2VC6A

Structure of mosa from s. meliloti with pyruvate bound
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
292
structure length
291
Chain Sequence
b'MFEGSITALVTPFADDRIDEVALHDLVEWQIEEGSFGLVPCGTTGESPTLSKSEHEQVVEITIKTANGRVPVIAGAGSNSTAEAIAFVRHAQNAGADGVLIVSPYYNKPTQEGIYQHFKAIDAASTIPIIVYNIPGRSAIEIHVETLARIFEDCPNVKGVDATGNLLRPSLERMACGEDFNLLTGEDGTALGYMAHGGHGCISVTANVAPALCADFQQACLNGDFAAALKLQDRLMPLHRALFLETNPAGAKYALQRLGRMRGDLRLPLVTISPSFQEEIDDAMRHAGILL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIHYDRODIPICOLINATE SYNTHASE
publication title Structural, functional and calorimetric investigation of MosA, a dihydrodipicolinate synthase from Sinorhizobium meliloti l5-30, does not support involvement in rhizopine biosynthesis.
pubmed doi rcsb
source organism Sinorhizobium meliloti
molecule tags Lyase
total genus 105
structure length 291
sequence length 292
chains with identical sequence B
ec nomenclature ec 4.3.3.7: 4-hydroxy-tetrahydrodipicolinate synthase.
pdb deposition date 2007-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2vc6A00
3UY7A 1GTEA 3PB0A 3S1UA 2ATSA 5FESA 3STEA 3EWWA 4NJIA 3SSJA 1R47A 3NQEA 3C61A 3NAVA 1T0OA 4MZ1A 2ISSA 4O0ZA 1P1XA 4P2VA 3T7VA 3VE9A 1JQVA 2WPBA 4N2YA 1SSGA 4M19A 3NEVA 3DFTA 2CWNA 3EEGA 1VLIA 2B0MA 5J5RA 1KV5A 1QO2A 4K8HA 4MY9A 1OFDA 3MHUA 3W86A 4LW7A 2JKPA 3QF0A 2NUWA 4XTDA 3STCA 4YCPA 4O0KA 4HKPA 4BI7A 1ADOA 2WO5A 4MYAA 3STGA 2XN2A 4ADSA 3P80A 3W7JA 1T96A 4LT9A 4UTKA 4FHAA 3S5NA 1QNVA 1YTEA 4LTSA 5C6MA 3UZJA 1I2OA 5K4ZA 2DP3A 1KTCA 4KFOA 1FBAA 4MFEA 2B7OA 3CIWA 1K3UA 4A3UA 3W7LA 3LHZA 2ZA3A 6TIMA 3BGJA 1QDSA 5KTLA 4NX0A 2QKFA 3NL2A 5EL1A 2EGZA 2X30A 1VPXA 1W5NA 4CQAA 3PUDA 1G4TA 1KFLA 2TSYA 3TW6A 5TIMA 1H1ZA 1THFD 2CU0A 1FWRA 4MFDA 5DCEA 3ZFHA 1DJNA 4HNTA 3P5ZA 2BWGA 1X8FA 2GOUA 3NA8A 2TMDA 2C15A 3I65A 3M7WA 3NQ7A 5D2VA 1XCFA 3LM7A 5HUOA 3BG3A 1F7BA 3EX6A 4O1BA 4UFIA 1DVJA 5FI8A 2FB2A 2A7PA 4TIMA 2A6NA 2JKAA 4ZMGA 3SIZA 3M1ZA 4PL1A 1SW7A 3W2LA 3W1NA 3G1YA 3HMJG 3UWUA 2ZZ2A 3BPWA 1W5MA 5I3GA 1JRCA 5CKSA 1K7FA 1S5TA 3UXAA 1W1ZA 5K9DA 1LRQA 3C2EA 1TPB1 3EWBX 2RKXA 8TIMA 3NL5A 1WBJA 3NPXA 2FIQA 4WZHA 2Y70A 4WUIA 3STFA 2P1FA 1WV2A 3HIJA 4I7UA 5AHNA 1AW2A 1QFEA 2J9XA 3F4NA 1DHPA 1QPNA 4CCCA 1HFBA 3RLVA 4HHPA 4AVFA 2GJNA 1HG3A 1U5JA 3ELFA 3GXPA 5F2LA 5L9FA 4IWWA 4O13A 4LUJA 4I7WA 1XBZA 3L5MA 2YFOA 3CLMA 3P62A 5CZTA 2ZYFA 3TSBA 1KFKA 2R94A 1KM3A 4UFJA 4ICNA 2CZ5A 4IPIA 4IMCA 4ZVJA 3SI9A 3TUUA 4FX8A 3NQMA 3S1XA 2BSLA 1K02A 3CHVA 3B0UX 1EP2A 1OG0A 3FYPA 2VEKA 3TNOA 5DCBA 1TMHA 3W7KA 4S2CA 4JTTA 3LV5A 1TSIA 1TREA 1RVGA 2QUUA 1NFBA 1QWGA 2Y7EA 4R53A 3W71A 4FEZA 4CQ8A 1VCVA 3LBCA 5G1TA 4FB7A 3MP5A 2J6XA 3ZWTA 1W3NA 3OA3A 3QC3A 5EPDA 1FWWA 4M7SA 1XM3A 3MBDA 3P8JA 2ZCGA 4YXGA 2VC6A 3M0ZA 2E6YA 3LCFA 4GUIA 4ZQRA 3UNDA 1H62A 5FEZA 2BLEA 2GJLA 1W3TA 4FX7A 1KM5A 3PG9A 4IGHA 4NNBA 5HWNA 2ZZ1A 1GT8A 2FQIA 3EKZA 5AYYA 3W7EA 1Q45A 1TYGA 1UBSA 2NX9A 4S2BA 5D09A 4JTJA 2C3ZA 5CZJA 4JYEA 1GG0A 4NUWA 4ZQCA 2GQAA 2ZRVA 4WOQA 2W6RA 3NGJA 4FIQA 1PL9A 4TO8A 4G1KA 2V9DA 1P5BA 4K6AA 3CPRA 1IIGA 4OU1A 3GAKA 3OVQA 3W70A 4CQ9A 5DXXA 1PIIA 1VRDA 1OFOA 1DOSA 5EMUA 3LXCA 5CPOA 3VE7A 1JCLA 2JGQA 3G1AA 2C13A 3S8HA 3HG2A 3HPZA 5FF3A 1YDNA 2BTMA 1QAPA 1IIHA 5K7JA 5CPNA 1MXSA 3PS7A 1SZGA 2X1RA 3B03A 5DXYA 2ISVA 5D32A 3EWZA 3L68A 3DKJA 2FFCA 4IUOA 5CSSA 2NUXA 3GVGA 1HO4A 1L2UA 1JCMP 3G0XA 4N9EA 1LP6A 3C2FA 1AL8A 3W1UA 2QCNA 4GFSA 3BG5A 1JUBA 3E02A 4DF1A 5D05A 1D3HA 3W74A 3QYQA 3LTSA 1MEIA 5AN7A 4GC4A 3AO0A 4WY0F 1VC4A 4JYFA 4O4WA 5KITA 5F2MA 3KVMA 2B7QA 5G1YA 1LOSA 1VS1A 4MJMA 1ZJIA 3NM1A 4LU0A 1J2WA 3B0PA 3W1XA 3TQVA 4ZQOA 4PCFA 1VCGA 3CB8A 3NO5A 2AQWA 1PS9A 2NV2A 4GUJA 4UTHA 3PUEA 3NYZA 1KLYA 3HOJA 4OHQA 3HO8A 4XKYB 5K4XA 5AC6A 4Z1AA 1DQWA 1YPIA 4R34A 3TFCA 3UPBA 4ZZ9A 4IMFA 4NZJA 1OX4B 3MWAA 3NDOA 3TMQA 5HUPA 5I3IA 5F4WA 3BLEA 3KRSA 1D3GA 3FA5A 4BK9A 3R8RA 3ABQA 4WQ6A 2E1DA 4AEOA 3W2NA 3O6DA 1UUMA 4ORIA 4OV9A 5LHEA 4O10A 2NWSA 4MPQA 4UTIA 4FNUA 4A21A 1VGAA 4LVAA 1GVFA 2OJPA 2YSWA 4NVTA 4S1FA 5CGQA 2OT1A 4WX2A 1WOAA 2Z6IA 1YYAA 4JDBA 4N6FA 4K7YA 3E9AA 4GJ1A 3CU2A 2Q8LA 5D02A 1R46A 4E2DA 1ZY9A 1YDOA 1A50A 1BKSA 4IXHA 3WK2A 3MP4A 1XBXA 4DO4A 3BK0A 3M5VA 3OEXA 4JY9A 2J27A 4H3DA 2ZRYA 1LROA 1YXCA 2NLIA 2FPYA 1GJPA 3M43A 5AC8A 3A24A 2ZA1A 1G67A 1CX9A 2TYSA 2YXGA 2E6DA 2QF7A 3DBPA 3SGUA 5K3VA 1VCFA 1OJXA 3TV8A 5AHIA 4NJJA 2R8WA 4XWUA 2G5WA 4ALDA 2E6FA 2QUTA 3TC7A 3MBFA 2NX3A 3QRHA 4QITA 2UV8G 1ZCOA 3HPSA 3Q94A 3SW6A 3Q2DA 4C1KA 2V82A 2PCQA 1DBTA 1A5SA 3E96A 1QOPA 3O1NA 1Q6OA 3PUOA 3VFLA 1R2RA 3B04A 5K9XA 3HGOA 1JCNA 5CSRA 2Y6ZA 2AAMA 3E12A 2V2HA 3BGGA 1YXDA 1X1OA 3LHVA 4ORMA 3M6YA 1EUNA 3I7SA 1GYLA 1WDWA 3G0UA 2DZUA 1LBLA 4MOZA 1ALDA 1HO1A 2CLHA 2A7RA 2QJGA 4GE8A 3H55A 3OIXA 4DF0A 1WXJA 1H7RA 1OYAA 3GDMA 3UXDA 4EIVA 2E77A 3OVRA 3SFKA 4BI5A 1TJRA 4Y6GA 1V5XA 4K36A 5KMYA 3NQFA 3TXZA 2GVGA 2YPIA 4AF0B 1WYIA 1QPOA 2JGYA 2IQTA 4LRTA 4MY8A 4PTNA 1SW3A 5LNWA 2V8ZA 4Z0SA 1F6KA 1I2RA 3PG8A 5A8GA 5FF4A 3DENA 2EHHA 3A22A 3LB0A 2A0NA 4NNCA 3W1QA 1SFJA 3L9CA 2ZRXA 1SQ7A 4R7JA 2CZEA 1QR7A 4E0CA 3IEBA 2XN0A 3BW2A 5IBXC 3GKFA 3B06A 3JRKA 2GQ8A 4UCGA 3R89A 1KFEA 1P0NA 7TIMA 4PEKA 1K8XA 2PE4A 3DFPA 4A2SA 1D9EA 3NZ1A 1PHWA 3QJAA 1K8ZA 1W0MA 3RU6A 3RMJA 4XUGA 3MHGA 3GDTA 1X7FA 1QO5A 1U83A 2E5DA 2C14A 3DH7A 4LVDA 4DF2A 1F74A 1AL7A 1G6CA 2QCDB 4N6EA 3CIXA 2ZFAA 2E6AA 4LC8A 1FX6A 3QM3A 4Y96A 1SFLA 1P0KA 4IPJA 1OFEA 2QCFA 4X3ZA 5LNSA 1F6PA 2ABAA 3W2JA 2QCMA 3GDKA 3NVTA 3QMTA 3P5YA 3M5YA 4XTIA 3MMTA 4O1DA 1O4UA 3LTYA 1TPC1 2PRMA 4YMZA 4AHPA 2WNNA 3TMLA 1DORA 4UFMA 2DORA 1AW5A 3N9RA 1IF2A 5CPMA 1OX5A 2DZTA 3LCWA 4RV8A 3G8RA 3PULA 2E5BA 2E09A 2GVJA 1I2NA 4TMCA 5C2XA 2X2GA 4JX5A 3ATZA 3W9ZA 2ZZ3A 4Z1DA 3THAA 3C4UA 4DQWA 4M6VA 4AXKA 3RNDA 1A5AA 5AFDA 4ML9A 1CW2A 4GUHA 5D03A 4HNUA 1XUUA 3DHDA 3LCGA 3P7YA 2Z6JA 1FWSA 1BWLA 3TFXA 3LHUA 3UWYA 3W7MA 1OFAA 3N19B 3RK8A 1DV7A 2NZLA 3LI1A 3G1DA 5FEWA 1JCYA 1O94A 1B57A 2FB3A 3NQCA 1PVNA 3LHWA 3N9SA 2ZRWA 1GZGA 3FS2A 3JR2A 2C19A 5D30A 1C8VA 1LRNA 2XN1A 1JVNA 3L0GA 3GDLA 5D2XA 2WOQA 5HMSA 2RFGA 3ZS4A 1GEQA 1OFPA 5F2IA 3S5YA 3SY5A 1LBFA 2A2IA 1FDJA 2DU2A 2QUVA 1O60A 4KKXA 4O53A 4Y9AA 3C3NA 3T44A 4JX6A 5C55A 4O52A 4LNYA 3PBUA 1H7XA 2KZHA 3UQNA 3G24A 5IM51 2AGKA 3FKRA 4DBDA 1N55A 4X9SA 3TH6A 1FUYA 1YXYA 1RQBA 2VKZG 1B3OA 1DJQA 3B0VC 2ZBTA 3MI3A 1KLZA 2LLEA 3L0KA 1TPFA 2CLEA 1GVQA 3W7CA 4U4MA 4YLWA 4LUIA 4MLRA 5G4EA 2H3BA 3TW7A 5DY3A 4UMCA 1JR1A 4OE7A 4OV4A 1KM1A 4LC6A 4UTJA 4IJBA 4UNLA 1JULA 1SUXA 3GLCA 1ML1A 3FIGA 3MP3A 3ZWSA 2CLLA 1KFJA 3AJXA 2X1TA 3T4CA 3I6RA 3B4UA 3KOFA 1UB3A 1HL2A 4O50A 3WJWA 5D33A 2W79A 3RFAA 1TPWA 3TROA 3W7RA 3S1WA 1UUOA 3EXRA 1H63A 1SW0A 4BWLC 4FXSA 4DELA 1S5WA 2ALDA 4W9TA 3G1XA 2ZZ5A 5AYXA 3IRDA 3NQDA 2GPTA 1H7NA 5F4XA 3BARA 3IGXA 5HJLA 3U2OA 4C1LA 2H90A 3LCHA 5LGXA 2CLKA 3WK3A 5HINA 3MI2A 5K2ZA 1G69A 3RLUA 3C56A 1ME7A 1JQXA 3W7PA 1OK6A 3FJ6A 1L6WA 1LBMA 4IOTA 4HT3A 1QOQA 1VH7A 5IBXA 4D2JA 5C54A 3HGSA 2DZXA 4JDYA 4JTHA 5AOUA 1F05A 3W85A 1SO6A 3TK7A 3W22A 1FQ0A 1QPQA 1ZFJA 2BXVA 4YWIA 3FEMA 5EKYA 3SZ8A 5KZEA 1TPUA 1Z42A 2V5BA 4WJEA 4MLJA 3FKKA 1L9WA 3L2IA 2YFNA 3W7IA 2DJXA 4WXZA 4JTLA 4QIUA 2V5LA 1TPH1 5LKYA 3TU9A 3SJ3A 4Z1BA 3N2XA 3DKLA 4M6QA 3G22A 3CTLA 3S9YA 1F76A 1WA3A 4CCDA 5E93A 3EWYA 4O1AA 5L6UA 1FCVA 2ZQ0A 4O19A 3PBYA 1JUKA 1LM1A 1W5PA 2C18A 2A5HA 1YPFA 3GXTA 5HR6A 4RX0A 3W7QA 4AAJA 3QW4B 2CLIA 1LOQA 4WY0A 4I7VA 2ZRZA 2A21A 4ZL1A 3R2GA 5DLCA 4CCEA 3LCLA 4MIMA 3VKJA 1DL3A 3GK0A 1YTKA 5EA9A 3NQVA 1TQJA 4A2RA 1TRDA 2PRHA 2X16A 4O15A 1GWJA 2V30A 5LNVA 3C2OA 3U8GA 4AWSA 3TQ0A 3OVPA 1TO3A 5LSMA 3YPIA 1XFBA 4HN4A 1XDLA 1MSSA 3KFTA 3G1HA 5K9CA 4UUIA 2HS8A 1EUAA 3LGEA 1FXPA 2QAFA 3R13A 5EBUA 2V2CA 1DKWA 4JEQA 4JTEA 3V1PA 1B4KA 2ZRUA 1OVDA 3PC0A 4BR1A 1XDMA 1QCWA 1DQXA 3O07A 4LS0A 4HIBA 3NG3A 4FXRA 2YDAA 1GVSA 3IV3A 1OYBA 4JGDA 4EWND 2V2DA 4NX5A 3NQ8A 3LLDA 4JN6A 1H7PA 1EWEA 5G4WA 3PBVA 5E1QA 2E5CA 1TIMA 3W73A 3MO7A 1C9DA 3UWVA 3INPA 4PA8A 3G3DA 1K7XA 1UJPA 1RV8A 3P8IA 1VZWA 1LDCA 2H8XA 4Q4KA 2RDUA 1M6JA 2PRLA 2RHGA 5DCDA 1VYPX 1EPXA 2QCEA 3DFOA 4O17A 3W1LA 4DO6A 3LTPA 2R91A 4UMBA 5G2IA 1TPEA 1XXXA 2A1YA 3M5ZA 2YYTA 4O54A 4QSHA 4YCOA 3LDVA 5A5WA 1TQXA 3KVKA 3TSDA 2DZPA 1TV5A 4BWLA 4UR8A 4LVFA 4AB4A 4HPJA 2I1OA 3G1FA 3NR0A 1GTHA 2G97A 1SR9A 1G4PA 3W2MA 3M41A 3TX9A 2FJKA 5I3HA 2O7SA 4R33A 1O5XA 1F5ZA 3HG3A 5AHLA 2YW3A 2I14A 5G5IA 2BZNA 1EP3A 4MZYA 2NXGA 5GVJA 3WJYA 3ABOA 4X22A 2ISWA 3IIPA 4M6PA 1V7YA 1ZHAA 1E51A 2V81A 4O11A 2QJIA 4JYDA 1RD5A 3W7NA 1GVRA 4KWWA 1I2PA 1FXQA 2YX0A 3S0CA 2EPHA 2DJLA 2DZSA 2FDSA 4LY8A 1JRBA 3DXIA 4UTWC 1LYXA 5E0KA 4MY1A 3NL3A 5DY2A 2Z2UA 3O63A 4JTFA 2I9EA 3DFSA 3TE9A 3B8DA 1Z41A 1OFRA 1SZEA 4HPXA 4Q33A 2ZZ7A 5F4SA 3TAOA 1RPXA 1IXQA 3ZR4A 1XC4A 2QCLA 2YW4A 2V0TA 2WV8A 1ZAIA 3EWXA 4RZ5A 2TRSA 1LTDA 4AHOA 2Q3OA 4XKYA 3MYPA 2NWRA 5BRBA 2C0AA 3HG5A 1OX4A 3FYOA 3HB9A 4JTKA 1TTIA 2H3DA 4JTSA 2NXHA 3BW4A 1RQHA 1ICSA 1L6YA 3QQ1A 5I3JA 4QNEA 3T55A 2G96A 1VYSX 1Z44A 3QMRA 1VLWA 2Y62A 3V75A 4LRSA 2VFDA 3LRLA 4LV4A 1W3IA 2Y63A 4NJHA 1Q3NA 1M5WA 1B4EA 1SPQA 3MI6A 3PR2A 3LBMA 1HUVA 2VOMA 1IXPA 1TCDA 1K7EA 4YL2A 4UR7A 1C29A 1IXNA 2D73A 3H54A 4M5PA 3HGJA 4B5NA 1KFCA 1MEWA 2CZFA 4UXDA 3GKAA 3N2MA 3PSWA 1VR6A 3P60A 4PL2A 4LVGA 5KSWA 3P84A 1XBVA 1YTDA 3WK0A 1W5OA 4HNVA 1BTMA 4WD0A 1GG1A 1N8FA 3QSRA 3CWOX 1RR2A 1OHLA 2Q3RA 3IGSA 1SO3A 2FPVA 4P61A 3QPYA 5AHEA 2ZDRA 2CLFA 2BX7A 3TQKA 1KFBA 2J9ZA 3Q37A 4FO4A 3KX6A 4DEFA 3GAYA 1ZAHA 4PH6A 2EKCA 2OCZA 3DI0A 3O16A 3BLFA 3PBWA 3QMSA 4JS3A 3UZ5A 3GXNA 3VI2A 3QH2A 3QSTA 3MJYA 1WBHA 3W2UA 3W88A 3LI0A 3VCRA 2J9YA 2RDWA 4CNPA 2QCGA 1TPDA 3WJSA 4UFHA 4JY8A 1MZHA 3KAOA 4EVZA 4WOZA 3LLFA 2QDGA 2GVLA 1NF0A 1VHNA 1WOBA 2QCHA 4RK8A 4MYXA 2YGYA 4A22A 3I7RA 3O6YX 3B05A 1KV8A 2Q8ZA 2VEIA 4O12A 3IIOA 4I9AA 3DFQA 3W76A 5CPLA 1ICQA 3OG3A 2QJHA 3TCEA 5H2ZA 3KRZA 5DELA 4ZQPA 5BMXA 4LV9A 3FLUA 3M16A 3MHFA 1S3HA 3LXBA 5D2YA 2WNZA 3BV4A 1H51A 1VJIA 4O16A 3T78A 3L0NA 1FWTA 4RLIA 2FLIA 4PODA 4UTMA 3MUXA 4J9JA 5G2HA 2HS6A 3UY8A 2WSRA 1HTIA 2ZTKA 2HTMA 4IX0A 3W1MA 2FPTA 4KFPA 3DAQA 3NL6A 3S6DA 3G0SA 1VHCA 3W83A 3TAKA 5FF0A 4AMAA 3L5LA 2Y89A 3HJZA 1LRTA 3NQ2A 1XI3A 2VEMA 2H6RA 3N73A 4GBUA 1O95A 2WQPA 3G8EA 4NNAA 1T8XA 3M44A 3EX4A 1KM0A 1L6SA 2ABBA 1ICPA 3PVFA 1AG1O 4O4VA 1UASA 5D2TA 3O06A 2WJZA 1SU5A 2VFIA 2Y7FA 1LZOA 1WQ5A 5KINA 1M7PA 3CM4A 4UTWA 3D0CA 4UC5A 2QCDA 4NJKA 3HBLA 1P4CA 3GIYA 1XL9A 4U28A 4IMEA 4AWTA 3G1SA 3RF9A 3QQ0A 3NQGA 1B9BA 3W6YA 5MHBA 1ZALA 3DFNA 3W84A 3KRUA 2Z1BA 3EX2A 3GB6A 3I7QA 1ONRA 5AC7A 1F73A 1XBYA 3NPUA 2HSAA 4MUZA 3EWUA 1PV8A 3DZ1A 4O8RA 4QJ1A 4OBTA 1R30A 4LS2A 1NVMA 4HSOA 4Z1CA 2J88A 2ZZ6A 3UPWA 3UD6A 2VFEA 5EY5A 2YYUA 4MZ8A 1A5CA 3O05A 1S5VA 5SWUA 3NZRA 5TBOA 4JTGA 3UWQA 1ZENA 1M7OA 3EX3A 3FJLA 3LV6A 5CG7A 3T40A 1TTJA 3TJLA 1PHQA 4ZQNA 4N02A 1G4SA 5U4NA 3GR8A 1AMKA 2H8ZA 4Q32A 4HSNA 2OX1A 2ZA2A 1FY6A 3PSVA 5LZLA 3P82A 5HULA 3H53A 3DHFA 4N9BA 3W87A 4K37A 5U7SA 4CLMA 1H61A 1LOLA 4ADUA 3W07A 5FF7A 3TC6A 1OFBA 2CLMA 3KVLA 2JKEA 3A5FA 3S5ZA 2A85A 2ZTJA 3EXSA 4CNOA 3LHYA 5AHFA 4AHQA 1KA9F 2OMAA 3LCIA 1KW1A 3EKLA 3GR7A 2A6LA 3NNTA 4N4QA 4RZ4A 3W72A 2YR1A 4IMDA 1JCJA 3OHIA 3DGRA 2GUUA 3QFEA 1OYCA 4LVBA 3E49A 4N9CA 3G1VA 4O1CA 4WY0B 1H50A 4N4PA 4TU1A 4FIRA 4A29A 1IGSA 3NOEA 1W8SA 2C16A 4NXSA 2ATMA 3TSMA 3C6CA 2P0OA 3O15A 2B7PA 1W54A 4OT7A 4TMBA 1TRIA 3C0JA 4JICA 4QAIA 2WKJA 5TQLA 3NPWA 3WFAA 4DPPA 4UTTC 5LHFA 1KM2A 5C5YA 3L65A 2X1SA 3QPZA 5J5DA 2Y7DA 4GUGA 3LX9A 2YZRA 1GVOA 3K30A 2C6QA 2VELA 1JCXA 2JK2A 3BG9A 2F7FA 5AYZA 4KWVA 1FDZA 3P74A 1Q6QA 3S42A 3C52A 4X2RA 1EB3A 3W1AA 4Y8FA 1K03A 3P67A 4M7TA 3TA6A 2VXNA 3NQ6A 4JTUA 4FNTA 1MO0A 1FCBA 4DBEA 5G2WA 3BW3A 4PC8A 3BO9A 4IMGA 3FFSA 2NXIA 1WX0A 2EF9A 4EF8A 3HQ1A 3IIXA 4Z08A 5DBUA 3A5VA 2QDHA 2QCCA 2Y85A 4FNSA 4NJGA 4AWUA 1IXOA 2F84A 4H6KA 4HNNA 2CZDA 5DBTA 4L4LA 4RZ6A 1W37A 5BOOA 1J4EA 1MEHA 1TV7A 4IQLA 4LS1A 4UFLA 3W3OA 4WXYA 3GX9A 1LLZA 1Q6RA 4Y90A 3TIMA 3W23A 2NX1A 4JNMA 4BFAA 2WNQA 5ABTA 2A4AA 3WK1A 3GZ3A 1TTQA 3KVJA 4E38A 2NV1A 2Y7GA 4LOCA 3W7HA 5BNKA 4OQVA 5BW6A 2VFGA 1OF8A 4QQ3A 2QEZA 5AB3A 2B7NA 3W7OA 3PF3A 1KBJA 4K38A 3W1PA 4O28A 3QZEA 1JJKA 4JD4A 4GRSA 3F1QA 1WAUA 5D04C 4FX6M 5F2GA 1OF6A 1EP1A 4RKAA 2Y88A 4JIQA 4RXGA 4JX4A 4RJEA 5CZSA 3IIVA 6ALDA 2CFFA 1EX5A 2YCEA 1A5BA 1QPRA 3Q58A 2X1UA 3USBA 4Z0JA 4ZQMA 4JIPA 1NAL1 3PM6A 3W7GA 1H60A 4RCXA 3ABRA 3NM3A 1NSJA 1OFQA 3WJXA 3WJZA 4UTUA 2QR6A 1JUEA 4DXVA 4TR9A 1AK5A 1RZMA 1W5QA 5LGZA 1EEPA 3TJXA 1F2JA 1G4EA 3EB2A 3KXQA 3R5EA 2NUYA 1CI1A 4XQ6A 4GUFA 4K8EA 3O6CA 4LWWA 2CW6A 4JR5A 1Z48A 3IVUA 3W2KA 4O18A 2OZ0A 4DPQA 3EX1A 1XUZA 3DU0A 2J24A 1OX6A 3W1TA 1YADA 3GNDA 3W75A 1KM6A 1NEYA 3P61A 1TV8A 3BVJA 4UMAA 5HWJA 3CEUA 4ONVA 1GOXA 5FEXA 4DO5A 3U6WA 3W1RA 4MVAA 4NXKA 3F03K 4EF9A 4JXCA 4NT0A 1ME8A 1LLWA 3M5XA 2O7QA 4RXFA 3R12A 5KZMA 3L5AA 3DI1A 4N9DA 4NZFA 2OT0A 4MJZA 3PY2A 1SSDA 2FTPA 1GYNA 4XBSA 5H91A 3HPXA 3F4WA 4QNWA 3THQA 3SECA 2VENA 3M9YA 1TJPA 3L67A 2DZWA 2VFHA 1VQTA 1PCWA 3NPVA 2PURA 3MYOA 2JBMA 1I4NA 2WSQA 3IGUA 2VFFA 3PWAA 1W31A 3N14A 1TPVA 3TR2A 2C1HA 3TKFA 1BEUA 2E68A 5EYWA 4POCA 1H7OA 4CNNA 4GXMA 3N34A 1OABA 3GYEA 3UYCA 1H5YA 3I68A 4IX2A 2RDTA 3O8AA 4UTTA 3TDFA 1N7KA 1R2SA 3PAJA 1J5TA 4GNJA 3UWZA 3TXVA 1I8JA 1BWKA 1ME9A 4XBKA 4QISA 3LRKA 5BMWA 1I2QA 2RH9A 4EOUA 2W0UA 1G7VA 1YLVA 3M47A 4K39A 2ZZ4A 1X6UA 3G18A 1GPWA 4NQ1A 2DZVA 1Q6LA 1SZNA 2CLOA 3E0IA 2WSYA 4MKNA 5HQEA 2GQ9A 3ANYA 1W56A 4L4MA 4NU7A 4ADTA 5HWMA 2PC4A 5HR7A 3SR7A 3VNDA 1YDVA 2Y61A 2EAWA 5HNRA 3CWNA 2XFWA 3IVTA 1FDYA 3A21A 3W7DA 3KHJA 5F1VA 3HGRA 4BF9A 3ATYA 3HF3A 4FNRA 5F1UA 3GNNA 4K7VA 3LXAA 1H1YA 5DN1A 1SZFA 4UNKA 5LNUA 4E2BA 2G95A 1QMLA 1X1ZA 1KM4A 1EA0A 3PB2A 2QAPA 4JTIA 1FWNA 5FF2A 2Z0IA 4UFKA 1K8YA 4BI6A 5D38A 1SO4A 3MW7A 3CQ0A 1KTNA 3L21A 5CZ0A 2B4GA 1KBIA 4FNQA 5T26A 3CEPA 3LHTA 3FOKA 5AHMA 3ABSA 1AW1A 3C2RA 1R2TA 1UCWA 4OWGA 5LNRA 1Y0EA 1LCOA 1EWDA 1FCUA 4UTLA 3LRMA 3P81A 1XKYA 3S1VA 3C8FA 4FF7A 1RQEA 3QW3A 1ZAJA 4UIOA 1O5KA 1A53A 1ZNNA 2R14A 3UWWA 3JS3A 3BLIA 3EXTA 4O14A 1GQNA 2HMCA 3CC1A 4TX9A 1TB3A 3A9IA 1SO5A 4AH7A 5KZDA 4XZ9A 3QEZA 3LCXA 4RR4A 1KTBA 5FEPA 2A7NA 1I45A 4OGZA 4GWEA 3IVSA 2TPSA 3L66A 3LERA 3N3MA 4IXXA 1EIXA 2P10A 5I3FA 3NXFA 4PFMA 1G7UA 4FNPA 3CT7A 1PE1A 5D2WA 2VEPA 5D37A 4KFNA 3GDRA 3C2VA 4QM1A 1OK4A 1FCQA 1T99A 3NQAA 4O57A 4H4IA 3G3MA 4AF0A 1TTPA 3HG4A 5I3KA 1LORA 3A23A 1VYRA 1NF7A 1H7WA 3OBKA 3IIZA 3LOTA 1PCKA 3SGZA 3S5OA
chains in the Genus database with same CATH superfamily
4DB7A 4H83A 2XU2A 4QE1A 3EMQA 3STEA 4AY1A 2VUYA 3NAVA 3AMDA 3CASA 4P2VA 3VE9A 2PTDA 4J40A 1WCGA 1JQVA 4N2YA 4M19A 4F66A 3EEGA 5J5RA 1QO2A 4IFOA 4K8HA 5HK4A 1EJ7L 1WPCA 2JKPA 3MV01 1QVBA 4XTDA 3STCA 4GABA 6REQA 3TWAA 3ARVA 1T96A 4HP5A 2PTYA 3T07A 5HPOA 5A6SA 1VBJA 2DGAA 4W84A 1U33A 3U9IA 3LHZA 2ZA3A 3NL2A 4B91A 3CQIA 3KL0A 2DT3A 2EGZA 4CQAA 3IAPA 3V0UA 4LBSA 4HPHA 1FWRA 4MFDA 2ACUA 2CKSA 4CD4A 3P5ZA 1X8FA 2GOUA 3NDZA 3NA8A 2TMDA 3KOWA 1NDYA 1I9CB 3NQ7A 1L2QA 1VRXA 1DVJA 1R86A 2FB2A 1A4MA 3KEHA 1EJUC 3U2CA 1JFXA 3SIZA 1SW7A 3W1NA 4EXAA 3HMJG 3UWUA 1S2VA 1K7FA 1S5TA 2HE5A 2VNCA 3UXAA 3C2EA 3EWBX 3NPXA 6XIAA 4HMEA 2FIQA 4WZHA 3STFA 1O7AA 1CPUA 2VGGA 3D6NA 4TXEA 3DYMA 3F4NA 1KCKA 2OSWA 1KXQA 4UB9A 4ZCWA 3RLVA 4RPPA 4AVFA 1U5JA 2GZXA 4O13A 4LUJA 4IZGA 4I7WA 4JFVA 1MNSA 1D8CA 3P62A 5CZTA 1HKMA 4QS6A 4MMWA 4DWSB 4UFJA 1F07A 1XLHA 2CZ5A 3ARTA 4R7OA 1NOWA 5LA2A 1ZP4A 3VCNA 4DIAA 4FX8A 5A2CA 2GL5A 1EGZA 3RLGA 1K02A 3FYPA 3TNOA 2IW0A 5DCBA 1TMHA 2BS9A 2VUNA 2I7GA 4I9TA 3WD2A 4DI9A 1NFBA 1QWGA 4R53A 1AH4A 4CQ8A 3LBCA 2WVSA 3ICJA 1ISXA 4AXNA 2J6XA 2P3ZA 3FSTA 4ZSTA 3HPAA 4KW2A 4C6MA 1W3NA 3T0AA 1X6NA 5BZAA 3MBDA 4S3JA 4YXGA 5H1WA 2YA0A 3UNDA 3PZ9A 1EJVC 4K2SA 3IUIA 5IDIA 4H00A 4NNBA 1XLGA 3UXIA 1GT8A 5D09A 1Q45A 1TYGA 2ICSA 4S2BA 3UEQA 1E4IA 4LAZA 5CZJA 3VINA 1HVQA 4ZOEA 1GG0A 4ZQCA 2IKJA 4WOQA 3VGBA 4C6KA 1CCWB 3THDA 2J75A 4U10A 1PTAA 3FJNA 3MCOA 1SFTA 4DJDC 1IIGA 5IRPA 4E3TA 4CQ9A 1VRDA 1A5LC 1XLLA 2DUZA 2PP0A 2QPUA 5TF0A 3CLWA 3VE7A 4D6EA 3G1AA 3GHTA 2BTMA 4FLSA 4KT2A 3D46A 3KOYA 3BLDA 1O66A 4K68A 4WSJA 4JEJA 4QP0A 1XR2A 3EWZA 4IQEA 1XSJA 2FFCA 4IUOA 1YE6A 5EGRA 4Q8TA 1SJDA 9RUBA 1IEIA 1L2UA 4L9XA 2IXVA 3UG5A 3S4TA 1DJZA 4N9EA 3ONBA 3AI0A 3W1UA 3K8MA 2O92A 1UKPA 3SN1A 4GISA 2X0YA 1Y5XA 1E43A 3HTWA 4LJ3A 2NQJA 5A3HA 1R3TA 5AN7A 4GC4A 1RH9A 1VC4A 5F2MA 2YA2A 1J6PA 1LOSA 2QUNA 3I4KA 5DMYA 3HMCA 4R88A 4OECA 1OC5A 4LU0A 5HA7A 3B0PA 3UJSA 2W91A 2OWCA 4HJWA 2AQWA 4A4AA 1PEZA 4GKLA 1PS9A 2BGSA 1DIKA 4L4PA 3PN8A 1KLYA 3HOJA 4INFA 4LAMA 3HO8A 1D7FA 1KRBC 4XKYB 3ISIX 2XINA 3EMCA 2QW5A 5BXSA 4DJEA 2PWFA 3I3EA 3UVAA 4IMFA 4ZZ9A 4NZJA 2VVNA 4RDZA 2PZ0A 1V0KA 3T0CA 4PBGA 4AC7C 4V1XA 3BLEA 4YYCA 3WYZA 3LM3A 2QNEA 5E09A 5LXEA 2NLYA 4OV9A 2GVEA 2W61A 2NWSA 3K5XA 2XGZA 4W7UA 4NVTA 1H49A 4BF7A 2QYGA 1CGTA 1WNOA 3T05A 4K7YA 3E9AA 4XZIA 4MJ4A 4LPCA 1XLIA 3TJIA 1R46A 4H8NA 1XS2A 3BK0A 1CGVA 2GGEA 5A6MA 4H3DA 3TC3A 2ZRYA 1LROA 1TWSA 1NWTA 3MZNA 2ZA1A 2YXGA 2OEKA 2L5HA 1W9BM 2E6DA 4PMXA 1B54A 3GFZA 4PRWA 4XAFA 3S5SA 3UCCA 1VJZA 2CHNA 2G3NA 4U31A 1UWQA 2FHFA 4X0NA 2FVKA 1GEHA 4NJJA 2V69A 3MBFA 2DVXA 2EG7A 5CQ1A 1O5QA 2UV8G 1SZRA 5CPSA 2PDFA 1DXFA 3QLLA 1XPYA 2EPKX 3Q2DA 3ME3A 4C1KA 2ISFA 3R0KA 4YU1A 3XIMA 4HYWA 3SCTA 3O1NA 1ZRQA 4RW5A 1J6OA 3HGOA 3BGGA 3M07A 2OSYA 3LHVA 4ORMA 1EUNA 2WCAA 2ZX8A 1GYLA 1Q6EA 3ENLA 2DZUA 3LA4A 3GVVA 4YTQA 3HM7A 1HO1A 1XCXA 1PAMA 2A7RA 3LNMA 3WQ4A 1QASA 1WXJA 3N2TA 2DSZA 1GW1A 2E77A 5C2CA 5LA0A 4Y6GA 1V5XA 4OUIA 2R1KA 2PC8A 3TXZA 2GVGA 1TV2A 5FJPA 4ZBCA 1WYIA 2JGYA 4DWSD 5LNWA 3N11A 1EF2A 4YIWA 4CUCA 4ZFMA 4Z0SA 1F6KA 4AD3A 3PG8A 5FF4A 2WQDA 1PKLA 1NP2A 4KWOA 1TWDA 4NNCA 4F0RA 3L9CA 2J7HA 1NFPA 3SUVA 1QR7A 1E0UA 3BW2A 4L61A 3ZSTA 3GKFA 1P0NA 2EJ1A 1IE7C 1EOKA 7TIMA 3B9EA 1YBQB 1VJSA 1EHAA 1K8ZA 3QJAA 5FKYA 4HK7A 2Y1HA 1CXIA 3MHGA 4NYUA 2Q09A 4LF2A 1R3QA 2E5DA 2WXDM 5LA1A 3T2PA 1AL7A 2QCDB 1A5UA 4LC8A 1P43A 4I8DA 4QLKA 1M01A 1XRTA 1P0KA 2XSBA 3N2BA 1R3RA 2VZUA 2V5JA 4X3ZA 5LNSA 2HDJA 3W2JA 1UZDA 2FZ9A 1DJXA 1PDZA 3NVTA 2Z1WA 3MMTA 4BKNA 1E1CB 3LTYA 2FDMA 5A95A 2HVNA 2WNNA 3TMLA 1LQ0A 2DORA 3N9RA 4XD3A 1IF2A 1OX5A 2F9RA 3EOLA 3AQUA 2X2GA 1A5KC 4JIIX 4DNHA 1UMLA 3C4UA 5DO8A 1XRVA 2CNCA 5AFDA 1BXNA 1B3ZA 1PWMA 1ODUA 2V63A 1ENUA 3DHDA 4E2OA 3SSZA 1BWLA 3TFXA 2J77A 2QDDA 1B57A 3VNKA 3NQCA 1PVNA 3N9SA 3FS2A 2Q6ZA 4EACA 5D30A 1LRNA 5I23A 2QPXA 4JQ2A 1XQLA 4Q8OA 2VZVA 3DG6A 3BZGA 3S5YA 2VZSA 4W4QA 2QUVA 1O60A 1TVLA 3T44A 1UYQA 4JX6A 1RSCA 2KZHA 3UQNA 3G24A 2FZ8A 4IIGA 2HPIA 1KFWA 4AD0A 3UPMA 4DBDA 1TIWA 4GLEA 2VKZG 1B3OA 1DJQA 3MI3A 3L0KA 1TPFA 2CLEA 3W7CA 4WJ8A 3V0TA 4LUIA 4MLRA 1KQZA 3SQLA 4GZJA 3GVRA 1JNEA 1JULA 1UP2A 1SUXA 3GLCA 3SCPA 3FIGA 3TEVA 3O9NA 1KFJA 1LF1A 4GQRA 4Q4MA 3KOFA 2XVPA 5AECA 4PB3A 1UB3A 1MW1A 2E3ZA 2W79A 3MU7A 3VZYA 3CZGA 2Y4SA 5E5CA 2ZX7A 1UUOA 2POTA 1YPXA 4BWLC 3QC0A 1S5WA 4TX8A 3G1XA 1E3ZA 1QUMA 4HA1A 3WLSA 1H7NA 3W24A 5F4XA 5HJLA 2REQA 3TWBA 5MF5A 5LGXA 2CLKA 2FVLA 4J35A 1WUFA 2ASHA 1EX1A 5IFTA 3MI2A 5BU9A 4CD5A 5RUBA 4AIBA 3W7PA 2QHAA 4Y9OA 3TYDA 2DPEA 1NWSA 3BAJA 3BAIA 4QEEA 3V0SA 1J0ZA 1VH7A 3UJ2A 3PJTA 3I6TA 3HGSA 3RJXA 3UNTA 3W22A 5C0QA 1N8WA 1FQ0A 1W1A1 3WELA 4PB5A 4YWIA 5XINA 3FEMA 5KZEA 4TUFA 2OO6A 2YCKX 2PEVA 3MCNA 3RR4A 2NQZA 3GHRA 4MLJA 4F0HA 3HFTA 5CBBA 3E0LA 1ZU8A 2V5LA 4AYGA 1MDRA 3TU9A 4MWAC 3N2CA 3EPOA 4FR1A 4RDYA 4CCZA 2ZXDA 4E8GA 3AYRA 1V3IA 4G6CA 2PTZA 3BAYA 5L6UA 3H2OA 1V03A 1JUKA 2PWUA 1HQTA 3W7QA 4DI8A 4Y9NA 3DX5A 2CLIA 1LOQA 4WY0A 5T9BG 1CXKA 2A21A 3WLKX 3R2GA 1KCLA 4S3CA 2OQHA 3LCLA 4MIMA 1VPYA 5J8LA 2HXUA 5ABHA 3SCUA 3VOHA 4A2RA 2PDMA 3CYVA 4O15A 3GTHA 1HJQA 5AVNA 3U8GA 4AWSA 3TQ0A 4JFWA 3W6MA 3WLJA 3YPIA 1MSSA 3G1HA 4GVIA 4DXXA 3D3FA 4E8CA 2X0SA 3CZLA 3FCPA 2WMHA 3R13A 4QQUA 3U57A 3MSDA 1A47A 4JTEA 1FFRA 1OVDA 4J3ZA 3AHZA 1XDMA 2F61A 1GVSA 2ZXAA 5AZ1A 1T40A 7ENLA 3BANA 1QATA 1OYBA 4JL2A 3QV9A 1U30A 3LLDA 2PGFA 1H7PA 2C91A 1UR4A 1EWEA 5G4WA 3PBVA 1TUXA 1BTCA 1TIMA 1LL6A 3KWXA 3W73A 1N8IA 3TJ4A 3REQA 1JZ8A 3G3DA 1UJPA 3WH5A 4RW3A 3T2QA 3T8QA 3P8IA 2J47A 1LDCA 4US5A 4DLMA 3SRFA 1XLDA 3M0IA 5T91A 3R11A 4HVXA 5DRCA 1LLOA 1L8NA 1VYPX 1EPXA 2OYMA 4DO6A 2R91A 3BLPX 2YYTA 3WH9A 1NWRA 2INZA 2TODA 2UWFA 4V33A 3URBA 2BASA 3A6OA 3LDVA 3WD4A 3M4HA 1QI0A 4B15A 1H41A 1TQXA 4F8XA 1W17A 1TV5A 1JAEA 1KO0A 1D7KA 1GTHA 4XO6A 6CGTA 2PF8A 3W2MA 1XSIA 4EX4A 4R33A 1F5ZA 3NZPA 3U3HA 4BEUA 4B4FA 1DXIA 2JQXA 4XVEA 3IJ8A 1EP3A 4GMEA 4MZYA 6XIMA 3WJYA 1UZ4A 1RLDA 4J3VA 1V7YA 1ZHAA 1NP0A 2V81A 4O11A 1F3WA 4JYDA 1GVRA 4KWWA 3FA3A 1FXQA 5H8UA 4H8UA 1FWGC 1OB0A 1SR0A 4LY8A 1JRBA 4C7DA 4W86A 1H0GA 2GK1A 1LYXA 2ZUMA 1KB3A 1W91A 1F4AA 4DM2A 2OELA 4KGLA 2G4FA 4JTFA 4YJ5A 4EAYA 4B4HA 2RAGA 1V6WA 4FMVA 3C86A 3VNJA 2D0HA 4HPXA 2EPLX 4Q33A 2ZZ7A 4F3HA 3SIMA 4GI4A 3GXMA 3B9OA 4HOWA 3W01A 2ZICA 2V0TA 2WV8A 4RZ5A 2PA6A 1LTDA 3VNLA 3K1GA 2J78A 3OB8A 2VWTA 2H3DA 3WDQA 2P53A 3OGRA 3OJGA 3WQ8A 4CKQA 3VMNA 4HU8A 2Y63A 1OQFA 1UWIA 1B4EA 3HV9A 3WLOA 1SPQA 3PR2A 2P8BA 2ZKMX 5FIPA 3I10A 2WHJA 3UXKA 2D73A 1Y5WA 4AZ6A 1AUSL 3MCMA 2PDNA 2CZFA 1AH3A 4UXDA 3WIJA 3NQBA 2V3DA 2B81A 2JFEX 4OTKA 3WNKA 3CZEA 2IXUA 3FSUA 4GY1A 3H23A 3MA8A 3WK0A 1W5OA 1IQ8A 1KXHA 4WD0A 3GTFA 2ALRA 3R6IA 1OHLA 5EBAA 3IGSA 2BNJA 3QPYA 2ZDRA 2BX7A 1DE5A 3VNMA 5HMFA 4DEFA 3GAYA 3U0HA 2VTFA 4ATDA 3GBDA 2XVGA 4ZENA 4JS3A 3VI2A 3ZYZA 1XG3A 2E25A 5LIUX 3VILA 3RPTA 4DN1A 4F48A 1W9PA 3ZLFA 3K8LA 1HW6A 4NF7A 1MZHA 1L6GA 5I6SA 3LLFA 2GVLA 1PKYA 3S3GA 2QCHA 4F79A 6REQB 4RK8A 4MYXA 3I7RA 3MUY1 2Q8ZA 4I9AA 3BAXA 2WLYA 2QJHA 1CBGA 2PDGA 3P93A 2BY1A 3TCEA 4RL3A 2E28A 2I5QA 3U2ZA 4Y2WA 3FLUA 3M16A 1KWKA 1RPKA 3V16A 3NO3A 1XQKA 5IXEA 5D2YA 3LPGA 4WJXA 3FV9A 3L0NA 4HCHA 4RLIA 2FLIA 4KERA 4XD5A 3MUXA 1OEPA 5G2HA 3UY8A 2J8FA 3H7UA 1MFUA 2FPTA 4ZB5A 3DAQA 3S6DA 3G0SA 1VHCA 3B97A 4V1YA 3RHGA 1P1MA 3M46A 3NQ2A 3ZLGA 2VEMA 3GW0A 4HA0A 4LUYA 2H6RA 1UOZA 2E67A 3SCVA 1EJSC 4PMRA 5C71A 3T0DA 3LZ3A 3HURA 3L12A 3M44A 1PSCA 3BQ6A 1ITCA 1V4YA 1AG1O 4O4VA 3OLDA 2OXNA 1BGAA 2WJZA 2VFIA 5A8QA 1LWIA 4UTWA 2A3BA 2OZTA 2WMIB 4NJKA 4F2TA 5E6ZA 2DSWA 1JF6A 3NQGA 1G94A 5H8MA 2VX4A 1C7TA 3DFNA 4P7QA 3BL3A 1UD2A 3GB6A 3I7QA 5HBFA 5AC7A 3EWUA 2NT1A 4PCSA 3KDOA 4OBTA 3LENA 1A4LA 1R30A 1NVMA 1K9TA 4HSOA 2BVDA 4RDVA 4MZ8A 2GYIA 1UR3M 1XLEA 1DWAM 1AQHA 1UJQA 1BYBA 3T40A 4PYSA 1T8QA 1VFLA 3M0KA 3C3UA 1U1JA 5U4NA 1AMKA 3LNPA 5HMEA 4Q32A 2OX1A 4YHEA 4UQBA 3U4AA 3H2EA 3CGTA 4QJ5B 1V6YA 5U7SA 1Q7ZA 2PGEA 5LIWX 2FVMA 2CLMA 3KVLA 2DEPA 2GWNA 1E15A 3S5ZA 2A85A 5I78A 8XIMA 1KW1A 3GR7A 1Q4NX 3IRSA 4HQVA 3OHIA 2GUUA 1F4HA 3TTOA 3G1VA 2YCLB 2VRQA 4FIRA 1I6NA 5FJTA 3NOEA 4B3ZA 1XGEA 4QJ3B 3URAA 2NQ5A 2XIIA 1LUCA 2QXWA 4JPGA 4S3AA 5TQLA 4QAIA 3WFAA 4DPPA 4GYPC 5LHFA 5C5YA 1S2WA 5XIAA 3QZAA 3QPZA 3Q67A 2Y7DA 1OWQA 3VIKA 1LG2A 4J5NA 2YZRA 4XV0A 1GVOA 2VELA 3F2BA 4I90A 3CIVA 3ECQA 4AEFA 1ZP3A 4GQQA 3S42A 1REQB 1Q6DA 3PPCA 5FSDC 4XK2A 3O7UA 3HU7A 4KS0A 4Y8FA 5A8MA 1UH2A 3R43A 4ACZA 4GZIA 3NQ6A 3SRKA 3SJNA 1M7JA 5G2WA 2XYLA 2I56A 3FFSA 4JTQA 1KQYA 1WX0A 2QLYA 4H8HA 4IFKA 2Q01A 3U7BA 1UD8A 1XH1A 4M1RA 1OC6A 5DBUA 2QDHA 1IHIA 1WZLA 1IEXA 4DZAA 3IAQA 4H6KA 2Z25A 2FGZA 3OQ8A 4HNNA 3IACA 3POHA 4RZ6A 1W37A 3TYZA 3GTNA 4IQLA 3B0YA 4LUTA 3GX9A 3TIMA 3S6TA 4XAYA 3QV8A 2NX1A 3RCNA 4BFAA 1RCXB 2VCBA 3N18A 5ABTA 5BW6A 4YTUA 2I5GA 4S23A 4HU4A 1OADA 2VGIA 2BVYA 1PDYA 2X41A 3PF3A 1KBJA 4K38A 4YHGA 1XIIA 2XISA 5D04C 2OX4A 2FMNA 3AU6A 5F2GA 2I57A 4MDOA 3AXMA 4DNMA 2Y88A 2FH8A 3IV8A 1QWKA 4R3UA 4RXGA 5CZSA 3IIVA 1EBHA 1EX5A 1A5BA 3Q58A 4ZOBA 3CZKA 1UROA 4GC3A 3B4YA 1TG7A 1FP9A 2W4XA 5E9AA 4RCXA 1PWLA 4LEQA 2QR6A 1GOWA 4O1FA 1PYMA 1W5QA 1EEPA 1I1WA 1NDWA 3AMLA 3O6CA 2C8NA 2C0HA 3IVUA 2QVNA 4C6NA 2QVHA 2OZ0A 2YBVA 4DJFA 3GD6A 3BTNA 3LSBA 4AZBA 1TV8A 3BVJA 5JBDA 1FWEC 4MWAB 4BZYA 1S5NA 3U6WA 5HNNA 5D4YA 4NAFA 3VOCA 4EF9A 4LAUA 6A3HA 4W8LA 3W4RA 3L5AA 3BDKA 3DI1A 3BLKA 1JZ6A 4JIEA 4MJZA 2GVYA 5I07A 4G7FA 2FTPA 3HPXA 1QW9A 2Z1KA 3THQA 1VENA 2WANA 5BOFA 4UQ9A 1EYWA 3SN4A 1TZ7A 1TJPA 1PUDA 1VQTA 1PCWA 3NPVA 3R0DA 3CH0A 4YTTA 1W31A 1X1NA 1CLVA 2XH4A 3ES8A 5HQMA 2Q02A 1JD9A 5CGMA 3CB3A 4G5DA 3N34A 1OABA 1FWIC 1H5YA 3I68A 1UKQA 2PCEA 2BP1A 3AS3A 1N7KA 4GNJA 3N29A 2XVLA 5CAKA 2HVOA 2CESA 3EOSA 3CZJA 3QQWA 2W0UA 4LYKA 1PB0A 3EZ4A 3WLHA 3G18A 3PPFA 2F38A 3GH4A 4R7WA 1Q6LA 3ABXA 2GQ9A 5E9XA 1P0BA 1IV8A 4L4MA 5HR7A 2PC4A 1PXGA 3SR7A 5M17A 2Y61A 1S2CA 3BMXA 2EAWA 4ZO7A 5HNRA 3ALFA 2XFWA 3IVTA 3T6CA 2NSXA 2IKIA 2RGMA 1FDYA 3VOGA 1J12A 3KHJA 3HGRA 3HF3A 5FL0A 2YJQA 3GNNA 3R0UA 3LXAA 1H1YA 1DWHM 4IIBA 1O5RA 1BXCA 3G6MA 1GYMA 2GLKA 3VUSA 5C70A 3KOZA 4MADA 3RPDA 2NVCA 3K13A 3PB2A 3PPGA 4JTIA 1FWNA 1RA0A 5AYBA 4LYQA 3CQ0A 1KTNA 3L21A 2B4GA 3VM5A 1KBIA 1W1TA 5A1AA 5A6BA 4BS0A 4OWGA 1W8GA 2DH3A 3NUKA 3QY7A 1JCTA 1XCWA 4HK5A 4GJIA 3URNA 4JAWA 1ZAJA 4UIOA 1O5KA 2DIEA 5A6JA 5DX7A 1PYFA 2HMCA 4TX9A 2E1WA 2NQ9A 2G3FA 1FHLA 2OG9A 1PIGA 3LCXA 3SCRA 3SDOA 1W9VA 2BVWA 4GWEA 1TWWA 3PZVA 4FALA 3CHEA 1EIXA 1UIPA 4ZGYA 7TAAA 4TVUA 3AXXA 5BU6A 4EPEC 1CXHA 1P7TA 4FNPA 1E6PA 1MQQA 4KFNA 3GDRA 1R7OA 4DWDA 1CT5A 1XP3A 3ITLA 4O57A 1V6TA 4H4IA 3G3MA 4AF0A 5I7GA 3KW3A 4NI8A 3GE7A 4US6A 1H7WA 1ZJHA 3LOTA 1PCKA 4FR6A 1XGDA 3FDGA 3XINA 1R5YA 2XFYA 1Y65A 1WDQA 4KMQA 5A8PA 5FESA 4J4KA 3OHMB 3KBSA 1XYCA 3GTXA 3C61A 1T0OA 1EGVA 1P1XA 3T7VA 3GH7A 3TZFA 1UD6A 3R25A 1ISWA 2XZ7A 1ZBWA 3AZTA 3A13A 4JN8A 4MY9A 1GQJA 1OFDA 1YHTA 4DJED 4LH8A 3MHUA 4LW7A 3KTXA 2DY3A 4O0KA 1EJWC 1ADOA 2WO5A 3STGA 2XN2A 3DC8A 3NWRA 3EDEA 4LT9A 1O6IA 3S5NA 3VO0A 4LTSA 3AIVA 2OR2A 1FBAA 4MFEA 4HN8A 1K3UA 3EBVA 4A3UA 1PKMA 1QDSA 4LBRA 2X30A 5IHSA 1W5NA 3HA1A 1G4TA 3ITOA 3TN4A 3TW6A 5TIMA 2CU0A 5DCEA 3VD3A 3ZFHA 4HNTA 2BWGA 1RJPA 4NP7A 3O0KA 4PMDA 1GORA 4Z42C 1Q2SA 2ZE0A 3VDAA 1A49A 4UFIA 3KTCA 2YIHA 5HANA 1I0BA 4JTAA 1YRRA 3WQCA 2WMFA 3BCJA 3LLXA 4PL1A 1ECEA 1W5MA 4AX7A 1ZL1A 1JRCA 4PTWA 5CKSA 2J7BA 4K8GA 1J93A 2GGJA 3MUIA 1LRQA 4M24A 5K9DA 1RY0A 2Y5SA 1TPB1 8TIMA 1PKNA 1VEOA 4FZIA 1O1ZA 2IPFA 1WV2A 3RXZA 2XM1A 1P48A 3HIJA 5JU6A 2PGRA 2J9XA 2PLCA 2VT0A 4CU7A 5IOBA 1QPNA 3KE0A 4CCCA 2WSPA 3APYA 2R1PA 3NSXA 4HHPA 2YDSA 3ELFA 3KS6A 5F2LA 1OT1A 3VNIA 1N2VA 3WQ5A 3CLMA 4HMNA 5CZKA 2ZYFA 2OEMA 4UTFA 1TMLA 3KP1A 1KM3A 3OZMA 2WVUA 2D2OA 4NYYA 5DF0A 4IPIA 4ZFCA 2A3HA 4ZVJA 3SI9A 3TUUA 1PTDA 1EP2A 1OG0A 4AWEA 3EA2A 3LV5A 1UIOA 1US0A 2Y7EA 1VCVA 4RE3A 1HJWA 4FB7A 5M2FX 4KCWA 1QW8A 1FFQA 1FWWA 3MWCA 1XM3A 3M0ZA 2E6YA 5DEZA 4GUIA 1DEDA 4A3YA 2XG9A 3POCA 1YMYA 3DFYA 1QI4A 2BLEA 1W3TA 1ZPTA 1PO9A 4B2DA 4G7EB 1PIFA 2ZZ1A 2FQIA 3BMVA 1OM0A 3EKZA 3W7EA 1UBSA 1UQYA 2NX9A 3QGKC 2OGJA 3GYCA 1WXZA 3WBAA 4HMCA 2WZMA 5EFDA 4NUWA 2GQAA 2PD5A 3H4XA 2W6RA 1XIGA 3JVAA 1M68A 1PL9A 5I2UA 2EJAA 4G1KA 1P5BA 2DSUA 4K6AA 4OU1A 1E9IA 4H41A 5GJNA 4C6BA 1F61A 1S38A 5CPOA 4R5EA 4CU8A 3GC2A 3AXHA 2XH0A 2YL6A 3DC0A 4FSAA 2JGQA 2C13A 3S8HA 3HG2A 5FF3A 1AJ0A 1YDNA 1QAPA 4ERAA 3RJYA 5B80A 5K7JA 2QPSA 6ENLA 1MXSA 3PS7A 3CUJA 2Z1XA 3S9ZA 3UW6A 3CZ8A 2P5NA 3V18A 5E70A 1CB7B 1JCMP 1C9WA 3LU2A 3VKKA 1H2JA 1VFUA 4U3CA 4XKMA 1JPHA 3BG5A 3QOKA 1D3HA 3W74A 4EXBA 3QYQA 4NI3A 4OUEA 1IYXA 3AO0A 2IS7A 4JYFA 4O4WA 2GK1B 3PJUA 3KVMA 2FJUB 1RBLA 2VCAA 3IJIA 1ZJIA 3JU2A 2WMJA 3VKDA 1RJRA 3SUTA 4OOUA 3TQVA 1H09A 5HAOA 3VKBA 1Z89A 4Q4OA 3AS0A 2CXGA 2CLPA 2CBVA 4BY3A 1XW8A 4C5YA 3AS2A 4OHQA 2Y8KA 1DQWA 4PCPA 4L7ZA 1YPIA 1E6NA 3MWAA 4I6KA 3VK5A 4JHOA 9CGTA 1MQPA 5ABEA 4I9JA 2D2GA 4QLJA 5I3IA 5F4WA 1JZ2A 4Z2JA 1D3GA 1TX2A 2VC5A 4GY0A 3W2NA 3O6DA 4MSSA 5I3DA 5LHEA 1SMDA 1N82A 3CPUA 1KRMA 1FOBA 1ZB5A 4O10A 4ATLA 2BOFX 4MPQA 4M56A 4FNUA 1VGAA 4LVAA 1GVFA 2YSWA 1OZMA 4S1FA 3AZSA 3FJ4A 3CBWA 4EP8C 4JNZA 1A80A 1GOOA 1YYAA 2G4JA 4JDBA 1E70M 4J2MA 1RA5A 3RCYA 4GJ1A 3CU2A 4IQDA 5D02A 3LBOA 1W2VA 1EHNA 3MP4A 1XBXA 4DO4A 3UR7A 1UKSA 4B3LA 2Q71A 2J27A 4MWAE 2OEJA 4R9OA 3TTSA 2X7VA 3A24A 4DVOA 3AOFA 4CU6A 3FW6A 2QF7A 3DBPA 4J3TA 3SGUA 4WKFA 1OJXA 5AHIA 2C71A 5LIYX 3TOYA 2R8WA 3ES7A 4XWUA 4PMJA 2E6FA 1K6WA 2VURA 1IWPA 2BBFA 3QRHA 2PDKA 4QITA 2XH2A 1J0KA 1ZCOA 4JTDA 3SY1A 5C7VA 4AC1X 3GU2A 4GH3A 3VC6A 4NAEA 4P5UA 1A5SA 2DUXA 1QOPA 1MDLA 1Q6OA 2CIPA 1DWIM 3E0WA 3VFLA 1AZ1A 4GI8A 3B04A 3FGCA 4WVXA 2AAMA 1YXDA 1X1OA 3M6YA 1S1PA 1YKWA 2XGBA 1F9CA 1W1YA 4FOKA 3BSHA 3E5BA 2CLHA 4GE8A 3OIXA 3GFYA 1Q6GA 3GG7A 3W29A 2KX9A 4LGXA 1J0YA 1GKQA 2YDRA 3CMFA 1W3JA 2QF8A 3TZNA 3QR0A 4LRTA 3GM8A 1SW3A 4S3BA 1ZQ5A 4HTBA 5A8GA 4A3HA 3J7HA 3A22A 2YBUA 3LB0A 1YQ2A 2PTWA 1E0XA 3RRXA 3AUOA 3SRDA 5EMLA 2FZNA 4HBKA 3OVGA 4R7JA 1J18A 3WX7A 2J74A 2Z7KA 2P3EA 1NIUA 4HZ6A 1UWSA 3UG4A 4JHZA 3KLLA 4GQ0A 2AL1A 3EOOA 4IG2A 3HN3A 3RMJA 2DH2A 2QGYA 2WNWA 1QW7A 2WSKA 4GY7A 2C14A 4DF2A 2QUMA 1YW1A 3M0XA 5CSUA 3CIXA 5KZ6A 1HL8A 1ZGDA 2E6AA 2MANA 1FX6A 3M0JA 3QM3A 3C0LA 3QLDA 4H9YA 3S47A 2WVTA 3NURA 5E0FA 2QCMA 3GDKA 2NVDA 3EPMA 3P5YA 3M5YA 4XTIA 5B7YA 3NGFA 4O1DA 4YMZA 4AHPA 1MVYA 4US5D 1GVIA 4KPLA 4ML4A 2DZTA 1S2TA 3WQDA 4AZIA 3TTYA 1HKJA 3B8VA 2D2HA 1XYFA 3GG0A 3BQ5A 4QLLA 3CUXA 4Z1DA 2HEJA 4XZMX 3BOFA 3UGVA 1OCBA 4OZOA 3S9IA 4ECLA 1XUUA 3P7YA 1FH8A 1IT8A 3JZUA 3UWYA 2XVNA 2D22A 4ZE5A 4LUSA 1O94A 1Q8JA 3CYJA 2ZUTA 3JR2A 3CH9A 1F3TA 3N1AA 4GVHA 3GDLA 2WOQA 5HMSA 1KBBA 2PWHA 3ZT7A 1VB9A 1OFPA 4NL1A 5F2IA 2PODA 4ILSA 3SY5A 2W9MA 2A2IA 3TOPA 2DU2A 5FJIA 1EC8A 3E74A 4H19A 3C3NA 2R1NA 5C55A 4C5ZA 2PD9A 2HVMA 1QNRA 3K46A 3TH6A 4BQ2A 3AXIA 4DHGA 1RQBA 2Y5JA 5XIMA 1KLZA 2LLEA 4F0KA 2W92A 4MKVA 1GVQA 4HD5A 4LBUA 2ZUUA 1GPFA 4XG1A 2H3BA 5DY3A 2YDQA 4FS9A 4UMCA 3UERA 3LK6A 4OE7A 3WFLA 1LUCB 4H2CA 4GI6A 3N25A 3VD5A 3ARZA 3AJXA 1E40A 1Z8AA 3OZYA 4GYJA 5D33A 3WH8A 1HKIA 2VGBA 1FWAC 2CC0A 3EXRA 4ZEPA 3FY1A 1SW0A 1PZ3A 3PTMA 4PSPA 2QULA 2J25A 1TVPA 4DELA 2ALDA 1XYBA 1WXYA 3PHAA 1G1YA 3ANVA 4PB4A 3XISA 3S2NA 5FD0A 2E9BA 4JOMA 2YZ5A 4ACZB 2CERA 3LCHA 4MNMA 1EA9C 2ZXQA 1FVPA 5K2ZA 1KGXA 3RLUA 3BLLA 4IFKB 1YNYA 4V15A 1OK6A 4R27A 1ADSA 4NKCA 3THUA 2OOGA 1RK5A 5IBXA 3V1HA 3WQGA 3VA8A 4D6HA 4HPGA 1FA2A 4LAOA 5AOUA 5CBJA 4DBUA 1QPQA 1OD8A 4LUTB 4PZVA 5REQB 1BVNP 3SQMA 4WJEA 1WDSA 1HGYA 4EAMA 3URQA 3L2IA 1CYGA 4WXZA 4H9ZA 4JTLA 4W85A 5LKYA 4YVPA 3SJ3A 2G8ZA 3N2XA 3DKLA 4M6QA 4CNUA 4CEXC 2XWEA 4E8DA 3G22A 4AZGA 3S9YA 4GYKA 1WA3A 4O1AA 3M64A 4GQGA 3KHDA 1FCVA 2ZQ0A 4GJJA 5G4HC 4CQCA 4Y8EA 4RX0A 1C8XA 1V3HA 1Z3NA 3QW4B 1CIUA 4I7VA 4ZL1A 1U5VA 5DLCA 4CCEA 5BOEA 3VKJA 5BXPA 1DXEA 1NFGA 1XG4A 2X16A 5FSEC 5LNVA 4JIRA 3MSRA 1QRQA 1TO3A 5LSMA 3GNOA 3W28A 3PZTA 2HPMA 1XDLA 2PMQA 3KFTA 3H2FA 3GW3A 2DVUA 4UUIA 1EUAA 2PDBA 3LGEA 2QAFA 2V2CA 2DW7A 1TJ2A 1DKWA 5C9RA 1JD7A 4LS0A 3NG3A 1CXLA 4QAWA 3ITXA 3MMDA 4WSKA 1EF3A 4J28A 4EWND 3N13A 4RE0A 3AJ7A 4PUKA 1EGMA 4JN6A 5FA5A 2QIIA 4IQJA 4D8ZA 4L4OA 2E5CA 1TX0A 2OWWA 3OQEA 3ARRA 2V3EA 5A6TC 3QTGA 1K7XA 2JEPA 5BWAA 3VFCA 1RV8A 1XIEA 4Q4KA 3VX1A 1SM9A 2PRLA 2FTWA 3DFOA 2OSXA 3LTPA 1TPEA 1XXXA 3M5ZA 1T6MA 2VEGA 2EPMX 2P76A 3CQHA 4QSHA 4AU0A 4YCOA 1JPKA 1OGBA 4QDWA 4L6OA 2VD8A 4NZ5A 2DZPA 3STPA 4J7RA 1M04A 3A4JA 5M5DA 1M1BA 1JI1A 3DHUA 2I1OA 4S3FA 3H22A 3VDCA 2FJKA 4L6DA 4GI9A 1O5XA 3HG3A 2NXGA 1MMFA 5GVJA 2CBUA 5H8PA 4ICCX 2ISWA 4M6PA 1E51A 5EMKA 3KZSA 4KCVA 1JYWA 3LZ5A 3F5KA 1I2PA 1Q2RA 2YL9A 2YX0A 1KXTA 1RBOB 1UUQA 5E0KA 4MY1A 3NL3A 4YPJA 4E4PA 2Z2UA 3O63A 3DFSA 2IKHA 1HP5A 4Q7IA 3CL6A 4W8AA 3TE9A 3MKKA 2J62A 1Z41A 3MDUA 1OFRA 3VXGA 5C9XA 2PFHA 2PDXA 1Q65A 1GOMA 2VQTA 3TAOA 1RPXA 1RCOB 2QCLA 2YW4A 2YL8A 4KCTA 1A3WA 3D47A 1ZAIA 4JFTA 3WF2A 2NSOA 4B5WA 3UP8A 3HG5A 3KUMA 4GG9A 4M82A 1BAGA 4WHBA 4JTSA 4AISA 4QBXA 2NXHA 4Z2KA 1TE1A 1RQHA 1L6YA 3QQ1A 1XRSA 3ITTA 3T55A 2G96A 4WDTA 5CPQA 1VLWA 1AQ0A 4LRSA 3LRLA 4FA3A 1VIZA 4NJHA 1Q3NA 3TNBA 3APTA 4I8YA 1ONEA 3AFBA 3MI6A 2XIOA 3LBMA 1RUSA 1HUVA 3DESA 1K9FA 1P7TB 4E6MA 1C29A 1IXNA 3CUIA 3HGJA 4IF2A 1KFCA 1MEWA 4O8AA 3N2MA 3PSWA 3QV6A 4PL2A 4LVGA 5KSWA 3OA5A 4C6JA 2OODA 4HNVA 1XLKA 3CUZA 1DWJM 1N8FA 3QY6A 1RR2A 2Q3RA 1TJ1A 1MFVA 2FPVA 3H2AA 2CLFA 3MO4A 3AIQA 4XIAA 4X0VA 1F8MA 3VDBA 4M0XA 1ZAHA 2EKCA 3W0KA 3SO7A 1TA3A 3QSTA 3DHPA 3W2UA 4HNCA 3LI0A 2CYGA 3A47A 3TYUA 2GOKA 3CHCA 2VC9A 3KAOA 1XIHA 2Z27A 4WOZA 5A2BA 2QDGA 1NF0A 1WOBA 1DTUA 4PMZA 4AY8A 1LL7A 1BKHA 2PLKA 2D1ZA 4O12A 2VEIA 3IIOA 3W76A 5CPLA 3OG3A 3QGAC 3F4VA 3N4FA 3KRZA 3PTKA 1A5MC 3MHFA 3UZWA 4D71A 4UBPC 4U5IA 3VUPA 1Q7MA 1H51A 3IJLA 4O16A 1POJA 1AVAA 3QKZA 3UFYA 4AD5A 2ZTKA 2HTMA 3W1MA 3WLRA 3NL6A 1WO2A 3W83A 1TCMA 4JQ1A 4AMAA 1BYCA 4DJFD 1LRTA 4QGCA 2DQWA 5I02A 4D6JA 1WDPA 3G8EA 4CN6A 3B9DA 3B9AA 3EX4A 5DMMA 1ICPA 3KBMA 3AHVA 3NSMA 3O06A 4C6LA 3CQJA 1LZOA 2NVAA 3CM4A 3D0CA 1E9ZB 2WC4A 4A8NA 1V3LA 4K3ZA 4UC5A 4H8VA 3DEQA 1P4CA 1M7XA 3PP7A 3GIYA 1DJIA 4QR6A 3M0VA 2DIKA 3W6YA 5MHBA 3SADA 2D2JA 3QBUA 3LQLA 2FGLA 4PUDA 2PWDA 5CPTA 3UZXA 4MUZA 5ABGA 2YB4A 3DZ1A 2J7FA 1CB2A 3FEQA 3LUTA 4O8RA 3AWNA 2J7DA 3ZR5A 4Z1CA 2J88A 2ZZ6A 3UD6A 2EG6A 3S46A 2POZA 1JL8A 3DYOA 1A5CA 3WQ6A 5A6AA 2AQVA 4LNCA 5SWUA 3E2QA 4FF5A 3LGDA 1S2AA 4DUOA 1TZ9A 1Q66A 4E4UA 4P8WA 1PHQA 3P0WA 3ONCA 4ZQNA 3UA4A 1EIBA 1JPIA 3GIPA 4YTSA 1VFOA 4N02A 4HHLA 2ZUSA 1R38A 2ZX6A 3H2MA 3PSVA 5LZLA 3P82A 3DHFA 2EKGA 4D8AA 2QJMA 1I1XA 1J9YA 4HZMA 3AZRA 4BQ3A 1E1EA 4CLMA 1H61A 4ADUA 2ADAA 3RGTA 2P88A 4IP5A 4M51A 3K4DA 3F5JA 4GPNA 1V7AA 2ZTJA 6TAAA 3LHYA 1VFMA 2ZIDA 4AHQA 2Z1VA 3L23A 3PZIA 4FLOA 3EKLA 3RDKA 3NJ3A 4RV3A 3NNTA 2IPGA 3QFEA 4C1NB 1OYCA 3E49A 2G50A 4N9CA 4HU0A 1UZ1A 4O1CA 3FAWA 3CL7A 4TU1A 5D9PA 4A29A 5A6BD 1W8SA 5JBEA 1K1DA 4GK8A 1DPMA 2O9RA 1C90A 3SB0A 3C6CA 3O15A 2D0GA 3WO8A 3ZSSA 3R79A 4H7ZA 2B7PA 1TRIA 3C0JA 3CMJA 1KXVA 3CMGA 1HGWA 4NZ4A 1CDGA 3EA1A 4GVGA 3L65A 1CLKA 2X1SA 3FX4A 3UCDA 4Q4RA 3K30A 2C6QA 4DY1A 3UR8A 3MJMA 3O3RA 5LYRA 3RPMA 4J27A 3C52A 3WSUA 1X6LA 4B9YA 3QHOA 4DYJA 3V5FA 4Q4QA 4O0QA 4QXIA 1JGIA 1JDFA 1UMYA 4DAIA 4AIEA 1FWDC 3EKGA 4DWSA 1YX1A 2Q8XA 1B0IA 2Y85A 4NJGA 4FNSA 2VDHA 4HHMA 5FAJA 1MWOA 1HKKA 2E40A 5BOOA 1J4EA 3PTDA 2CITA 2EBNA 4AZCB 5FAGA 4UFLA 3W3OA 1UPMB 3CAQA 5BXTA 4HTYA 2VJXA 4TTGA 1BYAA 1TTQA 4UZSA 3KVJA 4JFUA 1UOKA 3W7HA 5BNKA 1QHZA 3ITYA 4QQ3A 3IJDA 2J7GA 2B7NA 2OOFA 3GNXA 2EPNA 3W1PA 4O28A 4REQA 2WLZA 3F1QA 3KCJA 4LYPA 1XYLA 4RKAA 1EP1A 3OYXA 1EZWA 4JIQA 4RJEA 2VCCA 3AHYA 2CFFA 1W1VA 3EPNA 2YCEA 1CNVA 5JIWA 4D6FA 1HJUA 4JIPA 4IP7A 3LMZA 3TQPA 3W7GA 5HDRA 1NSJA 4GNKB 4D1JA 3GZAA 4EK7A 4AEEA 1JUEA 4S38A 3CUGA 1RZMA 5LGZA 4I3GA 3EB2A 3R5EA 2WZEA 2NUYA 4XQ6A 3ZVHA 2XWDA 3BJTA 4LWWA 4JKMA 4PUEA 1F8IA 4O18A 3QYSA 3EX1A 2A3AA 3AUJA 1TKKA 1H5VA 1Y7VA 4XVDA 4G1NA 1YADA 3KP0A 5I0DA 3CTTA 4ZTXA 1HXJA 3P61A 3CEUA 4PUNA 4PMUA 1GOXA 5FEXA 4DO5A 5I77A 1XIJA 4MVAA 4AY7A 5D9NA 2AMGA 4JXCA 1ME8A 4KCUA 1E4LA 4RXFA 1B9ZA 4DAFA 3B40A 4GO8A 4L80A 2R1MA 4IIEA 1IGWA 1KD0A 1J79A 3GHSA 4XBSA 5H91A 3FGCB 3S1GA 3F4WA 4QNWA 3PPHA 2VENA 3M9YA 1GOIA 3L67A 2JIEA 2DZWA 2VFHA 3DGBA 3IGUA 3CPGA 2VFFA 2OYLA 2A3EA 1IWAA 3N14A 3TR2A 2WPGA 2C1HA 1POKA 1H7OA 4CD8A 5EMMA 2JF7A 3O8AA 1IEVA 3BWWA 4PCTA 4UTTA 3TDFA 3BUVA 1J5TA 3UWZA 1PZ2A 3TXVA 1BWKA 3COTA 2VDIA 3G1RA 4H9VA 1J0HA 4M81A 3LRKA 3N15A 1H0IA 4G8TA 1AH0A 5CC6A 4EOUA 2HK1A 1V6XA 4IGSA 1YLVA 3M47A 1Q7QA 1X6UA 2ZZ4A 1GPWA 3GBEA 3KL3A 2DZVA 4GNVA 5HQEA 1VBRA 3TN5A 1W56A 2XJ7A 4NU7A 4ADTA 5HWMA 3T81A 4F2UA 1EJXC 3VNDA 2Y0FA 1Y8BA 1E0WA 4B9ZA 3W7DA 4DX3A 1W6TA 5F1VA 1GQLA 4ATWA 4BF9A 3ATYA 4GXWA 5I00A 2Y24A 1OCNA 4K7VA 1V3MA 1UR9A 3BMWA 4JIHA 1X1ZA 1W9XA 1GUVA 1Q13A 5FF2A 4UFKA 4B2DD 3VIHA 1R87A 1QI5A 3MW7A 4MNLA 2X09A 4PUMA 5CZ0A 3TN3A 4FNQA 3CEPA 4MAVA 2ZVRA 4AMCA 3ABSA 1AW1A 3P0XA 1VFTA 5BROA 3MC5A 1LCOA 2QT3A 4JQAA 2I16A 1EWDA 1AFSA 5DMLA 4L9YA 3C8FA 1XIMA 2YXOA 1XHGA 4U2YA 1EO7A 1ZNNA 1A53A 3JS3A 2HZGA 1GQNA 1B1YA 3A9IA 1C8YA 4AH7A 4TVDA 3QEZA 4RR4A 1KTBA 2F2HA 3WUEA 3CJPA 4FP1A 1LWJA 4GZ7A 2TPSA 3LERA 3WNLA 3N3MA 4IXXA 2P10A 1O1HA 3WUGA 1G7UA 4B92A 3WNPA 3GU9A 4B5VA 5D2WA 2VEPA 5D37A 2XHYA 2VVSA 3WMCA 3EOEA 1E9LA 2VWSA 1LG1A 3C2VA 1IZCA 1OG6A 3W25A 3UJFA 2VHLA 4RPQA 3OBKA 2FYMA 3GVQA 2Y8VA 2ZVIA 1GTEA 3S1UA 3OBAA 1C3FA 3SSJA 1R47A 3NQEA 3C0SA 3PFMA 2ISSA 4O0ZA 4PCNA 2D3LA 2W63A 1GVEA 3TYAA 2DT1A 2CKRA 1SSGA 2CWNA 1J0JA 1OCJA 4GINA 4QE5A 4TTUA 3FXGA 2W62A 3RM8A 3KBNA 4MB1A 2AQOA 1ELSA 3E38A 3NDYA 1G0CA 4C6DA 1HKVA 2HRWA 3V35A 4ADSA 3W7JA 1K70A 4UTKA 3AWOA 1QNVA 5C6MA 1I2OA 2W67A 2HQAA 5K4ZA 4M29A 4GBDA 1KTCA 4KFOA 5HNTA 1UKTA 1E1CA 1YIXA 3W7LA 1EJRC 3BGJA 4NX0A 2QKFA 2TAAA 1V77A 5CXPA 5BWFA 4GZEA 3PUDA 3KCLA 1KFLA 4ZSUA 1A3HA 3E2VA 3S6OA 1THFD 4JBRA 4B5UA 1DJNA 3H8AA 4A05A 2ACQA 3E5PA 1UWRA 5D2VA 1XCFA 5HUOA 2X40A 4M3PA 1F7BA 3EX6A 1JZ7A 3CV6A 4CQDA 3AAMA 4O1BA 3EYPA 4DZIA 3GS6A 2JKAA 4Q6JA 3M1ZA 3CHDA 1ITXA 3BCFA 3W2LA 3G1YA 3DYPA 4B16A 2ZZ2A 3BPWA 1J01A 3M0LA 1BSIA 2NQLA 1RAKA 3VVGA 1ECQA 4ZE4A 1Q6CA 3NL5A 4F0LA 2Y70A 2P1FA 4DJEC 5AHNA 4I7UA 4LCSA 4F2BA 1AW2A 5T9CE 3GXDA 2X0HA 4QDMA 1HFBA 1NELA 3L4XA 2QMJA 4GCXA 4PRRA 2GJNA 1HG3A 3MT1A 3GXPA 3D5HA 1OZQA 4IWWA 3WL1A 3L5MA 3BGAA 3DDMA 3TSBA 1KFKA 2R94A 1QNPA 3BSMA 4Z1YA 1NOFA 4BF5A 2WBGA 7REQA 3UG8A 1R9XA 4IMCA 5CLTA 4D6IA 2BSLA 3VIJA 3CHVA 3B0UX 2VEKA 3W7KA 1UP0A 5HOSA 4JTTA 3A3WA 1J11A 1TREA 1RVGA 3APGA 3W71A 4FEZA 1W32A 1UH3A 4MM1A 5G1TA 4AUBA 4H9MA 4WKAA 3CQKA 3OA3A 3QC3A 4M7SA 1K4HA 3P8JA 2ZCGA 4RZBA 2VC6A 3LCFA 1U22A 2XSAA 1XLJA 4KH2A 1EQPA 4NZ3A 4FOJA 4XZWA 3EOUA 2VX6A 5FEZA 2WZTA 5A94A 3HQPA 5M3WA 3KZPA 1Y5VA 2OLAA 4LB3A 4IP4A 5HWNA 3SUUA 3GDBA 4UOZA 3MV11 3NGJA 3T9PA 2G0WA 2PF0A 4I5RA 3UA3A 4TO8A 3CAVA 4IIFA 1XRFA 3QOMA 1WKEA 3GRIA 2WKLA 5FJUA 3W6LA 5DXXA 1PIIA 1US3A 3PZQA 3QTPA 3LXCA 5A8OA 3AIEA 1EO5A 3HPZA 1DHKA 1PPIA 1IIHA 1JDEA 2R1LA 1SZGA 2X1RA 4KGJA 5DXYA 5D32A 3AALA 3L68A 2JE8A 5CSSA 2NUXA 3WMBA 1HO4A 3K4AA 3TYBA 3G0XA 3WNNA 3C0QA 1UWTA 1LP6A 1W2PA 1PX8A 2QCNA 2J8GA 1JZ3A 2G3JA 1TFVA 3E02A 1ZBKA 2ISDA 3V7PA 4DF1A 3KBWA 4YYFA 3VZZA 4AG0A 1RD6A 5JH2A 4RNJA 4E2VA 1I75A 5G1YA 2GDVA 1XIDA 3U48A 3W1XA 5KETA 4ZQOA 5ABFB 1RP9A 4ASTA 4PCFA 2WWDA 3CB8A 3HQNA 2NV2A 4UTHA 3C8NA 5BRPA 4D6CA 2GSJA 2G41A 3NYZA 4IISA 4MHBA 2J79A 2HISA 3L2LA 4Z1AA 4I5XA 1AD1A 1GCYA 3TFCA 1E71M 1EC7A 3UPBA 1XD0A 4CVUA 3NDOA 4Y7EA 2AL2B 1HKWA 5HUPA 3KRSA 4GGHA 4WGXA 3A12A 1Q8AA 4WQ6A 1K4GA 2ZWYA 2OLSA 4AIUA 3H70A 4PGLA 1RBAA 2ESCA 1KR1A 2GJPA 4UTIA 4H9UA 3UXLA 2OJPA 2PWEA 4Q8PA 5CGQA 2OT1A 4WX2A 4TVCA 1WOAA 2VDGA 3QFWA 4KQNA 1KBKA 1ITUA 4Q7NA 4N6FA 2YCJA 1TE6A 4FXFA 3UT0A 1A50A 2QV5A 3L4VA 3WK2A 2DSVA 1X96A 3FHAA 4M6UA 3GIQA 3M5VA 4ZR8A 4QCEA 3KTSA 3WQOA 3FK4A 3B8WA 4CGTA 1GJPA 1G67A 2TYSA 4QS5A 2YOCA 5K3VA 2O4QA 1BRLB 1L0PA 1CWYA 3W27A 4ALDA 2QUTA 1V08A 3TC7A 1UR2A 3ABZA 1CZ1A 3PWGA 4PEEA 3SW6A 2PAJA 2GDUA 3OLIA 2PCQA 1DBTA 3ZO9A 2DUAA 2ZUVA 1UR0A 3WF1A 3E96A 1R2RA 5K9XA 1XJBA 2Y6ZA 2V2HA 2CZVA 1U1HA 1KRCC 1V0LA 2VEFA 2YCIX 3GXFA 1LBLA 1GJUA 4MOZA 1ALDA 4IPNB 2GDQA 3NFUA 1L8PA 2QJGA 3AU2A 3H55A 4DF0A 5FOOA 1H7RA 4EIVA 3UXDA 3OVRA 3SFKA 4BI5A 1TJRA 4H6QA 4DJDA 4K36A 1MUMA 1MW3A 1GQKA 3NQFA 4PBEA 5ECUA 4XSLA 4EPDC 3EGJA 4PTNA 3DFHA 1VAHA 1ZZMA 2V8ZA 4X60A 1BLIA 3DENA 3F4CA 3OU8A 3VCCA 2VX7A 3W1QA 4XO7A 1SFJA 1DP0A 3TLQA 3THCA 5CC5A 1JDCA 2IMRA 5HPCA 1A0DA 3ZVIA 3ZMRA 4GHRA 3GTIA 1BG4A 4CD7A 1HNYA 1Z6KA 1GHSA 3R89A 1KFEA 4PTXA 7PTDA 4NIRA 2UBPC 1D9EA 1PHWA 2D3NA 1DJYA 4MNJA 3WBYA 1W0MA 3L4UA 4XUGA 1X7FA 3CT2A 1T41A 1TV3A 1G6CA 4NILA 1UHVA 5FCZA 2XTKA 1VFHA 3TP4A 4C6EA 3GNRA 1S5MA 1OFEA 2QCFA 3BSGA 1UR8A 2W66A 3RX4A 3QMTA 1AJ2A 1TPC1 4GFIA 2PDCA 5D8WA 5CC7A 1DORA 4UFMA 3RO6A 3LCWA 1NDVA 3AICA 3G8RA 3AHTA 2E09A 2GVJA 4TMCA 3CL8A 1JYVA 2E7FA 2E8YA 2C7FA 2ZZ3A 3MKCA 1BXBA 4Q22A 3RN6A 2GSEA 4M6VA 1QHPA 1DQUA 1A5AA 1Z32X 4GKTA 5C9WA 1GZJA 4ML9A 2HXTA 1GKRA 1NQKA 2WVVA 8CGTA 3LHUA 5AC4A 4OVXA 3W7MA 3N19B 3RK8A 7XIMA 1DV7A 2NZLA 3ARUA 3LI1A 3G1DA 4RE2A 1KBLA 4ICMA 4GOAA 3BV7A 1XYMA 3LHWA 2ZRWA 2XGIA 3E0VA 4H04A 3V4BA 1JVNA 3A4WA 2RFGA 3ZS4A 3VKCA 1XDJA 1E5JA 1GEQA 3ORWA 3IUHA 1LBFA 1FDJA 2EPOA 4NASA 4KKXA 4O53A 3WD0A 2HE8A 4Y9AA 3UR2A 4O52A 2OLHA 3WD1A 5IM51 2AGKA 2RJGA 1VIWA 2VD9A 1N55A 1YXYA 1TUFA 3ANUA 3OZOA 3FNDA 2ZBTA 1LWHA 1MNZA 2PI6A 2X8RA 4YLWA 3VD4A 2R82A 2QDEA 5G4EA 3TW7A 3IJ7A 1TJ0A 3B8UA 3AXKA 1JR1A 1CENA 4QHRA 4LC6A 4IJBA 4UNLA 4DRSA 1ML1A 3OOQA 3ZWSA 2CLLA 1AODA 2X1TA 5IHRA 1XLBA 3I6RA 2WMIA 3R7MA 3M0MA 3G6LA 3N04A 2V67A 1HL2A 3RFAA 1TPWA 3TROA 1R9ZA 4IFRA 4V27A 4IJRA 1WZMA 4L64A 3MSGA 2BFGA 2AOSA 1V02E 4FXSA 1G5AA 5AYXA 9XIAA 2BODX 2WM0A 2W5FA 4Q8UA 3BARA 4C1LA 2H90A 1ADDA 3WK3A 3NOYA 3VAVA 1G69A 2ZXBA 2IUZA 4KRTA 3IGHX 4NZ1A 3C56A 1ME7A 4D72A 4AQLA 1LBMA 3N4AA 2GJXA 3LPPA 2WC3A 3JUGA 4IOTA 1QOQA 1ZBVA 4D2JA 5C54A 3QHMA 2FGBA 1F05A 1SO6A 1ZSXA 1ZFJA 3W38A 3USZA 3UETA 3SZ8A 1W3HA 4N42A 2Y2WA 4A8RA 1TPUA 2V5BA 4CEUC 3HV8A 3RG6A 1F3EA 2FH6A 3N6JA 2V5CA 4ZODA 1D2KA 2DJXA 2DT2A 1E3XA 1NOUA 3QR1A 1QT1A 3QV7A 4PFHA 4AFYA 4Z1BA 4REQB 3GG1A 4CNSA 3CTLA 4AZ5A 1F76A 1MW0A 5E93A 4R85A 3EWYA 1DWFM 4O19A 3PBYA 1LM1A 1W5PA 3AHXA 3I6EA 3AMKA 1AQFA 3FAXA 2A5HA 5HR6A 4W8BA 2BXYA 2YCLA 2PDYA 2ZRZA 5GNXA 3N2OA 4F9DA 2OQYA 1R8LA 3ARXA 5D8ZA 1DL3A 3N3TA 5EA9A 3G77A 1TQJA 4LX4A 2PRHA 4UQEA 1OT2A 3II1A 4M1BA 1LJYA 1JF5A 3OW1A 3ZVHB 4LSBA 3ZJKA 2XIJA 3OVPA 2Z26A 4HN4A 4XUYA 4YS1A 4XZBA 4HA4A 3I3BA 3ZT5A 2HS8A 1REQA 3ERPA 1D3CA 1B4KA 3PC0A 3F2CA