2FFCA

Crystal structure of plasmodium vivax orotidine-monophosphate-decarboxyl ump bound
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
332
structure length
318
Chain Sequence
NLKIKLQKRRDEVNTCLCIGLDPDEADIKSFMQSEKQNGYQSVKKNLSNSGELFAPQMGGQMLLATPPKEAQEKDEFFYFFNHFCFYIINETKEYALAYKMNFAFYLPYGSLGVDVLKNVFDYLHHLNVPTILDIKMNDIGNTVKHYRKFIFDYLRSDSCTANIYMGTQMLRDICLDEECKRYYSTFVLVKTTNADSHIFQNRLSLDGKEAYVVIAEEVQKMAKQLHLEENGEFVGFVVGANCYDEIKKIRELFPDCYILAPGVGAQKGDLRKMLCNGYSKNYEKVLINVGRAITKSGSPQQAAREYHQQIKEVLAEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Genome-scale protein expression and structural biology of Plasmodium falciparum and related Apicomplexan organisms.
pubmed doi rcsb
source organism Plasmodium vivax
molecule tags Lyase
molecule keywords orotidine 5-monophosphate decarboxylase
total genus 125
structure length 318
sequence length 332
ec nomenclature ec 4.1.3.23: Transferred entry: 2.3.3.2.
pdb deposition date 2005-12-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2ffcA00
2QCFA 2OX1A 2QJHA 3C3NA 4RLIA 3IVTA 4JYEA 2B7NA 5E93A 1CI1A 2Z1BA 3CHVA 3EXTA 5I3KA 4ZQCA 3LI1A 4FX6M 3NQVA 3N9RA 1F6PA 3TNOA 3WJYA 2NX1A 3NPXA 3FEMA 2TMDA 1UBSA 3BGJA 3NQ2A 4O17A 1PCWA 2ZRXA 3WJSA 5FEXA 2H6RA 1FWNA 3LTPA 5D04C 5T26A 1U5JA 4PODA 1FBAA 1OF8A 3HGSA 2QCLA 1W5OA 1TV8A 4BI7A 1JCYA 2ZRVA 2WO5A 4IXHA 1L2UA 2ZZ3A 1FCQA 1KFKA 3S1VA 2OMAA 1FCUA 3CWOX 3GAKA 2FLIA 1SFJA 5LGZA 2NV2A 4AMAA 2E09A 3PBVA 3R8RA 4I7WA 3C2FA 1O5XA 4YL2A 3ZWSA 4K39A 4UNKA 4NNAA 3M44A 1GT8A 1G6CA 1LBLA 3RU6A 3NZ1A 4UMBA 4GBUA 4PTNA 4K7YA 5FF2A 3QFEA 4FNRA 1JQXA 4JTLA 5D05A 3THAA 1IXPA 3W86A 2E77A 4WJEA 3QZEA 2V8ZA 3IRDA 3EWUA 4OGZA 4O1DA 3L5AA 4Q33A 4LT9A 2VFHA 3HJZA 3GKAA 3A5VA 3M7WA 4TMBA 4ZQOA 1TPUA 3PUDA 1Q6OA 1H1YA 3B0PA 1JVNA 1SZGA 4UIOA 5HWJA 1M7PA 1QWGA 1KLYA 4JX5A 1D3GA 4OBTA 3KVLA 4DO4A 4ADUA 3BG5A 5DELA 3SGZA 1EB3A 3QEZA 3G24A 3NVTA 5C55A 4EVZA 3TX9A 2GQAA 2I14A 4FNQA 1Q3NA 3LLDA 3DH7A 3EKLA 3UWWA 4CCCA 1KBJA 1FDYA 3HIJA 1OFQA 2A21A 1ICSA 5G1TA 3P5ZA 3DAQA 2X1TA 3KHJA 3C6CA 2YFNA 2DZUA 1O4UA 3KVKA 5D38A 3ABOA 4CLMA 3KRSA 1CX9A 3CWNA 3MO7A 3E49A 1VH7A 2A7RA 4N4QA 2GVGA 5LNUA 4XWUA 4GUFA 3OA3A 3MMTA 2Y7DA 4K8EA 4JTEA 1E51A 3EWXA 2EPHA 3CEPA 5IBXA 2ZZ2A 1FWWA 3A9IA 3NZRA 3C2RA 2YCEA 5BMWA 3SECA 4GUJA 4RX0A 4K6AA 3CM4A 1ZENA 3OG3A 1XBYA 3EWZA 3W2JA 3LERA 2YYTA 2YXGA 4FIQA 3SR7A 3W7DA 4EWND 1T8XA 1TO3A 1X6UA 1A5SA 5D02A 3LHUA 5EL1A 1H7PA 4IGHA 1AMKA 3FYPA 5CZSA 3QQ1A 1QNVA 2PCQA 5SWUA 5D03A 3F4WA 3LCFA 5EMUA 4GC4A 2Y89A 3W7OA 1EEPA 3WJXA 1R2RA 3NL2A 3P82A 3G0XA 1OX5A 5FESA 4HN4A 3LHYA 5GVJA 2BWGA 3I68A 1LORA 3CT7A 3S5ZA 1OYCA 3A5FA 1TV7A 1QR7A 3QMTA 1DBTA 1VS1A 2HTMA 4CCDA 1B3OA 1XL9A 1TPFA 1FDJA 5FF4A 4JTHA 2A5HA 1H62A 4KFOA 1Z44A 3DXIA 5LNRA 3UXAA 5J5RA 1L6SA 3NM3A 4IPJA 2NX9A 4R34A 1EP3A 1KW1A 5CGQA 3HG5A 1GPWA 1OF6A 1BWLA 3RF9A 3IGXA 3NA8A 2J9XA 2VFFA 5MHBA 1CW2A 1KLZA 1J2WA 2W0UA 5D2XA 1A5AA 1W56A 1BTMA 1SZEA 1TYGA 2ZZ5A 4IMFA 3NEVA 4MZ1A 3W7HA 2CZEA 4AH7A 3MI2A 1HUVA 1Q45A 1GVOA 1P5BA 1TB3A 3KVMA 4RV8A 1YPFA 2Y85A 1LOSA 2ZRYA 2ZFAA 3M43A 3KAOA 2FB3A 4FNUA 4GE8A 4D2JA 1OFPA 1U83A 3QYQA 4POCA 3DHFA 1H1ZA 5K2ZA 5LNWA 3BLIA 2ISVA 2QJGA 2FFCA 3TAKA 4YXGA 3I7RA 2TSYA 5K9CA 1V7YA 5AB3A 3NQMA 1LM1A 2JBMA 3O16A 1H60A 3UZ5A 1H7XA 4UFMA 1OFAA 4LVBA 1G4PA 1SW0A 1FCBA 3DFOA 2YZRA 1NF0A 1YTDA 3PULA 1IIHA 2Y7FA 4JEQA 2E5DA 4AB4A 4GUGA 3W70A 4EF8A 3NO5A 5HINA 2V2HA 4RCXA 3QC3A 1DVJA 5C5YA 4X3ZA 3G1VA 4N6FA 4BWLC 5AC7A 3GDRA 1VLIA 4UTTA 3CEUA 5DXYA 5AFDA 3GDMA 4LUJA 1W3NA 1YDVA 5D33A 4I9AA 1BKSA 1L6YA 4ORIA 4LRSA 3ZWTA 2WNNA 3O15A 2BZNA 4QM1A 3W2LA 3TUUA 3LOTA 4KWWA 3G0SA 3C2OA 3GR7A 3LGEA 3B06A 4WUIA 3BLFA 2QF7A 4AVFA 2ISWA 4WX2A 3TW6A 3C2VA 3MI6A 1XUZA 1RR2A 4JTUA 4O1CA 2CLOA 3QQ0A 4Z1AA 2Y70A 1TPH1 4XZ9A 4X2RA 3NL5A 3GNNA 3S8HA 3W07A 3FLUA 1MEIA 3N19B 4O18A 1AW5A 3W2MA 3I7QA 5IM51 2DJXA 1PVNA 1B4KA 3KRZA 3UWVA 1GZGA 3AO0A 2HMCA 3W71A 1LOLA 3EX3A 3QSTA 1W3IA 4HIBA 5DN1A 4JGDA 2C3ZA 4Y9AA 4YCOA 3L66A 2F7FA 1OFRA 3M0ZA 1TPWA 1MXSA 3CU2A 5BMXA 1VYPX 4RKAA 4I7UA 3TFXA 5HWMA 1KBIA 4YWIA 3GDTA 1F74A 3EX1A 3EX2A 2C16A 1YPIA 1YDOA 7TIMA 3LLFA 1GYLA 1I45A 2P0OA 3ANYA 2OCZA 3DHDA 3FJLA 3T40A 5E1QA 3C52A 4MUZA 3TJXA 1Z48A 4TIMA 2V5LA 4FNSA 2JKAA 4UTLA 2YW4A 3W2NA 4GWEA 2VFGA 2BX7A 1W3TA 5DBUA 4TO8A 3B8DA 5H91A 5FEWA 3RNDA 1NSJA 5EYWA 1OHLA 4ZQMA 2VENA 2ZA2A 4QSHA 1M6JA 1TREA 2QCEA 3IIVA 3O6CA 3NQ6A 4Z0JA 1X1OA 2R94A 2XFWA 3WJWA 1DORA 3IIZA 1TSIA 3PVFA 4K37A 5D2YA 2JKEA 3LV5A 1GYNA 1QDSA 4LC6A 3BLEA 4N9CA 4Z08A 3R12A 2VKZG 3UWZA 4JICA 1R2TA 1FY6A 4JD4A 3HO8A 5DBTA 3UWYA 2YPIA 4Q4KA 2YGYA 3JR2A 5FF3A 1HTIA 3PBYA 2F84A 3P80A 3H55A 2RDUA 4IMEA 4HT3A 1X1ZA 4HPXA 5LGXA 3TSDA 1Z42A 5DY2A 5KTLA 1HL2A 1KTNA 3EKZA 2O7QA 2JKPA 1XBVA 5F1UA 2Q8LA 1YTEA 3STFA 2ZA3A 5F1VA 1DJNA 1XCFA 3M5ZA 4OHQA 3MW7A 3T4CA 4UFIA 3MP3A 1GVSA 5TBOA 3W1XA 4MJZA 5CG7A 4O52A 4LWWA 3T55A 1O95A 1ADOA 2ISSA 4DF0A 1OJXA 2WQPA 4JTTA 4IUOA 4ZQRA 3W72A 2C18A 2NWSA 4LRTA 5G2WA 2EAWA 3G8EA 1EUNA 4OV9A 3MJYA 4HNNA 1VJIA 1VYSX 3MHFA 1HO4A 3W1PA 5AHLA 3FIGA 4FIRA 4J9JA 2RDWA 4S1FA 4PEKA 4ZL1A 2NX3A 4M6PA 1G4TA 3IGUA 3K30A 2ZBTA 2E6DA 2NZLA 3UQNA 2E6YA 3BW2A 1KFBA 4IOTA 1QO2A 3GNDA 4W9TA 4OWGA 2CLMA 4NUWA 1W37A 6ALDA 1OK6A 2ZZ7A 1S5WA 1H51A 5EPDA 4IXXA 1F2JA 1NAL1 3V75A 1XKYA 3M16A 5AHMA 3ZS4A 3KXQA 1GTEA 1DQXA 1KM6A 1S5VA 3LHTA 4HPJA 1LYXA 3UWUA 1RVGA 1PHQA 1OVDA 3PB0A 3HPXA 3P8JA 4AWTA 3IIOA 1IXNA 1Q6RA 5FI8A 2V2CA 4ZVJA 5U7SA 4OU1A 2PRLA 1MZHA 3PB2A 1UCWA 3O07A 4Z1CA 3UPBA 4P2VA 3ZR4A 2C14A 1SW7A 5HULA 2J27A 2CZFA 3N2MA 4UTJA 3NG3A 2WOQA 4UC5A 4LVFA 2V5BA 1XDMA 2VFIA 2Y6ZA 2J24A 3LBMA 4HNUA 1KTCA 5D2TA 3G8RA 4NQ1A 3T7VA 2JK2A 4HNTA 3TQVA 3BVJA 4K38A 4X9SA 3DKJA 3W7RA 3GYEA 2OJPA 4OV4A 1QOQA 4JY8A 2CLFA 2FPTA 3F4NA 1I8JA 2ZRZA 1OFEA 4N9DA 1VRDA 1IXQA 4MPQA 1IF2A 1QAPA 3W75A 2XN0A 3W9ZA 1QPQA 3QH2A 5EA9A 5H2ZA 1WV2A 4Z0SA 2WSYA 5FF0A 1RQEA 1WBHA 3W76A 1GWJA 3C8FA 5IBXC 1N55A 4UTTC 4Z1DA 3NM1A 4MY9A 1ZALA 3W1QA 5KZMA 4RK8A 1KFLA 2PE4A 3G3DA 1A5BA 5BOOA 5BRBA 5G2IA 3LRMA 1PCKA 3HG4A 4IX2A 3P5YA 2CU0A 3L5MA 1ZFJA 1LTDA 1GVRA 3I65A 1H7RA 1VCVA 3UD6A 3L65A 2A7PA 3M1ZA 1LOQA 4G1KA 4QIUA 4ZZ9A 1EWDA 1ME8A 1FXPA 2YFOA 4NVTA 3QSRA 3PM6A 3OIXA 1H7NA 3PAJA 4CCEA 5LKYA 4M6QA 3EX4A 2GOUA 4Q32A 1TIMA 4JN6A 3PSVA 3GAYA 1VHNA 1OX4B 2Z6JA 4UUIA 1YXCA 2ATMA 1B9BA 5K3VA 4WY0B 4QQ3A 4BFAA 4EOUA 3WFAA 1QO5A 1TRDA 5I3FA 5C2XA 1GTHA 5G2HA 2GUUA 1KV8A 3TMQA 3UWQA 2DZXA 3BO9A 1GVQA 2Y7GA 2UV8G 3KX6A 1O94A 5HUPA 1H50A 1ONRA 3B0VC 3MUXA 2YW3A 3STGA 1I2QA 3GB6A 2EF9A 5U4NA 1SO5A 1LLWA 4JDYA 4YMZA 4IPIA 4AHOA 5E0KA 5KSWA 3G22A 4HKPA 1W0MA 3DFPA 4AHQA 3JRKA 1JCJA 5F2LA 3W22A 5G4EA 4LS0A 3S1UA 3DI1A 1GG0A 4CNNA 1K8ZA 3CB8A 3QMSA 5LZLA 3IVSA 1KA9F 1OFDA 3NQGA 1OX4A 3QMRA 4GNJA 2VOMA 3Q2DA 1F73A 1WQ5A 3L0KA 3W7QA 1VC4A 3G1YA 3S1XA 4GUHA 4RR4A 2VXNA 2Q3OA 2JGQA 4NX5A 3ATZA 4LU0A 3BPWA 4I7VA 2OZ0A 3TMLA 3TROA 2VEMA 3NL3A 3U6WA 2YX0A 3G1AA 3P67A 5DXXA 2DORA 1YXDA 2PRMA 4Y8FA 3W87A 4ZMGA 3FJ6A 1RV8A 3GVGA 1EA0A 4GJ1A 3OEXA 3SFKA 2E1DA 3U2OA 2R91A 3ELFA 3KVJA 4FNPA 4AEOA 4H6KA 3W7EA 3U8GA 2J9ZA 3UYCA 4ZQPA 2QCNA 5F2IA 5EKYA 4UTUA 5KMYA 2ZDRA 1H63A 4O12A 2E5BA 3M47A 4CNOA 3P8IA 1R46A 1PL9A 3EB2A 1JUEA 1JULA 1TPVA 1AW2A 4E38A 1O60A 3O6DA 2EGZA 3BGGA 3LM7A 4ALDA 1W5PA 4CNPA 1WAUA 1KM5A 1K02A 3PWAA 2V82A 1XDLA 1P1XA 5F4XA 3MWAA 1W1ZA 1QFEA 1NF7A 2OT1A 1K8YA 2X30A 3D0CA 4NJHA 3R5EA 4X22A 4QNWA 1GVFA 1AW1A 4NT0A 2QUTA 3I6RA 4LUIA 5FEPA 2ZTKA 3NQ7A 5AC8A 4O57A 3L0GA 2NUWA 4JXCA 3UXDA 5G1YA 4NJJA 3C4UA 2VELA 4JTIA 3S5OA 4GRSA 5LHFA 5HR6A 2V30A 4KFNA 2BXVA 3STCA 1RQHA 1TPDA 3E12A 3P61A 3I7SA 2HS8A 1ICQA 1QOPA 3HPSA 4DBDA 1KM3A 1I2RA 4ONVA 2ZA1A 1OABA 1S3HA 2CLIA 1SO3A 2X2GA 4AF0A 3BW4A 1C8VA 2A6LA 3GXNA 2AGKA 3W1UA 4M6VA 2H3DA 2RHGA 3CQ0A 3FFSA 1H5YA 2W6RA 1SZNA 3SSJA 3TSBA 4GXMA 3NQEA 2QCCA 3DGRA 1J5TA 2XN2A 1MO0A 3DFTA 1QPNA 3KFTA 1SZFA 1EUAA 2TPSA 4NZJA 4M7TA 3TQKA 3G1HA 4U28A 4XKYA 1TTPA 1DQWA 2E6AA 3HG3A 1B57A 5I3HA 3W1MA 1QPOA 2CLKA 2RKXA 2A2IA 4XTIA 1XC4A 4DPQA 2FPYA 4PFMA 3LHZA 2GVJA 4UFJA 3W7PA 5DY3A 6TIMA 1M7OA 2ZZ6A 1XFBA 1KM4A 4O4VA 3W7LA 4LS2A 3TAOA 1PE1A 3W85A 3BW3A 2J9YA 2FDSA 2RDTA 5HNRA 2X1UA 3L9CA 3NQCA 3TDFA 3V1PA 5CSRA 4LVAA 4MFDA 1TTIA 5AHIA 5AN7A 2NWRA 3NQDA 1FWSA 1WXJA 2CFFA 3LTSA 1RPXA 3SGUA 5KINA 3LRLA 3DZ1A 1F05A 2Y63A 3W7JA 4DQWA 3PBWA 4JY9A 5D37A 1I2PA 2X1SA 1FUYA 2A4AA 2QCGA 1YYAA 4O8RA 1SO4A 1VGAA 1DKWA 2HS6A 4O0KA 3UNDA 3TKFA 1YDNA 1LROA 5AYYA 3NPUA 2G96A 2FIQA 2VFDA 2WV8A 2FB2A 4LNYA 5AHNA 3GZ3A 4GFSA 2ALDA 3LXAA 4K36A 4WQ6A 2Y7EA 2OT0A 2WNQA 5K4XA 2HSAA 4ML9A 2WKJA 4DF1A 1FWRA 4QISA 4UTHA 4IMGA 4Y6GA 4LW7A 1T99A 1P4CA 2BTMA 3B03A 4UTMA 1SUXA 1UUOA 3O6YX 4PH6A 4S2CA 2X16A 4MYAA 4C1LA 4ORMA 4OT7A 4XUGA 1SU5A 1TV5A 4O14A 4N02A 2ZRUA 5HQEA 1TJPA 1ZAIA 2DJLA 3B4UA 4R53A 3CIXA 3Q37A 4DBEA 1G67A 2DZTA 3S9YA 1G7VA 5KZDA 3LBCA 1D3HA 1FXQA 4JIPA 1K3UA 2GQ8A 4RXGA 1SW3A 2LLEA 1IGSA 4LTSA 1VR6A 2H8XA 3PR2A 1ZY9A 1TRIA 1LCOA 4PCFA 1YTKA 1TMHA 3IIXA 4A22A 5DCEA 1LRNA 3NR0A 3QM3A 4HNVA 3HMJG 3CTLA 3P84A 4Y96A 1EP1A 3O05A 2GPTA 1EPXA 1VPXA 3NOEA 2PRHA 4E2BA 1OYAA 1LZOA 4PA8A 3N34A 3S5YA 4JX6A 3QJAA 4UTWA 1LDCA 5L6UA 5CSSA 3SJ3A 1H7OA 1FWTA 3GKFA 1HG3A 4A3UA 1WBJA 1JCNA 4LS1A 3F1QA 2FTPA 5D30A 2Z6IA 3TSMA 1OFOA 1DHPA 5LHEA 3UPWA 3W7KA 3TU9A 3SW6A 2X1RA 1TJRA 5DLCA 4WXZA 3LV6A 3A24A 3R13A 5I3IA 3E9AA 4YLWA 1JCLA 3DKLA 4DEFA 1G4SA 3FOKA 1IXOA 4Y90A 3O1NA 3OVPA 4IMDA 3W83A 3LHWA 1ALDA 1Q6LA 1Y0EA 4BK9A 2QUUA 5CZTA 1TPC1 5HWNA 4DPPA 4GUIA 2QCDB 3W1RA 3S1WA 3NYZA 1BWKA 3O8AA 4DO6A 3M6YA 2DP3A 1C9DA 2V2DA 4RJEA 2WSQA 4MFEA 1TCDA 3B0UX 3GX9A 2PC4A 4AHPA 1GOXA 5G5IA 4MY1A 1ZAJA 4NNBA 5C6MA 5LNVA 3ABQA 5K7JA 3HG2A 4E2DA 5FF7A 1GEQA 5TIMA 3W3OA 4UTWC 3Q58A 1K7XA 2ATSA 3GK0A 3C2EA 2QDGA 3E96A 3LXCA 1L6WA 3G3MA 4K7VA 5HMSA 3W7MA 1B4EA 1JUBA 1JCMP 1LBFA 3BK0A 3ZFHA 5AYXA 1A5CA 3M5VA 2J88A 3RLUA 4A2SA 2E68A 3EWBX 3LI0A 4MLJA 4AWSA 2NUXA 2QCDA 2Y61A 4MIMA 3INPA 1DOSA 1VHCA 2W79A 3G1DA 8TIMA 2DZVA 1ZCOA 1H7WA 3WK1A 3E0IA 4ADSA 3NQAA 3TC6A 1I2OA 4JX4A 2C19A 3G1SA 3R89A 3MBDA 2Z2UA 1QPRA 5AC6A 4XTDA 4KWVA 3USBA 2WSRA 4AWUA 2NXHA 3A23A 4JDBA 2QR6A 3W74A 3QRHA 1N7KA 1LP6A 3P81A 3R2GA 3LCGA 1YLVA 1S5TA 4N2YA 4O28A 4LY8A 4WZHA 2QAPA 4S2BA 4MJMA 1KTBA 1UUMA 4UFKA 2NV1A 4R33A 2ZRWA 1JQVA 3HB9A 3FKKA 3IGSA 3OHIA 3E02A 3F03K 3NPWA 1OFBA 3BG3A 3VE9A 3RK8A 1SR9A 3PF3A 4AXKA 3SY5A 4JS3A 5F4SA 1QCWA 3LXBA 4Z1BA 4OE7A 1AG1O 4HSOA 5EY5A 3TH6A 1I2NA 4AAJA 2CLHA 1MSSA 1J4EA 4UFLA 3LCLA 3W73A 4O10A 1SO6A 1WOBA 1LLZA 4DXVA 1KM1A 1IIGA 2A7NA 5ABTA 3G1FA 4WOQA 4LVDA 4UXDA 1ML1A 3GXPA 1N8FA 4UMCA 1HFBA 3GIYA 1ZAHA 4JNMA 3C61A 3TJLA 4QNEA 4MVAA 2ABAA 1DV7A 4A2RA 3TXVA 1XUUA 3JS3A 1W31A 1LRQA 5D09A 5BW6A 5CPNA 1FX6A 4UR8A 5CZJA 2Q3RA 4QAIA 3EWWA 2P10A 3GDLA 4MKNA 3PG8A 1GJPA 3MBFA 4JTJA 1PS9A 1VCGA 4O1BA 2NXIA 4R7JA 1Q6QA 3W1TA 5DCDA 2ZZ1A 2AAMA 1FDZA 3TFCA 1THFD 1ME7A 1F6KA 2YSWA 3B04A 4K8HA 3RLVA 3DI0A 4L4MA 2WPBA 1GG1A 4DELA 3L68A 2JGYA 3LCHA 2A85A 1XM3A 1UASA 1XXXA 2J6XA 3GDKA 4WD0A 3N2XA 1V5XA 2RH9A 3EEGA 3VI2A 2Q8ZA 3LCIA 3UZJA 4LOCA 2Y88A 4XQ6A 2ZQ0A 4UTKA 3OBKA 4KKXA 1W54A 3EXRA 3G18A 5AOUA 2GJLA 1F5ZA 4P61A 5I3GA 1JUKA 4NXSA 1TPB1 1TQXA 1NFBA 3NAVA 4M7SA 4MY8A 2CLLA 4JTFA 1DJQA 2DU2A 1F76A 4IJBA 3LDVA 2QCHA 4DO5A 1NVMA 3O63A 3N9SA 5J5DA 1AL8A 3ABRA 4O54A 4N4PA 4LV9A 3TQ0A 4MLRA 3G0UA 3M5YA 2ZYFA 1AK5A 1BEUA 1HO1A 2CZDA 2ZZ4A 3DU0A 4NU7A 4WOZA 4O16A 3ABSA 4BWLA 1W8SA 3ATYA 3IIPA 3T78A 4FO4A 1PIIA 3GLCA 3LB0A 3PUEA 1VLWA 4PL2A 5CPMA 2AQWA 4JTGA 3PBUA 3P74A 1ZJIA 5D2WA 3PC0A 1LBMA 4N9BA 3THQA 4M5PA 1VCFA 2VFEA 2V9DA 2V0TA 2QJIA 2DZSA 4BF9A 4BI5A 3TIMA 4IX0A 3WK2A 3W1LA 5G4WA 4IQLA 1SSDA 1X7FA 3DFSA 2KZHA 2B7PA 3M5XA 4NJIA 3NGJA 1UJPA 1K03A 1OYBA 2BLEA 1P0NA 3LHVA 3VNDA 2VC6A 3VE7A 2B0MA 4NX0A 3HGOA 4O19A 5K4ZA 3C56A 1L9WA 4O13A 1WDWA 4RZ5A 3EXSA 2G5WA 3LCWA 2QCMA 3L67A 2CZ5A 3W2UA 5K9DA 5BNKA 4JYDA 4UMAA 1JR1A 2H90A 3NXFA 4DF2A 3W7GA 5A8GA 2WJZA 5TQLA 4JYFA 3TK7A 2BSLA 4O1AA 1A50A 1OG0A 5F2MA 2CLEA 1XI3A 3CPRA 3O06A 4FHAA 1K8XA 3OVRA 4A29A 1VYRA 2I1OA 5AHEA 4O53A 3G1XA 3L5LA 4PL1A 1YXYA 1ZNNA 3L0NA 3PY2A 3L21A 5AYZA 4ICNA 3HPZA 4NZFA 4O15A 2WNZA 3RMJA 5LSMA 4C1KA 3S5NA 3FYOA 5EBUA 4KFPA 4XBSA 4RXFA 1SSGA 4FF7A 2B7QA 3SIZA 4U4MA 4LVGA 2Z0IA 3NNTA 3W1AA 3LTYA 2A0NA 3SI9A 4CQ9A 3EX6A 1FQ0A 2VEKA 1ME9A 2EKCA 1KM2A 1WOAA 5CZ0A 1ICPA 1DL3A 3CLMA 5F4WA 1SQ7A 1KFEA 1A53A 3GR8A 3KRUA 5D32A 4ZQNA 1VQTA 1SFLA 4NNCA 2TRSA 1EWEA 4UFHA 3YPIA 3FKRA 4B5NA 1H61A 2R14A 4MZYA 2B7OA 3W7NA 2C13A 4TMCA 3P60A 3TV8A 4HHPA 3H54A 3SZ8A 5HR7A 4CQ8A 3MP4A 4N9EA 4NXKA 3PS7A 2YYUA 1F7BA 3W6YA 2A6NA 1MEHA 2CWNA 3HGJA 2C1HA 4OQVA 4WXYA 3IV3A 1JCXA 1LRTA 1TQJA 2ZCGA 5DCBA 2QKFA 2C0AA 3NDOA 4FNTA 1PV8A 4IWWA 3BARA 2DZPA 3L2IA 1R2SA 5L9FA 5FEZA 4O50A 3CC1A 4IMCA 3FS2A 4RZ6A 5F2GA 5LNSA 4JTKA 5HJLA 3W84A 3VKJA 4EIVA 1YADA 2V81A 5AHFA 3NL6A 3W2KA 2GJNA 4CQAA 1C29A 2VEIA 1NEYA 4TX9A 1X8FA 1K7EA 1EX5A 3HOJA 4O11A 3TCEA 2RFGA 3MHGA 5CPOA 2R8WA 1M5WA 4E0CA 4BI6A 3WJZA 1AL7A 1PHWA 2Y62A 2O7SA 3EWYA 2ZTJA 1JJKA 2NUYA 4MZ8A 4JTSA 5CPLA 3VCRA 1SPQA 2I9EA 4H3DA 4UNLA 3WK3A 4TR9A 2G97A 1K7FA 1KV5A 5KITA 4YCPA 2E6FA 1R30A 3S42A 2DZWA 4AF0B 2CW6A 3QPZA 4JIQA 4UCGA 3TE9A 4UR7A 4O0ZA 4WY0F 1GQNA 1EIXA 1D9EA 2QDHA 1G69A 2FJKA 3GXTA 1RD5A 2QUVA 4O4WA 3TXZA 2D73A 1W5MA 2IQTA 1EP2A 3MP5A 3NPVA 3A22A 1TTQA 2FPVA 4FXRA 4FX8A 4TU1A 2YDAA 3CIWA 3RFAA 1RQBA 3PG9A 3C0JA 3W23A 3PUOA 4FB7A 1I4NA 4XKYB 2VEPA 1TPEA 1G4EA 3PSWA 2TYSA 1KFCA 3KOFA 4MOZA 3W7CA 5HUOA 3DENA 4FX7A 5I3JA 2E5CA 3A21A 4NJGA 1UB3A 2GVLA 4QITA 3MI3A 5A5WA 5CKSA 2P1FA 3WK0A 3P7YA 2EHHA 3LCXA 4N6EA 3HBLA 2C6QA 3W7IA 3VFLA 1R47A 3N3MA 1TTJA 4NJKA 1ZHAA 3QF0A 3W1NA 1XBXA 2NLIA 3Q94A 3STEA 2PURA 1WYIA 3IVUA 3HGRA 5K9XA 1KM0A 3W88A 4HSNA 3UY8A 3FA5A 3TC7A 1WX0A 4EF9A 3B05A 1OK4A 3MYPA 1T0OA 3NQFA 3QW3A 1O5KA 2YR1A 2G95A 3M41A 1VZWA 2NXGA 1Z41A 3QW4B 3NQ8A 1QMLA 4H4IA 2H3BA 3LX9A 3P62A 5KZEA 1W5QA 3DFNA 1MEWA 2H8ZA 3HQ1A 1WA3A 1XBZA 1T96A 4MYXA 3IEBA 5C54A 2B4GA 3MHUA 3LRKA 4BR1A 3DBPA 2XN1A 1RZMA 4WY0A 3S6DA 4FXSA 4L4LA 4LV4A 3OVQA 3BV4A 1JRBA 2A1YA 3TA6A 3S0CA 3TR2A 3N14A 3BG9A 1P0KA 4XBKA 3DFQA 4M19A 4QJ1A 2QAFA 4JR5A 4FEZA 4ADTA 1OX6A 4LC8A 4RZ4A 3MYOA 3TW7A 1W5NA 3HF3A 3H53A 3QPYA 3N73A 3AJXA 5D2VA 2C15A 4UTIA 3T44A 3UY7A 1KFJA 1JRCA 4PC8A 1FCVA 4A21A 2QEZA 1G7UA 3M9YA 2FQIA 2GQ9A 2ABBA
chains in the Genus database with same CATH superfamily
1ZP4A 2QCFA 2XZ7A 4HU3A 1GVYA 4J28A 5LXEA 2QJHA 2FVKA 4RLIA 3TQPA 4XO6A 2B7NA 1P6WA 1CI1A 4ZQCA 3LI1A 4FX6M 3NQVA 3WEMA 3N9RA 3ORWA 3TNOA 3PTKA 3NPXA 5BRQA 1UOKA 3TZFA 1F4HA 3H70A 3QFWA 5H8UA 5LIXX 5FEXA 2H6RA 1VIWA 1FWNA 5T26A 1LWJA 1FBAA 2ESCA 4I5UA 1W5OA 2HE5A 3ALFA 1RY8A 4BI7A 1XLGA 4H2HA 1ZBVA 2ZRVA 3R25A 3DOPA 3KEHA 3IV8A 3E74A 1FCQA 4LB4A 5JBDA 2CWXA 4GKLA 3GAKA 1QWKA 1SFJA 4AMAA 2VEFA 1VIZA 3ZWSA 4NNAA 3M44A 1TMLA 4CN1A 3EYPA 4GBUA 2PDMA 1J0JA 4MAVA 4PTNA 3IJQA 1FHUA 2WMJA 4FNRA 3ITOA 3USZA 4UBPC 2E77A 3QZEA 5HNUA 1JEZA 3GIQA 1V7AA 3EWUA 5FD0A 1UR1A 4YTQA 2VX6A 3WCZA 3K13A 3AS3A 3H7VA 2GSJA 3KZSA 3ALGA 1NY1A 3M7WA 3SCVA 1D7KA 3CZJA 3VGGA 1Q6OA 1OCJA 2WLZA 4JFTA 5HWJA 1S5MA 4JX5A 1KLYA 3QC0A 3QQWA 4D71A 1D3GA 4DO4A 1F3EA 4ADUA 3A47A 3GH5A 5DELA 2DZAA 3QEZA 3PP7A 3TTYA 2WVVA 5A2BA 4EVZA 2DGAA 1Q3NA 1EC8A 3EKLA 3UWWA 5EMMA 3MPGA 4EK7A 4CCCA 1KBJA 2V38A 5EFDA 1OFQA 4QS5A 3WFZA 3M07A 1XLKA 3UU0A 2VUNA 2X1TA 3C6CA 2YFNA 1NDYA 4GJJA 4CLMA 4S3AA 3MO7A 1VH7A 2Z4GA 1KRAC 3MCOA 4XWUA 3E5BA 1RPKA 4JTEA 3WLRA 4V2XA 2WMHA 2EPHA 1AUSL 5DMNA 1VFMA 5BMWA 1J2BA 3WQPA 3VXGA 4GUJA 5KZ6A 2EPMX 1XBYA 2UWFA 1Q8JA 4EWND 1O5RA 2Z1WA 3QVQA 1TO3A 4IGSA 4HK7A 4LF1A 3WBEA 5EL1A 2WVVB 1H7PA 3N18A 2GSEA 3WQ8A 1AMKA 2WHKA 3D3FA 4GJIA 3QQ1A 5CZSA 1CTNA 4QHRA 5SWUA 5D03A 1O12A 3F4WA 4DWDA 5EMUA 2WMFA 2Y89A 2QIWA 2FTWA 1R2RA 3NL2A 4LGXA 2XM1A 1OX5A 1XIJA 2AL1A 5BU9A 1TV7A 3UERA 4ZENA 1SJCA 4GNKB 3U7VA 5H8MA 1TPFA 1XYLA 3Q67A 4LJ3A 1US0A 4KFOA 3TN6A 1Z44A 4LBRA 1AQ0A 1P0EA 2E9LA 2XVLA 4RPPA 3NM3A 4NF7A 2NX9A 2VZVA 3BAJA 2BY2A 5CGQA 4J3SA 3BE7A 3RF9A 2J9XA 2WZTA 2YCLB 4JTAA 4PE8A 3DECA 4M56A 5CH9A 2ZZ5A 4MZ1A 2BHUA 3NEVA 3W7HA 1EXPA 2YCKX 5H6HA 2AMGA 4AD1A 1HUVA 1TB3A 4RV8A 1YPFA 3N1AA 4Z42C 4WCJA 4JEJA 4LPCA 5JVLA 2R24A 3TLLA 5AYBA 4J3WA 3QY8A 3UEQA 3QYQA 3AMKA 3NZGA 4NP7A 1H1ZA 4UQAA 1XIBA 1LM1A 1KXHA 3WD4A 3V5FA 4UFMA 3SGGA 2Y1HA 5A6JA 1MWOA 1FCBA 1YTDA 3OZMA 2UY2A 4WRHA 1V02A 4AMCA 4AB4A 1U30A 4IIEA 1OZMA 4N6FA 1QNOA 4IUGA 3JW7A 3GVWA 4RE0A 4UTTA 3CEUA 1JCTA 1AH4A 3GDMA 2E28A 5A8QA 5D33A 2F9RA 2IPFA 2VC7A 2GJRA 3ZWTA 2WNNA 3O15A 4QM1A 1A49A 3QV6A 3TUUA 3PHAA 4KWWA 3C2OA 1UKQA 1B3ZA 3GR7A 3L2MA 2SFPA 5A8MA 5F7UA 3IPWA 1QW7A 1RR2A 4Z1AA 2CLOA 2Y70A 1VBHA 4X2RA 1PZ3A 2HDJA 3A3HA 3RR4A 1AW5A 4ZGYA 1EGVA 1U33A 3CPGA 1QBAA 1S1RA 1PVNA 3L4XA 3NSNA 1GZGA 1GONA 4A35A 1B1YA 3E2VA 4ATWA 3W71A 1OGSA 4M24A 2A3HA 3QSTA 4AVNA 4C65A 3ITYA 5DN1A 4JGDA 2WC3A 2FJUB 9XIAA 1ZQ5A 3BURA 2YOCA 4FLQA 4GO8A 3VKBA 3Q4DA 1ZP3A 2BDQA 3I3DA 4AZGA 1YPIA 7TIMA 4J7RA 3QKZA 4B90A 2QVNA 3PTMA 3DHDA 1Q7ZA 5E1QA 2VGBA 1Z48A 1TWWA 4TIMA 3OW1A 4W5UA 3FY1A 3GH7A 1QPKA 4PUWA 2VFGA 4ES4A 2HNHA 2BX7A 1KGXA 2W63A 4WKAA 5DBUA 5FEWA 4NI8A 3CV7A 3RNDA 1NSJA 5CPTA 5EYWA 1BKHA 2G3NA 1M6JA 1TREA 4L80A 2WVTA 4FR6A 4I9JA 1V0NA 1Q2RA 1TSIA 4K37A 4D6JA 2WBKA 2JKEA 3LV5A 1GYNA 3BLEA 3MKCA 3UWZA 3F5LA 2YGYA 4KW2A 3ANVA 2DUXA 3P80A 2RDUA 4IMEA 4HT3A 4WHBA 4PTXA 1X1ZA 3B9OA 4DWSB 3LZ3A 5A95A 5DY2A 4XISA 1UHVA 3TONA 2Q8LA 2ZKMX 3GTXA 3M5ZA 3EPMA 5DMLA 3KOZA 4OHQA 4D72A 3B97A 4DJDD 2VCBA 2P5NA 4LWWA 3L12A 4RUBA 1Q65A 1DEDA 1E72M 2ISSA 2DSZA 2C18A 4QEHA 2NWSA 5G2WA 1GGOA 5A2AA 3G8EA 4OV9A 3K4WA 4HNNA 3MHFA 1EDQA 3FIGA 4J9JA 2RDWA 2PWUA 1PEZA 4ZL1A 1H41A 2J25A 2WZEA 3LQLA 2E6DA 2RGMA 4DZIA 4IOTA 4OWGA 2CLMA 1LL7A 3M0XA 4Q4MA 3GG0A 3SCOA 1H51A 4HN8A 4Q6XA 3STPA 3ZS4A 5BOFA 3LHTA 1EA9C 1UZDA 4HPJA 3MZNA 3UWUA 3WLMA 2MNRA 1OVDA 1CGXA 3HPXA 2FZ8A 1Q6RA 3EMQA 4ZVJA 1K9EA 5M5DA 3CV2A 1TR9A 3TCSA 3O07A 1FKXA 3MUIA 4P2VA 1HVQA 4JFUA 1X96A 3OLDA 4XZWA 2YDSA 7A3HA 2FZBA 4I5XA 1WCGA 3G8RA 1RA0A 3T7VA 3MB9A 4LALA 3E2RA 3BVJA 4D6IA 1ONXA 3O0KA 4X9SA 2YL5A 1LUCA 3GYEA 1E3ZA 2ANUA 3QR1A 3M4HA 2PFHA 4I9TA 1QAPA 1R85A 3LENA 5EA9A 5H2ZA 1AJ0A 5A94A 4REQA 1MXDA 1GWJA 3C8FA 4XAYA 5IBXC 1N55A 2P8CA 4MY9A 3KBNA 3E0FA 1KCZA 3OHMB 1AQHA 1WDPA 5BRBA 1JPHA 2QZRA 1ISXA 1PCKA 4YHEA 4IX2A 3L5MA 4HCLA 3TA9A 1H7RA 1VCVA 3WNMA 2INZA 3UD6A 1CWYA 4WF7A 1R9YA 2B81A 2XIIA 3FHAA 4ZZ9A 1ME8A 3IJ9A 4CNTA 4U10A 3QSRA 1UP0A 2BVDA 4QBXA 1ZBCA 3BGAA 4A3RA 4LUSA 3ZYZA 3EX4A 2GOUA 4Q32A 4AQLA 1YXCA 3IJIA 2ATMA 1CYGA 1B9BA 3UCDA 2ZXQA 1Q5MA 4EOUA 3WFAA 3ZT6A 1T7LA 4RW3A 3H2AA 1C91A 3CAWA 2QJMA 5G2HA 2GUUA 3TMQA 3UJ2A 4ZODA 3GXDA 4J2PA 2Y7GA 4D8AA 4IMAA 3F5KA 5HUPA 3MUXA 3GUGA 3GB6A 2EF9A 4HMCA 1SO5A 3R0KA 4JDYA 4TV5A 2ZX8A 1UG6A 5KSWA 3G22A 4AHQA 1ITUA 2PA6A 4LUSB 3W22A 4LS0A 3HPFA 1GORA 1K8ZA 5LZLA 4M81A 1V4YA 4JPGA 2IPGA 6XIMA 1O6IA 1ZBKA 3Q45A 1UW9A 4WSJA 4GUHA 2Q3OA 1HJWA 2QUMA 5LA0A 1QW9A 3TROA 2VX5A 3U6WA 1KXVA 2VRQA 3IAPA 1CB2A 4DYEA 5DXXA 4HPGA 1Z89A 3AXKA 1EA0A 3U2OA 1J5SA 3KVJA 4FNPA 3U8GA 2J9ZA 4RE3A 3RU8X 2QCNA 1WUEA 5KMYA 4UTUA 2ZDRA 5ENLA 4O12A 4Z2JA 1I0BA 3M47A 1EJWC 5TF0A 2WB5A 4CNUA 1PL9A 4NZ3A 4HU4A 3AFBA 1TPVA 1AW2A 3S3GA 1O60A 2WWCA 1VAHA 2PP1A 4NZ4A 4CNPA 5CCZA 4QDPA 1UOZA 1GKRA 4NJHA 3R5EA 2INEA 2X40A 2W66A 5FKYA 4LUIA 1OADA 4QS6A 4PBEA 3NQ7A 3UR8A 5AC8A 5CBIA 2QMKA 2OEKA 2NUWA 4JHZA 1S2AA 5G1YA 4XAPA 4WVXA 1PAMA 4JTIA 5LHFA 4D9PA 2V30A 1K9DA 2CNCA 4H04A 1L6FA 3VCNA 2Z26A 1ICQA 4GKTA 4ZO9A 1I2RA 2GGIA 4ONVA 2ZA1A 1OABA 1V0LA 2AGKA 1FH8A 3W1UA 1B0IA 2XJ7A 1JAKA 5EMJA 1NTHA 2CXEA 4A4AA 3TVAA 3NQEA 3DGRA 4JTQA 1J5TA 1BSLA 3ITVA 3UJSA 1E6PA 1C90A 4TOQA 2TPSA 3SUUA 1UYQA 4XKYA 1TTPA 1JI2A 4RDZA 1DQWA 3LZ5A 3HG3A 5CZKA 1LLOA 4GYPC 2XWDA 5D9MA 4LYKA 4DI8A 1BLIA 5I03A 1LL4A 2AKMA 3S2JA 4PFMA 4CD6A 2AOSA 1VEPA 2XH2A 2J47A 4BZYA 1M7OA 1YIXA 3RG6A 3RILA 3WQDA 1KM4A 1E0VA 4GH3A 3AMCA 4O1EA 1HJUA 1EBHA 2BOEX 3BW3A 3C0LA 3SO7A 2C7FA 5HAOA 4CVUA 3L9CA 3V1PA 4LXFA 5BWAA 1WXJA 1RPXA 3W7JA 3AHTA 1E71M 4KH2A 2BY1A 1S2TA 4LAKA 2Z25A 2J75A 3I4EA 3PPHA 1RALA 4B3LA 1AZ1A 2I16A 1CECA 2WV8A 2FB2A 4FOUA 2ALDA 4G7EA 3LXAA 2ADAA 4WQ6A 1GK8A 3GTIA 2GWNA 3L4YA 2HSAA 4ML9A 2WQDA 2DW7A 4UTHA 1YNYA 4Y6GA 2J79A 2VZTA 4ZR8A 2BTMA 3B03A 5BU6A 3VOHA 1SUXA 3TN3A 1UUOA 1DQUA 3W4RA 3KM8A 4QCFA 3WD1A 4XK2A 3KTXA 1MNSA 4V28A 3FGCB 1Q13A 2CESA 1TV5A 4N02A 3LGGA 1ZAIA 4FPSA 2EBNA 4YVXA 4H8NA 3B4UA 2O0TA 3CQHA 3SCNA 2ZXBA 3PZMA 1G67A 3S9YA 1GOKA 2QJJA 1O7AA 1C8YA 1B3YA 3L4TA 4JIPA 4L7ZA 3VKCA 5BYWA 4GA8A 3OA5A 7REQA 1SW3A 3PR2A 1D7FA 5FJUA 1LCOA 1BF6A 1TMHA 4A22A 1BRLA 1R3SA 4D8LA 3MDUA 3EOEA 3NR0A 3HMJG 5C8BB 4Y96A 1EP1A 2GPTA 4RE4A 1AZ2A 1UPMB 4E2BA 3M0IA 1LZOA 3VC6A 3N34A 4H7CA 3AIUA 1PX3A 1SVDA 3SJ3A 1HT6A 1X98A 3GKFA 1BAGA 1WBJA 1JCNA 1JF6A 4TX6A 1EJVC 5AY7A 3WUGA 2GSHA 4O1FA 2BVTA 3F1QA 3WH6A 5MKGA 3TSMA 1A5MC 1OFOA 1RK6A 3GBDA 3HU7A 1UQZA 3UPWA 4QG8A 1AD4A 2ACQA 2PWEA 4HA4A 3R13A 1JFXA 4YLWA 1G4SA 4R7WA 4LANA 4CEXC 4LEFA 3SUSA 3LHWA 1Q6LA 1XIFA 3TP4A 3NO1A 1TPC1 5HWNA 4DPPA 4ZB2A 1JYNA 3O8AA 3S1GA 1C9DA 4D6FA 1K1DA 4RJEA 1RP8A 2WSQA 7ODCA 3GX9A 2W61A 3B9EA 2OGYA 5C9UA 4YTUA 1EC7A 4M80A 1FWIC 3KBMA 5FF7A 1E9LA 1GEQA 5DRCA 5TIMA 5MKGB 1Y8BA 2IKHA 3ARTA 3APTA 4PCTA 1L6WA 5HMSA 3WD0A 4RNIA 4JTRA 2G3IA 4IHCA 1HX0A 1WZKA 2OQLA 2E0PA 1LBFA 4C6BA 3ZFHA 3AHZA 1A5CA 3M5VA 5DO8A 1E0UA 2EPKX 4HYVA 3COTA 1WZMA 3OGRA 3SUWA 4FK9A 4BS0A 2Y61A 1ADDA 1DOSA 1VHCA 3GG8A 2FVLA 1OQFA 4C6QA 2Y5EA 3E0IA 1S1PA 6A3HA 1HGYA 3NQAA 1UZ1A 3N6JA 1GQKA 3GXIA 3JUGA 2BFGA 3PNUA 1VPYA 2GDQA 6CGTA 5C2GA 4YYFA 1BPLB 1QPRA 4KWVA 5BROA 1W3KA 1H3GA 3USBA 2A79A 4LAZA 3A23A 1XWYA 4J1OA 4YHGA 2NLYA 2YA0A 1S5TA 4N42A 3KOYA 4N2YA 1KTBA 4UFKA 3KTSA 1I1WA 5REQA 4NRSA 3NPWA 4AEFA 4MB4A 3RK8A 3WQWA 3PF3A 4RNHA 3RHGA 1A3XA 3SY5A 4JS3A 4Y9NA 1AG1O 2R9RA 2CLHA 1MSSA 1I60A 4Q7BA 1IEWA 4P5UA 1OD8A 1RA5A 3GNRA 2PWHA 2VWSA 5DX7A 2I5GA 2VGIA 1C9WA 2D0HA 3QY7A 4HB7A 1DJYA 4R3UA 2PDIA 1HJSA 4H9MA 1OGBA 3SCQA 1XPYA 3MWCA 4PULA 4YWSA 3NGFA 2ICSA 4B5WA 2PDGA 2ABAA 1DV7A 3VX0A 4AIOA 3B3DA 5REQB 1JYWA 3QY6A 2G3FA 2XVGA 3TN4A 5D09A 4U5KA 1DJXA 5BW6A 5CPNA 5I7GA 2QV4A 1QU4A 2Q3RA 1FWCC 3EWWA 2P10A 3T4WA 3VMNA 2OELA 1B54A 1XLAA 3WD2A 2YL9A 4CKQA 5FSDC 1A3WA 1UD2A 3WUBA 4JTJA 4O1BA 4R7JA 1Q6QA 1BGAA 4EXQA 3LUTA 2YSWA 3RLVA 4L1WA 1KQZA 4PRRA 1GG1A 2X8RA 3T2QA 4R7OA 1J6OA 2WMIB 2Q8ZA 2JIWA 4UCFA 3UZJA 2NSOA 3B9AA 2ZQ0A 3OBKA 4P61A 5BXSA 4DYKA 2DT1A 1TPB1 2BOGX 4WJ8A 1DJQA 2DU2A 2G37A 4IG2A 1E6SM 3CUJA 3O63A 2OLHA 4HPNA 4O54A 3OOQA 1NOWA 2O9TA 3O6AA 4N4PA 4LV9A 3TQ0A 2C71A 2D20A 5DFAA 2ZYFA 2ZZ4A 4NU7A 1WKYA 1US3A 3T78A 3IIPA 3HJEA 3GLCA 3LB0A 1VLWA 4JTGA 4NG3A 1ZJIA 3DG7A 3PC0A 1MNZA 3B9NA 3ANUA 2V9DA 4BI5A 1CT5A 3W1LA 5CSYA 4GYKA 1FKWA 3DN5A 1X7FA 4V27A 2KZHA 2X7VA 4PBGA 1CGWA 2B7PA 2PI6A 5T9BG 2VC6A 2B0MA 3HGOA 4KETA 5BXTA 1ZGDA 1L9WA 4O13A 2OVLA 4PMDA 2G5WA 2NT1A 2QCMA 3WSUA 2ODOA 3LNPA 1YE6A 1DJHA 1UR3M 4UMAA 2H90A 4DF2A 1Q7MA 5A8GA 1KCLA 1HN1A 3TWBA 4YVPA 5TQLA 1REQB 2BSLA 2CLEA 3PZIA 1GOIA 3WQOA 1G94A 1VKFA 3ARYA 3OLGA 1WKEA 4PL1A 1YXYA 2QF8A 3L0NA 1KRCC 3PY2A 3ABZA 3HPZA 3ZVIA 3CNYA 3W02A 4GIYA 1MDLA 1TA3A 3CBWA 3S5NA 1JPMA 4C6MA 4PZVA 3FYOA 3MA8A 1EOMA 1DJZA 4KFPA 2DVTA 2PWDA 4DWSA 3UG4A 1U1HA 4J27A 1E4IA 3SI9A 2ZADA 1FQ0A 3N4FA 2PBOA 1KM2A 2HBXA 2R1MA 5CZ0A 1SQ7A 1MFVA 5E6YA 5A6MA 1NFGA 4MG4A 3B8VA 4NNCA 2YXXA 2Z24A 1HQTA 4Q8QA 4B5NA 1H61A 2XFRA 2YCJA 2C13A 1JF5A 4DB7A 4TMCA 2QMJA 1L2QA 3QXBA 3T0TA 3CUXA 4WSKA 3H54A 5HR7A 3WMBA 4CQ8A 4N9EA 1E1FA 5TAOA 1AH0A 3BLLA 4OQVA 3SADA 4KCWA 3WLIA 3MMWA 1XYFA 2C0AA 3BARA 2DZPA 3L2IA 4PUUA 5L9FA 3KBVA 4KIEA 2DIJA 7TAAA 3CC1A 4IMCA 3FS2A 3W84A 2V81A 3W2KA 3NL6A 3KLLA 3ZT7A 1C29A 3MSDA 2BNJA 2HE8A 4JFVA 4TX9A 1X8FA 1MUCA 3DYPA 4QG9A 4TTUA 1BWVA 5CPOA 1GJUA 2VDIA 2R8WA 4N7QA 4LUYA 4E0CA 3KOXA 1PHWA 3QTGA 1CXKA 1JJKA 3E0VA 2AQOA 4JTSA 4GVHA 2WSPA 3VKAA 3AMDA 1PZ0A 2FHCA 1R9XA 2I9EA 4GGHA 3WK3A 4C6NA 4TR9A 1KV5A 5EMKA 3T07A 3OP2A 1XPGA 5A69A 2FH6A 3LMZA 3P3BA 3ZIZA 2DZWA 4B91A 3TE9A 3IACA 2W91A 4WY0F 2G3JA 2FJKA 1RD5A 2DIEA 2QUVA 2D73A 1A0DA 1W5MA 4KWSA 3W81A 3SM0A 3MP5A 1EP2A 1TV2A 3AQUA 1J6PA 3DCPA 2FPVA 1JIBA 4TU1A 3LPPA 3RGTA 3VNKA 1WKDA 1XJBA 4AY1A 5EU9A 1RQBA 4AG0A 3W23A 3ICJA 4W93A 1MVYA 2VEPA 1TPEA 3VOGA 1AFSA 4XD6A 3BL3A 3TJIA 3A21A 4WLCA 1DWJM 4HCHA 4BHYA 1UB3A 4PTWA 4QITA 4QE5A 3MI3A 5CKSA 2VL4A 4IIBA 3KS6A 4Q6JA 4MDOA 2DZBA 3LCXA 2J8TA 5RUBA 1R5YA 4I9MA 3SQMA 2TAAA 2VX7A 2UZ9A 3NWRA 3ZOAA 2BHYA 4QJ5B 1M3UA 1XGDA 2NSXA 4G7FA 1XBXA 4Y9OA 2NLIA 1UH3A 3MVIA 1IV8A 1XW8A 1ZSXA 3HGRA 2V6AA 1KM0A 2G41A 3TC7A 3B05A 1OK4A 2A3BA 3MYPA 1T0OA 1SJBA 2NT0A 2YR1A 2G95A 3DESA 1LT7A 4YU1A 3W82A 3NQ8A 4H4IA 1RK5A 3VDAA 1BXBA 3C3UA 1W5QA 3DFNA 3OQEA 2J78A 3BH4A 2XIJA 1ZRQA 1WA3A 1XBZA 1CGYA 1T96A 4CVWA 4MYXA 4IP5A 3GYCA 2H9AA 3KL0A 3RIKA 2OKOA 4FXSA 3N15A 4YTTA 2FZ9A 3OVQA 4UQCA 1JRBA 3EBVA 4F79A 3TR2A 5XINA 4M19A 4QJ1A 3ZJ7A 2RDXA 1QT1A 1W9DM 3N2TA 3GVQA 3TR9A 2QNEA 2VURA 1Q66A 3T44A 2ASHA 1CEOA 1CXFA 4B5SA 1TG7A 2HXUA 1U5VA 4DNHA 4PMXA 1TWZA 1VFSA 2OX1A 4Q8PA 1QTWA 3LSCA 3WNKA 3HQNA 4JYEA 5E93A 4WDXA 3S6OA 1QI0A 2VHLA 2H9AB 3WQEA 1F6PA 1HKJA 1E0TA 2NX1A 1YKWA 3BGJA 1C3FA 2ZRXA 3K8KA 3WJSA 4PTMA 3WLHA 3LPGA 1FTXA 1H49A 3LEPA 4UOZA 3LTPA 3H2OA 1U5JA 4PODA 1C7SA 4OBRA 3M6DA 3ZJKA 1O66A 4CD4A 1PKNA 4IXHA 3NZPA 4PBFA 2OLAA 4GXPA 2D23A 2ZUTA 1KFKA 3T81A 3QV7A 2OMAA 1V6UA 2KX9A 3CWOX 5LGZA 1JNDA 4I7WA 2P3ZA 4I90A 3PWGA 1GT8A 3M46A 3MDWA 1XGZA 1RCXB 3P14A 4IL0A 5PTDA 1FH7A 2YLLA 2X1IA 3MUAA 1SZRA 4K7YA 4XZIA 5FF2A 3QFEA 3II1A 1WXYA 3WEZA 5BRPA 5JH1A 2WZIA 3THAA 4WJEA 3IRDA 1EF3A 3L5AA 5E0FA 2O9OA 5E9XA 3WEOA 3VPLA 2J7HA 2X41A 3FAWA 5BXRA 1O5QA 3PUDA 4TVUA 4FSAA 1ZCCA 3NTYA 1HP4A 1BYBA 1L8PA 3SGZA 1EB3A 1Q6FA 2VP8A 2WYSA 2JE8A 3FVDA 1FDYA 1W6TA 1XKJA 2RJHA 5JIPA 1C92A 1GPFA 3DAQA 3NCOA 1TUFA 1O4UA 1OC7A 1TV4A 3KVKA 4XAGA 2YL8A 3ABOA 3KRSA 1CX9A 3CWNA 1W9UA 3VZXA 1A5KC 2EG6A 4GUFA 1CNVA 2Y7DA 3IJ7A 1YEYA 4IZGA 2V5JA 1JDDA 3NZRA 4HU0A 2YCEA 3SECA 4K6AA 5LIYX 3EWZA 3LERA 4GK8A 2OYKA 3SR7A 3W7DA 1X6UA 2CCRA 1EJXC 1EQCA 1HZYA 1XF0A 3ZR5A 3OIHA 2BS9A 2DSVA 4KEZA 3NVDA 4AD5A 1TE6A 1AQFA 2QLYA 5GVJA 3I68A 1LORA 3CT7A 3S5ZA 1PKLA 3WQ4A 2QQ6A 1O1HA 3QMTA 4UZSA 4MAZA 3OTRA 1ZLPA 1XL9A 2DUAA 3FV9A 2HBVA 1UWUA 3UG5A 2A5HA 1H62A 3DXIA 4KRZA 3R11A 4L9ZA 1WKFA 3UA3A 3TNBA 4B16A 3DBNA 3VVGA 4R34A 3N12A 1VBUA 1KW1A 3SCUA 5D9NA 4JIIX 1XISA 5MHBA 1CW2A 3CHEA 1A5AA 1BTMA 4IMFA 1UR2A 3C0SA 2FVMA 3UR7A 4ZEPA 2HK0A 3WLJA 1QUMA 3N29A 3RCNA 1W1TA 3ITLA 3VO0A 2ZRYA 3AXXA 4LAOA 2PGRA 4KGLA 3IJ8A 3M43A 2PDLA 2FB3A 4FNUA 1EH9A 2CIPA 4NZCA 1H4PA 4G9PA 4F2BA 2Z7KA 4C6EA 3NSMA 4HMEA 5LNWA 2ISVA 3D5HA 4X2PA 2FFCA 1TZ9A 4DAIA 3TAKA 1H60A 1H7XA 1OFAA 4LVBA 1G4PA 1SW0A 4C6CA 1TWDA 7REQB 3PULA 5E5CA 4JN8A 1EJUC 1P7TA 4DJDA 1BRLB 2V2HA 4RCXA 3QC3A 2WHJA 4Q7IA 3BCDA 3PZGA 4DWSD 1A5UA 3GDRA 4P7NA 2J6VA 3T8LA 4V33A 1H2JA 1BKSA 3DC8A 3WDPP 5I2UA 2OR2A 5FJOA 4GNVA 3FSTA 3CZGA 4KEUA 2GJXB 4W8AA 3LGEA 5BXPA 3B06A 4WUIA 3BLFA 4IQEA 4Y7EA 2GOKA 2XYLA 2QF7A 3EDDA 2ISWA 4M6UA 2IKIA 3TW6A 3MI6A 3WY1A 3NDZA 3QQ0A 2PGWA 1J8VA 1TPH1 4XZ9A 2C79A 2DY3A 3W07A 2VCAA 3N19B 4O18A 3H26A 3W2MA 1GW1A 2C91A 3CL8A 1B4KA 2Y8KA 2PSNA 4DZHA 4QE1A 3WBYA 1YHTA 1E9YB 4NASA 1UP3A 5FAJA 1IWBA 3PPGA 2C3ZA 3BAKA 2R1PA 2F7FA 3QGAC 4URIA 1MXSA 1S2CA 1ZZMA 2QV5A 3TFXA 4Q8TA 1F74A 1V03A 4AD2A 2C16A 1ZJAA 2GJXA 4OUIA 3URNA 3WH7A 2P0OA 2YIHA 3EPNA 3C52A 3LQGA 3H4GA 4MUZA 3TJXA 2V5LA 4FNSA 3BQ6A 3W2NA 3R94A 1ONEA 1I0DA 2OYLA 4TVCA 2FZMA 2XVKA 4C90A 2I5IA 2Y2WA 1CLKA 1OHLA 3CLWA 3REQB 2VENA 2DFAA 4ACZA 3QV9A 4QSHA 3E0WA 3NQ6A 4Z0JA 1X1OA 3WJWA 1G01A 5D2YA 3BOLA 1QDSA 3KUMA 4LC6A 3R12A 4N0RA 1Z8AA 1FY6A 5DBTA 3UWYA 1CLXA 1XLLA 2YPIA 4Q4KA 5LIKX 4HD5A 4B2DD 1HJVA 1H0IA 2F84A 2WZMA 4X0NA 2E9MA 1TE1A 1PX8A 3EDJA 1Q6GA 2JQXA 1A5NC 4P7QA 1V0MA 3P0WA 2HVNA 3WDJA 2O7QA 1YTEA 5F1VA 3ZSSA 1E6XM 4S3BA 2I57A 3ZJ6A 1Y5WA 2O4MA 3MP3A 1GVSA 2YA2A 5TBOA 3EA3A 1JDFA 5D8ZA 3T55A 1ADOA 4H8UA 1MW0A 2WQPA 3VILA 2EKGA 4ROPA 1UWRA 2OB3A 4ZQRA 2P0IA 2WK2A 5HMFA 1IT7A 1IEVA 1HO4A 5AHLA 4FIRA 5C2CA 2G0WA 3O9NA 3ZMRA 4DJFA 2NX3A 3NXLA 2WKGA 2BASA 2ZBTA 4W7UA 4WIWA 3ARRA 1XYCA 3K4AA 3BW2A 4WGHA 3G77A 1HKVA 4B5UA 2GL5A 1T8QA 3N4EA 4NUWA 1W37A 2GK1B 1OK6A 1DHKA 2ZZ7A 1PTAA 4F4RA 5EPDA 2VZSA 1H11A 1XKYA 2PD5A 5M2FX 5AHMA 3MCMA 4ZOAA 1FFQA 1RVGA 1EBGA 1L8NA 3WDRA 1HKIA 3IIOA 1IXNA 1JYVA 3IANA 1ZBWA 5FI8A 3U5YA 4MB1A 2PRLA 3PB2A 1BQCA 3ZR4A 3MUY1 4GABA 2DT2A 4NAFB 1XSKA 3WBAA 2WOQA 2XZ9A 2V5BA 1XDMA 3LBMA 4H9UA 3OJGA 1KTCA 5FCZA 1W2PA 4NQ1A 1UA3A 2WMKA 2DQWA 4G56A 3TQVA 2FDMA 2CLPA 2REQA 1DWAM 2QGYA 3W7RA 4OV4A 1X6NA 4N9DA 2OKTA 4Q22A 2BG5A 1IF2A 3W75A 2P53A 3U48A 3QH2A 2ZWYA 3N9KA 2QS8A 3GC5A 1K8CA 2ZX5A 1RQEA 1WBHA 2OZ3A 2VDHA 4ROQA 1QK0A 1XG4A 3NM1A 4V1YA 3N04A 5CEWA 4RE2A 4S38A 5C7VA 1FWEC 2O55A 2PP3A 1ITXA 1CXLA 4RK8A 1KFLA 3QYSA 3G3DA 2GLKA 5G2IA 3LRMA 3CAVA 3HG4A 4AVOA 3MS8A 2NQ9A 3HURA 5CBJA 3I65A 2ZX7A 2DT0A 3B8UA 2REQB 5B7ZA 3MY9A 3M1ZA 1LOQA 4G1KA 2P3EA 3APGA 4QIUA 1UR9A 4JFSA 2YFOA 2OXNA 3OIXA 4QLLA 1H7NA 3PAJA 1R7AA 4CCEA 5LKYA 4U33A 4AZHA 2BBFA 1JD7A 1TCMA 1ESWA 1VD6A 1DP0A 3GAYA 1W1PA 3OLIA 4Q4OA 3GVRA 5K3VA 1FH9A 3U2EA 1JL8A 4GX9A 8CGTA 1QO5A 2WHMA 3VNYA 4DI9A 2DZXA 2POTA 1GVQA 3SY1A 2I9UA 3UJRA 3VIGA 1T6MA 1S2VA 2YW3A 3FCPA 3STGA 3BSGA 5JUVA 1I6NA 1RD6A 1TZZA 3CIVA 4L4PA 1C8XA 4IPIA 2AKZA 3IJLA 3BLDA 1CGTA 4HKPA 1V3MA 1W0MA 1JCJA 4F0HA 2F6UA 2PDNA 5F2LA 3R58A 4L1XA 5G4EA 1GG0A 3QMSA 3RAOA 1KA9F 3NQGA 1D3CA 5BZAA 3GBEA 4GNJA 3CUGA 3DUGA 3SCPA 4EX4A 2X7WA 3S1XA 1MXGA 4NX5A 4LU0A 3TMLA 3NL3A 3P67A 1E0XA 1OC5A 2PRMA 4Y8FA 4PSPA 1RV8A 3O0FA 3THUA 2Z7GA 4GJ1A 4Q8MA 3FXGA 3SFKA 2R91A 1WDRA 3R8GA 4H6KA 3UYCA 4DUWA 5EKYA 3UZYA 1H63A 1KBKA 2E5BA 3P8IA 3SAZA 4D6CA 3VD4A 1R46A 1KRMA 2TODA 1GZJA 2EJ1A 2OSWA 1UKOA 3O6DA 2HJPA 3LM7A 1W1VA 1W5PA 1WAUA 1RH9A 1KM5A 2EJAA 1P1XA 4FALA 3CUFA 4G2DA 3DGBA 1NF7A 2X30A 4X22A 1GVFA 4MB3A 4NT0A 3IUHA 2R1LA 2QUTA 3VKDA 4IICA 5FEPA 2ZTKA 5IFPA 3EDEA 3N2CA 4O57A 4PB3A 3VCCA 1UD8A 3GC2A 4NJJA 3C4UA 3DEQA 4IFKB 4ZA0A 2WPGA 1BXCA 3TYUA 4Z2IA 1BD0A 1SMDA 4DO7A 1VEMA 3AIVA 3E12A 2A3LA 3LK6A 2HS8A 1JI1A 2Y5SA 1QOPA 3NOYA 4DBDA 1KM3A 1ZJHA 1ECQA 2CLIA 1XSIA 1FWDC 3BW4A 3TLQA 3A4AA 4ICCX 2A6LA 1K70A 3B8SA 1J0IA 2PWFA 2W6RA 3TSBA 2DVUA 2QCCA 4OVXA 2YDQA 3A9BA 1QPNA 1PZ1A 3KFTA 1SZFA 2W4XA 3MO4A 2OO0A 4NZJA 2P76A 3PZOA 3L4ZA 3G1HA 3VNMA 5H1WA 3D47A 3Q65A 4QR6A 4ZE4A 3C5QA 4HK6A 2OQYA 2RKXA 1XLMA 2A2IA 4XTIA 1IQ8A 1GHSA 2GVJA 4UFJA 3W7PA 3CPUA 3UYIA 1S3TC 4BF7A 4OIFA 5IDZA 3CQJA 3PJWA 4MB5A 5HNRA 1GHRA 3KL5A 4PMOA 4K1GA 5AZ0A 3GDBA 4XSMA 3NQDA 1FWSA 2OWWA 4BQ5A 5HNTA 3LTSA 3SGUA 2EG8A 4C6IA 4KEVA 2Y63A 3PBWA 4JY9A 1WXZA 4AX6A 1TWIA 4L61A 4P8XA 3OGVA 2QCGA 2VDGA 1YYAA 2BB0A 1SO4A 1ENUA 2HS6A 1FHVA 3VOFA 3HV9A 7PTDA 2PDPA 3RO8A 1ZU8A 1YDNA 1LROA 4ZTXA 1R86A 5AHNA 3EB4A 2HNEA 3LNMA 4K36A 2V67A 5CPQA 3SQSA 2WNQA 1GJWA 1LT8A 5K4XA 2WKJA 4ZFMA 5ABFB 3E5PA 3UP8A 2PDYA 1Z9AA 3UA4A 4GZEA 5CGTA 1P4CA 1NU5A 4UTMA 3SCRA 4EWJA 4X63A 3LM3A 3BLOA 3O6YX 1Q7QA 1UZHA 4PCSA 4IQJA 1TJ2A 4AD4A 1NOUA 1HNYA 3QV8A 1X38A 1MZRA 4ORMA 1EHNA 4XUGA 1NFPA 3DFHA 3PJXA 2CEQA 2DJLA 1XRVA 1PZ2A 4HZMA 4A3QA 3H4XA 1LQ0A 1M03A 4J35A 2DZTA 3T2PA 1G7VA 3HV8A 4AC7C 1FXQA 5D4YA 4Z2HA 1P48A 4DUXA 2BHZA 2D1ZA 4LTSA 2Y4SA 2H8XA 4B9YA 2J8FA 4K1WA 5DCEA 5M03A 4S23A 3OGSA 4GI9A 4HNVA 3CTLA 3O05A 1EPXA 4FLOA 1VPXA 3NOEA 1QASA 3BAIA 2ZVRA 1F3XA 1JXKA 5FACA 4JX6A 4UTWA 1LDCA 5L6UA 4EPBC 5I78A 2PF0A 1HG3A 2CBJA 4X60A 2PBGA 4EXBA 2HVMA 2JIEA 4GIEA 3RXZA 5D9OA 3W7KA 5LHEA 3TU9A 2X1RA 4M82A 2VRJA 3A24A 1CDGA 3E9AA 4S3CA 4W85A 3FAXA 3WD3A 2J7EA 3VYLA 3APYA 4XD3A 1TVNA 3OVPA 3H7RA 1B3VA 2O4QA 1OIMA 2XFYA 3KWSA 3LYEA 1F8IA 1ZS2A 4GIRA 4UOQA 1BWKA 4DO6A 2DP3A 4AZ5A 3BCJA 3CGTA 4AHPA 1OB0A 5G5IA 4GCAA 5A6BA 5LIWX 5C6MA 1XIHA 3V0UA 1FWJC 3HG2A 1UQYA 1OEPA 1PSCA 3W3OA 2CBIA 4UTWC 1QW8A 2VQUA 3TTOA 1E6NA 4XD5A 1K7XA 2ATSA 1SFSA 1XQLA 1G0CA 3ZJ8A 4JIHA 2YLAA 4A3YA 2PAJA 3IRSA 1KRBC 5CG0A 2V69A 1GZ1A 4JHMA 3RLUA 2E68A 3ARQA 4AWSA 2QCDA 3EPOA 1KCXA 1GOQA 2BVYA 2Y5JA 4I6VA 1J0HA 4UWMA 2PWGA 3UG8A 1M68A 3U0HA 3G1RA 3UW6A 3TC6A 1B3XA 3R89A 2R6OA 4PMUA 4XTDA 4DZAA 2PF8A 4IIDA 3V35A 3S4TA 2QR6A 3W74A 3JVAA 2PGEA 3P81A 3MKVA 4LY8A 2QAPA 2Y0FA 1FOBA 1UUMA 2NV1A 2ZRWA 3OHIA 1FWAC 3E02A 3AOFA 4W8LA 3BG3A 2OFJA 3AYTA 3QR0A 5JIWA 2FYMA 3NIYA 3VABA 2ZICA 4Z1BA 4CCZA 2Q02A 3LCLA 4GQQA 3W73A 5JQ9A 1T41A 4O10A 1SO6A 1KM1A 4MTVA 1DJWA 2PDBA 1N82A 1ML1A 1N8FA 4GD0A 3DX5A 1A5OC 1ZAHA 2DSWA 3KBSA 1KB3A 3TJLA 4MVAA 2GVYA 1A47A 2WMIA 3MU7A 3TYZA 1XUUA 3BTNA 1W31A 4GZIA 1C8QA 2GDVA 1OM0A 5C9WA 1NOFA 4UR8A 1XGEA 4H83A 3RM8A 3CZLA 2BGQA 3FW6A 4PTVA 3BJSA 1V77A 3H7UA 3W29A 4IG2B 3WQFA 3BANA 4NAEA 5DCDA 3MT1A 3UVAA 1FDZA 1GUVA 1F6KA 1ECEA 4H9ZA 4OOZA 4K8HA 3B04A 4CEUC 2IMRA 3BOFA 4L4MA 3VIPA 2OWCA 4KCVA 4DELA 1PYMA 1XM3A 2Q8XA 1MMFA 3N2XA 1V5XA 2RH9A 3EEGA 5CLTA 4B2DA 1POKA 1RCQA 3GFZA 4H1ZA 4LOCA 4ECLA 4H6QA 1DXFA 2IXUA 3CH0A 3G18A 5AOUA 4DUVA 4E5TA 5HQLA 3P2VA 3SRFA 2QPXA 1GKQA 3EB3A 4NXSA 3A4WA 3DC0A 5HMEA 4C6JA 3TYCA 1YRRA 1JDAA 4M7SA 3H4WA 1V6TA 2CLLA 2PDWA 1X1NA 1F76A 2I17A 2WXDM 4NAEB 1NVMA 3N9SA 3IUDA 1AL8A 2DT3A 4A8IA 1C93A 3G0UA 4Z1YA 2J7BA 3M5YA 3N13A 6XIAA 4XZNX 1AK5A 1BEUA 3ERPA 1HO1A 2CZDA 4BF5A 4O16A 4IIHA 1W8SA 1U5HA 3GUWA 6REQA 2XSXA 1PIIA 4F0RA 1HP5A 5E6ZA 3PUEA 3PBUA 3P74A 4DWSC 1LBMA 4N9BA 1JAEA 3TTQA 3TYDA 3WLKX 1W32A 4EE9A 1NWTA 2ON3A 1PO9A 3TIMA 3TWAA 3AU6A 2VCCA 4HTYA 1SSDA 3OU8A 4DBSA 1JZ2A 3WDIA 4AISA 2XHYA 5A6KA 1EC9A 1EO5A 1XR2A 3M5XA 4U3AA 3VE7A 3N4AA 2QVHA 4LYQA 3F4CA 3EXSA 3B40A 3LCWA 4JIRA 5BNKA 1L0PA 2NQHA 3GXMA 3SBFA 2Z1SA 4JYFA 3TK7A 4DYJA 4O1AA 3LPOA 1GOMA 1OG0A 4TXEA 3M0HA 4LH8A 1DWGM 3G2GA 3CPRA 3O06A 2V5KA 4Q3MA 4KESA 3OVRA 3AYSA 2I1OA 2VVNA 2PDUA 3WMLA 4ZCWA 4DJEC 3FSUA 3L5LA 3W26A 1ZL1A 3AIQA 2IPJA 3EKGA 5AYZA 4NZFA 3RPMA 2WNZA 2OODA 1K9FA 3S47A 5AVNA 5LSMA 3ZO9A 4F0KA 2O9PA 5EBUA 1P43A 2ZDSA 4RXFA 2B7QA 4U4MA 2W67A 3GXFA 3W1AA 1CXHA 3CB3A 2YB4A 3LTYA 1SJDA 3EX6A 4IQDA 4C6FA 2EKCA 3B0YA 1W1B1 4UNIA 5FA5A 2BVWA 5F4WA 1KFEA 5D32A 4ZQNA 4MADA 1VQTA 1SFLA 2TRSA 4B3KA 3ID7A 1DIDA 2IUZA 3ZVHA 4UFHA 4PGLA 3FKRA 3FDKA 4IJCA 3VNZA 3VGHA 4IP7A 4AIUA 3QLDA 3ME3A 3SZ8A 2CZVA 4NXKA 2YYUA 3VIOA 4GCXA 3W6YA 3AUJA 1MEHA 2NVAA 4EANA 1ISZA 2OYMA 5FL0A 3IV3A 1AVAA 3SRDA 1LRTA 5DCBA 3NDOA 4IWWA 1IEXA 1R2SA 2QUNA 5FEZA 2DEPA 3DFYA 4WGXA 5F2GA 2HPMA 1HKKA 2GK1A 3DIPA 4CQAA 1NEYA 5JU6A 1MI3A 4O11A 3MHGA 4U31A 2VUYA 3ZVHB 3E3HA 1RHCA 4BI6A 4F2UA 3DG3A 3VOCA 4ATLA 2ZTJA 4QTGA 5GJMA 3EMCA 2YBTA 4GPNA 5CPLA 3BAWA 4GACA 4W88A 3VCRA 2OTDA 4H3DA 2CXGA 3NJ3A 2ZIDA 3VGBA 2NQZA 3UBPC 2QDDA 5E9AA 2E6FA 1R30A 4IFRA 4AF0B 5CJNA 1XP3A 4LAMA 1BF2A 4O0ZA 3AMGA 4J3ZA 1HVXA 3WH9A 4JL2A 3GXTA 2I7GA 3PBMA 5M3WA 4CN6A 3VD7A 2IQTA 1TTQA 2OZ8A 1QOXA 3QOKA 1VBGA 2PDCA 4HOXA 2ZX9A 3RFAA 3PG9A 3C0JA 4JQ4A 3QHNA 1PYFA 5IFTA 2TYSA 4ERIA 4REQB 3W7CA 4FX7A 5I6SA 1PWLA 3WK0A 2V63A 1HIZA 2EHHA 4N6EA 1DXIA 3HBLA 2C6QA 1MUWA 2QPSA 4AXNA 2PDJA 1RUSA 3L4WA 3IK4A 4RDVA 4A05A 4PRTA 4RL3A 3STEA 2B31A 4BY3A 4OUEA 4QX4A 4PUMA 3W88A 3UY8A 3FA5A 2WW5A 4EF9A 1UD5A 1O5KA 3KZPA 1W3LA 2ZUMA 4IFOA 2J7DA 4CUCA 1KQYA 1QK2A 2VM8A 1F6YA 4QEEA 3AROA 1QI3A 4Q8UA 2B4GA 3WZ0E 2CC0A 3MHUA 3HFYA 2XN1A 2XVPA 5C9XA 2Y8UA 3QGKC 2R1KA 2GJPA 4LV4A 3BV4A 2J4GA 3A4XA 2IW0A 3CS2A 3N14A 1WPCA 3BG9A 1Z6KA 4XBKA 3DFQA 2QAFA 4JR5A 4FEZA 4ADTA 5CGMA 1M7XA 4LC8A 3MYOA 3TZNA 1W5NA 1X39A 2G3MA 1Z32X 5J8LA 4IGMA 1FCVA 1XQKA 3T08A 1EYWA 1QVBA 2ABBA 1C7TA 4OECA 1RLCL 4K2SA 1RY0A 2Z1BA 3CHVA 1VFTA 5I3KA 4C6DA 2VOTA 2XGZA 4NYYA 3WJYA 2TMDA 2GZXA 3NQ2A 4O17A 1GKPA 1PCWA 4MDPA 3CAQA 5D04C 1W3HA 1Q63A 1FWGC 4WKHA 1BYCA 1OF8A 2IQDA 1YMYA 1TV8A 4CD5A 9CGTA 2OSYA 5I23A 1XLIA 4DRSA 3CL6A 1L2UA 2ZZ3A 3SCTA 2Z00A 2BXZA 1EZWA 2FLIA 3LSBA 4QAWA 2NV2A 4S3KA 3PBVA 3R8RA 4YL2A 4K39A 4WDUA 4FA3A 3M0MA 3MTWA 1NP0A 1G6CA 4MHBA 3GNXA 4R9OA 2HEJA 1ONWA 3FHQA 4C5ZA 1JQXA 4JTLA 5D05A 1E6ZA 3D46A 3W86A 4RV3A 3WF2A 4JZ5A 4MM1A 4OGZA 4Q33A 2VD8A 4QDMA 2F2KA 3AXMA 4MNKA 3W6MA 2VFHA 4M29A 3KCJA 4J3TA 4M51A 3EA2A 3TN5A 3AJ7A 4TMBA 4ZQOA 1TPUA 4AEEA 4IFKA 3VD3A 1JVNA 1G5AA 4Y2WA 1M7PA 4AIEA 1A5LC 3BG5A 1EZ2A 3BLPX 2PDFA 3NVTA 4HPHA 5C55A 1DYSA 2GQAA 5T9CE 3LLDA 1XH1A 5KETA 4I5RA 4F0LA 3SRHA 5FOOA 4EPEC 3AC0A 3WMCA 2VJXA 5TD4A 2IKJA 2A21A 3F4DA 2EEXA 5E0CA 1ICSA 1OCBA 4NKCA 2DZUA 1RSCA 3W0KA 4GY0A 5C70A 3E49A 1LF1A 2GVGA 5LNUA 1F07A 3S9IA 5C9ZA 5IHSA 1E51A 4ZOCA 1QBBA 3CEPA 1FWWA 1CBGA 3A9IA 3UF9A 3C2RA 4R5EA 1ZENA 5JMUA 4C7DA 1XRSA 1EQPA 2YXGA 4FIQA 1T8XA 1DIKA 2C8NA 3M0VA 2HXTA 1A5SA 2J66A 4IGHA 4BJHA 4LCRA 3FYPA 4GY7A 1QNVA 2PCQA 3E2SA 1EGMA 3LCFA 1IZJA 3WJXA 2PC8A 2WJFA 3H2NA 3P82A 3PTDA 3G0XA 5FESA 4HN4A 4AD0A 4GFIA 3LHYA 3OBEA 4HVXA 4HSHA 1J0KA 1E43A 1MQQA 1NWUA 3FA3A 4CCDA 1B3OA 4D6EA 1FDJA 1LWHA 5FF4A 3D3AA 3QBUA 2DSKA 4TV6A 5LNRA 3VMPA 4QJ4B 3IUIA 4LBUA 5J5RA 1TWSA 1XH2A 3WL1A 2WJEA 2WC4A 4F3HA 3AZTA 3TOYA 1IHIA 3NA8A 2VFFA 1J2WA 1W56A 3CHCA 3CK5A 1SZEA 4KMQA 1KGUA 4AH7A 5ABFA 4AZIA 1GVOA 3VNLA 1EKOA 2GUYA 2VR5A 5I24A 2XSBA 4UQEA 2F6XA 1V6VA 4IIFA 1OCQA 2XDFA 1JFHA 4F9JA 5EBAA 3ZLGA 1OINA 1E9IA 3KAOA 4QSFA 4JIEA 4GE8A 4D2JA 4RNFA 1OFPA 1U83A 2E3ZA 4POCA 2FFIA 2E25A 5K2ZA 3DHPA 4YXGA 2TSYA 5K9CA 1GW9A 1V7YA 5AB3A 5H8PA 3NQMA 4DUOA 3O16A 1XIGA 4MJ2A 3WUEA 3UZ5A 2ZUSA 2F8QA 8RUCA 4RNJA 4XVDA 3DFOA 1XIEA 3WF4A 2Y7FA 4JEQA 2E5DA 4GZJA 3W70A 4EF8A 3NO5A 5HINA 3WQVA 3MJMA 3R4IA 1DVJA 3G1VA 5ABGA 3A6OA 4BWLC 4C7FA 5AC7A 2QGHA 4HJWA 3P0XA 4LUJA 1W3NA 2PLKA 3ITGA 4HBKA 1IGWA 4LRSA 1OBAA 3ES8A 3KW3A 3W2LA 2WCGA 1UKPA 3G0SA 1ZUAX 4AZ7A 3U9IA 4H41A 4WX2A 3VDBA 1EFZA 4XZMX 4JTUA 3QKEA 3S8HA 2FTYA 1XICA 1CXEA 3FLUA 3W28A 3I7QA 2DJXA 2P88A 1R8LA 3UFYA 3UWVA 4ACZB 1GVEA 1XLBA 1XDJA 1S5NA 1NH6A 1LOLA 1VRXA 4XVEA 3EX3A 5CC3A 2G8ZA 1W3IA 5HMDA 3HM7A 4YCOA 3WX7A 3L66A 2O9RA 3CU2A 3WF0A 4RKAA 4I7UA 5HWMA 1KBIA 4BEUA 3HA1A 4M1RA 4XO7A 3EX1A 3EX2A 4ZO7A 2WNWA 2HCVA 3U2ZA 3LLFA 1GYLA 2OCZA 3SUVA 2PTZA 1PUDA 4F48A 2G50A 3PPFA 2JKAA 4UTLA 4V1XA 1XLFA 1W91A 5GQBA 1W3TA 4TO8A 3B8DA 5H91A 1B2YA 4W89A 5I77A 4JOMA 2Q71A 2VR4A 1SMAA 4KF1A 2ZA2A 1TKKA 3ZQ9A 3UXKA 2XFWA 2CERA 1DORA 3IIZA 2P8BA 3PVFA 2VQTA 4Q4RA 2V3DA 1S39A 2VKZG 4XV0A 4JICA 1R2TA 4PYSA 3HO8A 4PMNA 4QRNA 3U4FA 3CHFA 1TX0A 3PUGA 3TSDA 1LJYA 5KTLA 4US6A 4LCQA 1HL2A 1KTNA 2FMOA 1V6YA 2DUZA 1US2A 1YDYA 1UZ4A 1XBVA 5F1UA 3STFA 4H6EA 1RCOB 1XCFA 2D3LA 1XLHA 4UFIA 4PMQA 3ARXA 4C7GA 3W1XA 1E55A 3W25A 4O52A 1JYXA 3CJPA 1KXTA 1P6CA 4IPPA 1OJXA 2ZXAA 1F3TA 2PGFA 4JTTA 4IUOA 3W72A 3IS4A 4LRTA 2EAWA 4AUBA 2F2HA 1POJA 1FP8A 3ZSTA 1VJIA 2VYOA 1R9ZA 4ICMA 2AQVA 2ZC1A 2WMGA 4S1FA 2CHOA 1R3TA 4PEKA 3OBAA 1XSJA 4NAFA 4FLRA 3IJDA 4IT1A 4QE4A 4KCTA 1QJWA 5JBFA 2NZLA 2DQXA 3VD9A 3UQNA 2E6YA 2WWDA 1QO2A 4W9TA 1NQKA 2PTDA 6ALDA 4JAWA 3AU2A 2VWTA 1NAL1 3V75A 3M16A 4H9XA 4KWUA 1EPVA 1JGIA 2YA1A 3KXQA 1UD3A 3ISIX 2F61A 1PHQA 4YYCA 1MYRA 3GH4A 3P8JA 4PTDA 9XIMA 3AMLA 4OU1A 4PB5A 1EJSC 1MZHA 1UCWA 2WHLA 2C14A 1SW7A 3PANA 3R43A 5HULA 2J27A 2CZFA 3N2MA 2PDQA 4MUPA 2VFIA 1R0MA 3S83A 2Y6ZA 5I79A 4HNUA 1O1ZA 3T05A 2OGJA 1ITQA 3WENA 3HN3A 2JK2A 4HNTA 4K38A 2E9BA 2OJPA 4QJ3B 2YXOA 3BCFA 3IARA 1QOQA 2PEVA 3C8NA 4MWAA 5CLWA 2FPTA 3F4NA 1I8JA 2ZRZA 4FXJA 4HOWA 2P50A 3S2MA 5C9RA 2IQ0A 1VEOA 4MPQA 4XUYA 1QPQA 4JQAA 1WV2A 1VJSA 2WSYA 5FF0A 3PPCA 5IXEA 3WO8A 1CENA 3BXWA 3W76A 2IS7A 3RRXA 4UTTC 2W3ZA 4E2OA 3CUZA 3MKKA 3NDYA 2Z1KA 1ZALA 3S46A 3W1QA 5KZMA 3EOUA 2PE4A 4S39A 6ENLA 1A5BA 1UWAA 6REQB 2NV9A 3WLNA 4WSHA 4MSSA 1YNPA 1QHOA 3P5YA 2CU0A 1LTDA 1EHAA 1GVRA 2PU0A 3UZWA 1OT2A 5AC4A 3E1F1 2A7PA 4HYRA 4GO9A 4MWAE 4GBDA 1EWDA 1FXPA 3PM6A 2BY3A 1DPMA 3K4DA 2J13A 1QNRA 1UWSA 4M6QA 3S2LA 3VIMA 1EDGA 2OO6A 3WF1A 4JN6A 3PSVA 3S6TA 1VHNA 1E56A 4LUTA 4IIGA 3T8QA 2PB1A 4JKKA 3T0BA 2D2OA 4WY0B 4R9XA 2J8GA 4BKNA 1TRDA 4RZBA 4DAFA 1GTHA 3UWQA 3AWNA 4Q8VA 5C71A 2XINA 1Q85A 1REQA 3MSYA 2UV8G 2C1GA 1O94A 1H50A 1ONRA 2PU1A 2VR2A 3CV1A 2JFEX 5U4NA 4AU0A 1XLCA 1LLWA 1M53A 3LA4A 4G5DA 5EB8A 1VFUA 2Z27A 3DYMA 5MF5A 4ACYA 3DFPA 3M64A 4XIAA 4KEMA 1WDSA 3VIKA 3R1ZA 2Z29A 3S1UA 3CB8A 3IVSA 3QMRA 3Q2DA 2WLYA 1VJZA 3GTNA 3QZ6A 1TR1A 1VC4A 1AMYA 1ZJBA 4US5A 4RR4A 5FIPA 3WYZA 2VXNA 1T5AA 2WKLA 1BHGA 4I7VA 3BC9A 2ZX6A 4QXIA 3G1AA 4L9YA 4GH1A 2DORA 3FJ6A 3GVGA 3OEXA 2E1DA 4H8VA 4AEOA 4K3ZA 3W7EA 2FH8A 4ZQPA 5F2IA 3TJ4A 5GJNA 1YW1A 4ZOEA 3WQ5A 2YKKA 4CNOA 3CQIA 2EPOA 4PEEA 3LU2A 3AHXA 3EB2A 1JULA 1UKTA 3H12A 2EGZA 4JNYA 5A3HA 4ALDA 3XISA 1Y65A 3PWAA 4PB4A 1XDLA 3NURA 4B3ZA 4ZO8A 2ACRA 5EGRA 1QFEA 2OT1A 1W1IE 1K8YA 2PZ0A 4FXFA 4QNWA 1MDRA 1Y7VA 3U4AA 3AHYA 1HGWA 3ITCA 4BEQA 4LBSA 1U1JA 4JXCA 2HRWA 3BAXA 5BWFA 3I6EA 4UOJA 3EA1A 3S5OA 3VD5A 4B5VA 5HR6A 4KFNA 3NFUA 2E8YA 2BXVA 3GQYA 3ARUA 3IK2A 1TPDA 2XH0A 4ENLA 3P61A 1HJQA 3BV7A 4HU8A 1K9TA 1W8GA 3VM5A 3T0CA 1S3HA 2CYGA 2Z1VA 6TAAA 2HV5A 2OWXA 1XG3A 4QQUA 4AF0A 4BQ2A 2D0GA 1C8VA 1UC5A 4PUKA 1XFCA 2EG7A 3GXNA 3CXOA 4XB3A 2X0YA 2H3DA