2VC6A

Structure of mosa from s. meliloti with pyruvate bound
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
292
structure length
291
Chain Sequence
MFEGSITALVTPFADDRIDEVALHDLVEWQIEEGSFGLVPCGTTGESPTLSKSEHEQVVEITIKTANGRVPVIAGAGSNSTAEAIAFVRHAQNAGADGVLIVSPYYNKPTQEGIYQHFKAIDAASTIPIIVYNIPGRSAIEIHVETLARIFEDCPNVKGVDATGNLLRPSLERMACGEDFNLLTGEDGTALGYMAHGGHGCISVTANVAPALCADFQQACLNGDFAAALKLQDRLMPLHRALFLETNPAGAKYALQRLGRMRGDLRLPLVTISPSFQEEIDDAMRHAGILL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural, functional and calorimetric investigation of MosA, a dihydrodipicolinate synthase from Sinorhizobium meliloti l5-30, does not support involvement in rhizopine biosynthesis.
pubmed doi rcsb
source organism Sinorhizobium meliloti
molecule tags Lyase
molecule keywords DIHYDRODIPICOLINATE SYNTHASE
total genus 105
structure length 291
sequence length 292
chains with identical sequence B
ec nomenclature ec 4.3.3.7: 4-hydroxy-tetrahydrodipicolinate synthase.
pdb deposition date 2007-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2vc6A00
3W23A 5DXYA 4RX0A 3GZ3A 3NQFA 4RZ4A 2WSRA 4CCDA 3GXTA 2ZRVA 1VHCA 2CLOA 1S5VA 1JQVA 2Z2UA 3HB9A 1FDJA 3QSTA 4JNMA 1NAL1 3F1QA 5HUOA 5LGZA 1GEQA 1BTMA 1UUOA 1FX6A 1IXNA 3BARA 3STFA 4XUGA 5FEWA 3BW3A 2KZHA 2CLMA 2TMDA 2RDWA 4GJ1A 3DHDA 4JTJA 3NPWA 2GUUA 3MO7A 4M6QA 2Z0IA 4RLIA 1DOSA 4NX0A 4Y8FA 3MUXA 3LCIA 1TTJA 3L66A 2Y70A 2YYTA 4FNTA 5CG7A 1H63A 3W1QA 4MYAA 1G6CA 3TKFA 3DZ1A 3CC1A 2NV2A 3NPXA 3E02A 1KV5A 3NA8A 3D0CA 3N19B 3RF9A 4UFLA 2C15A 3W2JA 1GYLA 3M5YA 5D02A 2I14A 3T7VA 4NXKA 4Y90A 4I7UA 4MPQA 1FWSA 4HIBA 4S1FA 2JKAA 2H3DA 3P81A 4DQWA 2FB2A 1W5PA 4HSOA 3W76A 2OCZA 4JDYA 4P2VA 3RNDA 1LBFA 4CCCA 1A5AA 2HS8A 2O7SA 1YTEA 3HF3A 4AF0A 4DBEA 3LRLA 2E09A 4MYXA 3IGXA 2QCMA 1HTIA 1OHLA 1UCWA 4H4IA 3O63A 1EP3A 1VCFA 3TC6A 1W5MA 3FEMA 1AMKA 4LT9A 2QAFA 3IIOA 4HPXA 4IX2A 2H8XA 3GKAA 2BTMA 1WX0A 3M5XA 5FF4A 2NLIA 3WJWA 1FXQA 3O15A 1KFCA 3HPSA 1SSGA 4KWVA 4TX9A 3TSMA 4EOUA 5BOOA 2W0UA 4RZ6A 1F74A 1OVDA 4O8RA 2RFGA 5DY3A 2ZA3A 4IMEA 4EF8A 5AHEA 4PTNA 3NZ1A 3LV5A 2A21A 3M5VA 2YFNA 1QOQA 4FHAA 4CQAA 2ISWA 1EWDA 3QW4B 4JTIA 4UFIA 4PODA 4GBUA 1KA9F 3GDLA 3W87A 1RD5A 4UTWA 4JY9A 4TU1A 3GAYA 3IVUA 4DO5A 4BI5A 3BO9A 5G4WA 3HPZA 3NQCA 2QJHA 4ZQPA 5CZTA 1GTHA 1K8XA 1W3IA 1ZCOA 2JK2A 5IM51 1XC4A 3S9YA 4UTJA 3P74A 1VRDA 1W5NA 4LNYA 4MKNA 3BLEA 2FPYA 1B57A 3LXAA 3KRSA 3L5MA 2PC4A 4AWTA 5KITA 4X9SA 3UPBA 5CPLA 3L0NA 3S6DA 3IRDA 1OYCA 1QPNA 1H1ZA 3W74A 3C52A 3LCGA 3SECA 3P8JA 4QITA 2XN1A 1OFDA 2VC6A 3G0UA 3FA5A 1THFD 3TDFA 2QR6A 3S1XA 4MY1A 1EEPA 4CQ8A 1RQBA 1TV7A 4E0CA 1H7XA 3QQ0A 2C0AA 4HNTA 1W8SA 3M9YA 4HNVA 3T4CA 2Z6JA 2ZA2A 1U5JA 2NUYA 3QPYA 3NO5A 1TPC1 3I68A 4WOQA 2HSAA 3W2MA 4UTMA 2Y88A 3PS7A 2AGKA 3U2OA 5ABTA 2GJNA 4S2BA 3RLVA 1A5BA 4N9DA 4Z08A 4L4LA 1QR7A 2OZ0A 3HGRA 3M47A 3WJYA 1F2JA 1KM1A 4ZQRA 4ZMGA 4UTTA 1TPH1 4MLRA 3BG9A 4JTGA 2GOUA 4AAJA 3MYPA 3R13A 2NX1A 3TC7A 1W31A 3W70A 1VPXA 3PBVA 5D05A 5D2WA 3FJ6A 2V82A 3GNDA 3QPZA 3N34A 4UFKA 2ZRUA 4YWIA 1R30A 3IGSA 4WY0F 3TUUA 1W3TA 2VFFA 4NUWA 3FIGA 1XFBA 1DL3A 3NAVA 3C8FA 4LS1A 3HPXA 3HMJG 3AJXA 4CNNA 1ME8A 1QAPA 1C29A 4LUIA 3PWAA 3TK7A 4IJBA 3W88A 1DV7A 1G4SA 1WXJA 3G1XA 3NL6A 3G1FA 2EHHA 1XM3A 4K38A 3U6WA 1KM6A 5C2XA 4H3DA 1EPXA 3WJXA 3Q37A 1E51A 4O13A 3NQGA 3OIXA 3UXAA 4O12A 4GUJA 4Y9AA 4MJMA 2QEZA 1QO5A 4JTTA 4JTEA 2BWGA 2E77A 1AW2A 4FX7A 3M1ZA 1A53A 3LM7A 1R2TA 3RU6A 3PY2A 4ALDA 1ME7A 3O6CA 3G0SA 1VC4A 2HMCA 3NEVA 3LLFA 2CU0A 4R7JA 1JCYA 1LROA 4ZL1A 1VS1A 1FXPA 3M5ZA 1QWGA 1Z42A 1OABA 3CB8A 3MWAA 4N4QA 5FF7A 3B03A 1S5TA 5FF2A 4BWLC 4AHOA 3PG9A 3NM3A 4C1KA 1VYRA 2PRHA 2FQIA 2F84A 4LOCA 3LXBA 3A24A 3LCLA 4YL2A 4ZZ9A 3CHVA 3L9CA 5HUPA 5BMXA 1KTBA 3EWWA 5D30A 5J5RA 3KX6A 4BK9A 4UTUA 5KZDA 3OEXA 3W1NA 2CZEA 4NZJA 3A9IA 1PIIA 4Z1CA 3NL3A 3PG8A 4IGHA 3B0VC 1Q6LA 3ABQA 2BZNA 3G1DA 3NOEA 5D2VA 1GTEA 3O6YX 1OFRA 4UCGA 4L4MA 3NQ2A 5C55A 4GUFA 2B7NA 5AHMA 5G2HA 3VE9A 5F2GA 1WQ5A 1OF6A 1UASA 1LOLA 1PS9A 3NQ8A 5CPOA 5AC6A 4PL2A 3WK0A 1Z48A 2QDHA 4WXYA 1VGAA 1JJKA 3C2EA 2DZTA 1CW2A 5C5YA 4UMBA 3TCEA 4HNNA 3OVPA 3SGZA 1A50A 3KRZA 4XBKA 1YTKA 3EEGA 3NYZA 1I2QA 2WPBA 4K6AA 2ZYFA 3VI2A 3EX2A 4KFOA 3SI9A 5HMSA 1PHQA 1IXQA 2PURA 1MSSA 4IXHA 2E5CA 2A7PA 3SZ8A 3ELFA 3G1VA 5TQLA 4FIRA 2VENA 2X1SA 2VFDA 5CZ0A 3MBDA 3TQVA 4O50A 3PVFA 1ZAHA 3CLMA 3W7MA 3R5EA 2NXIA 4NXSA 4UC5A 4MLJA 3IEBA 1LLZA 2DP3A 4IWWA 1P4CA 2OT0A 5F2MA 2VELA 4N9BA 4DPPA 2QCGA 4IQLA 2QDGA 2Y89A 2VKZG 5K9XA 1XUZA 1JCNA 4RXFA 3S0CA 1RPXA 2DJLA 3W7QA 5BW6A 3LDVA 1PHWA 4BI7A 5KZMA 3QM3A 4K7YA 1EUAA 1G4EA 2YDAA 2A4AA 3IVTA 5EYWA 1SW7A 3C2RA 2Y63A 4K8EA 4UFMA 5J5DA 5K2ZA 4LVAA 4CQ9A 3O07A 5HR6A 2AAMA 1KBIA 3MHGA 3B0PA 3TJXA 4PFMA 3TQKA 4JS3A 1LCOA 2P1FA 4UXDA 1FWRA 5F4WA 1TIMA 1VCVA 4DPQA 2CW6A 4NU7A 4LC8A 4JX6A 3TAKA 1N8FA 4GUGA 1B4EA 4TO8A 3W22A 3TAOA 4Y6GA 4M7SA 3SY5A 1BWKA 5LNVA 1QPOA 3GX9A 4UTTC 4HSNA 2DU2A 1PL9A 4N6EA 3WFAA 3FLUA 1B4KA 4N4PA 1F6KA 1VYSX 4AF0B 1SFLA 4WUIA 5KZEA 4J9JA 4DELA 1K8YA 5LNUA 2DZXA 1K7XA 4LW7A 3QH2A 1OFPA 4YLWA 1TPFA 3W7RA 2YSWA 3W1UA 1XBYA 4X22A 1K7FA 3EXTA 2YW4A 2Y7GA 1SU5A 3Q58A 4JDBA 1MEIA 1XXXA 3NM1A 3LGEA 2G96A 3P61A 3ZS4A 3W7JA 1KFKA 3LXCA 8TIMA 1OFEA 1SZGA 3UZ5A 3NPUA 3O06A 1ICPA 2E5BA 4IMGA 5HNRA 1JRBA 4AB4A 5BRBA 1VR6A 2PRMA 4O1DA 5CKSA 3T78A 2B4GA 5AHIA 2H8ZA 1W0MA 1KFBA 3GVGA 3G24A 4O52A 3A21A 1H50A 4O15A 1NF0A 4TIMA 3EWZA 4WD0A 2TYSA 3OVRA 3ZWTA 1XCFA 4LVDA 2B7QA 2NZLA 4PA8A 4JIQA 3W7CA 1KM2A 1Q3NA 1PV8A 1VCGA 4JY8A 3R89A 5CPMA 1Q45A 5F2IA 3U8GA 4FEZA 3N2XA 3TV8A 1TV5A 1ZY9A 3GLCA 1O94A 3IIXA 5EBUA 2XN2A 1X8FA 3IIPA 1L2UA 1ML1A 4NX5A 1L6SA 4O28A 4UTKA 3DENA 1KTCA 1Q6OA 4DO6A 2VEKA 4IX0A 3W85A 1ZENA 4N9EA 1RV8A 1LTDA 2ZRZA 3P5YA 3S42A 3C56A 3M0ZA 3C0JA 2FPTA 3M6YA 3C3NA 4K39A 1EUNA 4WZHA 2ZZ4A 3O6DA 1I2OA 4O1CA 4PC8A 5HINA 1OK4A 4OQVA 5AB3A 3W7GA 4UUIA 1H7NA 4AH7A 1KFEA 5GVJA 2WJZA 3YPIA 2WSYA 1KV8A 1NSJA 3UY8A 4H6KA 2RDTA 4NZFA 3L0KA 3OA3A 1LLWA 5MHBA 1FCVA 1SO6A 3DFNA 3NG3A 5HWJA 3G8RA 5G5IA 3KVKA 3RK8A 1W5QA 1FY6A 3FKKA 1H60A 3C61A 1JCXA 4UMAA 2JKPA 4ZQNA 2FPVA 2JBMA 4K7VA 4X3ZA 3KRUA 5KMYA 4WXZA 1H7WA 2YFOA 2YGYA 4E2DA 4DF1A 4NNAA 2ZFAA 1DORA 3F4WA 5AHNA 1LRTA 4FO4A 4QIUA 5T26A 3LRKA 4RR4A 3N9SA 5HWMA 5D33A 1JCJA 3G8EA 2E1DA 3CEUA 2A1YA 2TPSA 3K30A 2Y61A 5DCEA 1G7UA 4DXVA 2GJLA 4JTLA 1FWTA 5L9FA 4WX2A 4LY8A 2ZZ1A 1JVNA 1MO0A 3M16A 3FOKA 1GVSA 1B3OA 1SO3A 1MXSA 2E6DA 2WSQA 1MEHA 2A0NA 2ZZ3A 3TMQA 1OX5A 3ATZA 3W1PA 2WV8A 2Y62A 1I2NA 4UNKA 5E0KA 1KFJA 1WOBA 3Q94A 1EA0A 1LRQA 1QOPA 4M6PA 4MVAA 4LC6A 2RH9A 3TE9A 1V5XA 3C2FA 3TW7A 4Z0JA 2NUWA 5F4SA 4A29A 3C2VA 3W75A 3S5ZA 2QJIA 3I7QA 1N55A 3G1AA 1I2RA 5DLCA 1G4PA 3W1AA 2ZZ7A 3OHIA 1TRIA 1F7BA 4EIVA 3EX3A 1C8VA 3P60A 3EKZA 1XUUA 4DEFA 4A22A 3TW6A 3C6CA 3CTLA 2ISSA 5U7SA 3DFSA 1EIXA 4LUJA 4PEKA 4O54A 2CLIA 2ATSA 3IVSA 3LTPA 4R34A 2GVJA 3HJZA 3UYCA 1IXPA 2W79A 4X2RA 1RZMA 1XDMA 3OBKA 1KBJA 4FXRA 4RK8A 3LERA 3P62A 2F7FA 4PCFA 3DFQA 2WQPA 2Q3RA 4UR7A 4JYFA 1H51A 5K9DA 5FEZA 5C54A 4WY0B 3P8IA 3LOTA 4K36A 2ISVA 1OFBA 1EB3A 3PBYA 3W73A 2CLEA 3O05A 2VXNA 2ZZ5A 3BVJA 2V81A 1W3NA 4CNOA 1TJRA 2I9EA 1S3HA 2CZ5A 1BWLA 3LHWA 2R94A 5LHEA 3GR8A 2HS6A 4JTSA 3DU0A 3PUOA 3TH6A 2G95A 4ML9A 1X1OA 2DJXA 4OV9A 3GYEA 1FCQA 2J6XA 1LOSA 5I3IA 1K03A 2NWSA 2V5BA 1KLYA 3NZRA 1YPIA 3IIVA 3V1PA 4IPIA 2JKEA 3QMSA 3P5ZA 2ZRYA 4GE8A 4AMAA 2ABBA 4JR5A 3G0XA 3NQ7A 1H1YA 2A6NA 2A7RA 2QCDB 1SZEA 4XTDA 4QM1A 1OX4A 4UIOA 3CT7A 1G7VA 1I2PA 4UFHA 1RQHA 4RJEA 3DKJA 3GDRA 3AO0A 3KHJA 5AC7A 2C16A 2Y7FA 4ZQCA 4FNQA 3LHZA 5TBOA 1FQ0A 1DVJA 3LB0A 3E0IA 3TSDA 4UMCA 2EF9A 3CWOX 4MJZA 4LRTA 3SGUA 3MP5A 3HG3A 4A2RA 4XTIA 3UXDA 4DF2A 4AEOA 3E49A 3ANYA 3MHFA 3DHFA 1GZGA 3BPWA 1IF2A 2A5HA 3G18A 3UWYA 5AN7A 3CU2A 1ICQA 2WNNA 3UWQA 1Q6QA 4GWEA 4AWUA 1LORA 3NQEA 1WV2A 3G3MA 1H7PA 4ADUA 1MZHA 5G1TA 4AHQA 1GG0A 2VFIA 3JS3A 4O1AA 4E38A 3FS2A 2PRLA 1W1ZA 3W7DA 1SUXA 2DZWA 2Y7EA 1GQNA 4JYDA 2A6LA 4A3UA 2XN0A 3H54A 3NQVA 5EKYA 2UV8G 4JTKA 4M6VA 2TRSA 3GDKA 1YPFA 4TR9A 4NJIA 3CIXA 1P5BA 3BLIA 3L0GA 4D2JA 1L6WA 4IXXA 3IIZA 4IOTA 3BK0A 1YLVA 3MYOA 3PBWA 4O57A 2GVLA 3FYPA 3O16A 1L9WA 3IV3A 4UFJA 3W71A 4ADSA 3UPWA 3E9AA 1DQXA 2Y85A 3I7RA 4MZ8A 3ABRA 3EXRA 4OBTA 1I45A 3G1HA 1SSDA 5DXXA 1YTDA 5EA9A 1FDYA 3W7HA 1VHNA 5BNKA 4FF7A 1QPQA 3W7PA 1A5CA 1V7YA 4NT0A 3STEA 5F4XA 4HHPA 1OK6A 1AL8A 3W1LA 1H62A 5D2YA 3R12A 3O8AA 4WJEA 1AW5A 5EMUA 4FX8A 2CLKA 3N3MA 1OF8A 3RMJA 2TSYA 1XKYA 3PC0A 4MIMA 3W7OA 3LCXA 5F1VA 1U83A 5LHFA 4DBDA 2G5WA 3HGJA 3LV6A 2AQWA 4XKYB 1TTIA 5I3HA 2CWNA 3CWNA 1A5SA 1T0OA 1XBVA 5I3GA 4OU1A 1TJPA 1YADA 2V30A 5A8GA 3LCWA 3LCFA 4MOZA 1EP1A 3H53A 3TFCA 5I3KA 3W9ZA 2E6YA 3T40A 5C6MA 2C19A 3WK1A 3QZEA 3W7LA 1LOQA 3A5VA 3GAKA 2ABAA 5K4ZA 3MBFA 1JULA 4Z1DA 5TIMA 3N2MA 4MFEA 3WK3A 3NNTA 4HKPA 2X1TA 1J2WA 3HGSA 4KFNA 4KWWA 3HG4A 3B05A 1R2SA 1JUBA 1H61A 2FLIA 1JCMP 4DO4A 1W5OA 1PCWA 4A2SA 4MZYA 4QAIA 1SR9A 3MI2A 3NXFA 4ZVJA 1QCWA 4NNBA 3THQA 4AWSA 2VEMA 3USBA 2YR1A 4O0KA 4OHQA 4LV4A 3P7YA 1T96A 4FX6M 3GK0A 4OV4A 3S1WA 2QCLA 2GQAA 5AYZA 1VZWA 4ORIA 1RVGA 4UTHA 2R14A 1YXYA 3UD6A 3PUEA 4O19A 4RZ5A 3ZR4A 1HO1A 4GFSA 4R33A 3V75A 1FWNA 3M7WA 3NDOA 3VNDA 4Z0SA 5LGXA 2QF7A 3RFAA 4CLMA 1SO4A 3VCRA 1G67A 3GNNA 4GUHA 2WO5A 3LBCA 1EWEA 1Q6RA 3L5AA 4U28A 1ZFJA 3GR7A 3R8RA 2V8ZA 5EL1A 3PAJA 5CZSA 2V2HA 4O18A 4BF9A 5LKYA 5K3VA 3W84A 5CSRA 5DBUA 2OJPA 2VOMA 5EPDA 3KAOA 1YXCA 1W37A 4A21A 1BEUA 1WDWA 3HIJA 4YCPA 2CLLA 1DJNA 3LHUA 5DN1A 2FJKA 1J5TA 3BV4A 3GXPA 4O1BA 5E1QA 2Y7DA 1MEWA 3WJZA 4I7WA 2QUTA 2EPHA 1AK5A 2A85A 4GNJA 2X2GA 1CI1A 3UWUA 3NGJA 2C14A 3N73A 1QO2A 2BX7A 3M43A 4LS2A 2NX9A 1NFBA 1DQWA 3PM6A 5CPNA 3E12A 1OX4B 2LLEA 1ZNNA 2QCDA 4IUOA 2C6QA 3ZFHA 4JTHA 4WQ6A 4UTIA 3C4UA 1NVMA 2ALDA 3KVMA 4ICNA 2ZCGA 1NEYA 4FIQA 4BFAA 3PSVA 5FESA 1FBAA 1KM4A 3W7IA 4ADTA 3LTYA 3VFLA 4OWGA 3NL5A 4LVGA 5AOUA 3THAA 4OT7A 1QNVA 3DFOA 2ZDRA 2RDUA 3B0UX 4JEQA 3STCA 4RCXA 1O5XA 3OG3A 3R2GA 4Y96A 3EX4A 2X1UA 1ZAIA 1GVQA 1JCLA 3W2UA 1TTQA 4IMFA 4JX4A 2C18A 4B5NA 4BWLA 1YDVA 1KFLA 1WBJA 1P0KA 2E68A 2JGQA 1OJXA 5F2LA 1N7KA 1Y0EA 1GWJA 5HULA 4WY0A 3L65A 3W2LA 4M19A 2QCFA 3E96A 3TA6A 3CIWA 1TREA 1M7PA 1F05A 1KM0A 2GVGA 1J4EA 1FCUA 2G97A 1UBSA 2YXGA 1TYGA 1K7EA 3W7NA 4IPJA 3EWXA 4IMCA 2X16A 2FDSA 2V5LA 1UJPA 3QW3A 4E2BA 3MP3A 2QCCA 3W1MA 2YW3A 2HTMA 5CSSA 1JUEA 2WOQA 4O14A 1TRDA 2Z1BA 3KVJA 1HG3A 4QJ1A 1RQEA 5H2ZA 1UB3A 2VEIA 1OFOA 5DELA 1SO5A 1VH7A 2CLHA 1M7OA 3I65A 4HPJA 4RXGA 1OFQA 3LI0A 1NF7A 3LHTA 1IGSA 3M44A 3LLDA 4QQ3A 2VFHA 1GVRA 3H55A 2B7OA 1VYPX 1ALDA 4XBSA 4PH6A 3G1SA 1VJIA 3TR2A 4Z1BA 5K9CA 2H6RA 4QNEA 1YDNA 4LVFA 4MY9A 2ATMA 3W7KA 5I3FA 4O4VA 5SWUA 3PR2A 4EF9A 1KM3A 4JICA 3VE7A 1ZHAA 1PVNA 1QMLA 4QSHA 4YCOA 2OMAA 5KINA 5L6UA 2DZPA 3FFSA 1WAUA 1LM1A 2NXHA 5HJLA 5EY5A 3P82A 3UNDA 4OGZA 3CPRA 2GQ9A 2DZSA 2J9ZA 3B06A 3W83A 5IBXA 1TTPA 4POCA 3W72A 5CZJA 1TQJA 2RHGA 1IIHA 3DKLA 2ZA1A 2W6RA 1GG1A 3TQ0A 4ORMA 2P10A 4UTWC 1T8XA 3FJLA 2CZDA 4O53A 3SJ3A 3DGRA 1IXOA 1ZAJA 5DCBA 3UWZA 2J88A 5AHFA 3I6RA 4LS0A 5G1YA 3KXQA 3T44A 3WK2A 3NQDA 4JIPA 2WNZA 3UWWA 4NQ1A 3LHVA 2PE4A 2FIQA 3TU9A 3EX1A 2X1RA 2QCHA 2O7QA 1CX9A 1P1XA 4K8HA 3LI1A 4O4WA 3HO8A 1L6YA 3EWBX 1K8ZA 2R8WA 3ABOA 1JRCA 3LX9A 3S8HA 1F5ZA 2D73A 1XL9A 1VQTA 4FNPA 5G4EA 4O16A 3KOFA 3B4UA 5LNSA 1OYBA 1BKSA 1T99A 5E93A 1H7RA 1Z44A 2XFWA 3S5OA 2YPIA 3L2IA 3PF3A 3SFKA 2X30A 2I1OA 1DJQA 1D9EA 2YYUA 1LBLA 3UY7A 1X6UA 1TPDA 3WJSA 4LTSA 1K02A 3W1XA 1X7FA 3KVLA 2NXGA 1G69A 2B0MA 2IQTA 4JX5A 4P61A 5D37A 4C1LA 3C2OA 1FUYA 3S1UA 3QSRA 1AW1A 3MJYA 3BGJA 3O1NA 5G2IA 2BLEA 5AYXA 4GC4A 3P80A 1GOXA 4G1KA 3TSBA 1LZOA 2E6AA 3HGOA 4N02A 3PULA 1FWWA 4AVFA 3DFTA 1TPEA 1SW0A 3CQ0A 5HR7A 3QRHA 3F4NA 5F1UA 5D32A 4O10A 1GVFA 3TFXA 3EXSA 2H3BA 4N2YA 3SIZA 2QCEA 4N6FA 3INPA 3MP4A 5DCDA 1AG1O 5LNWA 1OG0A 1WBHA 3MW7A 4GRSA 3DBPA 4HT3A 5DBTA 4HN4A 3JR2A 1I4NA 2FFCA 1ONRA 1GPWA 1YYAA 2Q8LA 2ZQ0A 3ABSA 1HO4A 3L21A 2J27A 4RKAA 1F6PA 1TB3A 3W1TA 3STGA 1ICSA 3PUDA 2NX3A 4S2CA 4UNLA 3S1VA 3IGUA 3G22A 3HBLA 4JN6A 4JTUA 3W7EA 4ZQMA 5KTLA 4CCEA 3W6YA 4FNRA 3GDTA 4QISA 1F76A 2YCEA 1KTNA 5K4XA 4JYEA 2Q3OA 4U4MA 1SZNA 3QC3A 5LNRA 2V9DA 5FEXA 2QJGA 4YXGA 4O17A 3EKLA 1G4TA 1OX6A 3JRKA 3DI1A 1XBZA 3MMTA 1X1ZA 4LV9A 4JGDA 2E6FA 5A5WA 5DY2A 2BSLA 2E5DA 3QMRA 3FYOA 3B04A 1LBMA 1D3GA 4NJJA 3VKJA 2NUXA 3A22A 5BMWA 3CEPA 1TQXA 3UWVA 1VLWA 4FXSA 4XQ6A 4XWUA 4BI6A 3LBMA 4MZ1A 3TNOA 4WOZA 4AXKA 1LRNA 3L67A 2ZTKA 4K37A 1IIGA 2VEPA 3NQMA 1HL2A 3LCHA 2WKJA 1GJPA 1KM5A 4KKXA 4IMDA 3HG2A 4TMBA 3W2KA 2A2IA 4LWWA 5D09A 5D2XA 4LVBA 3TROA 6ALDA 4QNWA 2JGYA 2Y6ZA 1ME9A 3B8DA 2CLFA 3W1RA 1DKWA 2FB3A 4RV8A 5AFDA 1WA3A 2ZZ6A 4Q4KA 1S5WA 5FF3A 1H5YA 1FCBA 4UR8A 3N9RA 2PCQA 4JD4A 3BW2A 3MI3A 4AHPA 3A5FA 2ZTJA 3GXNA 4CNPA 4NJHA 1KLZA 3DAQA 3EWUA 3EX6A 2C3ZA 1QPRA 1ZJIA 4O11A 1R47A 2EKCA 1SPQA 3QMTA 3RLUA 3NR0A 4NJGA 5D2TA 5FI8A 1O60A 5H91A 3GB6A 2J9XA 5G2WA 1O5KA 4W9TA 5AHLA 2V2CA 2Z6IA 3KFTA 1JQXA 1YDOA 4KFPA 5KSWA 1WOAA 1M6JA 3L68A 4O0ZA 1QFEA 7TIMA 2ZBTA 3I7SA 1LYXA 3EB2A 5LZLA 3NVTA 2R91A 4XKYA 5CGQA 3NL2A 3CM4A 4Q32A 3GIYA 2DORA 4GXMA 1P0NA 4NVTA 1GYNA 3NQAA 1SFJA 1XDLA 3BW4A 2QAPA 3LTSA 2ZZ2A 1XBXA 3TXZA 2Q8ZA 2B7PA 3W3OA 2EGZA 3TMLA 5D04C 1R46A 3MI6A 1UUMA 4TMCA 1HFBA 3BG5A 4Q33A 1D3HA 4JXCA 3A23A 5HWNA 4JTFA 3N14A 1EP2A 1Z41A 3QF0A 3S5YA 2BXVA 3QQ1A 3SR7A 4LU0A 3GDMA 3ATYA 2QUUA 4Z1AA 1M5WA 3UZJA 2C1HA 3PB2A 2V2DA 5D38A 1H7OA 2OT1A 4HNUA 1SZFA 3L5LA 2QUVA 4MFDA 1TV8A 1KW1A 1C9DA 1TMHA 3HG5A 1TPUA 3NQ6A 2P0OA 2ZRWA 2J9YA 3FKRA 1DBTA 1TCDA 2ZRXA 5I3JA 4BR1A 1XI3A 2DZVA 2NWRA 4I7VA 2FTPA 1ZALA 3P67A 4NNCA 3G3DA 4NJKA 4MUZA 1W54A 3QEZA 5FF0A 1QDSA 1ADOA 5FEPA 4XZ9A 3W07A 3TIMA 3DH7A 1JR1A 5U4NA 1F73A 1TPB1 2C13A 3DI0A 1LDCA 4EWND 5K7JA 2V0TA 2A7NA 1SW3A 1TPVA 2QCNA 5HQEA 5IBXC 5LSMA 1TPWA 4I9AA 2GPTA 2J24A 3S5NA 2VFEA 4FNUA 4M5PA 3W2NA 4GUIA 3MHUA 4FNSA 3M41A 3HQ1A 1YXDA 3NPVA 4EVZA 4OE7A 3SW6A 3LHYA 4LRSA 1EX5A 2CFFA 1W56A 3DFPA 3P84A 2H90A 6TIMA 1AL7A 1TO3A 2QKFA 1FDZA 3TX9A 3Q2DA 3BG3A 3F03K 3TJLA 4ZQOA 2NV1A 3QJAA 3TXVA 3BGGA 1PCKA 1OYAA 2CZFA 3PB0A 4UTLA 3W86A 4FB7A 1K3UA 1PE1A 5AC8A 3OVQA 2OX1A 4R53A 4M7TA 3T55A 2EAWA 4YMZA 1R2RA 3PSWA 3LRMA 2WNQA 1HUVA 1O4UA 1JUKA 3G1YA 3BLFA 3QYQA 4DF0A 1GT8A 4ONVA 1I8JA 3SSJA 1GVOA 2RKXA 3DXIA 3QFEA 2GQ8A 1RR2A 1O95A 1VLIA 1OFAA 4PL1A 1LP6A 3PBUA 5AYYA 4MY8A 2YX0A 1WYIA 5D03A 3GKFA 1DHPA 2YZRA 1B9BA 4N9CA 1SQ7A 2DZUA 3UQNA 2VFGA 3HOJA 3ZWSA 1TSIA 3EWYA
chains in the Genus database with same CATH superfamily
4LF1A 2R6OA 3BE7A 3FSUA 4CCDA 1VHCA 3HB9A 4O1FA 4JFTA 5JH2A 3KTCA 1FDJA 3DG3A 3F1QA 3EDDA 4LNCA 1BTMA 1WKEA 4LB3A 4BS0A 4NAFA 3BW3A 3THUA 2CLMA 4KEMA 4AIOA 2XIBA 2IKIA 3MO7A 4M6QA 2Z0IA 4AQLA 3E38A 4AEEA 4NX0A 1NWUA 4W8BA 1XRSA 1TTJA 3CL6A 4IGNA 3L66A 2YYTA 1IT8A 5CG7A 1H63A 2ZX6A 1XQKA 3BAXA 1G6CA 4GIEA 4NZ1A 2NV2A 3WH8A 3NA8A 1QASA 3D0CA 4DRSA 3N19B 4UFLA 2C15A 2PCEA 2I14A 2V68A 4GO9A 1Z6KA 4Y90A 3UZYA 3W37A 4GI4A 4R9XA 1J9YA 1XH0A 4C6QA 4P2VA 3RNDA 2XINA 2PDHA 1WDPA 2P5NA 4PGLA 2O7SA 3THDA 1S2UA 1V0KA 4DBEA 2WC7A 4IQDA 1E6XM 3IGXA 3NFUA 1WB0A 4HMDA 1Q7ZA 4IG2A 1OHLA 3URNA 3SUUA 2IKHA 2R1PA 1VCFA 2DT3A 1EZWA 1OD0A 1UBPC 1UH2A 4PB5A 3AALA 3FEMA 1EBGA 4IX2A 1KRAC 4ZXLA 2VRKA 3NSNA 3ARVA 2NLIA 1L2QA 1FXQA 1AD1A 4KWVA 1FOBA 3TSMA 1F74A 3VGBA 4O8RA 4P7OA 3VM5A 4B91A 1X98A 1ISXA 1UH3A 1QOQA 4AD4A 4OJYA 4CQAA 5A6TC 2BV9A 3N17A 3QW4B 2YJQA 3GVQA 4Z1YA 3GDLA 1E9ZB 3W87A 1KQYA 3IJ8A 4UTWA 5LA0A 3MU7A 4TU1A 4GYPA 3ARXA 3GAYA 2HV5A 4QAWA 3RDKA 3L2MA 3BO9A 2ZDSA 3NQCA 4HCDA 3T8QA 4NZ3A 1K8XA 1O7AA 4OTKA 4MKNA 3CB3A 3UPBA 5CPLA 3B9NA 3L0NA 4INFA 1QPNA 3FK4A 1A0DA 3P8JA 3S83A 2Q01A 4L1XA 3CASA 1OFDA 2VC6A 4DJDC 3FA5A 2QR6A 3S1XA 4LALA 4EAMA 4LUTA 1GQJA 3N12A 4E0CA 2PP1A 4QJ5B 2GL5A 2WLZA 3NURA 1M04A 2Z6JA 3AZSA 2E0PA 2ZA2A 4AD5A 3NO5A 5PTDA 1JZ2A 4REQA 3L4TA 5C9XA 1H11A 2I9UA 4WKFA 3CHDA 3RLVA 2QJNA 4GHRA 3ARUA 4N9DA 3VX1A 1QR7A 4ZMGA 4M0XA 2YKKA 1BXNA 5A8PA 4JTGA 4V1YA 2NX1A 2DDXA 1W31A 3W70A 1Q8JA 2X0SA 5D05A 4R27A 4WDTA 4Z2HA 3VUPA 3R0DA 4F8XA 3TJ4A 9RUBA 4WY0F 3AYTA 1W3TA 3VDAA 4G9PA 1I1WA 4PMYA 3C8FA 4QE5A 3HMJG 3AJXA 3F2DA 4CNNA 3G6LA 1FVPA 1ZBCA 2PD5A 3TK7A 4IJBA 1DV7A 4W87A 3NL6A 3U2ZA 4K38A 1XM3A 3U6WA 3WJXA 1XLCA 1E51A 1LWHA 4L6DA 3UXAA 2E7FA 2RJHA 2VC7A 4Y9AA 1BTCA 1YQ2A 3PJXA 4JTEA 5DX7A 2OR2A 3H26A 3LM7A 4IZGA 1J79A 2W66A 3RU6A 3WN6A 2NW0A 1BG4A 3CZEA 3FA3A 1XH1A 5HNTA 3NEVA 1M1BA 3L23A 4R7JA 3I10A 2WK2A 4ZL1A 4C6NA 1VS1A 5FOOA 4QEEA 3QY7A 4C6BA 3CB8A 1OABA 3TWAA 1QI5A 4D6CA 2Q8XA 2FVMA 3NM3A 3V3WA 3OQEA 3ZJ6A 2PRHA 3LQGA 3BOFA 2F84A 2AKMA 3KOYA 4Z42C 4LOCA 5CC5A 2VX4A 5ABEA 3E6EA 2WB5A 1JFXA 2V5KA 2VD8A 5J5RA 4BK9A 3FHAA 4PRTA 4UTUA 1U30A 4H8VA 4NZJA 2PDNA 2ZX5A 3GD6A 3PG8A 4XAFA 4DM2A 3ABQA 4LBUA 2BZNA 1TZ7A 2ZXQA 1BVZA 4UCGA 3LNMA 3RMEA 1YBQB 5C55A 4XVEA 1J0YA 1UASA 1F9CA 1VEPA 2VO5A 3WK0A 1FFQA 1JJKA 3PHAA 4FK9A 2GYIA 1XYAA 3HN3A 1DJYA 4GO8A 4HNNA 1JL8A 1A50A 2FFIA 3EEGA 4K6AA 2WPBA 3S4TA 3WELA 4E8DA 1OADA 1XGZA 1F8IA 4C91A 1B1YA 4GIRA 5HMSA 1PHQA 4OBRA 1E3ZA 1TZZA 4IXHA 4Q6JA 3TA9A 3CMJA 3Q67A 3TQVA 1JAEA 3WF0A 2AQVA 2OSYA 8XIAA 9CGTA 4D71A 4YJ5A 1Q7QA 2NXIA 2PGEA 4S38A 2XVGA 2VELA 3G2GA 1JNEA 1BLIA 3GFZA 4UWMA 5LYRA 3NQBA 1Y7VA 5HOSA 3GW3A 2Z29A 4XBJA 2FGLA 5C9UA 1PHWA 4J3TA 4BI7A 3ALGA 2WANA 3QM3A 2DW6A 1EUAA 4J28A 1SM9A 3EOEA 1TMLA 3C5QA 3IWPA 4NAEA 3POHA 1X1NA 1E6PA 2Z7GA 3ZQ9A 1MZRA 4H7CA 3H70A 2Y63A 4H9XA 4UFMA 2FYMA 4HOXA 5K2ZA 3N13A 3R0KA 4CQ9A 3O07A 3VX0A 2I17A 3MPGA 5I79A 1N8IA 3TJXA 4PFMA 1J6PA 3N4FA 4H9TA 1B54A 4I6KA 5DF0A 2DIEA 4Y9OA 5F4WA 1VCVA 3WG6A 2DH3A 4LC8A 2EEXA 4JX6A 4CU6A 4TO8A 1VFHA 3TAOA 4M7SA 3SY5A 1BWKA 4IISA 2DU2A 3U2CA 4ATDA 5BXTA 1B3YA 3ITLA 3WFAA 4N4PA 2XH7A 1CGUA 4AZ7A 3ZZ1A 2GGHA 1TUFA 3MUY1 1H4PA 4LW7A 3SAZA 4YLWA 1Q2SA 3W7RA 3EPNA 1K7FA 2YW4A 3Q58A 1BGAA 1MEIA 1XXXA 3E0VA 2J47A 3SY8A 1R6WA 3OYZA 2G96A 3P61A 2TODA 3LXCA 1OFEA 3NPUA 3O06A 3TYEA 1ICPA 1DJXA 4IPPA 2KX9A 6REQB 3AMLA 4AB4A 5BRBA 3M64A 1KKOA 4Q8UA 4B5TA 3B8WA 2B4GA 5I6SA 1WZMA 5AHIA 1VBHA 1XISA 3B9EA 1HXJA 3GVGA 1NF0A 1WDDA 4TIMA 4KEVA 2B7QA 1VFFA 4L4PA 3FXGA 3W7CA 2OLSA 4W8AA 2CBVA 3R89A 3N2XA 4KEZA 4YIWA 1J10A 4X0VA 4AZ5A 4ZOBA 2GJPA 1JXKA 1ML1A 1L6SA 5BXRA 4UZUA 2PGRA 3DENA 2IKGA 1KTCA 1Q6OA 4NAFB 1ZENA 1LTDA 3UYIA 3S42A 1VFLA 4LEFA 2BY3A 3C56A 4W84A 3UR8A 2FPTA 3M6YA 3C3NA 4WZHA 3SN0A 2POZA 5ABFA 3WQDA 3FJ4A 1OK4A 2GK1B 4AH7A 3YPIA 2WSYA 3PWIA 1NSJA 1P6CA 3LENA 5FJIA 1QPKA 4H6KA 1X6NA 3LQLA 2X2YA 2RDTA 2OZ3A 1OT1A 1LLWA 4AX6A 1GEHA 3U0HA 3AMGA 1WZLA 2QW5A 1FCVA 2UY3A 5HWJA 3DFNA 3NG3A 1ZBKA 2QPUA 3KVKA 3RK8A 1W5QA 3FKKA 1H60A 3TNBA 4ICMA 2G4JA 1V7AA 4K7VA 4DJDA 3KRUA 1EZ2A 5KMYA 4D1JA 1B90A 4X63A 2YGYA 4ZE5A 2O56A 3GFYA 4EACA 4DI8A 5HMDA 3GXIA 3N9SA 3IS4A 4I8DA 3M7SA 3R8HA 3M0MA 4E4PA 3G8EA 2A1YA 5DCEA 2GJLA 1BF6A 4JTLA 1NQ6A 3UVAA 1XIIA 4LY8A 2ZZ1A 4RDYA 3SSZA 1SO3A 2WSQA 4GVIA 3S2CA 4LAUA 3TMQA 3ATZA 2BASA 2WV8A 4UQ9A 5E0KA 2XFYA 1KFJA 4X61A 1EA0A 2ACSA 5GJMA 4MVAA 4KH2A 3BOLA 2HVNA 2FZDA 2XZ7A 1V5XA 3Q65A 2XVNA 3TW7A 1EEXA 4HOZA 2YLAA 4Z0JA 3B0YA 5F4SA 4A29A 3I7QA 3BL3A 3G1AA 4C5ZA 3P3BA 2ZZ7A 1K70A 3UCDA 2WM1A 3EX3A 3P60A 1WXZA 4GQBA 4DEFA 3TW6A 3C6CA 1QK0A 5KEZA 2D0GA 1EIXA 4PEKA 3CGTA 3DFSA 3A9BA 2CZVA 5T8GA 3RCYA 3LTPA 1PX4A 1KCXA 3HFTA 4AU0A 4P7NA 2W79A 4US5D 4JQ1A 1E71M 4KCWA 5HPCA 3B3DA 1KGUA 5CBIA 3AWNA 1R3YA 4FXRA 2PDJA 2E40A 3WQOA 5BWAA 3P62A 4P8XA 6XIMA 3ES8A 1J12A 2Q3RA 4UR7A 5MF5A 1ODUA 4FPSA 5C54A 3JZUA 1TKKA 2WMGA 3ZT7A 1CGWA 1S2VA 3AXHA 2ISVA 2OO6A 3OYXA 3O05A 2HBXA 3AIUA 2V81A 3UJEA 3PZVA 2PLKA 2RGMA 3DCPA 1QWKA 1BWLA 3N1AA 4H8UA 3GR8A 2HVOA 1ZSXA 4AC7C 5DT7A 4ML9A 1MUMA 2ANUA 4DXXA 4OV9A 1V3KA 2Z2BA 3JU2A 1TUXA 5I3IA 3U57A 2ZKMX 3KZSA 3IIVA 3V1PA 4KCVA 4IPIA 4WSHA 1ODZA 2ZUUA 4AMAA 1MMFA 4JCMA 1FWCC 5D4YA 4NG3A 2QCDB 1SZEA 1EF2A 2BBFA 4UR9A 3WLPA 3CT7A 4UFHA 1I2PA 3GHRA 2J62A 3ECQA 1RQHA 2FH8A 3AO0A 3KHJA 2Y7FA 4ZQCA 1JZ4A 4LAKA 3LHZA 3LB0A 3E0IA 2E1WA 4E4FA 4DZHA 1WPCA 3MP5A 2YA2A 3HG3A 1NM9A 4XTIA 1DWAM 3E49A 5EMMA 1JF6A 3WQFA 3CUFA 3MHFA 3ES7A 1U1HA 3BPWA 3QV9A 1XIJA 3G18A 4GH1A 5AN7A 2GDUA 2WNNA 1OB0A 3AAMA 2ESCA 1AMYA 3G3MA 4L64A 2QGHA 3CXOA 5FACA 1JCTA 4AHQA 3KHDA 4PBGA 1ECEA 1GG0A 4K1GA 5FL0A 4O1AA 2GLKA 1JYNA 1W1ZA 3EZ4A 1PKMA 2DZWA 3VCNA 2PMQA 2Y7EA 4E8GA 1GQNA 4ENLA 2DH2A 2XN0A 2CITA 2REQB 2VCAA 4LYPA 4U3AA 2TRSA 1YPFA 3RM4A 2BOFX 4GYFA 1P5BA 3BLIA 4S3KA 1JXJA 1L6WA 5C0QA 2VX5A 4E3TA 3O16A 3CQKA 3IV3A 4XD5A 2J79A 1JIBA 1KBBA 2YL5A 2WKLA 4K8GA 3UPWA 1FWFC 4NP7A 2BHYA 3B8SA 1A3WA 3BC9A 1SSDA 3W82A 1VHNA 4WKAA 2R1MA 3STEA 2AKZA 5DMYA 3GSMA 2O9RA 2W27A 4H6RA 2X42A 4WJEA 3WMSA 2IXVA 2E9LA 1P0BA 1OF8A 2BGSA 3RMJA 3K4DA 3MUCA 3GRIA 2OYMA 3D3FA 2OQHA 4J5NA 1E4IA 5F1VA 1PB0A 3E0FA 2G5WA 1E9LA 2JF7A 3HGJA 3VABA 3LV6A 4LYKA 2AQWA 2CWNA 2WC4A 5I3GA 4OU1A 3KDOA 3E2RA 1YADA 3LCWA 2W62A 1A5KC 5I3KA 4EKJA 2DT1A 3WK1A 2Y0FA 4M1BA 1EJUC 4NRRA 3GAKA 2ABAA 5K4ZA 3GUWA 1UROA 3KCJA 1XG3A 6ENLA 3NNTA 4HKPA 3BICA 4H9MA 3HA1A 3BAKA 4QHRA 4ZTYA 3DFYA 1WKDA 5IHRA 2FLIA 2IUZA 1AD4A 1PCWA 3NCOA 1OZMA 2WHJA 3GVRA 4CD5A 3MV11 4ZVJA 3CV6A 4WGXA 2J6VA 2JEQA 2YR1A 1V79A 4PMZA 3LPFA 3GK0A 1VZWA 1DIDA 3UG8A 3LGDA 4J1OA 3VKCA 3CBWA 3ICJA 7REQB 3JZEA 4R33A 4ROQA 3VNDA 2WZMA 3RFAA 4D8AA 4CLMA 1UD2A 1VPYA 4UOQA 4LQ1A 3VCCA 2WO5A 3VIHA 5FAJA 3L4XA 3KBVA 4U28A 1ZFJA 3RX3A 3R8RA 2V8ZA 5EL1A 3PAJA 3W84A 5DBUA 2OFJA 5EPDA 1D7FA 1YXCA 5FJPA 2GUBA 1BEUA 4YU1A 1QHOA 1HIZA 1HJUA 1JZ5A 1DJNA 3UJRA 2FJKA 2PWFA 2PTDA 4O1BA 4DN1A 1RK6A 3LNPA 3U2EA 7CGTA 3UVIA 2BX7A 3I3EA 4B2DD 3URAA 4LS2A 1S3TC 3ZLFA 4A8RA 4RW3A 3PM6A 3QZAA 2CEQA 3QV8A 2J66A 2QCDA 3ZFHA 4DUVA 4PMXA 2PWUA 3AC0A 5AY7A 1CBGA 4MF4A 4UTIA 3AFBA 1KXTA 4BEUA 1NVMA 3KBMA 3TW9A 2ZCGA 4W8LA 1NEYA 1UQYA 3SRHA 3W7IA 5GQBA 1JDCA 1QNVA 2RDUA 1O5XA 3OG3A 4Y96A 2WYSA 1CGYA 1JCLA 3QQWA 2C18A 2VZTA 1KFLA 1MI3A 3CAQA 2HJPA 2Y5JA 2ZUSA 1RY8A 3TN5A 1OJXA 4PMQA 4PUMA 4LAMA 1O5QA 1E6ZA 3E96A 2DGAA 3CIWA 4BF7A 1TREA 2VZUA 2GJRA 4MWAA 1HJVA 3W7NA 2J13A 1UJPA 4HA3A 1R9YA 2X05A 3W1MA 1UPPA 5CJ5A 2YW3A 3ITXA 2ON3A 2HTMA 4JEJA 4WF7A 3PZGA 3QKZA 3MCMA 5H2ZA 1UB3A 2VEIA 5I06A 1OFOA 1HP4A 3IJQA 1SO5A 3TWBA 1A0EA 1Y8BA 2GSHA 3E1F1 1IGSA 1PTGA 2VJXA 2VFHA 1GVRA 3EWDA 3G1SA 5BYWA 2EKGA 2QJJA 2Y4SA 3I6EA 2ATMA 1RLCL 4F0SA 2E9MA 4DO7A 1PWLA 2ZUNA 1KM3A 3WX7A 4WJXA 1QMLA 2F2HA 2OMAA 5KINA 5L6UA 1RCXB 3FFSA 2W3ZA 1LM1A 5EY5A 1WUEA 3P82A 3UNDA 2HRWA 4JNYA 3Q4DA 3W83A 5CZJA 2RHGA 3DKLA 1IWAA 3NEHA 1V08A 4NILA 4O1EA 4ORMA 2AL2B 4UTWC 2YCKX 2EJ1A 1GOQA 4M1RA 1ZAJA 5DCBA 3UWZA 3KBNA 5A3HA 5DRIA 4X2PA 3WQCA 3OIHA 3SEPA 3NQDA 2F9RA 3MWCA 3WNPA 2DY3A 3ENLA 4NQ1A 4PSRA 4TTGA 2QCHA 4W88A 4Q4MA 4QQUA 1V0NA 4DI9A 1E0WA 1L6YA 1K8ZA 3ABOA 3UJ2A 4MB3A 4PUWA 3RO8A 5A8QA 2VHLA 4JIEA 2Z1KA 1TVPA 1T99A 4QP0A 3T6CA 4EPBC 3TYUA 4ILSA 1KO0A 2YPIA 3SFKA 3TCSA 4MDOA 1DJQA 3FAXA 3S9ZA 4ZXOA 4A35A 3WJSA 4Q8OA 3M0XA 4PCTA 3VUSA 4ZOAA 4BEQA 4C6DA 2XU2A 2QUMA 3ABXA 3W1XA 1CLKA 4IIEA 2B0MA 2IQTA 2POTA 2X8RA 1JI2A 4C6OA 5D37A 3S1UA 2EXOA 1AW1A 2I56A 3MJYA 2WC3A 1CECA 2BLEA 5AYXA 4GC4A 2GDQA 1ENUA 2E6AA 1TPEA 3CQ0A 1CLVA 1G94A 4O10A 2XVPA 2NQ5A 3TFXA 4TX8A 4AVNA 1JD9A 1KGXA 3M0VA 1W1A1 4N6FA 2BB0A 1XSJA 3OLEA 1WE5A 5LNWA 2YIHA 4G56A 3MW7A 4AD1A 3AXIA 4QBXA 1Q63A 4HN4A 1HL8A 4XKMA 2FFCA 4YNGA 5AYIA 2CC0A 2V5JA 2YCIX 1SJDA 5LXEA 3W29A 1YYAA 5TD4A 3V0TA 2VGBA 2ZQ0A 1VENA 3W1TA 3MMDA 1PUDA 2VEFA 3IGUA 2PS2A 3HBLA 3T07A 3EB3A 1NOUA 3V0UA 2O4QA 3TN6A 5KTLA 4CCEA 4IFRA 3F5LA 4FNRA 3GDTA 2YCEA 1KTNA 1SZNA 3OPSA 4GINA 1A0CA 1VF8A 5M17A 4M24A 4PMRA 1GJUA 1Y5VA 4XAPA 3M6DA 4GABA 1UZ4A 2OWWA 1G4TA 1XBZA 3MMTA 1X1ZA 4K1WA 1NFPA 3OGRA 1CXFA 1XF0A 3QBUA 3FYOA 1EL3A 2PLJA 4Q8TA 1HP5A 1SJBA 3UETA 1X39A 3A22A 2YDRA 3ZYZA 4NIRA 3LSCA 4F3HA 4FXSA 3PK7A 4JPGA 3ZR6A 4ZBCA 1LRNA 1BQGA 2WJFA 2VEPA 3FW6A 1RA0A 1JPIA 3QR0A 4IMDA 2ZC1A 4XZWA 3R11A 3FGCB 3HG2A 3DFHA 2FZ8A 2A2IA 3GVWA 1LF1A 4LWWA 5D2XA 3TROA 2JGYA 2PODA 2PP3A 4RV8A 1NY1A 1EJ7L 4KETA 1H5YA 4PCPA 4UR8A 3O2LA 3T1GA 2PCQA 3ID7A 3USZA 4FF5A 2QZRA 2P50A 4J2MA 2JIWA 1ZJIA 1GPFA 4JFWA 1BPLB 3A3XA 3RLUA 3OW1A 3NR0A 3VNKA 2G41A 3H24A 1KCLA 4JHOA 2OOFA 5H91A 4I6VA 1QHPA 2J9XA 5TAOA 1JGIA 1EBHA 3FGCA 2Z6IA 3KFTA 3WIJA 1JQXA 1Q85A 1YDOA 1FHLA 1NARA 5BRPA 1WOAA 5KSWA 5HA7A 4RDWA 4BF5A 1QFEA 7TIMA 1AJ2A 1V3IA 1LYXA 3EB2A 4GIYA 1GKRA 2R91A 1CGXA 5CGQA 3VTRA 3CM4A 4M29A 3UZZA 3RU8X 1FRBA 4NVTA 1GYNA 3NQAA 4DVOA 4ZB0A 1XDLA 2YDSA 1R7AA 1GOMA 2VOTA 3H2CA 3WQEA 3HURA 3HM7A 2B7PA 3UXKA 4TXEA 1FHVA 3AMCA 5D04C 1OWQA 3VO0A 3MI6A 1UUMA 5DMMA 4DX3A 3CJPA 1D3HA 8A3HA 2A3CA 4EAYA 4AZ6A 3C0SA 5FL1A 4GA8A 3QQ1A 3CL7A 4R7OA 3AMKA 3SR7A 4F9JA 3GDMA 3LUTA 3ATYA 1M5WA 2GJXA 2OT1A 3GM8A 2WBKA 5A6MA 1UWIA 4TVCA 4F2BA 2QUVA 1TV8A 1SGJA 2OLHA 4ZODA 2ZRWA 4KRZA 1XD0A 1O12A 2FZ9A 2DZVA 3UBPC 5BWFA 1UD3A 3A3WA 4NJKA 5FF0A 1W54A 2VR4A 3E5PA 4JFSA 2XISA 2DVTA 4B3KA 4XZ9A 4GBDA 3TIMA 1TX2A 3DI0A 1E9YB 3OVGA 2V0TA 2A7NA 1SW3A 1GW1A 1XLBA 5LA1A 1TPWA 4ML4A 3AHZA 2GPTA 5XIMA 2OWCA 1GW9A 3MUZ1 3C86A 3WH7A 3NPVA 2IW0A 4HNLA 5BXSA 1X8CA 3LHYA 3WBWA 1QNRA 1PWMA 3WDIA 2J4GA 2CFFA 2O9PA 6TIMA 3GQYA 1UKSA 3KL5A 2ZUMA 4NL1A 2HK1A 1PCKA 5B7ZA 2GFTA 3KTXA 3WL1A 1R3SA 1VBGA 4KWUA 1W3HA 4KS0A 3OVQA 2G0WA 4Q8VA 3T55A 3N18A 4C5YA 2HPIA 4F40A 2XFRA 1ZJAA 3BLFA 1GT8A 1I8JA 3IANA 3DXIA 3BLLA 3QFEA 1ZCCA 1XLJA 2GQ8A 4HA1A 1TR9A 4MY8A 1WYIA 3D3AA 3GKFA 2GOKA 1SFSA 3GC4A 2HBVA 2YZRA 1B9BA 1BYAA 4RE4A 2VFGA 1IZKA 4NF7A 5FJOA 3ARQA 2GGIA 1ZBVA 1E0TA 2C0HA 3NQFA 3DYPA 4MG4A 4RZ4A 2F2KA 2C91A 3K8MA 3VD4A 3CLWA 5FD0A 4YN5A 1WZAA 4JNMA 1NAL1 5HUOA 3S1GA 5LGZA 3EGJA 4OKDA 5FEWA 1O1ZA 3TOYA 2RDWA 4GJ1A 3DHDA 2VZOA 3NZPA 3PZTA 4CCZA 2GUUA 1E3XA 1DOSA 1G1YA 3MUXA 3N25A 1ZUAX 1EO7A 3UP8A 2FGZA 4GMEA 1KD0A 4LCRA 4WKHA 3OGVA 1DPMA 3DZ1A 3CC1A 7A3HA 3E02A 2OGJA 2PDPA 3RF9A 1UQZA 1OY0A 3S47A 2FB2A 3KZPA 3GTNA 3ZVHB 1AVAA 1W5PA 2JE8A 4ICCX 4NZ5A 1LBFA 3KP0A 2WKGA 4B5WA 4M8UA 3ZJKA 3HF3A 3W25A 4WRHA 3HQPA 4AXNA 1HTIA 1RY0A 3AXXA 3O63A 2NVAA 4JIIX 4XZMX 3TC6A 4FOUA 4ROPA 3SM0A 4LFYA 1DTUA 1PKNA 4PMNA 1GZJA 4XSMA 4D9PA 2PDUA 2BTMA 1WX0A 3M5XA 2OSXA 3LZ3A 1SSGA 4DBWA 2QGYA 1JI1A 4IP5A 1OVDA 1YNYA 5DY3A 4EF8A 3B9DA 3BUVA 3NZ1A 4PTNA 3LV5A 2A21A 3OU8A 1QI3A 4MB5A 5A2AA 2PAJA 4GIAA 4UFIA 4PODA 1XHGA 1PKLA 1RD5A 4JY9A 4W7VA 4KERA 1US3A 4DO5A 4BI5A 1PBGA 2VC5A 4L65A 3REQB 2YXOA 1EJWC 3MSRA 4ZEPA 5E6YA 1UWQA 1OIMA 4RDVA 1XC4A 3S9YA 3P74A 1JNDA 1E1FA 3GR4A 3LXAA 1JYVA 2XPKA 4QR6A 2PC4A 4PR4A 5KITA 2HPMA 2IPJA 4M6UA 1RLDA 1DYSA 3C52A 3LCGA 2XN1A 2ZXAA 2WVVA 5EFFA 4MHBA 4B15A 3VXGA 5FSDC 4GYKA 2C0AA 4G7EB 2FZBA 3PNZA 1QVBA 1M7XA 4KGJA 3N04A 1U5JA 2NUYA 2PDFA 3I68A 2XIJA 1A49A 2RAGA 1HZYA 4CKQA 4W89A 4UTMA 1KKRA 2CNCA 3PS7A 4NKCA 1R7OA 1RCQA 2D0HA 4KGLA 3ZLHA 3KEHA 1F2JA 2Q6ZA 5E5CA 2Q09A 4J35A 5REQB 4MLRA 1UA3A 2ZOXA 3LBOA 3WDHA 1UWRA 2X1IA 1QRQA 3EOLA 3FJ6A 1E5NA 3GNDA 4R3UA 3N34A 1Q4WA 4UFKA 4DJFC 1R30A 2EG7A 4C6PA 2VFFA 4XIAA 5A6AA 1DL3A 6REQA 3GU2A 4XX6A 3R4IA 3RHGA 3IJIA 4GXWA 4KRUA 3W88A 3GG8A 4I5UA 3RM9A 3G1XA 1XLDA 3VGEA 4H3DA 2CLPA 2Q71A 5C7HA 1JZ8A 3H2EA 4B90A 1E55A 4O12A 2WW5A 3OOQA 4GUJA 5T91A 4JTDA 2QEZA 4JTTA 4GZEA 1AW2A 4FX7A 4QLKA 1FH7A 3VOJA 2NV9A 1LL7A 3RO6A 3I3DA 1UD5A 1SZRA 1Z8AA 5D9OA 3KOZA 4HK7A 1FP9A 2HMCA 4FLQA 3S9IA 3GH5A 2CU0A 3TN3A 1WDRA 1RUSA 4HYVA 1UR8A 3AYVA 1VBRA 3VNJA 2G37A 3EMCA 3H2NA 5C2GA 3M5ZA 3TYDA 1Z42A 4N4QA 1ITXA 1S5TA 2IPGA 1W2PA 4C1KA 1W9BM 2CXEA 2YBTA 2P53A 4RE3A 4CU7A 3C0QA 1L0PA 3PTQA 1TE1A 1NP2A 2ODOA 4YL2A 5D8WA 4HMCA 5BMXA 1KTBA 3EWWA 3KX6A 3FCPA 5MKGA 2CZEA 5E09A 2YB1A 2XIOA 2IS7A 2CBJA 4GY0A 3NL3A 3FJNA 3NOEA 2G3JA 5D2VA 2C7FA 3LPGA 1GTEA 5DMLA 1UR2A 2CESA 3B0XA 4GUFA 4UB9A 3WUFA 1KR0A 5AHMA 5F2GA 5BOFA 3CZGA 1LG1A 1PS9A 3NQ8A 2Q02A 4PL2A 4B5VA 1PTAA 1Z48A 1F6YA 2QDHA 4WXYA 3II1A 1ESWA 3UERA 1GGOA 1CW2A 3U7BA 4TVUA 5C5YA 4UMBA 1QI4A 1A5MC 4XBKA 1YTKA 3EBVA 2PDKA 1OCNA 3VZZA 4KFOA 3WEZA 1J5SA 3NVDA 3WEOA 3MANA 1MSSA 3RJXA 1QNSA 3VKKA 2E5CA 3SZ8A 4JFUA 4S23A 5TQLA 2OQLA 1MRQA 3PP7A 2VENA 2X1SA 2VR2A 3SY1A 5RUBA 4U31A 1FWHC 4O50A 3PVFA 4BZYA 1ZAHA 3CLMA 2HDJA 3W7MA 4EPDC 2V3FA 4NXSA 4UC5A 3A6OA 3IEBA 1LLZA 2OT0A 4DPPA 1OT2A 4GLEA 1EYWA 1KXQA 2QDGA 3FVMA 2Y89A 2VKZG 1XLMA 5CCZA 1XUZA 1JCNA 4B5SA 1VFOA 3CYVA 1RPXA 1UP2A 3W7QA 4AD0A 3MV01 4NI8A 2BDQA 4K7YA 2W63A 8RUCA 3CWHA 3FV9A 5BU9A 1G4EA 2YDAA 4GPNA 2YZ5A 3M0IA 3IAPA 4PMDA 4AY7A 3RR4A 5EU9A 3BJTA 3LA4A 4YYFA 4NSBA 3CPUA 1TX0A 3GTIA 4WEVX 4LVAA 5HNUA 5HR6A 3KL0A 3WLNA 5DMNA 3MHGA 1OC5A 1FWEC 1R0MA 1V4YA 2P1FA 4UXDA 3WEMA 2O9TA 4DPQA 2CW6A 1J6OA 4GUGA 2QQ6A 3DYOA 3DX5A 2PA6A 4UTTC 1XLIA 3WQWA 3LSBA 4N6EA 2F6KA 3FLUA 1B4KA 3MB9A 4W5ZA 1VYSX 1K1DA 5FA5A 3OBEA 4WUIA 1WDQA 4J9JA 4DELA 4RE0A 2RJGA 5GNZA 1FWDC 1K7XA 1OFPA 4D72A 4HK6A 2X7WA 1J96A 4ERIA 3W1UA 4X22A 2VTFA 2OTDA 1JDDA 4JDBA 1CB7B 3ITGA 5I5RA 1EC9A 4MADA 3LGEA 4GQGA 3R6IA 3VDHA 3VFCA 3T0AA 4HU3A 5H8MA 1XRVA 4U2ZA 8TIMA 3OTRA 3UZ5A 4IMGA 2OYKA 4RNFA 3BAJA 1YIXA 1JRBA 1VR6A 2PRMA 3WD4A 3T78A 4F4RA 4P7RA 1MW3A 4MM1A 1CXKA 1KFBA 4X60A 3A21A 3M07A 4A3YA 4O15A 4E3VA 4WD0A 2P8CA 2P76A 4LAZA 1XCFA 4R88A 4HJFA 4JIQA 4JTQA 1WXYA 4CNSA 4M3PA 3U4AA 2J77A 3ITCA 4BHYA 2XVLA 3U8GA 4FEZA 1JD7A 1H0IA 4C6FA 2VEGA 2XH2A 1WNOA 1BYDA 1ZY9A 3GLCA 1O94A 1UIOA 1YHTA 4WDUA 3IIPA 4D8ZA 2PWDA 4XB3A 1IEVA 4UTKA 2HVMA 3IJ6A 3R58A 2QXWA 1L8NA 4PFHA 5TNVA 4OZOA 2PTYA 2R1KA 1RV8A 2ZRZA 3P5YA 1XRTA 4Y8EA 1M01A 3M0ZA 3GU9A 4K39A 4W85A 3HU7A 1QI0A 1I2OA 5HK4A 4O1CA 2OQYA 3KLKA 4PC8A 3AS2A 5AB3A 2WJZA 1KV8A 3LM3A 1IEXA 2YCLB 5C70A 4GVFA 2ZE3A 3L0KA 4IFOA 1UOZA 4XAYA 2ZE0A 5C71A 4Y9NA 1F4AA 4H19A 3G8RA 2J8GA 1R3WA 1JCXA 2ZX7A 4UMAA 2VDHA 4ZQNA 2FPVA 2EPLX 3ANUA 1K6AA 1XPGA 4HZ8A 1GZ1A 4WXZA 1H7WA 2YFOA 3QY8A 2D69A 1HJXA 1DWJM 3IPWA 2J74A 3ZLGA 4GZ7A 4HU8A 4C7DA 4FO4A 5T26A 4D6JA 5HWMA 3FXYA 5D33A 4FMVA 1V6WA 5BRQA 3NDZA 1K8CA 3BMWA 2Y61A 4DXVA 1Q5MA 3GTFA 3VIGA 1FWTA 2NVCA 3RLGA 4A8NA 4M80A 1FWGC 4NASA 4NHVA 2ZXBA 4D6EA 1MO0A 3TZFA 1FHUA 1GVSA 3SCUA 3CAWA 2NQHA 3HMCA 1YKWA 2EPMX 3PJTA 3QKEA 2A0NA 4OUEA 1HKWA 1OIFA 1OX5A 1I75A 3W1PA 1R85A 2Y62A 1I2NA 2PZNA 3S46A 4E2VA 2XZ9A 1ZRQA 1WOBA 2Y8UA 3Q94A 3T2QA 3KBSA 3H4WA 4A05A 3MQTA 3BV7A 2RH9A 3TE9A 5C9RA 4HB7A 3C2FA 4DJFD 3GC5A 2QV5A 2A3EA 2QJIA 1C3FA 1I2RA 3SO7A 5E9AA 1C8VA 3MSGA 1TWSA 1XUUA 4B92A 1CLXA 3H4GA 4LCQA 4O54A 2CLIA 5G4HC 1E6NA 2V3DA 2GVJA 1KGWA 2ACQA 2FJUB 2PI6A 3H4XA 4X2RA 5EMKA 3DDMA 2OKTA 1KBJA 5D9PA 2F7FA 3MJMA 4F0MA 3T0DA 1T5AA 3RPMA 5AKQA 4MAZA 4D6IA 5JBFA 4K36A 1QXLA 3N2OA 2KAUC 4JAWA 1EB3A 3APYA 4J3SA 3PBYA 1ISVA 4EK7A 2CLEA 3SCPA 1MUWA 1W3NA 4CNOA 3WQ4A 3WBEA 2I9EA 3B97A 2R94A 3HPAA 3N4EA 4JTSA 4JOMA 3DU0A 4JL1A 1XLAA 3JVAA 1FCQA 1K03A 3UR5A 4Z2IA 1YDYA 1YPIA 2W4XA 3MTWA 1EIBA 3WLHA 3QMSA 3W53A 3VOCA 4O8AA 2DV0A 1EC7A 1VEOA 3P5ZA 3WMBA 5JXQA 2ABBA 1L6FA 5C9WA 1QTWA 2ZWZA 3NQ7A 1H1YA 2JALA 1OBAA 4QJ4B 1UUQA 4OFCA 1XV8A 4LBRA 4UIOA 3OZOA 2XH0A 1MW0A 2VDIA 1XIBA 3O0KA 3N2TA 4FI4A 4BQ2A 5TBOA 1FQ0A 4DBSA 1DVJA 3V1HA 3MVIA 4UMCA 3WKZA 3QTPA 1NIUA 2D23A 3UXDA 4AEOA 2R1NA 3MDWA 3ANYA 3N2BA 4HQVA 4HK5A 4WLCA 1OM0A 2A5HA 3UWYA 3UWEA 4MB1A 2UWFA 2OEJA 3GYCA 1ICQA 1Q6QA 4GWEA 1PTDA 2PDGA 3NQEA 3TEVA 5A8MA 4A8LA 1CDGA 1B2YA 5G1TA 1JZ7A 1E6SM 2J7DA 1GVEA 4J40A 3WZ0E 3GTXA 4E38A 3ERPA 2GK1A 3W7DA 4L5ZA 3CUHA 3WNNA 4D8LA 1WKFA 4XZHA 1E43A 1BVNP 3N9KA 4A3UA 3H54A 5EKYA 2UV8G 5M2FX 2AMXA 3RGTA 3EDKA 3GDKA 1JPHA 5REQA 3GDBA 1SYTA 1IGWA 1BVWA 1K4GA 4IOTA 3BK0A 1YLVA 3AYSA 3N15A 4QLLA 3N3TA 4UFJA 3F4CA 3EWCA 3BLPX 4ADSA 3VOHA 2WMIB 2Y85A 1B31A 3K5XA 2GVYA 3ABRA 2VNCA 3BCDA 4LANA 4OBTA 1XYZA 1J8VA 1I45A 2GJXB 1E70M 3IK4A 5EA9A 5I78A 3RUBL 3F2BA 5BNKA 2D0FA 1D8CA 4GNVA 4NT0A 4HHPA 2Y8VA 4ATLA 4DHGA 5D2YA 4WGHA 2IMRA 3O8AA 4YWSA 3OA5A 1CPUA 3CO4A 1AW5A 4PUUA 1UD8A 1IEIA 3FHQA 3AIWA 2CLKA 4MWAC 3VNLA 2ONEA 3E0LA 4CQCA 3RPDA 3PC0A 4JTRA 3W7OA 1PXGA 3HPFA 4WHBA 4H2CA 3UZXA 3A12A 2NQJA 4XKYB 5I3HA 2G4FA 3NOYA 3UXLA 2P3ZA 1A5SA 1T0OA 3PPCA 1T6MA 9XIMA 1RJQA 3W9ZA 2E6YA 4A3QA 2C19A 3UW6A 5E0FA 1RBAA 2CBUA 1LOQA 2INFA 2WQDA 1AUSL 5TIMA 4MFEA 2OO0A 1QATA 2WHKA 3URQA 4KFNA 4KWWA 4ERGA 1R2SA 3WMCA 1JUBA 1LQ0A 3SCOA 2YDQA 3VK5A 1SR9A 2Z27A 1UZHA 5FAGA 1S46A 5CJMA 1GONA 1UC5A 3OO2A 3USBA 5JVLA 1XFCA 3KLLA 3BLOA 4LV4A 1T96A 3S1WA 4GH3A 4LGXA 1RBOB 4O19A 2Z1XA 1RD6A 1HO1A 4IP4A 3D46A 3NYDA 4AZHA 4L56A 3SCQA 4Z0SA 5LGXA 2QF7A 3CHFA 2OSWA 1G67A 3GNNA 3L4UA 4H01A 4B5UA 3L5AA 3H2MA 3GR7A 3A64A 2V2HA 5CZSA 5K3VA 1MRAA 5CSRA 1XSKA 2AL2A 2B81A 3KAOA 3GBDA 4PCNA 4A21A 3HIJA 4JCLA 3BQ5A 1JAKA 1WCGA 3U5YA 3W6MA 3O7UA 3LHUA 1EFZA 5M5DA 3GXPA 4YYCA 4IJCA 3WFZA 3VD5A 4P7QA 4NZ4A 4GVHA 4URIA 5HPOA 4K3ZA 1YPXA 3HJEA 1SR0A 5AZ1A 4DLFA 2X2GA 1O5RA 1P0DA 2DQXA 3WFLA 1QO2A 1YW1A 1DQWA 4P5UA 5CPNA 2PDQA 2XHYA 4FLRA 2C6QA 1E5JA 4QE1A 3AXMA 4HZMA 4KT2A 3KVMA 4BFAA 3PSVA 2DT2A 4ADTA 3LTYA 3TYBA 3EKGA 4OWGA 4LVGA 5AOUA 1EC8A 3UA4A 3ITVA 5A6LA 2ZDRA 4JEQA 3STCA 4MWAB 4F2UA 4Z2KA 3GY1A 4J27A 3W2UA 2ZX9A 1TTQA 3TYCA 4IMFA 4G7FA 1ISZA 1UH4A 2VD9A 4B5NA 3WDRA 1TV4A 1ISWA 1P0KA 5EB8A 5FIPA 1EXBA 4I9MA 2A3HA 3RM8A 1Y0EA 4Q4PA 1X6LA 4KBXA 1SMAA 2DEPA 3L65A 3W2LA 3VGHA 4M19A 2QCFA 3SRKA 1M7PA 2FZMA 1FCUA 2DSWA 4IPJA 3A4WA 3HTWA 2QCCA 3C0LA 4QSFA 1KXHA 3CZJA 3LZ5A 1JUEA 3SJNA 4QJ1A 3K1GA 1E73M 2CLHA 3PAOA 4HPJA 1OFQA 3LI0A 3LHTA 1XYLA 4EPKA 4DWSB 1GUVA 3HV9A 3M44A 1E6RA 2F6UA 2O92A 4C6MA 1F07A 3CZKA 4J3WA 1OGBA 1YDNA 3BJSA 2WMKA 4I5XA 3ISIX 3W7KA 5I3FA 1XG4A 1V6TA 3CUZA 4HTBA 2HWGA 3TOPA 7ODCA 4QSHA 4IUGA 3H7UA 1M65A 3L4VA 5CSUA 5HJLA 2PLMA 4HA0A 4UOJA 2GQ9A 1TTPA 1M03A 1JG9A 1TQJA 4UCFA 1DJHA 2YA1A 3I4EA 3ZVIA 2P10A 3QN3A 3DGBA 4G7EA 1B3VA 3FJLA 4RZBA 5IXEA 4MB4A 1IXOA 2ISFA 3LGGA 5CPTA 1VFTA 3QLLA 1PZ1A 3KXQA 3WK2A 5LA2A 4C1NB 4JIPA 3VNZA 2FIQA 2XIIA 3EX1A 2O7QA 1CX9A 1YNPA 1SVDA 4AIEA 3LI1A 5CLTA 4O4WA 3HO8A 2R8WA 3BWWA 1JRCA 3LX9A 5A6KA 1F5ZA 3S8HA 1VQTA 2VUYA 5G4EA 4O16A 3KOFA 3B4UA 5LNSA 1BKSA 2ZIDA 2G50A 3L2IA 3PF3A 3T0CA 2PFHA 2V3GA 3GIPA 2WVTA 2PDWA 5BOEA 3QR1A 3QHMA 3ITYA 3JUGA 3RLHA 4V27A 4KMQA 1UR0A 1G69A 3DERA 5GNYA 3POCA 3QSRA 3NZQA 3MCNA 3WF2A 3H2FA 3CV1A 4GQ0A 2V6AA 3P80A 3WD2A 1UKQA 1J01A 5B7YA 4AVFA 3DFTA 4RNJA 3QRHA 1XYCA 3V0SA 1U33A 3H7VA 1GVFA 4Q8QA 4N2YA 1EF3A 3KS6A 3K8LA 2D20A 1M3UA 3SB0A 3FAWA 2BODX 3MP4A 2NQZA 4XZLX 2AOSA 1U22A 3DBPA 5DBTA 5DFAA 2DPEA 3SADA 4XZNX 3MT1A 3CZ8A 1X7IA 1GPWA 3CTTA 2Q8LA 1S2TA 2QPXA 5CEWA 1VRXA 4B4HA 2QJMA 1KRCC 1F6PA 2VCCA 3STGA 1RAKA 4Q7BA 4S2CA 2IXUA 1TA3A 1W91A 3ARSA 5HQMA 3A13A 1GQLA 4D6GA 4QISA 3WF3A 1F76A 4PB4A 4U4MA 2Q3OA 4X0NA 3QC3A 5LNRA 4PSPA 2QJGA 4LAOA 4U5IA 4PMOA 4G1NA 2PC8A 3JRKA 4CQBA 1H41A 2BGQA 1XD1A 5DY2A 2E5DA 3HFYA 2ZC8A 3W28A 4DJEA 1LBMA 1XLEA 3VKJA 1GKQA 4ACZB 4DAIA 4G5DA 1B3XA 1TQXA 2GVEA 3RPTA 1VLWA 4XWUA 4XQ6A 1QUMA 1XDJA 1ADSA 1XIHA 1IIGA 4JL2A 2WKJA 1GJPA 2WSKA 3ZXWA 3TTEA 2Y1HA 1V02E 1UW9A 4TQTA 5IDZA 4ZB2A 2PF0A 1JDFA 4LVBA 3UJFA 4V1XA 3B8DA 3KRBA 3B9AA 3KCOA 3W26A 1DKWA 4R9OA 2ZZ6A 2XWEA 3AI0A 5FF3A 2RDXA 3WQVA 1DIOA 4JD4A 3BW2A 4AHPA 2ZTJA 3GXNA 5LXXA 4CNPA 2WVVB 1BG9A 2C3ZA 1RXOB 1QPRA 1EJTC 3D6NA 3QMTA 1X96A 1W1YA 3A4XA 4QX4A 2BVYA 1O60A 1SMDA 4PBEA 3VNYA 3GB6A 4W9TA 4KFPA 2YXXA 1F3TA 1M6JA 1UR3M 3L68A 2WVSA 2F8QA 2ZBTA 3I7SA 5LZLA 2FMNA 9XIAA 1YE6A 4MWAE 4KWSA 3ZSSA 3KTSA 4JTCA 1I0DA 3VINA 4ZSTA 4ZO9A 3AIQA 1XBXA 2Q8ZA 3TMLA 1OGSA 4FSAA 2XTKA 2R82A 3BURA 2IQDA 4XG1A 3BG5A 5FCZA 1XWYA 1IWBA 3VD3A 3TONA 3A23A 4ZO8A 4G2DA 1EP2A 1LT8A 1I1XA 4PMVA 3VZXA 4CVWA 3R7MA 1EQPA 2VWSA 2V2DA 1H7OA 3Q45A 3WLLA 4HNUA 4FXFA 1TVNA 3L5LA 1CGTA 2VP8A 1TMHA 3NQ6A 2J9YA 5F7UA 1LL6A 4BR1A 1XI3A 3OBAA 2PEVA 2FTPA 1JYXA 3T42A 4NNCA 4F2TA 4H9UA 3WNOA 5CC6A 4MUZA 3QEZA 1NTHA 2FMOA 1ADOA 3MZNA 1EJXC 1UWAA 5U4NA 5I09A 2BOEX 1LDCA 4PYSA 4QJ3B 5A94A 2QCNA 5HQEA 4HA4A 5LSMA 4C65A 2J24A 1C93A 1EOKA 4GUIA 4QG9A 5CGMA 1OCJA 3OHMB 4FNSA 2OGYA 1CT5A 4OE7A 3SW6A 2GUYA 4FALA 4LRSA 1EX5A 1AJ0A 1CCWB 3ARPA 1W56A 1RHCA 2VL4A 3BQ6A 3PWGA 1TO3A 2QKFA 1VD6A 1PZ3A 8XIMA 5T9CE 5A6BD 1YRRA 3I6TA 4DYJA 2FH6A 5JQ9A 3W86A 1K3UA 3GE7A 1NU5A 1Q7MA 1P43A 4M7TA 2EAWA 4YMZA 1R2RA 4PULA 1HUVA 5E0CA 1XLGA 4D6HA 1C7TA 1JUKA 3G1YA 3EA2A 4LB4A 3FSTA 2J7FA 3IAQA 2P8BA 1GVOA 2RKXA 3P2VA 3RAOA 3G1RA 3VAVA 4EPEC 1RR2A 3N29A 4CD7A 3AISA 5I03A 4ZGYA 2YX0A 1UYQA 4V33A 1D7KA 1SQ7A 2DZUA 1KRBC 1NDVA 3HV8A 5AZ0A 4FAMA 2BXYA 4J2PA 1JZ6A 3T09A 1OG6A 3GXTA 4ZSUA 5CZKA 2CLOA 2J7BA 1JQVA 2Z2UA 4JKLA 4C6KA 5C7VA 3NUKA 1AH0A 4OIFA 2EG6A 1DP0A 3B4YA 1IXNA 1ZJBA 1XX1A 1O1HA 2WM0A 1PZ2A 3MKKA 7TAAA 2TMDA 3FEQA 2J7HA 5C8BB 1LQ2A 6XIAA 3TR9A 2WWDA 4RLIA 4Y8FA 4S3JA 3LCIA 4IFKB 1YE4A 3BAWA 5FJUA 3QZ6A 3EDEA 2Y70A 4CNTA 4FNTA 4CNUA 1MQPA 3CIVA 3W1QA 1AQMA 1KCZA 3NPXA 2WCGA 1RALA 3SDOA 3VOIA 1UIPA 3LMZA 4W7WA 5D02A 3T7VA 4NXKA 5AVHA 4MPQA 4ASTA 1FWSA 4HIBA 4S1FA 2JKAA 2Z25A 4HSOA 2OCZA 3VNMA 4CCCA 1A5AA 2ZUTA 3O3RA 1HT6A 3WD1A 1YTEA 3GO2A 2E28A 2H9AB 1X38A 4XISA 3LRLA 2DSUA 2E09A 3ME3A 1G5AA 2QCMA 1W1B1 4H4IA 1AFSA 2OWXA 5IOBA 1TE6A 4QRNA 1XICA 4LT9A 3LLXA 1CYGA 3WJWA 1W17A 3HPSA 4FLOA 4U10A 4TX9A 5BOOA 2W0UA 3W81A 3OLDA 3T0TA 3ARRA 3IV8A 4IMEA 5AHEA 5EFDA 4B4FA 4DJDD 3R79A 3SCRA 3WNLA 2ISWA 1EWDA 2HISA 4GBUA 3SUWA 4ZB5A 1KA9F 4S39A 2ALRA 3MMUA 3N6QA 3WSUA 5G4WA 3HPZA 2QJHA 4ZQPA 4YVVA 2HE8A 3K13A 1EGMA 1GTHA 4W7UA 1W3IA 5IM51 3VKBA 4LNYA 4DWSC 1XIDA 3S2MA 1V03A 3KRSA 3L5MA 4HJWA 3KM8A 3R10A 3M0JA 5H6HA 3S6DA 2BXZA 1OYCA 3OJGA 3TTQA 3T9PA 2OOGA 1W6TA 1OSEA 3H2OA 4QITA 2DVUA 3H23A 1ZPTA 7XIMA 1BFNA 4MY1A 1EEPA 5CAKA 3N4AA 1RQBA 3NSXA 4JTAA 4AZIA 2HEJA 3T4CA 4EWJA 5BROA 2EPKX 4KCTA 1S39A 4WOQA 5I23A 1EKOA 1RP9A 3W2MA 3ZOAA 1Q6GA 4J7RA 2AGKA 5ABTA 2GJNA 1HNYA 4QGCA 2L5HA 4L4LA 3HGRA 3M47A 2CPUA 5BXPA 1PYFA 3WJYA 4ZQRA 2D2JA 3T4WA 4UTTA 3BG9A 4IIDA 2GOUA 3ZIZA 2XM2A 1XJBA 5XINA 3TC7A 1Q6FA 1HVQA 4DZAA 5D2WA 4GJJA 1V77A 2V82A 3QPZA 3T08A 4YWIA 3E74A 3VIKA 3MVTA 3TUUA 2O55A 4NUWA 1XFBA 3NAVA 2BHZA 4LS1A 3HPXA 1HQTA 1ME8A 1XLHA 1HKIA 3WQ5A 3AS0A 1C29A 2E67A 3M0LA 1E9IA 1IWPA 4YTSA 3ZJ7A 1WXJA 1NWSA 3NO3A 3H6OA 2Z24A 3C8NA 1BXCA 1KM6A 5C2XA 1UWUA 1GCYA 4O13A 2OXNA 5M3WA 4R7WA 4N0RA 1YBQA 3NQGA 3OIXA 4HZ6A 1VAHA 3MKVA 1P6BA 4MJMA 4WIWA 1EX1A 1G9HA 4I90A 4XO7A 1A53A 1M68A 1UD6A 4H1ZA 4AZCA 7ENLA 3GH7A 3TLLA 2GWNA 8CGTA 1NDYA 3G0SA 1VC4A 4AIUA 4XK2A 2O4MA 4LH8A 1LROA 4WCJA 1J0HA 4KRTA 5LIYX 1KNWA 3FDGA 1FXPA 3VZYA 1JEZA 1QWGA 5FF7A 1ZP3A 1XIFA 2ISDA 5FF2A 3TN4A 4BWLC 3PG9A 4IM4A 2QIIA 3LXBA 1XH2A 3PPGA 3REQA 3LCLA 5DQPA 5CAHA 3L9CA 2VVSA 5HUPA 4F66A 3QVQA 1AQFA 5D30A 1S38A 5I0DA 1XIMA 1TIWA 4BQ3A 2V5DA 3VPLA 3A9IA 4IGSA 4YHGA 1PPIA 3ARYA 4Z1CA 1RA5A 2TAAA 1Q6LA 3FYYA 2WZIA 2G3MA 5M03A 1A5UA 1OFRA 4L4MA 4JKMA 4L9XA 1XPYA 5C9ZA 3VE9A 4I3GA 3D47A 5CPOA 1QT1A 1VGAA 3C2EA 1HF6A 3GFXA 1QNQA 1OGGA 3OVPA 3SGZA 4OECA 1I2QA 3WYZA 2VUNA 1OCBA 3LD5A 2NT0A 5HJYA 1IXQA 2PURA 1RK5A 3N2CA 3WLJA 2O9OA 4CQDA 2A7PA 4JIRA 3G1VA 2X40A 1V3LA 1DWGM 2VFDA 5CZ0A 4L6HA 4HD5A 1UWSA 2B31A 4H00A 3MDUA 3R5EA 4UTFA 4MLJA 1E15A 4IWWA 4GGHA 4JN8A 4FP1A 2QLYA 2QCGA 3U7VA 4IQLA 3UG3A 4RXFA 1BD0A 3S0CA 5BW6A 3CHEA 1UJQA 1Z3NA 3BGAA 2QV4A 3PBGA 5HBFA 2EG8A 3PN8A 4HVXA 3KWSA 1DXFA 2A4AA 3LS9A 5I77A 3TLQA 4J3VA 5EYWA 3UNTA 4MSSA 3C2RA 5D9NA 1BGGA 4K8EA 5D8ZA 5A8OA 4CD6A 3OGSA 1KBIA 3B0PA 3TC3A 3TQKA 4JS3A 1LCOA 2BP1A 1FWRA 3QGAC 2ZUVA 3P14A 1FKWA 1QHZA 2OODA 3TAKA 1N8FA 3M0YA 1US0A 1B4EA 3W22A 4XIMA 4I5RA 3KOXA 1J0KA 2PDBA 1EDTA 4B16A 1BXBA 4HSNA 3PZUA 2FTYA 5H8UA 1GQKA 1C7SA 5BU6A 1K8YA 3RX4A 3TP4A 3WMLA 3V16A 3E2QA 1TPFA 2Z7KA 3W02A 1WKYA 2XIMA 4PUKA 1XBYA 3AXKA 3EXTA 5CLWA 2Y7GA 1SU5A 1FH9A 3MSDA 1J0JA 4Q3MA 3NM1A 1Q6DA 4KWOA 3ZS4A 4OOUA 2XGBA 4UQDA 2HROA 1US2A 1XP3A 2WMIA 4QCEA 2PTWA 4JKKA 1Q8AA 2HXTA 4ZOEA 5HNRA 4KIEA 2XWDA 4IG2B 3G5EA 4AY1A 4MKVA 1PZ0A 4H9YA 2P3EA 2D2HA 3OB8A 2H8ZA 4O52A 3VMOA 1IEWA 2QYGA 3EWZA 5CSYA 4H6QA 4HGXA 2BMBA 4LVDA 4B3ZA 1IEQA 4PA8A 1EPVA 5A2CA 4B2DA 3V7PA 1KM2A 1Q3NA 1VJSA 3SN1A 3MY9A 4MNJA 2GGGA 3UPMA 3KWXA 3TV8A 1M7JA 4MNKA 3SCTA 1ITUA 3IIXA 5EBUA 1X8FA 4RNHA 1L2UA 2IKJA 4NX5A 1XKJA 1UKTA 4IT1A 2Y5EA 3W85A 3B8UA 3GXMA 3VMPA 5FSEC 4O0QA 3AROA 4D6DA 3ARWA 4MGGA 3GVVA 1EUNA 2ZZ4A 1LLOA 5JBDA 3WNMA 3FA4A 1PYMA 4G6CA 1CXHA 3V5OA 3W7GA 4UUIA 4Y7EA 3DC8A 1KFEA 1V8EA 5GVJA 1Z7AA 1AODA 3WUEA 4FA3A 1KR1A 4MWAD 4GCXA 1PSCA 4NZFA 3M0KA 3OA3A 1HKMA 5MHBA 4HPHA 3V5FA 1SO6A 1AH3A 4K2SA 1FY6A 4AYSA 3C61A 4C6CA 2JBMA 1H1NA 4Q4SA 3T2OA 2ZFAA 1DORA 5AHNA 4QIUA 4S3GA 2C1IA 1AZ2A 4J3ZA 4GKLA 4F79A 1K9DA 4R85A 5HATA 1DIEA 4HOWA 1RCOB 4WX2A 3PFMA 3QHOA 1JVNA 2W67A 3WBAA 3VKAA 3FOKA 1XGDA 2C71A 3WF4A 1I6NA 1NOWA 1FWBC 2E6DA 1MEHA 1W9XA 2OYLA 4UNKA 1HJWA 4RV3A 1H5VA 1QOPA 4M6PA 4LC6A 3C2VA 2Z26A 4PTVA 1N55A 3W1AA 3HQOA 1XSIA 4EIVA 2R9RA 1S5MA 3EKZA 1PX3A 3AIVA 2HE5A 3CTLA 4KEUA 2FZNA 5U7SA 3T05A 2ATSA 3IVSA 4R34A 1E4LA 2VX7A 1UR1A 1IXPA 3WQGA 4WK9A 3IGHX 1RZMA 1XDMA 2R24A 2ACUA 1RSCA 4XAZA 3EDFA 4PCFA 3W6LA 4QS6A 2WQPA 4AZBA 4D6FA 3CQHA 3BZGA 4DB7A 2X41A 2OZ8A 4JYFA 1DXIA 1H51A 5K9DA 2RGLA 4WY0B 5JIPA 2UY4A 2WAGA 3BJFA 2VQTA 3W73A 4OUIA 4LUYA 1GVIA 4LYRA 1S3HA 5ENLA 4L80A 4GGBA 5LHEA 2HS6A 4WVXA 4DBUA 3VC5A 3PUOA 2DUAA 2ZXDA 2DJXA 3AHYA 1QI2A 2G3NA