3R89A

Crystal structure of orotidine 5-phosphate decarboxylase from anaerococcus prevotii dsm 20548
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
289
structure length
289
Chain Sequence
SNAMKIIDKLYEKVSKNGFVCIGLDSSIDYIPENMKAGKSVSEALFSYNKEIIDQTYDVCAIYKLQIAYYESYGIEGMIAYRDTLSYLREKDLLSIGDVKRSDIAASAKMYAKAHFEGDFETDFITLNPYMGMDSIEPYEEYIEKGDKGVFVLLRTSNPGAKDFEVLPVDGEEFFYKVGDKMRELNEKYIGKSGFGPIGLVVGATHSEEVEKIRKRYDKMFFLIPGFGAQKADSMNVYKLLEGLNGGVVNSSRAILKNWQNYEDGSEKVGYYARKKAIETYEEIKANEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of orotidine 5'-phosphate decarboxylase from Anaerococcus prevotii DSM 20548
rcsb
source organism Anaerococcus prevotii
molecule tags Lyase
molecule keywords Orotidine 5'-phosphate decarboxylase
total genus 110
structure length 289
sequence length 289
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2011-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3r89A00
2RDTA 4LWWA 4N2YA 3RU6A 3IIOA 4NT0A 3QRHA 4LVAA 3LCHA 4OV4A 5F1UA 2FPYA 2QCFA 1JUBA 1H50A 5D2VA 3W2LA 5HUPA 2VEIA 5DCEA 4NX5A 1M7OA 1W5NA 2HSAA 5DXXA 1KLZA 3OVQA 2AAMA 5LNSA 3WK3A 2AGKA 3EXTA 1LZOA 1GVSA 1OJXA 1LBLA 3QW3A 4IXHA 2QUUA 3U6WA 4M6VA 4A3UA 1GJPA 2DZVA 4ZQOA 1MEIA 3P81A 5FEZA 4M6PA 3RFAA 2W0UA 4XWUA 5F4SA 1N7KA 1SW3A 4AAJA 4BFAA 4QITA 3W7QA 4UIOA 3L2IA 4ZL1A 1JVNA 3B8DA 1XKYA 4RR4A 1I2OA 3G0SA 4O1CA 1TCDA 2DU2A 4MJZA 4W9TA 1ZY9A 1KV8A 5L6UA 3TQKA 3CEUA 1SSDA 3ABOA 4JX6A 1TRDA 3PBYA 3UY7A 4RJEA 4AMAA 3DHFA 2BX7A 3S1VA 1ICQA 2A85A 3GZ3A 3LBMA 3CB8A 3DHDA 3LV6A 3S8HA 2ISSA 4H4IA 2JKEA 4BWLA 4CNPA 1SW7A 4BK9A 4JTLA 1WX0A 3TW7A 1BWLA 2NX1A 1OFDA 2YPIA 3IGXA 2HMCA 3UXDA 2X16A 4YWIA 3ABQA 5G5IA 3VE9A 3KAOA 4ZQNA 3I6RA 1EX5A 3CIWA 4A22A 5G1TA 5DELA 3LV5A 2A7PA 3W22A 4LV4A 1X8FA 4X3ZA 4RZ4A 5K9DA 4MY8A 1L6SA 2TSYA 1K3UA 3LGEA 2P1FA 4JY9A 1GYNA 1KA9F 3WK2A 3LI0A 4UUIA 4LV9A 1XDLA 4CLMA 2X1TA 5K3VA 2ALDA 1OX4A 3EWZA 4O1DA 2E68A 2VENA 1YLVA 1TYGA 1G4TA 3BPWA 4M7SA 2ZTKA 4O16A 1FCVA 1LDCA 1Y0EA 4R53A 1SO3A 1D3GA 1UB3A 2Y88A 4QNWA 4GNJA 4FO4A 2NXIA 2C1HA 2F84A 4LUJA 5G1YA 3I65A 4C1LA 4FNQA 3NQGA 3MHGA 3C2FA 3TR2A 2B0MA 3Q37A 3BK0A 3TMQA 4S2CA 3S5OA 4O18A 3CIXA 1F6KA 2Y62A 3ZFHA 4QSHA 4Y96A 1EP3A 3GXPA 1FXPA 1SQ7A 3M5ZA 3QQ0A 2WV8A 1PE1A 1ME9A 4XUGA 4HNVA 5G2IA 5AHFA 4NJKA 3K30A 5AN7A 1GEQA 1KM1A 6ALDA 3C6CA 3BG3A 4IPJA 3NQ7A 3UZ5A 3HG5A 1JCLA 1VYPX 4MYAA 4RLIA 1SU5A 3SR7A 1ICPA 4MLJA 1VQTA 4XQ6A 3ABRA 1FWWA 2NX9A 4JTEA 5J5RA 4YCOA 1ALDA 1KM3A 1A5SA 4CCCA 4PA8A 1KM2A 1WBHA 1O4UA 1T0OA 4R34A 2A0NA 1W5OA 3CM4A 5EYWA 1YDOA 4JDYA 1MXSA 2QJGA 3N2MA 3N3MA 2NUWA 3NAVA 4QQ3A 3FYOA 4JIQA 3RLVA 1ZAHA 4K8EA 4A29A 1B4EA 2V2HA 1HUVA 2FB3A 4KKXA 1R47A 3I68A 5IBXC 4DF1A 2XFWA 1B57A 3TUUA 1TRIA 3A5VA 4UCGA 3UYCA 3KXQA 3NO5A 5CPNA 5CZ0A 4RXGA 1UBSA 1Z44A 3P5ZA 1W8SA 1OHLA 3UY8A 5GVJA 1CX9A 1V7YA 2QCLA 4MZ8A 2FFCA 5C55A 1FQ0A 1DKWA 3HPXA 2Q3RA 3EXSA 5F4WA 5FESA 2DZXA 4BF9A 1UASA 2XN2A 1EUNA 1JRBA 3PC0A 4OT7A 3GKAA 2CLFA 3LXBA 5C2XA 5HQEA 2E6DA 3LHZA 2YX0A 3HGRA 2Q8LA 3INPA 4KFNA 2A4AA 3IIZA 2C13A 2QCNA 2V2CA 4UTIA 1SO6A 3T44A 3W7KA 4XTDA 4IMCA 3NOEA 4N4PA 3F1QA 3L5LA 5KZEA 2NX3A 2ZZ2A 3G18A 5LNVA 2CU0A 3KOFA 1TJPA 2A5HA 4TX9A 4PL1A 3PS7A 1YPFA 5LZLA 4NUWA 3LB0A 1EWEA 2Z2UA 3DFTA 3EEGA 5HWNA 3PUOA 1QWGA 1F73A 5F1VA 4DF2A 2ZRVA 3IGUA 1W3IA 4K7VA 4WOQA 1DQWA 4ZQRA 2PRLA 2WJZA 4YXGA 1RZMA 3IVTA 2QJIA 2TMDA 4M7TA 4EVZA 1X7FA 4N9CA 3G1XA 4HPXA 3TXZA 4GRSA 4PH6A 2I1OA 3LX9A 1SPQA 2CZEA 2J6XA 3DFNA 3OHIA 3L0NA 1I2PA 4UMBA 2WNQA 4JTGA 2WO5A 1JQXA 3PY2A 4RK8A 4TO8A 3W84A 1YDVA 5FI8A 1G4EA 3M43A 3QH2A 3DFSA 5TBOA 1RV8A 1TTPA 3W1NA 4RV8A 1VZWA 4IX2A 2Z6IA 1DQXA 3O16A 2G97A 1QPRA 3W2NA 3W2UA 3BO9A 4IWWA 3UNDA 2QCEA 2H8XA 1PS9A 3LRMA 2OCZA 2ZBTA 1H60A 4UFHA 1K8YA 3WK1A 5FEWA 1I2QA 2VFEA 4K6AA 1TPEA 5D30A 2GVGA 4LY8A 4L4LA 3W1XA 4ZMGA 3CQ0A 1QMLA 3L5AA 2R94A 4JYEA 1PHWA 3LLFA 1FXQA 1S5TA 1OF6A 1M7PA 3QFEA 2TPSA 3W1AA 2YXGA 4MYXA 4G1KA 4OWGA 2VFHA 1P0KA 4FIQA 4X9SA 5CZSA 3B0PA 1P0NA 4Z1CA 1TIMA 1V5XA 4IQLA 4IOTA 4LUIA 1XBYA 3W7GA 4IJBA 2PURA 4HN4A 4AEOA 1ZFJA 3LBCA 3V1PA 1QOQA 4MPQA 2ZRZA 3NPVA 3DZ1A 2GQ9A 3PBVA 1WBJA 4LTSA 3NDOA 1R46A 1LCOA 3QC3A 3DFQA 3QZEA 3STFA 1YDNA 1PCWA 2YYUA 3M5VA 1YADA 3LHYA 5K9CA 1ZNNA 2NWRA 5CKSA 1FCBA 3W07A 3S1WA 1U83A 4LVBA 1R30A 2C15A 2PRMA 2BWGA 5DBUA 3O6CA 1FDZA 1T96A 3EKLA 4AHQA 3LCWA 4K7YA 1Q6RA 4HHPA 3GXTA 5ABTA 1G4SA 1W5QA 1QO2A 4Z0JA 3GDKA 2RHGA 2WSRA 2VEKA 4NXKA 3E49A 3LM7A 2H8ZA 3QPYA 3PBUA 3N9RA 3DFOA 3UPBA 4JICA 2JKAA 2V30A 3B06A 3DI1A 3W7JA 5CPLA 1ONRA 3LHUA 3UWVA 5I3JA 4UMAA 1T8XA 1XUUA 3OIXA 4O54A 1OVDA 3SW6A 5AHEA 4JTSA 4IMDA 3C2EA 1R2TA 1HO1A 4DXVA 4RX0A 3L0GA 3CWNA 5MHBA 3TXVA 4O15A 4NJIA 4E38A 3W7LA 3WK0A 4MZYA 1LM1A 1YXYA 5AFDA 1W56A 1H62A 5I3KA 3NM3A 1LRNA 1OYAA 1TV5A 1UUOA 1DJQA 2QCMA 1NVMA 3P61A 4YLWA 3QSRA 4RXFA 4P61A 5T26A 3ZR4A 1KBIA 3P74A 4UTKA 4OHQA 3W1RA 2GQ8A 5HR7A 3BLEA 4ZQPA 1GYLA 1VLIA 2CLOA 1PVNA 3M44A 3PF3A 1IXQA 2DZSA 3FOKA 1LP6A 3STCA 3C3NA 4C1KA 4IX0A 3BW2A 3BVJA 6TIMA 4Q4KA 2WKJA 3B04A 2H3BA 5D38A 5L9FA 3TA6A 3W7CA 2VEPA 3W85A 3W1TA 5CZJA 2XN0A 2DZUA 1ZAIA 1A5CA 1I45A 1P1XA 3G1SA 2H3DA 3E96A 3ZS4A 2HTMA 2CLHA 3MBDA 4NNCA 3PULA 5I3IA 2CLLA 4TMCA 2AQWA 1Q45A 4WX2A 3IIPA 3BW3A 3B0UX 4O53A 4AXKA 3HG4A 5FEPA 4U4MA 2PRHA 2NXHA 3JR2A 3PUEA 2EF9A 3EX6A 3UPWA 2ZZ3A 5F2IA 4LS1A 3LXCA 4EOUA 4TIMA 1G4PA 3HIJA 3MP3A 3KVKA 5I3FA 3BG5A 5E0KA 1I8JA 3I7QA 1O94A 5HINA 1L2UA 2DJXA 2VOMA 3MBFA 1SR9A 5A8GA 1YTDA 1VHNA 3M0ZA 4JGDA 4TMBA 3HMJG 2LLEA 4GUIA 1N55A 1PCKA 2E6YA 3KX6A 3SSJA 1QCWA 3TJXA 1DVJA 3O6DA 4NJHA 4MLRA 1EP1A 1TJRA 1KM4A 1Z42A 3OBKA 5CGQA 4FB7A 3W7DA 2O7SA 4FNRA 1A5AA 5D05A 4PODA 4A2SA 3VE7A 4LU0A 3W72A 2WNZA 4O1BA 2FIQA 2B7NA 3MI3A 1YPIA 5LNUA 3BGJA 1E51A 4RZ6A 3TC6A 3NZRA 2ZA3A 5AHMA 3W2KA 3AO0A 3U2OA 4LRTA 1Q6OA 1UJPA 3S9YA 3SGZA 3Q2DA 4MVAA 2YR1A 1J2WA 4JR5A 3WFAA 1W37A 2R91A 3G1YA 2BSLA 4CQAA 5AYXA 4GJ1A 2RDWA 4QAIA 5K2ZA 1TO3A 4A21A 5CG7A 3F4WA 4JXCA 4DQWA 2ATSA 4N6FA 3W87A 1H7PA 4UR7A 1KTCA 4HPJA 2CLIA 3BV4A 1D3HA 4BI6A 2DZWA 2HS6A 1F76A 3BLIA 4WXYA 3N34A 2CLMA 1AL7A 1C8VA 3EWWA 2JGQA 2V5LA 1LRTA 1FWNA 2ZZ1A 4GFSA 3W7NA 4DO4A 3TSBA 4O0ZA 2ABBA 4ML9A 1FWTA 3N14A 4CNOA 3W23A 4WXZA 2QUTA 4K8HA 2GJNA 2FQIA 1M5WA 3WJYA 3GDLA 2Z1BA 3TCEA 1TQXA 4LOCA 3R13A 1H1ZA 3E12A 3GAKA 4XTIA 4MZ1A 3W7MA 4ONVA 3P60A 5KSWA 4GWEA 1TPC1 2J24A 3B05A 3MWAA 5D2YA 1H7NA 5K4XA 5U7SA 5LGZA 1VC4A 1C9DA 4FXRA 4Z1DA 5KMYA 3KVLA 3PSWA 1NFBA 1H61A 2EKCA 1GG1A 2YFOA 2Y7GA 2XN1A 2E5DA 4CNNA 3IV3A 2E1DA 2E6AA 2ZZ5A 4HKPA 4J9JA 4QJ1A 4S1FA 5F2GA 1H5YA 3C52A 3ATZA 3GNNA 1ZALA 3HG3A 3CPRA 3UWUA 5I3GA 1LOSA 1F74A 3O06A 2CFFA 4JYFA 2V5BA 3NVTA 3ZWSA 3O63A 2H90A 4H6KA 2B7PA 2WOQA 4MY9A 2EHHA 2QR6A 4DO5A 5LNRA 1W5MA 1X1OA 4OGZA 1H51A 2QEZA 3C56A 1ZHAA 1ZENA 4HNUA 3PWAA 1TREA 4Y90A 1DV7A 1KLYA 3DFPA 3W71A 2YW4A 3NL6A 5AHIA 3W2MA 3A21A 3P80A 3RF9A 4UTTC 3NG3A 2ABAA 5FF7A 1EA0A 3FS2A 3CLMA 5BMXA 4DF0A 3NQMA 3QM3A 4WQ6A 4M5PA 1VCVA 5D2WA 3PB2A 3TV8A 2JGYA 3MI6A 4BWLC 2ISVA 5KINA 4MUZA 3G22A 1F05A 1D9EA 1PHQA 3FIGA 3M5XA 3FYPA 4LRSA 2X1UA 5HUOA 2H6RA 3HB9A 1YXDA 1VRDA 3NM1A 3RLUA 1XC4A 2OX1A 3S5NA 5HMSA 4UFJA 3IVSA 3PR2A 2CLKA 5G2WA 1Q6QA 3P62A 1VCGA 2Y7DA 1QR7A 1JCNA 3LXAA 1NEYA 2VFFA 1IXOA 1JRCA 3M5YA 5DLCA 3TNOA 1FBAA 3T4CA 2OZ0A 3DGRA 3G1HA 1KV5A 1B3OA 1GPWA 4ZQMA 5J5DA 5AHLA 2NLIA 3SZ8A 3P7YA 3A23A 3LERA 4MFDA 3USBA 3W1QA 1T99A 4NJGA 3GR8A 5KZMA 2QCDB 2V2DA 3OVPA 4WZHA 2EPHA 3L21A 3E9AA 3N2XA 4O52A 4QM1A 1KM6A 2QAPA 1IF2A 1SZEA 3A22A 4NQ1A 3NL3A 4DELA 1X6UA 4KWWA 2Y89A 4O13A 5D02A 3S5ZA 1LLWA 1LLZA 4H3DA 5LNWA 1OFRA 3L9CA 5DY3A 4HNTA 1FWSA 1F6PA 3THQA 2CLEA 1ML1A 1G6CA 1WOBA 5DBTA 3VKJA 2YGYA 3GVGA 3QMRA 1XI3A 3NZ1A 4L4MA 4UFMA 1CI1A 3RK8A 1QAPA 2BTMA 4ADSA 4R33A 3B4UA 5D03A 1XM3A 5AYYA 3W88A 3MW7A 3MMTA 3FKKA 4O11A 5CZTA 3DENA 3HJZA 1JCJA 1ZAJA 3TQVA 3EX2A 2C3ZA 3OG3A 2D73A 2RFGA 1SSGA 4IXXA 2FLIA 3SECA 5D2TA 3MI2A 4JX4A 3HPZA 2V82A 4QISA 3G8EA 3UWQA 2QF7A 4O14A 4GUGA 4ZQCA 1EB3A 2RDUA 2CW6A 4IMEA 4DEFA 3QMTA 1DL3A 1VPXA 5G2HA 1HTIA 2QKFA 3KRSA 3L66A 2TYSA 1VLWA 1K8XA 3MYPA 3SY5A 2WQPA 1P4CA 3TMLA 1Q6LA 3BGGA 3ZWTA 4JX5A 5I3HA 2VFGA 2DZTA 3C2OA 2J27A 3NQ8A 3HGOA 1K7XA 4FX7A 1CW2A 1VR6A 1KTNA 1L6YA 4UC5A 3CTLA 3TROA 3RNDA 2EAWA 3P8IA 3NL5A 4X22A 5BRBA 3S6DA 3Q94A 3BLFA 3YPIA 5KZDA 3HBLA 5C54A 2P10A 3W1UA 3C61A 3LRKA 3S1UA 3M1ZA 4EIVA 4FNUA 2ZYFA 5DN1A 3FJLA 3NQFA 3L67A 1XBZA 1TTQA 2W6RA 1NF0A 4O1AA 4TR9A 1O5XA 4GXMA 3ABSA 3TDFA 4PEKA 1LTDA 1THFD 4UFKA 2UV8G 2Y85A 1S5WA 4KFPA 1WYIA 2B7QA 2ATMA 4LVFA 2ZDRA 3F4NA 3NR0A 2Y61A 3SJ3A 4LS0A 2V9DA 3C8FA 1B4KA 2CZDA 1TPB1 3W76A 4JTUA 5D33A 3L68A 2A2IA 1GVRA 3UWZA 4XKYB 3O05A 3W7PA 4ALDA 3O6YX 1J4EA 2FDSA 2Y7FA 4AB4A 2I9EA 3L5MA 4Z1BA 4N9DA 3NQEA 2YW3A 3TFCA 2DZPA 3TX9A 4UFIA 1G69A 1GG0A 1KM5A 1XDMA 4LVGA 1MEHA 1XBXA 3KHJA 1NF7A 2NZLA 1TPVA 3TSDA 2C0AA 4JDBA 1DBTA 1TPDA 1DJNA 4MFEA 3G1AA 3KRZA 3AJXA 4HNNA 1LBFA 1OFBA 3IRDA 5EPDA 1GQNA 2QCDA 3M9YA 4PL2A 1J5TA 1EUAA 1K7FA 3NXFA 4WY0A 5E1QA 1AW5A 4N4QA 4WUIA 3QW4B 4XKYA 3MHUA 4JN6A 4U28A 2NUXA 3LHVA 3WJWA 1R2RA 1S3HA 4ADTA 3UQNA 3VFLA 3UZJA 5D04C 3OVRA 3TU9A 1TPH1 3E0IA 1OFQA 3GLCA 5IM51 4O4VA 1FDYA 2B4GA 2YFNA 4AHPA 1QNVA 3EWYA 2VELA 4FNSA 1WOAA 4QNEA 1AK5A 3WJZA 3LCGA 1ME7A 5H91A 3NYZA 2ZZ6A 1SFJA 3G24A 4PTNA 4E2BA 1PV8A 1YXCA 1WDWA 3NQVA 4IUOA 5G4EA 2X2GA 1KFKA 4UXDA 1O5KA 3ATYA 3GDMA 5HWJA 4AVFA 2VFIA 3O15A 3TAKA 4DO6A 1FCUA 3NNTA 4IGHA 1O95A 2Q8ZA 4O12A 3LOTA 1G7UA 4POCA 4JTIA 3R8RA 3T7VA 5KTLA 1LROA 3CC1A 4Y8FA 3S5YA 4JNMA 3WJXA 3LDVA 5HR6A 2QCCA 3LHWA 1XBVA 2WPBA 2QDGA 5EBUA 2ZTJA 1GTEA 1SZGA 3EWUA 5CSSA 1XCFA 3CEPA 3P5YA 5F2LA 4NNAA 4MIMA 3M16A 4JTJA 3NA8A 4JS3A 3TC7A 4UTJA 3IEBA 4Y9AA 1GTHA 4N02A 3S42A 2A7RA 5HULA 3T40A 3G0UA 3G1DA 3P84A 2YZRA 4UTUA 1OX5A 4GUJA 5LKYA 4Q33A 3LCLA 3PBWA 3FA5A 3IGSA 3C2VA 3WJSA 4FIRA 2A6LA 5LGXA 1JQVA 5AOUA 3HO8A 1HL2A 3QYQA 1UUMA 3PVFA 1WAUA 5F4XA 1FDJA 3UWWA 1LYXA 3RMJA 3TSMA 5FF0A 3LCIA 4JIPA 4NXSA 5C5YA 4HSNA 1EPXA 1MZHA 1RQHA 1KFBA 1SW0A 4D2JA 2FPVA 4RKAA 3FLUA 4O0KA 4WY0B 3CT7A 3QF0A 1A53A 4UTLA 4EF9A 5FF2A 2NV2A 3PG9A 4WOZA 4N9EA 1IXNA 1TSIA 1OFOA 4O17A 4JD4A 2GOUA 2ZRYA 1NSJA 2QDHA 2R8WA 1R2SA 2C16A 2YDAA 1BTMA 2IQTA 3HGJA 4O50A 2PE4A 1S5VA 1X1ZA 3OEXA 5U4NA 4YL2A 1VYSX 3L65A 3KFTA 2PC4A 1VCFA 2J9YA 1K03A 2X1RA 4O28A 2YCEA 2OT0A 2OT1A 4NJJA 4OU1A 4UR8A 1EEPA 3DKLA 1K02A 2Y6ZA 1WXJA 3SGUA 1O60A 1TV7A 1M6JA 1FWRA 3NQDA 3W86A 1JUKA 2GJLA 5AC8A 2VC6A 3DKJA 5KITA 1EP2A 1ME8A 1MSSA 2ZRXA 3M41A 3LRLA 1OF8A 3EWBX 1JCMP 1OFAA 1KTBA 2QJHA 1H7RA 2J9XA 3NQCA 3PM6A 2WSQA 5AHNA 5LHEA 3NQ6A 2QUVA 4HSOA 3R5EA 3R89A 3G3DA 4EWND 1F5ZA 1LOQA 1MEWA 4DPPA 2Y70A 4BR1A 1JUEA 4IMGA 4M6QA 3HOJA 3DH7A 4I9AA 3W70A 3NPWA 2QCHA 1U5JA 3GR7A 3Q58A 5EY5A 5K7JA 3V75A 3TH6A 3QEZA 5SWUA 4EF8A 3W7HA 4WD0A 1H7XA 3W83A 4AWSA 5A5WA 5LSMA 3T78A 2ZA2A 5C6MA 2JK2A 5FEXA 4RCXA 2C18A 3HG2A 3UXAA 1XXXA 3LCXA 2DJLA 1BEUA 1TMHA 2RH9A 1SZFA 3O8AA 4YCPA 5IBXA 2G5WA 2OJPA 3OA3A 1A50A 3W75A 4Z1AA 3W1PA 1OK4A 3MP4A 2GVJA 5G4WA 2FTPA 1F2JA 2J88A 4GE8A 3BW4A 1NAL1 1HO4A 1W0MA 2O7QA 5H2ZA 3GX9A 4PC8A 4ZZ9A 5D09A 1L6WA 3EXRA 4O8RA 1JR1A 4UTWA 3DI0A 3T55A 5TIMA 1KFJA 3G3MA 4AWUA 1QFEA 1H7OA 2A21A 4O4WA 2OMAA 1H63A 1HG3A 1I4NA 1GVFA 1LOLA 3GDRA 4BI5A 1AW1A 3GDTA 4JYDA 3CWOX 4UNKA 2YYTA 1PL9A 3NQAA 4E2DA 2VEMA 3LTPA 4P2VA 1AMKA 4K38A 4XBSA 5EA9A 4UTTA 3EX4A 1IIGA 3GXNA 1ADOA 2VFDA 2W79A 1A5BA 2G96A 4R7JA 4NX0A 1C29A 1VGAA 3LCFA 3L0KA 5EMUA 1G67A 3SI9A 2DP3A 2QAFA 4JTHA 2A6NA 2V8ZA 1SUXA 3NL2A 2HS8A 1TQJA 1I2RA 1RD5A 4K39A 2E09A 2R14A 3M47A 3PB0A 2V0TA 3PUDA 2Q3OA 5CPOA 1FY6A 4QIUA 4KWVA 3W6YA 3QPZA 5K9XA 3W7IA 1DOSA 2ZCGA 1W3NA 1VH7A 4UNLA 1OX6A 2FB2A 4LW7A 3JS3A 3A5FA 3TQ0A 5HJLA 1IGSA 4I7UA 4DBEA 1GVOA 3HF3A 3EX1A 1OX4B 2ZRWA 4DBDA 3TE9A 3NPXA 5K4ZA 3TK7A 1RQBA 3IIXA 1QO5A 3LTSA 5DY2A 2BLEA 4MJMA 1IIHA 3W3OA 1QPOA 2B7OA 3G1VA 4BI7A 3W2JA 1YTEA 2BXVA 3U8GA 4MOZA 3W73A 3DXIA 2C19A 2ZZ4A 1WA3A 2ZZ7A 1LORA 3MP5A 4FNPA 1OYBA 5CSRA 4O57A 5BNKA 3HQ1A 3GYEA 2EGZA 2DORA 1LBMA 3GIYA 3LHTA 1SFLA 1GWJA 1H1YA 4OE7A 2A1YA 4AF0B 5EL1A 3EB2A 3LLDA 3M7WA 5EKYA 3GK0A 3BG9A 3O07A 1UCWA 2C14A 2Y7EA 3KVJA 2E77A 3N73A 2KZHA 3BARA 4M19A 5AYZA 1H7WA 3E02A 3W1MA 3VNDA 4AH7A 3FJ6A 1N8FA 4GUFA 3N9SA 1RQEA 1VJIA 3C2RA 3B03A 3S0CA 3THAA 4JEQA 4Q32A 3MHFA 1SO4A 2Z6JA 4AWTA 2FJKA 1QPNA 1SZNA 2Z0IA 2PCQA 2CZ5A 1W54A 4CCDA 4ORMA 4K36A 3LTYA 1JULA 3NQ2A 4UTWC 3TAOA 2E5CA 2BZNA 4Y6GA 3GB6A 3GKFA 3W7EA 4JTKA 5BOOA 5TQLA 4DPQA 2YSWA 4FX8A 1I2NA 3W9ZA 4UTHA 1VHCA 5CPMA 1TB3A 3NGJA 3P8JA 4FX6M 3STGA 2NWSA 4PFMA 5BW6A 1G7VA 1W1ZA 3DAQA 1AL8A 2ZRUA 3I7SA 1K8ZA 1VYRA 2ZFAA 1KM0A 4JY8A 4AHOA 4XBKA 4LS2A 1JCXA 2X1SA 3N19B 1XUZA 1YTKA 5HNRA 1YYAA 4X2RA 4WY0F 4UTMA 1W3TA 4GC4A 3ELFA 2V81A 4YMZA 1XL9A 1EIXA 3H53A 5AC6A 1OFEA 4FHAA 4MY1A 4O10A 4FXSA 1GOXA 1ICSA 1OG0A 2RKXA 1K7EA 4FF7A 3STEA 2ZQ0A 3TIMA 2NUYA 3GAYA 3G1FA 1QPQA 2CWNA 3R2GA 4K37A 1RPXA 1F7BA 2VXNA 1HFBA 3TJLA 2I14A 7TIMA 2GVLA 1RR2A 3R12A 3FKRA 1VS1A 4UMCA 1QDSA 5HWMA 1GVQA 5LHFA 1FUYA 4I7WA 4GBUA 3HPSA 5F2MA 3QJAA 1IXPA 5DCDA 4GUHA 4ICNA 4AF0A 5AC7A 1OK6A 3NEVA 4OBTA 3UD6A 4CQ8A 4NVTA 1TTIA 1W31A 5D37A 3HGSA 1FX6A 3EKZA 1BKSA 2GUUA 1SO5A 3VI2A 3MO7A 3IVUA 1W5PA 3FEMA 4FNTA 5AB3A 4NNBA 3C4UA 4KFOA 2JBMA 2ZA1A 4LT9A 4WJEA 2P0OA 1BWKA 3G0XA 3QMSA 5D2XA 3MYOA 4E0CA 1TPFA 4RZ5A 3S1XA 2WNNA 3H55A 3DU0A 3LI1A 3P67A 4Z08A 4XZ9A 2C6QA 3I7RA 1GZGA 2J9ZA 4UFLA 1JJKA 1QOPA 1EWDA 2E5BA 2JKPA 1B9BA 1DHPA 1RVGA 1TPWA 3TKFA 2NV1A 5FF3A 3A24A 4TU1A 3EX3A 1ZJIA 3CHVA 1DORA 5BMWA 1XFBA 5DCBA 4MKNA 4I7VA 1LRQA 4N6EA 4CQ9A 3FFSA 4Z0SA 2X30A 3PSVA 3W7OA 1TTJA 1AG1O 3W7RA 3B0VC 3KVMA 1KFEA 1TV8A 2E6FA 4NU7A 3TFXA 3VCRA 4JTTA 3W74A 2VKZG 3GNDA 3O1NA 1OFPA 3CU2A 1FCQA 2F7FA 1Z48A 3EWXA 4PCFA 1WV2A 2G95A 3P82A 1WQ5A 4HIBA 1P5BA 4A2RA 2Y63A 2WSYA 4NZFA 8TIMA 3JRKA 1OYCA 2QCGA 4LC8A 1PIIA 4N9BA 4OQVA 1KFCA 3F03K 3MJYA 3DBPA 3MUXA 1OABA 2GQAA 4CCEA 4LVDA 1TPUA 3M6YA 4NZJA 1ZCOA 2A7NA 3G8RA 3W1LA 4ADUA 3KRUA 4IMFA 3SIZA 4IPIA 1KW1A 3PG8A 4S2BA 3SFKA 4O19A 3ANYA 4FEZA 4LC6A 3H54A 3D0CA 1MO0A 1GT8A 5DXYA 1AW2A 4ZVJA 4B5NA 4LNYA 1Z41A 2CZFA 5E93A 2TRSA 2FPTA 5FF4A 3C0JA 3QQ1A 1KBJA 3A9IA 4HT3A 4OV9A 4ORIA 1L9WA 2NXGA 3PAJA 3NPUA 2GPTA 5D32A 3QSTA 2ISWA 1Q3NA 3IIVA 3TW6A 1JCYA 1KFLA 3UWYA 4JTFA
chains in the Genus database with same CATH superfamily
1TKKA 1J18A 4LWWA 5FJIA 1XH0A 3RU6A 1E3ZA 2J7BA 5F1UA 1B9ZA 4GI4A 3VNZA 2VEIA 2JF7A 4NX5A 2DFAA 1KLZA 5ENLA 3N25A 2AGKA 5FJUA 3AC0A 1LZOA 3ZLFA 1GVSA 3E38A 4Y9NA 4A3UA 4B2DD 2DZVA 4ZQOA 1HNYA 2ACRA 4OBSA 3BAKA 3P81A 5CG0A 4M6PA 3RFAA 1EC8A 2DIKA 1ZBVA 1ZUAX 1SW3A 1GGOA 1TV4A 3SN4A 3TP4A 4CNUA 3L2IA 4U3AA 3N3TA 1RP9A 4WSHA 3G0SA 1TCDA 3M0MA 4PSRA 5DMNA 4U2ZA 1B3WA 4LCQA 3U48A 1X98A 1SSDA 4URIA 4MDPA 1Z8AA 1Q6EA 1OSEA 4RJEA 4AMAA 3DHFA 1F6YA 2BX7A 3S1VA 1B30A 3LBMA 1XW8A 3PUGA 3S8HA 4H4IA 2JKEA 4CNPA 4HMDA 4BK9A 3QVQA 3EMQA 2NX1A 2BVYA 2OWWA 1B31A 2HMCA 5FSDC 5G5IA 1W9PA 1MWOA 3GH5A 4ZQNA 2BHYA 1BGAA 3I6RA 3ARPA 4OIFA 4MB1A 2HROA 3OTRA 1FHLA 4C6BA 4F79A 4GY7A 4RZ4A 3TWAA 4D6CA 1L6SA 2HCVA 2X7VA 4B5XA 1M01A 4GKLA 4JY9A 4XKMA 2D3LA 5E6ZA 3AXKA 1GYNA 1KA9F 3AIVA 1VBRA 2FJUB 3RPMA 1ZJBA 5JH1A 3SCUA 1CLXA 2VR4A 1BKHA 3EOUA 4HYWA 4J7RA 4CLMA 2BFGA 1HQTA 2ALDA 4G7EA 4IFRA 2VENA 2FVLA 3H70A 1TYGA 2AL1A 1F8IA 2ZTKA 1BWVA 3U0HA 1LDCA 1G5AA 1XIEA 1SO3A 2G4JA 1D3GA 2OYLA 4QNWA 4GNJA 4FO4A 2NXIA 2F84A 1UWTA 3I65A 1X1NA 3NQGA 2IXVA 3C2FA 3TR2A 2W61A 1VFTA 3BK0A 3VYLA 1XRVA 3S5OA 5HANA 2PWGA 4GIAA 4QSFA 5A94A 3ZFHA 1YDYA 3SCTA 3WLIA 2WV8A 1ME9A 4MAVA 2OYMA 5G2IA 4H2CA 3K30A 4QS5A 1XLGA 3C6CA 4IPJA 3NQ7A 4W84A 4WHBA 3HG5A 1AQHA 1L8PA 4MYAA 4RLIA 3PTMA 1WZAA 1VQTA 3MUAA 3KTCA 1RLCL 7A3HA 1E9YB 5J5RA 2XM2A 1ALDA 2XINA 1VJSA 5KEZA 1E0WA 2WKLA 1D8WA 1FWFC 1CXHA 1W5OA 4JDYA 4Q8QA 1TV2A 2QJGA 1NP0A 1ZLPA 3E0FA 3N3MA 4QQ3A 4Q4SA 3S2NA 4A29A 2V2HA 5J8LA 3SRDA 2FB3A 4DI9A 4XVEA 2XFWA 3NSNA 1TRIA 3A5VA 4UCGA 3WH5A 4CU7A 5CPNA 5HJYA 3BICA 3K4WA 2EG6A 1UBSA 4YU1A 3AS0A 4HMNA 4H9XA 3VOHA 1W1TA 4RE3A 3AHVA 2YDQA 4G7FA 2FFCA 1UIOA 4V27A 4W4QA 3HPXA 2QJJA 1OT2A 3D47A 3PJUA 4FPSA 3SB0A 1TMLA 4LAKA 3LSBA 4Q8MA 3LXBA 5C2XA 1MYRA 1HX0A 3AHZA 2O4MA 2YX0A 4GKTA 4K1WA 4D6HA 2EXOA 2OU4A 2A4AA 3LZ5A 2C13A 1JYWA 2V2CA 4N4PA 3TN6A 1KCZA 3F1QA 3L5LA 3OU8A 2YB4A 3CNYA 3H12A 3OLGA 4ATWA 3KOFA 2A5HA 1T41A 1MZRA 2GDQA 2P76A 2EPOA 1UQYA 3N2CA 1KXHA 5EMLA 3PS7A 3APTA 3LB0A 3SADA 3IK2A 5JBFA 3EEGA 3HA1A 4JBRA 1QWGA 5AVNA 3W81A 1NTHA 2ZRVA 4J27A 4K7VA 1GQKA 4ZQRA 1BFNA 2WJZA 3WMCA 3IVTA 4M7TA 4EVZA 4N9CA 4HPXA 4IIGA 3TN3A 3JZEA 3D46A 2WWDA 2VCBA 4O1EA 1XG3A 3L0NA 4MPKA 4UMBA 5T91A 5BOEA 3BLPX 3CWHA 3DHUA 3RX3A 2WO5A 3EZ4A 1UWQA 2BHZA 4RK8A 3W84A 1YDVA 3WQ6A 1G4EA 3W4RA 2POTA 1RK6A 4KRZA 1ITXA 1RV8A 4WCJA 5IHRA 4RV8A 1VZWA 4QHRA 4IX2A 1E5NA 4DM2A 1E3XA 3BO9A 3DYPA 4IWWA 1PX8A 3UNDA 1K77A 1A5KC 2OELA 1QNPA 1CXKA 5J04A 2NVCA 4OTKA 2WSPA 1TPEA 4L4LA 3W1XA 4ZMGA 3VPLA 2VOTA 3L5AA 2R94A 1Q8AA 1FWAC 3LLFA 1OF6A 1D7KA 1O6IA 3KL0A 3FGCB 2YXGA 1ZGDA 4HBKA 4HB7A 3A9BA 4X9SA 4CN4A 1E56A 4ILSA 3CV1A 1J01A 4F2UA 4B9YA 3DOPA 4IOTA 1OEPA 4XSLA 1XBYA 2DT1A 3W7GA 1E71M 3M46A 2PURA 3RILA 2BP1A 1QWKA 3EKGA 1XD1A 5D9MA 2H9AB 4MPQA 4P7RA 2WHJA 2YCKX 4MJ2A 1Y5VA 3QOMA 4LTSA 3VUSA 2J25A 1R46A 4EK7A 3QC3A 3STFA 3ITXA 4HOWA 1C92A 1YDNA 1YADA 4Q7BA 5K9CA 4ICCX 5A6BD 4HMCA 5CKSA 1FCBA 3W07A 1U83A 3GHRA 3WF1A 4E5TA 2BS9A 4LF1A 5DBUA 5ABGA 1FDZA 1T96A 2NQLA 3GXTA 5ABTA 2J77A 4U10A 2VEKA 3BMWA 4UQEA 3RAOA 3E5PA 4D6JA 5EFDA 3CHEA 2V30A 3B06A 4LEQA 1ONRA 3J7HA 3WLPA 1WDDA 5GPRA 4C1NB 4UMAA 1VEMA 1XUUA 1E5JA 3OIXA 3KCOA 4O54A 2PGRA 5AHEA 4NI8A 4P8VA 3L0GA 4LEFA 1FVPA 5BYWA 3TXVA 4O15A 4NJIA 4E38A 1DIDA 5AFDA 3VC6A 2FTYA 3NM3A 2GGJA 1UUOA 3P61A 3QTPA 3QSRA 3VKAA 4UBPC 1KBIA 4WKAA 3WD2A 1HP5A 3P74A 4OHQA 3W1RA 4XSMA 2ZX7A 5FKYA 3R7MA 1A49A 3PF3A 5I23A 3BL3A 3GUGA 4KCVA 4M6UA 3BAYA 3DCPA 2WW5A 2NVAA 2WKJA 3WDPP 2H3BA 4DXXA 6REQB 3B9EA 3H2OA 3TA6A 1QI3A 2VEPA 3W85A 1QHOA 2DZUA 5I6SA 3G1SA 3N1AA 2H3DA 4AG0A 3DG6A 2WCAA 3N11A 5JMUA 4GQRA 4C90A 3LNPA 5I3IA 3KE0A 4F0LA 4O53A 3HG4A 1ZP3A 2EF9A 4W87A 2E9MA 1Y5WA 2INFA 4LS1A 4HPGA 5HBFA 4W88A 1V6TA 2R24A 4J5NA 1C7TA 3QGAC 3HIJA 4ZCWA 1O94A 1C90A 1CENA 4ZFMA 3MBFA 3M0KA 5A8GA 1VHNA 3M0ZA 4JL2A 3R79A 4JGDA 3HMJG 2E6YA 3SSJA 1QCWA 4ERAA 4KEVA 2WVVB 4J3VA 1KM4A 2BOGX 3E1F1 4XAPA 3B8VA 3W7DA 1UD5A 1CIUA 3QTGA 1A5AA 3H23A 4TTUA 7TAAA 4QJ5B 1CTNA 1R3QA 1H41A 2ZXQA 3EGJA 3WLJA 2B7NA 4LYQA 1ZP4A 2DY3A 3HQOA 4M3PA 3TC6A 2ZA3A 5AHMA 2FMOA 3AO0A 4LRTA 1US2A 3Q2DA 5M3WA 2YR1A 4IIFA 1SFSA 3N6JA 3S3GA 1W37A 2Z28A 1KGUA 3G1YA 2BSLA 5AYXA 4GJ1A 2ACSA 4JFWA 2GZXA 3URBA 4KERA 9XIAA 2DH2A 3WNMA 3EOSA 3AIUA 2V3FA 3W87A 1H7PA 1IV8A 1ISZA 1C8XA 4HPJA 3MTWA 1D3HA 4BI6A 4B3ZA 1E6ZA 3QC0A 1F76A 3N13A 4WXYA 1HKKA 1C8VA 3GC4A 2V5LA 1FWNA 4GFSA 3TSBA 4O0ZA 1X39A 1UWUA 1CWYA 3RM9A 3UCDA 4CNOA 1OCJA 2PDUA 2QUTA 5LIKX 3O6AA 3VZYA 3GNPA 2PDMA 1UR2A 3RM8A 3PN8A 3E12A 5DT7A 3W7MA 1K70A 3B9OA 5ABFB 3WN6A 1M53A 1XV8A 4GWEA 5HJXA 5EGRA 4GZJA 1KQZA 1WDPA 3APYA 4OBRA 3HN3A 3CUJA 3PSWA 2FMNA 2A3AA 1H61A 5XINA 1GG1A 2YFOA 1IZJA 3I4EA 3UVIA 3VKBA 5CAHA 4Z2KA 1QI2A 3M0XA 4CNNA 4ENLA 4UOQA 3VABA 2E6AA 3VNIA 4J9JA 4RUBA 3UG8A 5F2GA 4M80A 1JAEA 3HG3A 2XM1A 3NZPA 1F74A 3BOLA 4AZHA 4G2DA 2H90A 4H6KA 2B7PA 1KKOA 1PYFA 3PFRA 2OLSA 4C7DA 1K4GA 1OADA 3C56A 1ZHAA 1ZENA 3UJEA 4HNUA 1OZQA 2ZADA 1PAMA 3L2MA 3NL6A 4EXAA 4P7OA 3RF9A 4UTTC 1EA0A 1B3VA 3HFYA 3PJWA 4HA0A 1D8CA 4EPBC 3QM3A 2ZIDA 5FACA 4BWLC 2ISVA 5HDRA 2GYIA 5KINA 4MUZA 1PHQA 1R3WA 3R8HA 3CYVA 3HB9A 3CH0A 4GO8A 1VRDA 1XC4A 2BG5A 4GIRA 4PUMA 3GZAA 3OO2A 4DZ5A 5E0FA 2CLKA 5G2WA 1Q6QA 3AXXA 4QE1A 1PEZA 1IXOA 1W17A 4YVXA 5E09A 3M5YA 3O9NA 5A3HA 2EG7A 3DGRA 4S23A 1B3OA 1OZMA 4ZQMA 5J5DA 4LAOA 1EJRC 2NLIA 2QCDB 4Z2LA 5EMMA 1PKNA 5LA0A 3WO8A 3QY7A 3T07A 2OEJA 4QCEA 3NL3A 3ZR6A 1QOXA 4DELA 4KWWA 5BXRA 3KLLA 5D02A 2F2HA 5CBJA 2WMIB 1ZJAA 4LSBA 4HVXA 1DXFA 4JL1A 3SCNA 1OFRA 1FWSA 1F6PA 3THQA 3ZYZA 1O7AA 2BY2A 1OCBA 1G6CA 3WNOA 1BSIA 4J2MA 2YGYA 1I0DA 1C3FA 2XU2A 1CI1A 4DWSC 1RJPA 3E2RA 3B4UA 2PDFA 5AYYA 2XGBA 2QVNA 4Q7NA 3BGAA 3SFWA 2VQUA 2WHLA 1JCJA 1ZAJA 3PK7A 3WQVA 2C3ZA 2RFGA 4A05A 4HU3A 2FLIA 1P1MA 3G8EA 3UWQA 1B1YA 4O14A 2ZUVA 4R27A 4GUGA 1UH4A 1T8QA 4GYFA 4DEFA 3QMTA 3LENA 1S38A 2IS7A 4W7UA 1ZZMA 2TYSA 1FOBA 3MYPA 2J7FA 2WQPA 3MSRA 1KRBC 1KFWA 1QI0A 1XSJA 2VFGA 2DZTA 4REQA 3C2OA 2J27A 1HXJA 1AQMA 1VBJA 1YNQA 3E0VA 5T8GA 4DWSD 3CTLA 4Q4OA 3RNDA 4X22A 5BRBA 3Q94A 3LLXA 3HBLA 3B40A 3W1UA 4IICA 4LCRA 3LRKA 4LYPA 2GK1B 3M1ZA 4EIVA 4FNUA 2DIEA 4L80A 4LANA 1G9HA 3EA2A 3L67A 4RL3A 1O5XA 2XSBA 2CCRA 1LTDA 3TYEA 3N6QA 1E70M 2ATMA 4IPPA 4LVFA 1BAGA 3CPUA 4EXQA 4LS0A 4DYJA 4TVCA 1QW9A 3VIJA 2XIMA 4XAFA 1OCQA 3H7VA 3D3FA 4AIUA 1XQLA 1PSCA 2Y7FA 4LUSA 2YW3A 3TFCA 5AECA 3WEOA 1GG0A 1DP0A 2BY1A 4E2OA 2I7GA 2J13A 4GVFA 4AVNA 2NZLA 4IIBA 3V3WA 3VAVA 2C0AA 4KEMA 2AL2A 1H4PA 2YL6A 3WH9A 3IRDA 4ZTXA 2HK0A 4PTDA 1GQNA 2QCDA 4RPQA 1R7AA 4XZHA 1GOKA 4WSJA 1N2VA 5E1QA 4GI9A 3XIMA 3W01A 1HJSA 4L1XA 3QW4B 4JOMA 3AUOA 1NDWA 5D9NA 3UZJA 2HRWA 3TU9A 1TPH1 1O12A 4GXPA 3CZEA 4O4VA 5BROA 2NLYA 3NEHA 5A8NA 2YFNA 3ABXA 3EWYA 4HOZA 4MJ4A 4KCWA 4FNSA 1KRMA 1WOAA 5I09A 4GO9A 1AK5A 1A0EA 3LCGA 1R6WA 4YN5A 1J8VA 3NYZA 3W6LA 3QQWA 1PV8A 1YXCA 4IQEA 2V5DA 3NQVA 1TE6A 5G4EA 4H7VA 5E6YA 2X0SA 3TAKA 4DO6A 1FCUA 4HNOA 2GVEA 1IZCA 3OODA 1G7UA 3SCWA 4JTIA 3COTA 3HV8A 3M0VA 4HK6A 1NY1A 3JU2A 4L4OA 3SCVA 4JNMA 3OYZA 3LDVA 3QHNA 3CQHA 4BS0A 3SQSA 2V5CA 3M4HA 4EE9A 1XCFA 1XRFA 1GOQA 4E3TA 4QJ4B 5IHSA 2QULA 1XLDA 4G5DA 4I8DA 3S42A 3Q45A 1JD9A 1EHAA 5IOBA 2OKOA 4W7WA 3G1DA 4DJDA 4R9XA 5LKYA 3PJXA 2BOEX 2YOCA 5DQPA 1V08A 3WJSA 4Y9PA 5LGXA 1JQVA 3H2NA 3DYOA 1L6GA 4CD4A 1FDJA 2Q6ZA 3OHMB 4IUGA 5AZ1A 4A8LA 1M41A 1EPXA 4HSNA 3A13A 1MUWA 3N18A 1SW0A 2FPVA 4RKAA 3FLUA 3U2ZA 1N8WA 1FHVA 3ZQ9A 3CT7A 4AYSA 2CKSA 4V2XA 4AY7A 2ZICA 5D9PA 1OFOA 1TG7A 2XFFA 4O17A 4Y7EA 1E0XA 4R85A 3QV8A 2Z00A 2V3EA 3H6OA 3DDMA 1V3HA 3ARRA 3ITLA 2GGEA 1EDQA 2C16A 3FV9A 3GH7A 3KOZA 2FKPA 4AMCA 1XLMA 2YA2A 5U4NA 3IAPA 3KFTA 1V93A 1XIJA 1P7TB 2XHYA 3SEPA 4NAFB 4IF2A 3NCOA 1RSCA 1MW3A 3CYJA 3ZJKA 4XAGA 2VTFA 3WUGA 4O28A 1XLAA 4U33A 3T0AA 1QVBA 3SGUA 3WD4A 1O60A 2DDXA 3WUFA 1CXIA 1GVYA 3ZT5A 1TWSA 1UA3A 3DKJA 4X0VA 1I0BA 1ME8A 2O56A 3M41A 1XINA 1GKQA 1OF8A 1YPXA 4P8XA 4DBWA 3EWBX 3CL6A 1Y8BA 2OODA 1JEZA 3W38A 3PM6A 2WSQA 5AHNA 1TR1A 3NQ6A 1PDZA 3R89A 1F4AA 1MEWA 2CHRA 4JCLA 2C91A 4IMGA 2IKGA 4J3SA 1ONEA 3NPWA 2PLCA 3GTNA 1U5JA 3Q58A 1RLDA 3CUZA 3VINA 5K7JA 1UZDA 2I57A 2OOGA 3UXIA 4AZ7A 2DT2A 4ZXOA 3RO6A 3W7HA 4DAFA 2G3FA 4AC7C 2ZA2A 5FEXA 2B31A 2C18A 2XSAA 3UXAA 2DJLA 2Q8XA 4QX4A 2CLPA 2PTXA 1TMHA 3A4JA 3VIGA 1SZFA 4M8UA 1BPLB 4GIEA 4DXKA 1EF3A 4YCPA 1MMFA 4Q4RA 4HZ8A 4TV5A 4Z1AA 3S1GA 3MP4A 1LG2A 4Y9MA 2J88A 2VM8A 5EFFA 1L2QA 3BW4A 1TVLA 2Y5EA 1NAL1 4ZZ9A 4B4HA 3NOYA 3GNRA 3QZAA 1M1BA 4NKCA 3T55A 4AWUA 1L0PA 4AVOA 1KR0A 1HG3A 1LOLA 1GVFA 3DX5A 4MADA 4JYDA 1ISXA 1R9YA 2GJRA 2VEMA 3LTPA 3ARQA 4P2VA 4K38A 5EA9A 4S3KA 2C7FA 2YZ5A 3E0WA 1IIGA 4GGBA 5EB8A 2OQHA 4F0RA 1F61A 2VEGA 4NX0A 1C29A 5GQBA 2DVXA 3LCFA 3SI9A 4HPHA 1FWEC 2DP3A 2QAFA 2A6NA 2EKGA 1DIEA 2R14A 3CMGA 3M47A 4S3AA 1W3KA 3TA9A 1XIGA 4KWVA 1FKWA 3QZ6A 5BCAA 1I60A 5K9XA 3UVAA 9XIMA 4LW7A 1PBGA 4B5TA 2E1WA 3HF3A 3IJQA 1YIXA 1GQJA 3IIXA 1QO5A 4MJMA 1IIHA 1Q7ZA 4BI7A 5A8OA 1YTEA 2BXVA 1EJWC 4DZHA 4MOZA 3DXIA 1UKSA 2ZZ4A 2E4TA 1WA3A 1TA3A 2ZZ7A 3MP5A 1CGXA 4CQBA 4O57A 3HQ1A 3T2OA 4K1GA 4YTUA 3GXFA 4H8NA 3GIYA 3KDNA 4F9DA 1AMYA 2VYOA 3S4TA 1H1YA 4KRTA 2A1YA 1ODZA 5EL1A 3EB2A 4LXFA 3M7WA 3GK0A 3BG9A 4H6QA 3WCZA 4FXFA 3E6EA 3CTTA 2KZHA 3BARA 3FGCA 3FSTA 5AYZA 3UFYA 3OVGA 1PJ9A 3FJ6A 1N8FA 1ISWA 2QV5A 4FLQA 1AJZA 3C2RA 3FDGA 3S0CA 2JALA 3PPHA 3P14A 4Q32A 3NSMA 4AWTA 2PCQA 1BVWA 3C0LA 1HJVA 3N4FA 1IGWA 2D2GA 1TJ1A 1JULA 4K8GA 3GKFA 3M0JA 3UG3A 3QLLA 2YSWA 3H24A 3KTSA 4K2SA 4PULA 3P8JA 4FX6M 2YCIX 5TAOA 3UZXA 1SJBA 4WRHA 4NP7A 1W1ZA 3AALA 3T8QA 3DAQA 4N0RA 2ZRUA 1V0NA 2ZFAA 3KS6A 4XD3A 4XBKA 2D24A 2DZAA 2WVUA 3BQ5A 1ITCA 4X2RA 3L4VA 4WY0F 2QIIA 4UTMA 4BY3A 3KBWA 1LF1A 4GC4A 2V81A 4YMZA 1EIXA 4QDWA 2XYLA 1J93A 1XYFA 2ZQ0A 2XIIA 3GU1A 3KCLA 1J11A 2V5KA 3GAYA 1D3CA 3G1FA 1NOFA 3F4CA 1EQCA 4K37A 3PFMA 2Z26A 1UROA 2FVKA 3I3DA 3FKRA 2E9BA 3CL7A 2NQ5A 1EZ2A 2G8ZA 5LHFA 3SCOA 5F2MA 1SGJA 1IXPA 2E25A 2WM1A 3E0LA 3SY1A 1JZ2A 3TTOA 5AC7A 3MKCA 1OK6A 3W02A 4C6CA 4NVTA 1E0UA 5D37A 2F9RA 4D8AA 3ONBA 1KR1A 1SO5A 3T08A 4H9YA 3VI2A 3MO7A 4CNSA 4V1YA 1CNVA 1E1CB 3SRHA 4NNBA 3C4UA 2ZA1A 2V67A 4WJEA 3G0XA 3MYOA 4E0CA 1ONXA 1VEPA 3SUUA 4R9OA 1MVYA 2A79A 3CL8A 5LIUX 2YCLB 3TZFA 4KQNA 4DJFD 4UZUA 2C6QA 1GZGA 1IQ8A 2J9ZA 2BMBA 3IPWA 4MTVA 3UESA 4FALA 2XVPA 1TPWA 4KF1A 3DEQA 2HPIA 4TU1A 3EX3A 1BSLA 1ZJIA 3CHVA 5BMWA 1XFBA 4MKNA 2PDIA 3SUSA 4QS6A 5CPQA 5T9CE 3EDEA 1JFXA 1TTJA 2PDBA 1UOZA 2J47A 2AMXA 3W7RA 3B0VC 4QLKA 3TFXA 1T7LA 1CT5A 3ZM8A 3DYMA 3A12A 1C8YA 4M1RA 2QLYA 3GUWA 1Z48A 3VMPA 2GL5A 3P82A 2IW0A 2XDFA 4B5WA 1NELA 1FH9A 3JRKA 4LC8A 3L4YA 3W82A 4N9BA 3MJYA 1RA0A 3MCOA 1FH7A 1JI2A 3POCA 2GQAA 4CCEA 2WVTA 2VZVA 4NZJA 3ORWA 4CD6A 1E6XM 4ADUA 4IISA 2NSOA 3GFXA 3IUIA 3SIZA 5A8PA 3II1A 3WBEA 4GVIA 3URNA 3BAXA 4S2BA 3VVGA 1YNYA 3U7BA 4YPJA 3ARUA 5CZKA 1AW2A 3DFYA 2NW0A 4ZO9A 4GD0A 2FPTA 3QQ1A 1KBJA 5DMLA 4PUDA 5E70A 1J0KA 2PDPA 4HT3A 1UW9A 4ORIA 4RW3A 3EB4A 2GDVA 2GPTA 2OEKA 1TMQA 2QW5A 3WBWA 1HZYA 2AKZA 4IL0A 5FJPA 1X6NA 3VKCA 3GXDA 1HJUA 3TQPA 3B0YA 4PCTA 4OV4A 4P8UA 4P5UA 8XIAA 1M68A 3EA1A 2WVSA 2FPYA 1JUBA 3MV11 1I75A 3BZJA 5DCEA 2ESCA 1M7OA 3VDBA 5DXXA 3OVQA 2AAMA 4MGGA 3LPGA 1M7JA 4E8GA 3QW3A 2QUUA 3GYCA 1GJPA 2IUZA 2DSUA 5FEZA 4G1NA 3WDIA 2W0UA 4JIRA 1P6WA 4AAJA 4QITA 1J0YA 3W7QA 2W5FA 1OWQA 1UHVA 1JVNA 4GACA 5BOFA 2GWGA 3G6MA 4PE8A 1E9ZB 1I2OA 1BYAA 4RE4A 4ERGA 4W9TA 3CHDA 2ZX8A 5L6UA 3MVIA 3TQKA 1VFUA 1ECQA 4JX6A 1TRDA 3VX0A 4Z2JA 3PBYA 4WGHA 1Z32X 1Z89A 4GXWA 1A5LC 4BCEA 1ICQA 4H8UA 5A2AA 3CB8A 3LV6A 3RHGA 1E40A 1QASA 3MSDA 2J7DA 4BWLA 1HGYA 1SW7A 3T6CA 3BMVA 1EA9C 4MSSA 4CU6A 1OFDA 1XYMA 3EMCA 3IGXA 4LPCA 3RU8X 4XVDA 2VRJA 2OO6A 3ABQA 3DHPA 3VE9A 5DELA 3LV5A 2XVKA 1ZPTA 3W27A 2HVNA 5CC7A 3KW3A 3UP8A 4LH8A 4S38A 4FLOA 4E6MA 4AIOA 5AYBA 1E9LA 3LI0A 4U5KA 1CGTA 4LV9A 4J3WA 2PZ0A 4UQAA 3VD9A 3PWIA 1YLVA 4QDPA 1WO2A 1G4TA 3IANA 2WMIA 4M7SA 1KBLA 4UOJA 1BHGA 3QGVA 2FFIA 1FCVA 1Y0EA 2FGBA 1S2WA 4C1LA 4R7OA 2PFHA 3B3DA 1BD0A 3F2CA 3Q37A 3TMQA 4O18A 3MZ2A 3CIXA 3LMZA 2Y62A 3ZJ7A 4Y96A 1EP3A 1FXPA 4KS0A 4KT2A 3M5ZA 4KIEA 1QBAA 3LG3A 4HNVA 5C8BB 2CBIA 4NJKA 5AN7A 1GEQA 2VCCA 1OD8A 1XRTA 6ALDA 3WFLA 3BG3A 4LF2A 3UZ5A 2FHFA 4GI6A 3ITTA 4JN7A 4F0MA 3GXMA 1JCLA 4NI3A 3VGBA 1Q65A 1SM9A 3IACA 3QKEA 3ES7A 4C6EA 1QU4A 3AMGA 1FWWA 4JTEA 3KZSA 4H9ZA 4NL1A 1KM3A 4PA8A 1BXNA 1K1DA 2XIBA 1PTGA 5FA5A 2W3ZA 4R34A 1MXSA 4GINA 1UR3M 8CGTA 4IMAA 2UBPC 3N2MA 1OBAA 1QI4A 3I3EA 3H2MA 3KOXA 2X42A 1ZAHA 2Z2BA 2IKJA 3SGGA 1HUVA 5IBXC 3HJEA 2BGQA 5CQ1A 1B57A 5AZ0A 3HQNA 1FFQA 5CZ0A 3WMLA 2VHLA 8A3HA 2C0HA 2XG9A 1W8SA 5GVJA 1CX9A 3SCSA 2QCLA 1JPDX 4DIAA 3N15A 5C55A 1FQ0A 4F3HA 3PZOA 4QJ3B 5IDIA 2Q3RA 4BF9A 1VPQA 1UASA 3PHAA 3WQEA 4R7WA 1HL9A 4XD6A 1CXEA 2EPLX 4NSBA 1EH9A 3CQIA 3GKAA 4YYFA 4BQ2A 3QR3A 3M7SA 5ABEA 5HQEA 3BAWA 3LHZA 4MAZA 3HGRA 1W91A 2DUAA 3INPA 3IIZA 2QCNA 3W7KA 1SO6A 2Q09A 2QXWA 1EX1A 1UZHA 3H2CA 2POZA 5KZEA 2NX3A 2ZZ2A 1SJDA 5LNVA 1O1ZA 4X60A 1TJPA 1XGZA 5LZLA 4GY0A 4NUWA 4ASTA 5HA7A 2YBVA 1EPVA 3ICJA 3R58A 5F1VA 5CEWA 2DVTA 1DQWA 3AZTA 2XVNA 3V36A 3C0SA 3AYRA 5CPSA 5B80A 2OQLA 3LX9A 1SPQA 4ML4A 2QDDA 3OHIA 1XPGA 1I2PA 1LWIA 2XIJA 3FSUA 2MANA 1XLLA 2XFYA 4TO8A 4S3BA 3QH2A 3AICA 2CKRA 1NQKA 5F7UA 3W2NA 3KDOA 4A8NA 1IHIA 2YA1A 2QCEA 1RBLA 3G5EA 2H8XA 3LRMA 3P0XA 2ZBTA 1TCMA 1H60A 3WK1A 5FEWA 1I2QA 2VFEA 3BC9A 4KIRA 3BE7A 3WQCA 3CQ0A 4H8VA 1QMLA 2FGZA 3UU0A 1PHWA 3GTHA 1WKFA 3R6IA 4GYPA 1KGXA 2PDYA 4F2TA 4B16A 2TPSA 3W1AA 4B15A 1MRQA 4H2HA 2PWDA 1V3JA 1UR8A 4DYEA 3ZIZA 5C9RA 1PKMA 4FIQA 4NYYA 3B0PA 1K9EA 1TIMA 4EPDC 3T05A 3N2BA 3CUHA 4IJBA 4UQCA 4AEOA 2ANUA 3GW0A 3FNDA 3DC8A 2P8CA 1JPIA 3V1PA 4FZIA 3TLLA 1E55A 4PUEA 3L2LA 2P3ZA 4LUTA 3DZ1A 2WMJA 3WELA 2VUYA 3PBVA 3B97A 3WSUA 3NDOA 1IEVA 3CV7A 3QZEA 1B3XA 4QR6A 3K46A 3LQLA 2A3LA 1XHGA 4LUYA 3LHYA 4OOUA 1XF0A 1ZNNA 1JZ3A 2VI0A 3WEZA 1MQQA 3A47A 3VDAA 4KETA 3AJ7A 4AHQA 3LCWA 2AOSA 3PZQA 1G4SA 4HJWA 2WSKA 4C6QA 1EOKA 3QPYA 3DFOA 2IKIA 1FHUA 2JKAA 4AD3A 3CHFA 2PSNA 3UWVA 4DVOA 5I3JA 5A8QA 2RJGA 2PTDA 2VC5A 4WDUA 3OPSA 2G4FA 1W9VA 3C2EA 1S1RA 1R2TA 1HO1A 3GBEA 2D3NA 4ZB0A 3CWNA 3MMUA 3GRIA 2PLKA 3UA3A 4MZYA 1LM1A 2PUZA 2YXOA 1AZ2A 1FWGC 1NOUA 4AC1X 3B9NA 1B54A 1OYAA 2QCMA 3S6OA 1NVMA 4MB5A 4X61A 3UA4A 1AVAA 4QDMA 1OCNA 3QV9A 3UZZA 5T26A 1GJUA 5IFTA 4C91A 1PB0A 3BLEA 2VX6A 1PO9A 3UEQA 3OZMA 4ZQPA 1GYLA 2PF8A 1PVNA 3FOKA 1H3GA 4C1KA 5FL1A 1CZ1A 4JHMA 3MWCA 3B04A 5D38A 3ZR5A 1XLFA 5IFPA 5CZJA 1OGBA 2JF6A 2Y8UA 1G94A 4IIHA 1I45A 3OZPA 3E96A 3P2VA 2CLHA 4YIWA 3PULA 1R9ZA 2MUCA 2CLLA 2AQWA 1Q45A 2TAAA 4WX2A 3IIPA 3BW3A 3B0UX 4AXKA 4U4MA 5HPCA 2NXHA 3UPWA 2QNEA 4L7ZA 2ZZ3A 3CB3A 2FH8A 3DGBA 4L1GA 4EOUA 3RO8A 4FOUA 1RP8A 1PYMA 3WLTA 2PB1A 4HZ7A 1VBHA 2DJXA 2VOMA 3GFZA 1XYLA 5C2GA 4TMBA 1JF6A 2V3GA 1N55A 3AWNA 4IGMA 3IJIA 3T4WA 3TJXA 1DVJA 1GORA 1YW1A 3O6DA 1TJRA 3RUBL 4FB7A 3CV6A 4H00A 1IR2A 3URQA 2PD5A 1DJWA 2PU1A 3ANVA 4QAWA 3VE7A 3W72A 4O1BA 1X8CA 2QVHA 1WDRA 4ZOEA 1EO7A 1XLIA 3MI3A 1YPIA 5LNUA 3REQB 1ZBCA 3BGJA 4FSAA 1E51A 2DGAA 3EPMA 4U31A 3OGRA 3UF9A 4KWOA 1Q6OA 1UJPA 4WIWA 3S9YA 2CZVA 3O2LA 4M81A 3RJYA 4MVAA 1WKEA 3AXHA 1AQ0A 1BF2A 3WFAA 2DSWA 4XO7A 1VFFA 2R91A 1TVPA 1TX2A 4CQAA 4C6OA 1K4HA 1TZZA 4QAIA 5K2ZA 1TO3A 3K4AA 4A21A 1KXTA 5CG7A 2WC4A 3NXLA 1X7IA 4MDOA 3WF3A 1Q7MA 2EG8A 4UR7A 4E4UA 3VO0A 2CLIA 3RM4A 3OBAA 1OC5A 3N2OA 3BLIA 5JQ9A 1E1FA 2CLMA 4RNHA 3L23A 1RAKA 2WZMA 3VNLA 2ABBA 4GQ0A 1W2VA 1XYBA 3W23A 3GXIA 5HMFA 4K8HA 2PU0A 2FQIA 4XO6A 3PAOA 1K6WA 1M5WA 3WJYA 1V02E 2Z1BA 2YKKA 4EP8C 1TQXA 3GVWA 3R13A 3T0CA 4XTIA 3S6TA 3P60A 5KSWA 5LGZA 3RXZA 1VPYA 1POKA 4I3GA 3WQWA 4JTQA 1KBKA 3KVLA 2PP1A 3VUPA 3VIOA 1HKMA 2CPUA 2EKCA 4AZ6A 4WEVX 2Y7GA 2XN1A 1Y5XA 2E5DA 2W4XA 5JIWA 3IV3A 3OYXA 2J78A 2ZZ5A 4ZO6A 4QJ1A 4PR4A 3CIVA 3KWXA 1NDVA 3BLDA 3ATZA 1ZALA 1DJZA 2WJDA 3CAKA 1J6PA 1MRAA 2CFFA 2V5BA 3NVTA 1PPIA 3TYBA 4MY9A 4I8YA 1W9XA 2EHHA 3C0QA 1QNOA 1A3WA 4DO5A 5LNRA 4TX6A 1H51A 3AYSA 1T40A 4IQJA 3R4IA 4RNFA 4X2PA 1X38A 3ZSSA 2XH0A 3DFPA 2YW4A 2G3IA 3V16A 3W2MA 2HVMA 2XIOA 3BUVA 4GQGA 3CLMA 3WIJA 1AQFA 4L9YA 2VMFA 3RCNA 4WQ6A 5RUBA 5D2WA 3UZWA 2DSKA 3G22A 1F05A 2D1ZA 5LA1A 4DAIA 5I00A 4LRSA 5HUOA 4XK2A 2OX1A 4UFJA 3TC3A 3IVSA 3PR2A 6XIMA 1WZLA 1JPHA 1VCGA 2Y7DA 1JCNA 4AYGA 2VFFA 1EO5A 5DLCA 2ACQA 3MY9A 3TNOA 3KBMA 4IFKB 3CXOA 5EU9A 2OZ0A 3UPMA 1GPWA 5XIAA 3ABZA 4DUOA 4D6DA 1JNDA 3GG0A 4WDXA 3SZ8A 4L56A 1RK5A 3TLQA 3A23A 3W1QA 4NJGA 2WWCA 2V2DA 1UUQA 3SUTA 4C6MA 4O52A 3OGSA 4QM1A 3H4GA 2QAPA 1IF2A 3A22A 3V5CA 3XINA 1DE5A 2Y89A 3CUGA 2O55A 3AAMA 4O13A 1MI3A 3S5ZA 1LLZA 3VIPA 1B90A 4I90A 3L9CA 4HNTA 4DLMA 2HXUA 3VKJA 4I5XA 2QHAA 5DF0A 3QMRA 3NZ1A 2DZBA 3SBFA 4UFMA 4IIDA 2OPJA 3MUY1 1QAPA 2O9OA 1O5QA 3VIHA 5D03A 3W88A 3LUTA 1GEHA 3MW7A 3FKKA 4QLJA 2ZE3A 4GK8A 1SSGA 1GONA 3SECA 3MI2A 1FHDA 3HPZA 3UT0A 4LGXA 1Z9AA 1EYEA 1EB3A 2RDUA 3RLHA 1M3UA 4GH3A 1VPXA 1R9XA 3PZGA 1NFGA 2X7WA 3L66A 3EBVA 3KRSA 5I2UA 3KL5A 4DJFC 1K8XA 4EX4A 2Z1XA 1P4CA 3EYPA 3SUWA 5CLTA 3TMLA 2OSYA 1NDYA 4JX5A 3RCYA 1RCOB 5GNXA 4C6PA 2FH6A 1K7XA 1VR6A 5B7YA 3H2EA 5C9XA 3QFWA 2PS2A 4DJEC 3NL5A 3M0YA 3S6DA 2XWEA 3WZ0E 3PZ9A 1EHNA 5JBEA 4QG8A 2REQB 1XSIA 1IT7A 4PMOA 2WMKA 2AGTA 4BHYA 2ZYFA 5DN1A 3SAZA 3NQFA 2YDSA 1I9CB 1N8IA 2HBXA 1XLJA 3FN9A 2WBKA 5C2CA 2Q01A 3F2BA 3IARA 1ZBWA 1THFD 4UFKA 2Y85A 5GJMA 4DJED 4F8XA 1NWSA 1PZ3A 2B7QA 5E9AA 1V03A 3KBVA 3NR0A 2C1GA 2Y61A 4CQCA 4DJDC 4Z1YA 1FWIC 1HW6A 1JYNA 5BWFA 1TPB1 3NURA 2WCGA 2A2IA 2HDJA 3PWGA 4F2BA 3UWZA 3W7PA 3ITCA 3O6YX 3T2QA 1J4EA 3B9AA 3L5MA 6CGTA 4N9DA 1TUXA 1PX3A 2DZPA 4IG2B 3TX9A 3R0UA 4C65A 1VENA 1MEHA 5D9OA 4RDWA 4LYRA 1UMLA 3MCNA 3R0DA 4C6DA 1TPVA 3VOJA 3CV2A 3ZOAA 1R8LA 1TPDA 2WXDM 4MFEA 1I6NA 3KRZA 4D71A 3AJXA 1E6NA 2GJXB 1DPMA 4L6HA 4CUCA 1V0MA 3M9YA 4PL2A 4E4FA 1J5TA 3MC5A 3GW3A 3K4DA 2HVOA 4N4QA 2PTWA 4WUIA 3O0FA 3MHUA 4JN6A 4J28A 4JTRA 4GYJA 5HK4A 5D04C 3OVRA 3F4VA 2O4QA 3VGFA 1H0IA 3SCRA 2W92A 1RJRA 3CZKA 3IJ9A 4AHPA 1QNVA 4IQDA 4GYKA 4IJCA 5H91A 4OKDA 4PB3A 4D72A 4PEEA 1WDWA 1RH9A 1KFKA 5D4YA 4V15A 5M2FX 5DANA 4HCLA 3L7RA 3BQ6A 3O15A 4QFUA 2WNWA 3RITA 4A8IA 5BZAA 1O95A 2Q8ZA 4POCA 4HD5A 3T7VA 1LROA 4C60A 4Y8FA 3WD1A 1E4MM 1W1IE 4X0NA 4V1XA 3WJXA 1V4YA 5HR6A 1QRQA 1XBVA 2QDGA 5EBUA 3S83A 2ZTJA 3PPCA 5HQLA 1GTEA 1SZGA 4OZOA 3MPGA 3EWUA 2HQAA 3CEPA 4NNAA 4MIMA 4I5RA 3O7UA 2VZSA 4FR6A 3ALFA 1C91A 4UTJA 2QUNA 4Y9AA 1GTHA 1EF2A 1BLIA 3P84A 4Q33A 2IKHA 2ZE0A 3WF4A 3PBWA 3IGSA 5GJPA 1VFSA 2F6XA 4P8WA 4JQ2A 5AOUA 3FK4A 3THUA 3HO8A 1HL2A 3PVFA 3QYQA 5F4XA 3UWWA 3UR5A 1OGGA 1LYXA 3RMJA 3TSMA 2PP3A 3LCIA 4GHRA 2E0PA 1AODA 2JEQA 1MFUA 5C5YA 1RQHA 2PDWA 1KFBA 4GC3A 4D2JA 2VCAA 1R3TA 4L6DA 4YWSA 4WY0B 3QF0A 5M03A 4EXBA 1ESWA 4DYKA 3PG9A 2YJQA 5MKGB 1XCWA 2YBTA 3ZZ1A 4R5EA 1EGMA 4IPLA 3VM5A 2GUYA 2YDAA 3WLQA 3WUEA 2DV0A 2IQTA 3FXYA 4W93A 1UP3A 1X1ZA 3CZ8A 3OEXA 3DBNA 4YL2A 2XH2A 4P7NA 4ZOCA 1VCFA 2XISA 1ZU8A 4YVVA 1RHCA 1K03A 5A6SA 1J9YA 3L4TA 1G0CA 2OT0A 4L61A 2OT1A 2Z27A 3F5KA 4UR8A 4F0HA 3JZUA 3DKLA 4NF7A 1WXJA 4QEEA 4AQLA 4BF7A 3F5LA 3LPFA 2Z1WA 2BVTA 1PTDA 1T5AA 1EP2A 1MSSA 2ZRXA 4RDYA 3LRLA 1CGUA 1JCMP 2YLLA 1KTBA 1H7RA 3ARXA 5LHEA 1TZ7A 2KAUC 1S2AA 4HHMA 3W28A 3NIYA 4EWND 1V8EA 2C1IA 3G3DA 1F5ZA 1HKVA 1LOQA 3ZSTA 2QJMA 4DPPA 5DT5A 4HA3A 2Y70A 2V6AA 4NHVA 1MUCA 3DH7A 4I9AA 4MB3A 3W70A 1DWHM 2HV5A 4WKHA 3V75A 2BVWA 3QEZA 5SWUA 1UC5A 1GUVA 2P53A 5C6MA 2JK2A 1J10A 4QE5A 3LCXA 3SCPA 3POHA 3C3UA 1KNWA 3O8AA 4D9PA 2FZNA 5IBXA 3Q4DA 2G5WA 2OJPA 1QXLA 1A50A 3OA3A 1OK4A 2Z24A 2FTPA 4TVUA 4XIMA 3CUFA 4WKFA 3ONCA 2YCLA 4GZIA 3GX9A 3WD0A 4E8DA 3FJ4A 3EXRA 3ZLHA 1JR1A 5BRQA 3DI0A 5TIMA 1KFJA 3G3MA 2A21A 1H7OA 4KCTA 1H63A 1I4NA 2YLAA 1V6YA 4G8TA 7REQB 3CWOX 4UNKA 1VRXA 2OLHA 1AMKA 1R5YA 2XGZA 4HA1A 3UNTA 1PTAA 4KGLA 5LA2A 1HIZA 3T81A 4R7JA 2FZMA 5EMUA 1R3SA 1G67A 1X97A 2PEVA 4JTHA 1SUXA 1FFRA 2HS8A 1I2RA 4K39A 3TWBA 5DMMA 1BG9A 3D3AA 4S3GA 3PUDA 4L5ZA 4PRWA 4QIUA 2ZXAA 3W6YA 2DUZA 3TR9A 2Y1HA 3AI0A 3WKZA 2ZCGA 3T0TA 1OX6A 2FB2A 4YNGA 5A6MA 2WCSA 3TTQA 4Z2IA 1TJ2A 3ERPA 3WQFA 1XLCA 1IGSA 4I7UA 3WLLA 2PWVA 4DBEA 1XGDA 4JFTA 3TK7A 4J40A 3LTSA 3V0TA 2BLEA 2B7OA 3GIQA 3VNMA 4AIEA 3FHAA 1DWJM 3W73A 4Q4QA 9RUBA 2IQ0A 5BNKA 5CSRA 2O9RA 4NYUA 4AD0A 1PZ0A 1DYSA 4EAMA 1GWJA 1J0HA 3ECQA 1T6MA 5EKYA 2CWXA 1XLKA 1Z3NA 2Y7EA 3KVJA 1KCXA 2E77A 4M19A 1H7WA 1AD1A 4FP1A 3U5UA 2GUBA 2NQJA 4GUFA 3VCCA 1VJIA 3B03A 1PXGA 3H21A 1SO4A 4A3RA 1SZNA 2Z0IA 2CZ5A 1UP2A 1NH6A 3AHYA 2E5CA 2Z7GA 2D0HA 4JTKA 5BOOA 5TQLA 1DHKA 4DPQA 1S1PA 3W9ZA 1DXEA 3STGA 1G7VA 1MQRA 1QW7A 5I24A 1OY0A 3ISIX 4LS2A 3GSMA 4HZMA 4IG2A 2V63A 2INZA 5HNRA 4GJJA 2PPGA 4JIEA 1A3HA 2XPKA 3S46A 1NQ6A 2BXZA 3SCQA 4KH2A 1XL9A 2F2KA 5AC6A 1KKRA 1OFEA 3AIBA 1GOXA 1ICSA 3EDDA 2P0IA 3AROA 5TF0A 4FF7A 1EOMA 1MW2A 5FJRA 4AZ5A 1QPQA 3IJ8A 5C7VA 1EJVC 2VXNA 1EJSC 2I14A 3UWEA 3VX1A 1RR2A 3MV01 1VS1A 3GVQA 3CLWA 1QDSA 3QXBA 1Q4NX 2O9TA 4GBDA 3USZA 4JN8A 4QLLA 4PFHA 4AF0A 4ZGYA 4M0XA 1DJXA 2YA0A 2QMJA 1KO0A 1SMAA 4OBTA 4MWAA 3OZYA 1W31A 3HGSA 1FX6A 4XAZA 2GUUA 4H1ZA 1GKPA 1W5PA 3FEMA 1R3YA 4KFOA 2J79A 2P0OA 2W67A 6A3HA 4TV6A 1TPFA 4RZ5A 3KEHA 5A95A 4WLCA 1S46A 5D8ZA 2WNNA 3H55A 1H1NA 1GOWA 2J62A 4Z08A 3W24A 4XZ9A 3AIWA 3BTNA 1JJKA 2V69A 4ECLA 1EWDA 1RVGA 3KLKA 4V28A 3TKFA 1XPYA 3A24A 1DORA 3MB9A 5LIYX 4Z0SA 2X30A 3PSVA 5FSEC 3W7OA 2VGFA 3UJSA 1OC7A 3W74A 3M6DA 3GNDA 3BAIA 3V18A 5C0QA 1OFPA 1R7OA 3CU2A 1FCQA 2ONEA 2DQWA 2G95A 2ODOA 4KWSA 4BF5A 1P5BA 4X63A 5A6JA 2WHMA 1UR4A 3LD5A 4UZSA 2QCGA 4KMQA 5A8MA 4TX8A 4H6EA 1V0LA 4JFSA 1KFCA 2GFTA 1JDFA 5AC5A 1SJCA 3KZPA 4LVDA 2DIJA 4QP0A 2BHUA 3KHDA 4IFOA 3VGGA 1POJA 1E43A 3G8RA 4JQ4A 1QNRA 4IMFA 1OM0A 4IPIA 4DNMA 3PG8A 3N04A 4J3TA 3SFKA 3UYIA 4O19A 3UXLA 3WLKX 1W3HA 2BGNE 4BEUA 1GT8A 4XIAA 5AYIA 5DXYA 2X8RA 1JDDA 2NQ9A 3R43A 1Z41A 3WL1A 2TRSA 2RDXA 3C0JA 3K8LA 2IXUA 3ARZA 5DRCA 5JU6A 1L9WA 1WUFA 1IT0A 4FA3A 1JD7A 3LQGA 4LJ3A 3IIVA 5FJOA 1JCYA 1KFLA 7ENLA 1XLHA 3AMKA 3UWYA 4JTFA 2OXNA 4N2YA 3IIOA 4NT0A 1TX0A 3CGTA 4LVAA 3LCHA 4OJYA 3WQGA 4DWSA 2D23A 2WZHA 2PA6A 5D2VA 3W2LA 5HUPA 5H8UA 2WJFA 4MNJA 5LNSA 4HZ6A 3VA8A 3OG2A 5FOOA 4E2VA 4IXHA 2WVVA 3U6WA 3RMEA 4M6VA 4GVGA 2VVSA 2I56A 4F66A 4H19A 4XWUA 1F3XA 5F4SA 1K9FA 1J96A 2AQOA 4QROA 3T0BA 4UIOA 2PP0A 4DNHA 3B8DA 2DSVA 2PDHA 1XKYA 3T09A 3B8IA 1ISVA 2DU2A 2X41A 4L4PA 4HU4A 2WMFA 3RR4A 2QGHA 5HAOA 1W6TA 4JTDA 4Q8TA 1ZY9A 3CEUA 3ABOA 4IFKA 3PBGA 3EB3A 5LIWX 4DY1A 1W9UA 5HQMA 2A85A 3GZ3A 3DHDA 4XV0A 2ISSA 2NT1A 1XISA 4HA4A 4JTLA 1WX0A 2BOFX 4Q4MA 3TW7A 1HT6A 2YPIA 2WC3A 1A3XA 2VGGA 3A6OA 4MWAD 3UXDA 2PODA 1H09A 2X16A 4Q8UA 3TTSA 4YWIA 4DWDA 2O92A 1KRCC 3CIWA 3BOFA 1BTCA 2A7PA 4K3ZA 3W22A 3QN3A 1X8FA 4X3ZA 3PPFA 2TSYA 1K3UA 2AKMA 1A80A 4WVXA 2HE8A 1KD0A 3WK2A 3GTIA 2WB5A 4UUIA 3TYAA 1Q7QA 2X1TA 4O1DA 5G1MA 2E68A 3BPWA 4US5A 3MA8A 1V3MA 4O16A 4R53A 1LJYA 5G1YA 3ITYA 4AZBA 5DRIA 3ZO9A 2ZKMX 4S2CA 1V6VA 1PZ2A 3T42A 4QSHA 1RUSA 3GNXA 3GXPA 4RV3A 2QMKA 3QQ0A 2ZVRA 2W62A 5B7ZA 3W53A 2QUMA 4GYPC 6REQA 5AHFA 2R1KA 4V33A 2C8NA 3I3BA 2OB3A 4HGXA 1KM1A 4AIBA 1IWPA 3FVDA 4X9YA 3STPA 1VYPX 1SU5A 4DLFA 1EEXA 4OVXA 2J66A 5FIPA 3H7RA 3APGA 4MLJA 4XQ6A 1XH1A 3ABRA 1SMDA 6ENLA 3CAVA 2NX9A 2XGIA 5BWAA 4YCOA 1H49A 3GHUA 1E6RA 4QTGA 3THDA 1GZ1A 2OWCA 1O4UA 1T0OA 2BBFA 2A0NA 4JKKA 3CM4A 5EYWA 4AD5A 3IRSA 4GCXA 2W27A 1Z69A 3FYOA 3DG3A 4JIQA 3RLVA 3GG1A 1R47A 3RPTA 6TAAA 1XD0A 4IZGA 4MUPA 1HJWA 1CGWA 2VX7A 3NO5A 3ITGA 2NT0A 4KEZA 2X2YA 2P50A 3L12A 2QT3A 1OHLA 1YMYA 1V7YA 2X05A 4Q8WA 3N12A 1DKWA 1JFHA 4GOAA 3H4XA 5F4WA 2G37A 5FESA 4G7EB 3HV9A 5MF5A 3P93A 1ELSA 2GSEA 4E3VA 1JRBA 3PC0A 1F3TA 1U1HA 3GHSA 3TOPA 4PTWA 2CLFA 3VMOA 2E6DA 4AX6A 2KX9A 3SY8A 2Q8LA 1PWLA 4MNLA 1REQA 4UTIA 3NOEA 3LSCA 3K13A 1RXOB 5FJTA 3VKDA 4DJFA 2CU0A 3MKKA 4TX9A 1Q4WA 3ARVA 1JZ8A 4QBXA 1F4HA 2Z2UA 3PTKA 3VIKA 1D2KA 3NDZA 3SO7A 4PMXA 3CQJA 3WF0A 2OVLA 4C1NA 4DF2A 1UD3A 4WOQA 2PRLA 4NAEB 5IXEA 3IGHX 4GG9A 2QJIA 3R10A 3MT1A 1SVDA 4GRSA 4NRSA 4PH6A 2I1OA 3GTXA 2Y2WA 3TJ4A 4D8LA 2J6XA 5EBAA 3TEVA 4D6IA 2VWTA 1B2YA 3G1RA 1UA7A 3WLRA 4NILA 4DM1A 4JTGA 2E8ZA 4HCHA 1JQXA 2RAGA 3PY2A 4LX4A 4QEHA 2FDMA 1U5VA 3DFSA 5TBOA 3VGEA 3U4AA 1TTPA 1LL7A 3W1NA 1UR0A 4CGTA 4HHHA 1PUDA 3FAWA 1OQFA 3O16A 4C7GA 4MNKA 4IP7A 2G97A 3W2UA 4GGHA 3MUZ1 4KGJA 3KOWA 1CLVA 4UFHA 1V6WA 2HWGA 3MDUA 2ZWYA 1VFMA 1YQ2A 3LYEA 4L65A 5C7HA 3R1ZA 1JNEA 4JYEA 1B5TA 1S5TA 2A3EA 4EACA 2VX4A 1M7PA 4BQ5A 2GWNA 1US0A 3HM7A 5JXQA 4G1KA 5AVHA 3WX7A 4OWGA 2VFHA 1P0KA 4MKSA 1AZ1A 1F07A 1UKOA 1P0NA 1V5XA 4YYCA 4IQLA 1SJAA 3W29A 3GG8A 3UXKA 3ZJ6A 4K68A 3LBCA 4M29A 3P3BA 1QOQA 2ZRZA 5CGMA 2PWEA 3WQ5A 1E15A 3PBMA 1WBJA 3S47A 3GH4A 4XISA 4BEQA 3DFQA 3MU7A 1KWKA 3L4ZA 1PCWA 3MMWA 4QE4A 5HPOA 3AS1A 2ZUWA 4H9UA 2W66A 1YNPA 4LVBA 1RJQA 2BWGA 1DJGA 3O6CA 1US3A 2AMGA 3ARSA 1UQZA 1W5QA 4GLEA 2YB1A 3E3HA 4XX6A 3GM8A 2WSRA 2OTDA 4JIIX 4NXKA 3VD3A 3PZTA 3E49A 3N6HA 2RGMA 3LM7A 2H8ZA 3AYTA 3BCDA 2CHOA 2WK2A 1I1WA 4Q8VA 3W7JA 3DI1A 2XWDA 1CGVA 5CPLA 5CC3A 4PTVA 3LHUA 3LY0A 2F38A 4UOZA 4NG3A 3WG6A 5FAJA 1T8XA 1OVDA 3SW6A 4JTSA 1W9BM 2GQ3A 4DXVA 1I1XA 4RX0A 2BODX 1V51A 4FS9A 1BRLA 3W7LA 1Q63A 3WK0A 3GBDA 3TW9A 2YL9A 3GC2A 1W56A 4PUWA 1H62A 1TV5A 3RN6A 3IJ7A 2PDLA 3TZNA 4YLWA 2CIPA 5FD0A 1XWYA 3NDYA 4P61A 3ZR4A 2Z7KA 4UTKA 4PMDA 3AISA 2GQ8A 5HR7A 5AKQA 1VLIA 2CLOA 3M44A 1A5UA 2Z2AA 2DZSA 2ALRA 2HPMA 1DIKA 3VDHA 5LXEA 1LP6A 1RALA 3STCA 3BVJA 4JEJA 4J3ZA 5L9FA 3WH8A 2D22A 4MWAE 3W1TA 2XN0A 4ZFCA 1X96A 4I9TA 4PN2A 1A5CA 1P1XA 3N9KA 4AD2A 3LGDA 3ZS4A 3MBDA 4GZ7A 4TMCA 1DWAM 5ECVA 4OFCA 1TVNA 3JR2A 3PUEA 5C70A 3EX6A 3ARYA 2R6OA 4HSHA 1OGSA 3BMXA 5F2IA 1W32A 1E1EA 1WZKA 5CC5A 1OG6A 1UPMB 2P88A 5I3FA 1WPCA 3BG5A 1I8JA 3I7QA 5HINA 5I07A 4AISA 1S2CA 1UWAA 4I9MA 4JQ1A 5KZ6A 1SR9A 1YTDA 1V6XA 4IP4A 1PCKA 4GZEA 4HHLA 1J6OA 4LBRA 4OUIA 1Z42A 3OBKA 5CGQA 3QV6A 4GY1A 4FNRA 5HNUA 2A3CA 4PODA 4Y8EA 5E9XA 3R25A 4G6CA 4PB4A 4LU0A 4ZOAA 3BJSA 1BXBA 1JXKA 3F7JA 4PMZA 3FEQA 1UD2A 4AZCA 3U2OA 2WJEA 3SGZA 1M7XA 1J2WA 4JR5A 3BJFA 4PMYA 3QYSA 1NWRA 4LUSB 3BV7A 1HKWA 1HVQA 1CECA 5I77A 3UR2A 4JXCA 1DWFM 2ATSA 2JE8A 4N6FA 2OG9A 3AIRA 1KTCA 3WLOA 4J3UA 1BQCA 2DZWA 4Q8NA 4Q4PA 3N34A 3KCJA 2I5GA 1MDRA 1LRTA 2ZZ1A 2XUCA 4DO4A 1R0MA 4B4FA 3EOEA 1UZ4A 1MNSA 2FZ8A 3BANA 4ZB5A 4LALA 1TJ0A 3VOFA 2GOKA 2R82A 2GJNA 4XAYA 3ANUA 1WXYA 2F8QA 1VD6A 1AH3A 3TCEA 3GAKA 4MZ1A 4WJXA 5E0CA 4JFVA 1NJJA 2J24A 3B05A 5D2YA 5K4XA 1NIUA 1VC4A 4FXRA 3F5JA 1NFBA 1JL8A 1PZ1A 3QHOA 3EOOA 3KRBA 1FWDC 1ADDA 1SYTA 2ZUSA 1HJQA 4HKPA 2Y8KA 1MNZA 1TWDA 4F40A 3CPRA 3UWUA 5I3GA 1LOSA 3O06A 4JYFA 4TXEA 3O63A 4W86A 3V35A 2WOQA