1MFUA

Probing the role of a mobile loop in human salivary amylase: structural studies on the loop-deleted mutant
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
491
structure length
491
Chain Sequence
EYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHSILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords alpha-amylase, Salivary
publication title Probing the role of a mobile loop in substrate binding and enzyme activity of human salivary amylase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 176
structure length 491
sequence length 491
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2002-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1mfuA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1mfuA01
4IPNB 3CHDA 3ZR6A 2E3ZA 2WMFA 1NM9A 4JFWA 5CPQA 2V5CA 1E40A 1BG4A 4W88A 2DSZA 1MQRA 3HMCA 2EAEA 1JXKA 1AMYA 7TAAA 3N12A 1J0JA 3LRLA 1ITXA 4DWSD 1GOOA 5AYBA 1N82A 2BY2A 1D7FA 5A6AA 3AMDA 2XJ7A 1JYNA 1JZ2A 1RD6A 4MB1A 1UWSA 3FNDA 3VDCA 1JG9A 1QNQA 2UY4A 1R47A 5A6BA 1G94A 4GKLA 3M46A 1CLVA 1CXHA 1OGSA 3ZJ6A 4L4PA 4AZIA 5CJ5A 4FLQA 4QLKA 3VX0A 3OZPA 3NSMA 3L4VA 4TX8A 4PMUA 4PCSA 1WZMA 2VNCA 2QPSA 3CV5A 3AIRA 1CGTA 3J7HA 1KWGA 4F79A 1UR9A 4PEEA 1XSJA 3BC9A 3UG5A 1PAMA 3TTOA 4CN6A 2ALWA 3IGUA 5JUVA 3JUGA 1CLXA 4AYGA 4DM2A 2F7PA 3WBAA 5A2CA 3CPUA 1G0CA 1HJWA 2DIJA 4J28A 4PMYA 5EMYA 2YL6A 3B9EA 4AEFA 3BSGA 4CD8A 1CYGA 1KGXA 3VM7A 5IDIA 2WZIA 2WC4A 3MSGA 3NCOA 3W29A 1UD3A 2WVSA 4JFTA 3AMGA 1LL7A 8A3HA 3CIVA 3OLEA 5I78A 2NT1A 4UQDA 2OW6A 3H53A 4ACZA 4AZCB 3CC1A 1ESWA 1UD8A 2X09A 3AFBA 2HVMA 4ZFMA 1W1VA 3WNMA 3AHZA 3VIMA 2VZTA 1MW1A 2EPKX 2F1BA 1SR0A 2VTFA 3AYSA 2X2IA 2WCGA 4PUDA 3L2MA 1VFFA 1OIFA 5A6MA 3GXNA 4HP5A 2YKKA 1LQ0A 5EFFA 1UKTA 1OM0A 1I1XA 4AMCA 3ARUA 4XZBA 2GVYA 4M29A 4P7RA 5I77A 2WYSA 1GPFA 5A6SA 1JZ6A 3N1AA 3WH7A 3A21A 3UR7A 4BQ4A 4PYSA 4FLOA 2BY0A 3PZQA 1KGUA 4WK9A 3AI0A 4W85A 3VD7A 3D52A 2UY3A 1HIZA 1CXFA 5M3WA 3AMKA 3VKKA 2XIBA 2WPGA 2X0YA 2X0HA 1OGGA 1KXVA 3VIJA 4PTVA 3WN6A 1KBKA 1HJSA 5CXPA 5M17A 3VILA 4MJ2A 1H49A 4RE3A 3FY1A 3PZNA 3NSNA 1UR4A 1C8QA 4NZFA 4HMCA 3M07A 2VZOA 2F7QA 3BUBA 4JCMA 1E3XA 3WD4A 3W4RA 1P6WA 2GUYA 3WMSA 1TZ7A 3AZSA 3I3EA 3N04A 2O9RA 1J0IA 3WQ5A 3ZJKA 5A8MA 2DT3A 2JALA 1E70M 3A4AA 2VR5A 2QHAA 2YL9A 4KMQA 3AZTA 1JI2A 3N17A 3WL1A 1UWUA 2J4GA 7A3HA 4FNRA 3H54A 2OWXA 1LL4A 5ECUA 4DWSA 2DT2A 2Y5EA 4FNQA 1CECA 4M8UA 3KLLA 2XVNA 2VRQA 4MPKA 3WD0A 1W9BM 1HTYA 1EO5A 3F5LA 4MAZA 2IXUA 4IISA 1JDAA 3AMCA 4XV0A 2X8RA 5KEZA 1H2JA 3VIKA 2E40A 2OW7A 3APGA 3TONA 4W84A 3GXFA 4ZEPA 1JDDA 1DP0A 2W66A 1E4IA 2VURA 1H4PA 1TMQA 2J74A 1J11A 2EPLX 1LG1A 3CUHA 1NH6A 2X2YA 4S3KA 3AZRA 1E1EA 3VU2A 3ZSSA 4E8DA 3UERA 2WKGA 1C93A 1V08A 3SUWA 1VJZA 3D4ZA 1GOQA 1XSIA 3FN9A 3PZ9A 1E4NA 1X1NA 4NZJA 1XSKA 2D3LA 4AWEA 5CGMA 2C7FA 4E4PA 3PN8A 2WMKA 3K4DA 4NI3A 1XCWA 4FK9A 2CBUA 4W7WA 3NJ3A 4PMZA 1CGUA 4DM1A 3MMWA 5HNNA 1EHAA 1UD6A 4PMOA 1JD9A 3MUAA 1EDTA 1EQPA 3EJSA 4JCLA 3BCFA 1UH4A 2AMGA 4AYSA 1WPCA 4OKDA 4S3JA 2CBJA 1W3KA 1BVZA 1HP4A 1TQWA 3POCA 1A47A 1JXJA 3LPOA 1IT0A 4KH2A 5D4YA 2DDXA 3AHVA 1CPUA 3MUIA 3MV01 1CNVA 1US3A 3AS1A 1HXJA 1UWRA 3ZQ9A 3CZSA 2CEQA 3MUY1 2PBGA 2G8ZA 1V02A 2E8YA 2ESCA 1EOMA 4NX0A 2IXVA 2WKLA 3CBWA 1J9YA 3WF4A 4LPCA 4WKFA 4U3AA 1NOUA 1ITCA 1QI3A 2CBVA 1H41A 4D6IA 1TUXA 3CUIA 2QV4A 3DDFA 1XD0A 4TVUA 3M6DA 1C92A 4PUEA 3AS3A 3OGRA 1J0KA 2FHBA 1PPIA 3DX3A 5BROA 3WH9A 2GK1A 4L4OA 2ZE0A 1B3VA 2O92A 3SCVA 5BXTA 1T0OA 1XYFA 5DO8A 1W3JA 1XV8A 2WC3A 4P7QA 1SMDA 1JNEA 5CG0A 3HZ3A 4WKAA 3SCWA 1KQYA 5JIWA 1VBRA 2J8GA 3L4TA 1QBAA 4E8CA 2YIHA 1GUVA 4M56A 3KLKA 3WEOA 2DSKA 5HBFA 1GQKA 1WO2A 2EO7A 2QPUA 4LXFA 1TQTA 3WDHA 1QBBA 4CU6A 4GZIA 4EAMA 5HPCA 4W86A 5DF0A 2WLZA 3ZM8A 1HKMA 1ZBKA 3T0BA 1DTUA 2XVPA 3LPGA 1GVIA 3B8SA 3IJ8A 1LJYA 1V0MA 1R85A 3I3DA 1R86A 5EB8A 4CCCA 3W24A 5BWFA 4K68A 1E6XM 1H1NA 1ISVA 4U5KA 3ZR5A 5I3DA 4D6JA 5JIPA 4H41A 2VL4A 3AISA 1MXDA 3ALFA 5KZ6A 2BY1A 2CYGA 3SCQA 5TD4A 1PBGA 4P8UA 2G3IA 4PRWA 3WY1A 4N0RA 1FFQA 1VEPA 4GO9A 3CMJA 3TTYA 2DQXA 2A3BA 1VENA 4J3TA 1K6AA 1TFVA 3RDKA 5CSYA 2FHFA 4DO6A 5A6KA 3GBDA 3WH8A 4AD4A 2G3MA 4PTXA 4LYRA 4UQEA 4ATDA 3CHFA 2WNWA 4CVUA 4FLSA 1HVXA 1XRVA 2WVTA 2W5FA 2EPOA 1QNRA 3D4YA 3BLPX 4NXSA 3AYRA 2GFTA 4EE9A 1QW8A 2D24A 1BFNA 1HKKA 2BHYA 4AZCA 2FDMA 4H04A 1CEOA 3GNPA 3AIWA 2ZOXA 2GJRA 4AXNA 1WP6A 1Q6GA 1UQZA 1LL6A 4WJXA 5ABGA 1OT2A 3KZSA 4HPGA 2VX5A 1KQZA 1GW1A 2WC7A 3UEQA 4CKQA 1QWUA 3LPPA 4HOWA 3CTTA 5E9AA 3U5UA 4U31A 1FOBA 2D1ZA 3EDKA 2BHUA 5AC5A 1M04A 4JHOA 3ZIZA 4OBSA 3FW6A 3QR3A 4PMDA 4P8VA 1XCXA 2ZUTA 4HZ6A 2D3NA 5GNZA 3ZT5A 3U57A 1RH9A 2FH8A 2A3EA 3TA9A 4AZBA 2C0HA 4F8XA 1B9ZA 1UR2A 1MQQA 1E6SM 4EK7A 1KTCA 3GH7A 2D0HA 3IK2A 4FLRA 2VI0A 3MUZ1 3BAWA 4J7RA 1ZL1A 1E6QM 1JYWA 3ARXA 2VQTA 2XVKA 3DHPA 4JFUA 2VZSA 3BH4A 2OYLA 3SURA 4TTGA 3NSXA 3OZOA 4H7VA 3SCPA 4PSRA 1VFUA 1EO7A 3OLIA 2YA2A 4P7LA 1HKJA 3VIPA 1R33A 2F61A 4UOZA 3VPLA 3EJUA 1QVBA 4J3WA 2O9TA 1CXEA 5E1QA 2WMHA 3K46A 4F9DA 4LQ1A 1E1FA 1BGAA 2YA1A 2G3JA 2ZWYA 2OSXA 5A8NA 3OG2A 1W9VA 3VD4A 3VDHA 2D20A 3PBGA 3RM9A 3DX0A 1H5VA 1MYRA 3CO4A 3DYOA 1XH1A 5A1AA 3WUBA 4UOQA 1CBGA 5CPTA 4UZUA 3NUKA 1OINA 1HX0A 2OSWA 3CZGA 1QX1A 3N9KA 4KGLA 3W6LA 2EABA 3NDYA 1G9HA 4GQQA 4UTFA 5CZKA 1ZB5A 2PWGA 3ARPA 2VVNA 4D6GA 5BYWA 1B90A 1PEZA 1MFUA 3IANA 4UQ9A 3SCRA 1VRXA 2G3NA 1JNDA 3MO4A 5IHSA 1GCYA 3BAYA 4A4AA 1SFSA 1OSEA 3K8MA 3BGAA 5D8ZA 2XIIA 4FF5A 2V5DA 4C7DA 1W1PA 1NQ6A 1ZJAA 2WCAA 4AMXA 3AIEA 5F7UA 3WF2A 2OWCA 1K9EA 2A3HA 3AMLA 1J0YA 1M01A 3EJRA 4UZSA 1BPLB 1JAKA 1B3ZA 2CITA 5EBAA 1KCKA 4J3XA 1JZ8A 1DWIM 2FE0A 3BAIA 2O9PA 2WCSA 2YDRA 4BZYA 1JD7A 2VOTA 1C91A 1EOKA 5LA0A 1R75A 1KWKA 1WZKA 4AZGA 1JF5A 1F4HA 5DMYA 2GDUA 3WF1A 2XVLA 3D51A 2D0FA 4ZXOA 4CU7A 1DEDA 1UKSA 3NIYA 4U5IA 4WSJA 1GQIA 3GH4A 4ML4A 5GNXA 2ZX7A 3M7SA 7CGTA 1PX4A 4J3VA 4NZCA 1LF1A 3WUEA 5GQBA 2CERA 2J8FA 3AIUA 4A3YA 1W3HA 2WVUA 2EXOA 3VSUA 1UQYA 3IJ9A 4D1JA 3DYPA 4NRRA 5FL0A 1B3YA 2J7BA 1E72M 8CGTA 4Z2KA 3B9DA 2FYVA 4GIAA 3AIQA 4X0NA 1OD8A 5CQ1A 2XSAA 4A3HA 3WQ6A 3WEMA 3CGTA 4MTVA 4WSKA 3BLKA 3VIOA 1Y7VA 5M03A 2EEXA 4IUGA 3GNRA 1U33A 1GHSA 1XGZA 2GJXB 3EJQA 2PB1A 2VRKA 3NYDA 2CCRA 4RL3A 2WHJA 3PZUA 2CESA 3VNZA 4KRUA 3L2LA 1VB9A 3KL3A 3GXMA 3VSVA 2DPEA 5A2AA 4PMXA 2E9LA 2BVYA 4GI8A 3PZGA 1W1TA 4HOZA 2ZXAA 3RMEA 3WDRA 1TQUA 2YBTA 3N18A 4PTMA 3ZSTA 3EMCA 1EGZA 3SCNA 2F2HA 3K8LA 1EDGA 1HWWA 2F8QA 4Z2HA 4D6EA 1UASA 1F4AA 3CHEA 3POHA 1CGVA 3RIKA 2PWDA 1GOKA 3AOFA 3WNKA 2VZVA 2NW0A 2XPKA 5AYIA 4AZHA 1Q6FA 1V3HA 3F5JA 3D5HA 3OGVA 4OZOA 4OGZA 3VMOA 3GZAA 1UOKA 2E9MA 3LXAA 2PWEA 4DWSC 4XX6A 4E2OA 2YJQA 3RM8A 1H3GA 1FHDA 4P7NA 3GH5A 1PZ2A 3FXYA 3ZOAA 4M24A 3QOMA 1UA7A 1LWHA 1WB0A 3BUPA 1V02E 1E6RA 3FAXA 3BMVA 1HF6A 3LXBA 1QNOA 4D72A 2ZUSA 3VGBA 1ODUA 1S46A 2WSKA 3WNLA 4YHEA 3VIFA 2GJPA 5BCAA 1PIFA 5A8OA 1AVAA 2CXGA 5IHRA 2BY3A 2VZUA 4ATWA 2ZWZA 4YHGA 1QI2A 4JZ5A 5GPRA 2VX6A 3HG4A 1HP5A 5EFDA 3BAKA 1WNOA 1BQCA 2BS9A 1C3FA 4PSPA 1JYVA 4HA4A 1QI4A 1ZBCA 4JHZA 3FHAA 1FH8A 5JBDA 4TUFA 3VD5A 3LPFA 3RPMA 3ZJ7A 4UFMA 3PZIA 2XVGA 3GM8A 4AZ6A 4D6DA 2F1AA 4KRTA 4R5EA 4NSBA 5A2BA 1RP8A 1OCQA 5FD0A 4AZ7A 4PMNA 3W6MA 1TQVA 2ZX6A 2XM2A 3ZT6A 2OWWA 3BCDA 3WDPP 4DUVA 2JEPA 2JIWA 3MMUA 1JF6A 1VAHA 2E0PA 4NRSA 1HJXA 9CGTA 3GXTA 6CGTA 2VCAA 1GQLA 2DEPA 2A3CA 1V3IA 1BVNP 3VGDA 1B30A 1CGXA 2WZEA 1FA2A 1WZLA 1OBAA 5D9MA 2QMKA 1U2YA 5E6ZA 3KL5A 1ISXA 4PN2A 1HVQA 2BXZA 2VQUA 3EDFA 3SUUA 3T09A 4Q7NA 3L4ZA 4AY1A 4UCFA 2PC8A 3BUIA 2WVVB 1X6NA 2CHNA 1V3MA 2XUCA 5HXMA 5IXEA 4V2XA 2EBNA 2D23A 1XD1A 5ABFB 3K8KA 4BCEA 3EMQA 3AROA 3CZJA 2D22A 3EJTA 1C90A 3BXWA 3WDQA 3PHAA 1J0ZA 2J7CA 1V0KA 3IAPA 3VTRA 4B3KA 3QOKA 4TVCA 2GDVA 3BVUA 3ARRA 3EDEA 5D9NA 2OYKA 3AHXA 2XN0A 3PTQA 3U7VA 3VO0A 2ZUWA 2EJ1A 3DHUA 1HKIA 2BFGA 5C71A 1B0IA 4U3CA 2QMJA 1E4MM 2J7EA 1HJUA 3GYCA 1E5NA 1WCGA 4WF7A 3L4YA 4BQ2A 5DT7A 2DT0A 3B9AA 2ZXQA 3WKZA 3QHOA 2G4FA 1JL8A 2VUYA 1MW2A 2ZX5A 4KWUA 1UD4A 2UY5A 1QI0A 1KGWA 4FNSA 4U33A 3VGEA 4LGXA 2J77A 3N15A 5C8BB 2Y8VA 1SZNA 3GTNA 4JFVA 2HISA 2J79A 4HMDA 2J25A 4FNUA 3F4VA 3VIIA 1C8YA 2YLAA 3G6MA 3PZTA 1NWUA 3WBEA 4CD5A 5HDRA 1E15A 4OOUA 4IM4A 1NOWA 4JKKA 1V6YA 2RGLA 1KXQA 1LLOA 1E43A 1PX3A 4WLCA 1DWFM 1G5AA 3OIHA 1PJ9A 5E70A 2F18A 2YL5A 1R34A 3A22A 3VDBA 4P8XA 1XYZA 3AS2A 1GQJA 3CUGA 3MS8A 4Z2JA 2V3GA 1OIMA 1TE1A 2XFYA 4PTWA 2NT0A 5I23A 1G01A 2JF7A 2WM0A 3EJPA 1E0VA 3WD3A 3ZMRA 2DH2A 1VJSA 1FFRA 4W7UA 3VUPA 4JKLA 4MNKA 2VC9A 2XFFA 4HU8A 1NWRA 3L4XA 3WFZA 2W61A 1US2A 1ISWA 4AIEA 3WD2A 1V6UA 2YLLA 3TOPA 2JIEA 4B3LA 2W67A 1QI5A 2XSBA 3NDZA 3KEHA 4C7GA 4AEEA 2W4XA 1VEOA 2CBIA 2XYLA 4BQ5A 3HJEA 3S5YA 2WK2A 5DEZA 3GXPA 1Z32X 2FH6A 1CTNA 2WZHA 4MJ4A 4AC1X 2D2OA 4JIEA 3DDGA 5C70A 2WMGA 3AQUA 1DWGM 1BYCA 4GO8A 4FNPA 1VFOA 4ZENA 1CXIA 1PIGA 1EXPA 1K9TA 3T2QA 4CN1A 5BXSA 1VIWA 2EPMX 4MNMA 3ARZA 4B16A 2WW5A 1BYAA 1IZKA 2BVTA 5D9OA 1JFHA 1KBBA 2W92A 2WBGA 1NWSA 1UWIA 4B9YA 3OLDA 1LG2A 1GJWA 2IGTA 5M5DA 3K1DA 1E3ZA 4UFHA 1NWTA 4F9JA 1E5JA 2GJXA 3WQVA 5AC4A 2DSVA 3W82A 2ZUUA 1UR1A 3GBEA 3PTKA 4W7VA 2XWEA 3ZO9A 1CXKA 2V3EA 4W5UA 1E6NA 1ZU8A 2XM1A 1ISYA 4BQ3A 3VIHA 2Y2WA 2GSJA 1Q4NX 2F7RA 4Z2GA 1MWOA 5FOOA 2XN2A 4AIUA 3OBAA 1ECEA 2WHKA 1YHTA 2PF0A 4W8BA 4YN5A 1UH2A 5A6LA 6A3HA 1M53A 3CZLA 3RM4A 2YDSA 1EQCA 3WELA 4CD6A 1AQMA 3PZVA 5I79A 3BLBA 1EDQA 3SCTA 4ACYA 1C7TA 2DGAA 1H0GA 2V3DA 3VIGA 1V6XA 1UWQA 1C7SA 4CD7A 4XB3A 5I24A 1E6PA 2ZXBA 3D50A 1RPKA 1JGIA 1B3XA 4UQCA 1FH7A 4OBRA 3RO8A 3TP4A 5ABHA 2JE8A 3UESA 1GJUA 4AD2A 4TX6A 1IV8A 1H09A 1R46A 1UA3A 3MSDA 4C7FA 1OD0A 4CCDA 1CIUA 4GI9A 4U2ZA 3WUGA 1ODZA 1JFXA 3MU7A 4BA0A 2FHCA 2X05A 3TTSA 4M82A 4PMQA 1XC6A 4F66A 3ARQA 3O9NA 3VMPA 3A3HA 4CN4A 4M80A 2Q8XA 3DX2A 2VX4A 1CXLA 1VEMA 4LYPA 3CZ8A 3SCOA 4TXEA 2RGMA 2X2JA 5IFPA 1FH9A 2C8NA 3II1A 1H11A 2CKSA 5I5RA 2JEQA 3ARSA 1JZ4A 2A3AA 3BAJA 2CIPA 1WE5A 1RP9A 2ZX9A 3THDA 3VSTA 1SMAA 5A8QA 1UKQA 4DUXA 2PWFA 4PMRA 1VFMA 5BRPA 1J0HA 4B9ZA 5CPSA 2Y24A 2ZXDA 4CD4A 3WDJA 4CCEA 5LYRA 2B31A 3UETA 2WBKA 3WQ4A 1UR8A 4ATLA 4DO4A 3L4WA 3ZJ8A 3A47A 3U5YA 1V03A 4TTUA 1O6IA 3PZMA 2J7GA 3RILA 3ARVA 4H8UA 3KE0A 1R7AA 1TA3B 1W9UA 2BNJA 1QNSA 2MANA 5ABEA 1K9FA 2UY2A 5D9PA 3WIJA 4JL2A 4HOXA 5CGTA 1R8LA 3UG3A 1CGYA 3AIVA 3S2CA 4V27A 3AXIA 4EANA 1J01A 2PWHA 2D0GA 2J7FA 3BMWA 3W0KA 1W9XA 2DSWA 1GNXA 3GXDA 1NOFA 3WF3A 4HZ7A 4GPNA 2YA0A 1EIBA 4WIWA 3IJ7A 2CHOA 2WVVA 2J62A 1UH3A 3VMNA 1CGWA 2V3FA 5JBFA 2W62A 1UUQA 2JF6A 1W91A 5ABFA 1XH0A 3MI6A 1JDCA 2J75A 5IFTA 2WWCA 4D71A 1XH2A 1E73M 2EQDA 4HMEA 4MB3A 3VVGA 1KTBA 1E71M 3BVVA 2CKRA 3BVTA 3A24A 1KXTA 3WENA 3WNNA 3WQ8A 1KB3A 4QP0A 1UZ4A 3SUVA 3WNPA 3O6AA 1AQ0A 4AD1A 1BSIA 1W2VA 1WDSA 2YFOA 2VR4A 1YQ2A 1V3KA 4ZE5A 1TR1A 1ZBVA 5JBEA 4AD5A 1MW3A 3AS0A 2D73A 2VCCA 1V3LA 3LXCA 2EADA 4P8WA 1B3WA 3WMCA 2E9BA 4OJYA 3VD3A 3CZEA 1U30A 1EH9A 3ARWA 4NF7A 1BF2A 3VDAA 4UR9A 5GNYA 3VD9A 5BXPA 3E1F1 4RE2A 1WZAA 2WHMA 1R7OA 4CGTA 4HZ8A 3WNOA 3W28A 1E0WA 3WSUA 1E55A 4W8AA 2IUZA 1PZ3A 2JFEX 3CMGA 4OUEA 3CH9A 3UR8A 5A8PA 4AMWA 2ZICA 3THCA 2CPUA 3W53A 3CHCA 3AICA 1HXKA 1UKOA 3GDBA 2VJXA 4B15A 3VX1A 1E0XA 3OB8A 3WFLA 1DWAM 2XGIA 2WMIA 4JFSA 1B2YA 1FHLA 1W1YA 5I0DA 4UFJA 1UG6A 1TVPA 1TVNA 1WDRA 2WMJA 1C8XA 3DX1A 1V0NA 4HA3A 5FIPA 3BUQA 1Q6EA 1CWYA 1UYQA 5D8WA 1W3LA 4P7OA 1G1YA 1JZ7A 3VINA 3AIBA 1JZ3A 4J27A 4W89A 2WSPA 1KR0A 2QF8A 4W5ZA 3VGGA 5FKYA 4BS0A 1EHNA 3T0AA 1QHZA 2DH3A 3BVXA 4N42A 1L0PA 1IZJA 3CUFA 3WUFA 2E8ZA 1OT1A 3WEZA 3A5VA 3AJ7A 1DWHM 3PZOA 3SCSA 4QDMA 3QHMA 1J12A 4AD0A 2XG9A 3SUTA 1UKPA 2J7HA 2Y8KA 1NP0A 5CSUA 4ZE4A 3WMBA 2AOSA 4CU8A 2ZX8A 1MXGA 2Z1KA 1VF8A 3VOCA 1H0IA 2ZIDA 1M03A 2FGLA 2YDQA 1JI1A 5A6JA 4D1IA 1W9PA 1GOIA 2VT0A 1E6ZA 3OA5A 4MADA 4HU0A 4UQBA 4MAVA 1V3JA 3S6TA 2VCBA 3VNYA 3RJXA 1BGGA 1MVYA 1V6WA 3WQWA 4W8LA 1SYTA 1MQPA 1R87A 4Z2IA 4H8VA 1BTCA 5HOSA 4M1RA 3EBVA 4CUCA 4YPJA 4LYQA 4M81A 3WH5A 3PTMA 2BHZA 4QFUA 4DUWA 4Q22A 3T2OA 3MANA 3EYPA 1PX8A 1KFWA 1W9DM 4QLJA 5A69A 3GXIA 3VGHA 3QGVA 1ZJBA 3S5ZA 4IPLA 4UQAA 5E0FA 1TG7A 3KWXA 3BAXA 3N11A 4ACZB 1CZ1A 3WD1A 1BYBA 1KCLA 3BSHA 1GZJA 4ZXLA 2O9OA 1UD5A 2VX7A 4FMVA 1HJQA 4OOZA 1QOXA 2PBOA 4MB4A 3W25A 2WWDA 3CUJA 2Z1SA 1I1WA 5LA1A 3CZNA 1L8NA 4GZJA 3VM5A 5FCZA 3T0DA 3K4AA 2X1IA 3UG4A 3HN3A 1AQHA 5LA2A 3W38A 1D2KA 2AAAA 2OSYA 1QHOA 1DWJM 1HL9A 4GQRA 1TQSA 3KL0A 4CVWA 3WDIA 2PI6A 1OB0A 1HJVA 2YBUA 3AHYA 4QCFA 1KR1A 1UHVA 3WY4A 1J10A 1KXHA 1ZS2A 5A94A 2YOCA 2OLHA 3BVWA 4MNJA 1UWTA 4MDPA 3W26A 3F5KA 1B1YA 2J47A 6TAAA 2DIEA 3W27A 1FP9A 2WB5A 1A3HA 3CLWA 3HG5A 5AY7A 1WDPA 5E0CA 3T2PA 1UZ1A 1LWJA 1BAGA 4GXPA 2WXDM 1I75A 2XFRA 3T08A 1XHGA 2F7OA 1JIBA 2VO5A 4JKMA 1O7AA 3O2LA 4RE4A 4PCTA 3RCNA 4AW7A 3W37A 1VBUA 4GI6A 1QNPA 2YFNA 3A4WA 3IAQA 2UWFA 3H55A 2ZUMA 1E56A 3U7BA 1NARA 3CZKA 2DT1A 1MFVA 1GOMA 4JAWA 2WAGA 2XHYA 1E4LA 3I3BA 3LX9A 1OGBA 2WLYA 1B31A 2V38A 1FP8A 2WMIB 2BVDA 4UFLA 2TAAA 2DSUA 3AXXA 1OWQA 3WH6A 4GZEA 1X6LA 3DC0A 4XZWA 5A6BD 3HG3A 3OGSA 1E9LA 1HT6A 2XWDA 4X0VA 1BLIA 1QHPA 4X9YA 3HG2A 4TVDA 5I6SA 3TV8A 3A4XA 5E6YA 1PS3A 2QLYA 4D6CA 1CDGA 4HPHA 4QAWA 3DX4A 4GINA 1TA3A 2W63A 3FHQA 2J7DA 4DWSB 3ARTA 3A6OA 4UFKA 3TTQA 3DECA 2YL8A 5CLWA 2J78A 4XUYA 3WL0A 4D6HA 4QLLA 1WAWA 1O7DC 2CNCA 1BYDA 5DFAA 4AIOA 1ISZA 1GHRA 1DHKA 2XTKA 3W81A 4AD3A 4PBGA 4URIA 3ARYA 3A23A 1QWNA 3FAWA 4MNLA 4J3UA 2W91A 4UFIA 1V6VA 3LRKA 4HTYA 1QPKA 2BXYA 4U2YA 1D3CA 1BHGA 4EKJA 1EA9C 1M7XA 1ZBWA 3QHNA 4MDOA 2ZUNA 1BG9A 4TOQA 1V0LA 3MMDA 3BUDA 2WANA 4H8HA 1GONA 1UD2A 3SEPA 3SIMA 2XN1A 5BRQA 4D6FA 1HNYA 2NSXA 2VVSA 3UCQA 5E09A 2Y4SA 4NXKA 3MKKA 4JL1A 1CENA 1UR0A 3L4UA 5HPOA 4UNIA 4WKHA 5I2UA 3GNOA 3LRMA 3WY3A 2G41A 2X2HA 4DO5A 5A95A 3EDJA 1WKYA 1WDQA 2XGBA 4Z2LA 3ZT7A 5BXRA 4W93A 1K9DA 4MB5A 2BV9A 3RJYA 3ALGA 5FL1A 3WF0A 2OYMA 4Y7EA 3SUSA 4FNTA 1GVYA 1W32A 2WHLA 1Q6CA 4V28A 1Q6DA 2EACA 2EPNA 3SCUA 1W2PA 3EDDA 3G6LA 5A3HA 3HU7A 3D3AA 3N13A 3AXHA 1J18A 2CETA 4HA1A 4H2CA 4J3SA 4OIFA 4UOJA 2ZUVA 3VGFA 3MV11 4PMVA 3LMYA 5DT5A 1GOWA 3WY2A 4KGJA 1JAEA 4R27A 1HN1A 1NP2A 2FGZA 1GORA 1TCMA 2GK1B 4AISA 2E4TA 4LX4A 2VRJA 4AZ5A 1MW0A 4W87A 3OLGA 1JZ5A 4BF7A 3DYMA 4QCEA 3ECQA 1HL8A 1QW9A 3EMZA 5CLTA 3AHTA 2VMFA 1JYXA
chains in the Genus database with same CATH superfamily
3P5ZA 5FJJA 1UWFA 5D55A 1IGCL 1UXMA 1NLBL 5DJYA 2ZF9A 1A22B 3QHZH 3UTTA 4LSTL 5C07D 1QSED 3FU6A 4D2JA 3WS6C 2AJYH 1GYNA 3QG7H 1A14H 4PHZA 3DKHA 4M02A 2GAZB 2APBA 3WFDL 2XWTB 2HRLA 1ZLUK 3C0QA 4HLJA 3V0DA 4YR6B 4E38A 4IRSA 4L8BB 4I1RA 3HMXL 2ALWA 4NNYB 1UB6A 3UZYA 5KSAC 3PNZA 3P02A 4MRCA 4AL8C 3B0VC 3S5LB 4Z0JA 4A7UA 4JDEA 5FGBC 4JPGA 2K3HA 1VHNA 4AL8H 2YR1A 5H2ZA 1LL7A 8A3HA 1ZANL 3OGCA 5EUOE 4KXCA 3LSOA 4U1NA 4HKZB 1EO8H 1RY7B 4IKKA 2VE6A 3CC1A 1ESWA 4AVNA 1OSPH 4NQQA 2A0LD 4Q4QA 4O58L 2WBJD 2DQIL 1HQ4B 1Q72L 4GT0A 2HLFC 4MCZB 2VZTA 3IKCB 2EDTA 3L7FA 2QLVB 3GNMH 4C55A 5EBGA 4BK5A 1FNSL 5EFFA 5JO5B 3FYEB 4QCIB 4XN9A 2DLGA 1KPUB 2Z9TA 3DUSA 1TWWA 3WJJC 4Y9GA 5T3XL 4NQTA 1JZ6A 4GP8B 5MENA 3N1AA 2ZBTA 4BSWA 4EMZA 1MHCA 2W27A 1D5IH 3HPFA 4O1CA 3N43F 1FL3B 5GSRB 2QVHA 5F7MC 2QSQA 1V51A 3ISWA 5GGSA 2FD6L 3NQVA 4G8EA 4PUWA 1Z5LB 3DBPA 1PYMA 4L2LA 4NZFA 3E74A 4GIRA 3LZFL 1AO7A 1OP3K 3Q1SL 2DL9A 3I3EA 3QZEA 1AR1C 2O9RA 1EGJL 1KBJA 3D18B 3Q2DA 4KF1A 1JI2A 3OODA 3T77B 2PTTA 3RL1A 4BCYA 1LL4A 1OO2A 1QLRA 1OT4A 3WUWB 3GSQA 1BA9A 3VFCA 3B1UA 3S7GA 2GC7C 2HKHL 1EXBA 2X4OB 3QDMA 2IBGA 4HZLA 4ZAKD 3MVTA 3EWWA 3SY0B 2AQOA 5CJNA 2Z4QB 3G1YA 1SOSA 3UR5A 2MKWA 3QI9A 1I7UB 4E8DA 1P4LB 1V08A 2EYTB 2LGNA 5IM7A 1TPUA 5CGMA 3QSTA 5DMIL 3P14A 1KPRB 3MNVB 3RDTB 1TTAA 4FQXC 4UTHA 4CBZA 1W3KA 4K9EC 1BECA 1TPC1 3W7PA 4AHQA 2ALRA 2VDOL 4K37A 3ORWA 1A3QA 1C9SA 4Y4FC 1G9NC 5JHDD 2NQHA 5EMMA 3ZQ9A 2A74A 3SOTA 2IKGA 1RPXA 4XPTH 1HSBB 2DQEH 3MBXH 3ZFHA 2HJFA 2RDWA 3LIUA 1OGAD 1XD0A 1RQ5A 3WHXA 2CK0H 1YEKL 2PDXA 2CGYA 4DJMA 3E6HA 1MPAH 4G6KH 4X6CF 4WKAA 1DUZA 3B9KD 4B5NA 1EAOA 1XM3A 4PR5B 3GSNH 1G6RH 4P23B 3L4TA 4AY7A 1QBAA 2BRRL 2NV9A 4ZPVA 2I26N 2LFEA 4BCZA 2YZ1A 1K02A 4IKIA 5ALBL 3CK0L 1MZHA 3BUTA 4Y96A 5AC6A 1Z5YD 1TYRA 1FHNA 5H91A 3I3DA 3OMIB 2P52A 4YGVA 4MSSA 3GUWA 2EG6A 3T0EA 2V5RA 4A63A 1FFQA 2KH2B 3AU6A 1VENA 1YTKA 5EEYA 2O4EA 1ITUA 4DO6A 3GS4A 3GIVA 4ZUUB 3SCMD 2NR6C 1W6LA 2GIMA 3QHFH 3CHFA 5CJMA 3BRGC 3EUDA 4PGDA 1VCGA 2W5FA 3MX0A 4YDIH 3CH1A 4LKXA 3BLPX 2BOFX 1RZQA 2D24A 4IHBA 5JOPE 1O75A 2JB5L 2ZOXA 1IU1A 1JZDC 3NFPA 3KJ6H 3LD8B 4Y88A 3BZEB 4M43H 1MHHA 2VX5A 3LHTA 3RWCB 3UEQA 3MXVL 2F0CA 2IQAB 3WV0A 5ITBL 1VGEL 4H8PA 1M04A 3U82B 1I82A 1S7SB 3DHFA 2R94A 1NCHA 5JOEA 3COTA 2XKSA 5DD5H 5D7LB 4GIEA 4XD5A 3VFMB 5FXCH 3CXDL 1E9IA 1DN0A 4LOCA 1I8UA 4WI4A 1WOAA 2J8OA 3VB8A 3VI3A 2BXVA 5CKSA 4WEMB 3EJUA 1MEXH 1JFQL 3KZPA 1G1CA 4LCRA 4LASH 1Z44A 1BGAA 4QRRB 1AP2B 1AI1L 2YA1A 5CS7A 2G3JA 2Z4GA 5A8NA 3OG2A 5BRBA 1VADA 4X0KA 3ZE2E 3GMQB 1O6SB 1PTGA 5D1XB 5A1AA 1D5ZB 3PWPE 3PP3H 1OF0A 5L6UA 1HX0A 2AK4A 3L5XH 1RVFH 2NDFA 3C9NB 3IARA 3U0TA 3P4LA 5CZKA 5IK3B 1YN6A 1ZB5A 4NL1A 1T7VA 1MRQA 1BXNA 4QS5A 3JV5A 3V5FA 1XDTT 5HGAA 3TPUB 1O5DT 4JNZA 3S4SB 1YLBB 5D8ZA 4Q8BA 1BXBA 3O0LA 1HEHC 3EOSA 5AHMA 3QISA 4PRHE 3ITYA 5G2HA 2INZA 4IBYA 2X38A 1BD0A 1M01A 2JH2A 1CI1A 3HEIB 2YDRA 5ADPL 1BFTA 4BZYA 5KWYC 4LC8A 4L3CA 5BRZE 1SLUA 3DX7A 2G5BB 1KCVL 3K30A 3D47A 1UKSA 3DGGB 1E30A 1FWBC 3ONCA 1NCCH 5E8EB 1W8SA 2AEOA 5J1AB 2XZQH 4QXWA 3BWUF 3PHQA 1ZLUH 1AIFB 2MNWA 1JPIA 4WHDA 3ITXA 1PCSA 5D1ZD 2XSAA 4A3HA 4PD4J 2Y7SA 4RISH 3JTSB 5DJXA 2G75B 2K8QA 4OLWL 4LHJB 1Y7VA 4HS3A 2YD5A 1F76A 2WHJA 3PZUA 3PG8A 4UIKL 4WY7L 2EKSB 3RJQB 1SN0A 5ANMB 1U58B 3GSOB 3K8LA 4CC0A 5D4JA 3DSFH 1EEUA 3CNYA 2HN7B 1D9KA 1A6UL 2DORA 5BQDA 3F5JA 1PKQB 4JTKA 3VKCA 5J6GB 4Z7WA 1OARL 3MJ7A 1WFTA 3WXWH 3LZOA 2NV1A 4DWSC 4F15C 5TQ2H 4C47A 2R29A 3RM8A 4ONOA 4D94A 2E6YA 5DJDB 4H20L 1M6OB 3ZPDA 3T1GA 1LLZA 2BZ7A 1RZ7L 1S46A 5AVWB 3QJZA 1A7NH 1H3UA 3HV9A 4WU7A 2L5HA 2JBMA 3EGDB 1BQCA 2PPDA 2VJ0A 2E27L 4WDXA 1YN7B 4TUFA 3X3FH 3RZCD 3TF4A 7FABL 1B9BA 2PDUA 4PJ5D 5TQ0L 4S3FA 1T04B 1XDMA 4DAGL 4JPWL 2WNKA 7REQB 3WTYA 3GYRA 1OP3H 2W6RA 5KANG 4MA7L 4JN2B 2EDRA 3I74A 4R7WA 2AV1B 2WIIB 1BJ1J 5JPNB 1CFSA 2BXZA 3BXNB 3OWRA 3FGCA 3MZGB 4Q7BA 3K8KA 5KYWB 2F6AA 3BOVA 3GRBA 1U92B 1ECQA 4TVCA 3HHSB 2QPDB 1JWSB 5DEJA 1IGJB 3JV4A 3EH3B 5ESQB 4Y4KA 1PKLA 1QOQA 2OPCA 5D4QA 5F9WB 2OFQA 4XK2A 5J04A 2OX5B 1E4XH 3UTQB 2GABA 5IVXA 3TK7A 4JZNA 3CUZA 4F7TB 4ODTL 3MACL 1MN4A 2XXCB 1UD4A 1KELL 4HS6B 3OC5A 5I1EL 3PPSA 4G9DA 1A53A 1RJCA 4G1EB 4PS3A 3D3VA 5I0YA 4NRZA 2DQUH 3KYOB 3SOBL 1C8YA 4CD5A 4NZRL 3PZTA 2X9XA 5I76B 1OFBA 3TQ0A 1VLXA 4H1LA 3SQOH 4GKZB 3MLRH 1LLOA 3DDMA 3UDWC 2EDYA 1JHLH 2R2EB 1I8JA 1M7IB 4BI6A 3SGKA 1W5OA 2C9XA 5I0WA 3RFZC 1TVLA 3RA7H 3II2A 3H6AA 4KU1A 3VWKA 1B88A 4HUMB 4TOYH 3B5HA 1CU4H 4E41B 4XX5A 3G5YA 5FUOL 3WE6A 4O11A 5K1JA 15C8H 1SF3A 2DQJL 1KC7A 5D02A 2V5YA 4JHMA 4LCCB 2Q71A 3O2DL 4HAGA 3GI8H 3SY5A 4RSYA 3TOPA 3RWIB 5I8OL 1A5LC 4NZDA 4Z7OB 4ZTXA 2JJSC 3PPGA 3GXPA 4KXZH 5E2VH 4AH2B 3RGVD 1IAOB 1ZV5A 4JIIX 4S1SH 1TRIA 3L5LA 2YPKA 4TNEA 1EEYA 3REWA 2BSEA 2NQJA 1ZIAA 4P0DA 5BXSA 3ARZA 3H3BC 1SY6H 1KBBA 2XIJA 1EC7A 2WBGA 2R1WA 4L4MA 3MO1B 4UFHA 1QBML 3GHUA 4CKVX 3RUGA 3KPRD 3H2NA 4O50A 1UXLA 1KYFA 5DEFA 1SYVB 2E74C 4W5UA 2FVKA 3CFKA 3ILQD 2Z6IA 5A2FA 1BDYA 4WI3A 4AIUA 2ZZ7A 2WHKA 3V5CA 2R0LH 4Y9EA 2FEDD 5JIDA 3NIGF 3SCTA 5B7EA 3MJ8B 1WAAF 3S0CA 4DAIA 3NRQA 1YUHB 5DCBA 2Y5QA 1R46A 3SB3A 1XLGA 1KTDA 2ZPKL 1ODZA 3TTSA 2Z27A 4JN1L 2CZNA 4JFXA 5FLUA 2Q8XA 1FLTX 3SPIA 3SCOA 4GAGH 3L2IA 4YPGA 2AEWA 3ZL2A 3II1A 3QZBA 3GT6A 2YCIX 1QRNB 3QFEA 3TIMA 5FUZH 1JZ4A 2E7LC 1I9IL 2Z91B 3IUHA 5GS0D 2YX0A 2YCJA 2OCJA 3NXLA 2DZPA 2HJLB 3H4XA 5IG7B 3OOQA 3A47A 1O6IA 4G1KA 2EIJB 3AM8C 3KE0A 1G0DA 1FF5A 2NX3A 2I9TB 5IHLB 5T1LA 1FWNA 3MZ2A 3TC6A 2D0GA 2FJFA 1XLKA 4LVHB 4ALAL 5L7XH 3PSWA 4UU9B 4Q8UA 3TPKA 4DAFA 3QXAB 1T66C 1FDLL 5L4FA 5AVSB 2CNZA 3MI6A 1OY3B 4OZGF 2ZZ6A 1S5VA 4LMQI 5D6CB 3KOZA 2XH7A 2FJHB 3N4AA 1IX2A 3QYMA 4MWAD 3FQXB 2QADD 1Q3NA 3BYTA 5HBBA 3CFUA 1CFTA 5L88H 1FNEB 3CN4A 1AQ0A 4TSBL 4FG6D 1OP5K 5IB1A 1JR1A 4Y1AE 4W4QA 2PKDA 2V9RA 1WA2X 5IESH 4EOWH 3P77B 4M8VA 4IOIB 3CCHA 3TCLA 4HNOA 3US0A 4C6FA 4L61A 1PKNA 4TUKL 3SGDH 3TCEA 3QRBA 5E2WH 5AVRB 3PC0A 4G1NA 4NWTL 1FGVL 1RJYA 3WN5C 2VDOB 4XBGB 2IUZA 1PZ3A 4JRYE 3CFCH 3S3DB 3LM3A 3FFCB 4HTBA 1X7QB 3LHPL 3OVRA 3UO1L 4TS6A 4FQ1H 5IBUG 3H2OA 4OZFG 4UFJA 3SAZA 3FV9A 2BIIA 1HSAA 1GGIH 4UTMA 4MAYD 5TE4L 1IR1A 5H94B 2DQHH 4X5WA 1G1YA 2ZXEB 3NPVA 3W71A 1X5YA 3L2NA 4IQDA 4U49A 4LB8A 4BZ2L 3CUFA 1E5AA 5T1MB 4N2YA 3TW6A 3PZOA 3AVEA 1EQWA 3BO9A 2DBLH 4BH7A 2BSTB 4OJDH 2ZX8A 1PJWA 4Y5XB 4PRTA 2YZ5A 1WDDA 2OJZH 4YU1A 3QIBD 4MAVA 2NQ3A 4Z7VE 2IFFL 3RVWC 5KS9B 3RY4A 5CLXA 1TTRA 5HOSA 3EBVA 5JTWA 2YPVL 5FJPA 3M4HA 3GXIA 1UZ6F 5G55A 3PWUA 1D6EA 2H8ZA 4UQ2B 1PZUB 3QBTB 3N11A 4ACZB 1KIQB 2J88L 3R1ZA 1NGQL 3DRTA 4H9UA 3L3OC 2YC1A 4L4VB 3N40P 4P07A 3SR7A 4MB4A 4KH9A 3KVKA 3SGEH 5L6YH 3WQFA 4HQQL 4YIQB 3DVGB 2OJEA 4OZIF 1BFOB 4POUB 1GTNA 5C0CE 2AAAA 5EFIB 4M1GL 2PI6A 4XPAL 2YBUA 1DQXA 4HSCX 4AJ0A 3MJ9L 2IDTA 3AG3B 4NPKA 5IQOA 3QFDA 3R7MA 1K4CB 4MDPA 4LLVA 2FQGA 4JFYB 1B1YA 2PCFA 1FP9A 4LAOA 1A3HA 3HG5A 1UZ1A 1D5MA 2PRHA 4GXPA 5KYUB 2ADJB 3N6QA 1NCUA 4QX4A 1F6LL 2FQEA 4L4JA 4PCTA 3W37A 1XVSA 3V5OA 3VC6A 1GOMA 1Q6QA 4O54A 4G2AA 2QVNA 2A77L 1B31A 4ZNEA 1MRAA 3FCTA 3WH6A 3CZUB 5DD1H 1Z9SB 4P5MA 2XWDA 3BG3A 3WNJA 5ACZA 4FIRA 4BDVB 2H0EA 4P57A 1FSKB 3SYAA 3W3OA 1XICA 3WG7B 4OIAA 2FB2A 2CA3A 3V95A 4PB0L 3C3UA 4XPHL 4X5LA 1T4WA 2W0PA 1QPRA 1P48A 4XOCA 3S3SA 5IR1A 3CN2A 1G4TA 3DAQA 2VDNB 3ARBD 2CHDA 4QG6A 1NFIA 4AD3A 1PZ0A 5E94A 9XIAA 4HULB 2B4GA 3UIYA 4FX8A 5CBAA 4HA0A 4RW5A 3S4TA 4C6BA 4DI8A 4GO6B 2KPWA 2H4EA 4JDZB 3A64A 2RH0A 3RY6A 2DKSA 5TE7H 1NCTA 5EBMB 2CXKA 2NXHA 1ME9A 1HNYA 1OPGH 3SDAB 2Q8AL 4GRLC 4XP4H 1ZZMA 4HHMA 4O14A 3WGVB 5CGBA 2I9EA 4GB9A 1FRGL 4Y19A 1Q0EA 4FXLA 3B04A 3QM3A 2A1YA 2QVFB 2FLIA 2VLRA 1O4UA 2G41A 5EMLA 3ZRSA 4L48A 1KYAA 3QUYC 1NJ9A 1CDCA 3NMEA 2ZWLT 1UBPC 2P24A 1YUKB 4AQAA 3H2QA 5C92A 1NMCB 4A66A 4AJVA 4LAQH 5D37A 1GOXA 5E1GA 2EYRB 5A5WA 1E28B 1H5BB 4UOJA 3MLWH 2GVGA 3TZVA 3UTSB 4Q89A 1XF1A 1ND0A 1X39A 3LKSB 5F0MB 2HMIC 2WKOA 3FJ6A 4O02B 1B4EA 2FGZA 2NNRA 2XH0A 4BCXA 3OKLB 4FR1A 4ZTEA 4UI2A 1WFNA 3I2CH 2BWDA 2A9MH 3CTLA 3C6LB 2XG4B 1DPMA 3L9RB 3R8QA 5L2KD 3NN8A 4WFHE 4POZC 3H4WA 3L0GA 5A6AA 1QQDA 3SPCA 1R47A 3CIAA 3M46A 2J71A 3GUTB 4L3FA 3ZJ6A 2P5NA 4AEIH 3TZNA 5LGXA 4HJ1A 1NIBA 4X4YB 1Q1JH 1NCWL 3NIDF 1CGTA 4TXVB 1F00I 4TKWA 3DHDA 4PTTB 1UR9A 2G50A 1LRTA 3QWOA 1J7VR 3JTBA 2DWSA 3R7QA 3N4FA 5DRWA 1G0CA 4K7PX 2DIJA 2NUYA 3GRWL 2WZIA 3G5EA 3MSGA 2VISB 2JQZA 3LENA 4J2MA 1P7QB 2DV0A 3L1OL 2E6DA 2D7NA 5G5DB 3OLEA 3ASNB 4YBQD 3W1RA 2COQA 2QULA 2I7OA 5HDBF 4L9LA 2G3FA 4QTHB 2FVNA 2GLKA 4NO0B 1RQEA 1AGCB 1RK0A 2F1BA 4HK3J 5HHOD 3NM1A 4AHPA 3SDCB 2ZCZA 3D25A 5ECJE 1UATA 4CNSA 4HUXA 4DEPC 3GXNA 4HP5A 2ICEC 3PK7A 3Q4DA 5AAMA 2NZIA 3GIZL 4K5LA 4HFUL 2Y1AA 3UR7A 2VUOA 4PYSA 5AVVB 4JNMA 2BY0A 3PZQA 3PP7A 1YEHH 1TIWA 1LE9B 4WCJA 4TX9A 4PS8A 4B4HA 2WPGA 1SYSA 2NSQA 3O6CA 1OGGA 5HHQA 5M17A 3MRGB 3WTXA 4JANA 4QRPB 1HK6A 2WXJA 1KGCE 5CBBA 3W2UA 3AG2B 4JCMA 4WOZA 4YZFF 2GUYA 1MCLA 1OP5H 3D6GA 3N04A 1DZ0A 1L6YA 5I82A 3NQ6A 3N5AA 1H3VA 3M0KA 3GZQA 4FA3A 4FNRA 3KR3H 1NEPA 2H9AA 2DT2A 5C07A 1NA8A 1NIEA 3GQFA 2ZTKA 1BZDA 2YBGA 4RX0A 3F5LA 3NL3A 4C6MA 4QY8B 4CDHA 2AQ1A 4IISA 1OG6A 5B39B 4X6DB 3QDJB 2EIDA 1YEFH 5K9OA 4XNBA 4QAMB 3TQVA 1A1MB 1G69A 3FU3A 4FQHA 7ODCA 3AB0B 1NH6A 3RU8H 4DP5X 1KENH 4FXGA 3T07A 1F90H 4M5YL 4Z0BL 4QXGH 3ARDB 4H0LC 3HAEH 1J05B 3ILPA 4HXBH 5KINA 4QHMA 1IM3B 1GAFL 2V0TA 3W9EA 1H1YA 3TCXA 4FK9A 2PDKA 5H35A 4RRPG 1EHAA 2NLIA 2Q87A 4X4ME 4HBKA 3NOEA 3V9EA 4JCLA 1IGTA 3DERA 5IMKB 4OJCA 1ZVNA 1HP4A 5DQJB 3ECBB 4HH8A 1MJJA 1INEH 5I8KH 1I7ZA 1UWRA 5IQ7L 3MUY1 4HLZG 3GDKA 1TKKA 5LIYX 2B39A 4NX0A 1JNLL 3WF4A 4PY7A 3BG9A 3K74B 3AREC 5C6TL 2IF7A 3V6ZB 5FFLA 1JTOA 4C60A 3KBFA 4CNIA 4M6NL 5DRXB 2JIXB 2E59A 1DL7H 3KDOA 4Z1YA 4JG0L 1GCFA 4J8QA 3LHUA 5J11C 1CD8A 4UTBH 3V4VH 1P0SE 1TITA 3MOAL 2J8GA 1XF4A 1X8CA 3MSRA 1I1RA 1TPB1 3RNQA 5CEXA 1NINA 1BQGA 4K7PL 2ZG1A 1PKMA 5L9DL 4CU6A 5DR5L 3ISYA 1DTUA 3FU9A 3IJ8A 4KWVA 3KPSD 1FL6B 3MRJA 1IIIA 1XTMA 1JZIA 4KRNA 2OMXA 3VW3H 2EXYD 3GHSA 5D2VA 2IPUG 5B3JE 2NY1C 5D1QA 4BWWA 2DQXA 4DHLA 2XG5A 1BQHG 4H9TA 3BP7B 4GQBA 1A4KB 1U91A 4C91A 4HCDA 2VSMB 5D9SA 4D8OA 4N6EA 2FLRT 3ARFD 3AYRA 3NNTA 3BLIA 1L7IH 4Y4HA 4R90L 2VP8A 4GBXB 5MI0B 1TV8A 5DVPA 1EAQA 3KWWA 4HWNA 4A6YH 4XMXA 3TA4D 2JKXA 1U8HB 3IWPA 1ZS8B 3WFEH 3CTTA 4U31A 3VXTA 4B9GA 1TTGA 2D1ZA 1FWDC 4JKPL 3L9BA 4GQZA 2I17A 2ORBH 1X5HA 2PGFA 4YVXA 1PZBA 4C6CA 3NGJA 3TMLA 4K39A 2CRMA 3H7UA 3NEEA 5IW3A 2FT6A 1A1OA 3PUOA 5LJYH 2J55A 1J8HD 2D0HA 4EXBA 4APQA 5JHDA 1E6QM 3P5YA 5AW1B 1JXFA 1U8MA 1OQOA 4QF1A 4XKYA 2OYLA 3TBBA 2M83A 4E9TA 6REQB 3O9WD 4LSRH 4E42A 1AXTH 1EO7A 3I75B 4ZUTB 3QUZD 1OGAA 3G9AB 4WFFE 2O9TA 5CZVL 3UFYA 2B7DT 2ZOWA 2NY3D 4IOFD 2JKWA 2RFXB 3MDUA 1W9VA 3HPJA 4GFTB 1RLCL 3SFWA 4MD0B 4UZUA 2OSWA 3GVQA 2KL6A 3B9KA 3EJCA 1U0QA 3KLAB 3S8WA 4GG6A 2D2HA 2EG8A 3B06A 1FORH 3LNPA 1HXMA 2DTMH 3EF4A 4NUPA 4JHVA 2IG2H 1ZY9A 4UDUA 1U36A 4WEUD 4LAKA 3X3GH 2JK5B 1NQ6A 5C0EB 4TQIA 2ZA2A 5D5ME 4OSUL 1ZXKA 3N6YA 4LVEA 1DFXA 4LKCA 2VC6A 5CBIA 5EOCH 1SZEA 1ZVSA 2R0KH 5LBSH 2WCSA 4KK6D 3R8HA 3SCMA 1T0NA 2VOTA 3AG1B 1HQTA 5A3ID 1F1AA 4H88L 1GGOA 3WF1A 2XXFA 1I8MA 1WZ1H 4ZX3A 3ULUE 4NHUB 1PDKB 1TSHA 1Q9KA 2ZRXA 2DIKA 4LVNB 1F56A 1PSCA 1P4IL 4LUSA 3NFSL 4J3VA 1J9TA 5F4XA 5BV7B 3QAZC 4G9PA 3GTVA 2OO0A 2EXOA 2FTYA 1HKLH 2DEWX 2E9WA 3DYPA 2IWFA 4JGUA 4L1TA 2FYVA 1A6ZA 3BH9A 4X0NA 5DHVB 4H9YA 4YNYB 4K55A 4JM0A 3UEZA 3HHMA 1MFAL 1U33A 1XGZA 3CN0A 4DWDA 3FUFA 1XLAA 3QEHA 2FBOJ 2UBPC 2W94A 2HV5A 5LG1A 3W2DH 3SCNA 2YAHA 1UASA 3EHBC 3AOFA 2Z28A 1QLEL 2FX9H 5D4IA 4YTQA 3ULUC 1W0WB 4KFZC 3D5HA 5DUMH 4OLZL 4Y5YC 1E51A 3RGHA 4GUQA 4HIJB 3ULUH 2NY0B 2HG5A 4XX6A 1FHDA 2AI0H 1NCNA 3IRCA 2J44A 3DIDA 3LVTA 4DVBB 3FB7B 4M24A 4MMZB 5SWSB 1WUNT 4I0PD 5HYJE 5EOTB 4Y9FA 1QNOA 1N6QL 3P2TA 3ARGC 4D9LH 2GJPA 1TV4A 2PFHA 2ZSWA 2IQ9L 3QUML 4KOBA 4KXDA 3KM2A 5F93C 1CT5A 4L8SA 1C3FA 3AAZB 4QGYA 3EXSA 3SN1A 4KK9D 1I7TA 5HJBA 4WV1B 4RNIA 1CR9H 3IETB 4BK4A 1FWAC 4C6IA 2LABA 1SSGA 4PMNA 3MUGA 1NUGA 1LEKB 4PBDA 4FABL 2YUXA 1P84K 3H12A 4DBWA 2C9PA 4H0GA 1V3IA 1DL3A 3V4PL 3IRSA 3V8OA 1EHKB 1ISXA 3VH8G 2ZJSH 2YXMA 1EFQA 1DQUA 1KIPB 2QJHA 4XR8C 2HTKD 3HQOA 3QA3B 3MI2A 5D70H 1RULL 3K6IA 1UROA 3QFWA 4TLUA 5D1ZA 2P5EB 3RWJB 4F80A 3VO0A 1JJKA 1AIZA 1SJCA 4M51A 2MWCA 2QMJA 1E4MM 1JPSH 2ZRYA 3FPYA 3UTPD 5K3VA 3TWAA 2Y2TA 2DT0A 3QUKB 4UTTA 3GVVA 3LM7A 1FWJC 1OAKL 2J77A 5HPMA 3O3BB 4NZ3A 3MWCA 1KFAL 5KSBF 1A6WH 4ODBD 4XGZB 3U2SB 4A67A 2CLEA 4O4WA 4WLCA 1E5YA 3SIKA 1PJ9A 2ETWA 3TBYB 1OP9A 2Z8WC 1N7ML 4N2LA 2RMNA 3CUGA 4XCYB 4N9DA 2NQCA 4LBSA 3EJPA 3ZYOA 4M62L 1IM9A 1EZUA 3SODB 4U0RB 1G4PA 3LD5A 3RVTD 4U1MA 5DURB 4HAKA 4JQXC 3T4AB 1UJQA 1V6UA 1AS6A 2WN3A 4ZO7A 1OFPA 1F6YA 3AG4B 2DWXA 2WGNB 4X8GA 2CBIA 4BKNA 4PJ5A 1G7JA 2NXYD 2YBVA 4M4RB 2X9YA 5FJOA 4F37F 4FG2A 4W68A 4ERIA 1DVFC 4ONHB 4IXXA 3QH3A 4GQPH 1J86A 5IQLA 4FNPA 5DT1L 4AIZA 2EKJA 1ETJA 2DRUA 5MHBA 3BD5A 3BIAX 1IZKA 2BVTA 3E12A 4UAOB 4H4NA 5KITA 3X1BA 1H7XA 1JPTH 5DJ8A 2FL5A 4IGSA 2QKIC 2WY3B 5KYNA 4YZWA 4C6OA 2PXYD 3ONBA 3PTKA 3BFOA 1RZ8B 4H5SA 4NZ5A 1IEWA 1U1UA 5AECA 3UJJL 1X44A 4Z76A 4JAMA 1MWOA 3LH8A 4FEIA 4ENZA 4BZ1L 1CN4A 4YHYB 3AUWB 1IE5A 1RIUH 1ZNNA 3L7EB 1EQCA 4EBQL 4AHOA 3G5XA 1C7TA 3M5VA 1C7SA 3FRPA 5I24A 5AB3A 1B3XA 5HHXL 3SO5A 5BZAA 3TH6A 1EPFA 3B97A 3MSDA 1QPXA 1I9EA 1IMHC 1XGYL 3HE7B 4DEUA 1D7KA 1GS7A 4R7DA 5I8EA 2H8PB 2Y5SA 1QFHA 5HYEA 1Y65A 3FQTB 3TJHD 4GVGA 5L2JB 3P6LA 2HZHA 1MCOH 3TH4T 4EAYA 4IZGA 5I5RA 2GITA 4P2QE 2Y24A 5LYRA 2V2WB 2C4FU 3QIWB 2VDMB 2MJWA 1F3DH 2CUHA 1AD0A 4ATLA 3PS6A 2GGIA 4PTDA 3FU8A 2EAWA 3MMEA 3PZMA 2J7GA 1Q66A 1U21A 2HCZX 4GUPB 3PWGA 3O2WH 2BNJA 5FYLD 1QNSA 3DVNB 4CEXC 2CO7A 4EPDC 5KOVC 4X98A 2FMNA 4J2QA 3W0KA 3MV7E 4MNGA 4LCIL 4L8CB 1WBYA 3RGVA 1DBAL 1SEBA 5B1AB 1Q4WA 4GLRH 3CC5B 3EFDL 3MROA 1SQ7A 4KBPA 1IT9H 2OJPA 4M8QA 4J8RB 4B96A 4EWND 3WS3B 2ATSA 2OZ3A 4DVRH 3QDAA 3L5WB 2A3LA 3WQ8A 5DJ6B 5FYJL 5E00A 3C75A 3WNPA 3U83A 3WQPA 1FYHB 5ES4B 4WK4B 3KPRA 3OTRA 3KLDA 5FO9A 1GZHC 2ZDRA 1FIEA 5E56A 3LXCA 4M1DL 1KJ3L 2YQ3A 3C09C 3TA3D 3SE9H 3W39A 3ZLQC 4WJ8A 5BXPA 4NQVA 4ZFOL 4EI0A 1BVKB 3QGAC 2WHMA 3TT3L 4L6HA 4HN4A 3CSYA 4JRXB 5ESAB 1CYXA 1XP3A 3QQ4B 3AICA 4IOTA 2IADB 1HXKA 3A12A 4JTUA 1WXZA 3IK4A 3CFDB 1W1YA 3NAAH 5H37H 5K59E 4LLWB 3UYRL 4FP8H 4YUEL 1UZHA 3T40A 5FIPA 2WAHA 3AO0A 1SXBA 2Y5TB 4R33A 3H42H 2IPFA 3DIVA 4MF4A 2P5WB 4ODWB 3MRRB 3AQXA 2H3NA 4Y2DB 2VFHA 4N42A 4ORIA 1EBHA 3VNLA 2E8ZA 3EYUL 1P7KA 3X12B 4PJEF 5EBWA 2H32A 1YEDB 1CX9A 1ACCA 5TF0A 2IH3B 1YPZA 1P5UB 3BLFA 1Q6RA 3UH8A 4ZMZA 3V5HA 1E6ZA 4PGBB 4MUZA 3VXUB 4KZEL 3VXNB 4B97A 1E9ZB 1NDMA 2FZ3B 1R6WA 3FT2B 5BUAA 1QKZH 3NRFA 4TUUA 1JK9B 1BQRA 2BIOA 3WH5A 3M17B 3A4EA 5A7EA 1QFWL 1MCIA 1HTIA 4PCFA 5I9QB 3LERA 1Y1UA 4IL0A 4ANUA 3MSPA 1AGFA 2Y36L 2ILLA 1WD8A 2ODOA 2PU0A 4UUJB 3PPHA 4K5MA 1UD5A 2VWSA 4MWAA 5IKCB 3TJEL 1NFKA 2OB3A 4LIQE 3HNVH 4CNOA 1L8NA 4LP8A 2WB7A 4MCNA 1QVOA 1BKHA 3GAYA 5FX3A 3KPNB 3EFOA 3QZWB 3FA5A 1JXGA 5K9JH 1GYCA 3AHYA 3M88A 4NQ1A 4GYPC 5I1JL 3DGCR 1DEEA 3NPUA 2Y0SA 4ZFCA 4O4VA 1YPXA 5I75B 3Q9QA 3L95A 3W26A 3C0JA 3W27A 5E0CA 2E9GA 2C9QA 1ULVA 4P2OD 4F9LA 1I75A 3V35A 5AW2B 1HKFA 4PV8B 3OF6D 2ATMA 3KCPB 1AL8A 3DK2A 1AODA 3DOSA 4JFDD 5EZIH 2AKMA 3IDYB 1R3YA 1HHKB 3DC0A 4YDKL 3K0YA 3OGSA 1R3IH 4Z7NB 4MAYA 4NUMA 5L9FA 2OPJA 5E6YA 1JGUH 3E2HB 1UWGL 5EOQH 4LIQH 3FHQA 2XBTA 4UFKA 3LOWA 4IHOB 1KB5L 2PR4H 1E4KC 1NGYA 1ISZA 2ALAA 5FO8A 3T9PA 2C3VA 1IGIH 4D3CL 1HEJC 2TRHA 3NEHA 2NX5E 1V6VA 1WX0A 5TPWL 1O1ZA 3IFPB 4BFIA 3T2NL 3VD0A 4AX3A 1S4IA 4G80B 2IBZY 2W65A 4QRNA 2UY7B 2Y5JA 5FPIA 1UD2A 3MP5A 2VVSA 4R53A 1X97A 2X4TB 3VRJA 1KEML 4EN3C 4DPPA 1A0QH 5DCCA 3ZT7A 2FIQA 2ADYA 1HI6B 2DZWA 3RLUA 2AV7B 1Q6DA 4JX6A 2VENA 3ZW3A 2PTDA 2YYTA 3DX6B 2CO1A 4ODXA 3V6FA 3DGBA 3N13A 2WZAA 3KVPA 4J3SA 3CB3A 1FHVA 2ZKYA 3HB3C 4Q9RH 4PMVA 3MRBB 5DT5A 5EU7E 3EKLA 4QRUB 1GORA 1NDYA 2R24A 2E4TA 4PFMA 3BP6A 5AB2A 3BWWA 2OTWA 4TUOB 2EDBA 1AS7A 2PDBA 4JFWA 2E4FA 3T3MB 1F8MA 2COVD 4PUMA 1T7XA 1N82A 4KJQC 4PRPE 4YDMA 2OX4A 3C5QA 3Q6GL 3V6OE 3MCG1 3G2GA 1CBJA 3FNDA 1N67A 3QMSA 3EX6A 4V11A 4WEBL 3O6FD 4L4PA 3D39A 3CV6A 2YGOA 4R0LA 2YHGA 3TN0B 2FKPA 3AIRA 4ZB2A 43C9A 4ELMF 1IEHA 1VHCA 4K1WA 1SHWA 4FAAB 2XQYG 2ZVIA 3WLWC 4NN5B 3OMNB 3OHXC 5DFVC 4G2DA 4YSUA 3ARBA 3ANUA 1KGXA 4NHVA 4L1HA 1BX2B 2YRBA 2BLEA 3FB5A 3P2DA 4JDYA 2A73A 2X6MA 2YRLA 3VAEA 3M45A 2GIYA 4UQDA 4B5EA 1ZT7B 1SO5A 1UD8A 4W9IC 1TJHL 3AHZA 2HX7A 2DLIA 2JKTM 1K7EA 3V6OC 1SR0A 2X2IA 4ORMA 3UWVA 3IDUA 4YFLI 3W1PA 5DK0B 4IRZL 1EPVA 1FWWA 4N1HB 5CSGA 4P7RA 2I9LA 2WZ6A 3MBEB 4DF2A 3VUAA 3IS1X 4P06A 3VZYA 2A4AA 2CGRH 2P3EA 2Q3OA 1J2BA 4MA3A 1T1XB 1SDDA 1XIWD 4MVBC 3BICA 1T83A 3EH2A 1P7TB 3VIJA 3L3HB 4KZDL 2NOYA 2NY2D 3WN6A 4WI5A 1WKEA 4MJ2A 4IU2A 3FY1A 3PZNA 3ECWA 2J72A 2VZOA 3M07A 2F7QA 1IAKB 3WD4A 1CE6B 4XI5D 2ESVB 1FFNA 4CMHC 3WQ5A 4IMAA 5EH1A 1LP9A 4KMQA 1ZEAL 1UWUA 2ZE3A 2CA4A 4DCQB 2R6OA 4F58L 5L2KA 32C2A 1IJ9A 4LO9A 1LORA 5EU6E 5CN1A 4MPKA 2PMQA 3TVMD 1QOPA 5K1NA 3HF3A 2BGSA 2FIKA 2NXZD 4F40A 2AFNA 4MKVA 4YE4L 5FEWA 1FFPA 1BBDH 3MC5A 4DOHB 3FB8A 1A21A 1O6TA 4LLYB 5LSMA 5AOJA 1NAKH 2EPLX 2BSBA 1AYRA 4NO2B 2XVBA 4X6BB 4P9HC 5MHSE 1M6JA 4HETA 5FJUA 5CP3A 5IWLA 4H6QA 1XSIA 3S8GB 4P9HH 5LHFA 1VD6A 4H6RA 2CFFA 3GKWH 1ZSXA 3TBCA 3CXHK 1DXEA 1MWAL 1UD6A 1JD9A 4JRLA 1KM4A 4LLMA 1JTPA 4G7VH 3UBFA 4JTGA 2I56A 1K4DB 1H3PH 3FK3A 2V8LA 5ISZB 3VCLB 4YH6A 4KW2A 3DO4A 2PEVA 2IKHA 1IR2A 3PDGA 1YNLH 1T1WB 3W02A 5IV2B 3CUIA 2QV4A 1FRBA 1W80A 4M7ZB 5DZAA 3KYMA 3HFML 4N2HA 3P84A 4IPIA 5BROA 2GK1A 4EPKA 5FA4A 2ITFA 1L0YA 1T0OA 3KM8A 4BFBD 2ED9A 5EEZA 3HZ3A 1KMGA 4KDTA 5AZ2L 3JWNE 1OZQA 4ZO8A 2XX0A 5AVHA 5HR7A 2XTLA 4LL9A 5HDOA 3PVFA 4KKLC 4LHUG 1LLWA 4XVOA 3X17A 1U8QB 3UTZA 2BNUB 3H7LA 5BWFA 2Z1BA 3HM7A 3IF1A 3MYPA 5ABAA 1N3NA 1I9JH 4M5ZL 2O5XL 4EN2A 3JVGA 1QFPA 4NSKB 5I1CH 3TJLA 4AIXA 3FUKA 4MS8D 4EUPB 4UQEA 1N4XL 1EXUA 1WBHA 4PB9H 1NC4D 3A3WA 4X5XB 2EDQA 5F4WA 1G4SA 2CBMA 1DQQB 4CSZA 1BFNA 1UB5A 2HT2D 5F1NB 1CEOA 2WO5A 4RVBA 3UTTE 4L4TB 1TKWA 1M1XB 2WSYA 2DMBA 3ITLA 4Z7AA 3VFLA 3JWNH 5AYUH 3DFYA 4RZ4A 4XO7A 4HGKC 2OR7A 3CHXA 4MLJA 4KJYA 3LGGA 1OAXH 1ZWIB 4N2OA 2H0PA 1MCPL 3IGAB 4AGNA 4XPFL 1YKWA 2DWTA 4H2HA 3GSWA 3BESR 3IWVA 4XN4A 5DD0H 1P1VA 2M2DA 3IK2A 4E3VA 4YYFA 1XLEA 4ES4A 3LN4B 2XDFA 3W11D 3PULA 3TZFA 4KNUA 3NQKA 5KSUA 4UB0L 5IROC 3RTQC 1SPQA 1YXDA 3P4NB 1U8LB 4CADA 5E6IA 2AEIT 1QVBA 2R59A 3L6FA 5GS1B 3WQEA 4X2PA 1YYLL 4MDJA 2R4RL 5E8DL 2ZWKA 3FOLB 5FEXA 2OL3A 4DN4L 1ETA1 5EO9A 1JCYA 1H5VA 1R6VA 2FT7A 3K2UL 2L3BA 3DETC 1WDAA 3N9KA 4NNPH 1P1ZA 1W1IE 1W0VA 2VVNA 4J35A 1EBGA 2I85A 5D7SH 5L8JB 2G3NA 4WWKD 2Q7NA 2AGKA 3VAVA 3UXDA 5MENE 4IMLA 1XGDA 2DJLA 3PG9A 4RAVB 3IJHA 3IKKA 1P69B 4XXWA 3KPSA 2O6DA 3IPBA 2Q3XA 5T5FL 1CFNA 1QPPA 3OJDA 3T5WA 3EJRA 3NPSB 4R97C 4M8RA 4YS4A 1EFXD 1EYEA 3DH7A 3BPNB 5AYXA 2FE0A 3BAIA 2O9PA 4GSRA 2AJ3A 1JD7A 1C91A 1AO7E 1MZRA 5GRUH 1EXHA 4G9FB 4JIHA 5LLIC 1DQIA 5DDHB 4WSJA 3QPQC 2EHHA 1E27B 3L1FA 4BK5C 3RAJH 3QEUB 1LF1A 1HYRC 3W7EA 1A7QL 3OG6B 5C09D 3L65A 4S1QH 4CQ8A 4H8WL 3UCDA 5DJCA 2D8KA 3QDME 5CQ1A 1TTIA 1EIXA 4FFZL 4ODVL 4MTVA 3VB9A 1USZA 4BFAA 3IJEB 2JKLA 2XWXA 3P11H 3DUHA 3LPWA 2EEAA 3L2LA 1U8IB 3FDGA 2AABH 1HHIA 3QUXD 1E65A 1W0MA 1EDGA 1PMYA 1VYPX 3HTWA 3O9WA 3POHA 1N2RA 3EOYG 4XMLL 3QUZA 3L7RA 4MJ6A 3QP3A 1OC6A 4OZOA 4KHTH 4N24A 3TDFA 1XPYA 4L1DA 3G5ZA 3N40F 4CVXA 4ADSA 5FYKE 1H3GA 4LSUH 2A6IA 4RFOH 3FXYA 3UC0H 1E6JH 3SBQA 2H26A 4NWUH 4M1BA 1KFEA 5AW7B 1E6RA 4XPGL 1ORSB 5HHMB 3SE8L 5I18H 4Q4PA 1RHFA 3ZVHB 1F2JA 5AZEL 1ID2A 1KNWA 5FHBL 4QRTB 3NPXA 4PSPA 5GGTL 4HCRL 3U79A 3M1ZA 1J1XH 3CLFH 5HYSB 1KLUB 5FS5A 4KO9A 4QE1A 3ZE0E 4ERSH 4AZ7A 3H24A 4X9FA 1BAWA 2WQVA 2OWWA 1FO0A 5DTFA 4EI5D 1JF6A 4IRJB 1FVDB 4WGHA 3DO3A 2GFBB 1CGXA 1FA2A 1WAEA 1EJRC 4HIBA 4N9CA 2IV8A 4PN2A 5GS2D 5B4MC 4X83A 3T0EE 4ADGA 5FYKH 5CWSB 2A74C 1IC7L 3VXMB 2GEEA 1XD1A 3EJTA 1EAPA 3PHAA 3PGCB 4PGJA 1SO4A 4U3XA 5FCSH 1EANA 4UMGA 3V0WL 5KBKA 4BH8A 4TRPH 5C7HA 9RUBA 4BFEA 1KXTB 4FZ8H 4KRPB 2LQRA 3JWDL 2EJ1A 1YYMH 3RVXD 1UA6H 2CIKB 2EIBA 3FTUA 4BWUA 2KS0A 3A67L 2BP8B 1KBLA 2YCKX 3LEYL 1FL5A 3G7TA 4N2NA 5TH2B 2G4FA 3U1PA 1JL8A 2BOBB 2UY5A 3URBA 4XNQB 3WNIA 4DYKA 2L7EA 3GTNA 4MZYA 3N1QC 4GC3A 2HLAB 1TX0A 1HINL 4ES9A 4GKOA 3KVLA 4AGLA 3U6RB 3B0PA 3T0EC 1V4YA 1PX3A 4PJGB 4TVPE 5XINA 5E70A 4DETA 2F18A 3QIUD 1M71A 3MUJA 2RFGA 4I0PA 4KRZA 1U8CA 5I1HH 3C2OA 3VI3E 2FPYA 4W7UA 3KYNB 2OMZA 1NWRA 2Q20A 4MJMA 1US2A 4L9DA 1KG0A 5GVJA 4NO3A 2AL2A 3HFTA 2AK4E 3D2TA 5EKYA 2BSSB 3M47A 3FSZA 3DLQR 2F53B 1DWGM 1M05B 5GRYA 4YHOH 3EKCA 2SFPA 4HKBA 4K15A 2BC4A 1EXPA 2XIDA 1F1GA 4MNMA 5DJAA 3V7AE 3HOJA 1L9WA 3PNWB 2X30A 3STGA 4AMKH 4TVPH 4PVBA 2J5WA 3BP5A 1A7OL 2ZUUA 4Q4SA 5EU5A 4ZMLA 4UDTB 2Y70A 2QSCL 2QQ6A 2VDPL 3E5PA 4LVOC 5DHYA 2Z31B 3PY2A 2F7RA 3C60D 1G0YR 3OBAA 1QA9A 2PW1B 1UH2A 5TDPB 3QEGH 3U48A 1K4HA 3VCNA 5CP7B 4O51A 4P2VA 2PWVA 1QTYT 1R5WB 5E6RB 5J0BA 1FH7A 1I8IB 1F3JB 1I7RA 3ET9F 4BA0A 1F6KA 4UV4H 1DOSA 4J23A 3X14A 4NKDA 3ARQA 5I06A 3RHWK 4P46D 4LSDA 5JMOC 4BHUI 4ZFFA 2AANA 4WUUB 1GH7A 3NCEB 5EORH 4UT6A 2RQ8A 3BISA 4ZUVB 1ETZA 4RW3A 4M00A 4Z7OF 4E9XA 2MCPL 2EDFA 1PBYA 2ADAA 3IN0A 1R3QA 1KJVA 3QRHA 2JKPA 3OVUB 1FDJA 4M61B 1RZGA 1S8DB 1KTKE 3EYQC 5A8QA 4RLIA 2QHRH 3X13A 4OM1L 1YDPA 4B9ZA 1TU2B 3W0WB 1GKRA 2ZQ0A 4K8RH 2ZYIA 1FQ0A 3VKAA 4FADA 3I6KA 1MAJA 1LK2B 4E0RA 3OKNA 5BO1H 4F3FA 5DRZB 4Z7WE 2MANA 4OIIH 3L1GA 1XB6A 1VESA 3LZ5A 1WQ5A 4NT6A 3UG3A 3AXIA 4M5SA 2I1OA 4I13B 3GXDA 5TFSL 4W4NA 2ZADA 2G9HB 3BKML 3M1BA 3UY8A 5F6IC 2J62A 4P2RB 5JBFA 4Q2ZB 3V4BA 5IGXH 1AJZA 4U1JB 3Q05A 2CWRA 1OAYL 1GT8A 3MCMA 1QFWM 5BVPL 4N87A 4BHYA 3IFLL 5AW8B 3T71A 4KKCC 3NA9L 4AKPA 4C1KA 4PJBB 4QP0A 2HKAA 2NY4D 1W2VA 1M7OA 3GR7A 4WO0A 2PXYA 1V3KA 4AD5A 3HI5H 2F6UA 3GNDA 3D9AL 3SKNB 1UJ3A 2KZ1B 1D9KC 1B3WA 3UZQA 3GDTA 1TX2A 4WW1A 4C1NB 4PWHA 4QNWA 1J2WA 2RAMA 3NZQA 1U30A 1NGXB 5HK4A 2IDCA 3L3JA 1KV5A 5E8PA 1BG1A 1VFTA 3GLZA 1XL4A 4DBDA 2R29H 1M1BA 5I6XC 4NOBA 2EVGA 1V54B 3GDBA 1FYTA 1KN4L 3QQDA 1YQVL 3OB8A 1EF2A 1MVUA 1FHLA 4KXBA 2LE9A 1PYWB 5HJXA 4ZUWA 3MREB 3IGHX 2EKCA 4JJOA 5JQ6H 4QXTA 4HCIA 4LESA 4ZXBB 5IVXE 2E7CA 4NJHA 1QSEA 1OT1A 4Z5RB 3CFBA 2X2GA 2A6JA 4PJ7A 4W9ZA 3SSGA 4OFPA 3CQQA 1J12A 4AD0A 1QSFD 5I15L 3GMRB 1KYOJ 3D3VE 4D0CA 3E9TA 1AGEA 2QDWA 4YAQA 3W7GA 2Q7YB 3NQCA 5FK9A 2ZUXA 4O8AA 3NGBB 3LI1A 4XZLX 5KAQF 5IFAH 3CAWA 5KJ7E 2GSIA 1LT8A 5DXWA 2FWOB 4KQ0A 1TIMA 4IEFB 3RE0A 3MANA 2WXLA 4FQIL 1HFUA 4IM8A 3CL8A 3I65A 2R0ZL 4LFHG 1EZVY 1TG7A 4U3SB 3V5DB 4IF2A 4DSYA 1G5GA 1S5MA 1VPOL 2R0WL 4Y4KC 2UWEA 1AA1B 3MRQA 5I17B 1SHMA 2WBJA 1NGZB 5LA1A 4AQ8C 1B3JA 4MKTA 1LOSA 5EU9A 5HVHC 2NY6B 4M7JH 4IJRA 3ATYA 4PP1C 2YCLB 1HL9A 3KVQA 1OAUL 1OB0A 2A6DA 4K2UL 4HC1A 4QCFA 1EX1A 4PJ9C 1AQFA 1X3DA 3TA3A 2VDLL 4MKNA 1PZ5B 4U1GC 1Z7AA 4PRDA 3GMLA 4DN3L 4ANVA 1R2TA 4ZOEA 4M6UA 4H1LH 4JFHD 1LO0L 4RESB 3TN4A 12E8L 4AXWA 1O7AA 1XRFA 1EZLA 4KTEL 4KROD 2FATH 3RUGE 4ASTA 3VWKC 2PS2A 4H4IA 3BOLA 3H55A 3EXRA 3P60A 3T65A 2B3IA 3LX9A 4OZHB 2BVDA 2UV3A 3S34H 3HG3A 1AXSA 5KS9F 4TMCA 5F1SA 5C9JA 2XGZA 3UXLA 3R1GL 1H1ZA 2VGLM 4R4FL 1G9ML 4C83A 3A0OA 2J7DA 2E1DA 2VXQA 1TPEA 3Q6FA 3A6OA 2QBWA 2PW2B 3DECA 1JVLA 5F88A 2MOQA 4KKPA 2BS8A 5DFAA 1Z89A 3S4SG 4PRAB 2Q86B 1YMHA 2WXFA 4ZAKA 2W91A 4JO4L 1SHXA 4OKVA 3B0XA 4PRNB 4XPBH 4MJ5A 2GK0A 2MNUA 1U8KA 2V69A 5E4EC 1PDYA 1IHIA 2A0NA 3O3RA 3O11B 2K6WA 5E99L 3MMDA 1PZDA 2WANA 4I7UA 5DANA 1EJFA 5AB1A 2F54B 2X4UA 5EU3A 4JTQA 2VIRB 5AUMA 5HPOA 3JYBA 4KKRA 5IB5B 3BDKA 4H0HB 3LRMA 3TIEA 3LQAL 4I7ZC 4ZFGL 3I9GH 4GXVL 5K33A 3IGXA 1XBZA 5FF3A 3M64A 3W7DA 2GGJA 4BK8A 3BQUB 4KQ4L 4BFGA 4HCGA 4NRYB 2IH9A 1G7MB 4PVMA 3WFHB 1CICD 1GOWA 4GSDH 1MFDH 1KDJA 2ABAA 4XMKH 4ESKA 5JW3L 5LXXA 4P2OA 2ABBA 3AHTA 1IEAA 1QUPA 3CFNA 4WSHA 1NCJA 3OF6A 3M8OH 1JXKA 4DERA 1MHPL 3VZZA 4Z7QB 5AYBA 4JLRA 1NSNL 4JFDA 1RD6A 1UWSA 1H3XA 1JCTA 1QNQA 4LAMA 1G94A 3R11A 1TR7A 2FSEA 2OZ4L 3ZHFA 4H9XA 3L81A 1WXJA 1XXDC 3TBVA 3GMPB 1WZMA 2YSSB 3X1NA 3WEBA 3WMQA 4AITA 1XSJA 1X4YA 4HGMA 2DWEA 2QJJA 2QV5A 2X12A 3LY6A 1OJXA 2E7FA 2ZNXA 1XF5B 3VGAB 2Z93A 3MLZL 3MXWL 3HPSA 3VM7A 4IGMA 3BFWA 4AB4A 4ORZC 4LF3B 4RAHA 3LHYA 4OLYL 4C8XA 4DZAA 4LY8A 4ECNA 2AZUA 5ELIA 4DBEA 2G4JA 4HBQA 5EMKA 5FGSA 4DGIL 4REQB 3U9IA 4AM0B 4O1EA 3EO1A 4P59L 1VFFA 4U6HB 5MEQB 4XNZB 5C7ZA 3N85H 3JW7A 1YEEL 1EB3A 5I77A 3T3PE 5CD3B 1PKOA 4O12A 4UNLA 2VZ3A 3TO4D 1BVOA 4OU3A 1KXVC 2CNYA 1XCQB 2Q0ZX 5E03A 2N59A 2UY3A 2BOEX 1HIZA 1V93A 2Q2LA 3EWYA 3AY4C 4DF1A 1MAMH 2WKJA 3K72B 1KPVB 2P9RA 1TRDA 1QR1B 2NW2B 3RIAF 4XVSL 1HJSA 4MY9A 4RE3A 5KVEL 1CIDA 1S3HA 3CBJB 4HMNA 3P0GB 1ZSDB 1P6WA 2DVTA 1I85A 1TDQA 3IB4A 3L3GA 4FN0A 2VR5A 4MA8L 3VFTB 3GSXA 3B0UX 4QISA 1AKJB 5FFGA 4UM9B 1B9KA 3W9DA 5I2IB 1TFHA 2R56L 2VRQA 2Z8SA 1R3JA 1KJMA 3SIZA 1VSCA 4CBPA 3SPGA 1N64L 2E40A 4HCHA 4W84A 4BUGA 4WZ9A 1CG9A 1DJWA 3BFQG 4GG8B 3GIYA 3NQ7A 2QUVA 1IBGH 3AZRA 3VU2A 3CO8A 2NZ1A 3UERA 4ZNEE 3W85A 1NAML 3DX9A 2XKNA 4NZJA 1LTDA 4E4PA 3CUPB 2X7WA 5D2LA 1RK7A 1ET8A 35C8L 3GMNB 4K5NA 1BLNB 2ADGA 4J3OC 2P45B 3MUAA 2ADIB 4QKXB 4LRNH 5DY3A 3EOAB 4OKDA 4J3OH 5IQMA 3CVBA 2ZKHL 2YEZA 1NL0L 4MXWL 1LOQA 2C79A 4JFPB 1CNVA 1CD0A 1HXJA 5LDUA 4UTIA 2IS7A 4HFWA 1OTTD 1G67A 1K8ZA 4OD1H 3CBWA 4PW9A 1GPOH 3BN9C 4KRLB 1H41A 3WEXA 4TVUA 1MIML 1ONRA 4AWSA 4PUEA 2FHBA 3DX3A 1IBBA 5A7BA 3SCVA 2B7PA 5ITFB 3QT2A 1U3HC 3VI4B 2QFPA 1XIWA 4HSNA 4YHLL 4YHZL 1BBJB 4Y19E 3TURA 2HXTA 5CCKH 3BHBA 2VLRE 3MBWB 2FFIA 3DUUA 4ERAA 3MY9A 4X6DF 4XAKD 1JHKL 1HQRB 5ICUA 4GZIA 5C0AB 2DB8A 5DF0A 4X99A 1GVQA 4WTXA 4KTYA 3RP1A 2FFCA 4D6JA 3DARA 4XIAA 3ALFA 1CD9B 1FNGB 1PBGA 4GYKA 1I1FB 4FKHA 3TSBA 4HJJL 4LSPH 1K6AA 2VM3A 3VWJD 1GS8A 5DC2A 3E49A 4ADUA 3TVMA 3S5NA 5LHEA 1URLA 3GBDA 2FB4L 1MRDH 1K03A 2F8IA 4JPKL 5JDSA 1MFEH 2XBDA 3RZCA 3R25A 1HKKA 3QPXH 2X0WA 3ZKSD 1XGUB 3RWEB 1R0AL 2GJRA 1WP6A 2RD0A 5KVGE 4QWWC 1OT2A 2DWDA 4HISA 4N0CC 3LPPA 1MI5D 2BHUA 4OU1A 3OZMA 1MNSA 1KGJA 1ZP4A 2D3NA 5GNZA 1F02I 4KVNH 1MCEA 3U57A 4WW2C 1FC1A 3P9WB 2J56A 2CXEA 2C0HA 2NVAA 4F8XA 2OMWA 3IJSA 2PPGA 4JY5H 1SUXA 3MGOA 4NKCA 3BAWA 3G5VB 3MBDA 1XB8A 4IP4A 2R1XA 3TBTB 1P0KA 2VQTA 3DHPA 2OK0H 5F2IA 3K91A 5SWZD 2FJGA 2FR4A 4FJYA 5CPLA 2X4PA 2GY7B 4I4WA 3G6DL 3QJSB 4UOZA 3VPLA 1OABA 2AJSL 1CXEA 1X4ZA 4F9DA 4UTWA 1LO3L 3Q2WA 3KGTA 5C08B 4HAFA 4ZJ9A 5KAQG 4Q6IA 2GSMB 2ZWYA 2OSXA 5H4YA 4LPXA 2B14A 4IU3A 5F44A 3S1VA 5C9ZA 2XV0A 4POCA 4U3HA 4UOQA 5CPTA 3W83A 2Z0UA 3LEXB 4DZBA 2BSDA 1E7VA 2TMDA 1XH3A 5KVGH 1OLZA 5JHLA 5G4HC 4YSRA 4GWEA 5BYWA 3D7PA 3VQMA 3C5XA 3CH0A 2LR4A 1GCYA 3FKUS 3UJTH 1INQB 4C7DA 4PLNC 3JZ7A 4MFDA 3LQLA 5FECA 2AK1L 4OVXA 3AMLA 4ROQA 3APMA 1OHZA 3D85B 3GFUA 3FH5A 3AYVA 1QZNA 3IU4L 2HE5A 2VDRL 4GOAA