2VC6A

Structure of mosa from s. meliloti with pyruvate bound
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
292
structure length
291
Chain Sequence
MFEGSITALVTPFADDRIDEVALHDLVEWQIEEGSFGLVPCGTTGESPTLSKSEHEQVVEITIKTANGRVPVIAGAGSNSTAEAIAFVRHAQNAGADGVLIVSPYYNKPTQEGIYQHFKAIDAASTIPIIVYNIPGRSAIEIHVETLARIFEDCPNVKGVDATGNLLRPSLERMACGEDFNLLTGEDGTALGYMAHGGHGCISVTANVAPALCADFQQACLNGDFAAALKLQDRLMPLHRALFLETNPAGAKYALQRLGRMRGDLRLPLVTISPSFQEEIDDAMRHAGILL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural, functional and calorimetric investigation of MosA, a dihydrodipicolinate synthase from Sinorhizobium meliloti l5-30, does not support involvement in rhizopine biosynthesis.
pubmed doi rcsb
source organism Sinorhizobium meliloti
molecule tags Lyase
molecule keywords DIHYDRODIPICOLINATE SYNTHASE
total genus 105
structure length 291
sequence length 292
chains with identical sequence B
ec nomenclature ec 4.3.3.7: 4-hydroxy-tetrahydrodipicolinate synthase.
pdb deposition date 2007-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2vc6A00
3QPYA 3LHUA 4MZ8A 4I7WA 4BI5A 3KXQA 3PY2A 2WOQA 3P5YA 4FIQA 4MFDA 1I45A 4AEOA 4K38A 1KFEA 4AWUA 1H1ZA 3OA3A 3NL3A 5AC8A 2P0OA 1F05A 1ZHAA 3L66A 3WJSA 1DJNA 4R34A 1TPEA 1C8VA 3IEBA 1ZY9A 3BLEA 3IIZA 1GQNA 5TBOA 2WSRA 4TR9A 3EX3A 2DZTA 4DPQA 2CLKA 3HG2A 2BX7A 3MJYA 4Y96A 1XFBA 2A6LA 2NLIA 2YW4A 2V8ZA 3NPWA 3JS3A 3C52A 4FNPA 2CLEA 1DKWA 4MY8A 4NJHA 2TSYA 4IPIA 3Q94A 1LLWA 2X16A 4ZMGA 3W1AA 4ORMA 4R7JA 2FTPA 2VFDA 4DO5A 4OV4A 4JY8A 5HNRA 4N9EA 4NUWA 4JN6A 5EYWA 3S1XA 2X30A 1A5CA 4AVFA 4O1AA 3D0CA 3HJZA 2OCZA 1J4EA 2QCDA 1SZEA 3TXVA 5CKSA 1VHCA 4CCEA 3HBLA 1JCNA 3GAYA 4WXYA 1OX4A 3CIWA 4WXZA 2VKZG 1H1YA 2DORA 3G0XA 3B0UX 3L65A 3A5VA 1SW7A 2PRMA 4IMDA 4M7TA 5I3IA 1K7FA 4IMGA 4NJKA 5TIMA 4O57A 1FWRA 4RXFA 5FF2A 1Q6QA 4MLJA 4TMBA 4S1FA 4HSOA 1JCLA 2QAFA 1SSGA 3P8IA 3I6RA 4POCA 4ADSA 4LVFA 4JIQA 1VCFA 4BR1A 4HPXA 5D32A 3LGEA 1EA0A 1VZWA 1UUOA 1C29A 1G67A 4YL2A 4O15A 4AHOA 3KX6A 3LM7A 3G0SA 2ATMA 3MP4A 3GK0A 1K8ZA 1OYAA 1UASA 3W1MA 1YXYA 2DJLA 4GUJA 2O7SA 1IXOA 1YXDA 1I2PA 3NZ1A 5BNKA 4GRSA 4R33A 1EUAA 1SPQA 1W8SA 1TV5A 1UJPA 2BZNA 4LWWA 3W6YA 2QJHA 1ZCOA 3N9RA 3U2OA 3EWXA 2EKCA 1ML1A 2V5BA 2NUXA 3HB9A 4O13A 1F73A 4LY8A 4QAIA 5AFDA 3EXSA 5IM51 3IIVA 2RDTA 2YFNA 1NF0A 3KVMA 1QCWA 5HWNA 4Z08A 4Y9AA 5F4XA 1PL9A 3MI2A 3PBVA 3W72A 3LCHA 2Q3RA 4DF2A 1MZHA 1QPNA 3S8HA 3PG8A 1SFJA 2CFFA 2RH9A 3HOJA 3QSTA 3O1NA 3LCXA 1N55A 2JGYA 2WSQA 4LU0A 1OHLA 2XN0A 4UTWA 4DXVA 3TJLA 5D05A 2QF7A 2J27A 5HJLA 3U8GA 1DJQA 1QDSA 2NXGA 2QEZA 5AC6A 3UWYA 4UCGA 1Z48A 2E6YA 2NWSA 1OF8A 2GVGA 3GDMA 1Z41A 3B8DA 1VH7A 2VEMA 4YMZA 1XL9A 3IRDA 5HWMA 5CSSA 3SGUA 3DI0A 2WJZA 2GPTA 1KFBA 5CPNA 5D30A 3U6WA 4TMCA 1W3TA 5KINA 3DXIA 1JQVA 4P61A 5D04C 5AOUA 3QH2A 1RQEA 3ZWTA 5J5RA 3IVUA 1A5SA 3GB6A 2ISVA 3NL2A 3SW6A 2JKEA 2WV8A 1GVRA 3CWOX 2GQAA 1RPXA 3ABSA 3EWBX 3E02A 5D2YA 2J9YA 1FCBA 2V81A 3STFA 1TREA 4I7VA 1KM3A 4O1DA 3I68A 3WK0A 1FDYA 1TTPA 1F76A 3H55A 4LVDA 4HT3A 1UBSA 3UY8A 1BWLA 1WBHA 3DI1A 4O0KA 1JR1A 2CLHA 1SW3A 3QW4B 1FCQA 3NQVA 3KVJA 3S5NA 4QJ1A 3BW3A 4LV4A 1LDCA 1X7FA 3CEPA 1R30A 4YWIA 3PB2A 1K8YA 3N14A 1ZENA 4FXSA 4CQ8A 2CZDA 4TIMA 1LRNA 3MI6A 3MWAA 4AB4A 3G1SA 3KHJA 4KFNA 5AN7A 1WX0A 4MUZA 3STCA 3L0KA 3IIXA 2B4GA 1TRDA 2ZZ7A 3CTLA 1OFAA 2CW6A 3NQGA 3NO5A 2AQWA 3C8FA 3W1QA 1OK6A 3L68A 4IX0A 1KFLA 4AXKA 4JTTA 5K3VA 3HIJA 4UFKA 3NQFA 1OABA 3RMJA 3RNDA 4QISA 3QEZA 3C4UA 5CPOA 3NQMA 4Z1DA 3C6CA 1CX9A 1M7PA 1LCOA 4AMAA 2X2GA 1B4EA 2Y6ZA 1TV8A 2ZRVA 3UYCA 1GWJA 1PE1A 5CPMA 3O16A 3QMSA 5DY3A 5HULA 1H7WA 3W2LA 3LI1A 3B0VC 1AL7A 1OFDA 3E0IA 3CPRA 1WXJA 3BG9A 4OQVA 3ZR4A 2B7QA 2CLFA 2Y85A 4UMBA 5GVJA 2HTMA 1LBMA 3QMRA 1XCFA 3A24A 3G8EA 4XZ9A 2VEIA 2ZZ2A 1BTMA 2C0AA 4FIRA 4QQ3A 1OF6A 3M5XA 3P84A 1T96A 1F74A 3MP5A 4JICA 4A2SA 2Q8ZA 1H63A 1TMHA 3DAQA 4LS0A 1VPXA 5J5DA 3LV6A 1DV7A 3M5VA 5C5YA 3MP3A 3WJXA 5DCDA 1EWEA 1DQWA 5D2TA 3NQCA 3OVQA 5K9DA 4OV9A 3N9SA 3LX9A 3QQ0A 3W7HA 3WFAA 3FEMA 4LVAA 4GFSA 2ZRWA 1NAL1 3W7KA 4FHAA 4O53A 3UWUA 4OU1A 1J2WA 2A0NA 4NXKA 1A53A 5F4WA 3LTSA 3TX9A 5DY2A 4NJGA 2NZLA 3BVJA 4HSNA 4M7SA 2YDAA 1QPOA 4BWLA 4FNSA 4JNMA 3VCRA 1PIIA 1EIXA 2WQPA 3UWZA 3NYZA 1VHNA 1AMKA 1SZNA 1ICQA 4ZZ9A 1LYXA 4Q32A 2FPVA 4FX6M 3W71A 1YTDA 2V9DA 1G7VA 3N2XA 3THQA 4ONVA 5LSMA 4UFLA 4Z1AA 3G1YA 1H7OA 3R2GA 4C1KA 2Z1BA 2ZTJA 2DZUA 3THAA 1QOQA 4L4LA 1Z44A 4UR8A 4LNYA 2YZRA 4P2VA 4XKYB 3SECA 2A5HA 2CLLA 3MBDA 1D3HA 1SO3A 1KA9F 1WBJA 3P60A 4UFJA 4MLRA 4AH7A 4Z1CA 2PCQA 2CZ5A 4O18A 4DF0A 4FEZA 3N3MA 5U4NA 1PCKA 2H8ZA 1YLVA 4IQLA 5D38A 5AYXA 3S5ZA 3TR2A 1EUNA 1W5NA 3W7CA 4YCOA 5HUOA 4A3UA 5DCEA 1AW5A 2X1RA 1XUUA 2HS8A 3A9IA 3W1LA 5H2ZA 5I3HA 1H7PA 3TV8A 1OVDA 3TAOA 5A5WA 3FOKA 5HR6A 1TQJA 3SI9A 2QUTA 5AHEA 4CQAA 6ALDA 4FF7A 2GQ9A 3W7RA 4JYFA 1ZAJA 1KBIA 3PUOA 2VFFA 3ATZA 1KTCA 2ABAA 3M5YA 2Y62A 1O94A 2TRSA 3ZWSA 1FY6A 3LHWA 2YFOA 2ZZ6A 3DKLA 3NXFA 3LTPA 1TYGA 4MY1A 3AO0A 2E68A 1AL8A 2CLMA 1LRQA 6TIMA 2J88A 2Y70A 3UNDA 1ME8A 4N9BA 1LOLA 5KMYA 1MEIA 3LXBA 3B0PA 1ICPA 4FO4A 4HNVA 1H7XA 1VS1A 1U5JA 1W5OA 1VYSX 3W2NA 3NNTA 3QW3A 4LRSA 3TMQA 3W84A 3W3OA 3BGJA 4Q33A 3P67A 1TJPA 4N9CA 3GKAA 2YCEA 3EEGA 4H6KA 3OVPA 1N7KA 1EP3A 1EX5A 2QCGA 1GVFA 4O4WA 4OGZA 4JY9A 3DFSA 2YYTA 3M0ZA 5HQEA 1ALDA 3HGJA 1LRTA 5C6MA 1HG3A 5E1QA 1JUEA 2ZZ3A 3RU6A 1VLIA 2R8WA 1L6SA 1IXQA 4RLIA 1L6WA 3IVTA 1TPUA 1VCGA 2C16A 3W7JA 1OFPA 1TPB1 3O63A 2V2DA 5DLCA 3RK8A 3PG9A 3HG4A 1XBZA 1VRDA 2YPIA 3RF9A 2WSYA 3GXPA 4PC8A 5CSRA 1RV8A 3OBKA 3C2OA 1TTQA 2DZWA 4RCXA 1B9BA 1L2UA 2I14A 3GR7A 4FNQA 5K4XA 4LC8A 4FNUA 2NWRA 5CPLA 1IXNA 4RX0A 2G95A 1VC4A 4IXHA 1Z42A 3R5EA 2D73A 4MZYA 4ADTA 1P1XA 4UTJA 1DOSA 1YYAA 1EP2A 2ABBA 5HUPA 3PAJA 3KRSA 3KVKA 2Y7EA 3W1NA 1RQHA 1KM6A 2F84A 1KBJA 5D02A 3O6YX 4N6FA 2Y61A 2A7NA 3TE9A 3LTYA 2PC4A 5K4ZA 4X2RA 3IGUA 4XUGA 4UFMA 1QO2A 2RHGA 3N34A 1QPQA 2A7RA 5LNRA 1GTEA 3CC1A 2Y7GA 4DEFA 3LRMA 4S2BA 4ZQNA 4K36A 3C56A 3FIGA 1LORA 4WQ6A 5I3JA 5G1TA 3NGJA 5I3KA 4HNUA 1SW0A 1V5XA 1OX4B 4OE7A 1OK4A 2YR1A 2BXVA 3S9YA 3O6CA 4IOTA 2GVJA 4XWUA 4QSHA 4FX7A 1W3NA 4IJBA 4K8HA 5FF7A 5TQLA 1OFBA 3DZ1A 5C55A 1O5KA 3STEA 3W07A 4LW7A 1S3HA 3UWWA 4UNKA 3K30A 1JRBA 3PBUA 3PBYA 3WJZA 3TCEA 2NV2A 3EWYA 3M47A 4XQ6A 2E5CA 1L6YA 4JTIA 3RLVA 4Q4KA 1DBTA 3JRKA 2OT0A 5D2VA 3S5YA 1S5VA 1R2SA 3NL6A 1W56A 1K3UA 1G4PA 1HL2A 4IPJA 5FF0A 1JCJA 1ONRA 3M5ZA 3HGSA 4NJJA 3GR8A 3NQ7A 4ML9A 2R94A 3G1XA 3MI3A 1WV2A 2YGYA 1DHPA 4GXMA 1THFD 3CB8A 4WUIA 3G22A 1BKSA 3DGRA 3Q58A 4Y90A 4GNJA 1QMLA 4UC5A 4AWTA 3ELFA 3I7SA 3E9AA 1TPC1 1X6UA 2RFGA 4KKXA 3OIXA 2ZRYA 3F03K 5KZEA 3GDRA 1LOQA 4JTJA 3O07A 1W5MA 3CQ0A 5LNVA 4BWLC 2E5BA 3VNDA 4D2JA 5DCBA 2LLEA 4CNNA 5CZSA 1F7BA 2C14A 3KOFA 1B57A 1JUKA 3W2MA 4AF0A 1QOPA 3N73A 1VR6A 4JYEA 1LP6A 1MXSA 1N8FA 1T0OA 4UTWC 3S1UA 1SSDA 3UPWA 1XBXA 3GDLA 3OVRA 3WK2A 1M6JA 4FNTA 1I4NA 3DFTA 2ZBTA 3G24A 4MPQA 1JCYA 4K39A 1E51A 2ZRUA 4WD0A 3EXRA 1XC4A 2IQTA 1H7NA 5EMUA 3KVLA 1AW2A 1JCXA 1TQXA 3CWNA 4WY0A 4JTUA 3NQEA 1ME7A 2TYSA 2G5WA 3LCIA 2EF9A 2QDHA 2WPBA 3GIYA 3DFNA 4N02A 1FX6A 4CLMA 1ZAHA 4K7VA 2P1FA 1OYCA 4NNAA 4IWWA 2TMDA 1EB3A 2ZZ5A 5FF3A 1G6CA 4M6PA 3C2FA 1RVGA 3IVSA 3TXZA 3TSMA 4XTIA 3PVFA 2FFCA 3EX1A 5LGXA 4A22A 4PH6A 4AF0B 1O60A 3G8RA 2EPHA 3SJ3A 2OJPA 3QYQA 3DKJA 1GYNA 5D33A 3S42A 4ZQMA 4M19A 4NZFA 4K6AA 2ZDRA 4ORIA 2ZCGA 3MYOA 3W85A 3GYEA 5KZMA 1GT8A 3W2KA 3QC3A 4K8EA 3L5MA 4CQ9A 2C18A 3G1AA 1X8FA 1TSIA 3I7RA 1TV7A 5ABTA 5F1UA 1TPDA 3NG3A 3IGXA 3P8JA 4IMCA 4O8RA 4IMFA 3G3MA 5BMXA 1YTKA 4TU1A 2NX1A 5LNUA 1RQBA 1FWWA 3O6DA 3ANYA 3IIPA 3LCWA 3DHDA 4OT7A 1XI3A 2RKXA 3C3NA 4IMEA 3GNDA 3OG3A 3NOEA 4YLWA 3DFPA 3SY5A 4FX8A 4NNBA 1IIHA 3CEUA 1FXPA 1LBFA 5D03A 3LERA 4E38A 2KZHA 1XDLA 3FYPA 3L21A 1OJXA 1XKYA 5L6UA 4KFOA 2FJKA 3KFTA 4JEQA 2EAWA 2I1OA 3FJLA 3UD6A 2YXGA 3BGGA 1SZGA 1GZGA 1VYRA 3S1WA 2QUVA 2VFEA 3UZJA 2OZ0A 3SZ8A 1R2TA 1SO4A 1O5XA 3BARA 5AHNA 3P5ZA 5DBTA 5E0KA 4JS3A 3UQNA 3O8AA 3W70A 3UY7A 2OX1A 3FFSA 1YPIA 5IBXC 1J5TA 1UB3A 2NXIA 4PODA 2Z2UA 4EVZA 2ZA3A 3PWAA 4NX5A 1L9WA 2V0TA 4OBTA 1R2RA 2HSAA 3LXCA 4KWWA 3ABQA 1ZJIA 3EX6A 3MMTA 4JTKA 1KM5A 2C3ZA 3TSBA 3GDKA 2HMCA 1EEPA 1HO4A 4O0ZA 5AHMA 3MHUA 4JXCA 5AC7A 1F6KA 5D2WA 2Y88A 1G4SA 2QCHA 4Y8FA 1GVOA 3W2JA 4CCCA 2CZFA 1A5AA 5BW6A 1LM1A 3W7DA 3V75A 3W7EA 4M5PA 1FWSA 1D3GA 4DO6A 1TJRA 3G3DA 4C1LA 2ALDA 1JQXA 1ZNNA 4RZ5A 3VE7A 2NV1A 4O4VA 3TFCA 5HINA 3QZEA 3UXAA 1I8JA 4DELA 1TIMA 2NUYA 3LXAA 4PA8A 3PBWA 2C19A 2A7PA 3TW7A 4E2DA 1KLYA 1FDJA 3CM4A 4JTSA 3DU0A 2YX0A 3PSWA 1HTIA 2H6RA 2PURA 3LCGA 1Q45A 4GBUA 3B05A 3JR2A 5DN1A 1X1OA 1KM1A 4UTMA 2A21A 5A8GA 4DBDA 3T7VA 4AAJA 4NU7A 4UUIA 3G1VA 3A22A 2QAPA 1X1ZA 4EOUA 3TIMA 5K7JA 4N6EA 2QUUA 1G69A 1U83A 2FLIA 3QFEA 2YW3A 3L67A 5HR7A 2DP3A 1M5WA 1SU5A 4LUIA 2Q8LA 4G1KA 4O17A 3SSJA 5E93A 3NPUA 3NQ2A 4LVBA 3NZRA 3USBA 1SR9A 1HFBA 5G1YA 4U28A 4RR4A 1I2NA 1T8XA 1W37A 1YPFA 3M43A 5T26A 3CLMA 3W23A 3W88A 3AJXA 3NQDA 1Q6RA 4JTGA 3INPA 4O11A 4TX9A 3BW4A 4UTTC 5AHLA 3H54A 1GVQA 5D2XA 3QPZA 4O28A 5FESA 2E6FA 1P0NA 3QF0A 4EIVA 1D9EA 2DZPA 3EB2A 1LOSA 3M41A 4UIOA 2AAMA 2J24A 2Y7DA 2VFIA 1PCWA 4LS2A 1FUYA 1I2RA 2EHHA 2W6RA 3F1QA 3UPBA 1F5ZA 1IGSA 2VELA 2AGKA 2VEPA 4U4MA 4B5NA 1VLWA 4A2RA 2A6NA 2BTMA 4OHQA 2P10A 4CNOA 1G7UA 1Q3NA 5KZDA 4WX2A 3FKKA 1JRCA 4GE8A 4RXGA 4UMCA 5F1VA 1QR7A 1EP1A 3BO9A 1H7RA 4EWND 3FKRA 4ZQRA 4DO4A 4ADUA 1SUXA 1PHWA 2R91A 3WJYA 4MZ1A 5AHFA 1W3IA 4MY9A 3W75A 4KFPA 1TTIA 4HPJA 2GOUA 3SIZA 2VOMA 4WZHA 5FEZA 5LGZA 2V82A 2Z6IA 2QKFA 3DH7A 4W9TA 1XM3A 3TROA 1JCMP 4O54A 3ABRA 3TQKA 5F2MA 2O7QA 2C13A 3EWZA 4JTEA 1YTEA 4IUOA 5SWUA 3F4WA 2BLEA 4I7UA 4AHQA 2I9EA 1UCWA 4PL2A 2ZA1A 2ZQ0A 2QCDB 3NEVA 1W1ZA 2H3BA 3TDFA 3C0JA 1K8XA 4MJMA 5LNWA 3LDVA 2DU2A 1XBYA 4JD4A 3MW7A 3P61A 2A1YA 3W87A 3B04A 2ZZ1A 1WQ5A 4N4QA 3LI0A 4GUGA 3EXTA 4MJZA 4R53A 2DJXA 2XN1A 4J9JA 2ZTKA 5FEPA 4ICNA 3MBFA 2E6DA 4UTUA 3BK0A 1PS9A 3M16A 3A23A 1TRIA 3NQAA 2J9XA 1WOBA 2B7PA 3GAKA 3W7GA 2Q3OA 4UTIA 3W1TA 3CT7A 2E09A 5L9FA 2TPSA 4UNLA 1FQ0A 3BG5A 3TQ0A 3A21A 1VQTA 1OFRA 5G5IA 3G1DA 3NQ6A 2JKAA 3NR0A 4LTSA 1C9DA 4I9AA 3DBPA 3BW2A 5HWJA 4CNPA 1MO0A 5DBUA 2RDUA 1V7YA 2V30A 5AYYA 1AK5A 4MYAA 5AYZA 1A5BA 1IXPA 3M6YA 3HF3A 4HNTA 5F2GA 5C2XA 4BK9A 2YYUA 1TO3A 2ZRXA 1Q6LA 3PULA 2GJNA 3T44A 4A29A 1FWNA 2J9ZA 4KWVA 1F2JA 1P0KA 3LLFA 4K37A 5I3FA 5DXYA 3LHTA 2J6XA 4L4MA 4M6QA 3LHVA 5EL1A 4JDBA 2Z0IA 1XUZA 3LRLA 3WK3A 1TPH1 1DQXA 3PM6A 5CZ0A 1B3OA 1EPXA 1ADOA 3BPWA 5D09A 3QJAA 3W86A 2EGZA 4JDYA 1FWTA 1KM4A 3N19B 3OHIA 4Z0JA 1OX5A 2Z6JA 3FJ6A 1JULA 1QWGA 4S2CA 3HMJG 4LRTA 3NA8A 3R8RA 1JUBA 1K02A 3W7LA 4E0CA 3W1PA 3H53A 3C61A 1KTBA 4JTFA 3NM1A 3LBCA 1FDZA 5LKYA 1QPRA 1A50A 3HG3A 3TQVA 1GG1A 4LOCA 4MVAA 1OFQA 2Y63A 4WOQA 3FYOA 3KAOA 1LLZA 2ATSA 3IGSA 3GX9A 1WYIA 3TSDA 2CZEA 3N2MA 3TAKA 4HHPA 2A85A 3QSRA 2FIQA 3W9ZA 4ZQPA 3R89A 3L0NA 3MUXA 5DELA 3SR7A 3EWUA 4ZL1A 2XFWA 2G96A 1YDOA 3VI2A 3E12A 3M9YA 2CU0A 2FQIA 4GUHA 1H62A 4IXXA 1W54A 3PR2A 3VFLA 3TU9A 2CLOA 1KFKA 3V1PA 4X3ZA 2C6QA 1DVJA 4BFAA 4Z0SA 3EKZA 1H51A 4HIBA 1S5WA 4JR5A 1TTJA 4A21A 1GJPA 1RR2A 4OWGA 3TNOA 1W31A 2B7NA 5F4SA 3QRHA 3DFQA 3TUUA 1T99A 5CG7A 4YCPA 3MO7A 3W7NA 4E2BA 4O12A 1H50A 1G4TA 3LB0A 3TC6A 4IGHA 2ZZ4A 1TPVA 4O52A 3W74A 1R47A 3HQ1A 2ZA2A 3GXNA 4YXGA 5BOOA 2QCCA 3CHVA 3FA5A 3WK1A 4X22A 1LZOA 1KM0A 4RJEA 3F4NA 4PTNA 4JTLA 1NVMA 1Q6OA 1NSJA 4MYXA 3T55A 4X9SA 3L2IA 2WO5A 3WJWA 2NUWA 3C2VA 3IIOA 2QJIA 3KRUA 1NFBA 1MEHA 1KFJA 4NX0A 3NL5A 4JTHA 2JK2A 3G1HA 4UR7A 8TIMA 3W1RA 2QCEA 4ALDA 1FXQA 3SGZA 1OX6A 2UV8G 5F2LA 1YADA 4HNNA 3EKLA 4FB7A 2NXHA 2X1UA 4RKAA 4O10A 4N9DA 3TA6A 3LHYA 2YSWA 4PCFA 3IV3A 3LCFA 2HS6A 4RZ4A 2H8XA 5K9XA 4JX5A 1GPWA 3L9CA 4WJEA 4Z1BA 3PSVA 1TPWA 4O1BA 1SO5A 3P7YA 5LZLA 2B0MA 4JIPA 5DXXA 3PS7A 2ZRZA 3YPIA 4BI7A 1XXXA 1R46A 4HKPA 5G2HA 3S5OA 5H91A 3A5FA 3O06A 4K7YA 1HUVA 2CLIA 3HGRA 1GTHA 1WOAA 1XBVA 3L5LA 3EWWA 4NZJA 3LV5A 4XTDA 1SO6A 1B4KA 1O4UA 2OMAA 2QR6A 4N2YA 4UFHA 5F2IA 4QITA 5G4WA 4HN4A 1S5TA 5KSWA 3DFOA 5FF4A 4PL1A 1QO5A 2H3DA 3PUDA 4H4IA 4IX2A 3M1ZA 1LBLA 1JVNA 1QNVA 3LBMA 5FEXA 3C2RA 1HO1A 3O05A 1PV8A 2V5LA 3VKJA 1OYBA 1BEUA 1RZMA 3I7QA 4LT9A 3W1XA 4H3DA 3W7IA 1OFOA 5AB3A 1W5QA 3W76A 4LS1A 3S6DA 2E6AA 4UFIA 3UZ5A 3TK7A 1EWDA 1H5YA 4NNCA 3QQ1A 3MHFA 5BMWA 3T78A 4MFEA 1GG0A 3LOTA 2A2IA 3VE9A 3Q2DA 3I65A 3FLUA 4LV9A 4MIMA 1LROA 5EA9A 5EPDA 1K03A 2QCMA 4WOZA 2BSLA 3M44A 4UTLA 3NM3A 4JYDA 3HGOA 2VFGA 2ISWA 1DL3A 3GVGA 2ISSA 4Y6GA 1JJKA 1PHQA 3G0UA 5AHIA 3R13A 5I3GA 3W1UA 4AWSA 2ZFAA 3B03A 1TB3A 2PE4A 5IBXA 5LNSA 5G2IA 1YDNA 3W7QA 2Y89A 3W83A 3TKFA 2FPYA 2VC6A 3OEXA 4NVTA 2V2HA 3BG3A 1ZFJA 3NPXA 3TW6A 5EY5A 3ZS4A 1K7XA 2QJGA 4GC4A 4UMAA 1W5PA 4QNWA 1CI1A 4NQ1A 3TC7A 4XBKA 1QAPA 1G4EA 4NJIA 2VXNA 3FS2A 5EKYA 5C54A 4AHPA 5FEWA 1TCDA 5CZTA 5CGQA 3W7OA 2H90A 4O19A 1H61A 2A4AA 2NX3A 4UTKA 4DF1A 5HMSA 3CU2A 3R12A 4QM1A 3UXDA 1WDWA 2QDGA 3LHZA 4LVGA 5K2ZA 2VFHA 4NXSA 4WY0B 1I2QA 3PB0A 1KLZA 2WNNA 2PRHA 2PRLA 1K7EA 3LLDA 1KTNA 3L5AA 2RDWA 3TFXA 3TJXA 4QIUA 2QCFA 4ZQOA 3QM3A 4WY0F 1OG0A 5EBUA 3EX2A 3W73A 4GUFA 3TMLA 3UWVA 5U7SA 2E1DA 3P82A 3NAVA 4BF9A 3EX4A 3Q37A 2W79A 1AG1O 5MHBA 1KV8A 4M6VA 7TIMA 3C2EA 4O1CA 1VJIA 1FCVA 1AW1A 1O95A 5KTLA 4XKYA 3W22A 1GOXA 1YDVA 2VENA 3W2UA 1GEQA 4ZVJA 1F6PA 4GJ1A 1XDMA 3DHFA 3BLIA 3PC0A 1BWKA 1RD5A 2FB2A 4N4PA 1GYLA 3MYPA 1ICSA 1IF2A 3QMTA 3UWQA 1KV5A 1MEWA 2DZSA 4MKNA 2QCNA 3HO8A 2GQ8A 2E77A 3L0GA 4JX4A 2VEKA 3B4UA 2NX9A 1VYPX 3ATYA 3B06A 2V2CA 1IIGA 1WAUA 4JX6A 2C1HA 5G2WA 1W0MA 3NDOA 3PF3A 4LC6A 4UXDA 4RV8A 4XBSA 2B7OA 2X1TA 3RLUA 3M7WA 1MSSA 4NT0A 1OFEA 4RZ6A 1VCVA 3GXTA 3HPXA 2GUUA 2WNQA 1P5BA 3W7PA 1ZALA 2WNZA 2WKJA 4QNEA 2E5DA 3LRKA 3LCLA 3NPVA 3MHGA 4FXRA 4UTTA 3T4CA 4BI6A 1H60A 2FDSA 3PUEA 1I2OA 1ZAIA 1NF7A 2FB3A 5BRBA 1KM2A 1PVNA 4EF8A 4DBEA 2ZYFA 5K9CA 3GKFA 1FBAA 3S0CA 3NQ8A 2XN2A 5D37A 4DPPA 2FPTA 1CW2A 4FNRA 3BLFA 4CCDA 1KW1A 4TO8A 2JBMA 3HPSA 5LHEA 2Y7FA 4O14A 2GVLA 1SQ7A 4EF9A 1DORA 3W7MA 3BV4A 1WA3A 5CZJA 4ZQCA 2BWGA 2DZXA 2F7FA 3NVTA 4LUJA 1Y0EA 2R14A 4PFMA 3ZFHA 5LHFA 2X1SA 1TPFA 3HG5A 1GVSA 2JKPA 4O50A 1SZFA 3G18A 1VGAA 2C15A 3GZ3A 1YXCA 4MOZA 4RK8A 3GNNA 1P4CA 3P62A 5KITA 2DZVA 2CWNA 2QCLA 5FI8A 1M7OA 4GUIA 3O15A 3P74A 2JGQA 3G1FA 3P80A 4PEKA 4O16A 3S1VA 2GJLA 1FCUA 1NEYA 4JGDA 3RFAA 3E49A 4DQWA 4UTHA 3HPZA 3T40A 2OT1A 2W0UA 1UUMA 1QFEA 3ABOA 3TH6A 3SFKA 5G4EA 3GLCA 3KRZA 1KFCA 3DENA 1LTDA 3CIXA 3E96A 1SFLA 3P81A 3GDTA 1ME9A 2G97A 4GWEA 3STGA
chains in the Genus database with same CATH superfamily
1ZQ5A 2PDBA 4I7WA 4E2OA 4XD3A 3KXQA 2WOQA 1XWYA 4MFDA 2E4TA 1POKA 3I6TA 1KFEA 4PCNA 3NL3A 2P0OA 4E3VA 3DGBA 1TPEA 3CYVA 3NSMA 4C6LA 1C8VA 4Q8NA 2BY1A 3IIZA 2PDYA 1RPKA 1R38A 2BGNE 1FWAC 3EX3A 2ACQA 3H7RA 3I6EA 1XFBA 2NLIA 3PAOA 2YIHA 1A47A 1C8YA 3NPWA 4IJCA 3D6NA 4PCTA 1EXBA 3UZZA 4QDPA 4NUWA 4JN6A 3M0JA 4AVFA 4LBRA 1J4EA 3H2EA 4JTCA 3O9NA 3DEQA 2XJ7A 2WMIB 3UR7A 5CPSA 3SRHA 4P8XA 1XHGA 1UR2A 4XAZA 3KTSA 4OUIA 4D6DA 1SW7A 4UTFA 4RPPA 5EMLA 1HQTA 5I3IA 2WMKA 4GY0A 1JZ8A 4O57A 5GJPA 3WNNA 4S1FA 1SSGA 4HHLA 1LQ0A 4HPHA 1VCFA 4XZLX 4XUYA 5JBEA 3AZRA 1V3HA 1VZWA 4YL2A 1QBBA 2Y5SA 3T0BA 3MQTA 3MP4A 1K8ZA 1OYAA 3EBVA 1J2BA 4DUXA 3N25A 2R24A 3NZ1A 1E5NA 1ZRQA 3B97A 3IK2A 2V63A 4R33A 1EUAA 1SPQA 1B1YA 5MKGB 1UJPA 4LWWA 3W6YA 3TLQA 4AD3A 2XSXA 4AD5A 1PPIA 1CENA 3N9RA 3EWXA 4NRRA 2EKCA 2V5BA 3HB9A 1FA2A 1PEZA 4LY8A 1QCWA 2O55A 3VXGA 3WNOA 4Y9AA 3EWDA 2O9RA 4QLLA 1PL9A 5FJJA 3MI2A 3PBVA 3RO8A 2Q3RA 4ZGYA 1MZHA 1QPNA 3DHUA 3S8HA 1A5LC 1M53A 2CFFA 3WF3A 2WMFA 1SMAA 1P1MA 4GCAA 1V77A 4I5XA 3LCXA 4QBXA 1XD1A 4GKTA 5A6BA 1M7JA 4H83A 3WBAA 2XN0A 5FJOA 3N13A 4NILA 3T9PA 4DO7A 1UD8A 3TJLA 1GKPA 1HJUA 3O7UA 1DJQA 1QDSA 2NXGA 3QBUA 5KZ6A 3UWYA 1WPCA 4IJRA 4YYCA 1RAKA 1VH7A 4YMZA 1XL9A 2XM1A 2PDFA 3SGUA 5DMMA 4QG6A 1O5QA 4Z2JA 4O0QA 2WVUA 1IEWA 1BXNA 1B3WA 5AOUA 2GJXA 4I9TA 5J5RA 4S3EA 1O12A 3IVUA 3GB6A 3NL2A 3BSHA 1EJ7L 3CWOX 5BU6A 2VT0A 5CJNA 2J9YA 4LUYA 4D6FA 1EC9A 2YA1A 4EX4A 3WK0A 1TTPA 3TJIA 1F76A 3H55A 4LVDA 1UBSA 3DI1A 2IKJA 2G37A 4W89A 4AEEA 3QW4B 3ZQ9A 1FCQA 2GQ3A 3NQVA 3KVJA 2NV9A 4QJ1A 4LV4A 1X7FA 2MNRA 3FSTA 3Q4DA 1IT8A 3BAXA 1DJIA 2OXNA 1ADDA 1CGYA 2KX9A 3O0KA 5JBFA 4NZ4A 3NVDA 2ODOA 1R87A 5AN7A 2DIEA 4GFIA 3STCA 3THCA 3PZ9A 5D9PA 5F7UA 4WF7A 1QHPA 1FHLA 5HQLA 3CTLA 3WH5A 3OB8A 4Q4OA 4IPNB 3POCA 2DT2A 4Z2KA 5K3VA 2BMBA 4YJ5A 3RIKA 3MCNA 1LUCB 2AKZA 4J1OA 3SCVA 3RNDA 1UR8A 5EMYA 1KR1A 2ZRVA 1TKKA 3O16A 5DY3A 1H7WA 2EJ1A 1XPGA 1CEOA 3II1A 1UWUA 4AIBA 3B0VC 5XIMA 4LYQA 3LZ5A 2XH0A 4B2DD 1VKFA 2CLFA 3KDNA 4PUMA 4UMBA 1UR1A 3F2DA 3GU9A 3LPGA 4I3GA 2X0YA 4FIRA 4H9UA 1ESWA 1OF6A 3P84A 4JICA 4C5YA 3TTQA 1H63A 3T2OA 1UA7A 1BXCA 1TCMA 3WFZA 2GZXA 1VPXA 5A8OA 1UJQA 3G6MA 3LV6A 1YW1A 1F8IA 5DCDA 1EWEA 1DQWA 4HZ6A 5D2TA 3D3FA 3AXHA 5K9DA 2YB1A 1VFFA 2D2HA 3EPMA 4OV9A 5C7VA 3QHMA 3PFMA 5H8PA 3W7HA 4GZ7A 5JH2A 1W1PA 1IT7A 3GXFA 1F8MA 3UWUA 4OU1A 4CEUC 2OPJA 1DQUA 3A4AA 1F3TA 5I7GA 4KERA 3S2MA 3CT2A 3N3TA 4NJGA 3VOIA 2NZLA 4ZFMA 2DT3A 1QPOA 3CL6A 4BWLA 4BHYA 3VCRA 1JGMA 5HJYA 4FF5A 3UWZA 4F4RA 4AZCA 5C8BB 1AMKA 2R1PA 3TTEA 4ZZ9A 4Q32A 4FX6M 2V9DA 1G7VA 4NAEB 3MC5A 4WKHA 3VDAA 5LSMA 3EOEA 3U4FA 2GGHA 3THAA 3ZVIA 1Z44A 5BCAA 2BVDA 3F7JA 4CCZA 4Q4PA 4P2VA 1AODA 3KW3A 2CLLA 3MBDA 1D3HA 1XSIA 1KA9F 3OLEA 3GYCA 1JFHA 2PCQA 1UKQA 2X41A 4DF0A 3T0TA 2H8ZA 5D38A 5AYXA 1PSCA 3S5ZA 1E72M 2G3JA 2I16A 1W5NA 4A3UA 4X61A 2X1RA 3BJSA 3PZUA 2HS8A 1AQMA 2XGBA 2WC7A 2JFEX 3TV8A 1R3TA 5LIKX 1TQJA 3SI9A 2VEFA 1M3UA 4FF7A 1ZAJA 1KBIA 3UXKA 3ATZA 3M5YA 4Q7NA 3SAZA 5DT5A 3LHWA 2HRWA 3WD4A 3QOMA 2ANUA 1TYGA 1UWRA 2OELA 6TIMA 3AS2A 1LQAA 5B7ZA 3DIPA 5DRCA 1NOFA 2CESA 4N9BA 1XLGA 1LOLA 1OD0A 1MEIA 2Z1VA 4J3VA 1H7XA 2V3GA 2VX7A 1VYSX 3W2NA 3V35A 1E9LA 3LD5A 3BGJA 3PWGA 4FAMA 3N18A 2YCEA 4JNZA 1Y7VA 3OVPA 4HTYA 2WHMA 1IEQA 4OGZA 3R8HA 3DFSA 2CNCA 4ZOCA 1EJRC 4U3AA 3QV7A 5C6MA 4D6HA 2VZSA 2VQTA 1KQZA 3KCLA 4GVGA 1L6SA 1IYXA 1UOZA 1L6WA 1CT5A 1ITUA 3ZXWA 1TPB1 1POJA 5DLCA 4L5ZA 1VRDA 4BEQA 3GE7A 2VL4A 2D1ZA 3QZAA 4LJ3A 3IJ6A 2DZWA 2GLKA 3GR7A 3WEMA 4GI6A 4FNUA 2NWRA 5CPLA 4F48A 2G95A 1KXVA 1Z42A 2NQ5A 3R5EA 4LUSB 2GDVA 4ADTA 1DOSA 1UWTA 5LA2A 3KRSA 1PZ1A 3KS5A 1KM6A 1KBJA 1FVPA 5K4ZA 2DIJA 4X2RA 4C6DA 4HHMA 4EPDC 3M0IA 3QV6A 4UFMA 1QO2A 1ENUA 2VMFA 2RHGA 1FWJC 2XWDA 1WDPA 3VMNA 1QPQA 5LNRA 2Y7GA 2BASA 5HXMA 4GNVA 4QDMA 1BHGA 3M6DA 1N82A 5DT7A 4GZIA 4S3CA 1LLOA 3NGJA 2Z26A 2ADAA 3UW6A 2OZ3A 4B16A 4FX7A 4IJBA 2ZC8A 3GC4A 4QEHA 4K8HA 4PUJA 5TQLA 1OFBA 4PMXA 3STEA 4KGJA 3BLKA 1MQQA 3E0VA 4UNKA 4A3QA 4M6UA 3PBYA 1DWFM 3TCEA 4MAVA 4ECLA 3S83A 3M47A 1OB0A 1AJZA 4XQ6A 4J7RA 4JTIA 4Q4KA 1DBTA 3NYDA 1PTAA 3VD9A 2O92A 5FJUA 1S5VA 1R2SA 2HVNA 5BZAA 3IANA 1K3UA 1HL2A 1GZ1A 1JDCA 4AVNA 3M5ZA 3CAVA 4NJJA 3NQ7A 1RBAA 4CD6A 2YGYA 2VX4A 3A3XA 1B3ZA 4EE9A 7A3HA 4J28A 2HISA 3IUDA 3V4BA 4UC5A 1OWQA 4AWTA 4C1NA 1UC4A 3I7SA 3Q67A 3WQEA 2O4QA 1Q6GA 4KKXA 2NQLA 5CLWA 3NEHA 5KZEA 3O07A 1U30A 5LNVA 4BWLC 2E5BA 4FPSA 3UPMA 2YL9A 3SCRA 2LLEA 4CNNA 5M2FX 5CZSA 3DDMA 4A6GA 5CLTA 3W2MA 1J18A 3EDFA 3PJWA 4HNCA 4JYEA 1N8FA 5A1AA 1PXGA 3S1UA 2PDPA 3VM7A 2ZUNA 3OVRA 4GGBA 3WK2A 2IS7A 4Y7EA 3G24A 3BAKA 4E4FA 4K39A 4QJ3B 1ZSXA 1XC4A 5EMUA 1JCXA 1TQXA 2WBKA 1V79A 1IR1A 4JTUA 3ZT7A 3M46A 4AYGA 1ME7A 3WF0A 1HJVA 4PUNA 4RDVA 4ES4A 2G5WA 2WPBA 2NW0A 4HJWA 3GIYA 4N02A 1FX6A 2VZOA 4XZBA 1XX1A 3C3UA 2HNEA 4PN2A 2P1FA 3H26A 3KWXA 3LNPA 2TMDA 3FGCA 5I00A 3SUSA 3EMCA 1EB3A 1NP2A 3KBSA 3TXZA 4GQBA 3TSMA 4XTIA 3PVFA 3GVWA 4QJ4B 2FFCA 4QHRA 2P0IA 5LGXA 5M17A 1TE6A 1CLXA 1OCBA 1TJ0A 3TEVA 2J6VA 3DKJA 1GYNA 5D33A 3WF1A 1Q7MA 4NIRA 1UBPC 3FA4A 4ZQMA 5HNNA 1ZJAA 3CHEA 3LG3A 4K6AA 2ZDRA 1X98A 3W85A 4ACZB 1TWIA 2PGWA 1BGGA 4LFYA 4K8GA 3I10A 4CQ9A 4CN1A 4KEZA 1TSIA 1TV7A 1FWBC 3WUBA 3IGXA 4IMFA 4MNJA 1JDAA 4LF2A 1KCXA 1ZU8A 2ZXAA 1Z69A 3IIPA 2BOGX 2RKXA 4AZIA 4Z42C 2R9RA 3AQUA 4XZWA 2V5JA 4NNBA 3R0UA 1FXPA 3LERA 4E38A 2KZHA 3WH9A 3FYPA 3S5SA 3LNMA 1XKYA 5L6UA 4AVOA 2Y5EA 4JEQA 1E0VA 3R11A 1XRTA 1UPPA 1ZJHA 3UD6A 2YXGA 3BGGA 4XX6A 3TYAA 1SZGA 1VYRA 3S1WA 1MVYA 1ITXA 1QJWA 6TAAA 1QATA 2OODA 1E5JA 3CL8A 5C2GA 1O5XA 5AHNA 5FL0A 2WK2A 4ZEPA 2CHRA 5AVHA 3UQNA 3W70A 3FFSA 2IXVA 1YPIA 2OKOA 1H1NA 4EVZA 3H23A 3UXLA 2V0TA 4AZ6A 2HSAA 3ABQA 4GO9A 4XD4A 1MXGA 3NURA 2HMCA 3LGDA 5AZ1A 1R3SA 5AHMA 3RN6A 2Y88A 3CASA 3GH5A 5FJRA 1NIUA 5IXEA 3FVDA 3W7DA 2EG6A 5D9NA 1XPYA 4WGHA 3G3DA 3OU8A 1B30A 3E1F1 5C9RA 1KBKA 2J7BA 3WDRA 3PHAA 3TFCA 3BDKA 2VYOA 1ZBWA 4G7FA 3FN9A 1BWVA 2ZIDA 3WLQA 3PZTA 2GDUA 4E2DA 1XINA 2XIBA 1Q6FA 2INFA 3PSWA 4GBUA 4HTBA 3JR2A 1V0KA 3QHOA 1CZ1A 2QUMA 4UTMA 3LS9A 2A21A 2G3IA 4GPNA 1BRLB 3T7VA 4AAJA 3BLOA 1KC7A 3S47A 5REQA 5K7JA 4ROPA 5GQBA 1U83A 5CJ5A 3DC8A 2PBGA 4HB7A 3SN0A 2O4MA 5XIAA 2DP3A 1SU5A 3B0YA 2EO7A 4AZCB 4PMZA 1XISA 3ARWA 3BE7A 1SR9A 3F2BA 4AX6A 5G1YA 1FKXA 3NZQA 4RR4A 1JDFA 1T8XA 1QBAA 4PRTA 4I8DA 5HMFA 3T0AA 3AJXA 4DN1A 4O11A 3BW4A 1KGWA 3WLPA 1D9EA 2DZPA 3EB2A 4J2MA 2F2KA 4IQEA 4UIOA 4D1IA 2AAMA 2D0HA 1PDZA 4UBPC 1PCWA 3IS4A 1K8CA 1EBGA 3EPNA 4DAFA 3V1HA 3M7SA 3VD5A 2HNHA 4I90A 3M0HA 1VLWA 2X7VA 1Q8AA 1UMYA 3FKKA 1L8PA 3D3AA 4ZO7A 4QR6A 4MUPA 4LNCA 1SVDA 2R91A 1E43A 4W4QA 1B0IA 4N7QA 4Q4MA 2PTWA 4S38A 4MY9A 5AHFA 2YA2A 3UG4A 4Q8PA 3VNIA 2W5FA 2VOMA 3TYCA 5LGZA 2V82A 2Z6IA 4V27A 3DH7A 1Q63A 3KOWA 4WSHA 5EGRA 4G7EA 3ABRA 3AIBA 3TQKA 2O7QA 1TE1A 1YTEA 3PBGA 4IUOA 2BLEA 3CIVA 2JQXA 2PI6A 3EB4A 1W1ZA 1JYVA 3LDVA 1XBYA 1S3TC 1UQZA 3BGAA 4P8UA 5C9XA 4JEJA 4MDPA 3P61A 3EWCA 1RSCA 2J7CA 3FHAA 4LB4A 4DM2A 1E1CA 4ATWA 3O0FA 4MKSA 1JNEA 5A6BD 1QHOA 2XN1A 3B9EA 2G8ZA 3C8NA 2QLYA 2ZX8A 5FEPA 3G5EA 4UTUA 3M16A 4CD4A 1HIZA 3A23A 1TRIA 3NQAA 3R25A 2J9XA 4D1JA 1K9FA 3GAKA 2Q3OA 1EOKA 5A8PA 5C9UA 4ICCX 2E09A 3NXLA 2C71A 3BUVA 4UNLA 2WYSA 2JIEA 3BG5A 3EYPA 1OBAA 4Y8EA 4HMDA 1WZMA 3SFWA 1OFRA 2JKAA 3QC0A 4AYSA 1C9DA 1YQ2A 1E1FA 5HWJA 1MO0A 2RDUA 1V7YA 3LMZA 4ZXOA 4DJFA 5AYYA 4Z2LA 4LPCA 4J3WA 3RM8A 3VA8A 4FOUA 1DWHM 3HF3A 5F2GA 3T2PA 3CGTA 4WDWA 1OC7A 3OBEA 3GZAA 3PULA 3N2CA 1FWNA 2J9ZA 4KWVA 4P7OA 3OLDA 1P0KA 3SIMA 5I3FA 3LHTA 1TUFA 4XIAA 3K13A 2E40A 5EL1A 4CQBA 4JDBA 3GNOA 1WDDA 2Z0IA 3LRLA 3CV1A 3T08A 3PM6A 3NFUA 5CZ0A 1GYMA 2CITA 3IARA 1ADOA 3U48A 3GS6A 3QJAA 4UQAA 3W86A 1B90A 4JDYA 1RY8A 1FWTA 4KRUA 3N19B 3WLSA 1OX5A 2Z6JA 4JN7A 1QWGA 2PTZA 1FWFC 5I02A 1HVXA 4TTUA 3EZ4A 1QW9A 4BQ5A 4FR6A 1JUBA 1XF0A 3MDUA 3NM1A 3MPGA 3LBCA 4A3YA 3UGRA 1A50A 2B31A 3DUGA 4LOCA 4FOJA 4CQDA 2P5NA 1Q2SA 3KAOA 4S39A 4PBEA 3IGSA 3GX9A 3U2ZA 1Q7QA 3N2MA 3TAKA 4HHPA 4ZSTA 3C0LA 3L0NA 4Q4SA 1UP0A 3EWUA 4XBJA 1YDOA 3VI2A 2CU0A 2FQIA 4C6BA 4D6IA 4GUHA 1H62A 5E6ZA 1PYMA 3PR2A 3VFLA 1Q6DA 3IACA 4Z0SA 4HZ7A 3EKZA 4JFUA 1XJBA 2PGFA 3E74A 2ISDA 4UOJA 3TA9A 1W31A 4ZCWA 1QUMA 3ITXA 3TZNA 4HJFA 3TUUA 1SJDA 3MO7A 3W7NA 4LEQA 4JQAA 2OSYA 1H50A 3LB0A 4IGHA 2ZZ4A 2BDQA 1RCQA 3AROA 1LWHA 5BU9A 1BQGA 3HQ1A 4YXGA 3PJTA 1HW6A 4PMQA 4F66A 5IOBA 4HCDA 3CHVA 4OJYA 5A8NA 2VC7A 3FA5A 3OVGA 3KE0A 4JL2A 1LZOA 4RJEA 1ZL1A 2BY3A 3F4NA 4D9PA 1OM0A 1Q6OA 4DWSA 3T55A 3REQA 1W17A 4GZEA 2WO5A 1O1HA 3QR0A 3PTMA 3BMXA 1YRRA 2JK2A 4UR7A 2ON3A 2ZUTA 2QCEA 3H2MA 1OX6A 3AMKA 3W0KA 1YADA 1DTNA 3EKLA 1US3A 3FK4A 4CVWA 4JFVA 3TA6A 3FVMA 3LHYA 3LA4A 2YSWA 3IV3A 2HS6A 5FJIA 4RZ4A 1GONA 5K9XA 3L9CA 3LY0A 4Z1BA 2PTXA 3PSVA 4GLEA 2OYKA 1W3JA 1TPWA 4O1BA 1ELSA 3P7YA 3AIQA 1S2VA 3BAJA 2ZUWA 4BI7A 1XXXA 3PNUA 3APYA 1Q65A 5G2HA 1EF3A 2WJEA 3SQMA 3EOSA 3UCQA 4UOZA 1MUCA 3VUPA 1HUVA 1Q2RA 3HGRA 5FJPA 1WOAA 2YXXA 4NZJA 3E0WA 4C6NA 4W88A 2Y4SA 3BMWA 3H12A 1FHUA 4ZENA 1QASA 5FF4A 1G5AA 4PL1A 3LYEA 4BF7A 3T8QA 4IX2A 2XH4A 4YTTA 1IGWA 2MANA 1JVNA 1QNVA 3VNZA 3EDJA 2RAGA 2JEPA 1XSKA 3EPOA 2NSOA 3TN4A 5MKGA 1OFOA 1W5QA 3S6DA 5G4HC 1UR3M 5A69A 1G01A 1E6NA 3TK7A 3VGDA 2GK1B 4NNCA 3QQ1A 1QI4A 4MFEA 4LALA 1XC6A 3LOTA 2ZWZA 4D72A 1IEXA 1XRSA 2WJDA 4LV9A 1XGZA 4GO8A 5EA9A 4H6QA 2BSLA 3CUZA 3HGOA 3K8MA 3OZPA 4JL1A 1CECA 2D22A 3QY6A 2ZVRA 2X7WA 2VCBA 1PHQA 5AHIA 1EOMA 5LNSA 3GIPA 4NZ3A 3TKFA 1U1HA 3NPXA 2FZMA 3WENA 3S2LA 3ZS4A 2QJGA 3H4GA 4KBXA 4QNWA 1CI1A 1IQ8A 1UR4A 3WLHA 8XIAA 5DFAA 1CLVA 3Q65A 4IZGA 4NJIA 1VBGA 3RCYA 4PB4A 2AQVA 4TXEA 3W02A 5FEWA 1TCDA 4JCLA 2DSUA 1ZP3A 3GG7A 4UQCA 4KESA 3UCDA 3SY8A 2A4AA 5BXTA 4I9JA 1P6CA 2DSWA 3CMFA 3LHZA 5K2ZA 2VFHA 1PX3A 3VINA 1KLZA 2FTWA 8XIMA 2W92A 2WNNA 3LLDA 1W9BM 4PMVA 1R3WA 3TFXA 4QIUA 4FXJA 5EBUA 1UKSA 1TR1A 1XYAA 1MDRA 3A4WA 3P82A 2VWTA 1UZHA 4D6CA 3CWHA 4IGMA 5MHBA 3KHDA 4M6VA 1Y5WA 4O1CA 1FCVA 3N6JA 2XSBA 3SN4A 2PDJA 5EMJA 1QW8A 3AIVA 1UWSA 1LF1A 1ZCCA 1HKIA 1DIDA 3LK6A 2YCJA 4YVXA 4MPKA 4N4PA 1GYLA 3B8UA 1PZ0A 3ZSSA 4YVPA 3L2MA 1XLBA 2F9RA 1XLIA 3UWQA 3V0UA 4HD5A 3UJRA 2GQ8A 4HPGA 2NX9A 4DX3A 3GVVA 2V2CA 2WXDM 3N17A 1W0MA 3NDOA 4RV8A 5BXSA 1MSSA 4I8YA 4IP5A 1OFEA 3TP4A 4Y9MA 1J12A 4CNTA 1S5MA 4GACA 2E5DA 3IAPA 5ABGA 4FXRA 4BI6A 1PZ2A 2FDSA 3PUEA 1DE6A 1NF7A 3THUA 1JXKA 1OCNA 3OODA 3LQGA 1H0IA 1EC7A 4HK5A 4MF4A 3ARRA 1JXJA 3MWCA 4XIMA 5DX7A 3UF9A 2FPTA 3VABA 4M1BA 4PCPA 3NIYA 3P14A 1V02E 2BFGA 5J04A 4PULA 4P7QA 5I77A 3WDPP 4PMNA 3VIHA 2Y7FA 4C6IA 2GVLA 4EF9A 3W7MA 1UKOA 3OIHA 1UW9A 3HN3A 3NVTA 3CQIA 2R14A 4YHGA 1U33A 5HANA 1ISZA 4F0MA 2J75A 4QRNA 4GG9A 1YDYA 3QXBA 1YXCA 1BQCA 2VDIA 1FFQA 5CEWA 3XISA 1CXLA 2DZVA 4FZIA 2CWNA 1WP6A 2QCLA 3FJ4A 3RM9A 3O15A 3P74A 2JGQA 2VR2A 3VOCA 3VNJA 2GJLA 4WJXA 4B4FA 3GY1A 4GVHA 4F0SA 3T40A 2V68A 5AECA 4DLMA 3UG5A 3GW0A 2ZXDA 1QWKA 1KFCA 3DENA 3CIXA 2G97A 3RRAA 3LHUA 4LAMA 4MZ8A 1YNPA 3PY2A 2HV5A 4FIQA 2P53A 4AEOA 3NWRA 4AWUA 1H1ZA 5AC8A 4PSRA 1XLEA 3QKZA 1ZHAA 1S1RA 3PN8A 2XIMA 1MYRA 2GUYA 1ZY9A 2WWDA 1GQNA 2ZX6A 2YL6A 5TBOA 1IWPA 4TR9A 1TV2A 4DPQA 1IV8A 1E6RA 2CLKA 3VOGA 2QS8A 3RLHA 2PWVA 3B3DA 3GHTA 2YW4A 2V8ZA 4FLOA 3JS3A 1PKYA 1L6FA 4FNPA 2CLEA 4MY8A 3P0WA 4IPIA 3Q94A 2FTPA 1EA9C 4AU0A 4DO5A 2PDKA 4N9EA 1WKDA 3S1XA 2Q71A 1TV3A 3HJZA 6REQB 1VF8A 1BVWA 2DH3A 4LXFA 3NZPA 1VHCA 4GH3A 2CC0A 4CCEA 2G3NA 3NZGA 1JZ2A 2I5IA 1OX4A 2WSPA 3CIWA 4WXZA 3AYRA 1WUEA 1BRLA 1VPQA 4Q7IA 1XYZA 4WDTA 2VVNA 4IMDA 1I6NA 2WM1A 2HXUA 4RXFA 1WXZA 1QNPA 1HKVA 2YDRA 4MLJA 3RUBL 3MUAA 1JCLA 2QAFA 3IUHA 4PMUA 2E28A 3I6RA 4POCA 2FJUB 3MUZ1 4F2UA 2IQDA 3H7VA 4DJDA 1EA0A 1E0TA 1JPKA 3LM3A 1C29A 1G67A 2O9TA 1ZBKA 3KX6A 3G0SA 5FL1A 3VKKA 2DQXA 3GK0A 1UASA 3V0TA 3B8VA 2PWDA 3BOXA 4GY7A 2O7SA 1EYEA 3NUKA 1VFSA 1US0A 1IXOA 5FJTA 1YXDA 2QGHA 1B3VA 3AIWA 3IV8A 4MJ2A 3UZYA 2UY3A 1TV5A 2BZNA 4MGGA 3ITTA 4PRWA 1Q7ZA 3U2OA 1KNWA 4QAIA 2PLKA 5AFDA 3EXSA 5IM51 3IIVA 4CD7A 2YFNA 1E0UA 4DY1A 2FZ8A 1SJBA 2CXEA 2H9AB 5HWNA 5F4XA 4CQCA 4NASA 4GIEA 2E7FA 2BXYA 2INEA 3UXIA 3W72A 1H49A 3HU7A 1FFRA 4DF2A 3VILA 1Q85A 3PG8A 5H6HA 3U2CA 3QSTA 4MWAC 1YHTA 3RG6A 1E6QM 3CZ8A 2JGYA 2WSQA 4LU0A 1OHLA 3MMUA 4UTWA 4DXVA 3LN3A 3AICA 1FWHC 2IXUA 2J27A 4EPBC 5CGTA 4UCGA 1Z48A 4BJHA 1XYCA 1OF8A 1OCJA 3GDMA 2QZRA 1B3YA 1NDVA 4KWSA 1ADSA 5CSSA 3SY1A 1S5NA 1TA3A 2WJZA 1BXBA 3GTHA 2VD9A 5D30A 4LAKA 5AC5A 3SRFA 1XKJA 5KINA 5EFDA 1EEXA 3PBMA 4QG8A 2OKTA 2YBUA 4RNIA 3CZKA 3QH2A 3IJQA 5HPOA 4XZHA 1W1B1 4U31A 1WZLA 2P50A 2QNEA 2J78A 4FLQA 5A95A 4W7UA 2GQAA 4PUUA 3ZJKA 1W1A1 4WR3A 4Q8TA 3NSXA 1FCBA 4LF1A 4I7VA 4O1DA 3I68A 2BV9A 1WBHA 1JR1A 1SW3A 4H1ZA 1DTUA 2POTA 4GQ0A 4PTWA 3CZJA 2FVMA 3L4UA 5LIYX 4IIGA 1JPDX 3RPMA 1C7TA 2CZDA 2OOFA 3AMCA 4CQ8A 3SN1A 1LRNA 3MI6A 4WK9A 4C6MA 2F8QA 3G1SA 3TR9A 3E2VA 4W87A 3L0KA 3IIXA 2O9OA 3U7VA 3UBPC 3NO5A 2AQWA 3V16A 3BCFA 1KFLA 1NY1A 3ARQA 4AXKA 3ZR6A 2VOTA 3NQFA 3S6OA 1BYAA 2HJPA 1W3LA 4NF7A 1BSIA 5CPOA 4DJFD 5E9AA 1A3WA 1LCOA 3UYCA 4N42A 1J6OA 1WKEA 4HU0A 4K3ZA 4L56A 2ZE3A 3W2LA 3LI1A 1AL7A 1W32A 2PDLA 3VOFA 1VAHA 5D4YA 1WXJA 3BG9A 4OQVA 4UNIA 3ZR4A 1BSLA 4EACA 2Z2BA 5GVJA 4X63A 1LBMA 5GNZA 1E4MM 3A24A 1CPUA 2VEIA 2ZZ2A 3DX5A 2L5HA 2ZOXA 3WF2A 2HXTA 1PB0A 5HATA 2YBVA 4L64A 3VD4A 5BXRA 3M5XA 1GZJA 1F74A 1UD4A 4PTVA 4A2SA 3CZGA 1M9HA 2UBPC 3DAQA 1EH9A 4R7WA 1R8LA 3LGGA 2DGAA 2Z1KA 4K2SA 1P0DA 3GR4A 3FNDA 4GYJA 3U3HA 3WFAA 2FDMA 2DVXA 2GJPA 3ZLGA 4PTXA 3N15A 4FHAA 4O53A 1J2WA 2A0NA 4NXKA 3WIJA 1GQJA 1R7OA 2FVKA 3TX9A 4HSNA 3NTYA 4MWAE 4FNSA 4JNMA 3GHRA 3NYZA 4H9MA 4U33A 1KQYA 1EQCA 2FPVA 3W71A 1YTDA 4HN8A 3E2RA 3THQA 5D9OA 4MAZA 4UFLA 2DV0A 3AWNA 4GZJA 1OC6A 5C9WA 3G1YA 2YCLA 3EDKA 3R2GA 5EMKA 4C1KA 4KIEA 5TF0A 2DZUA 5DO8A 1QOQA 4L4LA 5XINA 1KD0A 1C3FA 3WDIA 4XKYB 2GVEA 2A5HA 5PTDA 1T5AA 2FHFA 5AKQA 4UFJA 3KL0A 2CZ5A 3N3MA 5U4NA 2WC3A 1L6GA 4IQLA 1EZ2A 1QNRA 4V1XA 2XIIA 5DCEA 1AW5A 3PNZA 3A9IA 3S9ZA 2Z7GA 3ARTA 5I3HA 3UVIA 3TAOA 2ZKMX 2GQ9A 1BF6A 1WDSA 3TYEA 3VOJA 4GYPA 3IPWA 1W9VA 4EXQA 1O94A 1PJ9A 2TRSA 1FY6A 4JHMA 1IZCA 1Z3NA 1TA3B 2YFOA 4V33A 3L12A 5I23A 4EPEC 2F6UA 2X1IA 4GY1A 4B5SA 1FWCC 1HN1A 1WB0A 3GQYA 3BJFA 1ME8A 1EXPA 5KMYA 1E6SM 1UIPA 1AD1A 4HNVA 3QW3A 1IE7C 4Q33A 3T4WA 1CB2A 3ISIX 3ITGA 3GKAA 2BVTA 3EEGA 4Z2IA 3LQLA 5JBDA 2ZC1A 4LBSA 3CXOA 3GTXA 1GK8A 3M0ZA 1DXFA 1RK5A 4QS6A 4QLJA 1GOOA 3TONA 5ABEA 1GOQA 3S46A 1HG3A 2ZZ3A 3PP7A 1VLIA 3HQPA 3TW9A 3ITCA 1IXQA 2OR2A 3C5QA 7REQB 1VCGA 2C16A 2WSKA 2V2DA 3RK8A 3A4JA 3PG9A 2GGJA 2OO0A 4V15A 2QVHA 3RF9A 2WSYA 1V6YA 3K8LA 3H70A 2R6OA 5HOSA 3C2OA 4RCXA 3RX2A 1L2UA 4FNQA 5K4XA 4LC8A 4RX0A 4IXHA 4REQB 4P8WA 2D73A 1JI2A 3FV9A 4LCSA 4UTJA 5H8UA 5HK4A 1EP2A 3CZLA 3H4XA 4GGHA 5HUPA 3PAJA 1IHIA 2QMKA 2Y7EA 1RQHA 1MNSA 2F84A 5D02A 2PC8A 4N6FA 4PFHA 3NJ3A 2PC4A 1VIWA 2P8BA 3IGUA 2R1KA 4G7EB 3COTA 4XUGA 1LT8A 1PZ3A 2C8NA 4G9PA 1W2PA 1DWGM 3UERA 5ECVA 3L4TA 3M0KA 1AFSA 3LRMA 2QULA 5A2AA 3U5UA 4IFKB 1W9PA 3FIGA 1CB7B 1LORA 1GJWA 3WQFA 3AZSA 2V67A 5G1TA 5I3KA 1OX4B 4FR1A 3O6CA 4D8LA 1V0NA 3IWPA 1W3HA 1W3NA 3WCZA 3AU2A 1VBJA 3V3WA 2WHKA 5C55A 2E67A 5LA1A 1JFXA 1O5KA 3L2LA 1K9TA 3DYPA 3SCOA 4AUBA 1JRBA 3PBUA 3WJZA 2NV2A 1EDQA 3EWYA 1L6YA 3M0VA 5BWFA 4LYRA 3JRKA 4PUDA 2OT0A 1RBLA 4RPQA 2D3NA 4PMYA 1W56A 3T09A 4IPJA 1JCJA 3UJ2A 2V69A 1EPVA 1PKMA 2R94A 3WQCA 2EEXA 3BANA 4GXMA 1NJJA 4ZBCA 4F8XA 3KP0A 9XIMA 5D8WA 1E15A 3O3RA 1XYMA 3LBOA 1LWIA 4E3TA 4H19A 4ASTA 5BXPA 2XYLA 1TR9A 3SCTA 2RFGA 1GQIA 2ZRYA 3F03K 3GDRA 4Q6XA 1W5MA 4TX8A 3CQ0A 2QV5A 3P6LA 4C6JA 5DCBA 4MSSA 1AH4A 2C14A 3MSRA 3EAUA 2CXGA 4AF0A 1TWWA 3E2SA 1MXSA 4DAIA 4JTQA 1A5OC 4FNTA 3OPSA 5E09A 3KZPA 4JQ2A 3R58A 2ZRUA 4WD0A 4KT2A 5IDZA 4ROQA 2OGJA 2WWCA 1Q4NX 3E38A 4C6FA 2PCEA 1JDEA 3WQDA 2ACUA 3LCIA 1YX1A 2QDHA 2VURA 1QI2A 3DFNA 5HBFA 1HJXA 3HPFA 1E1EA 4D71A 3GNRA 3RRXA 3ES8A 1FWGC 4HBKA 3GW3A 4O8AA 4GIAA 2A79A 3NDZA 4ATLA 3TWBA 4KRTA 2REQA 3HPAA 3WLLA 3AIRA 4ERAA 4AF0B 2XWEA 5CC3A 1O60A 3G8RA 3QYQA 2RGMA 2BB0A 1XDJA 4NZFA 4F2BA 4ORIA 1I0BA 3MYOA 1SJCA 2G41A 1GT8A 4AW7A 3I4EA 3QC3A 4K8EA 1MDLA 3G1AA 4DBUA 2HQAA 1Y5VA 2WVVB 5LIXX 3P8JA 4IMCA 4O8RA 3U2EA 3N6HA 3G3MA 4GISA 3M0YA 4DHGA 2KAUC 4TU1A 4R27A 1RQBA 1JAKA 1XI3A 4ML4A 1QHZA 4IMEA 2VO5A 3ZOAA 1QK2A 3OG3A 2HPMA 1AMYA 4Q8WA 3KOZA 5HQMA 4FX8A 5DRIA 1BAGA 2PLJA 1A4LA 5D03A 4DYKA 1OJXA 4KFOA 4ZB2A 2FJKA 2RJHA 3SO7A 2EAWA 2I1OA 1VFUA 4X9YA 4CU6A 2QUVA 2VFEA 3FY1A 4IISA 4MNLA 1SO4A 2FHBA 4PEEA 3RO6A 5E0KA 5GNXA 2FH6A 1JI1A 1EX1A 2OX1A 3UY7A 3VIJA 1EFZA 3CLWA 3QPEA 4AIUA 1YBQB 4DUWA 1UB3A 2NXIA 4NYUA 2Z2UA 3L4VA 1JDDA 2ZA3A 3PWAA 3D47A 4LB3A 4OBTA 1R2RA 2E9BA 4KWWA 4XG1A 4LAOA 3TJ4A 1DWIM 3EX6A 4JTKA 2BNJA 2C3ZA 2YA0A 1HO4A 1XGDA 4JXCA 3WEOA 5AC7A 4P7NA 1GVOA 4WDXA 4ZB5A 2WCSA 5JQ9A 1A5AA 1T8QA 3W7EA 1DWAM 1FWSA 4DO6A 1TJRA 1OQFA 3AI0A 1ZNNA 1GOWA 2XFFA 1X96A 3VE7A 3WD0A 2NV1A 4O4VA 2WB5A 2GSJA 3R4IA 4JTSA 3DU0A 4AZBA 1HTIA 2PURA 1B9ZA 1L8NA 3B05A 1GUVA 2PLCA 1RY0A 1X1OA 1JEZA 1KM1A 3NGFA 4L61A 5A8GA 1T6MA 2WM0A 2O0TA 2XTKA 1J0JA 1G69A 1TZ7A 2G3MA 3RPTA 2FLIA 3QFEA 2YW3A 3DHPA 3RYSA 5HR7A 1X8CA 3IUIA 3TN3A 1M5WA 9XIAA 2FGBA 1K77A 5GNYA 4PUKA 1V4YA 3NQ2A 3NZRA 4U28A 1I2NA 1LUCA 1W37A 3W29A 5T26A 3NDYA 3W23A 1NWUA 1EC8A 4JTGA 2DQWA 3INPA 3U9IA 4YIWA 1NU5A 4A8NA 5AHLA 3H54A 1OC5A 5D2XA 1MMFA 1P0NA 1XRFA 1GHRA 3KOXA 1KCKA 3QYSA 3WMLA 2Y7DA 1OD8A 4LS2A 2OB3A 3BZGA 4GXPA 2EHHA 1CDGA 3SCPA 2XISA 1F5ZA 3CMJA 3E3HA 4IL2A 4AD4A 3U0HA 4IQJA 2BTMA 4QX4A 3L4XA 4OHQA 3GTFA 3ONCA 1G7UA 1WCGA 2YDQA 4UMCA 1EO7A 1AVAA 1SFTA 1VJSA 1QR7A 4EWND 3ZM8A 3FKRA 1I1WA 3SUVA 3H2AA 1UWAA 1JPIA 3GSMA 4MZ1A 4X0VA 5B80A 3W75A 4BA0A 2QMJA 4W86A 2PPGA 2QKFA 4W9TA 1XM3A 5CAKA 3TROA 3F4CA 4TOQA 3AOFA 4DWSC 3SURA 3EWZA 3V36A 2OWWA 5SWUA 1FP9A 3F4WA 1SM9A 2I9EA 2HDJA 3QY7A 3TYDA 2YB4A 1BGAA 1UCWA 4H00A 2PMQA 4AIOA 5LXXA 2QCDB 3NEVA 2OX4A 4H41A 1J93A 3C0JA 1K8XA 2WMJA 2P76A 4DI8A 2D0FA 3B04A 4HMCA 3N2BA 3FDKA 1ZB5A 4XD6A 3UR5A 3CTTA 3LI0A 3EXTA 4MJZA 4QAWA 4ICNA 3MBFA 2E6DA 3BK0A 4IG2B 1WOBA 5DEZA 3W1TA 3CT7A 2MUCA 4XZMX 4Z1YA 3AS0A 1E4NA 5D9MA 1VQTA 3GXIA 1IZKA 3G1DA 3KEHA 4PB3A 1SZRA 3MS8A 1V0MA 4OOUA 4NI8A 1BYDA 1VP5A 4DUOA 1E71M 4AWEA 4MYAA 1XIEA 3M6YA 2CERA 3DFYA 1R9YA 1GEHA 3TYZA 4MNMA 3WBWA 2PDMA 3UJFA 2G50A 3FCPA 2BHYA 4XAGA 1FP8A 4MKVA 1QT1A 1C93A 2DSKA 1J8VA 3N9KA 1ZUAX 3LLFA 3ARUA 4Q22A 2VRQA 2J6XA 5BYWA 2ZE0A 2HVMA 1J0ZA 4HZ8A 4M6QA 3G1RA 3KS6A 3KCOA 3WK3A 1TPH1 1JYWA 3BLPX 4UQ9A 3TCSA 4L6DA 4DRSA 2EGZA 1HVQA 1TIWA 5JXQA 4IIFA 1A5UA 7TAAA 3GG0A 1V0LA 4MADA 3WD1A 2X40A 3UR2A 1R3VA 1A5NC 3HMJG 2QHAA 5E0FA 3NA8A 4OBRA 3R8RA 3GH4A 1EQPA 1V3LA 3REQB 1W8GA 5AY7A 3W7LA 4E0CA 4G2DA 3GNPA 4QSFA 2QDDA 3UYIA 1A0DA 1LLZA 3GG1A 1TVLA 1WYIA 3GC2A 3ERPA 3QSRA 4DJFC 4H8VA 5DELA 3ECQA 4ZL1A 4DIAA 2XFWA 2G96A 2Y0FA 3E12A 4JIHA 4ZO6A 2OO6A 4HYVA 2ZX7A 3UEQA 4MG4A 4IXXA 1W54A 2QIIA 2PSNA 1NH6A 2CLOA 5C70A 4IM4A 3PZGA 2HBVA 1NDWA 3OZOA 3K8KA 1PO9A 4PZVA 1H51A 3EDDA 3W01A 1GJPA 5CG0A 4OWGA 3TNOA 3U5YA 1P6BA 2EXOA 1U5VA 3AHXA 4RNHA 4A8RA 4O12A 4FALA 3WLIA 2D20A 3TC6A 2ZICA 3W74A 1Z7AA 2IPJA 2C7FA 2ZA2A 4IFRA 3WNKA 2DZAA 2INZA 4H9XA 5I0DA 1TV4A 4X22A 4GI9A 2ZX9A 1XYBA 1VBRA 1PWMA 4IICA 4Q8OA 7CGTA 1Q5MA 1O6IA 1UHVA 1QTWA 3B8TA 4XD5A 3T0CA 4P5UA 1Z9AA 3IIOA 1MEHA 5FKYA 3G1HA 5I3DA 3W1RA 1XLMA 4ALDA 2XH2A 3CB3A 1X97A 3SGZA 1XH0A 2UV8G 1JZ3A 2PLMA 4RE0A 4FB7A 3EA2A 4ZB0A 4O10A 4N9DA 5LYRA 4PCFA 4PUWA 3RR4A 4KGLA 3CUIA 4NAFA 3W28A 1B3XA 3CAWA 2AL1A 2HWGA 2CETA 5LZLA 4E8CA 2B0MA 4JIPA 1G9HA 3PS7A 2ZRZA 4C7GA 1R46A 3AS1A 2VX5A 3A5FA 3O06A 1IT0A 1RHCA 1R3YA 4IPPA 4XO6A 1EDGA 2CLIA 4C7DA 5CCZA 4E8GA 1GTHA 4S3GA 3LV5A 3V7PA 4AZGA 1B4KA 4UFHA 5HJXA 3W53A 5G4WA 1XS2A 2VDHA 4WKAA 1QO5A 4OIFA 4R7OA 2C0HA 1WKFA 4HZMA 1P0BA 5FEXA 1HO1A 4R9XA 3VKJA 4L1XA 1RZMA 3I7QA 4LT9A 2VZTA 3B9AA 4GJJA 4LS1A 1DHKA 1UR9A 4RW5A 3OG2A 4NSBA 3K2GA 4CVUA 1H5YA 2Z28A 5CBIA 3T78A 3OTRA 4JZ5A 1SFSA 1U2YA 3VE9A 1UQYA 5EPDA 1FHVA 3WQPA 3E6EA 2IPWA 2PFHA 3GVGA 3ZZ1A 4B5XA 4Y6GA 1UA3A 3CHFA 1W3KA 4TV6A 3R0DA 4AISA 2ZFAA 3B03A 5IBXA 1TB3A 1N8IA 4QJ5B 1E3XA 5G2IA 2DH2A 4HCLA 3G2GA 3N2OA 5FACA 4LUSA 4KCTA 2VC6A 3CAKA 1AA1B 5H1WA 2V2HA 3NOYA 1ZFJA 2J7HA 3TW6A 4TVDA 4ZOAA 1C8QA 5EY5A 4GC4A 1W5PA 4UWMA 4JNYA 4C1NB 1A5MC 4EXAA 4YTSA 3TC7A 2DUXA 1ISVA 1VEPA 2Z25A 2Z1SA 5EKYA 4AHPA 1GNXA 5CZTA 3W7OA 1OCQA 4AY1A 3IGHX 1LG2A 2GVYA 3RGTA 4DF1A 2Q6ZA 3CU2A 2F38A 3R12A 3VGBA 1WDWA 1JZ7A 3PPFA 1DJZA 5HNTA 2PRHA 2PRLA 4L6HA 3KBMA 2RDWA 3L5AA 4HVXA 3TJXA 2NVDA 4WY0F 1OG0A 3OJGA 1MWOA 4GUFA 2C91A 3CH9A 3TMLA 2BBFA 2OLSA 3NAVA 1VRXA 4BF9A 3ALFA 1AW1A 5KTLA 2UY5A 3MB9A 1KRMA 2YCLB 1F6PA 1YNQA 3W38A 3PC0A 3A3HA 1BWKA 4CD8A 2FB2A 3KLLA 1H0GA 3T07A 4D6GA 3MYPA 2EKGA 1DJYA 1CIUA 1W1VA 3QMTA 4Y9OA 4GXWA 1KV5A 4H9ZA 2DZSA 4MKNA 1ZJBA 2XIQA 4CD5A 2E1WA 4JX4A 2IMRA 3B4UA 4AZHA 2WBGA 1WUFA 4B3ZA 1WAUA 2C1HA 5G2WA 4S3FA 3SBFA 3PF3A 4LC6A 4UXDA 4XBSA 2B7OA 2X1TA 3HV8A 1R3QA 3M7WA 3JZUA 3PFRA 1XLHA 4RZ6A 2OTDA 1VCVA 1ECQA 2GUUA 1P5BA 1TVPA 4JKLA 4CU8A 4QNEA 3LRKA 1MW3A 3NPVA 1XIBA 1D3CA 3EMZA 3RM4A 3T4CA 4A8LA 4OFCA 3T81A 3L23A 2VR5A 3WD3A 4MWAB 1EIBA 2OEMA 4YS1A 4DBEA 5K9CA 4XAPA 5HNUA 4ZE4A 2XN2A 2RUSA 1CW2A 3AAMA 4Q8MA 3TWAA 1KCZA 5ABHA 4F3HA 4HOXA 2JBMA 1EJUC 1KKRA 3HPSA 5LHEA 4O14A 4AEFA 3BXWA 3USZA 3BV4A 5AYBA 4WDUA 2J66A 1XIGA 2QJJA 2X1SA 4M3PA 1TPFA 1GVSA 2JKPA 1SZFA 3W24A 2GSHA 1VGAA 3WBEA 2C15A 1E4LA 4RK8A 1P4CA 3T6CA 3P62A 2OWXA 3GIQA 1M7OA 1AJ2A 3NO3A 3G1FA 1HGYA 2FTYA 4O16A 2WC4A 1NEYA 1F3WA 1H5VA 4BF5A 4EWJA 3HPZA 4UCFA 3LSCA 4RW3A 2OT1A 4AMCA 4XK2A 3ABOA 3SFKA 1LTDA 1SFLA 3GDTA 2QPSA 1ME9A 3NO1A 2W62A 3W6MA 1CGUA 3PZOA 2Z29A 1W1IE 1VBHA 2EPKX 2ZXBA 1BFNA 4P8VA 3KL3A 2BOFX 4RDWA 6XIMA 1I45A 4K38A 4W5ZA 3OA3A 1F05A 1V3MA 1DYSA 3OHMB 4NZ1A 2WHLA 1MQRA 3UESA 4AY7A 1HP4A 2FGLA 1E55A 2WSRA 3HG2A 2BX7A 4Y96A 1H3GA 4YYFA 4TUFA 2A6LA 4C7FA 3AYVA 3A3WA 3U57A 3ANUA 2OYMA 4NJHA 1OSEA 5LXEA 1R3RA 3W1AA 2GOKA 4Q3MA 1P6WA 1KBBA 2X30A 1A5CA 4GX8A 4O1AA 4PSPA 2PODA 3D0CA 4Z2GA 5A6AA 2OCZA 4X0NA 2QCDA 3TXVA 4DJDD 3RHGA 3UWEA 3QLLA 3UR8A 3VGFA 1OIMA 2VKZG 1H1YA 1NWSA 3G0XA 1A3HA 3B0UX 4U3CA 1EKOA 3A5VA 2XZ9A 3C0SA 4M7TA 4IP7A 4IMGA 4NJKA 1QNSA 4DI9A 1G0CA 2EPOA 4TMBA 3ABXA 4GVIA 3UJSA 1GOKA 1HL8A 2W67A 1GVYA 2YCKX 5D32A 5ABFB 2HROA 3LGEA 3IK4A 2G4JA 2ZX5A 4PR4A 4EXBA 4UZUA 3LM7A 3DBNA 3P0XA 3UG8A 5IHRA 3W1MA 4M56A 3ARVA 2XUCA 3RMEA 2HK0A 1D7KA 3VO0A 4GUJA 1KRAC 1MFUA 5FCZA 1I1XA 2DVUA 5HMEA 4ACYA 1MW0A 1I2PA 1ISXA 4DBWA 3GRIA 3LSBA 3VDCA 5A2CA 2QJMA 1YE4A 5BNKA 3VX0A 4C60A 4JHOA 2XGZA 3L4WA 2DY3A 1ODZA 1QVBA 1ML1A 4O13A 2NUXA 1F73A 1OT1A 3ARZA 4J3UA 5CAHA 1NOUA 2SFPA 4Z08A 3FAWA 3LCHA 3MMDA 2VP8A 3VIFA 2XVKA 1JD9A 3WH8A 1DEDA 2XHYA 1WDQA 4E4UA 4EP8C 4JIIX 3A64A 4HA4A 3O1NA 1LL4A 2DZBA 4GCXA 1GJUA 1N55A 5JUVA 4JQ4A 4E4PA 1CXEA 2FHCA 2A3HA 4ZOEA 5D05A 2VGGA 3U8GA 3DESA 1K4HA 5AC6A 1QNOA 4HQVA 1Z41A 3B8DA 5HWMA 3IRDA 2GPTA 4IGSA 2BGQA 3O6AA 4U5IA 1KFBA 5CPNA 3TLLA 3VIKA 1W3TA 1JQVA 4P61A 3AISA 1RQEA 3I3DA 4IUGA 3R6IA 2QIWA 1A5SA 2ISVA 4E6MA 2WV8A 3PUGA 4A8IA 1ZBVA 4Q6JA 2VWSA 4RE2A 3UA3A 3DC0A 3UNTA 3ABSA 3EWBX 1HT6A 5D2YA 3STFA 1TREA 1KM3A 4YTUA 3WLTA 4IT1A 1FDYA 1C90A 3WEZA 1PKLA 2I5QA 3EOLA 5T9BG 4L4OA 4B3LA 1XH1A 4AC7C 2E9MA 1UP3A 5BRPA 1W9XA 3CEPA 3FXGA 1R30A 1D8CA 3AXKA 4NRSA 4YWIA 5RUBA 3ZVHB 3GG8A 3BAYA 3PB2A 1JYNA 3NQBA 3DOPA 4FXSA 3PTQA 3H2OA 4TIMA 3MWAA 4WKFA 4KFNA 4MUZA 4EAYA 2ZZ7A 3WH7A 2YLAA 2CW6A 3L68A 4IX0A 3BQ5A 4JTTA 5D8ZA 3H6OA 5JVLA 4QISA 3JW7A 1YEYA 3QEZA 3C6CA 2PF0A 1CX9A 1M7PA 2D2JA 4AMAA 5DMYA 4WSJA 4HOWA 2F6XA 2Y6ZA 4O1EA 1PE1A 4XISA 5CPMA 5HULA 1NTHA 3OW1A 1M65A 3E0IA 4M51A 5REQB 3VGHA 3CPRA 5FAJA 4RDYA 2X8RA 2BGSA 3RX3A 2ISFA 2YBTA 4XZ9A 2OLHA 3TZFA 1V6WA 2QF8A 1YKWA 1RK6A 4QGCA 2J25A 4Q7BA 4RL3A 1T96A 3MP5A 4J3ZA 3VC5A 1KRCC 4AXNA 5IFTA 2WZEA 5A6KA 1TMHA 3MA8A 3ITLA 4O1FA 3M5VA 1DV7A 2I56A 3MP3A 4HU3A 4UB9A 4IPLA 3AMGA 3RJXA 4DBSA 3PTDA 1FTXA 3PJXA 3N9SA 3A12A 3LX9A 3QQ0A 1Q4WA 1MI3A 2VC5A 3FEMA 3HTWA 4LVAA 3VKBA 3GTNA 1NAL1 2YCIX 1C9WA 4KEUA 1NM9A 2PDWA 2RJGA 1E4IA 4WSKA 2OSWA 5CC6A 5F4WA 3H2NA 3LTSA 5A94A 5DY2A 1Y65A 1M03A 4KETA 1RLCL 1XLKA 2WQPA 1FH8A 1VHNA 4D8AA 3K4WA 4JFTA 3IJ7A 1SZNA 3WMCA 1QU4A 2CBVA 1CCWB 4UR9A 2OG9A 4I5UA 4WIWA 2A3EA 1VIZA 1H7OA 4RZBA 2Z1BA 5ENLA 2ZTJA 1G94A 4HK6A 4MJ4A 4LNYA 4DLFA 4NYYA 3T1GA 2NQHA 1L2QA 3P2VA 3V18A 3SECA 2OEJA 4OECA 1ZGDA 3AHZA 1WBJA 3WLJA 1PIFA 4LCQA 4AH7A 3GDBA 2VI0A 3TQPA 4I6VA 3OQEA 1YLVA 1EUNA 4XZIA 1XUUA 5H2ZA 4YHEA 3WNPA 2I5GA 4MWAD 1AZ1A 5HR6A 2QUTA 2WVVA 4JIRA 5AHEA 6ALDA 1CGVA 3B4YA 4JYFA 2VM8A 2VFFA 1KTCA 3VAVA 4W7WA 5KEZA 1DJGA 4JBRA 4WLCA 3DKLA 4HCHA 3LTPA 3C2YA 4MY1A 4NL1A 1OGBA 2E68A 1J9YA 2J77A 1AL8A 4C6EA 2QYGA 2FMOA 3BOLA 2J88A 2EG7A 1QRQA 2Y70A 4Q4RA 3UNDA 1UD5A 3B0PA 4FO4A 3CUJA 1J5SA 1VS1A 1ZS2A 4KH2A 4GA8A 3ZMRA 3NNTA 4LRSA 3TMQA 3W84A 2J47A 3W3OA 3P67A 1Q13A 1E6XM 4N9CA 3ITVA 3VKAA 2Y2WA 1EP3A 1EX5A 2QCGA 4O4WA 3ZR5A 3R10A 1LRTA 4DJEC 3HA1A 4ZODA 4HHHA 5E1QA 2UY2A 3CHCA 1JUEA 3LENA 3RU6A 4RLIA 1IWAA 1KGXA 1TPUA 1OFPA 2DVTA 3QOKA 3E5PA 3IJLA 3HG4A 1XBZA 5A6JA 4DJEA 1DXIA 8A3HA 1RV8A 3ZLHA 1CGXA 3ME3A 4AX7A 1TTQA 2XG9A 2CPUA 3FSUA 1IXNA 3VMPA 5G1MA 1P1XA 1YIXA 3EOOA 2ABBA 2VQUA 3MKCA 3KVKA 1RCXB 4BY3A 2Y61A 3IJ9A 1UD2A 3VUSA 3LTYA 4L9XA 1VBUA 2RDXA 2XFYA 5HMDA 2NT0A 2IUZA 4BZYA 1J0IA 3ZO9A 4GC3A 3N34A 4PMRA 4GABA 1JF5A 1GTEA 4IGNA 3CC1A 3WMBA 4S2BA 3KLKA 4JKKA 3LPPA 4WQ6A 4ATDA 3AUJA 1AD4A 2WMIA 3CBWA 2YR1A 2BXVA 4R85A 3S9YA 2GVJA 1HP5A 3BV7A 1EYWA 4XWUA 2WANA 1A5KC 1REQB 1XIFA 5FF7A 2YDSA 5H8MA 3N11A 3TTOA 1WDRA 1LL7A 2WZTA 3W07A 1V3KA 2ONEA 2BVYA 4L1WA 3WQGA 1V51A 3PJUA 1SR0A 2E5CA 4WEVX 1QK0A 3RLVA 1X7IA 2W9MA 5D2VA 1H4PA 3N29A 5A2BA 1G4PA 4PMJA 1ONRA 4KCVA 1O66A 4H2CA 3GR8A 4ML9A 1WV2A 4RV3A 4GK8A 1DJWA 4AD1A 1THFD 4BQ2A 3RXZA 2JF6A 4NZCA 4WUIA 3DGRA 4Y90A 3ELFA 2X09A 3E9AA 2VDGA 2OOGA 1C91A 3GM8A 4L7ZA 1GHSA 1R86A 1TJ1A 3OIXA 1LOQA 3W00A 4JTJA 4JQ1A 3VNDA 2Y1HA 3B9NA 1M41A 2AL2B 3OZMA 1B57A 2IPFA 1H09A 4PTMA 4F79A 3EEZA 3N73A 4FA3A 4UTWC 1F4HA 3PANA 5BOFA 1XBXA 2FYMA 3MDWA 3DFTA 3R79A 2ZBTA 3FW6A 3MUCA 3KZSA 4MPQA 1JCYA 1E51A 3AMLA 4IH3A 3OYXA 3EXRA 4R9OA 1H7NA 3KVLA 3CWNA 1HGWA 1S2WA 4WY0A 2BVWA 3WZ0E 3QTPA 4E2VA 3TN6A 3VNKA 1MRAA 3F5LA 3OLGA 4KRZA 3UG3A 3AMDA 2V5CA 3ES7A 1OYCA 4NNAA 1HKKA 1KXTA 5T91A 2ZZ5A 2EJAA 4WVXA 1RUSA 5E9XA 3AIUA 1G6CA 4M6PA 3C2FA 1RVGA 1V93A 2YXOA 3RX4A 4D8ZA 2J7EA 3IJDA 4V1YA 2PEVA 2EG8A 2OQYA 3S42A 3KRBA 4G1NA 4QE5A 1QPKA 5M1TA 1Q66A 4U10A 5KZMA 2Y24A 3ZSTA 5FOOA 4J4KA 2C18A 2R1NA 1X8FA 5ABTA 4MB3A 1R5YA 1TPDA 2VEGA 2DUZA 3NG3A 2PU1A 3R0KA 4JFWA 5HDRA 3EA1A 4QCFA 1WNOA