1MFUA

Probing the role of a mobile loop in human salivary amylase: structural studies on the loop-deleted mutant
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
491
structure length
491
Chain Sequence
EYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHSILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords alpha-amylase, Salivary
publication title Probing the role of a mobile loop in substrate binding and enzyme activity of human salivary amylase.
pubmed doi rcsb
source organism Homo sapiens
total genus 176
structure length 491
sequence length 491
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2002-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1mfuA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1mfuA01
2NT0A 2X2HA 1LG2A 4H04A 3LPGA 4AD2A 3WDQA 2JIEA 3WMSA 3QHOA 1X6NA 1NWUA 5JIPA 1UR9A 4PMNA 4JFTA 5CJ5A 3AHYA 5E1QA 3WNPA 4AIEA 3ARWA 4CKQA 3WD2A 4LGXA 3SCWA 1UWSA 3CO4A 3N11A 2VZSA 4MB3A 2WPGA 3WF0A 1RH9A 4P7LA 3VDBA 4J3VA 4W89A 4H8VA 2B31A 3OIHA 1ODZA 1WDQA 4M82A 1RD6A 3PZQA 3CZGA 1W1VA 1GQJA 3VKKA 3WFLA 2BV9A 3HJEA 3ZJKA 2CXGA 3L4ZA 5A6LA 2VI0A 3W81A 1NP0A 1HL9A 1CTNA 1JXKA 3ZJ7A 2FH8A 3DYOA 4W84A 4ATLA 3DDFA 4D1JA 3RPMA 1CBGA 1UUQA 2DSWA 1UZ4A 4PMRA 4D6IA 1W9PA 2F7QA 4AXNA 1C8YA 1V03A 1JDAA 1CENA 3CIVA 1HJUA 5HBFA 1GJUA 2ESCA 5FD0A 5A2AA 2G3IA 4DUXA 1JZ2A 1W9VA 1OD8A 3UETA 4AD4A 4GI8A 2UY4A 1ZJAA 4CCCA 5A6KA 4R5EA 5A69A 4TOQA 3U5UA 2YOCA 1W32A 1CGTA 2PWEA 1EDTA 2Y5EA 3A24A 3IANA 1UD2A 4UZUA 4PTMA 2XN2A 2GVYA 1DHKA 3W29A 1GVYA 3CHDA 4GINA 2O9OA 3AS3A 2D73A 1ZBCA 3BAWA 4W5UA 1EO7A 4PTWA 2BHUA 1HJXA 1T0OA 3PBGA 3T0AA 3GBDA 5DFAA 4B16A 4ZE4A 1NP2A 1V0LA 1XYFA 1OSEA 2OLHA 3SCUA 2VO5A 4GZEA 1UA3A 4Z2HA 3CZEA 3ARQA 3VGHA 2WYSA 1WP6A 3T09A 3KL0A 3KWXA 5A8QA 1PAMA 1LG1A 3MUZ1 1L0PA 1ISZA 1GPFA 1V02E 3KEHA 1E0WA 1CEOA 1FFRA 2UY3A 1KBKA 4MNJA 2BFGA 3BVXA 3TA9A 1E43A 1W3KA 1M03A 3UERA 1VF8A 1WKYA 2WCSA 5E09A 3GNOA 1FH7A 1IV8A 1I1XA 4MJ2A 1E71M 5CSUA 5I3DA 2YLAA 3BVUA 1CWYA 1HL8A 3TOPA 3ZR6A 3T0DA 3VGDA 4ATWA 2XM2A 3DYMA 3A4WA 2WMIA 4QFUA 4NF7A 4OOZA 4YHGA 2PWGA 1CGXA 2WWDA 5I23A 3AJ7A 3W27A 2DEPA 1C8XA 2Y8KA 1EGZA 3BC9A 2WMIB 1MQQA 1AQHA 2X2YA 3WQWA 1WZMA 3F4VA 3DDGA 4CUCA 3ZR5A 1DTUA 2C8NA 4GO8A 1V0NA 4FNRA 1E6RA 1ECEA 5FOOA 1W1TA 4KGLA 2GJRA 1M04A 4U5KA 3BGAA 3BVVA 1MW2A 1W1YA 1HP5A 1QOXA 3QR3A 1BLIA 5EMYA 1MW3A 3VNYA 2PWDA 2PF0A 3AIBA 5HOSA 3AXIA 1B31A 1DWHM 1HTYA 2D2OA 1K9TA 6CGTA 2J25A 2TAAA 4WK9A 3WFZA 3AIEA 4JFSA 3BVTA 2BY0A 5M5DA 3SCRA 2F7PA 1O7AA 5CPQA 4F8XA 2XN0A 1EQPA 3WQ8A 1OT2A 1CXEA 4H8HA 4D71A 4EK7A 2W61A 3NUKA 2XUCA 3HG3A 4IM4A 1KXVA 4ZENA 1JFHA 4UCFA 1QX1A 1V6YA 3N15A 4H7VA 1FA2A 3PHAA 4EE9A 5DT7A 1B3ZA 1KGUA 1C7TA 2YBUA 1UQYA 5A6SA 3DX0A 1ITCA 4KRUA 1OCQA 4JKKA 1E6ZA 4PMVA 4UQBA 1HNYA 1K6AA 4IISA 4Q22A 3ARSA 2W62A 2WANA 1KCLA 1UOKA 5BXRA 4A4AA 4DM1A 1PJ9A 1C8QA 3SCNA 3WN6A 1OIMA 2WSPA 2Y2WA 3MUAA 3CPUA 1UR4A 3AZTA 1QNPA 3PZVA 4W93A 4ZFMA 4NI3A 4CN6A 4WKFA 1R34A 1VBRA 2VCAA 1BG4A 4J3TA 3FY1A 2GDVA 3JUGA 2VT0A 1WCGA 4AZGA 2WCAA 2CBUA 5AC4A 3WH9A 4HZ8A 3TTOA 4PRWA 1G01A 5A8PA 2ZX8A 5A6BD 5JUVA 4CVUA 1G1YA 4UR9A 1AVAA 3UG4A 3BAXA 1C93A 1BHGA 2QMKA 3L4YA 2PI6A 4P7RA 4FF5A 2D0HA 4TXEA 3DX1A 1EIBA 3TTQA 1UR2A 4UQCA 4D6EA 4WSJA 4PMDA 4MNKA 2AAAA 3IAQA 3BMVA 2YKKA 1D3CA 5A6JA 1WZLA 2XWEA 1FFQA 1Q6EA 5DEZA 5D9OA 3BSGA 2CKSA 8CGTA 2ZUNA 4V27A 2ZXBA 4M1RA 2OYLA 3FN9A 4AZHA 3WENA 3A23A 4AZBA 1LWJA 3PZMA 2YA2A 1Q4NX 4UNIA 5A95A 5AC5A 1DWGM 1HKMA 1KQYA 2WMHA 1MWOA 3NCOA 2J74A 4UQ9A 3BAIA 4GO9A 2CKRA 5D9NA 2FGZA 1HKKA 4AEEA 1OB0A 2OSYA 4E2OA 2UY5A 4N0RA 1R86A 3MSGA 1H49A 2W91A 1I75A 1KWGA 4AD1A 2WBGA 4TVDA 3BXWA 2IUZA 3WY2A 1E6SM 1E70M 3OLGA 3MU7A 2WVVA 2EQDA 3G6LA 3GXDA 1E0VA 4ZXLA 4DWSD 4CD6A 1KGXA 3W4RA 5BWFA 1XSKA 2WVVB 2XN1A 4JAWA 4CCEA 2WAGA 2EPOA 1GZJA 1LL4A 3BLKA 1SMAA 4P8UA 1QNQA 1HJWA 3OLDA 3WD3A 3GXPA 1WE5A 2J7FA 2FYVA 1BQCA 3WBAA 5JBFA 1QWUA 4TTUA 2WZHA 4HP5A 1TMQA 3CUFA 3VMOA 2BVYA 2DT3A 4JKLA 1HX0A 1XC6A 4X0NA 3AS1A 1V6UA 3VD3A 3VSUA 2WKLA 3M07A 5A3HA 4LYPA 4UFHA 3CZ8A 3MMWA 3WEMA 2XPKA 3LXAA 3MI6A 1VJZA 2YL9A 3NSNA 1UR0A 3NSMA 1J12A 2OYKA 1O6IA 2F1AA 2PBOA 1PX4A 1UR1A 1VFFA 1FH9A 1BFNA 1J18A 3ARTA 4PYSA 4DO5A 3SEPA 1KTCA 4AZ7A 1KXTA 3PZIA 1GOQA 3NDYA 3IAPA 1E0XA 4PTVA 2VUYA 1MXGA 2J75A 3EJPA 1U33A 1ZB5A 4OZOA 1H5VA 2WHKA 1UD5A 2E4TA 1C3FA 3A3HA 2XVPA 4J27A 1XH2A 2W4XA 4P7OA 1F4HA 3W26A 1J9YA 5E6ZA 5FL0A 4IPNB 4IPLA 1BGAA 3S5ZA 2VR4A 4GI9A 5GNYA 1JYNA 2ZX5A 1HKIA 2VZOA 3WNKA 1CXLA 3EJRA 4JFUA 3ZIZA 3ARRA 5KEZA 1MQPA 4FMVA 3GXTA 4TTGA 4NRSA 2HVMA 4W86A 3UESA 5A2CA 1Z32X 1R47A 5CSYA 2ZX6A 2OW6A 3L2MA 2VOTA 2F7OA 1LQ0A 2WC3A 2WMFA 1V0KA 1BYCA 3VDHA 1EHNA 1WZAA 3VGGA 2G41A 1RP8A 2V3GA 1HJQA 1EO5A 2G4FA 2YA0A 1WPCA 2V5CA 1G5AA 2F18A 1UZ1A 2WVSA 3HG4A 1VEOA 2EJ1A 2IXVA 3GH7A 2ZX7A 3VIJA 5LA1A 2O9PA 3CHFA 3LXBA 3SCPA 4IUGA 1J10A 1G9HA 3NDZA 4L4PA 1QBAA 1GNXA 1UKTA 1JXJA 3BAJA 1W1PA 3WUEA 3DYPA 1B0IA 4MAZA 2QV4A 1V08A 4AD0A 1CGWA 1HN1A 3VU2A 4P7NA 1LLOA 3MO4A 3WNMA 4W5ZA 5CG0A 1KXQA 3G6MA 3WQ4A 5M03A 2EXOA 1ZJBA 2GFTA 1JZ5A 5GPRA 3WDJA 3GBEA 9CGTA 2J7HA 2CERA 5EFDA 3S5YA 5LA2A 4MNLA 2VC9A 1FHLA 1H41A 2WLZA 3KL5A 2OSXA 4HA1A 3EYPA 4HU8A 5A1AA 1JD9A 1HJVA 4TUFA 3H53A 4DO6A 4LYRA 3WD4A 4NSBA 3HN3A 1R8LA 3CZKA 3BUIA 1IZKA 2GK1A 2J8GA 3T0BA 7TAAA 3GNPA 1NWTA 4BS0A 5BRPA 5D9PA 1BVZA 5FKYA 3VDCA 1F4AA 2DSZA 2GK1B 2GDUA 2VX5A 4AWEA 2ALWA 4UQEA 4WF7A 5I77A 2ZUWA 5E70A 4PUEA 3L4WA 1JAEA 1BSIA 3VINA 2VCCA 2YL6A 3WH7A 1KXHA 3AISA 5BXPA 3N13A 3PTQA 4E4PA 2VZTA 2CHOA 2D1ZA 4PN2A 3THDA 1SYTA 2W5FA 3VSTA 1XCWA 3RO8A 2WVTA 1TR1A 2ZOXA 5CZKA 1Q6FA 1BVNP 1E5JA 2JEPA 3AXXA 1NWSA 1KWKA 1GOKA 1KR1A 1PX3A 1WZKA 1ZBVA 1DWFM 1J0IA 4E8DA 4LYQA 3BAKA 4NXSA 2BHYA 4CN1A 3AS2A 1VB9A 2PB1A 5I6SA 3T2PA 4X9YA 4PSPA 1SFSA 2J8FA 3AZSA 1FHDA 4DO4A 3LRKA 2NT1A 2JEQA 2BVDA 1CPUA 1CLVA 2WCGA 1UWUA 1D2KA 1CNVA 1JYVA 2DIEA 3W0KA 1JI2A 4B9YA 5I2UA 1MYRA 1PZ3A 4FNSA 5C8BB 1E15A 3K4AA 2CHNA 3CMJA 2RGLA 3TV8A 3UR7A 1WDPA 5A8OA 3CC1A 2Y4SA 3CGTA 3CHEA 3ZMRA 3DHUA 1EQCA 3WD1A 2RGMA 2UWFA 2J7BA 2EO7A 1W9DM 3DX2A 4FK9A 2ZUTA 4HPHA 1GQIA 4RE2A 2C7FA 4FNUA 3UCQA 3KE0A 3FHAA 4DM2A 3O9NA 3OA5A 1CIUA 2DSKA 3UEQA 5D8ZA 3AIQA 3GTNA 5IFPA 1NOFA 3LPPA 5BXSA 5JIWA 3RM4A 2DSVA 3E1F1 1ZBWA 4MB5A 1WAWA 5BRQA 1UASA 1VIWA 2QF8A 4HU0A 3VIFA 4F9JA 4MDOA 4HMCA 2FGLA 3PZGA 1SMDA 2ZUUA 1JD7A 4HPGA 1JDDA 2A3BA 4W7WA 5GQBA 3KZSA 4D1IA 1UH2A 4CU8A 1E4IA 2BHZA 2GSJA 4F66A 5IXEA 1TQWA 3AIRA 4KWUA 3CUIA 3VGFA 2VR5A 4JHOA 3WY3A 3VGEA 1JYXA 1UG6A 4DWSC 1W3JA 2J62A 5FCZA 3FAXA 1Q6GA 4CU6A 4E8CA 4WLCA 4JIEA 1CXFA 1TVNA 3VX0A 4RE3A 1EHAA 3K8MA 2WBKA 2D22A 3B9EA 4JCMA 1CGUA 4P8VA 4HTYA 3ARXA 4W8BA 3FXYA 1H2JA 1PIFA 4WIWA 3CUGA 1DWJM 4MDPA 1H09A 4YPJA 3W38A 3QOMA 3RDKA 2WM0A 2G8ZA 2WKGA 1UYQA 1JZ6A 2XVLA 1EOKA 2F8QA 4GKLA 2JF7A 1FOBA 3N1AA 4JHZA 4FLOA 1UH4A 1X6LA 3WD0A 3LMYA 4J3WA 4XZBA 3F5JA 4JKMA 4HOXA 1VJSA 4GIAA 4ML4A 1E55A 3VIGA 4D6DA 3L4XA 2J77A 4Z2LA 1B9ZA 2YBTA 5D4YA 3ZT7A 1V6VA 1ISYA 4GXPA 1XV8A 4U2YA 1KB3A 2J7EA 4CCDA 4AZCA 3D51A 4UZSA 2Y24A 3BCDA 4AZCB 1V3MA 3OBAA 3W28A 2O92A 5DMYA 4W8AA 3HG5A 4L4OA 5LYRA 3S2CA 3ARZA 2C0HA 2EPKX 1V3JA 4MB1A 2O9TA 4AMXA 5KZ6A 4CD5A 1J0ZA 3VD9A 2XVNA 4RE4A 3GYCA 4B3LA 1JFXA 3GNRA 1E4MM 4UQDA 1LWHA 4QLKA 1X1NA 2VX4A 1KTBA 3WNOA 3MANA 4Y7EA 1J0JA 1E4LA 1B30A 4WKHA 5CQ1A 1ISXA 1K9FA 2DDXA 3ARPA 2GUYA 3MUY1 2XJ7A 1MQRA 2FHFA 3FAWA 4AZIA 4MB4A 4LPCA 4UFJA 4GI6A 2WHLA 3CBWA 1OWQA 4URIA 2F2HA 4M29A 3ECQA 3OGVA 3SCVA 3KL3A 3QGVA 1J11A 4H41A 3BVWA 1W3HA 3EDEA 1H1NA 3WNLA 1G0CA 1B1YA 1Q6DA 3D4ZA 3VM5A 1UD4A 2BS9A 2VTFA 3DX3A 4BA0A 4U31A 4GZJA 5C71A 1OT1A 2E8YA 2J7CA 2J7GA 5GNZA 1CXKA 4MPKA 2FHCA 2Q8XA 3WSUA 2PWHA 1PX8A 3WQ5A 3ZSSA 3ALFA 2GJXA 3SUWA 2XVKA 2X0YA 4TVUA 1ESWA 3AS0A 1E1FA 3LPOA 4RL3A 2GJXB 2ZE0A 1KBBA 2O9RA 4H2CA 3UG3A 4XZWA 2JALA 1QI4A 1QPKA 2A3AA 3F5LA 2ZICA 2XVGA 4PCTA 4EANA 3SUSA 5HPCA 2YDSA 3VM7A 1LJYA 4WSKA 3WEOA 4UQAA 2XHYA 2VURA 3PZ9A 4YN5A 4HZ7A 1WDRA 3WDPP 1PZ2A 4AZ5A 2ZUSA 3VNZA 1WB0A 1M01A 1E6PA 2W92A 1XRVA 4FNQA 4XB3A 1TG7A 3O2LA 1FP8A 5D9MA 4Q7NA 3AMLA 3OG2A 1E6NA 2FH6A 4UOJA 1NWRA 4NX0A 2VRJA 3HU7A 1H4PA 3OLEA 3NJ3A 1N82A 4AYGA 1IZJA 2XFYA 2DT1A 4QAWA 1TCMA 3CTTA 2EPLX 1E40A 1DEDA 4K68A 1EDGA 3ARVA 1KCKA 1GW1A 3AZRA 3BLPX 3WBEA 1G94A 2CITA 3AHZA 3EMQA 3VTRA 1JZ4A 2WWCA 4W85A 2VJXA 5A8NA 3VD5A 5JBDA 4OKDA 3AMKA 3B9AA 2J79A 2CYGA 3KLLA 3CMGA 1YHTA 4MAVA 1HWWA 4HA4A 3MUIA 2YFOA 3RJYA 2VNCA 3GH5A 3BUDA 3OGRA 2XM1A 1XYZA 1S46A 4MJ4A 3MV01 4UFIA 4P8XA 1UD8A 2Z1SA 5CPTA 1NOWA 2OWWA 1JYWA 3D50A 3EDDA 1GONA 5I79A 3NSXA 1O7DC 3WF3A 3OZOA 4V28A 4P7QA 3QHMA 4KH2A 1VFMA 1OGSA 3AMCA 1B2YA 1GHRA 3L4UA 3VILA 1BYBA 2ZXAA 1KFWA 2WMGA 5ABEA 2Z1KA 3SIMA 4GPNA 2UY2A 2XFRA 3PZTA 2W66A 2DPEA 4P8WA 5E0CA 3ZSTA 2WXDM 3W6MA 3SURA 4FLSA 1GOIA 5AYBA 2BVTA 2EABA 2X05A 3RCNA 3S6TA 2FHBA 4BCEA 2CEQA 4M24A 1QW8A 4MNMA 3OGSA 2WB5A 3WQ6A 1KQZA 3BH4A 3GXFA 5DF0A 3K46A 1GOWA 3APGA 3IJ8A 5A2BA 1H3GA 1JZ3A 1GQLA 5HNNA 3LRLA 2XG9A 4F79A 1VEMA 2X2JA 1HKJA 3WH6A 1Q6CA 2G3JA 3WF1A 2WC7A 1XH1A 4J3UA 3AXHA 1H11A 3VVGA 5HPOA 2JF6A 3AYRA 3ZM8A 4EKJA 2CNCA 1UD3A 4M81A 8A3HA 3WH5A 4QLJA 1BGGA 1L8NA 1JI1A 3CH9A 1QWNA 4Z2JA 1U2YA 3A22A 3W25A 3LPFA 4OBSA 2JIWA 2ZUMA 1TVPA 3AICA 3ARYA 3B9DA 3UG5A 4J3SA 2ZXDA 4MADA 1PS3A 1R7AA 7A3HA 3VIIA 5IDIA 1R7OA 2DSUA 4QP0A 4B9ZA 4OOUA 3U7VA 2E3ZA 3VIKA 1AQMA 1JZ7A 2DH2A 1I1WA 4GZIA 1BG9A 3SCOA 1CXIA 3GXMA 3EMCA 5E6YA 3TTSA 1K9DA 1HXJA 3NIYA 3SUTA 5DO8A 4AEFA 1GOMA 1V3HA 1NQ6A 2XWDA 1C90A 1UD6A 1UKOA 5CLTA 2NSXA 4UOQA 4DUWA 1R46A 3HZ3A 1JAKA 1LL6A 2YDQA 3FHQA 4UOZA 2F61A 1V0MA 2YJQA 3W37A 1JZ8A 3WL1A 3A5VA 1OIFA 4UFKA 3ALGA 4NXKA 4JFVA 1JF5A 1RP9A 4NZJA 3MSDA 3RMEA 3J7HA 4QLLA 1D7FA 4YHEA 4GQRA 5IHRA 1XSIA 1HVXA 2F1BA 5BCAA 3VX1A 2ZWYA 1TQSA 3CZLA 4HMEA 2E40A 3SUUA 4XUYA 3IJ7A 4C7FA 3M7SA 1HVQA 5A94A 2WHJA 2A3CA 3MMUA 4BQ5A 2DQXA 3W53A 5HDRA 3WUBA 2OW7A 4CGTA 1UWIA 3AIVA 3F5KA 3GZAA 2VL4A 1UQZA 1GHSA 4FLRA 4PSRA 4NZCA 5D8WA 2VVNA 4M56A 1BYDA 5GNXA 1NH6A 1E6QM 3VIPA 4CD4A 5ABGA 4OGZA 3WDHA 4GQQA 1WO2A 3RILA 3DECA 3WF2A 2F7RA 1ODUA 1PIGA 5BYWA 1UR8A 3MKKA 2IXUA 3U5YA 2EPMX 2XYLA 1TQVA 2ZWZA 3ZT6A 3MV11 3W24A 2YA1A 2WMJA 2BXYA 3I3DA 3DX4A 3U57A 1V3LA 1TE1A 5AY7A 1TQUA 1LF1A 1E73M 4ACZA 3II1A 3CHCA 1NOUA 2E9MA 3LRMA 3A4AA 2XSAA 3W82A 4ACZB 3D52A 3K1DA 4AD3A 1GUVA 5BXTA 1QI0A 3EJQA 2VRKA 3EDFA 1TQTA 1SR0A 1XD1A 4Z2GA 1W91A 3FNDA 4DUVA 1DP0A 3L4TA 2XSBA 3GH4A 3I3BA 1V6WA 3PZUA 3SCTA 1R33A 1R85A 1Y7VA 1B3WA 4PBGA 2X0HA 3ARUA 2QMJA 2D0FA 2XGIA 3MS8A 2WMKA 1OD0A 2E9LA 1M7XA 1HJSA 3GM8A 5E9AA 2YL5A 3A6OA 5EFFA 1CGYA 4BQ3A 2VRQA 2DIJA 4A3YA 5IHSA 1E3ZA 5CXPA 2YL8A 3TONA 1HIZA 3VDAA 2VQTA 2J47A 1UHVA 3TTYA 3VO0A 1BPLB 3D4YA 1QNOA 2WHMA 1M53A 2EAEA 4D6FA 2A3EA 5ABHA 2D20A 2BY2A 2EBNA 3UR8A 1ZBKA 1DWIM 1FH8A 1E1EA 2D3NA 1GQKA 1PPIA 4AMWA 1KR0A 1TA3A 2VVSA 2V3DA 3H55A 2BY1A 3WEZA 6A3HA 1UWQA 1U30A 4C7DA 3CZNA 4U33A 2A3HA 1V6XA 1TA3B 6TAAA 1VENA 5A6AA 1XH0A 2DH3A 5EB8A 3WUGA 2XGBA 3EJTA 2X09A 3VGBA 4F9DA 3AHTA 1AMYA 2G3MA 4AW7A 4OBRA 1KGWA 3WNNA 1QI5A 1VRXA 3ZJ6A 1NM9A 1QI2A 2D3LA 1JNEA 1V3KA 4AIOA 3NYDA 1WNOA 4PMOA 3WDRA 2FE0A 3D3AA 3T2QA 1P6WA 5M17A 3RM8A 5CLWA 4EAMA 5I24A 1ZL1A 4WJXA 4WKAA 4J7RA 5BROA 1EOMA 2WVUA 3CUJA 3THCA 1C91A 4ZE5A 1JF6A 3IK2A 5DT5A 1JL8A 1R75A 2WSKA 3ZOAA 4N42A 2OSWA 4W8LA 4PMXA 1VFUA 5FL1A 1QHZA 3BUBA 2EPNA 1W9XA 4JFWA 5I0DA 5HXMA 3DC0A 1ISVA 4H8UA 1E9LA 1ISWA 1ZU8A 2J4GA 3K8LA 2YDRA 3VSVA 3SUVA 1XSJA 5CGMA 4CVWA 4AMCA 4HMDA 3L2LA 3W6LA 4BQ4A 3K4DA 4S3KA 1E56A 1GOOA 1UWTA 4TX8A 2BXZA 4W7UA 1UWRA 4OIFA 5A6MA 4J3XA 4JL2A 4UFMA 1VAHA 1VEPA 2YFNA 1QHPA 1XD0A 2XIBA 4NZFA 2VX6A 2W67A 4JZ5A 3PN8A 3PTKA 2GJPA 4PMYA 1TFVA 3K8KA 2FDMA 4QCFA 1J0YA 4PTXA 2E0PA 3VUPA 4PUDA 3N12A 3OB8A 3QOKA 7CGTA 1B90A 2Y8VA 3GXIA 2CETA 3BUQA 4U3CA 1OBAA 3IJ9A 2QHAA 4LX4A 1A3HA 5E0FA 2CBVA 2D23A 2JFEX 4U5IA 2PC8A 1UH3A 5A6BA 3WUFA 1K9EA 4AZ6A 3WL0A 1QNRA 2X1IA 2D24A 4UTFA 3BLBA 3BMWA 4D6JA 3RJXA 1US3A 3WH8A 3VOCA 5LA0A 1MXDA 2YIHA 2XIIA 3WKZA 3VIHA 3VIOA 1XHGA 1BYAA 2CBJA 5M3WA 4FNTA 3MMDA 1UKPA 3T08A 4CD8A 1B3VA 4ZXOA 4JCLA 3AMDA 1QBBA 2NW0A 3EJSA 3T2OA 3CZSA 3PZOA 1B3XA 1MW0A 1BAGA 1HF6A 2OYMA 1E3XA 3SCSA 2ZIDA 4PMUA 5I5RA 1PBGA 1E72M 1QI3A 4CN4A 3N17A 3AROA 1B3YA 2VX7A 2J78A 4W88A 4BF7A 3QHNA 3WMBA 2J7DA 4KGJA 1ITXA 2VZUA 4W7VA 3SCQA 5I78A 2XTKA 1WDSA 2BY3A 1LL7A 2EACA 1W3LA 1MVYA 2HISA 2EEXA 1JG9A 1MFVA 5EBAA 2ZUVA 3AFBA 3WF4A 1HXKA 4FLQA 4AY1A 4DWSA 1CECA 1PEZA 2ZX9A 2ZXQA 1GJWA 3AQUA 1NARA 1FP9A 1OGBA 3POCA 4DWSB 2YLLA 1HT6A 1JGIA 3CUHA 1R87A 2V5DA 3H54A 3LXCA 2CPUA 4MTVA 1CLXA 3B8SA 4V2XA 2VMFA 1AQ0A 3L4VA 2QLYA 1QVBA 1QW9A 3AMGA 2CBIA 3AI0A 2IGTA 1E5NA 2V38A 4ATDA 4FNPA 3I3EA 3A47A 1V3IA 1J01A 1MFUA 3BSHA 3AYSA 5FIPA 3FW6A 1XGZA 2OWXA 1CXHA 1C7SA 2PBGA 1UA7A 4OUEA 2PWFA 1H0IA 3POHA 4PEEA 3VMNA 1CGVA 1OM0A 3RM9A 1EA9C 4Z2KA 3OZPA 1ZS2A 1OINA 1W2PA 4D6CA 2W63A 3WMCA 1CYGA 3D5HA 4UFLA 4Z2IA 2D0GA 3ZQ9A 1GCYA 2WW5A 3AIWA 3WELA 4BZYA 4HOWA 2V3FA 3GXNA 3AHXA 4A3HA 3TP4A 1SZNA 4W87A 2DT2A 2BNJA 1QNSA 2VZVA 2WZIA 4AC1X 3ZJ8A 3BCFA 1GORA 1OGGA 2EADA 4S3JA 2MANA 2OWCA 4BQ2A 4XX6A 5JBEA 5TD4A 3N18A 4C7GA 3VD4A 4ACYA 2DT0A 1VBUA 1C92A 4D6HA 1HP4A 3DHPA 1TZ7A 2VCBA 2WLYA 1EH9A 1J0KA 2G3NA 5ABFA 1UKQA 4CD7A 3EBVA 3WIJA 3M46A 3IGUA 4QDMA 3WDIA 4U3AA 3PZNA 4ZEPA 4XV0A 5ABFB 4CU7A 4D6GA 5A8MA 1W2VA 3WQVA 2WK2A 2WZEA 1J0HA 1GVIA 2E9BA 5F7UA 2QPUA 4HZ6A 3RIKA 3EDKA 4R27A 4LQ1A 3CV5A 4B15A 3BAYA 1US2A 2CIPA 2X2IA 3LX9A 1W9BM 4LXFA 2XFFA 4B3KA 1W9UA 2CCRA 2VQUA 3PTMA 1TUXA 4AIUA 1QHOA 4HOZA 3A4XA 1EDQA 3KLKA 4KMQA 3N9KA 1VFOA 1V02A 2WNWA 3CLWA 1E4NA 1CDGA 4JL1A 4M80A 5C70A 4PCSA 5IFTA 3O6AA 1YQ2A 3GDBA 3EDJA 5ECUA 3HG2A 1EXPA 2E8ZA 1E6XM 4AISA 1BTCA 3M6DA 1A47A 1H0GA 4D72A 2QPSA 1IT0A 4PMZA 5CPSA 3ZT5A 3ZO9A 2JE8A 2AOSA 1UKSA 1MW1A 4NRRA 4HA3A 2AMGA 2CESA 3VPLA 5CGTA 1JIBA 4U2ZA 3AOFA 1JDCA 1RPKA 3EJUA 4QCEA 4X0VA 3WY4A 4AD5A 3AIUA 3VMPA 2DGAA 3HMCA 1XCXA 3OLIA 4TVCA 4PMQA 2X8RA 3AHVA 3VIMA 2V3EA 3WY1A 1DWAM 1BF2A 3EMZA 3VD7A 2WC4A 4AYSA 4TX6A 3A21A 4OJYA 3CZJA 4M8UA 1CZ1A 4KRTA 5AYIA 3U7BA 1JNDA 3N04A 4J28A 3BUPA
chains in the Genus database with same CATH superfamily
4WEVX 2X41A 3L67A 5FV2A 1JPST 2WO3B 1UR9A 4R90L 4A6GA 3RX2A 4DZ5A 4LGXA 3VTTA 2IBZY 1KN4H 1I3GH 1L7IL 2WPGA 5DA0B 4AX3A 4M82A 4JICA 4NAJA 2Y1ZA 1YO4A 5GGTA 4DP2X 2PTUA 3HI6H 3DJZA 4C6FA 3DDFA 5L4FA 3C60A 3EH1A 1Z1WA 4QXGL 1Q6RA 3P1VA 5E2TH 6TIMA 4PRIA 3C60B 5ESQA 2G4EA 3CFTA 1SOQA 3UETA 5F97E 2J8UF 4PRIB 5ESQB 3MYZA 5GJTL 3U5UA 4S1SH 4F8PA 4QO1A 2XG4A 1OF2A 2JF1A 2NQZA 4R4BA 4QO1B 4ZG1A 2XG4B 1OF2B 4BHUA 5DHDA 4R4BB 4PTWA 1PU0A 3GBDA 5CBIA 1OSEA 2OB3A 5I8OH 3SCUA 3RWGA 2J4WL 2VO5A 4YXHL 3ZJAA 1MCEA 1ILSA 1AXSA 1MFAH 4E41A 3RWGB 3EXTA 2GBVA 5KYNA 4E41B 4AVFA 2YR3A 2W38A 2H3KA 3N55A 1PKQE 4X5QA 2VN5A 1OGPA 3FA3A 4J4KA 3AALA 3XIMA 5JHDE 2EDHA 1XJBA 3FYIB 5LKNA 5CJOH 4YR6A 5I23A 4BRJA 3GKAA 4YR6B 3LENA 4PB9H 1EV2E 1PKLA 1UA6H 3TJHD 3DBSA 1DTUA 1VFSA 2C1IA 2YDAA 3G9AB 4KJYA 2ARWA 3H7BA 5K1VA 4H9YA 3UBPC 1RU9L 1UT2A 4KJYB 3WHE1 3IGAA 3OG6B 3H7BB 4ZSOA 5G2NA 3IGAB 5FYJD 5I8KL 3B5TA 4ZSOB 3BSZH 2CFFA 4UTAL 1USQA 4HGWA 1GOGA 4EI5A 3FLUA 2WLNA 4RK8A 4HGWB 2X53A 2PYEA 4O1CA 4EI5B 5J3HC 1U93A 3BVTA 1EC9A 1YYAA 3RKDD 1O7AA 5CPQA 3RVUD 1MFCL 2PYEB 1U93B 2NWSA 3L6FA 1JFHA 1WAPA 4UINL 3MJMA 1TQCB 2R4SL 1FA2A 3L6FB 3PL6A 3RR4A 3MUHL 4PRIE 1WG3A 3PL6B 3WLWC 1UOKA 3C6SA 4J3ZA 2A6JA 3SCNA 5AECA 4WGKA 3A6CH 2Y2WA 1O9ZA 3CPUA 1DE6A 3C6SB 2HS6A 2IAMD 2A6JB 4M00A 3JUGA 1KC7A 5AC4A 2ED7A 5G4EA 2E27H 3PNZA 5A6BD 4POZC 4Z7UA 3VTMA 5FSDC 2HUEA 3PPCA 4Z7UB 4AE0A 2PTWA 3CVBA 5JW3L 4E41E 4PWEA 4P2QA 3VCCA 1C5BL 1X3DA 3L0KA 2XRAL 5IY5B 1JMZA 4P2QB 4UAHA 1O4UA 4JN1L 3HBZA 3AQYA 4LAJH 4NCC1 3MTXA 4C47A 5AVRB 3ITYA 4X63A 5F0MB 3M86A 4GO9A 5FW8A 4HHHA 1GZPA 5C09A 4MAYD 4WWKC 3CSFA 4PJ9D 2H1PH 1L9OA 1Q7ZA 3MZGB 4AD1A 1GZPB 5C09B 2KH2B 4UB0L 1K03A 1XSKA 2Z6IA 1MDRA 4ONFH 5EMMA 1QNQA 1XWYA 1IGTA 4ZAKC 4X50A 3BW9A 4YMPA 1IGTB 2VLME 1OWRM 3CUFA 1NAML 3HG1E 3ULVL 5U7SA 4JZNA 2P47B 4X0NA 1QXLA 1SVZA 1DUZA 1XLAA 4JZNB 4XGZA 3V0JA 3QMSA 3KOYA 3U7YH 4NHUA 1UWAA 1DUZB 3H12A 3SD2A 4HJTA 2PYEE 4XGZB 4NHUB 4WI5A 1VR6A 3B8TA 4FTDA 1J12A 5AZEL 1VFFA 3ZYOA 3LSCA 3GHPA 3O4LD 3QIUC 1KTCA 1B4TA 4Y4KA 1OFAA 4PTVA 5E9NA 3FTUA 4DVOA 3NH7L 2XVPA 4Y4KB 3V2AR 2W4XA 2XPYA 1H6EA 2WNGA 5B4MC 4IIDA 3DXAA 5BMXA 1BGAA 3AM8A 1MNZA 3V0WL 3COTA 1AGBA 4TNWF 4FZ8L 1ZAJA 3DXAB 4O1BA 4H6KA 2JFCA 3EYSL 4TO8A 4FMVA 1AGBB 2YEQA 4TTGA 4Q8QA 2F19L 2IPJA 3L2MA 1P69B 3CHVA 4WTWA 3DFSA 4GG8A 3THMH 3ANUA 2IDCA 3TT1H 4K94L 1EGVA 2WM1A 4GG8B 3BJ91 2X3BA 4E9QA 3VJ6A 1SXAA 3TUUA 5L7XH 3SYAA 3PM6A 3GVQA 1ZCCA 3VJ6B 1S4IA 5JXAL 2QCHA 4L4PA 2R1PA 1CLOH 5CP7A 4NNPL 4BKSC 1E5AA 4HBKA 3KCJA 5CP7B 2ZTJA 3SRDA 1PZBA 9CGTA 2H9GA 4QJ3B 3PP7A 1TREA 1H3UA 5E9DD 1PMYA 2H9GB 1FHLA 1A7NL 1H41A 2WLZA 1MJ8L 4PJFF 3B7SA 3ZE2F 4HEPG 3B06A 4FSAA 5F9OH 1MHEA 1A5OC 5TK2A 4IQDA 1OAKH 3HKZA 2WQPA 1RVKA 4WTQA 1MHEB 5E6IC 1GIGH 4GT0A 4Z3FA 1H1YA 1BSIA 1RURH 4KFMA 2V8ZA 4O11A 1G7MA 3FMGH 4XE5B 3DRTA 1BYOA 3S2AA 3PAOA 4R0LC 4LYKA 3US9A 4I18A 2GPTA 3H21A 1EEXA 1G7MB 4JZOA 3DRTB 1FNSL 4MBOA 5FOJA 3AXXA 1TLMA 4FXTA 1M42A 4I18B 4AJVA 2VN7A 3V79C 5LDUA 1RK1A 2BVPA 4CN1A 3EYUH 1VB9A 4B9CA 1VFTA 2J5WA 2LT9A 1E6JH 4RX4D 3ARGA 4IBWA 1VS1A 2GPZA 3AZSA 1XR2A 2A9BA 4JO2H 1RK1B 2BVPB 5AEAA 3QZNA 2HT4D 3ARGB 3IDIA 3E2HC 1XEUA 1UWUA 3KHJA 1JYVA 3FT1A 1JI2A 4B9YA 1J79A 2VMEA 3IDIB 3SDYH 1UZ6E 3UR7A 4I0KA 4Y88A 1SW0A 3W84A 1RXLA 2DMBA 1W9DM 2HNHA 2JKSA 5DJZA 2NLYA 1G6RH 3QPZA 2HQAA 1CIUA 2Q3RA 5DJZB 2Y69B 3GS7A 2DSVA 5A2FA 1LD9A 2R0WH 3JWNG 3QCVH 1GH7A 5EORH 2DZTA 2BVQA 5B3SB 1LD9B 2ZG2A 4BKTC 2BVQB 2YD6A 5GQBA 3OHXC 3TESA 4QYOA 1KCRH 1AKJD 3ATFA 1ZHLA 1EJUC 4QYOB 1MQ8A 3X1FA 1ZHLB 2I5YL 4IJ3B 1CXFA 1EHAA 4JCMA 4I0PC 4NY2A 1A7PL 5C08A 3QR2A 1PIFA 5LBVA 1GSMA 1DWJM 2YLKA 1P7BA 3QV8A 2BSBA 5C08B 3MRPA 4PJXA 4RDWA 4HVXA 2WYHA 5HHNA 3S6CA 2G96A 3MRPB 3BOXA 4PJXB 2VLRA 4Q4MA 2MNWA 5HHNB 3BE1H 1B9ZA 4YHIA 2VLRB 1CFVH 2FATH 4UT9L 3GYEA 1EWHA 4G2DA 2OG9A 3OF6A 4YHIB 1YPZA 4WUKL 4N2DA 1YPZB 2F53A 3RGVC 2A38A 1YQVH 4LKCA 2ZAGA 3BV7A 4EPKA 2RTTA 3DETD 2F53B 4XP6L 4U6HA 4K3DL 4LKCB 3HQNA 1X4XA 4OTXL 4KZCA 2ESVA 3TYGH 4U6HB 4QAMB 4JYFA 1GC1L 4JTTA 4S23A 2ESVB 1ISXA 4K23L 3RLHA 4FQ1L 2WHLA 4ZB2A 4M29A 5DUML 5C0IA 4G7RB 4QG8A 3MLUL 4C6KA 3BPNC 2IV9A 5C0IB 1BQ5A 2BP0A 4ODHL 3DX3A 4I3SL 3HKFA 5EA0L 2BP0B 2DZSA 1QMUA 2XVKA 2X0YA 4V33A 3ZDYB 3IMWA 4N2OA 3CBKB 1HWHB 3C2OA 5FI8A 4CNSA 1QI4A 5F93C 1V7MH 3DG7A 4O17A 4J5NA 5K9OA 4UTWC 2XXMB 1JFQH 3IGHX 1YTKA 4N9EA 4YN5A 3EZ8A 4H13C 5K9OB 2ZUSA 4YL4A 4GEIA 3MLXL 2L5HA 4FNQA 4YYCA 2RJHA 2NLJA 5D9MA 1TQBC 3B5GA 3UZJA 3V7MA 3LY6A 1S9XA 3HU7A 2NLJB 1EUNA 4NQVA 4BF9A 4F7PA 1S9XB 1J93A 4NQVB 4US5D 4JQIL 2XPZA 5FO8A 3AHZA 4F7PB 1JZ4A 2WWCA 2VJXA 2B4GA 1MAJA 3RJQB 3AMKA 5DHYA 3B9AA 5FO8B 3LKPA 3KLLA 1IXPA 4GRWE 4P2OC 1J5CA 1P9MA 2Y07L 1XYBA 3GH5A 3NQDA 1OC6A 5DHYB 1YG9A 3LKPB 1DCLA 4I9MA 2ADGA 1MY7A 1F90H 4BK8A 1NGPL 4P5UA 2ADGB 2HTKC 3OZOA 1PG7H 2A2QT 1E4XH 1RIHH 4UTMA 1VFMA 4FI8A 1OGSA 2F53E 4IDJH 4TVPE 4MVBD 3QSKB 3S36X 4BQ6A 2GGJA 2WMGA 2KZHA 2ESVE 2BRRH 5F0LB 3WJWA 1JHKH 3FO9A 5F2GA 4AEOA 1MWAA 5DF0A 5KVEL 3FO9B 1IE5A 2W9DL 1RH8A 2TYSA 1MWAB 4NFCA 2NX5A 2JF6A 4WSHA 4XVDA 4JG5A 3ISYA 8A3HA 3AXMA 3EYOA 3D09A 2NX5B 2OS7A 4FQXD 4KO5A 4FCAA 4W9EC 3SBWA 3EYOB 2ZUMA 3DSFL 1D9KA 4M93C 3P0VL 3B9DA 5LWYH 4HXBL 2CLIA 4LOCA 5D1ZI 1D9KB 3VNIA 3MFGB 3MA8A 5E2UL 2Y62A 3NQKA 3VD0A 1BKHA 1K9DA 4DEPC 3S5OA 4L8SA 1B3IA 2PDUA 4L8SB 4NJGA 3RNDA 1TEYA 1AYRA 4MNQD 3U4BH 2VC5A 3S7GA 4ERGA 2F1BA 3VX1A 1LEIB 5A94A 1D3GA 3FYYA 3RTQC 3FCBA 1LO2L 1U3HC 2WJ5A 4LGSB 3F5KA 2VL4A 4PSRA 3H2PA 4Y1SA 4OFIA 4OGZA 3JW7A 1E4HA 1I3RA 1ODUA 5HJGA 2IXUA 5HHQA 1I3RB 4C65A 3W24A 2F74A 3I3DA 5HHQB 3SODB 1TQUA 2EKCA 2F74B 1K4DA 5F21B 1KY6A 4XP1L 2YPVL 3MFFA 3W82A 1K4DB 3URAA 1O5DT 2PTYA 4XISA 5J06A 3RY6C 3CPLA 3MFFB 2ACQA 5DHVA 1WKFA 3A4EA 3CPLB 3UCRA 1CJYA 3LZ3A 4OQTH 2QCMA 3CUPA 1KM6A 1M7XA 3GM8A 3BPLC 4A7VA 3CUPB 3VYNA 3TA3A 2PZ0A 3U46A 4NUWA 1A4MA 4X5XA 3QORD 4D6FA 2BY2A 3U46B 4X5XB 3DBXB 4FMFA 1KR0A 2DUAA 3LY0A 2VMCA 2DM7A 4K8RC 4AJYV 4ENEC 4HQVA 5EB8A 1IXNA 2FQGA 1UZ6F 4AM0A 5K9KA 1QLEL 1VRXA 1UGKA 1JNEA 3OQRA 1FL6A 2E9GA 4AM0B 3PG8A 5K9KB 2MJWA 5DC0A 1JWSA 2V2TA 1CC3A 1WNOA 2YAHA 1G7UA 1FL6B 4BELD 4EAMA 1JWSB 3AYTA 2V2TB 3P0GB 2AEWA 2I5QA 3T55A 5I6LA 1KELL 4JQ4A 2R27A 4R5TA 4MWFA 3MCG1 3W71A 4H8UA 4MWFB 3UXKA 4ELDA 3MRNA 4U4BA 4S3KA 4U05A 3VQ1C 4W7UA 4JQXA 3OZKA 3MRNB 1DQMH 1FRGH 4MIMA 3MCKA 3PP3K 4MCYA 5KW9L 2H45A 3RFRA 4NERA 3MCKB 1HC1A 3ARBD 2BOEX 4MCYB 3HA0A 4I3GA 1A7RH 2IAMA 3VUPA 1AFVH 4D7BA 1W1ZA 3MLZH 5IESL 4XZIA 3RPKA 3BAEH 2IAMB 3IJ9A 4CAGA 3TR2A 2CBVA 2ZYIA 1QPRA 4M5PA 5A6BA 4XZMX 3NDOA 3UBXG 2GWGA 1TO3A 3AY4C 1F61A 1E4WL 3GHTA 5FEPA 4N8PA 4BV1A 2G3ZA 5I1EL 3IJSA 2QPEB 2EDWA 3DJRA 3IJSB 4UT6L 2EXYC 1BZOA 1DBAL 5AAMA 4JNMA 1HDMA 1TJGL 1HDMB 5KSWA 2QJNA 4JR9H 5CO1A 4PJ9A 4I3RL 5A16A 1RZGA 1FQ0A 3OODA 4PJ9B 4P23D 1D5IH 5A16B 1RZGB 1RIUH 1OGBA 4PUKA 1QACA 5FJJA 2Q20A 3WFBL 3EIFA 2L7UA 2OVLA 5DZPA 4XC3H 2V5DA 2OLAA 3RX7A 3D8MA 4XMWA 4Q33A 5TTRA 5HNTA 4QS5A 1S2TA 5FYJE 2C0AA 3AMGA 2X38A 1MUCA 4IOSD 2V38A 2FPTA 4FNPA 4FQIH 4ZMVA 5JPMA 3GGWA 2JLLA 1YNQA 4IW4C 2PWFA 5JPMB 3GGWB 3TZFA 3GTHA 2WJZA 2GVEA 3MLYH 5JYLA 2DT2A 3EOUA 2FYYA 4K3JH 3QRFM 2I5GA 2FYYB 1TOXA 4ZMLA 4C7GA 3VD4A 4UZGA 1XIJA 3DX9A 2H6RA 1JJKA 4PJXF 1DL7H 4J2QA 1ZSHA 3DX9B 3Q8CA 5I19H 4Z7OB 4JM2C 1DDTA 1HEZA 4YDZA 4X6EA 2C9QA 4AYID 1KFEA 3FQRA 3G6JA 1HEZB 2A6KA 4HJJL 4JDTL 4X6EB 3FQRB 3G6JB 5I1HL 3EUDA 3TE9A 2A6KB 4O10A 1D3HA 3ILPA 3W7KA 4MTMA 5FUOL 1FXPA 3A4XA 1JV5A 4ZO6A 1NCIA 4KMQA 3ILPB 3T6WA 3MCMA 4I5RA 1JV5B 2GVLA 2OXNA 2LLLA 1VBJA 1EX1A 1XF0A 4Z3HA 3GDBA 1K3UA 1EBPA 3TYBA 5HYEA 2CR0A 1AI1H 1IT0A 1P0SE 3GNMH 5CPSA 3UIZA 1W5PA 1L6XA 2CESA 2I56A 3VZXA 3V7PA 5I0ZA 1KY7A 4OQ1A 1SO3A 3VKJA 3R0DA 1Y65A 1FWHC 1TF4A 3AHVA 1AP2A 5HJDA 1J5SA 3WOVA 1Q1JH 3ZDYF 2NT0A 1B4KA 1AP2B 1RSYA 4IRJD 4BDVA 2K0RA 4OCMC 5HUOA 4BDVB 4FQPA 4B5UA 4TLKA 2R0LL 2VUOA 3M47A 1MFBL 1ZLUH 3KJ4B 1UUNA 2KS0A 2R1WA 4GW1A 3O4LE 1VPQA 4H8WL 1J8RA 4C83A 2XKUA 5IBXA 2R1WB 4GW1B 1NP0A 1KPUA 4HC1H 1Q13A 4WZ9A 4C83B 4W84A 3UC0L 1TZHA 3NFSL 1A49A 3RPMA 1CBGA 2K70A 1E5ZA 2F7QA 1KPUB 4JW3A 2YD9A 3B43A 1TZHB 3EGXA 2P1YA 5DHXB 4NWTL 5I6NA 3EGXB 4GI8A 4BGDA 2H3NA 1T7ZA 4O19A 3NTYA 5EF2A 2KZWA 4Z7OE 2PWEA 1EDTA 2H3NB 2VDIA 3A64A 2HEJA 4PTMA 2HVBA 1ZP3A 3QJFA 1GVYA 3KUMA 5D7EA 5C3TA 2D73A 4LU5L 4R3SA 1FZOA 1G0XA 3QJFB 1R3YA 4B95C 3HFFA 3IPBA 1NPNA 4MXWH 3T8MA 4R3SB 1FZOB 1AKJA 1ZFJA 5KSBE 4ZQOA 5BW7C 3VGAC 2UZPA 3DHJA 1WBXA 1AKJB 1EPXA 4ONVA 1T7VA 1GGOA 3D3VD 4NUGH 1WBXB 1FFRA 1OX5A 3QJVB 5CIPH 1K2DA 1WBZA 3AO0A 5IROD 1TO4A 5JO5A 3TA9A 5EU9A 4OCWH 3O6LH 3OJMB 5E9DE 4KI5D 1K2DB 1WBZB 3GNOA 4EIUA 5JO5B 4XX1E 4AQOA 4XD6A 4MJZA 4ZL1A 3I85A 4PTTA 2XM2A 2CKBL 3H2CA 3HHMA 1CGXA 3ZIYA 1R3IL 4WJ8A 4PTTB 1OM9A 4AVJA 1Q9OA 2V17L 3W87A 1Q9OB 3ABLB 1GW9A 3BMXA 5IUCA 1URZA 1JGLH 3T3MB 2Y6TE 2D7QA 4IMCA 1SM9A 4TX9A 3IRDA 1JPGA 2XDHA 2H8ZA 3QR3A 4GUFA 1JPGB 3TN6A 2PWDA 4GE8A 3LQZA 2WCPA 1DHPA 4RW5A 3AIEA 5IQNA 1BVKA 3LQZB 4OJDH 3CLEL 3HGJA 3QAZC 3B9OA 1NLDL 4OGYH 15C8L 2Z4GA 3QQ0A 1BVKB 3MUXA 4NKDA 5D70L 4HU3A 2FEDC 4HK5A 3FFCD 1CD8A 4NKDB 3HG1D 4YWGH 2BGNE 4IX0A 4JX5A 1T89A 1KKOA 1ITCA 3DX0A 1HNYA 4GMTH 3GVWA 4R9OA 3GSMA 4OY9A 2GVJA 2FTPA 1Z0NA 2BDNH 1QNPA 2MQ3A 3ZDXE 5LN4A 3TN4A 1UOZA 1AJ2A 5EN3A 4YDIH 1MCLA 1XF2A 3FQ2A 1EJSC 3N3EA 4X6BA 2YMXH 5FGBA 1XF2B 1A0QH 4X6BB 4TUKH 3BE7A 1CE1L 3ZTCC 4KK8D 3TPUA 4TXEA 2CHWA 4P99A 5C86A 3ABXA 2ZSVA 5HGHA 3RX3A 5EA9A 2C16A 2GK2A 4KJPC 3V0HA 2ZSVB 1D3CA 5HGHB 1CF8L 1G7LA 4F0MA 1ZA3A 1TYJA 2Q8BL 2OYLA 1KW1A 1G7LB 1OE3A 4UWQB 1Q4NX 1ZA3B 4US5A 5FUCC 1KQYA 4UV4L 1VGAA 2WSYA 1QZNA 5J13B 5HP5A 4JQ1A 2AABL 1E70M 1ADDA 1XS2A 5ILTH 3M9YA 1YMHA 2O30A 4M5YL 4ZW7A 3OYXA 2KHAA 3UBXI 1YMHB 4P8UA 4PL2A 1RIVH 5E23A 2YX0A 4KU1A 2YCKX 3UA3A 4TTUA 3SDAD 2WZHA 1TMQA 2BVYA 3IEAA 4JKLA 4WAFA 1XC6A 1O5QA 3MBXL 2G95A 2F5BH 2PLKA 3WAJA 3M07A 1U83A 1XLCA 1VFBA 4PN6A 1ECZA 2GUUA 4NHCH 3NSNA 1RZFL 1VFBB 4XXCA 1N67A 4WFHD 4IJTA 1KO0A 4U1GC 1QPOA 3ZVIA 2DQEH 1OF8A 1NL0L 1U33A 3PAJA 4NIYE 1AODA 2W0UA 3EOTL 4XHQA 1SJXA 4J3BA 4IWWA 1VRDA 2AQSA 5E6ZA 3U36A 2VZOA 3W2DH 3SE4C 3ROLA 3ARRA 2Q7YA 2YB4A 3U36B 1MOEA 1Z32X 3QC5X 1R47A 3ROLB 2Q7YB 1ONEA 3W2JA 1VA9A 4DESA 5FA4A 2EE0A 2R59A 4NQCA 2F5AH 1OC7A 3LI0A 2G41A 5FA4B 2J6WA 1SF5A 4NQCB 3EJCA 4JIHA 2IDFA 1XLBA 4ZMXA 5LA1A 3HM7A 1JBJA 1G9HA 3NDZA 4L05A 1IAIM 2R69A 4NP7A 2VCOA 3BAJA 4MNQA 4UBDC 1NDGA 4P7NA 2DQGH 4PV8A 4MNQB 3IFPA 1IEXA 4GQBA 2FT7A 1NDGB 2B0MA 1KXQA 4IOTA 1L4IA 4PV8B 1I9JH 2AGTA 3IFPB 4M5TA 3GBEA 5JOEA 2DFAA 1KBGL 3IRPX 1V7AA 2RMNA 5HD8C 3Q4DA 2QCCA 1EYWA 5CEWA 3KHDA 4N6EA 3PLYA 1RK7A 3OZYA 5CJNA 5F72S 3NQAA 4TUFA 1MHCA 5AOLA 4BXVA 3BVDB 4LYRA 5IUSA 2CZFA 2MTAA 7TAAA 1MHCB 1NWTA 3SZKC 3UGUA 3AY2A 3QCTH 1VZWA 1F3JA 3GSOB 4A2LA 2QDVA 3C8KA 4CC4C 1F3JB 3RO8A 3HQOA 1IMHC 2ZOXA 1IVTA 1OK6A 1E5JA 5LNVA 3C8KB 1NWSA 3RF9A 1XIWD 5EBWA 1DWFM 3R19A 3WU1A 4DFIA 4PBFA 4NXSA 4XNQA 4NJKA 3N1QC 5EBWB 3T2PA 1SJEA 1F4WL 4XNQB 5AWNH 2LTQC 4Y16D 4C4UA 1SJEB 2WCGA 1IGCH 1EAPA 4ES9A 3W0KA 3NFUA 5I2UA 3QORA 5C8BB 2BWDA 1DQDH 1EAPB 5A8OA 2PGWA 3CC1A 3VFSA 3QORB 3QI9D 4O12A 2E5EA 3IFNL 3VFSB 2EO7A 3NOIA 3W1MA 2J71A 4U3HA 3GTNA 2J73A 1SPQA 3EWWA 1OP5K 1A5NC 4MB5A 4R4FL 12E8L 4YSPA 4PJ8D 1I2NA 5DGQA 3PZGA 3K7UA 2A3BA 3K6NA 4J4PC 4Z7OF 1KBJA 4A2SA 4RMVA 3HE6D 3BN9D 1W1A1 4DJFC 4MNQE 4YEFA 3CK0H 3GLDA 2PTTA 2ZOTA 3G6JF 1SVBA 4H9XA 4WLCA 1I8LC 2PTTB 1CGUA 1WT5A 3LEVH 5KSBF 5J6SA 5AVZB 2JBMA 1ZJHA 2MOGA 4X7SH 4EZJA 4G8GD 5C9UA 2ZCKH 1XDLA 3E6HA 1NU5A 4F2MA 5B1AB 1IIIA 4U4IA 1S5IH 3ASNB 3E6HB 2A6NA 4F2MB 2Q8ZA 2B8OT 3BJSA 1G1CA 4BKLA 3OPZH 1UM4L 1O7DE 2E6DA 4JR5A 4UZSA 2V5TA 3BCDA 3NQFA 3UPWA 4BKLB 3NCMA 1OCBA 5LXXA 3E0IA 2AL2A 4RGNC 1V3JA 4MZ8A 4Z7AA 3CJPA 4PP1D 3AQXA 5D6DA 2C9XA 5LSMA 1WX0A 2AL2B 1T96A 1DLHA 4RISL 3OMNB 1FXQA 1CLYH 3N9SA 1E4XI 1DLHB 3V1HA 1SZEA 2P8LA 1EL3A 3O6FA 4YDVA 4UFJA 2P8LB 1EZVY 4TVPD 1J11A 3O6FB 4YDVB 4P05A 1OFPA 4P23A 1GGIH 1N3NA 3W83A 4S2CA 1X97A 1L6GA 1UCBH 4P23B 3LZPA 1N3NB 2XFGB 3W7LA 5FS5A 3ALFA 3NZHL 5FM5O 2FD6L 4U6XA 1R3LA 1UOWA 3ZE2B 2YAQA 2ZG3A 2VWTA 4U6XB 1R3LB 2O9RA 3KPSD 4QTIL 4B5TA 4YHYB 2R0ZH 4IOSA 3C52A 2MTPA 4O54A 5AB1A 1YEJL 4OFQA 5LQBL 3LLDA 2EIEA 3ZDXF 4RE0A 1HCVA 5JIDA 4RMWA 1DANT 1KIRA 3U2SA 1W5MA 1KIRB 3KM8A 3U2SB 2J6EH 3OG2A 1KENH 3CVHH 2BGQA 3ZKXC 4PAZA 4N4YB 4AYGA 2DT1A 5DJCA 4YU1A 1TCMA 1SGJA 4RNJA 1GY1A 5DJCB 2AJSH 2PO6A 3BRFA 4MKMA 1JS4A 3BKMH 4GFIA 4NAMA 3JVGA 5C8JA 1VGKA 4ZFFA 4MAVA 4F2ME 3KJ6L 3FN3A 2PO6B 4PPTA 5C8JB 4UFIA 1VGKB 4ZFFB 3FJ4A 5E08H 4UTBH 5I79A 1OOAA 2WJDA 3I10A 4WTZA 1LO4L 1FNGA 1U58A 4TMPA 2OQYA 2OKMA 2HYMA 2E77A 4FP8L 3T3MF 1FNGB 1U58B 1KLUA 2ALRA 3FU0A 1HKLH 1KLUB 5E0CA 4UTTA 4UNVA 3FXGA 3IJ6A 3QIWA 3USZA 1LO3L 1FO0H 1BSLA 3GNNA 4ONGH 2O56A 4ENZA 2ABBA 3QIWB 1OCWL 2CPCA 1QA9A 3DENA 1WWBX 3ILDA 2TRYA 1OTTC 4HPYH 4B91A 1QA9B 4UTUA 4ZQTA 3SGJA 3L9RA 4LAMA 4HNUA 2XY2A 4OF0A 5DX7A 3L9RB 2EAWA 3K6SA 2C6QA 3A4JA 4CVZA 4DW2L 5HMSA 3ZQXA 1ZHAA 3K6SB 4P2VA 3H4HA 2NY4D 4CVZB 1HXMA 4XKMA 4IRJA 2H8XA 4LLWA 4UMAA 3N3TA 1HXMB 5JHDA 3BG3A 4IRJB 5AL8A 1H19A 4LLWB 1CFNA 1E9IA 1HKFA 5IJKC 3AWNA 5JHDB 5KUKA 2E76C 3R7MA 1WA2X 3G6DL 3HZ3A 2C34A 1CFNB 1E9PA 2QKFA 3VG9C 1WAAE 4UFKA 3PPGA 3SDCD 1E9PB 3ENEA 2ZQKA 3EX2A 3RX8A 5KMYA 4YE4L 4JG1H 1CLZH 4ROPA 2JELH 3JT2A 2PCQA 4HPOL 1N64H 1UWIA 5DHVH 4TS6A 3RXZA 3QFEA 1AH4A 1QPPA 3WKML 4GA8A 2Y0FA 3URNA 3K91A 1J5OH 2IADA 4OT1H 5BNXD 3HJ0A 1MFDL 3W7DA 2EJAA 5K59F 2F7RA 2IADB 4Z76A 1R0AH 4W6YB 5FEXA 1RBLA 3GFYA 3T07A 1VC4A 4Z76B 3UC2A 4XPBL 4J3OC 1HKVA 4Z3JA 1XO8A 3OWEA 2JKTM 2XSAA 3CU7A 1A3ZA 3EHBD 1XI3A 2ZRVA 4LHUD 3GDTA 5KVFL 5ESAA 4JS7A 3V6ZA 2GWNA 5ESAB 1DORA 2MWCA 2VWEE 2X42A 2PZNA 5CGBA 3V6ZB 1AR1D 3I3BA 5EU7E 3D3VA 3DXIA 4QD2E 1B3WA 5IROA 3D3VB 4LCUA 2WMKA 3GI9L 4NM4L 1UZDA 4LCUB 2DQTL 5TFSH 1Z9PA 3NP3A 4XOEA 5DCEA 1QNOA 4KBXA 4HVBA 4BINA 1OLLA 4JANA 1DWIM 2NVCA 1GQKA 2BM3A 1TA3A 2VDHA 1T2QH 4QRFA 3O2DL 4JANB 3L5XL 4GJTB 3LB0A 1TA3B 4NQ1A 6TAAA 1HZYA 5A6AA 3VU1A 1YXCA 3U30C 4MJID 1RUSA 5D7JC 1QI5A 2PDCA 1NEPA 2JKAA 3AWOA 3RZCC 4NSKA 5GS3A 4D9PA 1QUPA 1H6UA 1ONQA 1UATA 4NSKB 1ONQB 1PTAA 1ME8A 4N42A 3QUKA 4ODSH 3QQXA 4K71B 3ASWA 3MGTA 3SECA 1KG0A 3QUKB 3FFCA 4WGXA 4NQEE 3MGTB 3HG1A 3E9TA 1KG0B 3K4DA 3K1GA 3FFCB 4OLZH 2BXZA 1UWRA 3KYNA 2AP2A 2DN7A 3HG1B 3OBEA 4NX5A 3QQNA 4BCYA 4N9BA 2JKPA 3KYNB 3IAGC 5DJYA 4IIHA 4XB7A 5JQIB 2NDFA 3E0LA 1NKGA 4GIEA 5DJYB 4P3CH 3W73A 1GYVA 1TVHA 5HJ3A 4EEEA 3LHTA 3BEVA 3O2VL 4NLHA 3DUHA 3B8VA 5D93C 1TVHB 5HJ3B 1K9EA 2H41A 1NGWA 4FXJA 3BEVB 3UVAA 1NGWB 3SSGA 3NEXA 4JHWH 1J5TA 3NJHA 5IVNA 4KROC 3D3VE 5HJXA 4OECA 1BAGA 5D2LE 2DQUH 2ARJQ 1HAUA 1OTSC 4KI5E 3LH9A 3M44A 4JTLA 1E8WA 3A12A 3QHNA 4W7VA 1RCOB 3CFDA 4W68A 4PI0A 1PXGA 2OZ4A 2WSQA 3V0IA 3OJVC 5C9XA 2GJLA 3SJVD 1NBVH 4MD4A 3CFDB 2O5YL 3VQMA 2LV4A 5L4JA 3EWYA 1QBLH 1O68A 4UM9A 4I87A 4MD4B 1JWMA 3N6HA 4EX4A 1JGIA 4UM9B 1JWMB 3KW7A 2CO7A 5EY5A 5HJBA 3GZPA 4C4KO 5LCVA 4XAKE 3QUGA 3LKSA 2CO7B 1DVJA 3AI0A 2PCFA 3G5EA 4OBTA 4FULA 2IGTA 4F8QA 3LKSB 1V3IA 2PCFB 2YPIA 1YYMH 5EZOH 1CXHA 2XZCH 4M7ZB 4OUOA 1UA7A 3NQMA 3ID7A 3PWLA 3PS7A 3T4CA 4WHDA 4OUEA 2XETA 1M7DA 4MZ1A 3PWLB 4FEZA 3FFCE 1PY9A 1M7DB 3TN3A 3VACA 3KGTA 4HOWA 3D7PA 4ML9A 3UXLA 4XOAA 4Q6JA 2BNJA 3VKCA 2ADAA 1CLKA 5E4AA 2DJSA 2Z6JA 4M6OL 2MSPA 1CCWB 1BZ8A 4NBZB 4H20H 4Q74A 2G3NA 3ET9F 1UKQA 2HLFC 4NWUH 2WN2A 5JZ7D 3EOLA 1G9NH 5T91A 1ZY9A 3WFEL 2EG7A 5DJXA 2C1GA 1ORSA 4B15A 5B38G 1US2A 1BQGA 5DJXB 4DP8X 4IMAA 4B3KA 1ORSB 3HO8A 3DHMA 1XKYA 1VFOA 5D96B 1T83A 2CG9X 3H26A 5C7VA 4C59B 1YYLH 5I30L 3IFLH 4L1GA 5JW5A 3BT2H 1JVNA 3F7YA 3UMTA 5JW5B 4PMZA 4WO4C 3F4NA 4O5LH 3IIZA 3F7YB 1JIBA 1CU4H 2IOOA 2B1HH 4PY8I 2BNUB 4LC6A 3VMPA 1ZNNA 3OLIA 1KV5A 5G5DA 1S2UA 2NX1A 4AGMA 3FUNA 1UFGA 4HCIA 1V51A 2GT9A 5G5DB 2WC4A 4MFEA 4UT7L 4TX6A 4RZKA 1Y8BA 2GT9B 4U0QB 1DQIA 5GS0H 3WMSA 3BG9A 2PLCA 3CYVA 3P3YA 5CJ5A 3BV4A 1EEYA 1EA0A 5BVPH 3N11A 4R8WH 1EEYB 2FTAA 4Y6GA 1RH9A 4WFHE 4NRZA 5DHMC 3OIHA 3J8F7 4KHTL 1RD6A 4J5VA 4WJ5A 2IC2A 3MRBB 3FTWA 3MP3A 4NRZB 1O7VA 1G9MC 5FYKU 1Z8AA 1JGEA 5HGDA 2OR8A 4WJ5B 2QGCA 3A67L 2ZVRA 4QGCA 5FYKL 3PGFL 3L5MA 1JGEB 1GR7A 5HGDB 1LTDA 5AW0B 3QI9A 4D2NA 3PRZA 1JDAA 1CENA 5TBOA 3P2VA 3QI9B 4W1TA 1R24A 5CKSA 1ML1A 2YOCA 1R24B 4TF4A 5DD3H 5EBUA 4PJ8A 4HHGA 3PUGA 4NENA 5LIUX 4PJ8B 7FABH 5DFAA 1SGKA 2FJKA 2VEMA 4NENB 4BFRA 3OR7A 2E46A 5JR1H 3UY8A 2JB6A 3O1NA 1UA3A 3HE6B 3QEUA 2FZNA 5C2CA 4ZB0A 4HKPA 3OR7B 2BTMA 2ZYFA 5JDJA 2HRGA 3FN0L 5A8QA 2JB6B 3QEUB 1L0PA 4A22A 2OJZH 4XP4H 4JTGA 2F7FA 1T6MA 3PWNA 4ZUSA 3UERA 2ZUQB 4UANA 4AV4A 3PWNB 4ZUSB 4TN9A 4LV4A 4L4TD 3NZ8A 4YOKA 5CCKL 2G5BA 4IPIA 5SWQA 4PGLA 1ZZMA 3TWBA 3NZ8B 4L8BA 3EKZA 4N0YL 4YHGA 2G5BB 3QNYA 5SWQB 3DBPA 2PRLA 4HJIA 4L8BB 2OZNA 3R1ZA 3QNYB 1XCTA 3H4XA 3OZ9L 4DN4L 1XCTB 3CQQA 4NOFA 5EGRA 4DN3L 4G6MH 4G7VH 4QRAA 1L6SA 4ATTA 4TVSa 4FQCL 2J21A 1ZAGA 2PF0A 4A05A 3NXLA 3AXIA 5IDZA 3PUOA 4GRWB 4LCCC 3H9SD 3LGGA 2A73A 1V27A 4P59H 3RWEA 2E6PA 3FEMA 2A73B 1TRIA 2C13A 1FC1A 3NUKA 4FLHA 4LAUA 3RWEB 4Q4EA 1Z3GL 3C08L 4NC0B 4JX4A 4MS8C 5G2HA 1IEVA 1C7TA 3GRIA 4HN4A 4HFUL 1U8JA 2GSIA 3WD5L 3QUHA 5AW4B 2LU7A 1HKWA 3PUUA 3KBVA 4HCLA 1U8JB 2GSIB 1T4WA 2VGFA 1HOEA 5DYOA 1U3NA 2XH0A 2WSPA 3KPSA 4ODTL 4QE4A 4WKFA 5DYOB 1HZHH 3KPSB 5IHUH 5F4WA 5TQ2H 5HQMA 2ZX8A 2CHZA 1FWJC 3W7MA 3GS0A 4HS8L 1A6VL 2K6WA 4OCLC 4WSJA 4JFFD 5EEXA 3IAQA 1IBZA 5EC1A 1V7NL 2XWEA 5EN2A 5ITFA 1OAZL 4MOZA 8CGTA 3MRMA 5EC1B 1DVXA 2AF2A 5EN2B 5ITFB 5IW6A 5CZXD 3I6LD 3NABL 3MRMB 3KHOA 1ONRA 3LD8C 2WMHA 4LBUA 5IW6B 3TAKA 3QDMD 4G8GE 4AFYA 4G1EA 2OSYA 5D2LF 1H49A 3H0TA 5F7EL 4L8DA 4G1EB 1QO2A 4KI5F 1IIKA 4OD1L 2AQPA 3H0TB 4KO7A 1IKNA 4L8DB 1DLFH 3MRFA 1NCDL 4Q0XL 4L4VD 4JAWA 2FIQA 3EJJX 1UWXK 3MRFB 1EBGA 5ID1A 4Q6IC 3GXPA 3DO4A 2ALDA 5A8GA 3FU6A 4AMAA 2OL3A 4PLKD 3RVVC 1X7IA 5ID1B 1UVQA 2VDKL 5J0BA 2OL3B 1L8PA 1UVQB 1Z66A 3LEPA 5AB9A 1T2JA 4NNAA 4LYPA 2Y85A 5MEOA 5J11B 3BGFC 1DVFC 2ZUXA 3K2IA 3CXDH 5MEOB 2CLOA 2G0LA 2PBOA 3X14A 1H15A 3P5ZA 3WLQA 3FSVA 3X14B 3BP7A 1H15B 3P0WA 3WJLA 4GYKA 3BP7B 3N2TA 4X7EC 2R69H 3VB8A 3WIHL 2WAQA 1UW9A 3IV8A 1TJ0A 2VKZG 4BSJA 3V52L 5A2IH 3CVIL 4S3BA 1BF5A 1I9RL 1XL9A 5AHEA 3MJ9L 3KPSE 2GAZA 1I9IL 1E42A 1LQ0A 2XZ7A 3VWKD 2GAZB 1EHNA 1PO9A 3WX7A 3A4FA 1RP8A 3FCPA 3CT7A 3TYFA 2P9RA 4IIEA 3GH7A 2WV3A 4YBLB 3QWRD 3TYFB 2J43A 5AYTA 4POZD 1UKTA 3SDCA 5KVDH 2Q76A 4AD0A 1ZE3C 1OAYH 1XGDA 1AQDA 3SDCB 1WHOA 2Q76B 4LCQA 1AQDB 1U5VA 1ZJBA 3UJTL 2J7HA 3LMJH 3RTLA 2ASHA 3UTPD 5LGJA 3RL2A 1LEIA 1HJVA 3PCYA 4WWKD 5LGJB 1TPWA 3RL2B 4DZHA 2GK1A 1TV7A 4O02A 3B2VH 3UG8A 4RNFA 4LRTA 2GK1B 4AWEA 4O02B 4LHUA 1J6PA 4DJEC 5B22A 1CWVA 4KESA 1K6QH 2X6MA 2A9NH 4JM0A 3EHBB 4ZAKD 4LHUB 4PN2A 2DQJH 4IHOA 1XCWA 4MS6A 1Q6FA 2QCFA 4IHOB 4RBPH 1RZJC 3TX4A 3FVMA 3NQGA 5FECA 3KBEA 5DO2C 1A0EA 2EG8A 3VFVA 1E7UA 3LZRA 1X96A 1EQWA 5FECB 5I8EA 5GVJA 5DCDA 1ZAIA 3VFVB 4AYFA 1P5VA 5I6OA 3BLIA 5I8EB 4GVIA 5C6WH 3K4AA 1X4YA 2CHNA 3QIUD 2VDNB 4AYFB 4IEFA 3NQ7A 3DDMA 1P5VB 3UDWA 4NNXA 4Q7BA 4N26A 4IEFB 1XRTA 3IU4H 4NNXB 2ZUTA 1QRKA 3LXUX 3FHAA 1EXHA 2VITA 2X6CA 3AIQA 4GIPD 3O0KA 2V37A 2VITB 5D8JH 4M7LT 4DGIH 3HFYA 3DBXA 4Y19D 3O3EA 5T3XD 1AIZA 3EG9A 4HPGA 1S2CA 5K93A 4GAFB 5K9DA 1I0BA 3O3EB 3CAQA 4F66A 3EG9B 3L1FA 3WXVH 1RCXB 5E0KA 4JHOA 3Q37A 1S9VA 4LOEA 3B3DA 2IAAC 1S9VB 5JW4R 4HTYA 3FXYA 4NQUA 3QOMA 2CU0A 3D05A 5C2BH 1BD2D 1NBYA 2ZCGA 1WC7A 1NBYB 1CK0H 1WC7B 1P4CA 4F8LA 1TV5A 3MSRA 1VJSA 1UCTA 4YUEH 5TH2A 3DAQA 1OAUL 2O26U 2ICWA 5TH2B 2ICWB 1NA8A 1VD6A 2VDRB 2FB4L 2A74C 3OBAA 2DWSA 4W8AA 3EB4A 1ADQL 3ZHFA 2EXWD 3QPXL 3GEWB 1HFBA 4ZGYA 3RL1A 1E5CA 5I73B 3DROA 4PFEA 1ZLSH 3KYKH 4DI8A 2P1FA 3PREA 4Q8OA 3IN2A 1KTBA 3RL1B 5DUPL 3DROB 1E4LA 1WKDA 3D12B 2ZQ0A 1K9FA 4ECNA 3S34L 2FHFA 3MJ6A 4LL1A 4ZO8A 1LDPL 1WUZA 1ITUA 3V5KA 4KPLA 4FTVD 1GEQA 3V5KB 4KPHL 4FQLH 4RLDA 4OI9A 1SN0A 4IBSA 2GJXA 2LU5A 4MJIE 2CJUH 1E1FA 2OMXB 3ILQC 5JIIA 2GJXB 5DLLA 3TSDA 3UG3A 1MJ7H 1DBBH 4MAYA 3OXSA 1N8IA 3S1WA 4X6DE 4MAYB 3OXSB 1TPH1 1LJYA 4HZ7A 2BB0A 3MBED 3MRIA 2CHRA 4D8OA 1YEFL 1M2OA 1Q9WA 3NK4A 3O2LA 1MCNA 3MRIB 2H6UA 1Q9WB 2OELA 1NWRA 2VRJA 2NQLA 1IZJA 1UT1A 1ETJA 1WDWA 4FX7A 2NY2C 4I0PD 3TS8A 1GW1A 3QISA 4FKHA 5F9DC 1G94A 4QNPE 5F7BA 4W85A 2D2JA 2QVFB 2NUXA 1JZHA 1HWWA 3MUIA 1JK9A 2B77A 1SSGA 1QFWM 1Q90A 3O4LA 1JK9B 4ZS6D 3O4LB 1VZIA 3GSRA 3H24A 4QTGA 1JRHL 2NCEA 5MENE 3AJXA 3A4DA 3GSRB 2DV6A 3UGRA 1I6NA 4PBWD 1X7SA 4BY3A 1TWIA 1F74A 4NCDA 4UTIA 3RGVD 4TUUA 5CAKA 2WXDM 1F7BA 5FGSA 4RA0C 1J1OH 1GOIA 2YSTA 3QTGA 3PE9A 5I0YA 4XN9A 4GRWF 2OCCB 2CALA 4BZ1L 3FQ1A 3M5VA 2G3JA 3S4SG 2CRIA 4A3QA 1YPFA 3AYRA 3SJVE 2KLRA 5KSBA 5HI3D 2P48B 5XIAA 1L8NA 1U2YA 1HINL 3NSCA 5KSBB 1OP4A 5ALCH 3AICA 2APSA 4PJEA 3MV8D 3VE7A 6FABL 1A8JH 1YAZA 3W7QA 4GYBA 4PJEB 4MLIA 5D05A 2WYIA 5E9DA 3U7VA 2E3ZA 1JZ7A 2JSFA 4KK9D 1N5YH 5FV1L 5E9DB 1U3JA 2WJFA 1Q2RA 3SKNA 2AZUA 5FYLD 1UKOA 3ULUC 2XQYG 1JAKA 3SKNB 1IL1A 1EPFA 4XNZB 2TPSA 5IOKA 4NI6A 1UOLA 1D7KA 4G3YH 4PWFA 5GGTH 1JF5A 1IL1B 1SEQH 2ZCHH 3O7UA 3F58H 5F7DA 5DHEA 3ESPA 5I26A 4AL8L 1QFPA 1QLFA 3BH8A 3SUUA 1JUFA 5F7DB 2DQFA 4GYPA 1QLFB 3BH8B 1JUFB 4YSSA 4OZFA 2DQFB 2P8MA 3FJTA 3APCA 4AG0A 2XNAA 3RBGA 5I18L 3V5OA 3TJPA 2CMRL 4OZFB 2P8MB 4RX4A 2XNAB 2GJ6D 4GLEA 3II3A 1FWDC 3HBGA 4IU3A 4P2OD 3DX4A 4UUJA 2GJNA 4UNLA 1TE1A 4IU3B 1H8OA 2QQNL 3II1A 4NQED 3CHCA 1ES0A 3LRMA 3EKCA 1S2VA 4UUJB 5IQLA 2V33A 1RQEA 2HTKD 1DJYA 1ES0B 4A35A 2TSBA 3EYVA 3I50L 4GBDA 2BSCA 1TYEB 1BQHG 2Z24A 1ID2A 4QTFA 1UADC 1BF8A 1IC4H 2M8XA 3EYVB 3AABA 3CUZA 2B9BA 2KT6A 2X0HA 4M4RA 4WEUD 3ZDXB 4M4RB 1TWSA 2BASA 2OYPA 5HR6A 2Y7GA 4L4TA 2JJSC 3AYVA 3S3SA 2PRHA 3U2EA 4L4TB 2EAEA 4WW2A 3APNA 4PWKA 3UR8A 1TPVA 4WW2B 1OCOB 3H55A 4MXQC 3S36L 4PJEE 6A3HA 3M41A 4PJAE 4FB7A 1U1UA 2E47A 2QCEA 1FZJA 3U2IA 3DFQA 4HJGA 1FZJB 3KS5A 4FQJL 3OG4B 1QI2A 4HJGB 3WNIA 1BMWA 3MC0A 1FCBA 5ICUA 1NCWL 1XF3B 1JZGA 4ZS7L 1NCBL 1Y5VA 2CLVA 3AWGA 4JKWA 2H90A 3QNXA 2AXHA 1JZDC 2CLVB 5I74C 3H9SA 3ZOAA 3QNXB 1G0DA 3MNVA 3WJJA 3H9SB 3CM4A 3MNVB 4DRSA 3NYKA 4JTSA 3IMRA 3L2LA 2EDDA 2W95A 2RAMA 4XAKD 2KZ1B 1PZUB 4WVRA 4TX8A 1QUMA 3LSBA 1F13A 1U3HD 2XIBA 3PFQA 2DZWA 2E0PA 3N4EA 2IPKA 1HE7A 3JBG7 5IEHA 2X16A 2IPKB 4OB5H 1TJRA 1HE8A 4PW3A 2JFEX 1ZKAA 1FKXA 5IEHB 4AKQA 4XIMA 4H25A 4NASA 1NUGA 2VXQA 1W6LA 3RHGA 4XN5A 1L9NA 4H25B 1U8LA 4GAGH 5DRCA 4JFFA 1XBZA 1ASOA 1H3PL 4M7JL 4CD8A 5B3NA 4JCLA 1U8LB 2QUVA 4JFFB 1K5WA 2A0LC 4ESKA 2WZAA 3D0LA 4MA8L 1UURA 1BQLL 1PCWA 1NOLA 3ZKMD 4L4TE 3D0LB 3QDMA 3RHWF 4QWWC 2WSDA 4F9LA 4HT1L 4GK8A 3QDMB 3FDKA 4WDXA 4HWBA 3QWQB 3ESVF 1INEL 4AY1A 3Q2VA 1S2AA 4KWOA 4L4VA 1SJVA 4YJZL 2YLLA 1T8XA 2N0MA 1BXCA 3CPRA 4L4VB 4R84A 4K8RD 3WIFA 4M8VA 2FVLA 5AC6A 4E38A 1EJ7L 4HXAH 1EHKB 3W9DA 2LU4A 3WIFB 1DJZA 1SQMA 1MCOL 5D7LD 3W9DB 3UWEA 4HWUA 3U25A 3SM0A 3H9SE 1DV7A 4UYPA 4AU0A 5HTSA 1HH6A 3N0AA 4X6DF 5EEYA 1ZS2A 1HH6B 2W63A 4XMZA 4UFLA 4Z2IA 4IMLA 4O58L 3T8VA 2V3FA 3GXNA 3PBUA 4IMLB 1KRCC 1IAIH 4LSTL 3G9VA 2QCDA 1RHFA 1OALA 3RK8A 4I9TA 2OWCA 3MHGA 3P61A 3K4ZA 2QCDB 4JIQA 3BQ5A 5IVZA 3IRCA 1S6NA 1RA0A 3I6RA 3S9YA 3OGOE 2R6OA 5IVZB 3ECBA 3VWKA 4CD7A 3C5JA 3O6MH 2HRWA 5KJ7E 6REQA 5IQMA 5J1AA 4WW1A 3EEGA 3ECBB 5A8MA 3VWKB 3C5JB 4FQXA 4J40A 6REQB 4NYYA 4JM4L 5J1AB 4WW1B 1LO0H 1SDAB 3MCLL 4FQXB 5FUZL 1M6UA 4NN6B 2F8VA 2WB1A 4JFFE 1AZNA 4XPFL 4LOUD 2X2IA 4C60A 4YSOA 2XFFA 3BISA 1W9UA 1IU1A 4CQ9A 5TIMA 1Y5WA 3QBUA 1CDGA 2X9ZA 3I6LE 2JWYA 4C4KT 4M80A 2B3RA 4Z0XA 3QDME 3PNUA 4H0GA 4Z0XB 3UJIH 3ZRFC 4K3GA 1YUHA 4PBXA 3D1MC 1EJVC 3H4WA 3V5DA 1YUHB 1EGJA 3VPLA 1EP2A 4JBRA 1JDCA 3V5DB 1H0DA 4L4VE 2LGNA 5TK4A 5AVNA 1H0DB 1CGSH 3MHZA 5FKAA 1AE6H 6PTDA 5TF0A 4P9HC 3KBFA 4Q6KA 5FKAB 2DV0A 3LPGA 5GZOC 1PNCA 3WDQA 5M94B 3P5YA 1XBRA 2W9EL 2JI3A 1JGVL 1TETH 4J6RH 2UZIL 5AKQA 1W31A 2WAHA 1EFXD 3VDBA 4NFDA 4L7ZA 3GSOA 2C1OA 4EQ2A 1KCUL 4XZ4A 4LLQA 2X4OA 3ZJKA 1ZHKA 2C1OB 4LLQB 2X4OB 1ZHKB 2DSWA 3VFPA 1UZ4A 3AUWB 1W9PA 3GKWL 4ZSTA 4AK2A 3VFPB 1A8ZA 1E9ZB 3U2OA 4AD4A 3V0AC 4N2IA 1ONWA 3Q13A 1MHPH 1L7TL 2ORBL 4A8IA 5TE4L 1Z44A 4BI5A 2WW8A 4Y19A 6PAZA 3BAWA 5E5LA 4DHLA 2BHUA 3R0MA 3H2AA 4Y19B 3T0AA 4JM2D 1XLHA 5E8PA 2NDGA 4RWHA 2ZA1A 5E8PB 3CZEA 1HO1A 3UZ5A 4WUUD 5HHOD 1C5CL 3DBNA 3HE7C 2AQVA 1ETZA 4IOFD 3KWXA 1PAMA 2EDQA 1WBYA 1X5IA 1ETZB 1EDYA 1MH5A 4NN5C 1BD2A 1WBYB 1AOHA 1MH5B 3UTPE 3L3OC 1BD2B 4LP8A 5JVLA 1UACH 3EB3A 3Q3GA 5BUAA 4QFUA 2PWGA 3CH8A 3GQFA 3Q3GB 1MQQA 2DQIH 4Y5VA 4CUCA 3DIFA 1OARH 4NC1C 4Y5VB 3EA1A 1KOAA 3DIFB 2AEOA 2HH0H 4S3CA 2PP8A 3K2UL 1ECEA 5F1UA 1VQTA 1E0OB 3DX7A 2ISVA 4PJEF 4YLBA 4PJAF 3ARBA 2VLLA 2GUOA 3QDHA 3DX7B 3OKDB 3P3SA 4IXXA 1IIGA 3PF3A 3ARBB 2VLLB 1HTYA 2GUOB 5EO0A 4JHVA 3L1EA 5J89A 5M5DA 3EFDL 5EO0B 2E09A 3V4PL 4Z7NE 2IJ0C 3W11C 4M03A 4EK7A 1OTUC 4IM4A 4DJDC 3EBIA 4JYEA 3JZ7A 1GYLA 1KGUA 1DIEA 4FAAB 2YBUA 1TXKA 4D9QE 4HA0A 3DI2B 4JKKA 4BJHA 2BPBA 4LLAA 4HWEL 1SHWA 2ZWSA 5C07D 4M6QA 2G2NA 4KERA 3CBJB 1GKPA 4R2GD 4LRNL 1UR4A 4O53A 5E6UB 2EIJB 3L1OL 4CQDA 2VWSA 4Y19E 5T3XE 1XYMA 2CBUA 3TTOA 2ABAA 1PY0A 4OM0L 1EUAA 3UG4A 1KPVA 3HFMH 1RBAA 3MBEA 3LN3A 3DX1A 4FMKA 1KPVB 2GI7A 5I71B 3MBEB 4EAEA 3OAWA 2PDJA 5L6YH 1P2CA 2OL3H 2QZQA 1FDLL 1BD2E 5F9WB 3RBSA 1P2CB 5EBLA 1DBKL 3E0WA 4UQ9A 3BAIA 1K8IA 2XXFA 5EBLB 3LQAH 1QEXA 1K8IB 1WAAA 3C12A 2IV8A 3WY2A 2IUZA 3QCUL 1KFBA 1R3QA 3FRPA 2XV2A 4C6OA 5C6TH 4WW2F 3P69A 4LH8A 1ZALA 4OZ4A 5C7ZA 3FRPB 4K7FA 3OLDA 1HJWA 4TMBA 2FYVA 1KV8A 1IJNA 3COOA 1T6VN 4OZ4B 1E5BA 4K7FB 1EF2A 3VFCA 1QBMH 3RPIA 1TJIL 1IILE 3AS1A 5T1MA 2ED6A 4C6EA 1PD1A 3C2AH 2E5CA 2QQKL 5E00A 1R3VA 3RPIB 1IIHA 4ZUWA 5T1MB 4JGDA 1MWAH 2ZNWA 1AGFA 3L7EA 1BWVA 5E00B 5T1DL 3GEFA 4ZUWB 5HULA 1OLZA 5J5RA 4LVNC 1AGFB 3L7EB 4MKSA 1FH9A 2DLFL 1W0YT 4DO5A 1MJUH 1UM5L 4E36A 4HSCX 2PDBA 4LF2A 5FO2A 1YN7A 2VUYA 4FTVE 1MXGA 2J75A 1MREH 3PG2A 1Q5MA 2HNEA 1YN7B 4Y96A 2FEDD 5HVFB 4CDHA 4HKJA 4KDTC 1TVDA 2NUPA 3MV8A 4HKJB 1UZ8A 1A5MC 3Q9QA 2NUPB 3MV8B 3L9BA 3P62A 4GKOA 1UZ8B 2OW6A 2BVOA 3MSYA 4DP0X 2GFBA 3V7AE 1OM3H 3FSUA 2BVOB 3MNMA 2GFBB 1EHLL 1EO5A 1WPCA 1MAKA 5DFVC 3Q48A 1K72A 1WK0A 1BFOA 4XX5A 3KR3H 3FK3A 3WTVA 1BFOB 4K5NA 3EWDA 2OQLA 2GQHA 4QTHA 4HYRA 3WNJA 4MA1B 4QTHB 1ZV5A 3TBCA 5DZ9A 1XIDA 3UW6A 2CERA 1R3KA 3A3YB 4KFPA 3F7KA 2GJ6A 1R3KB 3KL5A 2WLIA 4AV5A 5E9XA 3C56A 2GJ6B 2WLIB 4DO6A 1SF3A 1IGIL 4YDKH 3R94A 1VSCA 4FX8A 4PRDA 4NQEA 2IMMA 2VDNH 2HCVA 5DC2A 1MNSA 2VX5A 4PB0H 2P50A 2ZUWA 4PRDB 4NQEB 2X7LA 3OQEA 5BXPA 3AXLA 1BOYA 4N0CC 4MQSB 1SYTA 2X7LB 4M3PA 2C1PA 1ZS8A 2EPHA 2FO8A 1Q63A 3T9PA 3AXLB 3TA4D 2C1PB 1ZS8B 4JO4L 4ERSH 4KY1L 3W72A 3MO1A 3SRHA 1ET5A 4IMKA 4F57L 3AU0A 4ICMA 3QQDA 1FHDA 3MO1B 4DBSA 4MAUH 1CPUA 3QQDB 4JYDA 3PVFA 3GMQA 4AY8A