2CLOA

Tryptophan synthase (external aldimine state) in complex with (naphthalene-2'-sulfonyl)-2-amino-1-ethylphosphate (f19)
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
266
structure length
257
Chain Sequence
ERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRSGVTGHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords TRYPTOPHAN SYNTHASE ALPHA CHAIN
publication title Allosteric Regulation of Substrate Channeling in Tryptophan Synthase: Modulation of the L-Serine Reaction in Stage I of the Beta-Reaction by Alpha-Site Ligands.
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 102
structure length 257
sequence length 266
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2006-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2cloA00
2YYUA 1D9EA 3OVPA 3A24A 1NF7A 4X3ZA 3KRZA 2D73A 3T7VA 4RK8A 1JUEA 3CT7A 4LS1A 1DQWA 3PB0A 1QO5A 2NWSA 3NM3A 2BZNA 3A22A 2ZFAA 3W2MA 4O52A 3DI1A 1SW3A 4AEOA 3LCFA 1EP1A 4MY8A 5LNWA 4DF2A 1CI1A 2ZZ4A 3KHJA 3HPXA 3C2OA 4KWVA 1FDZA 3H54A 3LRLA 4KKXA 2QR6A 1FY6A 3LRMA 3C4UA 2ZZ3A 4MLJA 4A2SA 5BNKA 1H1ZA 1J4EA 1SO3A 1ZFJA 4GJ1A 4N02A 3ABQA 2ZRXA 4K38A 2A1YA 3GDLA 1KBIA 5KSWA 4R7JA 1H60A 1QWGA 3TC6A 3FIGA 3TX9A 2VELA 4ADSA 1W5MA 1XI3A 3M47A 1LROA 3P81A 3NVTA 1GPWA 4LV9A 1YDNA 3HB9A 2VFGA 3L21A 1ZAIA 3G0UA 2ZA2A 5DCEA 4NXSA 5HWNA 1X1OA 1FCVA 5KZEA 5FI8A 4UC5A 3CPRA 5HWJA 5AC6A 5TQLA 2ZZ2A 1M7OA 3GDKA 4XWUA 3DXIA 4LY8A 3S5OA 5HR6A 5LNVA 3BLFA 3NQ7A 5FF7A 1TPVA 2NXGA 2VEMA 5D37A 2VKZG 3GLCA 3W1AA 3TXVA 1QO2A 1P0KA 4O1AA 4UMAA 3F03K 5FF4A 4JYEA 3KVLA 1SZFA 3S5NA 3W6YA 4QAIA 1FDJA 3N2MA 2V2DA 4O15A 4K36A 1T96A 2AQWA 3E9AA 1LBLA 2CZFA 1W3TA 2YR1A 3EWBX 3NM1A 3CLMA 4GUHA 2DP3A 3DHDA 3U2OA 3FKRA 3L0GA 1ICQA 1QCWA 1LORA 3ZS4A 3HF3A 3NQAA 1VQTA 3W7OA 3PG9A 4RLIA 2J24A 3EX6A 2QCNA 1GQNA 4XUGA 4M7SA 5FEWA 2E6FA 1HL2A 4AWUA 1JUBA 5AHLA 4NNBA 3L5MA 5D30A 2WNQA 2ATSA 2I14A 2RDUA 1SFLA 2V0TA 4JTHA 3NPWA 3HGSA 3QPYA 3DKLA 3LLFA 4PL2A 2VXNA 1QPQA 1UASA 5I3IA 1QR7A 5EYWA 1RD5A 2A0NA 3FLUA 2ISVA 3A23A 1ME8A 1TQXA 2JKAA 3O15A 4XKYB 1EA0A 2YW4A 1VC4A 5CGQA 3TMQA 1U83A 4QISA 1P0NA 1IIHA 4K7VA 1YXDA 3S1VA 1HO1A 1TCDA 5ABTA 4UTTC 4JTUA 1W3IA 1O60A 3LHTA 1OHLA 3L9CA 3Q94A 2BXVA 3LTSA 4HSOA 4LTSA 1K8ZA 3OEXA 3HO8A 1PVNA 1WBJA 3AJXA 1YPFA 1TTQA 4MJMA 2A4AA 1TTIA 4NJJA 1JCYA 3PR2A 4NNAA 3JR2A 1S3HA 4DF0A 4WXYA 4BI7A 1WQ5A 5BMXA 3KAOA 3W7QA 2TRSA 1GYNA 1OFRA 3AO0A 1UB3A 3T78A 3C2EA 1RQEA 1UBSA 5K4ZA 5FEPA 3W86A 1VLWA 2TPSA 3P67A 4H6KA 3GXPA 5DLCA 1KM2A 3QMTA 5CSRA 1BWKA 5C5YA 3G1YA 2A7NA 4BF9A 4ADTA 4Y8FA 3NL3A 1JCLA 4O0ZA 3CU2A 4AHQA 1QOQA 2Y63A 3BGJA 2QAPA 4UR8A 2PRMA 3C52A 1OX5A 5F1VA 1JULA 1KW1A 5DXYA 3E02A 4BFAA 3KX6A 3BPWA 1ZALA 4WZHA 1L6WA 3NL2A 4RZ4A 4HNVA 5D2TA 5G4WA 4O13A 3F4NA 4KWWA 3W3OA 4MYAA 5AHFA 1ZCOA 3K30A 3TSMA 4JTTA 3SY5A 4IMFA 4S2CA 1JQVA 1KM4A 4DEFA 5E0KA 1JCXA 3NR0A 4AWSA 3C61A 3I7SA 2FDSA 3BARA 3GDTA 1I4NA 3RF9A 3ATYA 1XL9A 3VNDA 5BMWA 5A5WA 3M5YA 1GVRA 1GTHA 3GB6A 3USBA 3I7RA 3OG3A 3NNTA 1IXNA 3P8JA 4LWWA 2Y7DA 1PL9A 3C2VA 3L0NA 1B9BA 5IM51 1KV8A 2VEIA 5DY2A 1R30A 2FQIA 1JR1A 4FXSA 1YYAA 1ICSA 3GXNA 4Z08A 1QPOA 3PM6A 2XN2A 2QDHA 1TPDA 1A5BA 4EWND 3BLEA 2YFNA 2ZBTA 4HPJA 5HQEA 6TIMA 5KZMA 1G4PA 1OVDA 2V5LA 4NXKA 1OFDA 4FNQA 3W74A 5D2YA 4FHAA 1EX5A 2WKJA 3LERA 1WAUA 5HUOA 4P61A 4CQ8A 2IQTA 2ABAA 2E5DA 3QEZA 1XKYA 1DORA 3C56A 1PIIA 5CPMA 1LRQA 1BTMA 3TKFA 3GIYA 3NQGA 1FWSA 5CPNA 1X7FA 4N4QA 1YXCA 5MHBA 4DBDA 3H53A 5D02A 4OE7A 3RMJA 3W85A 4LNYA 1C9DA 1H7PA 4O54A 4FX7A 4LS2A 5KITA 2NUWA 4I7UA 1KLZA 1IF2A 5A8GA 3MW7A 1TV7A 4UMCA 4UTWC 3MP5A 3UWYA 3TNOA 1FXPA 1PV8A 1ZHAA 2O7QA 2H3DA 2ZCGA 2E5BA 3P74A 4W9TA 5C55A 1PS9A 5D05A 4O10A 2ZZ1A 3STCA 1TQJA 3W1QA 5G2HA 5F4XA 2BLEA 4MYXA 3KXQA 2YW3A 3QH2A 2NX1A 1JJKA 3L67A 3BLIA 1TPWA 3PULA 3EEGA 3NQVA 3VCRA 3W83A 5F1UA 1DHPA 3QYQA 4NX5A 1TV5A 2DJLA 7TIMA 1SR9A 1LYXA 1LLWA 3PY2A 4RCXA 3PVFA 2DU2A 2CU0A 3LV5A 4ZQPA 2XN0A 4DO5A 3M6YA 1ME7A 2NUYA 3O63A 4CQ9A 4DQWA 4FO4A 3EX2A 4EF8A 1WOAA 4QNEA 3TSDA 1GZGA 3EWZA 5HMSA 1IIGA 5D2XA 1SW7A 1G7UA 2JKPA 1Y0EA 1AG1O 2WSQA 1VR6A 1I45A 3FEMA 2J9ZA 3BV4A 1VLIA 1DJQA 3W72A 3N19B 2ZRZA 2WQPA 4JDBA 4UIOA 3R8RA 2Y89A 4WJEA 1ADOA 3W07A 3NOEA 3EX3A 1LP6A 4UNLA 5FF3A 1MEHA 3L5AA 3QSTA 5HUPA 2ZRWA 1GTEA 4ZZ9A 2CZEA 4R34A 2QCDB 1T0OA 3GKAA 4L4MA 4NU7A 4WQ6A 2C14A 1NVMA 1QPNA 2B7OA 3VFLA 3PBYA 3HIJA 3W7CA 1H63A 5IBXA 3TH6A 4D2JA 1LLZA 3BO9A 2WNZA 2PURA 4M6QA 1H50A 1N8FA 3G1HA 3MBDA 3UZJA 3HQ1A 1XBXA 4A29A 3W23A 3GNDA 4WD0A 1AW5A 1FWTA 2A5HA 4N6EA 2FJKA 3LCWA 5I3HA 2CWNA 4MPQA 4HNUA 1Q45A 1Z42A 3MI6A 4XTDA 1K3UA 4BI6A 3M41A 4NT0A 4Z1CA 4BWLA 1K03A 1OFAA 1QDSA 4UFHA 4AHPA 2YCEA 3G24A 3M7WA 4ICNA 3BW4A 3CWOX 4Y9AA 1OABA 4Z1DA 5LNRA 3D0CA 3FA5A 3OIXA 1XDMA 2Y7GA 1GG0A 4AB4A 4HPXA 1BWLA 1VYSX 4DPQA 2ZTJA 4QQ3A 1H5YA 3PBWA 5K4XA 3R2GA 4LUJA 5AHNA 3QQ1A 3QZEA 5AOUA 1EWEA 3CEUA 2CLHA 2NXHA 4JY9A 2HSAA 4RR4A 4DO4A 2NLIA 3MHGA 3I6RA 3W7MA 3LTYA 2EF9A 4MFDA 3NQMA 3I65A 1TPEA 1VYPX 4M7TA 2QJIA 4O12A 4AXKA 4E38A 5AB3A 4HN4A 4Q32A 4K8HA 3NXFA 1Z44A 5D03A 4UUIA 2BX7A 3CM4A 2RFGA 4IX2A 3IIOA 5BOOA 2A6NA 1O94A 4JEQA 5AHEA 1OG0A 3FFSA 3BK0A 2X2GA 3RLVA 2Y62A 1TTPA 2P0OA 1UUMA 3BG3A 3W75A 1W54A 2WV8A 3SSJA 1ONRA 1R46A 1W3NA 2FIQA 2VENA 1I2PA 1ZENA 3GKFA 1W31A 3YPIA 4POCA 4C1KA 3Q37A 1G4TA 2YSWA 1LCOA 3W7HA 2GQ8A 2E09A 3CIXA 2WOQA 3U8GA 3QRHA 3DU0A 3TJXA 1LBFA 1RQHA 3IVSA 3S1UA 4JYFA 5F2IA 3HGOA 5FF0A 4RXGA 2VEKA 2V5BA 2QCGA 3G1SA 1RQBA 2F84A 3G8EA 3NQEA 1KFLA 5TBOA 3NPUA 3C6CA 3M0ZA 2VC6A 4JIQA 5D38A 2QCFA 1HTIA 3DFSA 5D04C 1OFQA 5L9FA 3O07A 1OF6A 1TPFA 1D3HA 3L65A 5K9XA 3W88A 8TIMA 1KTNA 1PCKA 1T8XA 3OVRA 1PHWA 4N2YA 5HINA 5K2ZA 3EWWA 1R2SA 3GDRA 3IIVA 2QUUA 4A21A 2WJZA 5BRBA 5EY5A 1X6UA 3TW6A 2NZLA 4CLMA 1QPRA 5KZDA 1LRTA 2FB2A 4LW7A 5G5IA 3PBVA 2RDWA 4LVDA 3P82A 3PSWA 3QPZA 3HMJG 5LZLA 1Z41A 1VS1A 1EUNA 4Q4KA 3B8DA 2JGYA 3UWUA 3LBCA 3QFEA 5I3JA 3M9YA 5EMUA 5AHIA 5F4SA 3W1UA 1OFPA 2WNNA 4QNWA 4BK9A 2X16A 4JD4A 1XBVA 3W87A 3MHFA 3W1RA 2X1TA 1OYBA 4JTSA 3G1DA 4JN6A 1X8FA 4Q33A 1AK5A 4O53A 5CSSA 1T99A 4NUWA 4DXVA 3HPZA 2DZUA 1G7VA 2OT1A 3M1ZA 5D33A 1RZMA 2V9DA 1TPC1 2E77A 3QSRA 3HPSA 5G2IA 4GRSA 4O19A 5AYZA 2CLMA 1H7XA 1LOQA 5LGZA 1PCWA 1KM1A 3SR7A 4YCPA 2NV2A 3KVJA 3QC3A 1OYCA 4UCGA 4CNPA 1MEWA 3A5VA 3QMRA 4JIPA 2Y6ZA 3LRKA 3R12A 3EXTA 1N7KA 4WOQA 2NUXA 3PUDA 2RH9A 1F05A 4XZ9A 2DORA 1TPB1 5K9DA 4X2RA 3RFAA 3W2LA 3ZFHA 1AL7A 3IVUA 3VE9A 1YPIA 3RLUA 1KFKA 5KINA 3UY8A 4YL2A 4LU0A 2DZSA 4LVGA 5D09A 2NWRA 3TXZA 3TCEA 1EPXA 2V82A 5LKYA 1IXPA 2QJHA 3V75A 4Z0JA 1FCQA 1P4CA 3W7LA 4AF0A 2B4GA 2KZHA 4UTWA 2B0MA 3FYOA 2Q8ZA 1TO3A 3B05A 4IX0A 3IEBA 5CKSA 1F73A 4BR1A 2ISSA 3LTPA 4YWIA 3TDFA 1H51A 3P84A 4NJIA 1GVSA 2HS6A 3TC7A 3SFKA 2Q3RA 4O1CA 3UXDA 4PA8A 3EKZA 5K9CA 1B57A 1GVQA 5CZ0A 2O7SA 1TPUA 2DJXA 3NGJA 5SWUA 1W5OA 1JRCA 2C15A 4P2VA 3ABRA 3B03A 3TR2A 4Y90A 3G22A 4YCOA 3G1VA 4GUIA 1NAL1 4FIRA 3IIZA 1MZHA 1NFBA 4TMBA 4FIQA 3FKKA 2ZA1A 1J5TA 1SW0A 2OX1A 3LHYA 2CZDA 1AMKA 2G97A 3W73A 3MI2A 2CFFA 1KV5A 1OK4A 1ZAJA 4K8EA 3NZ1A 2QJGA 3HG4A 1RPXA 4Y6GA 2H90A 1SPQA 1RV8A 3G3MA 4FNUA 4O18A 2ZZ6A 4LS0A 1VGAA 5HR7A 1E51A 4AAJA 1ZAHA 3VI2A 2OZ0A 4N9BA 3OBKA 4K37A 1O5KA 1DOSA 4M6VA 5C2XA 1F76A 1GVOA 3CC1A 5LNUA 3UZ5A 3NQDA 5G4EA 1IGSA 4ML9A 3UQNA 3PWAA 4WXZA 2DZPA 1G4SA 1WOBA 1JCJA 1DKWA 4GFSA 4OV4A 1FDYA 2C13A 1TJRA 4XBKA 5LSMA 2CLIA 4KFOA 2BSLA 3EXSA 4YLWA 4B5NA 2NX9A 4R53A 4MLRA 2WO5A 4GUJA 3S1XA 1THFD 2UV8G 2A7PA 2XFWA 1KFBA 3VKJA 1OFOA 2J6XA 2ZYFA 3E49A 5AYXA 4JS3A 2FPTA 2NX3A 1YTDA 4O50A 1I2QA 3KOFA 1HFBA 3PBUA 2DZXA 4JX6A 4FF7A 1EB3A 3W22A 1EWDA 2YFOA 1NEYA 2WSRA 3STFA 1P5BA 4JTIA 3B0VC 2YPIA 1S5VA 2F7FA 3ABSA 3U6WA 4WY0F 5CPOA 5AN7A 3DAQA 3EWUA 4EOUA 1TMHA 2QAFA 2R8WA 5DXXA 2FFCA 4RZ5A 3SI9A 1L2UA 2Y88A 2CW6A 2YDAA 4NQ1A 3QM3A 1Z48A 3CWNA 3TQ0A 4DBEA 4IWWA 4IQLA 1CX9A 3ELFA 2PC4A 1L9WA 4O17A 5AC8A 2ZRYA 3TV8A 2EPHA 1KM0A 1TB3A 1FX6A 3KVKA 2QCEA 1RR2A 3OVQA 2B7NA 1RVGA 5HJLA 4AMAA 3HBLA 1K02A 4Y96A 3G1AA 3N9RA 1VHNA 3W7RA 4N6FA 4WY0A 2VFEA 1QOPA 5EKYA 1VJIA 1G69A 4JTLA 5J5RA 4JNMA 2ZZ7A 3EB2A 3W1LA 1CW2A 1ZY9A 5E93A 2LLEA 1XDLA 1FWRA 4ONVA 1DV7A 3B04A 4LRTA 4C1LA 1A53A 3N73A 4Z0SA 3S9YA 4UTUA 4K6AA 1BEUA 5CZSA 3UWZA 3WK3A 1SQ7A 4OT7A 4UTMA 2CLKA 3LV6A 3MBFA 5F2MA 5L6UA 1B4KA 1JCMP 5J5DA 3EKLA 3NPXA 1VPXA 3FYPA 4IMGA 3MYOA 1Q6OA 4HKPA 4TO8A 4IOTA 1DVJA 3DKJA 4LVBA 4UR7A 4O4VA 1ML1A 2BTMA 4PCFA 3S1WA 5D2WA 4AHOA 3BW3A 5EBUA 1AW1A 2ZRUA 2J27A 3GNNA 1G67A 3GZ3A 3ATZA 1VCFA 3QW3A 1LDCA 1I2OA 4ALDA 2AGKA 2JGQA 5DCBA 1WX0A 2GQ9A 1OFBA 4ZQOA 3LM7A 3HGRA 5G2WA 2QUTA 1TRIA 3NDOA 2Y85A 2X1RA 3QW4B 5EL1A 3W84A 3HG2A 4TX9A 1EEPA 2E68A 1VYRA 3SGUA 5EA9A 3VE7A 2GJNA 2VFDA 1YTEA 3W7NA 3I7QA 3LHWA 4X9SA 2FPVA 2OMAA 3EWYA 1KM5A 4PODA 4OWGA 5CG7A 4M19A 4JX5A 4OBTA 3CQ0A 3WK0A 4RX0A 4O1BA 1VH7A 4U4MA 1JUKA 3A9IA 1KBJA 3G18A 1W0MA 3HGJA 1VZWA 3C2RA 3O6CA 3M43A 3HOJA 1UUOA 2JK2A 3WJYA 3O05A 4JX4A 1OX4A 4UTJA 4OV9A 1LTDA 3INPA 2ZQ0A 1Q3NA 2NXIA 4UTKA 2C3ZA 4ZMGA 4M6PA 5HWMA 3ANYA 3UWWA 2GUUA 3THAA 2J88A 2QF7A 2ZZ5A 1WV2A 4JTJA 1XM3A 2PRHA 4DELA 1ME9A 4RKAA 3T44A 3TW7A 4LUIA 3RK8A 1KM6A 2AAMA 4MZ8A 1HO4A 1TIMA 1WA3A 4LVAA 3IVTA 4LT9A 2A6LA 2TSYA 1MSSA 4FNSA 1H7OA 1B4EA 4FXRA 3LGEA 4CQAA 3GDMA 4UXDA 5HULA 4E2BA 1SUXA 3LDVA 4E2DA 2PRLA 1S5WA 2QUVA 3TQVA 3MMTA 1VCVA 4MIMA 3LCIA 2FPYA 4XTIA 3S0CA 3DBPA 1K8YA 5BW6A 3LHUA 4FNPA 2C0AA 4MKNA 3DFNA 3P61A 3TSBA 3M5VA 3Q2DA 1K7XA 4AVFA 3TUUA 3S8HA 3NPVA 4NZJA 3W7IA 1F74A 2XN1A 4O8RA 3GK0A 3W1NA 3EX4A 5G1TA 4DPPA 1UJPA 1LZOA 3C2FA 2FB3A 4IMCA 3C8FA 2OCZA 3MP3A 1V5XA 4RZ6A 4JTEA 1W8SA 3L66A 1TV8A 1TJPA 3SECA 1YDOA 2R94A 4ZQNA 3S5YA 2GVJA 1MEIA 3UPBA 2YX0A 1YXYA 2OJPA 4JY8A 1ICPA 3WK2A 4O11A 1K7EA 1H7WA 4HT3A 3W1PA 1HG3A 1VHCA 1JRBA 3PUOA 3CTLA 3GVGA 3SW6A 1XBZA 2X30A 4PEKA 4A3UA 4CCDA 1FCUA 2VFHA 4UTTA 3ABOA 2ATMA 3WK1A 1O4UA 1U5JA 2VOMA 2I9EA 3ZR4A 4O14A 2Q8LA 1A5AA 5G1YA 3P5ZA 3A5FA 2PE4A 1FCBA 1DBTA 4IPIA 1SZNA 4LC6A 2EGZA 3R5EA 4L4LA 5FF2A 2E6DA 1GJPA 4IUOA 4KFPA 2Z6IA 1L6YA 4JYDA 1D3GA 4I9AA 1GOXA 3W7DA 2GQAA 1YTKA 2J9XA 4HHPA 3NG3A 4NX0A 3MYPA 4FB7A 4O0KA 1YDVA 3KRSA 3GAKA 3OHIA 4PH6A 1HUVA 1X1ZA 1OYAA 1UCWA 4OHQA 4UFMA 3DFTA 4GE8A 4JR5A 2A21A 4M5PA 5I3KA 4QIUA 3T40A 4UTHA 3LXCA 2X1UA 5DY3A 1F6KA 2E6AA 5GVJA 1NSJA 1WYIA 4WOZA 1SO5A 1PHQA 3V1PA 2R91A 5AYYA 4LC8A 1TRDA 1F7BA 3N34A 2QCLA 1W5NA 3B4UA 4PL1A 4MUZA 3KRUA 2YYTA 2RHGA 1WDWA 2ISWA 3W71A 1LM1A 1I2RA 2ZA3A 2GOUA 3ZWSA 2VFIA 4DO6A 4G1KA 4ORIA 1KA9F 3TU9A 3W1TA 1KFCA 2QCCA 3N9SA 3N3MA 5I3FA 3PSVA 5C54A 4YXGA 4EVZA 2RKXA 1OF8A 1SSDA 1R2TA 3TMLA 4I7WA 5LHFA 4RXFA 4Z1AA 2EHHA 1XBYA 4AH7A 1AL8A 1O95A 4IMDA 3EWXA 4NJKA 2G5WA 3S5ZA 3G3DA 3L5LA 2JKEA 3G0XA 1K8XA 1SU5A 3MI3A 3IIPA 4RJEA 3LCGA 1J2WA 1EIXA 5IBXC 3MHUA 3A21A 4K39A 5AC7A 4ZVJA 2EAWA 5K3VA 2GVLA 1H1YA 5CZTA 3W70A 3WJWA 3G0SA 4FX8A 5KTLA 1W37A 4NJGA 6ALDA 4IXXA 4GNJA 2FLIA 1PE1A 1QFEA 3LI1A 2H3BA 1TTJA 3TK7A 2ZDRA 4I7VA 2X1SA 4MZYA 4AF0B 3SZ8A 3BG5A 3BG9A 4UNKA 3TFCA 1ALDA 3TQKA 4H4IA 4ADUA 4BWLC 1R47A 3E96A 3UXAA 3GX9A 1L6SA 4HNNA 4ZQMA 1F6PA 3IIXA 1EP2A 3P60A 5LNSA 3G1XA 4LOCA 2E1DA 5DELA 2R14A 1KFJA 2WSYA 1I2NA 3TE9A 1A5SA 4CCCA 1R2RA 3NL5A 2W0UA 3LHZA 1FWWA 1VRDA 1A50A 2GPTA 3CIWA 5FEZA 1NF0A 3O1NA 5U4NA 4OQVA 5LHEA 3B06A 4MZ1A 1YLVA 2A85A 5FESA 3LLDA 5U7SA 2P10A 5DN1A 3DGRA 2W6RA 4NVTA 1N55A 4X22A 3IGXA 4R33A 3M5ZA 3LX9A 4JDYA 3GYEA 1F5ZA 4K7YA 2Y7FA 2W79A 3DENA 4S1FA 4TMCA 4DF1A 2ALDA 1KTBA 3TAOA 5C6MA 3MUXA 5AHMA 1OX6A 1F2JA 3NL6A 1Q6QA 4UFKA 2ABBA 2C6QA 3NYZA 1XUZA 2VEPA 4WUIA 2RDTA 1KTCA 2OT0A 4U28A 4XKYA 3R13A 4A2RA 3PC0A 2V81A 5F2LA 3O8AA 1TSIA 1JCNA 3P8IA 3W9ZA 3JRKA 5CZJA 2E5CA 2DZVA 3EXRA 2Y7EA 1B3OA 3R89A 1W5QA 4XQ6A 4FNRA 4LVFA 3KFTA 1I8JA 1O5XA 2Z0IA 3L2IA 3DZ1A 2H8ZA 3NAVA 4LV4A 1C8VA 2V8ZA 4QM1A 3TAKA 3W2KA 3NEVA 3O16A 3GR7A 4MOZA 2G96A 1LBMA 1KM3A 2V30A 4MY9A 2PCQA 4UFJA 3DI0A 1XFBA 2YZRA 3GR8A 4JTGA 3CEPA 5CPLA 5EPDA 4TR9A 4IPJA 2C16A 3G8RA 4MVAA 3NZRA 5FEXA 1QMLA 3QJAA 1G4EA 3STGA 4HNTA 3B0UX 1H7NA 3WJZA 3EX1A 5TIMA 2QDGA 2H6RA 3NA8A 3BVJA 3S6DA 5T26A 3RNDA 4NNCA 1FWNA 3HJZA 4IXHA 2YGYA 4N9CA 3SJ3A 5LGXA 2ZRVA 3B0PA 2A7RA 4O57A 4O16A 3TJLA 3HG5A 3UWVA 3H55A 3W2NA 5E1QA 1V7YA 3TIMA 4GBUA 4PTNA 4CCEA 3PB2A 3JS3A 1AW2A 3LXAA 3WFAA 1SSGA 3O6DA 1A5CA 2TYSA 4WY0B 3P80A 1G6CA 4UFIA 3CB8A 1OJXA 1XCFA 1FXQA 4HSNA 4OU1A 1BKSA 3RU6A 3W1XA 3W7JA 3F1QA 4IJBA 4MFEA 2I1OA 4CNOA 3E0IA 2CZ5A 3UWQA 3LCLA 1W56A 1TREA 5F4WA 3FJLA 3QQ0A 3PAJA 3PUEA 4N4PA 2A2IA 1VCGA 1IXQA 4H3DA 1M5WA 2QEZA 1KLYA 3IV3A 2QKFA 3KVMA 3L0KA 5DCDA 1GYLA 3CHVA 3W7GA 2WPBA 3UNDA 3SGZA 1XXXA 3P7YA 3W76A 3DH7A 2V2HA 4JTKA 2Z2UA 4Z1BA 4UFLA 1Q6LA 1GG1A 1TYGA 2Z6JA 3DFQA 1LRNA 4JTFA 3MO7A 1GEQA 4O1DA 3BGGA 2CLLA 2Y61A 5KMYA 4J9JA 3MWAA 4N9DA 4GUGA 1TPH1 2BWGA 4ORMA 2C18A 5I3GA 2Y70A 3ZWTA 3P62A 3TROA 4E0CA 4N9EA 3LOTA 4O28A 1ZJIA 4WX2A 3W7PA 3WJSA 3NQFA 3PS7A 3E12A 4O4WA 5DBUA 2V2CA 1JVNA 3T4CA 4ZQCA 2B7QA 3DFPA 4PC8A 3LCHA 5F2GA 1QAPA 2Q3OA 3P5YA 1SO6A 4KFNA 2P1FA 1MXSA 1OX4B 2NV1A 3TA6A 3C0JA 5AFDA 2DZTA 1H62A 3LHVA 3S42A 5D32A 4ZQRA 5HNRA 3N14A 4FNTA 5D2VA 3G1FA 4TU1A 1DQXA 1FUYA 5H91A 3M44A 2EKCA 2YXGA 2CLFA 1DJNA 3UYCA 1LOLA 1W5PA 3M5XA 4FX6M 4PFMA 1XC4A 4CNNA 3FOKA 3Q58A 4JICA 1W1ZA 3W1MA 1M6JA 1OK6A 1DL3A 1EP3A 2H8XA 2QCHA 3BW2A 3LB0A 3C3NA 3DFOA 3UY7A 2JBMA 1S5TA 2FTPA 1WBHA 1JQXA 3UD6A 1K7FA 4RV8A 2GVGA 4FEZA 4QSHA 3FS2A 4GUFA 2C19A 3DHFA 1LOSA 4GXMA 1SZGA 3LCXA 4BI5A 3W2UA 2HMCA 3M16A 3O6YX 4MJZA 4LRSA 3THQA 1XUUA 3FJ6A 2B7PA 3MJYA 4GWEA 1EUAA 3LBMA 1IXOA 2QCMA 4TIMA 4NJHA 2VFFA 3W7KA 4IMEA 1H7RA 2DZWA 1SZEA 3MP4A 3NQ8A 4OGZA 3TFXA 1KFEA 3IGUA 4S2BA 4UTLA 2HS8A 3NQCA 2ZTKA 2HTMA 2CLOA 1YADA 3NQ2A 2QCDA 3OA3A 1MO0A 3NQ6A 2TMDA 1FBAA 1ZNNA 4GC4A 4IGHA 1SFJA 3W7EA 3IRDA 2G95A 3LI0A 4HIBA 1H61A 2Z1BA 3L68A 4MY1A 2CLEA 3IGSA 2E6YA 3HG3A 4JGDA 4QITA 3SIZA 1GVFA 1M7PA 5DBTA 3T55A 3I68A 4JXCA 3F4WA 1P1XA 1Q6RA 3LXBA 4QJ1A 4EF9A 1SO4A 1OFEA 4XBSA 3GAYA 3QMSA 3GXTA 1WXJA 2J9YA 1GT8A 4ZL1A 2C1HA 2GJLA 3STEA 4EIVA 3PF3A 4YMZA 4UTIA 4NZFA 3UPWA 1GWJA 3WJXA 1C29A 3NO5A 3N2XA 3W2JA 3O06A 1QNVA 5K7JA 4A22A 5H2ZA 1FQ0A 4AWTA 3QF0A 4UMBA 3PG8A
chains in the Genus database with same CATH superfamily
3PTQA 2YYUA 3VM7A 1D9EA 1OINA 1NF7A 4J5NA 1XIMA 1CT5A 4EPDC 3KBSA 4RK8A 5C9WA 2DFAA 2J7BA 3FGCA 1L8NA 4S39A 4O52A 2VRJA 1W2VA 2XFFA 1UUQA 2PLMA 2ZE0A 4OJYA 1E9YB 2QUMA 4H9MA 1OD8A 2FMNA 3C2OA 3WH8A 1FDZA 4KRUA 3N6QA 2AMXA 1Z69A 4GYJA 1J4EA 1QXLA 1XISA 4ZO9A 1SO3A 4GJ1A 4TUFA 4MF4A 5BOFA 3LD5A 2IXVA 1FKWA 2PDHA 1RUSA 4NI8A 2I5IA 4B5WA 1D7FA 4AYSA 1KBIA 1H60A 1ZBWA 4QG8A 1QHZA 2XGZA 4W8BA 1SMAA 2VELA 4PUDA 2NW0A 4ADSA 3MV01 1W5MA 1XI3A 1I1XA 1LROA 3P81A 1GPWA 2ZICA 1GYMA 3HB9A 2CHNA 2Z7KA 4XISA 5HWNA 4RDZA 1FCVA 4FOKA 4ZEPA 4RDYA 4UC5A 5AC6A 2VX6A 3A6OA 1JPMA 5FD0A 3N25A 4DB7A 3B8WA 2ACRA 2HV5A 4TV6A 3S5OA 5LNVA 3U4AA 4M6UA 3BSHA 4ROPA 2X1IA 1FWDC 3B97A 2Y2WA 3W1AA 3N4EA 1UR4A 5DX7A 2BS9A 4PCSA 3VNMA 1I0DA 3F03K 3KDOA 2D23A 2YDSA 1FDJA 2P8BA 1XCXA 3VIJA 4D6HA 3QY7A 3B9DA 4F9DA 4R27A 1AMYA 5JU6A 1BTCA 1ZU8A 2IS7A 1H1NA 3O0KA 3ZT5A 2DP3A 3H2AA 3WDQA 4HTYA 3DYOA 4M81A 4PSRA 2W9MA 3V0SA 3WMCA 1QCWA 5G4HC 3R8GA 1LORA 4CVWA 3HF3A 4RLIA 4KEUA 1YBQA 3L5MA 4LJ3A 2YZ5A 4LCRA 3LLFA 4HZ7A 5A69A 1UASA 4J3TA 1GCYA 1EBGA 4QROA 2A0NA 3FLUA 4A05A 2ISVA 1JXJA 2JKAA 4XKYB 1B9ZA 3H2EA 1I0BA 2BY3A 1P0NA 4K7VA 3GVRA 2VDHA 2E4TA 5G1MA 4J3ZA 3VDCA 1OHLA 2G3MA 1SM9A 5JQ9A 2BXVA 3M0MA 3LTSA 4CU7A 2DSZA 4WCJA 1LT7A 4HSOA 4LTSA 3GU2A 1M53A 3UZYA 1PVNA 1C7SA 4FF5A 1MFUA 2IW0A 1YE6A 2A4AA 2E67A 3CT2A 3WNPA 4NNAA 4QE1A 3S1GA 3HPAA 1QRQA 4DF0A 1MW3A 4JBRA 3HPFA 4L80A 4BI7A 5BMXA 3KAOA 4ZB0A 2A3EA 4QTGA 2TRSA 1OFRA 3T78A 1HKVA 4NL1A 1FA2A 3OG2A 4YTSA 3BURA 2WVVA 2JE8A 1VLWA 4AZ6A 3P67A 9XIMA 1FFQA 5DLCA 3A4XA 2I5QA 4L6HA 5CSRA 1XG4A 3I3DA 4BF9A 2J78A 4ADTA 3VKBA 4O0ZA 2D24A 3SEPA 2Y63A 4UR8A 2WC7A 1UIPA 1OX5A 4YTUA 1T40A 1KXHA 4DRSA 2OKOA 3B0YA 5DXYA 1ZALA 3F4NA 4KWWA 1TX0A 1V08A 4ZCWA 3M4HA 4U33A 3K30A 3SY5A 1JNEA 4HCDA 2ADAA 1FH8A 3VIMA 1JQVA 3ICJA 4DEFA 2FHCA 5E0KA 2OO6A 4LUYA 1JCXA 1EJXC 1IWAA 2Z4GA 4HHHA 5EB8A 3H21A 1P1MA 3HV8A 1RVKA 1S1RA 3NNTA 4LUSA 4DXKA 4KWSA 3L0NA 2VEIA 3WF2A 1R30A 5GQBA 1Q66A 4R7WA 4GYPA 3ZJ6A 3MSGA 4FXSA 2C71A 1PYFA 3WF3A 4EPKA 1IEIA 1JZ6A 3I6EA 5HQEA 5KZMA 2V5LA 4NXKA 1OFDA 2Z28A 4UR9A 3EEZA 4BF5A 4P61A 1KCKA 1NTHA 1R3QA 4N42A 2ABAA 3OZYA 1WUEA 5BU6A 4CNSA 3B8SA 2WKGA 1MQPA 3TKFA 3T09A 3H7VA 4D1JA 4N4QA 1XLKA 2EG8A 4DBDA 3GU1A 2J7EA 4I5RA 3CGTA 4YYCA 5FACA 3RMJA 4W4QA 4QLJA 4XUYA 4WIWA 2HVNA 4FX7A 1XR2A 4X0NA 2P8CA 1KLZA 5A8GA 1TV7A 4Q8UA 4NZ3A 1WKDA 4H8NA 2C0HA 3MUAA 1XKJA 1ECEA 2VC9A 5D05A 1W9PA 4CNUA 1HIZA 2GJPA 3GW0A 1IZCA 1QVBA 1P0EA 4CGTA 2YW3A 2ZXBA 4US5D 4AIUA 1TPWA 2VX4A 3PULA 4PMDA 3UVAA 3RPTA 4QSFA 3RILA 7TIMA 3EDDA 1LYXA 3EMZA 1UD4A 1MRAA 4H7ZA 1F4AA 4DO5A 1ME7A 2R82A 3O63A 3EX2A 3O2LA 4QNEA 1DXIA 3TSDA 3EWZA 1W3HA 4XG1A 4H83A 4MTVA 2R1PA 3UG5A 3ZR6A 1S5NA 2BGSA 4WKFA 4PB5A 3W72A 1Y7VA 3WLHA 2JFEX 3N19B 2ZRZA 3GD6A 2PWVA 2WQPA 4JDBA 1HNYA 3Q67A 3LGGA 4WJEA 3FYYA 3CUGA 1H5VA 4UNLA 5FF3A 4J3XA 5HUPA 3EDFA 1W3LA 2GUYA 2QCDB 1T0OA 4NU7A 3CHFA 4C90A 1NVMA 2WQDA 3U2ZA 1QPNA 2JF7A 2GDVA 3IV8A 3GXDA 2B7OA 3QKEA 1P6BA 3W7CA 1CGXA 1V0NA 3TH6A 4GKLA 3VCCA 4NRRA 5A6MA 4ZO6A 1N8FA 1TMQA 3ZYZA 3GNDA 4WD0A 3WH5A 3LQLA 4N6EA 4FALA 2GK1B 3LCWA 4EPEC 2QULA 3FAXA 3WN6A 5A2AA 4W5UA 2O4QA 4BI6A 4AVNA 2A3HA 4Z1CA 2GGHA 3IK2A 3QXBA 1K03A 3S5SA 1PZ2A 2YBTA 4XZBA 1QNPA 1DWGM 3KM8A 5GPRA 1ITCA 1CLVA 1BWLA 3F7JA 4DJFC 4LUJA 1E40A 4JIEA 3CEUA 5BXTA 3T1GA 1UBPC 4HBKA 5E6YA 4XZLX 4DO4A 2NLIA 3MHGA 2XZ9A 3VNLA 3UXKA 3I65A 1VYPX 3ARZA 4E38A 3E0FA 3CMFA 1XWYA 1M7XA 1OBAA 3KBMA 4HCLA 5LIXX 1GOKA 1J12A 4XD4A 3E2SA 3QTPA 3OU8A 3GHRA 1H0IA 2F6XA 2A6NA 3UA4A 3B9EA 3QBUA 5AHEA 1OG0A 2GWGA 2V5CA 2PLCA 3W75A 2DH3A 1WDRA 3W0KA 5ABFA 1W54A 1HP5A 3SSJA 1NDVA 1R46A 2FIQA 3GKFA 1W31A 3M0LA 1LQAA 1IE7C 2YSWA 3B9AA 3VO0A 1TZ7A 4MUPA 3CIXA 2WMKA 1DE5A 3U8GA 3QRHA 3MT1A 5TNVA 3ID7A 1GNXA 4JYFA 5F2IA 5CC3A 3HGOA 4PUEA 2OZ3A 1VEMA 2V5BA 2QCGA 3G1SA 2F84A 3BMVA 3ZLGA 3WQVA 2VC6A 4JIQA 5D38A 4AZHA 4XV0A 2QCFA 3ARRA 5D04C 3O07A 1TPFA 4ATLA 1KTNA 1ZRQA 1T8XA 3WMBA 2ANUA 2YDRA 2XSAA 4N2YA 2F2HA 1OT2A 1BGAA 4JTQA 5K2ZA 3EWWA 5REQA 1R2SA 1PDYA 3FX4A 1AD4A 5BRBA 2V5KA 1QPRA 1LRTA 3LS9A 3PBVA 2RDWA 3P82A 3C0LA 2F61A 3W29A 5A8NA 3IAPA 1VS1A 5LZLA 5HNNA 1RH9A 3HZ3A 4D6EA 4Q4KA 2VVNA 5IDZA 2J79A 4PBGA 3QFEA 2PP1A 4K3ZA 3M9YA 5EMUA 3REQB 1QI2A 3HJEA 3W1UA 1OFPA 2WNNA 3L23A 2WC3A 4DZAA 3KLKA 3R6IA 3VIGA 1LQ0A 3MHFA 1EF3A 3IANA 3G1DA 1X8FA 4J28A 1XHGA 5CSSA 1T99A 3WD0A 2GVYA 6CGTA 3GG8A 1CIUA 4NUWA 3M1ZA 4GQQA 2E77A 3QSRA 1K9EA 3VXGA 2PDCA 2CLMA 1H7XA 1LOQA 1KM1A 1L6GA 1RP8A 2Z25A 1V6TA 2NV2A 3QC3A 1OYCA 1MEWA 2IQDA 4JIPA 3UF9A 4G5DA 1N7KA 2NUXA 1EC8A 4DWSD 3PUDA 4DWSC 3W53A 2NT1A 5K9DA 2XIJA 1PKMA 4X2RA 4H8UA 2IXUA 4X61A 4F0HA 3W2LA 1YPIA 4K68A 5M3WA 5MKGA 3CAWA 5HOSA 4G7EB 4GGBA 2V82A 1UC5A 1ZPTA 3V75A 3N18A 1P4CA 1MUMA 4KEMA 1X39A 5CSYA 4AF0A 2KZHA 4DJED 1MW2A 4UTWA 4DJEC 1HVQA 2Q8ZA 1TO3A 5BROA 5IDIA 4NZ4A 2OEKA 1H51A 3OBAA 2HS6A 3TC7A 5A3HA 4PUJA 2X8RA 4IICA 3UXDA 1VPYA 4HU0A 5K9CA 4F0MA 2DJXA 1XFCA 4QE4A 5SWUA 1W5OA 4AD2A 1H49A 1P0DA 4QLLA 3B03A 3WLNA 1ESWA 3TR2A 5DO8A 2G3JA 3GSMA 1EJUC 4YCOA 3G1VA 4FLQA 4GUIA 3Q65A 3C2YA 4HK5A 4FIRA 4RDWA 1MZHA 3S83A 4TMBA 2A3CA 3VMNA 3R43A 4C6QA 1PO9A 1PKLA 3D3FA 3UG4A 2CZDA 3H23A 3VVGA 1X6NA 3A9BA 4MSSA 5D9MA 1PKNA 4DUOA 2QJGA 3G3MA 4O18A 2ZZ6A 3SN4A 1ZAHA 1Q2RA 3NFUA 1VFSA 1QI4A 4K37A 2P53A 1DOSA 4IGNA 4L6DA 5C2XA 3CC1A 3UZ5A 5G4EA 3PP7A 1E6SM 1UW9A 1G4SA 1WOBA 4PTXA 3BLOA 4J3WA 5T8GA 4OV4A 1TVPA 3VU2A 4GLEA 1RA0A 1TJRA 5LSMA 5JBEA 2CLIA 3EXSA 4E2OA 2VGIA 2ASHA 4MLRA 2EG6A 1THFD 3WF4A 2PWFA 1TJ1A 3THUA 3UNTA 4XK2A 4LYQA 4RE4A 4W88A 3VKJA 2ZYFA 3E49A 3R11A 5AYXA 4YPJA 2FPTA 2NX3A 2PWUA 4B91A 1M9HA 3CNYA 1EA9C 1QI3A 2DZXA 4O1FA 3GNXA 1EWDA 2WSRA 1P5BA 4C6MA 2YPIA 1S5VA 3DAQA 1TMHA 2O9TA 2QAFA 3WMSA 3KOWA 3U5UA 1RA5A 4QJ4B 2IKGA 2VZVA 2XHYA 2E3ZA 3GH7A 1W6TA 1Z48A 3CWNA 4DBEA 2V38A 4UWMA 1JEZA 1Q7ZA 3WL0A 3SSZA 1L9WA 3PTKA 4H8VA 4RPPA 1B90A 3PNUA 2EPHA 4EE9A 3WQOA 2DT0A 2G37A 4NAFB 1ISXA 1O5QA 1ZGDA 4GI4A 2PSNA 1JGIA 3N9RA 1VHNA 3CZLA 3CS2A 2ACQA 1QOPA 5EKYA 3N12A 1BFNA 3AXIA 3C0QA 4RL3A 3LU2A 1MQRA 5AECA 1FWRA 4AWEA 4G2DA 3B04A 4C1LA 3N73A 4UTUA 1SQ7A 4OT7A 3LV6A 4S3GA 1B4KA 1JCMP 5J5DA 3W25A 5EBAA 1VBJA 3TTSA 3MYOA 4UB9A 1JZ8A 4IOTA 1ML1A 1V02E 3VPLA 2BTMA 3KZPA 4AHOA 3VOFA 1OCJA 3HQPA 2J27A 3GHTA 3CZJA 3ATZA 1VCFA 5BCAA 3QW3A 2GUBA 3AXMA 1ZZMA 5DCBA 2D0FA 1WX0A 1OFBA 3IJ6A 3KCOA 2H9AA 2QUTA 3NDOA 2ZUUA 2CXGA 3HG2A 4DUWA 5CG0A 4RV3A 5DT7A 4W84A 3FK4A 4HNLA 4X9SA 1W1A1 4S3FA 4F0RA 4PODA 2BXZA 2D22A 3WK0A 3V0UA 2DSKA 3QLLA 2PD9A 4Q4RA 2W63A 3EA2A 1VH7A 2V6AA 1XIFA 2VNCA 3A9IA 1KBJA 5HAOA 3C2RA 3HOJA 1CPUA 1OX4A 2VGBA 3T4WA 3UJEA 3INPA 1FWIC 3UGRA 4C91A 3QTGA 2QF7A 2WK2A 1WV2A 2I56A 3GTXA 2PRHA 2VQTA 3DX5A 1KM6A 1HO4A 1X7IA 3GH4A 4LT9A 2A6LA 3COTA 5J8LA 1CB2A 3EYPA 3ITGA 3KCLA 2V5JA 3IK4A 4LSBA 1OIFA 4FAMA 2NQHA 1VCVA 1CBGA 3QHNA 2FTYA 3LCIA 2I17A 2IUZA 3LHUA 2WMIB 3M5VA 1W1VA 2HCVA 5LIUX 3R0UA 1K8CA 3WCZA 1QWKA 2EEXA 3U2CA 3W7IA 4U2ZA 5MF5A 2XN1A 3ZOAA 5DT5A 3EX4A 1LZOA 3P93A 4IMCA 3C8FA 2ZC1A 1TV4A 3ALGA 2R94A 1H09A 3MCNA 4LF1A 4L1WA 1JIBA 2PWEA 2BODX 1Z32X 2OJPA 2VEGA 3WK2A 4YU1A 4O11A 3AROA 1H7WA 4HT3A 1X38A 3W1PA 2PWGA 3AHVA 3WD1A 1HG3A 4I9MA 1F61A 1VHCA 3CTLA 2HZGA 5GJNA 3WELA 4W87A 1XBZA 5GJPA 1TE6A 4GPNA 3EOOA 3PPHA 4XKMA 5E70A 2PTXA 2VFHA 1AFSA 4UTTA 1RXOB 3A3XA 2VOMA 2I9EA 3EOSA 3WH9A 2VO5A 2L5HA 1V79A 2Q8LA 5G1YA 2Z2BA 4U3CA 1DBTA 4FLSA 3R5EA 4L4LA 3SRDA 1QBAA 4XSLA 4Q8OA 1XIHA 1VFFA 3CL8A 1D3GA 1GOXA 2J9XA 1YTKA 3UR2A 3GC5A 3V3WA 1UH3A 2QV5A 3NG3A 2VHLA 4NX0A 1RAKA 1C90A 4JHOA 3AU6A 3C0SA 4JEJA 4GK8A 5IFPA 1XGDA 1UCWA 3B3DA 4OHQA 4MB3A 4UTHA 1PIGA 1FVPA 3GIQA 5DY3A 1F6KA 2E6AA 1NSJA 3ARUA 1ISYA 5C9ZA 1TRDA 1F7BA 2QCLA 1X96A 1CGUA 1E56A 4PB3A 1WDWA 2ISWA 3W71A 1I2RA 4DUVA 2ZA3A 1WKYA 3L4VA 1GGOA 1DXFA 4JKKA 3BICA 1KFCA 2QCCA 5D8ZA 5CC5A 4CQCA 3WQGA 3TMLA 2ZX5A 4UQEA 4RXFA 1WNOA 4C6LA 3S5ZA 1WO2A 3L5LA 2JKEA 4GX8A 3UBPC 1NFGA 3LPFA 5EMYA 1BWVA 4W7UA 3C86A 4IH3A 3L4WA 1PUDA 3CUJA 4K39A 4ZVJA 5K3VA 3HTWA 3WDIA 4EX4A 2YCKX 3WJWA 3BUVA 3WQDA 1PJ9A 4B2DD 1ADSA 3R58A 1DJWA 1W1IE 1GK8A 1QFEA 1ZJHA 4GINA 2H3BA 4CD4A 2WMGA 2DUAA 2WM1A 3BG9A 3DHPA 3TFCA 4IUGA 4XD6A 4PMQA 4YTTA 3VOHA 1R3RA 4H4IA 1R47A 7A3HA 1XLLA 2X0YA 1EPVA 4HNNA 1OB0A 3ONCA 1EP2A 3AICA 3P60A 5JIWA 1OT1A 2E1DA 4AIOA 2R14A 1KFJA 2WHJA 4XBJA 1B3ZA 3R1ZA 4J40A 2W27A 4J3VA 5E9AA 3NL5A 3L12A 4PUNA 2CESA 3I4KA 4F2BA 3B06A 3NWRA 1YLVA 4MZ1A 4Y7EA 5AC4A 2REQB 4XVEA 2EPMX 3VOIA 3DGRA 3M5ZA 1QUMA 3WNKA 3L4YA 1YE4A 1J96A 3CZGA 3RPMA 2Y7FA 3DENA 4S1FA 7PTDA 3TAOA 4J27A 2Z1KA 5AHMA 2O0TA 3NL6A 3MU7A 1GW9A 3OIHA 2OQHA 3SUWA 4WUIA 2VEPA 4ZBCA 1KTCA 2OT0A 4XKYA 3BAJA 1XLHA 1XSJA 2CLPA 1DE6A 2V81A 1UD5A 2WAGA 2ZX8A 3O8AA 1JCNA 3P8IA 3OA5A 4GZIA 3W9ZA 3BLPX 3P0XA 4L56A 3L4TA 2P0IA 1UROA 3TQPA 3GNOA 3LK6A 3LBOA 4I8YA 2VTFA 4RNHA 2Z0IA 4ASTA 2H8ZA 3ZO9A 1R0MA 4FMVA 3GR7A 2E9LA 3N3TA 1BF2A 3SQSA 1LBMA 3U4FA 5H8PA 5EPDA 4Z2JA 2IKHA 1CXLA 3VMPA 4IPJA 5I06A 5A6KA 3V5FA 1QMLA 4OOUA 5A95A 1ISWA 3A64A 2H6RA 2XIIA 1EFZA 4NNCA 3AMGA 3IUDA 2QLYA 3WQCA 4O57A 4ERIA 2GQ3A 2WZMA 3UWVA 5E1QA 3TIMA 3AAMA 1K6AA 3HQOA 4CCEA 1V3MA 3JS3A 1AW2A 2YOCA 1FHDA 4E8CA 2YL5A 1SSGA 3IGHX 1C8YA 4WY0B 1G6CA 3CV1A 4HSNA 1BKSA 3KTXA 4HU8A 4MFEA 4AZIA 5AZ0A 1NIUA 2CZ5A 3LCLA 4O0QA 5DMLA 4GCAA 5LIKX 1JPKA 4MWAD 3QHMA 2QZRA 1V8EA 3PUEA 1IXQA 5XIAA 4C60A 3W6MA 4M80A 1U30A 4XD3A 4NKCA 2PBOA 1PTDA 5BOEA 3UJRA 1Q6EA 2Z6JA 1U2YA 3HM7A 3GUWA 4JTFA 3GY1A 4HA3A 4J9JA 4DN1A 2BOGX 1TPH1 1FH7A 4K1WA 1EDGA 3ZWTA 2DQXA 4E0CA 3GFXA 3S3GA 3OZOA 4O28A 3VDHA 3PS7A 4AFYA 3E12A 3GXIA 4H1ZA 1JVNA 4ZQCA 4DM1A 2BVYA 3T6CA 4AU0A 1A4MA 2QMKA 3PPCA 1EL3A 1T41A 3CTTA 3HFYA 3TTOA 4DJDA 3VDBA 5F2GA 1ZCCA 5LA0A 4NIRA 1TWWA 1SO6A 4G56A 1Z9AA 4KFNA 3KBVA 3BTNA 2NV1A 2BVDA 2X0SA 1E72M 3C0JA 5AFDA 3S42A 3UT0A 5D32A 2OXNA 2PUZA 5D2VA 3ZT6A 1DJNA 3UYCA 1LOLA 5KZ6A 1VENA 3VX0A 4EACA 1W5PA 4FX6M 1XIIA 4PFMA 3AMKA 2F6UA 4JICA 1W1ZA 5I5RA 1EIBA 1FWGC 1ITUA 3LB0A 4YN5A 2TODA 4GQRA 3DG6A 2FVMA 1W1YA 3DFOA 3UY7A 4RNIA 1XRSA 2FTPA 2RDXA 3QFWA 1GKRA 1K7FA 2OLHA 1HN1A 4RV8A 2OWCA 3DHFA 3RN6A 3WUBA 1LOSA 2C91A 4DBUA 4AZ7A 3LCXA 4BI5A 2RGMA 2HMCA 3BJFA 1CXEA 1UKQA 1E4NA 1V3HA 2WBKA 1IXOA 2QCMA 2POTA 3K1DA 3OZPA 1VFUA 3VNIA 1XRFA 4IMEA 4OKDA 3PK7A 1SZEA 3MP4A 2Q01A 3OQEA 2XSXA 5CLTA 1T5AA 4S2BA 2VRQA 1KBLA 3SCRA 3V5CA 2F9RA 1HP4A 3D46A 4H6RA 3EPNA 1UR0A 1Q6FA 2QCDA 1EJTC 3A4AA 3NQ6A 2TMDA 3DGBA 4NILA 4QE5A 1SFJA 2G95A 4JAWA 1J0IA 3WF0A 2CBUA 1RP9A 3VDGA 2E6YA 1M04A 3GTFA 3ZQ9A 2J8FA 1GVFA 1IEWA 3BOLA 1P1XA 2D1ZA 4V15A 4EF9A 1R5YA 2WHMA 3VKCA 2GK1A 2ZDSA 3GAYA 4B16A 2J9YA 3GG7A 4ZL1A 1XYZA 4EIVA 1E4IA 4NZFA 1GWJA 3WJXA 4W85A 3N2XA 3O06A 2Z1WA 3KTCA 4LCSA 3CUXA 3H2MA 3B9NA 4YHGA 3R79A 1HKIA 3BOXA 2E1WA 4O8AA 4X3ZA 2J8GA 3T7VA 1Y8BA 1FWAC 4LS1A 2GWNA 4Q4SA 2WLYA 4NAEB 4RNFA 3A22A 1E0UA 1SW3A 2HNHA 2QPSA 2ZZ4A 3M7SA 4LBSA 3A4JA 4CQBA 1AVAA 4MLJA 4A2SA 3K5XA 4CN1A 2P88A 4GIEA 4H2HA 3ABQA 2ZRXA 4K38A 1JDFA 3GDLA 2XH4A 4PYSA 2Z1SA 3TX9A 3GVQA 1JZ4A 3W4RA 3GTHA 4S3EA 4DIAA 3KZSA 3VKAA 3B8TA 3NVTA 4UQDA 4LV9A 1YDNA 1EH9A 3QN3A 3RPDA 3L21A 3N6HA 3WZ0E 3G0UA 3AUOA 2ZA2A 3LN3A 4BZYA 5FL1A 5FI8A 3CPRA 3U2EA 2X09A 2ZZ2A 4L4PA 3RITA 2PCEA 2QJMA 1QHPA 4H04A 4LY8A 5FF7A 1GOIA 4LQ1A 2NXGA 3VGBA 5A6TC 2BV9A 4DZIA 2VKZG 1OCQA 1OGGA 2E9BA 2INEA 3GLCA 4FXJA 1CEOA 1Q6DA 3QQWA 4CD5A 1U5VA 2HE5A 1QO2A 3SY8A 2Q8XA 1XLIA 3S5NA 3W6YA 1E71M 1WE5A 4QAIA 3N2MA 2V2DA 4IP7A 3BQ6A 3AUJA 1LT8A 1T96A 4K8GA 1V6YA 5CBJA 3EWBX 3G2GA 1HKMA 3SJNA 3U2OA 3LLXA 1EJRC 3FKRA 3WL1A 4Z2GA 1KKRA 1AH4A 4MM1A 3L0GA 3REQA 1UR2A 5TF0A 2CNCA 3ZS4A 3EA3A 3P3BA 4HSHA 3TYUA 4ZA0A 3H26A 2Y5SA 3EX6A 2E8ZA 4XUGA 1HL2A 1RJRA 1JUBA 1UQYA 4EK7A 4NNBA 5LIWX 2I14A 2RDUA 5EMKA 1SFLA 1E5NA 3NO3A 3NPWA 3DKLA 2J74A 4IFKB 1QPQA 4M1RA 3GYCA 5I3IA 5EYWA 1E5JA 4YIWA 3AOFA 4DVOA 4ZR8A 5CAKA 2YW4A 3GHUA 1UWRA 2FHBA 3T2OA 2J7FA 4QISA 1F9CA 1P6WA 3OLIA 2ZUWA 3LM3A 4PTWA 1VAHA 1KBBA 1YXDA 3S1VA 2MUCA 1HO1A 5ABTA 4HHLA 3CUIA 2QT3A 2FYMA 3Q94A 3WNNA 4UCFA 4IF2A 5FCZA 1M03A 4B5TA 1K8ZA 3OQ8A 3OEXA 3HO8A 1WBJA 3AJXA 1BD0A 1YPFA 4NJJA 4G7EA 3PR2A 2PC8A 1JZ2A 1BG9A 3TYAA 1TA3B 5HDRA 4HYVA 4WXYA 3T42A 3ZLFA 1GYNA 4W86A 4QX4A 1GHRA 5K4ZA 2J13A 2INFA 6XIMA 1KGUA 3NDYA 5FKYA 3GXPA 4C7DA 1US2A 1BYDA 1BWKA 4GQ0A 1SGJA 3G1YA 2A7NA 3B9OA 3CZEA 3SUUA 2VCAA 1UR1A 3GVVA 5CC6A 4L65A 3PJUA 4HNOA 2MNRA 4OUEA 3C52A 3IWPA 1JULA 1IEXA 1KW1A 1XLFA 2I9UA 3WLIA 3N13A 3KX6A 1ONXA 4NI3A 1OD0A 4WZHA 1H2JA 1L6WA 3NL2A 3TN3A 5A2CA 1JI2A 1ZCOA 2PGFA 3L4ZA 4JTTA 1KXQA 4XAZA 4H01A 3KUMA 1R87A 1KO0A 2FMOA 3NR0A 1GQIA 4AWSA 3C61A 3I7SA 2FDSA 1J0ZA 1DJGA 3GDTA 3HQNA 3VGGA 3SRFA 3VNDA 5I3DA 1CNVA 1OIMA 5A5WA 1GVRA 5BXRA 3USBA 4JCLA 1IXNA 4LWWA 4GC3A 1PL9A 2WHLA 3C2VA 1FWFC 3BC9A 3BMXA 3FA3A 4I9JA 2FQIA 1QATA 1JD9A 3GRIA 1DWFM 1V93A 3GXNA 3M0VA 2XN2A 4DAFA 1TPDA 1A5BA 4D9PA 4EWND 2ZBTA 1A0CA 4HPJA 6TIMA 1G4PA 1OVDA 3TLQA 3MKCA 3U7BA 2GGGA 4R9OA 2WKJA 2IQTA 1EF2A 2E5DA 3QEZA 5M17A 2I7GA 1DORA 1NWUA 1LRQA 3TA9A 3OYXA 3WKZA 1YXCA 3BLLA 3AIBA 3H53A 5HANA 2VUYA 3SDOA 2C7FA 3PAOA 3W85A 4LNYA 1BVZA 4F66A 3TN4A 1H7PA 2OWWA 5KITA 3PUGA 1QNOA 1V77A 1AQFA 1W3JA 3AQUA 3AIEA 4UMCA 4UTWC 5BXPA 5I00A 5GNXA 1PV8A 2BB0A 1ZHAA 4DZ5A 2H3DA 2Z24A 1TWZA 1GUVA 3MVIA 4NAFA 4AMCA 4O10A 1JDAA 1C7TA 5G2HA 3E38A 4XZWA 1TV3A 4MYXA 1MI3A 3U7VA 2D3NA 1JJKA 3BLIA 2PTYA 3NQVA 3VCRA 2HVMA 4L1XA 4NX5A 2DJLA 1AD1A 5LXXA 1SR9A 3BXWA 3WLMA 1LLWA 4QP0A 2DSWA 3GM8A 4RCXA 4I90A 3PZTA 3KP0A 2PZ0A 1MYRA 2DU2A 2CU0A 1ELSA 2XN0A 4EWJA 2HQAA 3WNOA 3M6YA 1B3WA 4FO4A 3UFYA 2W5FA 2CC0A 2GSHA 5D9OA 1D2KA 4GIYA 4TVUA 2JKPA 1Y0EA 3CJPA 5HMEA 3BV4A 1D8CA 1DIDA 3UA3A 2J4GA 2QMJA 3DC0A 4UIOA 3DFHA 1ADOA 3BOFA 3I3BA 3NOEA 2FGBA 4G7FA 3HMCA 3L5AA 4ZB2A 1XLAA 2NV9A 1GTEA 1WKEA 4R34A 3GKAA 4L4MA 3VZXA 1XLCA 4D6FA 3NSXA 4PRWA 3A3WA 3II1A 1XIGA 2RUSA 4DWSB 4GO8A 3V16A 5IBXA 4HA4A 2PTWA 1H50A 4OOZA 2NLYA 3G1HA 4OVXA 3MBDA 1ITXA 1NU5A 3ITCA 4GABA 2DSVA 1FH9A 4JTDA 1FWTA 4QFUA 2FJKA 3AHXA 1RCQA 3MI6A 3OTRA 5HQLA 3OGSA 7XIMA 2AAAA 5AVNA 3RG6A 4Q8MA 1J6OA 2XGBA 1NOUA 5HMDA 1QDSA 2J62A 1OCNA 2GGIA 1K77A 3OLGA 1MNZA 4WKAA 3BW4A 3POHA 3FA5A 3OIXA 3H2FA 1GG0A 1UR8A 4AB4A 4DPQA 2QIWA 2ZTJA 4PMNA 3R2GA 5AHNA 3QQ1A 3QZEA 1EWEA 2ALRA 2CLHA 5A8OA 3DHUA 3WQPA 3I6RA 3VIKA 4JZ5A 3LTYA 2EF9A 1TPEA 2QJIA 4WVXA 3WG6A 1MMFA 4M29A 2WMIA 2OLAA 4KBXA 3AIVA 3GVWA 1B3VA 3HURA 3ARWA 5BWFA 5M2FX 2YXXA 1WZMA 4XAYA 3W38A 2RFGA 4IX2A 3URNA 3IIOA 2YB4A 1O94A 3N2OA 4B15A 3LPOA 3FFSA 4N7QA 1TTPA 2P0OA 3BG3A 2E0PA 3TP4A 1LL7A 3ZR5A 4WEVX 4FI4A 3E0LA 1AZ1A 2OQYA 4POCA 2DGAA 2O4MA 4IPPA 2DEPA 1BVWA 3GC2A 3NSMA 1LCOA 5EGRA 2E09A 3WQFA 3HV9A 4ZFCA 3TJIA 3TJXA 1K4HA 4Y9NA 1LBFA 1RQHA 3E3HA 4H9YA 2Z29A 3CL6A 2EPKX 1UD8A 4RXGA 1XPYA 2NSXA 1P0BA 1ZQ5A 1RQBA 4N0RA 4WSHA 2YCLB 1FWJC 3MS8A 5FOOA 2CXEA 7REQB 1ZJBA 5L9FA 2ZXQA 3L65A 5K9XA 1IWPA 3W88A 8TIMA 2VZOA 3AS3A 3RJXA 1KC7A 4UNIA 3A47A 1W1B1 3GBEA 3VD7A 2UY5A 2YJQA 2QUUA 3P6LA 4A21A 3ZJ7A 1UWUA 3TW6A 2NZLA 1DXEA 5AKQA 4CLMA 3RM9A 4LW7A 4EP8C 5G5IA 3GWQA 3S2NA 3F2CA 4PMJA 5PTDA 3VUSA 3LQGA 3VIPA 1HL8A 1PXGA 1MW0A 1VPQA 3LBCA 3W82A 1E9ZB 5AHIA 5F4SA 2X05A 1AUSL 3CYJA 2VURA 4RW3A 3W87A 4ZSUA 3W1RA 2X1TA 4JTSA 4C6IA 3SY1A 4JN6A 1H11A 2OEJA 4FR6A 2DZUA 4JNYA 3K2GA 2QQ6A 1RZMA 1TPC1 3HPSA 1C92A 1S2UA 5G2IA 1AQHA 1MVYA 3LNMA 4H9ZA 1U1JA 1HGWA 4F0SA 2QXWA 3MQTA 3KVJA 4PUUA 4UCGA 4CNPA 2HXUA 2VR4A 2WCGA 2BFGA 1UIOA 3VZZA 4QDWA 2Y6ZA 3LRKA 3R12A 4NZ1A 4WOQA 4ATDA 1UJQA 2RH9A 1F05A 2XH2A 2IPFA 1PDZA 3IARA 1XYBA 2OOFA 2HBVA 4H00A 1VBUA 2PP0A 1IT8A 4WLCA 3RLUA 5KINA 4IFRA 4YL2A 3TXZA 1RPKA 2OYMA 1IXPA 1PSCA 3W7LA 3XINA 2B4GA 4IX0A 3CH9A 3SCUA 4BR1A 4LXFA 2ISSA 3LTPA 4YWIA 1QI5A 3P84A 1TR1A 4HK7A 3SQMA 3UG3A 1GVQA 3VOGA 1PTAA 3URQA 3MSDA 1JRCA 1FWBC 4Q7NA 2VGFA 4I6VA 1DJXA 2NQ9A 2XGIA 3WLJA 4EANA 1A80A 5A94A 1NFBA 4Y8EA 3DG7A 1EO5A 3S9IA 1HKKA 2ZA1A 2ZUSA 1SW0A 4ZOEA 3LHYA 4P7OA 2REQA 3MI2A 2CFFA 4GVFA 4DX3A 2IKIA 1VEPA 3H12A 4IL0A 3HG4A 3XISA 1HJVA 1CLXA 3M0HA 1SPQA 3LGDA 1VGAA 4ROQA 4V1YA 5HR7A 5D4YA 2OQLA 2OZ0A 3VI2A 4B5SA 7TAAA 2PZNA 1BSIA 1F76A 4S3BA 5LNUA 3N4FA 3KP1A 4S3CA 3NQDA 4ML9A 4FLRA 1K9DA 4IIDA 1VBGA 4A35A 1VBHA 3OODA 4ES4A 1AJ2A 1DKWA 4YVXA 3WEMA 3VDAA 1FDYA 4UBPC 4B5NA 2WB5A 3KL3A 3S2LA 2NX9A 2FGZA 4JL2A 3S1XA 5FJIA 3O7UA 4PR4A 8A3HA 3PHAA 2J6XA 1A5UA 3VIIA 3BANA 1IV8A 1JZ5A 4GFIA 1I2QA 3PBUA 1GKQA 4FSAA 4Z42C 3W22A 1ISZA 4A6GA 5CPOA 4B4HA 4DYEA 3WSUA 1S2AA 3GC4A 1RY0A 2Y88A 1QI0A 3TQ0A 2WVSA 3C8NA 1CX9A 4FR1A 3ELFA 2PC4A 4L9XA 2Q71A 4O17A 5AC8A 1KWKA 4KWUA 4HOWA 1TB3A 4E8DA 1FX6A 2PI6A 2QCEA 5JUVA 1RR2A 2B7NA 1RVGA 2XG9A 4KRZA 5HJLA 1L8PA 3RHGA 3CMGA 1C9WA 3HBLA 4Y96A 4N6FA 4WY0A 2ZOXA 1G69A 3W1LA 3AIQA 3ITXA 1CW2A 5E93A 2G41A 2LLEA 2EJAA 1R3SA 4KRTA 4ONVA 3EOLA 1PWMA 2ZE3A 3QOKA 1QPKA 4Z0SA 4K1GA 2BVWA 5CZSA 3PFRA 2ZC8A 3SUTA 3EKLA 1FHUA 2D2GA 2XVNA 2PDMA 2NSOA 4TVDA 4UR7A 1OWQA 4HCHA 3ARXA 2R1MA 4PCFA 3ALFA 2ZRUA 3W26A 5BWAA 1YNYA 3WFZA 1G67A 1HKWA 3GZ3A 3SCOA 1TV2A 3WQ8A 2DH2A 1Y65A 2JGQA 5D9PA 4ZQOA 1I6NA 3LM7A 4HYWA 1KWGA 1TRIA 3U57A 1EZ2A 2Y85A 5LYRA 3W84A 4XAFA 1EEPA 5EA9A 3ITLA 2DIJA 3W7NA 3I7QA 2ISDA 2FPVA 1Z8AA 1SJBA 3EWYA 4J4KA 1KM5A 4OWGA 2AQVA 1DIOA 3H22A 5CG7A 3OVGA 1TWSA 4JX5A 1TJ0A 3CQ0A 3E1F1 4RX0A 1QOXA 4O1BA 1UG6A 1J0KA 2WZEA 1I1WA 4ACYA 1XYCA 1JUKA 4ATWA 3G18A 3O6CA 5HQMA 1J10A 2WYSA 2QHAA 4GZ7A 2JK2A 3O05A 4L64A 4IIBA 4UTJA 2Z7GA 4B4FA 1LTDA 5ENLA 2ZQ0A 3BE7A 1FFRA 2NXIA 3DN5A 3CUFA 4ZSTA 3FNDA 2FDMA 3PZ9A 3W6LA 5B7ZA 3ANYA 3UWWA 3TYBA 1JAEA 2CEQA 2J88A 1XM3A 3RGTA 4DELA 1A49A 4OZOA 1Q4NX 4LALA 1HKJA 4LUIA 5A6JA 2P3EA 3FW6A 1F6YA 1WZKA 1W91A 4GJIA 1H7OA 4J2PA 3LGEA 5CJNA 3CHEA 1CXIA 4UXDA 4E2BA 2FH6A 1GORA 1R85A 1W8GA 2PRLA 3MMTA 1I75A 4LEFA 3BH4A 2FPYA 2V69A 3CV2A 3S0CA 3THCA 4BS0A 1H0GA 2C0AA 4Z2KA 3TSBA 1K7XA 1TZ9A 2GYIA 3NPVA 4PMOA 1F74A 1JPDX 3OBEA 3O3RA 4HOZA 1UJPA 3MP3A 1V5XA 1MXGA 1W8SA 1TV8A 1BYBA 9CGTA 1YDOA 1SJDA 3S47A 5C2CA 1YXYA 1HW6A 1UC4A 3EBVA 1ICPA 3R8HA 4TXEA 3EAUA 3PJXA 3TVAA 5AC5A 3XIMA 3ABOA 3WK1A 1U22A 1XGEA 2ZXDA 4QLKA 5JMUA 3A5FA 3VNJA 1XGZA 3VK5A 4IPIA 2EGZA 4Y9OA 4KFPA 1L6YA 4JYDA 3ZXWA 2EJ1A 3W7DA 2GQAA 1F3TA 4HHPA 4WR3A 5C8BB 3AHZA 5M03A 2EBNA 2P76A 4FB7A 4O0KA 3KRSA 3GAKA 3TOYA 1LG2A 4WSJA 2NVAA 1E6XM 4GE8A 2A21A 2Z2AA 5I3KA 3T40A 1TVLA 1IWBA 5BU9A 2OELA 3GNPA 1PHQA 3V1PA 2R91A 5AYYA 4IT1A 3BL3A 1W5NA 3TEVA 3B4UA 4PL1A 4L5ZA 4CD7A 3UJFA 4KGLA 1WDSA 2YYTA 4NAEA 4JFUA 2GOUA 1N8IA 4G1KA 4L1GA 1KRBC 4C6KA 4ORIA 6PTDA 4QS6A 3ES7A 4JKLA 1RJQA 1AH3A 1RCOB 4MWAB 1POKA 4YXGA 2RJGA 4EVZA 1GOWA 4FXFA 3SQLA 4DY1A 3JUGA 2EHHA 1XBYA 2V3DA 2FJUB 4MB1A 4IMDA 4NJKA 2G5WA 3BV7A 1K8XA 1SU5A 3MI3A 3IIPA 1UZHA 3T2PA 1L0PA 4ILSA 3MHUA 4QCEA 1H1YA 5CZTA 3W70A 3G0SA 1Q8JA 4J7RA 4NJGA 4PUMA 4F4RA 2FLIA 3GO2A 2TAAA 2W66A 1EJVC 9XIAA 4NASA 3LI1A 1AQ0A 1TTJA 1QU4A 4I7VA 2X1SA 4S38A 2J77A 2DPEA 4U31A 4QBXA 4UNKA 2CCRA 1KD0A 4P7RA 2V63A 4BWLC 1SFTA 1B3YA 1IT7A 5AYBA 3RYSA 1GOOA 3ERPA 3KBNA 3E5BA 5C0QA 2PA6A 3IIXA 1M7JA 4LAZA 4QRNA 4LOCA 5T9BG 5DANA 3MO4A 1CCWB 1VD6A 3T0DA 1CTNA 4CVUA 2W0UA 4HVXA 1VRDA 2WWCA 4K2SA 2GPTA 2CERA 1X98A 1WB0A 3KEHA 1NF0A 5FEZA 5FA5A 5LHEA 1VB9A 2VR2A 3G6LA 3LLDA 2P10A 4GVIA 4PUKA 3GBDA 4HN8A 4X22A 4WRHA 4C6JA 1UWSA 4E4UA 4PEEA 4US5A 4K7YA 3E0WA 2W79A 5AZ1A 2QJJA 4TMCA 1EC7A 1K70A 1EBHA 1KTBA 1FTXA 1O1HA 3MVTA 5C6MA 4OBSA 3MUZ1 1W9BM 3CO4A 1F2JA 1LWIA 2Y5JA 2ZX9A 4IFKA 3CL7A 1Q6QA 4UFKA 3NYZA 3IJ7A 1FHVA 3R13A 3MANA 4PMUA 3PC0A 2IPJA 1DIEA 4PMZA 5F2LA 4IFOA 1B5TA 1TSIA 2ZUTA 3Q4DA 2XVPA 2Y7EA 1B3OA 1UQZA 1W5QA 2DUZA 4D6JA 4M3PA 3QVQA 2GDQA 3NAVA 4LV4A 6TAAA 3LZ3A 1C8VA 4QM1A 3TAKA 3N2BA 3NEVA 3ME3A 3URAA 1KM3A 1WAWA 2V30A 4MY9A 2PCQA 4GY7A 4UFJA 1XFBA 1TZZA 1UZ1A 3CEPA 3GHSA 4ZOBA 2PDJA 4U10A 1TA3A 2C16A 4DBSA 4MNJA 1YW1A 3NZRA 4H2CA 3VGDA 3STGA 1H7NA 1JDDA 3EX1A 5AYIA 4S23A 1ONEA 3S6DA 1HJUA 3RNDA 1DPMA 3VD3A 1VFHA 2O9PA 2YGYA 4N9CA 5LGXA 3AMLA 3C5QA 1EJWC 4DLFA 3AC0A 4BEUA 4HZ6A 3H55A 1X6LA 4GBUA 4PTNA 3FN9A 1NOWA 4PSPA 3T2QA 1QTWA 1UWAA 3K8LA 3WFAA 4MNMA 3O6DA 1S2WA 1A5CA 3AYTA 4UFIA 3CB8A 1FXQA 4OU1A 1JI1A 2UZ9A 3W7JA 4BQ5A 2I1OA 3CZ8A 3E0IA 1XG3A 3AS1A 2DIEA 3H70A 3QZ6A 3VOJA 1W56A 1ISVA 3HA1A 3QQ0A 4E6MA 3PAJA 1US3A 2A2IA 1PIFA 2PWDA 2QEZA 3KL0A 2WSKA 1J01A 3KVMA 5DCDA 2WVTA 1GYLA 3W7GA 2WPBA 4HMNA 3CYVA 3UNDA 3W76A 1YMYA 2ACSA 2PTDA 4JTKA 1Q6LA 1GG1A 1TYGA 2PLJA 3ZJ8A 6REQB 2B81A 3DFQA 1LRNA 5CXPA 5LIYX 3S4TA 4MAVA 2Y61A 5KMYA 4IHCA 2GGJA 5I3GA 2BWGA 4ORMA 3CH0A 2Y70A 2YL8A 1OC7A 2BBFA 4JFWA 1FWEC 1ZJIA 1UP0A 3PZMA 3NQFA 2DZBA 4JOMA 1XX1A 3SBFA 4GH3A 4JN7A 4O4WA 1M41A 4PULA 2V2CA 3T4CA 3FCPA 2WXDM 2W4XA 3DFPA 3T0CA 2Q3OA 1A3HA 1BPLB 3PZIA 1S1PA 3N15A 2DZTA 1H62A 3URBA 3N14A 4NSBA 4LB3A 4WGXA 3RX2A 3G1FA 4TU1A 2YXGA 2CLFA 4L7ZA 3M5XA 3FEQA 3VKDA 4AZBA 3FOKA 3R0DA 4D6DA 1K9FA 4PBEA 4R3UA 1M6JA 1RHCA 1EP3A 3BW2A 2H8XA 1JYWA 3C3NA 1TCMA 2OZTA 3SCPA 2JBMA 2HDJA 4F8XA 2PFHA 3I3EA 3U3HA 5BRQA 5D8WA 2FH8A 2GVGA 2ZVRA 1V6XA 4FEZA 4XVDA 3MWCA 4QSHA 4D6IA 4NRSA 2P5NA 1TWIA 4A4AA 3N2TA 3KLLA 4GXMA 1OY0A 1F8IA 2PPGA 3W2UA 2Q02A 3M16A 1GW1A 1VIWA 2OZ8A 4LRSA 4AG0A 1JPHA 2WJFA 3FJ6A 2B7PA 3MJYA 4GWEA 2OLSA 1MW1A 3MUY1 3UXLA 1EJSC 4TIMA 2JEQA 1NFPA 1NELA 1HJXA 1F8MA 4Z2IA 3TFXA 2GGEA 4ZGYA 4PN2A 2GSJA 3NQ2A 3PZOA 2HWGA 1S2VA 2C8NA 2G8ZA 1KRAC 7CGTA 4GNVA 2W91A 4L4OA 1ZNNA 2VJXA 5E0FA 2WCAA 3IRDA 3LI0A 2ESCA 4HIBA 4DWSA 3L68A 1B1YA 4MY1A 2CLEA 3IGSA 5HJXA 4JGDA 3KW3A 3PTDA 4QITA 4W89A 3SIZA 1M7PA 4GISA 5DBTA 1GQJA 3I68A 4QHRA 5DMNA 2OVLA 2BXYA 3LXBA 5I09A 1SO4A 4AD1A 4DJFD 2WZIA 5JH1A 1RY8A 1XD0A 2PBGA 2PDXA 3V35A 4DJEA 4AZGA 3STEA 3AXKA 4UTIA 3UPWA 2HPIA 1C29A 2WZHA 3O6AA 1XH1A 1VJSA 5CGMA 3UCDA 3W02A 1S39A 5FJTA 1GVEA 3QF0A 3PG8A 1V6WA 1JPIA 1O6IA 3OVPA 2OU4A 4XSMA 3FHQA 3A24A 3APTA 3WBXA 3KRZA 4XZIA 1JUEA 4IGSA 1DQWA 1QO5A 2NWSA 2BZNA 3EB4A 4WF7A 1XLBA 1E3XA 3DI1A 2I16A 3SCNA 3V7PA 3PZGA 4MY8A 5LNWA 4R7OA 3KHJA 2VOTA 3HPXA 3H54A 3C4UA 3KE0A 5BNKA 1SJCA 1H1ZA 4V27A 1ZFJA 4N02A 3M0XA 3LZ5A 1PKYA 2FZNA 4JQ1A 4IG2B 1QWGA 3TC6A 3FIGA 3WLLA 1EHAA 1REQB 2G3NA 3BCFA 3UJ2A 3WLRA 2W92A 5LA2A 2A3BA 1J9YA 3N04A 1ZAIA 4C6CA 1X1OA 3RXZA 3VC5A 4G1NA 8XIAA 1M7OA 1BF6A 1XSIA 3QV8A 2WZTA 2YCLA 1J2BA 1Q7MA 3NQ7A 4J1OA 1TPVA 7REQA 3ONBA 5D37A 4JPGA 1HVXA 1MDRA 3FJNA 1P0KA 4UMAA 2OYLA 4IIFA 3KVLA 5C9UA 1SZFA 2JQXA 4DM2A 1NWSA 4Y9MA 1XCWA 3NZQA 2XVGA 4O15A 4RNJA 4K36A 1J79A 1XLJA 2X41A 4QG6A 3JU2A 4R85A 3NM1A 1UR9A 3CLMA 3FV9A 3RX3A 4KIRA 1R9YA 1UH4A 3NQAA 1U5HA 3W7OA 1KCXA 2J24A 1MQQA 3UR7A 2QCNA 1O66A 2PDWA 5FEWA 3VGEA 2QPXA 5I78A 5AHLA 2WNQA 2ATSA 4LAMA 2V0TA 3HGSA 3QPYA 1CGWA 4PL2A 4HPNA 2YLLA 4LUTB 3LMYA 3O15A 3MCOA 4NF7A 1EA0A 3WNLA 3TMQA 2PDUA 1S2TA 5I79A 3QY8A 2WVUA 4B9YA 4GHRA 1TCDA 2ZWYA 4L6OA 2B31A 2BGNE 4JTUA 1VIZA 1O60A 3LHTA 1J0JA 1HF6A 4HTBA 1TG7A 3CHCA 3TN6A 4QS5A 1E0TA 4BY3A 2G4FA 4I6KA 1TTIA 4C7GA 5A8PA 1E3ZA 5CBIA 1F3WA 3IJLA 2PDLA 3FSTA 1WQ5A 1I60A 4X0VA 3W7QA 3VD9A 3SRKA 2O55A 1UB3A 3C2EA 4GYKA 3VNYA 1UBSA 4KS0A 3BJSA 4IJRA 5FEPA 4AIBA 1AZ2A 3W86A 3GG1A 2AKMA 3CQJA 2CKRA 4C6DA 4V33A 2GOKA 3ZVHA 1Z6KA 2XH0A 2GLKA 3NL3A 4UZUA 1OM0A 2W62A 3WO8A 4AHQA 1QOQA 4TTGA 5F1VA 1UWQA 3G5EA 3CPGA 3E02A 4BFAA 2XIMA 3BPWA 3DYMA 1WKFA 4RZ4A 2FZ9A 3NYDA 5D2TA 5G4WA 4GY0A 1EC9A 4GZJA 4O13A 3W3OA 5CZKA 2OSYA 1O1ZA 5DFAA 1DYSA 3TSMA 2D20A 2DW7A 4S2CA 1EQCA 3PNZA 4CNTA 4KW2A 5C2GA 3QV9A 4CQDA 4G9PA 4BA0A 1A5NC 4R88A 1GOMA 2PF0A 4QGCA 4HJFA 3TYCA 3RR4A 3BARA 1R7AA 1I4NA 3RF9A 2E8YA 3ATYA 2DSUA 5BMWA 3M5YA 2PD5A 4AISA 1GTHA 1PZ1A 3TYZA 4UOQA 2PDKA 3I7RA 4WDTA 2Z00A 1E0VA 3P8JA 4DWDA 1B9BA 4ZFMA 8CGTA 4CN4A 1R8LA 2GVEA 1LF1A 5B80A 3WX7A 1ICSA 3PM6A 3LSCA 5HATA 1A5LC 1HGYA 4AD4A 2VYOA 2DUXA 3G1RA 5FJPA 1TMLA 2Z1VA 4FNQA 3QGKC 5D2YA 1ZP4A 3M6DA 2XIQA 4BQ2A 4JHZA 4RPQA 3D5HA 5I23A 3QLDA 1XKYA 3C56A 1PIIA 3MSRA 1O68A 1JGMA 5CPMA 3ZJKA 1BTMA 2FTWA 2IKJA 1FWSA 5CPNA 1X7FA 1EGZA 5MHBA 2GSEA 4LY4A 1PZ3A 5D02A 2AOSA 4A8NA 1N2VA 1G5AA 3PBMA 4NY2A 2NUWA 3R4IA 4I7UA 1ZJAA 1XIEA 3A13A 5IXEA 2YL6A 1CDGA 3PBGA 1J11A 3UWYA 2ZCGA 4AYGA 4W93A 2E5BA 4OFCA 3U9IA 3P74A 4YVPA 4W9TA 4LYKA 1AH0A 4B3LA 2ZZ1A 4XB3A 3STCA 1TQJA 3W1QA 4HGXA 2V68A 3VIHA 3QH2A 2X7WA 1NJJA 1XQLA 3L67A 4HMDA 2OODA 5I6SA 3EEGA 3QYQA 1TV5A 2HK1A 2AL1A 3WH6A 3TYDA 1FWHC 5FIPA 1EOMA 3PY2A 5DMYA 3E74A 1E73M 1TR9A 2GL5A 4RDVA 3AZRA 3LV5A 2XSBA 3ABXA 2NUYA 4DQWA 4EXBA 2JEPA 1WOAA 4Q6XA 4V28A 2VX5A 1W9XA 5HMSA 1TWDA 1BSLA 1IIGA 4Z2HA 4B5VA 1DTNA 3LSBA 1SW7A 3NXLA 3S2JA 1AG1O 2WSQA 1VR6A 1I45A 2ZUVA 1HJWA 1DJQA 3WYZA 1EX1A 4BQ4A 3EPMA 4JNZA 2OG9A 3W01A 2WMJA 2BG5A 3W07A 2D2OA 1V3JA 3TNBA 4IQEA 1MEHA 3QSTA 1NDZA 2ZRWA 2CZEA 1R38A 1C91A 5IOBA 2O9OA 2C14A 4CU6A 1SZRA 5JIPA 4Q4OA 3PBYA 2Y4SA 3HIJA 1JYXA 1H63A 1LLZA 1DEDA 1E6PA 3AALA 4ZXLA 2PURA 4M6QA 2D0GA 2VMFA 2WLZA 3UZJA 3APGA 4B2DA 1XBXA 3WF1A 3W23A 4A29A 1AW5A 5C7VA 3GFYA 2A5HA 3OGRA 1OZMA 2QJNA 2CWNA 4MPQA 1KRMA 4HNUA 1MNSA 4Q8QA 4JQ2A 4NT0A 3GUGA 1HJSA 4IJCA 3B40A 4Q22A 6XIAA 1OFAA 1J6PA 4GJJA 3D3AA 4B3ZA 1XP3A 4OUIA 4ICNA 3M7WA 2J6VA 3CWOX 4QCFA 3UW6A 4Z1DA 4DO7A 1J93A 2ISFA 4LB4A 4GMEA 4CD6A 4TVCA 3PBWA 5K4XA 1KCZA 5T9CE 5TD4A 2F38A 3AMCA 1R9XA 4ZTXA 4RR4A 3PANA 3W7MA 3U0HA 3WDRA 1XLDA 2Z1XA 3NQMA 3MSYA 1NARA 4L61A 2SFPA 3N2CA 4HN4A 4JQAA 1ZP3A 4JIRA 1QW8A 3NXFA 1Z44A 3L2LA 1ECQA 5D03A 1XSKA 5BOOA 1TFVA 4IGMA 4JEQA 4F2UA 3BK0A 2X2GA 1UUMA 4P8XA 1W3NA 3WIJA 1I2PA 2ZADA 4CKQA 3Q37A 1R6WA 8XIMA 2QW5A 3MA8A 3W7HA 2GQ8A 2WOQA 1G9HA 3DU0A 3GXMA 3BWWA 1G01A 4WJXA 3IVSA 3DDMA 3S1UA 5HMFA 3MZ2A 3GH5A 2XFYA 1X1NA 3NQEA 1KFLA 3WQ5A 4IL2A 5TBOA 3S6OA 3C6CA 3M0ZA 4S3DA 1P7TB 1EYEA 5A6BD 1V02A 1HTIA 3DFSA 4M1BA 3CASA 1OFQA 2HPMA 5D9NA 4HZ8A 1OF6A 1FKXA 2PU1A 1U1HA 3DYPA 1K6WA 2ICSA 2AGTA 3MMWA 1HQTA 2VCBA 1PHWA 4GYFA 4ICCX 3V1HA 2WJZA 3PZNA 1XYFA 5EY5A 1X6UA 1TKKA 4UQ9A 3H2OA 5KZDA 1ITQA 2GFTA 4KCVA 3TTYA 2QPUA 1UR3M 3PSWA 1EUNA 1V51A 3B8DA 3LEPA 3KCJA 3KRBA 2EPOA 3UWUA 2FVLA 4HA1A 3RM8A 2WMFA 4UOJA 3DECA 4LNCA 4CCZA 3MUCA 4XZNX 3BJTA 3H4GA 4P7LA 6ENLA 1LQ2A 4YHEA 1OYBA 1W9VA 1JF6A 1XIBA 4O53A 2E7FA 4MWAA 4DXVA 2FZ8A 5FAJA 3AISA 5D33A 4JIHA 4IPNB 2V9DA 2GJXB 4GRSA 4IP4A 5AYZA 5LGZA 1PCWA 4IIEA 1UKTA 3WBAA 1AODA 1IEVA 3EXTA 2EQDA 1D7KA 2ODOA 2W61A 2HE8A 4HQVA 3W00A 2DORA 2YA0A 3WMLA 1AL7A 4LYRA 3ENLA 1KFKA 3UY8A 4BEQA 3DESA 5FAGA 1EJ7L 2NWRA 3J7HA 1BXNA 2R24A 4Z0JA 4BKNA 1FCQA 1V0KA 2B0MA 4D8AA 2DW6A 4C6NA 3SCSA 3WENA 2X7VA 3WH7A 3H4XA 3IEBA 4RW5A 5CKSA 3UVIA 4MB5A 1L2QA 3TDFA 3TLLA 4NJIA 3SFKA 2POZA 2UY2A 3WD3A 1W2PA 4PA8A 2YL9A 2WJDA 1B57A 5T91A 5CZ0A 2O7SA 3NQBA 3MMDA 2C15A 2OFJA