1PA 2WAGA 3A4WA 1WPCA 4PUKA 5AYIA 3BLKA 3LOTA 3HIJA 1JEZA 3GH4A 4O4VA 3TN5A 1WA3A 1UUMA 1ZCCA 3RJXA 3KVMA 4IQLA 4TVUA 3AHXA 4JQ4A 1TWWA 2XH2A 4ZA0A 4CNUA 1XYMA 2ZVIA 4BZYA 3W29A 2WNWA 3KX6A 5REQA 4X2PA 2GJNA 2OG9A 5ABFA 4TV5A 1CXLA 1X1NA 4L9XA 3II1A 4XG1A 1AH4A 4EOUA 2J47A 1XLHA 4OBSA 4CQAA 2DIJA 2FVMA 3KUMA 2C79A 2RHGA 4IIBA 3BLDA 4PMZA 5I6SA 5D09A 4R9OA 3H6OA 1VEMA 3UZ5A 2EGZA 2ZADA 3E0VA 4U3CA 1LZOA 4A35A 4UR8A 3GU2A 3ZFHA 5CC6A 3NL3A 1JXJA 2J66A 1XR2A 2A4AA 3UG3A 2QYGA 3WQDA 4IGSA 1RH9A 1G94A 3GIQA 4QBXA 3FSTA 4HYRA 3JZEA 2PEVA 2YZ5A 3VNYA 2B81A 1V6UA 4GFIA 4HZ7A 2WKJA 4UZSA 3T0TA 1XL9A 4ZODA 1CXEA 4H2HA 1VEPA 2BLEA 1A0EA 3GB6A 4NAEB 3W2NA 1QK2A 4LUJA 1GQNA 3N11A 4GC4A 2R14A 1EIBA 1TSIA 2FVLA 3NURA 4GPNA 2HRWA 3FIGA 1ML1A 1EA0A 1JNDA 2WMGA 3DFSA 4TXEA 3IIOA 1JZ5A 5IHSA 3AHYA 4HYVA 4KH2A 3PUOA 2Q01A 1PWMA 2FKPA 3CBWA 3CH0A 3HFTA 3VNLA 1AQHA 1W1A1 3OZOA 3IVUA 3UPWA 5CGMA 4H8UA 3NQMA 2YL8A 2FYMA 4L64A 3MJMA 4PMQA 1W17A 3AMCA 1BGAA 1EH9A 3VKDA 1D8CA 4N7QA 4IFKA 1BTMA 1OGGA 4IIFA 5EB8A 3UPBA 2QDGA 3KP1A 4F48A 4AWTA 3FAXA 2JFEX 3NQEA 3VZXA 2P76A 1VF8A 2LLEA 4QE1A 3AYRA 4LSBA 1ADOA 5I3KA 3UY8A 2VEKA 3CUXA 3TNOA 2FZNA 4UFIA 4JQ3A 4B5WA 3NQVA 3UP8A 5LIKX 1MFUA 4N9DA 3OZMA 1BYBA 3UNDA 3RGTA 5I3HA 1EUNA 5E0KA 3K8LA 5I0DA 3FCPA 2PC4A 1XLBA 1QW9A 3GHUA 3AZSA 2G3FA 3M0XA 4ZO7A 3TYAA 3E49A 4H01A 4HOXA 1XC4A 4KW2A 3H2MA 4O16A 3WDRA 4IF2A 3S5NA 4C7GA 3E0IA 4QISA 5BXTA 4HCLA 4PCTA 3OG3A 4LYKA 3G1YA 1BTCA 2OKTA 4D72A 3COTA 4LRSA 3TQPA 3CAWA 1E0UA 2PU0A 1Y5VA 4F0LA 1OYBA 1M68A 5BWFA 3DYMA 4KRZA 3W1QA 2Q8ZA 4LVFA 4BI5A 3MBDA 1S5WA 4AZ6A 3RIKA 3PWIA 5FEWA 3ZLGA 2BVDA 3W1UA 4RE0A 3WK2A 1VHNA 3M5VA 4AD1A 3W81A 1RJRA 2CZFA 1DWIM 4HK7A 4GIRA 2EQDA 1EQCA 2FFCA 2ZWZA 1X6NA 3U5UA 1MNZA 3U2EA 1IV8A 2QIIA 4A8LA 3DHDA 2QUNA 1ISYA 3GBDA 1W5MA 2A6LA 1F3TA 4V33A 4GH3A 4WXZA 3VGFA 2JK2A 1TTJA 2WWCA 1J96A 5EMKA 4JOMA 3QRHA 2IUZA 1E4NA 2Y70A 2PU1A 1NOUA 1GONA 4PR4A 4QXIA 3T7VA 4ZENA 3VC5A 1EA9C 1AW5A 1BPLB 2WHKA 1E3XA 1FHVA 3BCFA 1ZBVA 2X0SA 3WDHA 3G8EA 4HA4A 2DFAA 2J25A 2VWTA 1TB3A 1XBYA 2VFGA 1RSCA 4EX4A 1J01A 1R3TA 1PTDA 5DLCA 1UPPA 5D2XA 4JNZA 1L0PA 3C0SA 4IH3A 2DZXA 2Y4SA 3EX1A 1YMYA 2VCBA 1GYMA 5D8WA 3ID7A 2TODA 2NX1A 4Y9MA 5H8UA 2JIEA 3THCA 4PYSA 1XH2A 4LNYA 2J27A 4AD2A 3CEPA 4J3UA 1SJAA 1UR2A 4RZ5A 1F73A 1HIZA 2HV5A 1JCYA 3WK1A 1KA9F 3P62A 3QGVA 1Q6GA 4B4FA 1TV4A 1VKFA 5AHIA 2E40A 3TZNA 1BKHA 4ERAA 5A5WA 3WMCA 1VBJA 3WK0A 3AMDA 2XSBA 1PJ9A 3KWSA 3MPGA 4R85A 3TN6A 4RE2A 1QOQA 1FWEC 3ZT7A 3ITGA 1WBJA 3WLLA 4LWWA 3PUGA 1DWHM 3AMLA 2AAMA 3CM4A 3TAOA 4I8DA 3FY1A 2WM0A 3VMOA 3KVJA 2Q3RA 1KM4A 3EA1A 5GQBA 3GDRA 1GVYA 4XIAA 1W5OA 1J4EA 1UPMB 4OQVA 4C6KA 1RALA 4MLRA 4HHLA 1ONWA 3W85A 3IJ7A 1I1WA 4W7VA 2QCGA 1OG0A 3A3HA 4OZOA 4AZCA 2HS6A 3NYZA 2V38A 2INFA 1JI2A 2YDQA 1OK4A 2FGBA 3GHRA 3M0IA 3LGGA 4QIUA 3WDJA 4E4FA 4PA8A 3KRUA 1VD6A 1QO2A 3RLGA 1UMLA 4ASTA 3EWYA 3ARZA 2QEZA 2W0UA 4L5ZA 3GNXA 3Q4DA 1EXBA 3OBKA 3G1RA 3CO8A 3SJNA 2G4FA 2ZA3A 2DZAA 3IIPA 3ARSA 1E5JA 1KFCA 2X1RA 4AY7A 4IFOA 4FX8A 3APYA 4BWLA 4MKSA 1N55A 3E74A 5FJIA 4Q8WA 3NFUA 2OJPA 4XAZA 1QCWA 2HROA 3TJLA 5AKQA 2EEXA 3P14A 4OBRA 2PDXA 2OTDA 1PZ0A 3TTEA 2ZZ7A 4YU1A 3L0KA 3RNDA 2Y88A 8A3HA 2H3DA 4JTDA 4LANA 2P3ZA 3EWCA 4PUNA 1DIDA 2D22A 5E6YA 3AXHA 3LBOA 2Q3OA 4QFUA 3HJZA 4U4MA 1TCMA 2BWGA 4PB5A 4Q4QA 1QI5A 4WEVX 2ONEA 4GNVA 4QGCA 2JIWA 1K02A 1VBGA 4RXGA 3UA4A 3ALFA 3NO3A 1MQQA 4W8AA 3LPFA 2J7EA 3W07A 4IXXA 4J4KA 1AJ2A 1SJCA 3R5EA 3TW9A 3LBMA 3QSTA 8TIMA 1S2AA 2PDNA 3WH8A 2F7FA 2BTMA 3MSGA 4IPNB 1QPQA 2OT1A 1VS1A 3K30A 3RXZA 1OX4A 3PNZA 3STPA 3EDKA 2IXVA 1JYVA 4H8VA 2ZZ3A 4E3TA 2QQ6A 3LM3A 4NAEA 3N3MA 3TNBA 4A3YA 2Y63A 3SIMA 1KTBA 3GNNA 5F1UA 1RQEA 6CGTA 5L9FA 4FIRA 1Q7ZA 5FEPA 4HA1A 3U5YA 3VYLA 2R24A 4HNUA 1V3LA 2PDWA 2G97A 2PF0A 3RM9A 1L6SA 1G67A 5BOOA 4ZSTA 1MSSA 4J3XA 2FZ8A 1XF0A 1DXEA 3MZNA 1PXGA 3RHGA 3FYOA 4M29A 1I45A 3ATYA 3WF0A 1QW7A 4RPQA 1VP5A 3WNNA 2BODX 4GACA 5BROA 4DF1A 1EF2A 4WD0A 4WZHA 1EC8A 1CGTA 1PTAA 3L4UA 1ZJHA 3LEPA 3GTFA 3LS9A 3VXGA 4WOQA 1QNOA 3CUFA 1FH8A 1PYMA 2IW0A 1QXLA 4AC7C 3DUGA 3FSUA 4DZ5A 3W1NA 4ECLA 1GVEA 2VR5A 3AHZA 5A8NA 2JGYA 3M16A 1BG9A 3GC2A 3N2CA 2DV0A 3N13A 4A8IA 1H7PA 1EJRC 1TVLA 3REQA 1CLVA 2V3EA 2GOKA 2DUZA 3P0XA 3W37A 2HSAA 4FAMA 4B9ZA 3CC1A 1KV5A 1E6ZA 3G22A 4NRRA