3R89A

Crystal structure of orotidine 5-phosphate decarboxylase from anaerococcus prevotii dsm 20548
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
289
structure length
289
Chain Sequence
SNAMKIIDKLYEKVSKNGFVCIGLDSSIDYIPENMKAGKSVSEALFSYNKEIIDQTYDVCAIYKLQIAYYESYGIEGMIAYRDTLSYLREKDLLSIGDVKRSDIAASAKMYAKAHFEGDFETDFITLNPYMGMDSIEPYEEYIEKGDKGVFVLLRTSNPGAKDFEVLPVDGEEFFYKVGDKMRELNEKYIGKSGFGPIGLVVGATHSEEVEKIRKRYDKMFFLIPGFGAQKADSMNVYKLLEGLNGGVVNSSRAILKNWQNYEDGSEKVGYYARKKAIETYEEIKANEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Crystal structure of orotidine 5'-phosphate decarboxylase from Anaerococcus prevotii DSM 20548
rcsb
source organism Anaerococcus prevotii
molecule tags Lyase
total genus 110
structure length 289
sequence length 289
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2011-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3r89A00
3FKKA 3TKFA 3NGJA 1SW3A 1L9WA 1GVOA 2NZLA 3BGJA 3HG2A 1SFJA 2C18A 1S5WA 3A21A 2DP3A 2DZTA 1PVNA 1LOSA 4R7JA 3Q37A 3TR2A 1HTIA 3L68A 3T40A 2VOMA 4K38A 3FYOA 5CGQA 4GC4A 3ANYA 4X3ZA 1FXQA 2FJKA 2Y85A 4IMDA 5FEWA 2A5HA 1QWGA 4A29A 5F2IA 3FA5A 3DFOA 1DHPA 2AGKA 3FJLA 4LUIA 1B3OA 3QC3A 4N9CA 3R13A 4UTIA 3S0CA 3SECA 2HMCA 2PRHA 4K36A 4RCXA 3LCGA 4O53A 3GNNA 3PR2A 3TSMA 2FB2A 1XBXA 1YADA 1RQEA 1TTQA 4MYAA 4NQ1A 5CZSA 3L21A 4JEQA 5EPDA 1OF6A 3QFEA 3T55A 3Q58A 1M7OA 3EKLA 2Q3RA 4IX2A 3KFTA 4MOZA 5CG7A 1T8XA 4DBDA 1OG0A 1VR6A 3E12A 4Y96A 3G0UA 1FCUA 5AHMA 3KRZA 2ZQ0A 4MIMA 4UTWA 2VC6A 5F1VA 5KITA 1HFBA 4M7SA 1R30A 1LYXA 2CZ5A 3GLCA 2QCGA 1H7RA 1EIXA 2E6YA 2Y7FA 4JTHA 1KM6A 4UFJA 3DI0A 1K3UA 2BWGA 3LCHA 2CW6A 4Q4KA 1QOPA 1DV7A 1ICPA 3G3MA 3UNDA 1JRCA 4ADUA 4LTSA 3WFAA 3NQ7A 2W0UA 1KA9F 4DELA 1Q6QA 1HG3A 3EWYA 3TSDA 5FESA 1VYPX 5H91A 3DFNA 2NX3A 2Y7EA 3B05A 3NQ6A 3LTPA 3N9RA 2QCDB 2WNNA 4MY8A 3LTSA 3I65A 2ISSA 3MYOA 3HQ1A 3PSVA 3L2IA 5IBXC 1IF2A 1D3HA 2RH9A 4DPQA 4MJMA 2DU2A 4LRSA 1U83A 4AWTA 1IXQA 3MUXA 4FNRA 2V5BA 2P10A 1VC4A 1SO4A 3FLUA 3IVTA 5LHFA 4QIUA 4FIRA 1W37A 4W9TA 2ZRXA 4M6PA 1SO6A 3BV4A 5G2HA 1SFLA 1ZNNA 4GUGA 3G0SA 3P8IA 4UNKA 2BSLA 3HOJA 2NXIA 1ML1A 5KTLA 4GUHA 2WSQA 3W86A 4AWUA 2QCLA 3ABOA 1VCVA 3YPIA 2VXNA 1I2NA 2VEMA 4LY8A 1D3GA 3WK2A 5AHLA 3VFLA 4ALDA 1FWTA 2CLMA 4O1AA 3IIVA 3P5YA 6ALDA 3G1XA 1OFRA 3LBCA 1W3IA 1HO4A 1NEYA 1U5JA 3SI9A 4ZQRA 1PL9A 2WNZA 1VCFA 2QJIA 3UXAA 3NXFA 3F4NA 3IIXA 3NZ1A 3LERA 1EUNA 3FYPA 3QH2A 3PBUA 5K2ZA 1H63A 1K03A 4RZ4A 1AL8A 3M0ZA 4OT7A 1SO3A 3F4WA 3BW3A 5AHNA 2Z1BA 4LW7A 3V75A 1EP3A 3FS2A 2WOQA 4Q33A 1QPNA 1NSJA 3UWWA 3BLEA 2NWRA 3M7WA 1CW2A 3LTYA 3HGSA 3SZ8A 4ZMGA 3CEPA 1ZHAA 3PB0A 4JDBA 1N55A 2E5DA 3JRKA 1JRBA 1Y0EA 3EKZA 4JTKA 1VRDA 4NT0A 5HUOA 4YLWA 1F2JA 2TMDA 4O11A 2ATSA 1XL9A 1DJNA 1QAPA 5IBXA 4H6KA 1KLZA 1TCDA 4S2BA 2JBMA 2VENA 4NNCA 5G5IA 1BKSA 1LRTA 3EWUA 3GNDA 1JCNA 3WK0A 3GDMA 4CQ9A 3ZS4A 3BARA 4UCGA 3T44A 3W70A 2C6QA 2RFGA 3BG3A 2VFFA 2B4GA 3A9IA 3O6CA 4NJKA 3IEBA 1Q6RA 3P74A 5EL1A 1KFEA 4LNYA 1TJRA 4GNJA 5LNUA 4JICA 3W72A 2OX1A 1W1ZA 3NL2A 4JX5A 3SGZA 2BTMA 3LHVA 4XTDA 4ORIA 1QR7A 4NJHA 1ZAJA 1TPUA 1WBHA 4AAJA 1QDSA 4S1FA 2EAWA 3PSWA 3DXIA 3UZJA 1I4NA 4JYFA 2YYUA 4FX7A 3LHTA 3NQAA 4JTJA 5BMXA 3CLMA 1VCGA 3G1VA 3KVJA 3I7RA 1ZCOA 2DJLA 1AW5A 3OG3A 2VFDA 1HL2A 3A5VA 4ONVA 4K7VA 1H7OA 4CNPA 4IX0A 4C1LA 1KTNA 1XBYA 5CPOA 3THQA 1A5SA 1MSSA 2I9EA 3M16A 2Y63A 4IUOA 3NO5A 1ZFJA 5U4NA 4NNAA 2QCEA 4A22A 5G1TA 5H2ZA 1G6CA 1IIGA 2BLEA 2TRSA 3CM4A 1F7BA 4FF7A 4U4MA 1RQHA 1KBIA 1I2RA 4OV9A 3TFXA 2GVLA 4MLRA 3N19B 5F2MA 3HJZA 3DHFA 5C5YA 4XBKA 3AO0A 2ZFAA 2I14A 4A2SA 4DBEA 4YCOA 3KRSA 2GVJA 3KRUA 5E0KA 1GYLA 1GG1A 4N4PA 3M43A 3ABQA 4EOUA 3OVPA 4UR8A 4MZYA 2NUYA 1W5NA 4RXFA 3PBVA 2EGZA 1I2OA 3CQ0A 1OX4B 3QF0A 4N9DA 1Q6LA 1FY6A 1VQTA 3STFA 5J5DA 3KVLA 3BG9A 3C6CA 2YCEA 3QQ1A 3P7YA 3U2OA 2E6AA 4XQ6A 1KM4A 4KFOA 3HB9A 1P5BA 4ZQCA 5EY5A 1TV8A 2WSRA 5HULA 3E0IA 3GR7A 4KFNA 5CPMA 1QO2A 1TQJA 2Y7DA 3MHUA 5HMSA 4GE8A 3KXQA 4PTNA 1DOSA 2J9YA 3RLVA 1MEWA 3G18A 4R53A 1GPWA 1TV5A 3E9AA 3GXNA 4RXGA 3MWAA 1RQBA 1NF7A 3HBLA 3GDLA 4XKYA 5BMWA 3FIGA 4M6QA 3S1WA 2V9DA 1J5TA 3HGOA 2X1SA 3B03A 2C16A 3W7IA 1K7XA 3L66A 3G22A 2WPBA 3CWNA 3MHGA 4LV9A 5HUPA 4PC8A 4S2CA 4WY0F 3LCWA 3G1HA 4UFLA 4ADSA 4QNEA 3NQMA 3IGSA 1KM1A 3P8JA 3LRKA 3VE9A 3W7DA 2E1DA 2PCQA 1XM3A 3OA3A 4UFIA 3W7QA 3LRLA 1W0MA 2H8XA 2QDGA 1PS9A 4J9JA 4WY0B 4IJBA 3WJXA 4JDYA 1VLIA 3LX9A 5TIMA 4BFAA 1O4UA 1A5BA 1W56A 1LZOA 3CIWA 3KVMA 2ZZ7A 1XFBA 3S1UA 3W7KA 1JQVA 1DKWA 1FBAA 3W7NA 3W7PA 1AG1O 5HWNA 1KFCA 2R8WA 3IGXA 5AYZA 4NXKA 4FO4A 5D2TA 3CTLA 3MW7A 5CKSA 3PWAA 1TPEA 3S5ZA 2ZZ1A 5FF4A 3W7HA 2X1UA 2Z2UA 3LXBA 5KZMA 4UR7A 3G1FA 4LVAA 3L0GA 1GG0A 2E6DA 2V82A 2A4AA 1TRIA 3F1QA 1ZAIA 5AB3A 3EXTA 1Z41A 4OGZA 4QAIA 3UY7A 1BWLA 1C29A 3W7CA 1AMKA 4PL1A 4ZZ9A 1UCWA 3DZ1A 3LDVA 4Q32A 4PODA 4NJJA 1P0NA 1R47A 2YXGA 2GJNA 2VEPA 3CB8A 2R94A 2NX1A 2V2CA 4YMZA 3GDRA 4HNTA 3W73A 5EYWA 3G8RA 1TPWA 4CNOA 3B0UX 4NX5A 4FNUA 5FEXA 1SO5A 3HPZA 3MP5A 1G4EA 3WJZA 2NX9A 4AHOA 5SWUA 4EVZA 1LLWA 5AYYA 3TX9A 1TRDA 5C2XA 1TPB1 3TA6A 2I1OA 2YR1A 3EWBX 1WV2A 3O07A 3RFAA 1R46A 5A8GA 2EPHA 1PCKA 4XKYB 2OT0A 1I45A 3TC6A 3QM3A 4UTJA 1OYBA 1W5MA 1JVNA 5EA9A 4K6AA 1SPQA 4UUIA 1GT8A 3W2NA 1FQ0A 2YDAA 3MBDA 3MI6A 3M6YA 4UMAA 3G1SA 3W07A 1LROA 4JN6A 4IGHA 3QMTA 2F7FA 1O5KA 4Z08A 3GX9A 4UNLA 1QOQA 2B7NA 3NQ2A 3GB6A 1WX0A 5I3IA 4I7UA 3TUUA 1OK6A 3EX6A 3LHUA 2A1YA 4UTKA 5HR7A 4UTHA 3TFCA 1KFLA 3NOEA 2QCHA 4ZL1A 2A21A 3QYQA 5LSMA 1VYSX 3N34A 5D03A 3ZR4A 4O50A 3V1PA 5CSRA 1WYIA 4LC8A 4X9SA 5DLCA 2CLIA 1TPVA 1KTCA 4AHQA 1MZHA 5HR6A 3QSTA 5ABTA 4GUJA 4ORMA 1J4EA 4YL2A 3T78A 1KFKA 4M7TA 4HNNA 1EUAA 4P61A 3F03K 4O4VA 3A5FA 1SZEA 2YPIA 3W2UA 2PE4A 4AF0A 1G4SA 1YTDA 4JYDA 1TYGA 3MP3A 1F05A 3O8AA 4JNMA 3O6DA 3GAYA 1ME9A 2V8ZA 3UD6A 4QISA 5D2VA 1RD5A 4PCFA 1Q3NA 4MPQA 1YPIA 2YGYA 1G7UA 5L9FA 1TPH1 4PH6A 4DF1A 1QO5A 2PURA 3I68A 5J5RA 3AJXA 4M5PA 1VYRA 3LCLA 3M44A 2QAFA 4O54A 3LOTA 1WAUA 4E0CA 3EWXA 3R2GA 3GYEA 1VPXA 1DVJA 4K8EA 4TMBA 4E2DA 1H51A 3G24A 1LCOA 4WJEA 2ISVA 1SZNA 1YPFA 1FCVA 4UMCA 4TR9A 1G4PA 4LS2A 4XBSA 3W71A 4BI5A 5I3KA 4IPJA 1M7PA 1WA3A 3W88A 1IIHA 1K7FA 3SSJA 3PM6A 1PHWA 3ABSA 4Y8FA 4QM1A 2H3BA 4MYXA 4AXKA 3EWWA 3G8EA 1KW1A 3A23A 1DL3A 4HPXA 4O16A 2ZRUA 1JCXA 4MZ8A 3FOKA 3R8RA 1FDZA 3NNTA 3TIMA 2TPSA 5G4EA 1LRNA 3S1XA 3NQGA 1VH7A 3LCXA 2V2HA 5I3HA 3NL5A 4Z0SA 1X7FA 2FPYA 2CLFA 1KLYA 1SQ7A 1L6SA 3LGEA 3G1YA 3TROA 3OIXA 7TIMA 4X22A 2CLEA 3E49A 3TC7A 3W2JA 4NZFA 2FDSA 5KMYA 3NM3A 1GVSA 4CQAA 2DJXA 1N8FA 4MUZA 2J6XA 3BLIA 1KM3A 3LLDA 4FNQA 5D2YA 4I9AA 3DENA 3L9CA 4ZQNA 5DXXA 3C61A 5D09A 1I2PA 3NM1A 2C15A 2VFHA 4UMBA 2DZXA 4HN4A 4JGDA 2FB3A 1WBJA 1EWDA 1TPDA 3W1LA 1P0KA 3TNOA 5D38A 2FQIA 2VKZG 4EF9A 1UB3A 1VJIA 1EWEA 1YXCA 3N9SA 1XBZA 2WQPA 3P5ZA 2JGYA 4WQ6A 3P80A 4OQVA 3W3OA 2G97A 3TQVA 3IIPA 1F6KA 1H7WA 1THFD 4E2BA 2C0AA 3DI1A 2Q8LA 4AF0B 4IMFA 5BOOA 1E51A 4X2RA 4JTEA 2ZDRA 3RK8A 4GWEA 3LCIA 3DFQA 1OJXA 1I2QA 4O18A 4N4QA 3MI3A 4N02A 2WSYA 4K7YA 2PRMA 3HG3A 2GQ8A 4NX0A 3TW6A 3LB0A 3PVFA 4FEZA 3HMJG 3IV3A 4UTLA 4TU1A 4UTTC 2V30A 1EP2A 1SSDA 1H5YA 1KM5A 3CT7A 5KZDA 5LGXA 1Z48A 3N2MA 2Y62A 2HS6A 3U6WA 3JR2A 5LKYA 1VS1A 4FNPA 4DO5A 3UZ5A 4IXHA 4WX2A 1B4KA 4PA8A 3NQDA 3HG4A 3ATZA 3UWQA 4B5NA 3R5EA 3SJ3A 1UUOA 3B8DA 3G0XA 1W5PA 4N9BA 4BK9A 2ZZ3A 3NR0A 2QUVA 2ABAA 2ZTKA 3UYCA 2WO5A 5DCBA 2FPVA 4NUWA 2J9XA 3EEGA 3NPXA 3UXDA 3UY8A 3FKRA 4CCEA 3LM7A 1F76A 1MEIA 1GEQA 4UFHA 1XDMA 2NWSA 4LV4A 3P82A 1JQXA 3ATYA 1H62A 3EXRA 3NG3A 3UQNA 1N7KA 4NXSA 3DFPA 2FPTA 2Y89A 3FEMA 4FXSA 1W8SA 2GVGA 1ADOA 3CPRA 1G4TA 1ZY9A 5E93A 1EPXA 2OJPA 3LLFA 2ALDA 1EB3A 3TE9A 5DY2A 4TMCA 3ABRA 4O28A 5HNRA 1JULA 3BW4A 4GBUA 2R14A 3P81A 1VHCA 3MBFA 3WK3A 1JCMP 1OABA 1SSGA 3LV6A 3DKLA 1DQXA 4LS1A 5K9XA 3U8GA 1FX6A 3B0PA 2NXGA 3STGA 1J2WA 1LM1A 4WZHA 1LOQA 2RHGA 5U7SA 3W7JA 3P60A 1OFPA 2C1HA 2ABBA 4JX4A 4BWLC 4K39A 4JTTA 3W83A 2A7RA 5TQLA 3M1ZA 1H50A 3CU2A 3G1AA 3IRDA 1A5CA 1F74A 1RVGA 1FDYA 3W1QA 3W22A 4O15A 4JIQA 1OFEA 2Y88A 4TO8A 3TSBA 5AN7A 5LHEA 1LTDA 5G2WA 3WK1A 3EX3A 4BR1A 4CCCA 4IMEA 3QMRA 3W23A 3KOFA 4YCPA 3W6YA 4DEFA 1V5XA 1W54A 2G5WA 1R2RA 3NVTA 1QPQA 5LGZA 1SZGA 2CLKA 3W9ZA 3W75A 2J27A 1OHLA 5K9DA 2QCCA 2NLIA 2ZRWA 3DHDA 1YDOA 3NEVA 5I3FA 3INPA 4OHQA 3PULA 3W7RA 4MZ1A 1EA0A 3W1NA 1W5OA 1ICSA 1GJPA 1F6PA 2ZA2A 4NJGA 1H7PA 4IMGA 3RLUA 4LC6A 3C8FA 1OFDA 1LRQA 4IPIA 4AHPA 3TQKA 4IOTA 4ZQMA 2Y70A 3LCFA 5AC6A 3GKFA 1OFOA 3GDKA 2CLHA 3QW4B 4KWVA 4GUFA 3NQCA 3QQ0A 3L5AA 2RDUA 3RNDA 5KSWA 5D04C 3HIJA 5AFDA 5FF2A 5HWMA 5LNVA 5C55A 2XFWA 1SU5A 2J24A 2DZVA 1K7EA 3VE7A 2CZFA 3SFKA 5AYXA 1NAL1 4HT3A 1S5TA 4TX9A 2BXVA 3FJ6A 4BWLA 3OVRA 4Z1CA 3PS7A 1TTPA 5DY3A 3PG9A 2P0OA 2VFGA 4JTFA 4FXRA 3C4UA 1JCLA 3T4CA 1Q45A 1G67A 3K30A 2O7QA 2WJZA 4LT9A 4ZQPA 2FFCA 2ATMA 4JY8A 3QSRA 4NJIA 4IXXA 5CZ0A 2ZBTA 2ZRYA 2EF9A 2KZHA 3MHFA 1A50A 1K02A 3TAOA 3G1DA 3S5OA 1WQ5A 1FDJA 2DORA 1KM0A 3DFSA 4FIQA 2QF7A 3DH7A 3L65A 4L4LA 1GOXA 2JGQA 2XN2A 2QCMA 3LV5A 1KTBA 3QZEA 3CC1A 4JTLA 2Y7GA 2W6RA 3M9YA 2PRLA 4RV8A 1OF8A 3MYPA 1VGAA 3GDTA 1YLVA 3PC0A 2C13A 2UV8G 2Y6ZA 1XUZA 3B0VC 3TW7A 4RK8A 1FCBA 1QFEA 3GXPA 4N6FA 2J9ZA 3IVSA 2G96A 2QUUA 1Q6OA 2GUUA 5I3JA 3O6YX 4DXVA 3BW2A 1FWSA 3G3DA 5F4WA 3TMLA 1TIMA 4ADTA 5F4SA 5T26A 1TTIA 2A6LA 3NDOA 3PG8A 5L6UA 2GJLA 4DQWA 3VKJA 3DBPA 5AHEA 5AHIA 3W1AA 4NU7A 1OVDA 1OYAA 3EB2A 5LNWA 1SW7A 2VELA 1VLWA 3PF3A 2V2DA 2JKEA 4OBTA 3IIOA 3W2LA 1GZGA 1ICQA 2XN1A 3NQ8A 1DORA 3HF3A 3TK7A 1A53A 4R33A 3L67A 3E96A 4HIBA 2GQAA 3LI0A 3ZWSA 1UASA 2DZWA 3UWVA 1ZAHA 5DBUA 1IXPA 1DJQA 4UTWC 3SY5A 4WXZA 1VZWA 2VFEA 4N2YA 3S42A 1KFBA 1OFBA 3L0KA 4CCDA 5CZJA 1EP1A 1LORA 1MXSA 1C8VA 4YXGA 3S5YA 5D2XA 4O1CA 4Y6GA 3PAJA 3HPXA 3KAOA 1FCQA 1NF0A 1H1YA 4CNNA 1R2SA 3TCEA 3WJYA 3PBYA 1QMLA 1KV8A 2OCZA 2E77A 4DO6A 3O15A 4PEKA 3A24A 4GFSA 4RLIA 4HKPA 3EXSA 5D32A 1H61A 3I6RA 2B7PA 4DO4A 4O4WA 4MY1A 4JY9A 5EBUA 5G1YA 4Y9AA 3H54A 5G2IA 3SR7A 3SGUA 2W79A 5D2WA 2Z0IA 3OBKA 3TXZA 2JKPA 3PUEA 3LHYA 1XC4A 1S3HA 1QPOA 5BRBA 2FLIA 1QCWA 2E6FA 4IQLA 3RF9A 4QNWA 1K8ZA 1TB3A 4JTGA 4UFMA 5F4XA 1TTJA 5FF7A 4O14A 3E02A 3O06A 4QSHA 3UWUA 1XCFA 4K37A 2BX7A 4MJZA 4XWUA 3O63A 2LLEA 2YW4A 3LBMA 4ZVJA 1RV8A 3CIXA 4RZ6A 5FI8A 3PUDA 4LOCA 1X1OA 4KFPA 1OK4A 1EX5A 3SIZA 4AB4A 4RX0A 1ZENA 2C14A 1AW1A 3CWOX 4IMCA 2WNQA 1IXOA 2H6RA 2V0TA 3TQ0A 5DBTA 3W7LA 3M5VA 1W3TA 1TREA 3M47A 5IM51 3LXAA 4AEOA 3NYZA 1YXYA 2QAPA 5FF3A 4JXCA 3C2VA 3DU0A 3MP4A 3C3NA 1WOAA 3BK0A 4BI6A 2FTPA 3BLFA 1G7VA 3L0NA 5HJLA 2QR6A 2B7OA 4WXYA 3FFSA 1CX9A 4NZJA 5C54A 3S5NA 1WDWA 1AK5A 2ZZ6A 1GWJA 3TJXA 3C0JA 1X1ZA 1UBSA 2YSWA 3T7VA 2QCNA 3EWZA 3O1NA 3GXTA 2VEIA 1ME8A 4N6EA 1GVFA 4P2VA 5F1UA 2QEZA 3VNDA 2E5CA 4CQ8A 1JUEA 5FEZA 5HQEA 3IIZA 3M5YA 1JJKA 4TIMA 3NL3A 8TIMA 5D33A 3C2EA 3PY2A 1M5WA 4O1DA 4U28A 3IVUA 1YXDA 3USBA 1PV8A 2X1TA 2RDWA 3O16A 3QMSA 1YDNA 4RJEA 3W2MA 2HS8A 3ZFHA 3HPSA 1YDVA 1FWRA 3H55A 3M41A 2RKXA 1PCWA 4I7VA 1JUBA 4O0KA 4WOZA 2P1FA 2TYSA 4JD4A 5I3GA 3W7OA 4OE7A 2Y61A 3P62A 3STEA 4UTMA 5K9CA 2HSAA 3RMJA 3R12A 3P67A 4MY9A 2WKJA 1SUXA 1TMHA 1GYNA 3UWYA 4XTIA 3PBWA 4GUIA 3DGRA 4NNBA 1L6WA 1O94A 3Q94A 4ZQOA 4HNVA 2AAMA 2Z6JA 1YTEA 2PC4A 2ZA1A 3W1PA 4LVDA 4IWWA 1SR9A 4UC5A 4A21A 3VI2A 1FXPA 2OMAA 4BI7A 3GR8A 2X16A 3JS3A 3GAKA 2Q3OA 3TV8A 4GRSA 1VHNA 3HO8A 2GOUA 1WOBA 2NUXA 2E68A 3R89A 5G4WA 4JR5A 5DCEA 2NV1A 1ZALA 1ZJIA 2F84A 1RZMA 2YFNA 3BO9A 3W7MA 2QJHA 1TPC1 1IXNA 1OX6A 2VEKA 3W1UA 1AL7A 5C6MA 1Z42A 5KINA 3C52A 2BZNA 4RZ5A 1CI1A 4EIVA 4ML9A 1GTHA 3ELFA 1K8XA 2NV2A 5DCDA 4MKNA 5K3VA 6TIMA 5D30A 5AHFA 3QRHA 1SZFA 3W74A 3DAQA 2NXHA 1OX4A 4O8RA 1GTEA 3N3MA 3O05A 1H60A 2J88A 3N14A 1W3NA 4JYEA 3W85A 5FF0A 4RR4A 3N2XA 1T96A 4MFDA 4BF9A 4Y90A 4UIOA 2D73A 2ZZ4A 5CZTA 2E5BA 4O10A 1OFQA 4M6VA 3S1VA 3EX4A 3LHWA 2A7NA 5D02A 5K4ZA 3QJAA 2OZ0A 3B04A 3TH6A 3NAVA 1Z44A 1GQNA 3B06A 4O13A 4NVTA 4O57A 2ZZ5A 1FUYA 3L5MA 1JCYA 1QPRA 4Z1AA 5HWJA 1T99A 1XXXA 2Q8ZA 2QDHA 3S8HA 4H3DA 2JKAA 1T0OA 2AQWA 5K7JA 3P84A 4LU0A 4FX6M 3M5XA 4QQ3A 3BGGA 2YFOA 3M5ZA 3UPWA 2CU0A 5DXYA 5LNRA 4UTUA 1JCJA 1TJPA 3C2OA 3THAA 3OVQA 4AMAA 1TSIA 2IQTA 3I7SA 1KV5A 4MVAA 4KKXA 2G95A 3QPZA 5KZEA 1LP6A 5DN1A 2CZDA 2TSYA 4PL2A 1P1XA 2CFFA 3WJSA 1UJPA 4GJ1A 1LLZA 2R91A 5EMUA 1DQWA 3TJLA 2ZCGA 5CSSA 1B4EA 3QPYA 1H1ZA 5K4XA 4LVGA 3ZWTA 4JIPA 4AH7A 4WY0A 5LNSA 1YYAA 2ZYFA 1XI3A 3S6DA 4DF0A 2EHHA 3CEUA 1XDLA 1UUMA 4HSOA 5F2GA 5MHBA 3C2RA 1M6JA 1GVRA 2QCFA 1ALDA 3BPWA 1BEUA 2FIQA 1HO1A 3DFTA 1D9EA 3W84A 1DBTA 4A3UA 3C2FA 1H7NA 2A7PA 4O19A 1W31A 3N73A 4O0ZA 2A6NA 3HGJA 5AOUA 3W76A 4UTTA 3H53A 3NA8A 3OEXA 4LWWA 4JTSA 4K8HA 3NZRA 4MFEA 4UXDA 1JR1A 3VCRA 4HSNA 3LHZA 1XBVA 3B4UA 3WJWA 2GQ9A 4FX8A 3PB2A 3W7GA 3MO7A 5LZLA 1NFBA 3UWZA 3NQEA 3EX2A 1MO0A 2CLLA 2CLOA 2V5LA 3OHIA 2YZRA 4O1BA 5D37A 4N9EA 4HPJA 1MEHA 4I7WA 4WOQA 3S9YA 3TU9A 2B7QA 4CLMA 2H3DA 4H4IA 1FWNA 3NPUA 2ZRVA 2X1RA 4FNSA 1RR2A 4ICNA 3C56A 1BWKA 1L2UA 4OV4A 2VFIA 4QJ1A 1BTMA 4WUIA 1TQXA 3EX1A 1OX5A 4Z1DA 3TXVA 4XZ9A 4EWND 3MJYA 4GXMA 1C9DA 1B57A 3W1MA 3GIYA 3MMTA 2QJGA 1O95A 1FWWA 1K8YA 4DF2A 1L6YA 5A5WA 2OT1A 4HNUA 1O5XA 4JTUA 3STCA 2B0MA 3QW3A 3I7QA 3W1RA 1PE1A 1R2TA 2DZPA 2X30A 4Z1BA 1IGSA 3W87A 3W7EA 1EEPA 3GZ3A 5AC7A 5AC8A 1RPXA 2Z6IA 1PHQA 1AW2A 1X8FA 1OYCA 1H7XA 3UPBA 4LS0A 4LVBA 2ZRZA 2JK2A 5DELA 2A2IA 3BG5A 2HTMA 5CPLA 1W5QA 2A0NA 4KWWA 5CPNA 1KFJA 5D05A 3D0CA 4O52A 5EKYA 2X2GA 1LBLA 5TBOA 5HINA 3L5LA 3HGRA 1ME7A 3GK0A 3NPWA 3KVKA 2E09A 3CHVA 4RKAA 1LDCA 1O60A 5BW6A 4OU1A 4PFMA 2ISWA 4DPPA 4JX6A 3BVJA 2YYTA 3GKAA 4Z0JA 3W1TA 1KBJA 3IGUA 3GVGA 2V81A 4G1KA 3NQFA 3NQVA 2YW3A 1F5ZA 3KHJA 1NVMA 1PIIA 4M19A 4L4MA 2DZUA 1S5VA 3SW6A 1TPFA 4LVFA 1TO3A 4FNTA 4JTIA 2H90A 3DKJA 1OFAA 3PUOA 3LXCA 1XKYA 5F2LA 5FEPA 2DZSA 1A5AA 3QEZA 3A22A 4R34A 3P61A 4FHAA 1V7YA 4AVFA 1XUUA 2YX0A 3NL6A 2A85A 3LI1A 3TDFA 1YTKA 4LRTA 1LBFA 3MI2A 4XUGA 1QNVA 1WXJA 1G69A 5GVJA 3Q2DA 4C1KA 1SW0A 1ONRA 1X6UA 1HUVA 1GVQA 1JUKA 1KM2A 4JS3A 3NPVA 4FB7A 3TMQA 3RU6A 3W1XA 1F73A 2RDTA 3W2KA 4O12A 1LOLA 4HHPA 4YWIA 4A2RA 4MLJA 3HG5A 1I8JA 5BNKA 2QKFA 2QCDA 4AWSA 2XN0A 4WD0A 2CZEA 1LBMA 4POCA 5E1QA 2C19A 4LUJA 4QITA 2ZTJA 2GPTA 1TV7A 2CWNA 2O7SA 3KX6A 2NUWA 3TAKA 3LRMA 2EKCA 4OWGA 2WV8A 4UFKA 4EF8A 2ZZ2A 4O17A 2C3ZA 2ZA3A 4E38A 1B9BA 1P4CA 2QUTA 4D2JA 2H8ZA
chains in the Genus database with same CATH superfamily
3T0AA 2I5QA 2W66A 3H2NA 2NZLA 3HG2A 2YL8A 4QRNA 2V69A 2VNCA 1HP4A 1UIOA 2DP3A 1PVNA 1LOSA 3WD4A 3Q37A 5FL0A 4F2BA 3ZLGA 1XRVA 4GC4A 3RJXA 1BQGA 2QVHA 3LA4A 4XZNX 3AWNA 3L4ZA 1QWGA 3GTNA 4WDXA 1HL9A 1DHPA 2G0WA 4H01A 4U10A 1B3OA 4UTIA 2PRHA 3A4JA 4K36A 2CC0A 4O53A 4B3LA 2FB2A 2WVVA 1V02E 3CV7A 1RQEA 4MYAA 4NQ1A 5M1TA 4HZMA 5EPDA 3ISIX 3QFEA 1M7OA 5XIMA 3AHYA 1UKSA 2HCVA 2Q3RA 4IX2A 5JBEA 4DBDA 1OG0A 1NY1A 5C0QA 1XSJA 5AHMA 3ITYA 3KTCA 2WHJA 4WSKA 4H83A 4KWOA 2W62A 2ZQ0A 1VBJA 3QGVA 3IJQA 3T81A 1HFBA 3VIMA 1B2YA 2YLAA 3UXKA 2QGYA 2WM1A 2QCGA 4L6OA 1NDYA 3ZVIA 3CAVA 2W4XA 3DI0A 3W53A 3UJRA 4B5SA 1NARA 3PZNA 1ICPA 2V63A 3UNDA 4LY4A 3E6EA 4GZIA 3GWQA 5FESA 1VYPX 1IQ8A 1P0DA 4ZO6A 1JAKA 4F0RA 3V1HA 3LTSA 4J2MA 1P6WA 3ZZ1A 2ACQA 3MYOA 3GW0A 4GNVA 3MUAA 1J2BA 1KO0A 5IBXC 1EGMA 1D3HA 4DWDA 1E9ZB 2PDNA 4NRRA 1IXQA 3MUXA 4KH2A 2V5BA 3FLUA 3GG0A 4QQUA 3WQPA 3OA5A 1MXDA 2PB1A 4M1RA 1P0BA 1W37A 5ENLA 1XYCA 3F5KA 5AC4A 1SO6A 1RD6A 3MCOA 2DDXA 3P8IA 2NW0A 2NXIA 5KTLA 2WC3A 2WZEA 4EANA 3HM7A 3ABOA 3BAXA 5HA7A 3E74A 3QC0A 1I2NA 4W8LA 1RUSA 1BYDA 4ALDA 3WLKX 1FWTA 3TYCA 1U22A 3GXDA 3TN4A 3P5YA 6ALDA 2WAGA 5I77A 1W3IA 1UH2A 3WQGA 4PUWA 1NEYA 1U5JA 4ZQRA 4V27A 1PL9A 2PS2A 2WNZA 1VJSA 3IIXA 1LWJA 3FYPA 3MDWA 4QS5A 4H8NA 1QK2A 1XP3A 1AL8A 3F4WA 5AHNA 4X0VA 1ZZMA 2INFA 3FS2A 1F8IA 1MDLA 5DMLA 4Q33A 1QPNA 4Q8UA 3GC5A 1MRAA 3WNNA 2O0TA 2CNCA 3M7WA 1LWHA 3HGSA 3SZ8A 3RYSA 3VYLA 1NJJA 2ZWZA 1JRBA 2Z1SA 3EKZA 4JTKA 1VRDA 3SRHA 4YLWA 2NQHA 1V6WA 4DWSA 3WMBA 2VD9A 2TMDA 4MDOA 4O11A 4F4RA 3PAOA 2ATSA 2EXOA 3DC8A 5IBXA 3URQA 4H6KA 1KLZA 3T4WA 1PJ9A 5GNXA 2GJXB 4H19A 4MWAB 2J78A 3S6OA 4F79A 3VGFA 4NNCA 2EKGA 3ECQA 2BY1A 4JNZA 2R24A 3IJ8A 3UZWA 3RLGA 3BG3A 2P88A 3UPMA 1EBHA 5EL1A 1O1HA 1GPFA 4DJFD 1TJRA 2VRKA 2OX1A 2F6KA 2YB1A 3HPAA 4MB3A 1OINA 4ORIA 1ZAJA 1WBHA 4Q4MA 1QDSA 4S1FA 2EAWA 3PSWA 3DXIA 3B8SA 1M03A 3NQAA 1AZ2A 1EBGA 1Z3NA 3SM0A 3KVJA 3OG3A 3A5VA 4WHBA 1C8YA 2WMKA 1NWTA 3FJNA 3WUBA 3AXIA 3L4XA 5CPOA 5PTDA 2EBNA 5U4NA 1DWGM 2VR5A 4A22A 1VEPA 2BLEA 1X8CA 3V3WA 1KR0A 1T5AA 2C91A 1I2RA 4OV9A 3TFXA 4LAOA 3TOYA 5F2MA 3DHFA 3NURA 3AO0A 4DBEA 3KRSA 3CV6A 1GG1A 3M43A 4EOUA 3OVPA 3N6HA 3EEZA 4AYGA 1Y5XA 3PBVA 3BZGA 1XFCA 4J2PA 3ZJ7A 1ISZA 1OX4B 5BXRA 2ZUUA 3PBGA 5J5DA 1CXEA 2OYLA 4EX4A 4A35A 1YQ2A 5CC5A 2WMIB 2YCEA 3KM8A 4IGSA 3U2OA 3TYZA 2YDQA 2E6AA 4XQ6A 3U7VA 3VMNA 2WJEA 2VX6A 3AS3A 5D8ZA 5EY5A 3ES7A 3QR3A 2ZOXA 3WMCA 4DWSB 3E0IA 2X2YA 1TQJA 1XYAA 3MHUA 4J3TA 3WH8A 4OBSA 2J9YA 1EXBA 4CKQA 4LXFA 4Q8OA 3G18A 3WDPP 1E4NA 1TV5A 3VABA 1W32A 1UOZA 1RQBA 1NF7A 4ZB2A 3GDLA 1I60A 3TN5A 4W7UA 4XKYA 3FIGA 3F4CA 3S1WA 5E9XA 2X1SA 4WK9A 2YCLB 1XLMA 3N04A 4UZUA 3CH9A 3G22A 2WPBA 1CLVA 3MHGA 3MVTA 4EP8C 4S2CA 5BWAA 4WY0F 1E6ZA 4HHMA 4QNEA 3IGSA 1KM1A 2QHAA 3FA3A 1J6OA 1OG6A 4HOWA 5A8MA 3A12A 2OQLA 9XIMA 1XM3A 4UFIA 3W7QA 4AVOA 1EF3A 3VNMA 3P6LA 4J9JA 4WY0B 4LYPA 3V0SA 4JDYA 3LX9A 4LCQA 1UZHA 4RE2A 5AZ0A 4IIEA 1A5BA 1GOQA 2Y5JA 3MCMA 1MQRA 1OZQA 2CKSA 3ARQA 4YIWA 4PUJA 3W6MA 5I00A 4DY1A 4S38A 3LLXA 1FBAA 3CZGA 2R8WA 4URIA 4JEJA 2WSPA 3K1GA 5D2TA 3EKGA 3UWEA 4Y2WA 4DUVA 5CKSA 1TA3B 4HA3A 3PWAA 3AHZA 3W7HA 3JUGA 3F4DA 3BAJA 3LU2A 4LVAA 2FMNA 2E6DA 3ME3A 4XISA 4GIRA 4K1GA 1ZAIA 3WYZA 3GR4A 1EJXC 2YCJA 1FH9A 3UY7A 1BWLA 3T8LA 5C7VA 1GEHA 3SCRA 4ZZ9A 1UCWA 3LDVA 3VAVA 3HFYA 4G7FA 3DECA 4Q7BA 2X0YA 3I10A 2NX1A 4HNTA 2OZTA 1XISA 4H9UA 3FCPA 2WCSA 1P48A 2ON3A 3AFBA 1SO5A 4PUDA 3LQLA 2R1PA 4KBXA 3RX2A 1GKRA 4V1YA 1LLWA 3DYMA 3QVQA 5DEZA 3TX9A 4D8AA 4IIBA 2PC8A 1FKXA 1TPB1 1OCBA 2I1OA 2YR1A 1ITQA 5EGRA 4JIRA 3RFAA 5T8GA 1PCKA 4XKYB 2OT0A 3ES8A 1UKTA 3B9NA 4KRUA 1XLEA 5C70A 1JVNA 5EA9A 1K9EA 1SPQA 1RALA 3W2NA 3BAWA 3THCA 1EJRC 1FTXA 1K77A 3MI6A 4JQ1A 4JN6A 1BF6A 4Z08A 1WCGA 1QOQA 2VO5A 2Q02A 4JQ2A 1WX0A 1UWIA 5I3IA 3UG8A 4I7UA 1R3WA 1OK6A 3CL6A 2A1YA 2BXZA 4BCEA 4UTHA 2FGZA 1UKQA 4Q4OA 4JQAA 1MRQA 4LUSB 2XH4A 2HQAA 4GINA 4HA0A 5D03A 3SUUA 3WQDA 4LC8A 1AJZA 5DANA 2R1KA 3UJFA 1TPVA 4DM2A 4NAEB 1DJYA 5FOOA 4ZBCA 4ORMA 4M7TA 2X7VA 4P61A 3F03K 3B0YA 3W2UA 4CCZA 3W25A 1ME9A 1V8EA 3UD6A 5C9WA 3QGAC 3TCSA 1QHOA 3H4XA 4PBEA 1YPIA 4LUYA 1TPH1 3M7SA 2PURA 3I68A 3H2CA 4P5UA 3FSTA 4M5PA 4P7QA 1QNQA 2OXNA 2E9BA 5ABHA 2WSKA 1M9HA 4XO6A 3R2GA 3TLLA 1VPXA 2I9UA 1DVJA 1ZJHA 3G24A 2ISVA 1SZNA 1XIIA 3TN3A 1FCVA 3BLLA 3KBVA 4GNKB 5GPRA 2ZIDA 2NLYA 2AQVA 3VX0A 4M3PA 9CGTA 3VIIA 3EMQA 4I6VA 1E55A 3SSJA 3PM6A 1PHWA 3ABSA 5HATA 4QM1A 2VR4A 2PDYA 1IR2A 3APYA 4UOJA 4WRHA 5MKGA 4CQCA 4DLFA 1JCXA 3E2SA 3Q65A 1JYXA 3NNTA 2OSXA 4JQ4A 1RP9A 3TP4A 5A6AA 2FH8A 3M0HA 5M3WA 4Z0SA 4KIRA 5HMDA 3ARYA 4GLEA 1A3HA 4AG0A 4BF5A 3EA3A 7TIMA 3LNMA 4UBPC 3EOUA 1V6VA 4NAFB 4G9PA 4H9YA 4NZFA 1HIZA 3SN1A 4XZMX 1DTUA 2J6XA 1KM3A 3TWBA 5D2YA 4I9AA 1OT1A 3U2CA 5DXXA 5GNZA 1UZ1A 5I09A 1DPMA 1OQFA 3N4AA 4YPJA 4S3KA 5FA5A 1NU5A 2DVTA 3T0DA 2PDQA 1TPDA 2E0PA 1P0KA 2YXXA 4D6FA 2FGBA 2FQIA 4JHZA 4D8ZA 3EA1A 5IFTA 2ACSA 1TX0A 4PMQA 1XBZA 2WQPA 4Q6JA 3FNDA 3ZJ6A 4O0QA 1NWUA 3TQVA 2C0AA 1F4HA 4BQ3A 1S2AA 4K3ZA 4KWUA 5FD0A 1FRBA 3H8AA 1JZ5A 1E51A 2XDFA 2ZDRA 3RK8A 3LCIA 4IJCA 4GGHA 4DIAA 1M68A 1OJXA 4O18A 4N4QA 5CH9A 3GNXA 1Y5VA 3TW6A 1MI3A 3HMJG 4MNMA 2GWNA 4QDMA 5LGXA 3JR2A 3MANA 4C5YA 5LKYA 4LYKA 3V0UA 1UH3A 4FNPA 4IXHA 4WX2A 3NQDA 4E4FA 2Z7GA 5H6HA 4B5NA 3R5EA 4JN8A 4PMVA 2VGGA 4N9BA 3SY1A 2QUVA 3NR0A 2WC4A 2V5CA 4YHEA 3UYCA 3CPUA 1E6RA 1VFUA 3QV8A 3NPXA 2Q09A 3UY8A 4CCEA 3OG2A 3LM7A 5BYWA 5MKGB 4C60A 1XDMA 3P82A 3ATYA 1H62A 1N7KA 3SFWA 4NXSA 2WANA 3NSXA 1TV2A 2FPTA 2Y89A 3CUHA 3GE7A 5DMYA 4FA3A 2GVGA 3VGHA 1BPLB 3VOJA 3WQ6A 1NDVA 4G6CA 3LLFA 2PWHA 3PFRA 3TE9A 4W7WA 4MPKA 2J7BA 1E4IA 3S5SA 3BW4A 3HV9A 3JW7A 1X39A 2JF7A 3P81A 3BZJA 3F2BA 4CVUA 1OEPA 3LV6A 2YA0A 3AUOA 2F6UA 4UB9A 3B0PA 1TMQA 1TZZA 2FVKA 4WZHA 1LOQA 5CGTA 3P60A 2O92A 2VGBA 3FEQA 3K46A 2VDHA 4CN6A 2GL5A 2A7RA 2VZUA 4E3VA 1XH2A 3OGRA 1S38A 1UROA 1MDRA 3OVGA 4X2PA 3W1QA 1X6NA 4JTCA 1OFEA 1QNSA 3EOLA 4OBRA 3UFYA 4FK9A 3WH7A 5AN7A 4IICA 3WK1A 1G1YA 2WYSA 3EX3A 4UQDA 1U30A 1N82A 4IMEA 5CC7A 3MKVA 1WXYA 4DEFA 1XIFA 2WW5A 3NZPA 4MNJA 4OECA 1W54A 2G5WA 3UU0A 1R2RA 3RMEA 1QPQA 1WP6A 1POJA 1BVNP 1SZGA 1YBQB 4YTRA 3W9ZA 1W9XA 2VC5A 4WKAA 4IF2A 1LUCB 2VCAA 2ZRWA 2J7EA 3DHDA 1YDOA 1R3QA 5HDRA 3INPA 4OHQA 3VDHA 2C1IA 3LN3A 3PULA 3CQHA 4LUTA 4Y9MA 4FLOA 4MZ1A 1BWVA 1FWFC 2PODA 3KDOA 3O6AA 4W88A 4REQB 2R82A 1F6PA 4NJGA 1H7PA 4XBJA 2WVTA 1BLIA 1SYTA 3C8FA 5HOSA 4KCUA 1A5KC 4Z2LA 4PMOA 5EBAA 3WH6A 1J0ZA 2VX4A 2Y70A 1OFOA 3W38A 4KWVA 2D2JA 3K2GA 2RDUA 5D04C 3HIJA 1LQ0A 5AFDA 5FF2A 3WQ8A 3BJFA 1JL8A 4QE5A 2J24A 4DYEA 3VE7A 5A3HA 3WMSA 7PTDA 1UD4A 2R1MA 5DO8A 2PLJA 5AYXA 1C3FA 1J79A 2QUNA 4HT3A 5FSEC 2BXVA 2ZVRA 3LK6A 2JALA 1RLDA 4FXRA 2JEPA 3M0YA 4AZHA 1JCLA 2HE5A 3K30A 5A2BA 4V33A 1M65A 3CHCA 3K1DA 4WSJA 5ABFB 1K4HA 2KZHA 1A50A 1IWPA 1K02A 1ZU8A 3UA3A 1LQAA 2BGNE 3OZPA 3QR0A 3G1DA 1TWZA 4ZO8A 2OG9A 3GTIA 1EIBA 2DORA 1KM0A 3DFSA 3VDBA 3L65A 1B0IA 4H7VA 1KTBA 3QZEA 5LIXX 2D22A 3PWGA 1UP0A 3N1AA 3GHUA 3ARZA 7A3HA 3AS1A 1K8CA 3UT0A 1YLVA 3PTDA 1UD5A 1DHKA 3PC0A 2UV8G 2W3ZA 4WDUA 2Y6ZA 5TAOA 3TW7A 1YX1A 2BVTA 3MB9A 2R6OA 3CMJA 2BNJA 1P7TB 2G96A 2QUUA 3GTFA 1UC4A 5A1AA 1TIMA 4ADTA 3E2VA 5T26A 1TTIA 2EEXA 3NDOA 4Q22A 2GJLA 1Z6KA 3DBPA 1ZP4A 4NYYA 4KRZA 4NU7A 2OLSA 2ZE3A 1SW7A 1VLWA 3WBEA 1ZBCA 3IIOA 5FSDC 3RGTA 3W2LA 4MF4A 2PGFA 4A8LA 2EPKX 1R38A 2EJAA 2QV4A 2H9AA 2YB4A 3C3UA 3WFLA 1UR4A 4GO8A 2PWUA 2Q01A 2V6AA 2XVGA 1ZAHA 2HROA 3CUXA 1TJ0A 3V16A 2HK1A 1QHZA 1KFBA 1P6BA 3L0KA 1FFQA 4DRSA 3WBAA 1EP1A 3IAQA 2WVSA 1Y65A 3UGVA 3KAOA 1PPIA 1JPDX 3TCEA 1O7AA 1KV8A 2E77A 4PEKA 5D9NA 3A24A 2V38A 4AXNA 5T9BG 4XKMA 4HKPA 3JU2A 3WG6A 2DT2A 1H61A 4AZ5A 2B7PA 4DO4A 4QAWA 4GOAA 3OBKA 3PUEA 1GVIA 4IPLA 1S3HA 3EDKA 2FLIA 1S5NA 1XW8A 2EQDA 3R58A 3WNKA 4QNWA 4JTGA 5F4XA 3UWUA 1XCFA 2BX7A 1XCWA 3CLWA 2FTYA 3WBXA 3LBMA 2PU0A 4ZVJA 1RV8A 4D1IA 2PDBA 5A6BA 4OFCA 4LOCA 1JYVA 4TVDA 3V18A 3DFHA 2CYGA 2C14A 1AW1A 3W26A 2UBPC 2H6RA 4S3EA 5BCAA 3W0KA 1W3TA 4RE0A 2QMJA 1D7KA 3UVAA 4GZ7A 1GW1A 4AEOA 5FF3A 4JXCA 3C3NA 2D0GA 1E73M 2FTPA 1UHVA 2GJRA 3CUIA 1CX9A 1GKQA 4FOJA 2J13A 1AK5A 5G1MA 1KNWA 5FIPA 1UBSA 6REQA 3VNYA 1XSIA 2PDCA 1GVFA 1JUEA 4P8UA 4RW5A 3VGBA 1MXGA 8TIMA 2VHLA 1PTAA 1NOWA 2PPGA 3IVUA 1CXHA 3USBA 3GHSA 2X1TA 1CGXA 2RDWA 3QMSA 4XZWA 2HS8A 3HPSA 3M41A 1JUBA 2TYSA 3WDQA 4JD4A 5I3GA 3VKBA 1EGZA 3STEA 2HSAA 4MB5A 4E8CA 2ISDA 4U5IA 3H23A 1VFTA 4JIIX 4NNBA 4PE8A 4Q4RA 4ZQOA 2FDMA 2IKJA 1UZDA 2ZA1A 1XCXA 3KBWA 3VO0A 1UA3A 1HXJA 4C1NA 1SR9A 4DJFC 4KW2A 3VI2A 2OMAA 1J01A 1R7OA 3HN3A 1QI3A 1TELA 4LALA 1WOBA 3R89A 1E3ZA 2NV1A 3VK5A 1E71M 1YE4A 4D71A 1RZMA 3WLRA 3BO9A 3W7MA 1TPC1 5DT7A 1XG3A 2AL2B 5C6MA 5KINA 2BVYA 1CI1A 3RPTA 4ML9A 4ZODA 1ONWA 1K8XA 6TIMA 5D30A 5B80A 5AHFA 1KBLA 1EXPA 3DAQA 1DWAM 4JTAA 3OW1A 3W85A 5FF0A 1KRBC 1VFMA 2FHCA 1A5NC 4BF9A 1XIDA 1PDYA 1POKA 4O10A 2NQ5A 4M6VA 3S1VA 1XLLA 3I4EA 3L7RA 3QJAA 1TG7A 4JFVA 5J8LA 4HZ7A 4ZGYA 5LIYX 5HWJA 1H41A 2IQDA 4IGNA 1WDQA 1XXXA 2Q8ZA 4BF7A 3QOKA 1NP2A 1JZ3A 1T0OA 2AQWA 6REQB 3M0VA 4FX6M 4LU0A 3RCNA 3BGGA 4QDPA 1DJGA 1HF6A 1OC5A 2YFOA 4UOQA 2J7CA 4NHVA 5DXYA 3PTKA 1ZQ5A 2HDJA 4GABA 3OVQA 4Y8EA 4AMAA 4RPQA 1C7SA 2OKTA 3LSCA 2Z25A 5JBDA 3KCJA 1GCYA 2TSYA 4D6GA 3ZVHB 2R91A 1YW1A 3TJLA 4L64A 5CG0A 3VZXA 4E5TA 2CLPA 5I7GA 4AX7A 2J4GA 2XVKA 4AH7A 5AZ1A 4HMEA 2EHHA 5E6YA 4C1NB 1M53A 3B8VA 1GVRA 4Y9NA 4HTBA 2CITA 2FIQA 1U1UA 1HO1A 3W84A 1DBTA 4OTKA 2A7PA 2IPJA 2YJQA 3N73A 4NG3A 3W76A 5LIWX 3NA8A 3OEXA 4LWWA 2E8YA 1JR1A 1CGWA 1HNYA 3LHZA 3AXKA 2CXGA 3IANA 2FVLA 2G3MA 4WGXA 3WBWA 1L0PA 2FYMA 2YCIX 4RV3A 3MO7A 5LZLA 1EQPA 1NFBA 4CUCA 4RDZA 1EDGA 1HKMA 3EX2A 5DMNA 2CLOA 1ZS2A 4IIHA 3S9YA 3TU9A 1KR1A 4CLMA 2CBIA 3EMCA 2ZRVA 1EYEA 4ICNA 5A6KA 4JFUA 2WHKA 1OSEA 2CPUA 1BTMA 2PWDA 2G4FA 1TQXA 3EX1A 2IKGA 3HFTA 1C9DA 2ASHA 2NVAA 1C8QA 3W1MA 3QFWA 4IM4A 4J3XA 1V0KA 4HBKA 1BYAA 1L6YA 2NQ9A 2ZUSA 4CEXC 1O5XA 3MPGA 4GK8A 4JTUA 4LEQA 3CJPA 4FS9A 2B0MA 3MUCA 3I7QA 1JDFA 3W1RA 1R2TA 4Z1BA 1XIBA 1UPPA 3GZ3A 5AC7A 4Q8VA 1PHQA 1OYCA 1CYGA 3WIJA 3N6QA 4LS0A 1TUXA 4QG8A 2ZRZA 2JK2A 3U4FA 3BG5A 2HTMA 3FXYA 5CPLA 1W5QA 3D0CA 5EKYA 3W37A 2J79A 3SCWA 5AVHA 4V2XA 5CLTA 3BH4A 4RKAA 1LDCA 1BXBA 1FVPA 1O60A 5CSUA 1DYSA 1QBBA 4OU1A 2ISWA 2PDIA 1XYBA 4KT2A 4UCFA 3VNIA 2YYTA 3AIBA 1RBAA 3T2QA 1E1CA 2W91A 1T7LA 1WDRA 4G1KA 3EYPA 2YW3A 3KHJA 4QLKA 3VM7A 1RY8A 1PIIA 4M19A 2HXUA 1PIFA 2VC7A 3NO3A 2OEKA 3SW6A 4AEEA 3S83A 3OLEA 2PDMA 4HOXA 4JTIA 4L9XA 4NILA 1XKYA 5FEPA 2DZSA 4DHGA 2J7FA 1IZJA 4R34A 4AZCA 3POCA 5CSYA 2AKZA 3TDFA 1YTKA 4A8RA 1QNVA 1WXJA 1XQLA 3Q2DA 4PRRA 1QRQA 4C1KA 1BVWA 4X60A 1ONRA 3P0XA 3V5FA 2INZA 1EX1A 1GVQA 5CBJA 1KM2A 3KP0A 3T42A 3WF2A 4C6BA 4JS3A 2XWDA 3CYVA 3II1A 1F73A 2RDTA 3DG6A 3ZM8A 2A3HA 1A3XA 4XZIA 4HHPA 3UERA 3HG5A 1I8JA 5BNKA 5XINA 1EH9A 2QKFA 1WZLA 2CZEA 4CD4A 4XUYA 1KC7A 1HT6A 3U7BA 4GXWA 2NUWA 3QZAA 4D6HA 2ZZ2A 2C3ZA 3T09A 1P4CA 3KBSA 4D2JA 1ZSXA 3TKFA 4C90A 1SW3A 2F2HA 1L9WA 3BGJA 3CHEA 3ITOA 2EG6A 2A3AA 4C6DA 1S5WA 1US0A 4GI9A 4R7JA 3GVQA 1HTIA 3L68A 1ELSA 2I5IA 1LT7A 3ANYA 2FJKA 1WZMA 3RJYA 4WIWA 4IP4A 1O68A 2VI0A 4ZR8A 5FEWA 4TUFA 1WPCA 4Q4SA 4A29A 5F2IA 5FAGA 2YL5A 2ZX5A 1JNDA 3ZLFA 3QC3A 4H8VA 1CIUA 3S0CA 4IP7A 2OLAA 2HMCA 4ATDA 4NZ4A 1BSLA 4HZ8A 4DUXA 1XBXA 2PD9A 1IZCA 4W8AA 4PUNA 4Q6XA 5CZSA 3L21A 1OF6A 3T55A 3Q58A 1DEDA 2A79A 1PEZA 1KCLA 1PO9A 3QTPA 3BWWA 5CG7A 1T8XA 1JXJA 2QPSA 1R9ZA 3E12A 4Y96A 4P8WA 2WPGA 4AZCB 2PP1A 4MIMA 4UTWA 5KITA 3PJWA 3GUGA 4H04A 1R30A 1LYXA 1I0DA 2W9MA 2DT0A 3D46A 4U31A 1NQ6A 2PDKA 4IMAA 3WENA 3W00A 1IEXA 1KM6A 4PRTA 5EMYA 4B3KA 3FHAA 1XKJA 3C8NA 2O9OA 4Q4KA 1R3TA 2ZXBA 4WJXA 1QOPA 4PUEA 2Z1WA 1JRCA 1PDZA 3S6TA 2AGTA 4CU6A 3OBAA 1KA9F 4PMZA 3EWYA 3DFNA 1DIKA 3B05A 3LTPA 1YEYA 4CQBA 5AVNA 3VM5A 5IFPA 3I65A 4EAYA 4CGTA 3D3AA 4GY0A 3HQ1A 2BHZA 3L2IA 1AJ2A 1C93A 1IF2A 2RH9A 4HD5A 1T40A 4LRSA 2R9RA 3R94A 4AWTA 3NZGA 2YA2A 1SO4A 3WLOA 2GDUA 4WF7A 2DIEA 3IVTA 4QIUA 1DIDA 1ZB5A 2PI6A 4M6PA 3BSMA 3BXWA 5G2HA 2XFRA 4F9DA 1ZNNA 4GUGA 1MW2A 2BSLA 3E0LA 2QQ6A 3MMDA 2PBGA 3OZYA 3SQSA 1BFNA 2QCLA 4EXBA 1NOFA 1VCVA 3VOGA 3UCDA 3WK2A 5AHLA 3WUGA 4I9MA 2CZVA 4O1AA 1WUFA 3HV8A 3MCNA 3G1XA 4B90A 8A3HA 1Y8BA 1HO4A 3P3BA 3SI9A 4E2VA 1VCFA 2QJIA 1XYFA 1EUNA 3CQJA 1H63A 3N12A 1K03A 1KGWA 1GOKA 1SO3A 3S46A 5H8UA 4F9JA 4LW7A 3IAPA 3K8LA 2WOQA 3WZ0E 2VC9A 2Y8KA 1Q6CA 3GG8A 8RUCA 2NWRA 2DSZA 1ZHAA 1N55A 2E5DA 3W6LA 5HUOA 3QLLA 3WY1A 3L4WA 5D8WA 4MADA 4DZ5A 4IQJA 5HAOA 1XL9A 1QAPA 3UCCA 4IPNB 2JBMA 4D72A 3URBA 2WXDM 1N8IA 2Z28A 1JCNA 3WK0A 3GDMA 2VQTA 3BARA 1LG1A 3W70A 4FR1A 1A3WA 3O0KA 5BWFA 2XVPA 4KEZA 4CU8A 3O6CA 5FJIA 1YE6A 4ECLA 2ALRA 3W72A 1W1ZA 2BTMA 3AMLA 1WZKA 4XTDA 4PRWA 1QR7A 3GC2A 1M04A 4AAJA 3FGCB 4LCSA 4LYRA 2MUCA 4DZHA 3C5QA 2QUMA 4JTJA 3CLMA 1VCGA 1QASA 4XVDA 1F61A 1DE5A 2DJLA 2YIHA 4ICMA 4ONVA 4K7VA 4A8NA 2NV9A 4CEUC 2Z2AA 1XLKA 1UJQA 3THQA 4V15A 2Y63A 4IUOA 4FZIA 3NO5A 2P3ZA 2QCEA 2PTZA 1G6CA 5H1WA 1IIGA 2TRSA 2OWWA 4FF7A 2HNHA 1VBGA 1A0EA 4MLRA 1HVQA 4W8BA 4FMVA 5C5YA 3KOXA 4I6KA 2I14A 1F6YA 2KX9A 2NVCA 4YCOA 4GH3A 2GVJA 2XIOA 3KRUA 1RBLA 4N4PA 4HPGA 1UBPC 1W2PA 4MZYA 2BG5A 3GTXA 1BVZA 1W5NA 4JPGA 5I02A 2GZXA 1MQPA 2EJ1A 3ZJKA 4HK6A 1Q6LA 1W2VA 3STFA 1VQTA 3BMVA 3UR5A 4AZ7A 1KQYA 2O55A 3P7YA 3NZQA 3HB9A 1XLBA 1A5LC 4QJ3B 2HVNA 3E5PA 4MMWA 2Z4GA 3Q45A 1TV8A 2WSRA 5HULA 1OGBA 3GR7A 5CPMA 2Y7DA 3KXQA 4PTNA 4HYWA 3RLVA 5A8PA 2D3NA 3EBVA 1GPWA 1V79A 4DX3A 3CTTA 2DGAA 1A5UA 3MWAA 3VXGA 4M6QA 3IRSA 2V9DA 3HGOA 4HU3A 1G01A 1XIMA 4UQBA 1K7XA 2YDRA 1D8WA 4DBSA 5HUPA 1GUVA 1E0VA 3TZNA 1VJZA 2V5KA 3G1HA 1TVPA 5A94A 4UFLA 3UGRA 1F4AA 3NQMA 1XF0A 2YL6A 3KZPA 2PDWA 3LRKA 1UD2A 3S2LA 3W7DA 4TQTA 2E1DA 2C0HA 1ODUA 1L6FA 4BEQA 3AYTA 1S2CA 3DGBA 2GUYA 1XICA 4IJBA 4AIEA 1IEWA 1VLIA 1S5MA 3N2BA 3NEHA 4E4UA 2BMBA 4FXJA 4J3SA 3U3HA 3RUBL 1TUFA 2QYGA 2OSYA 1SGJA 1JQVA 4PMXA 1JCTA 3W7PA 1VEOA 1AG1O 1UR2A 5HWNA 5AYZA 4ACZA 2I57A 3A4AA 4I5XA 4FO4A 1MZRA 1O66A 1CPUA 1TPEA 2BBFA 2ZZ1A 1WE5A 3S5ZA 3UBPC 2QJJA 4L1WA 2Z2UA 2Q8XA 4W84A 2BB0A 1RXOB 4UR7A 2V82A 3FJ4A 1ADSA 1XX1A 5AB3A 3EXTA 2E9LA 1Z41A 1T6MA 4QAIA 3BLKA 2O4MA 5DF0A 5BXSA 3VD9A 3VKCA 4DI9A 1DWJM 4K1WA 1X7IA 3UW6A 2ZADA 4NJJA 2YXGA 4PB5A 4EWJA 2GJNA 2E25A 1TPWA 3AMGA 4XAYA 3T2PA 3BOLA 4CD5A 3WJZA 1XGDA 2NX9A 4AHOA 3WF3A 4PFHA 5AYYA 2VL4A 3AC0A 4EE9A 4GH1A 4IFOA 4DXKA 2IQ0A 1TRDA 2G41A 1PX3A 5DFAA 3OPSA 3O07A 2FGLA 1R46A 4J3WA 5A8GA 5CC3A 1I45A 3HQOA 3AROA 2OVLA 5C71A 3SCQA 4AVNA 1UR0A 3LPGA 1E0TA 2GVEA 4AEFA 4C6MA 5KZ6A 4IFKB 1QPKA 1LROA 2BFGA 2G37A 3ARTA 5HANA 2ZX6A 3OJGA 3QMTA 1O5KA 2PDGA 3DN5A 2B7NA 2REQA 3NQ2A 4UTKA 2OO0A 1KFLA 3NOEA 1L8NA 4ZL1A 2A21A 2VOTA 3BICA 3N17A 3ZR4A 4RNIA 4Z2KA 3RILA 1WYIA 1XS2A 1JGIA 4YVVA 5T9CE 2O56A 1KTCA 2CIPA 1MWOA 3BMWA 4J40A 3VOHA 2QJNA 4BHYA 3T78A 1CDGA 4O4VA 1SZEA 2YPIA 1I1XA 3GSMA 5I79A 1TYGA 4QTGA 3MP3A 4JNMA 3GAYA 1TCMA 2V8ZA 3ZO9A 3CZKA 1QI2A 2E40A 4PCFA 3THUA 1Q3NA 4MPQA 1UC5A 2UY4A 4R3UA 4PH6A 4DF1A 5J5RA 3AJXA 3OZMA 3R10A 4NIRA 3LCLA 3M44A 2PUZA 4K8EA 1H51A 3AHTA 2WCAA 1BAGA 1YPFA 1H0GA 2DQWA 4JZ5A 1X98A 4GYPA 3F4VA 1S39A 1WNOA 5JU6A 4BI5A 1KRAC 1D7FA 1FH8A 4JCMA 2I7GA 1K7FA 4GGBA 1NWSA 2XZ7A 3AWOA 2H3BA 4AXKA 3EWWA 5CBBA 4OJYA 1ZPTA 1DL3A 2ZRUA 3IGHX 4MZ8A 3IJ6A 1NM9A 3TIMA 4JQ3A 1VH7A 3LCXA 4JKKA 3W24A 4XSLA 4CU7A 3NL5A 3VOCA 5I0DA 4TVUA 2CBJA 4LX4A 4WKFA 1S3TC 5A69A 3TROA 3IS4A 4US6A 3CZ8A 2REQB 3TC7A 1FWGC 3TA9A 5KMYA 3NM3A 2DJXA 1N8FA 3BLIA 4AD3A 5BXTA 4FNQA 1Q8JA 5I23A 1DJXA 1AH3A 2V3FA 3C61A 5D09A 3NM1A 1NDZA 2C15A 2E3ZA 2VFHA 4UMBA 5FJRA 3AMKA 1WBJA 3U2ZA 4I8DA 1JZ2A 2PDFA 3TNOA 1BYBA 4C65A 4AMCA 3WF1A 3ZT7A 2VKZG 4PMUA 4EF9A 3ARVA 1LF1A 4U33A 1VJIA 4H7ZA 2PLCA 4HU4A 1EWEA 1YXCA 4BQ5A 2JGYA 4KF1A 4UNIA 4WQ6A 4OQVA 1XD1A 2G97A 1B3YA 1H7WA 4E2BA 2E8ZA 4QHRA 5BOOA 1QNPA 4X2RA 4JTEA 4M51A 3DFQA 1I2QA 8XIMA 5LXEA 1FP9A 2WSYA 4K7YA 5IOBA 4F3HA 3LB0A 2OKOA 3V35A 4UTLA 4TU1A 3LG3A 1H49A 3WEZA 1EP2A 4NZ5A 4IT1A 1KM5A 1Z48A 1ZJAA 3K4WA 2J47A 1M01A 3ITCA 4PA8A 3HG4A 4MJ4A 3BAIA 3UWQA 3VNZA 3R43A 4JKMA 2VRQA 3B8DA 1W5PA 4HK5A 2X40A 1W9BM 2ZTKA 4PBFA 2IPGA 3SUTA 3MV11 1F76A 1TZ9A 1MEIA 1ESWA 5HMFA 3MSDA 1CXFA 1VFSA 3WEMA 2NWSA 1JQXA 5LYRA 4E4PA 3UQNA 5LIKX 3IV8A 4FXSA 1GW9A 1KCXA 3ZMRA 4TMCA 4S3FA 2QV5A 3VGEA 1XLCA 1G9HA 3AISA 4OUIA 5HNRA 3FYYA 2R14A 3DG7A 2Z29A 4DM1A 3N2CA 1EPVA 4ZXLA 5IHSA 5HQMA 1Z32X 3MSGA 3GFXA 1JCMP 5F7UA 4NKCA 3UJ2A 1DQXA 4E3TA 2NXGA 1J2WA 3PPFA 1W9DM 4ZE5A 4H8HA 4JX4A 4BWLC 5TQLA 3M1ZA 3G1AA 4QDWA 3S2MA 4WCJA 1RK5A 1KXTA 2XWEA 5JH1A 1B54A 4JIQA 3VU2A 1F3WA 2ZICA 3TSBA 5C9ZA 3FY1A 4BR1A 1JPIA 1JXKA 4AD2A 3W6YA 1QK0A 1V5XA 3NVTA 4PCSA 3VILA 1E15A 3QKEA 4LB3A 2PGEA 2CLKA 2J27A 5K9DA 1EEXA 4UWMA 3HTWA 8XIAA 1KBBA 3TWAA 2NLIA 2PZ0A 4B5XA 4Y9PA 1RBOB 2J8GA 4ICCX 3FA4A 3VOFA 2HK0A 2A3LA 1V0LA 2J7HA 2QJMA 4GI4A 4X0NA 2OB3A 2RJHA 3ZYZA 1ICSA 3IUDA 2ZA2A 4QG6A 1ZTVA 2P8CA 3RLUA 4EKJA 1CGTA 3N2OA 3GZAA 1D2KA 1ENUA 4IPIA 3KHDA 4IOTA 1DE6A 4ZQMA 1KWGA 1VBUA 4JFTA 5KSWA 1BTCA 3ARPA 5HWMA 5LNVA 5C55A 2XFWA 3TQPA 2XISA 1SU5A 2RGLA 3N11A 2V67A 4OZOA 1UWTA 3APTA 2CZFA 3WL1A 3WLMA 1X97A 1NAL1 1S5TA 4BWLA 1BXCA 3LMZA 3OVRA 1ITUA 4PCTA 3PS7A 1TTPA 1EL3A 3PZGA 4DNMA 2NQZA 3SCSA 1HJXA 4UQAA 1ZBVA 1C92A 2P0OA 2VFGA 3LUTA 4PYSA 3ID7A 3MC5A 4YTUA 3ZIZA 2Y4SA 1XLJA 2GK1A 4ZQPA 5C8BB 1SJBA 3URNA 3CZLA 2W63A 4NJIA 4IXXA 1EFZA 2POZA 2YL9A 4OVXA 3TAOA 4QFUA 3S5OA 4CN4A 3GU9A 2XINA 1FDJA 1PZ0A 4C6FA 3Q4DA 4L4LA 3EPMA 4B5UA 2XN2A 2DIJA 3HMCA 3CC1A 2W6RA 3NSMA 4RNJA 2PD5A 4RV8A 5TD4A 1VGAA 4MB1A 1K9DA 4QJ5B 2GSJA 1R3RA 3CK5A 2XYLA 1XUZA 3B0VC 3SCPA 4B91A 3IVSA 1F07A 3UR8A 1JF5A 4Z42C 2GUUA 5I3JA 3O6YX 4WVXA 4DXVA 5F4WA 2OU4A 1Q65A 3KCLA 1BXNA 5F4SA 2ZUVA 1Q66A 3VKJA 5H8MA 3H22A 3EB2A 5A6TC 3PF3A 3LZ3A 1E4LA 1GZGA 1ICQA 2XN1A 1JDEA 3TK7A 3L67A 9RUBA 3WQ5A 1GQLA 2UY5A 1UASA 2DZWA 1IXPA 1U1JA 4AX6A 4UTFA 2IPWA 3SY5A 4L4OA 2VFEA 1GZJA 4K68A 3S42A 1OFBA 2UZ9A 4CCDA 1XQKA 1V3KA 4D6DA 5CZJA 1C8VA 3S5YA 5D2XA 4O1CA 3PAJA 2CWXA 3AIEA 3QKZA 3SGGA 1H1YA 4CNNA 4GG9A 1PSCA 4UQ9A 4DB7A 4DO6A 4C7GA 3WLTA 5HQLA 4BEUA 1H2JA 1UYQA 1RA5A 4J7RA 1KXVA 3SCVA 4KMQA 3VKAA 1IT8A 4JY9A 5EBUA 1PX4A 4PTMA 5G2IA 1OGGA 2WM0A 5D2WA 1R9XA 2GK1B 2Z0IA 2OGYA 3EMZA 2JKPA 2PF0A 3LHYA 2X0SA 1FWCC 3BLOA 3LGDA 2NQJA 1QCWA 3RF9A 1K8ZA 1VFLA 1TTJA 4O14A 1GQIA 2GGGA 4QSHA 5FJTA 5A6BD 4MJZA 2OQHA 4XWUA 4PSPA 1MVYA 2WZHA 2YW4A 1TWIA 5ECUA 3G2GA 4RZ6A 5TNVA 4F8XA 1J5SA 4U2YA 3AHVA 2YCKX 4AB4A 4IIGA 4RX0A 1ZENA 1PUDA 4IMCA 5EMLA 2WNQA 4JHMA 5DBTA 2Z24A 1GJWA 1JAEA 3M5VA 4XSMA 3ARWA 1TREA 5IM51 1SFSA 3SCNA 3KP1A 3T2OA 2QAPA 1RSCA 5E0CA 2X09A 1W1YA 3C2VA 3DU0A 3MP4A 1AQMA 3BK0A 4BI6A 3ORWA 3U57A 3L0NA 2QR6A 2B7OA 2XM1A 2YA1A 2BGQA 3L12A 4NZ1A 1AH4A 5C2CA 3FX4A 2HPIA 5C54A 1TE6A 3BUVA 4XAPA 2GJXA 1GWJA 4U3CA 4MWAA 3TJXA 3T0TA 3B9EA 1DJIA 2CETA 3T7VA 3EWZA 5JMUA 1Q4WA 5M5DA 3WUFA 3RM9A 3VNDA 4EPBC 5FEZA 5HQEA 1ZUAX 4TIMA 5D33A 1OIMA 4R88A 1UD6A 1JI2A 4DWSC 1UWQA 3PY2A 4U28A 2IKIA 1YXDA 4BQ4A 3M0LA 4IL0A 1PV8A 5CAKA 3O16A 1QNOA 3ZFHA 1FWRA 3GBDA 4XAFA 1M41A 2IPFA 2P1FA 3V0TA 3MDUA 3W7OA 2VEFA 1HKIA 2Y61A 5A8QA 3RMJA 4QGCA 1GOIA 3R12A 3H26A 3QV7A 1Y7VA 4MY9A 1SUXA 4R85A 1GYNA 1XV8A 3ZR5A 1XYZA 2ZUTA 3S2NA 3M46A 2WVUA 4GUIA 3DGRA 1MFVA 1L6WA 1D8CA 1Q6DA 2FH6A 3VKDA 3Q94A 4KGLA 1PTDA 2AAMA 3IJLA 2PC4A 3LEPA 5CQ1A 3LNPA 4UC5A 4BI7A 2JQXA 2VR2A 3GR8A 2E28A 3ONCA 2HVOA 1GK8A 1VHNA 1PKMA 2GOUA 3T07A 4JR5A 5DCEA 1H09A 2BOFX 3MT1A 1K9FA 1IXNA 1OX6A 2NSXA 1EDTA 3W1UA 1AL7A 1Z42A 1S1RA 3OP2A 4EIVA 5D9PA 3GVRA 2Y8VA 4NSBA 4XAGA 5DCDA 2WQDA 4MKNA 1HN1A 3QRHA 2RGMA 3I3DA 3H4WA 2NXHA 1OX4A 1GTEA 3UYIA 1BQCA 2J88A 3N14A 1J0IA 2FHBA 1FHLA 4C6EA 4RR4A 2WMIA 4UIOA 5CZTA 2E5BA 1OFQA 3WLSA 2A7NA 5D02A 5K4ZA 1TX2A 3AIWA 3B04A 3NAVA 2ZXAA 2ZZ5A 4MTVA 3BDKA 3WQCA 3DESA 4Z1AA 1T99A 1B9ZA 1EHAA 1ZBWA 1EC9A 3MJMA 4H3DA 3FXGA 4UQEA 5DQPA 3E1F1 4W7VA 4QQ3A 4ZOEA 3BCFA 4JIHA 2CU0A 5LNRA 2OOFA 1AQFA 3TYAA 3GC4A 2YCLA 4EPKA 1OZMA 1TSIA 1TZ7A 4AIOA 1SMAA 5I06A 2VDIA 3NWRA 2G95A 1LP6A 4KETA 5DN1A 3FSUA 3TC3A 3AALA 1IYXA 2J62A 5EMUA 1DQWA 5CSSA 1V6YA 2BY2A 3QR1A 2GSHA 3K5XA 3KEHA 6TAAA 4LAMA 4JIPA 2DW7A 4WY0A 1YYAA 3MS8A 3AU6A 2XU2A 4HHLA 1XDLA 1UW9A 3WLPA 4HSOA 3C2RA 2PDLA 4BJHA 1UOKA 3XINA 4A3UA 3BLDA 3CHFA 5CPQA 3KCOA 3UG3A 2GSEA 2A6NA 2Q71A 4UTTA 5A95A 4DVOA 4JTSA 1A47A 3NZRA 1EJWC 1TA3A 3VCRA 2QNEA 4KEVA 3GXIA 3B4UA 4TTGA 3GG1A 4C6LA 2XFYA 3PB2A 2XGZA 4YHGA 2ZE0A 3IUIA 2VT0A 3TTQA 4ES4A 3ANVA 4QS6A 1MEHA 4I7WA 1XH1A 2B7QA 1QW9A 1VPQA 1NQKA 2H3DA 4H4IA 2AMGA 1FWNA 4O1EA 1JPHA 5LIUX 3GD6A 5HNTA 1O5QA 5I6SA 1RR2A 3C56A 1IGWA 1BWKA 4V28A 3MJYA 2EPMX 2X1IA 5BU6A 1EC8A 4GXMA 4FALA 2CHRA 3KW3A 3WELA 3RR1A 1B57A 1EDQA 3UXIA 1E0UA 1XD0A 2MNRA 1O1ZA 2DUZA 2RDXA 3E2RA 1B3ZA 4RW3A 2MANA 4A3RA 1MUWA 3LSBA 4LSBA 1IGSA 3QHMA 3W87A 1EEPA 1RK6A 5BOFA 4NF7A 2XM2A 1UWAA 1Q5MA 1RPXA 3SN4A 2Z6IA 3VD4A 3WDJA 2VX7A 1X8FA 1K70A 3W01A 3NDYA 4AZ6A 5D05A 4FPSA 3ARUA 3E3HA 1JGMA 1FA2A 3M64A 3HGRA 1YIXA 3AZTA 3GK0A 3CHVA 7CGTA 5BW6A 4LUSA 4DPPA 4GJIA 3GKAA 1KBJA 3OYXA 2V81A 3NGFA 1MQQA 3NQVA 3QZ6A 2DSUA 5JQ9A 1NVMA 4L6DA 1OM0A 2DZUA 3F5JA 4NAEA 1TPFA 5JBFA 4FNTA 3ERPA 1AODA 2PGRA 2H90A 3DKJA 5BRQA 1OFAA 4NP7A 3P14A 3APGA 1E72M 3TYDA 1RAKA 3A22A 4U2ZA 4H9TA 2WJDA 3SCOA 3NL6A 2A85A 4XUGA 1J9YA 2D69A 2POTA 1KD0A 4PMJA 1DIEA 1V4YA 1UH4A 3GDBA 4ZSTA 3WNLA 2F38A 1JUKA 2GGJA 3W1XA 3W2KA 2PCEA 3UA4A 2OSWA 4O12A 1JFXA 4M8UA 3TR9A 4MLJA 2FHFA 1XLDA 4AWSA 3GQYA 2F8QA 4POCA 5E1QA 1R86A 2C19A 3QN3A 4HOZA 3A13A 2YBTA 4QITA 7TAAA 4ZFCA 1S2UA 3BSHA 1E3XA 2HISA 2OO6A 4OWGA 1Q13A 1JI1A 4EF8A 5IXEA 4JHOA 3C0SA 2Y0FA 3FKKA 3NGJA 1W1A1 2TODA 2FMOA 3KBNA 5AC5A 2XSAA 4DJDC 1SFJA 1JF6A 1RPKA 4HCLA 1H1NA 2C18A 2NT1A 1H3GA 2DZTA 4S23A 1CT5A 3TR2A 2VOMA 1OCQA 3FYOA 3C2YA 4X3ZA 1FXQA 2OZ3A 2Y85A 3DHUA 4NAFA 4IMDA 4QX4A 4X63A 1PIGA 2HEJA 1YNYA 1T41A 2A5HA 3CV2A 3VNLA 2PLMA 3FA5A 5FJPA 2XPKA 2WZMA 2OEJA 5HPOA 1K9TA 1AMYA 3SCUA 3BLPX 4GO9A 4RCXA 3LCGA 3GNNA 3PR2A 3TSMA 2DH2A 1YADA 3VNJA 1TTQA 1EJVC 2D2OA 1EJ7L 1GNXA 4JEQA 1JZ8A 3O7UA 1BYCA 4H9MA 3S9IA 3TYBA 3EKLA 3ZT6A 3KFTA 3VIPA 4DLMA 1VR6A 3P93A 1A5OC 1W6TA 1YMYA 2PLKA 3WH9A 3AIVA 3BSGA 6A3HA 4DUWA 4M7SA 2IMRA 2CZ5A 3GLCA 1H7RA 1UIPA 2E6YA 3DUGA 2Y7FA 1HKVA 4JTHA 4QCFA 4NY2A 4UFJA 3QYSA 1K3UA 2B31A 5LA2A 3K8KA 4BY3A 1DV7A 1QW8A 4XIAA 3M0XA 3NQ7A 3WFAA 2W0UA 5B7YA 4DELA 1Q6QA 3W4RA 1V0NA 4DJDA 2NX3A 1F3XA 3N9RA 4JTRA 2W67A 2GFTA 2P76A 2ISSA 2Y5EA 3PJXA 3KOZA 3SAZA 3PSVA 2X8RA 3AZSA 4DPQA 4MJMA 5E9AA 3WX7A 2EPOA 1X96A 1OY0A 1U83A 1XJBA 5HJYA 1YDYA 4WDTA 4FIRA 4D8LA 4KQNA 4W9TA 4KWSA 4XD5A 1SFLA 4UNKA 2UY2A 3CB3A 1ML1A 4GUHA 2WSQA 4GIEA 3VZZA 4AU0A 6XIMA 1JZ6A 3W86A 5BXPA 4AWUA 4HTYA 3YPIA 2VXNA 2WMGA 3B0XA 4RUBA 4LY8A 1D3GA 3BOFA 1UA7A 2XFFA 5EMMA 1P6CA 5JUVA 5BU9A 2HNEA 1UR9A 3MSYA 3IIVA 7REQB 1I6NA 3RM4A 1JYNA 3EDDA 2P3EA 3UXAA 4NL1A 3W81A 3NXFA 5GJMA 3F4NA 3NZ1A 3LERA 3R7MA 1QVBA 4R7OA 4HMDA 5ABEA 5K2ZA 2AAAA 1ISXA 4I5UA 4AYSA 4MUPA 3UEQA 4OT7A 2QDDA 3AU2A 2J7GA 3KWXA 3BW3A 4H6EA 4E8DA 5TF0A 2C1GA 3V75A 1FWIC 1EP3A 1TJ1A 4YNGA 1ZGDA 1NSJA 1YBQA 2W61A 1CW2A 3LTYA 5XIAA 1LUCA 2PZNA 3PB0A 2A3CA 3OQEA 3OZOA 4PB4A 1UWUA 1K6AA 1Y0EA 2RUSA 2ZWYA 4DAFA 1IZKA 1F2JA 2INEA 5A6JA 4B4HA 1DJNA 2VMFA 1J10A 1UUQA 4REQA 3O2LA 3VIJA 2VENA 2PGWA 1RHCA 3ZS4A 1FWJC 4UCGA 1PZ2A 3T44A 3E38A 4YN5A 2AQOA 4L80A 2C6QA 2RFGA 1BRLB 4F0MA 5J04A 2B4GA 3A9IA 1L8PA 4Z2GA 2WKGA 3WQ4A 3IEBA 4TTUA 1KFEA 4LNYA 2BODX 4QEHA 1NWRA 2ISFA 4JICA 1B1YA 4HPHA 1E1FA 3NL2A 3SGZA 2ZKMX 1R8LA 3LHVA 9XIAA 4C6QA 4NJHA 3ENLA 1CB2A 1XLGA 1I4NA 2YYUA 3LHTA 1OIFA 3PANA 6ENLA 5BMXA 3U5UA 4GACA 1SR0A 4U3AA 4LANA 1AW5A 3EDFA 2Z27A 4HU8A 4DI8A 4M82A 1H7OA 4CNPA 4FLSA 4H6RA 5FAJA 1PWMA 2XG9A 3OB8A 3GNPA 1MSSA 3M16A 1ZFJA 4NNAA 4L65A 3VCNA 5ABFA 5H2ZA 1GGOA 3CM4A 1F7BA 1KGUA 1LL6A 1HJQA 1XIJA 4U4MA 1RQHA 1KBIA 3UF9A 2GVLA 4CNSA 3N3TA 1W9UA 5HNUA 2OOGA 4XBKA 2ZFAA 3M0KA 4LGXA 4H2HA 5E0KA 4W5ZA 1GYLA 3ABQA 3B4YA 2HRWA 4RXFA 2EGZA 4HNLA 1I2OA 3CQ0A 3PN8A 2BOEX 3QF0A 2FZNA 3UP8A 1FY6A 3BG9A 1P7TA 3C6CA 6PTDA 2R1NA 2DSKA 5CLWA 3MV01 1I0BA 3MVIA 4ZQCA 2PU1A 4GQQA 3B8IA 2WMJA 4KFNA 3S3GA 4QG9A 1QO2A 3CGTA 3UJEA 4GKTA 3U2EA 4GQRA 3A4WA 1MEWA 4R53A 2CXEA 1OT2A 1RY0A 4EXAA 3PUGA 3GXNA 4F0HA 2D20A 2OGJA 4A05A 3AZRA 3VUPA 5KETA 4MJ2A 1J5TA 3B03A 2C16A 3FV9A 4AQLA 1UR3M 3UXLA 3W7IA 1F8MA 3L66A 3WLNA 4LV9A 1V51A 3LCWA 3HU7A 3GXFA 3GM8A 4ADSA 4I8YA 4UQCA 3P8JA 2DT3A 1ZP3A 3SRFA 3OO2A 3LRLA 1W0MA 2GWGA 2H8XA 4US5A 3F2DA 2QDGA 1HGWA 3ANUA 4D6EA 5TIMA 4PMNA 3KL0A 1O4UA 1W56A 3KVMA 1E5JA 1DXEA 3UESA 1W1IE 3S1UA 1DKWA 1ISWA 4INFA 4Z2IA 3OBEA 3W7NA 4Q7NA 2XVNA 4NXKA 4M29A 4HK7A 2Z7KA 3BL3A 3MW7A 1G0CA 2X1UA 1BSIA 3LXBA 2WMFA 1HKJA 4NASA 3FVMA 3G1FA 3L4UA 3RR4A 4RE4A 4MB4A 3L0GA 5B7ZA 2A4AA 3F1QA 4L9ZA 1V3JA 1BG9A 3OHMB 1PYFA 4OGZA 4IG2A 1U2YA 4C6OA 1UD3A 1GVEA 4IIFA 3CAQA 3DZ1A 3PK7A 4Q32A 3RX3A 1SJAA 2YKKA 1UQZA 1R47A 4AW7A 2VEPA 3CB8A 2R94A 1IWAA 2V2CA 4YMZA 3G8RA 1X1NA 1A0CA 5M03A 4CNOA 3OLGA 3B0UX 4NX5A 5GQBA 4DYKA 4HPNA 5FEXA 3RCMA 3MP5A 2VWTA 2QF8A 5SWUA 4EVZA 4HN8A 3ICJA 1PYMA 3LZ5A 3WFZA 5C2XA 2OLHA 1EOMA 1WV2A 3GY1A 3WQEA 3L2MA 1QJWA 1OYBA 3MY9A 1W5MA 1TKKA 1WKEA 3OOQA 4UUIA 1GT8A 4BKNA 3MBDA 1FQ0A 2YDAA 1XLHA 1E6PA 1GOOA 3KL3A 2RAGA 1S1PA 3M6YA 3G1SA 3MMWA 4EXQA 4AC1X 4ROPA 1CXKA 1CB7B 2F7FA 1Q2RA 4RL3A 3GX9A 4S3JA 3GB6A 4IJRA 3PPGA 3AQUA 2V5DA 3LHUA 3TFCA 1CENA 3CNYA 3Q67A 2DIKA 2Z2BA 3PZ9A 3U5YA 5LSMA 1F3TA 3N34A 2I17A 2C7FA 4JFWA 4O50A 5CSRA 1QW7A 1UG6A 3W28A 3URAA 1AD1A 1JD7A 3EWDA 1YKWA 2CLIA 3OTRA 1MZHA 1XGZA 1HJUA 2QPUA 4P7NA 4PTDA 1EO7A 2D2GA 4H2CA 4HNNA 4XX6A 4B5WA 1EUAA 5BRPA 1JPMA 2PE4A 4AF0A 1G4SA 5JXQA 4JYDA 2AL2A 4RNFA 1F05A 3SRKA 1C91A 3O8AA 1QI4A 3H7UA 3UG4A 1WAWA 5D2VA 4OOZA 1F9CA 4IG2B 4HJWA 1G7UA 5L9FA 3G6LA 4LFYA 1IEVA 3H2EA 1WB0A 3UR7A 1YRRA 1A49A 3BANA 2QAFA 3VPLA 4KCVA 4WEVX 3EWXA 4E0CA 4GI6A 2ZXQA 1V7AA 4WJEA 1G4PA 4GJJA 4HCDA 1E9IA 4NYUA 4LS2A 4XBSA 3W71A 4B4FA 1Q85A 3D3FA 1V3LA 4B16A 2PTXA 1M7PA 3W88A 1RJPA 1IIHA 1Q63A 4Y8FA 1DJZA 2XIJA 4MYXA 1KRMA 4GVHA 3G8EA 2PF8A 1KW1A 4HPXA 3R8RA 1UP3A 3PZOA 3D47A 3MSRA 1FDZA 4YTSA 2TPSA 3FW6A 3RO8A 5G4EA 2OPJA 1LRNA 4ZEPA 1A5MC 3NQGA 1TMLA 4W86A 5I3HA 1X7FA 2ADAA 3FVDA 3ONBA 2CLFA 1KLYA 2QGHA 1L6SA 2YXOA 2GDVA 2G50A 3ZVHA 1HKWA 2KAUC 4ERGA 4FF5A 2FDSA 3TVAA 4MUZA 3WD2A 3UR2A 3LLDA 2HXTA 2ZX9A 2AL1A 4ZQNA 1I2PA 2DZXA 3GHRA 4JGDA 3LS9A 3ZSTA 4OIFA 2WVVB 3W1LA 1HX0A 5D38A 3A6OA 3QHNA 3N9SA 5GJNA 5C7HA 2FZ8A 1WDPA 3W3OA 3MKKA 5I3DA 3QGKC 1XPGA 1THFD 4HJFA 3DI1A 3L4VA 2Q8LA 4LCRA 4AF0B 3MUZ1 3P2VA 3TYUA 3DX5A 1E56A 4A6GA 4GWEA 2XH7A