1MFUA

Probing the role of a mobile loop in human salivary amylase: structural studies on the loop-deleted mutant
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
491
structure length
491
Chain Sequence
EYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHSILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords alpha-amylase, Salivary
publication title Probing the role of a mobile loop in substrate binding and enzyme activity of human salivary amylase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 176
structure length 491
sequence length 491
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2002-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1mfuA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1mfuA01
5A8QA 5A6MA 2NT0A 4MNKA 1PZ2A 3N18A 4AC1X 3KEHA 1W9UA 5E09A 3WMCA 3VILA 3BVUA 1XH0A 1K9FA 3PZNA 1LWJA 2WVUA 1LWHA 5D9NA 4DM1A 4NI3A 2FGLA 1U2YA 3VDCA 2UY5A 3WDRA 2WCGA 3MU7A 1VEMA 1M53A 4MJ4A 1OINA 2OWXA 2EQDA 3BUDA 4UQBA 2BS9A 2WHLA 1RP9A 3L4UA 1XSKA 4N42A 4QDMA 1R86A 2GJPA 1TQVA 2JIEA 2VTFA 6A3HA 4HPGA 2A3BA 2DSKA 3SCTA 1JF5A 4OIFA 1V6YA 5E0CA 2FYVA 1Z32X 1UH4A 4M56A 1MFUA 1QW8A 1ECEA 3VDBA 1MXGA 2YA2A 3MSGA 2YKKA 2YDQA 2XN0A 2CHOA 3L4ZA 2PWGA 1XSJA 1O7DC 2JALA 1KB3A 4F8XA 1J10A 3ZSSA 4E2OA 2DH2A 2XVGA 1E4IA 1CXHA 2VC9A 3VNYA 2XFYA 3SEPA 1VJZA 4W7UA 1V6WA 2FHFA 1XC6A 2WWCA 2WKLA 1HL9A 3K8KA 4A4AA 3A4AA 2JIWA 4JL2A 4ZFMA 3RILA 2ZOXA 3DHUA 2VR5A 3AS2A 5IFTA 4DUWA 8A3HA 1P6WA 4W88A 2WHMA 3CUJA 2BY3A 2ZXBA 3MMWA 2D0HA 1V6UA 2X2IA 3VSVA 2WC3A 4AD1A 3DX0A 4EAMA 2YA1A 3PZOA 1JI2A 1JXJA 2YIHA 3VD7A 5M03A 1WO2A 5M5DA 2XVNA 3GXIA 1R85A 3BXWA 1MQPA 3WBEA 3HU7A 4CD4A 4KRTA 4L4OA 5CPSA 5BCAA 4NXKA 2BVTA 1H2JA 3MUIA 1L8NA 1ODZA 1E43A 5JBDA 4GZEA 1KWGA 4H8UA 1R46A 2J47A 3BVVA 1RD6A 4CD5A 2A3AA 1GOMA 2BHZA 1JZ4A 1G94A 3U7VA 3EMQA 1QNPA 4UQDA 4N0RA 1GQJA 1FH7A 3BVXA 3BCDA 1JYXA 1H0GA 5HBFA 3BCFA 4J3XA 4CCEA 1DWJM 4QP0A 1C8QA 3DDGA 3VUPA 3TTYA 3CZLA 1N82A 5D8WA 1LG1A 2C8NA 3WFLA 1E9LA 3WQ5A 1Y7VA 1W2VA 2W91A 3BLKA 3WEZA 4PMUA 5BXRA 1GOWA 4B3KA 9CGTA 3SCQA 4AIUA 3AZRA 4UOZA 1GQIA 2EO7A 1W9XA 1UD4A 3GYCA 3A4WA 3AYRA 4U3AA 4XX6A 1OT1A 4PSRA 1UD8A 1J18A 3AXIA 3CHFA 2D0GA 4HA1A 1A3HA 1CENA 2CERA 1E1FA 1GVYA 1I1XA 2VZSA 3A5VA 3GM8A 1D2KA 4W84A 2VX7A 4E4PA 2QMKA 3OLIA 3ZR6A 1ZBWA 5HXMA 3AIVA 3CZSA 4HP5A 4DUVA 2YL8A 1UWSA 1V3KA 1HP4A 1R87A 3VGGA 1E0XA 4JFVA 1FP8A 2DGAA 4CGTA 4XZWA 5BYWA 4F9DA 4BCEA 4PSPA 3SIMA 2E9BA 4D6CA 4MDPA 3SCSA 1J0JA 4GKLA 1XH1A 2WSPA 2E40A 2PF0A 1JZ7A 3AMLA 3TONA 3OBAA 3PN8A 2E8YA 5A6AA 5A69A 1XV8A 4AD2A 2J7DA 2FH8A 1CIUA 3G6LA 3HG5A 2WM0A 3KWXA 3VOCA 3B9AA 2J7GA 3ARZA 1HN1A 3QHOA 3IK2A 3VX1A 1FOBA 1B90A 5JBEA 3D4ZA 3WDIA 3ALFA 1VFUA 4XV0A 3WDPP 4CU7A 4DWSB 1KBBA 2EPKX 2GSJA 1QNOA 2BY1A 3AHYA 4W8BA 2HISA 1EO7A 4MNMA 3BLBA 4AZCB 4R27A 2X0HA 1Q4NX 1ISVA 1QPKA 4ZXOA 1UH2A 3UERA 1JYWA 3L4WA 2VZVA 2ZUUA 3SCNA 4DO5A 1NWUA 3AICA 2WMHA 3VSTA 1QNQA 1VB9A 1CXFA 1CGTA 3AIQA 4HOWA 4UQCA 2BNJA 3PZQA 3CHCA 5A2BA 4C7GA 2EABA 2ZICA 3I3EA 1V0MA 3CZKA 2WMJA 5A6BA 2XVPA 2XN1A 5A2AA 4AW7A 4Z2HA 3II1A 2VRJA 4BQ5A 3WUBA 4U2YA 5GNXA 3IAPA 1V3MA 5JUVA 4PMZA 2ALWA 2G4FA 2ZE0A 2PWEA 3WNOA 1KXQA 4JL1A 3EMCA 5AYBA 4U31A 1EDTA 3S5ZA 1J0ZA 1LG2A 3UR8A 4A3HA 3TTOA 3AMCA 4QCFA 2GK1A 5A3HA 4UFKA 1XD1A 2D0FA 3S6TA 4JKMA 4GI9A 3UG5A 2WAGA 4M80A 1OBAA 1OGGA 1R34A 4B9YA 3CBWA 4B15A 4JHOA 3A22A 4DWSA 2J7HA 3RM4A 4CU6A 2BXZA 3GXPA 2EPMX 1IZJA 4RE2A 3WF2A 4KH2A 2J7CA 2VCBA 2XVKA 1ITCA 4CUCA 4JFTA 2WANA 1BQCA 1D7FA 3EJQA 4AZ7A 1CBGA 3A6OA 1R47A 4RE3A 2VQTA 3MKKA 4JFSA 3LXBA 2W61A 3ZT5A 1HJXA 6TAAA 4TVCA 4YN5A 2ZUNA 1GOKA 3W6MA 2OSWA 2WHKA 3PZUA 4CU8A 5A95A 5A6KA 2GDUA 4U33A 2J74A 3N1AA 3IJ8A 4MB5A 1WZAA 3RJXA 2CIPA 2Y8KA 2ESCA 2PWHA 1BYCA 4PCTA 1ISYA 1NOWA 3RM8A 4D1JA 4ACZB 3ZJ8A 3LPPA 1OD0A 3NSNA 4JAWA 1FFQA 3APGA 4BA0A 1W32A 1R7AA 3O2LA 2X05A 4UFMA 4LX4A 1E6XM 1HJVA 2DEPA 3DECA 1Q6EA 2WC7A 4P7LA 1QW9A 3KLLA 6CGTA 1IZKA 4U3CA 1HJUA 1EQPA 3GH5A 4TTUA 4AD4A 5CPTA 4PMVA 4XZBA 5BRPA 2X1IA 1EO5A 3DX1A 4PMXA 4GINA 3WSUA 3CHDA 2WPGA 5I23A 3VIFA 2WK2A 1OGSA 4H8VA 3ARWA 1CNVA 3EDDA 1UD2A 2QF8A 1KQZA 4AISA 3WUEA 2W66A 1E4NA 3H55A 1KXVA 2JEPA 3D5HA 4HZ7A 2YOCA 4PTXA 5A2CA 1J0HA 3MMUA 1KCLA 4D6GA 4ZE5A 4QLLA 1U30A 1G01A 3SCOA 3NJ3A 1I1WA 2V5CA 1DWHM 3BMVA 1SMDA 4PTWA 1JZ3A 1FHDA 2XIBA 4TVDA 2F1BA 1AQMA 2EPNA 2CBUA 1C91A 2VX5A 2WBKA 4BS0A 4P7RA 1G9HA 2EADA 2V3EA 3BAXA 3MI6A 3F5JA 2DT2A 3UG3A 3BAIA 1UG6A 3BUIA 1M01A 4FLOA 2GDVA 1V0KA 4BZYA 7CGTA 4WKFA 1W1YA 7A3HA 5DMYA 5A1AA 3I3BA 1BLIA 4CN4A 2XGBA 3D50A 2ZXDA 3RO8A 2J25A 3AMKA 2V5DA 5I79A 1UQYA 4ACZA 3W82A 2J7FA 1ZJAA 4JIEA 2PWDA 3AHXA 1VAHA 4PMYA 1DWIM 1MW0A 3AISA 2VUYA 3AIBA 1NARA 2E8ZA 1C3FA 3SURA 1OGBA 2YFOA 3LPOA 3EJPA 2ZUTA 3VD4A 4WKHA 3QOMA 2X2JA 1CEOA 1ISZA 4KMQA 4OOUA 7TAAA 1EOKA 1XYFA 1UZ1A 4W5ZA 4AEEA 3CZEA 3DX2A 1MQQA 1UOKA 2W92A 3A4XA 4UFLA 2QV4A 2W5FA 2ZXAA 1XCWA 5HNNA 3PTQA 1VBRA 1PS3A 4DM2A 5CXPA 2GJRA 2YL5A 3QHNA 3H53A 4J27A 3SUTA 1JI1A 3BC9A 1M04A 4Y7EA 1TA3A 3ARSA 1UR2A 5I3DA 4IPLA 5E1QA 1J01A 2F8QA 3WD1A 2CHNA 1R75A 3OLEA 4WLCA 4PMNA 1H41A 2D2OA 2CESA 1HT6A 1Q6GA 4W87A 3VIGA 1EDGA 2Y5EA 1BG4A 2AMGA 2CKSA 2DT3A 1UA3A 4PUDA 3WH9A 1GORA 4PBGA 5I5RA 1PX4A 1GZJA 4AWEA 3ARVA 2J7EA 4QAWA 1E71M 4QFUA 2G41A 5CSYA 4ML4A 1UR8A 1GVIA 1EXPA 3TA9A 4NSBA 1SMAA 1TCMA 3T2PA 4GQRA 3IJ7A 5LYRA 5DT5A 2UY4A 1OIMA 3U7BA 2YL6A 5HPCA 1MWOA 3WF3A 3WEMA 3RDKA 4U2ZA 4AYSA 1WNOA 2NSXA 1JAEA 1PBGA 1EIBA 3QHMA 4MDOA 5ABGA 3LXCA 1EGZA 1QI0A 3PZTA 1UWTA 1LL4A 1ZBVA 2DT1A 1CGYA 4GXPA 1HVXA 2WHJA 2X2HA 2C0HA 1DTUA 5D4YA 5C8BB 2GJXB 3CHEA 1F4HA 1W3KA 1OCQA 1B30A 1H0IA 5AC4A 1B3ZA 1HXJA 1NH6A 2WLYA 2XYLA 4Z2GA 1XYZA 3HN3A 3VIJA 5HDRA 3I3DA 5A6LA 3AS0A 1HJWA 3FAWA 1HF6A 1JNEA 4TXEA 1PEZA 1V02A 2CBJA 3WNKA 1UR0A 3HZ3A 1Q6FA 3MANA 2PBGA 3EJUA 1UD6A 1OM0A 2OYLA 4C7DA 4WK9A 2OSXA 3OGVA 1DP0A 1BPLB 2VVNA 3BLPX 1EHNA 4LQ1A 3DYMA 3ZMRA 2YBTA 4X0VA 1UKTA 5E70A 4UR9A 2DH3A 1C8YA 1WZLA 1E72M 4WF7A 1GQKA 1FA2A 3S2CA 1UA7A 3GH4A 2F2HA 5D9PA 3WN6A 3ARTA 4X9YA 5I77A 3BUQA 3FN9A 3MO4A 4PEEA 3WQ6A 1GOIA 1SFSA 4TTGA 4D6HA 1PX8A 3GXTA 3WQ8A 1VIWA 1LL7A 5DFAA 2X8RA 3WD2A 3KZSA 4AMXA 2CXGA 3CH9A 1CLXA 1UHVA 3T2OA 2GJXA 4URIA 5LA2A 1B9ZA 1AQHA 2Y24A 1E3XA 3L2MA 3WNPA 3VM7A 1EQCA 2J77A 1V03A 4B3LA 3OG2A 2WXDM 1UWQA 2D73A 1W9VA 5EMYA 3AXHA 2O9RA 1QHPA 1GUVA 4F66A 3KE0A 1SZNA 2ZIDA 1TUXA 4UOQA 1S46A 4EE9A 3PZMA 4AYGA 2ZX5A 1TE1A 4MPKA 5FOOA 4FMVA 2ZX6A 2ZUWA 4AD3A 2QHAA 2J78A 1WAWA 1FH9A 1NWRA 3A3HA 3PZIA 4AXNA 4NZJA 5A6BD 3GDBA 1W1VA 4IISA 1JDCA 1SYTA 2NT1A 5I0DA 1E5JA 1E6ZA 1JG9A 3PZGA 4XUYA 1XCXA 2XWDA 4AD0A 4JCLA 4RE4A 1ZS2A 3RJYA 1IT0A 1HL8A 3NSMA 1KTCA 1ZU8A 4UQ9A 3WF1A 4CN1A 1K9EA 4UQAA 3VX0A 2O9TA 5HOSA 3MS8A 5D9OA 4H8HA 2VMFA 4P7QA 1W91A 2XPKA 4OBSA 5CJ5A 3W0KA 2OYMA 3VU2A 3AI0A 1WZKA 3GXMA 1UR1A 1M7XA 4HMDA 3L2LA 4E8CA 1HNYA 1B3XA 2XTKA 3ARUA 5CQ1A 2VO5A 2VOTA 4BQ4A 1E6NA 3PHAA 1QI3A 3BUPA 2F61A 2ZXQA 4HU0A 3W37A 3WEOA 1FH8A 2O9OA 2BVYA 3O6AA 4HMCA 3K46A 2G3IA 2JFEX 3ZOAA 3VIMA 4PMDA 3GXNA 4D6IA 4FNQA 4AMCA 3RM9A 1MQRA 2VT0A 5ABEA 1KCKA 2WWDA 1FFRA 3F4VA 4EK7A 1TZ7A 2W67A 3U5YA 4PUEA 3CGTA 4OUEA 3UG4A 3VIKA 3K8LA 3RCNA 3CMGA 1RP8A 4XB3A 3GXFA 3GBEA 2ZX7A 3SUVA 3W28A 1ZL1A 5LA0A 3WL0A 4OBRA 1C92A 1E0VA 3U57A 2WB5A 1W1TA 2ZUVA 1J0YA 4HTYA 1OB0A 3DYOA 1LJYA 5M17A 1GW1A 3AQUA 5I2UA 3KLKA 1E40A 1WCGA 2X0YA 1E1EA 1BYAA 1E55A 1X1NA 2G3MA 2Y4SA 4H04A 4PMRA 1WE5A 3AIWA 2F7PA 4AZBA 4QCEA 4A3YA 3K1DA 1BVNP 1JFHA 4H41A 3EJRA 1QWNA 1O7AA 1JZ6A 1D3CA 1QI4A 1TQSA 4Q7NA 4AY1A 3GH7A 4J28A 1G5AA 1NOFA 1KR1A 1XGZA 2HVMA 1XSIA 4D6EA 4ATLA 4WSKA 1E4LA 2FGZA 1AVAA 1JZ8A 1BAGA 2CCRA 1CZ1A 3DDFA 2EPOA 5FL1A 1CGUA 2RGMA 1L0PA 4FNPA 2WMIB 4NXSA 3POHA 1TG7A 3ALGA 4PMOA 2WW5A 1VFMA 4FK9A 1LL6A 2VX4A 2JEQA 2IUZA 4ZEPA 1BYBA 2A3CA 2WC4A 5AC5A 3HMCA 3JUGA 1V6VA 4IM4A 3B9EA 5IXEA 3W4RA 3LRKA 1U33A 1ZB5A 3EYPA 4JHZA 4P8WA 3NCOA 5D8ZA 4CN6A 1SR0A 4ZXLA 3L4YA 3J7HA 4H2CA 2B31A 1E4MM 3VKKA 4DWSC 4CKQA 2J8FA 2YJQA 1ISXA 4Q22A 4KWUA 2VR4A 4CD7A 2DIJA 5M3WA 4UZUA 3TP4A 3F5KA 1E70M 3N15A 4AZCA 1BGGA 2W4XA 2JF6A 3TOPA 5CLTA 1LLOA 2C7FA 4GPNA 4EKJA 1JAKA 3CO4A 3FHQA 5A6SA 4OJYA 3CUGA 8CGTA 4OZOA 3KL5A 2AAAA 4W85A 1V08A 1OWQA 1JZ5A 1WKYA 3ZIZA 2F7OA 3WH5A 2WNWA 5EFFA 5CSUA 1X6NA 1ISWA 1VFFA 2XFRA 1M03A 1JDAA 1UKOA 1H3GA 3N13A 1US2A 2WYSA 3ARQA 2EAEA 1GOOA 1WDPA 3N04A 3AJ7A 1EHAA 1H5VA 4GO9A 2WMIA 1HTYA 3T2QA 3N9KA 3AS1A 3WQVA 3TV8A 5BROA 2QPSA 3B8SA 2BHYA 3GTNA 4GZJA 3W26A 3BGAA 1HJSA 2QLYA 1AMYA 1TMQA 2VNCA 1BF2A 3LMYA 3AYSA 3W38A 1E6RA 1CGVA 5JIPA 1GJWA 3M6DA 4J3UA 4UNIA 1KBKA 2WVVB 3S5YA 1CECA 2X09A 3SCVA 3WDJA 3MSDA 1UD5A 1TFVA 4J3VA 3VTRA 4CD8A 5IHSA 5BXPA 3WMBA 1QOXA 4U5KA 2J8GA 2OW7A 3BSHA 2DIEA 4UCFA 2CITA 3PZVA 2ZUSA 4WIWA 3CPUA 1CLVA 1QBAA 3EJSA 1F4AA 3IANA 3WY3A 4HZ8A 2WZEA 5E6YA 1KFWA 4HU8A 4MTVA 3OA5A 1BTCA 5BXTA 1B3YA 1WZMA 3BH4A 1VENA 1W9PA 4D6FA 4J3TA 4TVUA 1QHZA 1TR1A 1KR0A 3ZT7A 1W2PA 3ZM8A 1C93A 4E8DA 3AZTA 2V3GA 5E0FA 1JZ2A 1Q6CA 3WENA 4YPJA 4FNSA 4CVWA 4KRUA 5LA1A 1CXLA 4BQ2A 1BVZA 2Y2WA 1BGAA 1X6LA 1OIFA 2CETA 1DWFM 2D3NA 4P7NA 4F9JA 2WVTA 4DO6A 4UTFA 4GI6A 3ZJ6A 1V0LA 3VGFA 3AIUA 3A23A 3VO0A 1HJQA 3GBDA 5IDIA 1V3LA 1HKMA 4AIOA 4Z2JA 2BFGA 2J75A 4HA3A 1C7TA 2J4GA 3EJTA 3HG4A 1VFOA 2PWFA 4UOJA 3WF4A 5FL0A 3D52A 1MW2A 1TQTA 4J3WA 1OT2A 1DWAM 3PTKA 3VGEA 2DDXA 4UFIA 4NRSA 2VZTA 1VEPA 1MYRA 3KL0A 1CXEA 3L4TA 4KGJA 3WNLA 1KGXA 2FDMA 4TOQA 2Y8VA 1T0OA 4FNRA 4P8UA 1CXKA 4W8LA 4P7OA 2NW0A 2WCSA 3A47A 2XHYA 1IV8A 1HKIA 5TD4A 3VD3A 3VDAA 1HP5A 3BAJA 1E56A 3BSGA 3HG2A 1E15A 3CV5A 1BSIA 2VVSA 4LGXA 2BXYA 1GOQA 3WH7A 1KTBA 3AHVA 2EEXA 2ZX9A 1H09A 2Q8XA 3MUAA 4PCSA 3SUUA 3M7SA 2WVSA 4Z2KA 1VEOA 3WBAA 3FXYA 1JGIA 3MV01 2O92A 4MNJA 2EACA 4NX0A 3K4DA 5FKYA 1KWKA 3VGBA 1GONA 2IXVA 4MNLA 3AIEA 2D23A 1HX0A 3WNMA 2J62A 3LXAA 3SCUA 3AFBA 3GNPA 3BAYA 3NYDA 1VRXA 1FP9A 3SCWA 3UEQA 1PX3A 1VJSA 2IGTA 3OGRA 2J79A 1JNDA 3OGSA 1UKPA 1W3JA 4JKLA 5F7UA 5BXSA 1ZBCA 2ZX8A 1K6AA 4D1IA 1W3LA 1BYDA 1CGXA 1XHGA 3ZT6A 3ZSTA 4AEFA 3BVWA 2OWCA 1UR4A 2AOSA 4FF5A 3WH8A 3MMDA 3FW6A 1JIBA 3WELA 3VMPA 4HA4A 4UZSA 3EMZA 1V3JA 1C7SA 3WUGA 1WPCA 2OW6A 4JFWA 4WKAA 2WMFA 3QOKA 4CD6A 4NZFA 1QBBA 3WIJA 1W1PA 3EDKA 1JYNA 4TX8A 3MUZ1 3EDJA 1HXKA 2F1AA 1JXKA 3D51A 3ARYA 5EB8A 1HWWA 4X0NA 3PTMA 5HPOA 1A47A 5CZKA 2QPUA 1UR9A 1GQLA 4D6DA 4RL3A 5KZ6A 2XVLA 3W25A 1UD3A 3AS3A 1R8LA 2CNCA 2VRKA 4PRWA 4MADA 4AZGA 2YFNA 1UWIA 3EDEA 2XSAA 2CBVA 3O9NA 4D6JA 4K68A 4M81A 2OWWA 3M46A 3VIPA 3CLWA 3WNNA 1ZBKA 4L4PA 4ZE4A 4TUFA 3OLDA 1QNSA 3BVTA 2DSUA 3GNOA 2UY2A 4M29A 4NF7A 5I78A 1LQ0A 1B31A 1PIGA 1JDDA 1J0IA 1C8XA 2A3EA 1CYGA 1WDQA 1UKQA 4FNUA 1E73M 2VURA 1WDSA 2WZIA 2WLZA 1NM9A 3VGDA 1ODUA 4UQEA 1OD8A 4GZIA 2D1ZA 2D24A 4B16A 1KGWA 2XIIA 2WMKA 4W5UA 1QNRA 4NRRA 3WD3A 1VF8A 1HKJA 3AZSA 3B9DA 5AYIA 3WDHA 4P8XA 5KEZA 2VX6A 1PPIA 3T0AA 4V27A 4W8AA 2VI0A 1E5NA 2EXOA 4ATWA 2XJ7A 1V02E 2F7QA 4MJ2A 2VCCA 5A94A 2PC8A 2DSVA 1R7OA 3AIRA 4AD5A 4QLKA 4S3JA 1UZ4A 1HKKA 1G0CA 1E6QM 2E3ZA 5BWFA 2DQXA 1YHTA 1B0IA 5FD0A 3VNZA 2DSWA 3HG3A 2CKRA 4WJXA 4GQQA 5FCZA 3TTSA 4S3KA 2YDRA 2WMGA 3OZOA 4JFUA 3AMGA 2FH6A 4NZCA 4LYRA 1V3IA 5CGMA 1XH2A 2XGIA 3WY1A 5DEZA 3WL1A 5A8NA 1UKSA 1H4PA 1OSEA 3SCRA 3VDHA 2E9LA 4U5IA 3ARPA 3WKZA 4DWSD 2XM1A 3VM5A 1UH3A 3N17A 3RPMA 2CPUA 5E6ZA 2E4TA 4D71A 3RIKA 1E3ZA 5CGTA 3T0DA 2YLAA 4YHEA 5IHRA 1J12A 4W89A 3L4XA 4AZHA 3AOFA 1NP0A 1UWUA 4BF7A 1CXIA 4UFHA 2V38A 1TQWA 1LF1A 1CWYA 1GHRA 1DEDA 3PBGA 4V2XA 1H11A 1V6XA 3D4YA 1ZJBA 4CVUA 3BMWA 5I24A 1E6PA 1CPUA 3LRMA 3W29A 4PMQA 3W27A 1TVPA 3LPFA 1UQZA 1EOMA 4ATDA 3WUFA 3WQWA 3A24A 4GO8A 1TVNA 5GNZA 4EANA 2XFFA 4J3SA 2YLLA 4W7WA 3QGVA 3LPGA 1ITXA 3PZ9A 5ABHA 4LYPA 1GNXA 3VMNA 3IAQA 3WQ4A 4V28A 1MVYA 3BAKA 3OLGA 4LPCA 2CYGA 1EA9C 4CCDA 3K4AA 4KGLA 3F5LA 2GK1B 4JZ5A 4OOZA 3OIHA 3POCA 3ECQA 2RGLA 2VL4A 1PJ9A 4WSJA 2D3LA 4UFJA 3VGHA 2OLHA 5A8MA 3ZJ7A 2FHBA 2VQUA 3OB8A 3NDYA 1NWSA 2DSZA 1BHGA 2XSBA 3BUBA 3CTTA 3GXDA 4IUGA 3SUWA 3WY4A 1JL8A 4HMEA 1KGUA 1V0NA 4MB3A 4LYQA 3DX4A 4QLJA 1W3HA 1ESWA 3WY2A 4FLQA 1NWTA 3VIIA 5A8PA 1MW3A 1RPKA 4FNTA 2PI6A 4YHGA 3AHZA 3BAWA 1E6SM 3UESA 5JBFA 3WFZA 3CZNA 4JKKA 2VZOA 3ARRA 2JE8A 3W24A 1MW1A 4LXFA 3FHAA 3CUIA 2YBUA 3FY1A 1UWRA 2J7BA 1GHSA 3VPLA 1GCYA 5CLWA 2GUYA 3CIVA 1BG9A 1AQ0A 1K9TA 3DX3A 2G3NA 2E0PA 1Q6DA 3DYPA 1NP2A 1H49A 2XN2A 3UETA 4F79A 1MFVA 4AZ6A 4HOZA 3AMDA 5IFPA 1J11A 1PIFA 1EH9A 2BVDA 3THDA 5I6SA 3CZ8A 3WH6A 2XM2A 4TX6A 1O6IA 2EJ1A 4MAVA 1V3HA 3THCA 3H54A 3ZQ9A 3DC0A 3ARXA 3UCQA 3ZJKA 5JIWA 5ABFB 1KXHA 1W9DM 3CZJA 3EDFA 4H7VA 3CUFA 3M07A 3VIOA 4W7VA 4DO4A 1KXTA 1XD0A 1JD7A 1GJUA 3A21A 1GPFA 2ZWZA 3T08A 2BY2A 4J7RA 2G3JA 2F18A 3G6MA 3VSUA 1B1YA 2DT0A 1UYQA 1US3A 2JF7A 3MUY1 2Z1SA 2D20A 5C71A 1MXDA 3ZO9A 1PAMA 5CG0A 1HIZA 2GFTA 1VBUA 1QI5A 1DWGM 3VD9A 1WDRA 1H1NA 2VZUA 1UASA 4PTVA 3W53A 2Z1KA 1J9YA 4B9ZA 4Z2IA 3D3AA 3CUHA 4M1RA 5D9MA 3HJEA 4W93A 4PTMA 1PZ3A 2VRQA 3QR3A 2BHUA 1KQYA 3FAXA 1J0KA 4FLRA 4DUXA 1B3WA 2MANA 1WB0A 2UY3A 2EPLX 1B2YA 3WMSA 2A3HA 4MAZA 1NQ6A 2CBIA 2EBNA 3VIHA 3SCPA 4M82A 1K9DA 4AMWA 3W81A 1YQ2A 2O9PA 2CEQA 3U5UA 5DT7A 5DF0A 3K8MA 4P8VA 4ACYA 3N12A 3CC1A 3WDQA 4AIEA 4JCMA 3FNDA 2OYKA 2X2YA 4M24A 1JFXA 3GZAA 3WD0A 5ABFA 2ZUMA 3MV11 2E9MA 1JF6A 1JD9A 3GNRA 3VVGA 2YDSA 2ZWYA 2V3FA 3NSXA 4R5EA 1RH9A 3NIYA 3DHPA 4OGZA 3IJ9A 1CGWA 2XUCA 2VJXA 1FHLA 3AXXA 3LX9A 1BFNA 3E1F1 4C7FA 5GPRA 1XRVA 5EFDA 4AZ5A 4MB1A 4M8UA 3L4VA 1TA3B 3LRLA 3SUSA 2WZHA 2DPEA 3NUKA 4IPNB 3N11A 4GIAA 3RMEA 1DHKA 5FIPA 2FHCA 1CDGA 4HPHA 1E0WA 5DO8A 4PN2A 3AHTA 2PBOA 4MB4A 2WCAA 3VMOA 2GVYA 3KL3A 1G1YA 5GNYA 2UWFA 2VCAA 1CTNA 2W62A 1UUQA 2WBGA 5A8OA 5CPQA 2WKGA 2XG9A 3UR7A 1JYVA 4AZIA 2QMJA 5E9AA 2WVVA 3OZPA 5ECUA 3T09A 2W63A 2V3DA 2YL9A 2YA0A 4W86A 4HOXA 5EBAA 3WF0A 4ZENA 2FE0A 1B3VA 1C90A 3VD5A 3CZGA 5A6JA 5GQBA 3ZR5A 2D22A 4HZ6A 2BY0A 3WD4A 1I75A 4D72A 4FLSA 3W6LA 2IXUA 2BV9A 4OKDA 1TQUA 2TAAA 1HVQA 1QHOA 1R33A 2OSYA 4Z2LA 1QWUA 5AY7A 1QI2A 4GI8A 3EBVA 3NDZA 1WP6A 4BQ3A 5BRQA 4CCCA 5C70A 1NOUA 1EDQA 1W9BM 2XWEA 3IGUA 3TTQA 1QX1A 3CMJA 4PYSA 3VINA 3AROA 2PB1A 2G8ZA 3T0BA 2F7RA 2WSKA 1QVBA
chains in the Genus database with same CATH superfamily
4I9MA 1J5DA 1KT2B 1NDTA 1PZ2A 1ZENA 4MA3A 3BVUA 1W72L 4MDRA 4IL2A 1F3JA 2FGLA 4K9EC 3VDCA 1M53A 1DQLH 5A3IC 3TFCA 4QITA 2YAHA 3GWJA 1X7FA 4F7CB 4TULL 3R6IA 4HYVA 2X4QA 1XF2A 2CK0L 4PB9L 1UP3A 2WHLA 3C52A 1RP9A 1BQUA 3FDKA 3NCFB 2YRZA 3MZNA 4U6XB 1ID2A 3HMXL 1TQVA 4XC1H 3OQEA 4KJYB 2A3BA 4IKJA 4ALAC 3OVGA 4KY1L 4M56A 1NCBL 3VDBA 2YDQA 3BOXA 2WJDA 3EGXA 4F8XA 3NN8B 4JQXA 1T1YA 5DJAB 4E2OA 3HO8A 4WNJA 2MKWA 1BJ1J 3DTXB 4DHGA 3CUXA 4H20L 2VH5H 1CTMA 3ZKXB 2A83B 4H1LA 5AVUB 5IFTA 3HE7C 1RHHB 3C6CA 3MJGX 3EWYA 3PCYA 3VUAA 5K9CA 5J5RA 3KPSB 5L0QB 5DEFA 2WC3A 5KJ7E 2DQCH 1K1DA 1MEWA 1WOAA 3ZU8A 3IWVA 2P8CA 4F93B 2IAMB 3DVNA 2R0KL 1OGAD 4I6VA 1T0NA 3MCYA 3I6LE 3RWCB 4KHTH 5MP6H 3W39B 1QUMA 1UB5A 3G7TA 1BQKA 4Y1AB 1QASA 4H4NA 2QKIC 3PG8A 1GOMA 3G3MA 1MHPL 1A9EB 4BKTC 1FH7A 2ZFAA 5DD0L 4KKAC 2ZCKH 4ZVJA 4DNHA 3B03A 4FXRA 3WFLA 1KG0A 3GSRA 4LYKA 4HIIB 3NQCA 4QE1A 4PMUA 3ETSA 4DK5A 3M1BB 4HGWB 1JERA 1U58A 4B3KA 2VDPB 2Z7UA 3AZRA 4UOZA 3ELFA 5EZPA 3BN3B 4WI5A 5EEXA 5BUPA 1BXBA 1VDGA 1XIDA 2VZSA 3A5VA 1JNLL 4K3DH 1PZUB 3UAJD 3JWDL 5IB3A 1Y1UA 1G1OA 4M6OH 3O2DA 2GYSA 1EGVA 4HUMB 1L6PA 4DJED 3C6LD 3LK6A 2ZP0T 1JV5B 3L1FA 4YMZA 2E9BA 3MYJA 35C8H 4GS7B 3GHEL 1SDDB 4UR8A 2TSAA 5B3NA 2TYSA 2PF0A 3KXFD 1HWGB 5C0RL 1I8MA 3CPRA 1Q0XL 4D3CL 2CBTA 5IUSA 1I1RA 2P52A 2HX9A 2AVFA 3FBQA 4PRIA 3WDPP 1U92B 4HMNA 5CEZE 5JOEA 5D2NB 1MEXH 2XBZA 3BLBA 5C0EA 2XH0A 2BVQA 1UH2A 3RGBA 1N2VA 1H1ZA 4HEME 3VG0H 4PBWD 2Q7YB 4NEHB 1VACB 4UQCA 1AC0A 4Z0BL 2J6XA 1WXZA 2BNJA 1FXQA 4NRYB 5CINH 5A2BA 1SYVB 3AU0A 4XNUH 7PTDA 2UYLA 5SWUA 5FDWB 4U3SA 1BVKB 3CQIA 1SEBA 2HJFB 4HH8A 3P77B 3RPBA 1J0ZA 4EAEA 3UYRH 3TTOA 1MIEH 1OZMA 2NQLA 5JMRA 3CSGA 4P3DB 1U5VA 1K2DA 2F0CA 3SDYL 1C5DB 4LVAA 2DJ4A 4GFIA 5G5DB 2R82A 1BFVL 4CU6A 1IARB 1GGOA 1GH7A 1FFTB 2ATPA 5BZDB 1G0XA 4JZJA 1OVDA 3FO2A 4U1IA 3C2SA 4Z7UA 4C6DA 2L7UA 2DY3A 3IFNL 3TBYA 3BEWA 5FSDC 5I07A 4UYPA 3BKMH 4J40A 3FFDA 5EKYA 4US6A 1XDMA 3VTMA 3N4AA 2GDUA 3LKOA 2BXVA 1WZAA 2AJ3B 2CIPA 2PWHA 1XIMA 2RGSA 3BHBA 4KUZH 2P7TB 3N1FC 5JH1A 3ROOA 5BZAA 2Z31A 2YWZA 5FYLL 1BAFL 1EQPA 2C9UA 4ZFOL 3DX1A 3GI8H 1DUZA 3N6QA 4OFIA 3GYRA 3R10A 1BW8A 4GQGA 3H55A 4AM0Q 4PTXA 3O8XB 3F2LA 4P2OB 1TTFA 5EA9A 3IDMA 4EF9A 3SCOA 2MMXA 5D2LF 3MO1A 4EVZA 5IJVA 2VYOA 5J0BA 3WLRA 5DR5H 1JGUL 3H2EA 3NO3A 4X7EC 4JX5A 3MMEA 3F5JA 3QDGD 2DT2A 4RESB 3DFTA 7CGTA 3QFJB 3DJRA 1W1YA 5GSRB 1VC4A 4QWWD 3E0FA 2IO5A 5K69A 4BINA 4JIEA 3K30A 3PWPB 5GSVA 3K6IA 4A8RA 1Q9KB 2YXXA 2R1NA 2D7TH 5AW6B 3V6OC 2YFOA 3DURB 2X2JA 1CEOA 3GZ3A 4KMQA 4ZMWA 4QJ1A 3CX5K 2R27A 1OTUC 3KPOB 4AYID 4ANKA 3PTQA 4DM2A 1P6AB 1A6AB 5D7SH 4A3QA 1GCFA 4HWEH 5I3DA 1TTRA 2BODX 3RNQA 5KVEE 1WA3A 1QPRA 4JM2C 3L3JB 2CM6A 3MBXL 2ITEA 3N55A 4Q7IA 4LUTB 2R29H 5LGZA 2UX7A 3OXSB 5CIPA 1KY7A 2HRLA 5K93A 3G1RA 2YZ8A 3E96A 2QS8A 2WINB 1RJRA 4GG6A 4YNYB 4MLJA 5DUJA 3OKNB 4YAQA 1Z9SB 2YL6A 2O6FA 5JOFB 3RK8A 2G5RA 4AYSA 1WNOA 4I48A 4H8WH 4KK9D 3LHPL 4J3OD 4NZTL 3WTXA 5LB1A 1S7TA 3K5RA 1A2YB 2MCG1 1H0IA 1HZHH 4APQA 1HXJA 4XMKL 1L9RA 4ZW7A 3MREA 4HTBA 4QAMB 3T3PE 5JH2A 4O8RA 2H2SD 2XUWA 1F41A 4XNYL 1DSYA 4Z7WA 1YTEA 5IQ9B 1EX1A 1NCJA 5G5IA 3O41B 2VW7A 4WZ9A 2R9RA 2C18A 1R6VA 4XQ6A 1IEBB 4WEBH 2VRAA 4HUNB 3W9ZA 1OK6A 3NYKA 2NY5C 4OH2A 5E70A 1K77A 1PXGA 5F1KC 3HGOA 1FA2A 2PXYA 4GW1B 1JZDC 4YVPA 4OGXH 5I19H 3KVLA 3I50L 1YEGL 2XDFA 3GLEA 3WQ6A 1N6QH 3LRHA 4ZNEA 2V8MA 3GZKA 2X8RA 3RTQC 4L3CA 4UT9A 4JFZH 3QCTH 3MC0A 1ZCCA 1JVNA 3F7YA 3IGHX 3ISYA 1HG3A 1A6ZA 1W72B 2BGSA 5TK2A 4AL8H 3IDJB 4KXAA 2WXDM 1IC7L 3MY9A 2WBJA 5E4IA 1DLHB 5EMYA 3D6GA 4F66A 3FSAA 5DO2D 4AYGA 3LQLA 2Q6WA 2AJYL 2V5YA 2ACQA 2CBMA 2QHAA 1UOWA 3ARED 5CMAB 1W6WA 3OGCB 3H9SB 3ES6A 3HC2A 2AEIT 4IMAA 1JG9A 3RJYA 1IT0A 4JD4A 3MJ9L 3EFFA 1S2VA 2WYZA 4N2DA 1DN2A 2N4IA 1UXWA 3UBHA 1KCRL 3BW9B 4UT7L 1KJ2L 4GT0A 4O02L 3TW7A 3HHSB 4ABVA 3HZYA 2PLKA 4Z77B 3VFGL 1CR9L 5K9KB 3LV3A 4K6AA 1PE1A 3NIDF 4HMCA 3ZOAA 3L54A 4Y9FA 2RUSA 2EIMB 4KH9A 3F4VA 2VLJE 1I9JL 1KIQB 3QXBA 3U9IA 3N44F 4ICXA 1NFDB 3GBEA 5KSBE 3SUVA 1TTAA 5LA0A 4PJEF 1FCQA 3BWAA 5EU3A 2WB5A 2HK0A 3RKDD 2PP7A 3BWWA 2MHAB 3U0PA 4PS7A 3AQUA 4KAQH 2VEPA 1JR1A 2VDLL 3O4LB 4GMTL 2J55A 3JZ7A 1GOGA 3T0TA 3E0LA 1REQB 3LKSA 3ZL1A 2PDBA 3WQCA 3L3HA 3FCPA 5T33L 2YD9A 1QI4A 4L3EA 1S7SA 1ZLDA 3QZWA 2CCRA 2EPOA 4WR3A 1RJZA 2PCEA 2B15A 2D7QA 2X6BA 2O4QA 3V4PH 1WWWX 1SUJA 4ZUSA 3ARBC 4PGCB 4RBPK 1TG7A 3L8QA 4TQPA 4BGLA 3BGFB 4RNHA 1TUPA 4I9TA 3AW5A 4KKLD 3X3FL 4QT5A 2HJKB 1P1ZB 1U33A 3EYPA 1A7BA 1GVEA 3GMOA 3QQDA 3AG4B 2AL1A 2NQZA 3ASOB 2PWUA 4QRUA 2NNAB 3LIUA 3U4BL 4Y19A 1JGEA 4NO2A 1ACXA 4HIXH 3VUSA 2W4XA 2DB8A 3EYQD 5JR1L 1NDMB 3I6GB 3ZHFA 1KCZA 3HA0A 5IHZA 4F48A 3UTPD 4OZOA 3CPLB 4IL0A 1YECH 4AIXA 1KJ3L 1OWQA 1WKYA 1A9BB 4YDNA 1OAXH 1YPZB 5E24E 1F90L 5GS2H 3CPGA 2PD5A 1W37A 4C6NA 2E46A 2VB5A 2XZAH 2WYSA 4PJGE 2DKUA 4RRPM 1F3WA 2IDUA 3SCMB 4PVLA 2Z64C 1DQJA 5KVDH 3DGRA 1NFBA 2QLYA 5LHDA 4OLVL 3MB9A 4Z1BA 2W38A 3EF7A 4AF0A 3WLOA 3S9DB 2JK5B 3ZKSD 1KM1A 5GS3A 1JTPA 2O5YH 2SEBA 4N2EA 4G1EB 2PTZA 2PCFA 2IG2L 1H7RA 3EJSA 3F6LA 3ZE1B 1A0QL 1QFEA 3BH4A 3LDBC 3S2NA 3OHXC 1VBGA 2XN9B 4HS3B 1JZ2A 2J4WH 3IK4A 1M71B 2JFCA 1X6UA 1CLOH 1FVCA 4OLZH 4LQFL 5LIUX 2IANB 5AKVA 2NQDA 5IGXH 5D7EA 4P7NA 5B1JA 1Q4WA 3LH9A 1IGML 5IESH 4OIIH 4EVNA 4ZS7H 5FUOH 2YEZA 3I68A 2QZQA 3DGGB 3CIAA 3DKHA 2VE6B 4CDGC 3GO2A 3NH7L 3SQBA 2F5BH 3FN0H 3PTKA 4B90A 4JEGB 1OF8A 4A29A 4QJ3B 2JELL 1D7BA 4GAAA 2G2RA 1EF2A 1E9PB 5F88B 3WNLA 2OJZL 3O15A 4FQ2L 3GO1H 1JGVH 2Y8VA 4FNRA 4P7OA 3TJHD 1LD9A 3N4FA 3HG2A 4OZFA 3CV5A 4LGXA 5ADOL 4ZX4A 3T3ME 2Q8XA 1E7UA 3MCOA 1ALDA 1D9KB 2ZJSH 1DQDH 3DOHA 3G24A 1OX4A 3O2DL 3JVAA 3CFJB 3WNMA 2D23A 2HFGH 3M8OL 3NYDA 4UV4H 4FX7A 3F01A 1ILSA 1TX2A 1TNMA 3A3WA 1WXYA 3ESPA 4DQAA 4DTGH 2J79A 3QIUA 1W3JA 4PJXB 1BYDA 3ZT6A 1LWRA 2DBLL 1T89A 1MSSA 1I7UA 4CRPA 3GRIA 1NJJA 1CF8H 3QTGA 4ZS6D 2X10A 4PMJA 1ORSA 3VSQA 1H7WA 1PY4A 2KS0A 2QPUA 4H9TA 4JJOA 2ARJA 1NCCL 2FAUA 2DEXX 3H4HA 4AZGA 2YFNA 4FZ8L 5CP3H 2VEGA 4JFFE 1KJVB 4EDXA 4TUFA 5JHAA 4L4VE 3PAYA 2XA8H 1XLLA 1J0IA 2C0AA 3VFRA 3FQWB 3BEVA 4J2XA 1CYGA 1FWNA 2Z4QB 2BPBA 1NQBA 3W1QA 2Q86B 4XNXH 1NLDH 3O6YX 2DQGH 1X5JA 4A66A 3MQIA 4O9HL 1YEHH 2D1ZA 5CAYB 1GZ1A 3UJSA 1KPUB 3EA3A 3ISIX 5AYIA 3RITA 2KKQA 2GC4C 4LOCA 4P46A 4OI9A 3P4LA 5F0JB 5A94A 4HUVB 3CFEA 3TA3A 2W0FA 2Z28A 2M26A 1OG6A 1RZFH 5CKSA 5BVPL 1XMWA 1IAIL 2WAQA 3VAVA 2J5LB 1ZZMA 4PUMA 2LV4A 4PWGA 4GQQA 5GGVY 4MWFB 2JJTA 2AJXH 5DUPL 3V5KA 4M7LH 5I1DA 1A5OC 2XFWA 1FDJA 5DEZA 3WY1A 3WL1A 1CFTA 3CXFA 3MBWB 4QI3A 3FU3A 3B9KC 2XV0A 3D39D 3QYSA 3DSNB 5L2KD 3RPMA 4FQJL 1WTGT 2AANA 3QZOA 3C2AL 4HJIA 4OGYH 3RIKA 3EGDB 4D94A 1UA6H 4WI0A 3EB3A 3LQGA 3PUUA 3T0DA 4HEMA 4DVBA 2Y63A 1Z6KA 1BMWA 2OAAA 3TE9A 2BNUA 1CWYA 1A3RH 5TDOA 5HI5D 1UWXK 3UXFA 5C2UB 1H8OA 1DVZA 4FGMA 4H1LG 3CVHA 4Q8PA 3NJMA 3VMNA 4WI7A 1MVYA 5ESVA 4FXSA 4JQIA 1TFPA 1YBQB 1IQ8A 2FPYA 1RK6A 3A67H 1E4KC 3FO1A 2P8PB 4IMKA 2VKXA 2X1OA 1A1OA 3ZTCC 1KC5H 3OB8A 2Q3RA 2DSZA 2XSBA 4MZRA 3SUWA 3GSWA 3Q7JA 4RZKA 4GISA 2B81A 5SWQB 4RDWA 1QBLL 2Y69B 3QWRA 3BKJL 1PDZA 2INZA 4NUMA 4GSXA 4ENEC 4XR8C 5HULA 4LV4A 2GGEA 3DX3A 1ACYL 5CS7A 3LI0A 5C9KA 1Q9LB 3MVSA 3FOLA 3PWNA 4LH8A 1KJ2B 2FJFB 3RPKA 3GS0A 1PZDA 1WX0A 1MY7A 2QVTA 4GFSA 1OQXA 2ZG2A 3KTSA 3SGUA 5EF3A 2WXNA 5BO1H 4NRXB 3ZWTA 2QAPA 1JD7A 1E1CA 2FWOA 4P49A 5FYKE 4W68A 3A6BL 5KZMA 3QPYA 2DQFA 4BJHA 2JF7A 4RCXA 1U8PB 2Z1SA 5F6IB 3ENEA 4DOHE 3SKMB 2VN4A 4JFQA 1DWGM 1TTGA 2HWZH 5AHLA 3VD9A 4AQAA 4DERA 1X97A 4EIVA 4Y5VC 4W93A 4KK5D 1KGIA 1S8DA 4K73A 1KTJA 2VDLB 4AVFA 1P4IL 4IX2A 2ZZ3A 4XNQB 4QSFA 5G55A 2FFCA 1B2YA 2FZBA 2AGTA 3VIHA 1DDTA 2AV1A 1CGSH 3QZLA 5DT7A 3NK3A 3QG6A 1H15B 3C5XA 3ZZ1A 1GPOL 2FO4B 3SO5A 1W80A 5AL8A 5BS0D 3S5OA 4AGOA 2IFFL 2ZWYA 4WVRA 3LZQA 2G3FA 2X87A 5DRWA 4HAFA 4UT9L 3HVDA 2HAZA 4GYKA 5PAZA 1QPOA 2XX1A 3RAJL 1F76A 3U0HA 5CD5C 4MA3B 4U3HA 2K3HA 3T0EE 5D7JC 3SI9A 3QI9D 3SRKA 3B2XA 3ITYA 1F3JB 4AC2A 1J5OL 3TBSA 1YMHA 2X4QB 1XF2B 2WVVA 2M2DA 1R0AL 2YL9A 4Q6XA 1T96A 3IIVA 3W6LA 1F58H 4NG3A 4OKDA 3ISWA 5SV3A 4E9RA 3RUGE 4QS6A 2P44B 4W9TA 3EGXB 4LRSA 3GLAA 1T1YB 3BESR 2Y7FA 1VD6A 4R4FH 3SADA 3LZLA 1FNLA 2IIJA 2HXAA 1LLWA 2DZEA 4H1LB 3DG3A 1EMTL 4AYDC 5DEFB 3WEXB 3MU7A 4F58H 1GVQA 2X1PA 4ZSTA 2ZA3A 3EXSA 3DVNB 4PJ8C 1EFXB 3CLEL 1T0NB 3MDWA 1EJ7L 3RUBL 4JHAL 1UB5B 3VCLA 3SCTA 5CN2A 1FPTL 4I9WD 4FF9A 3C3UA 1RZQA 1I6NA 1Z32X 4JRXD 1XINA 4E5TA 2O6DA 1TJ1A 1X7TA 1MUCA 4TQTA 4CGUB 3MRRA 2B1AL 4LFHG 4F15B 2BBFA 4JFHD 2XFYA 4A63A 3K8KA 2VLRD 1KULA 3CDFA 3UO8B 2NXZB 2ZONA 1FQ0A 5FO7B 3V6ZA 5K33A 1T1WA 4W9CC 1U58B 5AB0A 1OAQL 1JI2A 4EPSA 3HM7A 1O6VA 4QTIL 5GGSA 2PTVA 3VW3L 4BFAA 1D3GA 1HSBA 5CBBA 1XB8A 1CDJA 1FLRL 3MUIA 1LRQA 1DBBL 1ODZA 5HWNA 5HJ3A 3FFCD 3KGUA 2J47A 5D7KE 2XZ7A 4ORZC 4IDJH 2WQPA 1TJIH 4GJJA 4XPFH 1NF0A 1IFHH 4UYQA 2VLJA 3RE0A 2C8NA 3KOZA 5KSBA 3FO0L 1DJGA 2ICSA 1TLMA 4O15A 2W91A 3PK7A 3UJ2A 1QWKA 3W6YA 4R85A 4H88H 5CU5A 2AJSH 5E7BA 4DAIA 4JANA 4PSRA 1TEYA 1IFGA 4M6QA 4MQXC 4IQHA 4JDZB 2FWSA 3QYQA 2Y36L 2TMDA 1D2KA 5C0EB 2BVQB 4OCYL 4F2BA 2F54D 3ME0A 4EI5C 3GTFA 5B7EA 4HU4A 1THCA 4TQEH 2IKHA 4NO5A 4OI8A 1YSOA 2UYLB 4POYA 4U3SB 3O0LA 2WB7A 1SEBB 3CO8A 3UPCA 1JCVA 4ANUA 4HHWA 4GEJA 5HMEA 3ZVHA 4LS0A 4QXUH 1GMEA 1K2DB 3R89A 4PG2C 1LK2A 1HN1A 2WQAA 4JDEA 1IB5A 2EYSA 1CUOA 3W70A 2ZUQC 2ATPB 1FNSL 5HYSA 4MNMA 4HZLA 4U1IB 5E23A 4Z7UB 2DLIA 1I1CA 4Q0XH 3TBYB 3PUCA 3BEWB 4KX7A 5K5YA 4Q8TA 4OI7A 4PJGA 3S9ZA 3NP3A 2C1IA 1DJYA 3LKOB 1MEHA 4JEJA 1YCSA 5EOCL 3BHBB 4YQXL 2OT1A 1BX2A 3KEDA 3UXAA 3ZKNC 1IXPA 2Z31B 4KHXH 1INDH 3CLMA 1E8WA 5INCA 4E41D 4QEHA 1LG2A 3STZB 5LUMA 3OB0K 4QCFA 4AXKA 3LS5L 3UGUA 3EO9H 2Y1VA 4OFYD 3W7GA 3F7QA 5JNYA 1DUZB 5EEUA 2V9RA 2F2KA 2J7HA 5HY9A 3ZJAA 5CILL 3HAEH 2WKOA 1GZHC 1ITCA 3IDMB 4WXZA 2ZSVA 5IJVB 4LP4A 1CBGA 2WSRA 3MKKA 4J6RH 1Q85A 3OEXA 3U6RB 2K7QA 4ANWA 4YDIH 3DETC 4U1SA 2XU2A 3QJHA 2AK4D 5BV7C 3RM8A 4OTXH 5E1HB 3IIPA 4GVHA 2DEPA 4P7LA 4MKSA 1Q38A 2Y25A 4N6RA 4UMAA 3F7JA 2FECL 4XD3A 1EO5A 4PMXA 1NMAH 3US0A 1AHWC 3ZPDA 2QF8A 3TJPA 1KQZA 3OAZK 1XRTA 4NLAA 3QARA 4YXGA 2WSYA 5DELA 1KRBC 3RNQB 4ZE5A 1W5PA 4IGSA 1FHVA 3BQUA 1XRFA 4QHKJ 5CIPB 3QZWG 3MOAH 1KENL 5DDHA 4Y4HD 1UG6A 4MCYB 2O61A 3QHFH 2YAOA 3VXME 4YAQB 2CCLA 4F0HA 5JORA 2AQRA 4IX0A 1DO5A 1VAHA 3WBWA 5U4NA 3CQQA 5I71C 1BQGA 5I1GH 4IGNA 3DUHA 1FRBA 1S7TB 2YD0A 3W2DH 3W07A 1Z8AA 4DEWA 1XYFA 1UZ1A 4APQB 4Y4FD 2Z27A 3MREB 3RLGA 5D72H 4Z7WB 1TA3A 4RXGA 5MEPA 3UTSD 5CEZL 3D2TA 4IPLA 5LSMA 5HAOA 5ABZA 3S2AA 2XTJE 1EDGA 4I0KA 1CB7B 3SBWA 2CE6A 4ODHL 4JFFA 1A0EA 4QFUA 5IZ7A 1ROWA 4P06A 2I56A 2GVLA 4U1JA 2VXSH 4L4VA 3GTIA 4ONFH 3S98A 2IKGA 1TZHB 1W5OA 3GJFB 4JPVL 3CVHL 1WTLA 1U8JA 2PDYA 1NMCC 3QYNA 1W3KA 4OGQC 4L9ZA 2E27H 2Q9OA 4X0KA 3EX1A 4Z3HA 3NABL 1YHPA 2YBGA 3ELAT 2QVKA 4LW7A 1A3WA 4XVUD 2WBJB 3JXAA 4B3VA 4H44C 4TXEA 4HUWA 4EOWH 1R3QA 3NCMA 3P3TA 1BF8A 1OM0A 3APDA 4C7DA 1G7MA 3ES6B 4A7SA 1QSFD 3DYMA 3I2CH 4AHQA 1E72M 3ENLA 3E0IA 1QNIA 1EAOA 4FR1A 1AR2A 2Y22A 3OR6A 2Y3AA 1PYMA 4R97B 4PU2A 3NQDA 5I77A 2VP8A 1UXWB 4HPYH 4Y9NA 4NUGH 4KVCH 3NZUA 3GBMH 4ETYA 3MGTB 1C12A 2GJXA 2XZQH 3HVNA 4NP9A 1WWCA 3WLBA 3HV9A 3Q05A 1RZIA 5FA4A 1DYZA 4XAKD 3HZYB 1XVSA 2J77A 3V0HA 4HFWA 1BJMA 5AHEA 2EDQA 5A6IA 4ECLA 3VCRA 2D73A 2DWDB 4OZFG 2ENQA 1S46A 3QEUA 5FOOA 3DI3B 4FMVA 5AG9A 2GUBA 2FX8H 3CAQA 3MJWA 4FRWA 4W81A 3ZXAC 2NT1A 3BWAB 5EU3B 3D0CA 3I4EA 1TETH 1X5XA 2XWDA 4AD0A 4NSKA 3U0PB 2A21A 1IAKB 3KPTA 4FSAA 3W84A 1IM9A 3WF1A 3PUDA 3MBED 2X3BA 2O9TA 4GUGA 3VG9B 1AQDA 4YHIA 1E6OH 3LKSB 1MHHB 2XG4A 1TPC1 3KTCA 2I7OA 1R3IH 5D7HA 4HMDA 4IWWA 4D2JA 4L3EB 1HNYA 2FX7L 3U9WA 1EUAA 3E2HB 2F61A 4PV9A 1RJZB 3WEOA 1CB2A 4TV6A 1FNGB 6FABH 4NN6B 4ZUSB 5HDWA 4MQ7A 1SVBA 3RWEA 2E7DA 1AL7A 1X5YA 5KVEL 1GG1A 2ZCLH 2ALAA 3BV7A 1ND0A 4QT5B 3QYMA 3H4GA 5ILTH 2E6DA 1FIGH 4YC2C 3QWQB 3KH3A 4QRUB 4YXLH 4Y19B 1JGEB 4NO2B 1MNNA 4PMRA 5J9PA 3DJZA 1QYGL 4W6YB 4IIGA 4XN1A 2EDRA 3OJ2C 5IHZB 2FQIA 5JW4N 1N4XL 3BLLA 3MWAA 4IG2A 4MGGA 4P2YA 5D1QB 2FGWL 4PUUA 1UOZA 4FNPA 5GRJH 5K3VA 5CSRA 4RISL 4JPIB 2EDYA 3KS0J 4AF0B 3T6QC 3HMCA 4N8CH 2NVAA 1P7QA 3SM0A 1E2WA 3LHAA 2YN3A 2Z2BA 4QCIA 1VFTA 3J27A 1GKRA 4BQ9A 3LCIA 2PCFB 5JYLA 3VYNA 3RDTA 2DWSA 1U21A 2CSPA 4HG4K 4ZJ9A 4PVBA 4B5NA 2CBOA 4GRWF 3VH8A 4KWSA 5GGRY 5CAKA 2Y7SA 3MRFA 1XYAA 2WNWA 1XLCA 4L1SA 3FZUD 2NSQA 4WV1C 2NUTB 4LBRA 3N13A 4RLIA 1UEYA 3T0EA 4WKZA 1NLBL 1FFOA 1BVWA 3UY8A 2V37A 1XF1A 4EVNB 4DZ5A 2QDWA 1Z7AA 2YEZB 3EEZA 1P1MA 1XZWA 5TNVA 3MV8E 3V0TA 3SQBB 2B20A 2Q02A 5FGRA 1IEWA 3KCPB 1IIGA 3QJQB 3WMBA 5CM1A 2G2RB 3P84A 3PZVA 2ZUSA 2WLJA 2ACUA 2Q8BL 1C08A 3GIYA 3QQXA 3PV6A 2JGQA 2WZEA 2H1XA 1CFVL 4MNHA 3RUGA 1TSHA 1W9PA 2F7FA 1LD9B 4NKIH 3CL8A 4UV7L 3AZTA 2F53A 2V5RA 4BEIA 3QJSB 4MAUL 1Q6CA 4WTZG 4FP8L 4YPJA 4MXQD 4KRUA 2CUAA 4JRFA 4GUFA 4E42A 3GT6A 1D5ZA 2YHGA 1ADDA 5DHDA 4E9SA 3A23A 4RPPA 4Z2JA 1KM3A 3RX8A 4W9DC 4WY7H 5I1HL 4LAUA 4XAFA 3QIUB 2PTUA 3MKGA 5JHLA 1I1AD 5C3TA 4KK8D 3QUXD 4Q3MA 1MPAH 1ORSB 3NDOA 4L2YA 1CXKA 4EN3D 2P1FA 3NACL 2EO1A 1UOVA 4LPUA 3GF8A 3P14A 4R33A 2VVSA 2Q8AL 4NQDD 3WH7A 1GZGA 1HZLA 5FYJU 2ARJB 4YO0A 4WZHA 5D4QA 4IFKA 3TT1H 4MNLA 3LEVL 4X8JA 2EDFA 2BG5A 3V8OA 5IG7A 1SGJA 4P3CH 4IIBA 4JS7A 2XTSA 1UKPA 3RVTC 5AZ1A 2VDPH 4HCDA 3BD5A 2X30A 4Z7OE 3Q43A 4AFYA 3L16A 1OSPH 3TVMC 5KZDA 4WDIA 4IRZA 2WXGA 1KN4H 2DF3A 3WXWH 2RDWA 2R0WL 1QFUL 4XZUB 3L9CA 4H6QA 3RY5A 5H37H 3TA3B 2W0FB 3G6JF 4XPTH 1XBYA 2W0KA 4WJEA 4M81A 4KDVA 4RA3A 3R06A 1IHIA 2XPGB 3H42L 3NR0A 4M29A 4J4PA 1CICC 2XWXA 4PJIF 1CFTB 1C8XA 3S97C 2NCMA 2OSLA 1DVFA 1TJXA 1E73M 4EIZC 2VUOA 2XCMC 4HPNA 2VZ3A 1PVNA 3ATZA 3UZ5A 4WI0B 3NK4A 4B16A 2Z8SA 1EJFA 3UCDA 4DN4H 2QPXA 4H8PA 1DE5A 1GAFH 3HE6D 5IMMA 2BNUB 5TDOB 2HUEA 4ZQNA 3BQ5A 3NSYA 5IQLA 1KFGA 4W8AA 4J2PA 1JCXA 4IIQB 4S1QH 3ULVC 1A50A 2W65A 1FHUA 5CBAB 4NAFA 4CSSA 1E6QM 3OPZL 2EUXA 3CN2A 3TYZA 5ESVB 3VNKA 1YVLA 1WUNT 4NZCA 1QLRA 3VGAB 3NAVA 4YTSA 4BZ2A 2BSLA 4Z3FA 1WEJH 3FO1B 1IC0A 3O0RH 2QULA 5GISL 5J12C 2IADA 1FKWA 4YWIA 3GSWB 4D71A 4TLTA 1PKQE 3HB3D 1MN4A 4BCZA 4GVIA 1GRWA 3R7QA 4HNTA 3O3EA 5J8OA 4R2GB 1OHLA 3GWQA 1JS4A 2OCFD 4LNVA 2QVMA 1BXXA 1GY1A 3IFLL 2UZYA 4K8RL 3IBOA 3H12A 4K2UH 3OG4B 1EAJA 1KIPA 4FQ1H 4Z7VB 3FOLB 3PWNB 2RCSL 4A2RA 3N0PB 4FXGB 3LM7A 4OZHE 2JI2A 2EDTA 4CCDA 3F5LA 4G7EA 3BO8B 4OOZA 5L7XL 1E1CB 2FWOB 5I6PA 4FQXC 3ZJ7A 4QPEA 5DUMH 4Y2NA 1A4BA 4O12A 2DQFB 3GYEA 3BRDA 4ILDA 4OF3A 2PABA 1N19A 4N0CD 1KGUA 4WGKA 4JFQB 1UUSA 3IARA 1DIKA 2K4WA 1UXMA 1JXGA 4EXQA 3GI9H 1A4LA 4AQAB 3CWOX 3AHZA 1FGNH 4HWBA 1AODA 1VCBC 1S8DB 2RHEA 1RA5A 1OCWH 3QEQE 1XR9A 1U3HD 3EYVA 3CIVA 4WDTA 1K9TA 2DYPD 4K38A 5FESA 1DANT 4XPBL 3DYPA 3MLVL 4MYWB 2AV1B 2JSFA 1X39A 3DX8A 4XAWH 3QG6B 2EVGA 3DXIA 3TAOA 3EYOA 2J8TA 1OYAA 2HTLD 2Z26A 4M6PA 3CUFA 1F4XL 3VIOA 2WO5A 3AB0C 1JFQH 2OMVA 1S5MA 4GMSH 5DRWB 1XP3A 4Q8OA 1DQML 1XR2A 3CX5J 4GUCA 1PAMA 7FABL 5J6SA 3FSOA 2DQEH 1RK5A 4PJFE 1H1NA 3TZVC 4B9ZA 1VS1A 4M1RA 3B04A 3Q94A 2DDQL 3FQNA 4JE4B 3VXMA 3MACH 2VEFA 2MANA 4ZTXA 1YMHB 1TTJA 4R8WH 1NQ6A 2CBIA 3PBUA 2G5WA 4JTCA 3O11A 3DXAE 4QOKE 3GAYA 4W9KC 4LAOA 4L80A 4JTGA 1ET7A 4FYTA 2QBWA 2NY6D 3R43A 2VQ1A 1INQA 1QRNE 1GOHA 4FFTA 4Y9AA 3S0CA 3UTTE 3E3QE 1NDWA 2P5PA 1H3TA 3F62A 1O9ZA 4LLQA 4W4NA 3T3PB 4DB7A 3KPRE 5HYSG 1BFNA 5D37A 5HANA 3KWSA 3IFPA 3O07A 3P9LB 5TQ0H 1HNFA 2XISA 3ULAB 3LZNA 3UP1A 1RURL 1ZDQA 2ZDSA 2FHCA 3ARGD 4N1EA 1KBLA 3AHTA 2ZADA 2EKGA 4JO5A 2DJLA 4G2AA 4XPGL 5FHAH 4X5WB 3G5XA 2QSQA 3UJJL 2XIQA 4XMLH 5G2HA 3KM8A 4X9SA 3WF0A 2H1PH 2B5IC 2XYCA 2DMGA 3KHQA 1NEUA 4GUJA 2GT9A 4JO3L 3UYOD 3PF2A 1I75A 1OHQA 2PP1A 3VCLB 5IFHH 1SMOA 1D2OA 1AA1B 4KI1A 5HPMA 3TTEA 3QJOA 2EDBA 5BOPA 3MRRB 3LBOA 3SJ3A 4CCCA 1NOUA 4UU9B 2XWEA 3PXLA 1B88A 1W72H 3N14A 1ICPA 4HJWA 5KSAC 1IKFL 2YO3A 3N18A 3QR0A 3BPWA 5E6IB 3FUNA 4PB9H 3VILA 3V6ZB 2ATKA 1T1WB 4BI6A 3SDCD 3FBKA 1NWPA 3HMXH 4DF1A 2WB1A 5GGSB 3VA8A 3TN0D 1HSBB 1J5TA 2WQDA 4KY1H 3D08A 3D06A 3WLHA 1XS2A 5HJ3B 3P4NA 1ZHKA 4K7FA 1FFPB 5A8GA 3ECUA 3NQVA 4H20H 2YKKA 4K94C 3W11C 1GGYA 3P93A 4YOKA 3JSSA 5FYKL 1EEXA 1Q2SA 3VC5A 2QSTA 3HZMA 2EF9A 1Z9PA 2Z34A 7ODCA 5EIVA 5KSBB 1UXSA 4I3GA 1OFPA 4KJQD 4ZZKA 3QYCA 4RNRA 1YUHA 2R0KH 1I7TA 1O94A 2ZXBA 2ICWA 3MZTA 2QJIA 1RZ8B 5E2WH 4H9XA 4O8AA 3RLSA 1K7EA 4PTDA 4JANB 4YZFF 4XCEB 3ZYOA 1ONXA 5CN3A 2BLFA 2C9PA 3OAUL 2YXFA 2ZSWA 1EJOH 2BVTA 1MHPH 1ITQA 2NR6D 2XWCA 2F19L 2JB6A 3BE7A 3HG1D 3FNKA 4U1GB 1R46A 3ME0B 3VFVB 3QLLA 5C0BB 4N2NA 4G8AC 1A3ZA 3WIAA 5E51A 1HIML 2WN2A 3VRJA 1R2RA 5E1AA 2ZZ6A 1A0DA 1ZAGA 1Z42A 3D48R 2D2GA 1QT1A 3AUVA 1A8JH 4FE9A 2GSIA 3OAYH 4IKNA 3M44A 4X9HA 3ZVHB 3BLKA 2YXVA 3A6CL 4JRYD 2JJSA 1GOWA 2MH4A 3B3IB 1PG7X 3FGCA 1TVHA 3KJ6L 1JNLH 2EO7A 2A6IB 2X2GA 5GHWH 3JWDH 4Q4PA 2D0GA 2EYSB 1I1XA 3IUDA 5HYSB 2X40A 4IM8A 2QGYA 4ZAKD 4HZLB 3EOYG 1K6QL 3SR7A 4BD4A 4DUVA 3GHEH 5AB3A 2AQWA 5CZXD 1HP4A 3EBAA 2BCMA 4PJGB 2PYFA 1A0CA 1Q0XH 4YHPA 4D3CH 2HTKC 3RVVD 3M41A 1DIOA 2ZRUA 1O7VA 4IKIA 5FEXA 1TTIA 1OPGH 2VGIA 1I2OA 1AH4A 3MCLL 1DJWA 2NQ5A 1IE4A 4BA8A 1SUHA 3TFXA 2WM0A 5KVMC 4WFGD 3R0DA 3I9PA 3IK2A 1DR9A 1RJYB 4XTRD 4JTKA 4XV0A 5JNYB 2VXNA 2Z92B 2OQYA 4D9RE 5HY9B 2EPKX 4E4FA 2KL6A 3LEXA 4Z0BH 3LY6A 3V35A 6XIMA 3HS0C 1G9NC 2NX1A 2EHHA 3M4HA 3U4AA 3KPMA 3P3BA 5JHLL 3U0TA 3QGKC 4NQVA 3RZCC 2FEDD 4U1SB 3TURA 1GVFA 1UT1A 3FTUA 1P2CA 5EMMA 3ABKB 5C0GA 2Z6FA 4WW2C 4L4JA 5GNXA 5F9WB 4PFHA 3SDYH 3GDMA 3MV8A 3LV6A 4AIZB 3QKZA 1MUJA 3MLXL 3EMCA 1BFVH 4N6RB 3RNKA 5IUCA 1OM9A 5AVYB 5CSBA 3MV9B 4IZGA 2GJZB 2D0FA 1W2KT 4DBWA 3KRUA 4GRSA 4F8TA 1QXLA 3U8GA 3IFNH 4GP4B 1EPXA 1YNTA 4NKDA 3NAAH 4EPKA 1JRHH 5IK3A 4MFHA 5MENB 1LE5B 3T3MB 1ZT7A 3BQUB 5IVXF 1XL9A 4NQED 3IKKA 3L21A 3GRGA 4IRZL 4IT1A 1CE6A 3BG3A 3UR2A 3NQAA 1W56A 4TUJA 1WK0A 3RJXA 4F80A 5FYLH 2NQJA 4MLRA 3TEVA 1JWMA 4A68A 1PYFA 3C56A 3O2LA 4UFMA 4OFCA 4AD4A 3GG8A 4FOMA 2X1IA 4MS8D 3VIFA 2BS8A 4YFLI 5IRPA 1JGUH 3U1QA 3COTA 5ACZA 5DCDA 4X4YA 1UC6A 5MEPB 5FYKU 1S7RA 3TF7C 3MMUA 1MCFA 3NJ3A 3NEHA 4CSTA 1DWHM 4EE2A 1JZ3A 1SBBA 3UTQA 3JWOC 3OOQA 3TC3A 3ZDYF 3RU8L 3W7IA 4JFFB 4WWNA 1M7IA 3NL2A 2GB2A 4FQCH 1F00I 4L4VB 2GOKA 5FM5O 1WV2A 1BA9A 2R4SL 1ZIAA 1NARA 4W4OC 2A1YA 2G2PA 1L7IH 1U8JB 2ARJQ 2Z1VA 1ISZA 4IOTA 4X0KB 3B8TA 3R8HA 1GZPA 5CFHA 4MJ6B 4BZ2L 2GZXA 3GY1A 2EE6A 1W3NA 1UR2A 4JTSA 5AAMA 1AANA 3VKJA 3VH8G 2N7BA 1I3VA 2NY4D 3KRSA 4HSQA 2DT3A 3UWQA 4JGJA 3LKRA 4F2TA 3Q4DA 3IGKA 4GW4B 3FF8A 2X7WA 3LHPH 4NZTH 4ZFOB 5ANME 3OHIA 4JY6B 4MZ8A 3OR6B 5AG8A 3TJ4A 2R0ZL 4PRDA 4XTIA 2G5UA 3QJUB 4XMKH 3NIFF 5SV4A 3E3HA 3LXCA 1QNZL 1ZBVA 4LASL 4BFJA 2NXYD 1OAYH 1C12B 1NGZB 4JDTL 2GJXB 4XNYH 4V11A 3WLBB 1IBFA 4HBQA 5FA4B 5I1CL 3QCUL 4LF2A 1AYOA 4NNPL 5CFAA 4HFWB 2ZCZA 4WU7A 3U2JA 1HJWA 1HF6A 4YSPA 2EDWA 1HNGA 4QLRA 5D1XE 1SQ2N 5I8CA 3OW1A 3NIGF 4Y9PA 3IUHA 5KMYA 1PD1A 3AJXA 3MANA 3IV8A 4HUXA 4PW3A 1A02N 3K74B 3I50H 3NZSA 4ZFFB 1YEGH 2NXHA 4XNMA 1EC7A 4NSKB 2ATSA 3J07A 4HWBL 1K4DA 4QRRD 4JG0L 1IM9B 4X9YA 5T3ZD 1AQDB 4YHIB 3WK1A 1Q66A 2A2QT 4NOBA 1W1ZA 1U1JA 2GIMA 4WWOA 1S2EA 1IC7H 3T2OA 1AQHA 4B5XA 2H9AA 1N3NB 3ZYIA 2OQLA 2AJYH 1PKQA 4IRJC 4PV9B 3WE6A 5JW3L 3T05A 3ANUA 4F7MA 1WIOA 3RWEB 2CBPA 3LVTA 1FH9A 4Q4KA 4AXNA 3MJ9H 1A5NC 1XL4A 1LDPL 2JKEA 1JRHI 3RI5K 5BW7C 2K1MA 1LO2L 5C9WA 5I75B 1CD1A 5HNUA 1PZ0A 4OZHA 4S3EA 4XNZB 1XIWC 3T0VA 1KCRH 4UT7H 1KJ2H 3QJRB 4EPBC 3F04A 2FZ9A 1TJRA 4OBSA 3W0KA 3Q6GL 4BH8A 3CV6A 3EX6A 4K0OA 4K4KA 3VFGH 1CR9H 1VFSA 4E0CA 4PA8A 5CQ1A 1DDHA 2VOTA 3DJTA 3NSDA 4DOHB 1TJPA 3DLQR 3QEHA 1DIEA 4IG2B 3KVDD 2AW2A 1WUZA 1I9JH 2ZXQA 2EDLA 5D7LB 1SFTA 4LSRL 3GX9A 1HYSC 5C0CD 1CT8A 3PAJA 4UTTC 3QEQA 3QXVA 4QO1A 3B0PA 1TTQA 2W67A 1RUPL 4PUEA 3CMGA 2VDLH 1VRDA 5BMFL 2FGBA 1U95B 4GMTH 5FEBA 3L0GA 4BUQA 4Q6KA 3MUCA 1LHZA 4NPJA 3QW9A 1GW1A 3MRPA 1G4RA 5T33H 3GSMA 3RDTB 5KJ4A 2EXWC 1FFNA 3H24A 5MEQB 1EXHA 2PPCA 1QWNA 1H7PA 5FIEA 3Q44A 4FQHA 1NEZA 1HJCA 3M5YA 1S38A 3MRFB 3FJTA 3VI4E 4PJFA 2OMXB 4GUOA 4P2RE 4WTZA 3X3FH 3GSQA 3UWZA 1RK0B 4WKZB 3P1VA 4NXSA 3UXKA 1FFOB 1VFBB 4Q4EA 4F37F 1H3UA 3MLYL 2D3VA 1H1YA 3V1PA 2Y7NA 3U4BH 1UZ8A 3DXAA 4QOKA 5CJ8A 5AW9B 1POJA 5E8DH 3BPCA 3NCOA 1QRNA 1WFTA 4IUOA 3MSPA 5JR1H 4DWSC 3UTTA 1C08B 3KS6A 5I74B 4O02B 2NSMA 1IKNA 4O17A 3TPUA 3PV6B 5M3WA 2XNAA 1TENA 1KJ3H 1YDOA 3H2CA 5FC9A 1G4TA 4MNHB 4K9EL 5KG9B 3RUGB 5I09A 3KPRA 5BU6A 1BGGA 3WLTA 2G3XA 4EKJA 1KLZA 1BD2B 5C0ND 3KBJA 4PQXA 1E8XA 2IH3A 1BKHA 4XG1A 4TV5A 1SLXA 4MCZA 2XFRA 1OIOA 12E8H 4OLVH 4E42B 1D5ZB 1CW2A 2C13A 4L7ZA 5GZND 3RY6C 4ALAL 4YDMA 2EYTA 2BHYA 4H1LH 3K3QA 2FDSA 3V36A 3NBNA 4UNIA 1OFAA 2IG2H 3QLDA 1A14L 4Z23A 4ZMTA 3S5YA 1E9OA 1MRFL 5TQ2L 4BSJA 1A0QH 4ROQA 4CD8A 2DIEA 4F0SA 1NBVL 3UZEC 4PB0L 3QVQA 3BICA 4Y2DC 2ZUXA 1TG8A 3SRFA 4OAWA 4LQFH 2XKUA 4UDUA 1M6JA 5DK2A 2DQ6A 3HBQA 3D5OF 1IGMH 4YO0B 2ILLA 3M17A 5I18L 1DWFM 4DO6A 2Y7GA 3NH7H 4BF5A 3VO0A 4X6DF 2PDXA 4LEOA 4KTGA 2DWXA 3VXSE 2JELH 5FCUL 1WDDA 2OJZH 3DV4A 2BVPA 1HQTA 4RDBA 4FQ2H 1E4HA 1MLBA 3VKDA 4WDIB 1VEPA 4MVBD 4P5TC 3FOKA 5ADOH 1LP9E 1UADC 1B0GA 2NSOA 3BWUC 5EUOE 1RSCA 3R1ZA 3A47A 5I1KL 2XHYA 1WF5A 4G8IA 5E08H 4NNXA 2ROXA 3O2DH 4I88A 4IHBA 1GOQA 2GQHA 3UBGA 2F53E 3M8OH 5F3FA 2GC7C 3N6JA 3UPRA 4MNJA 2EACA 4AVNA 2NZIA 1GW6A 1WYIA 1O60A 5FCSH 2X89D 1IBDA 4ROPA 6REQA 5I1IH 1GTEA 2V5MA 3C0SA 2DBLH 4ZB5A 3FS9A 4ETQA 1CFMA 2GJ6E 4KY2A 3DK2A 4I7UA 5MF5A 3KJ4C 5DYFA 3FW6A 3WELA 3B9VA 1TYJA 4XH2A 5B8CC 3WIJA 1NCCH 3B3BA 4Q33A 5AL0A 2XC8A 4ZXBC 3ARYA 4FZ8H 1HWWA 2PDLA 3BWSA 2J44A 3B8VA 2W65B 2XVLA 4ZT1A 4AG4H 1YYLH 4KCWA 1ZK5A 3B97A 1AI1H 1UWIA 4GY4A 2UXVA 1SJDA 3QORA 3WUWA 3GHBH 3SDAC 1KG0B 3GSRB 4AZ8A 5HNRA 1KTLA 3ZQXA 4BSVA 1UGKA 3OR7A 4O9HH 4O0QA 1CB4A 1SLWA 4WCJA 2PPAA 3QSKB 1H3WM 2IADB 1RSYA 1ELSA 1JWUA 1QPXA 4GZIA 2GDQA 1G4MA 3EJYD 5IB3B 5BVPH 1IAIH 2WZTA 3O3EB 2PR4L 5XINA 4DRSA 1HTIA 1EBHA 3P02A 1W0VA 5FM4A 3MYJB 4AD5A 4Z08A 4RFNB 3IKCA 1Y5VA 2ZXGA 4KERA 1KIPB 3SO3C 3INPA 3JTSA 1QK2A 1I8MB 3OMZA 1V3IA 4FQJH 4C6IA 4G7EB 3C2AH 1ZK9A 1Y6MR 2PDIA 4PRIB 3SCRA 4XZMX 3HRZC 2E9LA 4I13B 3B9KA 1JZJA 1MI5E 1KDJA 4GCAA 1BQLH 2YLAA 3MZGB 1BBJA 1CXIA 4R6UA 4Y5XC 4AUJA 5J1TC 4LRTA 3B5TA 2X4TA 1XR9B 4Y8EA 3MTRA 3LQZA 3X1GA 4M6NL 3B2VL 4ATDA 3A24A 4JEQA 3DX8B 1NDGA 4WJKB 4W7WA 3LPGA 3QGVA 3UIZA 3EYOB 3THUA 3QXTA 3OLGA 2XA3A 2INEA 2OGYA 3K4AA 1MHCA 1KKRA 5ISZD 1S7VA 4PJ9D 4ZO9A 5BOZG 4MIMA 3M6YA 2OMVB 1SZGA 3BYTA 1QBLH 2CLFA 1NKGA 3BKJH 1LOQA 1V0NA 3GTHA 4JZJB 3TROA 3FO2B 2EDDA 2WBXA 3O6CA 5JXAL 2PW1A 1GC1C 5CHNA 2CG9X 3WFZA 3CZNA 1KKOA 2EVIA 1RSFA 4FHBD 2JE8A 1L4IA 5J3HD 3CUIA 3CS2A 3E2RA 3FFDB 3G9VA 2EE0A 5CIPH 1HGYA 2H5UA 3ZL4H 2AVGA 3PWVA 2XN2A 5C8JA 3VFTA 4Z1DA 1MAKA 4GYBA 4LCWD 3ROOB 1SDYA 1WAEA 3A6BH 4EZKA 5D38A 4FXKA 1KXHA 3BIAX 4LLQB 1EHLL 5AD0A 2Y6TE 3T08A 3QUYC 3IFPB 3UPWA 4NJIA 2PGEA 1MXDA 2BK8A 1P4IH 1CWVA 2ZOWA 3V6BR 5I15L 2XTJB 3GTTA 3MO1B 3WJJA 2Z1KA 4MFDA 3NSCA 4WEVX 4MDJA 1RZKL 2NUXA 4WFED 3MMEB 5LNUA 4HCGA 4XBEL 1LO0L 1KBJA 3G5XB 1GPOH 1RLCL 3CC5A 3KVJA 3B83A 1K4CA 3R18A 1NGQL 1K9DA 3SYOA 2IFFH 2JKSA 3UVAA 4PP1D 2XT1B 4A7TA 4M7ZC 4ERSL 5GSVB 1R24A 3SN6N 1SO6A 2GT9B 2R83A 1LYXA 4BDVA 4IHOA 2GLKA 4UT9H 2E9MA 4TX9A 1Y0LA 3GJFH 3GNRA 4FS9A 3VVGA 3RIAK 5K4ZA 2BOLA 4U0QB 5HPMB 4IFOA 4P4KD 1DBAL 4PVNA 3RCYA 2XUCA 3OKMA 3EX4A 3LX9A 3RAJH 3FU9A 1ME8A 5EWIH 2DPEA 1J5OH 1UQSA 3DKLA 2C4XA 4Y9EA 3M86A 1CDGA 3L1OL 4PN2A 1SM3L 4LAJH 3WK0A 1R0AH 1S39A 2ATKB 1DBKH 2GGHA 1M05A 4DN1A 3X1NA 5A8OA 5ANMA 4QRSA 4A2DA 4L65A 4WIQA 4GG6B 2LLLA 3P67A 4DJFD 2RR3A 1IAII 5F96L 1T21A 3LDVA 3WHE1 4I48B 3NA8A 4TPRL 1U8QA 1XXFC 1ZHKB 4UTWA 5JO5A 2BV9A 1ZDSA 5DZAA 3G1AA 4XAZA 1L3NA 3W73A 3V7PA 3WK3A 4BEQA 3B0YA 3FHEA 3T44A 5D1XA 5EZIL 3NCYS 4LT9A 1QX1A 1EMTH 1TRDA 4PYSA 4KRPB 4EWND 3HZMB 2X2UA 1OP4A 3KHDA 3NEOA 4FO4A 1UXSB 4AC1X 1MNUL 1MO0A 3DTUB 4GEIA 4RX0A 1NCHA 4Q7DA 4YWGL 1XH0A 4RNRB 5I73B 1K9FA 1I7TB 5MHSE 3ITVA 3FB7A 2QCNA 2PMQA 3CLEH 2ICWB 2V8ZA 3SN4A 2PXYB 3SKOA 1OINA 3DSFL 4JHAH 3I9AA 2Q01A 3ESUF 3W7JA 4RWYL 1FPTH 3BVNA 4L3CB 5E5LA 2B1AH 2JB6B 4YSCA 4MA7L 3T55A 5FSEC 1F1AA 2WQUA 1V6YA 4XCCL 3F7YB 4LEQA 4Q8NA 4JQIL 1A6ZB 2J6VA 1J10A 4ZMYA 2PPGA 1QTSA 4N9BA 5E1AB 1M3IA 3QEZA 3DBXA 5FJOA 2Q6WB 2OOGA 2GSIB 1OAQH 5D2TA 2CGYA 4M7TA 5D6DC 4QTIH 2Z3FA 5FO9A 5DLCA 3VW3H 3RU6A 3HC0A 4GUPA 1IVTA 2OMUA 3FGCB 2DIAA 4KKCD 1TVHB 5DC0A 4O4VA 1FLRH 1ME7A 3GDTA 4YTUA 4EAMA 2YA1A 2F8VA 3VD7A 5SX5H 1P0SE 1DBBH 1XI3A 1R85A 4HX1A 4YHLL 3EFFB 3WBEA 1TZGL 4S0SD 2ZZ1A 2B1HL 2YLKA 3TFKC 1HS6A 4PW9A 3VVVA 1AMXA 2A4CA 1X4ZA 4GUIA 3W74A 3M64A 4NCC2 4Q8UA 3V5DA 2A3AA 4XGZA 1QUPA 2YBRA 4I5BA 1TQCC 3FO0H 5EZJA 3N1QC 3LV3B 1NCDL 1FZOA 4N7QA 2IPUK 2J13A 5JZ7D 3SFWA 1C8QA 3VUPA 5ACMA 3W22A 2WW8A 4ZTPL 5AC6A 2Y36H 2I9TA 4OCYH 4NP7A 4P57A 1YDVA 4WO4A 4LHQB 3V52H 4N5EC 3UT0A 3CHFA 4MNGE 5K1JA 2ERJC 4B5SA 1YDNA 3LEXB 1A7RL 3LI1A 2EECA 3L3HB 1YY9D 4Y1SA 2J57A 5HXMA 3KPMB 3VI4A 4G8EA 4IKKA 4KROD 1S7SB 4N9OB 1UWSA 3M7WA 1KCWA 1OABA 4JFPA 4HG4J 3TSBA 3U4EA 4P2RA 4EI5A 4HJJL 4Y9GA 3QZWB 1P2CB 1A64A 3TO4A 3QIWD 5C0GB 2XTLA 5CZVL 3CXHK 4WTQA 4JFDE 1AQKL 5LNWA 3ITGA 3U6XS 1MUJB 3H2QA 1LVEA 3H3PL 3L2IA 1AC6A 1CIUA 4P5KA 1FNSH 5IVOA 3O9WC 1V4YA 3GMOB 2VR8A 3QQDB 3VX1A 4KBXA 4Y5YC 1OF0A 3D4ZA 2VYRE 3ZDXE 1YNTB 4NKDB 1IL1A 5B7MA 4GAYA 5IK3B 5MI0C 1G0YR 2ZUUA 1T66C 3FQ1A 1ZT7B 4MSSA 3AIQA 3OZKA 3Q5TA 3WJXA 1CE6B 2DVTA 4PJAF 4G72B 5EOCH 4YQXH 4LCCA 4N5UA 2OR9L 2WMJA 5T26A 4BQ5A 1DQJB 3GIZL 3LS5H 4KO7A 3CVDA 1AR1C 3C60A 1JWMB 2EDOA 3MA7A 1MCNA 5HQEA 3SPIA 1BQRA 5CILH 1KFKA 1XD1A 2NYYD 1WYJA 1PQZA 3S6TA 2SEBB 3SW6A 1RVKA 3ZBMA 5ACZB 4IGBD 2NV1A 5FW6A 3G5VA 4HXBL 1S7RB 3MRQA 5IOPA 5IQMA 4CUCA 2OR2A 3K5SA 4XMTA 3UTQB 5DN1A 2XXCB 2AF2A 1GYVA 1HJXA 1FVCB 6TAAA 4DKAA 1M7IB 4HU3A 4YL4A 1B9KA 1GOKA 4YTRA 2V7NA 2R6OA 3E1ZA 4D1JA 3RRAA 1MFEL 3VXSA 4WWKD 5FAGA 3ZJ8A 5IHWA 2K6YA 4ZG1A 4DZIA 4AAJA 4WXYA 1KY6A 2WC7A 3OBKA 2Q7AA 3BJTA 3CVIH 4G8TA 3NEEA 2TSYA 3ZHLA 3NQMA 3MRBA 3CHDA 4W6WB 5I23A 1GZPB 1OGSA 1L6ZA 3ASWA 3ARWA 3JWNC 3BN9D 1LP9A 3HZKA 1RZ7L 2MSPA 5EUOA 1LUCA 3L65A 2KC0A 4DYEA 3ZX1A 1CDBA 1KENH 1NEZG 3IPFA 4X6EA 4OZFB 1FHDA 3WK2A 1ZLVH 3LA4A 4LRIA 2BSEA 3P30L 3LKRB 1KN2L 2XKNA 1OX4B 4YHML 1IWBA 3MO7A 1FWFC 5T5FA 4GLEA 4CQAA 4FFWD 4UAHA 5I79A 3NZ1A 4PRDB 2GJ6A 2F58L 2VUYA 4YCOA 4R4ND 25C8H 1TIUA 5EBWA 3UBXA 5CEZH 1J79A 1SEQL 1U1HA 1I7UB 2IFGA 1RUQL 1XCWA 3QY6A 4CKVX 1VBRA 4WU7B 1QFWL 3VXUE 4HW6A 1A7NL 1SOSA 1JI1A 3BC9A 2CPCA 1NFGA 2QDDA 4Y7EA 4ODHH 4AX3A 4LUJA 5GGTA 2RJHA 3GG0A 5FF0A 4HUXB 4W87A 4ADIA 2B2XL 3IJIA 4FHAA 3W5NA 3PUGA 1K4GA 2IPWA 3CWHA 2BSDA 3PVFA 1M3JA 2D4FA 4GQRA 2NTFA 4JPVH 4EDXB 4JM0A 4P23A 4LKXA 2JXMA 2Z4TA 5BOOA 1UB6A 4M3JA 4XODA 3NABH 4MDOA 3SN0A 3VFRB 5ABGA 1UP2A 3BEVB 5C0AD 1CFSA 5LGKA 2GIXA 3IMRA 4PLJC 1B30A 2K70A 3V6OE