2FFCA

Crystal structure of plasmodium vivax orotidine-monophosphate-decarboxyl ump bound
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
332
structure length
318
Chain Sequence
NLKIKLQKRRDEVNTCLCIGLDPDEADIKSFMQSEKQNGYQSVKKNLSNSGELFAPQMGGQMLLATPPKEAQEKDEFFYFFNHFCFYIINETKEYALAYKMNFAFYLPYGSLGVDVLKNVFDYLHHLNVPTILDIKMNDIGNTVKHYRKFIFDYLRSDSCTANIYMGTQMLRDICLDEECKRYYSTFVLVKTTNADSHIFQNRLSLDGKEAYVVIAEEVQKMAKQLHLEENGEFVGFVVGANCYDEIKKIRELFPDCYILAPGVGAQKGDLRKMLCNGYSKNYEKVLINVGRAITKSGSPQQAAREYHQQIKEVLAEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords orotidine 5-monophosphate decarboxylase
publication title Genome-scale protein expression and structural biology of Plasmodium falciparum and related Apicomplexan organisms.
pubmed doi rcsb
source organism Plasmodium vivax
total genus 125
structure length 318
sequence length 332
ec nomenclature ec 4.1.3.23: Transferred entry: 2.3.3.2.
pdb deposition date 2005-12-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2ffcA00
1H1ZA 2QCGA 2VENA 3R2GA 1RVGA 1SZGA 1NF7A 4AXKA 4JDBA 4LTSA 5SWUA 3TR2A 4WXYA 3QJAA 1ZY9A 4FX7A 3CTLA 3MW7A 2Z6JA 1G4SA 1DVJA 3CIXA 3TU9A 3QYQA 5K4ZA 2YSWA 1C9DA 1W5OA 1B4EA 5KINA 4NT0A 5IBXA 5KMYA 3NDOA 3LTPA 3CPRA 4LC8A 3NQCA 4PFMA 1DORA 3T40A 3V75A 3PG9A 4O4WA 3GDRA 3M7WA 1MZHA 3RLUA 5BW6A 4GNJA 2AGKA 3C2RA 4PEKA 4XQ6A 4H3DA 1JRBA 4UCGA 3TSBA 2ZZ1A 3E0IA 4XWUA 4MKNA 5D33A 2A85A 3BG5A 1I4NA 3G3MA 2Y70A 4MYAA 3UZJA 5LZLA 4NXSA 1FBAA 2YPIA 4JTGA 4JX5A 1B3OA 3CWOX 1F76A 1NSJA 2B7QA 3W7NA 3HMJG 2RKXA 4DPPA 5D30A 4CQ8A 1U5JA 4MY9A 1IGSA 4K38A 3W76A 3QFEA 2QR6A 5F1VA 3SI9A 4BWLC 1Q6QA 3W6YA 3FLUA 3W1XA 3IVUA 1CW2A 3GAYA 3HGOA 3O1NA 4FXRA 1KLYA 3HG4A 2YDAA 2PRMA 1DJNA 3GNNA 1A53A 3LXBA 4WZHA 2C3ZA 3LHUA 3S1WA 3KVMA 2QCDA 1MEHA 2Y7DA 1GVSA 3K30A 1KFBA 4O1DA 2NWRA 4OT7A 2HSAA 2Y61A 3G1SA 4HNVA 3W7KA 5HWMA 1GEQA 5FEPA 3STEA 1ICQA 3W2LA 3SSJA 5I3GA 3W7QA 1EX5A 3EWBX 2WSQA 4JEQA 1TIMA 3MYPA 1SQ7A 2DZWA 2PRLA 3I65A 3N14A 3IEBA 3DZ1A 2I14A 1AK5A 3W1UA 3KXQA 1F2JA 4I7UA 5FF0A 2VELA 3CLMA 5HQEA 5J5DA 2E5CA 4Q33A 4ORIA 3ATZA 3LLDA 3PAJA 3NO5A 3NOEA 3JRKA 3B04A 2FTPA 2ZA3A 4O19A 2DU2A 4S2BA 5K9XA 1D3HA 2YYTA 1CX9A 3TCEA 3L5MA 1IIGA 1TPWA 4KFPA 3UWUA 1SZEA 4Q4KA 4UTHA 1WOAA 2QF7A 1V5XA 4UNLA 5CSRA 4G1KA 4TMCA 2V5LA 2GJNA 4KKXA 1H7NA 4GBUA 3BLEA 3ATYA 2YGYA 1AW5A 3OBKA 2VEIA 3B8DA 3OHIA 3UXDA 3QH2A 5GVJA 4EWND 4Z0SA 5AHIA 1FCVA 1JR1A 1SO5A 4DO5A 5AHLA 1SFLA 3PBVA 3HGRA 4WOQA 3NNTA 3LCHA 2Q8LA 4I9AA 4BI6A 4LVFA 2ZRZA 3H53A 3U8GA 5TQLA 1ZAIA 1SPQA 1TB3A 1EPXA 3TW7A 3L68A 4N9DA 1H1YA 4YCPA 3G18A 3W7EA 4BF9A 3D0CA 2NZLA 1SO4A 4HHPA 2QCDB 4LVDA 1OFAA 3W7LA 2ISSA 4P61A 4RLIA 3E02A 2B7NA 1BWLA 3EX3A 3BW4A 4M7SA 1G69A 4UFIA 3UD6A 4O53A 1W3TA 5D05A 3GVGA 5BOOA 1LYXA 1TPEA 2HS8A 4XZ9A 2XN2A 1VHCA 1ICSA 1FDJA 3NM1A 3TAKA 3HPXA 5D2YA 3MUXA 5H91A 3NQDA 2ZA2A 1QCWA 1OFEA 2Y7FA 3TROA 1LBLA 3NG3A 4KWVA 3LHWA 4QISA 3MBDA 3TX9A 3IIOA 3RLVA 3M5ZA 4UFLA 2VKZG 3GR7A 1KBIA 1RQEA 1YDOA 3HGSA 1T8XA 4PTNA 1L9WA 1KA9F 4JTTA 1OX6A 3WK2A 4BI7A 2YZRA 5CPNA 3WK0A 1IXQA 1OFBA 4U4MA 1A50A 4A2RA 3S8HA 1PE1A 4DF2A 1QOPA 4JTSA 3G8EA 4PCFA 3KAOA 3DU0A 1L6WA 4O0ZA 4NNAA 5EKYA 2FB3A 4AHQA 1YPFA 3PBWA 3OG3A 3IGSA 4MJMA 3P61A 1P0NA 3NR0A 1KFEA 2ZBTA 2V2CA 2TRSA 2WKJA 5KTLA 1T0OA 5EMUA 4ADUA 4A21A 4AAJA 1K7XA 2WPBA 4AHOA 1Y0EA 1GG0A 4E0CA 1QO2A 2C6QA 4JN6A 2V82A 4WQ6A 3SW6A 1XBZA 1YADA 4HT3A 5EBUA 1RQHA 3P81A 1D9EA 3QW4B 3DFOA 4JTHA 1UUMA 1OYCA 3IIZA 1AL7A 1ZNNA 3CU2A 3TQ0A 3L0NA 1FCQA 3I7SA 4JTEA 3G0XA 3CQ0A 1PHWA 4ONVA 1XUUA 5CZSA 3FKRA 3TH6A 2CZ5A 3LOTA 3N34A 3N2MA 4O10A 3NA8A 4MYXA 5A8GA 5BRBA 4IMFA 3SGZA 3NM3A 5HWJA 1LTDA 4LVBA 3R12A 3C2EA 4O54A 5G2HA 4IX0A 1F74A 3HG5A 4JTLA 2C16A 2TMDA 3KRZA 2JGYA 1GZGA 2WNZA 1AL8A 1RZMA 3LBCA 1S3HA 3VE7A 2WNQA 4X2RA 5AOUA 3LRLA 3KVLA 4RZ6A 4WUIA 3KVJA 3W1PA 2X1UA 3P74A 3QF0A 4R34A 4OWGA 5CGQA 3KHJA 3QMRA 1F7BA 2OT0A 1RPXA 4LRTA 3EXSA 3EWXA 3CM4A 2QJIA 3P5ZA 3P67A 3MO7A 4UTJA 2B7OA 3W7MA 5IM51 1EWDA 3L65A 4N9BA 2C18A 4D2JA 3PG8A 3MI2A 4FNTA 2QUUA 5D37A 2DZVA 4K8EA 4NX5A 2NXIA 3U6WA 1B9BA 2VFDA 3TFCA 2WNNA 2DP3A 3ABQA 1S5WA 5HULA 5EL1A 4HPXA 1FWNA 4R7JA 1JCMP 4AMAA 1S5VA 3N9RA 5DN1A 1K8ZA 2HS6A 3LCWA 1AG1O 5U4NA 3OA3A 3NQ6A 2QCEA 1GQNA 1Z41A 4MUZA 4TO8A 2ZZ4A 1SW0A 6TIMA 1J5TA 4Z08A 3BGJA 3I7QA 3LHZA 2ZQ0A 3BO9A 4TR9A 3QQ0A 4FIRA 1CI1A 5D03A 1EIXA 1NF0A 4XTIA 1M7OA 5L6UA 1IXNA 1UUOA 3KOFA 3Q94A 3SZ8A 3IVSA 4OV9A 4LUIA 3LTYA 3IIPA 5AC7A 5LHFA 3WK1A 3SECA 2FPTA 2TPSA 1L2UA 3EX6A 3LDVA 3N73A 4Z1CA 1EEPA 3R5EA 3NQMA 2V30A 2CW6A 4UFMA 4FF7A 2KZHA 2BSLA 4IMGA 4QNEA 5FF3A 1YLVA 3LHYA 4K36A 3UWYA 3MYOA 1JRCA 4WY0A 4EVZA 2A7PA 2WSYA 3CT7A 1D3GA 1HO1A 4KWWA 2X1RA 3O6DA 4IX2A 4ORMA 1G4PA 2A6NA 4MIMA 3MJYA 2G96A 4CCDA 1FQ0A 3T55A 3SR7A 4A29A 1YDVA 2G97A 4OV4A 1HL2A 1O95A 1TV5A 2QDHA 4ZZ9A 2A2IA 3CEPA 2FPVA 2EF9A 2YFNA 1PV8A 4UTKA 1THFD 1ME7A 1GVOA 1TPUA 1QPRA 1QAPA 3EEGA 1QFEA 4AEOA 1KTNA 4LNYA 4JYFA 2DZPA 3W75A 1G67A 3DHFA 2QUTA 1DBTA 3LX9A 4UIOA 3Q58A 3LHTA 4MPQA 3C4UA 4ML9A 1GTHA 1KM1A 2NX1A 2B4GA 3BW2A 1JULA 4Y96A 5G4EA 4WX2A 2Q8ZA 3W2JA 4Y8FA 3TQKA 1GOXA 5AC6A 3UY8A 4XKYA 1QPOA 2GVLA 4O50A 3FKKA 2TYSA 1TPDA 3O16A 5F4XA 3GKAA 1W0MA 2Q3OA 2GQ9A 4ICNA 1LDCA 3B0UX 1VC4A 3PB2A 2RDWA 2CFFA 2Z1BA 5I3KA 5LGZA 1VLWA 3C3NA 1FWRA 4Y90A 4UXDA 1H51A 4FNRA 4Z1DA 1VGAA 1XL9A 3T4CA 2OZ0A 4Q32A 4JICA 4BK9A 3KFTA 2H8XA 4IMDA 3KRSA 4O18A 2WO5A 1FXQA 1SSDA 5F2IA 3GXPA 1OFPA 1EUAA 2E6AA 1VJIA 4IMEA 2UV8G 4X22A 2DJLA 5FEWA 4WY0B 1XBYA 2CLFA 4ZVJA 4LRSA 2VEMA 2A7NA 4M6QA 3FIGA 4MY1A 2NXHA 1FXPA 2ZA1A 1FCUA 3RFAA 3G1DA 5HR6A 3TSDA 4UTTC 3AJXA 1WYIA 2RDTA 1VRDA 3LB0A 3NQEA 1ZAJA 1ME8A 3Q37A 5HUPA 4ZQOA 2QJGA 4IOTA 2J88A 3TE9A 1DHPA 4AWUA 4PH6A 3DFNA 2Q3RA 4IMCA 3W7DA 5K7JA 3P8JA 1DJQA 3THAA 8TIMA 3BLIA 2PCQA 2IQTA 5EPDA 3ZR4A 3E96A 4U28A 4MJZA 2ZZ2A 5DCEA 5CPOA 4AB4A 5D02A 3FEMA 3N3MA 4RX0A 1ZJIA 3GDMA 2A4AA 2F7FA 2BX7A 2H3BA 1HG3A 3LHVA 1EWEA 3BARA 2YW4A 1LM1A 4RZ4A 2O7QA 1ZALA 5LHEA 1DQXA 3YPIA 3ZFHA 5C5YA 3Q2DA 1HFBA 1LROA 4UFKA 2G95A 1VZWA 1OX4A 5C2XA 3TC7A 1YPIA 3S1UA 4N6EA 3EX2A 3JR2A 1ZENA 3PBUA 3T7VA 4GFSA 4XKYB 2Y85A 4NJJA 1HUVA 3DFPA 1I8JA 1MEIA 1FY6A 4ADTA 3W7IA 2QKFA 3W1TA 3RNDA 1KW1A 5LSMA 3LCXA 1JCYA 1FDYA 4NU7A 3LXAA 1C8VA 5J5RA 1W37A 1K3UA 2YW3A 2A6LA 5I3JA 3MBFA 1Z44A 3VNDA 3QMTA 3VKJA 4JY8A 4K7YA 1JCNA 2OCZA 4JXCA 1OX5A 4FNUA 2ZRWA 1VQTA 3W1MA 3G0SA 3IIXA 4LY8A 4ZQMA 1F05A 4JIPA 4LUJA 2E68A 2V81A 1G7UA 3W1LA 4LV4A 3W73A 2BLEA 4IXXA 2CLMA 3THQA 5I3FA 4E38A 2E09A 3QC3A 1X8FA 4ALDA 1V7YA 1KV8A 4QQ3A 5ABTA 4FNQA 3LCGA 4CLMA 1ZFJA 1FCBA 1OK4A 3O06A 4TMBA 3DKLA 2ISWA 4TU1A 3SY5A 2Y89A 3NQVA 4LS2A 3A9IA 2JK2A 1O5KA 3IGXA 4CCEA 1OF8A 3LCFA 2H90A 1TJRA 2A7RA 4ZMGA 3N9SA 5EYWA 3EKLA 1KM6A 3M0ZA 1WX0A 4GWEA 4JX4A 3GR8A 3W84A 2ALDA 3NL3A 5BMXA 1OFQA 3U2OA 5F2GA 3ZWSA 3DKJA 1GJPA 1XDLA 1IXOA 3A5VA 3EWUA 1PVNA 1U83A 2OT1A 3NQ8A 2ZZ5A 4UMAA 1AW1A 3DI1A 5G2IA 4H6KA 4AHPA 2A5HA 5CKSA 3ZWTA 2BTMA 3CIWA 3VCRA 1QPNA 1FX6A 5E93A 3GX9A 4JTFA 3ABSA 4IXHA 2RHGA 3C6CA 3QSTA 3W7RA 4PC8A 3MI3A 4OU1A 4O4VA 3NEVA 2FPYA 4CCCA 1JUEA 5D2XA 4AF0A 3PY2A 1W5QA 3NL5A 2NWSA 3B0VC 3P60A 3L66A 1PCKA 2CWNA 4DF1A 3C0JA 3G1FA 1W3IA 2RH9A 3E9AA 3W7HA 1OX4B 1QO5A 1EUNA 1YTDA 2NXGA 3G1HA 3C52A 1W56A 3GK0A 1F6KA 4RR4A 3NQ7A 4K37A 3L0KA 4J9JA 3NQAA 2QCHA 1ONRA 1WXJA 1LP6A 3C61A 1OJXA 1TO3A 5C54A 3DXIA 4MLRA 1HO4A 3TNOA 4UNKA 1B57A 4LU0A 3USBA 1H7RA 3O05A 4K39A 1JUBA 4O1BA 3W83A 4O11A 4IPJA 5G2WA 3W2KA 4E2DA 1NEYA 4GRSA 1P0KA 3LI1A 1H7PA 1YYAA 1LORA 4JGDA 4KFOA 3PR2A 5AHMA 4RJEA 2PURA 4UTLA 3NYZA 3L5AA 2DZXA 2BZNA 3W7PA 2QJHA 3W7GA 5IBXC 2CLKA 3LBMA 2J24A 3OVRA 4CNNA 1FDZA 2WV8A 1MSSA 4GUHA 4GUIA 3MP4A 3O6CA 4UR8A 1JCXA 1YDNA 4ZQPA 1L6SA 3HJZA 3WJSA 4RXFA 5AHEA 3TSMA 4R53A 4LOCA 3SIZA 3G1YA 2CLEA 1X1OA 3S5YA 1O5XA 4UTWA 1JVNA 2XN0A 1H5YA 3F1QA 4IWWA 4O57A 4YMZA 2RDUA 5K9CA 1P1XA 3GDLA 4ADSA 1LRQA 3M43A 3ABRA 3OVQA 3GXNA 4BR1A 1TQXA 1KBJA 3LRKA 1QNVA 3EX1A 1J2WA 3QZEA 2D73A 4UR7A 4JR5A 1SW3A 4AF0B 4DO6A 2ISVA 1TPVA 5F4WA 5CPMA 1OK6A 4R33A 2J9XA 1A5SA 4XUGA 3S9YA 3HQ1A 1VYRA 4IJBA 3W23A 1KM0A 1H7OA 3B4UA 5TBOA 5F2MA 3W9ZA 4QNWA 4NVTA 3PB0A 2FDSA 1VS1A 3W1AA 4K7VA 3PULA 1K7EA 3W07A 1W31A 2FIQA 4GC4A 1YTKA 2EGZA 1KM4A 4ZQCA 5E1QA 1XXXA 3DFQA 3IIVA 2HMCA 3FOKA 4JNMA 3QQ1A 4O1AA 4N4QA 3W2NA 2WOQA 3W87A 3UY7A 1OFRA 1KLZA 5CZ0A 1LOQA 4N2YA 1IXPA 2WJZA 3GDTA 2Z6IA 3A5FA 4HNUA 4UTTA 3F4NA 4MFEA 4QIUA 2C19A 2W0UA 3F4WA 1GT8A 1I2PA 3NAVA 3UWQA 3TJLA 1NAL1 4JY9A 2NX9A 4DPQA 3W85A 3KVKA 1FUYA 4I7VA 2QCLA 4LS1A 1M7PA 4M5PA 4NZJA 3UQNA 2P10A 2FFCA 3OVPA 3UWVA 2J9YA 3PSWA 3A24A 4ZQRA 4N6FA 4BWLA 3O07A 1F73A 1DKWA 4YL2A 3MP5A 1OFDA 3BV4A 3NQFA 4JTUA 1YTEA 4AWSA 3HPZA 3F03K 4RKAA 3PF3A 2ABBA 4PODA 1TPB1 1R30A 4HN4A 3NPWA 4K6AA 1K03A 4MZYA 2H6RA 3S5ZA 1SR9A 2E1DA 3W72A 2JKPA 4GUJA 3GIYA 2NUWA 3TXVA 3O8AA 2E6YA 1X6UA 4H4IA 2FQIA 4CNOA 2C0AA 2J9ZA 5DELA 3NQGA 4O13A 1VLIA 4NNCA 4S2CA 3B06A 1KFCA 4K8HA 3M44A 4JTJA 1QMLA 3W7JA 5HUOA 2E77A 1VCFA 2CLIA 4O16A 1R2SA 3T44A 2BWGA 2XN1A 2ZZ6A 2VEKA 3W3OA 1OG0A 5AB3A 1KM3A 3H55A 1T99A 4PL1A 3STGA 3ABOA 3TXZA 3P62A 3INPA 5KZMA 1T96A 4LV9A 3NZ1A 1VPXA 4JS3A 3UWZA 3PUDA 1PS9A 2CU0A 4JD4A 3V1PA 2P0OA 5BNKA 4C1LA 1SO6A 2AQWA 2DZUA 5K3VA 3W22A 2X16A 3EWWA 2R94A 5HINA 1PL9A 2JKEA 1S5TA 4JX6A 4L4MA 1RV8A 5AC8A 3CWNA 4GE8A 1UJPA 4UUIA 3DAQA 3P7YA 1W8SA 1MXSA 1SFJA 4RZ5A 3DFSA 5HR7A 2CLOA 1KTBA 2EKCA 4OE7A 1Z42A 3QRHA 4HSOA 4CNPA 2EHHA 4IPIA 2YXGA 1WBJA 1ADOA 3DHDA 2E6DA 3NGJA 4RV8A 5D2VA 2R14A 2X1SA 5D2TA 1XUZA 4UFJA 5HWNA 1SO3A 3HIJA 3IV3A 3KRUA 2QCNA 3R13A 3EXRA 3TFXA 5TIMA 4XBSA 3M5XA 3UXAA 3ANYA 2YFOA 4HIBA 3TA6A 1F5ZA 3HG2A 3G24A 1M6JA 3WJYA 1XBXA 5FF4A 1BEUA 2I1OA 4A3UA 1SZNA 3EX4A 2E5DA 4UFHA 3W1NA 4O14A 5I3IA 1G4EA 1QOQA 3DBPA 1R2TA 1GYLA 1O94A 1OHLA 5CSSA 5H2ZA 1KFKA 1TTJA 2F84A 3C56A 4BFAA 5D38A 5I3HA 4FIQA 1QPQA 3MWAA 1IF2A 5KSWA 5AYZA 4NJIA 4WD0A 1TCDA 4N02A 1OYAA 1TTPA 3EWYA 4NUWA 3HGJA 3S1VA 3R8RA 1PHQA 3DGRA 1TPC1 1QR7A 3MHGA 3W2MA 5DLCA 2I9EA 5E0KA 4O15A 4MOZA 3M6YA 4FB7A 1TJPA 3A23A 2GVGA 2GQAA 3W7OA 6ALDA 1YXDA 5BMWA 1XBVA 2ZZ3A 2QAFA 4O8RA 3W71A 2YX0A 3B03A 1VHNA 4UTMA 5CZTA 1QDSA 2VFIA 5C6MA 3IVTA 2W6RA 4JDYA 1GG1A 1DOSA 5DY3A 5CG7A 2P1FA 2VEPA 1KFJA 2V8ZA 1TSIA 2FB2A 2JKAA 1XM3A 4HNNA 3G0UA 3CB8A 4HNTA 3I7RA 2LLEA 2QAPA 3NPVA 3BVJA 3M5VA 2JGQA 1BTMA 3PSVA 2OX1A 5AN7A 4DQWA 3C2FA 4XBKA 2C14A 1FWWA 3TJXA 2WSRA 3I68A 3EWZA 3BGGA 4NX0A 3QPZA 2V5BA 2ZZ7A 5FI8A 3GYEA 2GVJA 4DXVA 4RCXA 7TIMA 1R46A 1OYBA 3HG3A 4POCA 4QAIA 2Y88A 2ATMA 4WOZA 3RMJA 4B5NA 2PRHA 4UTUA 5FF7A 3CC1A 3OEXA 5K2ZA 3TAOA 4GUGA 3JS3A 5D04C 4LVAA 2Y7EA 1EP2A 3QM3A 4M6VA 1VCVA 1VR6A 1WQ5A 2Y6ZA 4QJ1A 4O0KA 3WJZA 2G5WA 2H3DA 4N9EA 3GZ3A 1Z48A 1H63A 3BLFA 1ZHAA 2EPHA 2QCCA 3BK0A 3G8RA 4X9SA 5C55A 1TPH1 4ZQNA 4MFDA 1N8FA 2V0TA 3R89A 4Z1AA 3GAKA 2CZEA 1LCOA 2B0MA 2XFWA 2ZYFA 3PWAA 5HJLA 1AW2A 1EB3A 3HBLA 4FXSA 2VFEA 4WXZA 1A5CA 3DENA 1SUXA 4XTDA 3HOJA 3M47A 3TQVA 2GPTA 3VI2A 2ZRYA 4NXKA 3E12A 1YXYA 2BXVA 1ALDA 1G4TA 1JUKA 3AO0A 1YXCA 1VYSX 3TUUA 1KV5A 2AAMA 2V9DA 2FJKA 1GWJA 3EB2A 3W86A 1OABA 5DXYA 3H54A 3LGEA 4RXGA 5AYXA 5DY2A 2QEZA 2DZTA 1W3NA 1LBMA 1FWSA 1E51A 1F6PA 1ME9A 1RQBA 3G1AA 2EAWA 3TMQA 4AVFA 3LCIA 4JYEA 2R8WA 4BI5A 3L21A 3MI6A 3WFAA 1L6YA 4MY8A 1I2QA 3G1VA 1K8XA 3RU6A 1UCWA 4TX9A 3I6RA 4UTIA 2X30A 4CQ9A 3FYOA 2J27A 3WK3A 4RK8A 4Y6GA 5A5WA 1UASA 2A0NA 1ICPA 4FX8A 3NVTA 3S42A 3TC6A 5AYYA 3LCLA 2X2GA 1H60A 4FHAA 5AHNA 4UMCA 3TK7A 3L0GA 3HB9A 5EY5A 1KFLA 4DELA 5U7SA 4YXGA 3W74A 3LV6A 1WBHA 1P4CA 3G3DA 4DO4A 3P5YA 3T78A 4JTIA 2CLLA 1TRDA 5LNUA 3M9YA 4UMBA 2ZRVA 3LTSA 1W1ZA 4M19A 1JQVA 3LLFA 4KFNA 4GXMA 4N4PA 1KM2A 1N7KA 1LLWA 1LRTA 5DBUA 3MHUA 2NUXA 4AWTA 1GYNA 3NL6A 2GQ8A 2YYUA 2YR1A 4YCOA 4ZL1A 3NZRA 1J4EA 3W1RA 1H7XA 1W5NA 3SJ3A 2ZDRA 3BPWA 3LERA 1Q6OA 3RK8A 4Y9AA 1I2OA 2V2HA 3G1XA 4GJ1A 1I2NA 1WV2A 1TQJA 2NUYA 3STFA 1LLZA 1OVDA 5LKYA 2ZCGA 4IUOA 1EA0A 3W1QA 1KTCA 3VFLA 1SZFA 2CZFA 4JYDA 2ZRUA 3DH7A 2DZSA 2V2DA 5G1TA 4AH7A 3GB6A 1ZCOA 2VOMA 1WA3A 3PVFA 1XCFA 2A1YA 3NPXA 4FNSA 2Z2UA 3KX6A 4M7TA 2E6FA 4M6PA 4Z0JA 1C29A 3GXTA 1XKYA 2VFFA 4OQVA 2NLIA 5T26A 3MMTA 1G6CA 3W2UA 5KZDA 3EKZA 4QITA 5EA9A 3O63A 5FEZA 1LBFA 2HTMA 3M5YA 5D32A 1PIIA 1NFBA 4MZ1A 4EF9A 4P2VA 3DI0A 5CZJA 2J6XA 3SFKA 5G4WA 5FF2A 3FFSA 3W70A 3QSRA 5K9DA 3TV8A 1TV8A 3S0CA 4Z1BA 3OIXA 4OHQA 4MVAA 3SGUA 2QCFA 1TREA 3BW3A 4HKPA 4NJGA 1H7WA 4MLJA 2PE4A 1FWTA 2QDGA 1TPFA 1BKSA 1W5MA 3N2XA 3LXCA 4O12A 3S5NA 1JQXA 4S1FA 1LOLA 4IGHA 4PA8A 3M1ZA 5DBTA 3UZ5A 1JCLA 2DJXA 2VXNA 3L9CA 4C1KA 5LNRA 2DORA 3MP3A 2ZFAA 3BG3A 3MHFA 1JCJA 3WJXA 4X3ZA 4FO4A 1Q6LA 5DCBA 1A5AA 3GKFA 3S6DA 2CZDA 3PBYA 1H61A 1EP1A 1ZAHA 4LW7A 4MZ8A 4DEFA 3BG9A 3L67A 4EIVA 4IQLA 3QW3A 1HTIA 1WDWA 3RF9A 1H50A 1TTQA 4UC5A 3A21A 3FA5A 3FYPA 4W9TA 2W79A 3LV5A 1SU5A 2QCMA 1GVRA 2GOUA 5F1UA 2CLHA 2NV1A 2Y62A 1SSGA 3PUOA 1GVFA 5KZEA 4L4LA 4A2SA 2OMAA 4GUFA 1JJKA 2Y7GA 3FJLA 5DXXA 1K7FA 4A22A 3M16A 2B7PA 1WOBA 5HMSA 1Q3NA 5AFDA 1MO0A 1G7VA 3CEUA 2ZTJA 3TKFA 1VYPX 3VE9A 2JBMA 5MHBA 3TW6A 1KM5A 1BWKA 3LI0A 1RD5A 1TV7A 3UNDA 4E2BA 1WAUA 1W5PA 3GDKA 3NPUA 4NZFA 3WJWA 1XC4A 4O52A 1VCGA 4NNBA 3B0PA 4NJKA 4DF0A 1K8YA 1TRIA 3L5LA 4DBDA 1DV7A 1RR2A 5CPLA 5D09A 5LNVA 1I2RA 2H8ZA 3HPSA 3P8IA 5HNRA 3FJ6A 1PCWA 2NV2A 4LWWA 4JIQA 5G1YA 2C1HA 1TYGA 1TTIA 4O17A 3LM7A 4YLWA 3C2OA 4WJEA 1K02A 1O4UA 5K4XA 1LZOA 1XDMA 3FS2A 1DQWA 3B05A 3P82A 2E5BA 4HPJA 1DL3A 3IGUA 3ELFA 3A22A 3GNDA 1LOSA 2QUVA 1N55A 3UWWA 3QEZA 3P80A 1X1ZA 5G5IA 4LC6A 1VH7A 3PUEA 4LVGA 4EOUA 4NQ1A 5KITA 3S1XA 3TMLA 3HF3A 1MEWA 4O1CA 2ABAA 2Z0IA 5F4SA 2NX3A 4DBEA 4OBTA 4JTKA 1R2RA 1R47A 3CHVA 3NQ2A 3W7CA 5LGXA 3P84A 3STCA 3PS7A 5AHFA 3NXFA 1SW7A 1UB3A 3IRDA 4N9CA 3LRMA 4FNPA 1A5BA 4LT9A 2VFHA 1GVQA 2RFGA 4FEZA 3HO8A 1XI3A 1O60A 4FX6M 2TSYA 3NL2A 3UYCA 3UPBA 3EXTA 2ZTKA 3O6YX 1IIHA 1AMKA 2VC6A 2C15A 3GLCA 1X7FA 5LNSA 1Q45A 2ATSA 2R91A 3W88A 4WY0F 2VFGA 2A21A 5DCDA 1NVMA 3O15A 3ZS4A 3L2IA 3DFTA 4LS0A 3PC0A 4QSHA 1Q6RA 4I7WA 1ML1A 2O7SA 4UTWC 1GPWA 1P5BA 3QPYA 1I45A 4O28A 3G22A 1OFOA 1M5WA 1UBSA 3E49A 4PL2A 1QWGA 2YCEA 2C13A 4HSNA 4QM1A 3N19B 4EF8A 2X1TA 5D2WA 5L9FA 2GJLA 1B4KA 3TIMA 3TDFA 5F2LA 4NJHA 1LRNA 3C2VA 1W54A 2FLIA 3QMSA 1H62A 3S5OA 3PM6A 3C8FA 4TIMA 1EP3A 2ZRXA 5FESA 3M41A 4OGZA 1TMHA 1XFBA 2WQPA 4CQAA 1OF6A 2PC4A 4YWIA 5FEXA 3UPWA 1GTEA 2GUUA 5LNWA 2OJPA 2Y63A
chains in the Genus database with same CATH superfamily
2VENA 2WMIA 1NF7A 1GOOA 3SFWA 3HU7A 4FX7A 4KCUA 3MW7A 4P8XA 1WNOA 2X40A 2Y0FA 3E2SA 3OLDA 3TU9A 4HNLA 3W00A 2FTWA 1CXIA 2YSWA 3NTYA 3VDHA 4H6EA 5KINA 4J3UA 5IBXA 1TJ0A 1DORA 4LQ1A 4PFMA 3AXKA 1G0CA 2J7CA 3M4HA 4MB1A 1V03A 1C7SA 4QBXA 1DWHM 1JRBA 3PTKA 3MDWA 3NSNA 3TSBA 4E3TA 4MKNA 5D33A 2P0IA 3CBWA 3BG5A 3AS0A 3G3MA 2Y70A 2DSZA 4FALA 1R3WA 4LX4A 5LZLA 1EXPA 2YPIA 3HMJG 2RKXA 4CQ8A 1U5JA 3R1ZA 5AZ1A 3QFEA 5BWFA 4BWLC 1Q6QA 3H2AA 5DEZA 4NSBA 2ZX9A 4GZIA 2YDAA 4WHBA 1DJNA 1RP9A 3FHQA 1LG1A 2YB4A 4LAOA 3LXBA 4WZHA 4LAZA 3LHUA 3MUCA 3KVMA 4L65A 1MEHA 4V33A 3K30A 2WHLA 2GK1A 4BQ4A 3ZOAA 2CLPA 4O1EA 4HNVA 3K8MA 4PGLA 1GEQA 5FEPA 3STEA 3W2LA 3BGAA 1GQIA 5I3GA 4FAMA 1MNZA 2P3ZA 2PFHA 3MB9A 3MUZ1 4DWSB 4IIBA 5IXEA 3I65A 4C6NA 5CLWA 2D0GA 3DZ1A 1AK5A 1JYWA 3RJYA 3W1UA 3FW6A 4GIYA 4I7UA 1HJSA 1W1TA 2VELA 3CLMA 5J5DA 2E5CA 4ORIA 3ATZA 4CEUC 1JZ4A 2FTPA 1JNEA 1WO2A 5K9XA 5D9NA 1CX9A 3TCEA 4I90A 4U5IA 1P7TA 3L5MA 1IIGA 1TPWA 4CKQA 4FR6A 4RUBA 1WOAA 1JYXA 1XPYA 3ITLA 2INEA 5DANA 2V5LA 2GJNA 2D0HA 3VKCA 3ATYA 1TELA 3I10A 2YGYA 1AW5A 2VEIA 3KM8A 1ZS2A 5GVJA 2NQ9A 1WXZA 4GH3A 2F6KA 4DO5A 3TCSA 1FWDC 5HPCA 5AHLA 4WOQA 3HGRA 3VIMA 2OELA 3FSTA 4BI6A 4ZO9A 2W4XA 4LVFA 3U8GA 5TQLA 1SPQA 1AMYA 1QT1A 3L4WA 4GI9A 3LSCA 1PPIA 3A3HA 2BVTA 4N9DA 3VD9A 3OHMB 2DT0A 4DLMA 4GZJA 4DJFA 4J27A 3NUKA 1OFAA 3CUXA 1T8QA 1GEHA 2ISSA 4P61A 2B7NA 2XVGA 1BWLA 3EX3A 1G69A 3GXMA 2E1WA 1I1WA 3GVGA 3KBNA 1VAHA 1SFSA 1TPEA 2OO6A 3ORWA 4PUMA 4KW2A 4XZ9A 1VHCA 1ICSA 2P8CA 3NM1A 3STPA 4U3AA 1T7LA 3MUXA 3NQDA 1OFEA 3TROA 1FA2A 4GVFA 3M5ZA 3GR7A 3CWHA 4TX8A 3VKDA 3BAXA 1SJBA 2QF8A 1L9WA 3G2GA 5FJJA 1HKMA 1R38A 2YZRA 1IXQA 1UP2A 1J5SA 1DIOA 3ARTA 4JTSA 4URIA 2NQJA 3KAOA 3DU0A 4O0ZA 2BVYA 3T1GA 5EKYA 1B30A 4AHQA 4CN1A 1NARA 4AIUA 3OG3A 5DMNA 4L6DA 1Z8AA 3E38A 3D3AA 3NR0A 2ZBTA 3BSMA 2BHZA 1E43A 2WKJA 5EMUA 6XIMA 1FWAC 1UWTA 3UVIA 4AHOA 3AZRA 2WVUA 1GG0A 1QO2A 2OVLA 1EJWC 2V82A 2PDMA 3WENA 4LNCA 1RK6A 4NAEB 3EA1A 3GVWA 1D9EA 6PTDA 3QW4B 2FGLA 4H2CA 1VP5A 4X0NA 2GQ3A 3V3WA 1ZNNA 2PDQA 1ECEA 1Q65A 3I7SA 4JTEA 3UG3A 4NKCA 4NI8A 3RN6A 3IJ9A 3SGZA 5CJ5A 3F4DA 5HATA 3MDUA 4WJ8A 1NH6A 1UOKA 2GYIA 2I5QA 3M0XA 3WQ6A 3BLDA 3MA8A 3DX5A 3TLLA 4JTLA 4XB3A 3RG6A 3WDIA 1VJZA 4TTGA 1S3HA 2WNQA 4B3LA 2NQ5A 2SFPA 3W1PA 1QHZA 2X1UA 4IISA 3KHJA 2OT0A 4HK5A 5DX7A 2OGYA 3MO7A 4XZBA 4IGSA 1YIXA 1CXHA 2C18A 4HVXA 2JE8A 1XIMA 1XICA 3MI2A 4FNTA 1MFUA 5D37A 4NX5A 1VFFA 1QBBA 3TFCA 3TOPA 1ZP3A 2WNNA 1NIUA 2QZRA 1IT8A 2OYLA 4CQBA 1BAGA 4YYCA 4HPXA 4BCEA 1K8ZA 3LCWA 4EANA 4H6RA 4MUZA 4E5TA 2VDGA 3QY8A 2ZZ4A 4PUNA 1SW0A 1BYBA 1J5TA 4Z08A 4PR4A 3I7QA 5BXPA 2EPLX 3LHZA 2ZQ0A 5FJIA 2XH4A 1J18A 3AZTA 3PK7A 4I8DA 1IXNA 1UUOA 3A4XA 1N2VA 3FXGA 3IIPA 3APGA 5AC7A 7TAAA 2BMBA 3SECA 4F0RA 3AZSA 2FPTA 1DXFA 2VEGA 3BMWA 2TPSA 4Z1CA 3VGBA 3NQMA 2V30A 3MKCA 2BOFX 5ABHA 2J78A 2KZHA 5CC5A 3UF9A 4R88A 1YLVA 3UWYA 3RO6A 5AVNA 1RBAA 1UJQA 4U10A 4YS1A 4AY1A 2WSKA 1D3GA 5I3DA 1HO1A 4KWWA 2WC4A 2X1RA 2C8NA 4IX2A 3CZKA 4ORMA 2A6NA 1XYBA 3GUWA 1FQ0A 1K4GA 4C6JA 4OV4A 3V5OA 3B9OA 2PP3A 2Z4GA 1HL2A 2QDHA 4JQ4A 2YFNA 2GDVA 1PV8A 1ONXA 4UTKA 4DWSD 4JBRA 1LL6A 1ME7A 2V3EA 3VOJA 1IV8A 4DJEA 2DY3A 3S5SA 1PDZA 4A3RA 5BROA 2RUSA 2QUTA 4TUFA 1DBTA 3LG3A 2CETA 3BCJA 3RHGA 3P14A 4ZOBA 4ML9A 4LJ3A 1JDFA 4AZGA 1V3JA 3ONBA 4MNMA 1NOUA 3E2VA 3KCOA 4WX2A 2XWEA 4EAYA 3POHA 2BY2A 1IEXA 4DVOA 2WCSA 1YNQA 1GOXA 2PMQA 3UY8A 2GVLA 1RP8A 5I24A 2TYSA 3B8VA 5F4XA 4US6A 3N25A 1EZ2A 3KCLA 4PMQA 3WQVA 2CFFA 5I3KA 1VLWA 3RM8A 3V7PA 4FNRA 1XL9A 3T4CA 4UR9A 4Q32A 2PLCA 4JICA 3WLOA 2WAGA 2IKGA 3GXPA 3AS3A 1Y5VA 4GQRA 2YLLA 3M6DA 4H00A 1FKWA 1H0GA 4WY0B 2CLFA 4HN8A 2RGMA 1P0EA 5HR6A 4UTTC 1H11A 1M03A 3ITOA 1GYMA 3TE9A 1A3XA 2Q3RA 1J6PA 2PGEA 3TN6A 3P8JA 1DJQA 4J7RA 3W38A 3BLIA 1Z6KA 1QI5A 4GK8A 5EPDA 2FH6A 3W02A 1EA9C 3AMDA 3G5EA 3SB0A 2ZZ2A 4ZO8A 5CPOA 3CH9A 1RA5A 5D02A 3FEMA 4RX0A 3GDMA 1ZBVA 3NZPA 2F7FA 2BX7A 1EWEA 4BEUA 5ENLA 3VGGA 1ZALA 5C5YA 1LROA 1RJQA 4RV3A 1PKYA 3QTPA 2NQLA 4KS0A 2GFTA 1ZENA 3T7VA 1KCKA 4GFSA 1XGDA 5A94A 2A3HA 3CAVA 1JZ6A 1FY6A 4ADTA 4KWOA 1WUEA 2QKFA 3W1TA 3SRHA 1FDYA 3VPLA 4MDPA 6REQA 1HJUA 1W37A 2WXDM 2FVKA 1DHKA 3DCPA 3PZQA 4TV6A 4F0MA 1JCNA 2OCZA 3LNMA 1JI1A 4JXCA 2ZRWA 2G37A 2E68A 4Q6XA 1UIPA 2V67A 1M68A 4K68A 3RUBL 1PJ9A 3ENLA 4C5YA 5IRPA 1G94A 1OSEA 2E09A 1KV8A 2HV5A 1WAWA 3B97A 2F2KA 4IP7A 2ISWA 3SM0A 3SY5A 2JK2A 3IGXA 4CCEA 3LCFA 1KKOA 1TJRA 3EKLA 2GGHA 4RW3A 4JX4A 1WXYA 2ALDA 3W84A 2QJJA 3ZWSA 2OT1A 3H2NA 3KZSA 2A5HA 3DG3A 5CKSA 5E70A 4HPHA 4ZEPA 2RHGA 3C6CA 3QSTA 3W7RA 3PJXA 3ZSTA 4PC8A 3MI3A 3REQA 4AF0A 4KQNA 5HJXA 1W5QA 4PMUA 1HJWA 2NWSA 3UCQA 3GFYA 2R24A 3NJ3A 3E9AA 2Y5JA 5H6HA 6TAAA 1SJAA 3AU2A 5C2CA 4MUPA 4F9DA 1UPPA 2J8GA 1F6KA 4C6QA 1YEYA 3GTIA 5HBFA 3BAJA 1FFRA 2FH8A 5D9MA 4CN4A 2I56A 3S4TA 1RJPA 3VNIA 3W25A 3AXXA 3B9DA 1EHNA 3TNOA 4DWSC 1RSCA 4MF4A 1B57A 3USBA 1MW3A 1W1PA 5I77A 5FAJA 4CUCA 4K39A 3DG7A 3N11A 1NP2A 3AYVA 5BZAA 1FWFC 1TA3A 2HBVA 5G2WA 1YRRA 2PDGA 3L12A 2J74A 1P0KA 2Z28A 4GY7A 5J8LA 2OSWA 1H7PA 1YYAA 3H7VA 2WLYA 5AHMA 3UR8A 1E71M 3GH5A 2QDDA 2DZXA 3W7GA 3OVRA 2QGYA 4GISA 1W9XA 4GUIA 3MP4A 3O6CA 3I3DA 1DYSA 1LF1A 1TR9A 3WJSA 3TYCA 3MCNA 2HCVA 2D23A 2P88A 4IPPA 4AIOA 3S5YA 2WVVB 1H5YA 3F1QA 4PTMA 2WHKA 3N15A 4O57A 1OIMA 1DTNA 2RDUA 5K9CA 1LRQA 4D72A 3ABRA 4Q4SA 1XLJA 1EDQA 4TVCA 2CEQA 1QNVA 1J2WA 2D73A 4UR7A 3R10A 4DO6A 1E5JA 2VCCA 1V6YA 5F4WA 1OK6A 1V02A 5CJMA 3M46A 5DRIA 1JDDA 3B9EA 3HV9A 4IJBA 1KM0A 2QT3A 4R7OA 2OXNA 5TBOA 2HROA 1XV8A 2QDEA 3WNKA 2Z29A 2CIPA 4B5UA 3W1AA 3OBEA 3HMCA 2J7FA 4ZTXA 2OB3A 3GNPA 1W31A 4PBEA 3W07A 1DIEA 1H0IA 3BSGA 4BJHA 4ZQCA 3DFQA 3OIHA 1OQFA 1UZ4A 1UG6A 3WLLA 4N4QA 1CT5A 2WOQA 3C0SA 3UY7A 5DF0A 3N17A 2VZUA 4L9YA 5CZ0A 4PE8A 4N2YA 4PBGA 4GY1A 3BCFA 2Z6IA 4UTTA 4MTVA 4H9ZA 2C19A 3IJLA 3F4WA 2W27A 1AJZA 4JY9A 1UMYA 4PUDA 3W85A 3KVKA 1I60A 2QXWA 3S6OA 4I6KA 5KETA 3H12A 2HQAA 2IPJA 3KHDA 3EDJA 3UQNA 4OOUA 4HYRA 4N6FA 3K5XA 3O07A 3OP2A 5E6ZA 3MP5A 4KEMA 4XAYA 1OFDA 2WZTA 2G41A 3KLKA 1UR8A 1A5UA 2X0SA 5REQB 3DOPA 3PF3A 4HOZA 4HQVA 3F4VA 4QG8A 1JD9A 4D6DA 3IJ8A 1CTNA 4K6AA 2J79A 4MZYA 2QS8A 2E1DA 4ENLA 4Q8TA 2FMOA 1SGJA 5FJPA 2JKPA 2NUWA 5MKGB 3VFCA 1UKPA 4YIWA 3VU2A 3IAPA 1WDSA 4Z2HA 2FQIA 2J9ZA 5DELA 1FFQA 4GQ0A 2G0WA 4QXIA 4S3EA 4AW7A 2PLJA 2EPKX 2P8BA 3UXLA 3WL0A 4ZXLA 5GJNA 4W7UA 2AGTA 1UKTA 2R1NA 3GU9A 5CSUA 1UQZA 3GNOA 4Q8MA 1JZ5A 3DYPA 5AB3A 4F79A 1KM3A 1XP3A 2B81A 1Y8BA 1T99A 5AY7A 5C9XA 2C1GA 2DUAA 3EA2A 4XZHA 1POKA 4LV9A 3EKGA 3CT2A 5A6LA 4JQ3A 4JD4A 2RJHA 1VD6A 3V1PA 3PBGA 1SO6A 2IW0A 1XIGA 4I8YA 1S5TA 3LENA 4U31A 5AC8A 4GYPC 2V38A 2PGFA 4GE8A 4JIEA 1W8SA 1AQHA 1MXSA 5CPQA 2PTDA 3FA4A 1MDRA 3PZ9A 1QRQA 2IQ0A 1ECQA 2YXGA 3ZLHA 3H8AA 3NGJA 4RV8A 4Z2IA 3TYDA 5D2TA 4GXPA 3KL0A 3GC2A 2PP1A 3SUSA 2ACUA 2GGJA 1XKJA 2DVUA 3B8UA 2V3GA 4Q22A 5TIMA 4XBSA 3M5XA 1X38A 4AYSA 4AZBA 4DO7A 4DUVA 3TA6A 3G24A 2PDUA 4F0KA 1XBXA 4A3UA 1HIZA 1SZNA 2GLKA 3EX4A 1V77A 2E5DA 3WBAA 5I3IA 4GA8A 3BH4A 2NT1A 5CSSA 1TTJA 4CCZA 1E4NA 1DXEA 4AG0A 1S5NA 5AYZA 3TEVA 4KRUA 4NJIA 4WD0A 3RILA 1TCDA 4U2ZA 4A8NA 1TTPA 2E8YA 3NDYA 1GGOA 1J01A 3HGJA 1BWVA 3S1VA 3BE7A 3SGGA 3M7SA 1QR7A 3MHGA 5E0KA 1KB3A 2F6XA 4H6QA 3FDKA 2BG5A 2X41A 1ITQA 3A23A 3APYA 3SCSA 6ALDA 4QAWA 1EJTC 3AXMA 3ME3A 1YXDA 2HEJA 4O8RA 3B03A 4HYVA 1QDSA 1ZSXA 4ZODA 4PUKA 2W6RA 3W01A 2VC7A 5CG7A 1GORA 1B90A 4AIEA 3R11A 5DT7A 3R6IA 3C0QA 3CB8A 4GO9A 4HNTA 2YDQA 5TAOA 1ZJHA 2JGQA 1BTMA 3C2FA 4XBKA 2C14A 4M29A 1FWWA 2CBJA 2JQXA 2Y1HA 3TJXA 3WQFA 3EWZA 3T2PA 3UZZA 3UFYA 1IEQA 2OLHA 3BZGA 2BY3A 5FI8A 1HW6A 2GVJA 3QR0A 1NDWA 1R46A 1OYBA 3TNBA 2ATMA 3RMJA 3HZ3A 1PZ1A 2FDMA 4EP8C 5K2ZA 5D04C 3JS3A 4LEQA 1JDAA 1M3UA 3ZVIA 1K4HA 3PZIA 4EK7A 4TX6A 3TN3A 1K9FA 4M1BA 1VR6A 1SFTA 1MZRA 2IKHA 1V3IA 2PSNA 2G5WA 3U3HA 1IQ8A 3WH8A 1YW1A 1XLHA 2PD5A 2GZXA 3H4XA 3DFYA 2QCCA 1DTUA 1R3VA 5JBFA 3G8RA 2D2OA 5C55A 1HJQA 1TPH1 1F3EA 4WKHA 3URAA 1QI3A 3HN3A 3R89A 3KEHA 3VAVA 1RHCA 3PPHA 3GAKA 2CZEA 2ZYFA 3PWAA 4F9JA 5JBDA 2VFEA 1JXJA 4GYFA 3H2MA 4P8VA 4WXZA 3RO8A 1HGYA 4X9YA 2PCEA 1R8LA 1V3MA 4XAGA 2GGGA 3HOJA 1QHOA 3VI2A 3GFZA 4LCRA 1DIDA 2BXVA 1G4TA 2ZE3A 4AXNA 5C7HA 4MWAB 3AO0A 2AAMA 2V9DA 2ZX8A 4LYPA 1GWJA 2WW5A 2IKJA 4HNCA 4GH1A 1LWIA 2ZUVA 4CU6A 4ZGYA 1HZYA 4GG9A 4F2UA 1VBRA 1W3NA 3AMGA 2EAWA 4XD5A 3TMQA 2CKSA 1JIBA 3VDBA 4MWAE 2R8WA 3MI6A 1L6YA 3F7JA 4BS0A 3M0KA 4WLCA 3RU6A 4TX9A 2VVNA 3CO8A 3WLMA 3SCTA 2X30A 2VT0A 1OD0A 3VOFA 4QCEA 3WLPA 4IMAA 1EBHA 4S3AA 3L0GA 3VUSA 1FKXA 4NAFA 3RM4A 1VEMA 1XLAA 1FH8A 4DI9A 4UQBA 3IV8A 4DO4A 3E0FA 2O9PA 4JEJA 1Q6CA 1TRDA 2ZRVA 1W1ZA 4M19A 3A9BA 3LLFA 4KFNA 4GXMA 1B3VA 3I4KA 3WLRA 7ENLA 2NUXA 3NL6A 3QPEA 5H8PA 3W1RA 1BRLB 3AQUA 3SJ3A 1Q6OA 4R5EA 3GTHA 1XYLA 4Z2GA 1I2NA 3ZYZA 1OVDA 2O9OA 1U1UA 2ZCGA 7REQB 1PXGA 3VFLA 3TZFA 5RUBA 1SZFA 1B54A 4HTBA 3RIKA 5ABFB 2DZSA 2YKKA 4GI4A 3UVAA 2BY1A 1UP3A 4FNSA 2Z2UA 5HAOA 1VF8A 3S9IA 4M6PA 2FFIA 4A3QA 1TJ1A 1V6VA 5T26A 2XVKA 4H1ZA 4YTUA 2XZ7A 2CXEA 2HPMA 2UY4A 1KR0A 4Q4PA 3O63A 5FEZA 1J0KA 2HTMA 3WKZA 4E4FA 3GE7A 5D32A 4E8DA 1PIIA 1V6UA 3KUMA 4UBPC 4EF9A 3DI0A 2REQA 3FFSA 3V36A 3VDAA 4Z1BA 3S0CA 4MVAA 4HKPA 4NJGA 1VFSA 1H7WA 3B3DA 6CGTA 1PO9A 1PAMA 1EOKA 4MLJA 2PE4A 1FWTA 2J66A 1BKSA 5I78A 5A95A 1JYNA 4ZFMA 3AISA 4LAKA 2INFA 4FMVA 4S1FA 5JIPA 1QPKA 3ZSSA 2XDFA 3FAWA 2VXNA 3CQJA 1O68A 1GVEA 1IZJA 3MHFA 1F07A 4XO7A 4X3ZA 4FO4A 3VD4A 3UWEA 5E9AA 4ZXOA 1F9CA 2INZA 2CZDA 3AS2A 3UYIA 1EP1A 1AJ2A 4LW7A 1EJVC 4GNVA 4DEFA 1HTIA 4F0HA 1WDWA 3RF9A 4UC5A 3A21A 3FYPA 2W79A 2WKLA 1E4IA 3WBYA 1UUQA 4QDWA 3TN4A 5I7GA 2NVCA 2NV1A 1GVFA 4OUIA 4A2SA 1NWSA 3QZ6A 5E0FA 3KBSA 2P53A 2FTYA 1ESWA 5HMSA 1REQA 2E9BA 1G7VA 1YX1A 5A2AA 2WNWA 3M0MA 1BWKA 1RD5A 3VOGA 2WMGA 4E2BA 2GL5A 3TTEA 1HKVA 4JIRA 4NZFA 4O52A 3PAOA 4NNBA 4NJKA 3I6TA 2W61A 1C3FA 2VDHA 3CMGA 4DF0A 4DBDA 3L4XA 1Y7VA 4RW5A 1DV7A 4G9PA 4S3GA 4PCPA 1OCBA 4GD0A 1ISZA 4F8XA 5HNRA 1H49A 1ZZMA 2NV2A 4DI8A 2C1HA 3RLGA 3AHTA 4I3GA 1ZJBA 4YLWA 5A8PA 3V1HA 1K02A 4G56A 3BL3A 1UD2A 1DQWA 2E5BA 3AFBA 3IGUA 3A22A 5D8WA 3C2YA 3GTXA 1N55A 3QEZA 4XZWA 1EXBA 4LC6A 3PUEA 2RAGA 2CWXA 5KITA 4QJ4B 4J35A 4OTKA 3WCZA 5DO8A 1A5OC 4O1CA 2ABAA 2Z0IA 5F4SA 4DBEA 4OBTA 3CHVA 3W7CA 4BF5A 3LPPA 1A5MC 1XRVA 4H9UA 4C6PA 4GNKB 3W0KA 4LT9A 1EQPA 2PDKA 3WDRA 1GVQA 2FJUB 3ARZA 1KGUA 2TSYA 1RPKA 3N1AA 3M0VA 4GY0A 1IIHA 4US5A 2C15A 4DNHA 5LNSA 5IDZA 2ATSA 3W88A 5LXEA 1O66A 5DCDA 4Q8WA 5FACA 3BXWA 1Q6RA 2C71A 4FSAA 1XLBA 1Y65A 2O7SA 3I6EA 1R9XA 2PTXA 4O28A 3HJEA 3CV1A 4PCTA 4HK6A 3QVQA 2ZX6A 7XIMA 4MWAD 1OFOA 1M5WA 4UQ9A 4GX8A 5CC6A 2YCEA 2DV0A 2GJLA 2PLKA 3TIMA 1XLFA 3ZR5A 4NJHA 1UD5A 3QGVA 4AZHA 1V0LA 3ZT5A 1V6WA 2ZRXA 4UZUA 3CYJA 5FESA 3M41A 1SMAA 3IGHX 1J2BA 3ARRA 5FAGA 4L6OA 3N2TA 5FEXA 3AXIA 1GTEA 3SAZA 2OJPA 4DWDA 1ZP4A 3CUZA 2DVTA 2QCGA 2VZSA 4F4RA 4AXKA 3RXZA 4WXYA 5BOEA 3QJAA 1ZY9A 5GJPA 3CTLA 2BGSA 2Z6JA 2GVYA 2OKOA 3BLOA 5A6KA 4GX9A 5HQMA 5K4ZA 1C9DA 1KGXA 1FWCC 4DBSA 3QXBA 4U5KA 1B3XA 4NT0A 5AZ0A 3MMWA 1XX1A 2WMJA 3ITCA 2Y2WA 3NQCA 4NF7A 4O4WA 3M7WA 2AGKA 1IWPA 2DZBA 2QNEA 3A64A 3D3FA 3A12A 4H3DA 2E9MA 4AY8A 1EBGA 4UCGA 3E0IA 2GJPA 3IACA 1B2YA 4WRHA 2KX9A 3OZYA 1RK5A 1OC5A 1QWKA 4MYAA 3M64A 3FNDA 4NXSA 3AIQA 1B3OA 4P7NA 1F76A 1TFVA 3SO7A 2R1LA 3W7NA 1XH0A 1DJYA 4J28A 1UD8A 5D30A 4DB7A 4LGXA 4MY9A 3W76A 2CBVA 2OLSA 5F1VA 1BPLB 3W6YA 1A3WA 3IJIA 1CW2A 3HGOA 4J3TA 3DGBA 1JZ3A 3GHTA 2PRMA 4GKTA 3VC6A 1E9ZB 4Q8NA 1A53A 1Q6EA 2DW7A 5AECA 2C3ZA 1O7AA 1DE6A 2VOTA 4W8AA 4AFYA 2QCDA 1UR2A 1EFZA 1E3XA 3T42A 1BG4A 2Y7DA 1YPXA 4KH2A 3BSHA 3W7KA 4QDMA 2BOGX 4B9YA 3W7QA 2ZUWA 3EWBX 3VTRA 2WSQA 1S2WA 1TIMA 2FVMA 4Q8PA 2OTDA 2PRLA 4E8CA 1W1VA 4PULA 3OOQA 3VOHA 1EF3A 1K6WA 1LWHA 2WMIB 4QHRA 2WANA 4NHVA 4EWJA 3LZ3A 2XSXA 3KXQA 1F2JA 4C65A 1I0BA 5HQEA 4L1GA 1XIIA 1DXIA 3PAJA 4R9XA 1VFMA 3NO5A 3NOEA 3B04A 3GM8A 3AI0A 3SJNA 1D3HA 3UR7A 2YYTA 3L7RA 4KFPA 3WQ4A 4QSFA 2QF7A 4UNLA 3WBXA 4H41A 4GBUA 2W92A 4Y9PA 4HOWA 4B2DD 2WWCA 3B8DA 2G4FA 3MVTA 2EPMX 2PTYA 2YCKX 3OHIA 3UXDA 3S2LA 1IWAA 4M51A 3THUA 4LFYA 4O8AA 2VUYA 3LA4A 1JR1A 4BF7A 2ZUMA 3VK5A 5I06A 3PJTA 1SFLA 3PBVA 3ECQA 3LCHA 2Q8LA 5I2UA 1UR0A 2PZ0A 2ZRZA 3H53A 1WDDA 2HRWA 1R86A 2WJEA 2QJMA 5CBIA 3NCOA 1XIBA 3L68A 4PB5A 1H1YA 1FHUA 3UNTA 4Z2JA 3G18A 4V1XA 4BF9A 3WIJA 1TV2A 1PWMA 3B8WA 2WB5A 5LIYX 3KOWA 4XSMA 1KO0A 2A3BA 2GK1B 3ARWA 4M81A 1NU5A 1W3TA 1UC5A 4B4FA 3P0WA 3SQLA 1RBOB 3WYZA 2ZA2A 4IIHA 2VWTA 2Y7FA 3BAKA 3NG3A 1S2UA 1W1YA 3TX9A 3LHWA 4UFLA 2VKZG 1E0UA 5HNTA 1E0TA 4L7ZA 3HGSA 4PTNA 1KA9F 4C6KA 3PP7A 3RM9A 3VNJA 4U4MA 1P7TB 1RY0A 4A2RA 3IRSA 3S8HA 3VGDA 2DT1A 1QOPA 3VDGA 1US0A 4FPSA 1L6WA 4NNAA 3VNMA 3VILA 1JF6A 3R25A 3EEZA 3P61A 1P0NA 3J7HA 3E6EA 1JXKA 3RRXA 2TRSA 1TWZA 5KTLA 1WE5A 2ZUUA 4A21A 3R94A 4E0CA 2C6QA 3PFMA 4WQ6A 4LUTA 3KS5A 2AMGA 1YADA 5EBUA 1RQHA 3P81A 3DFOA 3WNPA 4JTHA 1Q4NX 5H8UA 3OB8A 1VBJA 1PHWA 1IHIA 4KRZA 3TH6A 5CZSA 1XLLA 3QKZA 2G3MA 3NA8A 3ZJ6A 4J5NA 5HWJA 4DHGA 3R12A 3C2EA 4O54A 3HG5A 3CPGA 2TMDA 3KRZA 1MDLA 3EYPA 1HKJA 2WNZA 1AL8A 2Q8XA 2EG8A 7CGTA 2VTFA 4X2RA 4PTDA 5AOUA 1XIHA 5CEWA 3LYEA 3P6LA 5JMUA 3D46A 4OWGA 2NSXA 1BLIA 1F7BA 5AVHA 4LRTA 2HBXA 3EXSA 3EWXA 2QJIA 3GYCA 5EU9A 4UTJA 4DJDD 5CC3A 4N9BA 3S2NA 3EOEA 2A3CA 3PG8A 2QUUA 2DZVA 1E1EA 1Q2RA 4PRRA 3EDDA 3JU2A 3ABQA 2GDUA 5EL1A 3G6MA 1B3WA 1S5VA 3N9RA 3WF4A 5FOOA 1XLGA 3NQ6A 5DFAA 3QQ0A 4FIRA 1CI1A 4F66A 1EIXA 1IE7C 2AL2A 1A4MA 1XQKA 2JEPA 1NF0A 1UWRA 1DIKA 4XTIA 2A79A 1M7OA 3Q94A 3KOFA 3ZIZA 3SZ8A 1AVAA 4OV9A 1X1NA 1FHDA 1VIWA 1W8GA 4ZSUA 2OEJA 2XUCA 2PA6A 1NELA 3EX6A 3ZJ8A 1MMFA 1EEPA 3R5EA 4HB7A 5D9OA 4GGBA 4IMGA 4QNEA 5FF3A 1XD1A 2XGZA 1JRCA 4EVZA 2A7PA 3CT7A 2BBFA 1XCWA 3VGHA 2ODOA 3SCQA 5B7ZA 1A80A 4PFHA 3T55A 3SR7A 1SJCA 3F2CA 4XAFA 5LIWX 3WQ5A 1PTAA 4D8LA 3AIBA 2A2IA 3SSZA 1XLCA 3D5HA 5EMMA 1TPUA 4JTAA 4AEOA 4PEEA 1KTNA 2I9UA 2DZPA 1UA7A 3SURA 4FZIA 5G1MA 1XJBA 1TVLA 4PN2A 5IHRA 1BQGA 3P93A 1KM1A 2NX1A 4KF1A 2FZMA 1TX2A 2B4GA 1JULA 2PBOA 3W2JA 1EZWA 3QOMA 1CGVA 3U0HA 3BWWA 4O50A 4QEEA 1KBKA 4B9ZA 2ZICA 4AZCA 3B0UX 2D20A 3GBEA 3PB2A 5D9PA 4B92A 5A6JA 2Z1BA 4DZAA 1AODA 3C3NA 4UXDA 4D6HA 4HZMA 4Z1DA 1VGAA 1QW9A 2J13A 2ACQA 2OZ0A 5CJNA 1DWFM 1P6BA 3KRSA 4GCXA 5D4YA 5HK4A 4O18A 3LS9A 1FXQA 1SSDA 3VNYA 1OFPA 1VJIA 4CD7A 1C8XA 1C8YA 4QJ3B 3GDBA 2ZUTA 1J9YA 2PTZA 4LRSA 2VEMA 1QOXA 3T05A 1VFTA 4MY1A 2NXHA 1VBHA 2Z2AA 4B4HA 2E40A 2C1IA 4I5UA 1E4LA 1WCGA 2FHBA 2RDTA 3NQEA 1ME8A 3Q37A 5HUPA 4HCHA 1XSIA 4ZQOA 3GTFA 1IT0A 2J88A 4AD3A 1HVXA 1GZ1A 3LPGA 2XIJA 2CERA 2C91A 4JTCA 2PCQA 1ADDA 2IQTA 4PZVA 3ZR4A 3T6CA 2CCRA 1AZ1A 5CXPA 3PWIA 4MJZA 4NZ4A 2YBUA 5I09A 4K1WA 2A4AA 3Q67A 1R3TA 2H3BA 3LHVA 4RZ4A 1OGGA 3T08A 1GUVA 1QASA 4LBRA 3RX2A 4AWEA 1VZWA 1E55A 1MXGA 1OX4A 5C2XA 1YPIA 3H23A 5CQ1A 2O92A 4PMJA 3C3UA 3EX2A 3JR2A 3PBUA 3CTTA 4XISA 2XU2A 5LA1A 1I8JA 3ICJA 1TWIA 2G50A 1V8EA 3RNDA 3AC0A 1KW1A 2I17A 1JCYA 3MWCA 3BC9A 2FHCA 1K3UA 2YW3A 3E2QA 1LQ0A 3VMNA 1DE5A 1Z44A 4DJDC 1CEOA 1HJXA 1J0HA 1W3KA 3VKJA 4JY8A 4JTRA 2IMRA 1C7TA 3G0SA 3PNZA 4ZQMA 1F05A 4WR3A 2FZ9A 1GQJA 2V81A 1PKMA 4AC7C 3W1LA 4N7QA 3W73A 1W3LA 3RJXA 1X8FA 4OECA 4ALDA 1JL8A 4DJFD 4QQ3A 3LCGA 3PUGA 4XAPA 2H9AA 2WMKA 4CLMA 1OK4A 1KD0A 3DKLA 4E3VA 4TU1A 3B8IA 2CZVA 3NFUA 1L8NA 4ASTA 3KLLA 1SYTA 2VURA 3OPSA 4AD5A 4ZMGA 4Y7EA 3N9SA 3BQ5A 4DUOA 1W3JA 5A6BA 5FJUA 3NSXA 1OFQA 3DKJA 5JXQA 3EWUA 1PVNA 1PB0A 2ZZ5A 1AW1A 3ZWTA 2BTMA 3CIWA 1QPNA 2VMFA 1FX6A 2E3ZA 4QE5A 4JTFA 5IHSA 2PDNA 4OU1A 2UZ9A 3QHNA 3NEVA 1TIWA 4JN7A 5D2XA 2VX7A 4RDVA 3PY2A 4KETA 3B0VC 3P60A 4DF1A 4C6BA 3G1FA 2XINA 3RYSA 1FH7A 1EJXC 4P5UA 4LAUA 4JNYA 1YTDA 3MS8A 1W56A 1B31A 1CZ1A 3IANA 3NQ7A 4K37A 4J9JA 2JF6A 1WXJA 4W5ZA 3C0LA 4WDUA 6REQB 5C54A 3DXIA 4MLRA 4GQGA 1C8QA 2ZXBA 4EE9A 1JUBA 4M24A 4O1BA 3W83A 1QW7A 2PP0A 2PTWA 2QIIA 3L4VA 4XZLX 2Q6ZA 2ONEA 4YTTA 4PMRA 3W6LA 2A3LA 2VQTA 3CYVA 2Q09A 2VWSA 4KFOA 1BFNA 3PR2A 1MRAA 4RJEA 3NYZA 2ESCA 3L5AA 2BZNA 2QJHA 5IBXC 4PSRA 1AUSL 1JNDA 2J24A 1HN1A 3BURA 4WCJA 3W82A 4UR8A 3H7RA 5LA2A 3CL6A 2OLAA 3U9IA 3HJZA 2PWVA 3RCNA 3EWCA 1O1ZA 3KOXA 3OO2A 4QEHA 1E0VA 3GIPA 3SIZA 3FJ4A 3G1YA 1E6XM 1UR9A 2IPFA 1E3ZA 5HJYA 4UTWA 4AZ5A 1JVNA 4IWWA 4HP5A 4YMZA 3WLHA 2GJXA 4MDOA 2WWDA 3M43A 4XUYA 4BR1A 1MUCA 1ZBKA 2CC0A 1TQXA 4JKMA 3WDHA 2EXOA 3REQB 3EX1A 4NRSA 4JR5A 4AF0B 2XISA 4R33A 4H83A 1PZ2A 2AKZA 1A5SA 3T0CA 4QS5A 3OJGA 3HQ1A 1ZCCA 4JQ1A 5A3HA 1H7OA 3ZJ7A 4QNWA 1MW2A 1GNXA 1VS1A 4GQBA 1LJYA 4K7VA 3WDQA 4YWSA 1H5VA 1I6NA 3PULA 4BY3A 4Q4MA 2CHNA 5FJTA 5CC7A 2YCLA 4GFIA 3CV6A 4LPCA 2VEFA 3R58A 5JH2A 3CASA 2HMCA 3FOKA 4BEQA 4JNMA 3QQ1A 3W2NA 2HK1A 3ALGA 1TA3B 5TF0A 3QV9A 1LOQA 1IXPA 1WPCA 1W9DM 1KWKA 1Q8JA 1M41A 1I2PA 1Z3NA 3IS4A 3SEPA 1W91A 2FYMA 1J96A 1PTGA 1FUYA 3W6MA 2QCLA 2XTKA 1CWYA 1EO7A 4S39A 4M5PA 1NDZA 4R9OA 2P10A 2Y4SA 3UWVA 2J9YA 3CB3A 5F7UA 2QV5A 3ABXA 1W1IE 4ZQRA 5A2BA 1F73A 1DKWA 1HT6A 1GVIA 3BV4A 1YTEA 4AWSA 3HPZA 4OOZA 2ABBA 2C79A 3ARSA 1TPB1 8A3HA 4E6MA 1R30A 3LUTA 1BGAA 4GQQA 1KR1A 3GIYA 2XPKA 3N2BA 4DJED 3TXVA 2E6YA 1X6UA 3ITTA 4H4IA 4W8LA 1XISA 4O13A 3KDNA 2E67A 5DT5A 4NNCA 4DJFC 4H2HA 2VUNA 3ONCA 4K8HA 3M44A 1NWTA 3W7JA 3WD2A 1V3HA 5HUOA 2E77A 1S2VA 5BXSA 1R2SA 2BWGA 1V02E 1OG0A 2Q02A 4PL1A 3COTA 1MW0A 3FXYA 3P62A 1T96A 2XIIA 4PMOA 4JS3A 3GIQA 1LG2A 1CNVA 4QCFA 1T5AA 2CU0A 3BLLA 1FWIC 2DZUA 3W22A 1O6IA 2X16A 3EWWA 1B3ZA 5HINA 2JKEA 4L4MA 3MUY1 2EJ1A 4HZ6A 2X2YA 1MQPA 3I4EA 4W7VA 3DFSA 2Z7KA 2EKCA 3AS1A 4OE7A 1Z42A 4H9XA 2HVMA 4HSOA 4CNPA 1TE1A 4IPIA 1WBJA 4ATWA 3GG8A 1ADOA 3DHDA 2E6DA 1OG6A 3NVDA 1QBAA 4GVGA 4W88A 2BVWA 4UFJA 1SO3A 3CH0A 5FIPA 4R3UA 1WKYA 3R13A 1KRMA 2Y5EA 3EDEA 4W86A 2QJNA 3FGCA 4L5ZA 3QV8A 1SVDA 1F6YA 4MB4A 2VGIA 1UR4A 3CUGA 1U33A 4H01A 4O14A 3MT1A 1QOQA 3DBPA 1R2TA 1OHLA 4GABA 2D69A 1KFKA 4BFAA 1TZ9A 3KDOA 5I3HA 4QROA 1IZKA 1XIFA 1BHGA 3W24A 2DUXA 1XLIA 1MWOA 3DHPA 5C71A 4DNMA 3R8RA 1VBUA 1KCXA 1F4HA 3IUDA 2DPEA 4JFSA 1SJDA 1GCYA 5DLCA 2I9EA 1TWWA 1S2TA 4MOZA 1CLKA 3M07A 4FB7A 4FA3A 3ZXWA 1JCTA 3KTCA 1GK8A 3BMVA 2POTA 3VIHA 2OR2A 2O4QA 1NWRA 2NW0A 4GIAA 1VHNA 3OLEA 3WF2A 3SADA 1LUCA 2WZMA 4X60A 2AQVA 3IVTA 1W9UA 1OT1A 4D9PA 5EMLA 4B5VA 1DOSA 2VEPA 3NYDA 4S3JA 2FB2A 2FHFA 2J6VA 5FD0A 3G0UA 3I7RA 4P7OA 1AH0A 3VINA 3PSVA 2OX1A 1EGMA 4Q4OA 3HV8A 1ISWA 4P8UA 1U1HA 3UR2A 4NX0A 1F8IA 3A4WA 3GYEA 4EXAA 7TIMA 2QUMA 2TODA 3HG3A 3HM7A 4QAIA 4D1IA 3OZPA 1NTHA 1XYCA 3WQEA 4LVAA 3VNZA 2Y7EA 1VENA 3QM3A 3V35A 3R7MA 4PBFA 1VCVA 3RR4A 3WG6A 2NVDA 1DP0A 4ZE5A 2J7DA 1JAKA 3V5FA 5ABEA 3HFYA 4N9EA 3GZ3A 4PMYA 3ES8A 1I0DA 3K8KA 3KBWA 1ZHAA 2HJPA 3WX7A 3DERA 4ZOAA 4A8RA 4HHLA 1XRSA 3IJ6A 1OEPA 4ZQNA 2DGAA 2DW6A 1N8FA 2ISDA 3WNOA 4S3FA 5D8ZA 4RE4A 3BICA 2XFWA 3GW0A 2OYKA 5EB8A 2FZDA 1OZQA 3UCDA 2VCAA 3A3XA 3OA5A 3H6OA 2PI6A 2C7FA 1SUXA 4XTDA 3M47A 3TQVA 6A3HA 2IPWA 3GWQA 4YTSA 3KOZA 3WLIA 4AY7A 3QTGA 1YXCA 3TUUA 1MXDA 2PU0A 1ODUA 1V0NA 2FJKA 3EB2A 3W86A 3V0SA 1OABA 3H54A 3VCCA 4JFVA 4RXGA 4DJEC 5FCZA 5AYXA 3LGGA 4H19A 2BS9A 2VCBA 3TWAA 1QTWA 4HZ7A 3DEQA 1FWSA 1E1FA 1ME9A 3G1AA 1RQBA 1UR3M 1Z89A 4XV0A 1W2PA 3WEZA 4AVFA 1GKRA 5GNZA 4ECLA 2IXVA 3TYEA 1XW8A 1WDQA 1UCWA 3I6RA 1E6PA 3PZTA 4CQ9A 3UESA 2X7WA 3FYOA 5A5WA 3N4FA 3S42A 1KNWA 5AYYA 4X61A 4XZIA 1EJRC 2RGLA 5B80A 1VRXA 3HB9A 5EY5A 4W8BA 4YXGA 2XFYA 2PGWA 3VABA 2A3AA 4AZ6A 2G3NA 4AEEA 3CHEA 1P4CA 2V63A 2OZ3A 1GOWA 1Q4WA 1KFWA 5A8NA 2G3IA 4UMBA 1JQVA 1N7KA 4NZ5A 1LLWA 1SM9A 2XIBA 3K2GA 3MHUA 2YIHA 1VFLA 1GYNA 3S1GA 1BSLA 4ZL1A 2GSEA 3GNRA 1BG9A 4S3CA 2BGNE 4Y9AA 3GTNA 1DQUA 1WV2A 1TQJA 2NV9A 4IUOA 1V08A 1EA0A 4YVPA 3H24A 1C91A 5LYRA 3OW1A 3MZNA 5M17A 1QU4A 2VOMA 3HQNA 3NPXA 4CD4A 4M7TA 3KL5A 4PTVA 2E6FA 1C29A 1V79A 2VFFA 2NLIA 4DLFA 3MMTA 1G6CA 3LZ5A 3PTDA 3L4UA 4QITA 3ZM8A 5G4HC 3VUPA 5EA9A 1OC6A 2EKGA 1M53A 3M5YA 1ONWA 1NFBA 3GZAA 3N6HA 3SFKA 2UBPC 5A2CA 3CQIA 4K2SA 5K9DA 4H9TA 1US2A 1Q66A 3IJDA 1OB0A 2AAAA 1TREA 2WLZA 4ERAA 4H9YA 4ERIA 2QDGA 1L6FA 4D6JA 3LXCA 4O12A 1OIFA 4DYEA 3EMCA 3DUGA 3QBUA 4NAFB 2QYGA 5DRCA 5LNRA 1T41A 4QX4A 3MP3A 2ZFAA 3Q4DA 3BG3A 1HL9A 2YA0A 3PPGA 4E8GA 4W85A 1ZUAX 2BY0A 4UQAA 1A0DA 3WSUA 1A5AA 3S6DA 4W5UA 4HMNA 4F3HA 1ZAHA 4MZ8A 3AMKA 3AUOA 3BG9A 4CNTA 3N2OA 4IQLA 3TR9A 6XIAA 3QW3A 2OWXA 5M03A 1H50A 4W9TA 3FA5A 2BOEX 2WZHA 2PF8A 1SU5A 1M7XA 2Z7GA 2QCMA 2CXGA 3KP1A 2CLHA 4DZ5A 5KZEA 5HNNA 1TE6A 4GZEA 3WQGA 4GUFA 3FJLA 5DXXA 3T8LA 1XGZA 2ZKMX 3BJSA 3M16A 2L5HA 5ECVA 2IXUA 2B7PA 1WOBA 2OOFA 4INFA 4L80A 3MVIA 1EIBA 3UG8A 1KM5A 3UG5A 4AIBA 1D7KA 1WAUA 3WLQA 3ITXA 3NPUA 1D7FA 3WJWA 1XC4A 3DC8A 5A6TC 4YN5A 4Q7BA 1QHPA 5IFTA 1K8YA 4OJYA 5A1AA 1NQ6A 1RR2A 5CPLA 5D09A 1FWBC 5E5CA 4A4AA 1I2RA 4W87A 2REQB 3VO0A 3U48A 3FJ6A 1PCWA 1PKLA 4JFTA 4IIDA 1XFCA 3M0JA 4LWWA 5G1YA 3BLPX 4L61A 3QYSA 3LM7A 1V4YA 1B9ZA 2WJDA 4MKSA 1Q7ZA 5IFPA 4WJEA 4PUJA 1OINA 4GLEA 3FS2A 3E0WA 3B05A 2J62A 1UHVA 1TZZA 4BQ2A 3ELFA 1AQFA 3K1GA 4GYKA 3FJNA 5G5IA 1FWEC 4A8LA 3OYZA 3S1XA 3TMLA 3OGVA 3CV2A 1HP5A 3IAQA 4PB4A 1ZBWA 3ALFA 5LGXA 3STCA 3WLTA 1DJIA 3IWPA 4JL1A 5AHFA 4Z42C 1J0IA 3GXFA 4NIRA 2OQYA 4FNPA 2VFHA 2VNCA 3SCPA 1HQTA 4G7EA 4OBRA 3HO8A 5GNYA 1PBGA 3PWGA 2GVEA 2E28A 2V3FA 3GY1A 4YYFA 4WK9A 3UYCA 3UPBA 1EX1A 2PDPA 2ZTKA 1AMKA 2PDBA 4HD5A 2R91A 4WY0F 2OO0A 1REQB 4W93A 3L2IA 2JALA 4LS0A 3PC0A 1G01A 1PUDA 3C86A 1GPWA 1P5BA 3QPYA 3K46A 3GS6A 2QVNA 2YCJA 4PL2A 7A3HA 1BYCA 2HNHA 4NILA 3AIVA 4REQA 4JCLA 2FLIA 3PZMA 3C8FA 1KXQA 4TIMA 1O1HA 4XBJA 1EP3A 4PCSA 1HX0A 2ZXDA 3NO3A 4CQAA 1B1YA 1OF6A 2PC4A 4UCFA 1A49A 5LNWA 2Y63A 4JFWA 5FSEC 3R8GA 3UR5A 3M0YA 1K9TA 4LTSA 2VYOA 3TR2A 4OFCA 3UJ2A 1XPGA 3HFTA 1FH9A 5EMYA 1M01A 2XFFA 1G4SA 4QRNA 1DVJA 1K9DA 4DM2A 4C7GA 3AYSA 1EJSC 1UH4A 4KT2A 3LTPA 4C6EA 4RNJA 3CPRA 2DDXA 1Q85A 3GXIA 1E15A 3PG9A 3UGVA 5B7YA 2VZOA 1C9WA 4I5RA 4LANA 5BW6A 3P3BA 4GNJA 3C2RA 4PEKA 4U2YA 3HQOA 1YE4A 3VOCA 4XWUA 3L2LA 2R82A 3VD5A 1J6OA 2A85A 1I4NA 3Q65A 3UZJA 4HCDA 1FBAA 5HMFA 4JX5A 3CAWA 1J10A 1CENA 2B7QA 4C91A 4HMDA 1OC7A 1ZRQA 2WHMA 1IGSA 2GOKA 4K38A 3ZR6A 1XLEA 2GSJA 1KWGA 1BVNP 1HL8A 3SI9A 3FLUA 2FGZA 3IVUA 3GAYA 3W4RA 4FXRA 3E0VA 1TKKA 1N8IA 3SUUA 1UKQA 4MJ4A 3HG4A 4IGMA 1U5HA 5AKQA 5C7VA 2YL5A 3CZJA 3EPNA 1XRTA 4KWSA 5J04A 5M5DA 1GQLA 1GVSA 3UXIA 4O1DA 2NWRA 4IJRA 4OT7A 2PDLA 2Y61A 3G1SA 4XZNX 5HWMA 1ICQA 4S23A 4AVOA 1EX5A 4JEQA 2Z1WA 1AJ0A 3GBDA 1CXLA 1SQ7A 4ACZA 5KZ6A 4PUEA 1V7AA 3RPDA 3IEBA 3WMCA 2I14A 4PRTA 3IUIA 1IGWA 4EX4A 5FF0A 3LPFA 3MC5A 4P7LA 4AZIA 4LUSA 3LLDA 4NYUA 1CGXA 3JRKA 2ZDSA 2ZA3A 4FF5A 1J79A 4LB3A 2HE5A 1XYFA 4DAIA 4HSHA 1DPMA 2Z1XA 3DFHA 2VM8A 4CQCA 4UTHA 4C6CA 4C90A 1BXNA 5CSRA 2BHUA 1YBQA 1H7NA 4LEFA 2G4JA 2VR4A 4Q7IA 2PWEA 3OBKA 3DG6A 3PBMA 4K3ZA 3QH2A 4Z0SA 1E73M 1KRBC 2EPOA 3NNTA 4I9AA 2D22A 3MJMA 3H4GA 1ZAIA 3LPOA 4I9TA 1TB3A 1EHAA 3TW7A 4M3PA 1FWHC 4YCPA 4S38A 1D8CA 1XIEA 1KQZA 4AD4A 1BGGA 1SO4A 4HHPA 2QCDB 4NRRA 3W7LA 1I1XA 3E02A 1XG3A 1A5KC 1S46A 4UFIA 1E6SM 3UD6A 4O53A 4F2TA 4UTFA 4IHCA 5BOOA 1LYXA 1Q6FA 2HS8A 1V0MA 1O5QA 3K4DA 1EC8A 1FDJA 3EOLA 3WUFA 3PN8A 4ZB2A 4O0QA 3H21A 1OWQA 4TOQA 3HPXA 5D2YA 5H91A 4G5DA 2FKPA 1QCWA 3RPMA 1PX8A 3BAWA 4KWVA 2Z26A 3IIOA 2XZ9A 1KBBA 2ZIDA 3FSUA 4PMVA 1KBIA 1FP9A 1YDOA 1SZRA 5FSDC 3ARPA 4JTTA 3WK2A 3RGTA 4BI7A 3WK0A 4BKNA 1OFBA 1BXCA 1A50A 4CGTA 1PE1A 4DF2A 4PCFA 2VR5A 4JZ5A 1EJ7L 4S3DA 1PWLA 3VZZA 1WB0A 2IKIA 4EAMA 1K77A 1QK0A 1LL4A 1TZ7A 4RDZA 2I57A 3IGSA 4YNGA 5E6YA 1P0BA 4OUEA 2MANA 4L56A 2DVXA 2V2CA 3MU7A 4J2MA 2J77A 1T0OA 3GUGA 4ADUA 4E2VA 1K7XA 2UY3A 5DMLA 2WPBA 1Y0EA 1E0WA 4JN6A 4ZSTA 2VHLA 3F5KA 1UH3A 3SW6A 1XBZA 3AHYA 4HT3A 4DN1A 4LH8A 3AU6A 2FZBA 1OYCA 5T9BG 3XINA 1K9EA 1BD0A 1AL7A 4TXEA 4XD3A 3L0NA 1FCQA 1J12A 3ARQA 3CQ0A 3FKRA 2CZ5A 3LOTA 1TUFA 3N2MA 3N34A 4MYXA 4O10A 1H2JA 5A8GA 4HNOA 2BHYA 2VGGA 4B5SA 2IPGA 2IQDA 1X96A 2AOSA 4LVBA 3PZGA 3DHUA 2D24A 1E56A 2JGYA 2HXTA 1YE6A 2G8ZA 3VYLA 1W32A 3LBCA 2O9RA 1D8WA 3VD3A 3LRLA 2WSPA 3KVLA 4RZ6A 4WUIA 1AA1B 3KVJA 4PTWA 3O0FA 3QF0A 3P74A 2BXZA 4R34A 2DSUA 4J3WA 3NURA 1CGTA 3U2ZA 4IUGA 3FV9A 1RPXA 3PJUA 4L1WA 3TYAA 1NDVA 1VFOA 2ZXQA 3P67A 3P5ZA 3T0TA 2B7OA 3W7MA 1EWDA 3L65A 3OODA 5A69A 3S3GA 4D2JA 2UY5A 4MB3A 3VNLA 2VFDA 4HZ8A 1VPQA 3BV7A 4E2OA 1S5WA 4QQUA 3LSBA 4S3BA 1UBPC 4XAZA 1OCQA 4R7JA 3TZNA 2HVOA 3CQKA 4W84A 4J3SA 4UOZA 4AMAA 2PDXA 3CGTA 1AG1O 2E4TA 4QJ5B 6TIMA 4HMEA 1X97A 3FYYA 4TR9A 4HA1A 1UZDA 1BF6A 4P7RA 1F3TA 1B0IA 4LUTB 1DJXA 4GGHA 3IVSA 2XVPA 1EO5A 4US5D 4LUIA 3CMJA 3V16A 2JIEA 3WK1A 1JGMA 2PAJA 1S38A 1L2UA 3H4WA 3N73A 4HJFA 1NFGA 2X42A 2VZVA 2CW6A 4DUXA 1FVPA 3WF1A 2BSLA 3NIYA 3LHYA 3LLXA 2WSYA 3VVGA 4HA0A 2XH0A 4JAWA 3JZUA 1GJUA 1OCNA 3WLNA 1QNSA 3O6DA 2OSXA 2QULA 3WD3A 5HNUA 3EMZA 5JU6A 1XQLA 4A29A 3T81A 1IWBA 3WBEA 2G97A 4MNJA 4GI8A 1C90A 1O95A 1TV5A 2V69A 4ZZ9A 1ONEA 3CEPA 2FPVA 4PMDA 2EF9A 4CVUA 3C5QA 5EMKA 5TD4A 4XD6A 3BAIA 1QPRA 3M0LA 4LNYA 1TUXA 3CUJA 5C9WA 4JNZA 4IG2A 4PCNA 3C4UA 3VOIA 2CPUA 3BW2A 3ITYA 2X0YA 3E2RA 4Y8FA 2AMXA 1LWJA 4XKYA 2OKTA 3FKKA 3BANA 1TPDA 1W0MA 2AL2B 2Q3OA 3TLQA 3IARA 4XO6A 1VFHA 3EB3A 1RXOB 5LGZA 1FWRA 4Y90A 1H51A 2HDJA 1JPIA 1R9YA 3POCA 4Q7NA 1LLOA 3SUVA 1Q2SA 4KCTA 4IFOA 4BK9A 2H8XA 2VJXA 1UR1A 5ABGA 4TVUA 1WUFA 2E6AA 4IFKA 4MNKA 3CK5A 1Z9AA 2UV8G 3GQYA 4X22A 4EXQA 1V51A 3OZMA 1XBYA 4ZVJA 3F2BA 4M6QA 1UIOA 3FIGA 4ILSA 3B0XA 3MCOA 2J7GA 2ZA1A 4YHGA 3JUGA 3AJXA 1PEZA 1WYIA 2GWNA 4GIRA 4LXFA 4GXWA 6ENLA 4IOTA 3FCPA 4PUUA 3R4IA 1DHPA 4PH6A 2VX5A 1R7OA 3THAA 3AHXA 3NO1A 1QUMA 3E96A 5DCEA 3N3MA 1E70M 3AROA 1ZJIA 2WBGA 2VRKA 2Q71A 1HG3A 3GD6A 4WSHA 1LM1A 2O7QA 3W28A 3AAMA 5LHEA 3UCCA 3ZFHA 1HFBA 4HMCA 3IJ7A 3KP0A 3TC7A 4N6EA 3GVVA 1JZ7A 1POJA 3M0IA 4NI3A 3USZA 4NJJA 1HUVA 3W27A 1MEIA 3GXDA 4QG9A 1X6NA 3KL3A 3W26A 4AZCB 4LALA 4B3KA 4IQJA 4M0XA 1GHRA 1X39A 5FL1A 1C8VA 5J5RA 2R1MA 3UJSA 2F9RA 1VJSA 1UC4A 2A6LA 3MBFA 3VZYA 1QNQA 3VNDA 3QMTA 5HOSA 3N18A 4K7YA 1OX5A 2OWWA 1CGYA 4LY8A 4XVEA 4LUJA 3ZVHA 5BWAA 3BOLA 3T09A 3TONA 1VEOA 3BCDA 3LU2A 4LV4A 3QR1A 3THQA 2WHJA 5I3FA 2QPXA 4GPNA 4XKMA 4FNQA 3AIUA 1ZFJA 4TMBA 5IDIA 2ZOXA 1V93A 4LS2A 3A9IA 1PZ0A 4P7QA 2A7RA 4YJ5A 4MJ2A 4ZOCA 5EYWA 2XWDA 1KM6A 3I3BA 3M0ZA 4GWEA 4GJIA 5LIKX 5F2GA 1XDLA 1IXOA 1U83A 3NQ8A 1E0XA 3DI1A 5G2IA 4H6KA 4AHPA 4FLSA 3ITGA 3ABSA 1TVNA 2FPYA 3S2JA 1MUWA 3H70A 4FLOA 1VEPA 3NL5A 3L66A 4AYGA 2CWNA 3RAOA 3C0JA 3QOKA 2FVLA 4KESA 1DJHA 1OX4B 1EUNA 1A5NC 1U2YA 3LN3A 3PNUA 3QV7A 1JDEA 3C52A 3GK0A 3SRFA 5M3WA 1PDYA 3WQDA 3R8HA 3NQAA 4K1GA 2QCHA 4IP4A 4Z1YA 4Q8UA 1LP6A 2WCAA 5XINA 1NFPA 1TO3A 1HO4A 4LU0A 9CGTA 1MNSA 1JYVA 5BXTA 1M1BA 4G2DA 1CXEA 4IPJA 3W2KA 4E2DA 2PWHA 3EGJA 4E4UA 3MKKA 3LMZA 3CV7A 4GZ7A 3ZQ9A 3O6AA 2WC7A 2CLKA 4Q8QA 3ZJKA 3GG0A 4CNNA 2H9AB 1QVBA 1FDZA 2WV8A 1MSSA 2XHYA 3S9ZA 1G5AA 4KMQA