2CLOA

Tryptophan synthase (external aldimine state) in complex with (naphthalene-2'-sulfonyl)-2-amino-1-ethylphosphate (f19)
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
266
structure length
257
Chain Sequence
ERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRSGVTGHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allosteric Regulation of Substrate Channeling in Tryptophan Synthase: Modulation of the L-Serine Reaction in Stage I of the Beta-Reaction by Alpha-Site Ligands.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
molecule keywords TRYPTOPHAN SYNTHASE ALPHA CHAIN
total genus 102
structure length 257
sequence length 266
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2006-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2cloA00
1ICSA 3B03A 2QCCA 3CPRA 1TSIA 3U2OA 5HNRA 3NPWA 3WJXA 3WJZA 3CHVA 4XKYA 1YYAA 3A23A 5U4NA 5FI8A 1ZHAA 4MKNA 1X1OA 3IIVA 1K8XA 3GVGA 4JIPA 1I2OA 3CTLA 5DXYA 3NL3A 3MJYA 3C2VA 1TTIA 3W1LA 3QC3A 4GRSA 3I7RA 1GEQA 4XTIA 2HTMA 1TQJA 4Y90A 4WX2A 1I45A 3UPBA 4PC8A 3FKRA 3NM1A 2VFIA 1JUBA 1RQHA 4UTIA 1KV5A 2OT1A 1XFBA 2CZFA 4E0CA 4J9JA 4LS0A 5DBUA 1QWGA 1J4EA 1H7OA 3SGUA 5EYWA 1TRDA 1QMLA 3W23A 3B06A 2NWRA 3DAQA 4Y96A 1DOSA 4MJMA 5J5DA 3M0ZA 4UFKA 5K4XA 4UIOA 1XBVA 3NL6A 3L9CA 3L5LA 3M5VA 3DHFA 2J9ZA 3N34A 2EGZA 3BV4A 1OG0A 3BW4A 5F2GA 3BG9A 2ZCGA 2OMAA 2RHGA 2V2DA 3W70A 3W7HA 4O1CA 3DI1A 4JY9A 3OIXA 4I7UA 1WBJA 3FYOA 3JR2A 1N55A 4BF9A 1AL8A 4YWIA 5HJLA 2CLHA 4N02A 5HR6A 1TV5A 1VPXA 4O17A 3GXTA 3HPSA 3QJAA 5D2TA 1A5AA 3O8AA 3S9YA 2BX7A 3A5VA 5KMYA 2CLEA 3W7DA 3WK1A 5AHIA 3MHGA 3BK0A 4PODA 4I7VA 4IJBA 3IRDA 4JR5A 2X16A 3EEGA 5FF4A 2V81A 2ZRWA 3A24A 4MFEA 4LC8A 3QPYA 2ISSA 2NV2A 5CZJA 1SQ7A 3G1AA 4CQ8A 3BLFA 4IPIA 1F6PA 2WNNA 4AHOA 5HINA 4KWWA 3O16A 1OF8A 3S6DA 5KITA 1KFLA 3DFTA 3MBDA 2E6FA 1H1ZA 3DFNA 4AWTA 3MP4A 4LVBA 1JCXA 1O60A 2ZRXA 3LCLA 3U6WA 3S5YA 4JX6A 4U28A 3G0XA 2PURA 3EWZA 1VH7A 2RDWA 1DQXA 1A53A 1TV8A 4EF8A 2CZEA 2ZFAA 2JKEA 3LHTA 2ZTKA 2JKAA 1TPDA 3LHYA 3UWWA 3HGOA 5AOUA 4KKXA 5LSMA 3TSMA 3W7PA 2WPBA 1XL9A 3G24A 5K9CA 3G0SA 4LVDA 4MLJA 1UUMA 1G4EA 3LGEA 2B7PA 3LRMA 5GVJA 1NAL1 1EA0A 3C3NA 3O6DA 4LWWA 4FNQA 3SZ8A 4FO4A 4WZHA 4PCFA 1DJQA 1YTKA 2OZ0A 5SWUA 1YDNA 4FX6M 4IPJA 1XDMA 3HPXA 3TMQA 1FCUA 4N9EA 1LLZA 1QPQA 3W22A 2RFGA 3QFEA 4GXMA 2CFFA 2OJPA 4O57A 3A5FA 3W72A 3OG3A 5D30A 2NX9A 4TR9A 5E93A 4N6EA 4UXDA 3TROA 1H51A 1EWEA 1LP6A 3S5ZA 4XUGA 1K7EA 1OFPA 3R5EA 1YDOA 1PHWA 1H50A 4QQ3A 6ALDA 5TQLA 4DO5A 3USBA 3IVTA 3BGJA 5HMSA 3E02A 1G4TA 4M5PA 4UFHA 5C5YA 3GNNA 3G0UA 4DQWA 3WFAA 3IIZA 3PBYA 5AHNA 3G8RA 4ZQMA 5K4ZA 5EL1A 3CB8A 3TAKA 1FY6A 1LRQA 4UTWC 1C8VA 5KZEA 4QAIA 1OFDA 2V5BA 4IGHA 4R7JA 5LKYA 2EPHA 3STGA 3W86A 2CU0A 4OWGA 3CEPA 3PM6A 2VKZG 4S2BA 1T99A 3L5MA 4ADTA 5EA9A 4JY8A 3PC0A 3CEUA 4L4LA 1G7UA 5FF7A 1JRCA 1VS1A 2BZNA 3DI0A 4BFAA 1YXDA 3P5YA 3UWVA 2O7QA 1KLYA 3WK2A 5BW6A 5CSSA 1OX5A 3TFXA 4K8HA 3FA5A 2YYUA 1JVNA 1IXPA 3LXAA 3ATYA 1XM3A 4O1BA 1KBJA 3PY2A 1A5BA 1O95A 2A7RA 4FHAA 5G2WA 3NXFA 3VE9A 1SO5A 4O53A 2X30A 2H90A 1G4PA 3NQ2A 4NJHA 3D0CA 2NV1A 2FFCA 2QCGA 1F76A 3HMJG 2JK2A 3CC1A 4JTTA 3Q58A 3GKFA 2Z2UA 3W1XA 4B5NA 3LXCA 4Z1BA 6TIMA 1KBIA 4QM1A 3OBKA 1K03A 4O28A 4RR4A 2FDSA 3O6CA 4DPQA 5G4WA 1TTJA 4OGZA 3IVUA 4IMFA 1YLVA 1QPNA 4IXXA 3FKKA 2ATSA 3NZRA 4LNYA 3KVMA 4XQ6A 3ZWSA 3F4WA 1GOXA 4K7YA 4AHPA 3QSTA 3L5AA 4TIMA 2XN1A 5CG7A 4MZ1A 4JTEA 3I68A 4NNAA 5DY2A 5L6UA 1GVRA 1VGAA 1IXOA 1ZAJA 2ALDA 2QR6A 4DEFA 1SUXA 3NOEA 4WOQA 2ATMA 3HGJA 3B4UA 2VEIA 4MY1A 1G6CA 1WAUA 1T8XA 3GDKA 5C55A 2O7SA 1OFAA 4O15A 4OU1A 4FNTA 3H55A 4PA8A 3QMRA 1OX4B 4K36A 2W79A 3HPZA 4BWLC 2H3BA 1CW2A 4JTGA 3MI3A 4OBTA 1ALDA 1GPWA 3WJSA 4JDBA 2YR1A 1ZALA 3N3MA 5BNKA 4O11A 3EX3A 5C2XA 5HWNA 1EB3A 3PBVA 1TYGA 3T7VA 2AGKA 1W3IA 2G97A 1ME7A 4UNLA 1FDYA 4JICA 1LBMA 4LTSA 2QEZA 3HB9A 1MEWA 3LTYA 2E5CA 4GJ1A 4MZYA 2Q3OA 2RDUA 4O12A 4JGDA 3C2OA 3EKZA 4AF0A 4H3DA 2A6NA 1SPQA 2ZRYA 3LRKA 5A8GA 4R53A 2VXNA 3W7CA 2DORA 3G1XA 2GQ9A 1MEHA 3DXIA 4O50A 3W87A 5DXXA 1JUKA 3BW3A 3HF3A 3TAOA 1GWJA 4QNEA 4AXKA 2RH9A 2VC6A 1Q6RA 1W37A 3W2MA 1J5TA 3S1XA 5D2VA 2BSLA 4NNBA 3PSVA 1OK6A 1DL3A 2DU2A 3UWUA 3BPWA 3STCA 4IX2A 1KM1A 4NJGA 3KVLA 3UWYA 1AW1A 3E9AA 3BARA 1SR9A 3IIPA 2FB3A 2F84A 3QQ0A 3KX6A 5KZMA 1L6SA 1H5YA 2YZRA 2WQPA 3DKJA 1QNVA 3M5ZA 1LRNA 1D3HA 1DQWA 1TCDA 1KV8A 4HSOA 2E77A 1ZAHA 3ATZA 1FWNA 3H53A 3GDMA 4LV4A 3SSJA 4M19A 4JEQA 1M7OA 1W5PA 3HO8A 2FPYA 4IOTA 2JGYA 3VNDA 1NEYA 3B0PA 1P4CA 3PF3A 3SECA 3W7RA 2B7OA 3STEA 1V5XA 4ZQPA 3G22A 1SW0A 3R2GA 4ZVJA 3IGXA 1K02A 2FPVA 2GVJA 4ML9A 1GTEA 5AHEA 1KW1A 4FEZA 4JD4A 4FNPA 3ANYA 3FIGA 4I7WA 3W1QA 3DFPA 1LYXA 3PBWA 3TDFA 3LHUA 2VEPA 3W73A 4JS3A 2QCNA 2QCDB 4YCPA 1QO5A 1ZAIA 2BTMA 1QR7A 3ZWTA 1RVGA 8TIMA 3B05A 3S8HA 1SW7A 4WXYA 3HG5A 2A2IA 3LERA 3GKAA 4EF9A 4JNMA 4O14A 5EKYA 4DF0A 3W2JA 4BR1A 1G69A 1GQNA 4IMCA 1TPUA 1QAPA 4MYXA 4LC6A 2J9YA 2W0UA 1YTDA 3QRHA 4UTUA 1B4EA 5K9DA 5LNVA 4E2BA 5T26A 4HNTA 1RD5A 2FTPA 5KINA 3NQFA 1D9EA 3LBCA 1UJPA 4UMBA 4MFDA 4N9DA 4LVAA 4NX5A 1MZHA 1UBSA 1GVOA 5KSWA 3MWAA 4GE8A 4TMBA 4O4VA 3DGRA 5FEPA 2CZ5A 2JBMA 4O13A 5CZSA 3WJWA 3GB6A 3SW6A 4O18A 3TIMA 3BG5A 5F1VA 4WY0F 4NU7A 2NWSA 3NQMA 5D2YA 3W2KA 2I14A 1RR2A 5TIMA 1WOBA 3KVJA 3BO9A 3FLUA 4ORIA 5D2WA 2ZDRA 1PL9A 2Z1BA 3PSWA 3P80A 4IX0A 2J88A 3KVKA 5IBXA 1JCMP 3HOJA 1X8FA 1L9WA 1NVMA 1T0OA 3B0UX 3B8DA 1EP1A 1F74A 1H63A 2DZWA 3WJYA 3LV5A 1VHCA 3W7NA 3EX2A 3RNDA 4WY0B 3LXBA 5I3GA 2ZYFA 3P8IA 3Q2DA 4X9SA 5CSRA 3QSRA 4TX9A 3PWAA 3GAKA 3NEVA 1P0NA 3IV3A 1VYRA 5D09A 3TXVA 1VLIA 1N8FA 3MUXA 3W2UA 3TQ0A 4MLRA 1JULA 2Q8ZA 4ZZ9A 3V1PA 1Y0EA 3NVTA 2DZPA 3E49A 4RLIA 4GWEA 4BI7A 3EX1A 2CW6A 3LCXA 2C6QA 1AK5A 4G1KA 1AG1O 3VFLA 1OFOA 1S5WA 1OX4A 2Y61A 3PAJA 5K2ZA 1PIIA 3DZ1A 2Y7DA 4MUZA 1RQBA 3M7WA 4XZ9A 4BI6A 1IGSA 1W1ZA 4R34A 3G1FA 3W1RA 1QFEA 4BWLA 1KM4A 5HWMA 4NXKA 3LI0A 4D2JA 3LHWA 2EF9A 4HT3A 3TC7A 2FJKA 3S5NA 3LCGA 5DLCA 3L68A 1THFD 3OVQA 1A50A 1M5WA 2YW4A 3KAOA 3EX6A 1M7PA 1TPFA 4MIMA 4KFPA 3LHVA 3DKLA 4MYAA 1O4UA 2CLIA 3MP3A 4PL2A 3NAVA 1XXXA 1SO3A 4POCA 2Q8LA 2C16A 4JTFA 4UR8A 2Z0IA 1G67A 1TPVA 4ZQCA 2DZUA 4UTLA 3TSBA 1GG0A 1DKWA 3C52A 3O07A 3RU6A 4H6KA 4OV4A 2A7PA 2QJGA 4M6VA 3DU0A 3DH7A 1XCFA 5K7JA 4DF1A 1TIMA 3U8GA 3VCRA 1EUNA 1JR1A 4A29A 3ZFHA 2NX3A 3PVFA 4LW7A 3G8EA 5LGZA 3I6RA 3BW2A 3NQ7A 2AQWA 4O0ZA 1DJNA 2PRMA 4O19A 4RK8A 3E96A 2PE4A 3C2FA 1TTPA 5F4SA 5AFDA 3LCFA 1TB3A 2EHHA 3FS2A 1LRTA 3LLFA 1SU5A 3EWXA 2YCEA 1KM2A 1J2WA 3TCEA 1M6JA 3M16A 2NXHA 5AYXA 4MY8A 1WV2A 4LVGA 4TO8A 1XC4A 2JGQA 5HULA 3TR2A 3MI2A 3FOKA 4JTHA 4BK9A 4HIBA 1BWKA 2VELA 1R30A 3LTPA 3DFQA 1KTNA 3PS7A 2PCQA 3RMJA 4RZ6A 1VC4A 4O4WA 4ZQOA 1WDWA 4LRSA 4O10A 3W1PA 1OFQA 3FEMA 3N9SA 5F4WA 2DZVA 3TU9A 3NPUA 3W3OA 4FXRA 1TV7A 2QUUA 3ABQA 3N2XA 1DORA 5BRBA 4WJEA 1X6UA 2FQIA 4FF7A 1TREA 3AO0A 3Q37A 5CPLA 3KRUA 4CNOA 2TPSA 1ICPA 3NO5A 3P7YA 1HTIA 4CQAA 3GDTA 2NX1A 1VRDA 2HS6A 3TSDA 1FWTA 3W7IA 4GUIA 3NQDA 3HG2A 1S5TA 1SZFA 1KTBA 1W54A 4NJJA 2GVLA 2QCHA 5I3JA 4ALDA 4FNRA 3QQ1A 3W1AA 1KM0A 4NVTA 2C0AA 4YCOA 3STFA 1W5OA 2CLFA 2I9EA 3QMSA 3LTSA 3M1ZA 1TPWA 3QMTA 2YYTA 4E38A 4GC4A 5CPOA 1XBXA 2XN0A 2TMDA 4XBKA 1MO0A 1LDCA 1GT8A 3NPVA 3DBPA 3QEZA 4EIVA 3W74A 2B4GA 4DO6A 3GR8A 4DELA 1H60A 3OVPA 1AW5A 2X1RA 1W31A 3MBFA 4WOZA 3MI6A 1YADA 2D73A 2BWGA 5FEZA 5IM51 4ONVA 3W84A 3W76A 1XI3A 1HUVA 3CLMA 1EP3A 1PCWA 2X1UA 1FX6A 1VZWA 1TPEA 1VHNA 5CGQA 1JQVA 3HQ1A 1DVJA 3HIJA 3LHZA 4LUIA 3T78A 3TW6A 2QCFA 2AAMA 1MEIA 2Y7EA 3TW7A 4M7SA 2J6XA 3M6YA 4ICNA 1H1YA 4IMGA 3TQVA 1B57A 3W71A 1Z48A 4UTHA 2HS8A 4UFJA 1WYIA 4LUJA 3WK0A 2G95A 3M43A 3EKLA 3B04A 2YDAA 4AWSA 3P74A 3HGSA 3VE7A 1Q6LA 3UD6A 2HMCA 3G1HA 3LB0A 1Q6OA 2Y85A 1AMKA 3TJLA 1KM5A 2CLOA 3NNTA 2Y70A 4NUWA 1ZNNA 1ZFJA 3R12A 1FWRA 4E2DA 3LCWA 3NQ6A 2QJIA 2RKXA 2V0TA 2ZZ2A 1CI1A 4KFNA 2WO5A 5H91A 1ADOA 4RCXA 5H2ZA 4Y8FA 3P62A 2E6DA 4HPJA 4K8EA 5DCEA 4KFOA 1NSJA 3P67A 2A7NA 3W7KA 3C2RA 3HJZA 1LTDA 4X3ZA 3UXDA 1PV8A 2H8XA 3W9ZA 1JCJA 4BI5A 4HPXA 4IUOA 1KLZA 2XN2A 3L21A 2QCEA 1LBLA 3CM4A 3G1SA 1NF0A 3GR7A 2J24A 4AB4A 2X1TA 5LZLA 3OHIA 1JQXA 4O8RA 1KA9F 1SW3A 3DHDA 3LCHA 4CQ9A 3SY5A 4ZMGA 4A21A 3WK3A 3R89A 3UQNA 4EOUA 2QAPA 5D04C 2Y7GA 1TRIA 3A9IA 2CLMA 2KZHA 4GFSA 1SFLA 3NQ8A 4K38A 1TPB1 3IIOA 2UV8G 3NDOA 2E68A 1GVFA 3ZR4A 2WJZA 4FIQA 5AC7A 5AC6A 3NPXA 2V82A 1A5CA 1QO2A 2NUXA 4XBSA 5D32A 3UZJA 4CCEA 2FIQA 5CPNA 2PC4A 2NUYA 5G2HA 1DV7A 1ML1A 1I2RA 2PRLA 1SFJA 3M44A 4Z0JA 3L0NA 3RF9A 4YLWA 5I3IA 3VKJA 5G1TA 1XBZA 2A5HA 1YXCA 2WKJA 2ZRUA 3OVRA 1K8ZA 5AC8A 4UTKA 1Z41A 4FX7A 3LX9A 1MSSA 1H7WA 1WX0A 4WUIA 2ZZ7A 4Y9AA 2OCZA 1I2PA 1QDSA 4DBEA 3NL5A 2ZZ5A 5F2IA 4U4MA 2Y89A 4YL2A 3GYEA 2Z6IA 1UCWA 2GQ8A 3THQA 2C1HA 2BXVA 4UTWA 4UC5A 3W1UA 5E0KA 2QF7A 3GDRA 2WSYA 2C18A 4QIUA 1EIXA 3TXZA 2E5DA 2P10A 4O1AA 3GNDA 5LGXA 3UZ5A 1P0KA 1XUZA 3M5XA 1W5QA 4WD0A 3N14A 1S5VA 4UFMA 4K6AA 2H6RA 1XKYA 2DJXA 3C0JA 1N7KA 2X2GA 5LHEA 4NQ1A 3W2NA 3W88A 2G96A 1XDLA 3MW7A 5K9XA 3KHJA 3CIXA 1U5JA 1K7FA 4MOZA 1HL2A 5U7SA 4XTDA 3O1NA 2B7QA 4JXCA 1I2NA 2A0NA 3GXNA 1GVQA 4UTMA 1TQXA 4RX0A 2VFFA 4ORMA 4WQ6A 2I1OA 4NX0A 2YPIA 2QCDA 4ADSA 4IWWA 2V5LA 5D33A 2GPTA 3TV8A 4FNUA 5DBTA 5AN7A 1RZMA 5KTLA 4YMZA 2V30A 1L6YA 3LV6A 1KFBA 4AMAA 3L65A 2ZA1A 2VFHA 1FCVA 1W5MA 4LT9A 1FQ0A 1F7BA 1KFCA 5G2IA 1G7VA 3SJ3A 5EPDA 3N73A 4UUIA 2A85A 1JRBA 2Z6JA 3OEXA 3TNOA 1A5SA 5DCDA 4HHPA 4JDYA 2CZDA 1R2RA 5CPMA 3C56A 1YPFA 1Z44A 2ZZ3A 4PFMA 5CKSA 3I65A 3O6YX 2Y7FA 3W2LA 1QPRA 1EX5A 1OYAA 4NZJA 4N9BA 4LRTA 4LY8A 4Y6GA 1F05A 3TX9A 4A2RA 3SI9A 4Q4KA 3M47A 1OF6A 3MP5A 1X1ZA 3IGUA 3IVSA 3MYOA 1WOAA 1KFEA 4IXHA 3ABRA 4MY9A 3F03K 2YW3A 2ZBTA 3PG9A 3NQEA 1JUEA 3QW4B 1XUUA 1OHLA 4NNCA 2LLEA 3P81A 4A2SA 5BMWA 1FWWA 2E6YA 4N2YA 1NF7A 1UUOA 3HG4A 4PH6A 4WY0A 2RDTA 4FB7A 4K7VA 4ZQRA 5FEWA 1P1XA 4QJ1A 4DO4A 1O94A 3SIZA 2H8ZA 3UXAA 2J9XA 4C1LA 1TMHA 3ZS4A 3S42A 1DBTA 4C1KA 3T4CA 1C29A 3DFSA 3LRLA 4RXGA 1ICQA 2ZRZA 4YXGA 2WNQA 5D03A 3TC6A 3VI2A 4Z1CA 4DXVA 4RZ5A 5FEXA 3FYPA 1ME9A 2WV8A 3CIWA 3GK0A 1UB3A 3QPZA 2CWNA 1GTHA 3QH2A 2C13A 2E1DA 5F4XA 2DZXA 2VOMA 2TSYA 1RQEA 1KTCA 1JJKA 2ZQ0A 3TE9A 3W1TA 3YPIA 5LNRA 1SZGA 2GOUA 3NM3A 2JKPA 2QCLA 2FPTA 1DHPA 5AB3A 1OYBA 3ELFA 5ABTA 4A3UA 4IMEA 5HWJA 3V75A 3TMLA 3G18A 5K3VA 5I3HA 3G1VA 4OV9A 5BMXA 5FF3A 3QM3A 2X1SA 3W83A 1EP2A 3LBMA 1TPH1 3IIXA 4JTLA 4Z1AA 1JCNA 5AHMA 5CZ0A 1ZENA 5DELA 2G5WA 3MHUA 4Z08A 5HUPA 1LROA 4FXSA 2W6RA 4MVAA 3W1NA 1B9BA 3W07A 5MHBA 3O15A 4Q33A 5EBUA 3A21A 1I2QA 3O63A 3TJXA 3W7GA 2Y63A 3F1QA 4N6FA 1OABA 4PEKA 3W85A 1V7YA 1IXQA 4RJEA 3UPWA 5LNSA 1O5XA 1SSGA 3GX9A 2R8WA 2NZLA 3I7QA 1FCQA 1TJPA 4UMCA 5CZTA 4LS1A 4RZ4A 3UY8A 2ZA2A 5D38A 1G4SA 1PCKA 3I7SA 3KRZA 3PUOA 3O05A 4NJIA 4Q32A 5I3KA 3BG3A 4AEOA 4QISA 3W7LA 4S1FA 5D37A 1HO1A 3BLIA 3NQVA 2FLIA 3MYPA 1H61A 1W5NA 5F1UA 3G1DA 3RFAA 4CCCA 4LS2A 3HGRA 5D05A 3C6CA 2ZTJA 4OQVA 4HNVA 3TFCA 3W1MA 4ADUA 4GBUA 3RLUA 2HSAA 4QITA 2VFEA 2ISWA 1OFBA 1AW2A 1BWLA 5D2XA 3UWZA 3W7MA 5L9FA 3PUDA 3NA8A 3T40A 4MPQA 1KFKA 5C54A 2GUUA 1VR6A 3PG8A 2DZTA 4H4IA 1OFEA 5HUOA 1R46A 1OJXA 4RV8A 4GUFA 3PR2A 3GXPA 4RKAA 1FUYA 3W7JA 1JCLA 2YXGA 5DCBA 2YFNA 3M41A 4HKPA 1U83A 4K37A 1EUAA 5D02A 4R33A 3S1UA 4JTUA 3S0CA 3S1WA 2YSWA 1LBFA 4UFLA 5EMUA 3OA3A 3THAA 2FB2A 2C19A 3NGJA 3FJLA 1ZJIA 4JYFA 3L2IA 3N19B 3EXSA 3UNDA 5FF0A 4OT7A 3TH6A 4O0KA 3BGGA 3W6YA 3QW3A 4JYEA 3P84A 4JTSA 1GYNA 1H7XA 1YPIA 4UMAA 3P82A 4K39A 4CCDA 2BLEA 3JRKA 3NG3A 4O54A 2YX0A 4P2VA 3ABOA 3GAYA 3M5YA 3QYQA 3EXRA 1L2UA 1QOPA 2J27A 2VFDA 5G1YA 4RXFA 3MHFA 2C15A 3G1YA 2TYSA 3P5ZA 5HQEA 5F2MA 3H54A 3FJ6A 4JIQA 1KM6A 5EY5A 3NR0A 2OX1A 1LOSA 3G3MA 4MZ8A 2ZZ4A 1TJRA 4M6QA 5G4EA 4HN4A 1WBHA 1H7RA 1F2JA 4QSHA 1KFJA 3EXTA 1IIGA 2QUVA 2QDGA 1ONRA 1VQTA 3E12A 4UTJA 3IEBA 2ABAA 1W3TA 4LU0A 2QUTA 4ZQNA 4IMDA 3RLVA 2V9DA 4ZL1A 3LM7A 1O5KA 1BEUA 2EKCA 4CNPA 3R8RA 1D3GA 1KM3A 2DZSA 1AL7A 4UTTC 3W7EA 2B7NA 5E1QA 1F6KA 3ABSA 3QZEA 2NXIA 1H7PA 3NL2A 1OFRA 2XFWA 4I9AA 2YGYA 2P1FA 4LV9A 1H7NA 2A1YA 5DN1A 2VEKA 1UASA 3R13A 1IF2A 1L6WA 2V8ZA 3TK7A 3A22A 1FXQA 4LOCA 1YTEA 2VFGA 3T55A 1B4KA 1TPC1 3L67A 3W75A 2WSQA 3KRSA 1Q6QA 2QKFA 3LI1A 4GUGA 3BVJA 3EB2A 3B0VC 2A4AA 4JN6A 1EWDA 4HNNA 1Z42A 3UWQA 1XBYA 5G5IA 2E09A 1LCOA 3FFSA 1SO6A 2Q3RA 1B3OA 2V2CA 3MMTA 3GZ3A 3L0KA 2NXGA 1WQ5A 4JYDA 4DBDA 1K8YA 1PE1A 2B0MA 1HO4A 1PHQA 3MO7A 3RK8A 4TMCA 3NQAA 1W56A 1FDJA 2QDHA 2QCMA 3O06A 5IBXC 1OVDA 1F73A 5AYYA 1HG3A 2C3ZA 1VCGA 4O52A 5AHLA 4FIRA 1QOQA 4M6PA 4QNWA 3LOTA 3EWUA 4GUHA 3EWBX 2R91A 3JS3A 3NQGA 3NQCA 1I8JA 1PS9A 5LNWA 2C14A 1VLWA 2Y62A 2ZZ6A 3DENA 4UR7A 4W9TA 1SZEA 1ME8A 3C8FA 4S2CA 2OT0A 1GJPA 1PVNA 3PUEA 1LZOA 3KXQA 1IXNA 1Q3NA 3INPA 4NZFA 4JTJA 1QPOA 4UCGA 4HNUA 3TA6A 1QCWA 5TBOA 3C2EA 1OK4A 1P5BA 1TO3A 3Q94A 5C6MA 4O1DA 1BTMA 2WSRA 3CQ0A 3F4NA 4UTTA 3GDLA 1IIHA 1W8SA 4JX5A 4AAJA 1WA3A 3L66A 4FNSA 1SSDA 1FWSA 5AYZA 1H62A 3M9YA 1EPXA 1S3HA 3PB2A 4AH7A 3W7OA 3SGZA 5LNUA 1FXPA 4MJZA 1LLWA 3HBLA 4Z1DA 2ZRVA 1GZGA 4UNKA 4N9CA 1MXSA 1Q45A 4P61A 4FX8A 1FDZA 1R2TA 4CNNA 1CX9A 3P61A 2WNZA 3C4UA 2GJLA 3EWWA 4XKYB 5J5RA 4M7TA 4HSNA 4JTIA 3NYZA 1OYCA 1E51A 3T44A 3AJXA 1VCFA 2GJNA 2NLIA 1EEPA 1W0MA 1K7XA 3SR7A 4LVFA 1JCYA 1R2SA 5BOOA 3TUUA 4GNJA 5HR7A 4NXSA 1VYPX 5FESA 4X2RA 3TKFA 2EAWA 1LOLA 3UY7A 2CLKA 1VCVA 3W7QA 4AWUA 4CLMA 2PRHA 3N2MA 5F2LA 3DFOA 3HG3A 5I3FA 3KFTA 2TRSA 1LM1A 2F7FA 3LDVA 5LHFA 2ZZ1A 2R14A 4N4PA 4AF0B 3NZ1A 4KWVA 4DF2A 1W3NA 3UYCA 4GUJA 5FF2A 1ZY9A 2DP3A 3PBUA 4WXZA 1SZNA 3LCIA 3EWYA 4OHQA 2GVGA 2E5BA 4X22A 3N9RA 5A5WA 4EWND 3E0IA 1NFBA 1FCBA 3GLCA 4L4MA 4O16A 1F5ZA 1LOQA 1C9DA 4JTKA 4N4QA 3PULA 4EVZA 1GVSA 1X7FA 2CLLA 4NT0A 1I4NA 2VEMA 2IQTA 1OX6A 3IGSA 2QAFA 3KOFA 2WOQA 3QF0A 3CT7A 1GG1A 3SFKA 1YXYA 2DJLA 4UFIA 1R47A 2H3DA 1RV8A 2Y88A 3S1VA 4PL1A 4NJKA 3PB0A 3K30A 4AHQA 3S5OA 1ZCOA 1GYLA 1LORA 3LLDA 4AVFA 4TU1A 3CWNA 3GIYA 2YFOA 1VJIA 2ZA3A 2GQAA 2A21A 4A22A 3L0GA 1WXJA 1FBAA 4IQLA 1TTQA 3CU2A 3TQKA 3P60A 2NUWA 3EX4A 1RPXA 5KZDA 1HFBA 2P0OA 3P8JA 1VYSX 1YDVA 2A6LA 7TIMA 1SO4A 1K3UA 4JX4A 2ISVA 3CWOX 2E6AA 2V2HA 4DPPA 2R94A 3G3DA 5AHFA 1T96A 4PTNA 4XWUA 2VENA 2ABBA 1BKSA 4Z0SA 5DY3A 3BLEA 2QJHA 4OE7A 3C61A 2Y6ZA
chains in the Genus database with same CATH superfamily
3B03A 4HQVA 1TVLA 3LENA 1W32A 2OSXA 4YTQA 4D6JA 5HNRA 2PUZA 5HBFA 4JHMA 3AHYA 2J4GA 5FI8A 1V4YA 1XLJA 1X1OA 1K8XA 3GVGA 4JIPA 3KL0A 5KZ6A 1O6IA 2WMHA 1HIZA 3CTLA 4H8VA 4H8HA 2HWGA 4W8AA 4R3UA 3F4DA 3QC3A 4XTIA 2GUYA 1YW1A 4WX2A 1I45A 3UPBA 3FKRA 1RQHA 4H41A 1DWFM 4WSJA 1M03A 1Q7QA 2OT1A 2HJPA 4L56A 5DT5A 3UJRA 5EYWA 1GZ1A 1TRDA 4BHYA 2NWRA 4TQTA 1R3SA 3KL5A 1HP5A 4J1OA 4LH8A 4IT1A 5TAOA 1UWRA 4UIOA 1P43A 3KTSA 1ZBCA 1J96A 4IIFA 5CJNA 5HANA 3RU8X 4AEFA 1HJSA 4PR4A 1W6TA 3BW4A 4DWSB 2OZ8A 4J3UA 4KRZA 4W89A 4GI4A 5F7UA 2PTYA 4DXKA 4O1CA 5I79A 1MVYA 3FNDA 4UNIA 4N42A 1NARA 4JY9A 1N55A 4X9YA 1XYMA 5HAOA 4BF9A 2HVMA 3LPFA 1AL8A 4L9XA 4BQ4A 2G4FA 1K4GA 4S3DA 4KIEA 5HJLA 4ACZA 4N02A 1TV5A 3CWHA 1HKJA 3QJAA 1A5AA 3O8AA 2BX7A 5KMYA 2CXEA 1EQPA 4M24A 1PTGA 2VRQA 3WK1A 5AHIA 3MHGA 3N2CA 3IRSA 4C6PA 4IJBA 3IRDA 4JR5A 4GY7A 2E9MA 2V81A 1Y65A 1GNXA 4AIEA 4G7EB 2G41A 3IAPA 1SQ7A 1Y5VA 2WNNA 4P5UA 3CAVA 1L8PA 3O16A 5KITA 1JXJA 5LYRA 3MBDA 3H7VA 1H1ZA 5AECA 4R5EA 3S5YA 4JX6A 2ZX5A 3UEQA 4CUCA 3CO8A 4ZSUA 1A53A 2CZEA 2JKEA 2VHLA 3LHTA 3M07A 3TCSA 4K3ZA 3TSMA 2I57A 2V5KA 2WCAA 4Y9PA 4DWDA 1UH4A 5K9CA 3G0SA 2WJFA 4TTUA 2E9LA 4LVDA 4F2UA 1UUMA 5GVJA 4KETA 3C3NA 4PRRA 1W9VA 5BXSA 2PAJA 1YTKA 3GFYA 1YDNA 5FA5A 5FJRA 1XH1A 4YS1A 1KGXA 5CAKA 3HPXA 3TMQA 3VX1A 2O56A 5H8MA 2CBIA 3E0LA 1XF0A 4TR9A 4NZ1A 3LNPA 1Z32X 1OFPA 1HKMA 2C7FA 3R5EA 1YDOA 3MUIA 3BAWA 4GQ0A 3VNZA 4UTFA 5HMSA 1R3TA 1CPUA 3G0UA 3IIZA 3MKKA 2PD9A 1TA3B 2FMNA 4RV3A 1W3KA 3G1RA 3AOFA 4ROQA 1XFCA 3EDKA 3WH6A 3TAKA 4GBDA 1IV8A 2Q09A 1C8VA 2I56A 1OFDA 4E8GA 1ZPTA 5I07A 4R7OA 3WQVA 1ADDA 1OWQA 2A3EA 1POJA 3CEPA 1IR2A 1MUCA 4S2BA 1E70M 4W93A 2GVEA 1G7UA 3EOUA 3NCOA 1JYNA 1XX1A 2D0GA 1VS1A 3P5YA 3UWVA 2YDRA 4I3GA 3DC0A 4XZMX 2YL5A 2VZTA 1GHSA 3UNTA 4IH3A 1JVNA 1Q6EA 3LXAA 3F4CA 3GSMA 2WVTA 2A7RA 3WF1A 2Y0FA 3NXFA 3QKEA 5FD0A 3VE9A 4O53A 4C6MA 2X30A 3ORWA 4HJWA 3D0CA 3ZQ9A 4JTTA 3Q58A 3GKFA 2Z2UA 1W9DM 1KXVA 3CL6A 2QT3A 4GKLA 4RR4A 2FDSA 1KRBC 4ICMA 4DPQA 5G4WA 5DMLA 5I23A 1FHVA 3GH4A 3TTQA 1HX0A 1TTJA 3IVUA 3AXIA 3TOPA 2EPOA 5E09A 2P8BA 1GOXA 4K7YA 4AHPA 2D23A 2WVUA 1XIJA 3QLDA 4TIMA 1GOWA 4PTVA 3C3UA 3E74A 4NNAA 5FSDC 1LT8A 3GR4A 2HBXA 1UH3A 1IXOA 2ALDA 4DEFA 1SUXA 3AXMA 3PPHA 4A8LA 4AX7A 4CVUA 4JNYA 1XHGA 1AJ2A 4JIRA 2PDUA 4HMDA 3QMRA 5BOFA 1DJHA 3HPZA 4K36A 4EPEC 1H2JA 4C6LA 1CW2A 1X38A 1NIUA 3GNOA 2WLYA 3S9IA 4RNIA 3NDZA 3WJSA 1J18A 1H09A 3MSRA 2XYLA 3P0XA 3KOYA 1IT0A 3FW6A 2G97A 4JICA 4B92A 1G5AA 3ITYA 2VX5A 1DJIA 4LTSA 5HATA 1GYMA 1MEWA 5LA1A 3LTYA 1X39A 2RDUA 2FVLA 4ZTYA 8A3HA 3RX4A 3CIVA 2A6NA 3D3FA 5A8GA 1X97A 3CV7A 2DORA 4DZAA 1VBUA 4GD0A 4Q22A 1RCOB 2CEQA 4RPQA 1JUKA 1Z3NA 1Q85A 2VC6A 5EB8A 4CQCA 5CXPA 4JCLA 3FXYA 3A9BA 3S1XA 3WNNA 5A8NA 3AMCA 2F2HA 3UWUA 2PBOA 4LUTB 3STCA 4IX2A 4NJGA 1B0IA 2QULA 4AZGA 2UY3A 2F84A 5BWAA 3LYEA 4MWAB 1L6SA 1H5YA 2WQPA 3DKJA 4LF2A 3FA4A 3AHTA 1D3HA 1DQWA 3IS4A 2D2HA 3ATZA 3MQTA 3GDMA 3MUZ1 4M19A 4S23A 4J3VA 4IOTA 2JGYA 2B7OA 4MTVA 4XIAA 1JDAA 2WZIA 4ZVJA 4Q4PA 1W17A 1XQLA 3KM8A 2FPVA 2GVJA 5LA0A 3FIGA 2REQB 5A6MA 2O9TA 3LQGA 3W1QA 3DFPA 3LHUA 2VTFA 2QCDB 5BWFA 3O6AA 1ZAIA 3WMLA 1AQHA 1FWJC 1RH9A 1V7AA 2P53A 4B5TA 1XYFA 1GOOA 1WDDA 5LIKX 3GKAA 1M53A 3THUA 4DF0A 4LAKA 4IMCA 1TPUA 2W0UA 1YTDA 3QRHA 4UTUA 5K9DA 4HNTA 1D9EA 4MFDA 2FYMA 1JGMA 5AYIA 4CVWA 1GVOA 4GE8A 4O4VA 3DGRA 1PWMA 1VRXA 3GB6A 3KP0A 3SW6A 4GIEA 4O18A 3TIMA 2NWSA 1PEZA 3NJ3A 1M04A 1D7FA 3WNKA 2ZDRA 5G1MA 3QKZA 2YIHA 5A8MA 2J88A 3KVKA 4MDPA 1RBOB 4Z2HA 3PNUA 3KLLA 3B0UX 2XH2A 2DZWA 4J3SA 4NYYA 3WJYA 4EPDC 4A3HA 4HPGA 3P8IA 1HQTA 2OQHA 1XGEA 1X98A 1UQZA 5AVNA 1O68A 1P0NA 2G4JA 4C91A 3TXVA 4IMAA 4WVXA 1PSCA 3KBVA 3MUXA 3VCCA 1V79A 4AU0A 1XLAA 3TQ0A 1JPDX 1JULA 4ZZ9A 1CBGA 2FZDA 3V1PA 3NVTA 1GCYA 3VNJA 2PDNA 4W8LA 2C6QA 4QHRA 1AK5A 3WMCA 4L80A 3GU1A 3AIWA 3PAJA 2BOEX 1JPHA 1PIIA 4PB3A 3M7WA 1QNSA 3BCDA 1B9ZA 4BI6A 4H9TA 3WF0A 4R34A 1UG6A 1A5OC 3F4VA 5HWMA 3I6EA 3WMSA 1QWKA 3L68A 3KLKA 5CPQA 3VGBA 4H2HA 1ENUA 1M5WA 2YW4A 3WY1A 1TPFA 4MHBA 3LHVA 3W53A 2E1WA 1UR1A 1KR1A 3GVWA 1O4UA 5FJIA 5A6TC 3MP3A 3NAVA 4JTCA 4JTFA 1JZ6A 3UBPC 1ZBKA 2PTZA 3N1AA 4J3XA 2A7PA 2QJGA 4UZSA 3RO8A 3DU0A 3HV8A 4CQBA 3VCRA 4JQAA 3SRFA 2WMKA 4FI4A 3I6RA 3BW2A 3NQ7A 1UWUA 2VCBA 4HMEA 4EK7A 3F5JA 2INEA 1DJGA 1DJNA 1BVNP 2E7FA 3C2FA 4S3GA 1ZCCA 3EDFA 5AFDA 1FWIC 2CCRA 4ZEPA 2OFJA 1Q6GA 1E5JA 1KM2A 3OIHA 3TCEA 3W28A 2HPMA 1EF3A 4ASTA 1VPYA 1M6JA 4JFUA 3WQGA 5HA7A 3EDEA 1UA3A 3UF9A 1WV2A 2JQXA 4LVGA 1XC4A 4LGXA 5HULA 3T0DA 4G9PA 4K2SA 4BK9A 1C91A 1PPIA 5JUVA 1VC4A 1CLXA 1J11A 2J13A 4NAEA 4ZQOA 1WDWA 3WBYA 3R10A 3FEMA 3OZYA 4DI8A 1REQB 3TU9A 4K1GA 3W24A 1TV7A 3N2XA 5CSYA 1KC7A 1FTXA 4J3WA 2FQIA 3VGGA 4ZOCA 1VIZA 4FMVA 3NO5A 4CQAA 3WBAA 3T42A 3TSDA 4EXAA 3NSXA 4GUIA 3NQDA 2V3GA 2HEJA 4NJJA 1UD4A 4DAIA 2XDFA 4GVGA 4ALDA 3UZWA 1GOQA 3W1AA 1EHAA 4R7WA 5B7YA 1Z69A 1WNOA 4BEUA 2CLFA 3VTRA 4W87A 4GPNA 4P8WA 4Q4SA 4YJ5A 1W1A1 1POKA 3QMTA 1VD6A 4L4OA 4E38A 4GC4A 5CPOA 1XBXA 2XN0A 1FA2A 4B4HA 2V38A 3NPVA 3DBPA 1AD1A 3GR8A 4DELA 4QLKA 3ITCA 1KR0A 4BQ2A 1AW5A 1S2VA 4D6GA 4H6EA 1CGUA 1J5SA 1UWQA 3MI6A 1YADA 2WZMA 2JE8A 2PGFA 3VKKA 2FZ9A 3WLPA 4F3HA 3SCNA 3CLMA 1DVJA 3BXWA 1GHRA 1R8LA 4LUIA 3T78A 1WDPA 3PN8A 4RNJA 3TW7A 1H1NA 2J6XA 3APTA 4ICNA 1H1YA 1QOXA 4PEEA 1OD8A 4FLOA 4LEFA 4CNSA 1B57A 1Z48A 4FLQA 2Z00A 5HK4A 4QJ4B 1IWBA 1A80A 1XLIA 4QDPA 1EJWC 4LUJA 2J7GA 5LIYX 3ZO9A 3EPMA 2OXNA 3DC8A 3HGSA 3VE7A 1Q6LA 3UD6A 1LWIA 4EACA 1B5TA 2Y85A 3POHA 2ZVRA 3BLDA 1PTDA 3S6OA 5A2CA 4AC7C 4J4KA 4NI3A 3BTNA 3ALGA 1K9TA 3DYOA 3NQ6A 2ZZ2A 1WKFA 2OLHA 1OIFA 1VEPA 1XLGA 3UZZA 4Y8FA 3OZPA 3WFLA 5HQMA 1IR1A 3UCQA 3W7KA 5A6JA 4DJEC 1YRRA 2FHCA 4PYSA 1I0DA 3W9ZA 3PAOA 4HPXA 4IUOA 1LBLA 3R25A 1NF0A 1E55A 3V7PA 3GE7A 5E6YA 3QGVA 4PRTA 1KA9F 1LG2A 3DHDA 3LCHA 4CQ9A 4H9XA 1JG9A 1FWDC 1N2VA 4HHMA 2CLMA 4GFSA 4YHEA 3RPTA 1TPB1 1OZQA 3IIOA 4BA0A 3FA3A 2E68A 1GVFA 4FIQA 2FHFA 2XUCA 2XFRA 5AC6A 1LWHA 5D32A 3UA3A 3UZJA 3VDHA 3WLQA 4MB1A 1I1WA 3PUGA 4M80A 1E43A 2WMFA 4R88A 4US5A 1I2RA 2PRLA 3WF3A 4YLWA 1YIXA 4ZFCA 4JN7A 1XBZA 3OVRA 1K8ZA 4ATDA 4RW3A 5AC8A 1K6WA 4Q4RA 4ZO6A 1Z41A 3ID7A 4FX7A 2DSVA 1MSSA 2UZ9A 2VMFA 4WUIA 3WDQA 3AQUA 4DBEA 3NL5A 3GTNA 3H2EA 4U4MA 3T2PA 3TNBA 3GYEA 1TWWA 1AQMA 2P50A 1XYLA 2R24A 4UTWA 2WHKA 3T07A 4MWAA 2WSYA 4ZOEA 2E5DA 3UZ5A 4S3KA 3WNMA 1P0KA 4MJ4A 3M5XA 1WB0A 2H6RA 1ZSXA 2PWHA 1UHVA 3RMEA 2EKGA 4JIHA 5FKYA 4FXJA 3WCZA 3VZYA 1U5JA 1K7FA 4M81A 3WLMA 4XTDA 3O1NA 1F9CA 1I2NA 3U2CA 1BYAA 4BQ3A 3CL7A 3CZEA 3AUOA 3FVMA 5BZAA 2YJQA 2DVXA 2I1OA 2WHMA 4NX0A 5AC5A 2VT0A 4FNUA 1RZMA 1YBQA 5KTLA 3CB3A 4YMZA 2OG9A 2CBJA 4I8DA 1D8CA 3IUHA 3LV6A 3M4HA 4AMAA 1BF6A 3L65A 1DHKA 2ZA1A 3SADA 1FCVA 4LT9A 4JEJA 1KFCA 3ME3A 4M0XA 4LYRA 2NVCA 4UUIA 4BCEA 3OEXA 3SURA 1A5SA 4RE4A 4IQDA 1Y5WA 3OTRA 4AZHA 1R2RA 3JZUA 4GY0A 4Y2WA 3ITOA 2ZZ3A 4PFMA 2BBFA 3W2LA 5IOBA 4HA3A 4XV0A 4PULA 3KW3A 4PMJA 2CESA 3I10A 3MT1A 4Q4KA 3PPGA 4WK9A 4I8YA 3MP5A 4CD8A 4IPNB 3ZSTA 4DUOA 3G6LA 5AVHA 4RDWA 4MY9A 1GEHA 2CETA 3F03K 1LLOA 2ZC1A 2ZBTA 3PG9A 2IPFA 4FF5A 4GCXA 1XUUA 3U4AA 3E5PA 1AD4A 5BMWA 2D22A 1NF7A 2YZ5A 3ZR5A 2CHOA 2UWFA 4WY0A 4H8UA 4FB7A 3UXAA 1TMHA 3ZS4A 4XG1A 3RR1A 2WSPA 4O1FA 2J8TA 3MJMA 4X0NA 4C1KA 4HNLA 3DFSA 4RXGA 3R8HA 1V03A 4GXWA 4YXGA 2WNQA 1N8IA 3DIPA 4Z1CA 4DXVA 2QPUA 2V68A 3OBAA 2CWNA 1GTHA 1RA0A 2ZXBA 4IIEA 2E1DA 3SRKA 2VOMA 1CT5A 1G0CA 3VOIA 2Z25A 4FS9A 1KTCA 1JJKA 4Q7BA 2OO6A 3YPIA 1SZGA 1DHPA 5AB3A 1OYBA 2BODX 3VILA 3S47A 4IMEA 5HWJA 1T40A 3V75A 5I3HA 3SO7A 1UWSA 4D1JA 1YE4A 3KWXA 3SAZA 4DN1A 3OLEA 3A4AA 2YXXA 3IIXA 4Z1AA 4GI6A 3SY1A 5AHMA 2Y8VA 5CZ0A 5DELA 3CQIA 3MHUA 1OT2A 4LAUA 1XRSA 4MVAA 2QMKA 3KP1A 2Z28A 3NZQA 1F8MA 3TJXA 3WD0A 3ZT5A 2W92A 4N6FA 1SSGA 4X60A 6A3HA 5CZTA 4DYEA 3TN3A 1VB9A 3N15A 1PCKA 4HB7A 1PB0A 4M6UA 1TZ9A 4AEOA 3V1HA 1EC9A 3NQVA 1XIGA 5A2AA 3HPFA 4N0RA 1H61A 2WVVB 4DIAA 4DJFC 4HNVA 4X61A 1JYXA 4GBUA 4H9YA 2PDYA 4RW5A 1WCGA 2ISWA 1R6WA 4P7NA 3W7MA 3ZYZA 1KFKA 3W00A 4GQRA 3CTTA 1OJXA 1R46A 3MPGA 4GUFA 3GXPA 4RKAA 1FUYA 2AQVA 2ZVIA 4HYRA 3D5HA 5DT7A 3CYVA 4PTMA 4JTUA 4QFUA 2FB2A 4K68A 4QCFA 3W27A 1TJ2A 5FF0A 4OT7A 1ECQA 1UZDA 3QW3A 3P84A 4ZODA 1H7XA 1YPIA 2IKIA 4UMAA 1XIHA 2QS8A 1X6NA 3HM7A 3CT2A 1CECA 3JRKA 1PYMA 2CKRA 3GAYA 3M5YA 1M9HA 1L2UA 1QOPA 4QLLA 5G1YA 3VYLA 2TYSA 4LNCA 4OUIA 4WGXA 1JDCA 2WHLA 3P5ZA 4J2PA 2BVWA 3H54A 1JI1A 3FJ6A 2J78A 3U2ZA 3QC0A 1CXLA 5EY5A 1QT1A 2WW5A 2JALA 5AKQA 3WLNA 4QSHA 1XLFA 3K13A 2QDGA 2DVTA 1VQTA 1O66A 2WZHA 1RLCL 4JTAA 1GJWA 2ABAA 1UWIA 2J7HA 1E6PA 2V9DA 2WMGA 3GS6A 3K1GA 2YBUA 3PJWA 4AZ5A 3G77A 4U3CA 3EB4A 1D3GA 3FGCA 5ENLA 1KM3A 4UTTC 1R5YA 1XYAA 3M0MA 3LPOA 3QZEA 2XIOA 2EEXA 1R9XA 1AH3A 3URBA 1K9DA 3E5BA 3ARSA 4UCFA 2BFGA 1QI4A 4DHGA 1QXLA 2PZNA 4US5D 2DW7A 4LV9A 1RCXB 1H7NA 2VEKA 1FH7A 4YTTA 1L6WA 3RJYA 1J10A 4QQUA 1FXQA 2DGAA 2W4XA 1YTEA 2EG6A 4HZ6A 1B4KA 1I1XA 1TPC1 2FKPA 2X2YA 5I0DA 4QE4A 3MCNA 1M01A 2PDHA 4D6HA 1T6MA 4RPPA 3F5LA 4EPBC 3SCOA 5FSEC 4AEEA 1EWDA 4HNNA 1Z42A 1LCOA 4XAYA 1A0CA 2V2CA 3H21A 1DP0A 1XH2A 3BE7A 3PFRA 2ANUA 2PLKA 5CGTA 3TWAA 4DBDA 4MKSA 3ECQA 3BAKA 4EXQA 1EF2A 1V0MA 5DEZA 5HXMA 1FDJA 4X0VA 1HG3A 4O52A 5AHLA 3P2VA 1YDYA 4M6PA 3LOTA 3EWUA 2DIKA 4L6HA 3UJEA 3T05A 2ACRA 3RUBL 3ITTA 3VKAA 1F3TA 5XIMA 2DSKA 1PS9A 2ZX8A 2ISDA 3KBJA 5RUBA 1G94A 2ZZ6A 4HK5A 3DENA 4W9TA 1ME8A 2PTXA 5ABHA 4IP5A 1LZOA 3KXQA 1IXNA 1Q3NA 4Q8TA 3C86A 1FWBC 1QPOA 4XSLA 1ITUA 1P5BA 3Q94A 2P3ZA 3BAJA 4CKQA 2Y4SA 3CQ0A 3WKZA 3F4NA 1W8SA 1FWSA 2QGHA 1KQYA 4AH7A 4WDUA 1BXNA 1E1FA 3UU0A 2VQUA 1Q4WA 3VUSA 4DUXA 4Z1DA 1VENA 1GZGA 3CAWA 3UP8A 1UP2A 3KBNA 1R2TA 4C6QA 3C4UA 3SSZA 5HJXA 1S1RA 3VZXA 4JTIA 1OT1A 3N6HA 1E51A 1K9EA 3T44A 3AJXA 4BF5A 1EEPA 1W0MA 1K7XA 3SR7A 4LVFA 5BOOA 3K8LA 5HPCA 4X2RA 3TKFA 2EAWA 1LOLA 2CLKA 1VCVA 4AWUA 4CLMA 3BAXA 2PRHA 4KRTA 2AL2B 5I3FA 1CXHA 4ERAA 1LM1A 1V6YA 1XH0A 4IQEA 3MUAA 4KWVA 4LBRA 1GKRA 2WZTA 4GUJA 4NZ3A 1ESWA 4MWAE 1WUEA 2P76A 1SZNA 3LCIA 4Q8NA 4OHQA 1BF2A 3R0KA 4EWND 1CXIA 4L4MA 4KEUA 1AA1B 1EPVA 1LOQA 1E0UA 1KKRA 4RNHA 4JTKA 4N4QA 3PULA 1GVSA 3DFHA 4QG9A 1F3WA 1DJWA 3S5SA 5A8QA 4DJFD 2XH4A 1I4NA 2XH0A 4FSAA 1LL7A 4PMUA 3QF0A 4HOZA 3CZ8A 1VEMA 1QATA 2VC7A 1W1TA 1IZKA 1R47A 2H3DA 1RV8A 1RXOB 4HA0A 3S1VA 2OX4A 4YIWA 3ZR6A 3N25A 3S5OA 1O7AA 1GYLA 3BCJA 3LLDA 4J28A 1Q13A 3DYPA 3EA3A 2YFOA 3VIIA 2ZA3A 2GQAA 1K77A 2GVYA 4MNKA 4QS5A 3L0GA 2G3JA 1FBAA 4ML4A 4IQLA 1P7TA 1TTQA 5KZDA 3WQOA 4ENLA 1HKIA 3VD3A 2BHYA 1M68A 3AYRA 2CBVA 4AY8A 2W63A 4GKTA 3ZVHB 2E6AA 1HF6A 2E4TA 1XLKA 4BS0A 4IIGA 2W5FA 2W66A 3F2CA 3C8NA 2ABBA 2DUXA 2QJHA 3QV8A 1XKJA 4AY7A 2QCCA 1UQYA 3GVQA 1PKMA 4PMZA 3AZTA 1TSIA 1Y5XA 2VVSA 2HDJA 3AFBA 3DBNA 4PCTA 1OY0A 4KCTA 1GOIA 3B9AA 3PBMA 4E4UA 3CHVA 3VO0A 2WBKA 3SCSA 1B3XA 3DEQA 3A23A 2PDWA 1I2OA 5DXYA 3B8IA 1FH9A 3QPEA 4GLEA 1QI5A 1GEQA 4C7FA 2OZTA 2HTMA 3SBFA 4Y90A 1FVPA 5ABEA 1JPIA 1JUBA 4DBUA 1YNQA 4UQBA 4J9JA 3AIUA 4IFKA 2Z29A 1J4EA 4QROA 3SGUA 4XAGA 2XGBA 3GC4A 3DAQA 3TR9A 4Y96A 4AX6A 1DOSA 4CD6A 3CUHA 4XUYA 4JKLA 1WZMA 2VR4A 4M29A 3M0ZA 4UFKA 4S3FA 3L5LA 4GABA 5HJYA 3BV4A 5F2GA 3BG9A 4WJ8A 3WDPP 4AVNA 2W61A 2RHGA 3UR7A 3W7HA 2F61A 3WLHA 3ZZ1A 3KBWA 1L6FA 3SQMA 3R94A 3OIXA 1B3ZA 5GJMA 2J7EA 1W1IE 2FTWA 1E71M 1IWAA 1Q8AA 2GJPA 1R3WA 2WQDA 4YWIA 1Q7ZA 5HR6A 1EDTA 4O17A 4RDVA 3HPSA 3N2BA 1NELA 2CLEA 3THCA 3BK0A 4PODA 3SN4A 3T08A 3WD2A 4WDTA 4LAZA 4DX3A 3VZZA 2ZRWA 4HA4A 3NVDA 4LC8A 2Y5EA 1KCZA 3MZNA 2NV2A 2XIIA 2WC4A 2Z1WA 4CQ8A 3BLFA 4IPIA 3RHGA 5BRQA 1ZQ5A 5HINA 1OF8A 3S6DA 2J7BA 3DFTA 4E8CA 1J0KA 3WYZA 3WQCA 4AWTA 1S2AA 4I5UA 4LVBA 2E67A 4U28A 4XVDA 3EWZA 3GHRA 3MMWA 4DLMA 2ACSA 4C60A 4LPCA 4MM1A 2ZTKA 5EBAA 4NAFA 4UOQA 3W7PA 2WPBA 3AZRA 4HPNA 2XU2A 1BGGA 3LQLA 2IPWA 2INZA 2WC3A 1KB3A 3VIFA 2X7VA 2WM0A 3BZGA 3UXKA 1R7OA 3O6DA 4FO4A 4WZHA 4PCFA 4DJFA 1YQ2A 2DFAA 4FX6M 1XDMA 3FV9A 1BTCA 4HHLA 1G01A 1LLZA 3W22A 2RFGA 4LCRA 3A5FA 3N29A 2BDQA 3ZM8A 5CCZA 4N6EA 1MDRA 2F6UA 3S5ZA 1PHWA 3USBA 4MB5A 2XIBA 3E02A 3GNNA 4GOAA 3H2OA 3WFAA 2BV9A 1CXFA 5BRPA 4GIYA 3G8RA 1XLDA 2ZDSA 1V08A 4F0KA 1OSEA 2WNWA 5EL1A 1LRQA 3LK6A 1B30A 1MDLA 2PP1A 4IGHA 2EPHA 2DUAA 3W86A 2XPKA 2CU0A 4ADTA 1W2PA 2Q8XA 1NU5A 4JY8A 4QP0A 3V16A 1JGIA 3PC0A 1JEZA 3MV11 1JRCA 2BZNA 3U0HA 2HZGA 2F8QA 1YXDA 4Z2GA 2V5DA 3WK2A 5BW6A 1M7JA 2FH6A 1TJ0A 2CXGA 4D9PA 3FA5A 2IQ0A 3CJPA 4O1BA 1KBJA 4REQB 4DB7A 5GJPA 1SO5A 3UZYA 5M03A 3GUGA 5C7VA 2Z1XA 2QV5A 2GOKA 2NV1A 4LY4A 4A4AA 3DG3A 1ZBVA 4B91A 4RDYA 3CC1A 4B4FA 3B8WA 3W1XA 6TIMA 4Z1BA 3GIQA 4O1EA 2Q01A 1NQKA 4IPPA 4O28A 3O6CA 2BB0A 3SCVA 4XX6A 1CGYA 4RE2A 3OU8A 3E2RA 1QPNA 1UD8A 3SCQA 4DAFA 3FKKA 4LNYA 3BCFA 1ITCA 2VGFA 4B2DD 3QSTA 3MDWA 5H8UA 1PX4A 2XN1A 3N6QA 3AIVA 5CG7A 8RUCA 3Q4DA 2FGLA 4FAMA 1BYBA 3APYA 3EOSA 5L6UA 4L65A 3NXLA 4OTKA 3UJFA 5IDZA 3HGJA 3B4UA 2VEIA 1OEPA 1G6CA 4MY1A 1WAUA 2IMRA 5CZKA 3TYZA 4H9MA 3GDKA 2O7SA 4O15A 3H55A 2W79A 1OIMA 2H3BA 4ZXOA 3CZGA 2I7GA 3MI3A 1JAKA 2G3FA 4FA3A 2VI0A 1ALDA 1UH2A 2WKGA 5C2XA 3L12A 2GZXA 4AC1X 3T7VA 2PF0A 2BY3A 1DPMA 5FL0A 2HV5A 1JZ4A 2QZRA 5IFTA 2VZSA 3HV9A 2ZRYA 1SPQA 3RIKA 1EZ2A 1MEHA 3DXIA 2VYOA 3GC2A 3ARTA 4B3KA 1KBBA 3BW3A 4LSBA 3CUJA 1S5MA 2OEKA 4QNEA 2NT0A 1PIFA 3IARA 4IGNA 2RH9A 3WLKX 5D2VA 2RDXA 1DL3A 1ZBWA 2DU2A 2CYGA 3S1GA 3C0LA 2ICSA 3UR8A 4NZ5A 1XYCA 1KM1A 3UWYA 1AW1A 1MW3A 4LYKA 3PJUA 3E9AA 1EO7A 3BARA 2FB3A 3E0VA 4GIRA 3QQ0A 4KMQA 5HMDA 3VOJA 2O92A 3AXHA 5HNNA 4G56A 1UUQA 1BD0A 3MKVA 1TIWA 2ZWYA 4DZ5A 1KV8A 4GI9A 2E77A 1H3GA 1TVPA 1ZAHA 3HFTA 1AQFA 3M0VA 4LV4A 3SSJA 3HO8A 2X7WA 4XD6A 1REQA 3ZJ8A 3PNZA 2G3IA 3DOPA 1CGWA 3D3AA 3B0PA 1P4CA 2PDMA 3W7RA 3STEA 4ZQPA 3TTYA 1SW0A 2ZUSA 3IGXA 4CGTA 4UQDA 1K02A 2ZADA 3A13A 1NWRA 2PFHA 2G8ZA 3ANYA 3KE0A 4JD4A 4DJED 2BXYA 1XG3A 3E0WA 2WMJA 4AD0A 3PBWA 4MB3A 3CMFA 2WJDA 3WH7A 1JZ8A 3ITLA 2EG7A 1UBPC 1M41A 4PCSA 2GGHA 4YCPA 1QO5A 1QR7A 1RVGA 3O3RA 1T7LA 2VRKA 2VEFA 4L64A 3TN6A 3S8HA 1SW7A 4W4QA 3W6MA 2J8FA 4QJ5B 4O14A 4LB3A 1JZ7A 3CAQA 3EEZA 4MYXA 4LC6A 2YDQA 3N4FA 1OC5A 1XPGA 5LNVA 1TV4A 5T26A 1RD5A 4I6KA 2FTPA 5A6KA 4N9DA 4G8TA 4Z1YA 4AZCB 2WWCA 4J40A 5FEPA 3UG8A 2CZ5A 5FCZA 4INFA 3H2FA 1E4MM 5FAGA 1I0BA 1M7XA 3TJ4A 1UD3A 2OLAA 3L4UA 1WOBA 3FLUA 5D2WA 1PKNA 1PX8A 1PL9A 4EKJA 3PSWA 1IT7A 2EQDA 3P80A 4IX0A 1BWVA 5IBXA 1EXPA 2BY1A 3HOJA 4GNVA 1X8FA 1E5NA 1EGMA 1L9WA 1T0OA 2PEVA 4EP8C 1H63A 3RRAA 2QJJA 2PF8A 3W7NA 3EX2A 3RNDA 3LXBA 3NEHA 3Q2DA 5CSRA 5I02A 1WKEA 5XIAA 3PWAA 2WANA 3WD3A 3NEVA 2NQ9A 4IF2A 3IV3A 5D09A 3BL3A 4ROPA 4BEQA 1VIWA 3GNRA 1V8EA 2XH7A 4LJ3A 4QXIA 3KDOA 2IXUA 2Q8ZA 3ZOAA 4WKHA 3N2OA 3AS1A 3E49A 3VD5A 4GWEA 4B15A 1CTNA 3RITA 3LCXA 3PZTA 1Z89A 3FXGA 4EAYA 1OX4A 3G6MA 1E4LA 5JH1A 3VK5A 2Y7DA 1XP3A 4HTYA 4B9YA 4XO6A 4FOKA 3UVAA 3ZLFA 5FAJA 4GI8A 4AVOA 4JL2A 4GG9A 3G1FA 3AU2A 3XINA 3W1RA 1LQAA 4NXKA 3LI0A 3LHWA 2EF9A 3ZMRA 3TC7A 5DQPA 3S5NA 3LCGA 5DLCA 4S38A 2CPUA 1THFD 1JAEA 2PWVA 3WBEA 2DZAA 3EX6A 1M7PA 3WQEA 4B16A 4MYAA 2W3ZA 3QR3A 1WDSA 1SO3A 4POCA 3BMXA 2YL9A 1LG1A 1ODUA 2Z0IA 3BMVA 3P14A 4ZQCA 4F2BA 4U3AA 2R82A 4GVFA 3RU6A 2E25A 2HISA 4H6KA 1S2CA 1E72M 1J0ZA 3DH7A 1XCFA 4DF1A 1IHIA 1EUNA 2J77A 4A29A 2AKMA 1K8CA 3U3HA 5M3WA 4W5ZA 2OLSA 3EDJA 3H26A 4O19A 2PE4A 4YTRA 5EMKA 2XGIA 3WL0A 1TB3A 2EHHA 3CPGA 1LRTA 1SU5A 4ZB5A 3GFXA 1PIGA 2VC5A 5AYXA 1KD0A 4MY8A 1ZRQA 5T9BG 3MI2A 4FOJA 3A3XA 3FOKA 3WH8A 2VELA 1R30A 2PODA 3DFQA 1XLMA 3RMJA 1B2YA 3KCJA 3PZUA 4RZ6A 1BLIA 3N13A 4GX8A 5BXPA 4O10A 3RX3A 4E2OA 3W3OA 3RR4A 3AO0A 3Q37A 5CPLA 3KRUA 4G5DA 1C7TA 2TPSA 4B5UA 4CN6A 3A4WA 3B3DA 3K1DA 3WNLA 2PDXA 3GDTA 7XIMA 4PMYA 4ATWA 3ERPA 1KTBA 2WK2A 2QCHA 2ZX9A 1UA7A 2GGJA 3QQ1A 5A3HA 3FHAA 4YPJA 3E3HA 1EGVA 3CHCA 1KRAC 2BVTA 4XSMA 3ITVA 3TOYA 4HSHA 3IJQA 2I9EA 4KPLA 3WQ4A 3MU7A 3GTHA 2XFFA 1TPWA 2TMDA 4XBKA 3QEZA 4DVOA 1GT8A 5MKGA 4DO6A 2JIEA 3IJDA 3GTIA 1EJ7L 5I78A 4QG8A 1W31A 3MBFA 2OQYA 3BANA 4QBXA 4LBSA 2A3BA 4IL0A 2D73A 2BWGA 1TA3A 3W84A 3BZJA 4B2DA 3WLJA 1HUVA 4XO7A 2WCGA 4Y9MA 1VZWA 1TPEA 3HQ1A 1U22A 4MG4A 4C6DA 1OG6A 3LHZA 1MZRA 4V27A 1HZYA 1MEIA 2QJMA 4M7SA 3WENA 3EBVA 3M6YA 1OCJA 4IMGA 1E3ZA 4GVIA 1EJXC 3W71A 3PANA 1NOWA 3ZT7A 2HS8A 1QU4A 4UFJA 3GXIA 1M1BA 3WK0A 2G95A 3M43A 4H1ZA 5JXQA 4EXBA 2JF7A 2YDAA 2OELA 4AWSA 5CBBA 3GW0A 3EB3A 1T8QA 3VXGA 2R1NA 3D47A 3IPWA 1AMKA 5JH2A 3TJLA 4J2MA 5E5CA 2Y70A 4NUWA 1SMDA 1Q2SA 3U7BA 4C5ZA 3PP7A 3LCWA 2WKLA 2V0TA 1HKKA 4KFNA 2WYSA 1ADOA 1TWSA 5H2ZA 5BCAA 2YB1A 4H8NA 4YWSA 4HPJA 2O0TA 5DCEA 3CHDA 6XIAA 3P67A 2VD9A 2HE8A 1CWYA 1RY8A 4WR3A 3C2RA 4D8LA 3HJZA 1P48A 1PAMA 2IS7A 1CGVA 3KEHA 3GO2A 4BI5A 3I3DA 3EA2A 3G1SA 1RAKA 2J24A 5LZLA 4QLJA 2FVMA 3EDDA 2I5QA 3COTA 1JQXA 4H9UA 4ZE4A 5TD4A 1EDGA 3NDYA 2GDUA 4CQDA 4PSPA 1TRIA 1ELSA 4AFYA 4K38A 4JTQA 1SFLA 3NQ8A 3QYSA 3U48A 1AMYA 2UV8G 3ZR4A 7A3HA 1XD0A 4TX8A 3NPXA 2V82A 1A5CA 1QO2A 2NUXA 3CV6A 2ZUUA 4LANA 1MQPA 5CPNA 3LG3A 1U2YA 1R9ZA 2CERA 1DV7A 2FGBA 4E8DA 1PDZA 4J7RA 3TYCA 3CQKA 4H7CA 4XD4A 3RF9A 1ZP3A 3AUJA 4DYJA 5G1TA 2A5HA 1YXCA 2PDLA 2ZRUA 4D6CA 3H23A 2ACQA 3EGJA 4UTKA 2PGWA 1RALA 3R1ZA 4Z2JA 3RX2A 1UIPA 3CAKA 4Y9NA 3DGBA 1I2PA 1QDSA 1OB0A 2L5HA 4S3EA 2Y89A 3ALFA 1UCWA 5CLWA 2GQ8A 3E1F1 1UD5A 4HMNA 2IQDA 1EHNA 3W1UA 4B3LA 2QF7A 2A79A 2C18A 4QIUA 1VJSA 2P10A 1XUZA 1W5QA 5JBEA 4UFMA 4K6AA 1XKYA 3QY7A 3C0JA 1N7KA 5IDIA 1A4MA 4NQ1A 1M65A 1EX1A 2G96A 1XDLA 1W1PA 3CIXA 5C2CA 3WBWA 4UZUA 4NRSA 3UG5A 2GWNA 2A0NA 3M64A 4HN8A 4UTMA 2NSXA 1TQXA 3HA1A 4RX0A 4WQ6A 4ADSA 3VDBA 3DERA 2V5LA 2E8YA 1F07A 1I9CB 3TV8A 1Y7VA 4FZIA 2CKSA 3VMPA 1RVKA 1KFBA 2VFHA 3TONA 5G2IA 1G7VA 3S4TA 2A85A 3TNOA 5DCDA 4RNFA 1BGAA 2VD8A 2QIIA 4DXXA 2WZEA 2YLLA 4RUBA 1EOKA 2QPXA 1C93A 5ABFB 3C56A 1YPFA 1A3HA 3I65A 4M8UA 1EA9C 1QPRA 4LCQA 4LRTA 3E2VA 1BKHA 2RGLA 4U31A 2EBNA 3M47A 1ZGDA 1OF6A 1X1ZA 3IGUA 3UR2A 2AMXA 1KFEA 1TJ1A 2VX4A 4YYCA 1EJTC 2VOTA 3CHFA 3NQEA 1JUEA 1XYZA 1BG4A 3W02A 1FWWA 4N2YA 1UIOA 4LEQA 3AAMA 3L2MA 4ZQRA 4K7VA 3FY1A 1YNPA 1VFLA 2J9XA 4C1LA 3S42A 1TR9A 1C9WA 3HU7A 2ZUNA 1C29A 3CUZA 3LRLA 4EANA 2ZRZA 4GH3A 3CQHA 2WAGA 5D03A 1JD9A 2Y24A 1VJZA 1MNZA 3UETA 1ME9A 1E0WA 4YN5A 4NZCA 2C13A 3SCTA 5F4XA 1Q66A 4V28A 3VIJA 2W27A 2DZXA 1W9XA 4JQ4A 2GDVA 1RQEA 1XIDA 1FHLA 1RP8A 5BXTA 1S39A 3W1TA 3NM3A 3E6EA 3ELFA 1F4AA 4W85A 3PZOA 4PE8A 4U2YA 3TMLA 1QK0A 5K3VA 1IGWA 4HZMA 3GFZA 2XVPA 3G1VA 4KWSA 2OOGA 2X1SA 4GQQA 4H19A 1EP2A 3LBMA 1TPH1 4HZ7A 4JTLA 5EMMA 4CD7A 1ZENA 3SEPA 2G5WA 1ODZA 2XVLA 5HUPA 3W07A 4WGHA 4L4PA 4Q33A 5EBUA 2EJ1A 1I2QA 3W7GA 1S38A 3MO4A 3VGEA 1RHCA 3GXDA 3MMDA 4JBRA 4P7LA 1IXQA 4RJEA 3UPWA 2HNEA 1O12A 1P7TB 1O5XA 3BV7A 3GX9A 3H2MA 3N18A 6XIMA 2NZLA 1FCQA 2FTYA 4HCDA 1E6QM 5D38A 2BOGX 3RXZA 4DYKA 2PWUA 4MNJA 1LWJA 3EZ4A 4ERGA 1IE7C 1VP5A 4JPGA 4LF1A 2Z26A 4Q32A 5I3KA 4GIAA 4AQLA 4GH1A 4S1FA 3B9DA 1HO1A 3BJSA 1UZ1A 3GU2A 5EMLA 1R9YA 4LS2A 2DH3A 3O9NA 4HK6A 1JDDA 1B1YA 2VFEA 1BWLA 3PUDA 3NA8A 3T40A 2GUUA 3PG8A 1OFEA 2OQLA 3NQBA 1V3HA 4WSHA 2YXGA 5DCBA 2YFNA 3M41A 4K37A 3WLIA 3S1UA 2IW0A 5I7GA 3PZIA 4YTSA 1Y8BA 3PZQA 1JF5A 1OCNA 4TTGA 2BP1A 3S1WA 3VNYA 4JTDA 3OA3A 2VWTA 2FZ8A 4UQAA 3NGJA 1PTAA 1ZJIA 1N82A 3ARZA 3N19B 3EXSA 1R3VA 3UNDA 3TH6A 4O0KA 3W6YA 3ISIX 1DIOA 3POCA 1GYNA 1PWLA 4NSBA 3LA4A 2Q02A 3KS5A 3NZGA 2BLEA 4O54A 2OSYA 3NG3A 5EMJA 3K46A 3OA5A 3ABOA 4GJJA 1XYBA 3CZJA 4QJ3B 2C15A 3Q65A 1QNRA 2VO5A 7REQB 3L7RA 1QW7A 5DANA 4M1BA 3M0YA 1GVEA 1KM6A 4GHRA 5XINA 4JN8A 2ZZ4A 4MZ8A 4HN4A 4YNGA 3A6OA 5JMUA 1KFJA 3QR1A 4DBSA 2QUVA 1ONRA 2VDHA 4D72A 2FH8A 4A6GA 1X7IA 4TX6A 3WLLA 3SFWA 4AZBA 4IMDA 3RLVA 3VVGA 3GNXA 4ZO7A 1QHPA 1ECEA 3MMUA 3VGFA 3NO1A 4CNPA 3QV7A 1J0YA 2ZIDA 4NL1A 2F6XA 4ERIA 4JQ1A 1XDJA 1UR3M 4XD5A 3ABSA 4RL3A 3BOFA 2PTWA 4A8NA 2YL6A 2E40A 4L9ZA 3I6TA 1OFRA 3QZ6A 3WLRA 3GBEA 4IFRA 5DN1A 3ARQA 2V8ZA 1SGJA 1WO2A 3A22A 3AS3A 4IUGA 3REQB 1XIFA 1V3JA 5CC3A 1SJBA 1GZJA 2WSQA 2ZXDA 1ISZA 3NSMA 2V5CA 4PZVA 4M3PA 3WDJA 1XBYA 2E09A 4AZCA 1SO6A 4KGLA 1H5VA 4F4RA 4C90A 3GZ3A 1US2A 2PI6A 1WQ5A 2PDCA 3REQA 1KBKA 4JYDA 4URIA 3WUFA 3U57A 1K8YA 2CBUA 3VM7A 1HO4A 4AZ7A 3MO7A 3RK8A 4TMCA 3RM4A 2W9MA 1E4NA 3O06A 1M3UA 2QCMA 2QDHA 2Y5SA 3HQPA 1BVZA 2OEMA 5JBDA 3UWEA 1MFUA 1DJYA 1JXKA 4QNWA 1UKSA 1ONEA 1FP9A 3OQEA 2PZ0A 3EWBX 3WH9A 1I75A 1V0NA 3NQCA 4GVHA 1I8JA 2OODA 2ACUA 5LNWA 3U9IA 3DFYA 1VLWA 1E0XA 3PUEA 2WM1A 3TZFA 3QY8A 4NZFA 4V2XA 4JTJA 4UCGA 3H2CA 1QCWA 1TO3A 1T5AA 5C6MA 4O1DA 3VGHA 3T0BA 4FALA 3SUSA 5HMFA 1J2BA 4UTTA 6REQB 1SSDA 5I3DA 2XHYA 1H62A 3UPMA 1EPXA 1S3HA 3PB2A 3EOEA 3SGZA 1XC6A 3H2NA 1FXPA 4MJZA 3HBLA 5EFDA 4N9CA 1MXSA 1Q45A 1KWGA 2Z1KA 4FX8A 3CZKA 3H2AA 1S5NA 1UP0A 2GJLA 1QPKA 2BGQA 4XKYB 4HSNA 2DT2A 1OYCA 2VR2A 4PTWA 5EMYA 1VCFA 1HVQA 4HCLA 2OGJA 2GJNA 2P3EA 5DMMA 4A3YA 3VNKA 3QHNA 5C70A 4C6KA 2Z2BA 2NQ5A 1JCYA 1R2SA 3TUUA 2EPNA 4GNJA 3PTDA 3EPOA 3TJIA 5FESA 2QDEA 1A4LA 1V02A 3HFYA 3T8QA 3AISA 1UR9A 3DFOA 1OD0A 5LHFA 3LDVA 4UOJA 2ZICA 3NO3A 2GGEA 4FXFA 1IZJA 3NZ1A 2IKGA 1EIBA 2BHZA 2TAAA 3DDMA 3BOXA 1ZY9A 5C2GA 3GUWA 2E5BA 2BVDA 3MV01 3PZ9A 4PUWA 5LIUX 1V6WA 3GG0A 1NFBA 3H6OA 3GLCA 2P88A 4O16A 4CEUC 2PA6A 3XISA 5I03A 5IRPA 4ZOBA 3WQWA 5A94A 2YDSA 3CASA 2IQTA 3IGSA 2QAFA 2V63A 1K1DA 3SUWA 5DF0A 2XFYA 3SFKA 1KXQA 4UWMA 1SR0A 3U5UA 1A49A 1KCXA 2HXUA 1U5VA 1OM0A 3PB0A 4Y8EA 2FZMA 1LORA 3AIRA 3FDKA 2D2GA 4TU1A 3TW9A 1DWIM 3CGTA 3N12A 4W8BA 1BHGA 1FP8A 1C8YA 5J8LA 1VJIA 1SMAA 1GOKA 4GNKB 3H8AA 3TTOA 2NUWA 1RPXA 5E9AA 3P8JA 7TIMA 1MFVA 1K3UA 1SO4A 3G5EA 2V2HA 3WNPA 1D3CA 4KEMA 3G3DA 4FP1A 2VENA 3WO8A 2VCCA 5DY3A 4OE7A 4PBFA 3C61A 2ONEA 2Y6ZA 3S9ZA 1ICSA 5BOEA 4E2VA 3CPRA 4OBRA 3F2BA 3U2OA 1R3RA 3WJXA 3QOMA 4F0SA 1YYAA 4GZ7A 2PDIA 4IISA 2X0SA 5U4NA 1ZHAA 4MKNA 2NQLA 1K4HA 1UP3A 3MJYA 2ALRA 1TTIA 1ZJAA 1B54A 1LQ0A 1RJPA 5KETA 1EC8A 1TQJA 1FWFC 4WHBA 2VFIA 4IIHA 1K9FA 4UTIA 1CGTA 1KV5A 2CZFA 1Q6FA 4LS0A 1QWGA 1DYSA 2E8ZA 4Q4OA 3LGGA 3GRIA 4W86A 3W23A 3GNPA 1SYTA 2HBVA 2KX9A 5J5DA 2DSWA 5K4XA 4NRRA 3N2TA 3L9CA 1BPLB 1DXFA 3M0KA 3DHFA 4NG3A 2J9ZA 3N34A 1A47A 3FDGA 4EAMA 1EXBA 3PPCA 3B0YA 3N04A 4BZYA 2V2DA 4WEVX 3W70A 3DI1A 1E9ZB 1CCWB 4MKVA 2WHJA 4DWSC 4R9XA 3WG6A 4I7UA 1WBJA 3FYOA 1WKYA 1JZ5A 4RZBA 1KCKA 4ZO9A 2VGIA 2VM8A 2CLHA 3IJ7A 1VPXA 3GXTA 5D2TA 1VBRA 3S9YA 3A5VA 4QRNA 4IL2A 3W7DA 3H4WA 4I7VA 3CMJA 3NZPA 3APGA 4C6OA 3EEGA 5FF4A 3RG6A 4E3VA 5D9NA 1BFNA 6TAAA 3QPYA 1ZB5A 1F6PA 4US6A 1YBQB 3BJFA 3UERA 4R85A 1KFLA 2R1KA 4IJRA 1Q5MA 4JL1A 2VJXA 2E6FA 1E1CB 3DFNA 3MP4A 4AYGA 2QF8A 3VD7A 1JCXA 1O60A 3LCLA 3U6WA 3IJ9A 7CGTA 1VH7A 1DQXA 1NWTA 2EJAA 5BU9A 2ZFAA 3R0DA 2JKAA 1TPDA 3LHYA 3UWWA 4NYUA 3HGOA 5AOUA 4KKXA 2FZNA 2VRJA 4QCEA 3BSGA 2ESCA 1WP6A 1Q6DA 1NAL1 1EA0A 1V3LA 4LWWA 2VP8A 3EKGA 3L4ZA 4V1YA 5I6SA 4Q8PA 1VFOA 4IPJA 3O2LA 4B90A 6ENLA 5A1AA 4GXMA 3QFEA 1P6WA 4O57A 3TVAA 3W72A 3KS6A 1EZWA 3PFMA 4X2PA 5D30A 4QEEA 5E93A 1KGWA 3TROA 1H51A 1LP6A 3QBUA 4GACA 2REQA 6ALDA 5TQLA 4DO5A 3BGJA 4H6RA 4DQWA 4AZIA 3AU6A 3PBYA 1E6NA 2DUZA 4ZR8A 5MF5A 1NQ6A 4J5NA 5AHNA 3ANUA 1WE5A 1YKWA 2CWXA 2OWWA 5K4ZA 2PDKA 3VABA 1YEYA 3CB8A 4LBUA 1FY6A 2XSBA 3OYXA 1YMYA 2WCSA 2X05A 3LN3A 1HJXA 2ZX6A 3LBOA 3T81A 4R7JA 5LKYA 4WCJA 2HVNA 4OWGA 2VKZG 3K8MA 2OKTA 9XIMA 4CEXC 3LPPA 4Q8WA 3CEUA 2O9RA 4L4LA 4CU8A 4AUBA 2YBTA 2O7QA 1KLYA 1IEVA 4MSSA 5CSSA 1OX5A 1XCWA 5H8PA 2JIWA 3BGAA 4K8HA 2YYUA 3T1GA 3TYBA 1XM3A 2POTA 3PY2A 1A5BA 1DIKA 1O95A 2PMQA 2HPIA 1ITXA 1E6ZA 4F2TA 2H90A 3SB0A 2GQ3A 1KXHA 3NQ2A 4J27A 1J93A 3USZA 3WEMA 2BS9A 4IZGA 3ZJ6A 2QCGA 2D69A 3B9OA 1RK5A 2PWDA 1FH8A 2ZUWA 1I60A 1V6XA 1NDZA 4B5NA 3OO2A 1A0EA 4QM1A 2GGGA 3OBKA 1K03A 4JQ3A 3QGKC 2BGNE 1E6SM 4OGZA 4BY3A 4IMFA 4HYWA 1YLVA 1Z7AA 3OHMB 2ATSA 3F4WA 2DV0A 4H7ZA 4I9TA 3L5AA 5B80A 1QASA 4MZ1A 4JTEA 3I68A 3B9NA 5DY2A 1NP2A 1GVRA 3GQYA 3LD5A 5CGMA 3V35A 3L23A 3LU2A 2Z27A 1W1B1 3M0JA 4WOQA 2ATMA 3S2JA 3MKCA 1TG7A 3ICJA 1CLKA 1T8XA 5C55A 1OFAA 4OU1A 1OX4B 3NURA 4JTGA 2ZC8A 3T4WA 2OR2A 2XIJA 5I09A 3HMCA 1HXJA 4JDBA 1ZALA 5BNKA 3EX3A 1EB3A 4B5SA 4MDOA 3WN6A 3PBVA 1TYGA 2AGKA 4B5XA 4UNLA 1FDYA 4HU0A 4UQ9A 1LBMA 1CLVA 3HB9A 1E15A 2E5CA 4GJ1A 4MZYA 1V3IA 2Q3OA 2PPGA 4O12A 3SRDA 4JGDA 5CEWA 1Q65A 2PD5A 1JDEA 3EKZA 4H3DA 1OC6A 4ZCWA 3BC9A 4YYFA 2XINA 2YBVA 4K1WA 1NOFA 1WDQA 3IJLA 1R3QA 4O50A 3W87A 3STPA 5DXXA 3TAOA 2AL2A 3VIOA 4AXKA 1UKQA 2V67A 4GQGA 4NNBA 3M0LA 3RLGA 3CBWA 3PSVA 1KXTA 1OK6A 4GYPC 2GFTA 2POZA 1TWDA 1I6NA 4IP7A 1F6YA 2Z7GA 3CYJA 1SR9A 3WQDA 3IIPA 5I00A 5CPSA 2NSOA 3ITXA 4NILA 2YZRA 4L9YA 1MXDA 3ARUA 3Q45A 1QNVA 2VR5A 1A3WA 3M5ZA 1TCDA 4LB4A 4P8UA 1NH6A 1QRQA 3L4VA 4C6BA 3H53A 4JEQA 1M7OA 4IICA 1JPKA 4H9VA 1YE6A 4HTBA 4R9OA 3OB8A 3VNDA 4WLCA 2WJEA 3KWSA 1NEYA 3SECA 3PF3A 3PZNA 3JUGA 1V5XA 2GWGA 3R2GA 1EQCA 3WF4A 1WZAA 1KQZA 4ML9A 1QNPA 4ZOAA 4I7WA 4ZXLA 3S46A 3W0KA 1B3VA 1LYXA 2F6KA 4XIMA 3VC5A 3TDFA 2QMJA 2VEPA 1XIEA 5FJUA 2QCNA 3QHMA 2BTMA 3ZWTA 4Q8UA 3OPSA 3RPMA 3GXFA 4U5KA 3RN6A 4WXYA 3HG5A 1Q63A 2A2IA 3LERA 1UC5A 5EKYA 4BR1A 2O9PA 5FJTA 3BICA 3VINA 1QAPA 3IUIA 5KINA 1RSCA 3NQFA 1Z8AA 2XVGA 1UJPA 4UMBA 3ZLHA 1EEXA 4NX5A 3BUVA 1MZHA 2DT0A 1UBSA 2DH2A 5KSWA 2X0HA 4TMBA 3S2LA 2JBMA 3EA1A 4O13A 5CZSA 4PMXA 2VZUA 3BG5A 1NWSA 5F1VA 4WY0F 4NU7A 3NQMA 2I14A 1RR2A 1WKDA 3KVJA 4ORIA 5I77A 2GSJA 1R3YA 2Z1BA 2Y8UA 1TMLA 2YCIX 3JW7A 3AMDA 1JCMP 1NVMA 5LA2A 3B8DA 1QHZA 1AJ0A 3CUFA 1KRMA 1VHCA 4C6IA 1HVXA 5I3GA 2ZYFA 4X9SA 3GWQA 4D6DA 1XD1A 3QSRA 5M5DA 4TX9A 2GYIA 5LIWX 3GAKA 2OVLA 2J79A 1HGWA 1VLIA 3K4AA 2AMGA 3W2UA 1RUSA 3VGDA 4Z2LA 2QGYA 4WDWA 2PCEA 4IIDA 3AI0A 4JZ5A 2YA0A 4D71A 3WUGA 4RLIA 1FHUA 3MSGA 1Z6KA 4BI7A 2CW6A 4D6EA 1AODA 3WBXA 2RJHA 1P0DA 3VFLA 1S5WA 5K2ZA 2HQAA 3DZ1A 3VC6A 4MUZA 2NT1A 1W3HA 1IGSA 3AZSA 3OOQA 3BWWA 4W7VA 1W1ZA 4TV6A 4P7RA 4B5VA 4BWLA 1QNQA 2ZKMX 4ZB2A 3UESA 2FJKA 3BSHA 1A50A 3OVGA 3QV9A 5EFFA 2QW5A 4C6FA 2A3CA 3DKLA 1VFMA 4GCAA 4PL2A 3TTSA 4PBEA 1XXXA 4MPKA 4BQ5A 2DT1A 2C16A 3VUPA 4JFVA 1P6BA 4UTLA 3TSBA 1GG0A 3AWOA 1C92A 3VU2A 3C52A 3O07A 3PTKA 5BYWA 1E40A 3WLSA 2EPKX 3UW6A 1UW9A 2PU0A 4BJHA 1TIMA 1JR1A 3ZFHA 2NX3A 4AIOA 1HKWA 2GSHA 3LY0A 2AQWA 4L1XA 1UWTA 1PO9A 4J3ZA 2PRMA 4NASA 1LL4A 3E96A 1GVYA 5C0QA 3WX7A 5A6AA 1TTPA 5F4SA 2Y2WA 2NW0A 2IPGA 4G6CA 3FS2A 3LLFA 3EWXA 4A8RA 3BMWA 3E2QA 3M16A 5DX7A 2GL5A 4TO8A 3TR2A 4KS0A 4NAEB 2ZUVA 3MDUA 4DZHA 2QPSA 5T91A 3MB9A 3AYTA 3SRHA 1H11A 4G2DA 4LRSA 3W1PA 1OFQA 2ZUMA 1C8XA 5F4WA 3HURA 3KOZA 2DZVA 3UT0A 2PLJA 3NPUA 3WLTA 4FXRA 4OJYA 2O55A 2VURA 3CQJA 1MWOA 3VM5A 3A12A 1UR4A 3P7YA 4PMOA 5I2UA 3HG2A 1S5TA 5D9OA 7ODCA 5EGRA 5I3JA 4HJFA 1QI2A 1KM0A 4NVTA 2P0IA 4KQNA 1D7KA 3WDHA 5A6BA 3E38A 1V02E 3QMSA 3IK2A 3OYZA 4AD2A 3RPDA 3TQPA 1TUXA 3FJNA 2YYTA 3URNA 2OO0A 2FMOA 1LDCA 4JKMA 4LAMA 1OZMA 3N4AA 4QR6A 3M0IA 4J35A 3MSYA 3RYSA