3R89A

Crystal structure of orotidine 5-phosphate decarboxylase from anaerococcus prevotii dsm 20548
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
289
structure length
289
Chain Sequence
SNAMKIIDKLYEKVSKNGFVCIGLDSSIDYIPENMKAGKSVSEALFSYNKEIIDQTYDVCAIYKLQIAYYESYGIEGMIAYRDTLSYLREKDLLSIGDVKRSDIAASAKMYAKAHFEGDFETDFITLNPYMGMDSIEPYEEYIEKGDKGVFVLLRTSNPGAKDFEVLPVDGEEFFYKVGDKMRELNEKYIGKSGFGPIGLVVGATHSEEVEKIRKRYDKMFFLIPGFGAQKADSMNVYKLLEGLNGGVVNSSRAILKNWQNYEDGSEKVGYYARKKAIETYEEIKANEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Crystal structure of orotidine 5'-phosphate decarboxylase from Anaerococcus prevotii DSM 20548
rcsb
source organism Anaerococcus prevotii
total genus 110
structure length 289
sequence length 289
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2011-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3r89A00
4HIBA 3UWVA 2DORA 5CZ0A 2A1YA 2Q3RA 4LV9A 1PVNA 4WXZA 3NA8A 4JIQA 5LNUA 5HWNA 1LOSA 2ISSA 1DHPA 1K03A 3RLUA 3E12A 1KM1A 5FESA 1OYAA 3W7DA 1KW1A 4MZYA 1VLWA 4IXXA 2QDGA 4FIQA 1O4UA 4PL2A 5G1TA 2EF9A 2YSWA 1K7XA 2CZ5A 3GZ3A 3ABOA 3M43A 2YPIA 1SO6A 2G96A 5D37A 1XBXA 5BNKA 3W87A 4OBTA 5CPMA 4UTIA 5F1VA 3WFAA 1RD5A 1TPVA 4Z08A 1OX6A 2OZ0A 3W83A 1KTCA 4UC5A 1JUEA 2J6XA 3CTLA 4WUIA 3TMQA 3MHFA 3MYOA 2YX0A 4O11A 2AQWA 3B05A 2P10A 1NEYA 3UWZA 3FYPA 1GVQA 3NGJA 1W5MA 4GUGA 3NM3A 4JTIA 1P0KA 2ZZ3A 1UJPA 1E51A 1A5AA 1W0MA 1HO4A 4JYEA 2WPBA 3QM3A 4RZ6A 4MY1A 1WX0A 5EYWA 3IVUA 1P1XA 2XN1A 4IMEA 2RH9A 1O94A 2ZQ0A 3UD6A 4BI7A 3PR2A 1H7RA 1OK6A 3LRLA 2CLEA 5LZLA 3BLFA 2KZHA 2X16A 3CIWA 3IVTA 4A29A 5J5DA 1QDSA 3TJLA 4IMGA 4LY8A 3L5AA 1G6CA 4Y90A 1TO3A 4A2SA 1ZENA 4ICNA 3MI6A 1B4KA 4BFAA 3TK7A 1MEWA 3M7WA 3RK8A 3WJXA 4JTJA 4IMFA 2CZEA 3OBKA 3QW4B 4IGHA 3MYPA 1OF6A 4K6AA 4UFHA 4OWGA 2JGYA 1O5XA 3C0JA 5D05A 1TPUA 3PS7A 1DORA 1I2NA 5KINA 4O28A 5G2IA 5C55A 4MFEA 1FQ0A 1FDJA 1FXQA 1H7XA 3BV4A 1WAUA 3IGUA 3HG4A 1R47A 2WQPA 3DHDA 4M7TA 3PUOA 3WK1A 3W1TA 3TNOA 1TQJA 3RFAA 3A5FA 3DFPA 1K7EA 4JEQA 3UPWA 1SFJA 3EEGA 3FIGA 4CQAA 3W2LA 1TPFA 2Y62A 1LM1A 4A22A 4O52A 2Y7FA 1C29A 1L6WA 3FJ6A 4S1FA 3PSVA 2GJLA 3IIZA 5G1YA 3A22A 4QNEA 4NXKA 4YCOA 2FDSA 1R46A 1PCKA 2NUYA 4XTIA 1LOLA 3T55A 1OFRA 4I7VA 3FKRA 3R8RA 3LXAA 1EP2A 5IBXC 1L9WA 3UZ5A 3QQ0A 1JULA 3FJLA 5FEXA 2ATMA 5HINA 3P61A 2ZZ6A 2C0AA 2CLKA 3LRKA 3O06A 3S5NA 1GG0A 5FF0A 4O1DA 2O7QA 2WNZA 4IOTA 1TSIA 5KZDA 4MUZA 3SJ3A 4LS0A 1EUAA 3S1VA 1QOPA 5AYXA 3G3DA 1W3NA 3WK2A 3BG9A 2Z0IA 4XWUA 1W5QA 3W7IA 4IPIA 4B5NA 1MEIA 2GVLA 2XN0A 3HO8A 3B4UA 2H8XA 4GUJA 1N7KA 1TCDA 3M16A 1VCGA 4GXMA 2O7SA 3N19B 4Q4KA 3STGA 1W3TA 1GJPA 2E6DA 4HNUA 2YFOA 3BGGA 2F84A 3E9AA 4O14A 2V0TA 5MHBA 3INPA 2NWSA 3CQ0A 5E0KA 4LNYA 4Q32A 4K7YA 1DJNA 1QPOA 2BX7A 2GQ9A 1H50A 2A6LA 4LTSA 5D2VA 4OHQA 1MO0A 1BWKA 4DBDA 1JCJA 4GRSA 3L0GA 4TR9A 2HTMA 5HWMA 3N2XA 4EVZA 3L65A 3S5ZA 1MEHA 3HPXA 5DXXA 1W8SA 4AHPA 1JUBA 2QCGA 3ELFA 1O60A 1VQTA 3NQDA 2CZDA 3HGOA 1IXNA 3G0XA 4QM1A 4QITA 4RKAA 4TU1A 5J5RA 2H6RA 5G2WA 3LXBA 4DO5A 4JTUA 3LGEA 4OV9A 3QMSA 2Z6JA 1W54A 4WD0A 3MHUA 2BTMA 1YXYA 1AL7A 1EUNA 3PC0A 2PURA 4LWWA 3NQ2A 3W75A 2ZFAA 4E0CA 4PH6A 2Y63A 3EWZA 2X2GA 4AHQA 2NV2A 1XKYA 3GKFA 4I9AA 3E49A 2FTPA 1QAPA 2ZRVA 1V7YA 5D2TA 3SFKA 3G1DA 4G1KA 2CLMA 3C6CA 4FX7A 1GVFA 3C61A 3HG5A 4A3UA 1L6SA 1ZHAA 2OX1A 3C52A 4AMAA 4FF7A 4MYXA 4JICA 2JKPA 1MSSA 4FNRA 1KV5A 4NJJA 3TXVA 1EA0A 3DI1A 5D2XA 2R91A 1EWEA 2E5CA 5FF4A 4FIRA 4LVFA 4FNTA 4UTWC 2VEIA 3LDVA 1J2WA 2OT1A 1WQ5A 4BWLC 4AWTA 5AB3A 1LROA 4MIMA 1DV7A 1OYCA 3STEA 3EWUA 3R2GA 3NQGA 3ABSA 1N8FA 3I6RA 4XUGA 3W1PA 1AL8A 1V5XA 2EGZA 1PHWA 1ZCOA 1EB3A 4RZ4A 3TC7A 3HGSA 3LHWA 2QDHA 3PVFA 5CZJA 4JTKA 2NUWA 3G1SA 2GJNA 4HN4A 1HUVA 4Z1BA 1JVNA 4FNUA 3GR7A 1LOQA 4UCGA 2QAFA 4J9JA 5TIMA 4NX5A 5K3VA 3W23A 4MPQA 1KM5A 3V1PA 2C19A 2VEPA 3TC6A 3L2IA 4O13A 2WSQA 1S5WA 1P4CA 3MWAA 4JGDA 4MLJA 3STCA 2FPVA 4LV4A 3O16A 2J27A 1KM3A 3LTPA 4M6PA 3W1MA 1K8ZA 3DH7A 3NPWA 4WOZA 2QCNA 3KVKA 2DJXA 1SZGA 5F2MA 3G1XA 3GX9A 1FWTA 1FX6A 3NL2A 3JS3A 4XBKA 5KSWA 3LHTA 4N4PA 5D32A 3RU6A 3V75A 3TW7A 3KRUA 1ZAJA 4LUIA 4JS3A 1EEPA 3GKAA 1B4EA 4ORIA 1I8JA 1B9BA 3EWBX 3LBCA 4YLWA 3PG9A 4WY0A 4OT7A 5TQLA 2J88A 1XUUA 1QNVA 2V2CA 3LTYA 1JQXA 3TAOA 1O5KA 1XC4A 3MBDA 1AW5A 5FF2A 4LC8A 3VKJA 2A7NA 3N2MA 2WNQA 3LCWA 3T4CA 3P81A 2C14A 5K9DA 1KLYA 4ADUA 1BWLA 1LORA 5AHEA 1P0NA 1KTBA 4GUIA 1JRCA 1I2RA 3NQMA 4JR5A 1T96A 1D3GA 1LRQA 3UNDA 1BKSA 4NJGA 3BLEA 3GIYA 4JY9A 3JRKA 4FX6M 3O07A 4DPQA 3WK0A 4KKXA 2CZFA 1LCOA 2C16A 3L67A 4M5PA 4NVTA 5CSRA 1L6YA 3EXTA 3W73A 1I2QA 2GQAA 3L5MA 3TV8A 3DXIA 1JCYA 3EX4A 1F76A 1JQVA 2QEZA 3NAVA 3IVSA 4X9SA 1M5WA 1GZGA 4WZHA 3W2UA 1OG0A 1SW7A 3D0CA 3G22A 2B7NA 3HQ1A 3LRMA 2CLOA 4NU7A 1K7FA 3EWXA 3M5VA 2D73A 1FWWA 1TRDA 2CLIA 3G8RA 4LRTA 3CC1A 2ATSA 1IGSA 4FXSA 2ZTKA 2FIQA 1T8XA 3HOJA 3O6CA 4PC8A 3W7RA 2C13A 1XI3A 2NX1A 5FEZA 3NG3A 3HB9A 4UTTC 1X1ZA 4JN6A 1FDYA 2ZZ1A 3KVMA 3GXNA 1VLIA 4UFKA 3K30A 1QFEA 2V8ZA 2R8WA 4OV4A 3ZFHA 3NZ1A 1C9DA 1H1ZA 2QJGA 4H6KA 1DL3A 3LCXA 5K4XA 4JX6A 1KFCA 4WY0B 1PV8A 3LHZA 4R34A 3QYQA 3UXAA 2Y85A 1GVSA 3W2JA 4MZ8A 1Q6QA 2QUUA 4O0ZA 3DAQA 4IMCA 3BW3A 4KFOA 3RMJA 5U7SA 2ZZ5A 4O4WA 3G1FA 4UNKA 1H61A 4ZMGA 1H7OA 3GK0A 3KVJA 5IM51 2HS8A 1RQHA 4RJEA 3NVTA 4O54A 1WBJA 1JJKA 4NT0A 3ATYA 2VFHA 5KITA 3L0NA 5AYYA 1FCQA 4DO6A 4W9TA 3G24A 3LX9A 3KX6A 1GT8A 4MLRA 2E09A 3G8EA 3W76A 5AHLA 1OFBA 2VEMA 2ZZ4A 1DQXA 4IX2A 1ALDA 1K8XA 4N9EA 3S9YA 5L9FA 1SUXA 3DBPA 1Q3NA 3EWWA 3W1LA 4YWIA 2NXIA 2QF7A 3VI2A 2ALDA 1GVOA 5F4XA 3CEUA 1YTDA 4JTEA 5DLCA 1YLVA 4N2YA 2NXHA 4NZJA 3OHIA 5CG7A 2G97A 1TREA 5I3FA 1ADOA 1MZHA 4TX9A 3G18A 3SY5A 4O0KA 1TB3A 5FI8A 3LLFA 2CLFA 3EWYA 1NF0A 1JCXA 4JTFA 3C2RA 5CKSA 4MZ1A 4FNSA 3AO0A 4YXGA 2TRSA 1XXXA 4XKYA 2QJHA 4O15A 4KFPA 5AC7A 4E2BA 1W56A 4CLMA 2QJIA 3TU9A 1RZMA 5C6MA 3PB0A 3FA5A 3P7YA 2G5WA 1RV8A 3M44A 2FPYA 5HJLA 1QMLA 3TMLA 3PM6A 5CZSA 4CNPA 5I3IA 2NX9A 3F03K 4AAJA 3GDRA 2JKAA 3BW4A 3N14A 4N9CA 3TQVA 3TROA 2A2IA 5EBUA 1A5BA 1FBAA 3LI1A 1SO5A 3RLVA 1IIHA 1IIGA 1VGAA 1LYXA 2Z2UA 4LVAA 1VHCA 4NNBA 2FJKA 3M1ZA 1H62A 4R53A 4HNTA 3A24A 1IXPA 4FNPA 4AEOA 3P67A 3L68A 3HPZA 2VELA 2E6AA 4TO8A 2X1SA 4DEFA 2J9ZA 2Y88A 2NLIA 5I3HA 3UYCA 3OEXA 2C18A 1TPEA 4K36A 3L0KA 2A85A 5LSMA 2PRMA 3FS2A 4GNJA 4UR8A 1Z48A 1KM2A 1VYPX 1VYSX 1W5PA 3L5LA 3I7QA 1W5NA 1OFDA 4IQLA 3OIXA 1H1YA 1S5VA 3KAOA 2GPTA 1H5YA 2WKJA 3R89A 2BXVA 3A5VA 3M5ZA 3DGRA 3VNDA 3TR2A 4Q33A 5AN7A 1O95A 4N4QA 3W88A 1AW1A 1OFAA 3B04A 4M6QA 3L21A 3OA3A 3F1QA 2V30A 5BMWA 3W71A 2A7RA 3NQ8A 4JX5A 1L2UA 3MP4A 2E6FA 1ZAIA 1SPQA 3QSRA 4MKNA 3UY7A 1LLZA 2DZWA 3HJZA 3M5XA 4MJZA 1OK4A 4LS1A 4XKYB 3HGJA 5L6UA 3W07A 1A50A 2BLEA 3W7LA 4HPJA 2W0UA 3UPBA 4UFMA 1Z41A 3AJXA 4QISA 3LCIA 2HS6A 4U4MA 1BTMA 1WBHA 1W37A 2VFDA 1EPXA 3SW6A 4FHAA 3NOEA 3DI0A 1OFQA 4GC4A 3UWUA 5HNRA 1ME9A 4YL2A 6TIMA 1KBIA 3M47A 4POCA 2YXGA 1SSGA 3MJYA 4PFMA 5LGZA 3M5YA 2V9DA 5IBXA 3GYEA 3QQ1A 3JR2A 3ANYA 4KWVA 1HL2A 3IGSA 3DU0A 4DF1A 3I7SA 2HSAA 5D2YA 4RR4A 2ZCGA 2ZA3A 3W7MA 2B0MA 2YCEA 2DZSA 4PL1A 1HG3A 1TPWA 2V5LA 3IIXA 4K7VA 3HG3A 5HWJA 3U6WA 3GB6A 1G67A 1XCFA 3GNDA 3LI0A 5BRBA 5DY2A 1WXJA 3L66A 1RQBA 4H4IA 1VS1A 2VFGA 1Q6LA 2YW3A 2VC6A 4PCFA 3SGUA 1RQEA 1DQWA 5A8GA 2OCZA 3IIVA 5F2LA 3P60A 3M6YA 3QSTA 3LERA 2F7FA 5KZMA 1KFBA 5HULA 1Z44A 1TTPA 3NQAA 3R13A 4UTMA 1H7PA 2RDUA 5HUOA 3I7RA 1DKWA 3G0UA 1YPIA 2H8ZA 1JR1A 1HFBA 2TMDA 4S2BA 3KOFA 1F05A 2CLHA 3NL3A 1YTKA 2Y61A 4C1LA 4UTKA 1T0OA 3PY2A 4N6FA 4PEKA 5K7JA 2A7PA 3NXFA 3SIZA 1QO2A 4JYFA 2RHGA 3S5OA 4IJBA 5U4NA 1KV8A 3GLCA 3T78A 5D30A 2VXNA 3VE7A 2I14A 3CT7A 4I7WA 4YMZA 3I68A 1S3HA 3VE9A 1EX5A 1F74A 2H90A 3BG5A 1SQ7A 2WOQA 4OQVA 3MI3A 1A53A 2QUVA 3DZ1A 3H55A 4PA8A 3LCFA 3F4NA 3KRSA 2XFWA 1B57A 1RR2A 1KFKA 4MVAA 2ZA2A 4ADTA 1H63A 3QF0A 5GVJA 2YW4A 1SW3A 2RFGA 3W1UA 3O63A 3BLIA 1TV8A 4LS2A 4Z1DA 1QPQA 3ATZA 3W7EA 4WQ6A 3P62A 1LBFA 3ZS4A 5EL1A 3W7HA 5LHEA 4WJEA 2QCLA 4Y96A 3TSMA 4UR7A 1Q45A 4DF2A 2YYUA 5AC6A 3E0IA 3OG3A 5FF7A 3N3MA 5C2XA 2ABBA 4O50A 1GEQA 3LV6A 3WJYA 3MUXA 4AVFA 4JYDA 3DFTA 2TPSA 2JKEA 4WX2A 1M6JA 1QO5A 3PBVA 1KFJA 1J4EA 5KTLA 3QPYA 2V2DA 1F5ZA 1R30A 1KM6A 3P5YA 3WJWA 1LRNA 4UTLA 4O4VA 5EA9A 2ZRZA 2ISWA 4BWLA 3A9IA 3G3MA 4CNOA 3CHVA 1NSJA 1I4NA 3TFXA 3P80A 4JDBA 4OGZA 3TJXA 5LNVA 5CSSA 2W79A 2NV1A 1BEUA 5CGQA 2DZUA 2G95A 2GVJA 1QCWA 4CNNA 4LVBA 3U8GA 4AF0B 3CM4A 2Y7GA 2ZBTA 3LB0A 2E77A 1TYGA 1EWDA 3CPRA 1TIMA 3GXPA 4IUOA 4LVDA 3P84A 4CQ8A 3W2MA 7TIMA 1N55A 4XZ9A 3CEPA 1F2JA 2RDWA 3HG2A 3EX6A 4IWWA 4IPJA 1ICSA 2VFEA 2I9EA 5HUPA 4UTHA 1OX4B 2Z1BA 2B7OA 3B06A 3RF9A 1ICQA 3DKJA 2FPTA 1WYIA 2ZDRA 4HSOA 3FFSA 4M6VA 4ML9A 3UXDA 3I65A 4EWND 2OJPA 4ZQMA 1SR9A 3NDOA 1FXPA 1KFEA 2GOUA 3CU2A 2C1HA 4NNCA 3W7OA 1TPB1 3IRDA 3S1XA 2EAWA 3W72A 1UASA 4KWWA 4GFSA 1D9EA 3TQKA 3F4WA 3HIJA 4M7SA 1S5TA 1ZY9A 1YPFA 2Y89A 4XBSA 5D38A 2V5BA 4MJMA 1XDLA 1FWNA 3DFSA 4UTUA 4MOZA 5DCBA 2QKFA 1VJIA 5I3KA 2ABAA 2J9XA 3EKLA 4AH7A 2GUUA 4AWSA 5TBOA 4ZQPA 4JX4A 5AHFA 1TPH1 4AWUA 3GVGA 4BF9A 1JRBA 1AK5A 5E93A 4RCXA 1K02A 3OVQA 2WJZA 3O6DA 3SECA 3OVRA 4KFNA 3W2KA 1XL9A 5I3JA 3DFNA 5CPOA 4HSNA 5HR6A 1DOSA 4HNVA 2WV8A 1H51A 1YDOA 4A2RA 3S0CA 3UWQA 4O57A 5DCEA 4M19A 1HTIA 2DZVA 1RVGA 3FLUA 1I2PA 4GUHA 2A0NA 2OT0A 1Q6RA 5DELA 1ML1A 3UQNA 1VCVA 3HBLA 4BK9A 4O18A 3M41A 1A5CA 3LM7A 5AOUA 3B0VC 3W7CA 1LBLA 5C5YA 3PF3A 4AHOA 3W7JA 1ZJIA 3GDMA 3W85A 4JTLA 3DENA 3S6DA 2LLEA 1QWGA 4O12A 4K8HA 1YXCA 3C8FA 1DBTA 1VC4A 2QAPA 4MY9A 3O15A 3W86A 4QSHA 4ZQRA 3GNNA 1OFEA 3KHJA 4N02A 3W22A 1GYLA 1R2RA 5DBTA 3NQEA 2YDAA 2PC4A 4RXFA 3SGZA 3KRZA 4UMAA 1OABA 1ZNNA 1J5TA 2B7QA 5LKYA 1PE1A 3ZR4A 2X30A 4UTTA 3PUEA 1VR6A 2QCHA 4GWEA 1TJPA 2Z6IA 1G7UA 1W3IA 5G4EA 2WSYA 4JY8A 3MP5A 1PL9A 2A21A 3NQCA 3R5EA 3FEMA 3DKLA 1KM4A 1UUMA 3DFQA 2TSYA 4Y8FA 3QRHA 2CWNA 1QPRA 4JDYA 1F6KA 1YDVA 2Q3OA 3LCGA 1OVDA 3FOKA 3SZ8A 1ME7A 2QCDB 4QQ3A 4Z1AA 4P2VA 2WO5A 3EKZA 3W7KA 2QCFA 4NJHA 3TIMA 4N6EA 2QR6A 3TKFA 4ADSA 1NF7A 3KFTA 4ZQNA 2X1TA 4NX0A 3TFCA 1NFBA 5LGXA 1LDCA 4O1CA 5E1QA 1VCFA 3W3OA 2FB3A 1M7PA 4O1BA 3CLMA 2YR1A 3EX1A 4UMBA 3NQ6A 3N34A 3T7VA 5EMUA 1W31A 2CLLA 1W5OA 3ZWSA 1EP1A 3GDTA 1WA3A 4JNMA 2QCEA 1FY6A 4I7UA 1ZFJA 4LVGA 1G4TA 5T26A 3W1RA 1AG1O 1XBZA 3IEBA 1F73A 3A23A 1JCLA 1YXDA 4Y6GA 4JXCA 4O53A 1SZNA 1F7BA 1FCVA 1LTDA 5LNWA 1ICPA 5AHIA 1P5BA 4GE8A 3ABRA 3CWNA 4L4MA 1OYBA 1MXSA 3NPXA 3G1HA 3PSWA 3WJSA 2DZTA 3LLDA 1SFLA 3C2EA 3QW3A 1G4PA 5D09A 4RK8A 2C3ZA 1W1ZA 4EIVA 5KMYA 1CW2A 1Q6OA 1VHNA 3W1QA 3U2OA 2FQIA 2VFFA 1THFD 1OF8A 1TRIA 2R94A 2YYTA 3HGRA 3TSBA 3IV3A 2J9YA 4BI6A 2BZNA 3W70A 1QR7A 3HPSA 3CB8A 2PRHA 1TTJA 4UXDA 2FLIA 1FUYA 5F4WA 1ZAHA 2DU2A 4O17A 1UUOA 2B7PA 2X1UA 2ZRWA 3TH6A 4O10A 3RNDA 2PRLA 4R7JA 3C2VA 2VKZG 3TAKA 3W2NA 3QMRA 5HMSA 3UWYA 1G7VA 2J24A 4IXHA 3BARA 5G2HA 3N9SA 3A21A 1RPXA 3EB2A 3R12A 4UNLA 5FEWA 1PHQA 1JCMP 3E02A 1IF2A 5EY5A 3S5YA 1X7FA 2R14A 3T44A 3SI9A 1GPWA 2VFIA 2CW6A 3VCRA 1SO4A 1IXOA 3QZEA 1QOQA 4S2CA 4EF9A 5A5WA 4HHPA 4ZQCA 4JTGA 4FB7A 4UMCA 2JBMA 4XTDA 3QJAA 5H91A 4Z1CA 3Q94A 2Y6ZA 1PS9A 3LTSA 4FO4A 4XQ6A 1H7NA 2QCMA 4JD4A 4ORMA 5AYZA 5BW6A 4UFLA 4DQWA 2ZRXA 3TA6A 1TV7A 4UFJA 2NZLA 1UBSA 1R2SA 3LV5A 5D04C 5D02A 3EXRA 3BG3A 5F2IA 1FCBA 3FKKA 1GVRA 2A6NA 5LHFA 2E5BA 4AXKA 4EOUA 5EPDA 2CU0A 2V82A 3PULA 3STFA 3W1AA 1NAL1 2EKCA 3TSDA 4QJ1A 4DBEA 4ALDA 4AB4A 3NPVA 4N9DA 1TTIA 1VH7A 3B0PA 3T40A 4JIPA 3NQVA 4X2RA 3KVLA 1WDWA 1PCWA 1TTQA 3MO7A 3BK0A 1VZWA 3B8DA 3LOTA 3IIOA 1YYAA 3W7QA 2VENA 4JTHA 8TIMA 1FDZA 4RLIA 3GXTA 4EF8A 1AW2A 1YDNA 5AHMA 4DF0A 3PAJA 2NXGA 2ZA1A 1I2OA 3C56A 4GJ1A 3S42A 3TX9A 3S8HA 2QUTA 3W7PA 3TUUA 3G1AA 2UV8G 4JTSA 4BI5A 5HR7A 5LNRA 3G1VA 1YADA 3PBUA 2AAMA 2BWGA 4E38A 3MI2A 3HF3A 5HQEA 3E96A 1K8YA 4O16A 3B0UX 2X1RA 4CCCA 1LRTA 2ZYFA 4K8EA 4NZFA 2E6YA 4LUJA 3UWWA 4K38A 5DBUA 1X6UA 3BVJA 3ZWTA 4MY8A 5DN1A 5DY3A 4WXYA 3Q2DA 4AF0A 5EKYA 4UUIA 3NQFA 5K4ZA 3Q37A 4NXSA 1EIXA 4K39A 3UZJA 3NM1A 3QMTA 4N9BA 3W7GA 5BMXA 2Q8ZA 2A5HA 3LHVA 3PWAA 1U83A 2E5DA 3BGJA 2V81A 4OU1A 2A4AA 1OX4A 5I3GA 2H3DA 5FEPA 1GTHA 3LCHA 2W6RA 5K9XA 1B3OA 1EP3A 1KTNA 5D33A 2BSLA 4UIOA 3WK3A 2E1DA 2C6QA 1T99A 4TMBA 5KZEA 3QH2A 2RKXA 2YFNA 3EX2A 3TQ0A 3YPIA 3BPWA 3IIPA 4Z0SA 3N73A 5F1UA 4DELA 1JUKA 4LT9A 3LHUA 3NYZA 6ALDA 1KLZA 2PCQA 3DHFA 3MHGA 3MMTA 3PUDA 4ONVA 5C54A 2NX3A 2JK2A 3QC3A 3EXSA 1AMKA 4CCEA 2EPHA 1WV2A 1Y0EA 2NWRA 2ZRUA 3LBMA 4ZZ9A 4CCDA 5LNSA 1I45A 4DO4A 5G5IA 2XN2A 1IXQA 4NQ1A 3C2OA 1VRDA 1FWRA 3UY8A 5ABTA 1XDMA 3NL6A 4WY0F 2FFCA 4H3DA 3W7NA 2E68A 2P0OA 3C3NA 4FEZA 3O05A 3NQ7A 2Q8LA 3TXZA 1TJRA 5AHNA 1CI1A 2WNNA 3S1UA 3TW6A 3P8JA 1FWSA 4X3ZA 3THQA 1GTEA 3W9ZA 2PE4A 3PG8A 3THAA 2HMCA 3TCEA 4RZ5A 4UTWA 4ZL1A 2B4GA 2QCCA 2VEKA 1XBVA 4RX0A 5K9CA 3N9RA 4QAIA 1GYNA 1DJQA 4GBUA 3LHYA 3W84A 4MFDA 4L4LA 3P82A 3NL5A 1CX9A 5D03A 5CPNA 3MP3A 2JGQA 1VYRA 1R2TA 1WOAA 2Y7EA 4DXVA 4D2JA 2GQ8A 4HNNA 4QIUA 1OJXA 1C8VA 1LZOA 2EHHA 5AFDA 3VFLA 1DVJA 3NPUA 1D3HA 3USBA 1U5JA 4LC6A 2NUXA 2GVGA 4O1AA 4JTTA 3H54A 3G0SA 3FYOA 1G69A 2WSRA 1SSDA 3M9YA 3GAYA 1GOXA 3LXCA 4IX0A 1TPDA 5F2GA 1SO3A 3C2FA 4CQ9A 2P1FA 3MW7A 5SWUA 2OMAA 1XM3A 3G1YA 4FNQA 2AGKA 1Z42A 5AC8A 1YTEA 1SW0A 4TMCA 1LLWA 2DJLA 3BW2A 1X8FA 2Y70A 3OVPA 3PBYA 4HPXA 5F4SA 4LRSA 3BO9A 2V2HA 4ZVJA 5DCDA 4MYAA 4X22A 1XBYA 3SR7A 1G4EA 4U28A 1TV5A 5K2ZA 3CIXA 5CZTA 1OFOA 3GDLA 5H2ZA 1SZEA 4PODA 1H7WA 3W6YA 1H60A 2QCDA 3NEVA 2DZXA 1HO1A 1KFLA 5FF3A 2ZZ7A 2DP3A 1GWJA 1KBJA 1KA9F 4Y9AA 4RXGA 3ABQA 2ZZ2A 4FXRA 4O8RA 1XFBA 3P8IA 2YZRA 3IGXA 1PIIA 4QNWA 4YCPA 4PTNA 3M0ZA 1GG1A 1LBMA 2C15A 4UFIA 1G4SA 1OHLA 4LW7A 1M7OA 4O19A 1F6PA 3P5ZA 4GUFA 5BOOA 2YGYA 4E2DA 4R33A 1OFPA 1XUZA 5CPLA 3S1WA 3O6YX 3EX3A 4BR1A 4DPPA 4C1KA 1UB3A 4LOCA 4NNAA 1FCUA 1UCWA 1WOBA 3PB2A 3H53A 1TQXA 4HT3A 1ME8A 2TYSA 4NJKA 1SU5A 3QFEA 1GQNA 1LP6A 3C4UA 1JCNA 4IMDA 4LU0A 3QPZA 1X1OA 3NZRA 2VOMA 3HMJG 4Z0JA 4OE7A 2ZRYA 3P74A 3NR0A 2FB2A 3GAKA 3QEZA 3B03A 2Y7DA 2IQTA 2I1OA 4HKPA 3GDKA 2ZTJA 1OX5A 1ZALA 1NVMA 3CWOX 3DFOA 3GR8A 3KXQA 1A5SA 3W1XA 2CFFA 1SZFA 4WOQA 3SSJA 4FX8A 3W1NA 2RDTA 4UTJA 3O8AA 3PBWA 5G4WA 3W74A 3Q58A 3O1NA 4TIMA 3MBFA 3NO5A 2H3BA 1ONRA 4ZQOA 3WJZA 4NUWA 3TDFA 3LCLA 2ISVA 5DXYA 1K3UA 4NJIA 3TE9A 1TPC1 4A21A 1KM0A 4P61A 1TMHA 4K37A 1VPXA 3NNTA 2DZPA 3L9CA 5D2WA 4RV8A 1QPNA
chains in the Genus database with same CATH superfamily
4LV9A 4E8DA 1PVNA 4MKSA 1W9XA 3NA8A 2VGBA 3B3DA 5HWNA 1W6TA 1XSIA 5CZKA 4JTCA 2Z1SA 3BAKA 4PL2A 2F8QA 5DX7A 1EL3A 4DUOA 1MQQA 2CZ5A 2BVTA 4UQEA 2I5IA 1GKQA 4B90A 4Q8NA 2FZNA 4UZUA 3QR1A 1SO6A 2G96A 1V7AA 3DESA 5FOOA 2FMOA 3QLLA 5F1VA 3ES7A 5A1AA 2OZ0A 3UXLA 2PDJA 3CTLA 1XGZA 3TMQA 5HNTA 1KRAC 5CBBA 3HMCA 5M1TA 4C65A 3ONCA 2BBFA 2AQWA 1NEYA 1QOXA 1YHTA 4NF7A 3NM3A 1M3UA 1P0KA 3MTWA 3GQYA 3TYBA 4DJFA 1V02E 3OODA 4QS5A 1GHRA 1P1XA 1DWAM 4OVXA 4JFUA 3PR2A 2WWDA 5A6BD 3BLFA 3ZM8A 4B15A 2KZHA 2OKOA 3HA1A 4IMGA 4LY8A 1R3RA 4HA4A 4DI8A 1G6CA 3TTOA 3BSHA 4W8LA 4HMCA 3VDBA 3MI6A 2PDQA 3ZJ7A 1IEIA 4BFAA 3WD0A 3CAVA 1R87A 3TJ4A 4GGBA 4IHCA 2VURA 4IMFA 2CZEA 4MSSA 4IGHA 3MYPA 1OF6A 4XAPA 3PNUA 4UFHA 3U48A 4L1WA 3VNYA 1NARA 1DORA 1I2NA 1EKOA 2YDRA 5ABEA 5KINA 1W1A1 3BANA 4IP4A 1H49A 4WRHA 1FXQA 4GO8A 2R6OA 2PCEA 1WAUA 3IGUA 8XIAA 1R47A 2WQPA 3ZT5A 3PUOA 1NDYA 1US3A 3TNOA 1VKFA 2FHCA 3B9DA 3A5FA 3SDOA 5CBIA 3FIGA 2V3DA 4CQAA 3BJSA 3W2LA 1TPFA 2G4JA 4Y2WA 1LM1A 4L61A 5I03A 1L6WA 1BYBA 2Y4SA 2D2JA 1EX1A 4D71A 4NXKA 2NUYA 4XTIA 3O9NA 1T7LA 3LXAA 3Q45A 1L9WA 4HTBA 4AZIA 3QQ0A 5FEXA 5C7VA 4PB4A 1UPMB 4GIAA 3WBXA 3UR8A 2PGEA 3S5NA 3WFZA 3CYVA 5FF0A 4FLRA 3E0LA 1A5NC 4W89A 4ZODA 4LS0A 1QOPA 3KOYA 1W3NA 3WK2A 2E3ZA 3W7IA 1UWTA 1N7KA 1VCGA 8RUCA 3STGA 3URBA 4H6EA 1GJPA 2E6DA 3BGGA 3B9NA 2PBOA 1GYMA 1PEZA 2GSHA 1B54A 3A64A 3H8AA 3EOUA 3GVRA 4AZCB 3CQ0A 2DPEA 3K5XA 1OY0A 1EA9C 1DJNA 1H50A 2A6LA 4LTSA 2V5JA 4OHQA 3JU2A 1ZBWA 1JCJA 3PWGA 4GRSA 1O66A 3R7MA 4ZO7A 2HTMA 1BSIA 4DZAA 1VB9A 3L65A 1MEHA 2BY2A 1JUBA 3UJEA 1OWQA 3OHMB 1B2YA 3HGOA 5CPSA 1UR0A 1C92A 4QM1A 5DO8A 3VCNA 5G2WA 3LGEA 3V1HA 8CGTA 2E8ZA 3BCFA 4P8VA 2WZHA 2VCBA 4WD0A 2BTMA 4Y9PA 1XGDA 2WPGA 5LIWX 2MUCA 3L4TA 1RCOB 3MT1A 4AVNA 4PH6A 1TWSA 3EWZA 4AHQA 3E38A 2NV2A 4W87A 3VMPA 4C6MA 1XKYA 4XV0A 3E49A 1QAPA 1W1B1 2PWVA 4CU6A 1EJ7L 1EZ2A 1A0EA 4G1KA 1W9PA 1Z69A 3VO0A 5CG0A 4DXXA 5TD4A 1L6SA 3GHRA 3IUDA 3WH8A 4FF7A 4JICA 2VX5A 1MSSA 3BMVA 3PBGA 4FNRA 4TVUA 3AZSA 4R27A 1C9WA 2E5CA 2WBKA 1EZWA 1GOIA 2PDNA 2VTFA 1XGEA 3F2DA 3IUIA 1NWRA 4AWTA 2XYLA 1OYCA 4TTGA 3R2GA 3ABSA 3I6RA 4XUGA 2ZADA 3WEOA 3GH7A 3QR3A 5EMJA 1ZCOA 3PVFA 5CZJA 4NZ4A 2Y24A 1QT1A 3ZT7A 3TYCA 5BZAA 2QAFA 2YBTA 3GVVA 4NX5A 4W8BA 3W23A 1XLGA 2VEPA 3L2IA 3CAWA 3W28A 1Q6EA 4Q8QA 3FSUA 3LTPA 4F66A 3W1MA 3UCQA 2NLYA 2EJAA 3SIMA 1Y5XA 1SZGA 2ZDSA 3GX9A 1FX6A 3NL2A 2UY3A 3DHUA 3RU6A 4I6KA 4LUIA 4S3EA 4JS3A 4GYPC 4ORIA 5A8OA 4W8AA 1B9BA 3EWBX 4AX6A 3PG9A 1G01A 5C9RA 3B40A 4WY0A 3ITVA 5TQLA 3CZ8A 1A4LA 4E4UA 2V2CA 3LTYA 1V0NA 4KEUA 1QASA 3H2CA 1I75A 3CUJA 1XHGA 3LCWA 1KLYA 1LORA 4H9TA 4REQA 1JRCA 3NOYA 4LUTA 8A3HA 4JR5A 1T96A 3WNLA 4HSHA 3UNDA 4NJGA 4JCMA 3SQMA 2VVSA 3MUIA 4DPQA 4FX6M 2OQYA 4C6JA 3WK0A 2X05A 4J3UA 4M5PA 4LANA 5BXPA 3EXTA 3VDHA 1CCWB 4M0XA 4IP5A 3S9IA 1JQVA 4M81A 4MNLA 3IVSA 2OLHA 3WNKA 4HCHA 1AVAA 3ISIX 1M5WA 4HOWA 1XQKA 4HU0A 3W2UA 1PWLA 1SW7A 4NU7A 3TCSA 1F4AA 4LRTA 2NW0A 2OO6A 1DIKA 2FIQA 2C13A 2NX1A 2QPXA 5FEZA 3ECQA 4DVOA 3A47A 3K1GA 3KBVA 4JN6A 3C3UA 1FDYA 4FLQA 1CYGA 3AHYA 3AXMA 3KVMA 3SCUA 1XISA 3SRDA 4HHHA 5LIYX 3FDKA 4LYRA 1C9DA 4GZJA 4H6KA 3NCOA 3LCXA 4JX6A 4PFHA 5E0FA 3LHZA 2YBUA 3R4IA 3TLQA 3UXAA 1JZ4A 3RIKA 1I60A 1Q6QA 5CAKA 1A5LC 1MW3A 5U7SA 4FPSA 1E1CB 2W67A 1MNSA 5B7YA 1UOZA 2HS8A 1ISVA 1BLIA 4CQBA 1F3EA 1WBJA 4AD2A 1OD8A 1WZAA 3ATYA 5KITA 1E4MM 1C8YA 1KR1A 1UMYA 1FCQA 2NSXA 3LU2A 1W3HA 1WDDA 3G24A 3LX9A 3NWRA 3W76A 5AHLA 1OFBA 2Y8UA 1Z7AA 1ALDA 2QS8A 5L9FA 1H0IA 4ACYA 3B9EA 3DBPA 3RAOA 1VBUA 3EWWA 4MHBA 2NXIA 2ALDA 3A4WA 4HVXA 4AD0A 5F4XA 2WBGA 4RW5A 1YTDA 4JTEA 2E25A 3AYRA 1V51A 5DLCA 2G97A 2DVTA 5I3FA 3R0KA 1Z6KA 1MZHA 2J66A 4TX9A 2E40A 3G18A 4DRSA 4HU8A 1JCXA 1TZ9A 5CKSA 3VD3A 3M0IA 4FNSA 3AO0A 4MNKA 4YXGA 2TRSA 1XXXA 1LT8A 4O15A 1R7OA 2WMFA 1RZMA 1RVKA 4C6CA 4BF7A 5AECA 3PM6A 1JGIA 2PDXA 4R5EA 3WQCA 1GNXA 3V18A 1TJ0A 3PZOA 3VM5A 1M65A 1IIHA 4GISA 4NZ5A 4NNBA 2OOFA 3VIPA 3ITGA 3A24A 3BSGA 4I5UA 5MF5A 2INFA 3WLLA 1TVLA 3L68A 3CL8A 4GNKB 2YLAA 2YOCA 1DJHA 1TA3A 1PXGA 4QS6A 9XIAA 4DNHA 3VX0A 3AMLA 5I3HA 2YIHA 2HVMA 4HYRA 5HDRA 4K36A 4IUGA 2IKGA 3PAOA 4AW7A 1Z48A 3L5LA 3U3HA 4JNYA 4X63A 1S5VA 1VFHA 1S2TA 3R89A 1Q66A 5EMMA 1KKRA 1EHAA 4P8WA 3TR2A 4Q33A 1O95A 3W88A 1EC8A 1AW1A 4AG0A 3UU0A 1X7IA 3GW3A 1IV8A 3RPTA 4UZSA 3JW7A 4AYSA 2R1LA 4JTQA 5EGRA 3V5OA 4LAUA 4PE8A 2ON3A 1MI3A 2E6FA 1ZAIA 5JIPA 1LLZA 4PUKA 2F9RA 4LS1A 4XKYB 1K9EA 3BJTA 3O0FA 4HPJA 3T0AA 4WCJA 3UPBA 4QISA 3AMCA 2HS6A 1LQ2A 1EPXA 3KBJA 5A6MA 2OU4A 4B91A 1ODUA 1B90A 1AJ2A 4YL2A 3VKDA 3CLWA 3QTGA 2E0PA 1J6PA 3M47A 5T9BG 3MJYA 3CUHA 5IBXA 3QQ1A 1LLOA 3JR2A 5EMLA 2QZRA 3DU0A 2FZMA 2XHYA 5D2YA 1OZQA 4DJEC 1UD3A 1HG3A 3ITCA 4IIHA 1TPWA 1Q65A 4DI9A 2WANA 4XKMA 1GKPA 2XM1A 3BCJA 5BRBA 2ACSA 1GONA 4H4IA 1A0CA 1RQEA 3ERPA 4RNHA 5I00A 2DT1A 2OCZA 4PUJA 3OZOA 3E0VA 3LERA 5KZMA 4D72A 4F0HA 3V5FA 4CU7A 4J27A 4MDPA 1MZRA 3WSUA 1YPIA 4EANA 1F05A 1YMYA 3NL3A 2Y61A 2BY1A 3PY2A 5CCZA 3WIJA 4IGMA 3LN3A 5U4NA 2HV5A 3T78A 4I7WA 4YMZA 2PTWA 3VE9A 4KWOA 4LBRA 1U2YA 3BG5A 4K3ZA 3UNTA 2WC7A 3MI3A 2DY3A 2OGJA 2OSYA 3O0KA 1RJPA 4PA8A 2XFWA 1I1XA 3D47A 1KFKA 4DYJA 3T0DA 4NRSA 1SW3A 5M17A 1Z3NA 3W7EA 4US6A 3CQHA 2Z2BA 3EB3A 2XH4A 5EL1A 2VGIA 2QCLA 4Y96A 5AC6A 3E0IA 1E6RA 1RAKA 3B97A 2DSZA 2TPSA 5CSYA 2PMQA 1AA1B 2OLSA 2OEKA 3I10A 1M6JA 1QBAA 3IJ6A 4U5IA 3PBVA 1IYXA 1KFJA 1N8WA 3VK5A 2PWUA 3E2QA 2V2DA 4HNLA 4CU8A 1GQIA 4W88A 4KCVA 5FL1A 4O4VA 4Z1YA 1V3MA 2X41A 2WVVA 3OGSA 2DUZA 4CNOA 5I07A 2GUYA 2QF8A 1KXVA 2Y1HA 5CSSA 3MMWA 2NV1A 4YHEA 2GVJA 1QCWA 4CNNA 2OQLA 4DLFA 1JXKA 4BS0A 4XD4A 5C2GA 4OBRA 1JYXA 3AIBA 2ZBTA 4HGXA 4I5RA 1TYGA 3A6OA 3UR2A 4KBXA 3CPRA 4KCWA 3GXPA 4LVDA 4CQ8A 2EPNA 3WLJA 1GOWA 1F2JA 3HG2A 1E4NA 2D69A 3KL3A 1ICSA 2VFEA 1JI2A 5HUPA 1E5NA 2Z1BA 3CAKA 2B7OA 3B06A 4LYQA 4J3WA 1BF2A 4MB1A 1V03A 2FPTA 4WK9A 4QHRA 4ML9A 2QMKA 4EXQA 3VC5A 2PPGA 2XVLA 1E1CA 3CU2A 3KS6A 1TPB1 3IRDA 3VOCA 4GFSA 3TQKA 4QG6A 3WQ4A 3BXWA 4XBSA 5D38A 1QNSA 2V5BA 2D2OA 2P88A 3WLPA 3VKBA 1FWNA 3DFSA 4UTUA 4MOZA 4B2DA 4BA0A 2QKFA 3E2RA 3N17A 1CPUA 1P43A 5I3KA 3WO8A 1E4IA 2GUUA 3VIKA 3KWXA 1WCGA 4QEHA 1JRBA 1W1TA 4Q8PA 3AIRA 4RCXA 1K02A 3OVQA 2WJZA 1WDRA 3SECA 3W2KA 1XL9A 4FLSA 3DFNA 2O4MA 4HSNA 2CBJA 1TR9A 1I1WA 2WV8A 4A2RA 4X9YA 4WKHA 1HTIA 2QPSA 2DZVA 3GIQA 1I2PA 2A0NA 1UKTA 4QRNA 5DELA 4WGXA 1VCVA 1X8CA 3HBLA 2Y5EA 5AOUA 3M41A 3LM7A 4IP7A 3W7CA 5BCAA 3VINA 5FJJA 1JG9A 3DENA 3S6DA 1CZ1A 1QWGA 1FHUA 1YXCA 2ALRA 4MY9A 1REQB 3GG1A 3O15A 1MW0A 4XX6A 3EDDA 4C7GA 3W0KA 1OFEA 4DZHA 4LPCA 3S1GA 5LXXA 3MSYA 3NQEA 1UYQA 2OWXA 3KRZA 4UMAA 4AX7A 1J5TA 2B7QA 5PTDA 1PE1A 5A6KA 2X30A 4UTTA 3LA4A 4DM1A 3NUKA 1NQKA 1VR6A 1QI2A 1TJPA 5CEWA 3CPUA 1X6LA 2ZXAA 3KE0A 3MP5A 4XAZA 4XZMX 1CXEA 1UUMA 2CCRA 2TSYA 3BAXA 3WQPA 2BGNE 4HJWA 3UBPC 1PUDA 4L6DA 1YDVA 5TNVA 4DWSD 3AWNA 2OYKA 1E9IA 3TZNA 1Q6GA 4XSMA 3VCCA 4Z1AA 2WO5A 2ZC1A 4HA1A 3W7KA 4GA8A 3TIMA 4GABA 1NF7A 2J7EA 1NFBA 4IICA 1EGZA 2YR1A 1OGGA 2VCAA 3NQ6A 3T7VA 3H2AA 2CLLA 1R0MA 4J3ZA 4LGXA 1WA3A 1IT7A 2CXEA 2IQDA 3KOZA 1XSJA 1BGAA 4LVGA 3Q4DA 3HFTA 3W1RA 1EIBA 5JBDA 3IEBA 4GI4A 3SY1A 1MQRA 4Y6GA 5H6HA 4JFVA 1F7BA 1LTDA 2PF8A 1OCNA 2PB1A 2TODA 2DT2A 4GE8A 5DANA 4IFKB 4L4MA 1OYBA 3E3HA 3PSWA 1SFLA 4GVHA 5ABHA 2BXZA 1SFSA 4EIVA 1HKIA 3C0SA 2YDQA 2D22A 4A3QA 4AIEA 3VDAA 3W1QA 4LYPA 1UW9A 1UZDA 1CXKA 1CXIA 1OF8A 3HGRA 2YYTA 3GUGA 4GIRA 4BI6A 3A4XA 3MVIA 3HPSA 3THUA 3ZJKA 3RDKA 4AD5A 1LL7A 3GG8A 1KXTA 1R38A 1YBQB 2B7PA 2X1UA 1V8EA 3R94A 3CQIA 2PRLA 3ZYZA 2PGWA 3BOXA 3BMWA 1XC6A 2VKZG 4IZGA 2NQJA 3W2NA 3RX4A 4IQJA 2IQ0A 1JF5A 5FEWA 1AJZA 3L4YA 3S5YA 4L5ZA 1GPWA 2XH2A 5BXRA 3QZEA 4S2CA 2QIIA 2Z26A 2VZUA 3NEHA 2D24A 2VWSA 3ZZ1A 1KBLA 2P3EA 4XTDA 4S3BA 1RA0A 3VTRA 3LNPA 4EAYA 1ZPTA 3QGAC 5EFFA 3OB8A 2F6KA 2RGMA 3PPGA 4DZIA 2ZRXA 3WEZA 1R3QA 1TV7A 4UFJA 2NZLA 1UBSA 1PZ2A 1QNPA 4QEEA 5D02A 1O1ZA 3AS3A 1FCBA 2E5BA 3H26A 5EPDA 2CU0A 3STFA 1JPDX 3ALFA 1NDZA 4EPDC 2EKCA 5A8MA 5EB8A 4WJXA 4ALDA 3PK7A 3NPVA 4N9DA 1W8GA 5IFPA 3PZGA 4X2RA 4GMEA 5XINA 3KVLA 1WDWA 1PCWA 1P48A 1LJYA 1IWAA 4JTHA 8TIMA 1FDZA 4MKVA 2E9BA 4GYJA 5AHMA 2YDSA 1V3IA 3M6DA 4ZCWA 1KWKA 1JI1A 4GK8A 4RNIA 1O7AA 3TUUA 4FAMA 2UV8G 4XO7A 4MWAE 5LNRA 3A13A 4D6GA 1OCQA 1BXNA 1K8YA 3B0UX 3IWPA 2X1RA 3L4XA 4CCCA 4K8EA 3UWWA 4K38A 5DBUA 4QE4A 4MY8A 5DN1A 3TWAA 4QE1A 5DY3A 2JALA 3Q2DA 4B5SA 3T05A 2Z2AA 4JTDA 5I23A 3KBWA 4N42A 5EKYA 4UUIA 3NQFA 1DXIA 4KPLA 2D0GA 4ECLA 1EIXA 4K39A 4GO9A 2PLJA 1Q6CA 1RXOB 3WDRA 4N9BA 4F2BA 2Q8ZA 3I3EA 2FZDA 3FA4A 3BL3A 1GGOA 1U83A 3GC4A 3VGBA 4XK2A 1YQ2A 5I09A 5I3GA 1HGWA 2H3DA 2MANA 5FEPA 4L6HA 4HYVA 2QGYA 3LCHA 1CXFA 1B3OA 3PHAA 1KTNA 3BICA 4ZB0A 4FR1A 2C6QA 2ZUVA 4TMBA 2YJQA 3SFWA 2RKXA 4AIBA 1R9XA 3TQ0A 3YPIA 1EPVA 4ZOEA 1CLVA 2HQAA 4H41A 4A8LA 3S47A 2BS9A 1J0KA 6ALDA 2PCQA 3E2SA 3TC3A 2NX3A 2WK2A 3LBMA 4ZZ9A 3PTDA 2NV9A 1BHGA 4OECA 4DO4A 4PMUA 4LBSA 3KLKA 5G5IA 3V0UA 2I5QA 2AL2B 4M82A 3UY8A 3NL6A 3RLGA 3LMZA 4H3DA 1PJ9A 2R82A 4AEEA 2P0OA 3APYA 4FEZA 4TXEA 1TJRA 3OLDA 3P8JA 1CGWA 1FWSA 4X3ZA 2HBVA 3SUSA 1GTEA 1KCLA 1XCXA 3TCEA 2GGIA 1TMLA 1XLLA 4MUPA 3WQEA 2VVNA 2QCCA 1XBVA 3KCLA 4RX0A 1JDDA 1FH7A 4KWSA 3IPWA 4HK7A 3LHYA 3L2LA 3PNZA 4L4LA 3P82A 4PULA 3ARXA 5D03A 2R24A 4RE2A 3HQOA 3MJMA 1VYRA 2Z1XA 1WOAA 1IWPA 3LSCA 3FA3A 1C8VA 1LZOA 1KGXA 2C79A 2GZXA 3FYOA 3UJFA 1G69A 2WSRA 4YYFA 3M9YA 4L80A 3LXCA 2WHJA 1REQA 2PBGA 3ARPA 4ZO6A 4CQ9A 5C9ZA 3G1YA 3PP7A 2AGKA 3TW9A 3VIJA 2ZXQA 3IACA 1XLBA 4DX3A 4D6HA 1EC9A 2CXGA 3L23A 4UQBA 1WP6A 1FVPA 1CXLA 4IJCA 3BO9A 2CBVA 3H7RA 2GJXB 4YNGA 3XIMA 2V2HA 3RM9A 3VA8A 4B3LA 4YVPA 1QRQA 1G4EA 1TV5A 3VVGA 3CIXA 5C71A 3KDOA 4GYPA 5FAJA 4EPBC 1U30A 2FH8A 4Y9MA 4PODA 1FWGC 1CDGA 1FH9A 3VZZA 3H21A 3WL1A 4E3TA 3WBWA 3MWCA 3N4FA 1GWJA 1KBJA 1KA9F 2X0YA 2BB0A 2GSEA 2RAGA 4LY4A 4LSBA 2JIEA 3E0FA 2WW5A 4O8RA 3P8IA 3FVMA 3VOHA 4NI3A 1WUFA 4UFIA 4Q8UA 4LW7A 5DF0A 3GG0A 4IGSA 1U33A 1W91A 2YGYA 1Y65A 4R33A 1VFLA 5FJPA 1KD0A 4DPPA 4C1KA 5CH9A 3W00A 1UB3A 4JZ5A 4PR4A 4NNAA 1R3SA 1UCWA 4GOAA 4PMDA 5CJMA 1F07A 1XDJA 4JOMA 1T8QA 4LBUA 1TQXA 2WXDM 1ME8A 1S5NA 2QDEA 4IMDA 3QPZA 3NZRA 4IFKA 1RLCL 4Z0JA 3DFHA 1XPYA 1UJQA 1MXGA 4PB3A 2I1OA 4HKPA 4A3YA 3EYPA 4CVUA 1ZALA 1NVMA 4EXBA 3DFOA 3WQGA 4PRWA 4M1BA 2VWTA 4RE0A 4WOQA 2HPMA 5C7HA 4ASTA 3SSJA 3UEQA 4W85A 1TE1A 3DUGA 4Y8EA 3O8AA 3PBWA 1BVWA 3Q58A 1KCKA 3MBFA 1E6NA 2X09A 3V16A 4ZBCA 4NUWA 4HZ8A 3LCLA 3QV8A 1W1VA 3M0YA 2FMNA 1VRXA 1KM0A 1ZRQA 2DZPA 4RV8A 4JHOA 4HIBA 2A1YA 2Q3RA 4JIQA 3VOGA 5LNUA 1XS2A 3OLGA 1W9DM 2ISSA 3T8QA 1K03A 3RLUA 1KM1A 3W7DA 3W38A 4P7OA 1VLWA 1S2UA 4IXXA 4FIQA 4GXPA 3T4WA 2YSWA 4PMXA 1XIIA 3ABOA 4CN1A 2WC4A 2JF7A 4Q3MA 1Y7VA 1XBXA 2QJMA 1V3KA 4WEVX 5BNKA 5CPMA 1RPKA 4UTIA 3WFAA 1TPVA 1OX6A 1EDTA 4QSFA 4K1GA 4UC5A 4WUIA 5DMLA 3KL5A 3VX1A 4HB7A 3MHFA 2YX0A 1XIJA 3AHZA 2HE5A 2A3LA 3B05A 2P10A 2WCAA 3OZMA 1I0DA 1ITXA 4JPGA 1Q4WA 4UBPC 4DYEA 2WHLA 1DYSA 3W37A 4Q7NA 4ACZB 1W0MA 4F2UA 3VNJA 4JYEA 3DERA 2WPBA 1ZGDA 4Z2JA 3NZGA 2RH9A 4TQTA 1H7RA 1QU4A 3CIWA 2PD5A 3IVTA 2P53A 2H9AB 3B8UA 4A29A 5J5DA 1QDSA 4KEVA 4EWJA 3H22A 2GWGA 1ZZMA 4Y90A 4A2SA 5CLWA 4IJRA 3IJLA 3EDFA 1MEWA 3ONBA 2EG7A 4XIAA 3RK8A 3SCRA 3OBKA 1NFGA 3M0VA 3U7BA 5D05A 3PS7A 4O28A 3MDUA 5G2IA 1GCYA 3DFYA 1Y5WA 3DC8A 2WJEA 2XJ7A 1J79A 5FA5A 4UB9A 3HG4A 1TV2A 2PLKA 2OWWA 4AZ5A 3UPWA 1SFJA 1R6WA 1YE4A 4H04A 3B9AA 3HQPA 4O52A 3IJQA 1X6NA 2Y7FA 4EACA 4AZBA 3MO4A 1C29A 3M46A 2Q01A 4S1FA 4I9JA 3BE7A 5ABFA 1RH9A 2GJLA 1TR1A 1D8CA 3A22A 4QNEA 4A3RA 3GTXA 4YCOA 3F4CA 3MCOA 1R3VA 3P3BA 3CL7A 2DQWA 4CNUA 4NILA 1XPGA 1S38A 3R8RA 3PZVA 1HZYA 4H7CA 3RMEA 2XFFA 2ATMA 5EBAA 5HINA 1BXCA 3P61A 2CLKA 2WCGA 5D8ZA 1GG0A 4O1DA 3N2OA 3WY1A 2O7QA 1V6XA 1TIWA 5KZDA 3SJ3A 2AL2A 3S1VA 3PJXA 3G3DA 3KHDA 2B81A 4IPIA 1MEIA 3HO8A 2XN0A 4NAFA 2VD8A 1TCDA 2IKHA 1XLIA 3N12A 4GXMA 3N19B 4Q4KA 1W3TA 1TWZA 4F0RA 4JTAA 1E5JA 2F84A 3E9AA 3HURA 2G4FA 3WDJA 1LG1A 2OEJA 2W63A 3INPA 1TKKA 4QJ3B 1EJSC 3T0TA 5JQ9A 4LNYA 1ZLPA 1NM9A 4GJJA 4K7YA 4DJEA 1CENA 3CO4A 4AY8A 1XYLA 5D2VA 2F38A 4Q6XA 2O92A 1HKVA 4TR9A 3WLNA 3N2XA 3TA9A 4EVZA 2V5CA 3T0CA 3HPXA 5DXXA 1W8SA 4GQRA 3VUSA 3VIFA 5M03A 2WMJA 3NQDA 3GS6A 1FKXA 1FWDC 3ALGA 4RKAA 3LXBA 2VZVA 4JTUA 1WKYA 3N6HA 3CV6A 3WBAA 1KXQA 4YHGA 1UH4A 3QMSA 3EMQA 1JYVA 2QUMA 4US5A 5B80A 1EOMA 2HDJA 2CHRA 4WKAA 5MKGA 1GVYA 4GYKA 4PMVA 3CUGA 4E0CA 1Q8AA 5A8QA 2GJXA 1OB0A 2GUBA 4W5UA 2X2GA 2CNCA 4I5XA 2ZRVA 1V7YA 5D2TA 2FZBA 4GQGA 2CKSA 4P7LA 3C6CA 1GVFA 4NAEA 3KCOA 3C61A 2DEPA 2FFIA 2OX1A 4FR6A 1ENUA 4AMAA 3UG3A 2JKPA 5D2XA 4N7QA 2Y0FA 2R91A 2BOEX 3MDWA 4H9ZA 4FNTA 3WLTA 2VEIA 2OT1A 3RXZA 3AYVA 1WQ5A 4BWLC 5AB3A 3STEA 2UY4A 1UBPC 4GG9A 3EOLA 4RNFA 3SADA 1EB3A 2OZ8A 3FGCB 4XVDA 3LHWA 2QDHA 5FACA 2NUWA 4JTKA 4LEFA 2VRQA 3G1SA 5T91A 1HUVA 1KC7A 1YDYA 3WF4A 3GR4A 4UCGA 3P14A 4J9JA 5EMKA 4DBWA 5TIMA 1K6AA 2EBNA 4AFYA 1JF6A 1RP9A 5EFDA 4GI8A 1KM5A 2PD9A 2QMJA 3V1PA 3UF9A 1LQ0A 3LPPA 3TC6A 3AXHA 2WSQA 4JGDA 3STCA 2FPVA 3TTEA 2HRWA 4HJFA 3SGGA 2DVUA 3WQWA 1K8ZA 4WOZA 1NY1A 1SYTA 1MXDA 3IRSA 2DJXA 2OODA 2W4XA 1FWTA 3LHTA 4N4PA 4ZSTA 3V75A 3AWOA 4EK7A 1A5KC 4IPNB 4PMRA 5G1MA 1K77A 3P0XA 3BLDA 1I8JA 2HJPA 3ABZA 4G7FA 3VZXA 1XUUA 3UG4A 1AW5A 1UR8A 2E7FA 4LC8A 2A7NA 3BJFA 2WNQA 5REQB 4ADUA 1BWLA 1US2A 1P0NA 2BHZA 1KTBA 3U7VA 4MM1A 3KZSA 2WMIB 3EA2A 3L7RA 1E72M 3BLEA 3II1A 1HJVA 3GIYA 3AIWA 2QT3A 3MMDA 3WELA 1E6ZA 1LCOA 2C16A 3L67A 2EPLX 2WYSA 3GUWA 2GQAA 3L5MA 1DTNA 2CBUA 4DWSC 1BKHA 3S2JA 4GC3A 1UD5A 1JNEA 3DYOA 3H12A 1E56A 5I06A 4WJ8A 3MSRA 3GC2A 3H2MA 4B3KA 2P5NA 3AHVA 1OG0A 3G22A 3HQ1A 2B7NA 3HPFA 1FP9A 4HZMA 3EWXA 4LAMA 1RK6A 3W02A 2OWCA 5LA2A 3C5QA 4AC1X 2ATSA 2ZTKA 4G1NA 1T8XA 4PCSA 2Q6ZA 4PC8A 2A3HA 3KS5A 1WAWA 3NG3A 4Q8WA 3HB9A 3E2VA 4ACZA 2DIEA 3VOJA 2ZZ1A 2QGHA 1GVIA 2QXWA 3GXNA 4PCNA 4UFKA 1S2WA 3GTNA 2HVOA 3S5SA 1QFEA 4IIDA 3ES8A 3GU9A 3B9OA 3EMZA 2R8WA 4OV4A 3NZ1A 2V5KA 2QJGA 3A3XA 3TP4A 3T6CA 1PV8A 3T0BA 2H9AA 3BUVA 1GVSA 3W2JA 5A94A 1EO7A 4KCTA 3B0XA 2VMFA 3CASA 4KFOA 2ZZ5A 3G1FA 2ONEA 1XICA 1V3HA 4ZMGA 1H7OA 3GK0A 1HX0A 5IM51 1RQHA 3L12A 4PTWA 4O54A 1JJKA 3UESA 1WKDA 2VFHA 3L0NA 3CH0A 1JYWA 5GNYA 4MWAA 4W9TA 1IGWA 2D1ZA 2CYGA 3GVQA 3UETA 3TOYA 2D0HA 2EPKX 4N9EA 3S9YA 3TEVA 2Z7GA 4YWIA 2OVLA 1BTCA 5H1WA 5CGMA 3WLHA 1YLVA 4AMCA 2NXHA 3VGFA 4Z42C 4UQCA 1JNDA 4HU4A 4C6QA 3R43A 4UWMA 3SY5A 4O0KA 3RRAA 5FI8A 2KAUC 1FHVA 3BAWA 3L4ZA 1VJSA 2PF0A 3C2RA 1UC4A 4MZ1A 4C7FA 1X98A 4KFPA 5AC7A 1W56A 1ZBVA 3M4HA 5C6MA 3ZT6A 3W81A 2J8GA 4BZYA 1F61A 5B7ZA 3R0DA 4G2DA 4CNPA 3F03K 4PUUA 3H2OA 3GDRA 1ZSXA 4N9CA 1RALA 3QY8A 2IPGA 3R10A 3AIUA 2XIJA 4B5XA 3RLVA 1IIGA 1DHKA 4DUVA 2X40A 3QGVA 1V6VA 1EYEA 4R53A 5BOEA 1IXPA 2ANUA 2J25A 3EDJA 1FP8A 1RY8A 3P67A 3GY1A 4XB3A 2VELA 4H8VA 3WD4A 2E6AA 7TAAA 4TO8A 4J3SA 2J9ZA 2Y88A 1GW1A 3THCA 1XF0A 4RV3A 5IHSA 1X38A 2A85A 3FS2A 4GNJA 1VYPX 1W5PA 3E0WA 4Z2GA 3ICJA 4IQLA 3MV01 4ZE5A 2WKJA 2GGHA 2EKGA 4CD8A 3VNDA 4N4QA 2D23A 1EJWC 1GVEA 4CNSA 3ARSA 1OFAA 3FHAA 4M6QA 3H24A 3T42A 4XG1A 2GQ3A 2V30A 5BMWA 3NQ8A 1L2UA 3MP4A 5DMMA 5AVNA 4M80A 4G7EB 1XINA 3UERA 3GHUA 1G9HA 1OCBA 4YVVA 3HJZA 4MJZA 4PYSA 3R8GA 2FVLA 2VRKA 3HGJA 3W7LA 3GTIA 1MFUA 5HQMA 4Q4PA 4UFMA 3AJXA 3N2TA 1BTMA 2VFDA 4FHAA 1IR1A 3D5HA 3NOEA 3KWSA 3UWUA 1QHOA 2G3FA 1JFXA 4POCA 3LK6A 1LG2A 2QPUA 2YXGA 1UR9A 3CZKA 3POHA 3O7UA 3IGSA 1DJXA 3WLMA 1QXLA 1DIEA 1RA5A 4LXFA 3CL6A 3I7SA 4EAMA 2ZCGA 2ZA3A 2VX4A 3W7MA 2DZSA 4C1NB 1H41A 3FGCA 2V5LA 1D2KA 4H2HA 3UVIA 1FWEC 5A2BA 3HG3A 1VEMA 3GB6A 1XCFA 3PFRA 3LI0A 3L66A 1RQBA 1VS1A 4NZ3A 5A8GA 2I57A 5AKQA 4RPPA 4A6GA 4B9ZA 3M6YA 5A6TC 3QSTA 2D3LA 4GINA 1KFBA 5HULA 2XISA 3LG3A 2G41A 3NQAA 4FSAA 4UTMA 2O9PA 3I7RA 1DKWA 2H8ZA 1JR1A 1CGYA 4NKCA 4H6QA 3KOFA 4S2BA 2RJGA 3M07A 3VYLA 2CLHA 3IJ9A 4C1LA 3AQUA 4UTKA 1T0OA 5C2CA 1W32A 4PEKA 4DLMA 4WDUA 3SIZA 4HPHA 1QO2A 3EPNA 4JYFA 3CZJA 2W5FA 5J04A 3GLCA 2OSWA 5C0QA 2Q09A 5BXSA 3QV9A 5I78A 3I68A 1S3HA 3ID7A 1EX5A 3ARVA 3SBFA 1SQ7A 4YU1A 4LH8A 1UC5A 4OQVA 4Q8VA 3W6LA 2BHUA 4CNTA 4DUXA 4Y9OA 3F4NA 3KRSA 1V6UA 1JPHA 4L56A 4MVAA 2ZA2A 3TN4A 3T81A 5E6ZA 3MUZ1 2RFGA 4AC7C 3BLIA 4ZFMA 1Q5MA 5IOBA 4RNJA 5REQA 1KFWA 1RBLA 2J8FA 3P62A 4G5DA 4NYUA 5LHEA 3FAWA 4DF2A 4V15A 3LZ5A 3N3MA 2ABBA 2DSKA 4CEXC 1GEQA 3PPCA 4P8XA 3REQB 4XD6A 3WJYA 4AVFA 1J10A 4JYDA 3DFTA 3S3GA 4R85A 4IQDA 4PTMA 4WX2A 2E9LA 1QUMA 3V5CA 3SCVA 1XLAA 1QO5A 1Q63A 3QPYA 1VFUA 3AMDA 4GLEA 4JKLA 4NSBA 3AU6A 3B0YA 4GCAA 5ENLA 3QQWA 2CKRA 1UWSA 3GFYA 3WENA 1B5TA 3LQGA 4ES4A 2OFJA 3G3MA 4FZIA 3ZR5A 3CHVA 1NSJA 4AD3A 4IMAA 3P80A 5LNVA 1XX1A 4BKNA 1T41A 4B4FA 1H1NA 1A47A 3FAXA 4ZR8A 4LVBA 1QVBA 3MQTA 5JU6A 3CM4A 3BWWA 1E71M 3OW1A 3GG7A 4D6EA 1W17A 2AL1A 2CESA 1HL8A 3P84A 3W2MA 4XZ9A 1SM9A 1RBOB 2CERA 4D8LA 1M9HA 4IPJA 2BV9A 1ICQA 4IH3A 5LYRA 1CLKA 1HJUA 4AIOA 4GD0A 2ZDRA 2E28A 4MADA 5A6SA 3I65A 2Y2WA 2X0HA 2OJPA 2I5GA 1QHZA 1S39A 1SR9A 4PUNA 2XH7A 4IIFA 1A80A 1KFEA 2C0HA 2GOUA 1TUFA 3CO8A 3ANUA 4NNCA 3S1XA 2J77A 2VYOA 1J0HA 2CLPA 3F4WA 1V3LA 2YCKX 2ZUWA 3AYTA 1J6OA 2Y89A 4LUSB 1PIGA 3AIVA 3FJNA 2V69A 2QUNA 3NO3A 2CHOA 4UQDA 3HQNA 3A3HA 2Q71A 2EJ1A 5CC6A 4K1WA 5CJ5A 3EPMA 5TBOA 4ZQPA 4ZSUA 4H7VA 1HXJA 2ZVRA 3N9KA 4C6IA 1NH6A 3O6DA 4KFNA 1W1PA 5I3JA 3D46A 4V2XA 3H2NA 4HZ7A 4HNVA 1H51A 1YDOA 2A3AA 3S0CA 4GVGA 5LIXX 4D8AA 3FYYA 2POTA 4OFCA 1HKWA 5LA0A 4GUHA 2VDIA 4J7RA 1ML1A 2PWFA 4O18A 2ZIDA 2QJJA 1L0PA 1UD6A 3VC6A 4D9PA 2O4QA 1FFRA 1POJA 2LLEA 3CUXA 4E5TA 1Q2RA 3S9ZA 4ZGYA 1DBTA 7CGTA 2QAPA 4B2DD 5CBJA 4QSHA 1NIUA 5FKYA 3KHJA 4Q4RA 5TAOA 3NYDA 1KXHA 3EOEA 1J11A 2Z25A 3PUEA 1FWFC 4X2PA 1U1HA 4ERIA 3S6OA 3B8IA 2Z6IA 1NELA 1CGTA 2WSYA 2D0FA 1MDRA 2C91A 3K4DA 3DFQA 4C6KA 2I9UA 2CWNA 4QLKA 3T2OA 4C6BA 3PPFA 2GJRA 1F6KA 4HP5A 3FOKA 1Q7QA 3SZ8A 4YS1A 6CGTA 4HHLA 2XIQA 3T8LA 2J7BA 2QCFA 2IKJA 2QVHA 1NQ6A 2QR6A 7XIMA 4ZQNA 1ZCCA 5XIAA 3BV7A 3IGHX 3MKVA 3GH5A 3TNBA 5E1QA 2WNWA 1A0DA 4BHYA 2FB3A 3R79A 3MVTA 3SUUA 3EX1A 4I3GA 1Z9AA 4D1JA 3WUGA 3PZQA 3ZWSA 4I7UA 2VOTA 4H8NA 3N1AA 5T26A 2CHNA 2PGFA 4J3XA 3A23A 2BNJA 4DWSB 3AAMA 3V4BA 2PZ0A 3O2LA 4JXCA 4O53A 4GY0A 1SZNA 1EEXA 3RR4A 2DZBA 4Q4SA 4M51A 1EDQA 5LNWA 1ICPA 5LIKX 2V67A 2BY3A 3RM4A 5A2CA 5AHIA 1P5BA 3AICA 3ABRA 3UG8A 3CWNA 4C5ZA 1NP0A 4U31A 3G1HA 3WJSA 1JZ5A 3LLDA 3C2EA 3RPDA 1G4PA 1R9YA 4DBSA 4DUWA 4RK8A 5CC5A 4D6IA 4PEEA 4BJHA 4F3HA 3B8WA 2FHFA 4H9XA 2Z4GA 2VC5A 2FQIA 1THFD 2Y8KA 4ZEPA 2CIPA 4F9JA 2J9YA 3DG3A 2BZNA 1KO0A 3CBWA 2FGLA 4H2CA 3WN6A 5F4WA 1YPXA 3WDHA 4O17A 1GK8A 5H8MA 1EF2A 4JHMA 5CC7A 3TAKA 3H7UA 2JEQA 4C60A 3R11A 3UWYA 2CETA 2WZTA 2J24A 1UG6A 6ENLA 2DIJA 1VEPA 3QOKA 1RPXA 3EB2A 4UNLA 1I6NA 5DRIA 5EY5A 4D6DA 1SO4A 4E6MA 4AYGA 1P7TB 3TQPA 4AY7A 5A5WA 5JH2A 4HHPA 4JQAA 1ZU8A 3SCPA 3CHEA 1UIOA 3QJAA 1J01A 1PS9A 3SCWA 4FO4A 3WNNA 4XQ6A 2J74A 2VR5A 5M5DA 2QCMA 4JD4A 5AYZA 1M68A 2VX6A 2QYGA 2ZWYA 1PDYA 4DQWA 4HA3A 2ZE0A 3WDPP 2AGTA 1F8IA 2PLCA 5D04C 3JZEA 4ATLA 1H4PA 5GJMA 3BG3A 3BOFA 3J7HA 3MCMA 4KW2A 3B8VA 3PULA 1BYAA 2GVYA 3SRKA 2XIBA 1A3XA 3TJIA 2YBVA 1PPIA 3ME3A 3BZJA 4QJ1A 1HVXA 2XVNA 3B0PA 3HJEA 2GWNA 1DJZA 3WLQA 4FI4A 1CT5A 2OLAA 3BK0A 1VZWA 3LOTA 3C8NA 4P5UA 1D3CA 1YYAA 5FAGA 3W7QA 2VUNA 3U4AA 2ISFA 4NY2A 4LCQA 2Z1KA 2NXGA 2VZSA 3C56A 3SURA 3DEQA 3TX9A 1JAEA 3FNDA 3S8HA 2QUTA 4JTSA 4BI5A 3AMKA 1TV3A 3G1VA 3PBUA 2AAMA 4E38A 1T5AA 3HF3A 1J0ZA 4O16A 3P6LA 1DWIM 4PTVA 1LRTA 1K1DA 3P0WA 3SCQA 3UGRA 2WJDA 4CQDA 3OLEA 5CXPA 4IPPA 1HVQA 2VDGA 2FJUB 3KTXA 2REQB 4Q7BA 3W7GA 5BMXA 2JE8A 2A5HA 3PWAA 3LY0A 2V3FA 3JUGA 5AVHA 2G8ZA 4ML4A 4EPKA 2VM8A 3E5PA 2WC3A 4YTUA 4F0LA 1W1YA 3UJRA 5JBFA 1GTHA 4JN7A 4DY1A 2BSLA 3WK3A 2E1DA 4QQUA 3ZLHA 4PUDA 3VXGA 1T99A 5BOFA 3QH2A 4PMJA 2YFNA 4PGLA 4TOQA 4Z0SA 3N73A 4MG4A 4DELA 1E55A 1J0YA 4LT9A 1QW8A 3NJ3A 1KLZA 4Q8MA 3MHGA 2QQ6A 3ZO9A 1W9BM 1PB0A 2JK2A 2EPHA 1Y0EA 2NWRA 4CCDA 1I45A 4BQ5A 2UY5A 3WNOA 2XN2A 4NQ1A 3C2OA 3COTA 1XDMA 4WY0F 1FWAC 3O05A 1G1YA 1XYAA 2Q8LA 1UWAA 2C71A 3N11A 8XIMA 4Q8TA 3THQA 3W9ZA 2PE4A 2HMCA 4ZL1A 2B4GA 3QBUA 2CPUA 5K9CA 4NZ1A 4TX8A 1LWIA 3ZVIA 1Q7MA 3N9RA 1E73M 1DJQA 1GYNA 4GBUA 3OGVA 3W84A 4MFDA 1JZ6A 5CPNA 2FTWA 2JGQA 4QX4A 1LF1A 3KCJA 2INZA 6REQB 1YRRA 2D20A 4HNNA 5A6JA 3WLOA 1DQUA 3DECA 2BY0A 2DQXA 2NT1A 1KBKA 2DUXA 2PLMA 1DVJA 1D3HA 2OTDA 3PJWA 3USBA 4XZWA 1XLJA 3GZAA 3WFLA 1JFHA 1CEOA 3UXIA 1SO3A 1EDGA 1DXEA 3C2FA 5SWUA 3GW0A 1BRLB 3IAQA 4FNQA 1O68A 1OIMA 3GSMA 3RX2A 3CHDA 3HV9A 3BW2A 3WF1A 2Y70A 3OVPA 4HPXA 5F4SA 2AMGA 4LRSA 1PZ3A 1OC7A 3C0LA 4RZBA 4MYAA 2V63A 4U28A 3ARQA 4HD5A 4WF7A 5DQPA 3EB4A 1QI4A 3E5BA 4JEJA 5FJOA 5CZTA 5D4YA 1UHVA 3FX4A 3GDLA 5H2ZA 4PBGA 2E67A 2OGYA 1H7WA 5IDZA 3GXIA 3W6YA 3U5YA 1H60A 3G1RA 4KIRA 2BODX 2EG6A 2NVCA 2ZWZA 1UQYA 1V08A 3WF2A 4Y9AA 4RL3A 4IGNA 5CJNA 4FXRA 1XJBA 2HXUA 1VIWA 2YZRA 3MKKA 1GKRA 5ECUA 4PTNA 1EOKA 3RO8A 1GG1A 2C15A 1G4SA 2ZUTA 4KS0A 3THDA 4WR3A 4BQ2A 4UOQA 4GUFA 1OEPA 4E2DA 1NWTA 1OFPA 3O6YX 1MRQA 1LQAA 3TOPA 4LOCA 4QROA 3EWDA 1X39A 4L4OA 3PB2A 2CZVA 3H53A 1XW8A 2TYSA 3M0HA 3QFEA 1JCNA 2VOMA 4UOZA 2ZRYA 3PTMA 3GAKA 1QNRA 3QEZA 2Y7DA 5E9XA 3BZGA 1S2VA 3GDKA 1OX5A 4GX9A 1JZ8A 1N8IA 1OSEA 1WB0A 3CQKA 2Z27A 1A5SA 2WVSA 4Q22A 2CFFA 4OUEA 1QNOA 1XG3A 1KQYA 2NVDA 4XISA 4I9TA 3W1NA 4UTJA 2ZOXA 4TIMA 4TVCA 2OB3A 4AUBA 3KBNA 4U3AA 2H3BA 2VGFA 4JFTA 3Q65A 3WJZA 3WQVA 2FH6A 3TWBA 5DXYA 3TE9A 1XRVA 1ZBKA 4O1FA 2GLKA 4HA0A 3K1DA 3G77A 4NHVA 4H7ZA 4K37A 3FEQA 1SFTA 3UWVA 1DJWA 4WLCA 4M29A 5CQ1A 4C7DA 4RE4A 4YWSA 4MZYA 3VD7A 3CPGA 2YCIX 4GACA 3SQLA 4DHGA 5G1TA 1JYNA 5G4HC 1UH3A 3HFYA 3M43A 1AH0A 5D37A 3O6AA 3AIQA 3W87A 4OBTA 1RD5A 3UJ2A 3WQFA 2WHMA 1JUEA 2J6XA 4U2ZA 4S38A 3ZQ9A 5I2UA 2WM1A 2WWCA 3EA1A 4MDOA 1UA7A 4XZLX 4HZ6A 4J4KA 2W91A 5IXEA 1IT8A 4O11A 2WB5A 5CPQA 3UWZA 4DNMA 3UWEA 3TR9A 4B9YA 1YIXA 5GJPA 2ZZ3A 3M0JA 4GQ0A 1EXBA 1E51A 3RU8X 4WGHA 1M7XA 4KIEA 2CC0A 4MY1A 4YN5A 5EYWA 3IVUA 5A6AA 2VR4A 2XN1A 4IMEA 2YA2A 3R8HA 1O94A 1XP3A 5JH1A 3LRLA 2CLEA 1FTXA 1SGJA 4L1XA 5LZLA 2GDUA 1E3ZA 1G94A 2PDKA 1O5QA 4Q4OA 3L5AA 4W5ZA 3BQ5A 3VNMA 2F61A 4ICNA 4AZCA 3OVGA 2XH0A 3URAA 4AY1A 3LD5A 2YCLB 3WJXA 4KGJA 3OP2A 4HU3A 2VZTA 5JXQA 1NWSA 4ZOAA 3QW4B 2HISA 3SUWA 1XH0A 2DZAA 4OWGA 2JGYA 1UWRA 1O5XA 4RDWA 3BLKA 5C55A 3TN6A 2C7FA 1E0UA 4MFEA 3SCNA 3DHDA 4QG9A 3WK1A 3W1TA 3RFAA 3JZUA 3DFPA 1K7EA 2E1WA 2OQHA 3BAJA 1YKWA 4J3VA 1VFFA 1ZUAX 3FJ6A 4J1OA 4LQ1A 3PSVA 2GYIA 3IIZA 3UG5A 5G1YA 3UXKA 7A3HA 4IIBA 4GZIA 4LB3A 1LOLA 1XLMA 4AWEA 4HPNA 3T55A 3FKRA 1GOKA 5IBXC 5CSUA 1BAGA 3UZ5A 1ZJAA 1G5AA 1JULA 3FJLA 3V0SA 3IANA 5LXEA 3PWIA 3O06A 3WF0A 1ZL1A 1IZKA 2WNZA 1W3KA 4IOTA 2AQOA 4J40A 4MPKA 5AYXA 3CMJA 1XLKA 2CBIA 2R1KA 4L9ZA 2BOGX 2Z0IA 4XWUA 2GDQA 3B4UA 2H8XA 4GFIA 3QTPA 1HF6A 2O7SA 1XIGA 2PTYA 2EQDA 2V0TA 1AD1A 5MHBA 2NWSA 5E0KA 2QIWA 4ATWA 1B3ZA 4FLOA 2IXVA 3AYSA 5D9PA 1NP2A 1QPOA 4MGGA 7REQB 1W2VA 1MO0A 3T9PA 3TTQA 1OZMA 4DBDA 1AODA 4PTXA 3L0GA 6REQA 5AYIA 1XLDA 4AHPA 4D6CA 1FHDA 2QCGA 2ACQA 1O60A 1GHSA 1VQTA 4KESA 1TMQA 1XLCA 2P8BA 4W84A 2CZDA 1IXNA 1TG7A 3OLIA 4QITA 4TU1A 4DO5A 1MYRA 2NQ9A 2Z6JA 1KRBC 1W54A 3GU2A 1BRLA 1XV8A 3MHUA 1AL7A 1EUNA 3PC0A 2PURA 1PSCA 4LWWA 4JAWA 2ZFAA 5I5RA 4P7QA 3H70A 5XIMA 2Y63A 3CB3A 3PUGA 1R8LA 2ZKMX 2AKZA 4DYKA 2IS7A 3QXBA 4HOXA 1J0JA 1GPFA 3PZUA 3HG5A 4L65A 3QZAA 2VRJA 3GBEA 1KWGA 4NJJA 1KV5A 3SCOA 3TXVA 1EA0A 4QAWA 1EWEA 1DWHM 2OXNA 5FF4A 4DJDA 4U10A 2HROA 4UTWC 4DM2A 1J2WA 3ZOAA 3MV11 1U5HA 2E4TA 1LROA 4MIMA 1DV7A 4V28A 1PHWA 1B0IA 4RZ4A 1TJ2A 1VPYA 2I17A 3OQEA 3TC7A 3GVWA 3FCPA 2GJNA 1JVNA 3AS1A 4YVXA 4Z17A 4C91A 1LOQA 5K3VA 1DJGA 4MPQA 1DEDA 1S2AA 2C19A 4URIA 3VMNA 4B5WA 3UZYA 4FMVA 3NURA 3RITA 1A5MC 1RUSA 4O13A 3MUAA 3MWAA 4MLJA 1A49A 2ZICA 1JGMA 3M64A 4ZTXA 1BG4A 3CK5A 1TWWA 1TCMA 1JZ3A 3ARWA 5A8NA 1L6GA 3G1XA 1WDQA 4F2TA 3JS3A 3GO2A 3KRUA 1ZAJA 3EBVA 2QVNA 3F2BA 1B4EA 1UZ4A 4M3PA 1TZZA 3KUMA 3LBCA 4YLWA 1KKOA 1V02A 2ZXBA 1YNYA 3RCNA 3DBNA 4QCFA 1QNVA 4IIGA 1JQXA 3TAOA 3MBDA 5FF2A 3VFCA 3T4CA 1PZ0A 3P81A 5K9DA 3T1GA 3FXYA 1I2RA 3VGEA 1XYCA 4L9XA 2XUCA 2FDMA 1TZ7A 4JY9A 3JRKA 4ZXOA 3O07A 4M56A 2FGZA 2CZFA 4F48A 2GOKA 5RUBA 1L6YA 3W73A 2G3NA 3TV8A 3DXIA 1TE6A 2XGZA 1F76A 2QEZA 1QI5A 1IEXA 2QV5A 2Z1WA 4X9SA 1GZGA 4GI9A 4WZHA 1JD9A 1QJWA 3D0CA 2CLOA 1K7FA 1GQLA 1EJRC 4GPNA 4HOZA 4P7NA 2D73A 1FWWA 4JQ1A 2UBPC 2CLIA 2HPIA 3G8RA 3MMUA 2HBXA 2E9MA 4GGHA 3HOJA 3EA3A 3W7RA 3W24A 4LX4A 3K46A 4HHMA 1H3GA 1DXFA 3W29A 4HQVA 4UTTC 1X1ZA 3PJUA 1R3TA 4H9MA 1EHNA 1VEOA 3N2BA 4C6OA 1VLIA 3VABA 3RO6A 3K30A 4B5UA 4PMYA 3UCDA 2V8ZA 1HN1A 1XYZA 1JDCA 1H1ZA 2X1IA 3EOOA 1DL3A 4WY0B 3IUHA 4H6RA 5I7GA 3UVAA 3WZ0E 3QYQA 4HNCA 2Y85A 5JBEA 4JIRA 3V36A 4O0ZA 3DAQA 3BW3A 3RMJA 4AZ7A 2V68A 4L9YA 3W4RA 2XIOA 2YCLA 4REQB 2WSPA 4RJEA 4NYYA 2JIWA 2HXTA 5AYYA 1S46A 4DO6A 1LT7A 1ONEA 3KX6A 3OZYA 2E09A 2BVDA 4MNMA 3W26A 3VIOA 2XTKA 2D3NA 2VEMA 1VFOA 4IX2A 1B9ZA 1WPCA 4E4FA 2VX7A 1K8XA 1QW9A 3GTHA 3W1LA 1V77A 2QF7A 3VI2A 4JBRA 1GVOA 2J47A 2XGBA 3CEUA 2XIMA 2R9RA 1N2VA 1V6YA 3OHIA 5CG7A 1TREA 4GZEA 3OYXA 3RCYA 3LLFA 3EWYA 1NF0A 1BFNA 5HMDA 1O6IA 3K4AA 3W27A 4JTFA 4MF4A 5HAOA 1R7AA 1LL4A 1ZS2A 4C5YA 1A3WA 4K68A 4XKYA 1KGWA 2QJHA 4E2BA 4JCLA 3UA3A 3TU9A 3VIGA 3PB0A 3WQOA 4DO7A 1XG4A 4MWAD 3M44A 1E0VA 5HJLA 1QMLA 3DCPA 2BDQA 3TMLA 5CZSA 5I3IA 1GZJA 2NX9A 3SB0A 4AAJA 2OYMA 2JKAA 3BW4A 3DIPA 2ZUSA 1RCQA 3TQVA 1FBAA 2X42A 3LI1A 2OG9A 2CEQA 2ZE3A 1LYXA 2Z2UA 3HU7A 2R1MA 4LVAA 1K6WA 4X0NA 2OELA 4CD4A 2FJKA 3E74A 2PTDA 4HNTA 4ERGA 4Q4QA 1PTAA 4AEOA 2GFTA 4JFSA 1XH2A 1A4MA 4V1YA 2OO0A 7REQA 1VJZA 4LFYA 1UP2A 2PI6A 4MJ4A 2VC7A 2DUAA 2X1SA 4R9XA 4IPLA 1KGUA 1ZP3A 5IHRA 4AVOA 3WLRA 4IIEA 1UKPA 3LPOA 1YEYA 3UYCA 1GORA 5AY7A 2C18A 3L0KA 3BGAA 4JQ4A 5LSMA 1KM2A 1VYSX 3UT0A 1HJSA 3I7QA 2J4GA 1W5NA 1NDWA 4PTDA 3OIXA 3GBDA 3KAOA 2GPTA 2EPMX 2BXVA 3M5ZA 5H8PA 3DGRA 5AN7A 1AFSA 4JL1A 3NTYA 4A8IA 4JIHA 3KTCA 3OA3A 1WZMA 3V35A 3F1QA 2JFEX 2WCSA 3W71A 2A7RA 1PKNA 3WQDA 3CV7A 3UY7A 1XIMA 1V4YA 3M5XA 1J93A 1OK4A 5L6UA 3W07A 1A50A 2BLEA 1Y5VA 1QI3A 2L5HA 2W0UA 3URQA 1Z41A 3EKGA 3LCIA 1WBHA 1W37A 1OFQA 4GC4A 2BVYA 3TVAA 5HNRA 2C8NA 1EJXC 3IJ8A 1QBBA 3AZRA 5HA7A 1GUVA 5EMYA 4GVFA 4PFMA 3UJSA 1UKQA 1HJXA 3M5YA 5LGZA 3GYEA 5E70A 2DDXA 3ANYA 2PWEA 4ZA0A 4KWVA 4JTRA 1HL2A 1I0BA 2BASA 1Q13A 2JF6A 2HSAA 4RR4A 2B0MA 2YCEA 3GNPA 1DE6A 1EC7A 4PL1A 3IIXA 4O8AA 3VKKA 4GIYA 2F2KA 3C86A 1G67A 5DRCA 3GNDA 1ISWA 5DY2A 3CMFA 1WXJA 1TA3B 2YW3A 2VC6A 4PCFA 3SGUA 1DQWA 5HJYA 3EEZA 2YLLA 2PU1A 3PTKA 2F7FA 1Z44A 1HT6A 2XFRA 4ZO9A 1KQZA 3G0UA 2Z00A 1TJ1A 1XH1A 4BF5A 4FS9A 3DYPA 1ISYA 5J8LA 5K7JA 2A7PA 1EF3A 3PANA 3GH4A 1W9UA 2RHGA 4W86A 1KV8A 4LAOA 1M7JA 5D30A 3VE7A 3AC0A 3CT7A 1ESWA 3B8TA 4BQ4A 1F74A 3WX7A 5GNXA 4XAFA