2CLOA

Tryptophan synthase (external aldimine state) in complex with (naphthalene-2'-sulfonyl)-2-amino-1-ethylphosphate (f19)
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
266
structure length
257
Chain Sequence
ERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRSGVTGHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allosteric Regulation of Substrate Channeling in Tryptophan Synthase: Modulation of the L-Serine Reaction in Stage I of the Beta-Reaction by Alpha-Site Ligands.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
molecule keywords TRYPTOPHAN SYNTHASE ALPHA CHAIN
total genus 102
structure length 257
sequence length 266
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2006-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2cloA00
1F76A 1YDNA 1PCKA 3WK0A 1T0OA 4K36A 4MLRA 3FJ6A 3NL3A 5D32A 1OX5A 4A21A 4LV9A 1K03A 1HFBA 3ZR4A 1AL7A 4EIVA 2EPHA 1TV8A 1XC4A 3Q2DA 1TREA 4UFJA 5DXXA 1VCFA 1YXDA 4K37A 1WOBA 3LCIA 3F03K 4MUZA 3QC3A 3VFLA 3W7JA 4M5PA 2FJKA 1EWDA 3KRSA 3MP5A 3GDMA 5D03A 2P10A 2E5BA 5F2LA 3W7DA 3S5NA 2NX9A 1HO1A 2J6XA 4XKYA 5FF3A 3G0SA 4LVDA 1I2OA 2QUUA 3SSJA 2Y70A 5D05A 4QSHA 1L6SA 1TPWA 2C13A 3S1UA 3TQKA 1ZJIA 3IIOA 1F7BA 4JTHA 4QJ1A 3A22A 3BGJA 1U83A 1KFKA 3TXVA 1YYAA 7TIMA 1PHQA 3CWNA 2J9XA 3QMSA 3ELFA 4GUGA 1ADOA 3LHWA 4MFEA 1UBSA 3E12A 4DF2A 1O95A 1X8FA 2GVJA 2CFFA 1Q6RA 2FDSA 2VFEA 3DFPA 4O1DA 4ADUA 4FXSA 1XBXA 3THAA 3TCEA 3P84A 4LT9A 5DBTA 4GWEA 4NNBA 3PULA 1B9BA 5HWNA 4MZYA 1XL9A 2EHHA 1LOSA 1GYNA 4G1KA 3VI2A 4FX8A 3W85A 5KZDA 4HNUA 2YYTA 2QCNA 3PM6A 1I4NA 4WD0A 3C4UA 4H6KA 1H7WA 6TIMA 4O12A 2I1OA 3TFCA 5HR7A 4ZVJA 3CU2A 5DBUA 3GXTA 4AXKA 3S0CA 3C8FA 2C3ZA 4GE8A 4KFPA 3NYZA 4I7UA 5I3IA 2J88A 2RH9A 3LCFA 4IUOA 3A9IA 5E93A 3W72A 1QOPA 4ZQPA 5I3GA 3GK0A 1B4EA 4UXDA 1SR9A 4OT7A 3W7GA 3M5YA 3SR7A 3TR2A 4O17A 3C52A 2H90A 1QR7A 4JX6A 2Y7EA 1FWWA 3CTLA 4WX2A 3UD6A 3W86A 3UXDA 2V30A 2GOUA 4GJ1A 1IXOA 4RXGA 3A24A 3NO5A 1ZFJA 3IVTA 1UJPA 2HTMA 1TRIA 4FB7A 3LHTA 4A3UA 2CW6A 3LHUA 1F73A 4PA8A 3PC0A 2PCQA 2LLEA 3QRHA 4AF0B 3BW2A 3P81A 2P1FA 1TTJA 2TYSA 4O1CA 3LI1A 4RJEA 3G8RA 4Z0SA 4O1AA 1KM4A 2TSYA 1KM0A 1FCVA 5HNRA 1QCWA 5U4NA 1IF2A 2NZLA 3M9YA 3BLIA 3FEMA 3MP4A 4UIOA 4W9TA 1UB3A 3LERA 2ZZ2A 2ISSA 1ME7A 3LXAA 1E51A 4UTWA 3VE9A 4IMGA 4IXXA 4NQ1A 3DFTA 3OVPA 4UR8A 1OYBA 4AH7A 3PBYA 4JX5A 3DH7A 4BK9A 1TQJA 1TO3A 3FFSA 3TAKA 2QEZA 3W1PA 3THQA 1SSGA 2HS6A 1K3UA 3NQVA 4NNCA 4X2RA 1FCUA 3BG5A 3TIMA 3SGZA 1LP6A 2VFHA 1S3HA 2QAFA 5C54A 2ZRVA 4CCDA 3YPIA 4AHOA 4Y6GA 4ORMA 4S2BA 3S9YA 2V81A 3TFXA 3ATYA 3W7NA 5G4EA 2QCHA 5AHNA 1VLIA 5CPNA 1XKYA 1DBTA 3KHJA 3LI0A 1J4EA 3GAYA 4MY8A 2E77A 1PS9A 4DO6A 1ALDA 3R2GA 1SO5A 3BVJA 3W7HA 2CLIA 3IGSA 4I7WA 5CGQA 2ZTJA 5ABTA 4RZ4A 4O14A 3W84A 2ZRYA 1P0NA 4C1LA 1JUBA 2J9YA 3WK2A 4KKXA 2YR1A 2DZSA 5I3HA 4U28A 1SZFA 2A1YA 1LBMA 4TU1A 1TPFA 2RFGA 3HMJG 3IIPA 2E6FA 4LVAA 1TTIA 2BX7A 3KRZA 2R94A 3S1VA 3LCHA 3NQDA 1KBIA 3W7EA 1OF8A 3F1QA 1SPQA 5CG7A 3W2JA 1OFDA 3KVMA 4IJBA 2Y88A 3UNDA 1JUKA 4MFDA 4LC8A 4HT3A 3MBDA 3VKJA 5FF0A 2PRLA 3NQ7A 4BI7A 5LGZA 3T44A 3NPVA 1XXXA 4OV4A 3L67A 4JXCA 3C2EA 2ZZ5A 3JRKA 4YWIA 3I7RA 2DZVA 3B05A 5LHEA 1Z42A 3OG3A 5BMWA 3IGUA 3GKAA 3NM1A 4PL2A 5DCEA 2W79A 1ZY9A 3H54A 1LRQA 1PV8A 1KTBA 2J24A 3GAKA 3TMQA 5FI8A 5BW6A 2ZZ3A 2ZZ7A 3G0XA 3R12A 3HGSA 1EA0A 3BLEA 1WV2A 1RQEA 3CM4A 3B0VC 5KZEA 2GQAA 5AHIA 1ONRA 1MEIA 3N2XA 3M5XA 4QITA 1XI3A 4O11A 4XWUA 2Y7DA 4MYXA 3W1XA 3RLUA 4GUJA 2QDHA 3EX1A 3DI1A 3NGJA 4OHQA 4CLMA 3ZS4A 1O60A 2XN2A 1P4CA 4LY8A 1CI1A 4ZMGA 1EWEA 3GLCA 1UASA 2CLHA 3W7QA 5LKYA 3QW3A 3C2OA 3O15A 3MBFA 1OFEA 3QQ1A 4Y96A 2X2GA 2ZA3A 1OYCA 1RQHA 3WFAA 4JTFA 2CU0A 3NR0A 1UUOA 1CW2A 2B4GA 2VENA 1RQBA 3NDOA 4JR5A 4I9AA 4O4WA 2VEKA 4O15A 4Y90A 1R2SA 3W6YA 3DI0A 2GQ9A 3ABQA 3KX6A 1G4PA 1P5BA 1OFRA 1JCNA 2FLIA 5LHFA 3B4UA 2ZRUA 3E49A 4MOZA 3EWZA 2IQTA 1LBFA 4LW7A 3A5FA 4KWVA 4UTTC 2WO5A 2NWSA 4JDYA 4XTDA 3RNDA 5D38A 3N9SA 4X22A 5HINA 4YXGA 1I2QA 4O16A 3LBMA 3HJZA 2GVGA 2ZZ1A 4DBDA 5KTLA 3BO9A 4JTSA 2JKPA 1H61A 2CZ5A 5TBOA 4GUHA 1TCDA 3EX2A 5LZLA 1JQXA 2ZQ0A 1A5BA 2XN0A 3C0JA 3W7RA 1GVSA 1W3NA 3MI3A 3W2NA 3P5ZA 1QDSA 3PWAA 1OHLA 4E38A 1VHCA 4LNYA 3CEUA 3W88A 1KBJA 2YCEA 2KZHA 2D73A 5FF2A 2YYUA 2YSWA 3W7PA 2Z6JA 4WZHA 3KAOA 4YL2A 1KFCA 4FXRA 2B7PA 4UTKA 3E02A 4DXVA 1ICQA 3LHYA 1NFBA 1MEWA 2PC4A 3MYPA 4HSNA 3PS7A 4ZQRA 1G7UA 3NL6A 2VKZG 3G1VA 3F4WA 1XDMA 3W70A 1FWRA 1YPFA 4UMAA 3LLDA 1H7NA 3G1HA 4WOZA 5EPDA 2RDWA 3FYOA 3NPUA 4LWWA 2QUTA 1LORA 3I7QA 4O1BA 3HGOA 2I14A 2CLMA 4NJJA 2R14A 5K3VA 5G2WA 4YCPA 1Q6OA 3N34A 1QNVA 3P61A 4NXKA 3PUDA 1FWNA 4PCFA 2B7OA 4Y8FA 1K8YA 3UWVA 1TPDA 3HB9A 4WY0A 3H53A 1P1XA 3HPZA 1JRCA 5EMUA 2QCCA 5SWUA 1FXQA 4NUWA 1A53A 2JGQA 2V2CA 4IMCA 1KLYA 3VCRA 3W76A 1GYLA 5EL1A 5BOOA 3QFEA 2H8XA 3C61A 3K30A 3STEA 5L9FA 1ZENA 1KM1A 4AHQA 2ZRXA 3SGUA 2C1HA 4WQ6A 4CNOA 1WA3A 4MVAA 2RKXA 2YDAA 1O4UA 1S5WA 4N2YA 5K9DA 3RMJA 3WJZA 5F2IA 3NNTA 4UTLA 4WY0B 2X1RA 3BW4A 4JNMA 3PBUA 3M44A 3T78A 3E96A 3W87A 4HNVA 5K2ZA 1EP2A 3QF0A 2BZNA 1GEQA 4EWND 3I65A 1AMKA 4IWWA 1DL3A 3NQAA 1YLVA 3L0KA 1FWTA 4OQVA 2H3DA 3QSTA 6ALDA 4UTIA 5LNRA 4RZ5A 4NU7A 3GDRA 1Y0EA 3BG9A 4LS2A 1VR6A 3OEXA 3TW6A 4PC8A 4RV8A 3G1YA 4JTTA 2Y63A 3RF9A 3Q58A 2Q8ZA 1JJKA 5F2GA 3NQCA 1LLWA 4DPQA 1H50A 2TRSA 4BR1A 4H4IA 1LLZA 2E09A 3PR2A 2JBMA 2NXIA 2NUWA 5KMYA 3KVLA 1PL9A 1VZWA 3E0IA 2VC6A 4QAIA 4DEFA 4JTEA 4H3DA 2J27A 5F4WA 3W1MA 1TV5A 1M6JA 2JKAA 2XFWA 3B0UX 2ZTKA 5MHBA 4JYDA 2AGKA 4OGZA 4WJEA 2ISWA 3TX9A 3LXBA 4XUGA 3DHFA 3RLVA 4D2JA 3LCGA 3ATZA 2EGZA 1W5NA 3PB2A 4JN6A 1KM6A 3M43A 4K7VA 4OBTA 1MZHA 2ZA2A 4Z1AA 1GG1A 5AYXA 4IGHA 3BARA 4M6VA 2YGYA 4FNRA 2WOQA 3HG2A 3M6YA 3G3MA 4RLIA 5AFDA 2G97A 1KV5A 4HIBA 2FIQA 4DPPA 3EWXA 3A5VA 4OWGA 3M7WA 2Q8LA 3VNDA 3H55A 3HBLA 4R7JA 3UWQA 5LNVA 4IOTA 4L4MA 3G18A 2WNQA 2GQ8A 2X16A 1ZAIA 1MSSA 4JY8A 2O7QA 2ZRWA 2Y89A 4UUIA 1LDCA 1RR2A 2E5DA 3ABRA 3NXFA 1DQWA 4NJGA 3WJYA 1DVJA 1YXYA 2QF7A 3HGRA 4ZQNA 3EXSA 2PE4A 3TV8A 2WJZA 4FHAA 2VOMA 1LBLA 3T40A 3L9CA 1AK5A 1C29A 1F05A 1VCVA 2E6DA 5HJLA 4JX4A 5CZ0A 4Y9AA 3C56A 1H5YA 1KM2A 1C8VA 3PBVA 2FFCA 3HIJA 3O05A 4N6FA 1H1ZA 2QKFA 2PRHA 2A0NA 3LOTA 4LVBA 3STGA 1VGAA 4Q33A 3TSMA 2PRMA 1OFAA 3CPRA 1EP3A 4ZQMA 4OV9A 1XDLA 2QCFA 4LRSA 2B7QA 3G8EA 3S1XA 1G4TA 1QPNA 3UWUA 3GKFA 5F1VA 1C9DA 3WK1A 3L0GA 4RKAA 1K8XA 2ZDRA 5G1TA 3W73A 4HPJA 4E2DA 1YTDA 5D09A 2H3BA 1W37A 2YFNA 3PSVA 4UFLA 4MLJA 3C2VA 3MJYA 4O4VA 5BRBA 3QSRA 3IGXA 3EWBX 3LB0A 1DJQA 3W1UA 3JR2A 5K9XA 1WOAA 3EKLA 1W8SA 3LM7A 3LTPA 1Q45A 1B4KA 5AHMA 5AB3A 2ZYFA 2WQPA 4O28A 5CZJA 1KV8A 3IIVA 1VYRA 1OK4A 2VEIA 3P74A 3W7KA 5G4WA 5C2XA 3W1QA 4PH6A 4XKYB 4MIMA 3EXRA 1XFBA 3EWUA 4NXSA 4MJZA 3S8HA 4YMZA 2OZ0A 4WUIA 4TMCA 1VYSX 1VHNA 4NZFA 4JTJA 1H62A 2VFGA 3AJXA 2HSAA 1TTPA 1R2RA 2E5CA 5HWJA 1SUXA 3B0PA 1SW3A 3N14A 2Y61A 4HNTA 2NX3A 1IXPA 3NQMA 3L66A 3EB2A 1YDVA 3BV4A 1W3TA 2NV1A 2OT1A 2C6QA 1GWJA 3PB0A 1YADA 1GVQA 2NX1A 3W7LA 1QPOA 3P80A 2ZFAA 1L6WA 5DELA 4ADTA 2VEMA 4IX0A 4M19A 3FKKA 4GNJA 2EAWA 3WJXA 2YX0A 1L6YA 1I45A 4N6EA 4YCOA 1LM1A 2Y7GA 1TPUA 2WNNA 3C2RA 1A5SA 3PAJA 3JS3A 4JYFA 1NSJA 3IIXA 3L68A 5K7JA 1MO0A 3TAOA 4FIRA 4QIUA 3UZ5A 3PUOA 1OX4B 4E2BA 2GPTA 3CB8A 1D3GA 3EWYA 3HPSA 1KTNA 3NZ1A 1IIHA 3LRMA 3LV6A 5KITA 1JR1A 4CCCA 3O6YX 2A21A 3W9ZA 1P0KA 3LCLA 1W31A 3HG4A 4QNEA 5E1QA 3O6CA 3NPWA 4C1KA 3GNDA 1R2TA 1YTKA 1OJXA 3BG3A 3UYCA 2QCMA 4KFNA 3G1SA 3OA3A 1OYAA 3ZWTA 1L2UA 3BW3A 1A5AA 1G6CA 1O94A 4BWLA 4LVGA 4RR4A 3MHFA 3O1NA 1EB3A 2C15A 4DO4A 3QMRA 2ALDA 2C14A 5IBXC 1G4EA 1U5JA 4K7YA 5G1YA 3I68A 1GPWA 4QNWA 3R89A 1SW0A 1OVDA 4FNSA 3PG8A 4IQLA 1GVOA 4M7SA 4JIPA 3NPXA 4JICA 4LVFA 4NVTA 1F2JA 1HO4A 4IMFA 1TPB1 3DFOA 1ICPA 3N9RA 5EBUA 3N2MA 4JD4A 3V1PA 2ZRZA 3QQ0A 1ME8A 1W0MA 1OX6A 1EIXA 4K38A 5D2XA 3TJXA 3P5YA 3TE9A 2ABBA 4UTWC 3MI6A 2B0MA 1D9EA 2WSYA 4NJKA 5GVJA 4XTIA 1GVRA 3UXAA 1ZCOA 1AG1O 4JYEA 2C18A 1HTIA 1WQ5A 3W7OA 2QCDA 5G2IA 3W22A 1JVNA 4AVFA 2GVLA 3LCXA 5A8GA 5HUPA 3QH2A 3M16A 4NJHA 3CT7A 1NF7A 2WV8A 2A7NA 3NQ2A 1OABA 4Q4KA 3DXIA 3OIXA 1KTCA 3DHDA 1H1YA 4IPJA 3L65A 3PSWA 1CX9A 3OHIA 3DU0A 2NV2A 3B8DA 3HG3A 4HNNA 2G95A 3GDLA 3W1TA 4MKNA 1Q6QA 3UQNA 1XUUA 3TDFA 1YXCA 1TTQA 2YPIA 4UR7A 1WBHA 2CLLA 4RX0A 1DQXA 1KM3A 5DY2A 4LUIA 1SO6A 5EY5A 5LNSA 3PG9A 3QPZA 4DF1A 3MYOA 1FY6A 1GQNA 1FXPA 3DZ1A 4UMCA 3M5VA 2OMAA 3EKZA 2RDUA 5D2VA 3OBKA 3TROA 3LXCA 4R34A 4NNAA 1H60A 2QCLA 5CPOA 3BGGA 2WSQA 2Y6ZA 1T99A 1F5ZA 5TIMA 3M0ZA 4OU1A 1M5WA 2NLIA 5G5IA 3NQFA 5AYYA 5H91A 2HS8A 4O0KA 1RVGA 4LOCA 3FOKA 5C55A 4JY9A 2QJGA 3MP3A 1K8ZA 2Z0IA 3GZ3A 4DQWA 1RV8A 3M5ZA 1JRBA 2ZCGA 1RZMA 1AW2A 3TMLA 3IRDA 3WK3A 4ML9A 5IM51 1BWLA 4LS0A 4BI5A 2A2IA 5F2MA 2DORA 3IEBA 4RCXA 3W2UA 1QOQA 2CLFA 2TMDA 3W74A 5C6MA 4O53A 4LU0A 2FB2A 3GXNA 1PE1A 3VE7A 1THFD 3LBCA 2V82A 4JTKA 3TC7A 2Z1BA 3MW7A 1HL2A 1TJPA 4FNPA 4K8EA 3P7YA 2H8ZA 3OVRA 3S5YA 2GUUA 2V8ZA 1IGSA 4LV4A 1SSDA 3TQ0A 2JK2A 3W2LA 3GYEA 2WPBA 3GB6A 2B7NA 4R53A 3P8JA 2Y7FA 3NQ6A 4O57A 4JS3A 3KVJA 1W5MA 3LCWA 1VJIA 4NX0A 1QPRA 3NM3A 1WX0A 2CLEA 1UUMA 2H6RA 4AF0A 4JDBA 5K9CA 1FCBA 3DAQA 1OFPA 5D33A 1OK6A 5DY3A 4BF9A 3P67A 1LYXA 2EKCA 2R8WA 1FUYA 1PCWA 4TO8A 3W1NA 2O7SA 2VEPA 4GBUA 4CQ9A 3S5OA 1S5TA 5HMSA 1DJNA 1R46A 4GC4A 1FX6A 3KRUA 2NWRA 1NEYA 3LHZA 4DBEA 4O13A 4WXYA 4UNLA 1Z41A 2FQIA 1Z44A 4FNTA 4FX6M 3L5AA 3L0NA 3GX9A 3W1AA 3HQ1A 4JTIA 3TA6A 1YDOA 2GJLA 1ZHAA 3MI2A 3QYQA 5FF7A 4HKPA 3C3NA 4DELA 1QPQA 2W6RA 3MUXA 3UWWA 2CLKA 4ZL1A 4CQ8A 4GRSA 2QAPA 4FF7A 3ANYA 1KLZA 4N4QA 1VC4A 4MYAA 4UTTA 4A29A 3UWYA 4ORIA 1K7EA 2JGYA 3DKLA 1TPEA 1TB3A 5H2ZA 2ZZ6A 4N02A 5CSRA 1EUNA 3R5EA 3KOFA 2C16A 2V2HA 3GVGA 5FF4A 1GG0A 4M6PA 2QJIA 3BK0A 5E0KA 3TC6A 4O8RA 1XBZA 1W56A 5FEZA 4M7TA 4O54A 2WKJA 2DJLA 2A7RA 3P60A 2QR6A 1JCLA 3UWZA 1JUEA 1EX5A 1TPH1 3EX4A 1FBAA 3BLFA 4UFHA 3SW6A 2A7PA 3O6DA 5HULA 3R8RA 1NF0A 3LGEA 4JTLA 3SI9A 1I2RA 3W07A 5L6UA 2RDTA 2E68A 1H7XA 3F4NA 3L5MA 5HQEA 1WAUA 3GDKA 2DP3A 2FTPA 3LDVA 3EXTA 4B5NA 1M7PA 2NUXA 4LS1A 2E1DA 5FESA 1TPC1 3TSDA 1XUZA 2W0UA 4UCGA 1SFJA 4X3ZA 1VQTA 1W5QA 2NXGA 2V5LA 3T55A 3G1XA 1HUVA 3I6RA 4S1FA 3LV5A 1K7XA 1G67A 5CZSA 1UCWA 2DZTA 2YZRA 3UY8A 2CZFA 5D37A 3IV3A 4AHPA 4CCEA 4JEQA 4RZ6A 3W2KA 3T7VA 2E6AA 2DJXA 4UTMA 3G3DA 4N9BA 3NAVA 2HMCA 3DFQA 4NZJA 1OG0A 3B04A 4K6AA 1QFEA 1I2PA 3NQ8A 3NZRA 1OF6A 3QZEA 1VCGA 3GNNA 3LTYA 4BFAA 1QO2A 4GUFA 5I3KA 3PF3A 1I2NA 3IVUA 3CLMA 4AEOA 3S42A 1TQXA 1H7PA 2YW3A 4PEKA 4TR9A 4EVZA 3PY2A 1OFOA 4XBSA 5CZTA 3ABOA 2Q3OA 3W7MA 2C0AA 3TJLA 3EX6A 1VS1A 1ME9A 2OCZA 4GFSA 5LSMA 4I7VA 2CLOA 3HG5A 1AW5A 3EWWA 4XBKA 1WBJA 1H63A 1ZNNA 5FEXA 1GTEA 1DHPA 5FEPA 4POCA 1PHWA 3STCA 1V5XA 2BTMA 4X9SA 1X7FA 3C6CA 3GXPA 1V7YA 4DO5A 1LCOA 3GR8A 5F1UA 1KM5A 1F6KA 5CKSA 4UTHA 2EF9A 1I8JA 2F84A 1FCQA 2Y62A 1B3OA 3N73A 2FPTA 4PFMA 1R30A 1VPXA 3CHVA 3SY5A 3MMTA 3W71A 5DCDA 3FA5A 1YPIA 3USBA 2ATSA 3FIGA 1SFLA 5AC6A 1GT8A 3B03A 3N19B 4IMEA 3ZWSA 2X1UA 3N3MA 1ICSA 4O52A 3O07A 3NA8A 3L21A 3U6WA 4FX7A 1KFBA 1LOQA 4MY9A 3DBPA 4UFIA 3LRKA 1TIMA 2C19A 3KXQA 3NL5A 2V9DA 1H7RA 3P82A 3EEGA 3QMTA 3QJAA 4PL1A 1EPXA 3TK7A 2AAMA 5D2TA 4Z1CA 2GJNA 1G7VA 5KINA 4CQAA 5BNKA 4A2RA 3QEZA 1KFEA 1BTMA 1AL8A 2J9ZA 3MHGA 5HR6A 5D2YA 1KFJA 1LRNA 1TRDA 1DORA 1SZGA 3QW4B 2VXNA 5DXYA 3PVFA 5CPMA 4QISA 1LZOA 4MPQA 2X1SA 3O06A 1WXJA 4LRTA 4UTJA 5CSSA 1W5OA 2A85A 1X6UA 3PUEA 3TSBA 2ZBTA 4OE7A 1K7FA 3HO8A 3DENA 3DKJA 3GR7A 4FNUA 4A22A 1JCYA 3BPWA 4LC6A 1PIIA 2ATMA 1IXNA 3SECA 4UC5A 3M1ZA 3W3OA 2Z6IA 3G0UA 3LX9A 5T26A 2WNZA 5LGXA 1VH7A 5EYWA 5AHEA 5AYZA 1Z48A 4MZ1A 3SJ3A 2FPYA 4NX5A 1X1ZA 3TNOA 4J9JA 1DOSA 3TH6A 3M41A 4XQ6A 2QDGA 5AN7A 2Z2UA 1EUAA 4MZ8A 1EP1A 5HUOA 3SZ8A 3CQ0A 2VFDA 4NT0A 4Q32A 3KVKA 1XBVA 3W7CA 4TMBA 5I3JA 4PTNA 1GTHA 4ALDA 3CIWA 3DFSA 1SZEA 3Q94A 3G1FA 4R33A 1VRDA 4ICNA 3MO7A 3RFAA 4CNPA 3CC1A 3G1AA 3KFTA 5AC7A 4JTGA 3UPBA 3U2OA 2BSLA 4M6QA 4O18A 4UTUA 3FJLA 2QJHA 3GIYA 3LRLA 4IX2A 1TMHA 2OX1A 2UV8G 1J5TA 2V2DA 1LRTA 2QCDB 3SIZA 3M47A 4QQ3A 4GUIA 4ZZ9A 1WYIA 2V0TA 1FDZA 2R91A 3U8GA 2DZPA 4UNKA 3W83A 2FB3A 4K39A 4WOQA 2YXGA 5DLCA 5D30A 2PURA 1QWGA 1RD5A 2A4AA 2DZXA 1QMLA 1H51A 1T8XA 1JCMP 4O0ZA 3HPXA 5U7SA 1N8FA 4IPIA 1TV7A 1AW1A 3RK8A 1GZGA 4QM1A 4UFKA 3UPWA 1QAPA 4AWUA 3RU6A 5EKYA 5KSWA 1B57A 1ZALA 3G22A 4Z1BA 1SW7A 1SO3A 3T4CA 2F7FA 2Y85A 4KFOA 1KFLA 2A5HA 3MWAA 5F4XA 5LNWA 4FIQA 4UFMA 4WXZA 4AB4A 4AWSA 1O5KA 1FDJA 1YTEA 4O19A 1N7KA 1JCXA 5F4SA 3W2MA 4AMAA 2NUYA 3D0CA 3P62A 3W23A 3L2IA 4N4PA 4O50A 5DCBA 5AC8A 5FEWA 1MXSA 1BKSA 4TIMA 4Z0JA 4CNNA 1RPXA 1OFBA 2X1TA 1A5CA 3AO0A 3NQEA 3S1WA 1G4SA 3HGJA 5CPLA 4MY1A 4DF0A 4LTSA 2TPSA 3NEVA 5J5RA 3EX3A 1JCJA 1H7OA 1IXQA 4AWTA 3TW7A 5C5YA 1DV7A 3V75A 1BEUA 3GDTA 4FNQA 2VFFA 3FKRA 3S6DA 5AHFA 3CIXA 3ABSA 4IMDA 2NXHA 3G1DA 3O63A 2XN1A 2WSRA 2OT0A 2VELA 3UZJA 1TJRA 2VFIA 1ML1A 5TQLA 3OVQA 3TXZA 1WDWA 5D04C 2YW4A 4YLWA 4HHPA 2YFOA 1J2WA 1F74A 2G96A 5I3FA 1N55A 4N9DA 1SU5A 3A23A 1FQ0A 5KZMA 3TKFA 1O5XA 4E0CA 1W54A 1XCFA 3INPA 3NL2A 3S5ZA 2BXVA 2CZEA 2A6NA 2JKEA 1OX4A 3CEPA 4UMBA 4BWLC 3NQGA 1KA9F 4NJIA 4Z08A 3IIZA 4GXMA 1JQVA 5AHLA 4P61A 5IBXA 2QCGA 3O16A 3IVSA 1PVNA 4HN4A 1GJPA 1X1OA 2DZWA 1F6PA 1TYGA 4JGDA 1GVFA 1SO4A 3G24A 2DU2A 3LHVA 4EF8A 1R47A 2QCEA 4ZQCA 2ISVA 2DZUA 5DN1A 3TU9A 3NOEA 4HSOA 1ZAJA 2I9EA 3TQVA 1VLWA 1D3HA 2AQWA 3QPYA 1LOLA 1Q3NA 1OFQA 2Q3RA 1S5VA 3STFA 5J5DA 3B06A 4ONVA 1IIGA 2ZA1A 4EF9A 1W5PA 3PBWA 5K4ZA 4RK8A 5A5WA 1T96A 3DGRA 1TPVA 5LNUA 3FS2A 3QM3A 4N9EA 1MEHA 3NVTA 4U4MA 3E9AA 2P0OA 1M7OA 4TX9A 4RXFA 1DKWA 4LUJA 3HF3A 1G69A 1JULA 3A21A 4JIQA 5HWMA 1NVMA 1W3IA 5D2WA 1GOXA 3W75A 2RHGA 5AOUA 4N9CA 3W1LA 2ZZ4A 3ZFHA 3W7IA 4HPXA 4PODA 2BWGA 2BLEA 1FWSA 3Q37A 3MHUA 3LTSA 2CZDA 1QO5A 1LROA 2E6YA 2G5WA 3DFNA 1SQ7A 3W1RA 1KW1A 1VYPX 5G2HA 1FDYA 4WY0F 4ZQOA 4IXHA 1A50A 1L9WA 3O8AA 1K02A 2CWNA 4ADSA 3FYPA 5EA9A 5BMXA 1NAL1 1W1ZA 3FLUA 4EOUA 8TIMA 2V5BA 3SFKA 2QUVA 4MJMA 4L4LA 4Z1DA 3UY7A 3R13A 1HG3A 3P8IA 1Q6LA 4P2VA 4BI6A 3C2FA 4XZ9A 2X30A 5D02A 4O10A 3NG3A 2FPVA 2ABAA 3HOJA 1ZAHA 3L5LA 4JTUA 4K8HA 1XBYA 4FEZA 1SZNA 1XM3A 3CWOX 2A6LA 3LLFA 4AAJA 3WJSA 1TSIA 4S2CA 1LTDA 4KWWA 3WJWA 2OJPA 3TUUA 4FO4A 4A2SA 5K4XA 1BWKA 1EEPA 3I7SA
chains in the Genus database with same CATH superfamily
1EGVA 2PP0A 3AMCA 2YDQA 1F76A 1TVLA 1YDNA 1DJIA 3WK0A 1XLIA 1WPCA 4MLRA 3FW6A 3T1GA 2IXVA 2OWCA 2EPHA 3V0SA 4D8LA 2YCKX 3RM4A 3PK7A 1VCFA 3KS5A 5DXXA 4LYRA 3F03K 4AD2A 2QIIA 3M0KA 3UR7A 1KRAC 5CAKA 3MP5A 4HVXA 4AY7A 3RCNA 1TR9A 2NX9A 2FHFA 4LNCA 3GXMA 3R7MA 4OUIA 3G0SA 3OLGA 3EGJA 3LN3A 1I2OA 2JFEX 2Y70A 5D05A 3GNRA 4B2DD 1TV3A 2W92A 4DRSA 2C13A 3QY7A 2F2HA 4L80A 1EHNA 1I0BA 1XF0A 2EPLX 3K4AA 4JTHA 4TOQA 1W1PA 3NGFA 1E3XA 5BRQA 3BGJA 1E72M 3NCOA 2J9XA 3NVDA 3F2DA 1QI3A 1X8FA 2GVJA 4JFWA 1Q6RA 3ARTA 4FXSA 1XBXA 1R8LA 5C2CA 3THAA 1W6TA 2WNWA 3P84A 1NDZA 4AYSA 4CN6A 4GWEA 4B9ZA 1GNXA 1XYLA 4FR1A 4FX8A 3TJ4A 3ONBA 4MWAA 1TKKA 4XO7A 1ISXA 3CPUA 3MS8A 4O12A 3QPEA 4UQCA 5ENLA 2HK0A 3TFCA 5HR7A 2CBUA 1OCQA 1EZWA 2E3ZA 3S0CA 3C8FA 7A3HA 1BQGA 3AU6A 4KFPA 2PDPA 3F5LA 5I3IA 2J88A 4IUOA 3A9IA 1B4EA 1SR9A 1RALA 4E8GA 2EEXA 3BCFA 3NJ3A 3ZLFA 3E3HA 2IW0A 2Y7EA 1HKKA 4PTVA 2V30A 3I3DA 5C70A 1Q7MA 4RXGA 3NO5A 4B90A 1RK5A 3V1HA 2HTMA 4FB7A 5DMLA 1F73A 3QRHA 3AHVA 4MM1A 3BW2A 3ZR5A 2P1FA 1H4PA 2ZVIA 4O1CA 1N2VA 4IPLA 3TN4A 3ZJ8A 1FCVA 5HNRA 3VNKA 3M9YA 3WF4A 1I1WA 4QSFA 2YL5A 4F48A 5BZAA 3R79A 4E3TA 1WXYA 1MFVA 1XYZA 3KOWA 1GEHA 1ME7A 1IZCA 1E51A 3Q67A 4NQ1A 3DFTA 4AH7A 3PBYA 1W3KA 4DJDA 4KW2A 3FFSA 4UZUA 1YDYA 3THQA 2X0SA 3JW7A 1SSGA 3EYPA 3MKVA 3VM7A 1O66A 1X97A 1DYSA 1Q8AA 3SGZA 1LP6A 3PZIA 2YB4A 5C54A 2J47A 3YPIA 4ORMA 1FWGC 2VUYA 3CO4A 1EIBA 1VLIA 5I09A 4CCZA 1DBTA 3KHJA 2E77A 3ES8A 2CLIA 3DC8A 2O0TA 5CGQA 3BWWA 4RZ4A 3RYSA 1JUBA 4A3QA 1TMQA 4I5UA 4KKXA 2YR1A 1WB0A 3NTYA 3BJFA 3NEHA 1TPFA 2RFGA 3HMJG 3VDGA 4LVAA 3H2EA 3ARYA 2HBVA 2BX7A 5GJPA 4RUBA 4S3AA 3S1VA 3LCHA 3M0JA 3PNUA 1T41A 1OF8A 1IWPA 1SPQA 3O3RA 5FIPA 4INFA 3GU9A 1R5YA 1O12A 1OFDA 3GY1A 4QR6A 4HT3A 4DBUA 2XYLA 2PRLA 1KNWA 4Z2IA 3VA8A 1J8VA 1XXXA 4OV4A 4DY1A 1PYMA 3JRKA 4YWIA 1U5VA 4H9UA 3PTKA 5BMWA 4Q8UA 3K13A 2VQUA 4PL2A 3IANA 3V16A 2OVLA 1J0YA 3EDJA 3N6QA 4D72A 3O2LA 1RPKA 1JDAA 3WDIA 1E0VA 1XRTA 4AEEA 3GAKA 3NYDA 2ZZ3A 3AJ7A 4H9MA 1S2UA 3G0XA 1EA0A 1RQEA 4MB3A 3H21A 4DJDD 1OGSA 2Y7DA 4MYXA 3CASA 2W9MA 4F0KA 3JZUA 2QDHA 5LIKX 3IJ7A 4LY8A 1P4CA 3OZOA 4ZMGA 3W37A 5BXTA 4F0MA 3SIMA 2GWGA 4B15A 2CLHA 3NQBA 3TLLA 1JDFA 1OFEA 4Y96A 2ZUSA 2WWDA 3H2OA 1A0DA 1D8CA 2Y1HA 2CZVA 2Z1KA 4JEJA 3CV1A 3FHQA 3H2MA 2V63A 1GKQA 4BZYA 2VEKA 3OU8A 3W6YA 1XLDA 3DI0A 4W7UA 1K8CA 2J8TA 2YJQA 3CH0A 2HZGA 4NASA 1GOOA 5LHFA 1TJ2A 1B54A 3E49A 4P8UA 1QUMA 3GIQA 2OGJA 3EWZA 5JXQA 1C90A 2FTYA 1OSEA 5BRPA 1VAHA 1X6LA 2VCAA 3CV6A 3U5YA 5CBIA 1G9HA 1GZ1A 1FWAC 2PDNA 2ZZ1A 4GZJA 1WUFA 2JKPA 2CZ5A 2CXEA 4GUHA 1TCDA 3KZPA 1S1RA 3AOFA 2ZICA 1A5BA 3W7RA 1GVSA 2WQDA 4B3ZA 3W2NA 3WF3A 4M24A 1XD1A 1VHCA 2X7VA 3W88A 1KBJA 1OBAA 4GIEA 3WUGA 3CT2A 2KZHA 4PMJA 5FF2A 3W7PA 2Z6JA 3KAOA 4YL2A 4FXRA 4UTKA 2DUXA 4AC1X 2BNJA 4CD8A 2GGGA 3XIMA 1XDMA 3SN0A 1YPFA 1UWAA 1X38A 3LLDA 4WOZA 1IT7A 1XW8A 4C5ZA 4HCDA 1SZRA 3AS3A 1WKEA 1VEPA 1LORA 4O1BA 5M5DA 1QHZA 2I14A 5K3VA 5FL0A 4AZCB 5G2WA 1UC4A 3DN5A 3OZYA 3H24A 2PAJA 3BGAA 3BLLA 1XRSA 2AGTA 2IUZA 3WELA 3KL3A 4QDMA 3IJ8A 3LENA 4W85A 2XVLA 3RU8X 5EMUA 2QCCA 3CPGA 1FXQA 4NUWA 1A53A 4QJ3B 3SGGA 3VCRA 3SRKA 1MRQA 3CMFA 1M41A 4GYKA 1AH0A 3RJXA 2H8XA 3C61A 3DBNA 2ZX8A 1C8XA 2ZRXA 3DYOA 4K1WA 4HK6A 5I3DA 2YCLB 4QS5A 3AUOA 3O6AA 3RMJA 4X0NA 3WJZA 4IGMA 3N13A 4ERAA 1SMAA 5FSDC 4GLEA 4RE4A 4GGBA 3W87A 4BJHA 1OZQA 2NVCA 1DL3A 1YLVA 2H3DA 8RUCA 4UTIA 5LNRA 4RZ5A 4NU7A 3PWIA 1Y0EA 3OEXA 1YRRA 4D1IA 4RV8A 3MCOA 3CZKA 5GPRA 4D6FA 4B5UA 2Q8ZA 1LLWA 4DPQA 4BR1A 1LLZA 3CAKA 3PR2A 2NXIA 2NUWA 5KMYA 1JGMA 1VZWA 3VDCA 2VC6A 4QAIA 2INEA 3N3TA 4JTEA 5F4WA 1LJYA 1E6XM 2XFWA 3B0UX 4C6FA 5J8LA 3EA2A 2BHZA 3QC0A 4D2JA 3LCGA 3ATZA 3M0HA 1FHVA 2REQA 3PB2A 4MG4A 3K8KA 2NQHA 2Y0FA 3WKZA 4Z1AA 4GI6A 4LB4A 4ZSUA 4IGHA 4KETA 4J3UA 1NU5A 3EKGA 2YGYA 4FNRA 3HG2A 2FFIA 3GWQA 3LGGA 3PPGA 4LBRA 4H8VA 3V4BA 5JQ9A 1MSSA 3MDUA 2ZRWA 4HPGA 1LDCA 1RR2A 3PZUA 2E5DA 3ABRA 4LBUA 4EXQA 2BVYA 4GVHA 1YXYA 2QF7A 4ZQNA 5EMKA 4FOUA 3B8TA 2PE4A 4JCMA 2CWXA 4FHAA 2VOMA 3SCSA 4F40A 3T40A 2GSJA 3L9CA 1VCVA 4C6MA 1X98A 4Y9AA 1M53A 3NZQA 4H04A 3GSMA 2WMIB 4AW7A 4H6RA 4DZ5A 4LVBA 1UH3A 3RX3A 1MRAA 1N82A 1OFAA 4QCFA 1KXHA 4D6IA 3PZ9A 4LCQA 2QCFA 1UMYA 3LLXA 2CKSA 2WMIA 4CEXC 4W87A 1HT6A 5F1VA 5IRPA 1E0WA 4GKLA 5D09A 2H3BA 3GDBA 4F2BA 3C2VA 5BRBA 1FRBA 4PUNA 3SCVA 3EWBX 4F0LA 1JNEA 4J28A 3RIKA 3JR2A 1AFSA 1WOAA 1KQZA 3R10A 4CU6A 1R3VA 2QGYA 2QS8A 1B4KA 1PKLA 3TTOA 5AHMA 2GL5A 3PBMA 1E5JA 2P5NA 3EDFA 3N04A 4O28A 4E8DA 5A95A 3MT1A 3K1GA 3W01A 1ESWA 2YL6A 2ZWYA 4EXBA 4QGCA 1GVYA 3W7KA 4GY1A 5C2XA 2YXXA 2VD8A 2CC0A 3PJTA 4S3FA 4PH6A 4GACA 4MIMA 4JIHA 3S8HA 5FA5A 4XUYA 1IEWA 2HCVA 1AQFA 3TA9A 2EBNA 2VFGA 4GKTA 3RPTA 5I03A 1QBAA 2HSAA 3TYZA 5HWJA 1SUXA 1Z69A 3QGAC 3TTQA 2DEPA 2NX3A 3B3DA 3V36A 3L66A 4G5DA 3A4XA 3EB2A 4A8LA 3BV4A 5HMEA 1W3TA 2NV1A 2OT1A 5D8WA 1JYNA 1GWJA 3RAOA 2BGQA 4QBXA 3F2CA 2VTFA 4AD0A 4I90A 2FVLA 4M19A 4Y8EA 1ITCA 3IRSA 2FZMA 3LZ3A 3WJXA 4ROQA 1MVYA 3WSUA 1L6YA 4M81A 3LM3A 4E4UA 4H83A 3FA4A 4NF7A 3C2RA 3JS3A 4O8AA 3IIXA 1M7XA 4HCHA 3TAOA 1UZDA 4FIRA 4Z2GA 3S9ZA 3UZ5A 3H22A 1WKYA 4E2BA 2OPJA 1FA2A 3FV9A 1QVBA 3ITLA 1KTNA 4FP1A 4ZOAA 1Q6FA 3RUBL 4CCCA 3KWXA 2XIMA 3NPWA 1GYMA 1YTKA 4KFNA 2MUCA 2HPMA 1OYAA 3RCMA 2J25A 3QVQA 4RR4A 1A80A 4LAZA 6XIMA 4LAKA 2BXYA 2POTA 4IQLA 4F3HA 4M7SA 1HZYA 1OD8A 4MPKA 3NPXA 4NVTA 1XLHA 1F2JA 4IMFA 3BMXA 3N9RA 1VPYA 2WLZA 3KBJA 2H9AA 1I1XA 3T0BA 3VFCA 3CUJA 3OLEA 3TJXA 3TE9A 4UTWC 3RITA 3MI6A 2B0MA 1DJZA 1MXGA 2WSYA 1A0EA 1YMYA 4XTIA 1GVRA 4H8UA 1HKMA 3UXAA 2QPSA 1AG1O 3SCTA 4UWMA 1VF8A 3OQ8A 5A6LA 1CXIA 4Q7IA 2ADAA 3G6LA 4QLLA 3SCPA 2QCDA 3W7OA 4L1GA 3RLGA 4AVFA 2GVLA 5A8GA 3BL3A 3BICA 2YXOA 4JFUA 4YVPA 2PDYA 4RW3A 1DHKA 2OEJA 5AECA 3OYXA 1UUQA 4TTUA 3KWSA 1PWMA 3DXIA 4IIBA 3GZAA 2D24A 2I57A 3RPDA 1H1YA 2O92A 1CX9A 3OHIA 2QQ6A 1FWJC 4Q4OA 3S5SA 1DEDA 2G3MA 1KXVA 1M65A 4HD5A 2VX7A 4H6QA 3WLSA 1CDGA 3T6CA 4S3EA 4KCUA 4RX0A 1DQXA 1KM3A 3UXIA 5DY2A 4ZA0A 2XHYA 1XSJA 5BXPA 5EY5A 5LNSA 3QPZA 1HKWA 2FGZA 3U0HA 1FXPA 1HKJA 4FLOA 3RMEA 2R1MA 2ISFA 1YW1A 3EKZA 1ECEA 5D2VA 3TROA 2WSQA 4FPSA 4JBRA 4OU1A 4C6DA 1CNVA 1M5WA 3MQTA 4O0KA 1KR0A 3FOKA 2PEVA 4JY9A 1U22A 1BG9A 1K6AA 1RY8A 7PTDA 1RV8A 3SSZA 1BVWA 1VKFA 4OJYA 4WGXA 4DXKA 3TMLA 3D47A 2O56A 2OKTA 3RR4A 3WK3A 4ML9A 4O0QA 2P8BA 1DJXA 4LS0A 2DORA 3QYSA 4RCXA 4IG2A 3ITYA 3UETA 1XLBA 2JIWA 3U9IA 6XIAA 4F66A 2QV4A 4ILSA 1R3SA 5FJRA 4XVEA 1QXLA 2BS9A 5EMJA 4JTKA 1PJ9A 3PWGA 4IFRA 3M0XA 4WJXA 4QQUA 1YKWA 1JG9A 4GINA 4XAZA 1LL6A 4EP8C 3IACA 2H8ZA 3ITXA 4V1XA 3ZO9A 4D6EA 3VO0A 2VX5A 4HSHA 4LV4A 3TQ0A 5CZKA 4DJEA 2GUYA 3WNNA 1BWVA 2WPBA 1HGWA 3MO4A 1GGOA 5CGMA 1CXEA 3G5EA 3LCWA 1VJIA 3SY1A 3G6MA 4AF0A 4OIFA 4TVCA 5CBBA 2VZVA 3E0FA 5HQLA 1FCBA 1OK6A 3BTNA 1DP0A 3VUSA 2YLAA 2EKCA 2R8WA 1ISYA 4TO8A 1T7LA 3KTSA 2CBJA 2PZNA 3VGGA 1R46A 8A3HA 5CC7A 1FX6A 4H9YA 3WQOA 4DBEA 3PJWA 4AWEA 3GX9A 1DXFA 1EC9A 4YTQA 3E0VA 2PTYA 3GYCA 4KS0A 1KCLA 3RLHA 1ZHAA 4DYKA 1EO7A 1CPUA 2GWNA 3K1DA 3QYQA 3MCMA 2R9RA 2PWDA 4IT1A 3UWWA 1UIPA 4MNKA 2CLKA 4CQ8A 4AD4A 2OOGA 3H2AA 1XFCA 3B9AA 2DSZA 3ANYA 2OSWA 4AVNA 4ORIA 1K7EA 4CN1A 4H41A 4M8UA 3DKLA 2XVKA 4XD3A 4N02A 4LUTA 4L1XA 3N12A 1EQCA 5FF4A 2BOFX 3TC6A 3TEVA 5DMMA 4HHMA 3M6DA 4O54A 3UJSA 2A7RA 4IFOA 2F6XA 3SW6A 2A7PA 1NF0A 1EDGA 2Y4SA 4YHGA 3U3HA 4JTLA 3SI9A 1I2RA 5L6UA 4GD0A 2D22A 3F4NA 4PBFA 1EJSC 1WAUA 4GZ7A 4B5NA 1M7PA 2GGHA 2XM1A 2ZX5A 3BAXA 4IICA 5CAHA 1IEXA 1R7OA 1R3TA 4IJRA 4XO6A 4UCGA 3WZ0E 4JQ1A 3VYLA 3SAZA 1ZCCA 4PBGA 5CPTA 4EPEC 3G1XA 4LCRA 2I56A 2PA6A 3TYDA 4DYEA 1J93A 1G67A 5CZSA 2DZTA 2YZRA 5D37A 4X9YA 3IV3A 4JEQA 4LXFA 2E25A 4LEFA 3N4AA 1MW1A 2HMCA 4U2YA 3W82A 2PZ0A 4NZJA 3WNLA 3SUUA 3UP8A 4OECA 3QZEA 3KUMA 3NWRA 3GNNA 3VC6A 1T8QA 3SCOA 2YCIX 3K4DA 1I2NA 4C7GA 3IVUA 4PEKA 3ABOA 2Q3OA 3WDPP 3W7MA 1HL8A 4REQA 1JPKA 2C0AA 1L6FA 4GFSA 9XIMA 3K46A 2CLOA 2WKGA 1EA9C 1O1HA 1BVNP 1Z89A 1RLCL 1H63A 1DHPA 4REQB 1PHWA 4ZB2A 4X9SA 1X7FA 4Q4SA 2I17A 3GXPA 1V7YA 1XRVA 1PZ2A 1I9CB 2GDUA 1ZUAX 1BFNA 2EF9A 1OT1A 3AXMA 2F84A 2JE8A 2NT1A 3DYMA 4WRHA 2Y62A 3M7SA 2OZ8A 3CHVA 4G1NA 3MMTA 2Z1SA 2DZBA 2WB5A 1YPIA 3UWEA 3OA5A 2XWDA 1SFLA 4NAFB 4J3SA 1WAWA 4IMEA 4IUGA 4O52A 1V6XA 3O07A 2PLCA 2Q8XA 4FX7A 3GXFA 2A3BA 1LOQA 2CBIA 3DESA 3DBPA 1TIMA 4PUEA 2ZADA 3FNDA 2VZOA 1FTXA 3H7VA 3WLKX 1E4MM 1ZU8A 2ESCA 4AZ5A 1OM0A 2Z28A 3QMTA 3R43A 5H8UA 3T0CA 3TK7A 4E3VA 1UP0A 5BNKA 4RZBA 3CZLA 1PEZA 3TYCA 3KHDA 2BDQA 3MHGA 1EFZA 5HR6A 1LRNA 3OLIA 2BHYA 4QROA 5CPMA 3WH8A 2X1SA 2DQXA 3OO2A 4PRTA 1WXJA 2X42A 2XUCA 4LRTA 1LUCA 5CSSA 3WQ8A 4EACA 4Z2KA 2A85A 3JUGA 3PUEA 1BLIA 1K7FA 1OT2A 3DKJA 3GR7A 1C93A 3NOYA 2VX6A 3BPWA 4B5TA 3SECA 3LY0A 2BP1A 3M1ZA 1RK6A 2F61A 4PFHA 1VH7A 5EYWA 5AHEA 3CLWA 4PMUA 2RUSA 1VBHA 2J4GA 1Q85A 4XQ6A 2QDGA 3GC5A 1K9FA 3QV6A 2VFDA 4Q32A 1ODZA 1Y5VA 4PTNA 1GTHA 3WMLA 3UVAA 1SZEA 3Q94A 3G1FA 1LQAA 3L2LA 4QDPA 4ICNA 4KEMA 2VVNA 3MO7A 4FLRA 3RFAA 4CNPA 1PX8A 2VVSA 3FJNA 3BDKA 3H7UA 3T07A 2BSLA 4M6QA 1KKOA 3FJLA 2QJHA 3UCQA 4IX2A 5CH9A 4LFYA 4LYPA 1J5TA 4Z17A 1LRTA 2QCDB 3M47A 2VT0A 4GUIA 1A47A 3T81A 3U8GA 1FDZA 4CVWA 1ONWA 4UNKA 4UNIA 4OBSA 5EMLA 2YXGA 5JBFA 3POCA 1F4HA 5I02A 4M82A 3PTQA 3V5FA 1GORA 3CHFA 3HPXA 3UCDA 4GX9A 2HK1A 5U7SA 1N8FA 1XIMA 5LIXX 3WH6A 4QM1A 1ZS2A 4FMVA 4AWUA 2KAUC 1DE6A 3I3BA 5EKYA 3G22A 4Z1BA 4WGHA 1TA3B 3NO1A 4MDOA 2F7FA 2GVEA 3ITVA 4Q6XA 4HK7A 3TTYA 4AB4A 2YDRA 5HAOA 2BVTA 1K77A 3W25A 5F4SA 1SJCA 3W2MA 1B3ZA 1MUMA 5DCBA 4Z0JA 3GC4A 1OFBA 2OG9A 3GS6A 1BRLA 2DVTA 1G4SA 4GH1A 3U57A 5CPLA 4MY1A 2TPSA 5J5RA 3EX3A 2Q01A 3BSGA 4Q4MA 3GDTA 3VOCA 2VFFA 3FKRA 4H1ZA 3ABSA 2NXHA 3G1DA 4EAYA 3O63A 2Z1XA 1C3FA 4FA3A 2OT0A 3H8AA 3UZJA 1UPPA 2PLMA 1WDWA 3FJ4A 5D04C 3SCNA 2PODA 3PAOA 1F74A 3NSMA 5I3FA 4N9DA 1FQ0A 3CQJA 2FYMA 4E0CA 3F2BA 6ENLA 2PDHA 3INPA 3NL2A 5FD0A 2JKEA 2GYIA 4UMBA 5LXXA 1W1VA 1R6WA 3IIZA 5E0CA 4GXMA 2DT2A 1JQVA 5ABFA 2C7FA 3HMCA 2J7FA 2DZWA 2V5JA 5E9XA 1WXZA 1TYGA 1GVFA 1R47A 4KRZA 3E5BA 1RBLA 4ZQCA 5DN1A 4MSSA 4L7ZA 3NOEA 5CJNA 1J96A 3TQVA 1VLWA 2XDFA 1RUSA 1JPIA 2AQWA 3VPLA 3WYZA 1LOLA 4P7OA 2X8RA 2QMKA 3STFA 1EJUC 1IIGA 4JL1A 1T96A 3DGRA 3U5UA 5LNUA 2QF8A 4I8DA 4U4MA 3E9AA 2P0OA 4TX9A 2FJUB 3ZJ7A 1DKWA 4PMVA 2PWHA 4KBXA 4Q4RA 4PTDA 1W3IA 3MANA 1GOXA 3U2CA 2ZZ4A 3QLLA 1UMLA 3VKAA 4HPXA 1H41A 3LUTA 2WZHA 3R0KA 4PODA 2J7GA 3PPCA 3Q37A 1S2CA 1BYDA 3LTSA 4K8GA 1QO5A 1LROA 3W1RA 1KW1A 2PDKA 4C6OA 2PTZA 1R9XA 1BXBA 1FDYA 4WY0F 4GH3A 1UR1A 1AJZA 3JZEA 2VJXA 1NAL1 1UC5A 3FLUA 4GG9A 1XIJA 2G4JA 3WNMA 1W1B1 2X30A 4O10A 3ISIX 3JVAA 1SMDA 1HVQA 3NG3A 2FPVA 2HJPA 1ZAHA 1UWTA 4K8HA 1YE6A 2GDVA 1E43A 2RJHA 1XM3A 3CWOX 4QCEA 4AAJA 1FP9A 4BQ5A 4AMCA 2OJPA 1BG4A 2XH7A 4EAMA 3TUUA 5K4XA 4Q8VA 1P0DA 1EEPA 3EBVA 2DDXA 1UQYA 1QRQA 4KPLA 4W89A 4CNTA 4ZXOA 3HPAA 1BGGA 3KBMA 1CGTA 5C9UA 5D32A 2V3FA 1LF1A 4LV9A 3AMDA 3ZR4A 2XFYA 3M4HA 1DIOA 1TREA 2ZE3A 1I60A 3MCNA 4UFJA 4M29A 3KTCA 3LCIA 4ZB0A 1IE7C 4YTSA 4M5PA 3WLLA 1TJ0A 3KRSA 2J79A 4Z1YA 3GDMA 2E5BA 3PBGA 5F2LA 2Z00A 3TVAA 2DT3A 1IZKA 4XKYA 1FOBA 4B2DA 1OIMA 3CHCA 3C2YA 1V4YA 5JUVA 4XZIA 5I07A 2QUUA 3SSJA 1XYMA 4QSHA 3RGTA 3H4XA 2V6AA 3S1UA 2GSEA 2CERA 3TQKA 1L8PA 1US3A 3WBYA 3IIOA 1F7BA 3TONA 1KGXA 3A22A 3TXVA 1KFKA 4FR6A 2PMQA 1UG6A 2D23A 3MDWA 3HTWA 4JZ5A 1UBSA 4C5YA 4K1GA 4QG8A 1E0TA 3VMNA 2ZX7A 2XIBA 1X1NA 3DFPA 3BURA 4UQEA 2IKJA 3VX0A 3BQ5A 3ZZ1A 1SR0A 4B91A 4IG2B 1Q6EA 5DBTA 3SN1A 1U33A 4NNBA 4ZE4A 4AY8A 1UD8A 3LPPA 1GYNA 4ECLA 2HNEA 2QPUA 5B7ZA 2YYTA 1S46A 1I4NA 3C4UA 3D46A 2I1OA 2YDSA 5DO8A 4ZVJA 3CU2A 4BCEA 3UW6A 5FSEC 4XIMA 4MB1A 3GXTA 4DN1A 5M03A 2OFJA 3NYZA 5HNUA 1I0DA 5ABFB 3T2QA 2ZX9A 4UB9A 2OKOA 5I3GA 4UXDA 3UBPC 5I7GA 4O17A 1JYVA 3C52A 5I78A 3L12A 1KR1A 1FWWA 4NHVA 5HATA 4TX8A 3GIPA 4WCJA 3WH7A 3W86A 3SCQA 2GOUA 1ZFJA 5DRIA 3IVTA 2IKIA 1TRIA 4A3UA 2CW6A 4PMNA 3AZTA 3PC0A 3VMOA 2PCQA 4Z0SA 3WLMA 1KM4A 4WSHA 3H7RA 1OINA 1QCWA 1VEOA 1RA5A 3WIJA 3CNYA 1UB3A 3PZVA 4AZGA 4D6HA 1RA0A 4IMGA 4IXXA 2BOEX 4KCVA 1ZBWA 2NW0A 4JX5A 4BK9A 1TQJA 1W1A1 4HA0A 1K3UA 3NQVA 4NNCA 4X2RA 1FCUA 1P48A 2WHLA 3W6MA 4S38A 2IPJA 2ZRVA 1FHDA 1UR9A 4AHOA 1XLKA 4Y6GA 3S9YA 4GFIA 4QG6A 4H8NA 3KDNA 2DH2A 2A3CA 4AZHA 2QMJA 3VMPA 2PF0A 1J4EA 4DO6A 4V28A 3IGSA 4LB3A 4I7WA 2E8YA 2XFRA 5IXEA 2Z27A 4W8AA 2ACQA 2ALRA 3V7PA 2ZRYA 3GTHA 4C1LA 3MA8A 1Q5MA 4ATWA 3WK2A 2XH4A 4ZEPA 2DZSA 5I3HA 4FZIA 1SZFA 3LEPA 2A1YA 5A8MA 5A6MA 1UR3M 3EB3A 5FJJA 3ITGA 2DUAA 3VNZA 2EQDA 2R94A 1DJYA 3CHEA 3WQ6A 1IGWA 4LBSA 1A5LC 3W2JA 3UNDA 1JUKA 3SN4A 1BRLB 3WUEA 1F6YA 4GBDA 4CNUA 5FF0A 2VI0A 3T44A 3AZRA 3C2EA 3UNTA 2HE8A 4AIOA 5EGRA 1V6VA 3B05A 5CCZA 3FX4A 5LHEA 4MGGA 1Z42A 2HVMA 1GZJA 2W79A 3H70A 1LRQA 3V5CA 5HNTA 2J24A 2VWSA 1P6WA 2PS2A 4C90A 3BLEA 3B0VC 4AC7C 4C6NA 2VC9A 5KZEA 2GQAA 1KRBC 3EA1A 5AHIA 1ONRA 3N2XA 1AH4A 2Z26A 2G4FA 1QHPA 3UEQA 2I7GA 4XWUA 3FN9A 5JH1A 3VCNA 4KEZA 1O60A 2XN2A 4XZMX 1CI1A 3VVGA 4NP7A 3L4WA 1UASA 3QR0A 4Q8PA 3QQ1A 2X2GA 2ZA3A 1OYCA 3LMZA 4AFYA 2CU0A 3NR0A 1UUOA 1E9LA 2B4GA 4HCLA 4JR5A 3RR1A 2YBTA 4O4WA 3TC3A 1R2SA 1XSKA 3GBDA 2Y5EA 1G4PA 1P5BA 2VM8A 1OFRA 1OQFA 2FLIA 3B4UA 4HTBA 1KBKA 4C6CA 5EB8A 1LBFA 4F9JA 3A5FA 2WO5A 2NWSA 4XTDA 3T2OA 2VGBA 3P0XA 5C9XA 4DNMA 5D38A 1TWZA 3G2GA 4EPDC 1X39A 1G1YA 4YXGA 1ADDA 4DBDA 4J3VA 1XLFA 1H61A 3W81A 3EX2A 2O4MA 5LZLA 4E6MA 1XCWA 1JQXA 3DFYA 4JTCA 3SUWA 1W3NA 3FEQA 2VO5A 3CTTA 1ITQA 1QDSA 1OHLA 4E38A 1XINA 3AHTA 1G0CA 1M3UA 2D73A 3SJNA 2P50A 4WKHA 2YSWA 4PGLA 4U5KA 4WZHA 2E4TA 3VIOA 3E02A 3LHYA 3N9KA 4X61A 4DZAA 2R24A 3WD4A 3MMWA 1FP8A 3MYPA 1G7UA 3AYRA 3VOFA 1KRMA 3F5JA 3W70A 1FWRA 4DHGA 2NQZA 3C86A 4Q8OA 3KRBA 5EPDA 2XVPA 1PKMA 3NPUA 2OLHA 3ONCA 2WC7A 2QUTA 2OWWA 4LUTB 1EJWC 4NJJA 1E9IA 5GNXA 1Q6OA 4GABA 1GVEA 3N34A 4PCSA 1MNZA 5PTDA 3PUDA 2VHLA 1FWNA 4PCFA 4PUKA 1W8GA 4W8BA 1K8YA 4H19A 2PDJA 3AC0A 2QLYA 4LAOA 1CT5A 3QKZA 3FHAA 1JRCA 4KCTA 1RY0A 1QNOA 5SWUA 2WHJA 1V0NA 3B0XA 4OZOA 1JEZA 1KLYA 3W76A 1GYLA 4XZHA 3K30A 5L9FA 2PDWA 1KM1A 1PKNA 4CNOA 4MVAA 1BVZA 2RKXA 1V3KA 1MFUA 2YDAA 2ACRA 4H00A 2CHNA 3KOZA 4UTLA 3WN6A 1GQJA 4JNMA 3PBUA 3E96A 2WXDM 4HNVA 1SGJA 5K2ZA 2P88A 3QF0A 3QY6A 4C7FA 1JFXA 2BZNA 3GVQA 1P6CA 1GEQA 3A4WA 1AMKA 3IUDA 3L0KA 3M07A 2FVMA 4P7QA 1HL9A 6ALDA 3W02A 2V5CA 3BG9A 4LS2A 1PZ3A 4PC8A 5TAOA 1KBLA 8CGTA 3PPHA 1BQCA 2DSUA 2Y63A 3Q58A 5BYWA 5DANA 5F2GA 5LIWX 4H7VA 1H50A 2E09A 4PMXA 3ZYZA 1PL9A 3C0LA 3E0IA 3TYAA 3UG8A 4DEFA 3W1MA 3WDJA 9CGTA 4GXPA 5MHBA 5T91A 4OGZA 1GJUA 1GVIA 3MSDA 3TX9A 3LXBA 2G0WA 3E2SA 2ACUA 2E0PA 1M03A 3B9DA 1C7SA 4URIA 4K7VA 4WHBA 3S6OA 1MZHA 1OC7A 3MUZ1 2WVVA 5AYXA 3U4FA 3M6YA 2WANA 1E15A 5AFDA 4KQNA 1OCJA 4DPPA 3VOJA 2CYGA 1VFUA 5JIPA 3IK4A 4A6GA 5LNVA 2HXUA 3TCSA 3AIVA 4EWJA 2X16A 1ZAIA 3HM7A 3NXFA 1L0PA 1KB3A 4NJGA 2X05A 4UOJA 1GOKA 3EXSA 2E40A 4IQDA 4O1EA 3NZGA 1LBLA 4DLFA 1C29A 1F05A 2E6DA 3ARZA 3AIQA 2AKZA 5CZ0A 5GJNA 2VZTA 4OTKA 1KM2A 2OZTA 3PBVA 3HIJA 4W5UA 4W5ZA 1VIZA 2QKFA 2Y8VA 2PRHA 4Q33A 3TNBA 3VZZA 3GC2A 3N4FA 2PRMA 3N2CA 1E9ZB 3CPRA 4ZO8A 3VKBA 3W0KA 1LWJA 3COTA 3VOHA 1ISZA 3VNIA 1B3VA 3VNMA 1QPNA 3UWUA 1C9DA 4KIEA 1NOFA 1JYWA 4RKAA 2ZDRA 4DAFA 1UWSA 3W73A 1W3HA 4HPJA 3GE7A 1YTDA 2D3NA 2YFNA 3PSVA 1HIZA 4ZCWA 4UFLA 4MLJA 3MJYA 5EMYA 4E4FA 5C9WA 5BCAA 3CL8A 1EYWA 1Y8BA 4M0XA 1DIEA 1DJQA 3W1UA 4GQQA 3IAQA 5K9XA 3EKLA 1B9ZA 4I3GA 3TOYA 3DHPA 3A6OA 3RPMA 2F8QA 3UG3A 1PUDA 3TN3A 1KV8A 1TV2A 3IIVA 1VYRA 3UR8A 2J13A 5LA1A 1HW6A 4NSBA 3PUGA 4EK7A 1XFBA 4DBSA 2AL2A 4NXSA 3HU7A 4PTMA 4YMZA 3CXOA 2GJRA 4WUIA 4TMCA 1VYSX 4PUDA 2GK1B 4H9TA 4NZFA 1OZMA 3WMBA 3DG3A 3AJXA 3B8WA 1R2RA 1VENA 1SW3A 3N14A 1U2YA 4NYYA 3MKCA 3AYSA 3WNOA 2XIOA 3BSHA 3NQMA 4PMDA 3SDOA 4E5TA 4Q22A 3NIYA 5D4YA 3HFTA 2C6QA 1B3WA 5HQMA 2ZUTA 3LU2A 3W7LA 1DQUA 2IPFA 3H2FA 3UU0A 1QPOA 1QOXA 3H4WA 1RXOB 5DELA 4YN5A 1DXIA 4N6EA 4A3RA 5LA0A 2WNNA 4BQ2A 3PAJA 4QJ5B 1MO0A 2G3FA 1KGWA 1OX4B 5HPCA 3CB8A 1GPFA 2D0GA 3UF9A 4JTRA 3EWYA 1UYQA 3HPSA 4QHRA 3NZ1A 3VZYA 3B8UA 2OYLA 1QWKA 3LCLA 1W31A 1NH6A 3HG4A 5E1QA 1FVPA 1PTAA 1R2TA 3UYCA 3TWBA 2QCMA 3OA3A 1QTWA 3ZWTA 1L2UA 3BW3A 5D9PA 5JIWA 1XIFA 1EB3A 4EXAA 3I6TA 4DO4A 3QMRA 4MKVA 4MNMA 2F2KA 5IBXC 1U1JA 3KTXA 4GHRA 4MJ2A 4A4AA 1VFOA 1OVDA 4FNSA 1JI1A 2Z7GA 4JIPA 2VOTA 4JICA 4ZB5A 2EO7A 5A6JA 1FKXA 1TPB1 2OEMA 4UQAA 2PDQA 4DJFD 2W27A 1O6IA 3QQ0A 3BANA 1OX6A 1XD0A 1EIXA 1NP2A 4XSMA 3P5YA 2HVNA 2ABBA 4L6DA 5GVJA 3UZZA 3UESA 2DT1A 2D2OA 4K2SA 3LMYA 3ARVA 5G2IA 3W22A 4NAFA 1V6UA 1E6SM 2GZXA 4JHOA 1QI0A 3LCXA 2E8ZA 5HUPA 5C9RA 2WM0A 4A05A 4CD5A 4NJHA 4MKSA 3CT7A 1WNOA 3WDRA 1NF7A 2A7NA 4K3ZA 3NQ2A 3F4DA 1LT7A 1OC6A 4MTVA 4BEUA 3DHDA 3WQDA 3L65A 3PSWA 3DU0A 3KM8A 3HG3A 3VIFA 1F07A 3W1TA 1Q6QA 4DJFC 3R58A 2NSXA 5C8BB 4S3JA 4AU0A 3UVIA 3UQNA 1E4IA 4B5SA 1UD4A 3GH7A 2BOGX 4HMDA 1YNYA 1YXCA 2YPIA 3M0MA 1UKTA 4S39A 1R3QA 2G3IA 4PUUA 1BKHA 1LL4A 3THUA 4JFSA 1CXHA 4IPNB 4HOWA 1FY6A 4GISA 3LS9A 3EMCA 3M5VA 4UQBA 4I6KA 3OBKA 3MB9A 3LXCA 1ISWA 4R34A 5CPOA 1UR4A 1FKWA 5CGTA 3BGGA 3N15A 3HFYA 1T99A 1F5ZA 5DT7A 2DQWA 5TIMA 5G5IA 2P0IA 3N2TA 3QBUA 5H91A 2HS8A 3KEHA 1CBGA 1RVGA 4LOCA 5C55A 1K8ZA 5DFAA 4DQWA 3N4EA 2PWGA 2DSKA 2V68A 2O4QA 3CHDA 2ZCGA 3AFBA 1JF5A 1JPHA 5REQA 3F4VA 3UGVA 2VNCA 5IDIA 2PDBA 3T42A 1H5VA 1MUCA 4H9XA 4PB3A 4CD7A 1IEQA 1S5NA 4BI5A 3DG7A 3IEBA 1Z6KA 2F6UA 5C6MA 2FB2A 5A6BD 3VE7A 4CN4A 2WMKA 3AXXA 5I5RA 5LA2A 3RM9A 3TC7A 4Z42C 3MW7A 1HL2A 3S5YA 4MNJA 1SSDA 4YYFA 4XAYA 5E09A 4GJIA 2B7NA 4H8HA 2FGBA 4IP7A 3WNPA 3NQ6A 4PEEA 3M46A 4J35A 4S3GA 1W5MA 4NZ4A 3IGHX 1IR1A 2PP3A 2CLEA 3OTRA 5D9MA 5K9CA 3SCUA 3P67A 4CKQA 1LYXA 5LXEA 2X1IA 1CTNA 3F7JA 2O7SA 2VEPA 4FF5A 4CQ9A 3GQYA 1UWRA 3E2QA 1QI2A 1UQZA 4KWOA 1NEYA 4ZODA 3CZ8A 4O13A 1IWAA 4CQBA 4XVDA 1OEPA 4WXYA 2FQIA 1Z44A 4FNTA 1FHUA 1E6QM 3L5AA 3L0NA 4JKKA 1PAMA 5T9CE 1OCBA 2BY0A 5FJIA 3WMSA 3WD0A 1K4GA 4B92A 5H8MA 5KETA 4HKPA 3C3NA 1SVDA 4LAUA 4GY7A 4ZL1A 3IJDA 4XG1A 4GRSA 1QHOA 2G3JA 1S38A 4F9DA 1KLZA 1HP4A 4MYAA 4UTTA 4A29A 3UWYA 2OGYA 4WDTA 2JGYA 2Y24A 5H2ZA 1DWFM 1JAEA 3ZMRA 3BOXA 2C16A 2OLSA 1AODA 3UG4A 4RE3A 2V2HA 4V2XA 3GUGA 1VPQA 1W9XA 1XBZA 4O8RA 5EFFA 1XLJA 3WF2A 5FEZA 2R1KA 4M7TA 4IM4A 5CPQA 4C6PA 4JTQA 4FAMA 1JCLA 1JUEA 3KL5A 3QZAA 2NQLA 4UFHA 3O6DA 3N2BA 3R8RA 3RO6A 4Z2JA 2RDTA 3GDKA 3UGRA 3UJEA 4HZMA 3UR5A 3LDVA 4Q4QA 3EXTA 3NO3A 3K5XA 4L65A 2UWFA 2QPXA 2NUXA 4LS1A 1Q65A 2RAGA 1TPC1 2O9PA 3IWPA 3LNMA 3A3HA 1VQTA 1W5QA 1TJ1A 3T4WA 1V93A 4S1FA 2SFPA 1E1EA 3OZPA 1K7XA 3WLOA 1W3LA 1ZBCA 2PDCA 2XFFA 4DM1A 4CCEA 3W2KA 2WCSA 4GY0A 2DJXA 5TD4A 5I0DA 4TVDA 2Q6ZA 1OG0A 4K6AA 2CESA 1QFEA 4MF4A 3NQ8A 4NIRA 3PFMA 3NZRA 3WLQA 4ZTYA 3GVVA 4LANA 5A8PA 4C65A 3LTYA 3BOFA 1QO2A 4GUFA 1ZBKA 1UW9A 3PF3A 2R1LA 4AEOA 3M0IA 4B3LA 1Z9AA 1HNYA 5CZTA 1V03A 5GJMA 1UJQA 4PMOA 2HXTA 3EX6A 1VS1A 3FXYA 3IPWA 2VC5A 2OCZA 5FOOA 4E4PA 5LSMA 4I7VA 2G8ZA 3HG5A 3V5OA 5IHSA 4XBKA 3EZ4A 5FEXA 1GTEA 4UQ9A 3MWCA 1DJHA 3AYVA 2QVNA 4JL2A 3WCZA 4U3CA 1EC8A 1YEYA 1CB2A 1HX0A 5F1UA 1KM5A 2XTKA 2JQXA 3I4KA 3A9BA 1R9YA 1I8JA 3QN3A 4H2CA 2WJEA 1V08A 2X40A 1VPXA 2PCEA 3H4GA 3ZT6A 3E1F1 2V69A 3FIGA 1KXTA 5AC6A 3B03A 3N19B 1XIDA 3ZWSA 1ICSA 1A3HA 2Y5SA 3WG6A 4D6DA 3S9IA 3L21A 4JKLA 3BZJA 2IPGA 4MY9A 3EA3A 3CV7A 1JF6A 4UFIA 1BGAA 2NQ5A 2C19A 1DIKA 2MNRA 2EG7A 1EJRC 1POKA 1H7RA 3P82A 5MF5A 3W26A 1JYXA 2AAMA 3ZOAA 1XS2A 2GJNA 1G7VA 2XZ7A 5KINA 1ZBVA 3S6TA 4A2RA 2R1PA 4GCXA 3QEZA 1KFEA 1AL8A 2V5KA 8XIAA 5D2YA 2ZXQA 1MW2A 3VTRA 3B9NA 1XISA 1ZJAA 5BU6A 2Z1WA 3TN5A 1LQ2A 1IQ8A 4OE7A 1SJDA 4A22A 1PIIA 2ATMA 1IXNA 4JN8A 3EWDA 3LPGA 1CIUA 4GIRA 3G0UA 3USZA 1W17A 1Z48A 2E1WA 1NDWA 3CV2A 4NX5A 1X1ZA 1IHIA 1EXPA 3M41A 1RVKA 3SO7A 3W53A 4W8LA 3TOPA 4KEVA 1GCYA 4MZ8A 4HZ7A 5HUOA 2VYOA 2PPGA 3SZ8A 4ENLA 3W7CA 2Y8UA 1HJVA 4RNJA 4R33A 1W3JA 2D20A 1VRDA 4P5UA 4GI4A 5AC7A 3UPBA 4B16A 3AI0A 5ABEA 4UTUA 3E0LA 4TX6A 3XISA 1NJJA 1NFGA 4J1OA 1E70M 4BF5A 2V2DA 3BJSA 3SIZA 4RW5A 5A94A 1OB0A 1OGBA 3EOUA 1V3HA 3L4TA 2A3HA 1AZ2A 4WOQA 2AQOA 1WZMA 5DLCA 2J74A 1TFVA 5LYRA 2VR4A 4F2UA 1GKRA 2A4AA 1H51A 2QYGA 1JCMP 4O0ZA 3U48A 4IPIA 4QP0A 2XH2A 1GZGA 1JZ2A 3PZQA 1TIWA 3N17A 4WJ8A 2VD9A 3GG8A 1D7KA 2OWXA 1SO3A 1RBOB 1KFLA 3UERA 2I5QA 1SYTA 5LNWA 4FIQA 1Q4NX 3APTA 4MB5A 1FDJA 4Q6JA 5C71A 1W32A 1UWUA 1YTEA 4XKMA 1N7KA 4IH3A 4QS6A 5B7YA 1YBQA 4US5D 3D0CA 3L2IA 1GQIA 1MXSA 4W84A 4TIMA 3EAUA 4CNNA 1RPXA 3AO0A 3S1WA 4TV5A 1L6GA 1QBBA 3AXIA 2H9AB 2VDHA 3GTIA 2G37A 1O7AA 1KQYA 1K9DA 2DVUA 3A4AA 2QIWA 3S6DA 2XJ7A 1DWGM 1FHLA 2XN1A 2J8GA 2VELA 1TJRA 3UYIA 3B0YA 4LYQA 1ML1A 5ABGA 3TXZA 2G50A 3OGRA 3K4WA 1E73M 4HHPA 1UA7A 2YFOA 1S3TC 1F3XA 1J2WA 4XSLA 1C7TA 3URNA 2AL2B 1SU5A 3B40A 1O5XA 1TX0A 2ASHA 4KESA 3VD5A 1W54A 1XCFA 1P1MA 3S5ZA 2CZEA 3ZLHA 4ATDA 3CEPA 4BWLC 4NJIA 1Q6GA 4CD4A 5I24A 3FAXA 2DIKA 5AVHA 1N8IA 3RRAA 2O9OA 3G24A 2DU2A 5LIUX 4M1RA 1J12A 3ZLGA 5AKQA 1F3WA 4I9JA 4F79A 4L4PA 3I10A 3TU9A 4Y9MA 1D3CA 1Q4WA 4XD6A 1Q3NA 2XVGA 3V0UA 5J5DA 3B06A 4ERGA 2ZA1A 3PBWA 4QE4A 4QEHA 4RK8A 4YS1A 5HBFA 3FS2A 2DZAA 2PB1A 4NYUA 1O68A 1EOKA 1GHSA 1UH2A 3E38A 2J8FA 4IGSA 3HF3A 1JULA 1KRCC 5CEWA 1NVMA 4TTGA 3C0SA 4HNLA 2RHGA 3W1LA 2W4XA 3FA3A 5IFPA 3WQWA 4BQ3A 1E56A 3THDA 3MHUA 1B30A 4PUJA 2E6YA 4GQGA 4V1YA 1A0CA 3WLJA 1AQMA 3GH5A 1XPYA 3VD9A 5A3HA 1GOMA 4ADSA 5BOFA 3AZSA 3ZJ6A 1W1ZA 1VFFA 3MUCA 2XVNA 1VBUA 3DC0A 7CGTA 3TW9A 1GUVA 3PP7A 3C2FA 4XZ9A 4WDWA 4O1FA 3EDDA 3HOJA 3L5LA 4JTUA 4W93A 4AG0A 3W4RA 4PSRA 3VKKA 1G01A 3I4EA 4OOZA 2WMJA 1SZNA 2CETA 3WJSA 5E6ZA 1VIWA 1LTDA 3WJWA 1ZSXA 3KCLA 3KZSA 4XZBA 2DSVA 4FO4A 4HYRA 4IFKB 4XX6A 1BWKA 3CQIA 4BA0A 4OKDA 2Z1VA 1J5SA 1M68A 1ZB5A 1PCKA 2YLLA 3MSRA 3SUTA 3CH9A 1T0OA 2FGLA 4K36A 3E74A 3FJ6A 3NL3A 1OX5A 4A35A 4A21A 4I8YA 1HFBA 4CNSA 3RJYA 4B4HA 1OY0A 1XGDA 4IIGA 3ARUA 3ZVIA 4A8RA 1QASA 1YXDA 3WQEA 3QC3A 3W7JA 1EWDA 2NVAA 3CAWA 1WZLA 2P10A 3M64A 3HA1A 2QZRA 1H11A 1HO1A 2J6XA 5FF3A 4YWSA 2EKGA 5XINA 2WJDA 4GMEA 3VILA 1L6SA 1TPWA 4ZO9A 1ZJIA 2J66A 2WW5A 3IJIA 2RDXA 1EJVC 1U83A 1PHQA 3QMSA 3SCRA 1B0IA 3VK5A 3ELFA 1ADOA 3LHWA 4MFEA 3MZ2A 4S3DA 4DF2A 3HJEA 1QK2A 4QTGA 4O1DA 3BJTA 1EHAA 4X0VA 4KMQA 4LT9A 2J77A 3PULA 1B9BA 2D69A 3VOIA 4QDWA 5HK4A 5HWNA 4MZYA 3QV9A 2EHHA 1YX1A 1XRFA 4G1KA 1J9YA 1W9DM 1V77A 2ZDSA 4HNUA 2QCNA 3PM6A 4HQVA 1RBAA 4WD0A 4A8IA 1TZZA 1C92A 4CVUA 3WUFA 2ZXDA 1WKDA 3ZVHA 1RD6A 2BASA 3L7RA 3GXDA 2PC8A 2QJMA 1IR2A 2XWEA 3GH4A 4AXKA 1CCWB 4TVUA 4RE0A 1E3ZA 4GE8A 4I7UA 4OFCA 3LCFA 5E93A 4Q8NA 3WQFA 1OD0A 3W72A 2HE5A 4JNYA 1QOPA 4JFTA 2OQLA 3WQCA 3C8NA 4OT7A 3M5YA 3SR7A 3TR2A 2XGIA 3FSUA 1XG3A 4MAZA 1XYCA 4DI9A 2ZVRA 3IJLA 3VKCA 3GM8A 4JX6A 1OG6A 3CTLA 3UXDA 2HPIA 3D6NA 3QKEA 4GJ1A 1IXOA 2NV9A 1XHGA 2DVXA 3A24A 3GFXA 1B5TA 3LHTA 3SQSA 3LHUA 4A8NA 2LLEA 4ICMA 1TTJA 2TYSA 2V3GA 2ANUA 3LI1A 4RJEA 4O1AA 3N18A 4HNOA 5U4NA 1IF2A 3QTGA 2PI6A 3FEMA 1GW9A 3MP4A 1HVXA 4W9TA 1VJSA 1E4NA 3LERA 1QW9A 2ZZ2A 3AUJA 2ISSA 4R5EA 3VE9A 4UR8A 1OYBA 4X60A 1PDZA 3BZGA 3DH7A 1EF3A 1TO3A 1XQKA 3T0AA 3TAKA 1ADSA 2QEZA 3KBSA 4MADA 3FCPA 5ECUA 5J04A 2HS6A 1BYCA 4AZBA 4M6UA 3TIMA 1RJPA 2VFHA 3OGVA 1S3HA 2X2YA 2QAFA 3U2EA 4IQJA 3AAMA 4CCDA 2V81A 3TFXA 5G4EA 1XIIA 2YCLA 3W29A 3N29A 3XINA 1XKYA 3KBVA 3LI0A 2BGSA 5XIMA 3GAYA 3OBAA 3R2GA 4MWAC 4Q8QA 2D2GA 1EO5A 2B81A 3OZMA 4W7VA 4DWDA 1ZP4A 4JCLA 5CC3A 2ZC1A 1XICA 4WSKA 3R0UA 4YIWA 3W84A 4G7FA 4L64A 3DOPA 4AYGA 2CBVA 1LBMA 1Y5WA 1E0XA 2E6FA 4Q7NA 3KRZA 3LSBA 3B4YA 5IHRA 1CWYA 4P7RA 1KBIA 3W7EA 2BY1A 3F1QA 2EPNA 1SJAA 2C91A 1GOQA 5CG7A 2IQ0A 1NWSA 4MFDA 4JHZA 3VDHA 3NQ7A 4BI7A 5LGZA 3NPVA 1CYGA 4JXCA 1R0MA 5A69A 2DZVA 2YZ5A 3ANUA 4ATLA 3OG3A 3IGUA 3MTWA 3GKAA 3NM1A 3NXLA 3H54A 1XLCA 2DSWA 3GTNA 2ZZ7A 4JTDA 4L6HA 3HGSA 1WV2A 5A1AA 3CM4A 1ONXA 1JAKA 2NQJA 2PU1A 2IKGA 1PWLA 1MEIA 4NZ5A 4QITA 1R38A 1XI3A 4M3PA 1Z3NA 3W1XA 3RLUA 1XIBA 3SADA 4OHQA 3NGJA 3SURA 3ZS4A 4HU3A 2HBXA 5IDZA 5LKYA 3C2OA 3O15A 3MBFA 4GZIA 3LYEA 2VZUA 1X7IA 4JTFA 1W1IE 3GHTA 2VENA 3KOYA 3NDOA 1OGGA 3ARXA 4I9AA 1MQRA 2QDEA 3LNPA 4GQBA 5GQBA 3OG2A 4W7WA 1JZ6A 1BXCA 1MW3A 3ABQA 3KX6A 4BHYA 4MAVA 2YA2A 1QW8A 3KLKA 1HGYA 2WCGA 2ZRUA 1UH4A 1XLMA 3BAWA 1JDCA 2IQTA 1WDRA 3QHNA 4LW7A 3ZSTA 3VD3A 3MZNA 4ZOBA 3UG5A 2X0YA 1GQKA 1L8NA 2JEPA 4GYPC 1C9WA 4X22A 2BGNE 3GXIA 4O16A 3HJZA 2GVGA 4GVFA 4G2DA 4R7OA 1R3WA 1VBJA 2ZQ0A 3C0JA 4DBWA 1RJQA 4I6VA 3P5ZA 2OO0A 1XPGA 3PWAA 3SB0A 4LNYA 3CEUA 2YCEA 1NARA 4BY3A 2YYUA 4R88A 3CB3A 2B7PA 2J7DA 3MC5A 1MEWA 2PC4A 2PBOA 1MYRA 4QRNA 3G1VA 3F4WA 1GK8A 1CLVA 3BLKA 4UMAA 3CAVA 3G1HA 1J0HA 3EMQA 4GX8A 2OO6A 3VD7A 1S2WA 3HGOA 5AYBA 2CLMA 3II1A 3I6EA 3S47A 3ITOA 1M9HA 3VIMA 2ZUUA 1QNVA 3TJIA 3ID7A 4DWSA 4YTTA 3ABZA 2B7OA 4Y8FA 3AS2A 2NVDA 2VRQA 1C8QA 1TG7A 3AXKA 3HB9A 2CNCA 3HPZA 2BMBA 3R25A 3FDKA 3WD3A 2JGQA 3L2MA 1V0LA 2Z4GA 3E2VA 3SFWA 2JEQA 3QFEA 5BOOA 3STEA 4AHQA 1DJGA 3SGUA 4XIAA 4WQ6A 1WA3A 3D3FA 4N2YA 2PGRA 4C6EA 5F2IA 1F4AA 3NNTA 1V6TA 2W3ZA 1DWIM 2X1RA 3BW4A 3NUKA 3ABXA 1EP2A 3SRDA 4EWND 4IWWA 2VL4A 1YNQA 4QEEA 2G41A 4YVXA 1FWTA 4X63A 4OQVA 2L5HA 3IS4A 3EOLA 1AD4A 3TW6A 4FOJA 3G1YA 3R6IA 4JTTA 3RF9A 3O7UA 3CYVA 3VGHA 3NQCA 1CZ1A 4H4IA 2JBMA 4FS9A 3OW1A 3KVLA 1E1FA 2WVTA 1AD1A 3F4CA 3RDKA 1QNQA 1TV5A 1E6PA 1M6JA 1GHRA 4PMQA 2ZTKA 3RRXA 3SRHA 4CD6A 1JCTA 4WJEA 4DZHA 1R3YA 5AC5A 2ISWA 4HNCA 4J40A 1XH1A 3DHFA 3RLVA 1OIFA 1JL8A 4EPBC 3QLDA 5FJTA 3HZ3A 2DV0A 4RE2A 4YYCA 2EGZA 1KM6A 3GD6A 3OLDA 5CXPA 1D8WA 3UA3A 1ECQA 2ZA2A 1GG1A 1V79A 1UKPA 4GZEA 3D5HA 3WY1A 4FOKA 3KW3A 4YTUA 4RLIA 1AA1B 3SUVA 3ES7A 3VC5A 1KV5A 1J0KA 2FIQA 4L9XA 3EWXA 4DXXA 3A5VA 3VDBA 4OWGA 1KC7A 3M7WA 3ALFA 2Q8LA 4HA3A 3VNDA 2WVSA 1FWIC 4R7JA 4L4MA 3G18A 4JQ2A 2GGIA 4JY8A 2O7QA 5HMFA 3QOMA 2YL8A 4I9TA 4IHCA 2Y89A 3M0YA 3WQVA 3CAQA 1VBGA 1DQWA 3WJYA 1DVJA 1E55A 1BSIA 1PKYA 5HDRA 1ONEA 4PB5A 4DIAA 2ZXAA 3OODA 2ZE0A 3C56A 1U30A 1BF6A 1NWUA 3QZ6A 2WBGA 5JU6A 1Q7QA 1TWWA 1TVNA 3TSMA 4IGNA 2FZDA 1BYBA 5D9OA 3HV8A 4OV9A 1EXBA 4LRSA 2WKLA 1CENA 2B7QA 3G8EA 1FWEC 4GXWA 5CBJA 2AMGA 5CLTA 6REQA 1G4TA 3GKFA 2WMFA 2F6KA 3L0GA 4UCFA 4GYPA 3UPMA 3B8IA 2W91A 4O4VA 3EDKA 2YB1A 1E4LA 5EFDA 4YPJA 4PYSA 2PDMA 1X6NA 3QSRA 1XWYA 3LB0A 3ZT7A 3IUIA 2I9UA 1SFSA 1T5AA 3LM7A 3VIHA 1UR8A 5BROA 5E0FA 3W27A 5A8OA 3S2LA 4IP5A 2R6OA 1UPMB 4AZ7A 4LYKA 1TV4A 4ZFMA 1W9BM 5CZJA 3CZGA 3AS0A 3MMDA 2VEIA 2WZIA 1Q6DA 3MMUA 4DWSD 4XBJA 1DWAM 4XKYB 2R1NA 2VRJA 2AOSA 3EXRA 4P7NA 4MJZA 2OZ0A 2HQAA 1DE5A 3PZGA 1HJXA 4HMCA 4ACYA 3GHRA 4IIDA 2DIEA 1M01A 4L6OA 2XIJA 1BYAA 1RP9A 1TTPA 5IFTA 3OP2A 3B0PA 4N7QA 3EOEA 4HNTA 1EDQA 3LK6A 4IPPA 1QPKA 3PB0A 3S46A 2NX1A 1GW1A 3DDMA 2DPEA 3P80A 2ZFAA 3IJ9A 5CSYA 1L6WA 1KWKA 4ADTA 2EXOA 6TAAA 4IX0A 1B3YA 3SCWA 2YX0A 4QXIA 1ZPTA 1AZ1A 4YCOA 2QJNA 2ZUNA 1TPUA 5F7UA 4JYFA 2PGWA 3L68A 2PDUA