2CLOA

Tryptophan synthase (external aldimine state) in complex with (naphthalene-2'-sulfonyl)-2-amino-1-ethylphosphate (f19)
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
266
structure length
257
Chain Sequence
b'ERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRSGVTGHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPTOPHAN SYNTHASE ALPHA CHAIN
molecule tags Lyase
source organism Salmonella typhimurium
publication title Allosteric Regulation of Substrate Channeling in Tryptophan Synthase: Modulation of the L-Serine Reaction in Stage I of the Beta-Reaction by Alpha-Site Ligands.
pubmed doi rcsb
total genus 102
structure length 257
sequence length 266
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2006-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2cloA00
3LLFA 4FNTA 2PC4A 5F2GA 3M1ZA 5AOUA 4UMBA 2C19A 1VCGA 2QCDB 3I7RA 1W3TA 3DGRA 2Q8ZA 3S1XA 2CLKA 1YTDA 3BG5A 4LS0A 4HN4A 1CI1A 2HS6A 2ISSA 4Y9AA 2NWSA 4N4PA 1LRTA 3DHFA 3W85A 4XTDA 5BMXA 2XN1A 4L4LA 1L6YA 3P61A 4MVAA 4O1DA 2VFIA 2Z6IA 4UNKA 1GTHA 2CZEA 1EP3A 3NQMA 4CNOA 4UCGA 1WQ5A 5G2WA 3M0ZA 3U6WA 1T0OA 5I3HA 3I6RA 3LCXA 2QDGA 5BNKA 4BWLC 1G4SA 1RR2A 1JRCA 4HT3A 4IMEA 2CLFA 3N14A 4UR8A 5D04C 2BXVA 4N9CA 1DORA 4UIOA 3SZ8A 4JX4A 2PRLA 2X1SA 3QRHA 2G96A 3LTYA 3UXAA 5U7SA 3GK0A 1A5AA 3UNDA 4HPJA 3MJYA 2HTMA 4JX6A 5K4ZA 1O95A 3NPUA 3LDVA 4WJEA 4DO5A 1UASA 1KFBA 4JS3A 3KX6A 4FIRA 5CKSA 3Q58A 2A6NA 2ABBA 4LC6A 5LGZA 1H7XA 3GDKA 4Z08A 1XL9A 1O60A 5E0KA 1ZFJA 2FTPA 1K7XA 1XI3A 3LCGA 5I3KA 4K37A 2VXNA 3TH6A 3VKJA 3P8IA 5D2YA 1LORA 2H8XA 3P67A 2XN2A 4LC8A 4TMBA 4QM1A 3NGJA 1RQEA 3EEGA 3W2NA 3FKKA 5DBTA 3WK0A 3M5XA 4WUIA 5K7JA 3HQ1A 1ADOA 1N8FA 4O13A 2ZCGA 3O6CA 3I7SA 2WSYA 3NR0A 4O8RA 3HG3A 3GR8A 2TPSA 1PVNA 1L6WA 5LNUA 2PURA 2NX9A 4ZVJA 4ADUA 1H61A 3WFAA 1JRBA 1KA9F 3M5ZA 1G7UA 4J9JA 4LUIA 1FCBA 1YYAA 1EWEA 1QPOA 3E9AA 1LBMA 2ZRUA 3C61A 3IIXA 3TE9A 1Z42A 1QCWA 1W3IA 3VE7A 1Q6LA 3NQ6A 1OJXA 1TV5A 1OFDA 3PY2A 4H3DA 4OU1A 3VNDA 2FJKA 1BWKA 3SW6A 5D33A 2ZTKA 5J5RA 3HG2A 3RFAA 3PF3A 1F5ZA 3NQAA 2VFGA 4YMZA 3BG9A 5FI8A 4CQ9A 2P1FA 1Q6OA 2CZDA 3VFLA 3EX6A 3TDFA 4X9SA 3W75A 3GNDA 1SSDA 3R13A 3QMSA 4AHQA 4HPXA 4ZQNA 3U8GA 2FLIA 3FYPA 2JBMA 3DKLA 1TMHA 3NQ7A 3ABQA 1H1YA 2PRHA 3CLMA 5A5WA 2CWNA 3PAJA 2X1UA 4QQ3A 1MEWA 1MSSA 3C2RA 5DN1A 4X2RA 1S3HA 5C54A 2CLIA 3WJZA 4FO4A 3FIGA 2WO5A 1JCLA 2GQ9A 1W5PA 5G5IA 1DOSA 1QNVA 2QUVA 5H2ZA 2TMDA 3SI9A 2Z1BA 3GNNA 1EIXA 3WJXA 3PWAA 1RVGA 5L6UA 4R34A 1LZOA 1OF6A 5I3GA 4O17A 1G7VA 1A50A 2WKJA 3KVJA 3W84A 1PCWA 5HR7A 4JYFA 4B5NA 3PUOA 1A53A 1MEHA 3NDOA 3NZ1A 1FBAA 1TCDA 1WAUA 3EXTA 3W7JA 5HJLA 2C15A 4O4WA 2BWGA 2E6FA 1VH7A 3MHGA 5MHBA 1PIIA 2YCEA 1C29A 2B7QA 4ZMGA 3S9YA 1QMLA 3HGRA 3LTSA 5D37A 5AC6A 5TIMA 1R2RA 3KVKA 5F4WA 1ML1A 1D9EA 1VC4A 3A5FA 1TPB1 2QKFA 4MYXA 4YWIA 3S6DA 4QIUA 3C2VA 3VE9A 1YXDA 5AYZA 1VQTA 4FEZA 1TTJA 1WA3A 4AWUA 3ZR4A 4BWLA 3DENA 4HNTA 1PHWA 3EWBX 3LBMA 4WD0A 2BZNA 4NJGA 2J6XA 4EIVA 3F4NA 2A6LA 2DZSA 4FNUA 2XFWA 4FIQA 4JY9A 4NX0A 1ZCOA 3UWVA 2JGQA 1AL7A 3G1HA 3M6YA 2ZQ0A 4WY0A 1VLIA 4N9BA 4L4MA 1FQ0A 3TFCA 2RDUA 1G67A 1YPFA 1I2QA 2YYUA 2A85A 4IJBA 3ZWSA 1LLWA 1X1ZA 3PC0A 3UY8A 3W23A 2V82A 3G22A 3B8DA 1LRNA 1W5QA 1W5NA 3ABSA 3C3NA 2P10A 3W83A 4LW7A 1A5SA 3W1RA 4P2VA 1H60A 1GVQA 3KRUA 4DBEA 2BTMA 3HPSA 1WX0A 1J4EA 3KFTA 3TKFA 5CZSA 3TQVA 1GVSA 1Q3NA 4BFAA 3MW7A 2HS8A 5G1YA 2JGYA 4CNPA 4LU0A 4M19A 5CZ0A 3NEVA 4N9DA 5AYYA 2C3ZA 1R47A 3NM1A 1R2TA 1U5JA 2ZDRA 2KZHA 4QJ1A 4GUHA 3YPIA 3CIXA 3QM3A 1GZGA 1RZMA 2DORA 5D09A 5AC7A 1H7OA 4N2YA 4Z1DA 3EKZA 1MO0A 3CU2A 3B03A 1G4EA 1OYBA 4IOTA 4CQ8A 1GWJA 4P61A 4JTIA 4PA8A 8TIMA 5FF7A 4IPIA 3CEUA 3STGA 4O57A 1PS9A 2V30A 1VZWA 3PULA 3BV4A 3L0NA 4ORMA 2A7PA 4Y8FA 4CCCA 3V1PA 2WSQA 3NAVA 4JTUA 5BMWA 1P0KA 3LHWA 4XBSA 2FPYA 5D32A 1BKSA 2YX0A 3B4UA 3OVPA 3QW3A 2OCZA 3W1MA 1VHCA 2ZA1A 3OVQA 2OMAA 3CB8A 2VFDA 1YPIA 2Y89A 3NXFA 3R8RA 1KV5A 2NXGA 3LHVA 4NXKA 3MYOA 4LT9A 1KM4A 1AW2A 1KFJA 4NJKA 1KFKA 5TBOA 1TTPA 4JTSA 4HSNA 4PTNA 1GEQA 4EWND 3NNTA 1TIMA 1SO4A 1TO3A 3HMJG 1VPXA 1F6PA 4MPQA 3FEMA 4Q32A 1KTNA 1D3GA 5H91A 3W70A 3L21A 2Q3OA 2UV8G 4JTLA 1P1XA 5F4SA 2XN0A 2X1RA 5FESA 4NJJA 4CLMA 3W7MA 2ZRWA 2BX7A 1HL2A 3GAKA 5D38A 3C2FA 2VFFA 2RHGA 5FEXA 1W5MA 2ZZ6A 3P80A 4JN6A 1F2JA 1OYAA 4OQVA 1G4PA 2ISWA 4IUOA 1IIGA 2O7QA 1JR1A 5DBUA 2VENA 1TSIA 4M5PA 4ORIA 4JTTA 1AW1A 2WOQA 4O16A 4LVBA 1O5XA 3UXDA 1C9DA 4FX6M 3SIZA 3FFSA 5I3JA 2E6AA 4ZQMA 4W9TA 5F4XA 1IXQA 3ZS4A 1UUOA 5G2HA 3C52A 1G4TA 1DQXA 3P5YA 5EBUA 3GKAA 2WNZA 4UFKA 3HPZA 3QQ1A 5C55A 3PG9A 3W2LA 3RU6A 1WBJA 3PB2A 3Q94A 3W7EA 3S5NA 1KFLA 3QW4B 4JTFA 3MMTA 1Y0EA 3EX4A 4I7UA 1SO5A 4I7WA 3EKLA 1M5WA 2A4AA 3PSWA 4O4VA 3TW6A 2FPTA 3NZRA 2ABAA 4OWGA 3NYZA 3W1TA 5LNRA 2YW3A 2NUWA 4EF9A 3H55A 1ZHAA 1VCVA 4AHPA 3GDMA 4O0KA 4WXYA 3NQ2A 3IVTA 3SECA 3W76A 3DHDA 4FXRA 2C6QA 3O16A 4CQAA 4HNVA 5ABTA 3Q37A 4NQ1A 1K03A 2NWRA 1M7PA 1SZEA 1NVMA 4JIQA 3IEBA 4YL2A 2NX3A 5K2ZA 1B3OA 2VEPA 3B0VC 1WYIA 4HNUA 2VEKA 3STEA 4LTSA 4RXFA 3IVUA 2ZZ2A 4POCA 4YLWA 1Q6RA 1TB3A 4KKXA 1JJKA 1QO5A 4UFJA 4AHOA 3T4CA 1DKWA 3NL2A 1FXPA 1TV7A 2PRMA 4UMCA 2E09A 4JYEA 3G8RA 5BOOA 4LVGA 1WBHA 1FDJA 3EX2A 4IMCA 3VI2A 3G1YA 4O28A 3P62A 3W22A 1H7WA 4EOUA 2W0UA 1EP1A 1H50A 2BLEA 3CIWA 3IGXA 5KSWA 4AWTA 3PG8A 2Y88A 4LUJA 3CWOX 3BK0A 3W86A 2Q8LA 4PC8A 4MY9A 3ABOA 1EEPA 3M16A 4S2BA 1N7KA 3MWAA 5LKYA 4RJEA 5CZJA 2EAWA 4HHPA 1JVNA 1T8XA 4K8HA 5D2VA 5IBXC 1H5YA 2ZRYA 1LDCA 2YW4A 4BK9A 3B06A 2Y70A 1SZNA 2ZZ4A 3HGJA 1QOPA 1FWSA 1EUAA 3EXSA 5EA9A 4RXGA 1FCUA 1OK4A 4O50A 2J9YA 1TPUA 1GG0A 3LI0A 2VEIA 3N9RA 3STFA 2Y6ZA 2X2GA 1AW5A 3MBFA 2LLEA 4IX2A 4UTKA 2VFEA 3EWZA 4M6PA 4NX5A 3DFSA 4UR7A 5D03A 2GVLA 4IQLA 4RCXA 3P84A 3EWUA 3FKRA 4AXKA 3QH2A 1TREA 4JIPA 4TO8A 3EWXA 1DBTA 4ML9A 3W7QA 4DF0A 4DO6A 1K02A 4TR9A 3BGJA 3PBYA 2TYSA 5D2WA 3MI3A 4NNCA 4AVFA 3PVFA 5C6MA 4LVFA 1I4NA 3W7LA 4NU7A 1JCXA 3CPRA 4H6KA 5I3FA 3W7NA 3T7VA 4HIBA 4UTTC 3NQ8A 1VLWA 5LSMA 1QPRA 1TYGA 1S5TA 4JY8A 5DY3A 1X6UA 4OHQA 2NV1A 3HG4A 1U83A 1M6JA 4JNMA 2FDSA 2YYTA 3C6CA 1VR6A 4A21A 3LERA 3LTPA 3GDTA 3S5ZA 2ZFAA 3NL6A 3LB0A 3FJLA 2VC6A 4U4MA 1UJPA 3CC1A 3N2MA 3UZJA 1F7BA 1ME8A 3LRMA 1B9BA 1XUUA 4CCEA 3LI1A 1K8ZA 2E5BA 4LNYA 1SU5A 1OHLA 4ZQPA 4WY0B 4O18A 5DY2A 3HO8A 1JQVA 1LROA 3MP5A 2CLEA 3O15A 3DZ1A 2X30A 5EMUA 1GVOA 2EPHA 2WV8A 2DZXA 4KFNA 3W1QA 1J5TA 3M5YA 5D2TA 3TMLA 1VYPX 4JTKA 1SFLA 1GT8A 4RKAA 1WOBA 1SFJA 1P5BA 1TPVA 5IM51 1G6CA 1XKYA 2O7SA 1H1ZA 2F84A 3PR2A 1EA0A 3GR7A 5F2LA 3JS3A 7TIMA 3NM3A 3S42A 3W2UA 3F1QA 4NUWA 4LY8A 4UTTA 3MP3A 4FNQA 1IXNA 4FB7A 2H3DA 3MP4A 3L67A 1SW0A 3W72A 1RQBA 2H90A 1HO1A 3TCEA 5KZEA 4DEFA 1VJIA 4O54A 3LCHA 3W7CA 3E02A 5AHEA 2CFFA 5EY5A 4E0CA 3NO5A 2VFHA 1I2OA 3LXAA 5A8GA 3SY5A 4OV4A 1KW1A 3W1PA 4FXSA 5LGXA 6TIMA 2RKXA 4U28A 1FUYA 3PB0A 2AQWA 4RX0A 1EPXA 2QCLA 3MYPA 3G24A 5U4NA 4YCOA 3OVRA 2E77A 1LOQA 1ZAIA 4NJIA 1JULA 1F74A 4GBUA 3AO0A 3CTLA 3PS7A 2TRSA 1Q6QA 3G1XA 3ZWTA 1O94A 3LCWA 1D3HA 2QR6A 3N73A 2E5DA 3JR2A 4AAJA 1S5WA 4JDYA 4A3UA 1ICSA 5D05A 1K7EA 4JICA 4OGZA 3O6DA 2DZTA 1NSJA 4AB4A 5LHEA 2H3BA 1A5CA 1OVDA 3DAQA 2DZWA 3WK3A 3L5LA 1V7YA 5HUPA 4Z1AA 4TMCA 1SR9A 5FF2A 3RLUA 1WDWA 3BW3A 4Y6GA 1KM5A 5DLCA 3PBUA 3TROA 1F76A 4N6FA 3M5VA 5I3IA 5FEZA 1TPWA 2GJLA 1LM1A 3ABRA 2HSAA 3ATZA 3W7DA 4EF8A 1GYNA 3W87A 5C2XA 4DXVA 4UFIA 1NFBA 3WJWA 4O19A 3T55A 5K3VA 2JKAA 1TJPA 4RK8A 3G3MA 1RQHA 3DFOA 4Z0SA 3M41A 1TPEA 1WOAA 3BVJA 4OE7A 3BARA 1GPWA 3UWWA 4I7VA 1F6KA 3N3MA 4MLJA 4PODA 1BWLA 1OF8A 2AGKA 4NNAA 1O4UA 3PBWA 4WOZA 1I45A 1TQJA 3V75A 3T78A 2ZRVA 1X8FA 1ALDA 4OT7A 6ALDA 3LCLA 3C8FA 1KM0A 4Q33A 1TPDA 4LVDA 1JCNA 3GB6A 3EB2A 1KTCA 3TSDA 3IIOA 1VRDA 5CSSA 1OFBA 2YR1A 4E38A 3WK2A 3ATYA 1QFEA 3KAOA 3KRZA 4BR1A 4ZQOA 3GLCA 3TSMA 2QCHA 1OX4A 3QJAA 2G97A 1H51A 5FF3A 2PCQA 2E6DA 2Z6JA 5HQEA 3TAOA 3W74A 3NQEA 3LHUA 1ICQA 2QJHA 3H54A 1S5VA 3EWWA 3UWYA 3G1SA 5DCDA 3CQ0A 1JCJA 1I2PA 4ICNA 4PCFA 4JTGA 3P81A 1AMKA 4WY0F 1W8SA 2ZZ5A 4XTIA 3HG5A 5HR6A 2NUXA 2JKPA 3QPYA 3DU0A 3WJYA 1YXYA 5AYXA 2OJPA 3LGEA 2Y62A 3L5AA 2B7OA 4PEKA 4GRSA 2V5LA 4RV8A 5K9DA 4MZYA 4UFLA 1V5XA 2QUTA 5AFDA 2ISVA 4Z1CA 3UWZA 5K9CA 3W2JA 4X22A 3W1UA 4UTHA 3W1LA 2CLMA 3OBKA 4JDBA 4Y96A 2EGZA 4I9AA 4AF0A 3S1UA 2WNQA 3M43A 3KVLA 3PM6A 3IGUA 2V2DA 1IF2A 3W7RA 3C4UA 5KTLA 3G18A 3A24A 4LS2A 1ICPA 2FFCA 2QUUA 1SSGA 4IXXA 4K8EA 2YXGA 3OA3A 1JUEA 3MHUA 1FX6A 1YDOA 3TR2A 4WXZA 4M7TA 4UTLA 2B4GA 5K9XA 3E49A 2QEZA 1OFAA 4XZ9A 4K36A 1HO4A 1KM6A 5GVJA 1DJQA 4IMGA 4KWWA 3UYCA 1SZFA 4N02A 2CZ5A 1UBSA 5G1TA 2C16A 1QWGA 4BI5A 3NG3A 1I2NA 2FB3A 1M7OA 3GIYA 3TW7A 4JEQA 1GG1A 2A1YA 4K38A 2GQ8A 1OG0A 3BLIA 4JXCA 2QF7A 4EVZA 2ZA3A 1TV8A 4M7SA 1HTIA 1SO6A 4GXMA 2NXIA 2QJGA 1NAL1 4NZJA 2V81A 5AC8A 4MY1A 1KM3A 4M6VA 1W37A 3LXCA 1QO2A 4KWVA 1XBVA 3PBVA 1JUBA 1RPXA 4IWWA 3P5ZA 4HSOA 4MOZA 2ZBTA 2GOUA 1OX5A 5EL1A 2R14A 3L68A 4UUIA 3W7IA 3HF3A 3M47A 3NOEA 1UUMA 1KLYA 1XBXA 3KRSA 4JR5A 4HKPA 5G4WA 2DZPA 1OFOA 2A7RA 1JUKA 3GXTA 3NL3A 3TQ0A 2B0MA 3QMRA 1FXQA 3MHFA 5DCBA 4O0ZA 3HPXA 1ZALA 3QF0A 4A22A 3TJLA 4OV9A 2OT1A 3LV5A 1G69A 5AHLA 4H4IA 4ZQRA 3G0XA 3B0PA 1W56A 4IPJA 1X7FA 1H7NA 2F7FA 3R12A 1LTDA 3FOKA 4JD4A 4MFDA 1VGAA 2ALDA 4IMFA 1KFCA 3LV6A 4JTEA 2EF9A 5DXXA 1Z41A 1QPNA 3NPWA 3FJ6A 2A0NA 3BW2A 4K7VA 5KINA 1SPQA 2FIQA 3TA6A 3W88A 3FYOA 3TAKA 2V2HA 4MUZA 1H63A 2V8ZA 2NXHA 4LV4A 3LHTA 1KLZA 3NL5A 2W79A 1DVJA 2NZLA 5CZTA 1SW3A 3EWYA 5FEWA 3GXNA 3NQGA 3L0KA 3NVTA 2ZYFA 1P4CA 3SR7A 3PUEA 4FF7A 4MJMA 1ZJIA 3GKFA 4MLRA 4O14A 3P74A 1H7RA 3ANYA 2EHHA 2NX1A 3QYQA 2DJLA 2G5WA 3D0CA 2ATSA 1QR7A 2QCMA 3EXRA 2WJZA 1PE1A 2C18A 4TIMA 2QCDA 3UPBA 2QCCA 3BGGA 3QSRA 3QQ0A 2GQAA 3UWUA 1W0MA 3CT7A 1XCFA 4PFMA 4PL1A 4UTJA 1TRIA 4RZ5A 1XDMA 3USBA 1IIHA 3GZ3A 2FQIA 3AJXA 4HNNA 2CLHA 1XXXA 1OFEA 3WK1A 2E6YA 1FWRA 1P0NA 2Y63A 4O10A 5K4XA 1B4KA 2Y7EA 2VELA 3LX9A 2NLIA 4YCPA 1Z44A 3LBCA 2FB2A 2QCGA 1O5KA 1UCWA 3OEXA 5FF4A 1TQXA 4KFPA 3C2EA 4NT0A 2A2IA 1I2RA 4AEOA 2QCFA 1AL8A 3I68A 1FCQA 2P0OA 2G95A 1H7PA 2QCEA 3BG3A 2ZZ7A 4QNWA 2C1HA 3SFKA 4ZQCA 4ZZ9A 4MY8A 4WOQA 3A23A 5DELA 3W71A 2E1DA 4GC4A 3GVGA 4ADTA 4K39A 2X1TA 1GJPA 3DBPA 2GPTA 4JYDA 5C5YA 3TXZA 4UXDA 1A5BA 2RDTA 4ZL1A 1NF0A 3M9YA 4FX7A 1TJRA 2QAFA 1CW2A 2Y7GA 1TRDA 1HUVA 3RK8A 2IQTA 4Q4KA 4FX8A 1R46A 1XUZA 4K7YA 2J9XA 3BPWA 4GUGA 4LOCA 3P7YA 1KBIA 1KV8A 2YFOA 4BF9A 1C8VA 3N34A 4K6AA 2DP3A 3CWNA 2GUUA 3VCRA 3DH7A 4GWEA 1SW7A 3H53A 2EKCA 4A29A 1FDZA 3W2MA 4PH6A 2DJXA 3NQDA 2WSRA 3PUDA 5F2MA 5E93A 4PL2A 4ONVA 5HWNA 5IBXA 3TFXA 3O6YX 1ME9A 4BI6A 3GDLA 5LNVA 2I1OA 3L9CA 5FEPA 3JRKA 3TUUA 5F2IA 1KTBA 1YTEA 4XKYB 1QAPA 1JCYA 1EUNA 3THQA 3L65A 1THFD 4AMAA 3RNDA 3S1WA 3LCFA 2R94A 3O1NA 5HWJA 4A2RA 4NXSA 3M7WA 1L6SA 4QISA 2C13A 1AK5A 3QMTA 2WNNA 1W5OA 2I14A 3QC3A 3T40A 4AWSA 3DXIA 3TNOA 4MZ8A 3LM7A 5BRBA 2R91A 2ZZ3A 1SUXA 1F73A 2W6RA 1OABA 3EX3A 4G1KA 3U2OA 4E2DA 2GVJA 3TIMA 3W07A 2WPBA 4O52A 3GX9A 4QAIA 3BW4A 5EYWA 1YLVA 3SJ3A 2OT0A 1BTMA 3HGSA 4LRSA 2YSWA 3NQCA 3LCIA 4MZ1A 5D30A 3STCA 3B0UX 2GVGA 5CPLA 3OIXA 3A22A 4ALDA 3GXPA 4UC5A 1LBLA 5G2IA 4XWUA 4FNPA 1EWDA 1TPH1 3W73A 4QITA 3GAYA 4IMDA 1SO3A 4NNBA 3RLVA 5LHFA 3CHVA 3R2GA 4TU1A 3PSVA 4R33A 3N9SA 3Q2DA 1SZGA 3T44A 1HFBA 3QEZA 1XM3A 3MI2A 5J5DA 3L0GA 4O53A 2Q3RA 1GVRA 3W7GA 4GUJA 1ZENA 3DKJA 4DO4A 3NQFA 1W3NA 3C0JA 1OFRA 1Q45A 5CPNA 4JGDA 5AHFA 1DL3A 1NF7A 3KHJA 5HMSA 1SQ7A 5BW6A 4XBKA 3UQNA 2BSLA 4AF0B 3THAA 2HMCA 1MXSA 1FY6A 3UY7A 3HGOA 1YDVA 3L2IA 1LOSA 1W1ZA 5AN7A 3RF9A 2JKEA 4WZHA 2A7NA 4UTIA 3MBDA 4LV9A 2QDHA 1OYCA 1T99A 1VYSX 3N19B 2B7NA 4DPQA 5T26A 1YTKA 3LRLA 3CEPA 4A2SA 4RLIA 4JX5A 4QNEA 1K7FA 5HULA 1H62A 3P60A 3DFPA 2Z2UA 5KITA 4Y90A 3TK7A 1L2UA 3L66A 4M6QA 1VCFA 1DJNA 1FDYA 3DFNA 1ZAHA 4X3ZA 4MFEA 1DHPA 3DFTA 3DFQA 3MUXA 3TC7A 3W7PA 3G0SA 2TSYA 5CGQA 1W54A 3G1AA 5EKYA 1K8XA 3I65A 1EB3A 3NQVA 3F4WA 3M44A 3W6YA 3R5EA 3O05A 4DPPA 1VS1A 3A9IA 5CG7A 3MO7A 3ELFA 1GQNA 4XUGA 3G0UA 2ATMA 4GFSA 2YGYA 1Z48A 3LHZA 5AB3A 3TJXA 3LXBA 1QPQA 4R53A 5LNSA 4O11A 1LYXA 4UFHA 4BI7A 1XFBA 2CW6A 5D2XA 1ZY9A 1OX4B 4IX0A 1I8JA 3ZFHA 3LLDA 1RV8A 1MZHA 3HB9A 3W9ZA 1RD5A 3B05A 5EPDA 3UWQA 1IGSA 3MI6A 3O63A 5F1UA 1QDSA 4UFMA 3W1XA 1OFQA 2X16A 3IRDA 2V9DA 3G3DA 4WQ6A 3SGUA 2Y7DA 3UZ5A 3KXQA 2J88A 1VYRA 3O8AA 3S0CA 2D73A 4O1BA 4MKNA 4RZ6A 4N6EA 4C1LA 1PL9A 3F03K 1MEIA 3G8EA 2WQPA 3DI0A 2ZRXA 3NA8A 2DZVA 3WJSA 3IIVA 3TX9A 1K3UA 2OX1A 1TTIA 1OX6A 2ZA2A 3K30A 1UB3A 2QAPA 4GJ1A 1YXCA 3P82A 4FHAA 3QFEA 5FF0A 3QSTA 5AHIA 1YADA 3OG3A 3W7KA 4LRTA 1DQWA 1LP6A 1KM2A 4MIMA 3E12A 2J24A 4C1KA 1ONRA 2I9EA 1XC4A 2YPIA 1PHQA 2VEMA 1FCVA 3S1VA 1FWNA 2Z0IA 3IIZA 4MJZA 2VKZG 1YDNA 3W1NA 3R89A 1GTEA 4UTWA 2V2CA 1LCOA 2QCNA 2CZFA 2RFGA 5TQLA 1WV2A 2RH9A 3CM4A 4RR4A 1R2SA 5D02A 4UTUA 1B4EA 1LOLA 3DI1A 4LWWA 2QJIA 2NV2A 3A5VA 1J2WA 3W3OA 2V0TA 2H8ZA 3P8JA 2CLOA 2ZZ1A 2JK2A 4GUFA 4CCDA 1TPFA 2V5BA 1QOQA 3QPZA 1TTQA 3EX1A 3I7QA 3GDRA 3IVSA 4TX9A 3GYEA 1EP2A 1LLZA 3QZEA 4QSHA 3UD6A 3W2KA 3O07A 1HG3A 5SWUA 2C0AA 1L9WA 2YZRA 4LS1A 3HIJA 3INPA 4O12A 5CPMA 5E1QA 1LBFA 1JCMP 3S5OA 2R8WA 3IGSA 5DXYA 2AAMA 2E5CA 4E2BA 5CSRA 2J9ZA 4Z0JA 2Y7FA 1KBJA 3BLEA 2CU0A 3KVMA 5HNRA 5HINA 3NPXA 1W31A 1EX5A 3HOJA 2ZTJA 4DQWA 2VOMA 3E96A 3SSJA 2C14A 3G1DA 1IXPA 4FNRA 4NVTA 1ME7A 4O1CA 5F1VA 3W7HA 1R30A 3BO9A 3HBLA 4N9EA 2A5HA 2DU2A 2OZ0A 1PV8A 4IGHA 4D2JA 3UPWA 3RMJA 1NEYA 5AHNA 4GNJA 3NPVA 3TC6A 4GUIA 2ZRZA 3SGZA 3A21A 1CX9A 4DELA 1KFEA 4CNNA 3W1AA 3HJZA 3C56A 2A21A 2B7PA 1GYLA 1AG1O 1LRQA 1OFPA 5L9FA 4DBDA 3LHYA 1OK6A 4UTMA 3O06A 3KOFA 3LRKA 4NJHA 5KZDA 4YXGA 5KZMA 4DF2A 2Y85A 4GE8A 4O15A 4XKYA 2DZUA 4ADSA 5LZLA 4S2CA 4WX2A 2NUYA 3TXVA 1ZAJA 2GJNA 4DF1A 2Y61A 2YFNA 4UNLA 4JTHA 4Z1BA 2FPVA 3TSBA 1XBZA 2RDWA 3TMQA 2E68A 1N55A 3LOTA 4LVAA 1WXJA 3G1VA 4JTJA 4FNSA 3IIPA 1VHNA 4UTWC 3TV8A 4UMAA 3G1FA 5LNWA 4R7JA 5CPOA 4IXHA 5AHMA 3L5MA 3TU9A 2CLLA 4MYAA 3BLFA 4AH7A 2H6RA 1JQXA 1KM1A 4N4QA 4OBTA 3N2XA 1BEUA 3TQKA 1K8YA 1IXOA 4KFOA 3IV3A 2J27A 2PE4A 1T96A 1E51A 1XDLA 4NZFA 2YDAA 1B57A 1ZNNA 5DCEA 5HWMA 3FLUA 1XBYA 1GOXA 1FWTA 5G4EA 1TPC1 1F05A 1PCKA 4RZ4A 3OHIA 1GVFA 3C2OA 3S8HA 1X1OA 3FA5A 3W7OA 3S5YA 5KMYA 3B04A 4O1AA 3E0IA 1DV7A 4XQ6A 1FWWA 5HUOA 3FS2A 4S1FA
chains in the Genus database with same CATH superfamily
4PSRA 4PUDA 3PHAA 2C19A 5LIKX 2QCDB 4QEEA 3S1XA 3G5EA 2INFA 3EKGA 1PX3A 4LS0A 3E38A 4MKSA 3TTEA 2ISSA 3BE7A 4Y9AA 4EE9A 3BMVA 3DHFA 4UOQA 3WMLA 1U1UA 1NM9A 1ZQ5A 3EMZA 2VC7A 3S2LA 1VBJA 1V93A 4C6IA 4W93A 4G56A 1Q7QA 1L6GA 1GTHA 2CZEA 4CNOA 3IGHX 5G2WA 1FTXA 2ZC8A 3GFXA 4LYPA 2E0PA 4BWLC 4UZUA 1G4SA 4HT3A 2CLFA 2BXVA 4AZ5A 3RPMA 4AD2A 1UYQA 1DORA 3SZ8A 2PRLA 2X1SA 3QRHA 3SCNA 5U7SA 2FHCA 4FMVA 1VEPA 4GGHA 3MJYA 1EJ7L 4UQDA 5K4ZA 1PEZA 2QNEA 5BRPA 1W1YA 2VCAA 4G7FA 3PTDA 3FX4A 3KX6A 4D8ZA 1UIOA 1U22A 1G9HA 5AC5A 5LGZA 1NDYA 2E9BA 1UW9A 1VBHA 1XL9A 4DI9A 3H7UA 5C9ZA 1K7XA 3LCGA 4JTAA 4J35A 4B2DA 3OQ8A 5HNTA 3RU8X 2P8CA 3FKKA 2YBUA 3W00A 1FA2A 4WUIA 4EXBA 4KCVA 1XC6A 3RO8A 1ITQA 4Z1YA 3KOXA 3KCJA 3R0DA 4O8RA 3T0CA 1PO9A 2V69A 3HG3A 2TPSA 5E09A 3ARQA 3WUGA 5AYIA 1HJVA 3CTTA 3WLQA 1NQKA 3VMPA 4B90A 4ADUA 3V36A 3NDYA 3KLLA 4X9YA 2CEQA 3RCYA 1CZ1A 3FDGA 4LUIA 1YYAA 1EWEA 4ZGYA 1Z42A 1QCWA 3T0AA 1Q6LA 1OJXA 1R3WA 3PY2A 4OU1A 3ITGA 4CEUC 2PDIA 3SW6A 1R9YA 3OGVA 4IGNA 3VOCA 1QVBA 3B8SA 3HG2A 2A3CA 3PTMA 1PKNA 1Y5WA 1TJ0A 3NQAA 2OQYA 1T6MA 5FA5A 1XGDA 3BAYA 3DESA 4AZCB 4PBEA 5REQB 3ORWA 3EX6A 2Z27A 2DT2A 1EDTA 2KAUC 1SSDA 3R13A 4KEZA 2OODA 3N2CA 4A35A 2JBMA 1TMHA 4YVVA 1WZAA 2YCIX 4XX6A 3IANA 5A5WA 3PAJA 4J3VA 1TELA 1MSSA 4XAGA 2PDFA 2OLSA 3ECQA 4KT2A 1MFUA 1SGJA 3WLTA 1JCLA 5C7VA 1QNVA 1G5AA 3VD3A 4P8VA 3SI9A 5A69A 3GNNA 1E72M 1SVDA 1EC9A 1M7XA 3GW3A 1E1CB 3IUHA 2CXEA 5L6UA 4JFUA 1REQB 1UMYA 3N1AA 4PB4A 1TV3A 1PCWA 3ALFA 2ZVIA 3EXTA 2DZAA 3GVVA 5HJLA 3EDKA 1PIIA 4AUBA 1UG6A 1JGIA 2AL2B 2GK1A 3EDEA 3CHFA 4ZMGA 2B7QA 2P53A 2ASHA 4MTVA 1XLGA 3DBNA 4DM2A 3HGRA 4H9XA 3UG4A 1LQAA 5D37A 5AC6A 4Q4RA 4C65A 3SUSA 1WAWA 1OY0A 3FY1A 3URQA 5C9XA 1Q6CA 4AWUA 2CESA 3EWBX 4WD0A 4NJGA 2XFWA 3VA8A 2ISDA 4F0MA 2C8NA 1OCQA 2QZRA 3UWVA 4X61A 3GDBA 4IQEA 1IEXA 3AALA 2P76A 3N6QA 3M6YA 3OLDA 4RUBA 2ZQ0A 1VLIA 4PMYA 2NT0A 4GOAA 4XZHA 2RDUA 4DJED 4WGHA 2PF8A 2A85A 1CTNA 1XH0A 3ZWSA 1GCYA 4ZO6A 4HA1A 2X05A 2V82A 3AC0A 3MMUA 3ABSA 3CQJA 4HOXA 1AD4A 1X7IA 2P3ZA 3CZGA 4AD0A 1V03A 4LW7A 5I77A 1DIDA 1NFGA 1XIFA 1H60A 4P2VA 4DBEA 2PU0A 1WX0A 3HA1A 3KFTA 3TKFA 1UP3A 3TQVA 1LL7A 1Q3NA 4BFAA 1F3EA 2VUYA 3NZPA 5CZ0A 4XZWA 4AY1A 1L2QA 3VZYA 3NM1A 1U1JA 2KZHA 2D2HA 4QJ1A 2Z00A 1VIWA 4AYGA 2FGBA 2VDGA 1NY1A 3WDIA 5BOEA 1D8CA 1OYBA 4PA8A 4JTIA 8TIMA 5EGRA 1VZWA 2I9UA 5CZKA 4RNHA 3ARSA 2CLPA 2WSQA 2YDQA 2ACRA 3S47A 3LHWA 5D32A 2YX0A 4YIWA 1JDAA 3N13A 2PDNA 1I0BA 1QHPA 3CQIA 3F5LA 4MAZA 3RGTA 3R8RA 3CV1A 2CBVA 4Z2HA 1O5QA 2O55A 4J28A 1CEOA 4AY7A 5TBOA 4US5A 3H22A 4HSNA 3NCOA 5C9UA 4EWND 1TIMA 1A0CA 2YZ5A 4Z2GA 4FOUA 1W2PA 2XIMA 3RG6A 4MSSA 1F6PA 3FEMA 4Q32A 1D3GA 5H91A 3UXKA 5I03A 2XN0A 4IFKA 5TF0A 2G41A 2ZRWA 4L4PA 2A79A 3GAKA 5D38A 3C2FA 4C6OA 2RHGA 4GCXA 5FEXA 2TODA 1W5MA 2ZZ6A 4KCTA 3OGSA 3T42A 2C79A 3P80A 1YDYA 4OQVA 1W1B1 1M7JA 2O7QA 2VENA 4ORIA 1WPCA 4JTTA 3SO7A 3MSDA 3UXDA 4FX6M 3WD2A 1O66A 2E6AA 3UJEA 3FHAA 4E2OA 2PGWA 1GKRA 3MUY1 1G4TA 1DQXA 5EBUA 5EMKA 3KTSA 4UFKA 3VNIA 5D9NA 2D2JA 5C55A 1W17A 3PG9A 1WBJA 1AMYA 3W53A 4JTFA 1Y0EA 4GYPA 4XK2A 3QC0A 1YX1A 2VZSA 2HPIA 3RX2A 2AQOA 2SFPA 2FHBA 3SUVA 5LNRA 4BKNA 3IS4A 1V3MA 4HJWA 3SCOA 4EF9A 2PWVA 1ONEA 4PMOA 3PNZA 3FGCB 4AHPA 2Y0FA 3KP1A 3SECA 3H2MA 3WDRA 4CQAA 2OTDA 2CKRA 1K03A 2XIBA 1M7PA 1SZEA 2E8ZA 1NVMA 2REQA 3SQSA 2PEVA 4QE1A 3XISA 2W61A 4HNUA 1S2UA 4IFRA 4B3ZA 2PDWA 1KCXA 4POCA 1TB3A 1TV7A 2PRMA 4JYEA 4W4QA 5BOOA 1FDJA 5CLTA 1U5HA 4O28A 3CH9A 1CXFA 2W0UA 3ZYZA 3CIWA 3QV9A 2GQ3A 5KSWA 3HM7A 2Y88A 3PG8A 3BK0A 3GXDA 3ABOA 1EEPA 4LUYA 3M16A 4RJEA 2BV9A 3OW1A 1TCMA 5A3HA 2V3EA 4KMQA 1IZJA 1LDCA 2HISA 3WDQA 2GOKA 2PBOA 1K4HA 4Q7BA 3GHTA 3E0WA 3RR4A 1JDEA 1SZNA 1JYXA 5H1WA 2XVLA 3HGJA 1FWSA 1QOPA 1EUAA 3EXSA 3H2CA 5EA9A 3VDGA 1AH0A 3H6OA 4Q4SA 2VEIA 1VBUA 3CPUA 3STFA 4B9YA 3N17A 1AW5A 3MBFA 4TX8A 2BHYA 4LB4A 2VFEA 1E0WA 3QFWA 4M6PA 3DFSA 4J3XA 1K1DA 1V0KA 3TTYA 4GYJA 4AXKA 1TREA 1RY8A 3OZYA 3WFLA 2WSPA 3H2OA 3J7HA 1LQ0A 3WNPA 3ITLA 4DO6A 2RGLA 2WZIA 3AZSA 1BQGA 3PVFA 5C6MA 4H7ZA 4KRZA 5I3FA 1BKHA 5HPCA 5DO8A 4S3CA 4B3KA 3SN4A 1XCXA 4IIBA 2HXUA 2D3NA 5BXSA 1MDLA 5LSMA 5M2FX 4HQVA 3TONA 4DYKA 3NYDA 4B2DD 4JY8A 3BOFA 3TZFA 2OB3A 3HG4A 1M6JA 2YYTA 1N82A 1M04A 3LPFA 1KXVA 2D1ZA 3MSGA 4JTDA 4TTUA 3UXLA 4C6QA 4DUVA 2WSKA 3BH4A 5F7UA 4PGLA 3LB0A 4RDWA 2VC6A 2FH8A 4Q6JA 3ES8A 3BL3A 5EBAA 3UZJA 1F7BA 2GGIA 4KGJA 4XZNX 3NSXA 4G5DA 1E6NA 4PZVA 3OJGA 4AIUA 4WY0B 1SJBA 1EJUC 3WBEA 1A3XA 3WSUA 3E3HA 3MP5A 2XH2A 1CLVA 1X96A 2V5KA 1F4AA 5XINA 4GFIA 1CIUA 1J5TA 1W6TA 3TMLA 3MDWA 4GIRA 1EHAA 3H8AA 1Z32X 4NY2A 1SFJA 1TPVA 3N6HA 2PUZA 3VIJA 4WF7A 2A3LA 2MUCA 3ITYA 3MZNA 1RA5A 2DDXA 2O7SA 2F84A 3OZOA 2R24A 4FS9A 2YLAA 4KQNA 4NUWA 3A4AA 3EOUA 3UCCA 4D71A 3THCA 4FNQA 3G6MA 3L67A 4RDZA 4A3HA 2J13A 1QOXA 3R0UA 1TX2A 4HK5A 3TCEA 4DEFA 3W7CA 3QHMA 2VFHA 4PMUA 4M3PA 4ZO7A 1VP5A 4LCSA 4OVXA 3W1PA 6TIMA 2RKXA 1FUYA 4AZGA 3COTA 3SADA 2QCLA 1F61A 3GFYA 3DECA 3OVRA 1LOQA 4NJIA 1WZMA 4GBUA 1J2BA 4PUMA 4IH3A 1JXJA 3PS7A 4Y8EA 3AYTA 4GZIA 1CXIA 2Z25A 4X0NA 2E5DA 4AAJA 3S9IA 3JVAA 4AZ6A 4A3UA 1ICSA 1K7EA 4JICA 3WN6A 4OGZA 1A4LA 3O6DA 3U4AA 2DZTA 1NSJA 1ISXA 5FJOA 3PZMA 5TAOA 2ZVRA 3WK3A 2VCCA 2DIEA 1V7YA 1W3KA 4LY4A 4PN2A 2G37A 4M56A 1WDWA 4Y6GA 1EYWA 2XG9A 2VGBA 1W9BM 3ABRA 4GVHA 3UYIA 1DIEA 3CZLA 1GYNA 4DXVA 3O2LA 1EC8A 4UFIA 4O19A 4L7ZA 4RK8A 4CD7A 4LAMA 1XICA 1HF6A 1RQHA 3M41A 1TPEA 1WOAA 3GE7A 3UWWA 4H2CA 4I7VA 3SY1A 4DRSA 1XIEA 3AICA 1HN1A 2E28A 5I23A 4N42A 1VFMA 3TYCA 1OBAA 4J1OA 2X40A 3FEQA 3V75A 2DH2A 4BS0A 3VILA 1RXOB 3C8FA 4AWEA 4ZFCA 2UY4A 1E9LA 3DEQA 4REQB 1KTCA 3E5PA 3IACA 2YR1A 2WKGA 5LXXA 3W25A 4BR1A 3KRZA 4ZQOA 3ZT6A 4EK7A 3TN6A 4HZ7A 2NQJA 1VB9A 4AX6A 5FF3A 2PCQA 1DJHA 5HQEA 3TAOA 3LHUA 1KO0A 3CQ0A 2EPMX 3BQ5A 4PCFA 3CBWA 5LA1A 3P81A 3K46A 4BF5A 2G3JA 2JKPA 3MS8A 3OLEA 4R9XA 1QRQA 5AYXA 5E0FA 4L6DA 4PEKA 4V15A 1GVEA 3GU9A 2FGLA 4UFLA 1HKJA 3OU8A 4DWDA 3W1UA 1U1HA 4U10A 5E70A 4UTHA 2X42A 1JZ2A 2CLMA 2EGZA 3GY1A 4ZOEA 3VK5A 5D9MA 3P6LA 4H9YA 4BJHA 2PP3A 2WNQA 4LBSA 4P5UA 4YU1A 3G18A 3A24A 4IJCA 5C9WA 2J77A 1C90A 3PZNA 3IJ9A 1EJXC 3QPEA 4IXXA 3UJ2A 3AUOA 4C6MA 1M1BA 3L12A 3OA3A 1ITXA 1YDOA 3VKCA 3IJ7A 3LY0A 3WNLA 4K1WA 4UTLA 2B4GA 1TVNA 5K9XA 3D5HA 3GH4A 1HO4A 3VUSA 5DMLA 2GUYA 3QQWA 5GVJA 1KFWA 2XHYA 3UYCA 1SZFA 4N02A 5CXPA 1UBSA 3VNJA 4BI5A 1I1WA 2XIQA 2GDUA 2DIKA 1M7OA 3GIYA 3UFYA 3TW7A 5MKGB 1GG1A 2GZXA 4FLSA 4M7SA 1HKWA 2AKMA 1SO6A 5AECA 4UQCA 1PTDA 5AYBA 1CXHA 2WKLA 3FSTA 3OIHA 4ROPA 3VGFA 3MUZ1 2BOEX 4GO9A 4M6VA 3LXCA 3WD0A 3MVIA 5BXPA 3M6DA 4GH1A 4JKMA 1OX5A 1NP0A 3AOFA 1AODA 3W7IA 1Q2SA 3KRSA 2WCSA 5G4WA 3E0VA 3CUIA 4HMCA 1OFOA 4B92A 2A7RA 4XSMA 1ONXA 2VQTA 2RJHA 2Y1HA 3HPXA 3QF0A 4A22A 4J3UA 3TJLA 1XIMA 4OV9A 4D8LA 4FLRA 2OT1A 3LV5A 4ZODA 1XLMA 1SZRA 3VPLA 1QHZA 3M0JA 5AZ0A 3AFBA 1NDZA 3G0XA 1W56A 1XRVA 1QNPA 2F7FA 2HVNA 1JYWA 1UQYA 3ERPA 1VGAA 3D46A 3ANUA 4IMFA 1DE6A 5GNXA 3EDFA 4K7VA 5KINA 2OEMA 1MRAA 2V2HA 2OQLA 2DUXA 1H63A 2V8ZA 4MUZA 1CXEA 4ZSTA 2IXVA 3LHTA 5HAOA 2NZLA 2NSXA 3EWYA 5FEWA 3WQPA 1P4CA 2HCVA 3TN4A 3ME3A 2BMBA 4AG0A 3GKFA 4DY1A 1H7RA 2EHHA 2NX1A 2DJLA 4TV6A 2A3BA 1RCOB 1E15A 1QR7A 2QCMA 5A2BA 1V77A 2J7CA 3A64A 1R9ZA 4TIMA 2QCCA 3BGGA 3QQ0A 1EGMA 2GQAA 1WXZA 4DLMA 4UTJA 1TRIA 4RZ5A 1XDMA 1MFVA 1OD8A 3AJXA 4AD5A 2CLHA 1OFEA 2WAGA 5BYWA 1FWRA 4O10A 1B0IA 2VELA 3SCSA 2NLIA 2WNWA 1UR0A 2Z26A 3R0KA 4U33A 3B9OA 1SJAA 4IIHA 2A2IA 1V3HA 1Q7MA 1AL8A 3I68A 5D8ZA 4RV3A 3QGVA 1UPPA 3AMLA 2G95A 4L56A 4U3AA 3BG3A 5A6MA 3H2FA 2C1HA 2EG7A 4ZQCA 4JTRA 1DJGA 8XIAA 1Q6DA 1UD2A 3W71A 2E1DA 1X6LA 1F9CA 1JFHA 5CJMA 1QNSA 2X1TA 1GJPA 3URAA 4JYDA 4BF7A 2WVVA 1S39A 3POCA 1V6YA 2YCLB 2W91A 1PKYA 4R9OA 2IQTA 1U5VA 1Y8BA 2HROA 3BPWA 2XVKA 2IKIA 1S1PA 2YFOA 2Y4SA 4AZCA 4J27A 4RNFA 3CYJA 3CWNA 4L1WA 1V3IA 2OR2A 3DH7A 4GWEA 1O1HA 3PPHA 4DIAA 3W2MA 3D3FA 1B3XA 4FK9A 2DJXA 4JL1A 1TJ2A 1TWWA 1NDVA 5IBXA 3O6YX 1ME9A 4BI6A 2I1OA 4H6QA 5FEPA 3I3DA 5F2IA 1AJ2A 1UROA 4AMAA 3JZUA 1PDYA 2JF7A 3LCFA 1XIHA 1W9VA 2VX7A 4QISA 2C13A 4ZBCA 2OYLA 1AVAA 1XISA 3QC3A 3DXIA 4ATWA 4IICA 3OPSA 1MUWA 4IJRA 1F73A 1PTGA 1OABA 3VC5A 2ZC1A 3TYBA 3W07A 3B9EA 4O52A 5FAJA 3JUGA 5IDZA 3A47A 3BW4A 5EYWA 1YLVA 2V3GA 2OT0A 1BTMA 3T1GA 1RBOB 3NQCA 2HBVA 1WUEA 2GVGA 1E73M 1M68A 3B8WA 4JFWA 3A22A 1EKOA 2DT3A 1XLIA 4CUCA 4FNPA 2AL2A 3GAYA 1RCXB 3MO4A 2VR5A 3CHCA 2VOTA 3BAJA 4NNBA 2VGFA 1ISVA 3A3HA 1GYMA 4E8GA 1SZGA 3T81A 3ZQ9A 2E3ZA 3L0GA 4XKMA 4W7WA 2NVCA 1EJTC 1ZENA 3DKJA 2CHRA 3NQFA 1W3NA 3L4ZA 3AIRA 3VNMA 1YNYA 3CWHA 4JGDA 5AHFA 1NF7A 1R3YA 2OU4A 3KHJA 2WJEA 4PMNA 2POTA 4DNMA 4WDWA 5HMSA 5BW6A 4PMRA 3QBUA 3QGAC 1RBLA 4H7VA 2NQLA 1JAKA 3EOEA 1QW7A 5HANA 1ITUA 4W8AA 1ISZA 5I78A 1VAHA 1BG9A 1W1ZA 4YYCA 4RDYA 1P43A 1T99A 2PC8A 2ALRA 2B7NA 4DPQA 1BRLB 1YTKA 2VEFA 4QJ4B 3B40A 2VWSA 2J75A 2FH6A 4Q8VA 3L66A 3QN3A 4P8WA 3TCSA 1SM9A 1W1VA 4FR6A 1E0XA 3STPA 3MUXA 7ENLA 3KS6A 4PRRA 6ENLA 4GVFA 1EZ2A 3M44A 2PDGA 3AZRA 1M53A 2WVTA 1GJWA 3QGKC 3LHZA 4MB5A 5XIMA 2X41A 1Z7AA 1UZDA 2I5QA 5FACA 3KW3A 4WKFA 2OLAA 3MQTA 4PTWA 3APYA 2FTWA 1RV8A 4K8GA 1BXNA 1H5VA 1OINA 1RD5A 3B9AA 5EFFA 1P6BA 3G2GA 3N11A 3W1XA 1OFQA 2V9DA 4WQ6A 7TAAA 4CQDA 4RW3A 1TIWA 3O8AA 3S0CA 3MCOA 1IQ8A 2R6OA 1PZ0A 3AMCA 3T6CA 4W7UA 4IIFA 1JPHA 1Q6FA 3NA8A 9RUBA 4QGCA 3VYLA 2XH4A 1K3UA 1W3LA 2J4GA 2ZA2A 2FMNA 4G9PA 4LXFA 2QAPA 2W62A 1KC7A 1FWAC 1YXCA 4FHAA 1HL9A 4ZOCA 5FJUA 2WBKA 1DYSA 2WHMA 1IT7A 3OG3A 3W7KA 4B16A 2Z2BA 4EPKA 4CD8A 2J24A 4A8RA 5CBIA 3SRDA 1FCVA 1FWNA 3IIZA 2VKZG 1YDNA 1TV4A 3R89A 2ANUA 4IFKB 1RJRA 5CGTA 3AQUA 1FWBC 1UP0A 2V2CA 4GVIA 2DUZA 3VNZA 1S5MA 2CZFA 4PUEA 1CB7B 2RH9A 1R2SA 5D02A 4MMWA 4C91A 1J2WA 2H8ZA 2ZZ1A 3AWNA 2JK2A 2ZUNA 1VFFA 1TMLA 3HPAA 3CL6A 4EP8C 3TQPA 2OSYA 4AY8A 4P7LA 3I7QA 3R1ZA 3GYEA 2NVDA 2GJPA 3M0YA 4OOZA 4QSHA 3W2KA 1DWAM 2C0AA 1L9WA 1Y65A 3MPGA 1J5SA 5GNYA 1PTAA 1JCMP 3OVGA 3HFTA 2R8WA 3IGSA 1MYRA 3NSNA 2AAMA 3ZJKA 4DWSD 5CSRA 2R1LA 4Z0JA 4LAZA 2L5HA 1XQKA 2QGHA 3GNPA 1W91A 2XZ9A 3L4UA 4OBSA 3ITVA 2NQ5A 2BGSA 3SSJA 3G1DA 1IXPA 3RRXA 2XIIA 3GBDA 4KW2A 4QFUA 4N9EA 1RK6A 3H2NA 3WQDA 3RMJA 1R3QA 4GNJA 3OBAA 3TC6A 2OZ3A 2ZRZA 3SGZA 3TTSA 1KFEA 2IPWA 3EDDA 4CNNA 3QOKA 3DIPA 8XIMA 3T05A 1OFPA 2DGAA 4KIEA 4W85A 1BYAA 3WQCA 4A4AA 5BWAA 3KUMA 2INEA 3EA2A 1UC4A 4GE8A 5DT5A 1TUFA 2BVDA 5LZLA 4S2CA 1D2KA 3E0LA 3QHOA 1IR1A 2OKOA 4PCNA 3CAKA 2FPVA 4LAUA 3MV11 3R10A 4HYVA 2YB4A 2E68A 3LOTA 3V7PA 1C91A 4JTJA 2D22A 2PTWA 3K1DA 3TN3A 5LNWA 4R7JA 4XD4A 4J5NA 1ITCA 2POZA 4IXHA 5AHMA 3OP2A 2OOGA 3BLFA 3V16A 2FVKA 1MDRA 1KM1A 3OYXA 3WLOA 4OBTA 1Q6EA 1BEUA 4F2UA 1QI5A 4HNCA 5DRCA 4KFOA 1IXOA 1P48A 3IV3A 2J27A 1T96A 3PUGA 3DOPA 4HU3A 2YDAA 3QY7A 4HPHA 3WNKA 4UOZA 1SR0A 3UR8A 1GOXA 2DIJA 4KWSA 1NWRA 1K77A 4AVOA 3WEMA 2ZXDA 3OHIA 3C2OA 3W7OA 3KBNA 3RPDA 3ENLA 3OODA 2Y8KA 1FWWA 4E5TA 5DCDA 4S1FA 3R25A 1OGSA 4FNTA 4F0HA 1MW0A 3B3DA 3LMYA 5AOUA 3BSGA 3M0XA 3I7RA 1K6AA 1W3TA 4ENLA 2D3LA 2CLKA 2D0FA 1WKEA 1SYTA 4HN4A 1PX4A 1CI1A 4GABA 2HS6A 4E3VA 1EH9A 4N4PA 1LRTA 2F2KA 3BUVA 2OQHA 4I6VA 4L4LA 1XSJA 1WCGA 5FAGA 4O1DA 4MUPA 4DO7A 2DVUA 2WCAA 4PSPA 4QG8A 4UCGA 5HNNA 4KEUA 1T0OA 2QIIA 3Q4DA 1BLIA 4MWAE 4PMDA 4BEQA 1UD6A 2C71A 1DHKA 2PTXA 3N14A 2PDCA 1R3VA 2GGJA 3WF1A 4JX4A 4XIAA 2F6KA 1EEXA 5REQA 1UR8A 1AH4A 1MXGA 2VX6A 3EPMA 3NPUA 4MF4A 4DO5A 4YS1A 3ZT5A 2W63A 1KFBA 4PMXA 5A2CA 4FIRA 3E2SA 3CMJA 2A6NA 2VYOA 4KS0A 3FXYA 1O60A 1ZFJA 4EAYA 1XI3A 1BQCA 4K37A 2VXNA 5LXEA 3TH6A 5CC5A 3P8IA 5D2YA 5A6JA 1Q2RA 2H8XA 3P67A 2XN2A 5HA7A 2WMIB 2W9MA 3W2NA 3EPOA 5DBTA 3M5XA 3BJFA 3FXGA 5K7JA 4DUOA 1GOKA 1XW8A 2BODX 3XIMA 2ZCGA 2V68A 3M7SA 3O6CA 3I7SA 4ZOBA 2RGMA 1N8WA 4CN4A 4DJEC 4QDMA 1C8QA 1R7AA 1L6WA 1N2VA 5LNUA 4ACZB 4HJFA 2NX9A 3WF0A 4EX4A 1S2VA 1A4MA 3UA3A 1H61A 3WFAA 1JRBA 3S3GA 4DZAA 1KA9F 3M5ZA 1QXLA 2Z1XA 3LQGA 2V5JA 3LPOA 3WDPP 1FCBA 3NURA 1UBPC 4P7RA 1QPOA 4UTFA 1B3ZA 1LBMA 1DJXA 3C61A 5A6BA 1W3IA 4TXEA 4GQBA 3VNDA 2AKZA 1IGWA 1BWKA 1W2VA 5KETA 3TOPA 5D33A 1UMLA 5TD4A 1OG6A 3B8IA 3WH9A 5J5RA 1N8IA 5DMNA 1F5ZA 3F2BA 2VFGA 3UWEA 1IEIA 2ISFA 4CQ9A 2P1FA 4MB1A 3HU7A 3VFLA 4I5RA 1KCZA 4PMJA 2R1NA 3W75A 5A8NA 1NFPA 4GJJA 2CCRA 2VX4A 4HPXA 4H9VA 1R7OA 1BRLA 1UA7A 1HVQA 1H1YA 2PRHA 3CV2A 3L4TA 2VCBA 1HP5A 2OYKA 3TN5A 4BEUA 3QZ6A 4HYRA 1MEWA 4Q7NA 5DN1A 4X2RA 1V79A 1S3HA 2CLIA 3LENA 4FO4A 3S6OA 1A49A 2WO5A 1XRSA 4O8AA 2GQ9A 1W5PA 4NZ3A 2QXWA 3PZVA 2TMDA 3NWRA 3P93A 1EIXA 2D2GA 5M03A 1GOIA 3PWAA 4H19A 1GPFA 3QLDA 1Q7ZA 2IQDA 1G7VA 3HURA 2WKJA 5IXEA 3GM8A 4JYFA 3B97A 4B5NA 3PUOA 3NDOA 1FBAA 1XYCA 7REQA 1WAUA 2W5FA 2C15A 2BWGA 4HMEA 1RLCL 2PAJA 1OADA 4PFHA 3OYZA 3WBYA 5A8MA 3PWGA 1C29A 1E6ZA 3BURA 5TIMA 1UWTA 1R2RA 3VVGA 3AS2A 3S83A 4C6LA 3A5FA 1TPB1 4HCLA 4KRUA 3ES7A 3I10A 4QIUA 2HQAA 5CPQA 1PKMA 3C2VA 1YXDA 4BWLA 3GW0A 3ZSTA 2EPLX 4EIVA 3F4NA 2EPNA 5HK4A 4WCJA 1YW1A 2AL1A 3WLJA 1C8XA 4FIQA 4FALA 1AL7A 2WZEA 1TG7A 2G3FA 2TAAA 1TX0A 4L4MA 3ISIX 3NIYA 1J79A 1YPFA 3C2YA 1UH3A 3BLPX 4CU7A 4WKAA 5FL1A 1T7LA 1CDGA 4IJBA 3PFMA 1NJJA 1E56A 3TYZA 3W23A 3TWAA 4XAFA 3C3NA 2X09A 2XH7A 3A13A 3W83A 2EBNA 4Q4PA 3W1RA 4CKQA 1H11A 2JALA 7A3HA 2WLYA 1A5MC 4S3GA 3WY1A 5KEZA 2YDSA 1EJSC 3GNOA 4CNPA 4M19A 5AYYA 4H9TA 2C3ZA 1ECEA 1J6OA 1U5JA 1JF5A 4GUHA 2PZNA 3M0KA 2RJGA 1GZGA 3EPNA 1CLXA 1MO0A 1BVZA 4IP7A 1Y7VA 1BF6A 3CU2A 4CNSA 1G4EA 4IOTA 3WNMA 4P61A 5FF7A 4IPIA 5A6AA 2DVXA 4XSLA 4YYFA 4GI6A 2QJNA 4XO7A 4ORMA 3VIFA 4Y8FA 4CCCA 2YLLA 3NAVA 4JTUA 5BMWA 2FPYA 3OVPA 5TNVA 3BOXA 9CGTA 4WRHA 3PJWA 2Y89A 3OBEA 2CKSA 4M0XA 3WH5A 3WH7A 3AS1A 1KFKA 2WBGA 4DAIA 1TTPA 4DBWA 2W92A 4JTSA 1J96A 1PKLA 3H2EA 3L4YA 4C6BA 1EDGA 3WL1A 1VPXA 4B5TA 5ABFA 4MPQA 1KRAC 1FP8A 3E2RA 4A05A 4JN7A 4JTLA 4QS5A 2X1RA 3WQFA 4CLMA 1YPXA 3W7MA 3VIGA 3H23A 4AU0A 1JI2A 4ZSUA 2I5IA 1FWGC 4YNGA 3BZJA 4IUOA 4REQA 2WB5A 1TSIA 3AI0A 4O16A 3S5SA 4LVBA 2V5DA 1JPKA 1K6WA 2BHUA 3FFSA 5I3JA 4W9TA 3ZS4A 1UUOA 3UG3A 2J66A 3ARRA 3GKAA 1E0TA 1MI3A 4H1ZA 4E4FA 4Q22A 3W7EA 3DG7A 4H04A 3S5NA 3QW4B 2A3HA 4W89A 3FSUA 8RUCA 1SO5A 1T40A 4UZSA 3EMCA 2A4AA 3PSWA 3CK5A 2C1GA 1JYNA 5ABEA 1VJZA 3VIIA 1JZ5A 4KH2A 3EOLA 4JFSA 3NYZA 2WJFA 1NQ6A 2VM8A 2HE5A 2NUWA 3ZR5A 4Z2LA 1ZHAA 3CHEA 3QTPA 4IIDA 1UR4A 4JHOA 4RW5A 3W76A 4ZXLA 3F5KA 2C6QA 3O16A 2WVUA 5ABTA 4ATDA 1R5YA 5B7YA 3IEBA 5FL0A 2XTKA 4YL2A 5K2ZA 1B3OA 3B0VC 1X98A 3KDOA 2VEKA 4LJ3A 3KWXA 1XYFA 4YLWA 1Q6RA 3VIHA 2O9PA 1JJKA 1OD0A 5ABHA 1FXPA 4UMCA 3G8RA 1NH6A 3EX2A 2CBJA 2Z1SA 3BDKA 1E43A 1KNWA 3ARTA 1S46A 3G1YA 4EPDC 1H7WA 1NWTA 4EOUA 1H50A 3S46A 1MW1A 1WDRA 4E4PA 2O0TA 4GY7A 2Q8LA 4OOUA 1F07A 4S2BA 5I00A 4HHPA 4KWOA 1IHIA 4K8HA 5IBXC 4IM4A 2CNCA 3B06A 2WJDA 1R9XA 2ZZ4A 3VUPA 1QPKA 3R58A 1FCUA 1AQMA 1GG0A 4PB3A 3QLLA 2LLEA 4UTKA 4DLFA 1ISYA 2BDQA 4NX5A 4EXAA 2HBXA 2CC0A 3K8LA 4IQLA 2G3IA 1LQ2A 3QTGA 1A5NC 3T0BA 1PXGA 2VDHA 3EMQA 4ML9A 4DF0A 1TE6A 4NNCA 1I4NA 3M0IA 1JCXA 3CPRA 3MSYA 3W7NA 3T7VA 3A6OA 4UTTC 3NQ8A 2PWUA 4AIOA 3UEQA 3E5BA 3R8GA 1S5TA 4FPSA 2P8BA 2QDEA 4OHQA 3C5QA 1U83A 4QBXA 5EU9A 2FDSA 4S3EA 3M64A 4GX8A 3LERA 1GKPA 1MXDA 2GVEA 3S5ZA 2D2OA 2ZFAA 1VFOA 2CBUA 2QDDA 2OFJA 3VOHA 2BOFX 2VGGA 3QYSA 3MWCA 3LSBA 3LI1A 3GBEA 4GKTA 4HCHA 3V4BA 2XM1A 1XLCA 1OHLA 4ZOAA 1LROA 2CLEA 1V02A 4JHZA 3V5CA 1EJWC 2X30A 1PWLA 3SFWA 2EPHA 1ESWA 2WV8A 4PUUA 2DZXA 1ZL1A 4Y2WA 5CBJA 1JGMA 1VYPX 4JTKA 5IRPA 3UR5A 1GNXA 1XKJA 2FDMA 5DF0A 1XYAA 2B31A 1XKYA 4GIYA 1H1ZA 3PR2A 2BBFA 1EA0A 1IZCA 4ASTA 7TIMA 3S42A 4Q8QA 1QHOA 4AZHA 4LY8A 2PDBA 2BS9A 1IXNA 4FB7A 2H3DA 3WD3A 6XIMA 3GTIA 2IPGA 1HKKA 3VDHA 4Z2JA 1VJIA 1SMDA 4O54A 2QUNA 5EY5A 2XZ7A 1KR0A 1V4YA 4E0CA 3CJPA 1XFCA 2Y5SA 1KW1A 3LA4A 3N12A 5I07A 4FXSA 1XF0A 3U7BA 1WE5A 4U28A 5JIWA 5JVLA 1LG1A 5FJIA 3CUFA 3ZJ8A 1EPXA 5HNUA 4G1NA 2G8ZA 4UQBA 1FFQA 1F74A 3SY8A 3AO0A 4UCFA 3S2NA 3CTLA 3GU2A 4Q3MA 1EF2A 1O94A 3TLQA 3N73A 4M1RA 4S3BA 4JDYA 5JH1A 3H24A 3PZUA 5LHEA 1A5CA 4CU8A 1OVDA 1JXKA 3V18A 2DZWA 3VNKA 3JU2A 4Z1AA 5FF2A 5IHSA 4XZMX 1KM5A 2J7EA 1XIJA 2DY3A 3M5VA 1E1FA 3WLMA 1LM1A 1DQUA 1Q66A 1JCTA 3LPGA 4EF8A 5C2XA 1BXBA 4PE8A 4QSFA 3H70A 3T55A 1RH9A 2VO5A 4DUWA 2JKAA 1TJPA 3G3MA 1V0NA 4MNMA 2PWDA 3BVJA 3GVWA 3VIPA 2RDXA 1GPWA 3BMXA 5DRIA 4F0KA 4IZGA 4PODA 3RRAA 5JQ9A 3ZLHA 1E4NA 2PDJA 3CV6A 3PTQA 4NNAA 4WOZA 2P0IA 2DH3A 1QU4A 3AHYA 1V6XA 4P8UA 1C7TA 1V8EA 1H1NA 3IJ8A 1ALDA 1FH7A 2GWNA 4IPLA 4TVCA 1KM0A 1XLBA 4AZIA 1TPDA 1PWMA 3U2CA 3EGJA 3RJYA 4CGTA 4NZ5A 3PP7A 2ZXBA 1E1CA 1ODZA 1QFEA 1UZ1A 4DX3A 1K9FA 3TSMA 3AXXA 1MUMA 1S38A 1UKOA 4AC7C 3P0WA 1LLOA 1OX4A 2G97A 2WMJA 4INFA 4MKVA 1WZLA 4H00A 3GG7A 2Z6JA 2PFHA 3RX3A 4H9ZA 1OC5A 3G1SA 1QI0A 1I2PA 2ZXAA 1AMKA 1XPGA 2Y2WA 1SMAA 2OWCA 1KD0A 3HG5A 4LFYA 4QLKA 5E0CA 4GZJA 2ESCA 3LGEA 2Y62A 3L5AA 2Z24A 1L8NA 2WMKA 3K8KA 1QK0A 5K9DA 1POKA 4O1EA 1V5XA 2QUTA 3T08A 5AFDA 2ISVA 3WF4A 3VKAA 3W2JA 1SJDA 5DMMA 3AYRA 3OBKA 4Y96A 1OCJA 4R7OA 1IZKA 1U33A 1JIBA 3S1UA 4I8YA 1B54A 3OA5A 3CXOA 3C4UA 1OIMA 3AU6A 4GACA 3N6JA 1OCNA 4LS2A 2OVLA 4QCEA 1ICPA 3WNNA 3F7JA 3II1A 5B7ZA 4A8IA 4HB7A 4S23A 3TR2A 1FX6A 4AZ7A 5A8PA 4WXZA 4OZOA 1BTCA 3DX5A 5I5RA 3BV7A 4K36A 3U4FA 2PD9A 7CGTA 4H01A 4FLQA 1DXFA 1ELSA 2J7GA 1KM6A 1R0MA 1BSLA 4A3QA 4IMGA 2CZ5A 4GINA 1XG4A 5G1TA 1I2NA 2OZTA 1JZ4A 3T8QA 3CZKA 4LYKA 4K38A 4GYKA 2GQ8A 1OG0A 3KOWA 5EMMA 1UIPA 3BLIA 4JXCA 2QF7A 1TUXA 2PDMA 1HTIA 3AZTA 3NSMA 3VOIA 2AGTA 1MRQA 2NXIA 1EFZA 3T2PA 2DT1A 5AC8A 4MY1A 4GVGA 1W37A 3DHPA 4KWVA 3UGVA 3WLIA 1EHNA 2FZBA 1JUBA 4F3HA 1OEPA 6PTDA 4HSOA 3P5ZA 1XLFA 4MOZA 2ZBTA 4TVDA 5EL1A 2WHLA 4IGSA 1MQQA 4M8UA 3PJXA 2DZPA 1FFRA 3GU1A 3KM8A 3NL3A 4JZ5A 1FXQA 2Z29A 3S1GA 2VD9A 1ZALA 4PMZA 2NLYA 3C0LA 5JH2A 1GORA 1IWAA 2JIEA 2XFRA 3I6EA 2QYGA 3UG5A 1CGUA 1G69A 4N7QA 3NO3A 1VJSA 3ZVHB 1VEMA 3EZ4A 5AC4A 1GVYA 3UZWA 3R12A 4JD4A 4MFDA 4X2PA 4WJ8A 5DXXA 3BW2A 1SPQA 3FYOA 3TAKA 4L1XA 2NXHA 4LV4A 1KLZA 2VRKA 4L4OA 2W79A 3NGFA 4FXJA 4QLJA 4GD0A 1WNOA 3LLXA 3GXNA 3ZVHA 3NQGA 5CJ5A 2ZYFA 3SR7A 4MJMA 4MLRA 4O14A 5HQMA 1VEOA 4H8HA 2G5WA 1KCLA 2ATSA 3ARXA 3EXRA 1EF3A 1YBQA 1PE1A 1G0CA 3R43A 4WGXA 1LL6A 3UPBA 3QSRA 1X6NA 3BLDA 2I17A 1E71M 3SRKA 1XCFA 4F0LA 1PUDA 1HZYA 4JQ2A 3USBA 1IIHA 3GZ3A 4FLOA 3SEPA 1V3KA 3WK1A 3QXBA 2Y63A 4HGXA 2FB2A 2QCGA 5FSDC 4YJ5A 1UCWA 4DN1A 1G94A 4LUSB 2PLJA 3QV8A 4AEOA 3RM8A 3VGDA 2QCEA 2ZZ7A 3WL0A 4QNWA 3O0KA 3DG6A 3OGRA 1SJCA 2BASA 3QOMA 1MNZA 5D9PA 3CIVA 4K39A 4PTDA 4AEFA 5C5YA 2YBTA 3TXZA 4K1GA 4DJFD 2RDTA 4DI8A 3ARUA 1H4PA 1TJRA 4DYJA 2QAFA 2YL5A 1TRDA 1HUVA 3O0FA 3RK8A 4K68A 4FX8A 4IG2B 1R86A 2INZA 4ERAA 4GUGA 2BP1A 1KV8A 4BF9A 1C8VA 3N34A 3VCRA 3D6NA 4FXFA 3NQDA 2WSRA 2BFGA 4PL2A 5BU6A 3SCRA 4ONVA 2VZUA 1QWKA 2XYLA 3OZMA 3JRKA 3PK7A 1YTEA 3G6LA 4XKYB 1QAPA 5IHRA 4DUXA 3KBMA 3V5OA 1VBRA 3LD5A 3NFUA 1WZKA 4CN6A 3GHUA 1J0HA 2VR2A 3O1NA 3M7WA 3F4VA 1L6SA 2XGBA 1W5OA 2I14A 2WMGA 3P0XA 3L4WA 4KEVA 3TNOA 2GFTA 4MZ8A 5BRBA 2R91A 1R87A 2X7VA 3GTNA 2W6RA 3GX9A 4QAIA 4PTMA 1UPMB 4KGLA 1B1YA 3E1F1 4MZ1A 1UKTA 1P7TB 5CPLA 3OIXA 5G2IA 4XWUA 1EWDA 1TPH1 1SO3A 1OZQA 3UP8A 3RLVA 5LHFA 3HZ3A 3RITA 3CHVA 1DWGM 3UZYA 2J78A 3PSVA 2YCKX 1HJXA 3LNMA 4AIEA 1HFBA 3QEZA 4M80A 4KWUA 4O53A 1GVRA 3KRBA 3AROA 5ECUA 4GUJA 4DO4A 2EJAA 3C0JA 4HNOA 1Q45A 5CPNA 4D6HA 1J6PA 1DL3A 4S3JA 1K9EA 4RDVA 2IW0A 2BSLA 2PI6A 3THAA 2HMCA 1UOKA 3FYYA 4YN5A 1LOSA 3L2LA 2A7NA 1Z89A 3MBDA 4JQ3A 1QNOA 5DT7A 1FWJC 4FF5A 1F8MA 2VWTA 3UESA 3P60A 4TX6A 5ENLA 3LYEA 2Z2UA 5KITA 3WLPA 4XO6A 1E6SM 1VCFA 1FDYA 4X3ZA 4KCWA 4QEHA 3DFQA 3W7PA 4E6MA 2VL4A 2TSYA 3EB3A 1W54A 3D3AA 3G1AA 3IJLA 3WDJA 3I65A 1ZUAX 1UH4A 3R5EA 3W6YA 3AS0A 4DWSC 3A9IA 1F6YA 3ELFA 1GQNA 2XPKA 4GFSA 5C70A 4AMCA 2E9MA 4GXWA 2PBGA 3LXBA 2C0HA 2GJXB 4KCUA 4R53A 5LNSA 4H9MA 3DC8A 4BI7A 1XFBA 4BY3A 2PDLA 4IX0A 1I8JA 4P7OA 5JIPA 1QT1A 1GOQA 4ERIA 1DJYA 3DYOA 4H8NA 5A8QA 1RCQA 3HQOA 3VIMA 1ZSXA 1DJWA 2OO0A 3SGUA 4WVXA 3WUFA 4HPNA 3KXQA 2ON3A 1US2A 3B9NA 1W9PA 1VYRA 2D73A 6A3HA 2GUBA 3I4EA 4MKNA 2GJXA 4RZ6A 3RXZA 4C7GA 5HJYA 1PL9A 2V6AA 4FI4A 3AHXA 2ZUTA 3G8EA 4J40A 2O9RA 3E74A 3DN5A 4I5XA 3IIVA 2GVYA 4L6OA 4DZ5A 1S2TA 2OX1A 3M46A 3KOZA 1T5AA 5FJTA 3P82A 2D23A 3QFEA 1KWGA 2VC9A 4XAZA 3CZEA 3W6LA 4LRTA 1DQWA 4MIMA 1OQFA 3UR2A 1I60A 1ONRA 1XC4A 2YPIA 2BNJA 3CAVA 4WDUA 1UD3A 2PF0A 1L0PA 1ZLPA 3VZXA 3ZLGA 4UTWA 3UNTA 1B30A 3S2JA 1CB2A 3SUWA 3LEPA 5FOOA 5TQLA 3VOJA 4L5ZA 3CM4A 2UY3A 4NP7A 4LWWA 1GUVA 1JG9A 3W3OA 2V0TA 3P8JA 2CLOA 3R79A 1O5RA 3GYCA 3CB3A 2V63A 1QOQA 3QPZA 2EXOA 3GDRA 3IVSA 4CVUA 1EP2A 5A1AA 1LLZA 2FKPA 3O07A 3HJEA 4F9JA 1EXBA 3HIJA 3INPA 3N29A 4PBFA 3SRHA 1I1XA 4E2BA 4J4KA 1EQCA 2Y7FA 4R85A 1KBJA 3BLEA 3NPXA 1W31A 1BGGA 4XG1A 1E5JA 5AVNA 2ZXQA 1D7FA 2VOMA 2C14A 4XAYA 1RP9A 4O1CA 3U2EA 1UWUA 3W7HA 2A5HA 4KPLA 1PV8A 4D2JA 9XIMA 3RIKA 3GXFA 1NEYA 1J0YA 1BD0A 4E2VA 3WQ5A 4GUIA 4D6GA 3C56A 2B7PA 1GYLA 1Y5XA 4LCRA 3MVTA 4DBDA 3PBMA 3LMZA 4JFVA 1OK6A 1OT2A 2ZX5A 2QGYA 4YXGA 5G1MA 1EPVA 2WVSA 3LZ5A 2A3AA 4O15A 3WEOA 4WX2A 1Q6GA 3GO2A 2GJNA 4DF1A 1CECA 2YFNA 4Z1BA 4JTHA 3W37A 4EXQA 3TSBA 1GVIA 2X1IA 1M01A 1XLEA 1WXYA 1C3FA 4LVAA 1N55A 1NARA 1XIIA 1LG2A 3G1FA 1OT1A 2YXXA 2CLLA 3PZIA 2H6RA 4HK7A 1JQXA 4LAKA 4UQAA 3N2XA 1K8YA 3UF9A 1C93A 4PUKA 3VU2A 2YJQA 3WF2A 1B3YA 3ONBA 1US0A 4NZFA 2OG9A 5GNZA 1ZNNA 1G1YA 4V33A 4JQ1A 4B4HA 4AYSA 1XDJA 1F05A 1PCKA 4ICMA 3SRFA 1OCBA 1GVFA 2QULA 4MM1A 3I6TA 3IWPA 3E0IA 3GRIA 2EQDA 1TV2A 4TOQA 5DEZA 3FS2A 2NVAA 3LLFA 5F2GA 3U7VA 3M1ZA 2DVTA 4UMBA 4O1FA 1VCGA 3DGRA 1YTDA 3BG5A 3KZPA 3AXMA 3IUDA 2NWSA 3OLGA 4DJDA 5ECVA 3W85A 1Z8AA 3CUJA 5BMXA 2XN1A 5A6LA 1KRCC 1L6YA 3P61A 3CYVA 4LH8A 2VFIA 3PN8A 3SN0A 2NQHA 2E7FA 1EP3A 3NQMA 1I75A 2J8FA 3LM3A 5D9OA 3GC4A 3M0ZA 1LWHA 1AQFA 3VD7A 5I3HA 3I6RA 3LCXA 3K4AA 4FOKA 5BNKA 1P0DA 3QR3A 4DJDC 1RR2A 1JRCA 4UR8A 3SDOA 1XIDA 2EKGA 4UIOA 2Z1KA 4K3ZA 3UXAA 3LTYA 3A12A 3GK0A 3VD4A 3UNDA 2WMFA 2HTMA 4JX6A 3IAQA 3T9PA 1O95A 3LDVA 4U3CA 1UASA 4JS3A 3RX4A 1ZP3A 4M51A 2BY2A 1EIBA 1MW2A 1RALA 3M0VA 5CKSA 1RA0A 1JI1A 1UWSA 4Z08A 5E0KA 4JEJA 2FTPA 3T2QA 3N3TA 4P7NA 5I3KA 6CGTA 2Q09A 3IK4A 1M3UA 3ARZA 3VKJA 2PA6A 1C7SA 4S39A 4LC8A 6REQA 3IK2A 3WK0A 4U2ZA 2CPUA 1NOFA 3HQ1A 3P14A 1XX1A 2X0YA 2VMFA 4PCSA 1J93A 4O13A 5A94A 1O7AA 3THDA 3MJMA 1UWRA 2GSEA 2WSYA 2ZADA 3BICA 3UETA 2IPFA 3GR8A 2QPSA 1PVNA 1P7TA 4GQRA 4YTRA 1XV8A 4LGXA 3K13A 4CD6A 3MTWA 4GBDA 3DYPA 2QIWA 5HJXA 3E9AA 2ZRUA 3AXHA 3TE9A 2C7FA 2Z7GA 3GNRA 4F79A 1IE7C 3NQ6A 4IMAA 1TV5A 4H3DA 3TYAA 3WQ6A 1S3TC 3K4DA 2OGJA 4H83A 2YL8A 1EXPA 4MG4A 1D3CA 1PZ1A 4YTUA 5FI8A 1Q6OA 1XLKA 1JPDX 3AU2A 1FHLA 4BQ3A 4MADA 2CZDA 3C0SA 4JBRA 1NTHA 3PFRA 3QMSA 4AHQA 4Q8OA 4H6RA 2GSHA 2HWGA 3U8GA 3KHDA 4GY0A 3FYPA 2GLKA 3KL5A 4JNZA 4PYSA 3U3HA 2VTFA 5HXMA 5CC7A 3CLMA 3QY6A 1H0GA 3AMGA 5A6KA 4CU6A 2X1UA 4QQ3A 3C2RA 3N15A 2MNRA 1OSEA 4Z42C 3WJZA 3FIGA 3R94A 1WUFA 3W27A 5H2ZA 1BVNP 4HHHA 2OPJA 3AIQA 2Z1BA 2W27A 1XH2A 3EA3A 4NASA 2DT0A 1RK5A 2HRWA 2WC7A 1KGWA 4R34A 2H9AA 1OF6A 1ZBKA 1WDQA 4O17A 3W84A 4WSKA 2OKTA 3IJDA 3NZ1A 4IF2A 1ZPTA 4Y9PA 4ZTXA 4Q8MA 3T8LA 3W7JA 1MZRA 3MHGA 4IL2A 1CGTA 3ONCA 5FSEC 2YCEA 3SIMA 4MJ4A 1GW9A 1QMLA 2OEKA 3FAWA 2Q71A 1KXTA 3KVKA 5F4WA 1ML1A 3RM9A 1VC4A 4L64A 4DJDD 2QKFA 3UVAA 4MYXA 4YWIA 1ZJAA 3S6DA 3VGBA 3H4WA 4ROQA 4C5YA 4JCMA 4KEMA 3VE9A 5AYZA 1VQTA 4FEZA 2R1PA 1TTJA 3M07A 3RR1A 1JFXA 3MY9A 3WMCA 1S2AA 3DENA 3GTHA 4HU0A 1PHWA 2BZNA 2J6XA 2Y8VA 2HVMA 2HK0A 2DZSA 3HQNA 4FNUA 2NSOA 4JY9A 4Q8WA 3ZXWA 2JGQA 4JHMA 4W5UA 3CMGA 3G1HA 1CXKA 3WCZA 3N9KA 4N9BA 2CBIA 1E0UA 4R27A 5BRQA 4B5WA 3TFCA 4HMNA 1PPIA 4ZTYA 8CGTA 1V08A 4C60A 3UZXA 4W5ZA 3C86A 1LLWA 3PC0A 3UY8A 4IG2A 4W7VA 3B8DA 2KX9A 3DYMA 1W5QA 4JN8A 2P10A 2VVNA 3SCQA 1V6VA 3N4EA 1A5SA 8A3HA 1AD1A 3HPSA 1J4EA 5CZSA 5G1YA 4Y9NA 2O4MA 2PWFA 1R47A 2EG8A 4US5D 1TWSA 5GJMA 4D6FA 2PMQA 3YPIA 5D09A 1RZMA 2DORA 3BANA 1H7OA 4Z1DA 3PZ9A 3EKZA 5HMFA 1RJQA 1GZ1A 2QV4A 1Q8JA 3B03A 3RUBL 2J47A 3S2MA 3BGAA 1GWJA 4CQ8A 3T07A 3CEUA 4Q4QA 3UJSA 4O57A 1PS9A 2FZNA 3PULA 3L0NA 2A7PA 4W8LA 5IFPA 1F8IA 1P0KA 4XBSA 3VGEA 1BKSA 3MUCA 5C0QA 3QW3A 5HMEA 5JUVA 3W1MA 3CUGA 2VFDA 1PZ3A 3NXFA 3JZEA 1GQLA 1FWHC 2NXGA 3LHVA 1GHSA 4R88A 4LT9A 1KM4A 1AW2A 4NJKA 2XINA 2NT1A 1ZB5A 1KQYA 2DW6A 3K4WA 4KERA 4PTNA 1GEQA 4GMEA 4E8DA 1AZ2A 1EO7A 1TO3A 1H49A 2UBPC 2CERA 4CN1A 1MNSA 4UOJA 2VP8A 2PB1A 2PTDA 2Q3OA 2UV8G 3TYUA 3V1HA 4E4UA 5F4SA 1P1XA 3F4CA 5FESA 3ITTA 2BX7A 1HL2A 2VFFA 2JF6A 2QW5A 3KL3A 1CBGA 1OYAA 4C6FA 2BVTA 1DTNA 1EOMA 1JR1A 2XSBA 3CUXA 3RHGA 4F0SA 1NOUA 4MDPA 1AW1A 2WOQA 1O5XA 1C9DA 4U31A 2XIOA 1IXQA 3CH0A 5G2HA 4GH3A 3P5YA 1KGXA 2WNZA 3HPZA 3QQ1A 5M3WA 3PAOA 3W2LA 4GQGA 1AJ0A 3PB2A 4RZBA 2PDKA 1KFLA 4ZE4A 3MMTA 3ZJ6A 3EX4A 4M82A 4I7WA 3EKLA 3K2GA 1M5WA 3LGGA 2FPTA 4WHBA 3PZTA 5FJJA 1XJBA 5CPTA 4OWGA 4MWAB 2YW3A 3TYDA 3UU0A 3UT0A 3AYSA 3H55A 2I16A 1HX0A 4B4FA 3GUWA 4DYEA 3NQ2A 3DHDA 3WQ8A 2RUSA 4C1NA 3A4JA 2XVGA 4JIQA 1E6XM 2Y8UA 3WFZA 2NX3A 1PIFA 4GI8A 3OTRA 3W26A 4PMQA 3IVUA 2ZZ2A 3ZJ7A 1K9TA 2DW7A 5H8MA 4AHOA 3T4CA 3NL2A 3N2BA 3RMEA 3CZ8A 3EDJA 3Q65A 5M17A 3VABA 4XBJA 4AFYA 3DCPA 3IGXA 4HOWA 2QJMA 3CAWA 4NI3A 4AWTA 4MWAC 2J6VA 4BQ2A 3W86A 3GWQA 1OIFA 4PC8A 2CITA 3IPWA 3CASA 2ZKMX 4Q6XA 1N7KA 3WH6A 5LKYA 5CZJA 1YE6A 4LUTA 1T8XA 3BAXA 4G6CA 4TVUA 5D2VA 1RP8A 1E6RA 1PDZA 2YW4A 1VPQA 3UR7A 4OFCA 2F9RA 2E25A 1UKQA 3N2OA 2AQVA 4RXGA 1OK4A 4O50A 5E5CA 2J9YA 1TPUA 3V0SA 4H6EA 2E9LA 3LI0A 4DWSB 1O68A 2X2GA 2Y5JA 3FCPA 1UKSA 1EDQA 2WWDA 4A3YA 1UJQA 2J7FA 3HPFA 3AISA 2WLZA 2YL9A 5D03A 2GVLA 4OTKA 4RCXA 1E1EA 4GI4A 2PCEA 2XDFA 4C6PA 4TO8A 3W7QA 1K02A 3A9BA 4GO8A 3PBYA 2TYSA 5D2WA 3MI3A 4AVFA 1O12A 1PBGA 3W7LA 4NU7A 4H6KA 4QS6A 3O3RA 2PU1A 3CMFA 4P8XA 1JNEA 3WBWA 1Q4NX 1VLWA 1TYGA 1P1MA 4HTBA 4LANA 1BPLB 5DY3A 1QTWA 1X6UA 2NV1A 2PP0A 4JNMA 3C6CA 1FWEC 1FHDA 3LTPA 3GDTA 1XRTA 1QI3A 5CEWA 3NL6A 3FJLA 4QQUA 5LYRA 3RM4A 2QV5A 3FA3A 3CC1A 3LRMA 5HOSA 1B9BA 1Q65A 1XUUA 3ZSSA 3AJ7A 1XYBA 4DB7A 1KGUA 3WNOA 1H2JA 2V3DA 5HATA 1BWVA 5DY2A 3T09A 1EOKA 2PP1A 4HYWA 1GVOA 3FHQA 1NOWA 3K1GA 4KFNA 3UGRA 3W1QA 2FMOA 3M5YA 5D2TA 4QP0A 1R8LA 3KP0A 1RVKA 3VFCA 1GT8A 4RKAA 3E2VA 3VAVA 1P5BA 3TR9A 5EFDA 5FKYA 1G6CA 5A6TC 2WQDA 3KBVA 1X8CA 2WHKA 3GR7A 5F2LA 3JS3A 1VFSA 3FJNA 3W2UA 3F1QA 5HDRA 4C6KA 1NU5A 1RAKA 1CENA 7PTDA 4RNIA 3MP3A 2XVNA 4H7CA 4LF2A 4J7RA 4S3KA 1KQZA 2H90A 1HO1A 2OWWA 4HBKA 3AIEA 3LCHA 4NKCA 2CFFA 5CLWA 3AYVA 3NO5A 1I2OA 3LXAA 4OV4A 4C6DA 3URBA 2PWHA 4PR4A 1HJQA 4UQ9A 4RX0A 1EL3A 4WLCA 3MYPA 3PNUA 3G24A 4YCOA 1ZZMA 3VM7A 1ZAIA 3QR0A 1JULA 4GQQA 4C6JA 2ZX9A 3D47A 2TRSA 3ZO9A 1Q6QA 3G1XA 3ZWTA 3VOGA 3MUAA 3LCWA 2QR6A 4AD3A 4FA3A 4AX7A 3TP4A 4C90A 5D05A 1LUCA 2JFEX 4F0RA 4AB4A 5CQ1A 1REQA 2H3BA 3E0FA 3DAQA 2ACQA 3IUIA 2VURA 1VFHA 2DV0A 1BYCA 3CAQA