1MFUA

Probing the role of a mobile loop in human salivary amylase: structural studies on the loop-deleted mutant
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
491
structure length
491
Chain Sequence
EYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHSILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Probing the role of a mobile loop in substrate binding and enzyme activity of human salivary amylase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords alpha-amylase, Salivary
total genus 176
structure length 491
sequence length 491
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2002-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1mfuA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1mfuA01
2J7DA 1QI5A 5A2AA 2O9RA 4HOZA 1QW8A 5A8MA 2WVUA 1ZJAA 3ZT6A 4S3KA 1BPLB 3PTMA 2BV9A 1Q6GA 2CHOA 1E4NA 4AD0A 3GNOA 3K46A 1VB9A 1E6QM 3GDBA 4QLLA 5HPCA 1KGUA 3VD7A 4AY1A 3PBGA 3NIYA 1Q6FA 2WHKA 1RPKA 4LYPA 4MB5A 2VRJA 3TA9A 3FNDA 1DWGM 2VX6A 3ALFA 3CZNA 3BVXA 4IM4A 5KEZA 3AMGA 4B15A 3WFLA 5JIWA 3SEPA 3WDRA 1HXKA 1G5AA 1BVNP 4U3CA 3DX3A 3WUBA 2Y2WA 1QBBA 2WVVB 2EXOA 5A69A 1B3XA 1GHSA 4B3LA 3B8SA 1QBAA 3I3DA 4AZ7A 2WB5A 3IAPA 3ZR5A 4CD7A 3AISA 4HTYA 2W5FA 3J7HA 3FN9A 4FMVA 1WDQA 1PBGA 1FA2A 3IK2A 1E73M 4CKQA 1EDGA 1QVBA 3MS8A 2EEXA 2J8FA 1TQSA 2PWDA 4AYGA 3LPPA 3W38A 1KFWA 4F9JA 3CV5A 2NT1A 3EDFA 3H54A 3EJUA 3S5YA 3CLWA 4WLCA 2YL9A 3OZOA 1EDQA 4U31A 1CTNA 1LJYA 1JGIA 5DO8A 3CHCA 2ESCA 2CKRA 3KLKA 1PPIA 3O2LA 3F4VA 2XM1A 3EJSA 4HU8A 2WYSA 5CXPA 1VF8A 1Q6CA 3IANA 1R33A 3EDJA 5LA1A 1V6YA 2HVMA 3I3EA 5C70A 4C7GA 1FFRA 3OLDA 1W3KA 2WLYA 4EANA 5CQ1A 1HKKA 1D2KA 3SCUA 3W25A 2XWEA 1E72M 1LL4A 3WQWA 5A6AA 2A3BA 3CPUA 1TUXA 3E1F1 5D9NA 3M07A 3VSVA 2WZIA 4IISA 3AS3A 4J3SA 3DECA 5BXPA 2EADA 2VJXA 5AC5A 5FL0A 4FLRA 4CGTA 2D24A 3QR3A 4JHOA 4R27A 3T2PA 4DWSC 3ARVA 1G9HA 4DM2A 5CLTA 2XSBA 2BHUA 2DIJA 2VMFA 2J62A 3OLGA 3GXTA 4OZOA 2D2OA 1KXTA 2JF6A 2Y8KA 2XYLA 3UCQA 3T2OA 4AMWA 1KQYA 4PMQA 4HMDA 5ABEA 3RIKA 1OGBA 2Y4SA 1ZBKA 1JI2A 4W5ZA 1QHOA 5ECUA 5M03A 4DWSB 1JAKA 5I5RA 2V38A 1UH3A 3VU2A 2DSZA 2XTKA 3KZSA 3EYPA 5A6BA 2XFRA 1MQQA 4HPHA 1KTCA 2D20A 2CBVA 5ABHA 3VGBA 4PMNA 3QOKA 4DUWA 4OGZA 5C8BB 3T0DA 3MMDA 1K9FA 5FD0A 2VCCA 4ZEPA 2EPNA 3CMGA 2AMGA 4UFMA 3HJEA 2MANA 4AXNA 1GUVA 5CZKA 5JBEA 2CBUA 1VIWA 3WY4A 4WKFA 4AZGA 3WF4A 1AQ0A 3AIWA 1DWFM 5HBFA 1B3VA 3BGAA 2YOCA 2CNCA 2X0HA 3WNKA 4D6DA 1C92A 3N11A 1BQCA 2TAAA 1HNYA 4PMVA 1RD6A 4Y7EA 4QP0A 1UASA 3D52A 1UZ1A 2J77A 3L4WA 1W9UA 3WDHA 4M56A 1KCKA 2WC4A 3WDQA 3WEOA 2ZUTA 4X0VA 2WMJA 3BAJA 3POCA 4E8CA 1E0XA 2V5DA 3NCOA 2CERA 3MUZ1 3N17A 5DT5A 3WD0A 3VNZA 4D6FA 3AIBA 1UOKA 4DO6A 2YA2A 3QHMA 1MVYA 3WNOA 2F2HA 1UUQA 3AIEA 1GOKA 1MFUA 2J8GA 2WHMA 5KZ6A 2WSKA 3ECQA 1RH9A 1JXKA 4W5UA 3CUHA 3DX2A 5GNZA 1P6WA 1JFHA 1CXIA 4L4OA 5E9AA 1CGYA 3N1AA 3N18A 2QLYA 1H1NA 2Y24A 1XD0A 4Z2KA 3AQUA 4BZYA 1E43A 4CN1A 3SUSA 3MMWA 2D0FA 4HA1A 4WSKA 1K9DA 1W3HA 4QCFA 2JIWA 5EFFA 5BROA 3FW6A 3VUPA 1FHLA 3THCA 5IHSA 1HVQA 4J3VA 1LWHA 3LPFA 1TVPA 3GXNA 1J0IA 1BGGA 3CHFA 3WMBA 3GBEA 1PS3A 4FLSA 3QHNA 1JD7A 3SCWA 5D9OA 1GOOA 2CBJA 1E4IA 4MNMA 3OB8A 3K8LA 2YBTA 5GPRA 4QLJA 1U2YA 1E6SM 3VDHA 2CIPA 4Z2HA 1TZ7A 1M03A 3RM4A 2X2YA 4MNLA 1UD4A 4GKLA 4KRTA 3LPGA 4FNRA 2HISA 3BSHA 3L4TA 4TX6A 4MNJA 2DSKA 1JIBA 4WJXA 2WNWA 3TV8A 4W84A 3PZ9A 3PHAA 5BRPA 5CPQA 1CGVA 1CECA 1JAEA 4KRUA 1TA3B 2ZX6A 3MV11 4LXFA 4TVDA 4PN2A 2X8RA 3PTKA 4IPNB 3BUIA 4MDPA 4OBSA 3NSNA 3AZTA 3SURA 4KH2A 2Z1KA 1XSJA 5CG0A 2ZWYA 1WAWA 1CLXA 4PMRA 1JI1A 2J25A 7CGTA 1JDDA 5M5DA 3ZT7A 2F7QA 1QW9A 4OUEA 3NDYA 1E6PA 2NSXA 3GXIA 3WH8A 2DSUA 1J0JA 2VQTA 1JZ5A 2GSJA 1ZBCA 2YDQA 4NRRA 4HU0A 1UG6A 1V3IA 3AYSA 2OSXA 3PZNA 3G6LA 2WBKA 1R47A 2X05A 3BUQA 2BXZA 1XSKA 2BXYA 4JFTA 3B9DA 4UNIA 3GXFA 4W8BA 2A3AA 1BYAA 1UYQA 4LGXA 4M1RA 3AMDA 4PUDA 4GIAA 1BFNA 2DDXA 4UTFA 2QMJA 1NWTA 2BS9A 1XYZA 1HIZA 2ZOXA 3IGUA 1CXFA 3IJ8A 5GNYA 6TAAA 4Z2JA 3HG2A 4GQQA 2VI0A 3N12A 2ZXQA 4F9DA 5EB8A 1V3MA 4H8VA 1ISZA 3OLIA 1B30A 1J18A 3WNPA 4H7VA 1ZS2A 4UQ9A 1UZ4A 2EPOA 4D72A 3U5UA 1E0WA 3LX9A 1E6ZA 4FNUA 3VGGA 1BHGA 3NUKA 2QF8A 1FFQA 1E4LA 4PSPA 1WKYA 2EQDA 4D6EA 2ZUMA 3WQ5A 1MQPA 1CZ1A 4V28A 3A4WA 1CXLA 5E6ZA 2OWWA 2VC9A 3D5HA 2VRQA 4QAWA 3BAXA 4DO4A 4WIWA 1UD8A 1CIUA 1QHPA 1UD2A 1JZ2A 1LLOA 1HWWA 2J78A 3DC0A 2CETA 2PBOA 2VO5A 1HKIA 4AZ5A 1HKMA 1VEMA 1V03A 4PEEA 2WW5A 1CXEA 4GZIA 2VZVA 3BVWA 1UWSA 4B9YA 1YHTA 4V27A 4AD3A 1O6IA 2EJ1A 4AZCB 4NZCA 2ZICA 1DP0A 1MWOA 2WK2A 1NQ6A 1HL8A 3RMEA 3WDPP 5I6SA 3VOCA 5HXMA 3D4YA 4MAZA 4WK9A 2BVDA 4HOWA 4Q22A 2ZX9A 2A3EA 1GZJA 1H49A 3U5YA 1UQYA 2WMGA 2GJRA 1DWIM 2YLAA 2X2HA 1KWGA 4DUVA 2J7FA 1I1WA 1IZJA 2XUCA 2VZSA 1W9VA 2D73A 3AXXA 5AYIA 4HMEA 2FH8A 2C7FA 1J0YA 3A5VA 2JIEA 3VM7A 1W3LA 1JF6A 2AOSA 1VAHA 1GONA 3AJ7A 4HZ7A 3WELA 4UQAA 3DX0A 5F7UA 1WDSA 1KXVA 1XH1A 2UY4A 5DFAA 5A6KA 4J3TA 4W7UA 3FY1A 1UKOA 4OIFA 3LRMA 5IFPA 1GOQA 1PZ3A 3S5ZA 3ARWA 4ACYA 4AZIA 3OA5A 2WCGA 1E6RA 4BQ2A 1C93A 3BH4A 5CLWA 2VTFA 2BNJA 3O9NA 3RO8A 4Q7NA 3CZGA 4PMOA 2IXVA 1FP9A 3CH9A 3A47A 3FXYA 4JCMA 3WH5A 1E9LA 1W1PA 3BLPX 2AAAA 1E71M 1HP4A 3AHTA 3AS2A 1C90A 4CCCA 1VEPA 4GI8A 3AIRA 3LXBA 1GJWA 2G3JA 4D1JA 2WHJA 3CUFA 5CJ5A 1V02E 1NH6A 3W4RA 1W9XA 3MUY1 3WMSA 1MXGA 4W85A 3WQ4A 4IUGA 3K4AA 3L4YA 4NZFA 1W32A 2A3CA 2YDRA 4HPGA 3CTTA 4UOZA 5CGTA 2WANA 1OD0A 3TONA 2Y5EA 3K1DA 2FGZA 4FNSA 3VX1A 4JFSA 1XD1A 1UR0A 1WZKA 3GXPA 3S2CA 3ZMRA 1E5NA 1CXKA 4L4PA 4P8XA 1PX3A 2XGBA 3UERA 4ZENA 2RGMA 3HG5A 1MFVA 1UA3A 3WD3A 5BXSA 2XVPA 3VIJA 2V5CA 3CO4A 1D7FA 4JFWA 4UZUA 3W81A 1QNOA 1BGAA 4TTUA 2YL6A 1B90A 3WQ8A 1V3LA 1OIMA 5I0DA 2EBNA 2F8QA 1NP2A 1R8LA 3MANA 2WCSA 3SCQA 1ZB5A 2OWXA 2C8NA 4OJYA 2WHLA 2V3GA 5CSYA 1H3GA 4DWSD 4EKJA 1ITCA 4OBRA 3L2LA 4MB3A 4ATDA 4AD2A 3D51A 1JZ6A 3BCFA 1ECEA 2W91A 5A1AA 3SCPA 3SCVA 4TX8A 3K4DA 3AHZA 1XHGA 1ZBVA 4E8DA 1BLIA 2EPLX 1XCXA 3WBEA 1QHZA 2XVLA 4GZEA 4NXSA 3RJXA 1OIFA 4NF7A 5CSUA 1M01A 4UQCA 2YBUA 3APGA 4J7RA 4AWEA 3ARPA 1ISYA 3ZO9A 3HZ3A 2ZX7A 3RDKA 2W92A 3W6MA 2E4TA 4P7OA 3UG3A 3AMKA 5M3WA 2DQXA 1X6LA 3JUGA 2XN1A 3PZMA 2F61A 3A6OA 3OBAA 1V0KA 1JNDA 3M7SA 2VT0A 5JUVA 3H53A 3VINA 3PZVA 1EOKA 3EBVA 2EO7A 3UESA 5EMYA 4Z2IA 1PAMA 1TCMA 1LL6A 5A8PA 1NWSA 2YA1A 4OOZA 2ALWA 2CEQA 3LPOA 1J11A 1CGUA 4UQDA 1E5JA 5HOSA 1R7OA 4D6IA 3DDGA 1ISVA 3ARSA 3OIHA 3OG2A 4B16A 4WKHA 1UKPA 1DTUA 1Z32X 4Z2LA 1JZ3A 2XFYA 2ZUWA 2YJQA 1VFOA 1O7AA 2JFEX 4DUXA 4CU7A 2ZIDA 3AXHA 1CWYA 3HMCA 2XIIA 1ISXA 5FCZA 4PTVA 5CPSA 3GZAA 4P7NA 5AC4A 1KTBA 3CGTA 3QGVA 2WSPA 1W1TA 1HKJA 4J27A 4J28A 2X2JA 1ISWA 1W91A 1G1YA 1TFVA 4S3JA 2JALA 5A2BA 2FHCA 4H8UA 2QMKA 3CHDA 3OGRA 4JKKA 1WP6A 3TP4A 1IZKA 1NM9A 3WQ6A 3BAYA 1G0CA 2IXUA 3AMCA 1J0HA 1V0LA 4GZJA 1XCWA 1E0VA 4GI6A 3EMCA 3WUFA 2WBGA 2CPUA 2ZXAA 2UY3A 3ZJ8A 4PMXA 1XRVA 1ODZA 1SMAA 1JD9A 1OBAA 3WF1A 2J75A 4QFUA 5ABGA 3W0KA 2GK1B 2B31A 3K8MA 1R87A 1ZU8A 2WVVA 5EFDA 2WM0A 3W28A 3OLEA 2W62A 1VJZA 3AZRA 5BXRA 4H8HA 3B9AA 2G3MA 1GJUA 3K8KA 2OW6A 3WEZA 1XC6A 4CUCA 1J0ZA 1X6NA 2E9MA 2XN2A 2F18A 1H4PA 2XG9A 3VD5A 3CC1A 1KCLA 2WLZA 4CD4A 3GH7A 1U30A 3ZQ9A 4M80A 1OT2A 2FE0A 4JL2A 3BMWA 5AYBA 3BVTA 2E40A 2WZEA 4NZJA 4B9ZA 3MV01 3SUWA 3TTQA 3WQVA 3ALGA 2D23A 1NOFA 2ZUVA 4NRSA 1E56A 4WF7A 2Z1SA 2GVYA 1MW2A 4NI3A 1E4MM 1JYNA 1R34A 2VVNA 4UOJA 3NJ3A 1HJVA 2E3ZA 1EHNA 2OW7A 2VURA 3MKKA 1I75A 2RGLA 3PZQA 2DSVA 3KL5A 4YHEA 3W29A 1GPFA 1GQKA 2GDVA 3ZOAA 2E9BA 3A4XA 3AICA 3CUJA 2GJXB 3D3AA 3PZGA 1AQMA 3QOMA 1PX4A 4RL3A 5HNNA 4X0NA 3VSTA 1E1EA 3ZT5A 1UR9A 1G94A 4XX6A 1KXQA 1HT6A 4UFLA 1ODUA 3VD3A 4J3UA 3VDBA 1CEOA 5GQBA 1Q6DA 4M24A 1UR2A 1E70M 2PF0A 2CHNA 2O9PA 4M8UA 3VNYA 3NDZA 1OD8A 2G4FA 3WBAA 1CENA 1NOUA 1VBRA 4YN5A 5HDRA 2FHFA 2WMIA 1QI0A 3AS0A 5EBAA 2D22A 2DEPA 4PMUA 1V6VA 2OSYA 4FLQA 1A3HA 1VEOA 4P8WA 3KE0A 2BY1A 4UFIA 5DF0A 4MADA 3B9EA 1CGTA 2PWHA 2JEQA 5FOOA 2WZHA 4KGJA 1GQIA 2FDMA 3WFZA 1EQCA 3HU7A 3OZPA 1NP0A 1GNXA 1KR1A 4U5KA 1JZ7A 3WKZA 4ML4A 5LA0A 2EAEA 4JFVA 1VBUA 2PB1A 1PIGA 3PZIA 4P7RA 3MI6A 5BWFA 4W8LA 2XVGA 3VO0A 3ZSTA 1GVYA 2OYMA 1B31A 1AMYA 1W3JA 1K9TA 4EK7A 1WNOA 2IGTA 1WDRA 1L0PA 1US2A 2J47A 1F4AA 1GVIA 3WL1A 3BLBA 1NOWA 4XUYA 1KR0A 1QOXA 9CGTA 1Q6EA 3EJQA 4PMYA 2VX5A 1GQLA 2ZE0A 1HL9A 2VUYA 3VGHA 4HA4A 3WD4A 3TTOA 5E09A 3WIJA 2WVTA 2GFTA 1WZMA 2O9OA 5BYWA 1VFMA 3L2MA 2BY0A 4DM1A 4OOUA 3VILA 4F79A 1UKSA 1VENA 4GO8A 4DO5A 4BF7A 4CU8A 2CITA 4D6GA 3KWXA 3EJRA 1IV8A 4NX0A 1W9BM 1J9YA 2WC3A 5E0FA 4P8VA 1UWIA 4TUFA 4FF5A 3ZM8A 2V3EA 3FAWA 4QDMA 2FHBA 3W26A 2QV4A 2DT0A 1WPCA 1C8QA 3SUVA 1MW1A 2FH6A 1JXJA 3WD2A 1M53A 2ZUUA 2VX7A 4MB4A 1H09A 3VIKA 1TG7A 4BCEA 3VGEA 4PSRA 3GXMA 3AIUA 1OINA 3GM8A 4TXEA 1X1NA 4PUEA 3WL0A 1US3A 2WKLA 2D0GA 4PTWA 3KEHA 1BAGA 2YIHA 3SCRA 1J01A 3OGVA 4QCEA 2PWGA 1G01A 4ACZB 1OSEA 1UD6A 1KGWA 3H55A 4DWSA 2FYVA 1QWNA 3LXAA 1LG1A 2PBGA 2CXGA 5A8QA 1HXJA 2YL5A 2OWCA 2XVNA 3DYPA 2F1AA 4LPCA 1M04A 1AVAA 1ZL1A 3DX4A 1JDAA 1JYXA 1JZ8A 4R5EA 4W93A 2IUZA 4CD5A 3RM9A 1EO7A 1QNSA 4XV0A 4ZXOA 4HP5A 2DIEA 5D8ZA 2F1BA 3VDCA 3FHQA 1VJSA 1QPKA 2XGIA 1WO2A 4HZ6A 4YPJA 2BHYA 3GXDA 3MSDA 3CZKA 4AIUA 1N82A 4A4AA 3VTRA 1C8YA 1HTYA 3AIVA 2VZUA 1W9DM 2DSWA 3BVUA 3NSMA 3WY3A 2YDSA 4BS0A 3D50A 1H11A 4H41A 5GNXA 2DGAA 3GNPA 1H5VA 2G3IA 1JDCA 5A95A 3SCSA 1VRXA 4JIEA 2QPSA 2QPUA 4B3KA 3L4XA 2D1ZA 5I78A 4XB3A 3BUPA 2XN0A 3CZEA 1HF6A 2X2IA 1W1VA 1E15A 3RM8A 4WSJA 2PWEA 3DYMA 3RCNA 2EACA 3LMYA 1UQZA 4PRWA 5E1QA 1KXHA 3GH4A 2UWFA 2WWCA 1RP8A 3EDKA 1M7XA 2VOTA 1HJQA 3UETA 2NW0A 4W89A 3I3BA 2E9LA 5D9PA 4MB1A 2WMKA 1R46A 1OB0A 1R75A 4PMDA 2Q8XA 1BYCA 3WEMA 2W61A 3SCOA 3CZLA 4UCFA 3ARUA 1GOMA 3ZJKA 1B1YA 3M6DA 5AY7A 3ZJ7A 4RE4A 1K9EA 4KMQA 2W4XA 5IDIA 4CD6A 1DWAM 1V08A 3AOFA 3VMPA 3D4ZA 1R86A 4F66A 1MW3A 4FK9A 3WH7A 1B2YA 3A23A 4X9YA 3RPMA 1WZLA 1UR1A 2BFGA 1EXPA 2OSWA 4JKLA 4URIA 4HA3A 1FH9A 5D4YA 3BAKA 3ARRA 4JAWA 1RP9A 1Y7VA 4AYSA 4JCLA 2J4GA 2W66A 3NYDA 1TQTA 2ZX5A 3MO4A 3A4AA 4RE3A 2ZUNA 4UFKA 3F5JA 1WCGA 2DPEA 4D6JA 4CCDA 1JFXA 3WD1A 1QI3A 3VMNA 1UR4A 2UY5A 2VQUA 3A24A 1V6XA 1S46A 1CPUA 1CYGA 3KLLA 3UG4A 4F8XA 4W87A 3QHOA 1E55A 5D8WA 1EIBA 3EJTA 3AHYA 3TTYA 1LWJA 2J7GA 2CBIA 1CXHA 1J12A 1U33A 1OCQA 3VGDA 3WNLA 3G6MA 2OYLA 2VR5A 3DHUA 2F7OA 4AZCA 1HX0A 3GNRA 5A3HA 5I79A 4H04A 1BYDA 4EE9A 2BVTA 3N9KA 4HMCA 4YHGA 1HP5A 4JZ5A 3AMLA 2XIBA 3LXCA 2WKGA 1WB0A 3ZIZA 4BA0A 4XZWA 3RILA 8CGTA 1GOWA 2FGLA 1FOBA 3OGSA 3WNMA 4ATLA 3AHXA 5IFTA 2XPKA 2J7EA 1BYBA 4AISA 1CGWA 4Z2GA 1KBBA 1VFUA 3RJYA 5I77A 1L8NA 2CKSA 3T0BA 5TD4A 3BCDA 3VMOA 1FHDA 1MW0A 2WC7A 3SUUA 3T0AA 3WSUA 6CGTA 4TOQA 1BG4A 3PZOA 1K6AA 1XGZA 1UKTA 3VM5A 3MU7A 4CN4A 4HOXA 1XH2A 3AZSA 4D1IA 4P7LA 5BXTA 1DWJM 4PMZA 3T08A 3WF2A 1VFFA 4AC1X 1KQZA 1V6UA 1F4HA 2YA0A 1OT1A 2DT3A 3EJPA 1JL8A 1W2PA 3W82A 4PBGA 1V0MA 3A21A 3ARYA 1J10A 3BAIA 1GORA 4H2CA 1MYRA 6A3HA 2VRKA 2XWDA 1BTCA 4PTMA 4PCSA 2EABA 1XYFA 3GH5A 1CLVA 3MUAA 1V6WA 4ATWA 3ARXA 2XM2A 4M29A 1KGXA 3GYCA 2D3NA 2VR4A 4MJ2A 2BY2A 1SYTA 2G3NA 4W8AA 3WN6A 4N42A 1UKQA 1UD5A 4ZE4A 2YFNA 1I1XA 1XV8A 4CVWA 4J3XA 1BSIA 3CZSA 1CGXA 4TVCA 2YLLA 5FIPA 2GJXA 3TTSA 4AD1A 2ZUSA 3AROA 1UWRA 3EDEA 4V2XA 4P7QA 4C7DA 3CHEA 1TA3A 7TAAA 2PI6A 1MXDA 5E70A 4ACZA 3WF0A 4W86A 1TVNA 3T2QA 3VD9A 1UWQA 3VDAA 3ZR6A 5DMYA 2VZOA 5LA2A 8A3HA 5BCAA 1YQ2A 1KBKA 3WNNA 2F7PA 4AIOA 4JL1A 1H0IA 3BUBA 3CUGA 1MQRA 3WENA 1UR8A 1C7SA 3AI0A 1QX1A 2EPKX 3SCTA 4NXKA 4UR9A 4D71A 1LL7A 3WDJA 3L4ZA 3PZTA 1J0KA 2BHZA 3DX1A 4P8UA 1B0IA 2J7BA 3FAXA 3BUDA 4MTVA 1QI4A 3HG3A 5CGMA 5ABFA 1CNVA 2XJ7A 5A8NA 5I2UA 3EMQA 4AZHA 2G8ZA 3HN3A 5A2CA 1JG9A 4BQ4A 1PEZA 4K68A 1HJWA 3PTQA 5IHRA 1HN1A 3IJ7A 2WMHA 4J3WA 2X1IA 1R85A 1WDPA 1ESWA 5I23A 1LG2A 4CD8A 5I24A 2WPGA 4U2YA 3UR7A 1PZ2A 4GI9A 1GW1A 4MDOA 3VIMA 4BQ5A 4GQRA 4JKMA 1JYWA 3BC9A 3EDDA 2WVSA 1EHAA 5C71A 2OYKA 1WZAA 1TQUA 5DEZA 4LX4A 1TMQA 2J79A 4FNQA 1XH0A 2ZXBA 1GHRA 3CZJA 3VIFA 1ITXA 1EO5A 4U3AA 3UG5A 1BG9A 4EAMA 3ARTA 4UFHA 3F5LA 1LF1A 3CMJA 1JYVA 3VGFA 1TE1A 1B3WA 4AMCA 3W37A 1UH4A 3WY1A 3SUTA 3F5KA 5E0CA 4ZE5A 1B3ZA 1QNPA 4UZSA 5A94A 3AIQA 3W24A 1UD3A 4AD5A 2J74A 2CYGA 3BVVA 1NWUA 3MMUA 1W2VA 4JFUA 2BY3A 3ARZA 2ZX8A 5ABFB 1OGSA 1UH2A 1EQPA 2X09A 1UHVA 4ZXLA 1KWKA 4PYSA 4D6CA 3N13A 3WY2A 3ZSSA 5I3DA 2Y8VA 1CBGA 3AS1A 4JHZA 5DT7A 2QHAA 3KL3A 1EDTA 1W1YA 1V3KA 3WF3A 3HG4A 1PIFA 1H41A 3T09A 3ZJ6A 1XSIA 5JBFA 3VIOA 4GINA 4W88A 4GPNA 2VVSA 2DH2A 4CVUA 2ZWZA 2D0HA 2YKKA 4NSBA 4UQEA 1LQ0A 5IXEA 1B3YA 1SFSA 1NARA 1QWUA 4U33A 3L4VA 1V3HA 4UOQA 3WDIA 4GXPA 4XZBA 2A3HA 3WH6A 2BVYA 4UQBA 1SZNA 5LYRA 5JIPA 5FL1A 4U2ZA 5HPOA 1OGGA 2G41A 2CESA 1PJ9A 4KWUA 2JE8A 4QLKA 2XSAA 1E6NA 1EGZA 3EMZA 1PX8A 1GQJA 1TQWA 3AXIA 3M46A 1HJXA 3U7BA 1V02A 4W7VA 3N04A 4LQ1A 3L4UA 2PWFA 7A3HA 2X0YA 2VL4A 4MJ4A 3IJ9A 1C91A 4OKDA 3IAQA 3TOPA 2GDUA 1FP8A 1QNRA 2OLHA 3U7VA 1D3CA 1V3JA 2VZTA 2EPMX 4N0RA 1JNEA 4AEFA 4FNPA 1GOIA 2PC8A 1KB3A 4LYRA 3SIMA 3DYOA 2YL8A 2E8YA 2XVKA 4AEEA 2VX4A 1H2JA 3BXWA 4MAVA 4FLOA 3N15A 5D9MA 2XFFA 1B9ZA 1C7TA 4A3HA 1QNQA 2CCRA 4RE2A 4M82A 1UWTA 4LYQA 2J7HA 3BMVA 3PN8A 4TVUA 1NWRA 1E3ZA 3BAWA 1UWUA 4AZBA 3PZUA 1FH7A 4MPKA 3MSGA 3W6LA 2J7CA 2WMIB 2YFOA 3CZ8A 1HJUA 3ARQA 5CPTA 2JF7A 2ZXDA 3WUGA 1E1FA 1A47A 3THDA 4E2OA 4HZ8A 2E0PA 4PTXA 3NSXA 1EOMA 1CDGA 4FNTA 1ZBWA 3U57A 2GJPA 5BRQA 3VX0A 1Q4NX 1GCYA 1WE5A 4AMXA 3W53A 2VCBA 3UEQA 1HJSA 3MUIA 3BSGA 2F7RA 1E6XM 4AD4A 4M81A 1DEDA 1H0GA 4C7FA 1JZ4A 2WMFA 1E3XA 1AQHA 4AZ6A 2DH3A 5A8OA 2O92A 2NT0A 3O6AA 1EA9C 3VIIA 5A6BD 3AHVA 1C3FA 1DHKA 3CUIA 2WAGA 3GTNA 3VPLA 1O7DC 2DT1A 3VKKA 3BLKA 4W7WA 1V0NA 4AIEA 5JBDA 5M17A 1W9PA 3II1A 1TQVA 3VIGA 3POHA 1OM0A 1DWHM 3CBWA 4BQ3A 5E6YA 2W63A 2O9TA 4CU6A 3W27A 5A6JA 3KL0A 2D3LA 3VD4A 2VNCA 3CIVA 4E4PA 3WMCA 2JEPA 1OWQA 4CCEA 4IPLA 3DHPA 5A6LA 1C8XA 2UY2A 4PCTA 1SR0A 3LRLA 2GK1A 3LRKA 3SCNA 3A3HA 2WCAA 3UR8A 5FKYA 1BF2A 3GBDA 1JF5A 1UA7A 4MNKA 5A6SA 3VVGA 1IT0A 1HVXA 1R7AA 2VCAA 3AYRA 4ZFMA 1T0OA 2V3FA 1FH8A 3VIHA 3VSUA 2WWDA 1E40A 2E8ZA 2DT2A 3WH9A 1EH9A 4D6HA 1BVZA 1ZJBA 3DDFA 4GO9A 4A3YA 2XHYA 4KGLA 2W67A 2V3DA 1QI2A 3FHAA 4TTGA 3VIPA 2WXDM 4UFJA 4WKAA 2GUYA 5A6MA 4AW7A 4U5IA 3A22A 1TR1A 4CN6A 1SMDA 2C0HA 3S6TA 3AFBA 3WUEA
chains in the Genus database with same CATH superfamily
3NL3A 1LDPL 3HBQA 4TUJB 1QI5A 4UTWA 2IFGA 4L29B 2O9RA 3ONBA 3OXSB 2XJLA 1W3NA 1A1MB 4LCQA 3AFLA 5A8MA 4E36A 1W1B1 1RPXA 4I18C 2JKRM 3OAYK 1ZJAA 5IEKB 3EZ4A 3WTSA 4CNSA 1BPLB 4OD2A 5CP7A 4JTAA 5DELA 5DJ6B 1RUKH 1Q6GA 4JDZA 1VCFA 2E1WA 5IJCC 1NFGA 1E4NA 2D2HA 4GK8A 5DLLA 4K4KA 2QEZA 2FMNA 3K46A 3ELAT 3LA4A 1E6QM 2V8ZA 2EGZA 3GDBA 1MF2H 2CSPA 5FI8A 3KGRA 1DJSA 3LEXB 3W3BA 4AY1A 4AUBA 5CINH 1I3GH 1YPZB 3RIFF 4OGAC 2P80D 3LV3A 3CD4A 3MV8E 1TTRA 5D6DC 3PBGA 2GVJA 4YTSA 2WHKA 1BAFH 1XZ0A 2B59A 3CH8A 1IKFL 1RPKA 3ABMB 1Q9KA 2ADIB 3ASOB 3VFGL 3KJ6L 4MB5A 4O51A 4HF5L 1KLFA 3RHWK 1XISA 3TA9A 4KJWD 5HMFA 1A65A 2UWEB 3MCG1 4LCCB 1DJQA 3FNDA 1MCWW 4JNZA 2VX6A 3WQOA 2L3BA 5E0QA 2FK9A 5L8LB 1D5ZB 3CZNA 5E8DH 3PB0A 3N44B 4LP8A 2VN5A 3TBBA 5IWLC 3OR7B 4Z76B 5KEZA 2WKJA 3BLDA 1FAKT 3AMGA 2Q01A 3K30A 4B15A 2HVKA 3L3DA 3MTWA 4HSHA 3WFLA 5FEPA 1DR9A 4D8ZA 4GW1A 2QGDA 1EL3A 4MSSA 1NIEA 4L9LA 2CHWA 1EANA 2ARWA 4GVHA 3MBWB 4YBQC 1BVNP 2EUVA 5KJRL 2GC7C 4U1LA 3A3WA 4C65A 3DX8A 5M1TA 3TQVA 1OCOB 3GHSA 3NN8B 1GHSA 3EGSB 4RGOH 1QBAA 2YRPA 3LTYA 5D2LE 1L6SA 3W7MA 4ZMLA 4I9XA 4E9LA 3DV6A 3CVHL 2YUWA 3GINA 3GS0A 1NBZA 2BJML 4M61B 3FT3B 3PXHA 1F58L 4APXB 1G9MC 2PYEB 2ZG3A 3QUML 4APQD 3SDXB 2A7NA 3VFTA 1JNHB 1RJZB 4YQXH 4PV9A 2GPZA 4WTXA 3WIHH 3J7HA 4HXAH 4JFEE 1SXCA 4FMVA 1Y18A 2JXMA 4FERA 1EA0A 1BZEA 1E4XH 1ZGLP 1WDQA 4FIQA 4QGTA 3UTQA 3QR2A 3LHAA 1XM3A 4G59C 1FDYA 4L9ZA 1I8KB 4H8WC 4F92B 3IIXA 3SGZA 2CG9X 1DVFC 4LCCC 1TQSA 4MLSA 4PGDA 3LPPA 5E8OB 2CO6B 3EYSH 1TEFA 5IOPA 1KFWA 3PBVA 4CLMA 4G7VH 3C8KA 3EDFA 4S2SB 1R3SA 2ADFL 6REQA 1OAXH 4HWBH 5C7XH 1C08A 1POKA 3EJUA 3Q1EA 4WLCA 3S5YA 1LO3H 2Z28A 2ZRXA 1D5RA 2DPKA 4KW2A 1EDQA 5ACZB 4MYAA 3G5WA 3N44F 3ES6A 2X3CA 4FZ8L 4B3VA 3DBXB 2X88A 5LNEA 3WD5H 4K07A 1CTNA 2JMRA 1VFLA 4DF2A 1OAUL 1I1AA 5CC5A 3BE1L 3IDNB 5DO8A 3S2JA 2BFVL 3PG2A 3DROA 3VKDA 1J5DA 2ESCA 2CKRA 5EUOF 4JZOA 3Q9QA 1QLFB 3HNVH 2Z8VC 4IS6B 4NC1E 2NYYD 3G04A 2PLCA 1FWDC 5TDOB 2FR4B 2OZ8A 3ZVIA 3BANA 4BWLC 2IBBA 1F6FB 3AM8C 1VF8A 1UC5A 4QOKB 2YC1B 3EDJA 2V2CA 1AGFA 5D04C 1TIWA 2XSXA 3GRIA 4KMLB 1L9NA 5DD1L 5C70A 3WLBA 3RRAA 1AGEA 1W3KA 4IOTA 4B9CA 2Z24A 2FB4H 4EANA 3QDMA 5IVZA 1SVBA 2JCCA 2DQ6A 4C58B 1QRND 1M7PA 2J8OA 3QB7C 1MJ8H 4OJFL 5EMKA 3W25A 4CSTA 4QHMB 1T0PB 5AECA 4PD4J 4IMFA 2I9LA 3SQRA 1E72M 2IH3B 4F7TB 1KPVB 1LL4A 3GFZA 3WQWA 5FFGA 4UB0H 1EUAA 3CPUA 4O57A 3QDMD 2DYPB 4RUBA 5D9NA 4Y4HD 4XMKH 2XVBA 3WTYA 4C4KT 3NAAL 4FYTA 5D6CA 2WV8A 3KPSB 1HO1A 3F65A 1IC0A 3WE6A 1K8DA 3DECA 1YPZE 2EADA 4LOUC 5BXPA 4P2QB 3C2OA 4KK5C 2NVCA 4EDWL 2X3AA 1VFHA 3GR8A 2VB5A 3UGUA 2D24A 3DUSB 2W59A 3QIUD 4LO9A 4WGWB 3T2PA 3GIVA 5DX7A 4DWSC 3W0WD 1G9HA 4DM2A 1HEHC 3X14B 2B7QA 1F8TH 1URZA 3H0TB 1F3EA 2J62A 4NKCA 2WXQA 1IAIL 1VGKB 1IQWL 1NCHA 1RVFH 2FCBA 3MLUH 1AKPA 4AU0A 1BQSA 4Z7WE 3VFRB 4DW2L 3CAQA 2OFJA 3WJJA 4OV6F 5J1TC 1C8VA 4ADSA 4JDVB 5EIIA 3ZGIA 5CN3A 2IBGA 1OPGH 5ILTL 5SWQA 1JXDA 5DJDB 2N59A 4K2UH 5DMKB 3WKML 2AL1A 1X3DA 3RIKA 1EPFA 1DQLL 1SJVA 1YDPA 4XO6A 1I6NA 1R24A 2PO6D 4JMNA 5F8QC 1K6WA 3K6OA 3PAUA 3QDHA 1IE5A 2QQ6A 3U30B 1B4JH 2NQJA 4Y8DC 1X7IA 1YYLL 2FL5A 3PGCA 3NXFA 2ZTBA 3AWOA 4FD0A 4ZO6A 1A3QA 3HQOA 4XVEA 5FJIA 2X38A 3HE6B 3BSZA 1DBTA 5IB4B 1A7NL 1W0MA 2ROXA 2XTJD 4GP5B 2DSZA 1EYEA 4I48A 4ZYKA 4JZNB 3CVCA 2H2SC 2YJLA 3D6NA 4UTTA 2FDSA 4N87A 5G2NA 3GRBA 1EZVY 4KX8A 3RKPA 4F7KA 4HPHA 1DXEA 1EEPA 1REQA 2JGYA 3QSTA 3WK2A 1FO0L 1RSFA 3A64A 5EPMB 3H4GA 2VQ1B 2C1HA 3EFFB 4CDGC 1JCKA 5ABHA 1YEYA 3XINA 1HCFX 1Z9OA 4FIRA 4OGZA 1GW6A 4RAHA 1INEL 1YN7A 2W0FA 4UM8B 3T0DA 3WYZA 2Y89A 3MMDA 4XP9H 3F62A 3SM0A 1BWMA 1K9FA 5I1IL 1Z9LA 4QTHB 12E8H 4XBPB 1F0LA 3A67L 3D39D 4H2AA 1TJIL 3DFTA 2FDBP 2N0MA 3ZDYB 3VFGH 3RWGA 5B3NA 4JPGA 2AMGA 5CPOA 4P23D 2MANA 1KYDA 4DCQA 1BJMA 4AXNA 1XGDA 5LCVA 2IS7A 4KV5F 3RL1B 3MUCA 1E5UI 3PIQB 1TETL 3LN5A 1K4DB 3Q2CA 4AZGA 1W6WA 2VISA 1AQ0A 4ODUA 2I32A 2J1YA 3LSOB 3RIAK 1DWFM 2POTA 1S9WA 5HBFA 3RX5A 1OSYA 3PHOA 4L1DA 1IR2A 1L8PA 4H26A 2DW6A 1NCGA 4FFWC 4Z7UE 2OSLB 1C92A 1XF3B 3PWVA 4KDVA 2KMWA 3VXSE 2EVFA 5LNGA 4N9OB 5ENWB 4OVXA 5F2FA 1WH0A 4F2UA 3MR9A 5CSGA 1HXMB 3HUJA 4YTUA 4YR6B 4Y7EA 2BOGX 4XAKD 3FK4A 5D02A 1LP9F 3MRPA 3GHBL 1IGIL 2P1FA 1D6VL 1UASA 2QIIA 3LGDA 2O72A 4X5QA 1QOPA 4L1SA 1LEIB 1NFIA 2J77A 4MX7A 3S6CA 4U28A 5GGUB 5HGGS 3S96B 4A7VA 1UWYA 1H8SA 2A1WH 4FFVD 2JFCA 4O2EA 3NPXA 1KCKA 4MCNA 4AGNA 2WC4A 3MV9E 3FN0L 4OV9A 3KW8A 4ONOA 3W7CA 2UZ9A 5AW0B 3ZLFA 2BWQA 1SEBA 3WAJA 3NNTA 4OLVL 1M41A 4OR1A 4E8CA 2CERA 3N17A 4ILSA 1X5ZA 3INPA 1BVKB 3KD4A 2ZZ1A 5DJ0A 4AVHA 5IQNA 3F83A 2O30A 2NCEA 4JX6A 3B5TA 4NQXA 4MZYA 2F2HA 4C4UA 1VFAB 4PW9A 5DU7A 1MNUH 1CE1H 2PDMA 5IESH 3K4WA 2ZCHL 1MFUA 3ZDWA 4GP4B 4BFOA 4Z0XA 3AC0A 4OJEH 1NDGB 4D0DB 2RALA 3HQ1A 3COTA 2I14A 1J8HB 1KZYA 4FOMA 2J1ZA 4LPTA 3V5CA 2FX8L 1WOBA 3SKJH 2FPTA 3DX2A 4R0LA 5GNZA 1U8QA 1O5KA 4HHAA 1QSVA 1CXIA 3A67H 1EXHA 4Q4RA 5CBJA 2K7PA 4XNQA 2ZSWB 5EZOL 4R7XA 2QCDB 2ZAIA 1H6FA 5AW4B 3ZXWA 4Y4FC 5C7HA 1ZLVH 2K3HA 4XMUA 3WLJA 5LNVA 3R12A 4XPBL 1CURA 3HBLA 3B9VA 5T3XD 2VC5A 2QLYA 3G6DH 2LV4A 1OX4A 1JPST 2J88H 3E8VA 4F0HA 3C0QA 1IBGL 3KX6A 2VCOA 4F15C 2O26U 4X98B 4PV9B 4Y2DA 1XGYH 2BOLA 4BZYA 2EDMA 3W1UA 3MMWA 4HA1A 3PBWA 5ICXB 3VUPA 5ABZA 3TYEA 5I3FA 1T7YA 3Q2LA 3W70A 3GF8A 4G1EB 1S9VB 4G71B 1Z9SB 3KNBA 3LQMA 1QNVA 4WQ6A 3SR7A 1J8RA 5C07B 5IHSA 1WFJA 3GXNA 5DTFB 1BGGA 3WMBA 1PS3A 4R0LC 4AQOA 4HAFA 3DJRA 1Q94A 4NYLB 5CJXC 3OD3A 1FFTB 4PJXA 3UXDA 1C08B 3R4RA 5I6OA 3MBWA 3C5ZA 1FNHA 4HH9A 4OGXH 4QUOA 1L5GB 5MEQA 2OB3A 1ACXA 4HCRH 5C09E 2Y88A 3BEVB 3LCIA 1MUJA 2VZ3A 3OX8A 2E4FA 1U2YA 1E6SM 4LAUA 4YTQA 4NC2B 4QOKD 4Z2HA 4MMZA 4X6BA 1TZ7A 2JGQA 4XP5H 2FSEB 5J6GB 7REQA 1LE9B 1ME8A 4NQVB 4EUPH 4WWPA 3PPHA 4N0FB 4E3TA 2XXGA 1FO0H 4Y2DC 2EEFA 4Z95L 4QLWA 2CLVA 5L2JA 5KS9E 1HKWA 4GKLA 3UW6A 4G8GA 4LL1A 3RUGF 4FXKB 1K72A 2FATL 2Q2EB 2AKZA 3R0MA 3O3EA 5AHEA 3PAYA 4PRHD 3NSYA 1G6CA 3OW1A 3CUPA 4TX6A 1FBIH 5ISZB 3OAYH 5T5NF 5IFJA 2VWSA 1LUCB 5DY2A 4M5SA 4LF1A 4MMXC 3KBHE 1S7WA 2XX0A 3KW7A 3Q4DA 3GNNA 2DKMA 3T6VA 5C9KA 1CECA 3NIDF 4UUJA 4N24A 2V9RA 3E0VA 4GKZB 4DJDD 2SFPA 4NO3A 2FT6A 1YNKL 3MRFA 3A5FA 1EJ6A 4PN2A 1V7NL 1ZLWH 1EYWA 2X8RA 2OPCA 3NQ2A 2J57A 2PR4L 3IXTB 4OBSA 3VXPB 3EAUA 1BX2A 3NSNA 1XSJA 2HP4A 3ALPA 3FSOA 3G9AB 3MJ8A 4B9JA 4KBPA 2QBWA 1CLXA 3F01A 3MJGX 4PMRA 4XBEH 2J25A 3S9DB 1K8XA 4IGBD 4JZOB 1XB8A 3TAOA 3MBDA 2PPCA 5JQ6H 2XBTA 3GK0A 2O5NA 2QVIA 2OPJA 3OMZA 3BH8A 1EJXC 5D1ZB 4Y2WA 1NIAA 4O14A 2F7QA 1QW9A 1ZAIA 2ODOA 4JHUA 3ROOA 2WLLA 3QFDB 2BVUA 1UXWA 3MW7A 5GGSA 4PUBL 5KITA 3BE7A 3E0FA 3SRFA 1RLCL 1Q38A 1IGTA 3E2SA 5GJPA 2ZKHH 3MRLA 3UYPB 2MWCA 1L6WA 5B7FA 2A6JA 3SKNA 2XTJB 1WXJA 2BX7A 2W0PA 3D69B 4OD1L 5JPMA 3AYSA 2VABA 3MRCB 1KYAA 1A21A 3STZB 1E27A 2I60H 2LU4A 4FQLL 5AALA 5GISH 5FGSA 2VM3A 1LRTA 5LXEA 1FORH 2IOOA 4YGVA 3OYZA 5G2IA 3B8TA 3EYQC 1EFXD 3QK0A 3BUQA 4R2GC 2DIBA 4L2YA 3BLFA 3MYOA 5DN1A 4L0PB 4OZFH 1PZ5B 2UZYB 4G6KH 3ROLA 5ABAA 2BSDA 3FFCA 2ZVRA 4NO0D 3HNTL 5CGBA 2DYSB 2EICA 2OMWB 3EH3B 5DRZA 4LKCA 3WIHL 5JQIB 3CHVA 3N6QA 1BYAA 4IGBB 1W3IA 4K55A 1CLOH 4P3CL 3AMDA 3WU1A 2V9TA 4NP4L 4PUDA 1T5KA 3DLQR 3EG9A 4FQHB 3UADA 3QDGB 3V6ZB 1BFNA 1PYMA 3VCLB 3DHMA 1AC0A 1K6QH 2QMJA 4JY4A 4WEVX 1IGJA 2UV3A 4NKDB 3KYNA 4GG6A 3FT4A 5AKVA 4F8LA 3JWDL 5T1JA 2ATAA 2ZOXA 4MZ1A 3IGUA 1IE7C 3MV7E 5CSRA 4AMAA 2OP4L 2JB6B 1UJ3C 5T1DL 3H7VA 2Y1AA 4Y8AA 5BRZB 2P24A 2WJZA 3NIGF 2Z4GA 4DF1A 2JI2A 3RITA 4E8GA 4ZSUA 6TAAA 3BESR 4AJVA 3HG2A 2ISWA 4R34A 4GQQA 1T22A 2O5XL 4JPIA 4NWUH 4M7ZB 5LSMA 2ZXQA 3H2OA 1G7UA 1V3MA 4HIHB 2CBMA 4H8VA 3E2QA 3ME3A 3O0KA 3OLIA 4PWIA 1IBBA 4W6XB 3SW6A 4FALA 4E5XA 1N59A 1EFXB 3KVQA 2Y7FA 3A4EA 5AW6B 4PJXE 1KBVA 4L8CB 4UQ9A 3UYRH 1A9BB 1AH0A 5AENA 3ULVL 3MTRA 2EPOA 2AHIA 4P9ML 5IR1B 1W0YT 4G6FB 4XHJC 1LOSA 5BV7L 5I1DA 1CT8A 4MD0B 4ZW6A 2DN7A 5EOCL 1E6ZA 1HXMA 1NUFA 1X5YA 5D7KD 1GVEA 4JR9L 1TOXA 3PFQA 4LBAA 5F4WA 5BMFH 4O4YL 4EQ3A 1ALDA 4FOJA 5C0RL 1TV3A 4LDOB 1CICA 1X1OA 4GBXC 3CXDH 5EU3B 5DEGA 1AL8A 1CDUA 3GZKA 1EZWA 2QF8A 3THUA 3ATAA 1JVLA 1MUMA 3MXVL 5TPWL 3GIQA 1A6ZB 3KEDA 4TVPD 2NY5C 3H7BB 4PBVC 1FV1B 2EXYC 5IB1B 4N4QA 1RUPH 1MQPA 1UJQA 1CZ1A 2E7MA 3U46B 4PS7A 4WIQA 4ZUSA 2OWWA 2H9GB 4ACPA 3ILDA 5IVNA 2VC9A 2BCKA 3LNFA 3D5HA 4GUHA 5FYJE 2E5BA 3BAXA 2BIOA 4HA0A 4JQ3A 3B7RL 1JFQH 1UURA 2V7NB 4G5DA 1CFQB 1K4GA 1HWWA 2NW2B 5I6LA 1PKMA 3W1NA 5EMJA 3TO2A 4X9GA 4I5XA 5C0AB 3SKNB 3O9WB 4G6FD 4XNYL 3RDTC 2AVFA 1TPFA 3NJHA 3K6SB 5SWSA 4RPQA 2WO3B 4M7LH 2OR7A 3D9AH 1SJDA 2I85A 2ITEA 5I17B 5E2TL 3GVRA 2DEYX 1FDZA 1TTIA 2A1YA 3KRZA 3ZS4A 1SFDA 3BVWA 4PTUA 1UWSA 2EE0A 2ITFA 1H5BC 4WEMB 2UX7A 1X7SA 4LLUB 1K8YA 3HC0B 2B77A 4RCAA 2PLMA 3DI3B 2Y07L 4GMSH 5IB4A 5KTEH 3LLFA 5I76A 2BNUA 1MWOA 4NZCA 4JPVL 1NQ6A 2G96A 1HL8A 3WFEH 4CEXC 1D5ZA 1GGBL 4PTTA 5GS0C 3B56A 4PY7B 1ES0B 2XA3A 3B9KC 4I6VA 4XE5B 1UROA 5BS0E 4KKNA 1KJVB 1JUEA 2BVDA 3QUKA 4Q22A 1SXNA 2ZX9A 3RNKA 3RHGA 3TFXA 4HJJL 3SO3B 4B0MB 2P3ZA 1U8CA 1H49A 1V79A 2VOMA 5FGBA 3KTSA 2I9TA 3N0PB 1SVZA 3PP4L 2QHLA 4C56D 1JULA 5HUPA 3UDWC 4NZUH 4EUPG 2WMGA 1YHPA 1CBVH 2EO1A 5EUKB 1OQXA 1IIGA 3V5KA 2HSIA 3O63A 2ENYA 3WIFA 3V4BA 3GUGA 3A13A 5D1QA 1UB5B 3RU8H 2XV0A 1AD4A 3NFNA 4PRBA 3C2AL 3KM1A 4YSRA 2IMRA 1DVFD 4Z6AT 5DMKA 2E6PA 4LTSA 5EU6A 4A6YH 2WZTA 3S9ZA 1PU0A 2J6EA 3S36L 5IHLB 3X12A 3D0AA 4DAGH 2GEQA 1SJBA 3CEPA 1OT4A 5AYIA 4YBHA 1IL1B 2FH8A 3X1GA 1IWPA 3QYCA 1J0YA 4OD3L 3SDXA 3H8NA 3SGJA 3QIBB 2NY2D 5I1AB 3B2DC 4KWOA 4XZNX 3DARA 4AL8H 3W07A 3L0NA 2Z6FA 5G2WA 3U2SB 4AYFB 3HKZA 4APQC 1VHCA 2EVGA 3GGWA 4HLJA 1NIFA 1DXIA 3FO0L 1GONA 4WNSA 3MODH 3KGSA 2IIJA 1P2CA 4TNWF 3LIUA 1XYLA 3C60B 4PB9H 1MRFL 3MRPB 4K36A 4U1HA 3V0HA 2P5WE 4XVSL 2EPHA 4G8GB 3U4FA 3ZUNC 4W7UA 4MXQC 5EU7E 3FY1A 1XQLA 3V4PL 3DUGA 3NQAA 2KLTA 2IWFA 3US0A 4B4FA 5IFPA 3PVFA 1TQJA 1CFVH 4M7LL 1MELA 4KK8C 2GGGA 3VFSB 4ENEC 3G0XA 1RSCA 3EOBA 2YXFA 5E2UH 1DQDH 3QZNA 4NLAA 4NZTL 3TJLA 5B39G 3M4HA 4FXFA 3VE7A 4BI7A 2WCGA 4XCFL 1OE3A 2H2PD 2QHRL 4TULL 1ONXA 2ZQ0A 1MFEH 1MH5A 1J1PH 3W9ZA 4NQEB 3GM0A 3WKNA 2R0ZH 3THAA 4K7VA 4PG2A 4PJXB 5I74C 4GKSB 5D37A 2BDNL 3DTXB 5JW4N 2NYYC 3CH9A 4Q0XH 5HJ3B 3G6AB 4C6BA 1IM3D 1IIIA 3FXYA 1Q0XH 2ICWA 2H8XA 3QXWA 1X7FA 3P8JA 3WH5A 3C6EA 1SYVB 3TWCL 4EEEA 1A2YB 3EEZA 2FIRT 1TNMA 4HEPG 1JJUA 2AAAA 3T0CA 1HP4A 3AHTA 1IM3A 3F5WB 1KB5H 3AS2A 2X4RB 4U3SA 1FQ0A 4LSPH 3TCEA 2D2CC 1JDEA 4QJ1A 4B5TA 3L2NA 4GI8A 1L0QA 1K4CA 5F9JB 2G5RA 1R5IA 3UTTA 3PWUA 2YGQA 3W00A 4Q6IC 1KNWA 2WHJA 2YDAA 1H8OA 2CO3A 3P3TA 2AFNA 4Z7AA 5CG7A 3IGFA 3OMNB 2JKAA 3CZFB 4J35A 3W2KA 5DZ9A 2DWDA 3V5FA 3QRHA 4G1MB 3ULVH 5EN2A 3DNKA 5AB1A 1OQOA 4LPYA 1UUOA 2VXSL 1HHHB 3X1EA 2OO6A 4AMKL 2F74A 4YLCA 4D7BA 2VE6A 1E5BA 4U6HA 5GS1A 5E24E 4J2MA 3DRQA 3BJSA 3OHXB 1TYRA 2W95A 3DG6A 3OHXC 3VC6A 4KROD 3EWXA 4UOZA 3N40P 1K5WA 2FWUA 4N2GA 4P5TD 2ZD0A 2BNRA 4H20H 1BZOA 4CDHA 2F54E 2NWSA 5DFVC 2BERA 2QXWA 4G9DB 3K1DA 5I74B 1UBPC 2DMHA 4IMGA 3QG6A 1TTPA 3S2CA 3ZMRA 2AQNA 1KFJA 4CQAA 1CXKA 3OIXA 4YHZL 1J93A 1A25A 4HIEB 2A9NH 3VXTA 3CSYA 1TIMA 2HXUA 3P9MB 4P2QD 3VC5A 5MEQB 3AU1A 4BZ2H 3ZYJA 1FWJC 1SJMA 1BRLA 2B2XL 2Y7EA 5BQ7B 3B1UA 5FF6B 3ZIMA 1MG3C 1MFVA 3HFFA 3WHE0 3IJHA 4JJHA 2JLLA 2OS7A 5K59F 4N9CA 2VLLA 3UROR 5AKQA 4R83A 1RLBA 4RGNE 1D7FA 1ND0A 1SJXA 3N1PC 1SDDA 3OWRA 3QT2A 5FCSH 4AYID 1QNOA 3B34A 4LARH 4AQ1C 3GMRB 1RJRA 3Q2DA 5LQBL 1CZ8H 2VQ1A 1GHFL 5GHWL 1OIMA 3T71A 2RA1A 4CQDA 1KPUB 4FG2A 3L3KA 4CA4A 1NP2A 2D31B 4E0RB 1DANU 3QDME 4AGQA 2HBVA 3SCQA 3ZLHA 1X8CA 3PAZA 2C8NA 4OJYA 5SWQB 5GVJA 1FDLL 1PZBA 3JV4B 4DT2A 2V3GA 5CSYA 1OGAB 4QHLB 3AXKA 1EGJH 4EKJA 1S5HA 1JK9A 3NQGA 3V0AC 4ICMA 2MTAA 4OBRA 3L2LA 4MB3A 4ETQA 1E67A 1ECYA 4AD2A 2ED9A 1K4DA 2AQPA 2ENJA 1VERA 4QRSA 1RZ8B 4PV8B 3LSOA 1WA3A 1BJ1J 5J1AA 1NGPL 3SCPA 3SCVA 5EV7A 4TX8A 3FDKA 3K5RA 4L1BA 4GYPC 3O2WH 1X5XA 4JVPA 3AHZA 4KI5D 4EKXA 3EJYD 3FTXA 2CFFA 1TZGL 2PDPA 2DBLH 1A14L 1FGNL 4K2SA 4E8DA 1FVEB 3O6KL 4UT7L 1R4XA 1XCQB 4RPPA 2CO2A 3GSUA 2DD8L 3LS5H 1LOLA 2OT1A 2VEPA 4NXSA 1ZLEA 1GGIL 1J9TA 1YMMB 2PTDA 1U58B 4IKKA 1AQ8A 4M6OL 3FJ6A 1SF3A 2O4MA 3QJHA 5HYIA 1CL7H 1DCLA 2DQFB 4P3DB 3T77A 4M5YL 5CGQA 5I3JA 4B6ZA 1A49A 4H8WH 1ISYA 3ZO9A 4AVOA 1KGJA 4J2QA 3CDZA 4KTYA 1M6UA 5GGVH 2VM8A 5E51A 3RDKA 2MIZA 3LKSA 3W6MA 4XC1H 4FZ8H 3UTSD 1RAKA 2XZ9A 1KYUA 4OV5A 3AMKA 2B14A 1F90H 2NNRA 5AD0B 3C52A 3CX5K 2Z91A 2IEPA 5TF1L 2DQXA 3G2GA 1X6LA 4JY9A 2DTMH 2WXKA 2XN1A 3CT2A 1PZCA 4FQXB 2OZ4H 4JN1L 1G7JB 3MLPA 1Q6QA 5AQ0A 3GMOA 2K6ZA 5FEZA 4DJFD 1HHGB 1V0KA 2BNQB 1OCWL 3M7SA 1BJ1H 3ID7A 1QBLH 2NPLX 3FCSA 4HB7A 4DJEA 1NBVH 1JPFA 4L37B 4PWGA 4QXGL 3U25A 1OKEA 2J7LA 4OGQC 1TZZA 4YMZA 4KCTA 3BJTA 4UTAL 3E8UH 4IH3A 5CR8A 3REVA 1LGVA 5DCBA 1NAKH 2V7NA 1HGWA 4IOSD 5EMYA 4LHUB 2GQAA 4WDIA 3BOLA 3DFQA 1GHFH 4Q9QH 1TCMA 1A1NB 2AEIT 2ZOLB 4EF3A 1NWSA 4PH6A 4RNIA 1V7NH 4PG2C 5K39A 3LM3A 4N8VA 2CEQA 2PCYA 3LPOA 1T83A 1J11A 5DC4B 1UC6A 4QF1B 3KLAA 4UQDA 4L3EE 4AIZB 2VEGA 5HOSA 5B4MC 1EJUC 2PLJA 4NNYA 2H3NA 4WKHA 4J8RA 1DTUA 1EF3A 2HVNA 1E6JH 4LSUL 1TR9A 1O5PA 3JWNG 1HWGB 3RPIA 1YTEA 1X9LA 1Z3GH 1R5YA 4QQ3A 3ZRFC 2I27N 3T8XB 3DFSA 3GSRA 4KXDA 1PQZA 4PJBA 3IGHX 4H01A 3T8LA 4H44C 2A9CA 4I1RA 5JOPD 5D03A 5AOUA 3HUJE 4L4TB 4FA8A 1AD9B 4JO5A 2VLKE 2BWIA 3QUKB 4XPHH 3DEQA 4WOZA 2X53A 1T7LA 3O16A 3GFYA 4S1RL 5C0BD 3QDGE 3RPKA 2CRMA 2OEJA 4I6KA 1AQKL 1X5KA 4QTFA 1EMTH 3WF1A 3QGVA 1W1TA 2FJSA 2JKXA 3GTFA 4XNQB 2QCDA 3PWAA 2HYMA 3S98A 3ULUD 4MMZC 1F11A 3K3QA 3Q8AA 2AGTA 3WSQL 5DK2B 1OB1B 5EH1A 3T3MB 1QLEL 3V0DA 2I5GA 3MGTA 1W91A 3GLAA 3VXSB 4ZB2A 1P0NA 2PTYA 5T3XH 4YZFE 1CX9A 1F76A 4F40A 2VR9A 1AH3A 2C5DC 1RZIA 2QMKA 2ZF8A 3FQ4A 4DP5X 2N7BA 1AW2A 3Q43A 3CHDA 5J5EA 3LBCA 3MHFA 3QQDB 1PY9A 1QKZH 1YNTF 3Q6GL 3N73A 2BOBA 2CC0A 1OABA 3WQ6A 4FG6D 2WWOA 5SV3A 4OCRL 3LZFH 4V2BA 1QWHA 1V0LA 2BZNA 4GZJA 5AZ2H 1PIIA 3HG1B 5AZ0A 4C56E 5CCJA 4MWAA 5BVJA 3W84A 4U6VL 1L7IL 4KNTA 1ZT7B 4EO5A 2REQA 3WUFA 2A0LC 1ZJHA 1IEVA 1CICB 1UZHA 4D2NA 5LN8A 3SGKC 1TJ0A 4UUJB 3TURA 4E41A 2EYTA 3DGBA 3NJVA 4JHAH 4AWJC 3LQAH 3W2LA 1SMAA 3U2EA 1T1YB 1WBJA 4Z1AA 3EZ8A 5D7IB 3H2NA 1KNOB 1QA9A 4BE6A 4KJPC 4F33A 4GCXA 1WFOA 2LLNA 4TNVF 4XN2A 3S48A 3K8MA 4TV5A 4NBYB 2XWXA 3KAAA 1ZU8A 3F04A 2WVVA 4EZJA 1MCBA 3MRMA 3SDYH 5EFDA 5I0ZA 3BQVA 3S37H 4KZDL 2G4JA 1UCBL 4TMBA 4JFQA 4MJ6A 3OLEA 4R2GD 4PR5B 3P0GB 2QGYA 3WMLA 3GAKA 5ADOL 1GJUA 1PCKA 5I07A 3QUXA 3K8KA 2OW6A 4H8WL 2Y9RT 4DEPC 1XBYA 3VOGA 4RSYA 3SO3C 3IDGA 1I8MA 1NWPA 5ALCL 5ISZE 1J0ZA 4MNLA 1EXGA 1X6NA 2E9MA 4WEBL 1AHWB 5FA4A 3DFPA 3QG6B 5HJYA 1QFWL 4HUVB 5FWQA 2GJZB 3W1PA 3ZL4H 1A5UA 3BSZH 4JTSA 1B3OA 5CPLA 1R6VA 1UJ3B 1CICD 1D5MA 5GGRY 3V6OE 1N4XH 1AG6A 3VI3B 4Q4OA 5HATA 3BKML 4S1DC 4O4VA 4K5NA 1U30A 3ZQ9A 3UYOD 3A6BL 2YBRB 2FE0A 1AGCB 2P80A 5LB1A 1KKOA 3BP4A 1QFUL 5AYBA 5SWZD 1X4YA 5H94B 3P73B 3CLEL 1UWGL 1FNSL 2X89A 3TNMB 2KI6A 3NA9L 4M1CC 4P5TC 5I3HA 5I1AA 3MUHL 2FJUB 1UBSA 3WQVA 1T21A 3DMMB 3L7FA 3MHZA 3FONB 3FUHA 4EE2A 1E56A 3SBRA 1MF2L 4PJ9B 4HALA 2D7NA 4X4ME 2Z1SA 5IDZA 1ZHKA 3WLNA 3VVVA 3BHBB 1R34A 2NZIA 3QCUL 1MRFH 1HJVA 2O93L 2CBOA 3IFPA 3O8XB 2WTOA 4GAFB 1AZ2A 1DQLH 1EEXA 1EHNA 2DI7A 1EXUA 1XXFC 4UT9A 4GRWB 1TQBB 3RPBA 5F72S 2Q0ZX 5SWSD 2R4SL 1S5MA 1IC5L 1U6AH 4YHEA 3THMH 1X5LA 3MRLB 1AO7E 3UYPA 4DVBA 2E1DA 3FGCA 4BI5A 4R4BB 5GGSY 1PB0A 2Y70A 3CO8A 4QRPD 4XH2A 2MOQA 3HCVB 1NAML 1T2JA 3T2LA 1RJPA 5A8GA 3AICA 5CHNB 2VITB 3QDJA 1TCRA 3QI9D 4K7FB 2GJXB 2Y1ZA 2OMXA 3CPRA 4LP4A 1PX4A 3H4WA 2E7CA 4ELMB 3PZGA 1S2CA 3HW7A 3L3OC 3E8UL 4QKXB 4ZAKA 2BO0A 5C0EA 5E6UB 1QPRA 3NOYA 1N8IA 3MJYA 3S35H 2AJXH 3EO1B 4C6CA 1EWDA 5HJDA 5EMUA 3UYCA 3LZ5A 3DMMD 3SJVE 4UNLA 2E47A 4P2OC 1G94A 4LVOC 4V15A 3TS8A 3O8XC 1B0RB 1HT6A 4AEHL 2R82A 1M2OA 3QZAA 4UFLA 2HG0A 4S23A 4JRYE 2K8QA 5F96L 4R7NB 35C8L 5LGJB 1JWSA 3VDBA 4NQCE 4DZHA 2D31A 3CHXA 3SQBB 1VLXA 3UMNA 1FCGA 1E70M 2CHNA 3E12A 1AR1C 2A9AA 3ECUA 1G1OA 2ZSVA 5FHAL 5HYSA 5MEPA 1U95A 2CJUH 1VGEH 4G8IB 3T1WA 3IRZA 5D2WA 3R89A 1PZDA 2COQA 1HJCA 1CENA 1MCOL 2VYOA 1U1JA 3T04D 5DHEA 3BIAX 2NW2A 4YN5A 3AW5A 1EJSC 3UPAA 5CZ0A 4P5KB 5D7JC 3TO2B 3BO9A 5CEZH 2WMIA 2J8UE 2XFXA 1NKRA 4QRTB 3K2UL 3ULUC 2C3VA 4J40A 4HFWB 3FK3A 3NVQA 2JCCF 1ANUA 2F9RA 4TS6A 3DI2B 4LFYA 1OK0A 4UQ2B 2OSYA 1WGVA 3W1LA 3CFCH 4MKNA 2YD9A 2HVKB 3L3DB 2C1IA 2R8WA 2JQMA 3KE0A 4JO3H 4TUJA 4OZIA 4UFIA 3EZJB 3X1FA 1CGTA 2PWHA 3CDGB 3ESMA 1P7KA 4YHIA 1SM9A 3HOJA 3V5OA 2DB8A 1N5YL 4F0LA 5DEGB 3G3MA 4YSAA 2FDMA 3UQNA 3STGA 1GKQA 4ZODA 1Z3RA 4LDCA 1F3DH 2F8VA 1K4CB 3P9WB 1EQCA 3ARDA 1N6VA 1T04B 4NIKB 3Q58A 1WWWX 3A4FA 3SPJA 1N0XL 3ZQXA 2OK0L 1KR1A 5JQ6L 2DQEL 2CKBL 4ML4A 3UVAA 4AH7A 2W65B 4JREC 4LK4A 3OBEA 2VR8A 2EAEA 4JN2B 4KZEH 1G0XA 4AEIH 4AKOA 1H3UA 1FWXA 3JZ7A 3IJLA 4P7RA 2YGPA 4XCEA 1PVNA 5IW6B 1ME9A 4YN3A 4U1NA 3PWJB 4XP4L 1HZHL 1DSFH 4ZQMA 5BWFA 4MA7H 2VDML 5IJVB 4W8LA 2QKIC 4G43B 3VO0A 4GUFA 3JV4A 4LLMA 4C91A 3D0VA 4A8LA 1AMYA 5ICZA 3GSVA 2ZA3A 2B3IA 4YSTA 1K9TA 3I02A 2ZCLH 4Q6YA 1WBHA 4IIDA 3ZWSA 4DUOA 2IGTA 1ZTVA 2ATPB 1FZMB 1NSJA 2PMZA 4GFXA 1YRRA 3U6RB 2J47A 2DQIL 3CWNA 4B95C 3IARA 2KBGA 3BIBX 5C0QA 2DQHL 2FMOA 5L2KD 4KK8D 1SN5A 3WLWC 3OVUB 5L6YH 3W11D 5IHWA 2FTWA 2E59A 4P4KB 1TO4A 43CAB 4ZQTA 2ZZ4A 4FEZA 5IHBA 4HIXL 1PWLA 2YSWA 3ZZLA 4C56B 2Y0SA 2EINB 1J1OL 2FYMA 1ADQA 3GSUB 1ZHBA 2B1AH 3OSKA 3QQ3A 5EOCJ 2J5LB 2CMRH 3JW7A 4KWVA 1L4IA 5H35B 4KQ0A 5IEHB 3UXIA 3VFNA 4XIMA 4KTGA 2ZKWA 4O2CA 2VUYA 3HG1D 4NPKA 5J9PA 2NZLA 4HA4A 3FUIA 2PTUA 4KO9A 1WWAX 1CLZL 2AV1B 2E86A 2XLLA 3KJ4C 5AOMA 1RU9H 4EI5C 3TTOA 4G5AA 2DWXA 2WVTA 3MNVB 1DJHA 3GO1L 4L8SC 2JKJA 5KVEL 2GFTA 5CEZL 2RH9A 4BKTC 2ADGB 4AUYA 1RHCA 4H40A 4BD4A 3WO8A 1I2OA 1WZMA 3F58H 2BVWA 3IIVA 1BQHA 1D8WA 2NYZA 1Z5YD 2ZP8A 4AT6B 4DKEL 3U9UA 4B2DD 5C6MA 1MREH 1SZEA 3T6CA 2EDOA 4Z18A 2D3JA 3VILA 4DM1A 2J9ZA 4YFLI 1NGQH 5D7LB 3VXQB 1DL7H 3IJSB 2NQHA 4XNMB 5ALCH 3NXLA 2AJ3B 3OXRB 1H63A 4F8TA 9RUBA 4PJDF 3MRQA 1EC9A 1FCUA 3QEZA 4AYFA 4HZ1A 4IM8A 3S34L 4OUUB 1W9BM 1JK8A 3NDOA 4LALA 3NQKA 4V11A 5H2BA 5E0FA 4P8VA 1XCQA 9XIAA 3HUJF 1K7XA 1VKFA 1EHKB 2Z35B 4JFPB 1DSWA 4H9TA 1LP9A 4TSCL 1AZBA 1QPOA 4DGIH 4YSCA 1CVRA 1GS6X 4HUNB 5ADPL 4JS3A 2FHBA 2O1AA 5XINA 2DU2A 4YL2A 4RESB 2GJ6E 1SLVA 3HEIB 1ZHAA 2HV5A 3WLOA 3MOQA 3CHQA 3DKHA 1T4KB 1JXJA 3PUUA 1EX0A 2VX7A 2H4EA 1R3QA 3DSNA 5EO1B 2J8UA 1FYHB 3MO1A 1TG7A 2OKOA 3K72B 3S46A 1G7PB 2GBVA 1HXYB 2ZUXA 3GTHA 4F9LA 2JKTM 4NRZB 5J8OA 2PPDA 2O5ZH 3GXMA 4QHMA 1X4ZA 2ENPA 4IGMA 1ODAA 4J8RB 1TYJA 1X7QB 1IIKA 1X1NA 5HYQA 4PUEA 4WD0A 3BUVA 4ERIA 3KTXA 1IIHA 4CNTA 1W0WA 2H5UA 4PM1A 1OARH 3PUEA 3PTDA 4O54A 1RIHL 4X9SA 4BFAA 4DZ8B 1IXQA 4NI8A 3SCRA 2B39A 4ZYKB 1ZOXA 2R2CA 4OWGA 4QCEA 3CWHA 3KBVA 3WLQA 4DAIA 3HNSH 1KM3A 5D1XC 4U6XA 2Z7ZA 1KGWA 3CMOL 3H55A 4QRRE 4K5OA 1XJBA 3UBPC 4HSNA 3R18A 1F1AA 3LH9A 1UZGA 2DEXX 1QWNA 4X0KB 1LG1A 4GXFA 1O95A 2PBGA 4GQGA 1FLRH 2IH8A 3TV3H 3V5DA 3FN0H 3UBXB 3DYPA 4K94C 1JUFA 4XAKE 2OOGA 4H9MA 5GJTH 1AVAA 2WIIB 1ZL1A 5FYKH 2H0EA 1QRNE 2FEEL 1PKQA 1P9MA 3HI1A 5TGBA 3U30C 2GK0B 4QTHA 5B38B 3ZKXB 5I18L 4OFYA 4QRPB 5JHLH 5LXGH 2Z1WA 1RU9L 2PABA 3BDXA 3NEOA 2IUZA 3NVDA 4NNCA 4NZTH 4PCFA 32C2B 3KPLB 2WNNA 3OA3A 1MI3A 2A7RA 4DVBB 4ZXBC 2GZXA 3KW3A 4XV0A 4M00A 3TJEL 2DZWA 4WHYH 3CSGA 2YD7A 3KHOA 1U93B 2VXUH 4JRXA 4UBDC 4ZW7A 3RU8L 5BZDA 1Z9AA 2Y7DA 1MDTA 1WO2A 2XGIA 3IK4A 4JN6A 4S38A 5HHVL 2VGGA 3P7YA 4RFNB 3WTWA 5KVMC 2WWKO 3F8UB 3M1CA 3MRNB 4HWEL 4XWUA 5DLCA 4NZUL 1FZKB 1RFDL 1Q4WA 1NVMA 2ONEA 3CHRA 1TDQA 2FX8H 4I48B 5D1XA 5B1KA 4ELMF 3W7PA 1WYIA 3AIVA 5DVLA 4HW6A 2QQLL 3OJ2C 4KQ3L 3HZVB 3VG9C 3VXUA 1W9DM 3IVUA 1A7OL 5D9SB 3QQ0A 4WDTA 2ZCHH 1AH1A 3WY3A 3NSMA 2QQQA 4I7UA 1LEIA 1CDHA 3MRRB 3QEGL 2Z7GA 3C6LD 1E6OL 4TNEA 2X7LB 4OD3H 1LEKA 1H11A 3FB7A 3PU7A 1CW2A 4H41A 1L3NA 5C0DB 2ADAA 1V27A 1E8WA 4QYAA 3U0PA 3ITYA 1H5VA 2X0SA 3C86A 2YK1L 4JIEA 3SZ8A 3IRSA 1YUHA 2QPUA 3MACH 4ZXBA 3KPOB 4RQQB 4CW1B 3QTGA 3L4XA 1UPPA 4N8UA 5E4EC 5BZXA 4JTCA 2TRHA 3V6FA 4AW4A 1CR9L 4PJEA 3DBPA 2A38A 2X2IA 2VISB 1WUEA 2QS8A 3C3NA 1LRQA 1XGPA 3LIZA 3MRKA 4I9WE 4YNYB 5C92A 3S0CA 5FWRA 4I7WA 2P26A 1E30A 5IM7B 3CFMA 3AREB 4TMCA 3T65A 5MKGA 1MLBA 2XG5B 4KKZA 4DJMA 1A5LC 3I4EA 4IMKA 5F3HB 2WJFA 1QZ1A 3AACA 3FRPA 5E9XA 4U1IA 2WWCA 5BVJB 5DJXB 3EDKA 5DZAA 1AR1D 1UT1A 2AV7B 3PS6A 1R2RA 1XDLA 5E5CA 4TQIA 2Q76A 2XQYK 1GW0A 1TETH 4KERA 2FVKA 3C56A 1KMGA 2E9LA 3MYPA 4JK0D 4MX7B 1R46A 2YMXL 3TT3L 3DIFB 4IG2B 4EIVA 3LB6D 3D9AL 4LUSA 4XAGA 1ASPA 4XZLX 2VW6A 4BWTA 4Z7QE 1ZVSB 1RZGA 2VXUL 4UT6A 2CWXA 4PMDA 4K1WA 1NFPA 3WEMA 1Q9LB 1PLAA 4M6AA 4IU3A 3DK0A 4MNGA 3RRQA 3ME0B 4R96B 3V5HA 4Z7OB 1SO6A 1U5JA 2P88A 2Z31B 3TVMA 1UT9A 1B1YA 2OXHB 1FVDA 3GUTB 5EORL 4H7ZA 3OQ8A 3GDRA 4LCUB 1XGTA 3I6SA 1K9EA 2WXIA 1ONRA 4LSVL 4WDIB 3UTSB 5ECGA 1M6JA 4CD6A 4GNVA 4XMVA 2QLVB 4J4PD 3J27A 2HPIA 1MCFA 1KT2A 2OZ3A 5E2VH 4PA8A 3VMPA 5I1CH 1LTXA 1WF5A 5IQMA 5KZMA 4TNVK 4KI5E 3MLRH 1AR1B 1J7VR 3NO5A 4HXBH 4X9YA 3U4BH 2QT3A 3TGXA 1NUDA 5I1KH 3LI1A 3ZK0A 4XWOC 3F6IA 1EXPA 3P8IA 1KPVA 2XPZA 1LORA 3ARRA 2HRPH 2FB2A 3AUOA 2BSTA 3F4NA 4DLMA 5EBLB 2AITA 3VXOA 4FQXA 4N68A 5I6XB 3R0UA 4NN7B 2NUPA 1WVZA 2WAQA 4XAPA 4LCYA 3IPFA 3R0KA 1NQBA 5KOVC 4K8HA 3R11A 4P4RA 5EF0A 2ZX5A 1MFNA 4N0FA 3SO5A 2XETA 1CGSH 3CB8A 1WCGA 4JFEA 3N40F 4O50A 4HNVA 2YGVA 1B0RA 3BE1H 4JM4L 1KOAA 3ZKNC 1JFXA 3WD1A 4JM2A 1QI3A 3W9DB 2Z2BA 1UR4A 5K9KA 3ZVHB 4P59L 3OKDB 2LLGA 1Z89A 2UY5A 4G9FA 1D5XA 1HHIA 3SDCB 4P61A 3HF3A 3NN8A 1CPUA 1XRSA 1PVHA 4HUUA 1OXYA 2BIPA 5ADPH 5DMGD 4MLJA 4OTXH 1X97A 3QBUA 1F90L 3KLAB 5DTFA 4GRSA 2NY3B 4IFKB 4JYDA 1F3DJ 4PUWA 4OF5A 2YCLA 3QHFL 4KHTH 4XCNA 2YN5A 3TTYA 3IEAA 5GGTH 3KWUA 1LWJA 3NAAH 5I15L 1JCXA 1IEQA 4XBMA 3K2GA 4NILA 4R3UA 3W7KA 1ZFJA 2C9SA 2JVUA 2P5WA 4BWLA 1U33A 3L5JA 4P3CH 4YHYC 5IB2A 1MUJB 2KZ1B 4J3OG 3WNLA 2E6FA 3G6MA 2OYLA 3BD4A 2FZMA 3DHUA 4XOAA 5GSRB 2VGBA 3QAZB 1NM4A 5F7DA 5EORH 2XFFA 1QUMA 4YDNA 1XMWA 1VYRA 5DRCA 1HOCA 4N20A 3WTVA 3NABL 4UBDD 3NEEA 1FAIH 2EE6A 3BH8B 2AQQA 4G6KL 4WW2B 1BYDA 2UZXB 3B4NA 5KBPA 4WR3A 1FQ9C 4YHGA 1LO0H 3ABXA 1TZGH 3CAFA 1SU5A 2EDEA 3OB0H 5GGUA 4D3CL 3US1A 2XIBA 2IWGA 2WKGA 5FO9B 3PY9A 5CEXB 4LDLB 1K77A 4MGGA 3I75A 5I0VA 4G9FE 3SE8L 1JNLH 2OVLA 4XVUD 3GK8L 3RWJB 2W65A 2BK8A 3KPRE 4X83A 4B5NA 1SY6L 2GI0A 3FJTA 4YHNB 1NGZA 4ZTOH 1KFAH 4JY6A 3VXSA 2NY6D 3AHXA 2PU1A 4HJWA 3GW0A 4N02A 1IFHH 2C9RA 2JKNA 3HS0B 4HXBL 7PCYA 2J7EA 1LZOA 3NGJA 1CGWA 4KKCC 2YRBA 1KBBA 2V82A 2NDFA 3EB4A 3TE9A 2BIMA 3RJYA 1PD0A 2C3VB 4IBWA 2RIKA 2ZPKH 5TD4A 5C7ZA 1K3ZA 1HKFA 1YSOA 1KIUB 3UC0H 1VJIA 3BCDA 4NL1A 3T9PA 3S4SA 2EVJA 4L8DB 4N9DA 1BQGA 3EG9B 4FQHA 4XIAA 4TOQA 4KXCA 3EKLA 1D3GA 2BASA 1IILE 5KANG 4WRHA 2ZJSL 3KYNB 2FJGB 4UQ3A 1CYXA 1UKTA 3IXAB 3V16A 1ZANH 3LDBB 1WHPA 5DS8B 1SBSH 3HRZA 5T1KB 4EI6B 4MOZA 4DIAA 3MI3A 5BXTA 4A8IA 5LGHH 2QZQA 2BSRB 1GSKA 4IJ3C 4V1DD 5JYLA 4FQQA 5AYYA 3KYMB 3W83A 2A9NL 1VFFA 3O0RH 1P5VA 1R5VA 1UJTA 4PY8I 4UB9A 1KCBA 3GLDA 1MZHA 2BNRE 5HBBA 2JKWA 4XWGL 1REQB 3H2FA 2XKNB 2GT9B 1RZJH 1TE6A 3ZFHA 4YU1A 4HX1B 1TTJA 1NY1A 2ZA1A 2BNQE 5DEFB 1QWGA 3MO7A 3V75A 4RFOL 5ETUA 1ZS8B 4KQ4L 5HJGA 4Q4MA 3NQ6A 5TE7H 3VJ6B 1O9VA 3A21A 3BP5B 3ARYA 5LBGA 3TXAA 1KSRA 4XPBH 1AD1A 3MRHB 4KQNA 1GORA 5IK3A 2VZ1A 3BPNC 1KM4A 1MYRA 1ZQ5A 4L65A 3AVEA 4IHBA 3QORB 3HMXH 3EYFB 4K3DL 2QNEA 5AZEL 5AG9A 2P5EA 1BTCA 4LNCA 5K1VA 4XNMA 3WTUA 2NUYA 1NTDA 1XYFA 3LBMA 3QWRA 4I8DA 1I7RB 1DANT 4L1HA 2KZBA 3RPTA 3UXKA 2WIIA 2CUIA 2VR3A 3LPWA 4GKNB 3UJ2A 1P84J 4FQCL 4YPGB 1KBPA 3U46A 4ZTOL 5IUSA 3VD1A 4XN8A 4R4NC 4XCCL 5BRZA 2XN9D 4ODWA 3K5SA 4ATWA 4E2DA 5HHQB 3FIGA 1NC4B 4Z3IA 3SE8H 1T22B 5E5MB 2UZIH 3JTSA 3TEWA 4UTWC 1C9SA 1T21B 2FT8A 2HJFA 2IPTL 3O0LA 5D7JD 4WI0A 5ID1B 2XBDA 2EILB 3WN6A 1G9NL 1S9YA 1UD5A 3M0VA 5T91A 1BMZA 4GG8B 5C08B 1XV8A 4DKEH 4IGNA 1X4XA 3HQPA 3CZSA 3MJ7B 5LNSA 1LDPH 3D5OF 2UY6B 2PRHA 3ITCA 1SOXA 4YEFA 1A5KC 4XPTL 5IR1A 4XN9A 1YXDA 1WISA 4NRZA 2VDIA 4RNJA 4M1CD 1S9VA 2HKHL 2H26B 2QJJA 4XD3A 3ZWTA 5FA3B 4HCRA 3UH8A 3TTSA 3UC0L 4KK9C 1BQLH 3QORD 3MLSH 1NGWA 3GHEL 3QZWB 5DUPH 3EDEA 1FE8H 3RVUD 3X1NA 3EF4A 5GZOA 1UWRA 2OXGB 1XLFA 3LSBA 4P7QA 4C7DA 5LGYA 1BVNT 1TX0A 3MP5A 2JB5L 1NBQA 2VLJB 4F9PA 4TV6A 2GJLA 4DY1A 2BM3A 1N70A 2LTQB 3CQHA 3UT0A 4AX7A 1MXDA 2RFXA 5E70A 3WJZA 3WF0A 5LIXX 4ELME 2X30A 2ZOTA 1R6WA 3L9CA 5EEUA 4GGBA 3T2QA 5H91A 3N9RA 3P4MA 2NX5A 3TO4B 1QLEB 3W71A 2R9RA 1R3LB 4JFDD 4Z17A 2DBJA 3O2VL 4IJTA 4KZCA 4YUEL 3VDAA 4D9LH 2C7UB 2X6UA 1UWQA 2A2QT 2PP3A 2VZOA 1FH2A 1QJWA 2Y6ZA 4N9GB 3O0FA 3GNDA 3FO2A 1SR9A 3RUGB 5BCAA 1O5RA 4HHPA 4DN3H 1YQ2A 3ABZA 5IMKA 1F13A 3QAQA 3WNNA 3KBNA 2Q09A 4NN7C 2WLLB 5CNHA 1FFOA 2K78A 4KKAD 2OQLA 4Y5YA 1LLWA 4AIOA 5A2IH 1E8ZA 4P2YA 2ED6A 3H9YA 4R84A 5FKPA 3BUBA 1ZRUA 2X1QA 2DJ4A 1LROA 3DTDA 2YOAA 2E7DA 3FN3A 4HNOA 4GFSA 1TJ2A 3BN3B 3HJ0A 2E7FA 4Q0XL 1WV7T 4QHPA 1JVNA 2EPKX 4O8AA 3OKEB 1S3KL 2IMMA 1SHMA 5D7SH 4IKLA 5DZPA 3FS9A 4UR9A 4D71A 1WD9A 1T1XA 3JWOH 2Z4TA 4U1NB 1Z5HA 3FKUS 3NRPA 1U2HA 4RAVA 2H1PH 2WOBA 1FZKA 1B0IA 1OP5K 3FAXA 4Q97A 1GYLA 3SY6A 4OFCA 1KA9F 5ABFA 3EKGA 2J4WH 3L3JA 2XJ7A 5EA0H 4M1DL 1ZGDA 1JCYA 2BX5A 1U92B 3UTPD 5KSBE 2RAMA 3TCLA 5TQ0L 2WZ0A 3HN3A 4GH7B 5A2CA 3SDCD 1JG9A 2GUOB 3NCBB 5FCUH 5FM8A 2PDHA 2J3SA 4NQSA 5MEOB 3IGXA 3BW3A 4XWOD 2WB7A 3MA8A 4QNEA 4DTGL 2DQGH 4MDJA 2XFGB 1XL9A 3WIFB 1VF5C 3KPSD 4XE0A 4BFBD 3URNA 5TGBB 3O6ML 1CL7I 3MVTA 1V10A 4G8FA 3LGGA 4MMZB 1AO7A 4X6BB 2X1IA 3QH3B 4MY9A 4XO7A 4F2TA 4GZ7A 2W5PA 4PRNB 4PGEA 1ESWA 4L1XA 2CJSA 3H3KA 1LG2A 4GY4A 2EDBA 1MI5E 1JTOA 3MOBL 4NQVA 5BWAA 2R6OA 1NFAA 5LGXA 1M7DA 3PQYB 3QDJE 4PJEB 3UAFA 1BSLA 1YXYA 1L6FA 5EO0A 4GI9A 4R7DB 5FK9B 3VIMA 4Q7IA 4P46D 4JEGB 4MF4A 4LNVA 5DHXB 4OFKA 2A0NA 1KC7A 1ZWIA 3BC9A 2V69A 2AGKA 2F15A 2WVSA 5KSBF 1FWWA 2YS4A 5J13B 4W9KC 4EXQA 5C71A 1I9JL 2DJMA 1PJWA 3LTVA 2NX1A 3CVHA 2WJDA 1WZAA 2IDFA 2G2PA 1DQTA 4ABQA 5IBLD 4LX4A 3QHZL 5E7FA 2C26A 1WAAE 2GVGA 1MHHB 2HS6A 3L17A 4MHHI 3IE4A 1X39A 1O0VA 3KZ8A 1IQDA 3M16A 3E74A 4FNQA 3MP4A 4RV8A 5AUMB 3AREC 1T7XA 1XH0A 1RULL 2AK1L 3DG3A 1G1CA 5E1HB 3N41B 2R1WA 1EO5A 3FNKA 1ITXA 4JKNA 1A1OA 4Q9CA 1H1ZA 3ARTA 2NQLA 4NUPA 3F5LA 4UFHA 1DVJA 2CRYA 3CMJA 3GTIA 4ML9A 5JHDB 1SPQA 1LWIA 3CFEA 5LIUX 1MWAB 4ZL1A 2FIKB 4I3RL 4KOBA 2RR3A 1WS7A 4JZNA 4CKVX 4RDBA 3ME0A 4NS0A 3CHPA 3DHDA 1M42A 3D12B 5HANA 4TTDC 4M6PA 2I07B 2W0LA 4AMCA 5IMMB 5DO2C 5BS0D 3SUTA 4YIQB 3WL9A 3MCKB 1I1AD 1U8OA 5B7EA 3F5KA 5E0CA 3D08A 4L64A 4ZE5A 4JFYB 2LU5A 4BHYA 3FZUC 4UZSA 5AWNH 2V0TA 1ZSDB 4XAZA 4JX5A 4KAQL 3APYA 3B8DA 1JV2B 1S3HA 5AN7A 4LLDB 5D2NE 4X5WA 2IFFH 3DVGB 5IFJB 2OJEB 2ZKYA 4MRCA 4N2OA 1W2VA 2QCEA 3L0GA 4XUGA 1XB6A 3JWNH 1IEBB 4XTRD 1NICA 4HSAC 1PG7X 1J5HA 4OCLC 1XIDA 4F58L 4WXZA 2ZX8A 3ARFB 3PWLA 2FO8A 4NERA 1W5OA 3F1QA 4AVNA 1OGSA 1UH2A 4H1LB