3R89A

Crystal structure of orotidine 5-phosphate decarboxylase from anaerococcus prevotii dsm 20548
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
289
structure length
289
Chain Sequence
SNAMKIIDKLYEKVSKNGFVCIGLDSSIDYIPENMKAGKSVSEALFSYNKEIIDQTYDVCAIYKLQIAYYESYGIEGMIAYRDTLSYLREKDLLSIGDVKRSDIAASAKMYAKAHFEGDFETDFITLNPYMGMDSIEPYEEYIEKGDKGVFVLLRTSNPGAKDFEVLPVDGEEFFYKVGDKMRELNEKYIGKSGFGPIGLVVGATHSEEVEKIRKRYDKMFFLIPGFGAQKADSMNVYKLLEGLNGGVVNSSRAILKNWQNYEDGSEKVGYYARKKAIETYEEIKANEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Crystal structure of orotidine 5'-phosphate decarboxylase from Anaerococcus prevotii DSM 20548
rcsb
source organism Anaerococcus prevotii
molecule tags Lyase
total genus 110
structure length 289
sequence length 289
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2011-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3r89A00
2A2IA 2NX9A 4HIBA 5HUPA 2OX1A 3LCLA 3L0NA 4OT7A 4UTTA 3PAJA 4M19A 2XN1A 3W7IA 1LBLA 2QCHA 2PRLA 2FDSA 5DXYA 1S5TA 5DN1A 2X30A 4Y96A 1FWSA 2VFDA 4NXSA 1B9BA 1TSIA 3UXDA 2XN2A 5CPLA 1ZENA 4O1AA 3NZRA 2NUWA 4XKYA 3PB2A 3S5ZA 4ALDA 4ORMA 3PSVA 3NGJA 3LRLA 1EEPA 4UTKA 4I7VA 3B06A 2C0AA 1A50A 3DFTA 5TQLA 4K38A 2WSQA 4O4WA 2FLIA 2ZA3A 3DGRA 3EX4A 1Q6OA 1KBJA 5I3JA 4JTKA 4N4PA 3MMTA 1G67A 1NSJA 2NV2A 3DBPA 1Q6RA 4CNPA 5AHMA 1G4PA 1VHNA 2E09A 4NVTA 3O6YX 1GQNA 4O17A 1ZAJA 3BG3A 2G5WA 2IQTA 4L4LA 4O10A 4QM1A 2NXHA 1UUMA 3E0IA 4UFKA 3W7NA 3KX6A 4HSOA 1W5MA 1Z48A 4NQ1A 4JXCA 3PVFA 4JNMA 5F4XA 3G0SA 4AEOA 3M1ZA 3B4UA 2Q3RA 2GQAA 3BW3A 4IXXA 3UXAA 2BWGA 1RR2A 3DKJA 5D2TA 1SW3A 4Z0SA 3LXAA 3HG4A 1B4KA 3C52A 2A7PA 4PTNA 3HPZA 3UZJA 3MYPA 3C61A 3MHUA 3W73A 3KVJA 4FIQA 4LUIA 5FESA 5G2WA 3QQ0A 4BI7A 1AMKA 2CZDA 1OFEA 1JR1A 4N9BA 3SJ3A 1P4CA 4OBTA 1TPWA 1P0NA 4S2BA 4AVFA 1A5SA 4YCPA 3GDKA 4NT0A 1EUNA 5I3FA 5D2VA 5LNUA 2ZA1A 3I7RA 3GXPA 3LV5A 3W7LA 3GLCA 2RDTA 3RU6A 3O6CA 3MO7A 2GUUA 3W1QA 2RDUA 2ZZ1A 3D0CA 5LGZA 1SO5A 1PV8A 2WOQA 5K9CA 1LP6A 3HBLA 1IF2A 1TREA 3G0XA 5E0KA 1KM0A 2E5BA 3PB0A 3LXCA 4KFNA 4A22A 3DKLA 3L66A 5EA9A 5IBXC 2EGZA 2QCNA 3C0JA 3G0UA 4UNLA 4K36A 1D9EA 3NQEA 2FB3A 2O7SA 1W31A 3PUEA 4MFDA 4KFPA 1S5VA 1Q6QA 1LTDA 1Q45A 3MJYA 4LVAA 3VKJA 1QR7A 4G1KA 1NFBA 1K7FA 4WD0A 3KRUA 4DO4A 2NX3A 5AHFA 3O63A 5DELA 1SU5A 4CQ8A 3FKKA 4UUIA 1AG1O 3V1PA 3ELFA 5HR7A 1XL9A 1Y0EA 3UQNA 4K7YA 1XM3A 5AC8A 4UTIA 4FNUA 1K03A 2A21A 1GG0A 1WYIA 4KKXA 3W07A 2EHHA 3FIGA 3LHUA 4YXGA 3ZR4A 3UY8A 1RQBA 4O12A 1YXDA 1GVOA 4LUJA 1TPUA 5G5IA 1JCNA 1I4NA 2V9DA 4K6AA 4X2RA 3GXTA 4GUHA 3S1VA 5D04C 3DU0A 4O1BA 2Z2UA 3F4NA 1FWRA 1KBIA 1CW2A 3EXRA 2YX0A 3QFEA 3M5ZA 1QPNA 4GUGA 3JRKA 1TMHA 4FX8A 3NQCA 1SUXA 4IPIA 1M7PA 3FA5A 1FCVA 4TR9A 2E68A 1PHQA 3LRMA 4K8HA 4RKAA 1N55A 2C6QA 3T40A 3CQ0A 5G2HA 2BX7A 2A7NA 3O05A 1HUVA 1EP2A 4CNNA 1V5XA 4EWND 3FYOA 1EP1A 3M41A 2CLOA 1AL7A 1IIHA 5F4WA 2CZ5A 1NF0A 3A9IA 2TYSA 3NQVA 1LLWA 4UMAA 4O53A 3PUOA 4WJEA 4ORIA 5I3KA 3EWUA 4DXVA 5D32A 2Z6IA 1QDSA 3GX9A 4UFMA 2VXNA 3TFCA 3UWUA 1M7OA 3P81A 1NEYA 3LTYA 1O5KA 4UIOA 4WY0A 1L9WA 3BLFA 3PR2A 3C2EA 4NNCA 3U6WA 1IXQA 4DBDA 5D09A 3OVRA 4OE7A 2AAMA 3STFA 3QMRA 4ZQRA 3SFKA 4DF2A 3TUUA 1F6KA 3G22A 3GDLA 4MJZA 1UASA 1W5NA 3NL5A 1WBHA 2ZFAA 1V7YA 4JTHA 5HWNA 4FNPA 1F2JA 5L9FA 3KRSA 2CLIA 4JX4A 4O28A 3S5NA 2Y88A 4AMAA 3NYZA 3W2MA 5G4EA 3OEXA 2WKJA 3O1NA 4WQ6A 3TXVA 4UNKA 1VLIA 4KWWA 3RMJA 1LCOA 1FXPA 3QMSA 1ZY9A 4Z0JA 3W7GA 1H50A 4K7VA 2A6LA 2V2DA 1MSSA 3UY7A 5J5RA 4Y6GA 3STGA 3RK8A 5HWJA 2DP3A 1HFBA 2V30A 1BEUA 3LERA 1W5PA 5D03A 1PE1A 2ZZ5A 3BW2A 3DFNA 4JTUA 3W7DA 3NQ6A 4TMCA 4MFEA 2CLFA 4FXSA 5A5WA 3ZFHA 3HGSA 4UFHA 1X1ZA 4FIRA 2H8XA 4HN4A 4O15A 5ABTA 2PC4A 4I7WA 4UMCA 3UYCA 4BFAA 2JKEA 2NXGA 3PUDA 4FNSA 4DBEA 3TJLA 5I3GA 4ML9A 3KRZA 1E51A 3LCXA 1PS9A 4UTWC 3BG5A 2ZRXA 4BI5A 4RV8A 3U8GA 3DI1A 5HULA 3W22A 5CSSA 4LTSA 3NG3A 1WX0A 4TMBA 3N73A 4LVGA 3FJ6A 1ML1A 1XDLA 1SFJA 3CLMA 1KM6A 1QAPA 5AC7A 2G95A 5FEPA 3W1NA 3IRDA 2ZQ0A 2XN0A 3KOFA 2B7OA 5TBOA 4OHQA 1KM3A 4JN6A 4LNYA 1WV2A 2NUYA 3BG9A 1PVNA 3TA6A 1WDWA 3W1TA 2FJKA 5HJLA 3W7KA 2QEZA 2A7RA 2JKPA 1IXNA 3N19B 5FF0A 2UV8G 4R33A 4LVDA 1SZFA 4Z08A 1ZAHA 4Q4KA 4JYDA 5TIMA 2ZTKA 3TX9A 3BPWA 2VEPA 4I7UA 4RJEA 2ZRWA 1KM1A 1H7PA 4BR1A 1C29A 4U28A 3TU9A 1BWKA 3STEA 1JQVA 1OJXA 1FY6A 3IIOA 3U2OA 3IIXA 3UWVA 4NJIA 2QCLA 5LNVA 1YTDA 3PSWA 1FXQA 1KTBA 1XDMA 1Z44A 2C14A 5K9XA 1VQTA 3L67A 3S1WA 1OK6A 1ALDA 4IWWA 3C2RA 3GAKA 2BSLA 1GT8A 3QPZA 4M5PA 1XUUA 4MUZA 4QITA 5DBTA 1VYRA 4GNJA 1LROA 1KM5A 4DO6A 1RQHA 3GNDA 1JCXA 3B0VC 1K7XA 1K8YA 4QNWA 2FTPA 1EP3A 5AFDA 4K37A 3NQGA 3THQA 4LC6A 1JUEA 1G6CA 1LLZA 2ZTJA 1LOLA 3NA8A 1KFEA 3NM1A 3QJAA 3S5YA 1F7BA 1EX5A 3KVMA 5F1UA 2I14A 3M6YA 1HG3A 4X9SA 2V82A 3TQKA 3L2IA 4BI6A 2E6AA 1ICPA 3O15A 1YPIA 1QOPA 4W9TA 1GYLA 2QCGA 4K39A 4JTGA 1OVDA 1R30A 3PM6A 4ZQOA 5LNWA 1W0MA 3E49A 3RF9A 4JGDA 2ZBTA 3B0UX 4ICNA 1VCFA 1XUZA 3GKFA 4NZFA 5G4WA 2EKCA 4N9EA 3EWBX 1PCWA 1KTCA 2X1UA 3CTLA 3TIMA 2GVLA 2ISVA 1H63A 2Y6ZA 4LS2A 3W1XA 2FQIA 4GWEA 2CLEA 4X22A 4HNTA 5FF4A 1R2RA 2YFNA 3MYOA 2CWNA 1TJRA 2YR1A 3BGGA 1FX6A 4IUOA 3LM7A 1K02A 3W7JA 2ABBA 5K3VA 5DY3A 2Y89A 3PBYA 4HT3A 3MI2A 1F74A 4TX9A 4JY9A 4O4VA 4UTJA 3BO9A 2DU2A 2WV8A 3W3OA 2ABAA 6TIMA 3N9SA 2BTMA 4FX6M 1LOQA 1ZCOA 1T0OA 2ZYFA 3T44A 3ZS4A 1A5AA 5DCBA 1VLWA 1N8FA 1ME9A 3R12A 4J9JA 2VFIA 4R7JA 4U4MA 4FF7A 1TPFA 3W1RA 1L6YA 1TPB1 4MLRA 1JRCA 1UJPA 2RKXA 1LRQA 5KITA 2WNQA 3S5OA 2ZCGA 3GNNA 3TH6A 3Q2DA 4JD4A 4LS0A 5KTLA 3SGUA 4DPPA 3KXQA 2A1YA 4LW7A 2NV1A 2F84A 2W0UA 1XXXA 1TRIA 4XQ6A 3G8RA 3T7VA 2CLMA 2E1DA 1FDJA 3BK0A 1L2UA 4Z1AA 2DZTA 2JGQA 2ZRVA 3QW4B 5D2XA 3S1XA 4ZZ9A 1P0KA 1TRDA 3SI9A 2RH9A 4FHAA 4JDBA 4JYFA 3BV4A 5D05A 1OFOA 3TQVA 3KFTA 2VFFA 1DQWA 2ZRZA 1LM1A 1Q3NA 4MKNA 4JTLA 2BXVA 5CPMA 5CPNA 1TPH1 4RR4A 4UTHA 5KSWA 1G4SA 1RVGA 1Z41A 3TR2A 4JY8A 5SWUA 1NF7A 2Q3OA 1D3GA 3W7PA 5LHEA 3W75A 3NL2A 4CLMA 3W1MA 3C8FA 1XBZA 2NUXA 3EX2A 2PRHA 4MZYA 2NXIA 3L5AA 3LGEA 2A5HA 5CZSA 4IMDA 4O0KA 4JIQA 4MPQA 1G4TA 1FQ0A 4S1FA 2P0OA 1TIMA 3OBKA 3EWYA 1DQXA 5U4NA 3LHVA 1TTPA 3M5VA 4H4IA 4N6EA 1A5CA 4ZL1A 3N9RA 5AYYA 4UFLA 1QPRA 2A85A 3IVTA 2C15A 3L68A 3L0KA 3PG9A 5FF7A 4CCEA 1OFPA 3M16A 1W37A 1ZAIA 3L5MA 5EMUA 1NAL1 4WY0B 4GXMA 1SO6A 1LOSA 5CPOA 1RQEA 2BZNA 2H6RA 1EPXA 4L4MA 4ADUA 2W6RA 1RZMA 5EPDA 1QNVA 4GC4A 3GDMA 2DZSA 3FLUA 3VNDA 3JS3A 2OZ0A 1NVMA 1I2NA 1EIXA 3A24A 1OX6A 3TSMA 3G1DA 1VZWA 3F1QA 4JR5A 4WOQA 4UTLA 4O8RA 2X1SA 1GVFA 2J27A 1EUAA 3ATYA 4NX0A 2H8ZA 3IIZA 1FWNA 2FFCA 5K7JA 3LV6A 4R53A 5T26A 1KFLA 2NWRA 2I9EA 1LBMA 5FEZA 3LCIA 2Z1BA 4Y8FA 3W83A 5EYWA 1WOAA 3TMLA 1TPC1 4HSNA 2QCDA 3G1HA 3P8JA 5DY2A 2ZRUA 1IXPA 5CZ0A 4LV4A 2DORA 4UTTC 3W23A 1W54A 3FS2A 4HPXA 3CEUA 3T4CA 7TIMA 1IXOA 3MHGA 2YYTA 4RK8A 1VGAA 1JRBA 3EX6A 3H55A 1I2OA 5C54A 1JULA 2QDGA 5FF2A 4D2JA 3RLUA 1U83A 3HG3A 4QJ1A 4N02A 1AW5A 3NM3A 3O8AA 3BVJA 4LOCA 4E2BA 4WOZA 2Z0IA 3PWAA 3RLVA 2QJIA 3QH2A 5F4SA 5HMSA 3G1VA 3IVSA 1WXJA 3TKFA 3SW6A 2NX1A 5AN7A 3TC7A 4PH6A 3G1SA 4MYAA 2X1RA 1PCKA 1LRTA 1ZJIA 2EF9A 1OFBA 1J4EA 4BF9A 1TO3A 4O14A 4RZ5A 3G24A 4ZQNA 5LHFA 3CPRA 4M7TA 4EVZA 5F1VA 3NL3A 4MY8A 2A6NA 3S1UA 4JDYA 1ZALA 2J88A 4A2RA 4AWUA 1OYCA 2QKFA 4AWSA 2QDHA 4DF0A 3AJXA 1XI3A 5IM51 2B7PA 3LHTA 3KAOA 1C9DA 3LTSA 3TFXA 2CZEA 4FX7A 1O4UA 3BARA 1F73A 5F2MA 1X6UA 1JUKA 2VEMA 3O06A 5J5DA 2GPTA 4M7SA 2OJPA 3E02A 1GTEA 4LWWA 1OYAA 3R13A 1W5OA 3LCFA 3P74A 4O52A 3ZWTA 3DAQA 4MZ1A 1PHWA 2C3ZA 4GE8A 2Y61A 4UMBA 2YGYA 5HUOA 4CCDA 3M9YA 3THAA 2J9YA 1SPQA 2ZRYA 1AW1A 3NPXA 4PCFA 3NAVA 1YDVA 2Y7GA 2DZXA 1FUYA 2G97A 2V81A 3GYEA 4UXDA 1F5ZA 1VYPX 4KWVA 4RZ4A 3L9CA 3NR0A 4GUJA 1VYSX 3GXNA 1GZGA 5DCDA 4QIUA 1FBAA 3TAKA 3T55A 2J9ZA 3WJXA 5CSRA 1H1YA 5HR6A 2H90A 1DJQA 1VJIA 3NVTA 2YW3A 2OT0A 1JCYA 3DH7A 5K4ZA 2RDWA 4HNNA 4NUWA 4TO8A 4UFIA 5CKSA 1X8FA 2ZDRA 3TXZA 2J24A 2G96A 3LB0A 3LLDA 3WFAA 4ADTA 4PA8A 4MOZA 4N6FA 3W1AA 5EL1A 2CLLA 3B8DA 3NL6A 3P7YA 1QPQA 4FEZA 2V5BA 4JTIA 1W3NA 3MI6A 2WSRA 3A5FA 3W7CA 5MHBA 3GIYA 2WNZA 1H5YA 3S8HA 5G2IA 2Z6JA 3BLIA 5C5YA 5AHLA 2H3BA 5AHNA 2HS8A 1TQJA 1IIGA 1FWWA 1X1OA 4XZ9A 1YPFA 3OVPA 1LZOA 2J6XA 3JR2A 3MP5A 4IMEA 5DCEA 1XC4A 4NNAA 4JTJA 4IMFA 3FJLA 2QCCA 3NDOA 3MUXA 4XUGA 5C2XA 5H91A 1W56A 5U7SA 5AB3A 1EWDA 1WOBA 3SZ8A 1LYXA 3HB9A 3UPWA 3PULA 4IPJA 4JTFA 1VRDA 3TNOA 2ATMA 2WQPA 2OCZA 3QW3A 2Y85A 4MIMA 2X2GA 5AOUA 1F76A 4NJGA 1LDCA 1WQ5A 1TTQA 5K4XA 1DL3A 1K8XA 4JICA 1XBXA 4RCXA 1VC4A 3WK3A 1UUOA 1W5QA 6ALDA 4DF1A 4OU1A 2VEKA 1TTJA 1H7RA 2TPSA 3C6CA 1W8SA 4P2VA 3W2LA 1YADA 1YTEA 1B4EA 4CNOA 2ATSA 2PE4A 2YXGA 3P61A 4Y9AA 1PIIA 2ZZ7A 3TW6A 1TJPA 3NXFA 4O57A 4X3ZA 3MBFA 3W7RA 4QQ3A 4BWLA 4CQ9A 1FCUA 1XBVA 3NQMA 2WJZA 3UWQA 1TB3A 1SO4A 1VCVA 1C8VA 3R5EA 5A8GA 2EPHA 3R89A 3HPSA 2C16A 2VFEA 3LRKA 2B7NA 3GR8A 4IQLA 5LGXA 1JQXA 1MEWA 1A53A 3LCHA 1H51A 3W1PA 3INPA 3B0PA 2GOUA 3P62A 5LNRA 1MEHA 3QSRA 3E12A 1YTKA 1K8ZA 3MI3A 3LX9A 1QO5A 2JK2A 5BMXA 1S3HA 1O5XA 4IX2A 4HPJA 3CWOX 1YDNA 3SR7A 3FKRA 3EXSA 1CI1A 1O60A 3PC0A 1MXSA 4PL2A 1M5WA 3W76A 1R46A 3L65A 3WJWA 5K9DA 2YYUA 3W88A 5H2ZA 3TSBA 3ATZA 3PF3A 3W74A 5FEXA 5KMYA 5F2LA 2OT1A 4GJ1A 4Z1DA 3QZEA 3SSJA 3M47A 3LBCA 3QSTA 2DZVA 4RLIA 4O54A 1AW2A 5GVJA 2VOMA 3EX3A 1W3IA 4NJHA 1G69A 2B0MA 3RNDA 2E77A 3TC6A 3AO0A 3SIZA 2BLEA 4P61A 3C2FA 4JTTA 3B03A 5I3IA 1D3HA 1GPWA 1SZNA 4C1KA 2RHGA 3QM3A 4LT9A 5D37A 4RX0A 3YPIA 3WJZA 1XFBA 3C2VA 1JUBA 2V8ZA 3M7WA 3P8IA 3S6DA 4PC8A 2FPTA 4ZQPA 3TROA 1SR9A 1XCFA 4DO5A 4PFMA 1H1ZA 4UFJA 1KW1A 2VKZG 1GWJA 1GJPA 1AL8A 2FPYA 4LC8A 2PRMA 4YWIA 2QCMA 2GVGA 3SECA 3IIPA 2QCDB 4UR7A 3HO8A 5AYXA 4DELA 3IEBA 1B3OA 3GR7A 3PBWA 5AHEA 3CIWA 2R91A 4OWGA 1TCDA 3G3DA 3TK7A 3TW7A 1PL9A 1TV8A 8TIMA 4ADSA 3IIVA 5HNRA 3W2KA 2F7FA 4EF9A 2ISWA 5LSMA 2CU0A 1DJNA 3P5ZA 4KFOA 5HINA 4JEQA 4N9CA 2C13A 1BTMA 4JYEA 3S9YA 2ZZ4A 3OVQA 2YZRA 3NQFA 5D30A 1F6PA 3STCA 1FWTA 3B04A 3FYPA 3W72A 1H62A 1KM4A 1OFAA 3KVLA 5E1QA 1QPOA 4O0ZA 2YFOA 4JS3A 4S2CA 1I2QA 2WNNA 2HS6A 2AGKA 1KV5A 3HGRA 2JKAA 4XBKA 4E38A 3DXIA 2O7QA 4OV4A 1FDYA 1ZNNA 4O18A 2CW6A 4YL2A 1KA9F 5IBXA 4C1LA 1LORA 1SSDA 2GVJA 3TE9A 5BRBA 3DENA 4UTUA 1KLYA 4GFSA 5AC6A 4QISA 3OIXA 3DHDA 3CC1A 5D33A 3MP4A 4FXRA 3W2JA 3GDRA 1F05A 1GVSA 2QCEA 3EWZA 4MZ8A 4WXZA 3HOJA 1R2SA 4JTEA 5G1YA 2R94A 2V2HA 3CHVA 2B7QA 5EY5A 2FIQA 3QYQA 1OYBA 1OFDA 1VHCA 3DZ1A 2E5DA 3TQ0A 2ZZ3A 4IX0A 1RPXA 4LVFA 3ABQA 5CG7A 4CCCA 3IGXA 3LHZA 1I2PA 3EKLA 3GVGA 3L0GA 3N14A 2KZHA 4NJKA 5I3HA 1T99A 3DFPA 3OA3A 4LVBA 1OF6A 2QAFA 4H3DA 1GVQA 3CU2A 2ZZ6A 3EKZA 2E6DA 3R2GA 2VELA 3OHIA 4GRSA 4XTIA 4UTMA 1N7KA 1KFBA 1OFQA 2QUUA 3O16A 3NPWA 1ZFJA 2YCEA 4OGZA 1H61A 2CZFA 3GK0A 4FNRA 3N2XA 4EF8A 5HWMA 1TPEA 3GKAA 4Q33A 4A29A 1OX4A 1T8XA 2QF7A 3W84A 2QAPA 3ABSA 1RV8A 4HKPA 5LKYA 4WY0F 3W85A 2TSYA 3HG2A 3I6RA 1GG1A 1SO3A 3EEGA 1JCMP 3KVKA 2E6YA 1AK5A 4PODA 3SY5A 4GBUA 1JCLA 3LCGA 3S42A 1QWGA 4QAIA 3LBMA 1KTNA 1SZGA 3P67A 4LRSA 3W7MA 2VFGA 4FNTA 1J5TA 3W7HA 4E2DA 4M6PA 3OG3A 2OMAA 1SSGA 1VH7A 3ZWSA 3E9AA 5D38A 1HO1A 3QPYA 4NZJA 3TV8A 3R8RA 1WA3A 4MVAA 2Y62A 1ME8A 2I1OA 1QOQA 1EB3A 4DQWA 1TV5A 1UB3A 3MBDA 2C1HA 2QUTA 1OHLA 3NOEA 5L6UA 1KFJA 1ICSA 4Z1BA 4Z1CA 4PL1A 1JJKA 1TV7A 1BWLA 5FEWA 2Y7FA 1X7FA 3DFOA 4O50A 3P5YA 3TAOA 2WPBA 2QCFA 1QFEA 3MW7A 2GQ8A 1P5BA 5BNKA 1GEQA 1RD5A 1GVRA 4WXYA 2A4AA 3HPXA 4O13A 3RFAA 4HNUA 3HGJA 3PBUA 5FI8A 4UC5A 4Y90A 4OQVA 4JIPA 2AQWA 3K30A 1SZEA 3GAYA 4MLJA 4IMGA 4O11A 3H53A 2WSYA 3IVUA 4NX5A 1SW7A 2HTMA 1K7EA 4O16A 4A21A 3QRHA 4LU0A 1TTIA 4QNEA 3C2OA 4LS1A 3HF3A 2V0TA 1ZHAA 3QEZA 2ISSA 3HIJA 5E93A 4AF0B 4N9DA 2H3DA 1ADOA 3PBVA 1OK4A 3UWZA 4AHPA 3C3NA 5D2WA 2VENA 3CT7A 3VI2A 4UTWA 2TRSA 3P84A 4MY1A 2C18A 3G1XA 4NNBA 3A5VA 3G1AA 5CGQA 1S5WA 4AWTA 1YXCA 4MJMA 1OF8A 3NO5A 1MO0A 3W7QA 5AYZA 3EWXA 1KLZA 1DOSA 3C56A 3UD6A 3CEPA 1VS1A 1YLVA 1YDOA 2JGYA 2P10A 1DV7A 1HL2A 4IXHA 3N2MA 3M44A 2RFGA 4ZQCA 1VR6A 4AAJA 1UCWA 1FCBA 3QMTA 3EWWA 4RXFA 4I9AA 3FFSA 2GJNA 2NLIA 2DZUA 4N4QA 4Q32A 2GJLA 2Q8ZA 1SFLA 2DZPA 3DFSA 1I45A 3EXTA 4ZMGA 3E96A 3LCWA 3NQ2A 2Y70A 3Q94A 2QJGA 3C4UA 3LOTA 4IMCA 4LV9A 4NXKA 1JVNA 1A5BA 4MYXA 1VPXA 1H7OA 3LDVA 3LI0A 3MHFA 1I8JA 3B05A 1W3TA 4M6VA 5KZMA 3A22A 5DXXA 3UPBA 1YXYA 3V75A 4NU7A 3ABRA 3CIXA 2WO5A 3LI1A 4FO4A 5F2IA 4M6QA 4ZQMA 4FB7A 2E6FA 1GYNA 1I2RA 3NZ1A 4HNVA 3IGSA 1ME7A 2A0NA 4POCA 1IGSA 4YCOA 1R2TA 3W9ZA 3GB6A 3HJZA 5EBUA 5BMWA 3W71A 3W2NA 1HTIA 3FOKA 3L5LA 3N34A 4UR8A 3G1FA 3I7SA 3P82A 1KFKA 1T96A 3W1UA 3ABOA 5HQEA 1WAUA 1ONRA 2DJLA 3BLEA 5FF3A 1O94A 1KM2A 2GQ9A 1SQ7A 4ZVJA 4AB4A 1QMLA 4WUIA 4YMZA 3G3MA 2B4GA 3BW4A 3IV3A 1CX9A 3W86A 3I68A 2FPVA 1OABA 1O95A 3Q37A 2X16A 3A21A 4MY9A 2EAWA 5CZTA 1QO2A 5G1TA 1HO4A 4DPQA 3F4WA 4XBSA 1L6WA 2JBMA 1XKYA 1EA0A 3DHFA 3MWAA 1Q6LA 3DFQA 3M0ZA 3LTPA 1MEIA 3M43A 4AHOA 5KINA 3FEMA 5CZJA 3SGZA 3LHYA 1LBFA 3GDTA 1OX5A 2R8WA 3NPUA 1G4EA 5KZDA 3VE9A 4RZ6A 3W70A 1BKSA 3W1LA 1P1XA 2NZLA 2ZA2A 2PURA 2TMDA 5KZEA 1THFD 3F03K 3WJSA 3VCRA 5LZLA 3NQDA 1DVJA 2C19A 2YPIA 1OG0A 3H54A 3G1YA 2PCQA 2XFWA 3HMJG 4WZHA 3I7QA 1H60A 2VC6A 4IJBA 4AF0A 2CFFA 4K8EA 1ICQA 3PS7A 2HSAA 1H7NA 3W6YA 4PEKA 4H6KA 5C55A 2D73A 2J9XA 1L6SA 3TSDA 3P80A 1U5JA 2V2CA 2ALDA 3WJYA 2E5CA 4QSHA 2VEIA 2LLEA 2W79A 3M5YA 4O19A 3QF0A 3TCEA 2VFHA 1M6JA 3KHJA 2Q8LA 4ONVA 4XKYB 3NEVA 1YYAA 2QUVA 3WK1A 4A2SA 3LHWA 4LY8A 3W2UA 4AXKA 1WBJA 2X1TA 3Q58A 1DBTA 1FCQA 3A23A 4UCGA 1Z42A 2P1FA 4XTDA 4AH7A 1VCGA 1TPVA 1TQXA 4EOUA 3EX1A 3PG8A 4WX2A 4TIMA 3S0CA 3O07A 2FB2A 2R14A 5D2YA 3VFLA 2Y7DA 1DHPA 1GOXA 4AHQA 3HG5A 3UWWA 3HGOA 3UZ5A 4NJJA 3CWNA 1W1ZA 3NPVA 2YDAA 5DBUA 3WK0A 4DEFA 3NNTA 3EB2A 4IGHA 5EKYA 3GZ3A 1KFCA 1JCJA 4BK9A 5C6MA 1GTHA 1G7UA 2NWSA 2Y63A 3TDFA 1QCWA 4B5NA 1OX4B 2ZZ2A 4HHPA 2QJHA 3BGJA 5D02A 3O6DA 2DJXA 4GUFA 3DI0A 3LLFA 3NQ7A 3QQ1A 3HQ1A 3T78A 3G18A 4A3UA 3UWYA 3USBA 1J2WA 3PY2A 3NQAA 4E0CA 4R34A 3W87A 3I65A 4N2YA 4OV9A 3UNDA 2HMCA 5BOOA 4JX6A 5AHIA 1LRNA 3VE7A 3QC3A 4YLWA 3G8EA 3W7OA 2CLHA 1FDZA 5K2ZA 1B57A 3IGUA 3TMQA 3NQ8A 3MP3A 1R47A 1MZHA 4TU1A 1DORA 1UBSA 1OFRA 1DKWA 4RXGA 1TYGA 4FNQA 3L21A 3TJXA 4BWLC 3LXBA 4O1CA 4EIVA 3P60A 4XWUA 3WK2A 3CB8A 3CM4A 3W7EA 3ANYA 1SW0A 3N3MA 4GUIA 5LNSA 2YW4A 4O1DA 3M5XA 5DLCA 4JTSA 4IOTA 1EWEA 2V5LA 1XBYA 4CQAA 1KV8A 5F2GA 2CLKA 5BW6A 1K3UA 2DZWA 1H7XA 4LRTA 1H7WA 1G7VA 2YSWA 2Y7EA 2QR6A 1TPDA 4JX5A
chains in the Genus database with same CATH superfamily
3VDHA 1YE4A 3BZGA 4KMQA 1R3YA 2OX1A 2X7WA 3NYDA 4UTTA 4M19A 1V6UA 4KGLA 1JZ6A 3W7IA 1LBLA 1CYGA 4LH8A 3KZSA 3AZTA 2VFDA 1XYZA 1TSIA 3UXDA 3TQPA 2ZUWA 5C9RA 2DUXA 4O1AA 1EO5A 4XKYA 1SJAA 1J0JA 3PSVA 3NGJA 3S3GA 1S3TC 4K38A 3R7MA 3VDCA 2FLIA 2ZA3A 5FA5A 2VR2A 1RK6A 4N4PA 3MMTA 2JALA 4KIRA 5AZ0A 1J9YA 1PZ2A 1K1DA 5T8GA 1G4PA 1PX8A 2OSYA 4C6NA 4Q6JA 4DAIA 1ZAJA 2G5WA 1UUMA 3E0IA 4JBRA 4MDPA 3KX6A 4HSOA 2W61A 1ISWA 4JHOA 4IP7A 4JNMA 3N4FA 4AFYA 1CENA 1XYCA 1R3WA 1M53A 1O1ZA 1H3GA 4LB3A 1UYQA 5D2TA 2Y8KA 4Z0SA 3LXAA 2V3EA 2AQVA 3CL8A 3K8KA 1AVAA 1ZGDA 2VP8A 3UZJA 3VMOA 3MYPA 3ZVHB 3C61A 3L4XA 3MHUA 3L2MA 4H00A 4DBUA 4UZSA 3EEZA 3KWXA 3UGVA 3AIEA 4HB7A 1FFRA 4CD7A 1BTCA 3H7VA 4BI7A 2CZDA 1OFEA 5CPTA 1JR1A 3U4AA 3V18A 1P4CA 3AICA 4ML4A 4AVFA 2DQXA 3AS2A 3UZYA 1L0PA 4AXNA 4AIUA 1GOKA 4ZO6A 4DM1A 4R88A 4JFTA 2XG9A 3LV5A 3W7LA 3O6CA 1JDAA 1UR8A 1WUFA 2RDUA 3D0CA 1M04A 1SO5A 4S3GA 5EMLA 4PMXA 1CB7B 1TREA 3GO2A 5E0KA 4H04A 4V2XA 3B8TA 2GJXB 2VUYA 3CMGA 3NQEA 1E6ZA 2FB3A 3ZOAA 1XPGA 1S2TA 2QMKA 5BXRA 1CGXA 1RLDA 3VIPA 1S5VA 1F3TA 1GOMA 3MJYA 1NFBA 3VD4A 4OJYA 1MW1A 2VGBA 5DELA 3ONBA 1DWAM 1TV3A 5H8PA 1AG1O 5E6ZA 2QYGA 5CQ1A 1Y0EA 3URBA 3T1GA 4UTIA 1GW9A 4FNUA 4M24A 5C9ZA 1Z8AA 3MCMA 2PAJA 1WYIA 5KEZA 2VYOA 3LHUA 2F8QA 4O12A 3TNBA 2BHYA 1GVOA 3TR9A 4LUJA 4H8HA 5IRPA 3OLGA 4K6AA 3KS6A 5CGMA 1XCXA 4GUHA 1IT8A 4TX8A 1FWRA 3H12A 1KBIA 3UR7A 3EXRA 3QFEA 4S3BA 2GDVA 4UWMA 1EC7A 4FX8A 4BY3A 3HPAA 4XAZA 3W27A 5G2HA 2BX7A 1XLDA 3WF0A 4PCPA 1IR2A 3BLDA 1IIHA 4H9ZA 3CT2A 4IG2A 2TYSA 5CJMA 4FI4A 4UMAA 3WH8A 3LPGA 2F2KA 5A2BA 3EWUA 4AZGA 4UFMA 4ZOAA 1IQ8A 1EHAA 4JIHA 3TFCA 3QR0A 1NEYA 4ZB0A 1CXIA 1MDLA 1RD6A 4DBDA 2HJPA 3KE0A 3QMRA 3GDLA 2QT3A 4JKMA 1W5NA 2XSBA 4A3RA 1F2JA 3VTRA 5L9FA 3KRSA 3WNLA 3K46A 4AMAA 3ES8A 3TXVA 2PGWA 2PB1A 3TTYA 1R9XA 1ZY9A 3BAKA 1H50A 5GJPA 1Y65A 4URIA 4LEQA 2V2DA 1MSSA 3UY7A 5J5RA 3WN6A 5D9MA 2VD8A 1JDCA 1HKMA 4C60A 1HFBA 2Z1XA 2EG8A 1HKKA 2V30A 3M0XA 3VC6A 1US0A 1KRBC 3URNA 4ROQA 5D03A 1MRQA 2QJMA 3BW2A 3W7DA 4MFEA 4QE4A 3GXIA 4H1ZA 3PPFA 4FIRA 2W3ZA 3T0BA 4GY1A 2H8XA 4HN4A 4O15A 3L4VA 1Z6KA 3GTFA 3AU2A 4PB5A 2NXGA 3PUDA 3QGVA 5I3GA 3DCPA 1S2UA 1PS9A 5HULA 1C8QA 1P1MA 5CSSA 1E4LA 1MNSA 4LTSA 1GGOA 4KRTA 4ATLA 4LVGA 1ML1A 2Q02A 2G95A 3GIQA 1IE7C 3IRDA 2XGIA 1OB0A 2NVCA 5TBOA 3B8IA 4XX6A 3NTYA 4DUXA 4QS5A 4M56A 4QDMA 3SRDA 4E4FA 1KM3A 1JEZA 4LNYA 3REQB 4GG9A 4AZ5A 3BE7A 1UP2A 2X05A 3RPDA 5DF0A 3TA6A 3VZYA 1WDWA 3W1TA 3FHAA 2A7RA 3A3XA 4R33A 1SZFA 4NI8A 4Z08A 2C0HA 4K3ZA 1ZAHA 1XD0A 3B3DA 2ZTKA 1JAEA 2CESA 3N13A 3FY1A 1C8XA 3AMGA 2WW5A 4D6GA 1C29A 4E5TA 1WZLA 1JCTA 1OJXA 2VCBA 5AKQA 3IIOA 1PKYA 3IIXA 4DJEC 4YWSA 3EA3A 3WO8A 5LNVA 1JI1A 3IJ6A 3SQLA 5K9XA 1NFPA 3L67A 4MNMA 5AVNA 2BVYA 4IWWA 3VX1A 4GHRA 4IHCA 4AD1A 1J0YA 1GT8A 4M5PA 2PTZA 4QITA 1VYRA 3O0KA 1FWAC 4C6FA 5E0CA 1OC7A 3DIPA 1JCXA 3B0VC 1NY1A 3A12A 3VIKA 2FTPA 1VJSA 5AFDA 3NQGA 3THQA 1KFEA 3NM1A 3VINA 4I8YA 2PZ0A 3AWNA 4LBRA 1D8CA 2BXYA 3F2CA 4W9TA 1RUSA 3D3FA 4DZAA 1OVDA 5LNWA 6XIAA 4GLEA 3ONCA 3RF9A 2OKOA 2ZBTA 1PKNA 1HW6A 3B0UX 4ICNA 1J0ZA 3UG5A 1Q6CA 1BYCA 2XWEA 5G4WA 2O0TA 3LNPA 4N9EA 3EWBX 1PCWA 4ECLA 1TWDA 3JW7A 3TIMA 1H63A 1KR1A 2YL5A 3POCA 2RGLA 4HNTA 5FF4A 2CETA 2J62A 3EPNA 1QWKA 1X6NA 2EG7A 1FX6A 3VGEA 2J77A 4GI6A 3LM7A 3OZPA 2ABBA 3NZGA 4UQBA 4HT3A 3MI2A 1F74A 4PCTA 2PBGA 4UTJA 3BO9A 3W3OA 1IWAA 2REQA 2KAUC 2ABAA 5FJPA 3E6EA 3AIVA 2PA6A 1ZCOA 5A2CA 3T44A 1A5AA 1G0CA 2VJXA 2YDQA 1N8FA 4R7JA 3UA3A 3W1RA 3ANUA 1BG9A 1TPB1 5CEWA 4MLRA 1JRCA 3CUJA 1G9HA 2ZCGA 3D46A 4JD4A 3PAOA 1XXXA 1TRIA 3LMYA 4IP5A 3A3WA 3BK0A 1XG3A 2FHBA 1OZMA 3ANVA 3KP0A 4JFWA 3S1XA 1TRDA 2WCSA 4GC3A 5D05A 2VR4A 1M65A 5I78A 3B9AA 3KFTA 3LSCA 1LM1A 1Q3NA 4MKNA 5CPMA 4AVNA 4IUGA 1TPH1 1M9HA 3PHAA 4CU6A 1XD1A 3V3WA 5A3HA 1E9YB 4MMWA 2UY3A 1TR1A 3T0CA 4REQB 2Q3OA 2QHAA 3SDOA 3W75A 3C8FA 1XBZA 3EX2A 4MZYA 4NASA 4B9YA 5EGRA 4O0KA 2ZXBA 4JIQA 4D6HA 4JIRA 4D72A 3QGAC 1B3YA 1R7AA 1DQXA 3MQTA 1A5CA 4IIEA 5AYYA 4AY7A 1UJQA 2A85A 2C15A 1E0TA 3L68A 3PG9A 1WDQA 1OFPA 1NP2A 1NAL1 3BMVA 1V03A 4GI4A 1SO6A 5CSYA 3FJ4A 1NWSA 5HXMA 3GNRA 2PGEA 4ADUA 1TX2A 1BQCA 3GG1A 5EPDA 1MW0A 3F5KA 4XZIA 3HV8A 1XRVA 1EIXA 3T07A 1OX6A 2PTYA 1VZWA 3R0UA 3ATYA 4NY2A 2H8ZA 3W81A 5K7JA 3KHDA 1XLMA 1ZJAA 1TVLA 2FKPA 2PDIA 1JNEA 2I9EA 3LCIA 2PBOA 4Y8FA 3RHGA 5LA0A 1GVIA 1XH0A 2J6VA 1TPC1 1BKHA 4HSNA 4PRRA 2QCDA 5BCAA 2G3JA 3G1HA 2ZRUA 4LV4A 3RX4A 3BL3A 1EKOA 3BLLA 3FS2A 1VBGA 1J6OA 3SCTA 1XSJA 4P8WA 3EX6A 3BJSA 3R11A 3G5EA 1JZ5A 3NM3A 2YDSA 3BVJA 4UOJA 1PBGA 3PWAA 4UQAA 2A3AA 5IHSA 3GYCA 3CV2A 3IVSA 2QJJA 3SW6A 2PDWA 4JKLA 2NX1A 2YIHA 1NFGA 3C86A 1M03A 3BICA 1RJQA 3KL0A 2QPXA 4WDTA 1AJZA 2G3FA 1UZHA 2EF9A 4A4AA 1OFBA 1L6FA 4EPDC 1TO3A 4M1RA 4LEFA 4O14A 4PMRA 3KTXA 4M7TA 4EVZA 4MY8A 5EFDA 5D9OA 4C6EA 1D7KA 4QLLA 1P7TB 4C6PA 2QLYA 4AZIA 2HPIA 3MSDA 1OYCA 1ISVA 1AZ2A 4PMNA 5FJOA 4IJRA 5I79A 1YQ2A 2CZVA 3EWDA 2CZEA 2WM1A 1O4UA 1F73A 1EF3A 1E0WA 1X6UA 3LY0A 2G41A 4QHRA 2HPMA 3QN3A 4FR1A 4RPPA 1OYAA 3P74A 3O6AA 3ZWTA 3VUSA 4YYFA 2CC0A 2FGZA 4MNKA 4UMBA 1O1HA 4CCDA 1B3ZA 4IL2A 2ZRYA 4D6IA 1EQCA 1MYRA 3E5PA 1FUYA 2V81A 2WJFA 4KWVA 4PMVA 3L9CA 3I3DA 4GUJA 1VYSX 1GZGA 1FBAA 1HGWA 1DJQA 3NVTA 1JCYA 3DH7A 2RDWA 3LEPA 4NUWA 4TO8A 5CXPA 2PF8A 4XO6A 3EYPA 2G96A 2X0HA 3LB0A 3FGCB 3N6QA 4DJEA 4N6FA 4ZSTA 1TA3B 2GGHA 3VNLA 3W1AA 3B8DA 5H8UA 1W3NA 3MI6A 9RUBA 3HM7A 3VNJA 3GIYA 1LL4A 2NW0A 2WZEA 4L61A 5C5YA 3AMDA 2VVNA 3MUY1 2H3BA 3WQ5A 4UQCA 1A3HA 1FWWA 3WH7A 4L1WA 3JR2A 3VXGA 4IMEA 3D47A 5DCEA 1XC4A 3R8GA 5JXQA 1NJJA 2QIWA 3L7RA 3AOFA 5DX7A 1QW8A 5DRIA 4IGSA 2QCCA 1GZ1A 3IUIA 1QU4A 2QPSA 5H91A 1W56A 4IL0A 2WC7A 3UPWA 4YN5A 1YNQA 2PDNA 1E1CB 4JTFA 1VRDA 3K8LA 1W3HA 3PWIA 2Y5EA 4WDUA 3CQKA 1K8XA 1V77A 2XFRA 1UWIA 1W5QA 2VEKA 2BVDA 3C6CA 1YADA 2BHZA 4IIHA 4CNOA 2PE4A 3P61A 1E6QM 3VIFA 1WZAA 5LIYX 3UESA 2VQTA 1FTXA 5DMNA 4O57A 4UB9A 4X3ZA 3W7RA 1S5NA 4NZ5A 1FCUA 2WJZA 1E72M 2DDXA 5A6JA 4AX7A 3AMKA 1S2VA 1TB3A 3W4RA 5A8GA 3L23A 2FVLA 2WVVB 3WNMA 2ZE3A 3BGAA 1XHGA 3RCMA 1YBQB 3ZR6A 4JHMA 4PTMA 2YOCA 4E6MA 2B7NA 3B8VA 1FOBA 3UBPC 3VNMA 4C6JA 2HROA 2HBVA 1LG2A 5LGXA 1V3KA 2C1IA 1MEWA 1PTDA 2PGFA 3LCHA 2RGMA 3OZMA 2ISFA 3H4WA 3W1PA 3INPA 3DERA 2GOUA 5LNRA 1MEHA 3H2MA 1BF6A 1Q4NX 2JK2A 5BMXA 3L12A 4MB5A 3CWOX 4FLOA 3EXSA 4XAPA 4LYPA 1F3XA 3CL7A 3I6TA 1HGYA 1M5WA 3W76A 1R46A 4BZYA 1BSIA 1TX0A 1XIBA 4ICMA 3BSHA 3FV9A 3AJ7A 5FEXA 4YS1A 4AIBA 5ABHA 4QCEA 3RR4A 3WF2A 1E56A 5E09A 3D3AA 1E4NA 3EX3A 4P7QA 1RBOB 1W3IA 4NJHA 1G69A 3RNDA 2D0GA 2E77A 3SIZA 1WNOA 2BLEA 2B81A 5I3IA 4KQNA 1SZNA 3QM3A 1XSKA 3MC5A 1E15A 1K9FA 1GQIA 4LT9A 1PIGA 4JTAA 4RX0A 3T0DA 2NQHA 3QHMA 3C2VA 4S3DA 1JUBA 3M7WA 3BAJA 3P8IA 4LYKA 2I5IA 4NZ4A 4ZQPA 1XCFA 4PFMA 5IFTA 4QJ5B 1DJHA 4YWIA 3Q67A 4HHHA 4IMAA 3IIPA 8A3HA 4PUKA 4ACZA 4HJWA 3HO8A 3WBWA 1NIUA 1BYAA 3MO4A 1GVEA 3SUVA 2YBUA 4OWGA 5DANA 5DMMA 4CD6A 1LLOA 3VOGA 8TIMA 2AMGA 4W5UA 3GW0A 4A8RA 3VNKA 1UC5A 5LSMA 4ZOCA 1QI5A 4BF7A 2VC7A 1OC5A 5LA1A 4DBSA 2OGJA 2CPUA 4IGMA 4U2YA 4N9CA 1FP8A 5CBJA 1K9EA 3DN5A 4D8AA 2OLSA 1HL9A 1N82A 2WJEA 1F6PA 1V02E 2YCLA 2I5QA 1I2QA 3AU6A 3MKKA 1S2CA 2WNNA 4NAEA 1V6WA 2GK1B 3UERA 3HGRA 4ZB5A 2CBIA 3DXIA 2O7QA 3S5SA 3SQSA 1U1UA 4OV4A 3ZLFA 1MXDA 4O1FA 3WLJA 1SSDA 3VMNA 5CAKA 3DHDA 3OLIA 1IEQA 5D33A 3W2JA 3GDRA 3OA5A 1OBAA 4JNZA 4QCFA 4EXAA 4Z2KA 4MZ8A 4WXZA 4MWAB 1XV8A 1OYBA 3KM8A 1V3HA 4RW3A 4TVDA 3DZ1A 1LUCB 3VGBA 1CGYA 5CG7A 1HT6A 2FHFA 3ZZ1A 3IGXA 3TYDA 3EKLA 3DG7A 3UZWA 5I3HA 1T99A 1NOUA 4HBKA 4H3DA 1DE6A 4XISA 1FWDC 4WJ8A 3EMZA 2E6DA 4CN1A 2VELA 5HA7A 3SCPA 4GRSA 3KBMA 2J7GA 1TE6A 7TAAA 1ZFJA 1XISA 1H61A 1E6XM 1TPEA 2ZOXA 1T8XA 1LWJA 2GVEA 1AQFA 1WDSA 3E2VA 4HKPA 1EBHA 2HNEA 4WY0F 2TSYA 1H11A 3TONA 1XYAA 3VD7A 3ZLHA 2Z25A 1JCMP 3UW6A 1UKSA 1C7TA 2PDBA 2G3MA 4PODA 4XSMA 4D6CA 4QAIA 2GDQA 1HP5A 3QV7A 4LRSA 1PKMA 3AFBA 3GUWA 1VH7A 5XINA 3EOLA 3UZZA 1FKXA 4NZJA 2UZ9A 3ARSA 3TV8A 3NSNA 1KGWA 4NIRA 1K9DA 2Y62A 1QOQA 3WEMA 2AL2A 3IAPA 4Q8NA 4DUWA 3MBDA 3NOEA 3SUSA 5FEWA 2X40A 1UP3A 4FOUA 4GCXA 4HMDA 2OPJA 3U9IA 2R1NA 3MW7A 4CEXC 3M6DA 2PWDA 3AXKA 5E0FA 3T0TA 3ARQA 3WBAA 4HNUA 2W92A 4Q8OA 5FI8A 1Z3NA 4QE5A 1FHUA 4UC5A 4OQVA 4JIPA 3AC0A 4LCSA 2J78A 3K30A 1SMAA 1SZEA 4IMGA 3IK4A 2V5DA 4LAOA 1K7EA 4N7QA 1TTIA 3HF3A 1JFHA 2J7DA 1ZHAA 3WD1A 1B9ZA 3B97A 4N9DA 4AHPA 3PTQA 2VENA 2HK0A 2TRSA 4R5EA 4M81A 4MY1A 2O55A 3A5VA 4F79A 3C8NA 4FLQA 3NO5A 1MO0A 2F2HA 5AYZA 2VD9A 4PMDA 1CCWB 5GNZA 1Q85A 1VS1A 4WEVX 3THUA 1BXBA 1YDOA 2JGYA 4IXHA 3CHEA 4GO9A 4MAVA 3N2MA 1OGBA 2RFGA 2CERA 4ZQCA 1FCBA 1OT2A 3EWWA 3FFSA 4C6IA 4NF7A 3B9NA 4Q32A 1WXZA 1BF2A 4JAWA 3OIHA 2XH4A 2Y70A 2QJGA 3LOTA 1DQUA 1JVNA 2V67A 3I10A 1RSCA 4RZBA 1W3TA 1F8MA 4LUTA 4M6VA 4HNLA 4PN2A 5DXXA 2OR2A 1YXYA 2J8GA 3CIXA 3SUTA 3U2EA 3HA1A 1JZ4A 4M6QA 2E6FA 1GYNA 3RR1A 1ME7A 1IGSA 4BQ3A 1R2TA 1TE1A 3W9ZA 5JBFA 5EBUA 2BGNE 1HTIA 3FOKA 4GYJA 5BXSA 3G1FA 3SY8A 3I7SA 1PO9A 1WAUA 4GXPA 5FF3A 2Z27A 3A4XA 4H7VA 1KM2A 3RJYA 4B2DD 4HP5A 2WAGA 3EA2A 3G3MA 1HIZA 2B4GA 2HK1A 4US6A 3I68A 4I9MA 2FPVA 1VPYA 1XJBA 3Q37A 3A21A 5G1TA 1R7OA 4XBSA 2E9BA 4FK9A 3IRSA 1XKYA 2EJ1A 1EA0A 4BEUA 1WCGA 3WF3A 4MTVA 3M43A 5KINA 3FEMA 5CZJA 4PMUA 1LBFA 2R8WA 1P43A 1G4EA 3NPUA 5A6SA 3QOKA 1J96A 4RZ6A 2PDCA 1BKSA 1P1XA 5MKGA 3WEZA 1THFD 4EPEC 4KETA 1R8LA 3WJSA 1L8PA 3V4BA 1DVJA 2C19A 2UY5A 4PUMA 4L65A 4WZHA 2J47A 3PZIA 4AF0A 1QPKA 4PTVA 4F9DA 1AUSL 3W6YA 4Q8MA 4MM1A 2D73A 3TSDA 3GW3A 4IIFA 4Z2LA 5ENLA 3KDOA 5ECVA 2ZXAA 4AIOA 2LLEA 1CXLA 1MUMA 3QF0A 3TCEA 2VFHA 1AH0A 3KLKA 1E70M 1HJVA 1C3FA 3LHWA 2D23A 3W2UA 3TN5A 4AXKA 4D6EA 2NQ5A 2E9LA 3Q58A 1CGWA 4UCGA 3ICJA 4XTDA 4S3AA 4AH7A 4PB3A 2VUNA 1ZBKA 1TPVA 3FCPA 1TQXA 4U2ZA 3U57A 2OOGA 3IUDA 1A5OC 2C91A 3Q4DA 5M3WA 4QG9A 1XIDA 3T09A 1E3ZA 1XRSA 3O07A 2R14A 5D2YA 2POZA 2WBKA 4WDXA 4Q8TA 1YPXA 4GVGA 3HG5A 2FZ9A 2WBGA 4DJDD 2F9RA 3NPVA 3NOYA 4JZ5A 2E67A 3H2EA 1O6IA 4P5UA 1T7LA 3GZ3A 1SJBA 5C6MA 2Y63A 3EKGA 4M0XA 1QCWA 1PX4A 1CLVA 1V79A 4OUEA 3DI0A 4WDWA 5CLWA 2ACSA 3T78A 4FAMA 2WHJA 1J2WA 2MNRA 1TWSA 4R34A 4H9UA 5HATA 3D6NA 3I65A 1N2VA 1MQPA 1IYXA 2A3HA 3VGFA 1TWIA 4S3CA 2HMCA 4LUYA 2CHNA 3T2PA 4CUCA 2OELA 1PZ1A 1FWJC 1UR9A 4XIAA 5REQA 1OCBA 3GRIA 3SN0A 3CS2A 3OYZA 1Q5MA 2V63A 4BWLC 4FNQA 2WWCA 3IANA 3LXBA 4O1CA 4XWUA 1KNWA 5CSUA 3WK2A 4D6JA 4KEVA 1CGUA 1KFWA 1ADSA 4GI9A 3M5XA 3H4GA 2QDEA 4IOTA 1QNSA 4CQCA 3GIPA 2OYMA 5A6LA 1BRLB 1EWEA 2HZGA 3KS5A 5CPSA 5F2GA 4D6DA 4XV0A 2O9PA 3PFMA 3F4DA 1ZLPA 3WQEA 4HN8A 1RJRA 2Y7EA 1X39A 3VIIA 2QR6A 3PPHA 3FJNA 2UY2A 5HUPA 4UR9A 2TAAA 4RNIA 3L0NA 3RLGA 3PAJA 4OFCA 4MNLA 4E8CA 5DXYA 2X30A 1FWSA 4Q7BA 4D1IA 2XFFA 1PDYA 2PTWA 3BURA 4W5ZA 3N11A 3L4UA 5CPLA 1ZENA 1K8CA 3S5ZA 2G3NA 1UZ4A 4ORMA 1UD4A 3KP1A 3VOJA 4UTKA 3VOIA 2C0AA 2AKMA 3DFTA 1B31A 2WSQA 4K8GA 3EX4A 5EMYA 1GHRA 5BWAA 1KBJA 2W67A 4HU8A 5I3JA 1G67A 2NV2A 3H2NA 1B90A 1DTUA 4Q6XA 1Q4WA 1Q6RA 2WZHA 4CNPA 1KBKA 5AHMA 3O6YX 3T4WA 3OP2A 3B0YA 4O10A 4QM1A 4V33A 3GHSA 1PUDA 2HBXA 2NXHA 3RAOA 3W7NA 1W5MA 3UWEA 2WSKA 4UNIA 1JPKA 5F4XA 4IQDA 3TC3A 4CD8A 3M1ZA 4IXXA 3EWCA 1Q6EA 1MQQA 4M51A 3ZR5A 3CV7A 3OTRA 5CG0A 1B4KA 1WP6A 2EEXA 4BKNA 5XIAA 1SGJA 2ANUA 4PTNA 3DYOA 1I0BA 4ICCX 2OOFA 4BQ5A 3BMWA 4IPNB 2RJGA 1PTAA 1ECQA 1LQ2A 4KWOA 4LUIA 5G2WA 3QQ0A 4ZOEA 1T8QA 1A5NC 2ZICA 1RPKA 3KBVA 4YVXA 3GVVA 2DGAA 4OBTA 3RO6A 1FKWA 1YKWA 2PU1A 4Q8UA 4YCPA 2F6XA 5I3FA 1Q2SA 3KBWA 1HXJA 3V5FA 4U5IA 3I7RA 2ZUTA 3BTNA 3U48A 1A3XA 1WO2A 2OEJA 4P7RA 1LG1A 3MO7A 2GUUA 3W1QA 2ZZ1A 1MZRA 2WOQA 1LP6A 2HXTA 3HBLA 4UCFA 2E5BA 3PB0A 3LXCA 4LCRA 1TUFA 4KFNA 4A22A 1ZPTA 3L66A 1CPUA 2EGZA 3G0UA 4B5XA 2BASA 3CQIA 4JQAA 3GG0A 3PUEA 4GH1A 4MFDA 3EMCA 4PFHA 4KFPA 1LTDA 1Q45A 3MANA 1QR7A 4G1KA 4WD0A 1EDGA 4WKAA 5AHFA 2OFJA 4YNGA 4CQ8A 5DFAA 3V1PA 3M0HA 4RDYA 4K7YA 4YVPA 3R1ZA 1QXLA 1OADA 1YDYA 2DIJA 4FR6A 1I6NA 2A21A 4KKXA 4ZENA 4YU1A 4N0RA 3PTDA 3BAIA 2ZUVA 2V9DA 4L64A 2VX7A 4AU0A 1RLCL 5EFFA 1CW2A 2YX0A 1ISZA 2WZIA 4PCNA 3TJ4A 1JYVA 1JI2A 1QPNA 1PKLA 3IARA 4W7UA 5HBFA 4CGTA 3GU2A 3NQCA 3S46A 1SUXA 3FA5A 5D8ZA 3WQPA 5T91A 3VVGA 1DIEA 2C6QA 3CQ0A 5EMMA 2A7NA 1EP2A 1L8NA 2FFIA 1V5XA 1ECEA 2XYLA 2H9AA 1AL7A 5F4WA 1GHSA 2CZ5A 1LLWA 3Q65A 1R0MA 4JIIX 4ORIA 5JMUA 2VOTA 2NT0A 1HJWA 2A3EA 3UWUA 4DM2A 3P81A 2EJAA 3NIYA 4WY0A 4PRTA 3PR2A 3GM8A 3O3RA 2Y5SA 3C2EA 4NNCA 1VKFA 3CQHA 4XD4A 3R0KA 2P76A 4AVOA 1IXQA 2W27A 4JEJA 4OE7A 3C3UA 3STFA 3LENA 4ZQRA 2SFPA 3QZAA 1QNRA 4MJZA 2PDMA 2PFHA 4BJHA 1UASA 2ZFAA 4JTHA 5HWNA 2UBPC 3W38A 3MUCA 3W2MA 3O1NA 1UA3A 1D7FA 2XPKA 3WDPP 5A6MA 1LCOA 1XQKA 3WLKX 3QMSA 4RE2A 1VJZA 2VGGA 3W7GA 1FFQA 1UR1A 4Z2IA 1MVYA 1B3VA 1GORA 3CK5A 4K7VA 3T9PA 1KXVA 5JBEA 2A6LA 4WR3A 2HDJA 4CNUA 5CC7A 1I1WA 4ERGA 4ILSA 3T8QA 2DT3A 3EA1A 2OODA 1W5PA 4HK7A 3DFNA 2FGLA 4TMCA 4KPLA 4INFA 3KRBA 4UFHA 1DHKA 1X1ZA 4JCLA 2PI6A 1UG6A 4TVUA 2PC4A 4TOQA 4H9XA 4UMCA 3UYCA 4BFAA 2W91A 4FNSA 2CCRA 1F8IA 4DBEA 4IIGA 3FDKA 4FXJA 3E2QA 3E0VA 3ZYZA 2ZRXA 4BI5A 4W7WA 1WE5A 1H5VA 3FSUA 2V3GA 4WJXA 2DVTA 4F48A 4OBRA 5AECA 3N73A 5A94A 1XDLA 3LU2A 2WANA 3BCDA 1AFSA 1IEWA 1SFJA 3CLMA 3HZ3A 2DSVA 1QAPA 2PP0A 3GBDA 5FEPA 2IPJA 2B7OA 1B54A 2D2GA 1AZ1A 4H01A 3T42A 4E4PA 3CUIA 3KCOA 2NUYA 4HU0A 4NSBA 2QEZA 1MMFA 3WLSA 2JKPA 5FF0A 2QW5A 4LVDA 4LAMA 3ABXA 3T81A 5TIMA 4HJFA 4RJEA 1K4GA 1KM1A 4B90A 1HZYA 4GY7A 4GQRA 4W4QA 4L6DA 4NJIA 2QCLA 4QXIA 1YTDA 1TV2A 1KTBA 1XDMA 5C70A 5J04A 2E7FA 5I0DA 1DJGA 3QLDA 4S3KA 1DTNA 1UOKA 3QV9A 2GUYA 3LUTA 1K9TA 1R85A 3PZNA 1TELA 1LROA 4YTTA 1KM5A 3W53A 1RQHA 3R0DA 2CIPA 2ZVRA 1K7XA 1K8YA 1EP3A 1Z9AA 1LLZA 1HF6A 1ZJHA 5HAOA 1XIJA 3KVMA 1DWHM 1HG3A 2V82A 3TQKA 4WKHA 1BAGA 4MAZA 3O15A 2DW6A 2FGBA 1TJ1A 1A4LA 1EPVA 3E0LA 3R94A 3PM6A 4ZQOA 4PULA 1UWAA 1EGVA 4QX4A 1ELSA 1ZP4A 4GIEA 3FDGA 3GKFA 1EZ2A 1MI3A 5BWFA 3CWHA 2BGSA 3QFWA 1EDTA 3URAA 1NOWA 2PLKA 1KTCA 2X1UA 3CTLA 1EOKA 3W00A 2FQIA 5HPCA 1R2RA 2YFNA 3NVDA 3MYOA 1W1PA 4BA0A 1TJRA 3RX2A 4C6QA 4R9XA 3BGGA 1Z89A 4UBPC 4K68A 2KX9A 3CAKA 3PNUA 4KCTA 4C6OA 2VEFA 4LB4A 5K3VA 3EAUA 1XQLA 1TR9A 4JY9A 4GJIA 1NDVA 1CIUA 2WV8A 2QZRA 6TIMA 3N9SA 2BTMA 4FX6M 4KS0A 1T0OA 2XWDA 4DJFA 3ZS4A 5DCBA 1VLWA 3SCSA 3R12A 1J01A 2VFIA 4FLRA 1XGDA 1OCJA 1TZ9A 1UMYA 1KXTA 1LRQA 5KITA 3GNNA 3TH6A 3REQA 3Q2DA 4LS0A 2OEKA 1U1HA 3KXQA 3G6LA 2NV1A 3WF1A 3G8RA 2E1DA 4G56A 2AQOA 1L2UA 4Z1AA 5D2XA 1P0KA 3KBJA 3BV4A 4JYFA 3H70A 3RUBL 5HJYA 2VFFA 2OWXA 3AYTA 1DQWA 1X6LA 3PTMA 4JTLA 3T0AA 3CBWA 4LJ3A 4UTHA 3AROA 1E1FA 4LAZA 5KSWA 1G4SA 2Z29A 3TYAA 3L2LA 3U5YA 1RVGA 4NRSA 2R82A 1PEZA 1D3GA 5LHEA 3R58A 3RITA 4X0VA 1EXPA 2PRHA 5C2GA 2NXIA 3IK2A 1BGGA 4IMDA 1XX1A 4IG2B 1G4TA 1FQ0A 1A5LC 2ZE0A 5U4NA 4G2DA 3LHVA 4GH3A 1TTPA 5D9NA 1QPRA 3IVTA 7ENLA 2VVSA 4CCEA 1MDRA 4B15A 1W37A 1ZAIA 5EMUA 4L7ZA 2BZNA 2INEA 4AUBA 1VFHA 4GIRA 4C5ZA 1QNVA 4GC4A 4LF2A 2DZSA 3JS3A 2OZ0A 1NVMA 4KEZA 4ZE5A 4JR5A 4ERAA 4NX0A 4HMNA 2VT0A 4YPJA 5T26A 4P7OA 1GCYA 3RILA 1R9ZA 2D0HA 5FEZA 3VA8A 2WKGA 1HJXA 4PMQA 1PZ3A 1SVDA 2GFTA 4RNFA 4S38A 2OU4A 2DORA 1JIBA 4UTTC 4HPXA 3CEUA 3T4CA 4BHYA 4QFUA 1IXOA 3OHMB 1VGAA 2QDGA 4D2JA 3RLUA 1U83A 4QJ1A 4N02A 3RMEA 1R3VA 3H6OA 1ZRQA 4PBFA 4G9PA 2QJIA 1P0DA 4ZO8A 1BQGA 5F4SA 2C1GA 5I00A 1WXJA 1F9CA 4J3SA 4PH6A 3G1SA 4MYAA 5FCZA 3VPLA 4W85A 2I57A 1KRAC 1FWHC 1J4EA 3MS8A 2DSZA 4BF9A 5G1MA 4RZ5A 3APYA 5LHFA 5FJUA 3CPRA 1JYXA 5A8NA 3NL3A 2A6NA 4J5NA 4J35A 3AI0A 5H8MA 3CQJA 4JDYA 4XB3A 3CUGA 1VAHA 2VURA 4TX6A 2J88A 2J7CA 4AWSA 2QDHA 1G1YA 1KXHA 1PYMA 1C9DA 4I6VA 1QNQA 3BARA 4QEEA 2F6KA 2ZX6A 4I3GA 1M68A 4XVEA 3ZM8A 1XLIA 1ADDA 3FEQA 3O06A 3R43A 1VFFA 5J5DA 2X41A 3P93A 2OJPA 3E02A 1KCZA 3OPSA 1GTEA 1DIDA 5IDZA 3RM4A 3KUMA 4HK6A 4O52A 1U5VA 4REQA 4X60A 4Y9PA 3SSZA 5A6AA 5HUOA 3IJ8A 2J9YA 1AW1A 3HQOA 1YDVA 1OC6A 2DZXA 4PE8A 3GYEA 1VYPX 4H6RA 3SUUA 1MRAA 1UBPC 3WJXA 4H9VA 1QW9A 3CZ8A 2H90A 3GU9A 4IPLA 1VJIA 2YW3A 3GS6A 3FK4A 3UYIA 4D6FA 5K4ZA 3GFXA 2FHCA 3OJGA 1X8FA 3LNMA 3TXZA 2XJ7A 4FS9A 3DX5A 3WFAA 3TTEA 4PUEA 4PA8A 1MXGA 4P8XA 3WX7A 1R5YA 3NL6A 4FEZA 3E3HA 4OKDA 4J3XA 3A5FA 2V38A 3W7CA 1U2YA 3M4HA 2WNZA 3VZXA 3HMCA 1H5YA 3MMWA 3CZEA 1XLEA 3M7SA 4NKCA 3CZJA 4ZGYA 1V3LA 3UJ2A 3NO1A 1TMLA 1O5QA 4J3UA 2Y4SA 2BDQA 3ITTA 1ITUA 4OECA 1X1OA 2QIIA 3E0FA 3OVPA 3NEHA 5D9PA 3AYRA 4RNHA 1UR3M 3U4FA 2Z2BA 4IMFA 1Q8JA 1E0VA 7REQA 3FJLA 3NDOA 4F2UA 4XUGA 1BD0A 4HOWA 3MDUA 5C2XA 3VFCA 5AB3A 2VTFA 3CUFA 1CB2A 1MNZA 1ITCA 3HB9A 3PULA 1ONEA 5CPQA 1HVQA 4UQ9A 3RDKA 3T2OA 2WQPA 5EBAA 1CXEA 3QW3A 2X7VA 1LDCA 1JXJA 2XVKA 3AHXA 4X0NA 1WDRA 1E5NA 5J8LA 3AZSA 4GZEA 3RPTA 4DF1A 4OU1A 1LL7A 4F8XA 1G01A 1B4EA 1P7TA 1V02A 2IKIA 3UCCA 3WZ0E 2YXGA 1RK5A 4Y9AA 4GQ0A 4PTXA 4HU3A 3ZSSA 2WSPA 3NXFA 3MBFA 4QQ3A 2VRKA 2DZBA 3NQMA 4DY1A 2BVTA 1JAKA 3R89A 1EC8A 1UMLA 2Z7GA 4DX3A 4PEEA 4HQVA 1XYLA 3WUEA 2PWEA 1JQXA 3B0XA 3LG3A 4EAYA 1B3WA 4F0SA 3QSRA 1K8ZA 1KKOA 1S3HA 3KTCA 3AYVA 4CD5A 4HPJA 3BJTA 2WC4A 3EPMA 1YDNA 4PGLA 5M03A 3S9ZA 4LBUA 1TIWA 2DT0A 3ABZA 1YEYA 3TN3A 5I23A 5H2ZA 5D8WA 3ATZA 4PCSA 5F2LA 2OT1A 4RDWA 2DZVA 1ZCCA 4O54A 5C9WA 3GQYA 3ZO9A 1AW2A 3WQDA 3FGCA 3H7UA 4QBXA 5C71A 3LQGA 5LXEA 1SZRA 4P61A 3ZT6A 3C2FA 4JTTA 1XW8A 1GPWA 3N9KA 1TMQA 3PJUA 3DC8A 5C9XA 4DWSA 1JPIA 3AXHA 2V8ZA 3JU2A 3S6DA 2FPTA 4DO5A 3EOUA 1KW1A 2VKZG 4RDZA 1GWJA 3WLMA 2FPYA 2IUZA 1O66A 3TZFA 1TJ0A 3V5OA 2PRMA 1GJWA 2QCMA 2GVGA 3GG7A 1PZ0A 2PODA 2QCDB 2EPKX 4DELA 3W01A 3EB3A 1EHNA 5A8MA 3PBWA 4WKFA 1XCWA 5AHEA 2R91A 3G3DA 5A8QA 2NLYA 2J25A 4C6DA 4PMOA 1JNDA 3IIVA 1XIHA 2F7FA 2XDFA 2O4MA 1ZBCA 3WMSA 2FMNA 1I75A 3RYSA 1OG6A 3P5ZA 5HINA 4GZIA 1JF5A 2C13A 1BTMA 4OTKA 4DO7A 3GG8A 4Q4SA 5B80A 3M46A 2XH0A 1PPIA 2YZRA 1VENA 1GVYA 1PJ9A 5M17A 3STCA 2OZ8A 4NP7A 5HOSA 1H62A 2NQ9A 4GY0A 4J7RA 1QPOA 2YFOA 4S2CA 1AJ0A 1VEPA 2ZUNA 2WPGA 2AGKA 3QR3A 4IQJA 1KWKA 1IWBA 5HPOA 4XBKA 1US3A 2CITA 4E2OA 2CW6A 4Q7NA 1KA9F 5IBXA 1LORA 2YBTA 3OLEA 1KLYA 5AC6A 6A3HA 1Q6FA 4L80A 3UT0A 1E3XA 1RVKA 3I4KA 3CHFA 2QCEA 1PIFA 2ICSA 3PZVA 2B7QA 2FIQA 1ONXA 2VDGA 1XYMA 1AA1B 4LUSB 2HRWA 1O68A 4H19A 4IX0A 4ZODA 1RPXA 4LVFA 1JYWA 4CD4A 4EP8C 1T41A 4A3HA 2GOKA 3ABQA 3CO8A 4R7OA 4AY1A 3QYSA 2QGYA 1Q6GA 4AEFA 4LFYA 2KZHA 4NJKA 1IGWA 1UUQA 5LIUX 3DFPA 3OA3A 3PNZA 3LZ5A 1GVQA 1W9PA 3AISA 1XGEA 2XIJA 3RX3A 5M2FX 1BPLB 3DECA 4UTMA 1KFBA 6CGTA 2WB5A 2QUUA 3WQ8A 3SN1A 2CZFA 3GK0A 4FNRA 4A29A 2VEGA 1OX4A 2QF7A 3W84A 3ABSA 4EXQA 5LKYA 2OQYA 4DB7A 1SMDA 4A8LA 1GZJA 1POJA 1LF1A 1CLKA 4TUFA 4L9XA 1ESWA 4U10A 4MHBA 2E6YA 2PWHA 3ZLGA 4U3CA 2OQLA 3SY5A 3LCGA 3S42A 1SZGA 5DO8A 2HEJA 3P67A 3QY6A 3B4YA 2OMAA 3DHPA 1OIFA 2P3EA 3E9AA 5D38A 3QPYA 3MZNA 4JFUA 5LIKX 4MVAA 1BG4A 1JGMA 1EJRC 4HNOA 1AH3A 1UB3A 4JL2A 3STPA 3AAMA 3PZOA 2C1HA 1UWTA 2CYGA 1X7IA 2OYKA 1KFJA 1ICSA 1JL8A 3ITGA 4Z1CA 1TV7A 2PDGA 3V16A 1BWLA 3CJPA 3OBAA 3PWGA 5B7ZA 3DFOA 4XZLX 4F2BA 2WPBA 1Q65A 5FSDC 1QFEA 1P5BA 4JKKA 3PANA 1LT7A 4XBJA 1LWHA 3WNNA 4WXYA 2A4AA 4O13A 1VFOA 2DW7A 3RFAA 3HPFA 3GWQA 2GJPA 3PBUA 3SURA 5C8BB 2VWTA 2AQWA 3I3EA 2GK1A 4YIWA 1PDZA 3H53A 1UD6A 4NX5A 3CZLA 1SW7A 1CXKA 3C2OA 2V5KA 1UP0A 4NG3A 4RV3A 2CEQA 1KRCC 3QEZA 2ISSA 4DRSA 1SFSA 5FL0A 4DXKA 1ADOA 3C3NA 3PFRA 4ES4A 1E1EA 4UTWA 4MWAA 2VX4A 3G1XA 4NNBA 2CBUA 3FA4A 5CGQA 4GQGA 4AWTA 2UY4A 4W8LA 4QTGA 1QHZA 2ZXDA 2E0PA 3H24A 3N6HA 2J66A 2QULA 1WB0A 3V5CA 3C56A 4GACA 4HZ8A 4OZOA 2V3FA 1DV7A 1UH2A 4XZWA 1VR6A 1UCWA 4RXFA 1OINA 3EDEA 4W87A 2CKSA 2WMIB 4N4QA 2FMOA 2FYMA 3GFYA 5FD0A 2Q8ZA 4KWUA 5GNXA 3WLIA 2Y1HA 5CC3A 1ZB5A 3DFSA 5FAGA 5C2CA 3ZJKA 4QROA 3EXTA 3N2BA 2XM1A 3ARVA 3E96A 3LCWA 4G7FA 3C4UA 3ITCA 4IMCA 3F5JA 1A5BA 3LDVA 1I8JA 1U5HA 3G2GA 5KZMA 3GD6A 3A22A 3UPBA 1BXCA 1E5JA 2OVLA 2X0SA 3LI1A 4LSBA 5F2IA 2AAAA 4OOUA 4HMCA 1I2RA 4HNVA 3AXXA 5BRPA 3HV9A 4POCA 5I7GA 1KQYA 1JG9A 4XK2A 4J28A 4FALA 4QR6A 1OSEA 4GQQA 3UJEA 3W71A 5BMWA 3W2NA 4IH3A 1C90A 4LAUA 1WXYA 1GEHA 3B8UA 2AGTA 4I9TA 4UR8A 3P82A 1NWUA 1UIPA 3NDYA 4J3ZA 3WLOA 2BG5A 3VKKA 5AVHA 2WYSA 4ZVJA 3S6OA 3O0FA 3FAXA 1XICA 3IV3A 4C65A 3L4YA 3B9DA 5DQPA 1SR0A 1O95A 2EO7A 1EGMA 3RO8A 1XH1A 4J3TA 3DOPA 4IP4A 5CZTA 4IPPA 1HO4A 5CBBA 3F4WA 1L6WA 3DFQA 4F66A 3A4WA 1DWJM 4AHOA 3CAQA 3GNOA 3SGZA 1OX5A 3PK7A 3VE9A 1S1PA 3SGGA 1Q66A 3W1LA 1FHVA 5KZEA 4P7LA 2HQAA 4H9YA 3F03K 4XD5A 2ISDA 2ZKMX 1G5AA 2YCLB 2YPIA 2ZX5A 3UJRA 3G1YA 2PCQA 2XFWA 2GSEA 4EAMA 5BXTA 2BMBA 4MB1A 3I7QA 1H60A 2CFFA 2DZAA 1ICQA 3FVMA 3UCQA 2J9XA 4HHMA 1U5JA 2V2CA 3BLOA 2VHLA 2E5CA 4DUOA 2DT2A 1Z7AA 2G8ZA 3RCNA 3S2CA 3M5YA 4A3QA 3QGKC 3GHRA 4O19A 2A3CA 4MGGA 3UETA 2GJRA 4QAWA 1PSCA 3O2LA 3SM0A 1J0HA 1M6JA 3ZJ7A 2OYLA 3NEVA 2ZX8A 3NZQA 3N2OA 3E5BA 1DBTA 3A23A 2E1WA 1VCGA 5EB8A 3AALA 1U30A 4WX2A 2I7GA 3S0CA 3VKAA 4CN4A 2Y7DA 2QUNA 3GXFA 1DHPA 4AHQA 3CAWA 3UZ5A 3IUHA 4NJJA 3CWNA 1H49A 5A8PA 2YDAA 3OU8A 3WK0A 4DEFA 4PUUA 4JQ2A 4HA3A 2JE8A 4NRRA 3CPGA 5TD4A 2P8CA 2QJHA 1AQMA 3BGJA 3O6DA 4YTRA 3NQ7A 4DYJA 3IGHX 3LLXA 3PY2A 4E0CA 3N15A 3W87A 2J7BA 4I9JA 1ZZMA 4O0QA 2Y8UA 3AQUA 2FZMA 1P48A 1KBLA 3NFUA 4BEQA 5HK4A 5AHIA 1LRNA 3VE7A 3MSGA 1HJQA 4KCVA 4JHZA 3VYLA 3W7OA 2CLHA 1FDZA 5K2ZA 2PWUA 3TMQA 3NQ8A 1AQ0A 2DPEA 1DORA 1UBSA 3ITLA 4MSSA 1DKWA 1TYGA 3TJXA 1IT7A 3TN6A 2Z1KA 2XISA 4GX9A 3MDWA 4F4RA 1SW0A 3G1RA 2YW4A 2DEPA 4O1DA 3U2ZA 2ZIDA 4LY4A 5DEZA 1KV8A 2CLKA 5BW6A 1K3UA 3L4WA 4MDOA 3AMLA 4LRTA 1G7VA 3MUZ1 5A69A 3MV01 1JYNA 5A6BA 1XYFA 1W2VA 4RE4A 2NX9A 3TLQA 3LCLA 1PWLA 4GA8A 4OT7A 2XN1A 1P6BA 5GQBA 3OB8A 2FDSA 1TCMA 3T08A 3AIRA 2RUSA 4L1GA 4US5A 2W5FA 1F3WA 3T05A 4U3AA 2XSAA 4NXSA 1Y5WA 1B9BA 2XN2A 4KGJA 3GVWA 3N4AA 4NAFA 3DESA 1EEPA 1RCQA 1V7AA 3WY1A 1TVPA 4I7VA 3WKZA 3B06A 4ZXLA 1OEPA 4Q8WA 1E6PA 3GC2A 5TQLA 2CHRA 4O4WA 4G8TA 4WIWA 3BWWA 2FZNA 4JTKA 3V1HA 3B8WA 4KEMA 2WVUA 3OBEA 3GTHA 1C91A 4JL1A 5HDRA 4L4LA 4JN8A 2GGEA 1VPQA 4UFKA 3EDDA 4NQ1A 2D20A 1S46A 4AG0A 1EXBA 4RW5A 3B4UA 4MPKA 2Q3RA 3BW3A 3DKJA 2IW0A 3UR5A 4GYKA 4C91A 3UXKA 3C5QA 4GABA 3C52A 4LUTB 3BH4A 1DJIA 2A7PA 4WGHA 1ITQA 2NVAA 3WQ4A 3NSXA 1OIMA 1WKEA 3BSGA 4H9MA 3W73A 1I9CB 4C7FA 4FIQA 3WH9A 5FESA 2OSXA 3H23A 4AD0A 1A0EA 3V0SA 4TV6A 3B8SA 4KW2A 3WG6A 1LQ0A 1TPWA 4S2BA 2NSXA 2XM2A 1Y5VA 3GDKA 4NT0A 1EUNA 1UQZA 3TVAA 4IFOA 4U31A 1ODUA 4HHLA 2GWNA 2VZTA 3GLCA 2G37A 1IHIA 4JOMA 5LGZA 1PV8A 5K9CA 3C2YA 2X0YA 3G0XA 2BVWA 3DKLA 4XD3A 3H22A 5EA9A 4DIAA 2QCNA 1HVXA 3C0JA 2VX6A 4H7ZA 3AHTA 2DVUA 1SFTA 2VZOA 3N18A 3VKJA 1FWCC 3VM7A 1K7FA 3DHUA 1VFTA 1SU5A 3FKKA 1GNXA 4UUIA 4LPCA 3ELFA 5HR7A 1XL9A 1CEOA 3UQNA 3T6CA 5AC8A 3HQNA 6REQB 1K03A 2PEVA 1GG0A 4Y9NA 3W07A 1OT1A 4N42A 3ZR4A 1AD1A 3UY8A 1RQBA 3UG4A 2GWGA 3IJLA 1JCNA 1Q63A 1PXGA 2AOSA 3GXTA 4O1BA 2GYIA 3F4NA 2R1LA 3SUWA 4NZ1A 3GY1A 3M5ZA 3SAZA 4GUGA 2Y5JA 1KGUA 2OWWA 2J79A 3WFZA 2PDPA 1M7PA 2BY3A 4KIEA 1FCVA 3OQ8A 4QRNA 2E68A 1PHQA 4MJ2A 4K8HA 3VDBA 1N55A 4QJ3B 1WDDA 2D0FA 1HUVA 3BLPX 3O05A 4Q4PA 1GOIA 3FYOA 4ZFCA 1EP1A 4LXFA 3SO7A 2PDLA 1MWOA 3RJXA 2VQUA 3VMPA 3A9IA 5EMJA 4EXBA 3NQVA 3PUOA 4EPKA 3MUIA 5I3KA 2WMGA 5D32A 2Z6IA 4FA3A 2ZUUA 2VXNA 3OQEA 4DBWA 4GISA 1A3WA 1O5KA 4UIOA 3BLFA 1G94A 1K6AA 4GYPC 1VF8A 3U6WA 5D09A 3IACA 3OVRA 2AAMA 4KWSA 1F6KA 3A64A 3E74A 4KERA 1WBHA 1V7YA 3MUAA 4HTBA 4FNPA 3MJMA 2P3ZA 2CLIA 3S5NA 2BNJA 3OO2A 5G4EA 3M0KA 2WKJA 3AXIA 2WMFA 2R9RA 4GPNA 1FXPA 2ZUMA 4Z0JA 3F5LA 3WL1A 3PJXA 1VB9A 3N29A 4B3ZA 4FF5A 1BFNA 4EPBC 1J8VA 1XDJA 1BWVA 3RK8A 5HWJA 5DT7A 2DP3A 4CEUC 1UPMB 3LERA 4IJCA 2HVOA 2ZZ5A 1UOZA 4CN6A 1K6WA 2CLFA 4FXSA 3ZFHA 1FH7A 3HGSA 3NWRA 1I0DA 1REQA 3SCWA 4WLCA 5C9UA 1FWIC 1V6XA 4I7WA 2ZVIA 4R7WA 1R6WA 2JKEA 3GZAA 3KOXA 3BG5A 4CVUA 1IZKA 3W22A 3ARWA 5I07A 2INZA 1WX0A 4MF4A 4TMBA 4C6MA 3FJ6A 2J74A 5D4YA 2I9UA 1GJUA 1C7SA 1JZ7A 1KM6A 2ON3A 5H1WA 1S2AA 5JUVA 3KOFA 3R8HA 2W62A 4B16A 3RRXA 3SADA 1WV2A 3PZGA 4H2HA 2BOGX 2FJKA 4OUIA 3W7KA 8XIAA 5I24A 3ID7A 1IXNA 3BOFA 1H1NA 5E6YA 2VL4A 1ZP3A 4Q4KA 1J12A 2VEPA 2ZRWA 4PRWA 1BWKA 2IMRA 4GINA 1TZZA 1MFVA 2YL8A 4E4UA 1ZQ5A 3H4XA 3U2OA 5CC6A 4HTYA 3NO3A 3PSWA 1Z44A 3H2FA 4RL3A 1VQTA 2O92A 3GH7A 1QOXA 3S1WA 3BZJA 1OK6A 4HCHA 4RUBA 3C2RA 3GAKA 4F0HA 3GBEA 1PYFA 2NT1A 4MUZA 5DBTA 2XVNA 4P8UA 2J7HA 4DO6A 2JIEA 4LGXA 3GNDA 5HMEA 3VCNA 2PSNA 3LS9A 3A6OA 3N25A 4K37A 3WD2A 1L2QA 3WBEA 4DWDA 2ZTJA 1LOLA 3NA8A 3QJAA 3S5YA 1EX5A 3K4DA 5F1UA 1UC4A 3M6YA 1R38A 3C0LA 4BI6A 4DHGA 2E6AA 4DJED 1QOPA 2P0IA 1XRTA 2QCGA 1YRRA 4JTGA 4Z17A 3GVRA 3E49A 4PUNA 2WVTA 1TG7A 8CGTA 2R1MA 2YB1A 2Q01A 2BY2A 3N6JA 2J7EA 2DQWA 2VDHA 5A2AA 4NZFA 4YYCA 3WUFA 2EKCA 1FA2A 2G0WA 2NQJA 2ISVA 4F2TA 2Y6ZA 4BF5A 3W1XA 4GWEA 3DYPA 2CWNA 2YR1A 5JBDA 2XU2A 4IUOA 2BXZA 1K02A 3G6MA 1XLJA 3W0KA 3IS4A 2HWGA 1XIMA 1BLIA 5AY7A 5DY3A 2Y89A 2JEPA 1EYEA 5IDIA 1PX3A 1M7XA 2O9OA 2BY0A 1HKIA 1POKA 3ITXA 1ME9A 1UQYA 4J9JA 2VGIA 3KWSA 4FF7A 3NGFA 3WMLA 3BMXA 3UJFA 3UZXA 2E9MA 4HCDA 3LA4A 4QG6A 4IFKA 1EJVC 3SGUA 2DSKA 4LW7A 2F84A 2W0UA 4BQ4A 4XQ6A 2BS9A 4IT1A 5JVLA 3T7VA 2CLMA 3ZJ8A 2VR5A 1NOFA 4UZUA 2ZRVA 3QW4B 5I3DA 1KCLA 4ZZ9A 1GONA 5I2UA 4JDBA 1W9DM 1OFOA 2PDJA 3UP8A 1GOOA 1P6CA 2HXUA 3GH5A 2ZRZA 3BLKA 1OGGA 1UWUA 5CPNA 5IHRA 1QTWA 4F0MA 4RR4A 4F40A 1KR0A 4O1EA 2VCAA 1Z41A 2RDXA 3V36A 1NF7A 2GVYA 1E9ZB 4CLMA 3NDZA 5LXXA 3TTSA 2NUXA 2O4QA 2H9AB 3LGEA 5CZSA 3FXGA 1W32A 2Q6ZA 3QVQA 4JQ1A 1DJWA 4IM4A 1K4HA 4GXWA 2P0OA 3EWYA 4B3LA 3ZJ6A 4N6EA 3M5VA 4H4IA 4HK5A 4C6CA 4ZL1A 3N9RA 3NXLA 1HL8A 2C71A 3VM5A 1X38A 5FF7A 3L0KA 1T5AA 3M16A 1L6GA 4WCJA 4JTDA 4WY0B 4GXMA 4PMZA 5CPOA 1RQEA 2H6RA 1EPXA 1H0IA 4L4MA 3TZNA 4F0KA 3P3BA 2W6RA 4ZR8A 1EF2A 2EPOA 3V0TA 3FLUA 4B5TA 4BQ2A 2PCEA 3A24A 4XAYA 3TSMA 3G1DA 3UA4A 3F1QA 4UTLA 4O8RA 2X1SA 1QT1A 1GVFA 2J27A 4B92A 4S39A 4GKLA 1FWNA 2YL6A 2FFCA 1J2BA 2Y24A 4R53A 1H41A 3MV11 4YTSA 1KFLA 1E9IA 3KOZA 2VRJA 3WNKA 2OTDA 5EYWA 4R9OA 3TMLA 4HGXA 4S3JA 1P6WA 3P8JA 1IXPA 2EBNA 5CZ0A 3AIWA 4TXEA 3QC0A 3W23A 1W54A 4G7EA 4GYPA 2CLPA 7TIMA 3VGDA 3H55A 1I2OA 1JULA 4E3VA 5FF2A 4JPGA 3CYJA 2FVKA 4LOCA 1EYWA 2OWCA 4E2BA 4WOZA 2Z0IA 4V1YA 3RLVA 1FH9A 5HMSA 3G1VA 1SM9A 3ENLA 3SRHA 4UTFA 5AN7A 3TC7A 1YIXA 3OLDA 2WNWA 2XINA 3OYXA 4HPHA 2Q8XA 5CC5A 2X1RA 1CBGA 3I6EA 2Z24A 4X63A 5AYIA 1XGZA 3AMCA 1KGXA 3GC5A 3G24A 1NDWA 5F1VA 3ZT7A 3S1UA 4PZVA 1QI4A 5BXPA 3OOQA 1VBRA 1UH4A 2QKFA 4GX8A 4D8LA 1XI3A 2UWFA 1QNPA 2PTXA 5CBIA 5IM51 2B7PA 3CHCA 3LTSA 1Q7QA 3TFXA 3QLLA 4FX7A 1V08A 1NDYA 3AS1A 5F2MA 2NSOA 1S38A 2YBVA 2GPTA 1UKOA 4H8UA 4M7SA 2PU0A 4KRUA 2AL1A 4I90A 3JVAA 4ZFMA 3R13A 4M6UA 4QGCA 3VOHA 1X1NA 3HN3A 5HNUA 1U22A 4GE8A 2Y61A 4LAKA 3THAA 4Q22A 1HJSA 3V7PA 5HNTA 2DVXA 2OG9A 3SRKA 3NAVA 1B0IA 2G97A 3VAVA 1HJUA 1WKDA 3ZMRA 4RZ4A 3NR0A 3GXNA 5DCDA 4QIUA 3P14A 3TAKA 3T55A 2J9ZA 1A5KC 1H1YA 3W25A 5CSRA 4HA4A 1RBAA 1YX1A 2XH2A 1UHVA 4GZJA 4HNNA 3CH9A 2E4TA 1NARA 5CKSA 1TWWA 2J24A 4AZHA