1MFUA

Probing the role of a mobile loop in human salivary amylase: structural studies on the loop-deleted mutant
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
491
structure length
491
Chain Sequence
b'EYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHSILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords alpha-amylase, Salivary
publication title Probing the role of a mobile loop in substrate binding and enzyme activity of human salivary amylase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 176
structure length 491
sequence length 491
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2002-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1mfuA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1mfuA01
3PZUA 3O2LA 4P7OA 1KXQA 3OG2A 1B9ZA 1GQLA 4XZBA 1AQHA 3BVXA 3J7HA 2WC4A 4EE9A 3ZJ6A 3CH9A 1KQYA 3DECA 1WP6A 3WUBA 1K9TA 3AHXA 3A4XA 4M8UA 4UR9A 4QFUA 1WCGA 2J7FA 4HZ6A 1UUQA 4LXFA 4D6JA 1SYTA 2XVKA 3E1F1 2JF6A 3KL3A 3AMCA 5F7UA 4GQRA 2YA1A 5A94A 1QHZA 3BUPA 4FNPA 1OD8A 3IK2A 1FP8A 1XH0A 2BS9A 2ZUVA 1ISYA 4AD1A 1SFSA 1LLOA 1K9FA 1Q6DA 3BUBA 1HIZA 1EHAA 1UR8A 5A69A 1OD0A 2WVSA 4UFMA 4U2ZA 3I3DA 2BVDA 2VX6A 3PZTA 4W84A 4BCEA 3NSMA 2J8FA 4AD3A 5JIPA 5GPRA 1VIWA 3CHEA 1FH7A 3WF4A 3PTMA 5I24A 1XYZA 2W5FA 3MUZ1 4P8VA 1LWJA 1CECA 2WK2A 4OZOA 4AZCB 5BRQA 2WHMA 1B30A 4HA4A 1V08A 3SCVA 2XFFA 3FNDA 1TVPA 5I79A 4KRTA 3VDBA 1UKQA 2WVUA 1R33A 4AIOA 2VURA 1HKIA 4OIFA 3DC0A 2DSKA 3EDFA 1VEMA 3NCOA 3NIYA 1QNRA 4W85A 3GM8A 3VINA 2VZOA 1E0VA 2EPNA 1CXFA 2V3EA 1W9BM 1AQ0A 2E9BA 1HJWA 3ZT7A 2GK1B 3CZJA 2QMJA 2ZE0A 4NI3A 4GI9A 2EAEA 4WSJA 1UWSA 3U7VA 6TAAA 1HP4A 4IUGA 2ZWYA 2VRQA 1HKJA 4BQ3A 2WCSA 1OIFA 1UD4A 3M46A 3CLWA 1TQWA 2XVGA 1JZ7A 3T2OA 3NSNA 1XV8A 1J12A 3ARSA 4AEFA 2PC8A 2QF8A 2YLLA 1J9YA 1JAKA 3POCA 3FY1A 3QGVA 3UCQA 1S46A 3NSXA 3A21A 3GH4A 5D9PA 3W4RA 4MAVA 3WUEA 4D1IA 4UQ9A 5JBFA 1TQUA 1J11A 4CD5A 1W1VA 3WDHA 3K1DA 3EBVA 3UR7A 1E5JA 3MMUA 1R86A 2OYKA 4MJ2A 4C7GA 2WC7A 4YHGA 1B3VA 1OT1A 1OCQA 1ISWA 4WIWA 4DWSB 1JXJA 5BXSA 5I3DA 2WLZA 1PX4A 2O9OA 2YOCA 2NT1A 2YLAA 2F1AA 3D4ZA 3L4YA 1ITXA 3TTOA 3T2QA 3S5ZA 2WKLA 4FLRA 1W1PA 3FXYA 5BXTA 1HKKA 1NARA 4GZEA 4AMCA 2WZIA 6CGTA 4UQDA 1UHVA 2WMIB 1TA3B 2AOSA 5CSUA 3DDGA 1I75A 4V28A 3DDFA 1RP8A 2G8ZA 3D5HA 3L4TA 4Z2GA 3NDYA 3QHMA 3VIKA 1E43A 1PIGA 4PTVA 4PSRA 3KZSA 2FGZA 3WNKA 1ZS2A 2YJQA 3LXCA 3VGHA 2ZX9A 3MMWA 3ZJ7A 1M7XA 5BRPA 4Z2IA 2BVYA 3T0AA 2Y2WA 3ZJKA 3VIGA 1TZ7A 1B0IA 2ZXBA 3T0DA 1ODUA 1OGSA 3WEMA 1H49A 2CPUA 1V3MA 2QV4A 1RD6A 1E3XA 4UOJA 3DX2A 1PAMA 3FAXA 1WO2A 3BC9A 1EDTA 4J3TA 2VO5A 4DO4A 1GOIA 1R87A 4CD8A 1R75A 4JL2A 5HBFA 1FFRA 1FOBA 3VUPA 4W7UA 2BVTA 5EMYA 1KBKA 1HNYA 3RILA 2YL6A 3W28A 2X2YA 3VPLA 1MW3A 4P7NA 1R8LA 1VFUA 2E4TA 2CBUA 3OZOA 1V6XA 2PBOA 1G5AA 2VTFA 3BMWA 3ARRA 1H41A 2ZXQA 2UY5A 2VX7A 2E0PA 4NSBA 3SCOA 2VUYA 4HZ8A 1QI3A 1W2VA 1HJVA 2XSBA 4NF7A 3ZMRA 1BYAA 2VOTA 3L4WA 4OOUA 2XGIA 3MS8A 2DT3A 2QPUA 3W6LA 3LPGA 3OGSA 2J75A 4PTWA 3PZGA 4FNTA 3A47A 1ECEA 1QOXA 3AMDA 2WSPA 3GBDA 1BYCA 1JG9A 4L4OA 4JFVA 3CGTA 4WJXA 4DWSC 3LPOA 3AZRA 3WQ6A 4W8BA 1C3FA 2DT1A 3AIQA 3DYPA 4MJ4A 4TTUA 1PX3A 5FL1A 2EQDA 3AROA 4IM4A 2C7FA 4ATWA 1QI0A 3AMGA 1WPCA 5A3HA 3PBGA 3PN8A 2VQUA 3SUVA 1ODZA 3OIHA 1CIUA 1CGVA 2BHYA 4NZFA 2BY2A 1M04A 1PIFA 4WF7A 3W29A 1E4NA 1ISVA 4S3KA 4H04A 1E6QM 4WKHA 3MI6A 4QLKA 1HL9A 1V6VA 2ESCA 5A95A 2Y8VA 1QHPA 2WHLA 2VZTA 3N12A 2X0HA 3M6DA 2X0YA 5GNXA 3GXMA 3WELA 5EB8A 2UY3A 1EO7A 3VIFA 4DWSD 2O92A 3AHYA 1HXKA 1W1YA 2D2OA 2D0HA 2WLYA 3M7SA 1HJXA 3AYRA 3WH5A 3VGFA 2YBTA 1NP0A 2YDRA 1E6XM 4MTVA 4F79A 4TTGA 2WHJA 1UD3A 3NJ3A 5A8QA 1KXVA 3MUAA 3F5LA 1JD9A 2D3NA 2J62A 3RJYA 1JF5A 1E73M 5IHSA 3SCWA 1GJWA 1ITCA 3RMEA 3WMBA 4W87A 3GXDA 1MQRA 3N15A 3PZMA 1E5NA 3KL0A 3K46A 1C8YA 1GPFA 2GFTA 4GXPA 1B2YA 2GUYA 2WBGA 1G1YA 2OYLA 1CPUA 1XHGA 3F4VA 1CGWA 5E09A 3VSUA 3IJ8A 3MUY1 2JIWA 2DGAA 4H2CA 4FNSA 3K8KA 3W6MA 1E70M 2BFGA 2D73A 3CZKA 3VMPA 2VCAA 3CBWA 1OGGA 1NWRA 4ACZB 2EABA 4ZXOA 3ARTA 1B3YA 1HTYA 3VD4A 1MFUA 3LXAA 3JUGA 3WDJA 4JFTA 2VL4A 4J3UA 4GI8A 1HXJA 2RGLA 1WE5A 2J7BA 2F1BA 4W7VA 4OBRA 4MB5A 1J0KA 2DH2A 1J18A 3BGAA 1KWGA 1UWIA 6A3HA 1GQJA 1YQ2A 4MDPA 2DPEA 2OWWA 1W91A 1IZJA 4AIUA 1OGBA 4NXSA 3PZ9A 1CXLA 3MSDA 3WDQA 3BUQA 4URIA 1I1XA 3N13A 5E0FA 4BQ4A 1NP2A 1ZBWA 3QR3A 4M82A 4ZE4A 4AZ7A 5FOOA 4CN1A 1J0HA 5GNYA 3KWXA 4A3HA 1G9HA 3D3AA 1BFNA 4DWSA 5M17A 4UZSA 3RCNA 3OZPA 4ZE5A 1UH2A 3VX0A 4OGZA 2WBKA 3U5YA 4CD4A 5JBDA 1TMQA 3EJSA 5A6BD 1CNVA 3FAWA 2HVMA 2J8GA 4D6IA 4CVUA 2G3MA 1B90A 2E3ZA 3CUJA 3WF0A 3OA5A 1R7OA 5EFFA 1TA3A 3NUKA 2WZEA 1H3GA 4Z2HA 3HZ3A 3ALFA 1KCKA 5CJ5A 3CHFA 3WSUA 1ISZA 5LA1A 4HPGA 2WPGA 3VM7A 2J74A 1TQSA 3CZ8A 1JYXA 2BXZA 1UKOA 2DDXA 4BZYA 3ARVA 5AC5A 2CITA 4E4PA 1BYDA 4H8HA 2XM2A 5FCZA 1V0KA 4H8VA 4MNJA 3VD3A 4GPNA 1KBBA 2CKRA 3VIJA 2O9PA 3WMCA 3N04A 1ZBKA 1E0WA 1K6AA 4UCFA 2E8YA 4AZGA 4M24A 1HT6A 4M56A 4JKMA 3VU2A 3VSTA 3RIKA 2CERA 3QHOA 4D1JA 2ZUNA 1J0YA 5GQBA 5M3WA 3T0BA 4F9JA 2WVTA 1JYVA 1CXIA 1UASA 2OWXA 3A6OA 1SZNA 3QOMA 3RM8A 1XD1A 3GYCA 1JI1A 3H55A 4CCCA 1F4HA 5D8ZA 1BG4A 3AISA 4PEEA 1XSJA 3AFBA 1DWGM 2DSWA 2GJXA 5A8OA 1M01A 1H0IA 4JHZA 1KR0A 3PTKA 1EQPA 1P6WA 5E6ZA 4W88A 2O9TA 4ATLA 4ZEPA 2GJRA 4LQ1A 1UG6A 1V3HA 4C7FA 4M80A 4U3CA 4ZXLA 3CV5A 3ZR5A 2WW5A 2XWEA 2ZUTA 1QVBA 2WHKA 3DYOA 2CIPA 1E40A 2YFNA 3VNYA 2XJ7A 2YDSA 4KGLA 5HPOA 3SCSA 3CUIA 3W38A 1GQKA 5I78A 1EA9C 3LRKA 2A3EA 1K9DA 2VRJA 1V6YA 2XVNA 5DEZA 4DUXA 4UNIA 4CU6A 3B9EA 3AS1A 1U30A 2ZX8A 1UZ4A 1JNDA 1SMDA 4PCTA 2WVVA 1EQCA 3DX3A 3BSGA 4ATDA 2XTKA 1EH9A 2DT2A 1MXDA 3OLIA 3MU7A 1R47A 1E6PA 3UG3A 3MKKA 1LQ0A 4EK7A 2X8RA 1R34A 2XFRA 2YDQA 4PN2A 2WNWA 4OBSA 5IDIA 1VBUA 4H41A 4U31A 4RE3A 1VJZA 4CKQA 1KXTA 2WWCA 1OIMA 2Y24A 4LGXA 5BXPA 4LX4A 1NOUA 2WKGA 3A24A 1C7SA 3VGBA 1PZ3A 5ABFB 3D50A 1UR1A 2DT0A 4PSPA 4J27A 4RE2A 3WD1A 2WXDM 4HPHA 2Y8KA 1JZ4A 3AZSA 2JEQA 1XD0A 4KMQA 2ALWA 4Z2LA 2X2JA 3FN9A 1CENA 5E1QA 2V5DA 4UFIA 3CZNA 2XN0A 3BXWA 3BLPX 5BROA 1KGWA 2XGBA 3WQWA 1NM9A 1MQPA 1DHKA 3WQ5A 3GH5A 2RGMA 3F5JA 4WKAA 2XVLA 2UY2A 3H54A 5M5DA 1E4IA 4U5IA 4MDOA 3AMLA 4D6HA 1ZBVA 5D9NA 2ZX5A 3N17A 4MB4A 2D0FA 3FHQA 5A2BA 1C90A 4GINA 3SUTA 1GQIA 1Z32X 3CZGA 3KL5A 4MB3A 3ZJ8A 1KR1A 2XIIA 1B31A 2F61A 3ARYA 3O6AA 1HJQA 1C93A 4B15A 1GZJA 4B16A 4HU0A 4EKJA 1HJUA 4UFKA 3SCPA 2JALA 2W63A 2VZSA 3N11A 1KFWA 4ACZA 4AISA 4U5KA 3TV8A 1JDCA 1J01A 4YPJA 1EDGA 1LL6A 5A6KA 1JZ8A 4N0RA 1QNQA 1E9LA 4J3VA 1HKMA 1V6UA 3AHVA 2BV9A 1J0ZA 4NRRA 1Q6FA 4NZJA 2JE8A 1SR0A 1OSEA 4GO8A 3WD2A 1V6WA 2F18A 2XFYA 4U2YA 4X0VA 4QAWA 3WN6A 4HZ7A 1BG9A 1XGZA 2HISA 4B9YA 3HG3A 4GKLA 3AZTA 3W24A 4IPLA 1WZAA 3GNRA 5I6SA 2V3FA 2YBUA 3K4DA 1IV8A 1KB3A 1JZ2A 4B3KA 2J7CA 4AMWA 2DQXA 4J3XA 4JHOA 1GJUA 2VNCA 4W86A 5ABHA 2W66A 3GXIA 3TONA 3VOCA 1JZ5A 1BYBA 3W26A 4JAWA 2A3BA 2QHAA 4UFHA 4QLJA 3ARXA 4HMDA 3MV11 4D6GA 2W62A 3AQUA 1KXHA 2YKKA 2CCRA 3WF3A 1JXKA 3UESA 2XN2A 5E9AA 4CGTA 3AXHA 2CBJA 2AMGA 3CZSA 1UR9A 5JIWA 1XCXA 4W8AA 2Y5EA 1TR1A 3VGGA 4Z2KA 3HG2A 1NQ6A 4XV0A 3OLEA 3LMYA 2VRKA 3S6TA 1NH6A 1E3ZA 2WZHA 4BQ5A 1UOKA 2EACA 1CEOA 2X2HA 1WAWA 4AZHA 2XVPA 4H7VA 4UZUA 4R27A 3CC1A 2YL5A 3IAQA 2G3IA 3GXFA 3AS2A 2CESA 3W25A 3WENA 3BSHA 2OWCA 1CXEA 2XWDA 2O9RA 2CEQA 4ML4A 1H4PA 3K8MA 5A6AA 5LYRA 3VTRA 3TP4A 1BVZA 2ZX6A 1UR4A 4L4PA 3EMQA 3AI0A 3VO0A 3CIVA 2J78A 3VKKA 2V3DA 4NZCA 1O7AA 1MW0A 2UWFA 3VIIA 1I1WA 1Q6CA 2VZUA 4CCDA 4B3LA 3CZEA 5AYBA 4BA0A 1X6NA 1ZBCA 4CVWA 5FKYA 1EIBA 2D3LA 3NDZA 1MW1A 2EPLX 1FH8A 4PMUA 3BAXA 3N1AA 1VEOA 4PTXA 1GOWA 2BHUA 3WDIA 2PWFA 2ZUSA 3WH7A 4AYSA 2FYVA 1GOQA 4R5EA 1OBAA 2C0HA 2YIHA 4WLCA 2BNJA 4HTYA 3AJ7A 1CDGA 2J79A 2WWDA 2VCCA 4KRUA 3SUSA 2WCAA 3WQVA 1XYFA 4MB1A 1MXGA 3BVUA 1M03A 5CGTA 4MADA 4Z2JA 3PZNA 1C91A 4QCEA 5HXMA 1ZU8A 2OW6A 3I3EA 4V27A 2WCGA 4D6DA 3W82A 3T09A 5E6YA 3PTQA 1SMAA 3WBAA 3S5YA 4W5UA 1U33A 2WM0A 1KGXA 1GOKA 1UWQA 2IXUA 2WC3A 5A1AA 3UR8A 1D2KA 1CLVA 2X09A 1A47A 3EJRA 3N9KA 3MV01 3OBAA 2CHNA 4UFJA 3VDHA 1JZ6A 1GNXA 3MANA 4HOZA 1E6NA 2WANA 2BXYA 3VILA 3RO8A 1W3LA 1CGYA 3WNPA 5E70A 1FH9A 2WAGA 3AIWA 4P8XA 1DP0A 3VIPA 4OOZA 1UA3A 1UR0A 3THCA 3ALGA 3A4AA 1JDDA 1B1YA 1HJSA 3WUFA 2CXGA 2E9MA 2A3AA 2C8NA 3VIHA 4AZCA 3L4VA 2D20A 5CPSA 2D24A 1QHOA 3GNOA 1H5VA 2XSAA 1PEZA 1KTBA 4CN4A 4D6CA 1H09A 3PZIA 4PMZA 3WH9A 2Y4SA 3GTNA 2D22A 2F2HA 3WNMA 1TQTA 3CUFA 2OLHA 1E71M 5D9OA 3D4YA 1CWYA 5JBEA 1JI2A 3RM9A 3VSVA 2GK1A 4GIAA 1W3JA 3WFLA 1UA7A 1CBGA 1W1TA 5A2AA 1VB9A 3WH6A 1V02A 3POHA 1HL8A 2DH3A 2VCBA 1OB0A 2J7GA 2Z1SA 2E8ZA 5D4YA 1DWAM 1W9VA 2VT0A 2F7QA 4YN5A 3AIEA 4JL1A 3WD0A 3SCUA 3N18A 4HMEA 3WY1A 2XN1A 3UERA 3I3BA 3LPFA 3AHZA 2XHYA 3WY2A 1AMYA 5FD0A 2J4GA 3RM4A 2QPSA 1V3JA 1WZKA 4ZFMA 4PMVA 4FNUA 3CPUA 1E6RA 3RJXA 5DT5A 5AC4A 2GVYA 2F7RA 1ESWA 3HMCA 4XUYA 1HN1A 5AY7A 3BUIA 5TD4A 1W9UA 5M03A 3MO4A 1XH2A 2CYGA 4ACYA 4CCEA 1US3A 4JIEA 4EAMA 4FLQA 1L8NA 1NWTA 2GJPA 2PWGA 3IGUA 1VFMA 3BCDA 3H53A 3L2LA 4P7LA 2VR4A 5CQ1A 3RDKA 1CXKA 4J3SA 2BY1A 3MMDA 1OM0A 4UTFA 3WEOA 3VIOA 1UD2A 1B3XA 4AZBA 2EBNA 2DSVA 4PUDA 4FNQA 1AVAA 2VQTA 2WMIA 1BSIA 2F7PA 2XG9A 3WEZA 3S2CA 4DO5A 3OB8A 3W0KA 4U3AA 4PMDA 1HVXA 1WDQA 1UQYA 2QMKA 1DWIM 4X9YA 4AWEA 5CZKA 4AZ6A 1TVNA 3U57A 4XZWA 2XIBA 2YL9A 1DWHM 1O6IA 1TUXA 3AS0A 3U5UA 3IJ7A 1HX0A 4J28A 3GDBA 3QOKA 1BF2A 2XM1A 4PRWA 1PPIA 8A3HA 1G0CA 4GZJA 1G94A 2ZIDA 3B9DA 2CBIA 2FH8A 4UFLA 3ARWA 4IISA 4AD0A 1X6LA 2NSXA 1E1FA 2JFEX 2EPMX 4BS0A 5A6SA 3WD3A 4HU8A 4E8CA 1E4LA 1ZJBA 1PX8A 4JKKA 2XYLA 3G6MA 2XUCA 1E0XA 3PZVA 4UQAA 3EJUA 5HDRA 3OGRA 3WQ4A 2G41A 1PJ9A 1U2YA 3GXNA 3UG5A 2J7HA 3ZOAA 3CMGA 3ARUA 2TAAA 2OSYA 4JFSA 3CTTA 3VX1A 4IPNB 3K4AA 2E9LA 5IFPA 4PMQA 5CSYA 4Q22A 3M07A 3BVVA 1JFHA 2VR5A 4P8WA 4A4AA 3ZQ9A 2IXVA 4PCSA 4A3YA 5A6BA 2ZXDA 1RP9A 4X0NA 3TTSA 1FFQA 5I23A 1QI2A 2WMJA 5E0CA 1XRVA 2YA0A 5C71A 2PWEA 2FDMA 3WIJA 1V0LA 1GHRA 4HMCA 1WNOA 2W67A 4RL3A 3HN3A 2V3GA 2CETA 5EBAA 2A3HA 5HPCA 2BY3A 2EPOA 1D3CA 2V38A 4HA3A 4BF7A 4PTMA 2CKSA 2JF7A 3SCTA 3LXBA 1UYQA 1EHNA 5EFDA 1JD7A 1BGGA 5GNZA 4DUWA 1E6ZA 4EANA 2XPKA 1R46A 4TOQA 2UY4A 3SCQA 3VGEA 1TQVA 1W9XA 1WDRA 3HJEA 5I2UA 3ZT6A 4CU8A 3EJTA 1QBAA 1V03A 1X1NA 4FMVA 7TAAA 2J7EA 1DWJM 1EXPA 1BTCA 2EPKX 1CTNA 4CN6A 2J77A 3AMKA 1V3LA 4RE4A 1VFOA 4LYRA 3BMVA 2G3NA 1WKYA 1V3KA 1VEPA 4TVUA 2E40A 2GSJA 1UD5A 1XSKA 1QW8A 1XSIA 4HP5A 5DT7A 1LJYA 4AD2A 1QI5A 5A6MA 1V0NA 1VBRA 3TTYA 1EOKA 1PZ2A 5KZ6A 2CNCA 2Z1KA 1YHTA 3HU7A 5FIPA 3B9AA 3QHNA 1JFXA 2X05A 4MNKA 1QWUA 2ZICA 1Q4NX 3EMCA 1K9EA 1CGUA 1W9PA 3GBEA 3L4UA 4JCMA 2ZUWA 1HP5A 1QNSA 2QLYA 3UG4A 1QX1A 1UR2A 4UOQA 1KCLA 3BAYA 2EXOA 1T0OA 1V3IA 1QW9A 3D51A 1GUVA 3OGVA 4AD4A 2G3JA 3BAIA 3BAJA 1ZJAA 1A3HA 4OKDA 3WDRA 4LPCA 3K8LA 2VI0A 1JGIA 2CBVA 3EDEA 2WMHA 4AYGA 4E8DA 2YFOA 3UETA 2WYSA 3VM5A 1XC6A 3EJPA 3W53A 1JYNA 1UH3A 3AICA 3IAPA 4AC1X 4DM1A 5CG0A 4FK9A 3W37A 1DEDA 1WZLA 3AIVA 3TTQA 4BQ2A 1UQZA 3WDPP 4KH2A 4CUCA 4UOZA 3OLDA 1LL7A 4E2OA 3VGDA 2ZUMA 3SUWA 2YL8A 1UH4A 4GZIA 3DX1A 1NWSA 1JAEA 3VMOA 1JF6A 1XH1A 2ZUUA 3FHAA 3GNPA 5IFTA 2YA2A 1J10A 3T08A 1WB0A 3GH7A 3PZQA 1VRXA 1FP9A 2Q8XA 3OLGA 1L0PA 3BLBA 1C92A 4DM2A 3A23A 4B9ZA 4JCLA 4NX0A 1ZL1A 4F66A 1M53A 3SCNA 2FH6A 4MPKA 7CGTA 7A3HA 3BLKA 4KWUA 4QDMA 1BVNP 4KGJA 3RPMA 9CGTA 3VVGA 1BPLB 1GONA 2J25A 1WZMA 5A8PA 4P7RA 2CHOA 4DO6A 3THDA 3WQ8A 1KGUA 4M1RA 3ZO9A 2D0GA 1EGZA 4C7DA 4FNRA 4NRSA 4JFUA 1DWFM 2VVNA 3WF1A 5FL0A 3BAKA 2W61A 3WKZA 4D72A 1GOMA 3D52A 1LG2A 3AXIA 1TCMA 3SCRA 2VC9A 3WBEA 4MAZA 4AD5A 1MYRA 2PBGA 1ISXA 2VX5A 4JZ5A 3SEPA 4UQEA 1QNOA 3EDDA 4AW7A 1GCYA 2IGTA 1CGXA 3PZOA 1JYWA 4PYSA 3AS3A 4XB3A 5LA0A 1UZ1A 1CXHA 1MW2A 1JIBA 3WMSA 3ZR6A 4UQCA 1UKPA 2A3CA 5D8WA 2NT0A 3B8SA 4F9DA 1BGAA 1C8XA 1KWKA 1RPKA 3WL1A 4WSKA 3VD9A 3CO4A 3GXPA 1V02E 3VDCA 4H8UA 2GJXB 2DEPA 4PMNA 5A6JA 1ZB5A 4XX6A 5A6LA 5D9MA 3ECQA 5CGMA 4CU7A 4P7QA 2G4FA 2NW0A 5IHRA 4OUEA 4AMXA 4HOWA 3ARZA 4PMXA 3CZLA 2V5CA 3WL0A 3LPPA 4D6EA 3HG4A 3CMJA 3ZIZA 3WNLA 1CZ1A 1LWHA 1C7TA 2DSZA 3VNZA 3AXXA 1UD6A 4AZ5A 5DMYA 1EDQA 3EMZA 3SURA 4AY1A 1KTCA 8CGTA 2WB5A 3SIMA 3AIRA 1UWRA 1B3ZA 2B31A 2FHFA 4YHEA 2EADA 2J7DA 3WNNA 1TFVA 1US2A 3KLLA 4F8XA 1PS3A 2WVVB 1TE1A 3WD4A 2EJ1A 1QWNA 3FW6A 1DTUA 2ZOXA 1IT0A 4W93A 5C70A 4TXEA 1UD8A 4AIEA 3EYPA 4GO9A 2AAAA 4PBGA 3CUHA 3A22A 2F8QA 3II1A 2DSUA 1R7AA 1VJSA 2EEXA 3DX4A 1IZKA 1XCWA 3BVWA 4QCFA 5DO8A 2ZXAA 3W27A 3DX0A 3CHCA 4W8LA 4PMRA 5DF0A 1E6SM 1G01A 3EDJA 3LRLA 4U33A 1HWWA 3BH4A 3AYSA 2IUZA 4J7RA 5I77A 5ABFA 3WUGA 3ZSSA 4W7WA 2OW7A 1FA2A 5BYWA 1E55A 4W89A 1MFVA 1NOFA 2WMKA 2GDUA 1V0MA 3AHTA 4ZENA 3WY4A 5HOSA 1UKSA 3DHUA 3L2MA 3L4ZA 2GDVA 4JFWA 4QLLA 3AIBA 3WFZA 1H1NA 1J0JA 1LG1A 4FF5A 3ZT5A 4DUVA 2WSKA 5BWFA 5C8BB 5A2CA 3EDKA 3W81A 5IXEA 3A5VA 3T2PA 4GI6A 4MNLA 2PB1A 3VD7A 2VZVA 4M29A 5JUVA 1BLIA 3BUDA 1NOWA 1C8QA 3O9NA 4Y7EA 4TVCA 5CXPA 4FLOA 3WY3A 1BQCA 5LA2A 3WH8A 2VX4A 1QI4A 3EJQA 1GVIA 3UEQA 1LF1A 1MWOA 4LYQA 1BAGA 1MQQA 1J0IA 1OWQA 1CYGA 1RH9A 4N42A 1W3HA 2D23A 5A8NA 3KE0A 1TG7A 1W3KA 1W2PA 1UWTA 3CUGA 4MNMA 3LRMA 1H2JA 3KEHA 5CLTA 1F4AA 4M81A 3ZM8A 3G6LA 3SUUA 1OT2A 1E56A 1E1EA 3PHAA 4FLSA 2VVSA 3A3HA 4J3WA 5DFAA 3ZSTA 1JNEA 1W32A 2W92A 1MVYA 1VF8A 1E4MM 3IJ9A 1KQZA 2D1ZA 3GZAA 4NXKA 3TOPA 3HG5A 1EOMA 1Q6EA 1E15A 3WF2A 5I0DA 4GQQA 5KEZA 5BXRA 4TVDA 1QPKA 2J47A 5BCAA 3CHDA 3MSGA 2DIJA 3TA9A 1WDPA 1W9DM 3L4XA 2JEPA 3VMNA 3U7BA 2X1IA 4PMYA 2JIEA 4WK9A 3KLKA 1D7FA 3GXTA 4CD7A 3ARPA 1GW1A 1JZ3A 5CPTA 2BY0A 4TUFA 4AXNA 3APGA 4HOXA 5I5RA 1PBGA 3ARQA 1FHDA 2FHCA 2FHBA 1HVQA 5AYIA 2FGLA 4D6FA 5ABGA 4AEEA 2PF0A 1GORA 1R85A 2OYMA 1EO5A 2WMFA 2MANA 2OSWA 1H11A 5A8MA 2EO7A 4TX6A 2W4XA 5HNNA 1JL8A 2VMFA 4D71A 1CLXA 1FHLA 3VIMA 4WKFA 1O7DC 1NWUA 4P8UA 2VJXA 5ECUA 4QP0A 4W5ZA 2PWDA 2ZWZA 1WDSA 4HA1A 3DYMA 3IANA 4OJYA 2W91A 1QBBA 2F7OA 1GOOA 1N82A 4LYPA 4TX8A 5ABEA 4V2XA 1H0GA 3WNOA 1B3WA 3AIUA 1VAHA 1VFFA 4S3JA 2PWHA 4Q7NA 4AZIA 5CPQA 3AOFA 1VENA 1E72M 1Y7VA 1BHGA 2X2IA 2ZX7A 1GVYA 1AQMA 2DIEA 4JKLA 1Q6GA 4CD6A 5CLWA 1UWUA 2WMGA 1OINA 4UQBA 3BVTA 3F5KA 1CGTA 4PUEA 2FE0A 1JDAA 4K68A 3DHPA 1LL4A 1UKTA 4PMOA 3BAWA 1HF6A 3MUIA 2BHZA 3A4WA 2PI6A 3VDAA 3LX9A 3VD5A 2OSXA 3BCFA 1QNPA 3NYDA 1GHSA
chains in the Genus database with same CATH superfamily
1S9XB 2Y07L 3TA4D 4P7OA 2Q3RA 2X9YA 4E5XG 1NVMA 3VGAC 4TUKL 5FM4A 4PS4H 4ICCX 2EEDA 3L7FB 4J2XA 4QFUA 3WIHH 1BZ7A 4PLOB 2XVKA 1JVKA 2JF6A 5AENA 2NY4B 1ONXA 4XTRC 3HUJA 2PYEE 4YVXA 4BFAA 3HVDA 1HS6A 3BUBA 3MLRL 4ZFFA 1K6QH 4KNTA 2DRUA 1NC4B 2AVGA 1M6OB 3OMIB 4AQOA 5AOJA 5CJOH 3W11D 2UY7A 1TZHB 4IKIA 2WTRA 3LHPL 4GY0A 1TETL 4TUJA 3NFUA 4XNMA 1WRFA 3DBNA 4JNYA 3QULA 5K9XA 5EIIG 4XO7A 3TN0D 4OIFA 4OM1H 1VEMA 4JQXA 3K6SB 4KTEL 1KGCE 2OODA 4L4JA 5AVWB 3RVVD 3NL6A 1YN7B 2CZFA 4OQTH 4ZNEE 3CZJA 1OFRA 3W1PA 3SN6N 3LS4H 4X9IA 4DZ8B 3GDCA 1D7KA 1HP4A 1KBIA 3VH8B 4A66A 1B4EA 1YVLA 2AJVL 4GBDA 1QPPA 2VM4A 1DJSA 2PC8A 3KGUA 1G7IB 1S46A 1KYUA 3S97C 5ALBH 4GY7A 2ALRA 5U7SA 2K6YA 2ISSA 1I1AC 4GQ9L 5DJZA 3H3KA 1I2QA 1UCBL 4AWTA 2IF7A 3O07A 4EVZA 1EHXA 5EOCJ 2Y3NA 5BXSA 1D7DA 2M8XA 5GJMA 2ZOUA 4IGBD 1MHCA 2WKLA 5LGZA 4TQPA 2EE9A 3ISWA 3B2VL 5BXTA 1U3HD 3EZ8A 1RFDL 4YU1A 4HW6A 2WMIB 4JTSA 3DDGA 1I75A 3R0NA 4JDVB 5EPMA 4CAGA 3QFJD 2ZOTA 3PWPA 5LG1A 2NTFB 5I1DB 3ZJ7A 2Y2WA 5I8EB 4WGVB 1ODUA 3IFLL 3HFMH 4ZZKA 1M7JA 3C8DA 3QUYA 1T7YA 4DO4A 1QFPA 3WQGA 4U6HA 3Q6FA 4O4YL 3CFEB 1WA3A 3VC6A 4U3SA 1OW0C 2FZMA 4G8IB 5EORH 2P3ZA 3IPBA 3D18B 4DOHE 4M8VA 7ODCA 4LT9A 1VFUA 1K1DA 2R0KL 4Z7QE 2A74B 4L4TA 2IANA 3PWJA 4Z7VB 1T5WB 4AVKA 2N0MA 3RTQB 4M8QB 1Q85A 3LPGA 2J7LA 4G6FB 1TPH1 3MOQA 1ME8A 1I7ZB 1DSWA 1BGXL 3LCHA 2FZ3B 1F6LL 3KOFA 5JYLA 2XQ0A 4QITA 2EQDA 4ATWA 1RBOB 1A8JH 1A6WH 2OSLB 3DV4A 3V6FA 1R0AL 4UIKH 2EXWC 5GGSA 5FYLH 2YZ8A 1HZLA 3QUXA 2JIXD 2ZE3A 2J1XA 2G5UA 3CDYA 2VZTA 2CHRA 3NZ1A 4HUVA 5GNXA 1PKNA 3OYZA 4K15A 2C16A 4Q8MA 2GDQA 4NZRH 4LVOB 2AQ2A 2ZUQC 3WO4C 4S0TD 4ODVL 1HJXA 3D5OF 3ITYA 4LKCA 2NY3D 3N5AA 3FUJA 1K8ZA 4TSBH 1ZVHA 3QIWD 2V7NB 5DCEA 2YGQA 4CNIA 2X4UB 1C8YA 1I7UA 1QMUA 4GJTB 4JG1L 3TYGL 3UTZA 4LCSA 4GKZB 1ZNNA 4HS3A 3JVAA 1MI3A 4TMBA 2JNZA 4HCDA 3RURA 4JFYB 5I2IB 2JKAA 1A7QH 4LU5H 3BDBA 4PYHA 3H9SE 2NY1C 1DVTA 2VCAA 4YDIH 3OW1A 1LP9F 2BDNL 1OGGA 4ACZB 1EJ7L 4JX6A 2VDPH 3ARTA 1DO5A 2RMNA 4NC2B 1LL1A 1X5MA 1B0GB 1E8WA 1RUAH 2VISB 4URKA 4LIQL 5FGCB 4NN7B 1S5IH 4Z76B 1S7VB 3IWVA 3WKNA 4C1KA 1BWWA 1AHWA 2HROA 1ZBWA 1UWEL 4JDZA 4AZ7A 4AVFA 2GQAA 3D3AA 1ONWA 3EXRA 3A4EA 1PKYA 2HVMA 1W0VB 4DN4L 1IGML 3SIZA 2QJJA 1S9YB 2VDIA 4WUUD 4IH3A 3S8HA 5HYSG 4ZMLA 5IHZA 1OGTB 1WKEA 2X87A 1ZSXA 4KMTL 1EANA 3FXIC 1EBPA 1OTTD 4R3SB 4DVBA 3GIYA 2JI2A 3STBA 2NQ3A 2CITA 1ETZB 5LGKA 4O1FA 3VD3A 1NEYA 3WMCA 5C0JB 4DKEH 1WBXA 3R4IA 3QAZC 4LLYB 3UC0H 3SW6A 3UWUA 3B34A 4YHLL 1Z66A 3MJ6A 4W9TA 1UUNA 3E9TA 4BKLB 3QQ4B 1D9KD 3ABSA 3K0YA 4DFHA 1K6WA 3LCWA 3ES6A 1YC7A 5J5DA 2AI0L 1GJIA 5C6TH 3EWZA 5EUOE 4RNHA 1BG4A 3AISA 3IEAA 3JV4A 1LNUA 4ZS7H 4E2DA 2ARJA 1IAII 2IADB 5F0PB 4M5ZH 2Q8LA 5I66B 4ATLA 4HKBA 1S1RA 3CV5A 2B59A 2XWEA 3CDCA 4HQQL 3KCLA 4BHUA 5DJ2A 1MLBA 5HPOA 2LOEA 3TN0C 5I78A 2WSYA 3L3JB 1OCWL 1YW1A 5J5EA 3F58L 4E8GA 1OF0A 2GK2A 5F7AA 1A3WA 2V68A 3RVVC 1OO2A 3C08H 4ODWB 3Q45A 3GZOA 2PPFA 1CD1A 5EU6A 5IDIA 4N90E 1HHGB 3NG3A 1LOQA 4YE4L 1KRCC 3WJLA 4I5BB 3FDGA 2VDQL 1E9OB 1YMMD 1NCAH 2HZGA 4LC6A 3O6CA 5F0LB 2PMQA 4Z0XB 2XGBA 5IW6A 4F8OA 3BP7A 2R1YA 3VFGH 4YHPA 5M5DA 1FYHB 4YGVB 5AWNL 3AMLA 2BO0A 1BQKA 4Y5VB 3JTBA 1U8MB 3SUTA 4IGBC 5I1LA 1XF2B 1NCCL 4HZMA 2VFEA 2XIIA 2BFVH 5C2XA 3TH4T 3PWNA 2Q76A 5IT2H 4OZGB 4YC2B 1HJUA 2XINA 4N3TA 2JALA 3C5SB 3SIKA 3L3DA 1QU4A 3KYMB 4YR6B 4H7CA 5T3ZH 3KXFD 1JDCA 4YPJA 1EDGA 3OZ9H 4P4KA 2MRYA 4X8JB 1FCQA 3H24A 2P3YA 3CLMA 2CIKA 4KJYA 1J0ZA 3W6YA 2O1AA 5E03A 1B4JL 1S3KL 3B43A 4HKJB 4PRIA 4DHLA 1W8GA 4CVZB 4GYPC 3H3BC 3MQIA 3HQPA 3GBNH 2Z35B 4MTMA 1KFEA 5CIPB 5KTEL 3SDXB 3H2CA 5HHPA 3V5DA 2J7CA 2YCIX 3NEHA 3SJVE 1RZKH 2IPTH 2QHAA 4CJ1A 1VF5C 3QS2A 2XKNA 3T8XA 3QHTC 2GPTA 1CLZL 3WD5H 4H6QA 1VBHA 3RJOA 5FF7A 1XCXA 2KZKA 4E2VA 1FYTB 2CBPA 5I6PA 1XF4A 3LHUA 2UVFA 2EYRB 4H7VA 4UBDD 4JN1L 3ARBA 3HE7A 3AS2A 4QRPA 2OWCA 3N43B 1P4LB 3QQDA 2IH3A 4QIRA 4XO3A 2YARA 3GINA 5J5RA 3T8QA 3QG6B 4HIEB 4H8QA 4UIMA 3IMRA 4NO5B 2NOYA 4QOKE 4CVXB 1X6NA 5C08A 3DJTA 1NGPH 2D3LA 3LCYA 1AZCA 2ENPA 2A9CA 7TIMA 4C6QA 3VYLA 1GOWA 4JFPA 3P9MA 3LDBC 1GOQA 3PFMA 4RZBA 1WISA 1CC3A 2DZEA 4V33A 4FQCL 2H0FA 3UDWC 1ZRUA 5DJ8B 2GPZA 1DSFL 3WXWH 2ZAHA 4WW2F 1O5RA 1CFSB 1KJ2H 3CAFA 3STZA 3BZFB 3WEBA 3THML 4IKJA 4XXCA 1LP9A 1HHJA 5D1XA 3QIWC 1CCZA 2YS4A 4HNTA 5KSAD 2XZ9A 2LU5A 1JNNH 4F8QA 4IEFA 4EAEA 3C6LB 3PQYE 4XPAL 3CPRA 3WG7B 4A22A 4PN6A 1DEEB 3DU0A 4RGND 1UWQA 2J6EA 3O3DB 3U2OA 2I9LA 3SQMA 4UTLA 3VILA 3GR7A 3GNXA 2WAGA 3OZMA 1ZT1B 2PP7A 4GVIA 1JPHA 2QBWA 3PABB 5DHVB 4PJEE 3V9FA 3N42F 3B9KD 1GOHA 3VIHA 3UBXA 3F12B 5CPSA 3A9BA 5FYKE 4CN4A 2HLFD 3RGVD 1T96A 5LIXX 1ET5A 4P2CG 1TQTA 3O3RA 2OLHA 2Z24A 1FWEC 2GJ6A 4WY7H 4O16A 4MMXB 2EG8A 4XE0A 3B8DA 3ATBA 3S6CA 2P8PB 2V8MA 4XPBH 4OU1A 5D4YA 1R2RA 4WWKB 1M65A 3I7QA 1J2WA 4QXVA 3WY1A 4PJXF 2XN1A 4JFXB 3PLYA 4K3HA 4WFGE 2DFAA 3I3BA 3JWNC 3BPNC 4N4YB 5KVFL 3N2OA 5IK3B 5GRJL 3RJXA 5I7GA 2EIMB 1AE6H 4JRWA 5D72L 3I7RA 3FU9A 3QJUB 3HZYA 4OZFB 4IF2A 1HOCA 1G7HB 1FFPA 3HBZA 1L8NA 3QUKB 1JF1A 4EACA 3U2EA 1RURH 3OKEA 2IS7A 4K7FA 4PD4J 2Q02A 3WEOA 1UD2A 2Z25A 1BSIA 5FOBA 4FXGA 1D9KC 1HVXA 3L95B 4IG2B 3ZX1A 3HCVB 25C8L 1AKJA 3AS0A 1IBZA 4JN7A 5KN5B 2R2HA 3K72A 3C6CA 1SO6A 2FDSA 2LVEA 2XM1A 35C8L 3P4MA 4LHUB 5BUAA 1IEVA 2ASHA 4KI5F 1NUNB 2NDGA 5I3KA 3HMWL 3FRUA 4FZEL 4AJWA 1W31A 3SRDA 3GO2A 3O4LB 3VA6A 3QO0A 4G42B 1PX8A 5I17A 2MCAA 4Z9KB 1IJNA 4MLSA 5C0BE 3TIDB 2VN6A 1F3DH 4GSQA 3DCPA 5EV7A 3A9IA 3NSFA 1G7PA 5FOJA 2VJ8A 2WXPA 1RHHA 2J7HA 5LUMA 1Q1JL 1NJ9B 3INUL 2E9LA 5D7SL 4GG6B 2WUBH 4HETA 3GMOB 4P3DA 4GD0A 1K8DA 1W17A 5EUKA 3TYCA 2P5EB 3GAKA 5C71A 3IJHA 2FDMA 1GHRA 3RUGF 1P0NA 4RAVB 3VFMB 4JMXA 4N0YH 5EBAA 4P5KB 1FLRH 3CV7A 1UYQA 2I9TB 1J9SA 2R4RH 4OJEH 4NB7A 3W39A 3VFUB 4DI9A 4C6OA 2QT6A 1LYXA 2ZTBA 4YVNA 5F7MC 3WLOA 2IPFA 2X9XA 9RUBA 1IQWH 3DN5A 3EJTA 5ICYA 2EPKX 2J77A 2VE6A 3OC8A 3BP6B 5M7QA 2Z1PA 3QJVB 1BBDH 3QUMB 1LEKA 2E7DA 3V4PL 2I9EA 2P53A 5FF6A 5CBBA 4JY5L 2G3NA 5DR5L 1WAUA 2GSJA 4XODA 1TO3A 5DT7A 3D9AL 5IIEB 3E7JA 3PGCA 2ZC1A 4WJG3 4XMLH 5EO1B 4X0KB 1LDPL 2AJ3A 1XCQB 2IQ9H 2VDLB 1SM3H 3LNHA 1WWAX 3JWNH 1UR2A 1RHCA 1WTGT 3ZVHB 4OVXA 3BAIA 1C5DA 1JHTA 3BLLA 1SBBA 4L23A 4IL0A 2EH7H 3ARFD 4JN2A 5AOUA 1KTLA 3BH9B 5EEYA 2FTWA 2GK0A 5D2TA 2PEVA 3CSFA 5BXFA 4RSYA 5D2NC 3AICA 3IAPA 1XH3B 4H01A 3GJFK 4I5XA 5I1GL 2C4FT 1FBIH 1NLBH 3WU1A 5CN1A 3LOTA 2G4GA 3P9LA 3FO2B 4PB4A 1QSEA 5D2LE 5ABZA 1F4XH 3GDRA 1YECL 3H3PH 4OLVH 1XH1A 3MCKA 1XBRA 4UBDC 3QQNA 4XPGL 4P4RB 2RCSL 3A23A 1KOAA 5AW2B 4PBDA 1A6TA 1TJ1A 4DGIL 2P5WA 2FECL 1GKEA 1MUJA 3T42A 4NNYA 1UW9A 5KS9E 3RPMA 4WW2A 3UG8A 4HEME 5A8PA 4H4IA 4PRNB 4HSQA 5CINL 3DX8B 1H50A 5JXEA 4MD5B 5GSRB 3ZYOA 2Y8UA 5FO8B 2ZONA 3HV8A 4Z95H 4DEWA 4AD5A 4KVCH 3MUCA 2NLJA 2QULA 3ARGC 2DLFH 4P2RB 3SE8H 5IB4B 4GC3A 5KSAC 5T3XD 3GJEA 1PSKH 5IRPA 1UWXK 1S2CA 4XBEL 3HI1B 5CSGA 4F9DA 4Y5XA 4RGNC 2I32A 3GJFH 4PPTA 4U6TA 3RHGA 1K02A 2YPKB 3TZNA 3TCLA 2TODA 3GXPA 2A6DB 2A85A 3L45A 1DANU 3B4YA 2VO8A 5KUMA 3VWKD 3ONCA 2AK4A 4WHCA 2F15A 3UZVA 4NFBA 4M51A 1IWPA 3B9KC 3REVB 4XPFL 4AMKH 2NWRA 3CMJA 4HHPA 2GLKA 1UD6A 3HPAA 2B15A 3T6CA 2HLFC 3RGVC 3KPRA 3FCSB 2A5HA 4DTGH 4PODA 1EAQA 3RKDD 1TFVA 1US2A 1M1SA 3CFBA 2HJKB 5IJDC 4AIEA 3U2SB 3S8FB 4H0HB 4MKVA 4NAEB 5SWQA 1R7AA 1RR2A 1JCJA 2F0CA 2ZXAA 1YY8A 3L9BA 3C87A 5DK0B 4NAQA 3DPDA 1HWWA 3GHPA 1O9VA 1DJIA 2PZNA 1T5AA 1CR9L 3ULVF 4W9KC 2NY5L 3P0YH 1K03A 3P67A 3G5XB 1RAMA 1J0JA 9XIAA 3KPLA 1V5XA 1UWXH 2PLJA 5FAGA 1KNOA 1F0LA 1QXLA 3ENLA 4JFEE 3HNVL 5B8CB 1EV2E 4H25B 1BQCA 1RK0B 4L3EB 1QI4A 3EJQA 3WIIL 4R7OA 1F58L 5DZVA 2V5TA 4INFA 1Z9PA 4IRZH 3F7VA 1XL4A 3VE0B 3REWA 1B88A 1W8EA 1W3HA 1ORSA 3LI0A 4BKTC 4YHZL 3N9GL 5EBLA 4IWWA 1W32A 1MIMH 4UTUA 2W9LA 4UMSA 4N0UE 1E4MM 4Q3MA 3IJ9A 3BDYH 3TOPA 3DX6B 3BDKA 1TZGL 4M3KB 3NJIA 4DK5A 3HI5L 4S0HA 3LKNA 4PFHA 4R97B 4MDJA 1IFRA 1R3JA 4I85A 1CICA 4ICMA 1TUFA 2OEMA 5CPTA 1L9PA 4AXNA 3APGA 1NDGB 5IV2B 2QR6A 1MFBH 2FHBA 5C0FB 4M6QA 4EQ3A 1MIEL 1OGPA 5A8MA 4PB0L 3BZEB 3CU1A 4JVUA 4WKZA 1XPGA 4K2UL 2XOTA 3U83A 3EOLA 2AS5M 4UTWA 3K2IA 1WDSA 5T8IA 1EL3A 2G50A 4HWBL 1QBBA 4NWTL 3SQRA 3GVRA 3AJXA 2VC6A 1VFFA 1HCYA 3KOYA 3EX6A 4K3EL 4MMZB 3SPVA 5JHLH 3CK0L 2AJUH 4CMHB 1NCTA 3EOAB 5LKNA 4M6ML 1T8XA 1UKTA 2IWEA 1U83A 2BHZA 1F13A 2PU0A 5F4SA 3DETD 4I9WE 1SZRA 3LQGA 4ZMOA 2Z4GA 1GGOA 3F05A 5C8JA 4AGPA 1OP3K 1ET8A 5B38A 2OV0A 4A6YA 2XYCA 4ZAKD 5D7LD 3K2UH 1ZALA 3CHPA 2X7VA 3FSOA 1G9NL 2ID5A 4AT6A 5BMFL 4S11A 4UTAH 3KW3A 1SFSA 4P23B 1BF8A 4DP9X 1HIZA 2OR9L 4Q2ZB 2Z93B 3O3BB 3OVQA 3PHQA 1UJPA 3ARFC 2N7BA 2Y69B 1FH7A 3VQMA 4DZHA 1SJCA 1G7UA 3HA1A 2UX7A 1XKYA 1CFTA 1KTRL 4FTVE 2WHMA 1BECA 4LFHD 5JH1A 1H63A 2AXGB 1R3TA 2Z0UA 4L1GA 3AAZB 2ZA3A 3PWIA 2W5PA 2ACRA 4KF1A 4UQ2A 3ISIX 4ZSTA 3K13A 5AVNA 5LCVH 4G9FA 4QSFA 2QVFB 5D7EA 1UB5B 3U6XA 2EAEA 5EC2A 2FVLA 1UD4A 3CLWA 1GMEA 4AF0A 4HUWB 5SWSD 2V9UA 4F33A 1OP3H 1ES0B 5JBFA 4RZCB 2NUPA 4K6AA 2APTA 2Z00A 2P7TA 4C7GA 5BW7C 3RG1C 1FNSL 4MA1C 3SQLA 3BANA 2X1SA 3MP4A 5CUSL 3VI3B 2IBBA 2VDRH 2MHAA 1MEHA 2WZIA 3WFAA 3RFZB 3HN8A 2ABAA 3E5PA 1QR7A 3BLEA 5IB5B 4YJ5A 5I8CB 4P5TA 5JNYB 2DUAA 3QARA 5BRPA 3FMGH 3P3TA 5BOFA 1L6PA 1V3MA 1RD6A 3DIFA 4TNEA 3O4OC 4UOJA 4DCQB 3VWKC 2ZCLH 4WI8A 3NM3A 3TBBA 4OBTA 4WI9A 4CC0A 4JRFA 1E6JL 4HAFA 4GYFA 5I00A 1HNYA 3CUPB 3IFPA 3DHDA 1L7TL 4PB3A 1R8LA 3W7IA 4G7VH 5I6OA 2CGZA 5T33L 4NF7A 3WGVB 4U6YA 4LARH 4KEUA 3FFOA 4FX6M 3TNNA 4XNDA 3WQOA 3ZHKA 3MS8A 3W7NA 5HULA 1P69B 2O5XH 3EFFB 4PFEA 1AXSB 2GSIB 1QOXA 3Q5OA 3CVDA 5C9KA 1JG9A 1GL4B 1WBYA 1L3NA 4ANWA 4DZAA 3BGGA 4MZ8A 3HKZA 4MJ4A 3D3VD 4QRRE 1M9WA 3GB7A 2PETA 1SO3A 3UQNA 3ZDZF 5DMMA 3U25A 5A3HA 1GCFA 4NQEB 5B1CA 4YQXH 3O3EB 3MTXA 3O41A 2XTJE 2BY2A 1EZUA 5AYQA 5FW7A 1KTJA 2D7TL 2BMKA 3V10A 2J55A 5DUML 3UBGA 1UB6A 3UWWA 3MRLA 4OJAA 5L9DL 4CC4A 3QRGL 4ZO6A 1DQWA 3PBUA 2LTQC 3V0WH 3M7SA 1TMLA 1UXMA 4MWFA 1T89A 1LTXA 2ATPA 3CFCH 4FQLL 5FFOA 4WTZA 4DKFL 1M7UA 1JF5A 4LAQH 2ZZ6A 4YLWA 3CVHA 4IP5A 3EGXB 5FEXA 2JH2A 5BS0A 3NO3A 5E09A 3M0LA 2Z8RA 3RWIB 1TG8A 1LBLA 4UMGA 4HUNB 3M6YA 5HA7A 4JAMB 1FKXA 3L67A 3VXNA 5HJGA 3SBQA 3PJLA 4FHKA 3NN8A 2MOGA 1XGRA 3KPPB 3EXSA 2F6UA 1SVCP 1MZRA 4J3UA 4OHQA 4LALA 1UT9A 3UPMA 1MLCB 3I2CH 2VN4A 3UZ5A 4NZ5A 2VDOB 1J8VA 4ODXB 4O8AA 4AIUA 5T3XH 4JS7A 5EU9A 4OGXL 4XBGB 3FN3A 1JZDC 1A14L 1DL7L 1LM8V 3Q2LA 5GS2H 2WZAA 1TLMA 3RWEB 1IL1A 5FCUL 4M6AA 4YHKH 5CAKA 4MA8H 1Q38A 4D6IA 3VXUD 2DVXA 4M48L 5E94B 3RWFA 4Q0XH 4L56A 4HPYH 4Z77B 1TA3A 1N64L 2B4CL 1X38A 3S1VA 2G2PA 1MREL 2H47C 3MKGA 2FPTA 4PR4A 3S9IA 5DDHB 4JHUA 4JTFA 3WIHA 1I8KB 4HPGA 2VMDA 1BVLB 2D7QA 1FNAA 5FHAL 3S48A 3ARVA 5LJYH 4E4PA 3RWGB 1ECYA 3SO3C 1LORA 3P0VL 4ZAKC 5F2MA 4TLUA 3RU8L 2BVWA 3NIFB 4DIXA 4RDYA 1SXSA 1JMZA 3CFDA 4DBWA 2E8YA 2FATH 3QK0A 5J1TC 1O7DE 4M5SA 3VSTA 2ZWKA 3OXRB 1LWRA 5KJRH 5IMMB 1C16A 4PJDE 2OXHA 3T0BA 3PXHA 2WP3O 2LT9A 1SZNA 4DZBB 4LSTL 2FJFA 1MY5A 3MCMA 4GJIA 3V0FA 4RMUA 1TV3A 2TSAA 1KA9F 5J7CC 4B95C 2Y0FA 1U8HB 3GW3A 2GVEA 1PD0A 3JWOL 1KENH 1HCVA 1WVZA 1WDAA 1HL4A 4LQ1A 4Y2DD 4HVBA 2ZYSA 3FU5A 1SJAA 3ZR5A 4PJFE 1KC5L 3LKRB 3EGDB 1E40A 3V5CA 3R4DA 2VR7A 3QDGB 1KY6A 1PKQA 1S7RB 1YQVL 4OIIH 3TEXA 1XLIA 1AY1L 1GEQA 4JFDD 5DJ0B 1SMDA 4JHVA 5I74B 3T65A 1UZGA 2WSQA 2YDQA 1BX2A 3RPDA 5LIKX 4J3OD 1PTZA 1OIMA 2K8QA 1JNHA 3KXQA 2YCEA 3A64A 3MXWH 2YSSB 2X6UA 3SKJL 3IUDA 4Z7NB 1DHPA 4KFZC 1M2VA 3GH5A 3SE6A 3WFCL 1WX0A 4NKCA 3H9HA 3ARDB 2MKLC 3QMTA 1CZ8L 3VYOA 2WKJA 1Z32X 5F1IB 1HZHH 2Y06H 4WV1B 3O6AA 5HJ3A 2V6HA 3CSTA 3G8EA 1XR9A 3T1FA 1FORL 4D3CL 1MHHA 3JWNG 5GGVY 2AQTA 1TVHA 5E8DH 2X1XR 5E2WL 2IGFH 3LZRA 4OFQA 1HKMA 3MGOB 2Y1VA 5JHBA 4E68A 2Q5BA 4QNPF 3KPSD 3PAZA 4Y1AB 3WD2A 3O6FA 5D7KD 1R3HA 4U2YA 3VKCA 1YEIH 2PUZA 1OAYH 4B9YA 4NZTL 3W24A 2LLLA 3S5NA 4ZW8A 3W72A 3CSGA 2XN9E 3RLUA 1JZ2A 3SHSA 2HTKD 4Y5YA 4LP8A 3TEYA 4OLYL 2I5QA 1M3UA 4W86A 3TVMD 4XP4L 3JZ7A 1BYBA 5G4MA 4Q74A 3USBA 5FB8A 3UBHA 1REQA 1CK0L 5JOPE 5C2CA 3G6JB 1KXHA 3WF3A 1J1XH 1JXKA 4PGEB 4JHMA 1CVRA 2IG2H 5ESVB 2H1PL 2WP3T 3ORWA 2EIDA 4AK1A 3NR0A 5DRWB 5F1SA 3OAUL 1MCRA 3A3YB 4QHNB 3HGSA 4DIAA 3RIFK 2N56A 3DJRA 3O9WD 4PV9A 2QXWA 3BZJA 1S5TA 3VI4F 1PD6A 4GXUN 3FFCE 4ZVJA 3VKKA 1ZZMA 1A7OH 2UWFA 4NUGL 3W75A 4TLKA 2ZA1A 2G30A 4A2MA 2CKBA 3BQUD 1EJ8A 3W84A 3OPZL 4JFHE 5HD8D 4ALAL 2B1AH 1FRGH 5LNWA 2VCOA 4MASA 1WFMA 4WLCA 3IJYB 3JQOB 3NABL 5EMLA 2X4QB 4G82A 2WWNA 4HIHA 2QSCL 1WBHA 1T20B 3V6OC 4K9EC 2EDXA 2RIKA 5FDWA 2C91A 1MXGA 1X9QA 5D6CA 4GUCA 5F8RC 5I1JL 4RMTA 3W82A 4HIBA 3MWCA 3TYDA 1A47A 4ANXA 3N9KA 1ZGLB 1QFUL 1E6NA 1AD9A 2BXYA 5C9WA 2H0PA 5JVLA 1FH9A 4HG4K 2IGLA 2ICSA 1QPRA 1AO7D 2CE6A 3TBWB 2QQLH 4MXWL 5F7EH 4BDVA 3JRKA 1XS2A 1B1YA 1QLRB 3EYVA 3K2GA 1PUDA 4Y8FA 1K5NB 4Z8FH 3MI3A 1TENA 3GNOA 1MJUL 3QPEA 5FJJA 2NPLX 5D70L 3U36B 4XNQA 2EYSB 3VQ1C 4OWGA 4S1SH 3WEXB 1PAZA 2GBVA 5D9OA 4I0KA 2PYFA 1IEBA 3VSVA 1IARB 1BKSA 4UR8A 3MGTA 5A2AA 3RVUD 4HT3A 4FI8A 4PREB 4KRNA 3EUDA 1MVUA 3AGVA 4WNSA 3DVIA 2NY0B 3VA2C 4XISA 2XHYA 4KO5A 5C2BH 3B3IB 3G5WA 3RM4A 4HIQA 1FWWA 3WLRA 5IQOA 2B0SH 1TRIA 1ESWA 4MLRA 3UXFA 1BJ1J 4BFIA 1XH2A 1OYAA 1F45A 1AGFA 1QEWB 1IAKB 3BCDA 1SFDA 1A5MC 3SDAB 3VIOA 5FESA 4JDEA 3DBPA 2AEQL 2GVGA 4GBUA 3NPZB 5CNHA 4KFOA 1OP5K 4ODHH 5ELIA 5IMLA 1CI3M 4J28A 3V0JA 5BQ7A 1HDMB 1MNUL 2CUAA 1MPAH 1EF3A 3CIQA 2L3BA 2ZWLT 2R0WL 1KT2B 4Y2DC 1GGCL 3TDFA 2NSXA 2EPMX 2XQYK 5DA4A 4UM8B 5D1ZD 2XQBL 2ARJQ 2XYLA 4DW2L 3F84A 3IRSA 2NXHA 1J1PL 4TLSA 2HH0L 4MGGA 4XXWA 5J11C 2XUCA 4B9IA 5T26A 3EPOA 2EKJA 4JJHA 3ZZSA 4C58B 3R13A 2AQRA 4QG6A 3CTTA 3M5YA 1EJFA 1QI2A 1GAFH 4Z1DA 5IOPB 4NZ4A 3WIJA 4NVTA 1ZGDA 2DZUA 4NAMA 1D3CA 3LHVA 1OPGL 1NGZB 2CW6A 2FD6H 5ERWB 4WK0B 4PJBF 5HYJE 2JQXA 2HFGL 3S37H 5GNZA 4RMSA 5HDLA 3FH7A 1OF8A 1TJIH 5ADPH 1WDRA 3JV6A 5I6XB 1DUYB 7TAAA 2ZT9C 3QDMD 1AL8A 2DQDH 3TXVA 3C86A 1ZTXH 4F2ME 4TU1A 4PRAB 3DX7B 4Q4QA 1P53A 3V6BR 3W7MA 3L2NA 1UD5A 2XGZA 3LY0A 3MRRA 5CEZE 1NCBH 4I88A 3SGJA 3CN2A 4JK0D 4PJ8D 3U0PA 1OX5A 2YXXA 1JCXA 1QLEH 5CU9A 2FSDA 5JW4M 4Q32A 2BPBA 1LMKA 4LY4A 4K8HA 4L4VB 3RWCB 4M6OL 3CSYB 4JN6A 2G3JA 5CGQA 1RVFH 4QX4A 4XCEA 2A2QT 2HTKC 5ILTL 4JYEA 5LIUX 1B3JA 1LK3L 3QISA 4CJ0A 5DD5H 3TVMC 1IM9A 5J6SA 2PKDA 2RUSA 3W53A 3D2UD 1YEJL 4F20A 1MFDL 2KZBA 4NKOB 1YY9D 3VI4A 3NDZE 1FWTA 5ESQB 1Y1DA 1OAZL 1J1OH 2Q1EA 5CFAA 3GS6A 1ZOXA 1UH4A 5I8OH 5D96C 1EEPA 4IMKA 4AGOA 1FZMB 3VOIA 1IM3D 3O9WC 4WRHA 4Y19D 4JCLA 1FWRA 1QUPA 7CGTA 3ZZLA 1BPLB 3BQUC 3FCBA 4Z7UB 5FYJD 3C0JA 1KJ2A 3E8VA 4L37A 1D5ZB 4QF1A 2D0GA 4M6PA 1C1EH 2QTVA 2JJVA 3LEXA 2VVNA 2BNRE 1GOMA 4ZS6D 1FCCA 2ICWJ 3ZL2A 1VYPX 1YBQB 5FK9B 1QNOA 1GCYA 3VWJC 2ACQA 3AS3A 1IIHA 4IFKB 2WWMD 4GT0A 3EHBD 1AZZC 1ZVSB 1R0MA 3OKDA 1OX4B 2A6JB 4J9JA 3QPQD 4WX2A 4F2BA 1N59A 4ZODA 3ZUCA 3B2DC 4XX6A 4BIKA 3WJJA 2VGBA 1KBVA 4D0CB 3DBXA 1FDYA 3G18A 1M6JA 1A5LC 5DS8B 1XG3A 1NBYB 1Q6OA 4YPGB 1CF8H 3HS0B 4P9HL 1MRCH 3PU7A 4EPKA 2WVVB 5K4ZA 4GRMA 2J9YA 1NM4A 4BK5C 3MUGA 3FQRA 3BUYA 3RVUC 1F8MA 4NDMA 1G84A 1S3HA 5HHVL 3W27A 3NPVA 4W8LA 1K85A 1G01A 3EDJA 1CFQB 1OAUH 3T0EA 3QNXA 1RCOB 2DDQL 3ZRCC 3APDA 1NOFA 3VXRD 2VFIA 3N2CA 4X7TB 4FF5A 1ACXA 4XZMX 3NMEA 3MDUA 1AJZA 5E6RB 1T83C 3VD7A 2J4WL 4YXHL 3IUHA 2H6PB 3O9NA 4TVCA 4NRYA 2W1NA 4FQXB 3TNMB 2F9BT 2W0FA 3TT1H 1MQQA 4I18B 2D23A 3CH1B 5A8NA 4EI5A 5IZ7A 3CUGA 1I3VA 4HNVA 3UTSE 1QEXA 2Q87A 4FLSA 2VVSA 2WOYA 3VFOB 1KQZA 3WF2A 1T03H 3H0TB 5KEZA 3OG3A 1PBYA 2J8UE 1QKZL 5E1HB 2PF8A 4Z7WF 4G6JL 5D1ZC 4DJEC 1XIFA 3VXMA 4R26L 1D7FA 4KESA 3QIUD 2DM2A 2E9IA 4NM4L 1E27B 4D6FA 2PF0A 1MDLA 4Y2OA 4Q6KA 3G08A 5ID0B 3L81A 3LV3B 4PJBA 5ECUA 1AI1H 5JR1H 4UT6A 4OUOA 3G1FA 1KN2H 4U1HA 2XH0A 5ETUB 5ADOH 1KIRA 1BXVA 4MKTA 3D07A 4GSRA 2IV9A 1V54B 3FSUA 2Z31A 4YHNB 1Q6GA 2YUXA 4HIJB 4C6EA 3HZKA 1FN4A 4N2FA 4U1LB 3PS7A 5E4EC 3MLUL 1TTAA 2VLKB 2PDJA 4QXUH 1ED3A 1E0OB 2VLLB 3KHJA 1E9ZB 4OZIA 3MVTA 2PI6A 1HI6B 1QNPA 1ZT4A 1TSRA 2IAMB 2EINB 2YX0A 3S88H 4RNJA 4H1LG 4W9EC 3PDOB 5IM51 4PUMA 2OX5B 1AQHA 3W11C 4MBRA 2X38A 2YR1A 3WUBA 2ADIB 4PJ8C 3U7YL 5FGCE 2MSPA 4FZ8H 4HZ6A 1CE1L 4L3CA 3O6KL 2G5BB 3IK2A 2NZ9D 3KPTA 3HPLA 1BEYH 3H7RA 5BRZB 2C9QA 1VCVA 2H0EA 2VXSL 4MNQE 3T6WA 3LI1A 3QZWB 1P84K 4ZFOL 4ZOEA 2KPWA 5L2KD 5AAMC 5F97E 3CDGA 4AZCB 2FEJA 2HFFA 5J13C 2CUHA 4YO0B 3PBVA 2EDRA 1YY9C 3VTAA 2VURA 1HKIA 3D12B 3KS0J 5TK2A 2QPEB 3TR9A 3FS2A 2VZOA 4NQ1A 2FX8L 4MKSA 4Y9MA 3UZJA 1D5MB 2QMJA 4OCYL 5HMSA 5FLVA 2BWDA 2X6MA 1A4AA 1PCKA 4XN9A 4FQQB 4FYRA 4LDLB 4Z7AA 5GRWA 1U3HC 5IBTH 1A5FL 1N3NA 3DPBB 1RXLA 2C9XA 4QDWA 4R8WH 5E2UL 5PCYA 2QJIA 3BJLA 3KYNB 3TESA 3LZ5A 4X9GA 3B2MA 4HMNA 1AGCB 4WDWA 1UOLA 1GVFA 4HGWB 2VLRE 1GW9A 1E5JA 2QQ6A 4FQIH 3CCHA 3ELQA 2NNFA 2UZPA 5I15L 1Q3NA 4REQA 3WFEH 4WJ8A 5I3DA 3B83A 3ULAB 4P5UA 3GJFA 4ZS6C 5C3TA 1RMFL 2W60A 2NVCA 5C0AB 1NARA 4OGYH 3MJ7A 4RZ6A 3GK8L 2I14A 4FLHA 2WMPA 4E42B 4LF3B 4LLAA 1RL1A 3ABOA 3D5HA 3MBEB 2WWMC 3O0RH 1Q9LA 1NQKA 4XN8A 2NV9A 4YNYA 1MJ8L 3A13A 4RPQA 3VGHA 1SVDA 2X6VA 4N8VB 5C3LD 1TZ7A 3TYFA 1ZSDA 3QZLA 1HHIA 1PVNA 5AKQA 1D5RA 5I09A 3H7LA 1SR9A 5KETA 4HUUA 4J4PA 4R5VA 4JANB 2BZDA 1I7TA 4JPSA 4AYDC 1BFOB 1RQBA 2OKOA 1PLAA 3ZLQC 3G8RA 5DXYA 4LEQA 1FRBA 3W28A 1KGIA 2A4AA 4ODSH 4G7YH 3OZOA 2OXGA 4YSAA 3KJ6L 3PIQA 2VDQB 5MHSE 2ZSWA 5BOPA 4AI7A 3ZHLA 4P2QA 3KS5A 3IGSA 1L8PA 1RCYA 3LG3A 4ZW6A 1I8AA 4KY1H 4JFVA 4ABUA 1JK9B 5HNRA 4LFHG 3CGTA 1KCVL 3EA2A 3AZRA 2A0NA 3UR5A 5LIYX 1T4WA 3RI5F 3VOHA 3LEVL 4IM4A 2NY3C 1DQLL 4G7EB 1CURA 3IIVA 1IT9L 1MI5D 3MXVH 3N40P 4IRZA 3OIHA 4K71C 4IU2A 4H6RA 4YZFF 2H32H 2MTPA 1CX9A 3FN0L 4POYA 3GHSA 4NASA 1F2XK 3N1PC 2WLKA 2EC8A 3SDXE 3ULVL 2JB5L 3MFFA 4LSQH 3KUMA 5F3FA 1HXKA 1AQKL 1L5GA 4TTGA 4Z7WA 4HJGB 4GRWF 3FSAA 2W9EH 3BJ91 1E1CB 1TWZA 2A38A 3R6IA 3V6ZA 2ETWA 1S8DA 1U8QA 4YHML 1FYTE 5FUOH 1GYLA 2H8XA 2DKUA 3GUWA 4X5PA 3QORA 3IIPA 2WTPA 3T9PA 1NMAL 2DKSA 3WNIA 2YKLH 3VFSA 2H26B 3CZKA 2EHHA 1P5VA 4YWGL 3UJFA 4ZTXA 4EN2A 3QIUC 4OFYD 4LNRA 2FQFA 4YFEA 3TU6A 5CC3A 1HXJA 2WO5A 2J7BA 4AEHH 3KVMA 4DBDA 5L0QB 1PTGA 2OMNA 4P9MH 2R2EB 2UUDK 2ZXWB 3SO7A 1CXLA 1OF2B 5JHLA 3WDQA 5GHWH 5TF1H 4HIIA 5DTFA 4S2CA 1OTTC 3FUNA 4JCWA 1L9MA 4OIAA 2EO9A 4LQFL 4I5UA 4CN1A 4A3HA 1G9HA 5DHXB 5F7WC 5CGBA 4E5XA 3S2AA 4UZSA 1A2YB 4ZMQA 2PW2B 2WBJD 1JPKA 4GW1B 2G3MA 4MY9A 4Y9NA 2PTUA 3HZMB 3P30H 3M86A 2GOUA 1YTEA 4KK6D 2QCEA 3NZRA 1BSLA 4L8SA 3FTXA 1FWAC 1IFHL 3GIVB 3R2GA 1FSKB 4MZ1A 3K4WA 1OE1A 1Z0NA 3WBWA 3WIAA 1SW0A 2OR7A 1V0KA 3VFVB 2A7BA 4M03A 3T07A 3TO4A 1E0WA 3IDIB 1MCLA 4ZXBD 5EIIA 4D1JA 2X9ZA 5GQBA 4YBLC 1RK1B 2HWGA 1RZIA 3UTTB 2NZ9C 5DZLA 2FGWL 4EUPH 3DOPA 1KLFA 2E9JA 1SRDA 2HDJA 1DE4B 3RZCD 4N0CD 5CEXA 4LS0A 1JGVL 3G24A 4Y90A 2W0KA 1U1UA 5AZ1A 5IMKB 3HR5A 4UDUB 4JHZA 5D04C 4LT7A 5TJWK 1XICA 5LCVA 4GGHA 4U3CA 5C0ND 4O14A 2ZUTA 4Y4HA 3V7AE 2CIPA 3PGFH 1P0DA 3SCSA 3ECBB 5HR6A 4G6KL 3HB3D 3QQWA 2W8CA 3TIEA 4TIMA 2PP9A 5IY5B 3BSGA 2DQEH 3ZVIA 3MU7A 3CNKA 2XU2A 3QE5A 3TIMA 1E5UI 3QJTB 3UPRA 2YAQA 3ZE2F 4P57B 3LTSA 1JTPA 2A3LA 2WKGA 3R7RA 1DBBL 2ZOWA 3D50A 4PSPA 1Y0LA 4DT2A 3L9RA 2ALWA 2NQ9A 1CENA 4UB0H 1A6PA 5BROA 3L08A 1QJWA 4U0RB 5HJYA 4DGVH 4U5IA 5D9NA 2ZX5A 3HC2A 2AABL 2REQB 1V77A 2D0FA 2XQYG 5SWZB 2ZWNA 2V82A 1HILA 4IHOB 2EKCA 1Q0XL 1FGNH 1KPRA 1F3JA 4QI3A 3KPQA 2JKEA 2F61A 1J5OL 3O4LE 1OYCA 4UV4L 4G8GE 5GS0D 2Z92A 4HZ1A 4JYDA 4F0SA 2FX9L 5LXGH 4B9FA 2W9MA 5TPWL 2JKXA 4GG6E 5FM8A 4L8CA 5FYKU 1V6UA 3F2DA 1YC8A 4WJ5B 2PR4H 3IAGC 1OSEA 4HVXA 5M94B 3B04A 2CLMA 4HZ7A 1L3WA 5LSMA 5J3HD 3HG3A 4GKLA 5BO1H 1KN4H 5EU7C 4CKVX 2GSHA 5I6SA 1QBLL 1K8XA 2NX5A 4XTDA 1SLXA 4JHOA 4NJAH 3R06B 2YR3A 1YG9A 4DI8A 1KIPB 2NNAA 4F58H 4JFFD 4HMDA 5ANME 1U8OA 1IILE 4WNJA 4ELKB 4K3JH 1UACL 1WF5A 1VPOL 4A2SA 2Q8BL 2DS4A 2Y5EA 3WLSA 2L7QA 4HBQA 5MEOA 3TA3D 3GG7A 2E27L 3CC1A 5IESH 5XINA 2O9RA 4N1HB 3K8MA 5JU6A 3TP4A 3UPCA 2OZ8A 2ESVE 3STLB 3V4PB 4NERA 2A4CA 3D25A 5IF0B 3PP7A 2AXFB 1CL7L 1JUFB 4G70B 1EMTH 1MFAH 3EX2A 1E9YB 3L9EA 5DQ9B 4LDEB 1CQKA 5DZOA 1FH8A 4KT2A 2PDXA 1OARH 1XCFA 2F5AH 3R8BB 4CSZA 3QXVA 4G6ML 1OBAA 4MJZA 4PJHB 5HYEA 1EC8A 4BI6A 5E8OB 1U91A 3RL1A 2DPKA 3SCMA 4MB1A 3PZNA 4JM2D 1ZU8A 3PM6A 4XGZB 2ZC8A 5EC1B 3NQDA 3FNKA 3O8XB 1T04A 2W88A 2R1XB 5A1AA 1D2KA 2X09A 3VDHA 2E74C 4HOZA 4ZX4A 5D5MB 2CKBL 3RO8A 4LSPL 1ASPA 4EO5A 4H0GA 3NESA 3MLWH 4ZMGA 3NAVA 1UA3A 3KYAA 4KV5E 4LFYA 1QOPA 4AQAB 4RDWA 4ETQA 1OQOA 5F7YC 4M93B 4CDHA 5HYSA 3QQ3B 4X9BA 3GTNA 3UJJH 1N70A 4UMBA 3FPXA 1QSZA 4NOBA 1MCEA 2JF1A 3A5FA 2QQKH 1BZEA 2H5UA 5A8GA 4P07A 4P2OD 4H9VA 4IPIA 3QIBA 4NC0B 2WBJC 1W9VA 4POCA 5D1ZI 5KZDA 4G8EA 4TR9A 4YN5A 3GSVB 4P2RE 1ZANH 5DD1H 5DGQA 3R1GH 1IC5L 2F74A 1IC4L 3BEVA 2AKMA 4W4OA 4KK6C 3U6XS 2QPSA 1TTJA 4TS6A 3DV6A 1XIGA 3HMCA 3RL2B 5L6YH 4MYAA 3MO4A 4FAMA 4LJ3A 2CGRL 4BZ2H 4S3DA 3FTGB 3SKNB 3ZR4A 2ED8A 1Q13A 3DLQR 3L23A 5FWQA 2I07A 2ZP9A 4IP4A 5GRYA 1BWLA 4ZXBC 2VL5A 3UFYA 1CTOA 1P7QA 5DMLA 1WDQA 3O7UA 1UM6L 2QMKA 1OV8A 4ZTEA 3X12B 4YXKL 4LSSL 4I87A 3UMTA 4N0CC 4P61A 1IGFH 4KZDH 4XH2A 5CZVH 5DZAA 4UM9D 4GYJA 5HMDA 5C07B 5REQB 3NA9H 8A3HA 2HG0A 2ZIDA 1A21A 1ENUA 1QFHA 4Z3HA 1K2DA 1IKFL 4DGYH 3E2RA 1X6LA 5C0NC 4BS0A 3SPIA 3NFNB 3G5ZA 3PNRB 1ZIBA 1IXNA 2V5BA 1E0XA 4LVBA 3S9ZA 3HB3C 3PYCA 3FO0H 3OGRA 2CZNA 3FPYA 1IMHC 3P0GB 1IGCL 1KYDA 5IFPA 3ME0A 1ZHNA 3JU2A 2CM6A 2WZTA 1GKPA 3C2AH 4YJZL 3FQWA 4A4AA 5D4IA 4RW5A 2XBZA 1XM3A 1ZA6B 5IVXA 2LV4A 4LLDB 2BOBB 2VB5A 3HN3A 3MLTB 3GI8L 1W8NA 3ECUA 3GTFA 2Q8AH 1NOAA 1H1YA 3V4VA 3IDYC 5CJXA 4XQ6A 4XBPB 2VXNA 2HA1A 3BZ5A 3EG9B 4LW7A 1R46A 3ZYZA 4M6VA 2X16A 4NBZB 2B2XH 3ZE1F 3HRPA 5I2UA 3ALXA 4QBXA 1EXPA 1CF1A 4MDIA 4Z3JA 4JHWH 1R19A 1E3FA 3S35X 4QSHA 2DOCA 1U6AL 1T7ZA 1NDZA 5GS0C 3IVKA 4TVUA 2WJ5A 1QW8A 2YCLA 4GJ1A 2I25N 3KVLA 1R4XA 1LJYA 5A6MA 2FUTA 5DMKB 1F74A 1XDTT 1H6UA 1TPXC 2MCMA 2BIQA 4CBPA 3V1PA 5KVEE 4C6NA 2AZUA 2UY6A 3CNYA 4FFWD 4YUEH 3HNSL 4NU7A 1WUZA 1BRLB 2ROXA 3WDRA 1NGQH 2HFTA 4PGDB 2CLFA 3BW9A 3OJMB 5DEGB 2YC1A 1ZTVA 3AQDA 4F0HA 3K5RA 4TSAH 3UETA 1HL2A 3CXDL 1C5BL 5KVGE 1TX0A 4PY8J 2BNQA 4EOWH 4HFWB 1D5BB 4FQ2L 4TPRH 3K30A 3SECA 2ZKHH 1MCNA 3UX9B 3KHOA 2IQAA 2ZUMA 1ONQA 2ICEC 3TA3C 5LNGA 4G1MA 4IDJH 3B06A 5E08H 4PRHD 3BIKA 5HDBB 1PLBA 3GH7A 1EEQA 1PNDA 4MSWB 4CQCA 4NX0A 3G1XA 1FC1A 1ZL1A 2FH6A 1QBMH 3B6SA 4KWUA 4QDMA 4I48A 1BFSA 3NCXA 2Y85A 3WQ8A 2HMCA 1TZ8A 3DWTA 2VITB 5AW5B 3CEPA 1FO0H 1EYEA 5HMEA 3LN4A 3IFNH 1FPTL 4F5CE 2WHVA 4L9YA 3E3HA 4EE2A 3ESOA 4OF0A 4M7KH 3WKZA 3D52A 1Z41A 3SRKA 2ANUA 4POUB 3SCRA 3WBEA 4NN5C 4NAFB 3MV7A 2VR9A 3RA7H 4DLMA 3SEPA 3RX5A 2R15A 3SGZA 1JYWA 4U1NB 3W7RA 3TPUA 5G2NA 1CDIA 4JM2C 4X3ZA 2XDFA 1UKPA 1SJHA 3M0YA 3RKDC 3Q7JA 1PNCA 5HQLA 3V5HB 3L7EA 5JHMA 4MD4B 3CO4A 2VERN 4KWVA 2YAFA 1V02E 3SE4C 4W9LC 5D32A 4AL8L 3RLSA 5IKCA 3UGVA 4XVSH 1ZVYA 4MNGA 4DRSA 2VWEC 3HPSA 4HOWA 2A9BA 3H4WA 3PB0A 3G0XA 5EG6C 3ZIZA 3WNLA 5DYOA 3SURA 3GMQB 3PY9A 3WMQA 1UWRA 3P93A 1R5VB 2DLGA 3DTDA 1XIJA 4AC2A 1YYMH 2AAAA 4HBKA 3MZ2A 2HCVA 3II1A 1Q4WA 2DSUA 1R3LB 2Z29A 1WQ5A 3TC3A 2B3RA 4H5SA 5DO8A 2Z6JA 4G8FA 1F5ZA 1XRFA 1BM7A 4PGJA 2X1PA 1PLGL 3QULB 5KINA 3IK4A 3N0PB 3CZFA 3QXWA 5CCZA 1NDTA 2O55A 3E9UA 2BJML 2GDVA 1AHMA 4JFWA 4LV4A 2FNBA 3UP1A 2EVFA 3AQXA 5C8BB 1U92A 3D39A 3PAOA 4MS8D 4S1QL 5AZ2H 4F7MB 1H6FA 2PDMA 5DT1L 1VCFA 3ZGHA 2HWZH 3BWAA 2V6AA 2VX4A 5DQPA 2BOEX 4QR6A 5DX7A 5FJOA 3BWUF 1AH3A 2WXGA 5DELA 1TG7A 3KYKL 1RV8A 4M81A 1Z48A 4WENB 3GFYA 2QCLA 3PHAA 4TTDD 1QO3A 5I0WA 3QSRA 4KDTA 4H26B 4NXKA 1MHCB 3HG5A 5AG8A 3WTTA 2H45A 3BWSA 4OV5A 2EDOA 1KXQE 3OVUB 3DUSA 2OK0L 1GWJA 3A4FA 2FDBP 3IIOA 3AQZA 2DQUL 3KLKA 4GRSA 4J12A 1FGVL 2FSEA 4EAYA 4TX9A 3PWPB 5I5RA 2V2WA 2PPAA 4NILA 3SY1A 3SPCA 4MYWB 2AQ1A 2W4XA 4HWUA 2WWKT 5J6GB 5CSBA 3IDXH 1I3RB 3I9AA 1G5GA 1HXMA 4UI2A 4U6HB 3DETC 4NUJB 4U3SB 4LL1A 1T21B 4QGCA 1B3WA 3REQA 4WCYL 2AJYL 4F2FA 2P1FA 1MCIA 3E8UL 3GIPA 4H9UA 2JTYA 1NSNH 3WKML 1IO4C 4E0CA 5I07A 1RXOB 1AQMA 4QHPA 3C2FA 5FO9A 4L4TB 1YEHL 2YD1A 1ML0A 4H1LH 2FE0A 4KX8A 1KFGA 3MR9A 3W23A 2FJHA 3MRCB 3QWOA 3M47A 2QZ5A 1EJRC 1VERA 1JK8A 4D7PA 1QNVA 2O5ZL 4X5XB 4DP5X 2ZNWA 3MZTA 4XOCA 3PFQA 3L12A 4PLKD 4KTDH 1W5PA 1M9SA 1B9ZA 4EUPG 4LU0A 4G5ZH 3TF7C 4UT6L 1WFJA 1HEHC 4OI8A 1TEGA 3QWRA 4OQTA 1AZRA 1GZHA 4UR9A 3V6FB 1F3RB 3MCNA 5IP4A 5E9DE 3VQ2C 3NDOA 2R1NA 4KY2A 1ISYA 2QKIA 4EP8C 1CG9A 4E3VA 1A7NL 2IMMA 3AUVA 1EGVA 2H8PA 3O6MH 4W84A 1ND0B 3PNWB 1XYZA 2W5FA 4LVNC 3MUZ1 2NY7L 3F7YA 2D2CC 4CNIB 2BC4B 4JN8A 1JERA 3N2XA 1KCRL 2V7HB 3CAQA 1I7UB 1KIQA 4H0IA 1ZE3C 5GGRA 4HS3B 2EH8H 2F53E 1AQ0A 2AGTA 4X99B 2R8SL 3TJEH 3HG0A 3KBMA 2O7QA 3S46A 4WSJA 1F05A 4E38A 1BMWA 3M46A 3NIFE 3NJLA 1TQWA 1JZ7A 4AEFA 1G4MA 3QGVA 5K5YA 2YMXH 4AX6A 1MQ8A 3MHFA 4ML9A 1O4UA 3B7YA 3AW5A 1D3HA 4UUJA 1B4LA 3K0WA 4CD5A 1W1VA 5EA0L 3W1ZA 4NC1E 2IPKA 4UTTA 3T9WA 2X6AA 1NIBA 1EYWA 1A9BB 1B3VA 3FB5B 1EPXA 2G2RA 2YLAA 4QEHA 1JHLL 2X4OA 4GAAA 5J04A 3HB9A 4XNZB 2FO8A 3UTPD 3ZDXF 3QDGE 2DVUA 2AOSA 3ULUE 3RUBL 3L4TA 4PRPD 1BP3B 3VIKA 3MPCA 1T1XA 1NEZG 3KZSA 2EG7A 1FHNA 3U0WL 4RDVA 4BZ1H 2J12B 4FGMA 3T0DA 2DQFA 1KELH 3QCVL 1H49A 1AS7A 3P6LA 1JPFA 1E3XA 3DH7A 1A8ZA 4J3TA 1CFVL 1I9JH 1YX1A 3MYJA 3W02A 2FJGA 2K9UA 1WWCA 4Z7NE 1GYVA 4LLWA 4LLVA 1AZVA 1AR1D 4OCMC 4FFTA 3JV4B 4KEZA 4Y4KB 3UACA 1LNUB 3CUZA 3TJLA 3EGSA 2PDKA 2XGIA 2OEJA 1IEWA 1YADA 5FJRA 3T4WA 4AV4A 4BCYA 2B59B 4OCSL 1SJBA 4XX1E 3Q06A 5DJ2B 1MLBB 3GSOA 4FCAA 2PCQA 1INDH 1A0QH 3X17A 2Z4TA 1FL3B 4ONHA 1I1AA 3EJZD 3MRFA 3ZDYF 5H8DA 5HQEA 2CK2A 4MS8C 4Y1AE 2VXQH 5EU6B 1M04A 1D6VH 4QLKA 5I0XA 3PPCA 3UOAB 3PP4H 2X0HA 2B20A 2MPVA 5FSDC 3UYRH 1J9RA 4XOEA 3IN0A 3NQCA 3P0XA 1R5IA 5D1QE 5KZCD 3G6JE 2J62A 5AC6A 3BARA 3RJYA 4TTDC 2R1MA 3N15A 5I26A 1LLAA 1FQ0A 3PUOA 5EF3A 3MLZL 4FA6A 4A3QA 4N1CA 5AQ0A 1CPUA 3QY6A 3NFPA 3KTXA 2Q76B 2FQGA 4TV3A 3GQFA 3WKPA 3IJ8A 3MUY1 3SYOA 1OW0A 1P4IL 2J6EL 1B3YA 1MDRA 1MFUA 3B03A 2LGNA 3TVAA 4XCYB 2XWTA 2CIKB 2F1BA 1O12A 1IR1A 5FEWA 1DQML 3SPGA 4KJYB 4GXMA 4WTXA 4L1TA 4MDPA 4KKNA 1YEGH 5K93A 2VDNH 4FHAA 1KV5A 4UV7L 5FDYA 2PU1A 4Z0BH 2OMBA 2FWLB 4YTUA 3MRHB 1M71B 3QTPA 5HHPB 2Z9TA 4DEPC 4F9LC 1YMHA 3S0CA 3FUHA 5JBDA 1TMQA 4XVTH 3ZYJA 3LH9A 4JEQA 2W65A 3MU3A 2HT3D 1LXMA 2P9RA 4WSHA 4X9HA 1DDHB 2Q10A 2A5UA 1B6UA 1H3GA 3UY8A 3QC6X 1J48A 1XAUA 1RUPH 2GC7C 3PPFA 3L13A 2J57A 4QM1A 1XF4B 3IFOA 4H88H 3MCLH 5DMIL 2WOBA 3ARBB 4TQEH 4QRPB 1K72A 3SPJA 4JEGB 4PLKC 3QZEA 4CA4A 1F3EA 1HJCA 4MNJA 4HS8L 2YMOA 3VIJA 4IBTA 3RNKA 3N04A 1FDZA 4NJ9L 1ZBKA 2JK5B 3ELFA 4DVRL 4UIMB 4AGNA 5CEYB 2AZAA 1X7QA 3G0UA 4AHOA 4YSUA 3FCTB 1NFPA 2A1WH 5ACZA 5B22A 2DUZA 5ITFA 3GG8A 1HO1A 5C08B 2E6YA 1WAAE 3FQNA 2E67A 4Z0SA 3EH4B 4FADA 2F9RA 5DCCA 3NL2A 2HAZA 4K8RD 3P9MB 4JFQA 4KEMA 3GUTA 1XX9C 4K9EH 1QR1A 5E6ZA 1YXDA 3DXAA 4J3OC 3Q5TA 4PUBL 3W1XA 4C7FA 1V93A 5DJCA 5I1IH 4X7SL 1LP9B 1SGJA 5D1XB 4PWKA 2YDSA 1WS8A 1G0YR 4P3CH 4IEFB