3R89A

Crystal structure of orotidine 5-phosphate decarboxylase from anaerococcus prevotii dsm 20548
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
289
structure length
289
Chain Sequence
SNAMKIIDKLYEKVSKNGFVCIGLDSSIDYIPENMKAGKSVSEALFSYNKEIIDQTYDVCAIYKLQIAYYESYGIEGMIAYRDTLSYLREKDLLSIGDVKRSDIAASAKMYAKAHFEGDFETDFITLNPYMGMDSIEPYEEYIEKGDKGVFVLLRTSNPGAKDFEVLPVDGEEFFYKVGDKMRELNEKYIGKSGFGPIGLVVGATHSEEVEKIRKRYDKMFFLIPGFGAQKADSMNVYKLLEGLNGGVVNSSRAILKNWQNYEDGSEKVGYYARKKAIETYEEIKANEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of orotidine 5'-phosphate decarboxylase from Anaerococcus prevotii DSM 20548
rcsb
source organism Anaerococcus prevotii
molecule tags Lyase
molecule keywords Orotidine 5'-phosphate decarboxylase
total genus 110
structure length 289
sequence length 289
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2011-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3r89A00
3N2MA 1XBVA 3C2RA 1GYNA 4RLIA 3FIGA 3PUDA 1UBSA 1VS1A 1EWEA 3EX6A 4TIMA 3B0VC 3UYCA 3GIYA 1IXPA 3A5FA 1WA3A 1OFPA 1G4SA 3STEA 3LHUA 3EEGA 2TRSA 3KRSA 3M5XA 4MYXA 4O54A 3SSJA 4BI7A 4H6KA 1L6WA 4JXCA 1FDZA 1GVSA 4A2SA 1UB3A 1K7EA 3TXVA 4CCEA 5K2ZA 5C55A 1K3UA 4RX0A 5AOUA 4BF9A 3NPUA 4ZQOA 3FA5A 4PA8A 2Q8ZA 3NOEA 5D09A 2ZA3A 3N19B 3NQEA 4CQAA 1J4EA 3PY2A 3W2LA 1KM6A 1WV2A 3E9AA 4PCFA 2VFGA 4GE8A 1JJKA 1QMLA 4MPQA 1PCKA 3EWYA 4X3ZA 1SR9A 3TK7A 5HWMA 1XUZA 1LROA 4WOZA 1ICPA 3LLDA 3ELFA 3L0KA 1H61A 1YXYA 1YLVA 3IGXA 3NQAA 5C2XA 2Y7DA 2B0MA 3UY7A 1XCFA 3N14A 1R2RA 4Z0JA 5F4SA 4HNTA 5LNSA 1UCWA 4DBDA 1OABA 3MJYA 2DZPA 4OGZA 5CSRA 2FLIA 3NL6A 2YGYA 3SJ3A 2FJKA 3GVGA 4ZL1A 1QWGA 2WO5A 1M5WA 4GC4A 3F4WA 4JGDA 3DFQA 3O1NA 1LLZA 3S1WA 2XN1A 4TMBA 5HR7A 2Y70A 3B8DA 3HMJG 4DO5A 3TJLA 3CWOX 3W2UA 2GVJA 3P67A 4TR9A 1KFLA 2JKAA 2NX1A 4R33A 7TIMA 5I3KA 3S1UA 1SZNA 3R2GA 4I7WA 4O1DA 4A2RA 5CZTA 2ZZ5A 3QW3A 3RLUA 5KZEA 4GWEA 1OK4A 1UJPA 2Z2UA 3W1MA 3O6CA 1F6KA 3HG3A 3AJXA 4DF1A 2V30A 4XUGA 3DKJA 2GVLA 1TJPA 1S5TA 4K37A 2DZTA 3UQNA 2W6RA 3QMSA 1YADA 3W7OA 2NV1A 4P61A 4WY0A 4CNPA 1JUKA 3LRMA 3STCA 1Z42A 3IGUA 1PIIA 3W7EA 3S0CA 3R13A 1G4TA 4BWLA 3LTSA 4IMFA 3LX9A 4JDBA 1JCLA 4Q32A 5DBUA 4O12A 3L0GA 3W83A 3L21A 3W87A 3GB6A 3TQ0A 3GXPA 5G2HA 1GVRA 1LM1A 2XFWA 1P1XA 1ZENA 1KV8A 4AWUA 5F2MA 4JD4A 1I2PA 5FEZA 1TRDA 3KRZA 2E1DA 3LV5A 4PTNA 3CC1A 3JRKA 5J5DA 1VYPX 3PWAA 4XBSA 3M41A 5CSSA 2H3DA 2YW3A 3B05A 5D38A 1O94A 3TKFA 4HT3A 1XKYA 1FY6A 4OQVA 4UCGA 2C1HA 1H60A 3S5OA 3W7LA 1TPFA 3LBCA 2VEMA 4KWWA 1TB3A 1TSIA 4MY8A 4YMZA 3S9YA 5F4XA 5LNVA 1IXNA 4YLWA 5FEPA 2Z1BA 1B57A 4N4PA 1W5PA 4IQLA 1YTDA 3NQMA 3G18A 3PSVA 1H7NA 2YPIA 1KTBA 1G67A 4HNVA 3BG9A 4BI5A 1OYCA 2A5HA 3W3OA 3NO5A 3I6RA 2Z6IA 4P2VA 2J24A 3QJAA 4N9BA 3NL3A 3W1NA 3TNOA 2PE4A 2OZ0A 1D3GA 2ZA1A 2DZWA 4BK9A 4ZZ9A 4A21A 3TAOA 3MI2A 4FNUA 2ZQ0A 3GKFA 4TU1A 1ZNNA 3UPWA 3W2NA 3RF9A 4EF8A 3Q2DA 4JYFA 4IOTA 4GJ1A 3OA3A 2ABAA 1B4KA 5AHNA 4LVGA 3EWZA 4LV4A 1WAUA 1PVNA 4O53A 4POCA 4YCOA 3QFEA 3L5AA 2QDGA 3U2OA 1ZAIA 3G3MA 1W54A 3M47A 1GOXA 3HGJA 2V81A 3DBPA 2NUXA 4GFSA 4JTEA 2NXGA 3A21A 2RDWA 1JULA 3NR0A 1F7BA 5FEWA 3WJWA 2QAFA 3CB8A 4BWLC 4FXRA 2C19A 3G1DA 3PG8A 2NWRA 4ZQMA 3ANYA 3MYOA 5LGXA 4NXKA 1YXCA 3NM1A 3L66A 4FX7A 3N3MA 2V2DA 3O6DA 3IV3A 4JDYA 5DY3A 1A50A 1GEQA 2C16A 3H53A 2QCEA 4ONVA 4FNSA 1GTEA 1VYRA 1DQWA 3UWQA 1LLWA 4HHPA 3C6CA 2OX1A 4UFJA 1CX9A 4TMCA 3P74A 1L6YA 1KM5A 3LHVA 1LRTA 1RVGA 3IIZA 4OV9A 4L4LA 1RQEA 2ZTKA 5AN7A 1S5VA 1K02A 4I7UA 2WV8A 3IGSA 2CLFA 3IIPA 5CZ0A 4GXMA 1RPXA 1VLIA 1KM3A 2Y7GA 4O10A 3LTYA 3MUXA 3F1QA 1HUVA 3DH7A 5BMWA 3STFA 1NAL1 2YX0A 5A5WA 4YCPA 4W9TA 3NPVA 1NF7A 3FLUA 3BLEA 2OCZA 3FJLA 1GPWA 2DZUA 4M7TA 3PM6A 3TV8A 3EXRA 1MEIA 3JR2A 1CW2A 1WX0A 4EVZA 2E77A 2HTMA 2I14A 3HO8A 4FHAA 2ZRZA 2Q8LA 4XKYB 1S3HA 3GNNA 5TIMA 1TIMA 2V82A 4IX0A 3TSBA 4L4MA 5D30A 5AHEA 1TO3A 4I9AA 2Y89A 3W1AA 2HS6A 1K7FA 2V2HA 4QAIA 3V75A 5D2XA 3VE9A 3W70A 3SW6A 4CCDA 8TIMA 4O11A 2YYUA 3TAKA 1SW7A 1ICQA 3BO9A 4FO4A 3QQ0A 1FWNA 3F03K 3O6YX 4ORIA 3P8IA 1GQNA 5AFDA 2QEZA 3KHJA 2PRLA 3QPYA 2QCCA 3IIVA 4JS3A 2Y62A 3GNDA 1NEYA 5IM51 2CLOA 1V7YA 3L2IA 1WOAA 4B5NA 4DELA 1A5AA 1LP6A 3LHZA 3LLFA 5AHIA 3T78A 3CIWA 1XBXA 4WOQA 3T55A 4C1LA 4MFEA 2E6AA 4FNRA 1PHQA 2JK2A 2QR6A 2V0TA 2GJNA 1OF6A 2DP3A 3WFAA 2A0NA 2TSYA 3CEPA 4NVTA 2LLEA 3B03A 3GAYA 4O1CA 3THQA 4Z08A 2YCEA 3GR7A 3NQGA 4FB7A 1KFKA 3BG5A 2Y85A 4QSHA 1V5XA 4Q33A 1M7OA 4NU7A 5D32A 2BSLA 1H7XA 5AC7A 3HBLA 3S5YA 4BR1A 3N9RA 4O57A 3HOJA 3C56A 1GZGA 3A9IA 3HPZA 1RQHA 1JCXA 3INPA 1VR6A 3FEMA 2YSWA 1F73A 4DPPA 1FCQA 3L65A 4EF9A 4GBUA 3KVLA 3BW4A 3W85A 1OFQA 2VXNA 4RV8A 1VCVA 4IWWA 3NL2A 3G0UA 2CLHA 3S5ZA 3W75A 1F76A 2CFFA 5HNRA 3UWZA 3IRDA 3CHVA 3QZEA 1PCWA 5D2TA 3MWAA 2FPYA 4UTWC 4UXDA 5D05A 4Z1CA 5L9FA 1QFEA 2QJGA 3OIXA 1EUAA 1ME9A 2H8XA 5LZLA 1H1YA 1K8YA 1G4PA 3DKLA 1LORA 1DL3A 1QOPA 4UNLA 1L6SA 4DBEA 2GUUA 2C13A 1F05A 3EXSA 1HG3A 4UUIA 3C2VA 3KFTA 2ZDRA 1DQXA 3OVPA 4X22A 4FX6M 5CPNA 2BX7A 2ZRUA 1KM2A 2ZFAA 1JR1A 3C52A 3O06A 2C0AA 3G3DA 3UNDA 4WY0F 3SGZA 3UZ5A 2H8ZA 3W7DA 5D04C 5F2LA 3EX3A 2FFCA 4M6VA 4LVFA 3NPXA 3IEBA 3DFOA 3P7YA 5K4ZA 3LTPA 3RMJA 2DJLA 4O0KA 3C8FA 3GYEA 3VNDA 3LCIA 1NSJA 3LDVA 4MIMA 1SQ7A 1D9EA 4O52A 5F1UA 2CZEA 3LI0A 1H7RA 5IBXA 5L6UA 3TDFA 4ICNA 3R5EA 1E51A 1N8FA 1X8FA 3M1ZA 3CPRA 1Z44A 4RXFA 2QJIA 1T8XA 3RNDA 1PS9A 5KZDA 1KFCA 4JTFA 2TPSA 1K7XA 4MZ1A 2J27A 5AB3A 2G97A 4K38A 3BARA 1C9DA 4JX5A 3QRHA 4OWGA 1AW5A 2NX9A 4AWSA 5ABTA 5FEXA 2QF7A 3EKZA 1Z41A 1K8XA 1Y0EA 4NXSA 3ABRA 5D03A 5I3IA 4PH6A 3LERA 2VFDA 1LYXA 2Y7FA 2QCDA 3A24A 3QM3A 3O63A 1FBAA 5BNKA 1O5XA 3NGJA 1T0OA 3EWBX 4DO4A 1ZFJA 4PC8A 2FB3A 1HO4A 3TW7A 4X2RA 4NZJA 1MEWA 4KKXA 4TO8A 1ONRA 4NUWA 1VRDA 4MJZA 1I2QA 1JCYA 4O4WA 5EPDA 2Z0IA 4DPQA 1B4EA 4RZ6A 4UFIA 4E38A 4ZQNA 1SU5A 4QJ1A 1QNVA 1H62A 2RDTA 3EWUA 3FYOA 2V8ZA 3NM3A 2J9XA 3V1PA 3FFSA 1H7PA 3W2KA 1DKWA 1F5ZA 1FUYA 1I2NA 2VFIA 3FYPA 3SI9A 1TRIA 2YW4A 1ZCOA 1EP3A 1TV5A 2ISVA 3UXAA 3W7MA 2ATMA 3BGGA 4M6QA 5GVJA 3L67A 3HGOA 2B4GA 5HWNA 4LC8A 4Y96A 3LXAA 1H7WA 2ZZ3A 5SWUA 5T26A 3EXTA 1JUBA 4M19A 2KZHA 4RK8A 1DVJA 3L0NA 5BW6A 4N6EA 4QNWA 5G1TA 2A4AA 3HG2A 3DFTA 4GUHA 1TTQA 3HQ1A 5AC6A 1TPC1 4FEZA 3NQFA 1O95A 4HKPA 3DFSA 3KXQA 4HSOA 3B0PA 4XTDA 3CIXA 4PODA 4IJBA 2VFHA 1U83A 2BTMA 2QDHA 4JTLA 3VKJA 3QYQA 5EL1A 1TTIA 2DZVA 3RU6A 4O19A 2CW6A 1EEPA 3M6YA 1GG0A 5LNWA 3CEUA 4KFPA 1L2UA 5DELA 5D02A 4XZ9A 3QEZA 3A22A 1H1ZA 2ZZ6A 1X7FA 3IVTA 3W1XA 3HGSA 2GJLA 4N6FA 3FKRA 3W23A 3STGA 4N02A 4IMGA 4UTTC 1YDNA 1KBJA 3EKLA 1A5SA 1VGAA 2CZDA 1MZHA 4FF7A 1QO2A 4DO6A 5IBXC 4Z0SA 3W7KA 1FX6A 1TQXA 4Q4KA 1EIXA 2E5DA 5DCEA 2R94A 2A7PA 5I3JA 4ZMGA 1PL9A 3GLCA 3VI2A 4AHQA 3NQDA 5HUPA 4AHPA 3GDTA 2EKCA 4PFMA 4X9SA 4FIQA 2NZLA 4A3UA 4PL1A 4LVAA 3P5YA 4MJMA 2A6LA 4CQ8A 4JX4A 1ZY9A 5F1VA 2RFGA 1LZOA 3H54A 1W5MA 3BGJA 1F2JA 2J9ZA 3PUEA 3DU0A 3THAA 2ZZ2A 3G8RA 4AXKA 4EWND 3GK0A 3PULA 3M9YA 1Z48A 1TPWA 4JTUA 3Q58A 4NT0A 4WZHA 3W86A 3UWYA 3DI0A 5DBTA 2CLIA 3C4UA 2V9DA 2QKFA 1Q3NA 3CLMA 3RLVA 3BVJA 1QR7A 5DXXA 4JTGA 2ZZ7A 3R8RA 3MI3A 1C8VA 3N73A 2BWGA 3DFNA 1QCWA 4WXYA 4D2JA 3G1FA 3LCFA 2NX3A 2I1OA 3NQVA 3A5VA 3P60A 3SECA 4AF0B 3W1LA 2C3ZA 5AYZA 3O15A 4AF0A 4XTIA 4IMDA 1W8SA 1L9WA 3G1VA 2RDUA 3O16A 3LI1A 2WJZA 4LV9A 2F84A 2H3BA 2JGYA 3KVJA 3O05A 3W7CA 2BLEA 1LOSA 3O8AA 4ADSA 5AHLA 4NQ1A 3QC3A 4K8HA 5HWJA 4NX0A 1H63A 1T96A 4OT7A 1N55A 4OBTA 2E6FA 3HGRA 3VE7A 3DHDA 1AW1A 2GOUA 1DJQA 3DI1A 4WY0B 4O8RA 1I45A 2WNQA 4IX2A 4O16A 5F2GA 4AEOA 4LRTA 4JTTA 3OEXA 4LOCA 1FXPA 3EX1A 2WPBA 5G5IA 3FJ6A 2QJHA 3HG4A 2G5WA 1T99A 1NF0A 3LXBA 4IXHA 3VFLA 5AHMA 1TPEA 3ZFHA 1VZWA 2E68A 5EYWA 4O15A 1XDLA 4NZFA 1OJXA 2NXIA 2WSRA 4R7JA 3NG3A 2OJPA 4ADTA 4KFNA 2QCHA 3ZR4A 3ATYA 4FX8A 1YYAA 3YPIA 2EGZA 2A7NA 4WQ6A 4S2BA 2PRHA 3W1UA 3D0CA 1KFEA 4CNOA 3CQ0A 3TSDA 3MP5A 4K7YA 3TXZA 4RR4A 1FCBA 3S1VA 2XN0A 1DBTA 4UTUA 1ZAJA 1XBZA 4LT9A 5HJLA 1RQBA 3TU9A 1TV8A 2H90A 3W2MA 1Q6OA 2P1FA 3S42A 2X1SA 1DOSA 1KLZA 1U5JA 5D2WA 4ZQCA 3K30A 1BEUA 2YXGA 3W1PA 3KVMA 4WXZA 3LCXA 3MHFA 2QCDB 1IXQA 1VJIA 4IXXA 3SY5A 4LNYA 4UR7A 1BWLA 1TREA 1QDSA 2EHHA 5G4EA 1EPXA 2CZFA 3M43A 2H6RA 5CZSA 1FWWA 1DJNA 2YR1A 1JRBA 4JEQA 3TX9A 5DN1A 1VLWA 1OFDA 4OHQA 4QM1A 2A85A 3G0XA 4FNQA 1KM1A 4Y9AA 4MZ8A 2Z6JA 5D2YA 3P61A 1VHCA 3PC0A 4FNTA 3GKAA 4FNPA 4LS2A 2X2GA 4CQ9A 1TPDA 1P0KA 4N9EA 5C5YA 3I65A 4LS1A 1IGSA 3IIOA 3OG3A 3LBMA 5DY2A 1XDMA 3E02A 3P62A 4IUOA 2R14A 3PBUA 1JCNA 4E2BA 4O50A 1J2WA 2ZCGA 3W7QA 1GYLA 3BLIA 3W7IA 1GT8A 5LNUA 3LRLA 1GTHA 4LVDA 1SZEA 2ZTJA 5KSWA 4LC6A 1YDOA 1TPB1 3EWWA 2GQ9A 4YXGA 4BI6A 2BZNA 1ADOA 2VELA 1H5YA 1LOQA 3MP3A 2E5CA 5LKYA 4IPIA 5AYYA 3W9ZA 4DF0A 3BG3A 3HG5A 1VQTA 5U4NA 4NX5A 2VEPA 3B0UX 3N34A 3L5MA 1W3TA 3P80A 4JY9A 3LXCA 2A1YA 5BOOA 3BW2A 2YFOA 2DORA 3ZS4A 1OF8A 3KAOA 3PG9A 3S8HA 1A53A 3LGEA 3C2FA 2NLIA 4KWVA 1FDYA 2OT0A 4NJIA 3BW3A 3W7HA 4DXVA 2QUVA 2W0UA 3TIMA 1O4UA 2ALDA 1SZGA 4S1FA 3QH2A 4O18A 4LUIA 1I4NA 4HPJA 1RV8A 1KW1A 3SGUA 1N7KA 3R89A 4O28A 4DF2A 2ISSA 2WSYA 2GQ8A 3UWUA 1W3IA 4O0ZA 1QO5A 4NJHA 4JYDA 3TROA 4AAJA 2JGQA 1SO6A 3LHYA 3ZWTA 3QF0A 1THFD 4HSNA 4MLJA 4IMEA 2G96A 1BKSA 3UPBA 1EP2A 1PE1A 3QMTA 2VENA 2ZRWA 4QIUA 3IIXA 3VCRA 4ZQRA 4GUGA 2C6QA 2P0OA 3SFKA 2ISWA 2IQTA 3ABQA 1JUEA 3W72A 1KLYA 3DENA 3IVUA 2DJXA 4FXSA 2OT1A 2V2CA 4QITA 4UMAA 2ZBTA 3MBDA 4XBKA 2I9EA 1WXJA 5TQLA 2TMDA 1M6JA 3R12A 3NXFA 3W7RA 1OX4A 2A2IA 2HSAA 3T44A 3CT7A 3N9SA 5A8GA 2EAWA 4NNBA 5DCDA 1G7VA 3NZRA 3WK0A 3JS3A 3T7VA 3I7QA 4RZ5A 2B7QA 1LDCA 2WSQA 3LHTA 1Q6LA 5G1YA 3KVKA 3TFCA 1LOLA 2CLKA 5G2WA 3DXIA 1GVFA 5FI8A 1MEHA 1TTPA 1YTEA 3C61A 5CGQA 1W0MA 4LU0A 3NA8A 3NVTA 3QPZA 3NL5A 3TE9A 2AAMA 4LW7A 5CPOA 1YXDA 1LRNA 3BV4A 3TSMA 5CKSA 3MYPA 2CLMA 1UUMA 3LOTA 1ICSA 3GDMA 2DZXA 2C14A 5AHFA 3NQCA 4AB4A 4AMAA 3QW4B 4NNAA 2C18A 3C2OA 4FIRA 3G1HA 3G1SA 3NEVA 1B3OA 4RJEA 4Z1DA 1YPFA 1R46A 2X1UA 3RFAA 3MP4A 2WKJA 2O7QA 1IXOA 1LRQA 1TV7A 2Y6ZA 2PCQA 3TA6A 4UTHA 1ZALA 2AQWA 5K4XA 3WJXA 3W22A 4U4MA 5BMXA 2JBMA 1ZAHA 1K03A 1VHNA 4R34A 1QPQA 5E1QA 5G4WA 2VFEA 2QCNA 1TPUA 4LTSA 4E2DA 4MZYA 3G1AA 3W7PA 4JTIA 4N2YA 5DLCA 3C3NA 4UTKA 3UXDA 1VC4A 3CM4A 1GJPA 3M5VA 1OFEA 1SSGA 1H7OA 3UWVA 3W76A 4UNKA 2EF9A 1S5WA 4JX6A 4K36A 5D2VA 1BWKA 4UMCA 1VYSX 4Y6GA 2HMCA 3PVFA 4NNCA 3GDKA 3P84A 4MOZA 4GUJA 5LSMA 5KINA 3NAVA 3NDOA 1TPVA 3EX4A 1FWTA 1H51A 2B7PA 4R53A 4JTHA 2X1TA 4RCXA 2PRMA 3G1XA 2B7NA 1TTJA 4LY8A 2GVGA 4CNNA 1I2OA 5H2ZA 3PUOA 4ZQPA 4MVAA 1G6CA 2FTPA 1SW0A 3G24A 4JYEA 4QNEA 4H3DA 4CLMA 4ML9A 3ATZA 1NVMA 3MO7A 4H4IA 1SFJA 3OBKA 4JTKA 1P4CA 2W79A 2FPTA 3RK8A 3QMRA 3TMQA 4NJJA 4GUFA 2X30A 3PF3A 2F7FA 5FF7A 3SZ8A 5I3GA 1DHPA 2ZZ1A 1FCUA 1W5OA 4HN4A 3W71A 1EX5A 4Y90A 4JY8A 3G0SA 4UTWA 3OHIA 5BRBA 3L68A 4GRSA 5EA9A 2V5LA 4LVBA 4OU1A 3WK3A 4LRSA 4A22A 3DFPA 3LCWA 1W31A 1DORA 2FQIA 3W7NA 1O5KA 1C29A 5G2IA 3M5ZA 1D3HA 5EBUA 5EY5A 4N9CA 2VKZG 2YDAA 3NYZA 2NXHA 3C0JA 4PEKA 2J88A 3TC6A 3MBFA 3O07A 4I7VA 1WOBA 5FF0A 2FDSA 4JIQA 3DGRA 4IGHA 3PBYA 3W88A 1TPH1 2Y88A 2E09A 4QQ3A 4K6AA 2TYSA 1WDWA 4Z1AA 1YPIA 4MFDA 5CPLA 1SO4A 4ALDA 2CLEA 1VCGA 4YWIA 4AVFA 1HO1A 2NUWA 3TH6A 5K9XA 4M5PA 1PHWA 1TCDA 3KX6A 3Q37A 1XFBA 3E49A 5C6MA 1OX4B 1SZFA 3KRUA 4HPXA 4WJEA 4ZVJA 1FWRA 4IMCA 4UTJA 4RKAA 2D73A 2YYTA 4KFOA 5D37A 1OX6A 4J9JA 3ZWSA 2XN2A 3NZ1A 3GZ3A 1F6PA 3G22A 3M0ZA 2A21A 1MXSA 2J9YA 2CWNA 2CU0A 4TX9A 3FS2A 3S1XA 3UZJA 1XM3A 3AO0A 1P5BA 1TYGA 5C54A 3LCGA 4IPJA 1KTCA 1ZHAA 1EP1A 4O14A 4K39A 5LHFA 3C2EA 4JICA 1OVDA 1R2TA 4JNMA 1EB3A 3WK1A 5D33A 3EWXA 2VC6A 3TQKA 4JTJA 1BTMA 2GPTA 3PR2A 1W56A 2G95A 2QCFA 1HFBA 1Q6RA 4M7SA 3NQ6A 1LTDA 4E0CA 1KBIA 1MSSA 1X1OA 1G7UA 1KTNA 1G4EA 4A29A 5LGZA 4OV4A 3I7RA 5K9DA 5KTLA 3MHGA 1GVQA 3TCEA 3W1RA 1OHLA 5KITA 1R30A 2NV2A 1AW2A 1JCJA 1VH7A 1KM4A 1OK6A 3USBA 4UTTA 3WJYA 1FXQA 2WNZA 5H91A 2WQPA 5CZJA 3W74A 4O13A 4Z1BA 3W2JA 4N9DA 4UMBA 3WJZA 3M7WA 3IVSA 1IF2A 1SUXA 4LWWA 3TMLA 1TJRA 1K8ZA 2QUUA 3W1TA 3MMTA 5KZMA 1GG1A 4UFKA 3WJSA 2YZRA 3DAQA 4WUIA 2R91A 2E6YA 3MHUA 4WD0A 1KM0A 2C15A 2Y61A 3LCHA 4Y8FA 5F2IA 4K8EA 4GUIA 2VFFA 4OE7A 5E0KA 2Q3OA 3TFXA 3FOKA 1IIGA 1P0NA 3L5LA 3PBWA 1AL7A 3N2XA 3CWNA 5EMUA 4UFMA 1ME7A 1KA9F 1ML1A 1OFRA 2Y7EA 1EUNA 2ZRVA 3L9CA 1QOQA 2VEKA 4MUZA 5LNRA 3B4UA 3PBVA 5AC8A 2VEIA 2ZRYA 6ALDA 5MHBA 1XXXA 3HPXA 4HNUA 3W84A 3U8GA 1YDVA 3GAKA 2O7SA 3MW7A 4XKYA 4MYAA 3W7GA 1VCFA 1UUOA 1KFBA 2X1RA 4JIPA 4M6PA 3TC7A 1OG0A 1B9BA 2QCLA 4JTSA 3GX9A 1XUUA 3PB2A 3Q94A 5HR6A 1SO3A 1W1ZA 4NJGA 3CTLA 1IIHA 3HB9A 1J5TA 2RKXA 1FQ0A 1SFLA 5I3HA 4DQWA 3UD6A 1Q45A 4ORMA 1AK5A 1PV8A 4RXGA 1OFAA 3TQVA 4O1BA 1FWSA 3T40A 2RH9A 3ABOA 3B06A 2Y63A 2RHGA 1RR2A 2ZA2A 3I7SA 2ZZ4A 3GDLA 5U7SA 1RZMA 3BPWA 1LBLA 3WK2A 2FB2A 1AG1O 1EA0A 5I3FA 4GNJA 1XC4A 2A7RA 2CLLA 2PC4A 3ABSA 3P8JA 5LHEA 4DEFA 1LBMA 1RD5A 1SPQA 3OVQA 4XWUA 2GQAA 4LS0A 3W07A 3LB0A 1ALDA 4JN6A 4O17A 1JQVA 4UFLA 3UY8A 1HTIA 5TBOA 1W5QA 3EB2A 1SO5A 4AHOA 3TUUA 1OX5A 3TR2A 1GWJA 2WNNA 5CG7A 3GXTA 3P81A 3QSRA 1LCOA 3S6DA 3CU2A 4BFAA 2HS8A 2BXVA 1QAPA 3B04A 3LM7A 3LV6A 3E12A 1VPXA 3U6WA 1Q6QA 3LHWA 5HQEA 3HIJA 4C1KA 4HIBA 2E5BA 1XBYA 1YTKA 3M5YA 4K7VA 2JKEA 4UR8A 3NNTA 1EWDA 1A5CA 1FDJA 1LBFA 1SSDA 3PB0A 4UTMA 2JKPA 3LRKA 2DZSA 5HMSA 4XQ6A 2WOQA 2UV8G 1JQXA 4ADUA 2P10A 1OYAA 3MI6A 4UTIA 2YFNA 4AH7A 1WYIA 1XL9A 3I68A 2ZYFA 5HINA 3TW6A 2X16A 5K7JA 1QPNA 3HPSA 3M44A 2ZRXA 4UFHA 3SR7A 1W37A 3P82A 5EKYA 2B7OA 2CZ5A 4YL2A 3W73A 1KV5A 3H55A 2PURA 3KOFA 5J5RA 3E0IA 5HULA 2E6DA 1SW3A 1O60A 1DV7A 2QUTA 2FIQA 2V5BA 4RZ4A 1JVNA 2QAPA 3DHFA 3W7JA 1NFBA 1WBHA 1M7PA 4QISA 4UC5A 2ATSA 2NWSA 3EX2A 1TQJA 3DZ1A 3TJXA 3FKKA 1ME8A 2ABBA 4UIOA 3S5NA 1QPOA 3GR8A 1ZJIA 1WBJA 1JRCA 1GVOA 5KMYA 4MLRA 4UTLA 4NJKA 5FF4A 5DCBA 4MY1A 3G1YA 3NPWA 3UWWA 1AL8A 1UASA 1W5NA 3SIZA 4U28A 3T4CA 3F4NA 5CPMA 4LUJA 1I8JA 3E96A 5DXYA 4EIVA 1A5BA 1FCVA 1QPRA 3NQ8A 4JR5A 5HUOA 1XI3A 3M16A 1CI1A 3PSWA 3BLFA 2NUYA 3W6YA 3HF3A 1HL2A 2A6NA 4O4VA 2J6XA 2QCGA 1OFBA 3LCLA 1X6UA 1F74A 3A23A 3OVRA 5K3VA 3G8EA 1R2SA 1AMKA 3PS7A 2OMAA 4O1AA 5K9CA 3NQ2A 5FF2A 4AWTA 1OFOA 2FPVA 1R47A 4MKNA 1W3NA 1MO0A 5F4WA 4EOUA 5E93A 4CCCA 3QSTA 4G1KA 1TMHA 2Q3RA 2QCMA 1H50A 3GXNA 3BK0A 3W1QA 1X1ZA 5FF3A 4HNNA 4S2CA 4WX2A 5FESA 2DU2A 1I2RA 3NQ7A 2EPHA 4MY9A 2AGKA 5AYXA 3QQ1A 2VOMA 1WQ5A 1JCMP 3GDRA 3PAJA 4N4QA 1KFJA 1G69A 6TIMA 4PL2A 1OYBA 3P5ZA 3HJZA 2R8WA
chains in the Genus database with same CATH superfamily
3TN6A 3N2MA 2H9AA 3C2RA 1Q6FA 4RLIA 2GUBA 1PB0A 3BLDA 3RDKA 1VS1A 1EWEA 1DP0A 4W8BA 4F2UA 3GIYA 4IGSA 4A35A 1OFPA 3STEA 1BVWA 1XG3A 2GGIA 2TRSA 4MYXA 4HB7A 4BI7A 2PWDA 3OLGA 4HOWA 4X0NA 5FSEC 1IGWA 4EPEC 3N3TA 1FDZA 4YWSA 4UOZA 4PMOA 1PAMA 4PN2A 1XLMA 1Z32X 1HJUA 4IFKA 1UB3A 3GXIA 4GYJA 5C55A 5K2ZA 2PDHA 4IUGA 4I8DA 3CK5A 5LIKX 1TUXA 1B3ZA 4IP5A 4AZBA 2DVUA 4DB7A 3FA5A 4PA8A 4LYRA 2QF8A 2QVHA 2V38A 3CZGA 1GVYA 4CQAA 2W66A 1DE5A 1RCQA 1WV2A 3UG5A 4QJ3B 5I09A 3K8MA 4X3ZA 3PPCA 5AYIA 3FCPA 4S3GA 1XUZA 2PD5A 4WOZA 4M81A 1EA9C 1EYEA 1YLVA 2I5QA 3NQAA 4G7EB 3QKEA 1XCFA 3KOZA 3N14A 1R2RA 4GA8A 4R7WA 1JPHA 3GR4A 5LNSA 4LB3A 3MJYA 2BY1A 3BAYA 1VF8A 1ZP3A 4OGZA 5CSRA 3NSNA 3NL6A 2QW5A 1JD9A 2YGYA 4JAWA 1XLHA 1QBBA 5FJJA 3AXMA 4AC7C 4O1FA 1M5WA 4IZGA 3WQCA 2G4FA 4JGDA 1EZ2A 2QMJA 2PBOA 2O4MA 1YE4A 3L12A 4AZIA 4TMBA 2RAGA 4DO5A 1AUSL 3W2UA 4F2TA 3WDQA 3P67A 3TQPA 1YBQA 5DMLA 1UZDA 4YN5A 2NX1A 4R33A 4QG8A 4BEUA 1UBPC 3D6NA 2GSHA 2WJEA 4QEHA 3EAUA 1H49A 2OQYA 3ZQ9A 1SZNA 4TXEA 3K8KA 4HPGA 3RLUA 5FL0A 3ITGA 1OK4A 4LYPA 3W1MA 3O6CA 4KWSA 3HG3A 1FWBC 1I0BA 5JH2A 4XD4A 1QHZA 1TJPA 4K37A 2DZTA 4WLCA 3AIBA 3CUGA 3QMSA 1V6YA 3AMLA 3W4RA 1JYVA 2NLYA 1JG9A 3STCA 1J2BA 4GVFA 3M0IA 5ENLA 3IGUA 2VJXA 4BY3A 1EQPA 4JDBA 1JCLA 1L8NA 2UBPC 3L0GA 5GJMA 3L21A 2RGMA 3UERA 1GVRA 1XIIA 4GY7A 3UA4A 5FEZA 4PBFA 4S3CA 3VNZA 2GYIA 2E1DA 3W25A 2GL5A 4XBSA 5EMMA 1TV2A 4I5RA 5D38A 1XKYA 4Y9NA 5I3DA 1VBJA 2W27A 4Q7IA 1TFVA 3W7LA 1LT7A 3W26A 3ZMRA 3WDJA 4MY8A 1TSIA 3S9YA 2OVLA 3OBAA 3EPMA 2HXUA 5FEPA 2ISDA 2Z1BA 1FKWA 4N4PA 1W5PA 3T2OA 3N25A 2OLHA 1TWWA 4AD1A 2IXVA 2FFIA 2YPIA 1KTBA 3WLOA 1ONEA 1XKJA 4J2MA 4TQTA 5DFAA 3B8SA 4IGNA 1UKPA 3MA8A 3THCA 3RXZA 3QJAA 3W1NA 4HMEA 1ISVA 3TNOA 2PE4A 2OZ0A 2ZA1A 1EJ7L 4BK9A 1FH8A 1E0WA 3MI2A 1S2VA 4HZ6A 2J78A 4PMNA 2QIWA 3W2NA 4EF8A 3RF9A 2PMQA 1A3HA 4YYCA 1BGAA 2PDKA 1KBLA 4FXJA 1O1ZA 1B4KA 3UXIA 2EKGA 4LVGA 3AYSA 1CGXA 4FSAA 3EWZA 4LV4A 4O53A 2DIKA 1HL9A 3L5AA 2QDGA 1QNOA 4ERAA 4M6UA 1ZAIA 4KPLA 5TD4A 1AZ1A 3VIKA 4RPQA 2WLYA 4IPLA 3H2EA 4LQ1A 2I5IA 2V81A 4US5A 2XM2A 4JTEA 3BAKA 2NXGA 1F7BA 1MDLA 2ZIDA 4K68A 3CB8A 1KKOA 2PDFA 3EEZA 4OBRA 2PTYA 2C19A 2NWRA 3CLWA 4XSLA 2VYOA 1EO5A 3ANYA 2IPGA 4LUTA 5LGXA 1CLKA 1NQ6A 3ARVA 3O6DA 1A50A 1GEQA 4QHRA 4KERA 1VYRA 2E9LA 3VGGA 2OX1A 4UFJA 4TMCA 3P74A 1L6YA 1LRTA 3IIZA 4OV9A 3T9PA 4U5IA 4R88A 1W9DM 3IGSA 1VLIA 2OKOA 4O10A 3SUSA 3LTYA 3DH7A 1WNOA 5BMWA 1HP5A 1KXVA 1UWSA 4IP4A 1JZ3A 4YCPA 1GQLA 2ZICA 2WKGA 1G01A 1D3CA 3FJLA 1E72M 1GPWA 2DZUA 4QLJA 4U31A 5H8PA 1J18A 3PBGA 3EXRA 3WBXA 1WX0A 2PP1A 2E77A 2I14A 1VEPA 4B3KA 5C9ZA 4E3TA 4YHEA 1S3HA 2VX7A 3RR4A 3CQHA 1E6QM 5TNVA 3WD1A 2XIOA 3FAWA 1O7AA 1TO3A 2XTKA 5CPQA 1XYMA 5HOSA 2MNRA 5C71A 1JPDX 3D46A 1UWIA 3GNPA 3VE9A 3W70A 3SW6A 2UY5A 3K46A 1RA5A 4GQQA 1W91A 2XU2A 1UD6A 3TYCA 4MWAB 2OYLA 3TWBA 2WANA 1NDZA 3O6YX 1VB9A 3E0VA 1GQNA 5G4HC 3FVDA 1EL3A 5MKGB 4JS3A 3DOPA 1FP8A 1PXGA 3M6DA 1V7YA 5ECUA 4M82A 2JIWA 3L2IA 3UCDA 5C8BB 1A5AA 2VD9A 4GYPC 2FTWA 5AHIA 3KTXA 4WOQA 3LPGA 2XGZA 3V35A 2F9RA 1M1BA 1OF6A 4ZSTA 2DP3A 3M0YA 2VR2A 2TSYA 2D20A 2YCIX 3QN3A 2VZOA 3T0DA 3B03A 2YCEA 1KFKA 2D3NA 2CBJA 4TVDA 3UEQA 4C6KA 1JZ4A 3M46A 3UVAA 5AC7A 4BR1A 3ZOAA 3A9IA 3M0VA 1RQHA 2X7WA 1DIKA 4CN1A 4ASTA 1P6CA 1F73A 1FCQA 3VDBA 3NO3A 3KVLA 1V3IA 5BXSA 4IIHA 3W85A 4DBWA 2WQDA 3TCSA 2CLHA 3W75A 3U2EA 2PWFA 3VOJA 5C2GA 1UZ4A 4LAUA 5DF0A 3WD3A 2BGNE 2OX4A 4MMWA 4NAFB 1X96A 2H8XA 5LZLA 3CH9A 4KEZA 1YX1A 4ICCX 1LORA 1A5UA 1DL3A 1QOPA 4ROQA 3CV2A 4MJ2A 2C13A 4UUIA 3C2VA 1K9TA 9XIMA 1XRTA 3OYZA 5CPNA 1E6SM 3MS8A 4S3FA 1ZB5A 4C6JA 1V6UA 2BX7A 3T4WA 1HF6A 1VD6A 3ARZA 3ARRA 1JR1A 3C52A 3O06A 4PUDA 5F7UA 1EGVA 3W7DA 3GU9A 2DJLA 4O0KA 3LCIA 1O6IA 2OTDA 3NZGA 3THDA 2CZEA 5L6UA 4LUSB 1WAWA 3SURA 5A94A 3S2CA 1Z44A 3E3HA 4RXFA 4ECLA 2QJIA 1KFCA 1PBGA 2TPSA 1FWGC 2XUCA 1OSEA 3CUZA 1Z41A 1FFRA 1AQFA 4NXSA 4Z2KA 3PTQA 4PH6A 3T09A 3BURA 1LYXA 3QM3A 3WQEA 3AHXA 3II1A 3NGJA 3CYJA 1PWMA 3BWWA 2D2GA 3QTGA 4PC8A 2FB3A 2GDQA 2Q71A 3HQOA 3U7BA 1POJA 3V0TA 4X2RA 3O6AA 1R3WA 2HVNA 1ONRA 5DMYA 4IFKB 3AWOA 4MJZA 1I2QA 3ITXA 1JCYA 2ZUTA 1B4EA 4RZ6A 1CBGA 1NOUA 1SU5A 5BU6A 5BRQA 3A9BA 1HKKA 1QNVA 2RDTA 4GI8A 4JL1A 3NM3A 4PB4A 1DKWA 1I2NA 5ECVA 2VFIA 4NASA 3SI9A 2YL6A 4TUFA 2R82A 4HU4A 1R3TA 1BAGA 2ISVA 1OQFA 4URIA 4W86A 1JDEA 4CU6A 1AVAA 3REQA 4MNLA 3R0KA 2ZE0A 5HWNA 4DJDA 2PCEA 1GKRA 2EEXA 1LWHA 2ZZ3A 2HDJA 2FZ8A 2XSXA 3EXTA 4XIMA 4M19A 2HJPA 2KZHA 4WR3A 3RM9A 3WF4A 3HG2A 4UTFA 1EC7A 1E3ZA 1JF5A 5XIAA 3NQFA 4S3EA 4HKPA 4TX6A 3LNPA 3FJ4A 1U83A 4ZOBA 5T8GA 4ES4A 3VKJA 3SJNA 1TTIA 3CPGA 3KRBA 3RU6A 4LCRA 2CW6A 1IZJA 4E2VA 4GQ0A 1GG0A 3CEUA 3UJRA 5DELA 1F9CA 1H1ZA 2OWXA 2Q6ZA 2PDNA 1X7FA 3W1XA 4C91A 3HGSA 2GJLA 5CGTA 3W23A 3H70A 3VM5A 1MMFA 1KBJA 1UKTA 4PSRA 1V0KA 3EKLA 3N29A 1AQ0A 3NTYA 4DO6A 4Z0SA 1TQXA 5CSYA 4ZMGA 1KRMA 4DYKA 4AHQA 4AHPA 4U33A 3SO7A 3VIIA 2EKCA 2GSJA 4TTUA 5A2BA 4FIQA 4PL1A 4LVAA 2QT3A 2A6LA 5HATA 1LZOA 4RPPA 3DU0A 3THAA 4AZHA 2WM0A 1MQQA 4EWND 3GK0A 4YU1A 2J6VA 3GO2A 4A8NA 3W86A 5JBFA 2AL2A 2CLIA 3C4UA 4BQ2A 2D0GA 3GTNA 3CYVA 3WF1A 5DXXA 5DMMA 5HMFA 4XAGA 2WB5A 3IJQA 3FSUA 4B9YA 3RLGA 3DFNA 4XVEA 2VRKA 4D2JA 2NQ9A 2VGIA 2BP1A 3PJUA 3DN5A 4IP7A 4GI6A 3P60A 3SECA 2D1ZA 3AU6A 1UR1A 1GHRA 4QAWA 3LI1A 2VX6A 4QE5A 3K1DA 5CPSA 2F84A 3EOUA 3BC9A 2H3BA 2JGYA 1T6MA 5LIYX 1QATA 3O05A 2PDCA 3EA1A 2WWDA 3AXHA 4NX0A 1T96A 2CNCA 2IKHA 1TVLA 1N55A 4OBTA 1YQ2A 2E6FA 3HGRA 4FZIA 3DHDA 1AW1A 3CIVA 5AVNA 2W9MA 4O8RA 2ICSA 4JTQA 4FP1A 4LRTA 4XD3A 1UA7A 3OEXA 4MHBA 4LOCA 1EF2A 2OEKA 4GGHA 1W32A 2WPBA 2QJHA 3HG4A 2DZAA 3WKZA 1J01A 3QOKA 4IXHA 3VFLA 1UMLA 4AZ7A 4O15A 1OJXA 1SFSA 4R7JA 3LMZA 1CGWA 1V6VA 3ATYA 4UZUA 4QP0A 2AKZA 4RNIA 1TV4A 3W1UA 1VPYA 3MP5A 2XSBA 4K7YA 3TXZA 4ERGA 1TZZA 4UTUA 3MV11 3M4HA 4LT9A 9CGTA 1RQBA 1SJBA 1JXJA 2H90A 2CXGA 4C60A 2ZXAA 3S42A 3SQMA 1UWUA 1U5JA 3K30A 1ZBVA 3KVMA 1QI5A 1QNQA 4E4UA 4DJDC 1TX0A 4JNZA 4PR4A 3RUBL 4IXXA 1BWLA 1R9ZA 1M41A 1W1YA 3SCWA 4B5VA 2GDVA 1BQCA 4JEQA 1DJNA 2YR1A 3SRFA 3TX9A 1FP9A 4W7WA 1CGUA 4QM1A 1CIUA 2A85A 2VX4A 3WEOA 5AC5A 3WQOA 5D2YA 1VHCA 4H9VA 4FNPA 3IJ7A 4LS2A 3ZSTA 5E9AA 5I6SA 3WQVA 3KWSA 4AD2A 4N9EA 2HVOA 4LS1A 4D6GA 3S1GA 1PZ2A 2BBFA 1QRQA 1T7LA 2GWNA 3PBUA 3W7IA 4EPBC 3FYYA 4JEJA 4AD5A 2PTZA 4LJ3A 1IE7C 1SYTA 5LXXA 2GQ9A 3O0FA 4V2XA 2BVWA 1JD7A 3DEQA 1ADOA 1LOQA 2E5CA 1TWIA 2Z1KA 3BLLA 5LKYA 3BG3A 4NX5A 2V3FA 1DJYA 5GNYA 3AICA 4C6LA 1FWFC 5BOOA 2YFOA 2DORA 1EO7A 1Q8AA 1W9UA 3GW3A 3IAPA 1NM9A 5CGMA 1UKQA 2NLIA 4PUEA 2YL8A 4L5ZA 4DXVA 2ON3A 2W0UA 1E5JA 2VC5A 1O4UA 3ARSA 2DDXA 1SZGA 1TMQA 4WDWA 3ITOA 3ZT6A 1F3WA 1KW1A 1Q5MA 4JFTA 3R89A 3SGUA 2Z25A 2ISSA 1KBKA 1TWSA 2GQ8A 1ZLPA 4O0ZA 1QO5A 3RPTA 5DRIA 3IJ8A 3GH7A 2FZBA 4I8YA 3TROA 4AAJA 1A5KC 3U2ZA 2JGQA 3W24A 3LHYA 3CUIA 3QF0A 4Q8QA 1S1RA 4A8RA 1RJQA 4ZOEA 3QMTA 3WLKX 2ZRWA 3STPA 1YNYA 1KWKA 3QR0A 4Q4PA 1KQZA 3UGVA 4HK6A 1W1PA 4K1GA 1FWCC 5FJIA 3SFKA 2ISWA 3BLOA 2IQTA 4JQ2A 4UCFA 3RM4A 4LSBA 4MPKA 4UMAA 3J7HA 4MB4A 5TQLA 4JL2A 4UQDA 3UCQA 3NXFA 4IQEA 2WVUA 3CT7A 5DCDA 3NZRA 2WPGA 2P3EA 4S39A 4C6PA 4AY1A 4J7RA 3JS3A 3ZYZA 3HN3A 3QBUA 2OO0A 1X38A 2XIBA 2E7FA 3TFCA 4R27A 1LOLA 2CLKA 2B81A 2SFPA 1GVFA 1TTPA 1YTEA 5B7YA 1ECEA 4RNHA 4US6A 3VC6A 3QPZA 3NL5A 3WX7A 1ZJBA 1ITCA 3UJ2A 1DEDA 1ICSA 3GDMA 2VWSA 3TJ4A 1A80A 4NNAA 5FL1A 2C18A 3C2OA 1Z7AA 4KQNA 2INEA 1GONA 3G1SA 2O56A 4DWSA 3NFUA 4RJEA 2XFRA 2X1UA 1HNYA 1DE6A 2FZNA 3VGDA 2DZBA 4GXWA 4AX7A 3F5LA 2G37A 3WJXA 4A6GA 1ZAHA 3WQPA 1VHNA 5G4WA 3DCPA 2QCNA 1TPUA 4LTSA 4B2DA 4MZYA 2YCKX 3WMCA 3QLDA 3V18A 4YHGA 3W7PA 5AYBA 4JTIA 2HVMA 3DDMA 1WUEA 1EFZA 4HGXA 1DIOA 1SSGA 2O9OA 3MWCA 4UNKA 4Y9MA 1UPMB 4UMCA 4DWDA 1VYSX 4HJWA 4Y6GA 4NNCA 4AZCA 3EMQA 5KINA 3NDOA 3OZOA 1KBBA 1CB7B 4R53A 2J7EA 4JTHA 4H8VA 5E5CA 2B7NA 1TTJA 3WBEA 5H2ZA 5KETA 3QHOA 1G6CA 2FTPA 2GVEA 2PFHA 1SW0A 4JYEA 4H3DA 2AQOA 3Q45A 3ATZA 5DT5A 3AIQA 3OPSA 5C7VA 1CWYA 1M65A 1SFJA 1QI4A 1YMYA 1S5MA 3CQIA 1NOFA 3GSMA 3OBKA 2OOGA 4JTAA 2W79A 2FPTA 3QMRA 4GUFA 3PF3A 1PKMA 5FF7A 1FCUA 3W71A 1EX5A 3QPEA 3OHIA 5BRBA 5A3HA 4ZGYA 2PA6A 1K8CA 3AUJA 3MQTA 4A22A 1JCTA 1OD0A 4L61A 1RBOB 1E15A 2FVMA 4XZMX 3EA2A 2FQIA 1QASA 3W6MA 3FHAA 4AVOA 3M0XA 5G2IA 5EBUA 5EY5A 4N9CA 3TN3A 3APGA 2EQDA 4PRTA 3TC6A 1NH6A 3DC0A 4CEUC 3IAQA 1WOBA 4QSFA 2OKTA 3U48A 4IGHA 5C9UA 3W88A 1TPH1 4MWAA 2TYSA 4MFDA 5EMKA 1VCGA 1HO1A 1TG7A 4M5PA 1PHWA 1B9ZA 3Q37A 1BRLB 2REQA 3WF0A 4HPXA 4JCMA 1BLIA 1H2JA 3GFXA 1R5YA 4IMCA 4UTJA 3OQ8A 4WKFA 4DY1A 1V6WA 4KFOA 5D37A 3NOYA 3CAKA 1E1FA 3S6TA 1B2YA 1JZ7A 3G22A 4DLMA 3GQYA 2A21A 1W17A 2CKSA 5TAOA 2YL9A 3LCGA 6XIAA 2PGEA 1O1HA 4K39A 3LN3A 1M7JA 1E4NA 2JQXA 2PPGA 4ZB2A 5CLWA 1VBUA 3A4AA 2X41A 3FHQA 2QCFA 2EG8A 1HFBA 1M3UA 3NQ6A 1IYXA 1LTDA 1KBIA 1EC8A 1G7UA 1KTNA 2J7GA 3T81A 3AMGA 3EDJA 2ACRA 4D6HA 2NT0A 5M2FX 1R8LA 1BTCA 3MHGA 4E4FA 1OHLA 5HNNA 1R30A 4A3RA 3BZGA 1JCJA 1VH7A 1UQZA 1KM4A 2IUZA 3T08A 1OK6A 3USBA 1P7TA 1IWAA 2WNZA 3U5UA 3ICJA 3O3RA 1D7FA 3T8QA 1Q66A 2YBTA 3CMGA 3G77A 4UMBA 3V5FA 3M7WA 3KTCA 4CU7A 2WVVA 3TMLA 4LGXA 4P8UA 3CL8A 1GG1A 1AJ2A 3WJSA 3DAQA 1OT1A 5IXEA 2E6YA 1X7IA 3MHUA 1KM0A 4DJED 4GUIA 1AH0A 3I3EA 4DVOA 1KA9F 3AIEA 1OFRA 1EUNA 4PMVA 3CB3A 1RSCA 1QOQA 2VEKA 4MUZA 3KBVA 5D9PA 2Y0FA 2BVDA 3MANA 3PBVA 1Z89A 3QFWA 1YRRA 2FMOA 1SJCA 6ALDA 1KD0A 1XXXA 4QROA 1SGJA 2PLCA 4QBXA 3CZ8A 3ARTA 1VCFA 3T2QA 1UUOA 1Q4NX 3O7UA 2HNHA 1B9BA 2QUMA 4JTSA 3GX9A 3WH7A 3Q94A 4GZIA 4B3LA 1E4MM 5HR6A 2QYGA 2IS7A 4NJGA 1IIHA 4WSKA 2Q02A 1J5TA 1FQ0A 1ONXA 2VO5A 4IIBA 1V77A 1OFAA 4O1BA 3T40A 2Y63A 3VKCA 2RHGA 3P3BA 3I7SA 3D3AA 2XVGA 1AJZA 4GZJA 1XPGA 3WK2A 2FB2A 3VIPA 1AG1O 4XV0A 5I3FA 4B5TA 2A7RA 3C0SA 3PHAA 2PP3A 4WCJA 2ZWZA 1QBAA 4C1NA 3FAXA 4UFLA 1JQVA 3UY8A 3GC5A 3EB2A 1TUFA 1SO5A 1WDQA 3VUSA 5CG7A 3GXTA 4GBDA 1JYXA 1CGVA 1RP9A 3AOFA 4GPNA 3GG8A 1H1NA 1QAPA 5A69A 1XF0A 1V79A 1E73M 1VPXA 3LHWA 5HQEA 1YBQB 2AL1A 4W89A 3MZNA 2JEQA 3JZEA 3N13A 3RPMA 4K7VA 3VIHA 3VKKA 5I02A 1AMYA 5E9XA 1A5CA 4E3VA 1SSDA 4UTMA 1K70A 4KCVA 5HMSA 4XQ6A 2WOQA 1D8CA 2NQHA 3I3BA 4ADUA 4B90A 1VENA 2YFNA 3R0UA 4AH7A 1WYIA 4CQCA 2DSWA 3QVQA 2X16A 1QPNA 1R3YA 4UFHA 4I90A 3SR7A 3E5PA 4UBPC 3P82A 3CUFA 3OGSA 3H24A 2WMFA 2EPKX 2J74A 4ZSUA 1R85A 3E0IA 1SW3A 4WRHA 3ABZA 2EBNA 2V5BA 1JVNA 4PTVA 1C93A 3W7JA 3APYA 2OQHA 1NFBA 2W4XA 3EYPA 4L9XA 3BAXA 2PWUA 2J77A 1UOZA 3FKKA 1M53A 3ARPA 2ABBA 1QPOA 3VKBA 1CXHA 4LEQA 1ZJIA 1XGZA 3B4YA 2FKPA 5KMYA 5KZ6A 5FF4A 4R7OA 4GI4A 3G1YA 2OLSA 1AL8A 1EXBA 2JEPA 3SIZA 3CHFA 1I8JA 5CSUA 4JR5A 4K3ZA 7XIMA 2FHBA 1E0VA 1ENUA 2J6XA 2QCGA 3LCLA 4Q8MA 1F74A 5E09A 3ZXWA 3AMCA 3QZ6A 4PMQA 2BY0A 4X61A 1M03A 5K9CA 4Q8WA 5FF2A 4F0RA 1YW1A 1XH0A 4Z2IA 5JBEA 3U5YA 2F2KA 2GWGA 5D9NA 5BWFA 4FLSA 4G1KA 1B3WA 3MUZ1 4GYKA 2IMRA 2OPJA 1H50A 4HZ7A 2ACSA 3MV01 1X1ZA 1W8GA 1Q2SA 4S2CA 4WX2A 4CUCA 4HOXA 1DPMA 1I2RA 5D8ZA 3JZUA 2AGKA 5AYXA 1PKYA 1WQ5A 1MNZA 4L80A 2HWGA 4H1ZA 3ARWA 3HU7A 4ROPA 1ECQA 2PODA 1XBVA 3QYSA 4DBSA 1RUSA 4XAZA 3EX6A 3N17A 4TIMA 3S5SA 2WMJA 1G4SA 1XCWA 3MUCA 2DH2A 2DY3A 4YNGA 4XO7A 4H9MA 4H6KA 4RW5A 4JXCA 1GVSA 1R3VA 1XFCA 1GPFA 3H22A 2NQLA 1DTNA 1UW9A 4GZ7A 3TXVA 4J1OA 3SY1A 4RX0A 2WBGA 3LZ3A 2TAAA 4H9YA 2PDXA 3L23A 1QHOA 3C3UA 3NOEA 3N19B 2VR5A 3VZZA 1IT7A 3E9AA 1DTUA 4AIEA 5EMJA 3SCPA 1E9IA 1W2VA 4QDMA 4GVHA 2PLKA 4MPQA 1YDYA 3EWYA 4FPSA 1KCKA 1J0ZA 4P7RA 4PUWA 1ICPA 3LLDA 4G7EA 3GDBA 3ELFA 3GUWA 2AKMA 2A3EA 4LBSA 5C2XA 5A8NA 2Y7DA 3WF2A 3M64A 1UOKA 4Z0JA 4XX6A 4ICMA 3H6OA 4HNTA 3ZZ1A 3GU2A 4WEVX 3CHEA 2FVLA 4AY8A 2J25A 2FJKA 3ZVIA 1R3SA 3MTWA 3F4WA 3RR1A 4JKKA 3N18A 3O1NA 1LLZA 1Z8AA 1GOQA 2CHRA 3RHGA 3A3WA 3HQNA 4QE4A 4PMYA 1BSLA 1CTNA 2JKAA 3EWDA 3WN6A 3QOMA 4ZO7A 2XVNA 5I3KA 3S1UA 4D72A 2YB4A 3PJTA 1K4HA 3R2GA 4I7WA 2CHNA 4O1DA 5CZTA 2Z2UA 1UJPA 2O55A 2OZ3A 4MNJA 1F6KA 3AJXA 4DF1A 4NG3A 2V30A 4XUGA 1UPPA 3MUIA 3DKJA 1S5TA 2W6RA 3W7OA 3A13A 2NV1A 1R7OA 3I10A 3PNUA 3LSCA 4QS5A 1L6FA 5IRPA 3CNYA 1Z42A 2FVKA 3WLQA 3PAOA 1HW6A 1PIIA 1AQHA 3FX4A 1KCXA 4IMFA 3T0AA 1UIOA 3F2BA 4O12A 3VIJA 3TQ0A 4YTSA 4DUOA 2PDMA 3B40A 1R0MA 2DH3A 2I7GA 1UR3M 1KV8A 4AWUA 2CESA 2NSXA 1UD5A 5FJOA 5C2CA 4IT1A 3VIGA 3ALFA 1SJDA 1PZ3A 1TRDA 4W8AA 3WLSA 4PTNA 3UFYA 3JRKA 2YBUA 4EXQA 2H3DA 3B05A 1O94A 3TKFA 2DUXA 4PCPA 4ACZA 4UCGA 1C7SA 2C1HA 2OZTA 2ZUVA 3DYOA 4NRRA 4XG1A 1QK0A 4YVVA 4MJ4A 3LBCA 1A0CA 4PYSA 4YMZA 3CZJA 4C6QA 5DX7A 3G6LA 4YLWA 4AD3A 1B57A 1ZSXA 3NQMA 3RJYA 3VGFA 3V4BA 4IL0A 5A1AA 1LG2A 2Z29A 3TEVA 3BG9A 2J47A 3GNXA 1Y7VA 3EOOA 1E6ZA 3CUXA 3N6HA 2Z6IA 4HPNA 4HZ8A 3NL3A 3BOLA 1LF1A 4A21A 4FNUA 4PMZA 2ZQ0A 4TU1A 1VPQA 6ENLA 2DT3A 1Z3NA 4GJ1A 1VBHA 3UGRA 3OU8A 3ORWA 2YXXA 3QHNA 3BLKA 1E1CB 4YCOA 1CECA 5HBFA 3WEZA 1W54A 1GW9A 4CNSA 2R24A 4Z2LA 3DBPA 4J3VA 4GFSA 5I23A 3EDKA 1JULA 1A0DA 5FEWA 2VCBA 3CL7A 3VC5A 3V7PA 4D1IA 2V5JA 1RLDA 4BWLC 3PG8A 3E2VA 4HPHA 3WLMA 4QJ4B 2W63A 5CJ5A 1ADSA 5A8QA 3NM1A 4FX7A 3ABXA 3N3MA 4GJJA 3S6OA 4JDYA 4LB4A 3UZWA 1Q6CA 4DHGA 2QCEA 1DQWA 3UWQA 1RAKA 1EPVA 3C6CA 3WD0A 1PX4A 1CX9A 1KM5A 3LHVA 2Z1SA 3UR8A 4G8TA 1RVGA 4L4LA 3TTEA 1BXCA 3CHDA 1K02A 1RK5A 3RM8A 1OC5A 3IIPA 1KM3A 2XGBA 3FVMA 1GVIA 3MUXA 4ZB5A 3F1QA 3RRXA 4AZCB 4YTTA 3IJLA 4S3AA 1VEOA 1GQJA 3JVAA 3STFA 1NAL1 2F8QA 2BHZA 1NF7A 3W82A 2OCZA 1XLDA 3M0HA 3UZXA 1MEIA 1Q65A 1MRAA 3HO8A 2BASA 2WZIA 4D6DA 2ALRA 3GNNA 4U2YA 5TIMA 4XSMA 1PYMA 3QGVA 3VD4A 3ZJ8A 5AHEA 4GX9A 3QLLA 1O68A 2HS6A 1K7FA 3V5OA 1QVBA 1BSIA 3V75A 5D2XA 1MYRA 2QUNA 3GTXA 3I4EA 3HQPA 8TIMA 4O11A 5E0FA 3WUFA 4IHCA 1ICQA 5JMUA 4C6OA 3FN9A 3QQ0A 3F03K 4DX3A 5HMEA 4OVXA 4ORIA 4JKMA 3WMLA 3QPYA 4Y9OA 1Q8JA 2W3ZA 2Y62A 2ZX9A 1NEYA 2CLOA 3OA5A 4B5NA 4F79A 2ZXDA 3VNIA 3EOLA 1E1EA 1CT5A 1VEMA 2O9PA 1K6AA 3CIWA 3F5KA 1QT1A 5CEWA 2E6AA 4FNRA 1W9VA 2PWVA 2JK2A 2E3ZA 2QR6A 4LAZA 2A0NA 3WLPA 1C8XA 1IV8A 1GHSA 1NFGA 2ISFA 3SRHA 5BWAA 1UZ1A 3GR7A 3KBJA 4FB7A 3BG5A 1E70M 2Y85A 4IL2A 1V5XA 4C7DA 4GG9A 1W6TA 5FSDC 4NU7A 4WHBA 2BSLA 1HL8A 3NGFA 3WNOA 1TX2A 3N9RA 2VCCA 3HOJA 3C56A 1GZGA 4M29A 5EB8A 1JCXA 1VR6A 2PWHA 3BUVA 2YSWA 4QG9A 1XLCA 3BW4A 4H19A 1XS2A 1VCVA 5BROA 5I2UA 1TR1A 4BQ3A 3I4KA 3G0UA 3TJIA 1F76A 1E6NA 1F4AA 2CFFA 2XG9A 3UWZA 1LL7A 3IRDA 1BYBA 3CHVA 3QZEA 3VD5A 2VZTA 2ZE3A 1CB2A 3GBDA 4PB5A 4PUMA 5D05A 4Z1CA 2VDHA 1QFEA 2QJGA 1EUAA 2P8BA 2OR2A 4HK5A 1K8YA 3VX0A 1G4PA 3V0UA 4GY0A 3DKLA 1ONWA 4ATDA 1HG3A 1UD3A 3Q65A 4UQAA 4GH1A 3ZLHA 1E5NA 1BXNA 4KGJA 4X22A 3I6EA 5JIWA 4NP7A 4DBUA 4F3HA 2CCRA 2ZRUA 3WDHA 1BF2A 2XIIA 2C0AA 2ZVRA 3G3DA 3H7VA 2GOKA 3LBOA 4DAFA 3FJNA 3IUHA 4Q8UA 3UZ5A 3TYBA 2H8ZA 2FFCA 1X8CA 4LVFA 4OECA 2VVNA 3LTPA 3MSGA 4FOJA 3VNDA 5CAKA 4FR6A 3LDVA 5CC5A 4MIMA 1V0NA 3LS9A 5F1UA 4Z2JA 4N0RA 4JIHA 1H7RA 3PP7A 2FDMA 4ICNA 1E51A 1N8FA 2G3MA 3RNDA 2R9RA 4JTFA 4S3JA 5M5DA 2J27A 5AB3A 3BARA 4OWGA 1B90A 2NX9A 3PUGA 5FEXA 2QZRA 1K8XA 1Y0EA 4MWAE 3ABRA 1W3LA 4J3UA 2Y4SA 3LERA 3MKVA 4PMUA 3AHZA 1G5AA 5J8LA 5IHRA 4RDZA 2CYGA 3BH4A 1V08A 3TW7A 1D2KA 2EPNA 4TO8A 1VRDA 4DI9A 2ZX6A 3GVQA 5EPDA 2BB0A 2Z0IA 2R1MA 4E38A 1HGYA 1F6YA 1UD2A 1DWIM 1KXTA 4AZ6A 3T42A 3FYOA 2V8ZA 1IWPA 2IKIA 4IG2B 2J9XA 3LM3A 3FFSA 3W2KA 3OODA 3CT2A 3SCQA 3WQ6A 4O0QA 3LYEA 1UR9A 2FZDA 3WLLA 3K13A 3ID7A 2QGHA 4ATWA 1I0DA 1U33A 2RDXA 4M6QA 3L67A 3HGOA 2B4GA 4GIRA 4KRZA 1MFVA 3SCNA 4Y96A 4XIAA 2DVXA 1W1IE 1IZKA 5T26A 4REQA 3BLPX 1JUBA 1TR9A 1XIBA 3AI0A 4N6EA 4QNWA 3WDIA 5G1TA 3RO8A 1XGDA 4ERIA 1RH9A 1B1YA 2PTXA 1KWGA 1LQAA 1QI0A 3PZ9A 4MWAC 1FH7A 1O95A 5EU9A 3ZJ7A 1I1XA 4GYFA 4XTDA 3B0PA 2V3EA 3ENLA 3CZKA 4O1EA 2YB1A 2C91A 4DJFC 2PDQA 3QYQA 1LUCA 1R86A 4O19A 3WNPA 2DQXA 4M0XA 4YVPA 3DFHA 1EEPA 3SQSA 2CITA 3M6YA 5LNWA 1WKYA 2OOFA 1VFLA 4M8UA 5D02A 4PCSA 4XZ9A 5BXTA 4J28A 2ZZ6A 3IVTA 3QV8A 4LUSA 3QV6A 4DI8A 1E40A 5JBDA 3S9ZA 1H41A 5PTDA 3VMPA 1VGAA 5EMYA 2PWEA 4JKLA 3W7KA 1FX6A 3IWPA 4Q4KA 3DUGA 4MF4A 3PBMA 1XCXA 2O9TA 4YYFA 3VI2A 1X39A 3NQDA 5HUPA 2KX9A 1AFSA 3GDTA 1C7TA 4ATLA 5H8UA 3U9IA 1EBGA 1U22A 3SCTA 3QY7A 4MJMA 4CQ8A 3ZLGA 4Z17A 3H54A 3LLXA 1F2JA 2J9ZA 4ENLA 3SCOA 1GUVA 4ILSA 3G8RA 1Z48A 2GQ3A 3K8LA 4GK8A 1KKRA 3RLVA 3VOFA 1A5MC 1WZMA 3MMDA 3KLKA 2ZZ7A 1LT8A 4HYRA 2HCVA 3R8RA 4BEQA 3MI3A 3N73A 3UJEA 1QCWA 1YEYA 1FWHC 2NX3A 1PSCA 4EK7A 5AZ1A 1EJSC 3VOCA 4KCUA 4C7GA 3W1LA 5AYZA 1U2YA 3AMKA 1CXFA 4AF0A 4HJFA 5C7HA 4XTIA 4CKQA 2PC8A 1W8SA 1L9WA 3EDDA 1BG4A 3E2SA 5JQ9A 1NDWA 3H26A 3FK4A 2OLAA 4BF5A 2CETA 3W7CA 4C6FA 1AQMA 3USZA 3QC3A 5HWJA 4IIDA 4TX8A 2GOUA 4O16A 5F2GA 4LPCA 1W3JA 5DRCA 4AXNA 1QW8A 3IACA 5BXPA 1FXPA 3EX1A 3K4DA 1UIPA 4H6RA 3FJ6A 1T99A 4I5XA 3LXBA 2YZ5A 4L64A 1JEZA 5AHMA 1TPEA 3ZFHA 4GX8A 1XDLA 4NZFA 4Q4OA 2WSRA 4BHYA 4XZLX 2XIQA 2OJPA 4MB3A 4D8ZA 4S38A 1CYGA 5FJUA 2V5CA 2QCHA 3ZR4A 4FX8A 1PTAA 1XRSA 4S2BA 2VP8A 3LGDA 2Z1WA 2QV5A 1FCBA 3V36A 4FLRA 3OBEA 1XBZA 4J35A 4AVNA 4FMVA 4OOUA 1Q6OA 2P1FA 2X1SA 3GVRA 1BEUA 3CV6A 1ZBCA 3UF9A 3MHFA 1TA3B 3PWIA 2PEVA 4JNYA 3AC0A 1JZ6A 4LNYA 3FGCA 3URBA 4CNTA 2I57A 5ABHA 2EHHA 3VINA 1EPXA 3SGGA 1UWAA 3ARUA 5BOEA 1FWWA 2NT1A 2FHCA 2BHYA 5CZKA 3AXIA 4MZ8A 3EMZA 5A6BD 2Z6JA 3P61A 3PC0A 2FGZA 2X2GA 4CQ9A 4ZB0A 1TPDA 1E0XA 5C5YA 4J3ZA 1V0MA 1HJWA 1IGSA 5DY2A 2MUCA 3E02A 2E9BA 3T07A 1N8WA 3W7QA 1GYLA 3BLIA 1GTHA 4CN6A 3GIPA 5CH9A 5KSWA 1K9EA 3VUPA 1YDOA 1TPB1 3A12A 2C79A 4MNKA 2BZNA 3MP3A 2BVTA 3SRDA 4IPIA 4WJXA 2FMNA 3ZIZA 1VQTA 2VEPA 4W88A 4A3HA 4JY9A 2HPMA 4HBKA 3OHMB 2DEPA 1MW2A 1UR8A 2VMFA 1ZBKA 4GIAA 3S8HA 7ODCA 3EB4A 3LGEA 1E6RA 3C2FA 1AODA 1KCLA 2OT0A 1V7AA 1R9YA 4NL1A 3TIMA 1BKHA 4LUIA 2BY3A 4HPJA 2BGQA 1QW7A 4O28A 3L4YA 1W3IA 4XZHA 1I75A 3GHSA 3VM7A 4UQ9A 4TVCA 4HHLA 4NJHA 1XHGA 1THFD 1E43A 4HSNA 3DC8A 2XWEA 3H8AA 2WCAA 3WNLA 2BOGX 4FOKA 3WLHA 3TN5A 1KCZA 2C6QA 2OB3A 3THUA 2WCGA 2XGIA 3TYAA 1XX1A 3DENA 2E0PA 1I60A 3AS2A 4KGLA 4XBKA 2ZBTA 3MBDA 4JPGA 1MXDA 4PZVA 1UQYA 3OIHA 3HPAA 3VXGA 1JYWA 2DSUA 1OX4A 3T44A 3N9SA 1PPIA 5A8GA 4NNBA 1G7VA 5FOOA 4E8CA 3I7QA 3CJPA 1LDCA 3LHTA 1NU5A 1B3XA 2XSAA 5G2WA 4OUIA 2ODOA 5FI8A 2I56A 2ZKMX 5CGQA 5KEZA 1X97A 1W0MA 3R58A 3NA8A 4I6VA 3NVTA 2YCLB 4LW7A 1LRNA 3TSMA 2WC4A 4QEEA 4V15A 5CKSA 3VX1A 1HVXA 4MDOA 3MYPA 2CLMA 4D6JA 4D8LA 3H2CA 1EHAA 3W0KA 1PJ9A 5E6ZA 1JGIA 4Z1DA 4C6CA 3SM0A 3RFAA 3QGAC 2WKJA 1TV7A 2PCQA 1NARA 4CD4A 4HMCA 4EXBA 1ZALA 2AQWA 5A2CA 5K4XA 3MVIA 3OTRA 1NFPA 1SFTA 1K03A 2Y2WA 4R34A 3RG6A 1VBRA 5D9OA 3V16A 4PCTA 3ZJ6A 4W84A 3GD6A 2JF7A 4N2YA 5BYWA 1RVKA 3W38A 1VC4A 2D0HA 3M5VA 1H7OA 4DO7A 3UWVA 3W76A 2EF9A 1S5WA 3XINA 5D2VA 1FWEC 5IDIA 2J7CA 3DYPA 1P6BA 2HMCA 4MOZA 2V6AA 4GUJA 3EX4A 1H51A 2B7PA 3Q4DA 4RCXA 5LIXX 2PRMA 2WAGA 3CAVA 3ZVHB 5E0CA 3M0LA 4CNNA 2D22A 1KO0A 2XPKA 3GRIA 2OELA 1I6NA 2QLYA 3Q67A 1E9YB 3G24A 2Q01A 1YIXA 1Y5VA 3P0XA 4H4IA 5EFFA 3SUWA 1P4CA 2OSYA 3WY1A 3T1GA 2BXYA 3NVDA 3CUJA 1WZAA 4LYQA 2QMKA 3SZ8A 5I3GA 1DHPA 1KRCC 2WC7A 3ITLA 3AS1A 2YDSA 4O8AA 3BSMA 4ZXOA 4JY8A 1NWTA 4P5UA 3L68A 2PDJA 4Z2HA 1BG9A 1R3QA 2V5LA 4Y8EA 4PUNA 3LCWA 1W31A 2V67A 1GKQA 1JAKA 3A4JA 4MG4A 1R6WA 1KR0A 4PUJA 2OYKA 3HTWA 3M5ZA 2F38A 4KETA 3QV9A 2WVVB 3O07A 4I7VA 3IGHX 4XZIA 3DGRA 3PBYA 1XW8A 4CD7A 2Y88A 4C6MA 4K6AA 3N12A 3WD2A 1UUQA 4FI4A 5CPLA 3IJDA 3AZTA 2C7FA 1KGUA 1ZS2A 3WZ0E 3KX6A 3OLEA 5C6MA 1BYAA 1OX4B 1SZFA 2HV5A 1P1MA 4RKAA 4GH3A 4J9JA 3ZWSA 4C6DA 3M0ZA 1MXSA 1MRQA 4NILA 3G5EA 3S1XA 3WUEA 3AO0A 1TYGA 1BFNA 4OIFA 4BZYA 1VFTA 4F0MA 4O14A 1V3HA 4PULA 4F0HA 1DHKA 4JICA 3E74A 1E0UA 1OVDA 4JNMA 2VC6A 1PO9A 5FAJA 1BTMA 1Y8BA 2GPTA 4PRWA 2G95A 1V03A 5IDZA 1Q6RA 2OZ8A 3UCCA 4C6IA 1MSSA 4A29A 3BZJA 4OV4A 5A8PA 1MW3A 3AJ7A 3KOWA 4HU3A 4G9PA 4GXPA 4NHVA 3WJYA 3W74A 5H91A 3WG6A 2PDWA 2GUYA 2F6UA 1E6XM 1EOKA 3CTTA 3WJZA 1IF2A 4LWWA 1J6PA 4AFYA 4MSSA 5KZMA 4UFKA 3VYLA 3W28A 4WUIA 1REQA 2EG6A 2R91A 1C3FA 3KP0A 1QJWA 2Y61A 1XINA 3LCHA 3MMWA 4OE7A 5E0KA 3TFXA 3L5LA 4DWSB 2YDRA 1DXEA 2J7BA 3CWNA 2AL2B 3N2XA 4CEXC 5EMUA 1ME7A 4HYVA 5E70A 1V02A 3WQ4A 2EXOA 3EWCA 1FOBA 4F0SA 2ZRYA 2YIHA 2XH7A 3QY8A 5EMLA 3VNJA 3W84A 2X7VA 3MW7A 4XKYA 4H83A 5E6YA 1XDJA 5FACA 1U30A 3W7GA 8XIMA 2WYSA 4JIPA 3ALGA 3R25A 2YDQA 4AYGA 4H6EA 2YA2A 3SY8A 3VNKA 3AALA 4P7NA 1SFLA 1ZRQA 1XLLA 2HISA 5HAOA 1IEIA 3ABOA 2QNEA 2EJ1A 3F5JA 2WMIA 1RR2A 3GDLA 3LY0A 5U7SA 1RZMA 1RP8A 1XH2A 3N2CA 3NXLA 3POCA 1XC4A 4KF1A 1UJQA 2CLLA 3KUMA 4H01A 1RBAA 1RK6A 1LBMA 2WZTA 4GKLA 1RD5A 2WSKA 1VJZA 3LB0A 4JN6A 1MNSA 3VNYA 3LSBA 4LNCA 4AWEA 1GZJA 1IQ8A 3TR2A 5A8MA 5I00A 1GWJA 2WNNA 4GINA 1TJ1A 3AISA 4S3BA 1V3KA 1LCOA 2J8TA 1CLVA 2EO7A 4K8GA 2PTWA 3B04A 3E12A 3PTMA 4LCSA 5M03A 3HIJA 4HIBA 3VGBA 1YTKA 5HQLA 4AYSA 2JKEA 3SUVA 2J7HA 1K1DA 5A6SA 4PUUA 2JKPA 4D6EA 3PFMA 4QGCA 1TELA 3HFTA 2UV8G 5LA0A 2QS8A 3TTQA 1KGXA 4UTIA 4AIOA 1HGWA 3UG3A 1XLKA 3BOXA 3TW6A 4RNFA 1W37A 5EKYA 3BSGA 5H8MA 2CZ5A 3H55A 1TCMA 3FDGA 1HN1A 4ZODA 1DV7A 4IFRA 2QUTA 1F3TA 2FIQA 4RZ4A 2QAPA 2VGGA 2ZUMA 5XINA 4ZOCA 3PZQA 1M7PA 1Y65A 3PZNA 1XYLA 3WLIA 3ZO9A 2FYMA 2NWSA 1TQJA 4KW2A 4DYJA 4W7VA 1HKWA 2QPXA 1VFHA 1EQCA 3GR8A 3NWRA 1DYSA 1JRCA 1WBJA 2Y8VA 4NJKA 5DCBA 4P7QA 3NPWA 3OB8A 3DG3A 3NUKA 3VK5A 3OG2A 3F4NA 4HP5A 3RX3A 3RMEA 1GQKA 3E96A 1N2VA 4EIVA 1A5BA 3NQ8A 5HUOA 1US0A 4R9OA 3BLFA 4WJ8A 3WQ8A 1A47A 2C8NA 4R85A 1OFBA 3R43A 1W1VA 3G8EA 5BCAA 2QJMA 3SRKA 1R2SA 3OZMA 3BXWA 4DRSA 2OMAA 2YJQA 2UY2A 3HZ3A 4O1AA 1NOWA 1KQYA 3O9NA 4RW3A 4Q8NA 1XJBA 2FPVA 5ABFA 2VUNA 4C6EA 5E93A 2BG5A 2PDLA 4XO6A 3TYEA 2ZVIA 2DT1A 1MVYA 3BK0A 3TA9A 4MB5A 3W1QA 3WENA 2OG9A 3MJMA 1EH9A 1J0JA 4IM4A 4D9PA 4QDWA 1E3XA 3QQ1A 1E1CA 2VOMA 3E2RA 4JN8A 1RPKA 4LANA 4GFIA 1OYBA 3HJZA 2R8WA 1GYNA 1GOWA 4M3PA 3FIGA 3B8UA 5FAGA 3DERA 4S3KA 3UYCA 4GGBA 1NP2A 3AWNA 4KMQA 3S2MA 4F8XA 3ITTA 1P0DA 3M5XA 4O54A 2XJ7A 2PI6A 1L6WA 2VCAA 2BY2A 3QXBA 3VD9A 3GXFA 1CZ1A 1YNPA 4XK2A 1KFWA 2ZWYA 4PFHA 5JUVA 1JYNA 3K1GA 3NPUA 2WCSA 4IG2A 1JZ5A 5CPTA 2Q8ZA 3FGCB 4XD6A 3W29A 1J4EA 3W2LA 4YTRA 3A6OA 2VFGA 1HT6A 1JJKA 4CN4A 1QMLA 1FH9A 4BKNA 5HWMA 4G5DA 3L0KA 1H61A 3IGXA 2UY4A 4XZNX 3RCMA 3UY7A 2BGSA 3POHA 3CHCA 3ZR6A 2DFAA 5BXRA 3E0WA 5F4SA 4AX6A 4E5TA 3PPHA 1W1TA 4CNUA 4PEEA 2YL5A 3R10A 3ARQA 3SJ3A 3SAZA 4M80A 1QWGA 4GC4A 3RJXA 4JOMA 1H3GA 1GKPA 1CPUA 3RLHA 5HR7A 3B8DA 3HMJG 3TJLA 3CWOX 3GFYA 4DIAA 2GVJA 3N2OA 3RX4A 4CD5A 4ZCWA 4PSPA 1PKNA 2O0TA 4HHHA 2ZC1A 4H9XA 3BDKA 4A2RA 3PPGA 3QW3A 4C1NB 1UR4A 4HD5A 2X09A 1A0EA 2ONEA 4OTKA 4A4AA 2GVLA 6XIMA 4I9MA 3UQNA 5REQA 5T91A 4HA3A 2XIMA 4CNPA 1JUKA 3LRMA 2D3LA 4R5EA 1AJ0A 2E4TA 1TE6A 3W7EA 3S0CA 3R13A 1DJHA 5I77A 1JPMA 1O5RA 5DBUA 4DM2A 4H7ZA 3GB6A 1D8WA 3GXPA 4GO8A 2D23A 5G2HA 4HMDA 1LM1A 2XFWA 1V8EA 1P1XA 1ZENA 3UVIA 1QNPA 1AD1A 1ZPTA 1SMDA 1F61A 5F2MA 4Q8OA 1I2PA 3IPWA 2W92A 3VDHA 1IT8A 2QXWA 3MVTA 4KCWA 3LV5A 3WBAA 3CPUA 1QI2A 3CC1A 5J5DA 1QTWA 2YW3A 2Q09A 2F6XA 4JQ1A 3WCZA 4HT3A 1JZ2A 3NYDA 1FY6A 2BFGA 1IZCA 2P0IA 2PDYA 1H60A 3IJIA 4FLQA 4GI9A 1JDCA 3D3FA 1TPFA 2ESCA 2VEMA 4KWWA 1B3YA 1OB0A 5F4XA 1XYCA 4HOZA 2X40A 1EGMA 2OYMA 2CXEA 4IQLA 2W67A 1YTDA 2DSKA 2V5DA 3G18A 1H7NA 1G67A 2NQ5A 2PGWA 4NYUA 5C70A 3W3OA 4IF2A 4PUKA 3I6RA 3DHPA 2BHUA 1HX0A 1RXOB 4J40A 3M0JA 3WH6A 3VZXA 4P2VA 2J24A 4GOAA 4N9BA 3FDKA 4NRSA 2G0WA 5DO8A 4F0KA 1V51A 4MKSA 3W37A 1ZNNA 1JI2A 3L7RA 5DQPA 3Q2DA 4JYFA 1T40A 2CBIA 4OFCA 3OA3A 5AHNA 5JXQA 2YLLA 2XISA 1OADA 4POCA 1E6PA 1VAHA 3QFEA 2GLKA 3WQGA 3VO0A 3M47A 3HGJA 4OOZA 2C1IA 2NUXA 4A3YA 1UP3A 2RDWA 3NR0A 5A6JA 3RCNA 4W93A 4KRUA 4FXRA 7A3HA 3SCVA 4CVUA 3U4FA 4C5ZA 3UT0A 3A4XA 1GEHA 2P76A 1XV8A 3ARXA 4ONVA 1LLWA 4ZR8A 2WWCA 2C71A 3VOGA 1J0IA 1X6NA 2A3LA 1K9DA 4ACYA 3BQ5A 4WSJA 3VGHA 2WV8A 1RALA 2CLFA 4RE2A 1XC6A 3WD4A 3E6EA 1HUVA 2NV9A 1S2WA 2GJXB 4M51A 3R8GA 2YX0A 5A5WA 2HEJA 1BHGA 3EMCA 5CG0A 2ZXBA 3BLEA 4ML4A 1EBHA 2INZA 5A95A 3PM6A 2OO6A 3CUHA 1CW2A 3AZRA 3APTA 1GCYA 2HTMA 4NI3A 2ZX7A 4H8HA 1GYMA 3LPOA 3OGVA 2WNWA 4IIFA 4AZ5A 1TIMA 2GGHA 5HQMA 1EOMA 4IX0A 4L4MA 4ZE4A 3SQLA 3F2CA 3QR1A 4P7LA 3LQLA 5FKYA 3RITA 2Y89A 1Q2RA 3W1AA 2O4QA 4XZBA 3MPGA 1F8IA 3F7JA 3GM8A 2J79A 2OXNA 4V33A 2WKLA 1DWGM 3TAKA 3N9KA 3BO9A 3C8NA 3NZQA 3HV9A 3AHYA 5HJXA 2PRLA 4DWSC 3H4XA 4LAKA 3PTKA 4D6FA 2E40A 2PAJA 3GNDA 5IM51 2Z7KA 3KS5A 4GC3A 1WOAA 3KM8A 3LHZA 1LP6A 2I9UA 3WLRA 3T78A 1VFMA 1XBXA 2PDIA 4MFEA 1PHQA 3CAQA 1A4LA 2V0TA 1KRBC 2GJNA 3M0KA 3WFAA 1UH4A 1GJWA 4QE1A 2PDPA 1X1NA 3S9IA 3CEPA 2DIJA 5A6AA 4O1CA 5CJNA 3K4AA 4Z08A 4C6BA 1HKVA 3V1HA 4QSHA 4Q33A 5D32A 1XSIA 2NQJA 3HBLA 1IEQA 5AZ0A 4IJCA 2PF8A 4O57A 3UG4A 2E67A 4XD5A 4GZEA 3MC5A 3GH5A 3AROA 3HPZA 3B8TA 3FEMA 1OG6A 4DPPA 3D47A 3L65A 4EF9A 4GBUA 4Q8TA 4KEUA 3LD5A 2VXNA 3U57A 1PDZA 1FA2A 1K6WA 4IWWA 1MW0A 1H0GA 3S5ZA 2XH0A 2AMXA 3PZUA 2VUYA 1NTHA 5D2TA 4OUEA 3GHTA 3MWAA 4YPJA 2FPYA 2HBXA 3OIXA 4X63A 3VKDA 1ME9A 2QQ6A 3WELA 4DBEA 3GG7A 2GUUA 2VEGA 1F05A 3UJFA 3LK6A 3N1AA 4HU8A 3BJTA 2J8FA 3KFTA 4XBJA 3TTYA 2ZDRA 3GG0A 3OVPA 2VGBA 4FX6M 5D4YA 4Q22A 1Q6EA 1KM2A 2ZFAA 2NW0A 1J11A 1TMLA 1C9WA 3LG3A 3FA3A 4NIRA 1XRVA 5JIPA 3UNDA 3HPFA 1OGGA 4M6VA 1C8YA 3IEBA 1O12A 3P7YA 3RGTA 5K4ZA 1BXBA 3GC2A 1GNXA 4Q7NA 3C8FA 1XIGA 3GYEA 1EIBA 1C92A 2OGJA 1NSJA 5A8OA 1D9EA 4O52A 1MI3A 5IBXA 4IISA 1X8FA 3M1ZA 1QOXA 1PS9A 3AHTA 2IPWA 4INFA 2G97A 4K38A 4UQCA 3QRHA 5XIMA 5G1MA 1AW5A 2OODA 2HNEA 4GHRA 2QF7A 4FK9A 1UWQA 3RAOA 3KHDA 2QCDA 3A24A 3O63A 1FBAA 1PWLA 5BNKA 1O5XA 3EWBX 3T0TA 2TODA 1HIZA 1FHLA 1OIMA 4NYYA 1M04A 4KKXA 2XFYA 4YTQA 4B2DD 4NUWA 2XVLA 5C9WA 3T0CA 3W53A 4O4WA 3W27A 4DPQA 4NAFA 2GGEA 5HNTA 4U10A 4HU0A 4AC1X 2PDGA 4ZEPA 1H62A 4F40A 3KZSA 4D6CA 3ZM8A 4DUWA 1FUYA 3V5CA 3B97A 3FYPA 2YW4A 4LCQA 1ZCOA 1TVPA 1J93A 3M07A 4UNIA 4W85A 2OWWA 3ZSSA 3UXAA 2G3JA 3KZPA 4L6HA 4NAEA 2ATMA 1RY0A 2HBVA 3AS3A 4E8DA 4NZCA 4LC8A 3LXAA 1FWJC 3G6MA 1DIEA 1ISZA 1OCNA 3BCFA 3UESA 2YXOA 4B16A 1L8PA 5BW6A 2A4AA 1KR1A 1DJWA 1TTQA 1Q7ZA 3HQ1A 1V02E 4LF2A 2QPSA 1EZWA 2BV9A 4GISA 4UZSA 3KS6A 4HSOA 1IR1A 4PODA 2VFHA 4B4FA 4PTDA 2ZUWA 4JTLA 2PWGA 5EL1A 1PYFA 4AIUA 2IKGA 3UNTA 4AW7A 1NDYA 3BL3A 1L2UA 1S5NA 1W9PA 3URAA 3UYIA 1L0PA 1WKDA 4QFUA 3FKRA 4MAVA 3WDRA 1YDNA 3KBNA 3WBYA 3KCJA 1A5SA 2FJUB 2WVTA 3PZIA 4FF7A 4IGMA 2VC9A 1QO2A 1JDFA 4FR1A 5IBXC 1WUFA 4DNMA 1EJTC 1EIXA 2A3HA 2E5DA 3IJ6A 6REQA 1PL9A 3LENA 5CJMA 2JALA 3GLCA 3WNKA 1EC9A 2PUZA 4PFMA 2NZLA 5I0DA 1NQKA 3VVGA 1FTXA 3P5YA 1ZY9A 5F1VA 1GVEA 2RFGA 5JVLA 3A4WA 3BGJA 3PUEA 1XPYA 2AAAA 3LEPA 2ZZ2A 3GBEA 2W61A 1CLXA 1TPWA 4JTUA 1WDRA 4NT0A 4EP8C 1JDAA 3UWYA 1ZBWA 2GGGA 3DI0A 5DBTA 3K2GA 3KP1A 3CLMA 3BVJA 2WLZA 4ZE5A 4AZGA 1QR7A 3EA3A 4C5YA 3N2TA 2E28A 4H8NA 5GJNA 3B9AA 1C8VA 2BWGA 3FW6A 1HJXA 3LCFA 1JDDA 2E9MA 2ZOXA 3NQVA 3A5VA 2PBGA 4Z42C 2E25A 3P6LA 4AF0B 2QHAA 4JQ4A 4G56A 1CXLA 5HK4A 1DJIA 3O15A 3OGRA 3G1VA 2RDUA 3C5QA 2WJZA 3VTRA 3QHMA 4KEMA 1XH1A 1WXYA 3OLIA 2ZXQA 1Z6KA 3KVJA