2VC6A

Structure of mosa from s. meliloti with pyruvate bound
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
292
structure length
291
Chain Sequence
MFEGSITALVTPFADDRIDEVALHDLVEWQIEEGSFGLVPCGTTGESPTLSKSEHEQVVEITIKTANGRVPVIAGAGSNSTAEAIAFVRHAQNAGADGVLIVSPYYNKPTQEGIYQHFKAIDAASTIPIIVYNIPGRSAIEIHVETLARIFEDCPNVKGVDATGNLLRPSLERMACGEDFNLLTGEDGTALGYMAHGGHGCISVTANVAPALCADFQQACLNGDFAAALKLQDRLMPLHRALFLETNPAGAKYALQRLGRMRGDLRLPLVTISPSFQEEIDDAMRHAGILL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords DIHYDRODIPICOLINATE SYNTHASE
publication title Structural, functional and calorimetric investigation of MosA, a dihydrodipicolinate synthase from Sinorhizobium meliloti l5-30, does not support involvement in rhizopine biosynthesis.
pubmed doi rcsb
source organism Sinorhizobium meliloti
total genus 105
structure length 291
sequence length 292
chains with identical sequence B
ec nomenclature ec 4.3.3.7: 4-hydroxy-tetrahydrodipicolinate synthase.
pdb deposition date 2007-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2vc6A00
3EWWA 4KFNA 2D73A 1GWJA 2WV8A 1M6JA 3AJXA 3TAKA 3B05A 4HSOA 5AC6A 4RX0A 3PM6A 3THAA 3R2GA 1FDZA 1OFOA 5I3KA 5AHIA 3NM3A 5K4XA 2ABBA 3TQ0A 1TJPA 2OT1A 4FXSA 3B03A 5LNUA 1GT8A 3PBVA 1SW7A 1OVDA 3I6RA 1W5QA 2YFNA 2VKZG 3SSJA 2YSWA 2CZDA 4H4IA 3UWQA 1TREA 3C56A 3CWNA 3G3MA 2QCDA 5KTLA 2QCMA 1LZOA 3LBMA 4CCCA 1CI1A 3N3MA 3W87A 2CW6A 4JYFA 1QNVA 2YDAA 3HPZA 3HF3A 1K02A 3FJ6A 4AWTA 3HGSA 4NZFA 1T99A 4RKAA 5CSSA 3STEA 1QWGA 3HBLA 3E49A 1QO5A 3MHFA 4RK8A 3S5OA 3HPXA 2VXNA 3TW6A 1WDWA 1VPXA 1SFLA 3BLFA 3NA8A 3M6YA 4OE7A 1H62A 4MYXA 1N55A 1G69A 4Z0SA 5F2GA 1OFDA 2C16A 4IMFA 2FLIA 5K9DA 3MBFA 3BPWA 1F2JA 2ISVA 5FI8A 5KZDA 2XN1A 4W9TA 4GNJA 1KA9F 2G95A 4O1AA 3W9ZA 4YCPA 1H7OA 1XDMA 3UPBA 2Q3RA 3HGOA 4IUOA 3ATZA 3HIJA 4BF9A 4UTJA 4FX8A 1JCXA 1Q45A 2CLEA 3W7KA 3L66A 1VGAA 2Y62A 4EOUA 2V5BA 1XUUA 2VFIA 1B3OA 2ZZ3A 1EX5A 5LZLA 1YADA 5HUOA 4Z1BA 5LSMA 3GDTA 2QKFA 1KM5A 2NUXA 3OVRA 1H5YA 2B4GA 4JD4A 3GDMA 3HO8A 3P61A 1J5TA 4FEZA 2ZYFA 4NVTA 2C6QA 4NJJA 3LCFA 3P82A 3M5XA 1O4UA 1OJXA 4N4QA 1JCNA 4O28A 2QJGA 2QCNA 1EWDA 2DU2A 1SW3A 4AB4A 2C18A 4QM1A 2FJKA 1H50A 4M6PA 2UV8G 2OMAA 4FIRA 1OYBA 4D2JA 4JTIA 1K8XA 2OJPA 3HPSA 3MHGA 1RQEA 1J4EA 5U4NA 3BK0A 3VI2A 5E93A 1UUOA 1DQWA 1H60A 4GUHA 4ZQOA 3QMTA 1D3HA 3P8JA 4Z1DA 2X16A 4FNPA 3G1VA 4XBKA 2VEMA 5CZJA 3O6YX 2Y70A 2YW3A 4OGZA 2V82A 3EX3A 2E6DA 3FEMA 3NL5A 3W73A 3OVQA 4O19A 3LI0A 4UR7A 3GKFA 4FNUA 1PIIA 1ZHAA 4O52A 1YYAA 1DORA 3G1XA 3THQA 4N6EA 4AVFA 3N14A 1I2PA 4E2DA 3TK7A 4JY9A 5I3IA 2ZDRA 3GK0A 3UPWA 8TIMA 4Y96A 2A7RA 3A5FA 1R46A 1VCVA 4A29A 1VC4A 4DBDA 3BG9A 3TQKA 4JIPA 5EY5A 2ZZ5A 2VOMA 3EXRA 3O05A 4IJBA 1A5BA 3GNNA 1F5ZA 3QC3A 2FTPA 4OV4A 3BVJA 4HT3A 1WYIA 3KXQA 2QDGA 2QJIA 2ZA3A 4CNOA 1QPNA 3NQ7A 1TQJA 3HG4A 4Y6GA 1W54A 3NZRA 5D2YA 4CLMA 1OK6A 2ZRZA 1GEQA 3OVPA 4KFPA 1A5AA 5CSRA 4YLWA 4UTMA 3PSWA 1ZJIA 4S1FA 3W7NA 5HWJA 1YPIA 4NJHA 1FWWA 3LCGA 3W70A 5AHLA 4FNRA 1UBSA 1VLIA 2BX7A 4N4PA 3QPZA 1H51A 1W1ZA 1TPVA 3DBPA 1GZGA 4O18A 2E68A 3MW7A 1X1ZA 2VEIA 4JN6A 4O13A 3B0UX 3TE9A 1JUBA 3C2EA 5DELA 4POCA 4DPPA 4BR1A 2W79A 3R13A 1IIGA 1HO1A 4YMZA 3CT7A 3QW3A 2EF9A 2HTMA 4YXGA 2YYUA 4OU1A 1N7KA 3RU6A 4E0CA 4ZQPA 5LNWA 1K8YA 4LV4A 1XI3A 3R12A 4O16A 5AYZA 4TIMA 4H3DA 3LX9A 3SGZA 2J24A 1KM6A 4IOTA 1B9BA 1TV5A 1V7YA 1TTQA 1VLWA 2DJLA 5G1YA 4PCFA 3EXSA 3TDFA 3NQDA 1HL2A 3PC0A 2ATMA 3ABSA 3INPA 3P7YA 5FF3A 3W1RA 2O7QA 1EUAA 1IXOA 3P67A 3B0PA 3MBDA 3KVLA 5DBUA 3W2MA 4UIOA 2HS6A 2PRLA 1O5KA 5CPMA 4O1BA 1R30A 1XBVA 1FCUA 2ZRYA 5F2IA 5KMYA 3NM1A 3C2RA 3R89A 5AYYA 4LOCA 1O95A 2CFFA 3G18A 3GLCA 1LORA 4AEOA 2WOQA 1JCLA 1ME8A 4CCDA 3ANYA 5G4WA 1BWKA 1RQBA 1PHQA 1L6SA 4OHQA 4R34A 4UFJA 3CC1A 3LXCA 2YYTA 5C5YA 2ZCGA 1H7NA 1IF2A 3EWUA 1M7OA 3ZFHA 2WNZA 5K3VA 3TR2A 5CKSA 1JVNA 3U8GA 3M9YA 3MYOA 4NJIA 1SO4A 1U83A 3JR2A 5AHFA 3GR8A 4HSNA 3UZJA 1TTIA 5HR7A 2GVLA 3SIZA 1RQHA 4JX5A 2BLEA 2NX9A 1SU5A 5I3FA 3O06A 5LKYA 4A2RA 2GPTA 1ICSA 4CQAA 2TMDA 2V2DA 3L0NA 2CZFA 5TQLA 1GG1A 4LW7A 3PR2A 3GDRA 3GVGA 4JDBA 1RPXA 2CLIA 4MLRA 5LNRA 5D33A 3BLEA 2I1OA 2BSLA 4P2VA 1F05A 3B0VC 3P84A 3EX2A 2W6RA 3GAKA 3ABOA 5AHNA 3DFQA 3QYQA 2ZZ1A 1K7XA 1AW1A 2ZRWA 2E09A 5U7SA 3Q58A 1FWTA 1TPC1 3TAOA 5C6MA 3LCLA 1KFJA 4AH7A 3P8IA 3TU9A 2Z6IA 2FPTA 2DZVA 3OIXA 1TJRA 4LS0A 1OG0A 3LHZA 3M5YA 3ELFA 3NQEA 1UB3A 2AGKA 3A23A 1GYLA 4EIVA 1DV7A 5HWNA 3CIWA 3W86A 4DELA 2NWSA 3RNDA 4U4MA 1R2TA 3LHYA 3DFTA 3TIMA 2B7OA 1TSIA 2QUTA 1FWSA 1KBJA 3FA5A 4EWND 3IIXA 1W31A 3TSBA 5HMSA 2QJHA 3O63A 3PSVA 4JTEA 4RR4A 4UFMA 4O8RA 3NXFA 4GE8A 1TV8A 4MOZA 2VFHA 5G5IA 3CHVA 3NG3A 1KTCA 1NF7A 4HPXA 3CQ0A 3G1SA 5F1VA 3DKJA 3LERA 3EWZA 2FPYA 3O15A 1UCWA 2CLFA 1FY6A 2PRMA 1NVMA 1GG0A 2JK2A 3NPUA 2A6LA 4MZ1A 4M7SA 5D2WA 2DZPA 4DBEA 3W6YA 3YPIA 1XBXA 1GYNA 3WK2A 1GVOA 5FEXA 1ZAIA 3USBA 2RFGA 3IIZA 3MHUA 2R94A 1OX4A 3DU0A 5DXXA 5EKYA 5FF7A 1AL8A 4DXVA 4HKPA 1LBMA 3DFSA 2E6AA 3L0GA 2A0NA 3C2OA 3GYEA 4M6QA 4JTKA 1MEWA 1Q6LA 4N9CA 1WOAA 3GXPA 3W84A 4JYDA 1JRBA 1FDYA 2A85A 4RXGA 2Z2UA 2X30A 1U5JA 4AAJA 3NZ1A 1SQ7A 1I2RA 2ZZ7A 3NO5A 1KBIA 3N2XA 4EF8A 1HTIA 3G1DA 4TX9A 5K2ZA 3QFEA 1THFD 3QJAA 3S0CA 3P60A 3MI3A 3CLMA 2QCHA 4ML9A 2VENA 2VEPA 3PS7A 5AOUA 3LLFA 4N2YA 1P1XA 4NJKA 2C14A 3KVMA 5LHFA 4DEFA 3N34A 4UTHA 5BRBA 1GVRA 1LOLA 2EGZA 3S5NA 4IQLA 2WNNA 3MI2A 2V81A 1QPOA 5G1TA 1QMLA 2PCQA 3RFAA 5HJLA 3W2NA 3VCRA 2GQ9A 1JCYA 4LV9A 5AN7A 2J88A 4HN4A 4FB7A 3HOJA 2ALDA 3UYCA 3BG3A 3L2IA 1OFAA 3P81A 4ADSA 1YXDA 5D37A 4RZ6A 1JQXA 5IM51 3E02A 3LV6A 1JJKA 5J5DA 2NX3A 4CCEA 1DJNA 3BW3A 2C13A 4RJEA 3NGJA 2QCLA 3OBKA 4NJGA 4O50A 1KM2A 4HNNA 3TSDA 4FX6M 4MY9A 1R2SA 5DCEA 1K8ZA 2TRSA 3CWOX 4G1KA 2R8WA 5FESA 1SUXA 2Y7DA 5F2MA 2P0OA 2FB3A 3CIXA 4IMGA 3BW4A 3HG5A 2G5WA 4JR5A 2NUWA 3E96A 4MIMA 3FOKA 5L6UA 2AAMA 4OQVA 3MYPA 2P10A 4XTDA 2C1HA 3CEPA 4O54A 2WSRA 1Q6QA 3UNDA 3W07A 1YXCA 3EWBX 4LU0A 3TNOA 4RV8A 2ABAA 2A21A 3DFPA 4P61A 1SZEA 4IPJA 4N02A 1FQ0A 3DI0A 4N9EA 2W0UA 2ZBTA 5D09A 1X1OA 1OFEA 1FWRA 3W2JA 2QEZA 4DF1A 2DZUA 5FEZA 1DHPA 2I9EA 5CPLA 4E38A 1XBZA 5KINA 1LRNA 3TMLA 4HNVA 4QSHA 3TQVA 1G6CA 3PBUA 4OT7A 4K6AA 1XL9A 1T96A 2FIQA 2R14A 2F7FA 2TSYA 2X2GA 3SY5A 3F03K 2ZZ2A 2E5CA 4FX7A 5G4EA 1LTDA 4O15A 3GDKA 3S5ZA 3NQMA 5LNSA 2IQTA 1KV5A 1JCMP 3DGRA 5G2IA 3NL6A 4CNPA 1JCJA 1WBJA 3LTYA 1SZGA 4O4VA 5LGZA 4XQ6A 2BWGA 1VJIA 2ATSA 3ZWTA 3TJXA 4Z0JA 3M16A 2WNQA 4FNTA 4TMBA 1F7BA 4ZQNA 3MWAA 3QPYA 3T7VA 3CM4A 3FYPA 3IIVA 3O6CA 4IPIA 5AHEA 4BWLC 3OG3A 1BWLA 2ZZ4A 1Y0EA 5BNKA 2YR1A 4O10A 1KFLA 5DY2A 1ZAJA 1ZALA 1E51A 4GBUA 4NZJA 2BZNA 4PL1A 3STGA 3I7QA 3QEZA 1LBLA 1GQNA 4JTTA 5E0KA 3LXAA 1KTBA 3AO0A 4YCOA 1OABA 1SR9A 3GKAA 3W1NA 3NPWA 4GUJA 2H90A 2ZRXA 5C54A 4UFKA 2ZTJA 1KM0A 3NAVA 3M1ZA 3RLVA 1GOXA 2CLOA 3MO7A 1OYCA 3TJLA 2YZRA 3PF3A 1G7VA 1N8FA 5DXYA 2V9DA 5IBXC 3EWXA 1M5WA 1EB3A 4QNEA 2OZ0A 3TFCA 1EA0A 1UASA 5AB3A 1RVGA 2C15A 3C2VA 3IIOA 4UMBA 4UCGA 5SWUA 3S8HA 3WJSA 4ZQMA 4XBSA 1V5XA 3TFXA 1YXYA 4UTWC 2J27A 4PFMA 1OX4B 3NQ6A 2GUUA 2V30A 3LTSA 3LLDA 3NOEA 3W1MA 4NU7A 1W5PA 4E2BA 3QQ1A 4AXKA 4JS3A 4XKYA 4UTUA 2BTMA 4NXKA 4NNBA 5E1QA 3GAYA 1TB3A 4WX2A 5K4ZA 1CW2A 1X8FA 3DHFA 4MVAA 2CLMA 4MY8A 4J9JA 1DQXA 3WK0A 5LNVA 1XCFA 4LVGA 2KZHA 3LGEA 4K8HA 4M19A 3MI6A 4JX4A 3G8EA 1G4SA 1LBFA 2H8ZA 2CU0A 1LOQA 4HHPA 2V0TA 4I7WA 3TKFA 2P1FA 2OCZA 1K3UA 4R7JA 1A5SA 5F4SA 3W2KA 5G2WA 4KFOA 2C0AA 4FO4A 4C1KA 3STCA 3EXTA 5AYXA 4UFLA 3QSTA 4JTHA 2NXHA 3NNTA 4O57A 3LHTA 2RHGA 3QMRA 2CLLA 2QUUA 4UMAA 2GJNA 4N9BA 4WOQA 1OHLA 3W71A 3O07A 1ICPA 3NVTA 3PBWA 4DF2A 4PA8A 1MXSA 4B5NA 4A21A 4PL2A 2EHHA 3TW7A 4O4WA 3DENA 2YCEA 5DY3A 4RZ5A 4DF0A 2OX1A 4JTUA 4K36A 5FF2A 1B4EA 3PWAA 4QAIA 4LTSA 4WUIA 1AW5A 3GXNA 1QOPA 1X6UA 1O94A 3ABQA 3EKZA 2G97A 4IMCA 1KLZA 1TPUA 1ZENA 2ZQ0A 5BW6A 2A7PA 1G4PA 2E5BA 2QCDB 4AMAA 3N73A 4KWWA 1ONRA 2A1YA 4MZ8A 5D04C 1VH7A 4Y90A 3M43A 4TO8A 2J9ZA 3TCEA 2H6RA 3N19B 3NPVA 3LB0A 4DO4A 4UNLA 1SO5A 2VFEA 4QIUA 4ZMGA 2PRHA 1C29A 1KFBA 5CZSA 3E12A 3NYZA 1VR6A 1SZNA 1VCGA 1JQVA 3F4NA 4EF9A 3T55A 4FF7A 3I65A 3E0IA 1BTMA 2A7NA 4WZHA 4UTTC 2PURA 3K30A 4LUIA 2FDSA 3W7LA 1W8SA 4ADTA 2G96A 2WSYA 2C3ZA 1QDSA 1R47A 4H6KA 4C1LA 1L9WA 3W1UA 3W75A 2H3BA 3W7GA 4X22A 4WY0A 1H7WA 4AWSA 1JUKA 1WXJA 4BK9A 1O5XA 1JRCA 5HULA 6ALDA 1PHWA 1G67A 3B4UA 2E77A 4ZQRA 1W5OA 3OA3A 3SFKA 3KRUA 5KSWA 4IX2A 4LVBA 2GQ8A 1K7FA 3VE9A 1KM3A 2GVJA 1A50A 2Z1BA 5TIMA 4UC5A 1DBTA 4BWLA 1X7FA 5A8GA 4LRSA 4QQ3A 4Z1CA 4LVDA 4ORIA 3W22A 3L68A 1M7PA 3GR7A 2WKJA 3M47A 4IWWA 4ADUA 1Q3NA 3TXZA 1YDOA 2Z6JA 3QW4B 1NAL1 1PS9A 5CZ0A 2E1DA 5J5RA 4AF0A 2YFOA 4I7UA 2PE4A 1I2OA 3C6CA 4WXYA 4X9SA 4JYEA 3GB6A 3W1QA 3IV3A 5D02A 1H63A 3HGJA 1LM1A 4M5PA 1GTHA 3ABRA 5C55A 1ZAHA 1MEHA 3NQ8A 3TC7A 3C0JA 3NQGA 4MYAA 1YDVA 3BV4A 1GPWA 1QOQA 5CGQA 1TO3A 3G3DA 1YTKA 3WJWA 1FXQA 3KRSA 3T78A 3QMSA 3TMQA 4L4LA 5IBXA 3L0KA 5ABTA 3TUUA 1VHCA 2ZA1A 3SI9A 1LCOA 1VCFA 1Z48A 3MUXA 2QCFA 4UTWA 4XZ9A 6TIMA 5CPOA 1OX5A 1TMHA 3IEBA 3LM7A 3L67A 3W85A 3UXDA 3W7QA 4GJ1A 2FPVA 1LYXA 2B7QA 3RMJA 3RF9A 1KM1A 1SZFA 5AC8A 3NL2A 2A5HA 3S9YA 4L4MA 2WO5A 5BMXA 4X3ZA 1LP6A 3RLUA 2B7NA 3P62A 4JXCA 4UMCA 1OK4A 1VYSX 3I7SA 1DL3A 5I3JA 3UQNA 1A53A 1VZWA 2CZEA 4NXSA 2V5LA 3W7HA 1UUMA 3A21A 1OFQA 4OV9A 4LC6A 3SZ8A 2EPHA 1S5WA 3FLUA 2NUYA 5DN1A 3EB2A 3W74A 3T4CA 1NFBA 1PCWA 5G2HA 4IMEA 1H61A 2JKAA 3CU2A 1QAPA 1S3HA 2NZLA 4NX0A 3G22A 1SO6A 4GUFA 4ZVJA 2CWNA 3IGSA 3QRHA 3NR0A 5FF0A 4X2RA 2WPBA 2FQIA 3G0XA 4Z08A 1H7PA 5F2LA 4UR8A 1TQXA 4RZ4A 1OF8A 3G8RA 4WJEA 3S6DA 3C52A 5HWMA 4XWUA 4LS2A 4AHPA 1ALDA 3W88A 4NUWA 4DO6A 3MP5A 5FF4A 5HUPA 3L21A 2NXIA 2QCGA 3Q2DA 3FIGA 5D05A 1ZFJA 2RDUA 1ZNNA 2CLKA 3PUDA 1SFJA 3W7RA 5EA9A 2QCCA 4JDYA 3PUOA 1SSGA 3M0ZA 2VFDA 2DP3A 1NEYA 1YTDA 3B04A 3G24A 3QZEA 1FXPA 2YW4A 5C2XA 3M44A 3UXAA 2HMCA 3W2LA 1GVFA 1I45A 5A5WA 1S5TA 2DJXA 3PG8A 2OT0A 2X1RA 1QFEA 2J9XA 4Y8FA 3G1FA 3LCXA 2YPIA 4O17A 3FKKA 4HPJA 1PL9A 5T26A 1KM4A 4M6VA 1I2NA 1W3TA 5DCDA 3I7RA 3JS3A 4GUIA 3GX9A 3M41A 5D2TA 3W1XA 2NX1A 1C9DA 3IIPA 5KITA 1WA3A 4UTKA 4IXHA 4DQWA 1K03A 3CEUA 1RV8A 2Y85A 2V8ZA 4MZYA 3PUEA 5I3GA 3UY8A 4LNYA 3U2OA 2DORA 4JTJA 1F73A 5KZMA 3G1YA 1QO2A 1LDCA 2Z0IA 1AW2A 3UZ5A 1ML1A 4UTTA 3P5YA 2C19A 1OF6A 1S5VA 1W0MA 3W7CA 5LGXA 4JTSA 4LS1A 1H1YA 2J6XA 3A5VA 2TPSA 2WJZA 1TRIA 4QISA 1GVQA 1A5CA 3S5YA 5DLCA 2HS8A 3P74A 1LRQA 1IGSA 4DO5A 3GDLA 3MP3A 4CQ9A 1KFKA 1ME7A 2Q8LA 3SJ3A 3TSMA 3M5VA 1W3IA 5AC7A 5AFDA 1WAUA 1VS1A 4JTLA 4MUZA 4A3UA 1JUEA 4K8EA 3EWYA 3UWZA 3KHJA 4KWVA 4AHOA 2E5DA 4KKXA 4WY0B 2VELA 5DCBA 2EKCA 3LV5A 3WK1A 1PCKA 5K9XA 1ADOA 2V2HA 4AHQA 3H54A 3W1TA 3EX4A 1IXNA 1TPB1 1KFEA 2NLIA 4WOZA 3SGUA 2JKEA 2DZSA 2H3DA 3LCHA 3W1PA 1BEUA 4DPQA 4UTIA 7TIMA 3HB9A 2NXGA 3W7OA 3C3NA 1AMKA 1OFRA 3KVKA 3QQ0A 4O0KA 4Z1AA 3WJYA 2ISSA 2WQPA 3P80A 1JULA 4ORMA 4AF0B 1F74A 4R53A 5F4XA 3W3OA 1BKSA 1ZCOA 4LUJA 1QR7A 4LVAA 3BG5A 3GIYA 3W2UA 5LHEA 1HUVA 5K7JA 4HNTA 1PVNA 4JTFA 4O12A 2DZXA 2QDHA 3IRDA 3LDVA 3U6WA 2Y7EA 1DOSA 1TPWA 3PB0A 3O8AA 3BGJA 1PV8A 1XDLA 1RZMA 3CB8A 2JKPA 1TCDA 3B06A 3DHDA 3UWVA 2RDTA 4JICA 4EVZA 1VYPX 1W37A 5EYWA 5BMWA 5EL1A 4MJZA 1D9EA 1HFBA 3BARA 5EBUA 3PULA 1FCVA 1SPQA 1I2QA 4MKNA 5F4WA 1TPDA 2Y7FA 4I9AA 3S1UA 3PAJA 1P4CA 4NNCA 3TA6A 2XFWA 2E6FA 1XM3A 3BGGA 1O60A 2VFGA 2TYSA 3A22A 3UWWA 3L65A 4MFEA 2BXVA 4ICNA 3EEGA 3ATYA 1GJPA 3FS2A 3W1LA 1NF0A 3L5AA 3Q94A 1Q6RA 2DZWA 3LI1A 3LOTA 5D03A 4GUGA 1TPFA 1LROA 3O6DA 1EUNA 3N2MA 1HG3A 3W7MA 4MLJA 4UUIA 3GNDA 3V75A 2ZA2A 2JGQA 3FKRA 3MMTA 3DFOA 3EKLA 5D38A 1ME9A 4QNWA 3PVFA 4MFDA 4GXMA 3R5EA 4IGHA 4A2SA 1VHNA 4TR9A 2X1SA 4K37A 3QM3A 1C8VA 3ZS4A 1DVJA 1G4EA 3HG2A 4GWEA 4WXZA 1G4TA 4TMCA 1Q6OA 3KX6A 1AG1O 4BI6A 4LC8A 5HINA 5K9CA 4CQ8A 1DKWA 3HGRA 3BLIA 4JGDA 3VE7A 3ZR4A 4LRTA 3SW6A 3LXBA 2EAWA 4AWUA 3EX6A 3C2FA 1EIXA 4QITA 1WQ5A 3LHWA 3V1PA 5CG7A 4LWWA 3TH6A 4IMDA 4WY0F 1TTJA 3OEXA 1OFPA 4ZL1A 3NQ2A 3VFLA 1H7XA 4RLIA 1KTNA 3C4UA 1VRDA 4GRSA 1XXXA 3WFAA 3LRMA 1Z44A 3DXIA 4PODA 4HNUA 1VQTA 2AQWA 1OX6A 3EX1A 4IX0A 4K7VA 2A4AA 3LTPA 5H2ZA 4RCXA 2ZRUA 2ZFAA 1YDNA 5CPNA 1PE1A 1DJQA 1MEIA 1F76A 1TTPA 5I3HA 3KVJA 2XN0A 1R2RA 3E9AA 4ONVA 2B0MA 3KOFA 1NSJA 4JY8A 1OFBA 4I7VA 3JRKA 1F6PA 3VKJA 1TIMA 3F1QA 5DBTA 1L2UA 2GQAA 4LY8A 1WV2A 3W7IA 2X1TA 3UD6A 1RD5A 3KRZA 3TROA 1T8XA 1CX9A 3A24A 2NWRA 4O0ZA 3G1HA 3SECA 1L6YA 3OHIA 3FFSA 2RKXA 2I14A 3CPRA 1OYAA 4JNMA 4U28A 5EMUA 3GZ3A 3ZWSA 1F6KA 4UFIA 3HJZA 1XKYA 1FWNA 2HSAA 3PG9A 3HMJG 3LRKA 4UXDA 3IGXA 3HG3A 1K7EA 3TXVA 1D3GA 1I8JA 5GVJA 1EEPA 3S1XA 2DZTA 3RK8A 3N9RA 3W7EA 1LLWA 3NQVA 3R8RA 1KW1A 3L9CA 4XUGA 4OBTA 2A6NA 3TV8A 2ZRVA 2QAFA 3B8DA 3WJXA 4A22A 4NNAA 1KV8A 5H91A 2QF7A 3HQ1A 5D30A 3T44A 4Q33A 3TC6A 2GOUA 4FIQA 1RR2A 3SR7A 4FNSA 1EP3A 4Q32A 5HQEA 3S42A 3W7JA 1FDJA 1QPRA 2XN2A 3W1AA 3NPXA 2F84A 3W76A 4NQ1A 2LLEA 2VFFA 2ZZ6A 2CZ5A 1HO4A 2QCEA 3KAOA 4O1DA 1LRTA 5EPDA 2ISWA 4S2CA 5HR6A 1B4KA 1T0OA 3DH7A 1W3NA 4ZZ9A 1MZHA 1EWEA 3IGUA 2YGYA 4JEQA 2FB2A 2WSQA 5D2VA 1YLVA 3G0SA 4ALDA 1VYRA 3LCIA 4O14A 1B57A 3A9IA 4K38A 2CLHA 1TRDA 3W7PA 1EP2A 4UNKA 2V2CA 5MHBA 1P0KA 3W23A 4MJMA 1L6WA 2QAPA 2O7SA 4JTGA 3NQFA 2JBMA 1AK5A 4N9DA 1TPEA 3IVSA 3Q37A 3T40A 1FX6A 4OWGA 1GVSA 2Y88A 3LHUA 3KFTA 3GXTA 5AHMA 1Z42A 4PTNA 4NT0A 2R91A 3LRLA 1SSDA 2X1UA 3D0CA 3BW2A 1MSSA 2QR6A 5FEPA 3LBCA 3P5ZA 1G7UA 3NEVA 5BOOA 4O53A 3MP4A 4K39A 1W5MA 3WK3A 1YTEA 2J9YA 3DZ1A 3G1AA 1GTEA 3N9SA 3H53A 1TPH1 3LCWA 3WJZA 1FCQA 3DKLA 1ZY9A 3M5ZA 2RDWA 4HIBA 1FBAA 4LVFA 2QUVA 4TU1A 3FYOA 3VNDA 3PB2A 2YX0A 3UWYA 3LHVA 2JGYA 1I4NA 4GC4A 2H8XA 2ZTKA 2Y89A 2NV2A 4S2BA 3IVUA 3S1WA 3CTLA 1P0NA 1SW0A 4FXRA 3QSRA 1EP1A 4NX5A 5F1UA 3L5LA 4YL2A 5CZTA 4Q4KA 5L9FA 2Y61A 4M7TA 2Q8ZA 3C8FA 3F4WA 3UWUA 1WBHA 3S1VA 2Y7GA 3O1NA 3NQAA 1J2WA 1ICQA 4WD0A 1Z41A 4UTLA 1H7RA 3I68A 2E6YA 2VC6A 4MY1A 4JX6A 4XKYB 5D32A 4XTIA 1IIHA 5D2XA 3W7DA 1IXPA 1JR1A 4GFSA 3UY7A 2NV1A 3C61A 4CNNA 3IVTA 1XFBA 1SO3A 3DAQA 1WX0A 3MJYA 3NL3A 4UFHA 3H55A 1QPQA 2GJLA 4FHAA 1W56A 3PY2A 1AL7A 3NQCA 3W83A 4N6FA 4BI7A 3FJLA 4RXFA 4LT9A 3STFA 4R33A 4FNQA 4ZQCA 2PC4A 3L5MA 4YWIA 3QH2A 2A2IA 4QJ1A 1LLZA 5TBOA 2VEKA 3TX9A 5HNRA 4BI5A 4IXXA 4PEKA 1EPXA 1YPFA 3DFNA 2YXGA 1MO0A 1XBYA 1IXQA 1TV7A 1H1ZA 1KFCA 2RH9A 3G0UA 2GVGA 2B7PA 3DI1A 1FCBA 1FUYA 1UJPA 2Q3OA 3QF0A 3M7WA 4JIQA 4O1CA 4WQ6A 1QCWA 4MPQA 1P5BA 3W72A 1WOBA 2Y63A 4PC8A 1W5NA 3PBYA 3BO9A 1KLYA 1LOSA 2Y6ZA 2FFCA 4PH6A 5FEWA 1XUZA 4O11A 4BFAA 4K7YA 4Y9AA 1TYGA 3O16A 1XC4A 3NDOA 5KZEA
chains in the Genus database with same CATH superfamily
3EWWA 3WLHA 1UA3A 2WV8A 4ZEPA 1M6JA 3R0UA 4GOAA 1UWTA 1PTDA 4HSOA 1REQB 2OXNA 1UPMB 1HP5A 1FFQA 3PM6A 3THAA 2A3LA 4HQVA 2XZ9A 1GOMA 5BROA 2ISFA 1TJPA 4FXSA 4NSBA 3WBAA 4PUKA 1W5QA 2XHYA 4KGJA 2VKZG 2CZDA 4JTAA 2IPJA 2WSPA 5D8WA 1EJSC 3W87A 3UXIA 2YDAA 3HPZA 2OSWA 1K02A 4AWTA 5CSSA 1QWGA 1A5UA 2X42A 3HBLA 3KUMA 3HPXA 4HZ7A 2C7FA 4C7FA 3WH8A 1WDWA 3E2SA 3FSUA 4AY8A 3NDZA 1XYLA 4W84A 1K8CA 4V27A 4YTSA 1N55A 4OZOA 1OFDA 3LSCA 4B91A 2C16A 3L4TA 1C3FA 3CBWA 5IDIA 3T42A 2XN1A 4W9TA 2WC3A 4F0LA 2Z26A 2FTYA 1SJBA 4O1AA 3CMFA 1B5TA 1CENA 3RCMA 3U5YA 3UPBA 3HGOA 3HIJA 1UKQA 3DFHA 2E0PA 3GFXA 1V7AA 2CLEA 2J7EA 4Q8WA 3WQ6A 4JBRA 1VGAA 1XUUA 2E67A 2ZZ3A 5LZLA 3UFYA 5HUOA 4Z1BA 3GDTA 4EPKA 2B4GA 2I5QA 2FH6A 4JD4A 1WE5A 2D1ZA 3P61A 4Z2GA 2ZYFA 2VDGA 4NVTA 4NJJA 3SQLA 1JI2A 3BZGA 2YCIX 1RSCA 1CEOA 2BOGX 1EXBA 1H50A 2GZXA 4MMWA 4C1NB 4FIRA 4D2JA 4X61A 1KBBA 2Y8KA 5U4NA 2FJUB 1DQWA 1XH0A 3QMTA 2H9AB 4Z1DA 3G1VA 3VDCA 2INFA 1WXZA 3DG6A 2HDJA 4GI9A 1XYAA 1IT8A 5CZJA 3O6YX 1JDEA 2Y70A 3IACA 4MDOA 1C7TA 2YW3A 4REQB 2PB1A 2QLYA 2GSHA 2V82A 4PBFA 5JBEA 2E6DA 3FEMA 4RV3A 1OWQA 2ZUUA 1LWIA 3GKFA 4FNUA 3BC9A 3B8WA 2OEJA 4AVFA 3FVDA 2P8CA 4FXJA 3BCFA 3UPWA 2DY3A 4Y96A 2X7WA 2HVNA 2FGBA 1VCVA 1VC4A 4L9XA 3RYSA 3BG9A 1ODZA 1TELA 4LUTB 2EO7A 5HJYA 4XG1A 3AS3A 3EXRA 5FOOA 3LEPA 2E40A 2NQZA 1E1CA 1HJVA 2MNRA 1AJ0A 3UESA 3WFLA 2GJXA 3KXQA 4CNOA 1QPNA 4J5NA 3NZRA 1OK6A 2WLZA 2CKSA 4NF7A 4Q7IA 3WY1A 2GWGA 3W7NA 5HWJA 1YPIA 1FWWA 3LCGA 4GCAA 2O9RA 3BSHA 2PCEA 3BCJA 4LUSA 1VLIA 2YL8A 1GPFA 5RUBA 4IHCA 2Q01A 3QPZA 2NVDA 1Q66A 5C9XA 4XV0A 1RA5A 3NO3A 3B0UX 3DGBA 3WQGA 4AVOA 1K9TA 4BR1A 2WVSA 1OD8A 4C90A 1IIGA 1AUSL 3VD4A 3N6HA 2OLSA 5LNWA 1BHGA 4XKMA 1EHAA 3N2TA 4L4OA 4B3LA 1EX1A 5BXRA 5AYZA 3PJTA 4CQDA 3E0WA 4R27A 3CAQA 3BOLA 2J78A 3S2LA 2O4MA 4IOTA 3A64A 2PDXA 1PDZA 4NAFB 4PCFA 1XINA 1HL2A 4DO7A 3PC0A 3UR8A 3PTQA 2IW0A 5FF3A 1IXOA 4RPQA 3M0LA 3MBDA 4IGMA 4C65A 1EXPA 3KVLA 3R11A 2PRLA 4WHBA 1O5KA 2HNEA 2CPUA 1FVPA 5BZAA 5FL1A 1BLIA 1Q2RA 4B9YA 3REQA 2WJEA 5F2IA 5DMYA 2WZIA 2VJXA 2QVNA 5AYYA 4UBPC 3GLCA 2WOQA 1JZ3A 1JCLA 4CCDA 1QT1A 4C6QA 2F9RA 3LPPA 2PODA 1M7XA 1RQBA 1JF5A 3CC1A 3GO2A 5C5YA 4OOUA 1H7NA 4DWSB 3VD9A 1KXQA 2WNZA 2Y5EA 3MYOA 4QE5A 2WXDM 1SO4A 3E5BA 1TTIA 1ZGDA 1MXDA 4DNMA 2QXWA 1UD8A 3NZPA 4CQAA 1UKTA 2TMDA 4DUWA 1GG1A 3E6EA 2CLIA 4MLRA 1KGWA 1VFLA 4CVUA 4CD6A 4P2VA 1D7FA 4GJJA 3EX2A 3ABOA 3ORWA 3QYQA 4TV5A 2ZRWA 4GZJA 4PB4A 5C70A 4C7GA 3BAIA 4GI6A 3TU9A 4HA1A 3EB3A 2DZVA 1JZ5A 3TN3A 1BTCA 5LIYX 3TYAA 3M5YA 3TZNA 5TD4A 3RHGA 2JE8A 2E1WA 3N11A 1DP0A 2AGKA 4H41A 5HNUA 3CIWA 4XAGA 1VF8A 4D8LA 1CGWA 4D6DA 2NWSA 1R2TA 3L4ZA 3UVAA 3ZIZA 3TIMA 1GW9A 3UPMA 4AUBA 1WZAA 4AD4A 3FA5A 4HPHA 1W31A 4MWAD 5HMSA 4TTGA 4ACZA 2QJHA 2ZXAA 3WLIA 3D3FA 4UFMA 1U5VA 4QR6A 6TAAA 4MOZA 5G5IA 1RP8A 5C9ZA 1NF7A 5A6MA 5HAOA 5F1VA 1AFSA 3EWZA 2FPYA 1GG0A 2JK2A 4ZO7A 1EO7A 3KCLA 1L2QA 5D2WA 4EKJA 4QLKA 3SY8A 1GOOA 3VCNA 1LL6A 1XBXA 1GYNA 7XIMA 3IIZA 3DU0A 5EKYA 3FGCB 1AL8A 3UR5A 3DFSA 2E6AA 2V6AA 2XUCA 4UOJA 4PEEA 3E0LA 1MEWA 4N9CA 1T6MA 4YTUA 1TR1A 1JRBA 3E74A 1FDYA 1YRRA 2Z2UA 2X30A 3UETA 1KCLA 4D6FA 4ZR8A 2ZZ7A 1QNRA 3GD6A 1EJTC 3QFEA 3QJAA 3O2LA 1ISZA 3CLMA 3QQWA 2VENA 4L5ZA 3N2BA 3DIPA 1LG2A 3CAVA 4F2UA 3N34A 3AJ7A 2QMKA 4JN7A 2VWTA 4IQLA 4GMEA 2WNNA 4GQQA 4W86A 3MI2A 1TV3A 1AZ1A 4IIFA 5BCAA 2PCQA 3K13A 3W2NA 1IT7A 1MUCA 5I0DA 3VCRA 3VDHA 2PWFA 2AOSA 4BF7A 2KAUC 1ENUA 4JFVA 3SFWA 4F3HA 1MXGA 3R58A 3L2IA 3HM7A 2G3JA 4IJCA 3EPOA 4LY4A 4XZWA 3AHXA 4ADSA 1PYMA 2DUAA 1QHPA 5AVNA 1JJKA 5J5DA 1GQIA 4CCEA 3EKGA 4ZA0A 2C13A 3KL5A 1Z9AA 1BGAA 4PB5A 2QCLA 4O50A 4ZSUA 2WNWA 1WKDA 4HNNA 3TSDA 1S38A 5REQA 4FX6M 5DCEA 2TRSA 3CWOX 1SUXA 5F2MA 2P0OA 1EJ7L 2ZX9A 3WQDA 3CIXA 3SCNA 1IHIA 1RALA 4JR5A 2YBUA 2NUWA 3VMOA 4U2YA 1VBGA 3FOKA 3H2MA 4TXEA 1JXKA 3MYPA 2F2HA 1TG7A 2C1HA 5BXPA 4O54A 1S39A 3FDKA 4FZIA 3W07A 2P53A 3EWBX 3W00A 3LBOA 2A21A 2W66A 4IPJA 1RA0A 4W5ZA 5M5DA 3NDYA 3BDKA 3NWRA 1FWRA 4GO9A 5TNVA 1V93A 4D6GA 2XU2A 4CU8A 5KINA 1W9PA 4QSHA 3CO8A 3F4VA 1JDCA 2QHAA 2FIQA 2R14A 1FFRA 5G4EA 4O15A 3GDKA 3S5ZA 2OQHA 2Y24A 2XM1A 4M82A 3NL6A 4FMVA 2BWGA 1VJIA 4XQ6A 2AL1A 1U30A 3OBEA 3TJXA 6REQA 1BSIA 1UUQA 1F7BA 4ZSTA 3MWAA 4Q8MA 3T0BA 1J2BA 5AHEA 3OG3A 1BWLA 4IIGA 1LUCB 3GR4A 1Y0EA 4IL2A 1PX3A 2BXYA 2YR1A 4O10A 5IFTA 4WSKA 3BURA 1E51A 3KL3A 4GBUA 4PL1A 2DIJA 3UWEA 4AMCA 1KTBA 3AO0A 2J75A 4NZ4A 4GUJA 4JPGA 5C54A 3GU9A 3R0DA 2XIQA 4FS9A 4B5TA 3OU8A 2O9OA 2CYGA 3MTWA 3NAVA 3C0QA 1EFZA 3OGSA 1DJIA 1FHVA 3ARVA 5GJNA 2YZRA 3MT1A 4A8LA 1N8FA 3CZJA 5IBXC 3WH5A 4C6IA 3EWXA 1PSCA 1FHUA 3B0XA 1EB3A 2OZ0A 3TFCA 1TUFA 3GIPA 3BMXA 4XBSA 4UTWC 1CNVA 2J27A 4HMEA 2W4XA 3WLLA 4DI8A 3LTSA 3W1MA 4NU7A 1C7SA 3CAWA 3LY0A 1HL9A 4E2BA 1PZ3A 4ZOCA 4UTUA 1RD6A 5E1QA 2J8FA 3Q4DA 4FOJA 1TX0A 5K4ZA 1DWHM 2REQA 2WZTA 1RHCA 3DHFA 1XIFA 7TAAA 4AZGA 5LNVA 1ZSXA 1XCFA 3UEQA 2E25A 4K8HA 1GEHA 2J6VA 1YBQA 4G7EB 4HCHA 3CL8A 4Z17A 2PS2A 1LOQA 4HHPA 2Q8XA 4CNSA 2PDNA 2WB5A 2YA2A 2OCZA 3W28A 2I56A 4R7JA 1A5SA 3W2KA 1ITUA 8A3HA 3EXTA 4HCLA 4UFLA 4JTHA 1E73M 2NXHA 4H9XA 4UMAA 4XBJA 4S38A 2G0WA 3VGFA 3QPEA 2HBXA 1ICPA 3WF4A 3D6NA 1MXSA 2FGZA 4MWAC 3GW3A 3WX7A 4GLEA 2EHHA 4XZLX 4JCLA 4DF0A 3ZJ8A 4QAIA 4Z2JA 4PBEA 3A6OA 4CVWA 1QOPA 3EKZA 2G97A 4JAWA 4HCDA 1TPUA 2A7PA 2OOGA 3EEZA 4HD5A 3SO7A 5E9XA 3KTCA 5BRQA 4ZXOA 1AQHA 3CQHA 4LNCA 4KEVA 1RBLA 1KCZA 3KBNA 5D04C 7ENLA 4Y90A 4TO8A 3N19B 3LB0A 4UNLA 3ZLHA 3MU7A 1E5JA 2DVXA 2Y4SA 6PTDA 1M68A 1NDVA 1J18A 5C7HA 3ZJ7A 4BQ4A 1K70A 1E6PA 1KKOA 3E0IA 4IUGA 1DE5A 1ISXA 2P8BA 2XIJA 3K30A 5AKQA 2AMXA 4DI9A 3OOQA 1UR8A 3H2NA 1KGXA 4ADTA 1NWSA 1KQYA 4C1LA 1L9WA 1Q6FA 1PJ9A 1HJWA 3ZVHA 4J3SA 4AWSA 3BZJA 3BLPX 1W5OA 2C91A 1CGXA 4B2DA 5KSWA 3VE9A 1A50A 2NQ9A 2X8RA 5TIMA 2GLKA 3QGKC 2V5JA 4Y9NA 3G6MA 4EPEC 3GR7A 2O92A 3KM8A 4E4UA 1FH8A 2WCGA 1X38A 5JQ9A 3NIYA 3AUJA 1XF0A 1JDAA 1I2OA 3C6CA 1XRVA 1ISYA 2YDRA 4YHEA 1FRBA 4ZODA 2NVAA 3HGJA 1CGYA 4XUYA 2O9TA 1J0KA 3NUKA 3ABRA 1ZAHA 1UP2A 3LD5A 4R7OA 4GI4A 1M41A 4AIBA 5CLTA 4FAMA 3KRSA 3CXOA 3TMQA 3IGHX 1BF6A 5IBXA 3TUUA 4XD5A 4PTWA 4UTWA 1V3IA 3GHUA 4QCFA 5CPOA 3A13A 3RGTA 3T08A 3IEBA 3KS6A 2NQJA 3LM7A 3L67A 3CB3A 1AA1B 2FPVA 4JTCA 3GZAA 2PGFA 1V8EA 3RF9A 1KM1A 3S9YA 4L4MA 3WMBA 1XYFA 4LAOA 3AIQA 4X3ZA 2VC9A 2B7NA 4JXCA 2Q71A 1OK4A 3I7SA 1DL3A 4HJWA 3UQNA 1UH3A 1A53A 1JGIA 1XRFA 2CZEA 2V5LA 3D47A 2EPHA 3RLHA 3FLUA 2WANA 4GZIA 3VA8A 3FJNA 3T4CA 1OIFA 4MDPA 3WQFA 4HPNA 1PCWA 5G2HA 3WMSA 2NZLA 2ZUMA 2E8YA 4J3ZA 1CGTA 2OKTA 4PMVA 4LYPA 2BG5A 3KBVA 3BQ6A 4ECLA 4X2RA 2ZC1A 2CERA 2BVYA 3VMNA 1UWIA 4WJEA 3T1GA 3C52A 3JUGA 4KW2A 5HMFA 3GG0A 2NSXA 4NUWA 1SFSA 3LS9A 5J04A 2AKZA 3U3HA 1J0JA 2RJHA 4FR1A 4US5D 5D9MA 3R25A 3W24A 3WBWA 4MWAA 3GNPA 5DEZA 2NXIA 4IL0A 3Q2DA 3FIGA 2PD5A 4QLLA 2CLKA 3ZQ9A 2OEKA 8XIAA 2QCCA 3PUOA 3M0ZA 5GNYA 4LJ3A 1XH1A 1FXPA 2WAGA 3K4AA 4MJ2A 3NZGA 4IQJA 3AHYA 1Z6KA 2HMCA 1I45A 5A5WA 1JFHA 2DJXA 2OT0A 3RJXA 3R7MA 3GRIA 4Y8FA 4NG3A 3FKKA 4AZBA 5AC5A 1HGWA 1PL9A 4M6VA 4PUJA 4GK8A 4N7QA 3DCPA 3I7RA 3JS3A 3IUHA 4C6LA 2IKGA 3KBWA 3IUIA 1MWOA 4GKTA 1US0A 1B3ZA 1EZWA 4P5UA 4GO8A 4DWSD 3UNTA 4JL2A 5I3GA 2X0HA 3UY8A 3KBMA 3EB4A 4XVEA 3U2OA 1XIGA 1VKFA 1EZ2A 1JPKA 4LYRA 4NY2A 4J1OA 4JTSA 4DUVA 3A5VA 4Z2IA 3T2QA 1TRIA 4PCNA 4QISA 1JFXA 3S5YA 3WFZA 4ZB0A 2QUMA 4DO5A 5XIMA 3MP3A 1KFKA 3SJ3A 3M0HA 3M5VA 2DUZA 2EG8A 5BYWA 4H9TA 5AFDA 3AS1A 3VXGA 3THDA 4G56A 3MUCA 3VIJA 1ITQA 2POTA 1PIFA 1ESWA 4A3HA 1S2TA 5DCBA 2EKCA 4GINA 4RDWA 1B3YA 2V2HA 4AHQA 4F79A 3ECQA 3FAWA 3EX4A 1TVLA 5A95A 2NLIA 1KQZA 3SGUA 2JKEA 1J9YA 1HKVA 1UD4A 4QDWA 4DZHA 7TIMA 1A5LC 3HB9A 1K9EA 3UGRA 1OFRA 2J13A 4Z1AA 3KZSA 2XISA 4PCTA 4EAYA 3O0FA 4ORMA 1WUEA 4IFOA 4XISA 3W3OA 1BKSA 2BFGA 1EJRC 5GJMA 4Z1YA 3AHVA 3W2UA 3B9OA 1UQYA 2DZXA 2QDHA 2Y7EA 4LEFA 4U2ZA 3BGJA 3O8AA 2GVYA 3ZSTA 3SRDA 4GQGA 1DTNA 1PV8A 3M0IA 2VZUA 3WUFA 1PKMA 2JKPA 5JIWA 4CEUC 3UWVA 4JICA 4D9PA 2VEFA 1JF6A 1PBGA 2ZXBA 1BVZA 3C86A 3GM8A 1YX1A 3TNBA 5EBUA 3PULA 3PANA 1NJJA 3I10A 4GY1A 1UW9A 5BWAA 3PWIA 3S1UA 1E6ZA 4Z2HA 1I75A 2XFWA 1XSIA 1LWJA 2CEQA 2WK2A 3AS2A 3BJSA 2VFGA 3A22A 3L65A 4Q4RA 3POHA 1GJWA 4BCEA 1GJPA 5CPQA 5IFPA 2XH2A 3LOTA 2PDCA 4WCJA 2PGEA 1PKLA 3N2MA 3S83A 4UUIA 3GNDA 3R8HA 3FKRA 2PI6A 3KP0A 3PVFA 3P2VA 4PMDA 1HNYA 4EACA 4M8UA 4TR9A 3NCOA 3WNMA 3EOSA 4LCRA 1C8VA 2VL4A 1R9ZA 1EDGA 1E55A 4BI6A 3APGA 2OYLA 3HGRA 4RNHA 4LRTA 2EAWA 4AWUA 1EIXA 4QITA 2XINA 1L6FA 2WCAA 1WQ5A 5CG7A 2HISA 5CLWA 3SCSA 2GQ3A 1TTJA 2V5KA 4IIBA 3VFLA 1H7XA 1KTNA 4JHMA 3LRMA 3DXIA 2EJ1A 1OX6A 3EX1A 3R4IA 4IF2A 1CTNA 3ZSSA 5H2ZA 2ZFAA 1JD9A 1K6AA 3NGFA 2HXTA 1PE1A 1EF2A 1S2WA 1KRBC 1MEIA 5I3HA 3OZPA 4B90A 2XN0A 4H8UA 1O12A 2XGIA 2GK1A 3KOFA 1GONA 4JY8A 4S3DA 3RUBL 1EBGA 5DBTA 3W7IA 1M7JA 4WDTA 3UD6A 1CX9A 3A24A 4Q8OA 4O0ZA 3ZO9A 3OHIA 4JKKA 4Y2WA 3SUSA 3CPRA 3KS5A 5I23A 1DWJM 4U28A 1TV4A 4JHOA 3RLGA 4DZAA 3G5EA 5LA0A 1REQA 1OCNA 1DJHA 3HJZA 3W53A 2Z28A 1NWUA 4J3WA 3HMJG 3K4DA 4WKFA 1MW2A 4PMZA 3TXVA 2VZVA 1D3GA 1NP2A 2CC0A 4JN8A 3S1XA 1TV2A 3W7EA 1LLWA 3NQVA 1ECQA 3R8RA 1TWDA 1TJ0A 4XZIA 3ISIX 1KCKA 1ZUAX 1PWLA 2QF7A 3PPHA 3TC6A 1BGGA 1RR2A 1BSLA 3S42A 4H2CA 2ACRA 1FDJA 3FW6A 1CWYA 1KGUA 4NQ1A 2ZZ6A 2WVVB 1SYTA 3KAOA 4O1DA 1AD1A 2ISWA 2XPKA 2MANA 4CN1A 4RDVA 4ZZ9A 2YGYA 2P88A 2J8GA 2C1GA 4TVUA 1CGVA 3LNMA 4ALDA 4O14A 7A3HA 3A9IA 1TRDA 1V0LA 3U57A 5MHBA 1R5YA 4MJMA 1MW0A 4JTGA 3NQFA 1UKSA 2JBMA 4KWSA 1B2YA 4YNGA 4CU7A 4Q7BA 1FX6A 1GVSA 1UR1A 2XVLA 3SUUA 1JZ8A 5XINA 4DWSC 3KFTA 5AHMA 4PTNA 1E40A 1H09A 2Y0FA 2Y2WA 4EXBA 1Z69A 3CS2A 5FEPA 1CXFA 4J3TA 1QNOA 5CAKA 3S47A 1G7UA 3JW7A 5BOOA 5XIAA 3V5FA 1O1ZA 1K9FA 1YTEA 3T09A 1QHZA 1XIBA 2YCLB 2D2HA 3H2EA 4C1NA 3LCWA 2XDFA 1ZY9A 2RDWA 3AAMA 1CYGA 1QJWA 4GY7A 1UWQA 2P0IA 2DFAA 5GNZA 2H9AA 2YX0A 4IIDA 2Y89A 2NV2A 1F4AA 1XLFA 2FFIA 1EP1A 1TWZA 5F1UA 4Q4KA 3WELA 3WD2A 3UWUA 3ARRA 1WBHA 1HGYA 3RMEA 4UTLA 2FDMA 4MB5A 5A8MA 5JBDA 1A5KC 4H9ZA 1XYZA 3EMCA 5D2XA 1XLCA 3UZWA 3TYZA 2EQDA 4LUTA 3UY7A 5HNTA 3C61A 1Y5VA 1XFBA 1POKA 3DAQA 1WX0A 3R94A 3CWHA 4AXNA 4YVPA 3NJ3A 1QPQA 4FHAA 4U31A 3NQCA 3W83A 1V6VA 3FJLA 1L0PA 3QHMA 4R33A 3QH2A 1YE4A 2OR2A 2PWHA 5A6BD 3SIMA 2OO6A 3SN0A 1ITCA 5KZ6A 7REQB 4PEKA 2FZ8A 4DYJA 4GC3A 3U9IA 5HNNA 1CXEA 1KKRA 1TV7A 1H1ZA 3VIKA 3G0UA 3MCNA 2J7DA 2EJAA 2JQXA 1XGDA 5D8ZA 5LXEA 3VZYA 4JIQA 4O1CA 2Z1VA 2HWGA 3UZXA 1XIEA 2CNCA 3BO9A 3DG3A 2FFCA 2PDWA 3FK4A 4EPBC 2FZDA 3WLPA 1E72M 1XC4A 2IXVA 2RDXA 3NDOA 4S23A 1C91A 3NYDA 2IXUA 3APTA 1GWJA 1EGVA 4S3JA 3TAKA 3B05A 4YU1A 5CBJA 3DHUA 3A4JA 4RX0A 3ARPA 2OGJA 1XP3A 4X2PA 1I0DA 1GHRA 5AZ0A 2YB1A 1QPKA 1ZJBA 3LZ5A 1OFOA 4AISA 5I3KA 1EO5A 4B5WA 5K4XA 4XO7A 2ABBA 2INZA 3UZYA 4F48A 4NAFA 2BB0A 3ITGA 4RDYA 3N25A 3QXBA 3SSJA 4WGXA 2FTWA 3VIMA 2F6XA 3RM8A 1OQFA 3LBMA 3G6LA 3W27A 3N3MA 2PDJA 1Q5MA 4EP8C 2AQOA 3FJ6A 3QY7A 1T99A 4P7OA 5D9NA 4AIEA 3E49A 1QO5A 4RK8A 3NO1A 1F3WA 3TW6A 3UF9A 1VPXA 1XG4A 3M6YA 4RNFA 4UNIA 4X63A 1G69A 4Z0SA 3TLLA 3BPWA 2JF7A 1F2JA 2ISVA 2VI0A 3IUDA 4PR4A 4N0RA 1GVEA 4S3BA 4DXKA 5J8LA 2XH4A 4DWSA 4YCPA 4KMQA 1H7OA 3MVTA 2P5NA 1R3WA 3RIKA 1HW6A 2CWXA 2PLCA 3TYCA 5IRPA 4UTJA 1NQ6A 2Y62A 2V5BA 4PUNA 5KEZA 4M56A 1OGSA 2V68A 1H5YA 2GGIA 3FX4A 3LG3A 4HZ6A 4ZFCA 1H3GA 1H4PA 4GZEA 1J5TA 3RJYA 2XJ7A 2DIEA 2C6QA 1M3UA 5E6YA 4N4QA 1JCNA 3TA9A 2QCNA 2XH0A 4NAEB 2DU2A 3GVQA 4GXPA 3WQWA 2FJKA 1JNEA 3R10A 4OVXA 2OMAA 1OYBA 4JEJA 1ECEA 3LQGA 2Z4GA 4G9PA 3MHGA 3ZYZA 1RQEA 4FXFA 1UMYA 3BK0A 3WLJA 4KGLA 1H60A 3KOWA 4GYFA 4RUBA 2YDSA 2X16A 4DNHA 4XBKA 2VEMA 1C8XA 2Z1XA 2D20A 4AG0A 3EX3A 4S3KA 3NL5A 3W73A 2HE8A 3OVQA 3WEZA 3WDRA 1ZHAA 4O52A 5HXMA 1DORA 1VEMA 1XICA 1Y5WA 4E2DA 2P76A 4JY9A 3EA1A 3GK0A 1MDLA 3WNNA 3B8SA 2DW7A 1ZQ5A 3FV9A 3A5FA 3PPGA 4ZB2A 1EGZA 4A29A 1VEPA 2J62A 4ROPA 4IJBA 1YMYA 1VIZA 5AECA 4OV4A 3BVJA 3MKKA 4HT3A 3KDOA 2QJIA 2FVLA 2ZA3A 3LMZA 3B4YA 1AD4A 3OODA 4Y6GA 3FGCA 5E0FA 1U5HA 1GEQA 3RX4A 2WQDA 4I8YA 3PSWA 4S1FA 2PDHA 3DUGA 4NJHA 3W70A 4HN8A 4XZHA 5AHLA 3H22A 4FNRA 4AYSA 3N1AA 4KCVA 1E70M 1DJZA 1E0TA 2BX7A 3I3EA 3VMPA 5I77A 4BEUA 1H51A 5FA5A 1U2YA 1W1ZA 5HQLA 1XCXA 3DBPA 1GZGA 4ZOAA 3SB0A 3A4XA 2E68A 3MW7A 4JN6A 2VEIA 4O13A 3ES8A 4ATWA 3TE9A 1JUBA 5JMUA 3W01A 2W79A 1DYSA 1Q63A 1IR1A 1HO1A 2NQHA 1HJQA 2Y1HA 1Q4WA 4O1FA 3FVMA 2R24A 3CT7A 4GYKA 4L80A 2CLPA 3RU6A 4EAMA 2HPIA 1E15A 1ZB5A 3WQCA 1MFUA 4O16A 3AIRA 4TIMA 1W3HA 4YJ5A 1IR2A 4H3DA 3LX9A 3V7PA 5LIUX 5M17A 3WDPP 3VDGA 1TV5A 1TTQA 1V79A 1VLWA 2DJLA 4AZCB 1ZBVA 3QR1A 3EXSA 3NQDA 4R85A 3V35A 1V6TA 3W1RA 1EUAA 4FLOA 1E0XA 1EC9A 4UIOA 2HS6A 2O55A 3I3BA 4J4KA 5AYIA 5DF0A 3AU6A 1JZ2A 2VRJA 4O1BA 3UGVA 1R30A 1XBVA 2ZRYA 3ZLFA 1P43A 2WLYA 3C2RA 3V5CA 4F0MA 4HYVA 3R89A 3KBSA 1MQQA 1O95A 3G18A 2HJPA 4AEOA 3WENA 4E4PA 2XFFA 1UYQA 3ANYA 3EGJA 4EWJA 3GHTA 1PHQA 5I79A 1L6SA 5EMMA 1HVXA 3BJTA 3H24A 2YZ5A 3TYDA 1YNQA 4L9YA 2YYTA 4ILSA 1MUMA 3B0YA 1A3WA 1UP3A 5BU6A 1IF2A 3EWUA 3ZFHA 2HPMA 1UIOA 3U7BA 3TR2A 5K3VA 5HMEA 1KBKA 3S9IA 2BHYA 1JVNA 3W29A 4ENLA 5AHFA 1VFHA 3GR8A 4HSNA 3WZ0E 3UZJA 5AVHA 5HR7A 4IMAA 2GVLA 5ECVA 1DWGM 1SU5A 3GW0A 3E2QA 4A2RA 3EDDA 4GQBA 3I6EA 1ICSA 4PUWA 2V2DA 4OUEA 4DJDC 4HZMA 3TJ4A 4LW7A 3OZYA 4DRSA 2W27A 5LNRA 3ZM8A 5D33A 2P3EA 3BLEA 3S3GA 3ALFA 2GDUA 1F8MA 3PNUA 1F05A 4E3TA 1X39A 3GAKA 5EB8A 1JDDA 2ZZ1A 1K7XA 3CO4A 1FWTA 5C6MA 1KFJA 8RUCA 4AH7A 2PWDA 2Z6IA 2FPTA 4DXXA 2A3HA 7CGTA 1PZ2A 1OG0A 3PP7A 2O56A 2YA0A 3PZTA 3ABXA 3ELFA 2I5GA 1QW8A 1DV7A 1MNSA 5HWNA 3OG2A 3W86A 3AMGA 4U4MA 3LHYA 3MDUA 3FA4A 2QUTA 4WRHA 1Q6DA 1EC8A 4H8HA 4PB3A 2G8ZA 4PMXA 5T9BG 3O63A 4JTEA 1J01A 3NXFA 1TV8A 4W93A 4QDMA 3VZXA 1O5RA 3NG3A 1KTCA 3DKJA 4FALA 2CLFA 1FY6A 2V5DA 2PDQA 2VYOA 2A6LA 4MZ1A 1UBPC 5DMMA 3VU2A 3CHCA 4F2BA 3BOFA 4DBEA 3YPIA 3WK2A 1WDRA 4J3XA 5FEXA 3BUVA 1V6UA 1PKNA 3MKCA 1PIGA 3V3WA 3Q65A 3PFMA 3MHUA 2R94A 5DXXA 5FF7A 4F8XA 3NOYA 2VVSA 4B5VA 4DXVA 5JIPA 3L0GA 5JBFA 4AZHA 1R3YA 2PBGA 4R5EA 1Q6LA 1WOAA 2VOTA 4JYDA 4QRNA 4AAJA 1IZCA 1I2RA 3NO5A 3HQPA 4EF8A 4TX9A 4I5XA 3GYCA 1THFD 4G7EA 1TWSA 3P60A 2FYMA 3T4WA 4ML9A 3PS7A 5AOUA 4N2YA 1P1XA 2XGZA 3KVMA 1LOLA 4M81A 1LG1A 4MUPA 4H01A 5MF5A 4FI4A 4Q6JA 2DUXA 3RO6A 1EJVC 4H04A 3RFAA 2CIPA 3N6JA 1JAKA 2GQ9A 2Z25A 4LV9A 2J88A 4HN4A 4FB7A 2ALDA 3S1GA 1M1BA 1TA3B 2JEQA 4JQ3A 5D37A 4RZ6A 5IM51 3LV6A 2EPOA 2QDDA 3ZXWA 3SDOA 4M80A 4Q8VA 5PTDA 3BW3A 4ES4A 4AY7A 3DDMA 2J79A 2R8WA 3AROA 1QBAA 2FB3A 1H11A 2AGTA 1LJYA 4IMGA 3BW4A 3ZZ1A 2AAMA 1A4MA 4R7WA 3CYJA 4PZVA 3K8LA 3FNDA 1Q6QA 2V3DA 3UNDA 3QKEA 2A3AA 2ABAA 2F61A 4DJDA 4P61A 2BNJA 4Q4OA 3BGAA 5CC7A 3VIGA 1GVIA 3OVGA 2ZBTA 4URIA 2XSAA 2DT2A 2QEZA 3FSTA 1DHPA 3G1RA 1V0NA 5CPLA 3GUGA 2D3LA 2W63A 3T2OA 1RUSA 2UY3A 1LRNA 5FJJA 3WN6A 4GG9A 3PBUA 1XLHA 1XL9A 4QLJA 3F4CA 3TP4A 4I6KA 2TSYA 2ZZ2A 1PYFA 4C6MA 3ZLGA 3NQMA 4IFRA 2NVCA 2IQTA 4OECA 1KV5A 1JCMP 4CNPA 1WBJA 1N2VA 3E0FA 2ATSA 2O0TA 2R1NA 2WNQA 4L64A 4ZQNA 1OSEA 4KWUA 4HVXA 3AOFA 3CM4A 1K6WA 2C79A 2GDQA 2QQ6A 1J79A 2ZZ4A 4J27A 4GNVA 2E8ZA 1E9ZB 4NZJA 2RGMA 1ZBCA 2FZNA 3QEZA 1GQNA 3GQYA 4QCEA 4RW5A 5BRPA 4P8VA 4ZO8A 4YCOA 2BGNE 3W1NA 3NPWA 1VAHA 3A3XA 2H90A 4F40A 3I3DA 1AZ2A 4B16A 3M07A 3V0UA 4BQ3A 4TTUA 1XDJA 3R0KA 2ZTJA 1KM0A 1KWKA 3HV9A 1RVKA 3M1ZA 2XM2A 4QE4A 3GXMA 3VNLA 4H83A 1NELA 2DSWA 2VX6A 2O9PA 4A35A 1IT0A 1XLBA 5DXYA 2PD9A 4GHRA 1M5WA 5SWUA 3C2VA 2ZE0A 1TMQA 2OSXA 3VDBA 4ZQMA 3TFXA 3ZMRA 3NQ6A 5CAHA 3GUWA 1BRLB 3CGTA 1EEXA 4HYWA 4NYYA 3QQ1A 1HL8A 3PJUA 2PBOA 4XKYA 3ENLA 4G6CA 4HU0A 1TB3A 4GQRA 3ANVA 4RNJA 1JD7A 3TVAA 3TN5A 4KRUA 9XIMA 1V6YA 1OC7A 3CPUA 3WLQA 2KZHA 3V0TA 1TVNA 3LGEA 1M9HA 4M19A 1CIUA 4JIRA 3G8EA 4IPLA 3IAQA 3AQUA 3PBGA 1A5OC 1G4SA 1LBFA 5M1TA 2CU0A 4CUCA 2ACQA 3WCZA 3V1HA 4I7WA 2QVHA 3MY9A 3TKFA 1FH9A 1K3UA 6XIAA 4KFOA 1QRQA 2XYLA 4FO4A 1OINA 1ZZMA 3NNTA 3QMRA 4WOQA 4D6IA 3NVTA 3PBWA 4PA8A 4A21A 1H2JA 4PL2A 1VFMA 4RZ5A 5FF2A 4CGTA 2ON3A 3B8TA 3AFBA 4R9XA 1UD6A 1X98A 3LA4A 4DAFA 2XIBA 1O94A 5JVLA 1KR0A 5G4HC 1KLZA 1ZENA 5BW6A 3N4EA 4AMAA 2D22A 5H1WA 4KWWA 2TAAA 1ONRA 4TV6A 1E6QM 1UZ1A 3K1GA 2A1YA 1VH7A 4IH3A 3MS8A 2H6RA 4MKSA 1TCMA 3H6OA 1X97A 1KFBA 3H7UA 4QBXA 4GIRA 3EZ4A 3E12A 3E0VA 1VR6A 1VCGA 2EPNA 1JQVA 3F4NA 4NI3A 4NZ5A 4EF9A 2NW0A 1IZJA 2PP3A 4MG4A 3T55A 3I65A 2F38A 1T7LA 4UQCA 2PURA 2VT0A 2DT3A 4ZO6A 4JFTA 4DLMA 4A3YA 4WLCA 3W7LA 2W3ZA 2I57A 1W8SA 1QI4A 1UH4A 2H3BA 3W7GA 4X22A 1WKFA 6A3HA 4K68A 1WXJA 3HURA 3WDHA 1PHWA 1CB7B 4CQBA 3OA3A 1BFNA 4D8ZA 3TOPA 2Z1BA 3H21A 2PU1A 1GOWA 3C5QA 4QS6A 2ZC8A 2Y8VA 2ODOA 4LRSA 4Q8TA 3WBYA 5EGRA 1XX1A 2WMGA 2ZUWA 3MSGA 4IWWA 2Z6JA 3QW4B 5CZ0A 4W7WA 1DIKA 3CV6A 3EOUA 2W62A 4QG9A 1SJDA 1R3TA 4LGXA 2YFOA 4Y7EA 2PE4A 4XD3A 2ZIDA 4X9SA 1HN1A 3GB6A 3IV3A 3T05A 4NZ1A 5D02A 1GTHA 2XTKA 2VC7A 2E9MA 5C55A 3NQ8A 1MEHA 3C0JA 1ISWA 1YDVA 4I6VA 1TO3A 3PTDA 3WJWA 3T78A 2HZGA 3L0KA 3L4UA 1Z48A 4DJFD 2F6KA 2QCFA 1O6IA 3M0MA 2PTWA 1NDYA 6TIMA 1TMHA 3VC6A 4IG2B 3NEHA 1UZ4A 3UXDA 1O7AA 2WHMA 2QGYA 4UQ9A 3RMJA 4CD8A 1KWGA 5I24A 5AC8A 2A5HA 2DT0A 5CCZA 3RLUA 4UMCA 2I16A 3I4KA 1VYSX 4DBUA 2JFEX 3VIIA 4L1XA 4AQLA 1LT7A 5CJNA 5HATA 2WM0A 3W7HA 3MUZ1 1XQKA 1UUMA 3A21A 1OFQA 3UR2A 4OV9A 2GJXB 5DN1A 2NUYA 3FA3A 1NFBA 3CMJA 1WDSA 1H61A 2JKAA 4NX0A 3G22A 1SO6A 5BOFA 2PUZA 3CL7A 4F9DA 2XFRA 5FF0A 4GY0A 1W91A 4UR8A 1AQFA 1OF8A 3S6DA 5HWMA 3UXKA 4XWUA 5EMJA 2R1LA 5B7YA 4DO6A 5FF4A 2QPXA 5HOSA 1JGMA 3N4AA 2VMFA 3CT2A 2VR4A 3LLXA 2A79A 1PXGA 1ZNNA 1V4YA 1EDTA 3N15A 3PUDA 2E28A 3IJQA 3AIBA 1YW1A 5C0QA 3W7RA 4JDYA 3VM7A 2OOFA 1SSGA 4ZO9A 2VFDA 3L7RA 3B04A 1NEYA 1YTDA 3G24A 3QZEA 2BHZA 4AD5A 2YW4A 3SRFA 1B90A 2WHLA 3M44A 1A0CA 1I1WA 3W2LA 3OQ8A 5CG0A 1S5TA 3MJMA 2X1RA 1M53A 2YPIA 4Q7NA 4LFYA 2ONEA 3VGHA 4DWDA 3DECA 5T26A 1I2NA 3AYVA 3AMDA 2FVMA 6CGTA 3KP1A 4E6MA 4J40A 5D2TA 3OYXA 1NOWA 2D69A 3IIPA 4UTKA 2F2KA 2VCBA 1JXJA 4DQWA 1RV8A 2PDIA 1G9HA 3BQ5A 3IRSA 1F73A 2B31A 3G1YA 1JEZA 1JYXA 2C19A 3REQB 4L7ZA 1S5VA 1G5AA 1QK2A 1Q8JA 1KXHA 3THUA 2TPSA 2WJZA 1GVQA 3SADA 1A5CA 1WP6A 4NP7A 2GDVA 2HS8A 1IEQA 1LRQA 1E6XM 1V0MA 1W1PA 5MKGB 1E9LA 5DT7A 2GJPA 3TCSA 2G3MA 1W3IA 2CHNA 5FKYA 3WD3A 5AC7A 3RM9A 4JTLA 2BHUA 3R8GA 3QR3A 4A3UA 2B81A 3UWZA 4XSLA 2OTDA 3ABZA 4AHOA 2E5DA 5I2UA 3G2GA 4KERA 1WUFA 3GBDA 3WK1A 3N13A 5K9XA 3T9PA 3H54A 2WVVA 2J66A 2G37A 2AQVA 1M65A 1TPB1 1KFEA 3RPTA 4WK9A 3IJDA 3CZGA 4PYSA 2OLAA 3A47A 3RXZA 3W1PA 1UOKA 1K4GA 3BLDA 2CHRA 4LPCA 4UTIA 3PBMA 3C3NA 1AMKA 4O0KA 3QQ0A 1BVNP 1Z32X 2YL6A 2ISSA 4WDXA 2WQPA 4GBDA 2FKPA 4AF0B 1FH7A 1E4IA 1T40A 1E6NA 1ZCOA 3DYPA 4LUJA 4B92A 1SR0A 2RAGA 3BG5A 3LGGA 1XIMA 3LDVA 3U6WA 1DOSA 3T0TA 4AZ6A 3GNOA 2ICSA 1XDLA 1PX8A 1RZMA 3CB8A 3ZJ6A 3C3UA 3E5PA 3U2EA 3AS0A 2E3ZA 1W37A 5EYWA 2QJNA 5BMWA 1XIJA 4ZXLA 4IQEA 3U7VA 3DC8A 3CPGA 4W4QA 2BDQA 3N2CA 4NKCA 4RE2A 4KIRA 4H9MA 2XVNA 1FCVA 3MO4A 1SPQA 1UC5A 3QV7A 2YCLA 3CIVA 3CV7A 2Y7FA 4I9AA 2BY0A 3D3AA 4KRZA 3TA6A 4JZ5A 1UKOA 3BGGA 1O60A 2TYSA 2QIWA 1QBBA 4YN5A 2OGYA 2PC8A 1VBUA 1NF0A 3Q94A 4QQUA 4OTKA 2NT1A 1KXVA 5D03A 4GUGA 3URQA 1TPFA 1BAGA 3POCA 5BOEA 1Z3NA 3V75A 3UBPC 5D38A 1F3XA 5ABHA 4OFCA 1WO2A 3WH6A 2FZMA 3R5EA 1JPIA 1IEXA 4BF5A 4C6BA 2VUNA 3HV8A 4F0KA 5HA7A 3ZS4A 4ZE5A 1DVJA 4GWEA 4WXZA 3VKAA 3KX6A 3WIJA 1R0MA 3OLDA 4V33A 3ARYA 3SW6A 4L61A 5C9WA 3MUY1 3QY8A 4LX4A 3V1PA 1NY1A 4JIIX 7PTDA 4HGXA 3OEXA 1OFPA 4ZL1A 2OZ8A 1N82A 2PPGA 4RLIA 4GRSA 3WFAA 1RJQA 3K8KA 1EIBA 3ARTA 3IJ7A 7REQA 4HTBA 2UZ9A 3KTXA 4O8AA 3BSGA 2ZRUA 4XD4A 3E1F1 1F76A 3KVJA 2WCSA 5A6SA 4AFYA 2DQXA 1FKXA 2B0MA 3SCUA 2WKGA 3COTA 3JRKA 1F6PA 3N12A 1JI1A 2GQAA 3AIEA 4GVIA 2X1TA 4UZSA 3LPGA 3QGAC 4B4HA 5ENLA 1G94A 1L6YA 1MRAA 2OEMA 4UQAA 4JNMA 4YVVA 4US6A 3GZ3A 4MB1A 5REQB 1IWBA 4UFIA 1YDYA 1QOXA 1FWNA 4QHRA 4H6EA 2UY5A 3IGXA 1ZP4A 4KCUA 2X1IA 4GD0A 1I8JA 1SMAA 2DZTA 3RK8A 3SEPA 1XLMA 3ITTA 3VX1A 5A6KA 1Y8BA 5CH9A 4FLRA 3TV8A 4H9YA 3BANA 1Z89A 2VQUA 1MDRA 4Q33A 2GOUA 4FIQA 1RJPA 4F9JA 4FNSA 1EP3A 3B8VA 5A1AA 1CPUA 1QPRA 2XN2A 3BICA 3NPXA 1BPLB 3RG6A 1OCQA 1UH2A 4BS0A 2CZ5A 3B3DA 4JIHA 1RLDA 3U2CA 4WF7A 2G4JA 5T91A 4WR3A 2QDEA 3SUTA 3OA5A 3IGUA 4JEQA 2FB2A 4E8CA 1XR2A 2VWSA 2WWCA 3ZR5A 4AWEA 3K5XA 5BWFA 1YLVA 1EHNA 1PTGA 1VYRA 1DHKA 1BQCA 1NDWA 4A8RA 4K38A 1UOZA 2CLHA 1QW7A 1EP2A 1Q6GA 4UNKA 1P0KA 4JKMA 3DHPA 3OGVA 2O7SA 2ZVIA 3CUZA 4NL1A 1AK5A 1BYCA 1IEIA 4N9DA 3CUGA 1CLXA 4XAPA 2GGJA 3IVSA 3T40A 1TJ1A 3LHUA 1GGOA 1F07A 4R9OA 2ZX5A 1Z42A 3QY6A 3SBFA 2DQWA 4NT0A 1SSDA 4MKVA 1MSSA 1WZKA 3LBCA 1VPYA 1GW1A 3LYEA 1JCTA 4D8AA 2QS8A 3NEVA 2NT0A 4AX6A 1JYVA 1EGMA 2ASHA 3SURA 4NAEA 2D0HA 3V36A 3WK3A 1DXEA 2VX7A 3NXLA 2P3ZA 3N9SA 3H53A 4A05A 3AZTA 3WNPA 3TZFA 3VK5A 3WJZA 5CEWA 1HF6A 1FCQA 3VGEA 3E2VA 4HIBA 1FBAA 1MW3A 3MZNA 4TU1A 2WWDA 3H7VA 3FYOA 4C6KA 3PB2A 3UWYA 3FDGA 1E1EA 1C9WA 2ZTKA 3S1WA 3CUJA 3CTLA 4HA0A 3PJXA 1GCYA 3H2FA 5L9FA 5I09A 2Y7GA 4WD0A 1DPMA 1PTAA 3I68A 2QJJA 1MFVA 3PPFA 2VC6A 5IHRA 4TQTA 2RUSA 1NARA 1XGZA 2POZA 3N4FA 3O7UA 3VD5A 1JR1A 3UG4A 4GFSA 3BXWA 4CNNA 3G77A 3IVTA 4C6FA 4IIHA 3MJYA 2OYMA 3NL3A 3OW1A 2GJLA 5BXSA 3PY2A 3UJEA 1EDQA 4ATLA 1R38A 1QU4A 4FNQA 4ZQCA 2PC4A 3F5LA 2BGQA 1E4LA 3GHRA 3WQOA 2A2IA 4H8VA 1LLZA 3KCOA 5HNRA 4BI5A 4IXXA 1XV8A 3O9NA 2DSVA 4S3GA 4R3UA 2HRWA 2GVGA 2HVOA 2B7PA 3DI1A 1FCBA 2WZMA 3EMZA 2CXEA 2Q3OA 1VJZA 4IP5A 3M7WA 4WQ6A 2J7BA 4Q6XA 1QCWA 3VOCA 1F9CA 4MPQA 5A3HA 1TZ9A 1WOBA 2Y63A 1C93A 5JUVA 3EOLA 3QR0A 1QI0A 3QFWA 2XSBA 4DVOA 3W0KA 1DIEA 3D46A 2JEPA 1XLJA 4HU4A 5EFFA 4RPPA 3UA4A 2J25A 3VNIA 2CZVA 5KZEA 1MMFA 3ZOAA 3PN8A 2ZXDA 4C60A 1OY0A 2XIMA 5C9RA 1LQAA 5AC6A 4U33A 1AODA 2VP8A 3PNZA 3GY1A 3KOXA 3TQ0A 1HKJA 3QTPA 4AZCA 1GK8A 2HVMA 1RP9A 1SW7A 3SJNA 2YSWA 2A3BA 3UWQA 3CWNA 1RY0A 2QCDA 1A0DA 2QCMA 2INEA 4MNLA 5H8PA 4IICA 4ZOEA 4DIAA 4LAMA 4DLFA 3HF3A 4EK7A 3HGSA 4RKAA 3MHFA 3S5OA 3GG7A 3H4GA 3W02A 1SFLA 5CC5A 4H19A 3NA8A 4OE7A 1B30A 3EPMA 5IDZA 3ZVHB 1GVYA 2CHOA 1PDYA 4QSFA 4IMFA 2FLIA 5K9DA 2BMBA 1CGUA 1S2AA 3LENA 5DRCA 3U5UA 4GNJA 1KA9F 3OZOA 3OPSA 3TONA 3W9ZA 5FJTA 5IHSA 1XDMA 1SZRA 3ATZA 4LEQA 2VD8A 2OO0A 4GI8A 4H6QA 2QPUA 9RUBA 4FX8A 1G1YA 3U0HA 5C2CA 3L66A 4EOUA 1WCGA 2VFIA 4G8TA 3ITXA 1LT8A 5E9AA 5H8MA 1LQ2A 1FWIC 1C92A 4I90A 3QZ6A 1KM5A 3N18A 2NUXA 1XQLA 4ATDA 3OVRA 1OZMA 3GDMA 5FD0A 3OHMB 3M0JA 4EPDC 2PWVA 1OJXA 4HNLA 5H8UA 3ARZA 4O28A 3BAKA 1EWDA 1F6YA 1XLGA 3L2MA 3M46A 1SW3A 4AB4A 2OQYA 4GCXA 4QM1A 1W17A 3R43A 3WUBA 1RBAA 1HT6A 2UV8G 4M6PA 1K8XA 2X0YA 4A3RA 1J5SA 3V16A 4WGHA 1J4EA 3W6MA 1EOMA 3VI2A 3WO8A 5E93A 1UUOA 3WUEA 4ZQOA 4GUHA 1D3HA 4FNPA 3W25A 4NZCA 2PF0A 3ZT6A 4C6PA 4HTYA 2WW5A 5E70A 4OGZA 3K46A 5FJIA 1VP5A 1WAWA 4O19A 2BOFX 3LI0A 4FLQA 5EBAA 1W1IE 3G1XA 3QVQA 4N6EA 1FWAC 2BY2A 3O0KA 3N14A 1I2PA 3JU2A 3B8IA 3OLEA 3VOIA 5C71A 2A7RA 2VZSA 4B5XA 4DY1A 4MNKA 1DJWA 3TQKA 5D4YA 2ZZ5A 2FHBA 2VOMA 1A5BA 3GNNA 3UXLA 1RXOB 1TMLA 1DQUA 3SM0A 1WYIA 2CESA 4DX3A 3HG4A 1QVBA 5D2YA 3T8LA 1RCOB 4KFPA 5CSRA 1CZ1A 4YLWA 4UTMA 1HIZA 4F0HA 4QE1A 3IWPA 1A4LA 1Q65A 1R7OA 4H9UA 1UD3A 2VGGA 1Q4NX 1W9DM 4I5RA 4PUUA 1JDFA 4HNCA 3P6LA 3SSZA 3BAXA 4MB4A 3J7HA 4D6HA 4DUOA 1IEVA 1X1ZA 4GGBA 5DELA 3KLLA 1VFTA 3RPDA 3R13A 1XIDA 4YMZA 2AMGA 2VRKA 5HBFA 4YXGA 2XVKA 4AC7C 4S3AA 2CBIA 4J28A 2BY3A 4I3GA 3URBA 3B8UA 4WKHA 3THCA 2V3GA 3C0SA 3MSRA 4JNZA 4GJIA 1J10A 1V7YA 1XRSA 3GTIA 5A94A 4F66A 3VM5A 5G1YA 1FTXA 5FL0A 3TDFA 1TA3A 4HK6A 5CJ5A 1OIMA 3GSMA 4IFKB 2ATMA 3CUXA 2OLHA 3ABSA 1P7TB 1GORA 1F3TA 3P67A 1IE7C 3MUIA 1F61A 3II1A 4PMQA 1P6BA 5DBUA 3W2MA 3OTRA 3RO8A 2ZXQA 4Q8UA 3M4HA 5CPMA 1FCUA 3CK5A 1ZS2A 5KMYA 4WSHA 2ZX6A 4LOCA 4UOQA 2HK0A 4XB3A 1FWFC 3VCCA 3ID7A 5G4WA 3M7SA 3TN4A 3FEQA 4V15A 1XYBA 3L12A 3GH5A 1D8WA 2J7FA 3DOPA 2WMIB 2QT3A 1C8QA 1VBJA 2FGLA 2FZ9A 2FHCA 4I9TA 2WHKA 1M7OA 4JKLA 4GQ0A 3NVDA 3ZT5A 2AKMA 3M9YA 4K3ZA 3VGGA 3XISA 4HMDA 4NJIA 1U83A 3JR2A 4L65A 3QHOA 3TTSA 2G3IA 1VBHA 2VC5A 3SIZA 1W3LA 2BLEA 5I3FA 3O06A 1A47A 1W1VA 8CGTA 5LKYA 1TZ7A 2PZNA 5CJMA 4IIEA 4PULA 1YNPA 3GDRA 4JDBA 4WJ8A 3CL6A 1R87A 2I1OA 4Y9PA 3B0VC 3P84A 3AICA 5AHNA 3EWDA 1XKJA 3TWBA 1TPC1 4DM2A 2OWXA 3EDEA 3S2NA 1XWYA 2GOKA 2IPFA 2PZ0A 3LHZA 3ZVIA 4H7VA 4DAIA 3TWAA 1JZ7A 1GQJA 1UB3A 3A23A 1GYLA 2J74A 2J7CA 3VOFA 5HPCA 3KEHA 1MQPA 2VZOA 4P8WA 3RR1A 1XGEA 3RNDA 1UIPA 3DFTA 1E71M 4M29A 2B7OA 2FH8A 3HZ3A 3WD1A 4EWND 3IIXA 4GX9A 3TSBA 1KNWA 4PN2A 2CCRA 4P7LA 4O0QA 3MVIA 4RR4A 4O8RA 4PE8A 4E5TA 3ICJA 2VFHA 4FSAA 4FLSA 3G1SA 1KXTA 4W7UA 3O15A 1UCWA 2PRMA 3SAZA 4W88A 1D7KA 1JZ6A 4LANA 5CQ1A 3WKZA 4M7SA 1SM9A 3T2PA 5E09A 1H0IA 4NIRA 3CTTA 4B3KA 4JQ4A 3AXKA 3USBA 1XYCA 3PK7A 2V63A 1VRXA 3U48A 3VX0A 1P1MA 4E4FA 3I4EA 1BRLA 3GTHA 1QWKA 1BXCA 1R9XA 3ES7A 4LCQA 1OC6A 4MJ4A 4UQEA 4LCSA 3RDKA 2A0NA 4H7CA 4BEQA 1NOUA 3C2OA 4M6QA 1FP8A 1ZBKA 2PTYA 5DX7A 1L8PA 2PP0A 3GXPA 3W84A 4A3QA 2A85A 3WD4A 1S46A 3NZ1A 1JL8A 3VVGA 3WQ4A 2ZUNA 3N2XA 1J11A 1HTIA 3RX3A 4L6HA 3MANA 4LUYA 3MI3A 2HBVA 4W89A 1POJA 5HQMA 2QCHA 4QFUA 1UWAA 3LLFA 2C14A 5LHFA 4UTHA 5BRBA 3SQSA 2EGZA 4OOZA 1IV8A 2AL2B 4D6CA 1GQKA 1YQ2A 4KIEA 1QPOA 3APYA 5G1TA 4BQ2A 5HJLA 1GYMA 3UU0A 2FMNA 1IWAA 1JCYA 4R88A 3HOJA 5BXTA 4B15A 3S4TA 4HHMA 3WLTA 2FHFA 3V0SA 2A3CA 3P81A 1YXDA 3GU2A 1DJNA 3N04A 3QZAA 4RJEA 3KL0A 1H5VA 1CB2A 2XSXA 4NJGA 1KM2A 4HOXA 3EDFA 2AAAA 1K8ZA 5A8OA 1B3VA 5FESA 2Y7DA 3LZ3A 3E3HA 4B9ZA 4AEEA 3HG5A 2A3EA 4OQVA 5ABFB 3T0DA 1I9CB 2WHJA 4AZIA 2P10A 5C8BB 2IKJA 2WSRA 1YXCA 4LU0A 4RV8A 4HHLA 3DFPA 1SZEA 2R82A 2C1IA 1KRCC 4L9ZA 1FQ0A 3DI0A 2W0UA 3SY1A 3W26A 1F3EA 3ARUA 1R3SA 3KOYA 3W2JA 4DF1A 2DZUA 1W9UA 4E38A 5BU9A 4GIAA 1XBZA 3UG8A 1EC7A 3O3RA 4HNVA 4JTRA 3TQVA 2YDQA 1G6CA 3VOGA 2QMJA 4K6AA 3GVVA 1UR3M 3H4XA 1WPCA 2F7FA 2X2GA 1XLIA 3IS4A 3F03K 2ZX8A 3ARQA 1LTDA 1S2VA 3EDJA 5LNSA 3GXDA 4QROA 3L4VA 4CU6A 1BYAA 2QYGA 5I78A 1JCJA 2QNEA 3MSYA 1SZGA 4O4VA 3SRKA 1S1PA 4MAZA 3VIPA 3ZWTA 4Z0JA 3M16A 4TMBA 3EOOA 1WB0A 1O1HA 4Z42C 1NM9A 3QPYA 4XAYA 4X60A 3GVRA 2ZDSA 2WKLA 3FYPA 4IPIA 1UP0A 4LH8A 4QX4A 3ITLA 2Y8UA 3I6TA 1KFLA 1ZAJA 1ZALA 1TJ2A 2BZNA 3KOZA 3STGA 3VAVA 3I7QA 4GGHA 5E0KA 5LIXX 4FOUA 3F7JA 4MF4A 2BP1A 1OABA 1SR9A 3FY1A 3GKAA 5FJOA 1U1UA 4UFKA 1EH9A 1H49A 1AJ2A 3LPFA 1ONWA 3RLVA 2CLOA 1P48A 1OYCA 1BXNA 3GH4A 3N2OA 4IG2A 3TJLA 4QGCA 2PMQA 4LXFA 1FA2A 3PF3A 3ZT7A 2I17A 3MQTA 1M03A 2DZAA 3GC4A 4FF5A 4MM1A 4AD3A 3F2DA 2CBUA 3BLKA 4MAVA 4QNEA 3NZQA 1AQMA 1EA0A 1OCBA 5AB3A 2C15A 3IIOA 3S8HA 4UCGA 3WJSA 3ITCA 3K8MA 4XSMA 1V5XA 3MV11 1YXYA 1OX4B 3GHSA 2V30A 3LLDA 2XG9A 4M1RA 1W5PA 3FXYA 3IJ8A 5FIPA 4NNBA 3FYYA 1I0BA 3PAOA 4KETA 4WX2A 9XIAA 2NLYA 4NASA 3ALGA 1QNSA 4MY8A 4J9JA 4E8GA 1DQXA 3WK0A 1J0HA 1UJQA 1HJSA 2QF8A 4JX4A 2WC7A 4IT1A 2ANUA 2D2OA 2W92A 4QJ5B 3AXXA 2OX4A 2WZHA 1W8GA 4U5KA 1EA9C 4XVDA 4QP0A 6XIMA 3MC5A 5F4SA 5G2WA 5DMLA