2WJFA

Crystal structure of the tyrosine phosphatase cps4b from steptococcus pneumoniae tigr4 in complex with phosphate.
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
244
structure length
244
Chain Sequence
GMIDIHSHIVFDVDDGPKSREESKALLAESYRQGVRTIVSTSHRRKGMFETPEEKIAENFLQVREIAKEVASDLVIAYGAEIYYTPDVLDKLEKKRIPTLNDSRYALIEFSMNTPYRDIHSALSKILMLGITPVIAHIERYDALENNEKRVRELIDMGCYTQVNSSHVLKPKLFGERYKFMKKRAQYFLEQDLVHVIASDMHNLDGRPPHMAEAYDLVTQKYGEAKAQELFIDNPRKIVMDQLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords TYROSINE-PROTEIN PHOSPHATASE CPSB
publication title Crystal Structures of Wzb of Escherichia Coli and Cpsb of Streptococcus Pneumoniae, Representatives of Two Families of Tyrosine Phosphatases that Regulate Capsule Assembly.
pubmed doi rcsb
source organism Streptococcus pneumoniae
total genus 95
structure length 244
sequence length 244
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2009-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 2wjfA00
3CS2A 1PSCA 1M65A 4EP8C 1M68A 1QXLA 1FWEC 3AU2A 3SFWA 2Z24A 1NDZA 1WXYA 4C6CA 4Z42C 4CQDA 1YRRA 3NURA 4H9TA 2PGRA 2WJFA 4RDYA 3T81A 4IG2B 3EWCA 4BY3A 4LAMA 1YNYA 4GX8A 3F2BA 2AQVA 3OU8A 1RJPA 3S2NA 3K2GA 3K4WA 4C6BA 1EYWA 1PTAA 4XAGA 3JZEA 2Z2BA 4KEZA 1FWGC 4XD4A 2QVNA 3RYSA 4EPDC 3UPMA 4H9VA 3DCPA 4C6QA 4C6EA 4H9ZA 2CZVA 2PLMA 1PO9A 3HTWA 1UBPC 4CNUA 3MJMA 3UF9A 2I9UA 4TQTA 3GUWA 4H9MA 1XGEA 2R1NA 4DI8A 2FTWA 1EJVC 2D2JA 1VFLA 4F0LA 1YBQA 1JGMA 4C5YA 4CNSA 4IGMA 2R1PA 4HA0A 1WXZA 4F0RA 4LCSA 4F0SA 1XWYA 2OB3A 4NG3A 1J6OA 1A5KC 3B40A 4LCRA 4IH3A 3AU6A 4RDVA 3GTXA 3A4JA 3MTWA 2R1LA 2AQOA 3N2CA 4B3ZA 2BB0A 1I0DA 1POJA 2E25A 1HZYA 4CQCA 3HM7A 4E3TA 3LA4A 3B0XA 4I6KA 4GYFA 4XAFA 3F4DA 4RE0A 1K6WA 2I5GA 1K1DA 1EJRC 1EJTC 4J35A 3URNA 1E9YB 3IPWA 4H9YA 2DVUA 1E9ZB 1DPMA 4LEFA 3CJPA 3AUOA 4LAKA 2VC5A 1ZZMA 4PCPA 5AKQA 2GSEA 3S2LA 4BKNA 3LGDA 3FDKA 2WJDA 4C6DA 4C6JA 4WHBA 1FWBC 4AC7C 4R85A 2Q09A 4DI9A 1KRBC 3EGJA 3E38A 2DVTA 1P6BA 4NP7A 1V4YA 4XAZA 3NQBA 5G4HC 1RJQA 1P6CA 2G3FA 1BF6A 3IARA 3O0FA 1GKPA 3E3HA 5FSDC 2ZC1A 4D8LA 1FWCC 4B92A 4WGXA 4QTGA 2P50A 4G2DA 3F2CA 4DYKA 2ANUA 2O4QA 4H9UA 2GWNA 3KM8A 3S2MA 3PAOA 4QSFA 4B91A 4ERGA 2R1MA 1POKA 3GU2A 2HBVA 4PBFA 3NEHA 1S3TC 1NDVA 4IQJA 3QY8A 5E5CA 4IG2A 1FWHC 3TN3A 3URAA 4C6NA 2O4MA 2Z25A 4J5NA 4IFOA 2FVKA 1FKXA 4QS5A 1YMYA 4H01A 2HPIA 4EPBC 2ICSA 2AMXA 2F6KA 4GX9A 2Z2AA 4CNTA 4KETA 2E1WA 3MVIA 2OGJA 1A5NC 3OQEA 4H9XA 1RAKA 1J5SA 3G77A 1W1IE 1A4LA 1NDYA 4YIWA 3LGGA 2Y1HA 2Z27A 4C6IA 4C5ZA 3QY7A 4V1YA 3IGHX 2BGNE 3CAKA 3GTHA 3ORWA 4DO7A 2HNHA 3TN4A 4C6FA 1FWJC 1V7AA 3F2DA 3MSRA 4J2MA 2PAJA 2WM1A 3GG7A 2GOKA 5HMEA 1I0BA 4RDZA 3MPGA 2QPXA 4C65A 1ITUA 4GY1A 4H00A 2YZ5A 4KQNA 4AQLA 4IFKB 3ICJA 2PGFA 2XIOA 1QW7A 3QGAC 2EG7A 4LFYA 1J6PA 4MUPA 3FEQA 3UR2A 3S4TA 1ITQA 4C60A 2D2HA 4KF1A 3URBA 4WVXA 4QRNA 1FWAC 1XRFA 2W9MA 3GTIA 4RDWA 2Z26A 4L9XA 1FWIC 3RHGA 1IE7C 4DIAA 4BJHA 2IMRA 4LALA 1O12A 2OODA 3PANA 3WYZA 3RCMA 4XD3A 1ONWA 3PBMA 3V7PA 1M7JA 3GU9A 5A6TC 1J79A 3LS9A 3URQA 2RAGA 3GIPA 4C6KA 4LCQA 2WJEA 1A5OC 2YB1A 3E74A 1V51A 4M51A 1A4MA 3TNBA 1K70A 4ERIA 3ID7A 4JOMA 2DVXA 4DLFA 2YB4A 2ADAA 3IV8A 5FSEC 3EWDA 4IF2A 1EJWC 3S2JA 4B90A 3IRSA 2D2GA 4IFRA 2A3LA 1PB0A 4GOAA 1R9XA 2P53A 3LU2A 3GRIA 3B0YA 1GKQA 3MDWA 4ZSTA 1EJSC 3OOQA 3OJGA 1EJUC 2QT3A 2VC7A 2Z28A 4XAYA 3UR5A 3A3WA 2VR2A 4KESA 3PNZA 3PNUA 5HMFA 1RJRA 1A5MC 3GTFA 3LSCA 1UIOA 4EPEC 3ITCA 4KEUA 2Z4GA 4QS6A 1R9YA 3BE7A 4ERAA 2OOFA 2KAUC 2QS8A 4GY7A 4C6OA 3GU1A 4GK8A 4EPKA 2HQAA 4G7EB 2R1KA 1ADDA 3QY6A 4G7EA 1EJXC 4KERA 4PE8A 2YXOA 4HK6A 1UMLA 4PBEA 3E0FA 3DC8A 4UB9A 2Q01A 2VM8A 3A3XA 3IACA 3RN6A 4LANA 3T8LA 4L6DA 3MKVA 3O7UA 1V79A 4NI8A 1NDWA 3LY0A 2UBPC 1FWFC 1KRMA 4IFKA 1YIXA 2FFIA 3T1GA 5HMDA 2PUZA 4ZSUA 3QGKC 1RK5A 4CQBA 4CEXC 1YBQB 3LSBA 3WMLA 4C6PA 3TN6A 1GKRA 3LNPA 4C6MA 3GIQA 4GZ7A 3UBPC 1NFGA 1FKWA 4GBDA 1KCXA 2Z7GA 4GXWA 4ICMA 4DLMA 1XRTA 1RA5A 2FVMA 4HK5A 3OODA 4R88A 4IGNA 2UZ9A 1RA0A 3C86A 2HPMA 2GZXA 3D6NA 4UBPC 2FTYA 2GWGA 4P5UA 3DUGA 1EZ2A 5CH9A 4GC3A 3SO7A 3R0DA 1ONXA 4DZIA 2Z29A 3MDUA 3MVTA 4XD5A 1R9ZA 3OVGA 3K5XA 1FWDC 3HPAA 3FDGA 3F4CA 3IJ6A 4CEUC 2VUNA 1P1MA 4LAOA 3TN5A 1V77A 3E2VA 4DZHA 4KEVA 2OQLA 4PCNA 1KRAC 4INFA 2EG8A 1EF2A 4I6VA 2VHLA 1O5RA 4QROA 3WZ0E 1KRCC 3ISIX 1RK6A 4KIRA 2EG6A 4V1XA 4R7WA 3E0LA 1A5LC 2Z00A 4RZBA 1UIPA 4HK7A 4HJWA 4OFCA 4DNMA 4GY0A 2HBXA 4LH8A 4XD6A 4C6LA 5LXXA
chains in the Genus database with same CATH superfamily
3LEPA 1RLDA 5D05A 2PP1A 4CQDA 4GINA 1E70M 4RDYA 3EWCA 1QK2A 3EKZA 2X7VA 2OSXA 1FTXA 1JCJA 3STFA 5DELA 2QAPA 1RJPA 1FCBA 1DJGA 1SZFA 4MG4A 1DV7A 3K2GA 2HVNA 3DKLA 2OX4A 3Q94A 4KWOA 4AVOA 4ZFCA 3UFYA 4D8ZA 4L9YA 5EMMA 2PURA 4Y8EA 3IJLA 1J10A 2R9RA 1E3XA 3CPRA 2IQ0A 1H2JA 3EEGA 3TYDA 1R5YA 4YHEA 3W71A 1WX0A 4JX4A 4RPPA 3TYEA 3MJMA 3KXQA 4LYKA 4KFNA 5AYZA 4FIRA 3PUDA 4NAEA 2UY3A 1E4MM 3N11A 3B05A 1IYXA 4A2RA 5FJJA 4D6EA 1VEOA 1XWYA 3NO1A 4IQLA 3UG5A 4RE2A 1AH0A 1LWJA 3PZOA 1DQUA 3TQKA 2GJXA 5CBBA 1YADA 6PTDA 5G5IA 1K03A 1OFRA 3OVPA 1LYXA 1G4SA 1LOLA 3EXTA 4O4VA 4X9SA 4IOTA 5GPRA 3I6TA 2E28A 2YXXA 4EAYA 3WLJA 5H8UA 4NNAA 3WIJA 4GUGA 4E4UA 4Q22A 2YSWA 1YDYA 4OBRA 1QU4A 3WQOA 4PCPA 2GSEA 5EBAA 4BKNA 2WSKA 4AYSA 3WLNA 2Q8LA 3ARVA 2NV9A 3KOWA 4NUWA 1EBHA 2Q09A 4KWUA 2J7DA 3ZWTA 4N6EA 3G1RA 1BF6A 3O0FA 1PTGA 2PRHA 3WO8A 3R43A 1SGJA 3WN6A 1E0WA 1E72M 2XGIA 3VK5A 4OECA 4UNIA 4UOJA 3F5KA 3M7SA 2R1MA 1POKA 1SMDA 2P8CA 4PBFA 3UZJA 1S3TC 2DSVA 1UD5A 1XRSA 3QH2A 1OB0A 4IQJA 2PDQA 2OMAA 3ANVA 4IG2A 3KRBA 5A6JA 5FJRA 2OVLA 1LDCA 1E6QM 1IXQA 1Q6LA 4EX4A 2PF8A 1S5WA 3REQB 4UOQA 3EXRA 2XVGA 4GNJA 4AUBA 1TKKA 5C55A 2QGHA 3E5PA 4N4QA 1AA1B 3ORWA 3LGEA 3ONBA 3KVKA 3FOKA 4BZYA 4L4MA 3P5ZA 3RIKA 4DXVA 5E70A 3UA4A 2PAJA 1PPIA 5F2IA 4PUWA 3E9AA 4QAWA 1M6JA 4GY1A 3VZYA 3O6DA 4HHHA 1JUEA 3UWVA 4NZCA 2WNWA 2G0WA 4L6HA 2OSWA 3SQLA 1UR9A 3KRSA 4KF1A 3URBA 3W2KA 4CD5A 2WB5A 4LS1A 4OOZA 3NZQA 1GVIA 3L2MA 3CWNA 4IPLA 4LB3A 3RCMA 2YCLB 1Q2RA 3OZOA 3TQVA 4E2VA 2ZOXA 3NQCA 5FEZA 1J0JA 4R9XA 3DEQA 1DXIA 3VOIA 4YYCA 1SFSA 2QULA 4M56A 2GK1A 4EWND 3U8GA 1TMLA 1MEHA 5E93A 3C6CA 4MLJA 3B03A 4WUIA 4JFVA 3P14A 1HKMA 4LUSB 1RBAA 3LRMA 1GOIA 3GG0A 5IM51 3O3RA 5LIYX 3WQCA 3GW0A 5HAOA 3HQPA 3CT7A 1WZLA 4WQ6A 4GOAA 3EDDA 1OFAA 2BHUA 3UY7A 4ZSTA 1D3GA 1S3HA 3TDFA 1ESWA 4AVFA 1B54A 2VDIA 4JNYA 2DSUA 5AC7A 1S39A 2HE5A 1XS2A 3U4AA 2ZVRA 2G97A 4NI3A 4L80A 3V35A 2FDSA 2BY2A 2JGQA 1OFPA 3OIHA 3DBPA 3MQTA 3OYZA 2PDHA 1D3CA 3SGGA 3IJIA 4LVGA 2YXOA 3BW4A 4JHOA 2FTPA 3TFCA 4PMVA 4A6GA 3BARA 1QOXA 1QBAA 1SFTA 4D9PA 5T9CE 3LQGA 4HPNA 5CZSA 4R53A 3R0UA 3T1GA 4B16A 1VFMA 4TR9A 1D8CA 1YBQB 3PBGA 1EWDA 3TZNA 3P80A 1W31A 2R8WA 3M5ZA 1W32A 2JE8A 2OZ0A 5I3JA 3HPZA 4ZR8A 1YEYA 5DQPA 2Y88A 1SM9A 5FKYA 1CB2A 5E09A 4TOQA 3VNDA 1RA0A 4IIEA 1B1YA 2XZ7A 4GKLA 3AMCA 1U5JA 1PAMA 3SO7A 1KM4A 4DZIA 5I3HA 4OU1A 1XIJA 1W5PA 4DJEA 4ZB0A 4RKAA 2ACQA 3IVSA 4A3HA 3SUSA 3WF4A 4IJCA 1LL6A 1DORA 1E6SM 3TXVA 1Q6RA 2PDXA 2V68A 5AY7A 3DFOA 4IL2A 3B0VC 2ZWYA 4S3DA 1LORA 4V1XA 5KSWA 1S38A 5C2XA 3VGFA 1HKVA 3CU2A 4HGXA 1U1JA 1M65A 7A3HA 3ITYA 3MJYA 1Y5WA 3NZRA 1W3JA 5A2BA 4LU0A 2HS6A 5HQMA 1P0NA 3M0MA 3WKZA 5CSRA 2AQVA 4JS3A 1WAUA 2WK2A 3DU0A 1QPRA 4O12A 3W2MA 1YE4A 3UPWA 4E5TA 4RV8A 3MCOA 4UFMA 1OZMA 1JNEA 1V02A 4KEZA 1FWGC 1QO2A 1J0KA 1IEWA 2QVNA 1UWSA 1Q6EA 5HNNA 2Y70A 3BLLA 8A3HA 1EDTA 2PLMA 4O11A 5HATA 2YGYA 3LPPA 4W8AA 3NUKA 1BKSA 1M41A 1QOPA 2E5CA 2Y5JA 4H9MA 1REQB 1PWLA 1LT8A 3TUUA 1FX6A 1GVYA 1S5MA 2GVJA 3W29A 1LP6A 2FJUB 1QNRA 4JTGA 4F0RA 2GVEA 2FZMA 4UTJA 3GTNA 1F2JA 4G9PA 1EZWA 4W84A 2NW0A 3GDKA 2PDMA 4UR7A 4DZAA 2J7GA 5CGQA 4XUYA 1R7OA 4JDYA 3SIZA 4A2SA 4MTVA 4B9ZA 2G96A 4WSKA 1GQKA 4A8NA 5CZJA 3BLPX 1KM5A 3GDBA 2CFFA 2ZA1A 1UMYA 3SURA 2FB2A 2EQDA 3OEXA 4L61A 2TSYA 1X39A 2WNQA 4DBWA 3GFXA 4QLKA 4CU6A 1NEYA 1I1XA 2WJDA 4NZFA 4GCAA 1LBLA 4HTBA 3E38A 3FYOA 2G3FA 1AQFA 3IARA 1W5MA 2UWFA 2PDUA 4WGXA 5DBUA 5TF0A 3R11A 4E0CA 1QPQA 1V3JA 1XIEA 1AG1O 3WK0A 5LYRA 4CNNA 3GU2A 3ENLA 1H7RA 3MUZ1 4A8LA 3RJXA 1F8MA 3B9NA 4RNJA 4MKNA 3ARPA 4FOJA 1TWZA 1T41A 1UA3A 2ZUVA 4AMAA 4ZZ9A 5DT5A 4BA0A 4QISA 5BU6A 1WKFA 5FL1A 4YS1A 4NJGA 3WLQA 1A49A 4TUFA 4IISA 1ZBKA 3GH7A 1JYXA 3AISA 4QDWA 2CITA 1L6FA 3S5YA 1VBRA 3PZNA 3BLDA 2O7QA 3OA3A 5ABFA 2QKFA 1QI2A 3F2DA 3IVTA 3STGA 3L0KA 3NVDA 4NIRA 3O63A 2CLKA 3HA1A 5HMEA 2DT0A 4H00A 2OO0A 2AL2A 2VVNA 3CZ8A 1XKJA 3CC1A 1VP5A 5FEPA 2CZEA 4AEEA 1LF1A 3IV3A 3POHA 2XFFA 1EHNA 4NJJA 5FESA 4US6A 2BS9A 1H62A 3PJTA 3K8MA 4A4AA 4DF0A 3QQ1A 3AIWA 1UR8A 4NT0A 4L9XA 3NQDA 1Y0EA 1I2NA 2CW6A 2FZ9A 3T08A 2REQA 5DMNA 1WUFA 1S1RA 3KVMA 9RUBA 4Z1AA 1EHAA 1XL9A 2GGIA 2PBGA 2VFHA 3PS7A 4PA8A 1EEXA 3RCNA 4DJED 1L6SA 3BK0A 1TCDA 4M7SA 3RXZA 4GZEA 3S1GA 4YCOA 2XFRA 3VNMA 4UWMA 1SSDA 3K46A 3LCIA 1FH8A 4PUMA 1XLCA 2YW4A 5KMYA 1NWSA 4JKKA 2X7WA 3C0LA 4JTAA 4MOZA 2GDVA 1A4MA 1EQPA 4B5XA 2TYSA 1T8QA 3GM8A 1V6XA 3IGXA 1NFPA 2CIPA 5CSSA 3L5MA 3NTYA 2QCFA 4M6UA 1V3KA 1C7SA 2EHHA 4GA8A 5FOOA 3I65A 4NZ5A 2VR5A 3L4VA 3ALGA 1E9LA 2A3LA 4ZXOA 2P53A 2X41A 1LG1A 3QTGA 1TSIA 5D2WA 2QPUA 1E5NA 4U3AA 5HNRA 2OQHA 5AYBA 5LNVA 1G5AA 3CLMA 4HU0A 4JN7A 4KEUA 3NDYA 5DXYA 4EF9A 3LHVA 4F2BA 1RBOB 1ODUA 1XYLA 3QF0A 3VTRA 2OOFA 1BYDA 3KLKA 2EPOA 1XHGA 2VC6A 1K8YA 3WH7A 1XPGA 3ITGA 2HV5A 4E4PA 2DZAA 4GBUA 1WV2A 3EPOA 1GJPA 3QMSA 4G7EA 2ZTJA 4XZ9A 3GKFA 1EJ7L 4OV9A 1PDYA 2EJ1A 4CQ8A 2C91A 2ZBTA 1KA9F 4GKTA 1XUUA 3CUJA 2PF0A 2NQHA 1V79A 2UBPC 2DH2A 1VJZA 2VWSA 4J2PA 4DJFD 3QJAA 2WJZA 1AUSL 3FJNA 2PP0A 4HYRA 3H21A 3HPXA 3C5QA 2Z6JA 3OPSA 2YYTA 3TLLA 1CYGA 1QI0A 1NFGA 1KM0A 4K7YA 3AYTA 2NLYA 4DO5A 3HGRA 4MNJA 2I5IA 4AWSA 1FRBA 3F4WA 3PFMA 5KZMA 4GC3A 3G3DA 3N6JA 5J8LA 3NSXA 1ONXA 4HA4A 2HK0A 3CMGA 4M6PA 1XBVA 2EKCA 1BWKA 4S2CA 4UTIA 1HF6A 5CBJA 4G6CA 4FEZA 4JQ3A 1HJSA 3B04A 2CXGA 4ZQCA 3A5FA 3WD1A 4PCNA 3SIMA 4QROA 5BU9A 2XN0A 4R7WA 3AIEA 2TAAA 3QZEA 2WNNA 3ABZA 3GLCA 4UTKA 1LZOA 3PB2A 5FF0A 2VFIA 4PMXA 7CGTA 2XH2A 3THCA 3D0CA 3DFTA 4MY9A 1YTDA 4Q4QA 4W88A 4HTYA 4W7WA 3ZWSA 2GSHA 1FHVA 1GPFA 3UEQA 2B31A 3NFUA 3CUHA 4BY3A 1FHUA 1W5NA 5HINA 2CNCA 3H4WA 3C4UA 1M1BA 4HU4A 4C7GA 4MB5A 2Y7GA 3BC9A 4FP1A 1WZKA 1NTHA 1MW0A 1FBAA 3EMQA 2AMGA 4CD4A 3JZEA 2QJHA 2PDKA 2YLAA 3STEA 3RYSA 2QQ6A 3UXIA 1TA3A 5I23A 2Y5EA 4FLRA 4Z1DA 5E9XA 1CNVA 4Q6JA 3WK1A 2Q6ZA 2R94A 4ICNA 4O16A 3P8JA 2FPVA 1UR1A 1EP3A 3RR1A 5AC4A 1DWGM 1MMFA 4IGMA 1DIEA 1ZJIA 4ILSA 1N8FA 3KEHA 3ES8A 4ECLA 1EC8A 1HO4A 4WKAA 1NWTA 3P82A 2GJXB 4X22A 4IMAA 3TTYA 2PLCA 2HEJA 1G4EA 3AO0A 2ZUTA 3IJ8A 1LUCA 1B3VA 1HJWA 4B3ZA 2PGEA 3JZUA 4YYFA 4GI8A 4CQCA 2PDLA 3TR2A 4HU8A 3TP4A 2ALRA 3K8LA 1GEHA 4WY0F 3F4DA 1K6WA 3RITA 1VLIA 2IKJA 1O66A 4DF1A 1GYMA 4H9YA 2QCDB 1VFUA 1WDWA 3H2NA 3P60A 4AZHA 3CL7A 4J28A 1W2PA 4DAFA 4LBUA 3SCPA 2Z7KA 4HHPA 4C6DA 3W7RA 1KRBC 2BVTA 2PB1A 4DBUA 3BOXA 2R6OA 3WLOA 4DUXA 3C2FA 3SUWA 1UWIA 1X8FA 2Q3OA 2V30A 3MMUA 2WANA 2RHGA 5DCDA 1GG1A 3HIJA 5I3DA 2NVAA 4UMCA 1BXNA 4V28A 1TRIA 1G4TA 4M81A 5KZ6A 2O56A 4AAJA 4ML4A 3QSTA 1ODZA 4MZ1A 3AYSA 5HDRA 5BXPA 4OV4A 2I57A 4XBSA 2D23A 2E1WA 3PZIA 4ZOBA 4POCA 1VGAA 3MUY1 4EKJA 4O13A 4WDXA 1K4HA 1VFFA 4WSJA 4AWEA 3F7JA 4L9ZA 2ABAA 4IPIA 1F73A 4TX9A 1RCXB 3CO8A 4HB7A 1FFRA 3TN4A 1WOAA 5I6SA 1E1CA 2BZNA 4G1NA 2AAAA 3U5UA 2WAGA 1NF7A 4Q4SA 4RXFA 2XIOA 5D9OA 1DJXA 3EXSA 4JN6A 3S5ZA 1GQNA 5I03A 2VKZG 1JXJA 3THDA 1X1NA 2DW7A 4J3SA 2E09A 3CHDA 4Y9NA 3ITXA 3A5VA 3B4UA 3ITOA 3PG8A 3BO9A 2YXGA 4LVDA 3GTIA 4V2XA 3GVGA 4P7QA 1CLXA 4QGCA 1IEQA 3EX6A 4GABA 4MIMA 4XSMA 1PV8A 2ZX8A 1BWVA 1H60A 5HPOA 3G24A 2O92A 1V6WA 1F3XA 1AL8A 9XIMA 2ZE0A 3ATZA 3QM3A 3HMJG 2ZDSA 5KITA 2GK1B 3M0KA 4LYRA 4F2UA 3ZJ8A 3AWOA 3KLLA 1KBLA 4UTWC 3D3FA 1XYCA 2XN1A 1W0MA 2YB4A 4U4MA 1E6XM 3AMGA 3M1ZA 5FSEC 1XGZA 1JDDA 4AXNA 1BG4A 1EXBA 1XV8A 3M6YA 1FHLA 2A7RA 4HNNA 1RQEA 1HG3A 2G95A 4Q8OA 1EX1A 1LBFA 2PWUA 3TVAA 2VENA 4Q8QA 4JXCA 3I7QA 5F4WA 3WG6A 5DFAA 4M7TA 4BWLA 1R0MA 3NQ7A 9CGTA 3ITCA 3B0PA 3WLMA 5EY5A 7ENLA 1BG9A 2FHBA 4NU7A 3VD3A 4NJIA 1Q7QA 2X0HA 5I3GA 4TTGA 4Y90A 5IFTA 3QKZA 3M5YA 4H7CA 2JEQA 3VI2A 2HJPA 2NQJA 1C91A 3DAQA 3S6DA 5LIKX 1HQTA 4GZJA 4LVBA 3RN6A 3W72A 1EYEA 3GNNA 3OA5A 4NAFA 2Q71A 2E6YA 2OZ8A 5LNSA 3WMBA 4JQ1A 4QE5A 1I45A 1AW1A 4Z0SA 3LSBA 3BV4A 4CCCA 1BD0A 4E8DA 4DBSA 2NSOA 2EXOA 3SY5A 2EPNA 3OVRA 1EGZA 1XFCA 4ICMA 3NGJA 2UY5A 1B90A 4R88A 3WCZA 5A6BA 3BLFA 4MAVA 2W5FA 2IPGA 3SCOA 1G7UA 1AD4A 3V5OA 4QP0A 1H61A 2XIIA 3HG5A 2YL5A 3A24A 1L6YA 3T44A 3K13A 1BVZA 1UZHA 3VAVA 1W9XA 1H7OA 4H6EA 2B7QA 3DFNA 4MWAE 3UNTA 4HBKA 3TWAA 4AF0A 4K2SA 5C8BB 1ZLPA 1SFLA 3PR2A 3P93A 2Y8KA 4UFIA 4NQ1A 3VMOA 1A5LC 4EXAA 4Q7IA 3ANYA 4OFCA 3VUPA 1DWFM 4GY0A 5LHEA 1UR0A 2XH0A 1O4UA 1K9EA 2RGMA 3G0SA 3TMLA 1FHDA 1KTCA 3UXLA 3FHQA 3R2GA 3NURA 4JYFA 4LAUA 1X6UA 1RP8A 4JR5A 1HFBA 1ZQ5A 3FAXA 1GNXA 5BOOA 3MO4A 4WEVX 1ECQA 3ZXWA 5IHSA 3LI1A 4PR4A 3ITVA 1XLGA 4XX6A 2AGKA 3RK8A 4C6BA 1F3EA 4GIRA 4JFTA 3H2OA 1FWRA 1S2VA 3W83A 1VD6A 1XLFA 1TPWA 2DPEA 3WEOA 1E0UA 2RKXA 1IGSA 4HA1A 2P76A 2G4FA 2CZVA 1GOOA 4GNKB 4OTKA 5JBEA 3DYOA 2YBTA 4S3EA 1F76A 1NSJA 1ZNNA 1NQ6A 3YPIA 3GUWA 4X0NA 4B4FA 3DKJA 4DI8A 1E55A 2VFEA 5CG0A 4GACA 1V3IA 4CNSA 3QEZA 3OZPA 1C90A 1JXKA 3BH4A 3KZPA 4NG3A 1RD6A 1K7FA 2J27A 3M0HA 5BRPA 4EACA 5BCAA 5HUPA 4BCEA 4ZB5A 3MHFA 2ONEA 1XKYA 3EX3A 2OKTA 4ZOEA 2VFFA 3CAVA 3GUGA 3FVMA 5HULA 3IWPA 4X2PA 2ATSA 4JGDA 5FF7A 2ZVIA 4TIMA 3UG3A 1H7WA 3EPMA 3W84A 1RSCA 1TYGA 3DDMA 2VVSA 1JF5A 4F8XA 3EOUA 1RJQA 1S2WA 4AD4A 1BVNP 2P0OA 3NPXA 4N9EA 1QWGA 3RLHA 1DXEA 1DWJM 1M3UA 1KKOA 4DB7A 1C8YA 3KOXA 4WOZA 5KINA 3WF2A 4GIEA 3PAOA 1U5HA 3P6LA 4DBDA 5AB3A 3MUXA 5CGMA 2BGQA 4NRSA 3PBYA 4U10A 4RE4A 3UG4A 2FZBA 3M0VA 2E7FA 3DC0A 5M3WA 1R7AA 4AZCA 3SUTA 5BOEA 2HPIA 3HU7A 1TQXA 1W3KA 5LXEA 1VHCA 2XSBA 2WKJA 3DN5A 4L5ZA 1SW3A 3NO5A 5AHMA 3QC0A 4NHVA 3MHUA 4H9XA 1X1ZA 1JZ7A 3UESA 5JBDA 3WDQA 5M5DA 1W1IE 2DIKA 4MADA 5JXQA 1DBTA 2V3FA 1RPXA 3QOMA 2G4JA 4HCHA 4Z1YA 1XQLA 1TJ0A 2GQ8A 3MP4A 1LCOA 3M4HA 3VOJA 2AL2B 2QPXA 1AMYA 3O16A 2QCCA 2VO5A 2HDJA 3VMNA 3GXFA 5AVNA 3NGFA 3ZLGA 2J9XA 3W85A 3QSRA 1XYFA 2X0YA 4JIEA 1H0IA 1CGWA 2A79A 2DZWA 2E8YA 1ITQA 4L7ZA 2W3ZA 2XZ9A 3EOEA 3SCVA 4UTTA 4H1ZA 4XUGA 4UCFA 2W9MA 1WZAA 1CXEA 3RHGA 2ZZ6A 2VX6A 4WXZA 2JIWA 2V8ZA 5D4YA 1YXDA 2HTMA 1W54A 5CZKA 2DFAA 4XKYA 2DP3A 3H2CA 1EPXA 5E0KA 3P0WA 2XDFA 3TMQA 1IZKA 3KWXA 1I6NA 1DJZA 1TTIA 5M17A 4FLQA 4JTQA 3ZSTA 4IXXA 6ALDA 4YLWA 3NL6A 1SJCA 1TV3A 2WJEA 3LI0A 4PULA 1TVNA 3IS4A 2OT1A 2YB1A 3KDOA 3W81A 3ID7A 3GX9A 2Y8VA 3KTXA 3LHUA 1VYRA 2DZSA 3RRAA 3XIMA 1JR1A 4K7VA 2A3BA 3IGSA 5FAJA 3VDHA 4AD1A 1A0EA 5IDIA 2VGFA 3WNKA 3WLKX 1NOWA 2PC8A 3B4YA 3MBDA 4UZSA 2W79A 1PWMA 1F05A 5REQB 3MDWA 4PRRA 3L4YA 1EJSC 3MYOA 4B15A 1YYAA 5BW6A 2OELA 4NKCA 2YZRA 4M6VA 2D2OA 3RM8A 3KBNA 1MSSA 4UQDA 2CWNA 3UVIA 4DJEC 4EPKA 3FXYA 5T91A 1CGTA 3FAWA 4G7EB 2R1KA 1MDRA 1PIIA 1S46A 2B7NA 3LRKA 4GPNA 1BWLA 2WW5A 4L6DA 1VYSX 2WWDA 4NI8A 1NDWA 3GVQA 4CU7A 2WKGA 1QI4A 1O7AA 2W0UA 2Q8XA 1R3SA 3EDEA 5KZDA 1JI2A 3AIVA 4GZ7A 3LX9A 4M1RA 4FLSA 1FKWA 3WD4A 1E6NA 4AZ6A 3N12A 4LUTB 2WZEA 4HN8A 2GGEA 2GPTA 4QCEA 1IWAA 3W3OA 1JZ3A 1SVDA 3H6OA 4AZ5A 3CV6A 2VDGA 4PMJA 3TONA 4GVHA 2BV9A 1S2TA 2NX3A 2HISA 4WCJA 1PX3A 4S39A 1UOZA 3PJXA 2E8ZA 5BXTA 2FDMA 2NXIA 1TPEA 4IX0A 1E0XA 1M7XA 2HZGA 2SFPA 5GNXA 1NP2A 4V27A 3U2CA 1JFHA 3NR0A 2WC4A 2PA6A 4KIRA 2J79A 3WY1A 5E6ZA 3QC3A 1S5TA 5DO8A 1W8GA 1QHZA 4HK7A 3S1UA 4QM1A 3W1RA 5HPCA 3ZJ6A 3AHYA 2DV0A 1A50A 3CTTA 3PZUA 3VPLA 1RALA 2W91A 1VBHA 4LRSA 5E6YA 4U33A 2J8FA 1F3TA 5F2LA 4CLMA 1KFKA 5AHEA 1LLWA 1WDQA 1FQ0A 1PJ9A 1F3WA 3R25A 1VRDA 2VZVA 3HOJA 3NO3A 2O0TA 5HQLA 3DESA 3OGVA 1RVKA 4K38A 1P7TA 1UUOA 1JCMP 3W26A 4S3KA 3CAWA 1FCUA 1TA3B 1C9WA 1VCGA 1KM1A 3H12A 5J5RA 1A53A 2J7BA 4GCXA 4CNUA 3U7BA 2Z6IA 1DJQA 1MW1A 1BHGA 2VXNA 1QWKA 7REQB 1XGEA 1J12A 3UY8A 3TYAA 4FXFA 1VR6A 3BQ5A 3IJQA 3ARTA 3KS6A 2X2GA 3W7EA 4FAMA 5TBOA 5J04A 4IH3A 3N3TA 4Q33A 3BGAA 1RQBA 3H4XA 5AZ0A 3AMLA 1KXTA 1N55A 3TW9A 4JY9A 4UNKA 1FP9A 2FIQA 2LLEA 1XGDA 3B0UX 3UP8A 4G5DA 1ZCOA 3GFZA 3VYLA 2I5GA 3URNA 4RUBA 4MHBA 4Y9OA 3DYMA 3S2LA 4I9JA 4ZXLA 1C93A 2XINA 4MFDA 3RPDA 3CXOA 4AG0A 1DWAM 5DMYA 1J5TA 2OO6A 1HGWA 5I79A 5BWAA 4HPGA 3HGJA 5KTLA 4Y8FA 1CCWB 2OWXA 3KX6A 1MXGA 1C29A 3KBSA 2P50A 1YLVA 2WLYA 3A4AA 4HJFA 4GQBA 1ADOA 3KTCA 3GYCA 1R3YA 2CYGA 4JIQA 1BRLA 3BCDA 3CK5A 5LSMA 3V5FA 2NUYA 1B2YA 3GC4A 2ZIDA 1KBJA 4W5ZA 2CEQA 2FVKA 4QS5A 4NXKA 1CB7B 4RE3A 2ZA2A 4JTJA 4KFOA 2A3HA 1FOBA 3NZPA 1XH1A 3DYPA 2NX9A 1C8QA 3KBWA 1CENA 2OGJA 3EOLA 1QHPA 3L4ZA 4ZQNA 1KBKA 3EWWA 4J3TA 1JL8A 1NDYA 1IT7A 3LGGA 4PTNA 2BMBA 3M0ZA 4E2OA 2BTMA 1UROA 4V1YA 3B8TA 4FF7A 1MFUA 1J01A 1EOMA 3N4EA 4J2MA 4FS9A 3D5HA 2CBUA 2Y62A 1E1CB 2VQUA 3M0YA 1OJXA 4WZHA 1CBGA 4R27A 2ZADA 3RLGA 4I3GA 4KCWA 2GLKA 1NP0A 4PMNA 1B57A 3TJLA 5GQBA 4HYWA 1JPIA 4IIGA 3VNZA 3TCEA 4K8HA 3I6RA 3WUEA 1QT1A 4DRSA 3UZZA 1JUBA 5J5DA 3CPGA 5G4WA 1OFOA 3BCFA 3V16A 4DF2A 3M9YA 1HJQA 1VFOA 5FEXA 1BSLA 3EPNA 2UY2A 3CPUA 1G01A 5BRBA 4LJ3A 2PRMA 2PBOA 4FSAA 3LQLA 2CU0A 4XVDA 3F4NA 4P7LA 3PWIA 5TD4A 3CIVA 4TMCA 3P84A 5FF4A 1JZ5A 2IQTA 4KWVA 5K3VA 2BXVA 1CXLA 5EU9A 4WGHA 3DGBA 1OFQA 4JOMA 4JEJA 1TV2A 1K8ZA 2ZZ7A 3WK3A 4DJDA 2C18A 5IXEA 2HSAA 3AS3A 1OSEA 1R47A 3D46A 1LG2A 1EX5A 4WD0A 3LU2A 3UERA 2CCRA 2CHOA 1A80A 4IJBA 3T9PA 5LNWA 3N2MA 2OLSA 4HZMA 3T0TA 1TIMA 4ZQOA 3PNUA 4BF7A 3ZT5A 3GTFA 4LYPA 2DQWA 1DWIM 3T2QA 1B0IA 2Z4GA 1OG6A 3V0TA 3NL5A 2O9OA 3VKJA 4HHMA 4AB4A 1MUWA 3S5SA 4P7RA 3NWRA 1VC4A 4WKHA 4L1GA 1HL2A 5MF5A 4K6AA 4TU1A 1FXQA 4ZOAA 1HJVA 1AJZA 4OUIA 4MDPA 3EMCA 3IACA 4R7JA 3SSZA 1DEDA 5C0QA 1HKWA 4FNUA 1E0TA 5HMDA 1M03A 4MWAB 4HP5A 3F03K 3AI0A 3N9RA 5T26A 3TEVA 3WDPP 2YBUA 2X1UA 1YDOA 3WBAA 3GIQA 4RL3A 3S0CA 4DXKA 3W37A 3G18A 4PMUA 4WK9A 4AHOA 2XGZA 5AHIA 2FGLA 4GXWA 4FOUA 3ZFHA 5EA9A 4DWSA 3BZJA 3OBEA 2FZ8A 1E6ZA 3ZVHA 1IV8A 5CH9A 5A6KA 3G1YA 1KV8A 2OYMA 1W1YA 1PEZA 1JDEA 3ATYA 3ZJKA 3K5XA 3S6OA 2NUWA 3FNDA 2GGGA 1V77A 4JIPA 4M80A 1KRAC 2EG8A 2ZTKA 3I7SA 4YVXA 3COTA 1AH3A 4NYYA 4IUOA 3STCA 4HJWA 1UD8A 1X6NA 3VA8A 3RPMA 1Q8AA 4Y9MA 3QLDA 2WBKA 3SFWA 4JL1A 2CZFA 4ZE5A 1VYPX 2P3ZA 2BX7A 1VKFA 4D1JA 1KBBA 4A3UA 5D37A 1QPKA 4X63A 1I2QA 4KBXA 1VIWA 1XXXA 2HNEA 2J4GA 3P67A 2Z2BA 1XIFA 1F07A 1MNSA 3WF0A 1XIDA 2TMDA 2I14A 4C6QA 3OW1A 2AGTA 3VNYA 1JQXA 3ZLHA 4UFKA 5HUOA 1UBPC 2XFWA 1UBSA 4UXDA 3PZMA 4UCGA 3T8QA 2JIEA 5U4NA 4GO9A 2A4AA 3W7QA 2R1PA 2H9AB 3AC0A 3KRUA 3N6QA 1K7EA 4U2ZA 3FCPA 3W6MA 3W7OA 1US0A 1QI5A 2QJIA 2TODA 3UGVA 1EUNA 1ISXA 2AQOA 1EDQA 3RO8A 2E25A 3UWWA 4TV6A 4KMQA 4XB3A 2OSYA 3QLLA 2QCLA 4HPJA 4P7NA 2OZ3A 4GYPA 3WLSA 4XWUA 3SZ8A 4JTIA 4O52A 4GQRA 4Y6GA 1CXHA 3B9OA 3CJPA 2Y4SA 1PL9A 3VIGA 1AMKA 4LS2A 3CQ0A 3FEMA 1VJSA 4Q8WA 3EGJA 5K9CA 4NP7A 4HSOA 1SPQA 1XINA 3W74A 3O06A 1PYFA 5XINA 1Q66A 2D24A 1WDDA 2ASHA 3AXKA 4QLLA 4OOUA 3V1HA 4AWTA 3JW7A 3WNPA 2QUMA 3FKRA 2HBVA 1IXOA 3CH0A 4PEEA 3GHUA 1F6KA 3RX2A 2VEKA 4ZQMA 5CXPA 1LWIA 4F48A 4DEFA 4R5EA 3R5EA 1OY0A 4IHCA 1GCYA 4Q7BA 1B3OA 2ZXAA 4YU1A 3O8AA 1A5NC 3OQEA 3SGZA 4IPJA 5JIPA 4HVXA 3FHAA 4YIWA 2Y1HA 2QAFA 5CPMA 3VD4A 1W9BM 3II1A 3CAKA 3ONCA 4DO7A 3TROA 1DE6A 2HNHA 1XBXA 4FA3A 4ROPA 1NF0A 1ISVA 2QMKA 4XV0A 3NL2A 1PKYA 4PL2A 2PD9A 1OFDA 2NWRA 3AROA 3FN9A 1I8JA 3LBCA 2ZE3A 2CLMA 1ZPTA 1MNZA 4AZ7A 4GYJA 1JPMA 4DWSD 4GUIA 3U7VA 1KM3A 2WM0A 1QNSA 3NQFA 4RDWA 4O54A 1J11A 1B9BA 1IE7C 4BWLC 2PDJA 1UC4A 2JFEX 1AD1A 4JQ4A 3CZJA 5KETA 4XKYB 3VNJA 1RY8A 2ISWA 3KL5A 4L4OA 1UPMB 2JKAA 1I9CB 4OVXA 3KL3A 1L9WA 4XIAA 1J79A 3UWQA 2PI6A 3O07A 3SJ3A 3WUFA 1CECA 3S1VA 4FIQA 1A5OC 1IF2A 3BQ6A 1GVQA 1LT7A 3BAJA 3DG6A 2WXDM 1UD2A 3VD5A 4WDUA 3QMTA 1XLAA 5EMYA 1JFXA 4HSHA 1RQHA 4QQ3A 1JD7A 3LBOA 2BHYA 1G69A 1IHIA 2QPSA 4S3CA 3VKAA 3HJZA 4R33A 3VILA 4UFJA 1U33A 2XSAA 3NYZA 1EF3A 1JUKA 2BFGA 4JIRA 1A5SA 1BGGA 1CGUA 4LT9A 5MHBA 3PB0A 3LMYA 7PTDA 3SCTA 3Q65A 3GY1A 3CWOX 1TPH1 1IXNA 3SRHA 4ERAA 3OG3A 4Z2GA 3GU1A 3IIPA 2BNJA 4GH1A 1ZUAX 3G1AA 1O1HA 2YL8A 1BYCA 2IPWA 1UD4A 3ALFA 1PKMA 2V2CA 1OBAA 3CQJA 1W1A1 3E0FA 5EPDA 2J6VA 4IX2A 1ZALA 3A3XA 5L9FA 2ZX6A 1JPHA 2QCEA 4IFKA 1AVAA 4X9YA 3ZR6A 4XZIA 3IJDA 4B5VA 5KEZA 2V9DA 4AWUA 1XLKA 2DGAA 1W56A 2J7FA 3WQ8A 4Z17A 4LVFA 5LIXX 4HKPA 7XIMA 1OADA 1KV5A 3CWHA 3RU6A 1R87A 3OLGA 4GBDA 3ZLFA 1XLIA 2ACUA 4ZO6A 3ITLA 3GR8A 3LPFA 4DLMA 4Q8VA 3VIJA 2CLFA 5DRIA 2HPMA 4UQEA 1JCXA 5FJOA 1OCJA 2EPLX 1BPLB 2Y24A 2FTYA 1EZ2A 3GNPA 2WHKA 1XPYA 4L6OA 1XYAA 4PMZA 4LAZA 1MZHA 1FH7A 2G3IA 3IJ9A 3LPOA 2BBFA 3HPAA 3FDGA 3FGCB 4KT2A 4AW7A 2WWCA 4YN5A 4DZHA 4L4PA 3NQ6A 3VVGA 1MRQA 4ZVJA 1RK6A 1UKOA 4QDMA 5F2MA 2PTDA 4MGGA 4E2DA 1ZU8A 4PYSA 5LGZA 1TV7A 3G1DA 1HX0A 1ME9A 3QHOA 2X42A 1ONEA 4C6LA 3CS2A 3CQHA 5C9XA 1NDZA 5C7VA 4M3PA 4Z42C 3VGGA 2PGRA 3OIXA 4WJEA 4TVUA 4JTSA 2D1ZA 2WLZA 1E71M 5T9BG 4H2HA 2E4TA 2OEJA 3UJ2A 3UETA 1P7TB 2BY0A 5D9MA 2B81A 4KGLA 1HJUA 1HP5A 4LVAA 1JGIA 1VFSA 1UZ4A 3EWUA 3TKFA 1TTQA 2XM1A 2EO7A 3KTSA 4GGBA 3KW3A 3SCSA 1WYIA 2Y0FA 3R1ZA 4NX5A 2WHJA 5LIWX 4PUUA 4C90A 2CPUA 1MQQA 1UJQA 2PWVA 1JGMA 5G2IA 3AHZA 2B7PA 2I5QA 4B2DD 3E1F1 4QHRA 2A1YA 4IM4A 2W92A 4D6GA 2NV2A 2EEXA 4RDVA 2DY3A 2C3ZA 1WUEA 3SGUA 4ZTXA 3GG1A 5MKGA 1BGAA 5F4XA 1I0DA 3TIMA 2XIJA 4BF9A 4R3UA 2RH9A 4ORIA 1OT2A 2ZUUA 4PMDA 1V3MA 1Q6OA 3OZMA 1E9YB 2R91A 3WD2A 3S9IA 1YPXA 3EX2A 1UB3A 3AUOA 1Q3NA 2C13A 2FGZA 5A69A 1ITXA 3LGDA 4PB3A 1FWBC 4DI9A 3RMEA 4JTEA 5DEZA 2FGBA 2V69A 1OFEA 4M19A 1DOSA 3BWWA 4F4RA 1T99A 5A1AA 1EGVA 3VFLA 3S2MA 4PSRA 1PCKA 3IUDA 2YDRA 4LS0A 3M0LA 3R7MA 2O7SA 1VEMA 3UA3A 2INEA 4ES4A 5GJMA 4UTTC 4JZ5A 2Z25A 4LRTA 2WV8A 3CB3A 7TAAA 3DGRA 4NX0A 4N2YA 5IOBA 1H1ZA 4UFLA 4JICA 3F5JA 3LCXA 5LA2A 1UD6A 3WBWA 4GX9A 3VOHA 4J3XA 1XLJA 3TYBA 1Z44A 2VGIA 3FA4A 1IEIA 3K4DA 2ZX9A 3IGHX 3KVLA 2BGNE 1P0KA 2P3EA 3ZVIA 1TV4A 1M01A 2J13A 2YR1A 3W0KA 4IT1A 4KQNA 3QYQA 1EPVA 3AFBA 3CH9A 1BEUA 1FY6A 3SY8A 3HN3A 1M9HA 1BLIA 2EG7A 4IPNB 2CWXA 1PUDA 1RCQA 2J47A 4MUPA 1I75A 3TTOA 3UR2A 1OINA 5XIAA 1PYMA 1UR4A 2DSWA 2XFYA 3N15A 1NAL1 1RUSA 2J62A 1O5XA 3UNDA 1JCTA 2XU2A 3ZOAA 5T8GA 3KCOA 3N73A 3RM4A 3E2RA 5HBFA 1O12A 3V1PA 5AHFA 3WYZA 3IAQA 2WVVB 3OLDA 4TX6A 1T8XA 3FYPA 1OX4A 1KD0A 3VOGA 4F0HA 3L0GA 4CNOA 5CPTA 3VE7A 1NY1A 1SJAA 3LS9A 2HK1A 3B06A 3VZZA 2WCSA 4QX4A 3G3MA 2BOEX 1LQ0A 3GIPA 1LROA 5A8MA 3MV01 2DUAA 3E12A 3EWBX 3E74A 3VXGA 4N6FA 2POTA 3K4AA 1YDNA 2WCGA 2F84A 3TNBA 3S9ZA 1UP3A 3S2CA 5CZTA 4M82A 5DMLA 3WQFA 4DHGA 3S42A 4GNVA 1JYNA 1GUVA 5L6UA 4QAIA 2ZRWA 1A5BA 3B0YA 2QJMA 4C1NB 3PTMA 4XAYA 4RZ5A 1EH9A 5CAHA 5DY2A 2VNCA 3FW6A 5FEWA 3MB9A 4TXEA 2XGBA 4H6RA 1J0YA 3VKBA 3MWAA 1SO6A 3FJ6A 2BDQA 1XLHA 5A8QA 2VD8A 3EA3A 4GK8A 3WQVA 4JX6A 2XUCA 2J78A 4REQA 4S38A 3IVUA 3NAVA 1MWOA 3M0JA 3SCWA 1B5TA 1Q4WA 4OGZA 1S5VA 1WO2A 3P8IA 3LY0A 4GJ1A 5F7UA 3LZ3A 1RLCL 1ZENA 2CZ5A 4PL1A 3LXAA 4ZCWA 1A0CA 4S23A 4JTLA 1G67A 3NQMA 3UBPC 1H7NA 3GR7A 2J9YA 2XIBA 5LGXA 2V2DA 4AFYA 2GFTA 4PTMA 4IGNA 3GNOA 3VZXA 3ZVHB 4OZOA 3QV9A 2FLIA 4CVWA 1PZ2A 3TC7A 1OWQA 4LC8A 2V38A 3M44A 2GOUA 1MEWA 1YXYA 1TQJA 4HA3A 1KFCA 3NL3A 5D32A 3AS2A 1J9YA 1EGMA 3F5LA 3ARZA 3ZT7A 4GO8A 2HCVA 3RJYA 1Y7VA 3BOLA 3U5YA 3IGUA 3FX4A 1B9ZA 4AYGA 1LLZA 2WBGA 4YL2A 3TSMA 3G1FA 4X60A 2Z00A 4J4KA 3W7MA 1EFZA 1XW8A 2HBXA 4JPGA 4W4QA 1PSCA 2XH7A 2XJ7A 2V3DA 5U7SA 3PPGA 5AZ1A 4AD3A 2XWDA 4YTQA 4HMCA 1JIBA 1AQMA 4ASTA 5G1MA 2PDBA 1E6PA 4AEOA 2IKIA 3TC6A 1XRVA 3O1NA 3DFQA 4PUEA 3W7JA 4KRTA 4AEFA 1P48A 5B80A 3WFZA 3H24A 3W2UA 3W7PA 4I7UA 2BOFX 2OLAA 3H55A 3DCPA 2X1IA 1QFEA 1HKIA 3R4IA 1HTIA 4GI6A 4QDPA 4KGJA 4HOZA 3BGJA 3TOPA 4AZBA 3AIQA 3TA6A 2RGLA 4BF5A 2C6QA 2J8GA 5K2ZA 1WDPA 3SEPA 4HA0A 3H2AA 1HL8A 3VGEA 3I3BA 4K37A 5DMMA 2POZA 3JU2A 2Y8UA 2OZTA 2PPGA 4M1BA 1T0OA 1KFBA 3UXAA 4X2RA 4H83A 2V0TA 1OHLA 1O5KA 1PKNA 1FH9A 3LXBA 1LQAA 3EX1A 1TR1A 2BG5A 2RDXA 2WSRA 3VIKA 1HZYA 2ZDRA 4E3TA 5FACA 3A12A 2FPYA 5HWJA 3SJNA 3WLRA 4H2CA 2QJJA 4Q8MA 4XAFA 3C56A 4FALA 5IBXA 3FY1A 4CN1A 3EA2A 3IPWA 1B3ZA 5D33A 3CIXA 4Q8UA 3N3MA 2VC5A 4IP4A 3AIUA 4UUIA 2A7PA 4W85A 1UKTA 3QQWA 1BTCA 3OLEA 1KKRA 1WAWA 1GZ1A 2YCKX 4AIBA 1AFSA 2JF7A 4LX4A 5EGRA 1W6TA 3CIWA 3E3HA 4JCLA 1AODA 3H23A 1KM2A 1PBGA 2NVCA 2VDHA 2OEKA 3UCDA 1K6AA 4TVCA 1H7XA 4H9UA 4C91A 4BEQA 2WC3A 2FH8A 4WOQA 3FSUA 3SW6A 1P43A 4RZ4A 4PMQA 3PSWA 3NEHA 3UWEA 3ZYZA 3KRZA 1R46A 5ECUA 1UG6A 4C6NA 3VOCA 1TV8A 1KR0A 3AXIA 4HMEA 3VIHA 2V5DA 4HYVA 4X0VA 1Z7AA 3CMFA 4H19A 2F6KA 3SFKA 4E3VA 4JTHA 3BVJA 3FXGA 4J27A 3A3HA 4GUFA 3DHDA 2D20A 3BAIA 4U3CA 4NNCA 1EEPA 5HOSA 3UJSA 2GQAA 1V93A 3LM7A 4O1DA 1QASA 3ZT6A 3N2TA 2V63A 2CLOA 4J7RA 4C6FA 1FWJC 1WXJA 3P3BA 4NASA 4F9DA 1QCWA 3C52A 1TO3A 1OC7A 5TNVA 2E9MA 3PF3A 4DJDC 1AJ2A 4P8XA 2H6RA 2BGSA 2PGFA 1IIGA 1VFTA 2V67A 1DKWA 3L5AA 1QNVA 5GVJA 4MKVA 1E0VA 4N0RA 2YDSA 5C5YA 4W8BA 3LV5A 6REQA 4YTSA 3LCFA 5EL1A 4F3HA 2XYLA 1JF6A 1MVYA 4D71A 4I9MA 3OVQA 4O1AA 2QNEA 2FVLA 3W88A 1SJDA 3PBMA 4GH3A 5EBUA 4NVTA 3N1AA 1K9TA 1KXVA 1FXPA 4UTUA 4RV3A 2VX5A 3BGGA 4RPQA 3AOFA 3VABA 4C6KA 1S2CA 1LWHA 2BVYA 2CETA 4EE9A 5GJPA 4O15A 1FWSA 2ZZ4A 2DVXA 3RLUA 1WBHA 1TPUA 3QQ0A 2QDDA 5M2FX 4IGSA 2NX1A 3MMTA 1TPDA 1R85A 2PDWA 3AZRA 1R2RA 1D8WA 2FZDA 4JTTA 5LIUX 4YVPA 4AX7A 3M0IA 4JTCA 3UWZA 2Z28A 1EJUC 1VPQA 3I10A 4DWSC 1E51A 2DZVA 3VCCA 1GQLA 1GW9A 4TVDA 1QJWA 2OTDA 5AHLA 3S1XA 5HMFA 2PC4A 8CGTA 3NQ2A 3WLIA 3F1QA 2GGHA 2G3JA 3O9NA 1J18A 4DY1A 4JD4A 4Z2IA 1N8IA 1ADDA 1ZJAA 4KERA 2XWEA 1Q6QA 3QR1A 3HJEA 4HK6A 4RCXA 4PBEA 2HXTA 5AOUA 3RX4A 3NNTA 1TJRA 1XBYA 2XN2A 3BCJA 2IKGA 4DM2A 5I00A 5H8PA 1X96A 3LENA 3M7WA 4CQBA 4ZTYA 4C6PA 4BFAA 3LZ5A 3LNPA 2VYOA 1GTHA 2FH6A 4DJFA 1LTDA 3V3WA 1RXOB 4HU3A 4PFMA 3W75A 4JQAA 4AC1X 4NJKA 2J25A 1W37A 3K1DA 2YCLA 1GW1A 3ZM8A 5ABGA 1OG0A 1V02E 1ZB5A 4O17A 3E2QA 2PU0A 3PG9A 1TWDA 1US3A 4DUOA 3BJTA 4Y9PA 1B4KA 3TQ0A 1GOWA 5A95A 4XAPA 3QHMA 4LY8A 1IEXA 1FVPA 2YW3A 2IPJA 4HNOA 4CN4A 1R8LA 1H11A 1IIHA 3KL0A 2NQ9A 3UXKA 3IJ6A 4XO7A 3UJRA 4TO8A 3BJSA 2XH4A 3H53A 2DJXA 2DU2A 2QUNA 3CZEA 4ALDA 1ADSA 2OCZA 2OQYA 2PS2A 1VBGA 2WZIA 3SCNA 4LUSA 1HN1A 2VZUA 3Q67A 2Z1VA 4LBRA 1X7IA 4S3JA 1WKEA 5AC6A 1WDSA 5HJXA 4PMRA 3E0IA 1V3HA 4Y7EA 1PHQA 2E40A 4YTTA 3M16A 3TYCA 4JN8A 4Z2KA 5LNUA 1HT6A 4B3LA 1KW1A 3S2NA 4GYPC 1K9FA 3T05A 1PE1A 4XISA 3W1LA 3EAUA 1PTAA 1QTWA 3BW3A 2JKPA 2F7FA 3GH5A 1WZMA 1OCQA 2ODOA 3OLIA 4N9BA 1PO9A 4IP7A 3WUBA 4NZ3A 5AYYA 1T7LA 7TIMA 3WLTA 5DN1A 4Q6XA 2YCEA 2ZQ0A 1UHVA 3WL1A 3MUAA 1VFLA 1YBQA 3G5EA 2V2HA 3RCYA 4CD7A 5EYWA 1XD0A 2A3CA 2E68A 3L4XA 3ARRA 3CYJA 3IK4A 1KFJA 4GGHA 1UWUA 5JUVA 4LCRA 3W2NA 2NQLA 3TYUA 3GNDA 3OG2A 5MKGB 1XIHA 1SU5A 5CAKA 3I4EA 4LPCA 3NQ8A 3GC2A 4XIMA 5FF2A 4I6KA 3QR3A 4GD0A 1M53A 3W01A 5AHNA 4PCFA 4XZBA 3V4BA 2DVUA 1I2PA 1J4EA 4QITA 4R85A 3WH5A 3MKKA 2YBVA 3STPA 3MBFA 4W86A 2CBVA 3L67A 4UQBA 1P6CA 5H91A 3UCQA 2ZC1A 2QR6A 4B5SA 5HWMA 2GDUA 1UC5A 1JAKA 1OF8A 1TZZA 1KC7A 1XBZA 4DYKA 4X3ZA 4ZA0A 2D3NA 3WMSA 3KBMA 4O28A 1XLMA 1XYZA 2GSJA 3W25A 3LN3A 3ZR5A 3DHPA 3IUIA 1I2RA 1Y5XA 4WF7A 4UNLA 4YTRA 1FWHC 1KQZA 1UH4A 3ZR4A 3TTSA 3EEZA 1ISZA 4EPBC 2J88A 1BF2A 1OD8A 1UOKA 4YTUA 5C7HA 4KETA 4MNKA 2ACSA 4MJ2A 3LCLA 1RY0A 3VIOA 1R6WA 5D38A 1TJ2A 3GBDA 3INPA 4KCVA 4KWSA 1VAHA 3LK6A 1V0NA 4CUCA 4WRHA 1EA0A 3TA9A 2E5BA 4H8HA 3EWZA 3LUTA 3LERA 2NXHA 3W70A 3NIYA 1EP1A 4MY1A 4PRTA 3GR4A 3KOYA 4PC8A 3T78A 3OHIA 1DL3A 5HK4A 3HMCA 2EJAA 2NLIA 3WNOA 5A8PA 1MQRA 2DUZA 5EMKA 1QW7A 1VPYA 4XZLX 3NQAA 2EKGA 3W7HA 1SW7A 1DHPA 3TW6A 5C9RA 4GXPA 2VCAA 4WVXA 4QRNA 2Y63A 2G3MA 2DIJA 4FPSA 1FWAC 3ZMRA 1XRFA 1R2TA 3T4WA 1A47A 3IANA 1LJYA 2X16A 3WNLA 3SN1A 2DDXA 2QDEA 4K8GA 1RD5A 1UR2A 1OX4B 4L65A 4Z1CA 4B9YA 3OTRA 3TNOA 4JIIX 4CQ9A 4O19A 1HKJA 3IIOA 4PUDA 3UJEA 2WOQA 3KOZA 3M47A 3HQOA 3VE9A 3HV8A 2YCJA 5SWUA 5I3IA 3MS8A 5JQ9A 1OK6A 3GB6A 2EF9A 5EFFA 4F0KA 2VX7A 4FF5A 3ABOA 1EJWC 1Q6GA 1EUAA 2GJNA 3SSJA 3TFXA 3IRSA 3PWAA 3KP1A 3I68A 4JKLA 1E4IA 3THAA 3BUVA 5D09A 5GNZA 3I6EA 2NT1A 2W63A 3N2OA 1I2OA 3W53A 4G56A 2RUSA 3AWNA 1NOUA 3CHEA 3AJXA 2PLJA 4QJ5B 3MI2A 4KIEA 5CPOA 3RUBL 2ZFAA 4ZEPA 4XZHA 4GY7A 4QEHA 4DXXA 2C15A 4BQ4A 3TOYA 3NZGA 1JDCA 4L4LA 4O57A 3VKCA 2DW6A 1FA2A 2KZHA 3SM0A 3NQEA 1HP4A 4LUIA 2Q01A 3MP3A 1VQTA 4XK2A 3MKVA 3N9KA 4OUEA 4HCDA 1DQXA 1FWWA 1AZ2A 4LB4A 3C0QA 1IGWA 1RP9A 3W86A 4NAEB 3B8DA 1KO0A 3EB4A 4PB5A 5FJTA 1PHWA 3GVRA 1OFBA 4NF7A 3VMPA 1X6LA 2PEVA 1JRBA 3T2PA 4ZGYA 3PPCA 3EBVA 2PDYA 3EB3A 2FVMA 4HPXA 2ESCA 1DIKA 5D8WA 5CSUA 1WKYA 3AICA 2YDQA 2BSLA 3SRFA 1QAPA 3NPUA 3UR8A 2FMNA 1V6VA 2YIHA 4J3VA 1R9ZA 3OVGA 5IHRA 2VRKA 1JCLA 1ZS2A 1JEZA 3BLEA 3WF3A 1OM0A 3CHVA 4EF8A 2BOGX 3RX3A 4KWWA 4GUHA 1VCFA 4JFWA 2W61A 5FI8A 3HG3A 3KBVA 5H2ZA 2BP1A 1EKOA 4DNMA 4D6FA 5AYXA 4K3ZA 1MW3A 1ZAJA 3OHMB 5GJNA 2ZRYA 4FX6M 3BL3A 1XSKA 4D6DA 3T81A 3A13A 4IG2B 2GVYA 1NQKA 3WJZA 3K30A 3M46A 4KW2A 5LA0A 3GW3A 2FKPA 1WB0A 4S1FA 5H1WA 3SADA 3VGHA 2ISFA 4FHAA 3DBNA 5FAGA 1N2VA 1KGUA 1AJ0A 1PZ1A 2J77A 2EGZA 3ME3A 3N04A 3A23A 1Q4NX 5HA7A 1TVPA 3JVAA 4LWWA 4RJEA 4ROQA 3I4KA 1OGGA 1W1VA 1V6YA 4H7ZA 2VGGA 4XZWA 4PTDA 4ORMA 3GQYA 3PN8A 3CMJA 2E9BA 3LB0A 3BLOA 4C5YA 1W3NA 3L21A 5FD0A 1OYCA 4CU8A 4LCSA 3DERA 5C9ZA 3B3DA 4G1KA 4MB1A 2IKHA 1L0PA 3W1QA 1ENUA 4DPPA 1GVRA 5C6MA 3LRLA 1B3XA 4WDWA 3XINA 3EX4A 1J93A 4ONVA 5D03A 2J66A 3N2CA 3TTQA 2ZRZA 3AHVA 4Q8PA 2BVWA 2ZX5A 4HNTA 2O9RA 2QUVA 2IQDA 2WSQA 1NWUA 1Z48A 4V33A 4GYFA 1JQVA 3K8KA 3QHNA 2DZXA 4L1XA 3QW3A 4NZ4A 4HN4A 4LAKA 2X1SA 3U48A 4I8YA 3AYRA 1CGYA 4C6JA 1XCXA 1C8XA 1IXPA 3SDOA 5DX7A 4AC7C 1XF0A 1VZWA 2CXEA 3N14A 3KAOA 4HZ8A 4ADUA 4MPKA 3IUHA 3FK4A 1TX0A 3KFTA 1UP0A 3RILA 3ARSA 3MANA 1DIDA 2GJRA 5K7JA 4NZ1A 1KB3A 4B91A 4QSFA 3Q4DA 3VNLA 4DUVA 1NDVA 1TWIA 4ATDA 5A6SA 3KP0A 3IEBA 3T40A 3C0JA 3TN3A 2O4MA 2OKOA 4IIDA 8XIAA 1VS1A 1P0DA 2YL9A 3AJ7A 3V18A 1SO5A 3AMKA 4U28A 1HVQA 4PFHA 3VIPA 1A3WA 4AZGA 1MW2A 3MSDA 4JYEA 3TWBA 1H5YA 4Y9AA 3VGBA 3UR7A 2F38A 2C16A 1A5CA 4C6IA 2HMCA 3QY7A 4QE1A 5CPLA 4EOUA 2HROA 1IEVA 1UUMA 1AQ0A 1OX5A 1I0BA 1MXDA 3A4XA 2QMJA 3ICJA 3WLHA 1AW2A 2FQIA 3QGAC 4H6KA 4LFYA 3MU7A 3B8VA 3WBYA 5HMSA 4MNLA 4QCFA 3WJYA 4I5XA 4U2YA 2PP3A 3ZSSA 4EAMA 1ML1A 2WCAA 2PMQA 2NVDA 6REQB 5JU6A 2XTKA 5AN7A 3GKAA 5AVHA 4L64A 4FK9A 5CGTA 1Z9AA 1Y65A 2QCDA 1KWKA 3Q2DA 1TIWA 2CKRA 1O94A 4Q4RA 2R24A 4O50A 2ISDA 2F2HA 3C8FA 5A6TC 1JULA 1K8XA 2ZYFA 2VEMA 4J3ZA 2RAGA 1IWBA 3TAOA 1GOXA 2HRWA 3WQGA 4M51A 4AD0A 1GOKA 4B5UA 1F8IA 3AQUA 2PTWA 1Z32X 2RDWA 3NM1A 1QDSA 3IV8A 1CLKA 3KE0A 4EXBA 3R10A 4HMDA 4B90A 1W1PA 1JCNA 1KTBA 1E4NA 3DFYA 1GK8A 3NXLA 5G2WA 1FWNA 3H2FA 1GHRA 1W3TA 1KTNA 2H8XA 3UR5A 3ECQA 1UW9A 5HR6A 4NL1A 1ZJBA 1EB3A 1M04A 3BDKA 3NM3A 2G8ZA 3QFEA 4PEKA 3HBLA 1EIBA 4QS6A 3S3GA 1R9YA 1UH2A 1R30A 1TE1A 4E4FA 2QS8A 5EB8A 2I17A 2QVHA 2H90A 1OD0A 5AYIA 3C2VA 4LBSA 4GQGA 3E49A 4I9AA 4WKFA 1XFBA 3GXTA 4PE8A 4M29A 4O1CA 5CC7A 4OQVA 1VCVA 1A3HA 3O7UA 3GVWA 1G1YA 2WYSA 4JEQA 2FFIA 2PUZA 3O05A 1O5QA 3GXMA 2D73A 2A3EA 1QVBA 3AS0A 3WMLA 1YTEA 3G6LA 4AH7A 3R12A 1GVSA 4C6MA 2DZTA 3B9EA 3E02A 5CJMA 1KCXA 1ZBVA 5LNRA 2BXZA 3N9SA 2WMGA 5AECA 3OODA 1Q6DA 2H8ZA 1WA3A 1GONA 5LHFA 1WE5A 4F40A 4A22A 3E96A 3GDTA 2Z29A 4YHGA 1H7PA 2G37A 2INZA 3FKKA 7ODCA 4KEMA 3GXDA 4LUYA 1FP8A 3W76A 3DHFA 1FWDC 1B3WA 1F4AA 3A64A 3H70A 4QLJA 3RNDA 1OC5A 1A3XA 3WFAA 3BSHA 1J0ZA 1FDZA 3Q37A 4BI7A 1VBUA 2W6RA 1KRCC 3PZ9A 3GZAA 3S5OA 1FCQA 2VL4A 4GG9A 5BXRA 1K77A 2EBNA 2CBIA 4QIUA 2HS8A 4MVAA 3AXMA 3W7KA 3LBMA 5LXXA 4B5TA 4EP8C 2J74A 3D47A 1FWEC 3GDRA 5EMUA 4IWWA 4JFSA 4WXYA 3P62A 2Y85A 3WH6A 4AIUA 2FZNA 2PFHA 1YPFA 4ZMGA 3CEUA 4PBGA 4O10A 2DH3A 2DT3A 5IBXC 3HGOA 5FJIA 4FZIA 2RDTA 1JZ6A 5C70A 3W7IA 1HKKA 3AZTA 4BR1A 3DZ1A 3DFHA 2CLIA 3P0XA 3MHGA 2PDNA 3TAKA 4HPHA 5CJ5A 4H9ZA 5ABFB 2QIIA 2ZUWA 3BICA 3UF9A 4KFPA 2E5DA 4M8UA 4AHQA 1TTJA 1OEPA 3VCRA 2GQ3A 4FXJA 3PPHA 4NILA 1JRCA 3NQVA 1XDMA 4E8GA 4U5KA 4FNQA 2D0FA 1A5KC 3B40A 2FB3A 4OE7A 1OABA 3L2LA 2PU1A 4ATLA 1Q13A 1QPOA 3MV11 6XIMA 4G8TA 2HVMA 2WZHA 2PODA 2REQB 4DQWA 5HANA 4K36A 1UR3M 4J35A 5CJNA 1I1WA 1XCWA 1QO5A 4RK8A 2JKEA 3VIIA 4NNBA 3AZSA 3WNNA 4DYEA 3EA1A 2NZLA 3FDKA 3TR9A 4HNVA 2G41A 2WHMA 2PDFA 1X7FA 2C0AA 1L8NA 2XVLA 1XD1A 5BYWA 1GYNA 2F6UA 2ZXQA 1HNYA 2Z2UA 4D8LA 4QTGA 8TIMA 3CUFA 4G2DA 3F2CA 2WC7A 3JUGA 4LF2A 5BROA 3W2JA 2V5LA 1OT1A 2JEPA 4Z2HA 3NZ1A 2PRLA 1QMLA 2YX0A 3WJXA 4QJ1A 4RX0A 4K39A 4ACZA 4PUNA 1LLOA 4Q4KA 1PTDA 2B0MA 4UC5A 1YMYA 3ES7A 4BQ2A 4MDOA 3WQ6A 2VT0A 4LQ1A 4LV9A 2VCCA 3TK7A 3DIPA 2F9RA 1RVGA 4LF1A 1YKWA 3ZZ1A 1E3ZA 4CCZA 4E6MA 1D9EA 2ZZ3A 2WKLA 1Q6FA 5EKYA 1X1OA 4PGLA 2GL5A 4XTDA 1V7AA 3MI6A 2PSNA 2GUBA 1E73M 3VINA 2Y7EA 4RDZA 1MYRA 3KBJA 4H6QA 4WJ8A 2W27A 2YZ5A 2F61A 1OVDA 3VUSA 4A29A 3QVQA 1NIUA 4QNEA 2W4XA 1NH6A 1A0DA 1ZHAA 2DT1A 4MKSA 3LTSA 5JH1A 2UV8G 1EDGA 1KBIA 1NOFA 2F2KA 3M5XA 3UYCA 2V82A 3AXXA 4P61A 3LYEA 4C1KA 1D7KA 2VRJA 2IMRA 4N42A 4I8DA 5FF3A 1ZJHA 2P5NA 3KHDA 2ZA3A 3G8RA 3V7PA 2YFOA 3VIMA 4O18A 3WMCA 2YFNA 3GU9A 4AY8A 4BHYA 2NWSA 2DJLA 4IQEA 1MUCA 4OWGA 4CCDA 4UQAA 1PXGA 4LCQA 3EDJA 4K1WA 1V51A 1F61A 3VDAA 1I4NA 4W7VA 2NQZA 4HD5A 1MO0A 3S8HA 4IF2A 3LLFA 3CL8A 4DJFC 4IFRA 4XBJA 1OYBA 1F5ZA 4GC4A 1QW9A 1AK5A 2WPBA 1QUMA 2NV1A 3VC6A 3B8UA 4CNPA 1V03A 3GO2A 2QUUA 3GDMA 2CLHA 5D30A 1Q45A 1DTUA 2VD9A 1W17A 2XISA 4EPEC 3G22A 3KHJA 4GZIA 3TC3A 4Q4OA 1DJIA 3PAJA 1QHOA 4CN6A 5I02A 4P2VA 4LUJA 1DWHM 3WDJA 4XZNX 2TRSA 3BZGA 2ZUNA 5FJPA 1Q5MA 3MSYA 3R13A 4HQVA 3W23A 2VM8A 3HPFA 1ME8A 3GNXA 3WD3A 3T4CA 3VX0A 1TTPA 4MYAA 3PY2A 2D0HA 3BSMA 5HR7A 4FMVA 4NSBA 3BJFA 3TLQA 2Z1XA 3LXCA 4PB4A 2ZZ2A 3UQNA 5CSYA 3OGSA 5CPQA 4PCTA 1CLVA 3GWQA 2PDPA 3GXNA 2YJQA 4IMGA 3NDOA 2FJKA 1GOMA 4DO6A 3WJSA 1LUCB 1T6MA 2DSKA 1MUMA 4GRSA 4Q7NA 3WELA 2Q3RA 3I7RA 4FXRA 2OOGA 1AL7A 4IMFA 3DUGA 4AMCA 4QBXA 2OEMA 1O6IA 5TAOA 1PDZA 1CI1A 1QK0A 4PTXA 4MZ8A 3LV6A 3PPFA 1SO4A 1C8VA 3A9IA 2XIMA 3LLDA 3MVTA 2PDGA 2EPMX 2IW0A 3SUUA 1CX9A 2D22A 1TREA 3F4CA 6A3HA 1U30A 3BAXA 2QJNA 3D3AA 5A6LA 4UZUA 5C9UA 4GI4A 2QJGA 2INFA 4QG6A 3R89A 1E5JA 1JAEA 1BFNA 2FHCA 4MJZA 2IPFA 1AW5A 2EG6A 1G7VA 3E0LA 4A21A 5I06A 2CLPA 3VNKA 5H8MA 4O4WA 5F1UA 3OB8A 4IQDA 4WY0A 4N7QA 5C54A 1OC6A 3BANA 2OWWA 1M68A 5REQA 3W07A 4ZL1A 4R7OA 3VFCA 3KOFA 1YNYA 3HPSA 2E6FA 3LD5A 1OGSA 1I60A 1ONRA 3DOPA 1DJNA 4RNFA 3T0AA 2KX9A 2GGJA 4OKDA 2WZMA 4JX5A 1EYWA 1FWTA 3C2YA 3WQPA 4GI9A 5CC6A 1ALDA 4XTIA 4R9OA 4H3DA 1CTNA 2X2YA 4UTMA 3MWCA 1GQIA 3NXFA 3E5BA 2PWDA 2AKZA 1UWQA 3UD6A 2WVSA 4RZ6A 5CLWA 1SR9A 4F0LA 5I24A 4YNGA 2C71A 3I3DA 1V0LA 2OB3A 3MT1A 4LXFA 2MNRA 4IPPA 3NJ3A 2EAWA 3AU6A 3IAPA 4LUTA 4N9CA 3LHWA 1E56A 3MTWA 3UWUA 2R1LA 3NSNA 1LBMA 6XIAA 1XYBA 3QFWA 3HM7A 5G1TA 3TTEA 1JCYA 1V08A 3B0XA 3PM6A 1RBLA 4QJ4B 3ERPA 2C1GA 1E40A 1ZRQA 2WMIA 4WR3A 3SQMA 4LEFA 4PUKA 3GK0A 3JRKA 3H54A 4K68A 1UP2A 1B31A 4AY1A 4JTDA 2C8NA 5AC8A 3BXWA 1TELA 1EO5A 1WNOA 3TE9A 1JYVA 3ZIZA 4XAZA 3CASA 2OGYA 4UQ9A 1LQ2A 4DAIA 1VFHA 5FSDC 4LNYA 2V6AA 3EDFA 4W93A 2X40A 3W7CA 3OBAA 1T40A 1G6CA 4UMAA 1UD3A 3KM8A 4ERGA 1GHSA 2TPSA 4YJ5A 1SMAA 4TMBA 1PIGA 5JVLA 4D6IA 2Z1WA 4J40A 4J5NA 1Q85A 4H01A 1US2A 4MMWA 1DJHA 2AMXA 4JQ2A 4H4IA 1OZQA 3N13A 1LM1A 4J3WA 1TFVA 1V7YA 1Z89A 4DM1A 2IXVA 4ZB2A 1A4LA 4AHPA 3U2EA 2CESA 3L4WA 3B9DA 2X30A 4KS0A 4D2JA 3HZ3A 4KRUA 2DT2A 2P88A 3GTHA 3CO4A 2OR2A 1LL4A 3HQ1A 2WM1A 3CQKA 3GG7A 3NCOA 7REQA 3DFSA 2QXWA 1IZJA 4NAFB 3W27A 4AQLA 1CXIA 3RPTA 3SCRA 2VR4A 5DRCA 3UGRA 4ZE4A 4XKMA 2VOMA 2C7FA 2QCMA 3KVJA 1XH2A 3LM3A 5ABEA 3EWYA 1F74A 2B4GA 4YXGA 1EWEA 1DJYA 3IRDA 3CZGA 4YPJA 2RFGA 1J0HA 1O1ZA 1D2KA 5K4ZA 2C19A 3PUGA 2Z26A 4B5WA 1HJXA 4DIAA 1TMHA 3DX5A 1MZRA 3G0UA 3V5CA 2YKKA 2J7CA 2ZRXA 4Y2WA 2HE8A 3T7VA 4QG8A 3GDLA 6ENLA 3SN4A 2GUYA 5EFDA 3APYA 4H04A 1XISA 3WD0A 2ZRVA 1FDYA 4KH2A 3TQPA 4UFHA 3OO2A 3ELFA 1BSIA 5A2AA 1JD9A 4S3FA 3BV7A 1SFJA 3TSDA 2VZOA 3LMZA 4AF0B 4S2BA 1Z42A 5HXMA 1CPUA 2Z1BA 3PZTA 1C92A 2ZZ1A 3TZFA 2I16A 4M0XA 5F1VA 2D2GA 3PHAA 1SZRA 5DY3A 3RO6A 2F6XA 2JBMA 1CZ1A 3W7LA 3UPBA 1E15A 1K9DA 2QGYA 3BG5A 3DG3A 1EC9A 2EPKX 3PNZA 3ABQA 3PTKA 1XICA 5I07A 4GFSA 1SQ7A 4XG1A 1PKLA 4IIHA 5CZ0A 2IXUA 1HW6A 1XP3A 3C2EA 3RR4A 2PTYA 4B5NA 3OQ8A 3KWSA 2C1HA 3W1PA 2ISVA 4HZ6A 3DC8A 3RMJA 3WF1A 3T8LA 3W1XA 2ABBA 3PC0A 2AKMA 2ZC8A 3OGRA 3ANUA 2PCEA 1XUZA 5IDZA 2VURA 3WNMA 4XBKA 1WKDA 3QGKC 4ZSUA 4ZQRA 3WH8A 5M03A 1NU5A 1CW2A 4ADSA 2BVDA 3H26A 3FA3A 1N8WA 2OPJA 4K8EA 4JKMA 1KFWA 2GVGA 2WZTA 2J9ZA 4OBSA 4QJ3B 1XRTA 1RA5A 4HK5A 3W4RA 3ZS4A 3C86A 1TPVA 4MF4A 1RZMA 3OBKA 4AIEA 2GWGA 4O8RA 1O95A 1ELSA 1Z8AA 1W3HA 4QE4A 1XJBA 1QI3A 3L12A 3VC5A 4TV5A 2RDUA 4TX8A 5CPSA 4C7FA 4XD5A 3UT0A 5LZLA 4FNRA 2WMFA 1BYBA 2IS7A 2YLLA 4IICA 2CERA 1TUFA 1XSIA 5E0FA 2A7NA 2YOCA 1R3WA 3E2VA 4KEVA 3CB8A 2OQLA 1P6WA 5AC5A 2CC0A 1EF2A 1JI1A 3QXBA 1WQ5A 3ISIX 1AZ1A 1DIOA 1UZDA 1O68A 3POCA 1XI3A 3RM9A 1S2UA 3B97A 4CGTA 3CUIA 3TV8A 3MY9A 1TPFA 3O15A 4HNUA 1YNQA 2DORA 2QW5A 4H9TA 1L6WA 3PBWA 2PD5A 3WUGA 1YXCA 3WK2A 4ZODA 4LAMA 5LKYA 4AZCB 1OYAA 3BSGA 3F2BA 4JAWA 1QW8A 4BS0A 4GWEA 1S2AA 3N4AA 4Q8NA 4DZ5A 1OQFA 3R8HA 2Q02A 2VCBA 5I3KA 1EIXA 4EPDC 1OCNA 1W9VA 2XPKA 4AISA 1OCBA 1V8EA 2PE4A 3M64A 3VDGA 3CUXA 2I9UA 4MWAA 4YWIA 4PMYA 4S3GA 2FTWA 3SBFA 1CXFA 2J6XA 1GTEA 3CV2A 1GYLA 5G1YA 1WXZA 4LW7A 4HOXA 1W9DM 1J6OA 3ZO9A 4BEUA 5G2HA 4O14A 3WENA 3A4JA 5CEWA 4B2DA 3GXPA 3W1AA 1EA9C 3WSUA 3CUZA 1CGVA 4D72A 3NOYA 4F79A 3C2RA 1F6YA 1TJPA 4IMCA 1D3HA 3PUOA 4RE0A 2PLKA 1QRQA 5CPNA 3B9AA 1THFD 1GGOA 1UYQA 1E9ZB 1K4GA 2WPGA 4IL0A 2DUXA 1TR9A 5AKQA 1L6GA 5HQEA 3GH4A 4JTRA 4JTKA 1UKSA 3TCSA 1P6BA 3IK2A 3MW7A 4Q4MA 1ZP4A 3S6TA 3BAYA 1JZ2A 1RCOB 4GQQA 3IIVA 3G1VA 1V5XA 1UQZA 1VF8A 2ATMA 1H0GA 1ZTVA 2FFCA 3W1TA 1M5WA 3CLWA 2X8RA 4KRZA 5E5CA 3WEZA 4ACZB 1MXSA 5EMJA 1SSGA 2PWFA 3N17A 1X98A 1P5BA 5IRPA 2Y89A 2PDCA 2X09A 1EL3A 4DX3A 4JTUA 1VENA 3CTLA 1W2VA 3U57A 5FJUA 3W7NA 4I5RA 1QOQA 4CCEA 3UVAA 1J5SA 4ICCX 1ZY9A 2O55A 1XG4A 2QUTA 3QZAA 2VZSA 3W28A 1Q63A 1R3RA 4CVUA 3P81A 5E1QA 3N29A 4S3AA 4QFUA 3MPGA 3C3UA 3CV7A 2BASA 1U83A 2H9AA 4JNZA 4MY8A 3W00A 1LRNA 3RLVA 4GHRA 1J6PA 3UZXA 1BTMA 4G7FA 3MA8A 2QCGA 4W89A 4HZ7A 1R38A 3M41A 3PZGA 4C60A 2QYGA 3PULA 1XLDA 5AFDA 1B30A 1TVLA 4NXSA 1NJJA 4BQ5A 4GVFA 1QBBA 1ECEA 4BJHA 3N25A 3QN3A 4LALA 3UCCA 2OX1A 1T5AA 3GG8A 3QV6A 1C3FA 5BNKA 2X1TA 1ZBCA 3BPWA 3U2ZA 3PTDA 3W1NA 1H1YA 2HXUA 4XO6A 2ALDA 3E2SA 2VFGA 4IGHA 1DTNA 3AIBA 2E6AA 2L5HA 8XIMA 1Y5VA 1TWSA 3FA5A 1U1HA 4M24A 3T0DA 4ERIA 1CT5A 3BG3A 3DFPA 1OX6A 3QBUA 4IZGA 2VRQA 1WBJA 4LNCA 4EIVA 3PSVA 1ZCCA 4HCLA 1PIFA 3EB2A 3GIYA 1E6RA 2OJPA 3R8RA 1KGXA 4XQ6A 1R9XA 1XR2A 1XC6A 2VOTA 1GKQA 4E2BA 1S5NA 3FV9A 4GYKA 3G1XA 3CM4A 1TJ1A 2VC7A 3OJGA 5BXSA 3O2LA 3A3WA 1DQWA 3AUJA 2E0PA 3QTPA 1C9DA 1RJRA 1AQHA 1KCKA 3A4WA 4Z1BA 5I5RA 1SZNA 1UKQA 1OIFA 3RRXA 2OYKA 2KAUC 4Z2LA 2Z1SA 3TU9A 1VRXA 3BW2A 2HQAA 3UWYA 2VQTA 1TZ9A 3P74A 3T07A 3EOSA 2GJPA 4MWAD 5I7GA 3QPZA 4L56A 4LANA 2XVNA 1LRTA 2J7HA 4LV4A 5FIPA 3L0NA 3NSMA 1ITCA 1QNQA 3ABRA 1KLZA 2F8QA 1KFEA 3LNMA 2Y7DA 4O0QA 1N7KA 3CQIA 4O53A 1K7XA 2OXNA 3NOEA 5A6BD 2O9TA 1XM3A 1R86A 1A5UA 2DZBA 4P7OA 1W91A 2W67A 3R6IA 1YTKA 3DI0A 1KR1A 4PODA 3KDNA 2GZXA 5CQ1A 4QG9A 1ZAHA 3D6NA 1D7FA 3GC5A 4E38A 4UR8A 4JY8A 5A8NA 1BAGA 5GNYA 4FNTA 3BMWA 1J8VA 2JALA 1GVOA 1F7BA 3W38A 3V0UA 1UASA 4O1EA 3Q45A 1IT8A 1W8SA 4ZO9A 1IR1A 3PBUA 3GNRA 4A3QA 4Z2JA 4CEUC 1P1MA 4E8CA 4ATWA 1ZSXA 3RG6A 4INFA 3RDKA 3VOFA 4D6HA 2E9LA 2XIQA 5CLTA 5JH2A 2CBJA 1GVFA 1P0BA 3C0SA 1QATA 4A3RA 1J0IA 4RZBA 2FMOA 3R8GA 3OYXA 3E0WA 4NY2A 3FYYA 4WY0B 3H2EA 1TPC1 4O8AA 2I7GA 4LH8A 4OIFA 3A47A 1BRLB 2VI0A 3HG4A 3PJUA 3AU2A 4JIHA 4JHZA 1F4HA 4BI5A 1WXYA 3DENA 1X38A 4WSHA 1XH0A 3W7GA 3U4FA 4PSPA 3FS2A 4GX8A 1W5QA 2QV5A 1LOQA 3BTNA 1CIUA 3PVFA 1VPXA 1GQJA 4D8AA 1IR2A 5ENLA 4A8IA 4O0ZA 2Z1KA 2WVTA 4FR6A 4B4HA 4I7VA 3MC5A 4MM1A 4C6EA 3DI1A 3RF9A 3HTWA 4LTSA 1Z6KA 5CC3A 1QPNA 3TYZA 1NELA 2AL1A 3APTA 1E4LA 3LPGA 1JG9A 1TCMA 3AIRA 3I3EA 2XSXA 1A5AA 1HO1A 4DELA 3TXZA 5I09A 1S1PA 5D9NA 3IIXA 5I3FA 1XLLA 2P1FA 3WQ4A 5A5WA 3G6MA 3FVDA 1POJA 1EXPA 1KLYA 4EVZA 3N4FA 3QR0A 4URIA 2WMIB 3FFSA 2PTZA 1M7OA 2P0IA 4GIAA 6TAAA 1DPMA 2CHRA 1WPCA 4F0MA 2WNZA 1RR2A 3KS5A 1ZZMA 2PTXA 1UA7A 3FGCA 3ARWA 2E3ZA 3N19B 4WHBA 3T0CA 5B7YA 3SECA 1TX2A 3G1HA 2DVTA 3PJWA 2CLEA 3NQBA 5BOFA 1C7TA 1HGYA 4GVGA 4P8UA 4JTFA 5C9WA 3V36A 3SI9A 3UJFA 4DBEA 2VC9A 3USZA 3LLXA 2ANUA 1GORA 1JPKA 4BK9A 3VNIA 1XCFA 2BXYA 1G94A 3MUCA 1XIBA 2XHYA 3LHZA 3QPYA 4CD6A 3QY8A 2YDAA 2R82A 3URAA 3GBEA 4BQ3A 3B8IA 3W87A 4NZJA 3VIFA 4HNCA 4ZQPA 2WMJA 3WQDA 4GJIA 2PWHA 2CZDA 4RNHA 4NRRA 1ICPA 5ECVA 1JPDX 1W1B1 3N2XA 1GT8A 4C7DA 1BXCA 1ICSA 1PX8A 2AOSA 3L2IA 4AX6A 3AAMA 1GZGA 3GE7A 2QHAA 2Z27A 5D2VA 1Q8JA 3S83A 4C5ZA 3WH9A 2A2IA 4D1IA 1H4PA 3QPEA 2PCQA 1EC7A 2GOKA 2NT0A 1ITUA 2QCNA 4CKQA 1UH3A 2VX4A 1GJWA 1PZ3A 2ACRA 2VMFA 3AHXA 1LOSA 3LHTA 3TH6A 4JBRA 5A8GA 2QF7A 3G8EA 3CYVA 3M5VA 4RLIA 4A05A 3RGTA 1KQYA 3AALA 4HHLA 5A6AA 2VWTA 1ZGDA 3JR2A 4HMNA 4F9JA 5CKSA 1FWIC 2CLLA 1B4EA 2QLYA 3HV9A 2OODA 4DWSB 4GMEA 3PANA 5M1TA 4BI6A 4GQ0A 3U0HA 3L5LA 5JMUA 2V5JA 2ZUSA 1LRQA 3PFRA 4MLRA 3CZKA 1W5OA 3U3HA 4A3YA 2GQ9A 3G2GA 3V0SA 5IFPA 1MQPA 4OHQA 2IUZA 4GXMA 3HB9A 2J7EA 3WDIA 2OFJA 2PDIA 2WQDA 5DBTA 2OT0A 4RNIA 1XIMA 4UOZA 2A6LA 4MJ4A 1FDJA 5F2GA 1HL9A 3MCMA 3V75A 4N9DA 4I7WA 3NPWA 1K70A