1MFUA

Probing the role of a mobile loop in human salivary amylase: structural studies on the loop-deleted mutant
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
491
structure length
491
Chain Sequence
EYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHSILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Probing the role of a mobile loop in substrate binding and enzyme activity of human salivary amylase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords alpha-amylase, Salivary
total genus 176
structure length 491
sequence length 491
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2002-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1mfuA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1mfuA01
3EMQA 1V3MA 4AD1A 2ZWZA 3VD5A 4CU7A 4XX6A 3IGUA 1H2JA 5TD4A 3TA9A 2WC3A 3AS0A 2WWDA 3EMZA 4B9YA 5JUVA 1KFWA 3M07A 4CKQA 2YDRA 1FH7A 1GQLA 3AIBA 3OIHA 1TUXA 4EAMA 4LXFA 5KZ6A 1PX8A 4AD4A 2ZXDA 3VSTA 4D6CA 3DYPA 3WN6A 1CGXA 2XN0A 4DO6A 3LPFA 1UH2A 5CZKA 1PBGA 5IHRA 3DHPA 1XD1A 2XFFA 3BAXA 2WXDM 5ABFB 1KR1A 1HL8A 4D6EA 2WLZA 2QMKA 4PMYA 5JBFA 4JHZA 1HKKA 4Z2KA 3VUPA 1XSJA 2EXOA 3T09A 2FGZA 4MNLA 1E6NA 3GXNA 4W87A 4BCEA 1QHOA 3WQWA 1W3HA 4WLCA 4M24A 4CVWA 1SYTA 4C7GA 1UYQA 1WPCA 4OOZA 1EH9A 4ATDA 3UERA 4U2YA 3W53A 1HVXA 3N11A 3N9KA 4CN6A 3WNKA 1MW2A 4IPNB 2ZXQA 1E0XA 4AMCA 2VR5A 1VEPA 5LA2A 2CIPA 2ZICA 4M82A 5A2AA 3FHQA 3K4AA 1PJ9A 5A6LA 3AICA 3ZQ9A 3WNMA 2J7DA 1MXGA 1HXKA 4AMXA 1B90A 1GORA 1R7AA 2WAGA 1FFRA 4IUGA 3ZT6A 2X2JA 4JL2A 5A2BA 1UZ4A 1VEOA 5LYRA 1E40A 5BCAA 4F79A 3W37A 2VX6A 4FLRA 3TTSA 4H8UA 4W7WA 3WQ4A 1JXJA 1OM0A 5CPSA 5E0CA 3U7BA 1EO7A 3CBWA 4W89A 2EPLX 3VIMA 2ZX6A 7A3HA 1UD5A 2YDQA 4PTVA 1RH9A 2Y2WA 4B15A 1KCKA 4GXPA 3TV8A 3EJPA 2FE0A 1GQKA 2DT2A 3RMEA 1ZU8A 3NSXA 1M03A 3WBEA 2WHMA 1XV8A 2FH6A 1V3IA 2ZWYA 2G41A 2VRKA 4WK9A 2Y5EA 2GK1A 2GK1B 3U5YA 4EANA 4HMEA 4PSRA 4ACYA 4FNPA 1QI2A 2WWCA 3W6MA 2F7QA 3GH4A 1Q6CA 1EDGA 4M29A 2VRQA 1ISYA 5AYIA 3AISA 2GJRA 4J3WA 2OWXA 2J7HA 1EO5A 1QI3A 3RDKA 3BUPA 2WZEA 4HMDA 1ISWA 2F2HA 2PF0A 3CZEA 2X0YA 5I3DA 1TQSA 2WHJA 3GM8A 1E71M 4HZ7A 4NSBA 4XZBA 2VI0A 1JL8A 4D1IA 4OZOA 2QPSA 5HXMA 3CLWA 1CXEA 3A4XA 1VBRA 3CH9A 4V27A 1ZJBA 3MMWA 5E1QA 5CLTA 4NXKA 1VJSA 1W9VA 4EK7A 1MVYA 1HVQA 1UKOA 1FHDA 2F7RA 4YPJA 5CPQA 1GZJA 4ATWA 4TX8A 4P7QA 4A3YA 3A47A 1K9DA 3AQUA 2V3GA 2UY3A 2G3MA 3B9DA 4UZSA 3UG4A 1UWRA 1VFUA 1GW1A 1BYAA 4CCDA 1KR0A 1ISXA 4GO9A 3A6OA 2DEPA 2OSYA 4JFWA 5FCZA 2ESCA 3H54A 3GBDA 4AMWA 2VO5A 2WMHA 4QLLA 4AZHA 2VCCA 2DT1A 3WF3A 4JL1A 4FF5A 3T0AA 3CGTA 1PIGA 5D9MA 4WKAA 2ZX9A 4NZFA 5M3WA 1D3CA 4F66A 1U30A 3GNRA 2V5DA 1E4NA 1KTBA 3RJYA 2MANA 1BVNP 2XYLA 3ZIZA 1V6UA 2G8ZA 4JCMA 1UG6A 4TUFA 1TG7A 3MUY1 3UCQA 1DEDA 3BSGA 1E43A 2BV9A 1QNQA 3BMVA 2DPEA 3M6DA 3ARXA 3SCTA 4CCEA 2VT0A 5A69A 2UY4A 4X0VA 1LLOA 2J78A 3VGGA 1CLXA 3AZSA 4W7UA 2J74A 1X6LA 3CZGA 2VVSA 1JNEA 2F8QA 5AC5A 1BQCA 2CEQA 2G3IA 2CITA 4RE3A 1KGWA 2E4TA 3A21A 2EADA 1CXIA 1KBBA 5E9AA 3CZNA 3PZVA 4PTXA 2J8GA 5A8NA 3SUTA 4CD8A 2VRJA 3LRKA 3KEHA 3QHOA 1C90A 3K46A 3AMKA 5JBDA 4KGJA 2PWGA 2XVLA 4N0RA 4HU8A 1Q6DA 2J7CA 4BF7A 4OGZA 1B3XA 2X1IA 1EXPA 1PZ3A 4DUWA 5E09A 1LG2A 3MO4A 3PZGA 3POHA 3SCVA 4MB5A 2J7BA 4W5ZA 1V0LA 3AYRA 3AZTA 3KL3A 8CGTA 3WSUA 3IK2A 4QLKA 3OLIA 3AS2A 1TQUA 2JF7A 1HF6A 2J4GA 1KCLA 2WZIA 1VB9A 1W1YA 5CQ1A 2PWFA 1D7FA 1CGVA 3NDYA 3B8SA 4TVDA 4HZ6A 3VIHA 2Y8KA 3MMDA 2PWDA 3WEOA 1GPFA 1QW9A 4ACZB 1EOMA 2WKGA 3IJ9A 3W0KA 1B9ZA 3WENA 2NT0A 1JI2A 2C0HA 2FHBA 2CERA 5C8BB 2EPNA 4M8UA 1V3LA 3K8KA 1VRXA 2Z1KA 4DUXA 1AMYA 1MW3A 1E72M 4D6DA 3IJ7A 1V03A 4FK9A 5DMYA 1XCWA 3I3EA 1BFNA 1GHSA 1WCGA 2BVTA 3PTMA 4QLJA 3N13A 4QP0A 2WMKA 3WDHA 4WKHA 3LPPA 4AZ5A 3AMDA 3ALFA 2WMJA 3SURA 2IXUA 1QNPA 3UEQA 1NP2A 1NM9A 2WVUA 4JKKA 1W32A 1HP5A 4UFIA 2XTKA 1E0VA 5CXPA 3GTNA 3TP4A 1CLVA 1QHPA 4UFHA 3A5VA 4JCLA 1C3FA 2VMFA 1WZKA 3KE0A 1OIMA 2D3NA 2V3FA 3MV11 1DWJM 1XRVA 3AYSA 1HKJA 1J9YA 1K9TA 3TTQA 5M5DA 2OYMA 2OYLA 3IAPA 3K8LA 2WSPA 4NXSA 1J0HA 1HXJA 9CGTA 1PS3A 3A24A 3VIJA 4P8VA 4AYGA 5ABFA 1W9UA 1JD9A 2DIEA 3OA5A 1KWKA 1HT6A 2O92A 1ODZA 1JGIA 3DDFA 4XB3A 4FMVA 4Q7NA 4J3UA 2XN1A 3AIVA 3KL5A 1GOQA 4H8HA 1F4AA 1IV8A 4WJXA 1E6PA 1KTCA 1CYGA 2F7OA 3OG2A 4B3KA 1E6ZA 1I1WA 3MS8A 5D9OA 5DFAA 2WSKA 4CD7A 1CBGA 3MUZ1 3GXPA 1DWHM 5LA1A 3WFLA 1N82A 3EJQA 5GNXA 1E3XA 4QCFA 3VO0A 5I2UA 2ZXAA 1B1YA 2WLYA 1UOKA 1O7DC 3HG2A 3AHXA 2ZX8A 4GKLA 4HOZA 1BYDA 1BTCA 1UHVA 2JEPA 4D1JA 4RE4A 4W8LA 1NOUA 5ECUA 5A8PA 5AYBA 4CU8A 4D6IA 1R87A 1TVNA 3PHAA 4LPCA 1GQIA 4AZ7A 3ARRA 5I79A 4FNUA 3WEZA 2WMIA 3FAXA 1C92A 3AHZA 2WC4A 3MUAA 2EABA 4GPNA 1HIZA 3WF2A 1XCXA 2GDVA 4NZJA 3W38A 2JALA 1KXTA 1K9EA 5AC4A 5ABEA 2BHYA 5D8WA 4UNIA 1AQ0A 4PUDA 4W85A 4GQQA 2VR4A 3AFBA 3OGSA 3L4XA 1H09A 1JFXA 2DGAA 1FP8A 5IFTA 1JZ7A 1W1PA 1I1XA 1W1VA 1E6QM 1H4PA 3WH9A 1GJWA 4AEFA 4H2CA 5HPOA 2VJXA 1OWQA 4F9JA 3BC9A 3WF4A 3VMPA 1LL7A 4TOQA 3VD9A 2GDUA 2Y24A 5A6BA 1OGGA 3ZJKA 2YIHA 1CDGA 1J10A 5DT5A 1Q6GA 1QNSA 4MB3A 2PBOA 5F7UA 3W27A 2V3DA 1G01A 8A3HA 4HPHA 1BG4A 2XVNA 3CUHA 1TE1A 3AROA 3SUUA 3VX0A 3ZT7A 5A1AA 2VCAA 2WM0A 4AD0A 4A4AA 5FL0A 3LXCA 4PMRA 3DX2A 3S5YA 3VMOA 3VMNA 3WDIA 2VTFA 3VPLA 1EOKA 3CUFA 3EMCA 3F5LA 4PMZA 2FH8A 5CG0A 4AXNA 1GJUA 3ZJ8A 1UA3A 3VD4A 1EQPA 2Q8XA 2WCAA 2XM1A 5JIPA 4TX6A 4D6HA 3CHCA 1UQYA 4OBRA 1OCQA 4OBSA 3BAJA 1GHRA 2EAEA 4RL3A 2DSZA 4UCFA 2YKKA 1UUQA 2ZX5A 1OD8A 3II1A 3WNNA 3NIYA 1UZ1A 4S3JA 1BYBA 2WBKA 1MXDA 1CGWA 3VSVA 5CGMA 4HOWA 4ZE4A 1PAMA 5EFFA 2DT3A 5A95A 1E9LA 2JIEA 2A3CA 1WO2A 1VENA 1V02A 5CJ5A 3GH7A 3S5ZA 4NZCA 1EQCA 3RO8A 1FA2A 5A6SA 2F18A 2DSVA 7TAAA 1LWHA 1XSIA 2VCBA 3GH5A 1G0CA 5FD0A 4YHGA 2YLAA 1H49A 1HWWA 1RD6A 5IFPA 3VGFA 2E40A 4HPGA 1W3JA 3WH5A 1HKMA 1VF8A 3OB8A 1PEZA 3NUKA 2VZTA 3L2LA 4GI9A 4ML4A 4QFUA 1QW8A 1WZAA 1UD8A 1QBBA 2W92A 4HMCA 3UETA 1GOKA 3OLDA 5E70A 4MTVA 3GNOA 1R33A 1D2KA 2HISA 1Y7VA 2W91A 2RGMA 2IGTA 1H0GA 1JDAA 1GOOA 3T0DA 2E9MA 4UQAA 4E2OA 1XGZA 2CXGA 1R47A 3AI0A 2GJXA 1JYWA 4EE9A 1CGYA 3PBGA 5A6MA 3QOKA 1JDCA 4JAWA 3BSHA 1XH0A 3BVTA 4FNQA 4TVCA 4U31A 4P8XA 3A4AA 1J11A 2C7FA 5DO8A 3A3HA 2X8RA 3PTKA 1BG9A 3RM8A 2F7PA 3GBEA 2OLHA 3OGRA 1FOBA 3NSNA 1IZJA 1J18A 1CXLA 2EBNA 3GNPA 1K6AA 3WDRA 1V02E 1M53A 3MMUA 3EDFA 1H1NA 4URIA 1FP9A 2VQTA 4YN5A 1UR2A 1NWTA 1E6SM 3AHYA 1LF1A 1WDRA 1MQRA 2GFTA 2YOCA 4RE2A 3BXWA 2CBIA 3WUEA 3KLKA 2VX7A 2TAAA 4AEEA 3BH4A 5D9NA 3WNOA 1CPUA 1UR0A 1RP9A 3WY1A 3WL1A 1CEOA 1HL9A 4TTUA 2WW5A 2BS9A 3W28A 2YA0A 1SMDA 3N04A 2BXYA 1MYRA 3ARTA 5C71A 3WH6A 5ABGA 3VGEA 1VBUA 2XVPA 4F8XA 1H0IA 3WQ5A 2Y8VA 2Y4SA 2WANA 3PZTA 3KWXA 1WDPA 3SCRA 1UKTA 1DHKA 4L4PA 1HN1A 4DWSA 2IXVA 4W86A 1WKYA 1VAHA 4GZJA 2WYSA 1PZ2A 2GJPA 4UZUA 3VIGA 4P7OA 3OLEA 2CBUA 1JG9A 1AVAA 1R7OA 1X1NA 5HNNA 1BVZA 4DO4A 3RM4A 5E6ZA 3SUVA 2BHZA 3D50A 2F1BA 4TXEA 1W2VA 2D22A 2J79A 3VIFA 1OSEA 3BCDA 3ECQA 3THCA 3W6LA 4GQRA 1TFVA 3K1DA 1B31A 1WZLA 5HOSA 1R75A 5ABHA 4AD5A 5D8ZA 2DSUA 4WSJA 1W9BM 3ZR6A 4F9DA 2WHKA 2A3AA 1OB0A 4JIEA 1W9PA 1V6VA 5AY7A 1B3YA 3VINA 1TZ7A 2YL8A 3N17A 3SCOA 2A3HA 1GVIA 2W67A 4Z2GA 1R8LA 1ZBCA 4W5UA 3KL0A 5KEZA 4UTFA 4UQ9A 1QNRA 3KZSA 1ZJAA 2E9LA 1G9HA 4FLQA 2O9OA 2E9BA 1B3VA 1BYCA 1DWGM 1QBAA 2WK2A 4E8CA 4D6FA 1UWUA 2ZUWA 3AMLA 1A3HA 3S2CA 3PTQA 1MFUA 4L4OA 3AXXA 2J8FA 2D23A 3RJXA 2X0HA 3U7VA 5EB8A 1CXFA 3L4UA 3EDJA 3LPOA 1CWYA 3NJ3A 2G3JA 4U33A 5A3HA 1LJYA 1DWAM 1K9FA 2YBUA 1OGBA 2BXZA 1KXHA 3UR8A 1WZMA 2CHNA 2OWCA 3DC0A 1MW0A 2ZUMA 4AZGA 1C7SA 4PN2A 1NARA 2CBVA 3AIEA 3QHMA 1J12A 3B9EA 1U33A 3QR3A 4B3LA 4UFJA 3DHUA 1UD3A 2WCGA 3D52A 2BY3A 2DT0A 3SUSA 4MNJA 5DEZA 2W61A 1C91A 4MB1A 3WDQA 4DO5A 4PMXA 2WVVA 3VU2A 3ARZA 4B16A 1XYFA 3DX4A 3WDPP 1PIFA 4OIFA 4C7DA 4J27A 4CD4A 1V6XA 4JFVA 4CUCA 3SCQA 1BGAA 3H53A 4S3KA 4UOZA 4AZCA 2GSJA 2WZHA 3I3BA 5CGTA 1B3ZA 2JE8A 2J7FA 2NW0A 3CUGA 4CN4A 1CTNA 3VDAA 3AS1A 1HJXA 1CZ1A 2QHAA 2B31A 3D3AA 2F1AA 1KGUA 3L4WA 1A47A 2J62A 1GOWA 2VURA 4AISA 2XG9A 3WUGA 1PX3A 1JF6A 2YLLA 3DECA 1W3KA 2PWEA 5C70A 5I6SA 4FLOA 4AD2A 1O7AA 4U5KA 5A8QA 5BXPA 3CPUA 1ZBKA 2EQDA 1HNYA 1EA9C 4PMVA 2O9RA 4PMDA 4TVUA 2VVNA 5FOOA 3NSMA 2XWDA 1B30A 5I24A 2ZE0A 2NSXA 1J0YA 4WKFA 5BROA 3VTRA 1NWSA 3PZUA 4FNRA 1DWIM 2J77A 4KWUA 2WPGA 1ISZA 2ZOXA 1XC6A 3VDHA 4PBGA 4AZCB 1NH6A 4HA1A 1C8QA 4UFMA 3BLKA 1F4HA 4ZXOA 4J3TA 3A4WA 4DM2A 2DQXA 1HJUA 3AHTA 1EGZA 3AXHA 1ZS2A 2JF6A 3ZJ6A 1JYXA 4AIOA 2XN2A 2WNWA 1HKIA 3W4RA 3D4YA 3QHNA 1ESWA 3VDBA 6CGTA 2QV4A 1W1TA 1H5VA 1FH8A 3CIVA 4PMQA 3OGVA 1JXKA 4AIEA 3MI6A 4KH2A 4DUVA 4ZE5A 1T0OA 3CZLA 2CESA 4GO8A 2X05A 1XSKA 4P8WA 1E4LA 1ITXA 3PZOA 3CC1A 4E8DA 1UD6A 4HU0A 2XVKA 3ARSA 2VNCA 2VX5A 2WMFA 3OBAA 1VFMA 2XGIA 1M01A 1JZ4A 2ZIDA 3D5HA 4MNKA 4R27A 5A6BD 1JZ6A 2J75A 4J3XA 1UKPA 2XJ7A 3U5UA 5A94A 4BZYA 3WH7A 3AMCA 3BVWA 1C8YA 1JZ2A 4ZFMA 2V38A 5DF0A 4CCCA 1EHNA 4K68A 5JBEA 2E0PA 3BUDA 3DX3A 5I77A 1E55A 3ZM8A 1UR8A 1JYNA 3WY2A 3CHEA 3VIOA 3WUBA 2VUYA 4QCEA 2J7GA 3N12A 3WD2A 1E4IA 2W5FA 3UG5A 4W84A 1JF5A 4V28A 2BNJA 5IXEA 5BYWA 2CKSA 3EDEA 1TVPA 4W93A 1QX1A 3ARUA 3E1F1 2QPUA 4PYSA 2AOSA 3HG4A 4U5IA 3WD1A 3ZOAA 2PB1A 3FW6A 3FHAA 3QGVA 1H41A 2DSWA 1V6YA 2GUYA 3WMBA 4MPKA 2W62A 1W9XA 3BGAA 1BHGA 2YFOA 1GVYA 3CMJA 2OSXA 1ZL1A 4CD5A 3CZKA 5CSYA 4FLSA 1V0MA 1JFHA 3EJRA 3AIQA 3BMWA 1MFVA 1KQZA 1XD0A 3A22A 4MNMA 3NYDA 4UFKA 1QNOA 4LQ1A 4WF7A 3EJSA 1YQ2A 1NOWA 1W91A 4LYRA 4H8VA 4UQBA 2EACA 3GYCA 4JZ5A 2VZVA 1ODUA 3FY1A 3OZOA 4EKJA 5A6AA 1B0IA 1UH3A 5E0FA 4C7FA 3SUWA 4Z2IA 2F61A 2UY2A 4E4PA 2D0HA 3VM7A 2OW6A 3L2MA 1JZ3A 4JHOA 3BCFA 2WKLA 3WNLA 2WMIB 2EPKX 4P7RA 4HA3A 4HP5A 4YHEA 5CPTA 2W4XA 3MANA 2J7EA 1WAWA 2XSAA 2XWEA 2VOTA 4KMQA 3HU7A 1CXKA 4NI3A 4OKDA 4JKMA 3HMCA 2DIJA 3DX1A 3CO4A 1HJQA 2ZUNA 2D0GA 3ZT5A 2E3ZA 1L0PA 1ECEA 4PEEA 2UWFA 4X9YA 1W3LA 1FFQA 5LA0A 1C7TA 1GOIA 1E5NA 1DP0A 7CGTA 3MSDA 3N18A 5E6YA 1V0KA 4V2XA 4ATLA 1S46A 3L4TA 4JFTA 3W24A 3WQ6A 2AMGA 2JEQA 4B9ZA 4P7LA 3G6MA 1QI5A 2C8NA 4ZENA 2GJXB 1J01A 1RPKA 3POCA 4ZXLA 3ZSTA 3WD3A 3BVUA 3FXYA 1JZ5A 3BUIA 1GOMA 4W8BA 2VC9A 4CU6A 3WKZA 1GUVA 5FIPA 4QAWA 4HOXA 1NOFA 5D4YA 1CXHA 5CSUA 4PTMA 2WVTA 2O9TA 4ZEPA 3CUIA 1EDQA 5BRQA 1G94A 4A3HA 1UWQA 3O6AA 4W8AA 3I3DA 3WFZA 1UR1A 5DT7A 2VZOA 2ZXBA 3D51A 3B9AA 4DM1A 1PPIA 2CHOA 1B3WA 4DWSC 5GPRA 4AIUA 3WY4A 3GXDA 3LRMA 3WIJA 1Q4NX 3IJ8A 1OT2A 3RIKA 2FGLA 3WD4A 1QI4A 2X2HA 1UWIA 1V3JA 3BLPX 3HZ3A 1W9DM 1R34A 3IANA 4PMOA 3NCOA 3BVXA 1HJWA 5EFDA 5HDRA 1JAKA 3TTYA 3M7SA 1B2YA 1ISVA 2WB5A 1WDQA 4UQCA 2DH2A 2XM2A 4BQ2A 3L4YA 3VIIA 3UESA 3SCWA 3VSUA 2BFGA 3SCPA 2D2OA 4FNSA 3WF0A 2WMGA 2YL9A 3GZAA 3JUGA 4IM4A 2ALWA 1UD4A 1V0NA 2J47A 1LWJA 1UWSA 2YJQA 2XGBA 1XH1A 1VFOA 1E3ZA 3TTOA 3FN9A 3T0BA 2A3BA 4KRTA 3S6TA 3RPMA 2VZSA 1KXQA 1WB0A 4PCTA 5GNZA 1E4MM 3VILA 1AQMA 4H41A 4LYQA 4N42A 1ZBWA 2IUZA 2QMJA 3SCSA 3CTTA 1CECA 1UKSA 1FH9A 2CYGA 4Z2JA 5IDIA 2FYVA 3AJ7A 1MQPA 1CIUA 1QWUA 3OLGA 1UR9A 3W29A 6TAAA 1TCMA 4LX4A 2G4FA 5FL1A 1QVBA 2WBGA 1KB3A 3BAIA 3CZ8A 3AMGA 1E6XM 4UOJA 2X2IA 1FHLA 4UR9A 5A8MA 4BA0A 3O2LA 3RILA 1QOXA 2CPUA 4TTGA 4XV0A 3SCNA 3AXIA 5I5RA 3CZSA 4J7RA 3THDA 4MAVA 1PX4A 1EDTA 4U3CA 4OUEA 4Q22A 2XUCA 3PZIA 1LG1A 2QF8A 3AIUA 2XIIA 5HBFA 3UR7A 5EMYA 1HJSA 3VNYA 1WP6A 1GQJA 4U2ZA 4QDMA 1U2YA 2YA2A 4JKLA 3VKKA 3GXFA 3WF1A 1H11A 3APGA 3GXMA 2BHUA 1HTYA 2XSBA 4FNTA 3WDJA 2QLYA 4PUEA 3SCUA 3AIRA 1JI1A 1YHTA 1LL4A 2D1ZA 2YDSA 4WSKA 3WEMA 1CGTA 3FAWA 1Z32X 4MAZA 1LL6A 1X6NA 3RM9A 4MJ4A 4R5EA 4NRSA 4UOQA 3WUFA 3FNDA 3GXTA 1JNDA 4XZWA 1EIBA 4UQDA 3LRLA 3WY3A 1QPKA 3ARWA 1BPLB 3AS3A 1JAEA 3MV01 1NWRA 3ZJ7A 5I23A 3MUIA 5HPCA 1L8NA 3WD0A 1SMAA 1UD2A 1H3GA 2UY5A 3VX1A 4KGLA 4OJYA 3VM5A 3ARYA 3WNPA 1WDSA 1TQWA 2YBTA 3EBVA 3W81A 1KBKA 2WC7A 1NP0A 2WVVB 1EHAA 3AIWA 4IPLA 3L4ZA 1GNXA 1NWUA 2FHCA 5BWFA 4MADA 4PRWA 4M56A 2CKRA 1G5AA 1E0WA 1RP8A 4BS0A 1SFSA 2W63A 4D6GA 1OINA 4P8UA 3G6LA 1M7XA 2YL5A 1V3HA 3H55A 2FDMA 3VD3A 5CLWA 4ACZA 1MWOA 4D72A 1TQVA 5EBAA 1V6WA 3BUQA 2JFEX 4W7VA 1AQHA 4MDOA 2DSKA 5BXRA 2PWHA 3WQ8A 4Y7EA 2PBGA 2BY0A 3WBAA 2VX4A 3CHFA 1KGXA 3F4VA 1VFFA 3RCNA 1GCYA 4GI8A 3EDKA 1UWTA 1J0IA 2BY2A 2OWWA 3VD7A 4D71A 3ARQA 4AD3A 3CMGA 5A6JA 3K4DA 4MDPA 3WELA 4BQ3A 3DYOA 1UASA 4U3AA 3VGDA 4BQ5A 1UA7A 4PTWA 4CD6A 4GZEA 2G3NA 1R85A 1WE5A 4CGTA 2D73A 3EJTA 2XHYA 1E6RA 4JFSA 2D0FA 1SR0A 2YA1A 3HG5A 5BRPA 1TMQA 4AYSA 2XFYA 5BXTA 3IAQA 1P6WA 2YL6A 2EJ1A 3L4VA 1I75A 4M81A 1Q6FA 3TONA 1JD7A 2ZX7A 4AZIA 1E73M 3AZRA 3K8MA 4JFUA 3AHVA 2NT1A 2CNCA 3PZMA 3W82A 3ARVA 3AOFA 3BAWA 4PSPA 4BQ4A 3PZ9A 3DX0A 4Z2LA 1OIFA 4H04A 1OD0A 1J0KA 3T2PA 1J0JA 1CNVA 3GXIA 3D4ZA 2ZUUA 3SIMA 4HA4A 4AZBA 1UR4A 2ZUVA 1NQ6A 5I0DA 3BUBA 1W2PA 1M04A 3T2OA 2BY1A 2HVMA 2PC8A 1OT1A 3VDCA 1VJZA 1V08A 2D20A 3LXBA 3HJEA 4PMUA 5BXSA 5IHSA 3MSGA 2X09A 3LMYA 3BLBA 1JIBA 3SEPA 4XUYA 2E8ZA 4H7VA 1HJVA 1KXVA 1CGUA 5M17A 4GIAA 4MB4A 4GZIA 3DDGA 4X0NA 3LPGA 2XPKA 3MU7A 2DDXA 1E56A 1C8XA 5GQBA 3CHDA 3PZNA 3VIKA 5A2CA 3CV5A 3HG3A 2XIBA 1DTUA 3O9NA 1E1FA 2OW7A 2VQUA 1XYZA 1ZB5A 3J7HA 5JIWA 1V3KA 2D3LA 2A3EA 3QOMA 1ZBVA 4DWSD 1SZNA 1UKQA 2BVYA 2DH3A 2O9PA 1C93A 1IT0A 4HTYA 1BSIA 1XH2A 4P7NA 2E8YA 1R46A 2CCRA 3VGBA 3ALGA 2WHLA 4KRUA 3TOPA 1LQ0A 2FHFA 4AWEA 5A8OA 3ZSSA 2JIWA 1UH4A 1MW1A 3PN8A 1G1YA 3PZQA 4AZ6A 4Z2HA 2Z1SA 2GVYA 1MQQA 1TA3B 1BF2A 4GI6A 5M03A 2PI6A 3W25A 2RGLA 3F5JA 2X2YA 3WMCA 1IZKA 3VVGA 4PMNA 4CN1A 1JDDA 2WVSA 3VOCA 4M1RA 1US3A 5FKYA 4UQEA 1CENA 1HP4A 3HN3A 3N15A 3GDBA 2VZUA 3BAYA 4GINA 2OSWA 5GNYA 4AC1X 1J0ZA 2CETA 3A23A 2AAAA 1JZ8A 2ZUSA 3N1AA 1GONA 3NDZA 1WNOA 1E1EA 4AW7A 4NRRA 1DWFM 3EYPA 4J3SA 5D9PA 1VIWA 1E15A 1Q6EA 2V3EA 3VGHA 1QWNA 3LXAA 1KWGA 4OOUA 2EPOA 1R86A 4W88A 2XFRA 1TR1A 3F5KA 3WQVA 4HZ8A 4MJ2A 1HX0A 2EEXA 1XHGA 3KLLA 3OZPA 3ZO9A 1VEMA 1BGGA 3VIPA 1KQYA 1JYVA 1ITCA 4LGXA 1QI0A 1BLIA 3EDDA 3MKKA 1E5JA 1US2A 3CZJA 3U57A 5A6KA 4PCSA 2D24A 2W66A 2EPMX 1UQZA 2V5CA 3CUJA 1OGSA 4LYPA 3BAKA 3W26A 4WIWA 1OBAA 4NF7A 4DWSB 4J28A 2EO7A 1BAGA 3ZMRA 3M46A 3WMSA 4M80A 3ZR5A 4NX0A 2XVGA 2WCSA 3DYMA 4AY1A 3LX9A 6A3HA 1QHZA 3WH8A 3ARPA 2OYKA 3EJUA 3T08A 1TQTA 4UFLA 5I78A 2BVDA 3WL0A 4D6JA 3T2QA 3BVVA 1TA3A 3VNZA 4IISA 2VL4A 2YFNA 2ZUTA 1O6IA 3UG3A 1E70M 2J25A 4CVUA 2CBJA 4J3VA
chains in the Genus database with same CATH superfamily
3NAVA 2VAAA 2ADJA 1N7KA 1O5QA 2J24A 1VF5C 4NT0A 1IIKA 4XX6A 2A38A 4XBEH 1SN0A 3ZE1F 2WC3A 3ITOA 3BKCH 4JQXC 3RU8L 4PRBA 3ZTJH 3EMZA 2DYPA 4RBPH 3CXHK 3BT2L 2WLIA 1KFWA 4HUNB 4UT9H 4CKQA 4ZD3H 1FWSA 1Z66A 4GIRA 4DGIH 4EIBA 5DMMA 2PF8A 3UGRA 4RSYA 3TA3A 4F3FB 2PPAA 5AC8A 1Z3GH 3MHZA 4KI1A 1P0NA 5I1HL 3G2GA 3AIBA 4O50A 2YJLA 1L7IH 2I17A 3D85B 4AG4H 4IFRA 4F9PC 3VQMA 3Q6GH 2DQWA 3HS0B 3TO4A 4ZMXA 4JLRB 3PSVA 2CD0A 3NZSA 4JFYA 3LOWA 2MHAB 4G8EB 4CADB 3DYPA 5L88L 3GSUA 4NM8H 2XN0A 4WO4A 4MJ6B 1H6TA 3CCHB 3EAUA 5CSSA 5T33L 3CT7A 4DO6A 1KYUA 3LPFA 3W1XA 4XVEA 3L17A 1UH2A 4XOBA 5M94B 1GXEA 5FI8A 4F8QA 2QQQA 5KVDH 5FUOH 1PBGA 4LHUA 2QADB 5HHOA 1IT7A 3PUUA 3BZDA 5DD6B 5E2TL 4PA8A 3BAXA 5KANI 5D2LF 1OAKH 3B0YA 2ED7A 5DGQA 4DJDD 2WXDM 3CQ0A 1UP2A 1C5CL 4R2GD 2QSTA 1MO0A 4D6EA 1JGEB 2WLZA 1L6ZA 4JUTA 4UT7H 2I57A 4TNFA 5JBFA 1L9OA 4PEKA 1RH8A 3RWEA 5T1DH 3M64A 3QQXA 3FSUA 3N6HA 3TW6A 1PDYA 5KOMC 1ZLWH 5F1UA 4GSUA 1S3RA 2CHDA 4B9PA 4QKXB 4N5UA 3ITXA 1GRWA 1QSZA 3INUH 5E8EA 2L0DA 5I71C 1LZOA 1AXTH 2FGZA 5H37A 1MCSA 5HYJA 3JW7A 5BRZB 5C6WH 1IILE 5K9OB 1ALDA 1QHOA 4RX4A 5E9DE 1A7BA 5EC1A 1W3HA 3PG8A 4AL8L 2DZBA 2FX7H 1VS1A 3CIAA 5LNDA 1IAKA 5U7SA 3HMJG 2FX8L 2LV4A 5KOVC 1A6AB 3BKCL 3RU8H 2BX7A 1HQRB 1FZKA 1MF2H 1A4KA 3GJFH 3LZNA 5CCGE 2X1TA 2NY5C 4ELMA 3DGBA 4DJED 4OOZA 3EO1A 2WJEA 5TQ2H 1ZLVH 3V6ZB 3D2UB 4JZOB 1ADSA 3AWFA 1KYOJ 5IJKA 3TUUA 4LASL 2FLIA 4OB5L 4PLJC 5IGXL 3N11A 2ZTKA 3OAYH 3H12A 4DNHA 5I73C 4BH8A 4DVRL 4CN6A 1RZPA 1XDMA 3CDCA 4RE0A 2CLHA 2Q9OA 2PRHA 5LCVH 4PFEA 1HH9A 3GXUB 2EXWD 1S8DA 1YECH 3FU7A 3ZZSA 4YHOH 1QNIA 5F7DA 4ETQA 3MA8A 1KO0A 3NN8A 1AO7E 4KPHL 2F68X 2X2GA 5LA2A 4PLKD 1WD9A 4ODWA 4JFYB 5ANHA 4NYUA 1O4UA 2AMXA 5KSBB 4JFHD 2PP7A 3ZQ9A 2EVGA 4ABWA 5FV2A 5JIMA 4Y9GA 5EOQH 3QZPA 4KX8A 4XBPB 1AQKL 5IQLA 4AMXA 1ONEA 4FQCH 1RZ7H 4Y2OA 3NZ8A 3RFAA 1O75A 2YXFA 2NUWA 4DK5A 5A2BA 1UZ4A 2WV3A 2P1FA 1IKNA 4NAMA 4WI7A 1FRGL 4Y8DC 4DZIA 3ROLA 1CFTB 2VFDA 2RD0A 2AVFA 3TJHD 3W37A 4A8NA 4LF2A 2AGJL 1I1CA 3L5LA 2WXIA 3QHFL 1YO4A 1BECA 5GJSH 2NY2D 1LLZA 1M65A 2YPIA 4G9PA 3DROB 5ANME 3PAZA 1S39A 4W9DC 3MSPA 4HKJA 4N4YB 2G4GA 3WFEH 1LOSA 4R4NC 2ZX6A 3SPGA 3KPQA 3KLHC 2A0LC 2P42B 4GG6F 2APWA 4RNJA 3NCYP 2Y2WA 2Z8SA 4NCC1 4R7LA 3CXFA 5KITA 3BVJA 2NZ9C 2ITDA 1RSFA 4I9XA 5DLML 2ZCLH 3EJPA 2J5WA 4E0RB 1RA0A 3JV5A 2GK0A 3T4WA 1T1ZB 3NSXA 2VQ1A 2FJGB 1JGVH 4Y4HB 1M03A 4Z08A 2CLRA 1F3JA 4ODTH 1PG7H 3M43A 4RFNC 2FH6A 1PG7X 1GZPB 3C6SB 1UT2A 3T0VA 1MFDH 5DHDA 2ZFAA 3QF0A 5MHSE 2HK1A 3R0MA 3O07A 3PXJA 3KM2A 3U5YA 3V0UA 5EPDA 4AVFA 2VC5A 4PSRA 2GJ6E 4L4TE 4IP5A 4A6YA 3QAQA 1QI2A 3W6MA 3GH4A 3A3WA 2JI2A 1A4JA 4PRAA 5AYIA 1O9WA 4OZHA 2YPKB 2CE6A 2GJRA 1UWGL 1IWBA 2BNRE 3G5YA 4Q4QA 4ZX3A 4YHPB 3NIFF 4FA3A 3LKSA 4FFVC 3VI4B 4B3VA 4PJBF 3B3BA 4LAUA 3FULA 5J13C 1WV7T 3B2UD 4ZTPH 3R1GH 1OP3K 2ICSA 5IOKA 1QWHA 1P7QB 2IPUK 1KTKE 1AE6L 4HMDA 2D7TL 4XPAH 2F2HA 2LE9A 4G9FD 1OK0A 3MV8B 3SYAA 4NC2B 3U48A 4D0DA 5L2KA 2Q02A 2P46B 2QJJA 4OZHE 4R26H 1YN7B 2HJLB 5I8EA 3RVTD 4WAFA 3SN6N 5CEXA 1E71M 2HROA 3STCA 4XZBA 3HS8A 4Q9CA 5HPMB 1JL8A 3L3HA 3M0JA 1JV5B 3HLAB 4NP7A 1CT8A 1EHKB 4LVOB 4WY7L 1INEH 5B22A 3GTXA 4MGGA 4OCLC 3SR7A 2GJZA 5LHEA 1XP3A 1HZHH 4F5CA 2PDWA 5JW4M 3HHRB 1ZJBA 3MLSH 4U7KA 2JELH 3U4EB 3S42A 3VB8A 4DWHA 4YQXL 1H0DB 5BZAA 4ADJA 2YCLB 4NXKA 2O5NA 4PJEB 3UDWA 4JX0A 4KZDL 1YNTB 3IBEA 5AFAA 3IN2A 3KGTA 1OW0A 3PWVB 2VEPA 1FHDA 5GRWA 1MH5B 5KSBA 2BDNL 2H32B 1OGPA 3FCGA 3RVWC 4JZJA 4I5RA 1JPIA 5BMWA 4TX8A 1JCMP 1MJ8L 1L0XA 4NZ1A 5F4XA 4A3YA 1TRDA 1BOGB 3UPCA 1M3JA 3KM1A 4G8GE 2V3GA 3HI1B 4D0CB 1P1XA 1HQTA 3G5ZA 3FU7B 3B9DA 3BESR 3B4UA 2B1OA 2R56H 4I8YA 3RU6A 1L6XA 2Q3XA 2C7UA 5I6OA 1L6WA 1ISXA 4FXSA 4GO9A 4XCCL 4N9DA 2NVAA 3O3DA 5FDYA 4Q0XH 5FCZA 1E42A 3H54A 4YR6B 2NW2B 3MX0B 2GGGA 4AZHA 4BI5A 3ULVF 5E1GA 4ETYA 4FF5A 4FL4C 3T0AA 2OMVB 5DS8A 3MLPA 1VGAA 3GRWL 4F7PA 2TYSA 1DJSA 1PIGA 5D9MA 2E68A 3PPCA 2XFWA 4FXGA 1MFEL 3WF1A 2WAHA 4NZFA 4P23A 4Y7MA 5AC7A 3V5DB 4KZ0A 5M3WA 1D3CA 2JK5B 2WQWA 1U3YA 2GTZA 4F66A 4FIRA 2WO5A 3I75A 1E4NA 1IGMH 3JWDC 3HGJA 4K7YA 3GFZA 1BVNP 3AREC 3QQ1A 4I6KA 3AAZA 4JY4A 1JP5A 2G8ZA 3THAA 3GK8L 1UG6A 4I0KA 4MX7B 3MUY1 4YMPA 4IMLA 5CJXA 3TVMB 3PGCA 4U1SB 5JVLA 1OAXH 4OLUH 4GBDA 3BZFB 4A8RA 4MVBD 2LABA 3P73A 5IK3A 2AQVA 4HVBA 1U8HB 1FZJA 3H85A 1NCTA 4NO5B 4WKZB 1BFVH 2F8XC 3SCTA 3R43A 3KS5A 5DQ9B 1H3WM 3LZPA 3MODH 1F8TL 4F80A 4ZS6C 1A53A 3KP0A 5HSFA 1NCUA 2EDRA 4JVUA 4MAYB 4QRSA 2IW0A 3QZ6A 4X0VA 4P3CH 4I7ZC 5ES4B 1LLOA 3UWUA 1P4UA 3RPTA 3V0TA 3WBYA 3TWCL 1FL3B 2AV1A 4BEQA 3CZGA 5HYJE 3ARGD 5BMFL 5AC5A 1I1RA 2CW6A 1GC1L 1Y5WA 4GVHA 2KPWA 2CITA 4RE3A 1IR1A 2XKSA 4NI8A 2FWUA 3B9KB 3C5JA 1ZENA 3W7MA 2Y1HA 3FSVA 3NJGA 1DBBH 1XUZA 3V18A 1MNSA 3K71B 3TIDA 2VDLH 3LQZB 2IDSA 5E99L 3Q8BA 3UC0H 3S6DA 3LMJL 3KEHA 3SGDI 4EN3D 4WFED 1KPVB 4AQAA 4DXVA 1MY7A 3K46A 3AMKA 5HNUA 3LY6A 4KGJA 3DMMC 1F6KA 3TBYA 1K4DA 2OGYA 2X12A 4N0RA 1KIUA 3T77B 4HU8A 1Q6DA 2J7CA 4BF7A 3VB9A 3HOJA 2X1IA 1PZ3A 2BZDA 2P8LA 4DUWA 2X0WA 1SYVA 3LYRA 4U1MA 4FZIA 5E09A 1LG2A 3W2UA 2X6MA 3HNVH 3W7OA 5IVXB 1R3SA 3CWHA 3MV7D 3TU9A 2B9BA 4ZS7H 1Q72H 1X5IA 4EIGB 3WSUA 2HXAA 3C87A 3EGDA 3QC6X 1TQCC 4X6CF 3BGJA 3PDDA 4XNQA 4OF5A 4TM9A 4NNYB 1GZ1A 4JHAL 1E9QB 4FOMA 1FC1A 4YE4H 4APQD 4AVIA 3GBLA 3P4OB 4IMCA 4NAQA 3AS2A 5C2UB 4JN2B 2R9RA 3HQOA 4HPYH 4BFIA 2J1KA 5HYFA 2JF7A 5C97A 3GIVA 3E02A 3FQTA 3EOOA 2J4GA 2PU1A 1A7RL 2WZIA 1VB9A 1W1YA 1SU5A 2PWFA 4X60A 4XZUA 3FK3A 3ZXAC 1KCXA 4MWAC 3DURA 5LGKA 4ZO7A 3L13A 1L9QA 4XNXL 2EKCA 3RFZC 2A6JB 2ITEA 3B8SA 4IU2B 4JFFB 4TVDA 1SHXA 3K3QA 3SJ3A 3FOMA 4XVJH 3HR6A 3WLSA 3BAEH 4HUVB 2WD0A 3HG1A 1LK2B 4NNXB 4OKVB 4K2SA 3MMDA 4UYQA 5A3ID 2AJ3A 3I6GA 4A7TA 3V0WH 1BQRA 4HIJA 3AU1B 2DF3A 1YJDL 3KOFA 4R7NB 2XN9E 5IQOA 5MEOB 5BO1H 2HFEB 3OJMB 5EH1A 3WLRA 1KC7A 2ATSA 3UZVB 1O5RA 1IFRA 3SZ8A 3QDGB 5C8BB 4Y1AD 4M8UA 3HOGA 3FTXA 5EG6C 1FYTD 1JPST 2XTJC 1QO3A 2NZIA 3ELQA 4MMXB 3U7BA 1I8UA 4A67A 5ID1A 1FWTA 4UR7A 5DLMH 2VXVH 4HIIB 1E72M 4IIQC 2JLPA 1IIGA 4WZHA 4D6DA 5DMYA 1XCWA 3I3EA 3KS0H 4GWEA 1MFMA 3PTMA 4R7OA 4H9TA 1DDTA 4GJTB 3QJZA 3N13A 4QP0A 4FTVA 4DKFL 3HGOA 2FBOJ 5CJXC 5CHNB 3BKYL 4MCNA 3CL6A 3LPPA 3OXRA 3VFWA 4OVUA 5FCSH 2P48B 3QDME 1Q0YL 1DL7H 2D7PA 3FFDA 1U91B 5B1JC 3AMDA 5JTWA 4PJFB 3Q37A 3D3VB 2ZBTA 2B0SL 4O0KA 4YVPA 1NCBH 3PP3H 3PWUA 3LCWA 3G1XA 1O5DT 2P5EB 4PWGA 5EN2B 3UEQA 1NP2A 2DJLA 1NMAL 3I65A 3LCGA 3WEAA 1TVHA 3FRUA 1CF1A 2C13A 5F93C 2V2WB 3OKOA 1W32A 5BRZE 2CZEA 4RK8A 1EKOA 2LU3A 3MV8E 1HP5A 1WDDA 2VZ3A 2PMQA 4TN9A 2XTKA 1E0VA 2Z35B 1U2CA 3QBTB 3GTNA 4MDIA 1QHPA 3NP4A 4IOFC 4NHUB 4OM0H 1EJRC 4UFHA 4U0RC 2Z00A 4FADA 3S46A 1QABA 5GZNC 4YL2A 4Z7QF 1C3FA 4M4RA 1W8SA 3MBFA 1WZKA 2PCPA 1NCOA 1UUOA 3RLUA 3D4GA 1S9XB 1ORQB 1WKDA 5I6LA 3D34A 1IM9D 3MV11 1DWJM 2Y7DA 2H7WA 1J9YA 1DVYA 3DC8A 5GJSL 3IACA 3RLVA 5FFOA 4XCFL 5E24E 4XWGH 4EF3A 1A9BB 1DVFA 1NJJA 3S6OA 4K71B 1ICQA 3BSZL 1US0A 4Z7VF 2IAMA 5M5DA 3HC4L 1TQCB 5I3JA 2I7OA 4V2BA 5C92A 2CJUH 2NLJB 1AO7B 2CR3A 3Q2WA 1LUCA 1G7LB 1LO2L 4NXSA 5T1LD 4JY6A 1SJEB 4F1SA 4YHZH 1U93A 2HYMA 4DT2A 1B5TA 2CA4A 1EEPA 4JRXB 9CGTA 1U1JA 2HNEA 4IOSA 2CALA 1IBGH 4IT1A 3MRQA 4LSSL 1NUGA 2W07B 4GIOA 4OLYL 3SDXF 3WXWL 3VIJA 3TYUA 2NY3D 2FEJA 4WHTB 1L7TL 3RKPA 4HXAL 3T6VA 1JD9A 3H9SB 4EXPX 5BVPH 1FVEB 5JW3H 4LUJA 5A8GA 3P77B 1HT6A 5AYQA 2MNWA 2WZAA 4YL9A 1H50A 3OYXA 2R8SL 3DDFA 4UTTA 4FMVA 4D9QD 4J3UA 1GZQA 4CD4A 1XF2B 2RACA 1RU9H 3KPLB 3NJHA 1S3KH 1YE6A 2FJKA 3KL5A 2A77H 2QW5A 1RSYA 5F9OL 4CVXA 2R6OA 3HURA 3NQIA 5D5ME 3OG2A 1ZSHA 4KK6D 2BSCA 1KBWA 1JHLL 1HSBA 1YNPA 5ANMB 2YMXH 4B60A 5IG7A 3MS8A 4G71B 3W01A 2FQFA 3KXFE 4OTXH 1XAKA 4Z1AA 3KUMA 4GYPC 3V4VL 4XTIA 4S1FA 4RAVA 5I3KA 5LA1A 4ZUSA 5EZLA 3B3IA 3SCMB 2Z6FA 1MRDH 3EJQA 3V5KA 2NOYA 2DQTH 4QCFA 3ZKQD 3SKOB 5DJAA 3VFGH 3ESPA 3MLWL 2FZ3B 3P3RA 3T77A 2BVPA 2IQ9L 1TZOA 3C5ZD 3VWJB 5A2IH 2H90A 3JWNE 4C5YA 1RUPL 4ZO8A 1L5GB 2VWTA 3N9GH 2KLTA 5ICXA 2ZX8A 4DP6X 1UWXK 7REQB 2JEPA 4D1JA 3HBQA 4JTTA 4ODVH 2P80D 1H1ZA 2AQ1A 3FTVA 3EYUL 5EUKA 4BHUI 2FT8A 4GQZA 4NPYA 5E5RB 3S98A 1NOUA 1OB1B 3QEQB 5DLCA 1YMHA 1FBIL 4CU8A 5AYBA 2EINB 3D6NA 3QISA 1WHPA 2E4FA 3CFBA 5EL1A 3MO1A 4HEMA 3RG6A 3KWWB 4WFEE 3TYDA 1AQDB 4DVOA 4N2MA 2V17L 3AWGA 3CVCA 1TVNA 4LSTH 4LPCA 1GQIA 5C0GB 1GVEA 1K8IB 4AJ0A 5EFIA 3ES8A 1FDJA 4AZ7A 1BREA 2XZCL 4HSQA 4MLRA 3TFKD 5I79A 5EZJB 5F4SA 3R18A 3WEZA 4TF4A 1ZA3A 2EDTA 4QRPD 3FAXA 4JG0L 2WMIA 3H3PH 3K5XA 4EUPH 1CE6A 3CFDB 3OM3B 5JNYA 3M5YA 3WUZA 2QHRH 3TW7A 3IFPB 3MUAA 4XKYB 2FL5B 3WLIA 3IF1B 1AY1L 4O58H 1RAMA 4PJ5E 3LN4B 5IDZA 3C5ZC 1DVXA 2A6DA 3RY6A 4D8PB 3IVUA 1UCBH 5IEHB 2DMCA 1ZGDA 1I1AD 2HT4D 3BZFA 4LSRH 2XZZA 3RJDA 1JV2A 2XFGB 4FTVE 4JTLA 3V4BA 1A5LC 4GK8A 4IMLB 1ORSB 3MYJB 3WF2A 3EZ8A 1MHHB 4AYMC 3P0XA 1KENH 4P9HC 1LM8V 4P99A 4Z95L 1JGLH 5G2NA 3QBUA 5DBTA 2R1XB 1GYNA 1N5AA 4L80A 1SRDA 4CNNA 3AAZB 4JY4B 1KXTA 3FB7B 1S7RB 3ZHKA 5DBUA 1K3ZA 2YAPA 1RZGB 2JWYA 4WJG3 1OSZB 3ABSA 5D8WA 3QZWG 3P74A 3CVIH 1N59B 2NY5H 2DAVA 1LJMA 1WKFA 4QHLA 4DFIA 2OU4A 4LRNL 1ZGLA 3GW0A 1B4JL 2BLFA 3DRQA 4XPGH 5E08H 2P8MA 3L48A 3UP8A 4AX6A 3BN3B 4GQQA 3UTZA 1LE5A 3AFBA 2VP8A 4P4KA 3S34L 1NGYA 1BVKB 1J1OH 1RUPH 3L4XA 3VSQA 4ERSL 1H09A 2I1OA 1LD9A 4NO2B 2NW2A 4LAOA 3IJYB 4DP9X 2X1OA 1JFXA 4H8WC 1JZ7A 1D8CA 2QPXA 1W1PA 4KHTL 3RA7H 3UD6A 1TZZA 4PRRA 3WO4B 3H4FA 1KV7A 1W1VA 2PDFA 3WH9A 1XVSA 4IRZA 3TH2T 4MZYA 4AK2A 4XIAA 3EHBD 2QT3A 4AG0A 2VIRA 4JFFE 1HJBC 3MPGA 3GO1H 5HPOA 2AXFA 2VDKL 4OF7A 2GVJA 2BOCB 3EYFB 4A21A 5IJBC 2YMXL 2PW1B 2LU4A 3HI1A 1M05A 3QNZB 3BC9A 3WF4A 1LQ2A 4IOIB 4GFIA 4Z3FA 3ABOA 4K8GA 4TOQA 4X80H 3CS2A 1AG6A 5I9QC 2NNFA 3QRLA 5AKTA 5A6BA 4JFDE 4YEFA 3ZJKA 1IC5H 2HMID 1S7XB 8PAZA 4PRPE 5F89B 4MCYA 1CDGA 3EHBB 4JO1H 4MS8C 3H9SD 3QIUC 3G1AA 4ZYKA 2NUXA 4PJEA 5H94B 2HFGL 4LFYA 1L6GA 1NGXB 1VZHA 2V3DA 1A0DA 2XT1B 3KG5A 4HJSA 2ZUYA 3Q2DA 2UWEB 1OGAA 3S2LA 3FO0L 1B0GA 1DQIA 2DQTL 1PYFA 4YUEL 3ARFD 2ADFL 5LO7A 5HDQH 1E6OH 1S2EA 2PPDA 1FWEC 4BH7B 4R4FL 5C7XL 3MTRA 3IB4A 4LEOA 3EOBA 3TZVC 1R5IB 5L2KB 1TUPA 5DCBA 2GFBA 2YR3A 4BUQA 2WM0A 1KPUB 4H26B 3Q48A 5HVWA 2J6VA 3Q05A 3EYQD 4FI6A 3KS0J 5D55A 4M8VA 2WZ6A 3HNTH 3DX2A 5C2XA 1HSAB 3DX6A 3MR9A 4KFNA 4YNGA 1NGQL 3MRFB 32C2A 4NQVB 5AB1A 4MOZA 5G4HC 2EEBA 2VTFA 3VMNA 5J1SC 4AUYA 1FA4A 3CUFA 5E7FA 3HC0A 3TXVA 4A38A 4JGNA 5C09E 4L4VE 5DJ0A 2FH8A 4POZD 4F2UA 1A0EA 1RCOB 3S9IA 3FA3A 1RVGA 4UT9L 1UA3A 1OANA 1WGVA 2I5QA 3PSWA 4RZ4A 5K39B 1QFHA 3RZCD 5IM51 5CPOA 1MI5D 3LQGA 2Q8XA 4TULL 5HGAB 3MJ8A 4QRPB 4WWID 1T41A 3E5BA 3H2NA 3TCEA 4APXA 1XWVA 2R4SH 4ODUB 1YZZA 1IM3A 2WBJA 5D96B 4JQIA 4XE0A 3W39B 2V63A 3CU2A 2VQ1B 2A5UA 3GSOA 1WF5A 4Y4HA 3FH8A 1YEIL 4B4FA 4WUKL 4HNOA 5K69A 2P26A 1E4JA 3M0ZA 4WU5A 3QWOA 3MUGA 1OCQA 5J56B 2Q10A 1KUMA 2WGXA 4OF6A 4X6DA 3ZL4H 1LEIA 4A2RA 4JPQA 2GAZA 2YB4A 4DVBA 5JOPE 2YKKA 3AT0A 2Z26A 4EAMA 3FO0H 4Z78B 1A14H 4TYUA 5ABAA 3J27A 3WNNA 1NVMA 1UZ1A 12E8L 2ZYIA 2Y7QA 5L2JA 3NIYA 4CSTA 3IIPA 1B0RA 1PKQB 5BQDA 4L8BB 5F9DC 3NZHL 4LLYB 5CGMA 5KJ7E 2PDCA 2PPGA 2VDGA 2VOMA 3TVAA 4QTIH 4FMKA 1EK3A 3GJFA 3IGAA 1Y6KR 3PHOA 1NIBA 5JHLL 1Y0LB 4E41E 1F1GA 2V2TA 2DT3A 2EPHA 4KPLA 5K7JA 2XG4B 3ML8A 4F57H 5A95A 1OE2A 1UJ3C 4ZDHA 2BVWA 2UVFA 2Q6WB 3WLBA 2JIEA 4WI8A 1I3GH 1CFQA 1WO2A 3QUYA 1TUFA 1OAZL 4K9EC 4U6XB 5CJQL 3VYPA 5CJ5A 1V02A 3C2EA 3EH1A 3KH4A 4L5ZA 1M1XA 1FGNH 1LO0L 2WUBL 5B80A 5T1KB 4JO4H 1FA2A 2W1NA 3VAEA 1AXIB 2X4UB 3NJLA 1ZVSA 2QJMA 2HKHH 3PJXA 4KJQC 3EXRA 3VNDA 5TFSL 3MC0A 4HKBA 5F7DB 3RA7L 1CDIA 5FCUL 4PY8I 1G0CA 2R1NA 4HYWA 5IBTH 1HH9B 3SM0A 4C6QA 4NQCD 4M8QA 3SJVA 3LHZA 2Z7WA 3QXAB 4B2DD 4NCC2 2UX6A 1LK3H 2PLTA 2WJZA 3M47A 5AYUL 2BP1A 4N25A 4BH8B 1DSYA 4XPFH 3H56A 4HQQH 5C0FB 2HX7A 3PNWA 3VGFA 2EUXA 3UTSD 1QRQA 2AABL 1TTJA 1W3JA 1E67A 4Z7VB 1PUDA 1HKMA 3X1FA 2R8SH 2OAAA 2IDTA 2PGEA 3QUXA 3W7HA 1TE6A 1PEZA 5DHXB 1EWDA 4Y5XA 3WE6A 2CH8A 3JU2A 2NXHA 3QSRA 4G1EB 1VBHA 2Y7FA 3LGGA 1JOIA 1Q9KB 4I4WB 1L2UA 1FE8L 3H24A 3MLRH 1CO1A 2VENA 3FO2A 5I2IA 1P0EA 4XTDA 4FFZL 3BLIA 1GOKA 3D09A 3H6JA 5F9JB 2YCEA 4MTVA 5DHYB 4S11A 5F96H 1AZNA 4BM7A 3WOVA 3VG9B 4BELD 1R33A 1WBZA 4D8OA 2M1KA 1J8SA 2QGCA 1FWXA 1Y7VA 2BG5A 2RGMA 1BQ5A 1M6UA 3W56A 4KK5D 2QLVB 5C09D 2KDYA 5C9XA 1EEZA 4LTSA 1FL6A 5HA7A 4EKXA 2E09A 2BSBA 4Y2WA 2CXGA 5DX7A 1OEZW 1T99A 5IB2A 3AI0A 3ZTEA 4HT1L 4AQ8A 1N64H 3QOKA 1JPTL 2X7LB 4HKZA 5AKSA 4FQJL 3GU1A 4GXMA 1S7SA 4GXUN 2JFCA 3UW6A 3FQ1A 6REQB 1KBPA 1QFUH 3W2MA 5E2UH 4FNQA 3F7RA 3VW3L 1FBIH 3N4FA 5CP3A 3CCHA 3SYOA 2RFXB 2EIDA 1MI5B 1P7KA 3GHTA 3QY6A 4RZBA 1TLMA 4P5KB 3MODL 2F7PA 3KP1A 1NANI 1CYXA 4GAYA 1WA0X 2F38A 2CLZA 2OLHA 3GZKA 5B8CA 5JDJA 3LBCA 2GIXA 2R2EB 3PG2A 4RLDA 4M6NH 3PQYE 3QHZH 3LKRA 3V52L 3S9YA 3GNPA 4UNUA 4A2DA 1K6AA 3TR2A 1BBJA 4ANWA 1RAKA 1V02E 1M53A 3UJTL 3MBWB 5C0IA 4HS8L 2WLIB 2XPGA 3H9SE 4WO0A 1R2TA 2Y72A 2EKSA 2VQTA 3MLSL 4P5TD 1UR2A 1JZEA 4YN5A 4EAYA 2AK4E 2DQDH 1EO8L 4IXHA 4JD4A 2OI9B 1TXKA 1LF1A 5KS9B 1MQRA 4WU7A 2A74C 2HH0L 2YOCA 3QUMA 2JQZA 1D9KC 1I9IL 3QR0A 3J2PA 4G59C 3UO8B 1KM1A 1SO4A 3C60C 2V5JA 3EEZA 4K37A 3ULSA 4RE2A 5CCZA 2WBWB 3H3KA 3T81A 1TETH 3PGDA 5CCJA 1IGTB 1VHNA 1CK0H 2WYIA 2TAAA 3OG4B 5I6MA 5SX5H 1WOAA 3BH4A 1XYLA 2BC4A 2C1GA 2O5ZH 3W1QA 2WXFA 3EOTL 5K9XA 4W4NA 2ADGB 2VXTL 4DW2L 5FYJU 3WY1A 1U1UA 3KBSA 3V0WL 4AZUA 4ANKA 1CEOA 2JJVA 3IDXH 4MA3B 1ACZA 4R9HA 1WIUA 4NYLA 4XXDA 5JPNA 3BAEL 2BS9A 3WXVL 2FT6A 1EEXA 2EE2A 2GJ6A 4GY7A 3XINA 4IKJA 3BJSA 5KSAD 4GIYA 2GL5A 4FE9A 4APQB 4NP4L 4RAUB 2CO6B 4C4KO 4CC1A 2KAUC 4YPGA 2QCHA 3VNJA 3KDMA 4J8RA 5C71A 4AWSA 3O15A 3O3BB 5AAWC 2ZKMX 2CUMA 3O6LH 3QUXC 3QEQE 3F4DA 3CFEA 5IB3B 4F8XA 1KLGA 2IWGA 3ARBC 3GKZA 1M2VA 1ET5A 3H70A 3PZTA 4I13B 1F7BA 4WI2A 2QR0A 2DKUA 3A5FA 25C8H 2QGDA 5J11C 4O02A 2EVHA 3CHPA 4L4PA 2KH2B 2R7EA 1HILA 1AP2A 4H44C 4N8VG 1BM3L 1TTFA 3GSVA 3KPNB 4K7PY 6ENLA 1PF3A 5TGBB 3ZX1A 2X4TA 2EUWA 5E1AA 1TWDA 5KZEA 4PJ5D 3FUFA 3SQBB 2GJPA 4NHCH 4HD5A 2VEFA 4X98B 1R1CA 1JPTH 3DGGA 1RUQL 3LZ3A 1TPXC 4IX2A 2WQDA 4P7OA 2OLSA 4MJIA 3CASA 4Q8PA 4CBPA 2WLLB 2D7TH 3FT4B 3EYSL 2E3VA 2AC0A 3SY0A 1PZ0A 3VFNA 3T5WA 1MEWA 2B39A 3JT2A 1R7OA 1NPJA 3UGEA 2R23A 3K13A 1M6OB 1T6VN 4Z8FH 4KF1A 3HRZC 2Z1PA 1T89C 4R7XA 3FGCB 5HNNA 4OFYA 5C0CB 4LW7A 4Y6GA 1C08A 5D2LA 4C56E 3V95A 4JHBA 4EI6A 2BHZA 3D50A 1JULA 4NZDA 4U4MA 3HNSL 2F5BL 1GGTA 1J5TA 3MLZL 5CZ0A 1BQLL 2J79A 3VIFA 3L3GA 2H32H 2GHWB 5CGYC 1OSEA 4MYAA 5EO0A 4BWLC 4OUOA 2WGNB 4X6DE 5J1AB 1C9DA 3VFLA 3STZB 4B97A 3ECQA 2FZBA 4YK4B 3D18B 3BP5A 2BK8A 4YDJA 5AOLA 1I53A 5F1IB 4DEPC 1WZLA 2YYTA 4MKTA 1R75A 4WI0B 2ZA3A 4AD5A 5U4NA 5BV7L 3TWYA 3E0GA 5F1NB 2DSUA 3SYPA 3ZR6A 4DF0A 4JPVL 4F20A 4N90E 1WICA 1IKNC 4BXSV 2PO6C 4FERA 2OMUB 4IRSB 5JDSA 4CRPA 5I8CB 1LRNA 2IH3A 4XP1H 2NR6C 3K74B 2A3AA 4FX8A 4OW6A 5TNVA 5AY7A 1HHJA 1F11B 1PW3A 3IMUA 4JVWA 4PJBA 5IZ7A 3R0UA 2IADB 3SQOL 1GVIA 2NX5E 3VXSD 4B96A 1XBYA 5KTLA 5IT2L 4FP8L 4HAFA 3QR2A 1D7BA 1R8LA 1ZBCA 3BWWA 1IWAA 3BWUF 3KL0A 5D4JA 3CVHB 5GGQH 1YEKH 3O9WA 2XKNA 5DK3A 4JM4L 5KBMA 1WT5A 1OTSC 3RL1B 1G9HA 3WV0A 5EEWA 1TTAA 2GPZA 1P6CA 4AUBA 2YGVA 1TELA 4BCYA 1DDHB 3OMAB 2XIDA 2H9AA 3ZDYB 1F74A 4C1NA 2YCIX 2WK2A 2NLYA 1AJ7L 4MNGA 3VQLA 2V68A 2BGQA 5FB8A 1UWUA 2Y36H 2ZUWA 4HIPA 3VXUD 5LLIC 1A3HA 1REQA 2CLIA 3CAWA 4MNHB 4L6HA 1GS6X 1LVEA 2BSEA 4F57L 1XKYA 3B4YA 3CH0A 5EUOF 3M1CA 1CR9H 4PJCE 1QEXA 2APTA 4JDTH 2FJSA 4JFZL 5EA0L 3HNVL 1JPKA 1VH7A 3N42B 2X0HA 1TSHA 1KTLA 2FX9H 3AWNA 2IAMC 3RTQB 3ZO0A 2HVBA 1CXFA 4MCMA 3LHUA 5FYJE 3LPOA 5KSVB 3IS1X 1ZDQA 3NJ3A 4G83A 2JKWA 2BMKB 2HWGA 3NQEA 3A4DA 4PREA 1DVQA 1FFTB 3RUGE 4JN1L 1BMZA 3VXTB 3O6LL 3FB6B 4LHUG 2VDLL 2NY6C 4DP4X 3UTTB 2I9TB 5G55A 4GE8A 2BXZA 1KXHA 3D2UD 5D03A 5D32A 3OHXA 1WZMA 4YX2L 4JFDA 2ZOKB 4C57C 3MA7A 1I31A 1NSNL 2FZMA 3W1MA 5I18L 1FFNB 4RMBA 4OGQC 5IIEB 2ZQKA 2X6BA 3FHEA 1IJNA 3QUMB 4KROB 4H8WL 4PCYA 4G82A 2CBVA 3AIEA 1J12A 4B3LA 3PL6D 3O4OB 5E2VL 2VN4A 3D52A 2BY3A 3IFOB 3K2KA 1NTDA 5DFVC 3S8FB 3MV8D 3TF7C 2DT0A 4CW1B 4JTUA 4MNJA 3IGSA 3I9GL 4DO5A 5T3ZE 2H8XA 1YEJH 4J2QA 1FHNA 2WVVA 5IOPA 1XCFA 4X2UA 3MJ9A 4CJ0A 1HJCA 4FQJH 5I1KL 1B88A 3QUZC 3OTRA 1TZGL 5KJ4A 4JQIL 1TZIB 2JIXB 1BRLB 3QJTB 4FQPA 3OKKA 4J27A 5C1MB 1IAIM 2OS7A 4XBEL 1U8CB 2KLSA 4JFVA 3W1LA 2AXWA 7PAZA 4Q2ZA 3H53A 4DQOL 2K78A 2ICEA 2GSJA 3QIBC 3RP1A 1BWWA 2BVQB 4IFKA 3HPLA 5IBTL 1FY6A 3CUGA 1IBYA 1HJXA 5DQJA 5IR1A 4I0PD 4RGNC 3L3IB 2XWXA 4E9LA 5DJ8A 4DPRA 3UA4A 1EXUA 2PRMA 4BGLA 2DJUA 4DBWA 2WXQA 3L45A 1N10A 2F1AA 5IFJB 2X7LA 2Z65C 2IH1A 1OX4B 2FJFB 3RNKB 3L4WA 5G5IA 1A47A 1FZOB 1NEPA 2J4WL 2E7BA 3KFTA 1IARB 3EZ4A 3HC3L 3PJLA 5MI0C 4AISA 4E9VA 4N8CH 4JO1L 4Z18A 3SBQA 1MFAH 4PW9A 2YBVA 5D09A 1BEUA 1DBKL 1XLFA 5FIEA 3VWKD 4H5SA 3MCLL 4N0YL 2YLLA 4FEZA 2IKGA 2FQIA 5FUZL 1Z48A 1I9IH 2PWEA 1O95A 4G6FB 4QTHA 5E9DB 4I3SL 1DFXA 2GLKA 5I6SA 4EAEA 4HV8A 1RA5A 1R3JB 4L3CA 1W5OA 1Z9NA 4FI7A 4JO8A 3VFOB 1CGSH 2VEMA 3KTSA 5A8QA 1ZBKA 1HNYA 1V93A 4TIMA 4UBPC 2X9XA 4PMVA 2O9RA 2E7HA 3FT0A 2GGIA 1P5VB 1PNCA 4XVUD 3M5XA 2ZSWB 2IBBA 4O9HL 3V0JA 1MRAA 1VFAA 1ZTXH 4WTZG 5KBKA 1Q9OA 2B59A 1G6RL 2RDWA 4NWTL 1ANUA 4AXWB 3N6QA 4G8AC 4RAHA 1B30A 3DKJA 5I24A 2NSXA 3W9EA 2XDHA 5I28A 1UOWA 4LRSA 2WAQA 3STBA 4WKFA 1J1OL 3E9UA 5FYLH 1MHEB 5DA0B 2QJHA 2MOGA 3A4FA 4B9JA 5BROA 3UZXA 4JFFD 2QUMA 1XGPA 2EH7L 1D5XA 4WEEA 5JHLA 3ULVH 4FNRA 3VZXA 1X5LA 2N4IA 1P5UB 3FA5A 2WPGA 5T3XE 1L7IL 5J6SA 3H26A 4PV9B 5IM7B 4PBGA 2Z27A 5HHOD 4AITA 3PJWA 4OUUB 4FXRA 3RQ3A 2B4CL 1YEEH 1RUKL 2V5BA 3MOAH 5C6MA 1C8QA 4UFMA 1DVZA 4MA7H 3T4YB 4ANUA 2A0NA 3LN3A 5DGRA 4XD4A 4YLBA 3T4AC 5B7ZA 2VDPL 4ZXOA 3GGWA 4L5FH 1UTDA 3HNTL 1XCQB 2EILB 3AW5A 1DLHB 2J1YA 3L3DA 5L4IA 5HYSG 4EF9A 3IBOA 4KRPC 4TUOA 3AHTA 4FKKA 3O05A 3V4PH 2JF6A 1IC7L 5AVRB 1JYXA 1S3TC 1K03A 1GGCH 2C1OB 5F44A 3UMTA 1HKIA 3UNTA 3WX7A 1G4EA 2CCLA 2V9DA 2COVD 3P62A 4F58L 1BZ8A 4X7TA 3ZS4A 3ROOB 1FH8A 2GUUA 1PV8A 3HBPA 1YNKL 1THCA 1JXKA 4KH2A 3ATYA 3NSCA 4NN6C 1VFTA 3A13A 5I76A 5CBIA 1MFDL 2CESA 2GAZB 4G6CA 4QYAA 4MMXC 4P8WA 1U5HA 3RNQA 1ITXA 2XV2A 3AG1B 3C09C 3EYUH 4PJ7A 3CC1A 1UD6A 3S1XA 4HLZG 5EPMA 2VEGA 2ZF9A 1ZE3C 3ARSA 4K15A 2WIIA 3NDZE 1EC8A 3FCBA 1OFPA 1FL5B 3KWTA 1VD6A 1RI8A 1M01A 4APXB 1JZ4A 1THFD 3D5HA 4MNKA 3E2QA 4R27A 4O2EB 4QXGL 1MG2C 4U1KA 1NGPL 4HFWA 4LRIC 1JZ6A 4M5SA 2D9QB 1QO5A 1SEQH 2AJXH 3FVMA 3SBFA 1NBVH 4PH8A 4YBLB 4AVJA 3QFJD 3CYJA 3NO3A 4K23L 1VFLA 3QR1A 3NPWA 1UKPA 2ADIB 1E90A 3Q01A 5CN1A 4QLLA 4KRLB 3SYCA 4ZPVA 5EUOE 2DL2A 2E56A 4BKTC 1QPRA 3T04D 4UNLA 3LZFL 2DFAA 2XGZA 4ZMTA 3X1EA 4M61A 1AZBA 3BFQG 4G7FA 4ALDA 2IF7A 2XUWA 2VDQL 1XL4A 3B7RL 4XGZA 1YDVA 3K30A 4CCCA 4K68A 3K4ZA 5F9OH 5AW8B 1KIPB 3BUDA 4HUWB 4QHKI 5EU7C 5CN3A 2B15A 4BFOA 2ATKB 4LOFA 3OC5A 1AGCB 4I5BB 1IT8A 1E55A 4NCDA 1ASQA 4JR5A 4X6BB 1QLEL 3TPKA 3P5YA 3NG3A 3QTPA 5REQB 5BOEA 2QFRA 4K7PH 4KDWA 1BJMA 1YPZB 2VUYA 4YH6A 2R69L 1R19A 4LEXL 4UT9A 3P2VA 4PG2C 3T3PE 1NBCA 5CSBA 1YNKH 1TB3A 4LP5A 4PCKA 3PNRB 5K9CA 5JYMA 3UCDA 5CJNA 4ZXBC 3O2WH 1U58B 3NCBB 3EDEA 4XNMB 3T6ZA 4QNWA 5BYWA 4LAMA 1QX1A 3M8OH 2Q8AH 5HGHA 1UCBL 3ARUA 2F2KA 3NBNA 5DT1L 4PYSA 2FBRA 4O58L 1T2JA 1BGXH 3K6OA 1W31A 1EDYA 4LLWB 5L8KB 4HWZB 4PFMA 1JK8B 3ZOAA 3SKUD 1OJXA 1LT7A 1NBQA 4Y7OC 3FW6A 4HZAA 4ZNEE 1DHPA 1BZQK 5I1LA 1RIHH 1YLVA 3QGVA 4IOIA 4R8WH 4TL4A 5C0RL 4MPQA 2PW1A 1E28B 3MQIA 3RIAK 4E42B 4WEMB 3PBYA 4HZLA 3MJGX 2XINA 2ZZ2A 1EIXA 3BISA 1E9OA 4FKEA 4KK6C 5D1XE 1GGUA 4L56A 1FIGL 1NANH 1Q9OB 2B59B 2H0PA 3EJJX 1GVQA 3CMJA 2NY2C 1ZIAA 4YWGH 1QTPA 3APDA 1OFRA 1WTLA 1XYCA 4FQXD 1OO2A 5FF6A 3BOFA 2XOTA 3DG3A 4C6KA 3CZKA 5BU9A 5MHBA 2A9NL 3MACH 2FDBP 2MSPA 2Z31A 1A6WL 1A3XA 2IBZY 4G9FA 3EHBC 3MV9A 1JFHA 3EJRA 3WIHA 4HV8B 3ESMA 2N7AA 3ZDXF 3G77A 1Q0XH 2YSSB 4PCPA 2ICWI 4ENLA 2WXOA 3MY9A 1KXVC 2DQJH 3BMWA 4DZHA 2QSCH 3W7GA 3DRQB 1BSLA 5CP7B 4ZQMA 3A22A 3FFCB 2VDKH 1C5BH 4M43L 2O6FA 2JKLA 5F6IC 3W7DA 4G9FB 4LQ1A 1VPOH 2ADFH 1XLLA 2WTPA 3K7UA 2C1PA 1XX1A 5T5FL 1NIDA 4H8VA 5GRVK 5IF0A 5EEUA 2EACA 3DKHA 5MENB 2AFNA 4QXGH 4X7CC 1AD4A 2BBFA 5IFJA 4U05A 5AECA 3GLCA 4QMEA 3VA6A 4A68A 1NFAA 4HZLB 1RZJC 4XAGA 1OZTG 4KI5D 4YBQD 5A6AA 2YHGA 1F05A 2BW4A 4KKCD 4UTAA 1I4FB 4BQBA 5E0FA 5K9KA 5K93A 4JQIH 2TSAA 1VGKB 4MDJB 3T0CA 1W3TA 2VM4A 2UY2A 2PCEA 2VGGA 4JGDA 3IFPA 3VM7A 4XKYA 2XYCA 4FHAA 4G8GA 3HC3H 4B5TA 4QHKJ 1XG3A 3GSMA 4E3TA 2WMIB 3KLDA 4EWND 4EVNA 4NGHH 1RJYB 4N0UB 4Q6KA 4G8IA 5IVZB 5CGBA 1W8NA 3KHOA 5BRBA 3NQ6A 3RPIA 3GG7A 2RGSA 1S9YA 4AYBA 3MANA 1PCWA 1BVOA 3DSNB 4YSCA 1DOSA 4LUSA 3EJYC 5HULA 2X4PB 3RHWF 4N2FA 2HTKC 4FJYA 3CO4A 5E5MA 4O13A 1T0MA 4MCZB 4F2MA 1BGXL 1XB3A 2WSQA 4GY0A 4BEUA 1OB1A 3QEQA 3TEYA 3BQUC 2E3ZA 1EGJA 3L7EA 3GR8A 3IV3A 2IMMA 2N56A 3NEVA 1NCIA 4HNCA 3E0IA 4JRWA 3SDXA 3FTGA 4MKVA 3OQ3B 4F2MB 1R3HA 1AH4A 5DC2A 3TXAA 3C5SA 4J3OF 5IVXF 1JZDC 1Q72L 3BI9X 1KGIA 2YXXA 2NYYC 2RCSL 1Z7JA 4Y9CA 4M6ML 2GGEA 5LXXA 3WMPA 4GUPA 3DHMA 4D2JA 2OQJB 3W7LA 1S9YB 1A7QL 3H0TB 4CBZA 4RPQA 4XNZC 1P48A 1NGWB 5FYJL 5TDNB 5B1AB 2DQIL 1GY1A 4EVNB 4F8PA 4YDVB 4OI9A 1V05A 4TLSA 3NEHA 3CUXA 1P4IL 1PKOA 1P1ZB 1YNYA 5BW7A 4ATLA 3L4TA 4MLIA 2NY4D 4XNUH 4GQ9L 5HBBA 4HFWB 3SDXE 2Z34A 5JORA 1XIMA 2Z92A 2JMRA 2ZRYA 4O28A 3WQ6A 1Q7QA 5IMMA 2JEQA 3LNPA 1A9EB 4DHGA 1DE5A 3G6MA 1G6RH 2VDRB 4NQQA 3K6SB 2QKIA 1DEEA 4U1GB 3FUDA 2ANUA 3CV6A 4CN4A 3CWOX 2XSKA 1LNUA 4PMFA 3CT2A 2YQBA 5DZLA 3DVGA 4F37F 4M6UA 1RPKA 2GQHA 4Q7BA 3W1ZA 3KCPA 4OQTA 3QW4B 3LCXA 3TCTA 4MS8D 1X3DA 5F7MC 3I7QA 3I50H 4UTBH 1TRIA 3SE9L 2ATMA 1DDHA 3BUIA 4U1JA 4UAOB 2VC9A 3FTZA 3C5QA 5BWAA 5DJZB 1CVRA 5LQBH 1FWGC 1GUVA 1ZPUA 3FYPA 1OD9A 1FNLA 2N01B 3MLXL 2NLJA 3VFSA 4QAWA 3NGJA 4X5QA 4HOXA 2FB4H 1O6SB 2IAMB 4MA8H 3O6CA 4ZA0A 1NFDE 1RV6X 3K0WA 4W70A 2OJPA 3RLGA 3H7BA 2AK1H 5D4YA 2F9RA 3BTNA 2ZOLA 1CXHA 2E5EA 2NZ9D 5F9AC 3W0WD 1YJDH 4DN3H 4Y19B 4PV8A 3B9NA 4ZEPA 1CI1A 2Q5BA 4H01A 3VIPA 4Y90A 3EYQC 1G4SA 3E2VA 1YYML 4XRCA 1Z9OA 3IE4A 5BRQA 3BG3A 4H4IA 4BJLA 3M6YA 1DSFL 1G94A 4F58H 4UWMA 3MLUL 2QDVA 3QDAA 4XO9A 3U9UB 2CR6A 1GYWA 1ZP3A 3FSOA 1OVDA 2VZOA 5IT2H 1TJ1A 3D51A 3B9AA 1Y18B 5IMOB 5B1KA 2VM3A 1U36A 4DM1A 4FIQA 2EYRB 3PIQB 5E00B 3GIZH 4BSVA 2POTA 2V2WA 1HYSD 1UM5L 1J4EA 3VI3B 4X0KA 3G1YA 3HFYA 4PJGF 2DI7A 3GEWB 3ALXA 4YVVA 2CO2A 1QFOA 3C6LB 3L5XH 1B3WA 4DWSC 5HGHB 4PWFA 1D5XB 5C0CA 2GT9B 1RERA 5AW4B 4M7SA 3CLEL 1F13A 3K5RA 5DD5H 1AHKA 1D5IL 2NQZA 3WY4A 3LRMA 4KT2A 1IXOA 4IJ3B 2YR1A 4JQVC 1D5ZB 3FQWB 3D33A 4GP5B 5CHNA 4JDVA 1IGCL 3Q3GB 4LBAA 1KCUH 1V3JA 1NTHA 1U1HA 3PBVA 1FZMB 3D39B 1ZCCA 4XK2A 3NCOA 4Y1AA 2CO3A 4S10A 2X89D 4WUUD 1FYTA 4G80B 4X6BA 1W5PA 3G5WA 2C0AA 2OV0A 3GSVB 3KPNA 5HDRA 3KPRD 3VFOA 2BDNH 2ATAA 3D46A 5FEZA 5J5DA 2OZNA 3L3JA 1E51A 1XKJA 5I6XB 3ITCA 3L54A 2WB5A 5HHQB 2QR0B 1P1MA 1WG3A 4UQCA 1DLFH 2C4FT 5AVZB 1DL7L 1NCHA 1KZYA 3HE6B 1LOLA 3SCPA 4AVKA 5J5EA 4GC3A 4KKAC 3WF0A 3C0JA 5TPWL 4PVLA 3RVWD 2YL9A 1OADA 4P06A 3GMNA 3JUGA 5EYWA 3S8HA 1VCGA 1NOAA 1XHHA 4R7DB 1V0NA 1OXYA 1FXPA 1KNWA 3JVGA 5DZJA 4FAMA 4TRPL 3NQFA 2EDYA 3ABGA 4ZPTB 3V6BR 2A6JA 5ALBH 2YJQA 1PO9A 1BD2A 4IGBA 2AGTA 3V9FA 1FNGB 1CICC 2HXTA 1Q9LB 3DURB 1NLDL 4NFDA 1E3ZA 1HS6A 1TETL 1UB6B 3ZMEA 1F8TH 4K73A 1EX5A 1YYAA 4GXVL 2QTEA 2G4EA 1OGAE 5EOCL 4AKOA 2WNXA 4JHMA 4NT6A 1EFQA 2GTWB 2HLFC 3BVNA 3SFWA 2HK0A 1X7QB 4PCTA 3VILA 1UZ6E 1VRSA 1AQMA 2LU5A 4XN5A 4ABUA 1E4MM 1KRBC 1QW7A 1HQ4A 1UOLA 2ZC8A 3CV7A 5I5MA 1ZBWA 4ZMGA 2QMJA 1IGTA 1MREL 5CD3A 3SCSA 4DXXA 5IB5A 4PS7A 1UKSA 3OP2A 2NTFA 1XZ0B 3PWJB 5JO5B 3OJDB 3WFBL 4C55A 3DFYA 4Z2JA 3JV0A 2FYVA 2IPKB 3KW8A 3IVKB 1UR9A 3OLGA 2J13A 1VCBC 5KANG 4RMQA 4IIFA 4NC1E 4IHOA 4X7TB 1SN2A 4JR9H 4PGDA 1EVUA 4JDBA 5HK4A 5D7KD 1XR8B 5LNGA 3CZ8A 3AMGA 2AVGA 4UOJA 4FG6C 4G3YL 4P3CL 3DOSA 5C0IB 1Z0NA 5C0BB 1T4KA 2IAMD 1BBJB 1CK0L 3HTWA 4DKTA 1E4XH 4JRFA 4BA0A 3RILA 1NIUA 1X1OA 3O2LA 2P49B 5CZTA 5LG6A 5F7EL 1FCCA 2CPUA 1AD0A 4FRWA 1QOXA 1U6AL 2XV6B 2QDDA 1QSED 3AUJA 3LTSA 4XCYB 3B9KA 3C5JB 4D9QE 4F2BA 1M57B 1BXVA 2VGLM 3A3XA 1IR2A 3TJEH 2UYLA 2D4DA 4HNUA 1CN4A 3QNYA 5DC4B 2E27L 4TUKL 1MI3A 2HRGA 3VH8A 1I60A 4C83A 1GTEA 5HI3C 2YXWA 3PZIA 1JUBA 2R4RH 5JR1L 3DVFA 1U95A 3ULVE 3MCKB 2XIIA 4XMPH 1PDKA 1ZS8B 3FSZA 2Q3AA 1P5UA 5D7LD 4IICA 3FJLA 1KN4H 1S7SB 4K71C 5EMYA 3ZDXB 4IMAA 4P9MH 1N8ZA 4RMVA 5TE7H 3T0WA 4BSWB 4FB7A 1GQJA 1U2YA 1FZJB 4RFNB 4HWBH 5L9DH 4F1ZA 3SO7A 4F0RA 1H11A 5HMFA 3TFCA 5BMFH 3BURA 1KCWA 4HN4A 1DUYB 3O45A 4FNTA 5I1IL 4M1BA 3WDJA 5DRWA 2QLYA 2Y3NA 1OE3A 2KKQA 2ESVB 3CAQA 3CEPA 1JPFB 4XD6A 3SCUA 3XISA 5DD5L 1YHTA 4CSSA 4C1NB 5IB4B 4P2RB 1B4TA 5FECA 5B39G 2P43B 2DDQL 1G4MA 2PW2A 1AYOA 1QP1A 3FAWA 3O9WB 2FJHB 4LMQE 4G3YH 1RUAH 4MXQC 1BD0A 4Y2DC 1OFDA 3P0WA 4MAZA 1Q9KA 4MLSA 1QRND 3G6DH 4M7KH 4E4UA 4G1EA 4X83A 1LK3L 3BOVA 1S5HB 5LUMA 5INDA 2E6YA 2XX0A 3KX6A 4I77L 2XX1A 1TT6A 1HHJB 1FZOA 5MI0B 4CDGC 2D7MA 3GHEL 4ELMF 1EHLL 1RK0B 4OZFB 5D1ZC 1JNDA 3PNWB 2Q09A 4Q9QL 3SSZA 4NPKA 3M0HA 1EIBA 1MREH 3ZQXA 5JQHC 2VN5A 5HDBF 4UBDC 3TNOA 5E4EC 1QPKA 1NIFA 2GJJA 3KEDA 1J05A 1FE8H 2A9DA 4LLVB 1HZHL 3G5XB 4X6EB 3ARED 3AS3A 3EYVA 3S48A 3V0AC 5JW5B 2DZWA 2PTZA 3W1TA 3U2EA 1AZUA 1BQUA 1W72A 1AIZA 5GISL 2GQ8A 3QC5X 4ESKA 2GQAA 3RX5A 4S1DC 2VJ0A 2PABA 4GXVH 4HX1A 5CJOH 4Q2ZB 2XXGA 4GW1B 4U1NB 4IMFA 4OFCA 2V2XA 8XIMA 2UY5A 1KY7A 4FZ8H 1RK7A 3KVLA 3D6GA 4IRJB 3NZRA 4OJYA 4GBXB 3PL6C 1AE6H 2C9XA 4JDEB 3VM5A 4U6HB 3WNPA 4PR5A 1TZIA 2JIXA 4ZQTA 1YNTA 4X4XA 1QK0A 4JQ3A 5HYQB 3PWAA 4WY0F 1CFQB 3P0GB 4Y19E 1NP0A 2YCLA 2WVVB 4PS4L 4Y5VC 3VI4F 1FFOA 4WW2F 5IOPB 3AIWA 3ATEA 3MXWL 4O1AA 5TF0A 3N34A 3WFBH 1NWUA 3BH9A 1U8KB 3V55A 5BWFA 1EPFA 4QG6A 4PI0A 2GJZB 5LGYA 3IFOA 4ZGYA 1VGEH 2XDFA 1G1OA 2VCOA 3GR7A 4NL1A 4AGNA 1WAAE 1E0WA 5DD1H 5ADOL 2BODX 3ZE0E 4G8FA 2NUYA 1FFNA 1JERA 1VFHA 4BS0A 1IEHA 4P4KD 5G4NA 4D6GA 4ZQPA 3NIFB 2BSTA 4P8UA 3G6LA 1JBJA 2YL5A 2Q86B 2BASA 2K3TA 1N55A 4XQ6A 2I9TA 1MWAA 3NAAL 3RWGB 1EA0A 4Z0SA 5CLWA 4QX4A 2BOLA 1MWOA 3A67L 4D72A 4YDIH 3GUTA 2IEPA 5FYJH 3TFXA 3B3DA 1OX6A 2BMKA 2YGNA 4HIXL 3DFOA 2JFEX 2O4EA 5BXRA 4Z42C 4LARL 2EZ0D 4PBWD 3ZBMA 3SY1A 4IRJD 3DMMD 3OPUA 3WQ8A 1CDYA 4KRPD 4OCRH 3F62A 1HESA 3MMEB 2IOOA 5LAXB 1VCAA 4J8RB 5HMEA 1HGYA 3AADB 1Y6MR 1IU1A 2BY0A 3THMH 5AKVA 5I19L 2YZRA 2R2HA 5DMKB 2GJ6B 1M41A 4NP9A 4XMLL 4LAZA 1CLCA 4KUCD 2PXYD 3IDJA 4MNHA 3F4VA 3QDMB 2OL3H 5CZSA 2RMNA 4HA0A 5GZOA 4NBZB 2OSLB 2J73A 1B4RA 4DP5X 4L9LB 2XHNA 1M7OA 4LQFH 1XLBA 4L37B 3M17A 4OZHF 3B34A 3RL2B 1OGAD 4PCNA 4WI3A 2ABAA 1UWTA 2A4CA 3G6AA 4K2UL 2QJGA 3SW6A 4Y9FA 5KBNC 4ZUVB 3OZKA 2UZ9A 2HRPL 3BRDA 2PMZA 3SY5A 2WINB 4PGCB 1RJZA 1N8FA 1QRNB 3K4DA 2E7FA 3NVTA 4MDPA 4C65A 5B3JE 5EB9A 5G5DB 3WELA 1ML1A 2FZ8A 4KXDA 5LNEA 3W7CA 2PLCA 1AXTL 1UASA 3TJ4A 3QARA 4R96A 4G1MA 4E9QA 3BWAB 4CD6A 4LCWB 1H62A 1I8JA 2XPGB 1OM3H 3UYCA 1EF3A 1R85A 3FCTB 2VSKB