1K03A

Crystal structure of old yellow enzyme mutant gln114asn complexed with para-hydroxy benzaldehyde
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
399
structure length
399
Chain Sequence
b'SFVKDFKPQALGDTNLFKPIKIGNNELLHRAVIPPLTRMRALHPGNIPNRDWAVEYYTQRAQRPGTMIITEGAFISPQAGGYDNAPGVWSEEQMVEWTKIFNAIHEKKSFVWVNLWVLGWAAFPDNLARDGLRYDSASDNVFMDAEQEAKAKKANNPQHSLTKDEIKQYIKEYVQAAKNSIAAGADGVEIHSANGYLLNQFLDPHSNTRTDEYGGSIENRARFTLEVVDALVEAIGHEKVGLRLSPYGVFNSMSGGAETGIVAQYAYVAGELEKRAKAGKRLAFVHLVEPRVTNPFLTEGEGEYEGGSNDFVYSIWKGPVIRAGNFALHPEVVREEVKDKRTLIGYGRFFISNPDLVDRLEKGLPLNKYDRDTFYQMSAHGYIDYPTYEEALKLGWDKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADPH DEHYDROGENASE 1
publication title The role of glutamine 114 in old yellow enzyme
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
total genus 145
structure length 399
sequence length 399
ec nomenclature ec 1.6.99.1: NADPH dehydrogenase.
pdb deposition date 2001-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1k03A00
3KAOA 3USBA 3W86A 4LS2A 5I3HA 5DN1A 3N9RA 1QPOA 1SZEA 2ZRYA 3O8AA 4O57A 2EPHA 3PC0A 4M7TA 2OT0A 3CQ0A 4WY0A 4IPJA 2GVJA 4EVZA 2OX1A 3NQMA 4YCOA 2QCHA 3N9SA 4E38A 4POCA 1ICSA 4X3ZA 1XBVA 2CZ5A 4DBEA 2CLLA 3DAQA 3IIVA 4JTTA 4O54A 3CIXA 2I14A 3WK2A 1W37A 1GYNA 4RK8A 4JY8A 1JULA 1UUMA 3G3MA 2QCEA 3E02A 3W1AA 4LVGA 4ML9A 4JTEA 1VCFA 2A7RA 1EP1A 2P1FA 3MP5A 4GUGA 1JVNA 1I2PA 2ZFAA 4JIPA 3TE9A 2TPSA 5BOOA 4Y90A 2EKCA 1G7UA 4FHAA 5G1YA 4LV4A 4G1KA 3W7GA 3C3NA 3W1QA 3M47A 3HF3A 3R89A 4UTMA 2QUTA 3U6WA 3N2MA 1EX5A 2ZA1A 2E1DA 4ZQNA 1QOQA 3NL3A 4R33A 1EP3A 3V1PA 1R2SA 4JICA 1FWTA 3S5OA 4WUIA 5HR7A 4JTGA 1YPFA 3MBDA 1L2UA 1VHNA 1JCJA 5G2IA 1XUZA 1XM3A 4LS0A 3NNTA 4WQ6A 2A2IA 2ISVA 4EIVA 3ABQA 3TIMA 1MXSA 4IUOA 1ML1A 1WX0A 2NUXA 2FFCA 4LTSA 4DEFA 4ORIA 3PY2A 3L0GA 1ZNNA 2FPTA 3NO5A 1LOQA 4MIMA 2V2CA 1EUNA 4QIUA 1MEHA 3DI1A 3GDMA 4R53A 3O6DA 1HTIA 5IBXC 3FS2A 2JGYA 2EAWA 5D2YA 4HNVA 2GVGA 3KX6A 5K3VA 2TSYA 1JUKA 2CLHA 1T8XA 4XWUA 3HGSA 3L9CA 3H54A 3W1PA 2ZZ4A 4OHQA 2VFDA 1R46A 4JYDA 5CGQA 1KTNA 4DF0A 1KW1A 3FKKA 5LNRA 3AJXA 3I7SA 2W6RA 3W6YA 5G1TA 3W7CA 1I45A 2EHHA 3NQFA 3W84A 2CZDA 2RHGA 2EGZA 4WXZA 4FX8A 3M5VA 2FLIA 4JXCA 2QCLA 5C55A 3TSDA 3LTSA 1LRNA 4XUGA 1GEQA 2TYSA 1ZALA 2XN1A 4GRSA 4GUIA 1X6UA 4FX6M 3GNDA 4JX4A 4O4WA 1X7FA 1ME8A 3PUOA 1T96A 2YPIA 4ALDA 1TMHA 1KTBA 1LLZA 4CNOA 3TAKA 4YLWA 3MYPA 3NPUA 2Y7GA 1L6WA 3C4UA 1GPWA 1Q3NA 1TV8A 3NYZA 2LLEA 3L68A 3T55A 4Q33A 4UNLA 4D2JA 2CLKA 1FQ0A 1SFJA 2PRMA 3W71A 4FF7A 4O12A 4UTUA 3NDOA 2O7SA 1GYLA 4L4LA 1OK6A 3W2UA 1W54A 4MVAA 3EX1A 4IMGA 1TPVA 3TJLA 2B7NA 4Y6GA 5KITA 3TW6A 1MO0A 3EEGA 2JKEA 1KM3A 4RLIA 1XDMA 3L21A 2GUUA 3DFOA 4Z1CA 5LNWA 3KRSA 2B0MA 3MO7A 3MI2A 3DU0A 4A22A 3LXAA 4WXYA 1LROA 2VEKA 2VELA 3MHUA 3DENA 5G2HA 3QMSA 1MZHA 2HMCA 1OYAA 1F5ZA 3F4NA 1N7KA 5CZJA 2ZDRA 1NAL1 4M5PA 3GK0A 5CKSA 2CLFA 3PAJA 5D2XA 2BLEA 1XC4A 1LDCA 4OV4A 5FF2A 1AW5A 4Q32A 2QAPA 2X1TA 3LCGA 3HQ1A 4CQ9A 1B3OA 2ABAA 4GBUA 5AHEA 1RQBA 2NX1A 2PURA 5EPDA 4LC8A 5CPOA 5F2GA 3W1MA 1FXQA 1OF8A 2WOQA 1VLWA 3G18A 2Q3RA 3EX4A 1YYAA 3G1VA 1A5BA 1FUYA 2QJIA 5I3IA 1VCVA 6ALDA 2F7FA 2GQ9A 1XKYA 5G5IA 2BZNA 4FNTA 4RXFA 4JTUA 3CC1A 3ABOA 1O95A 2FPYA 2RH9A 1H61A 1SW3A 1FDJA 2ZZ2A 4WOQA 1GG0A 2IQTA 2Y85A 1JCLA 3W7DA 3HOJA 4GXMA 4K7YA 3THAA 1Q6LA 3Q58A 3T4CA 4NUWA 3FLUA 1F7BA 2GQ8A 5G4WA 1Z42A 2ABBA 5FEXA 5HR6A 4O16A 1YDOA 2C6QA 3G0UA 3IRDA 3P60A 1VGAA 1OHLA 3UZ5A 4BI6A 1QO2A 5BMXA 1Z41A 3BG5A 3L66A 2G96A 3DFSA 1AG1O 4HNNA 3QYQA 5E0KA 3NQCA 1PIIA 3S9YA 4UUIA 4DELA 1RD5A 1CI1A 1JCMP 3WJWA 5K2ZA 4MYXA 3P80A 4FXRA 5D2TA 4CCDA 3KOFA 1QWGA 1AL8A 5EY5A 3W2MA 1WBHA 3LM7A 5DY2A 4NXKA 1H5YA 1JCNA 3EWYA 4O1CA 1F76A 4KWVA 2FQIA 2H90A 2J88A 3BG3A 3F1QA 3UXDA 3TSBA 1YADA 2WNZA 1IXOA 1KFJA 5AOUA 3C2EA 3DKLA 1JUBA 3O15A 1C8VA 1OABA 5K4ZA 3HPXA 1QNVA 3W2LA 3PBVA 5LGXA 1V7YA 1KM2A 1OX4B 1T0OA 4M6PA 1PE1A 1O5XA 1QR7A 2A7NA 3C6CA 1O60A 4XKYB 4BWLA 3PWAA 4OT7A 5AFDA 1BWLA 3F03K 3G1DA 3NVTA 5F2LA 1VH7A 4GUHA 1RR2A 1V5XA 1B4EA 3WJSA 1ZFJA 1OFOA 3RF9A 5DY3A 3ZS4A 3NA8A 4HIBA 1JUEA 1YXCA 5CPNA 4IMEA 4PTNA 3C2FA 1WOBA 3LI0A 1GOXA 5FF3A 4RJEA 4MPQA 1F6PA 4X22A 4Y9AA 4ZQOA 2YX0A 3INPA 5DXXA 3RLVA 3LTPA 3TKFA 1JRBA 1XBYA 2GJNA 3IVTA 1NF7A 1RV8A 2QCGA 2QJHA 3S8HA 3Q37A 1P0NA 4QSHA 4Q4KA 4K39A 5J5RA 5I3JA 1KM1A 2P10A 3OVPA 2E5DA 2VFEA 3EXSA 3GDKA 4QITA 5FF7A 4B5NA 5D09A 3HG5A 4IMDA 4MY9A 2E6YA 4O52A 2DZUA 4OQVA 5DBUA 3HGOA 1L6YA 1Z48A 5AC6A 1ALDA 3UNDA 2X16A 2YYUA 1O4UA 3W1NA 4HPJA 2J9XA 3KVLA 5AC7A 3W83A 3W22A 4ADSA 1A50A 2J9YA 3ZFHA 1H7NA 5A8GA 1GWJA 3BLIA 4P61A 4N6FA 3CEPA 1I2QA 1ZAJA 1WDWA 4S2CA 5LHEA 1DORA 5K9XA 1YTEA 3ANYA 5EL1A 1MEIA 4MFDA 3DHFA 3G1HA 3TC6A 4IMFA 3A9IA 2E5BA 5AYXA 4GE8A 2E6FA 2QEZA 2ALDA 5BW6A 2V5LA 2V8ZA 4JEQA 1EUAA 4DO4A 3NPXA 4O1DA 4RR4A 2FB3A 1LP6A 3IGUA 1LRQA 1TV5A 4NNBA 1OFEA 3EX6A 2QCNA 3S1UA 1M7PA 1TJRA 3W7NA 1OJXA 1GVQA 3CIWA 1K8ZA 1A5SA 3G8RA 2NXGA 3W72A 3TROA 3T7VA 5AN7A 4NU7A 5CSSA 5F2IA 1W5NA 3T78A 3QC3A 2ZZ5A 5U4NA 4IX2A 3P5YA 4QM1A 2A21A 2XN2A 1W5OA 4H4IA 1RZMA 4UTWA 5D03A 4K7VA 4UNKA 1D9EA 4TR9A 1K7EA 3NPWA 4LC6A 2VEPA 3GKAA 1M6JA 2V0TA 2NWSA 4XTIA 3HGRA 3DZ1A 1Q6RA 4O13A 1G67A 2RFGA 3GAYA 3N19B 4UCGA 3QF0A 1PV8A 3L0NA 5CSRA 3SECA 3CWNA 1YLVA 1FWWA 1VYPX 1WQ5A 1FWSA 3UWYA 5ABTA 4JDBA 3QSTA 4O0KA 3TUUA 5D37A 3GXNA 4K36A 2WSRA 8TIMA 5HUPA 3M5ZA 5H2ZA 1OX4A 1W31A 4NJHA 3BO9A 4MLJA 5DLCA 4XKYA 3GDLA 4NQ1A 1DVJA 3GAKA 5D32A 3BG9A 2DZWA 2C15A 3PM6A 4WJEA 4NJIA 3PUEA 5HJLA 1DOSA 1X8FA 4KFPA 1TIMA 1QPRA 4O4VA 4ADTA 1UB3A 3W3OA 1IXNA 4O8RA 4K8HA 3BVJA 3IVUA 5BMWA 4JDYA 4N4PA 2A6NA 3OG3A 1H60A 4AEOA 1TPWA 2YFNA 5KINA 2QAFA 3I7RA 3LRLA 4JTSA 4IXHA 1IXQA 4NZJA 4O28A 4JS3A 3IIOA 3YPIA 3HBLA 4A21A 2ZA2A 1NFBA 3LV5A 1KA9F 2NV2A 1PVNA 2VEMA 3P62A 1ONRA 5IM51 2VXNA 2QCDB 3G8EA 4I7VA 4ZQPA 4O10A 5EA9A 4QJ1A 3LGEA 1J2WA 5KZEA 1TPDA 5FEPA 3TR2A 1OFAA 5F2MA 3R12A 3HPZA 3B8DA 3GDTA 1SW7A 1W1ZA 3G22A 4EF9A 5D2VA 1TV7A 4DF2A 2DZXA 4A29A 4JTJA 1G4PA 2NV1A 3U2OA 4LUIA 2VENA 4M7SA 5KSWA 3UY8A 2V2HA 3N73A 4PFMA 3LX9A 4UIOA 1RQEA 3TMLA 4JTFA 1QPNA 3LHTA 4BWLC 1BEUA 3UQNA 2DZPA 3NZ1A 1DV7A 4ADUA 3T40A 1WXJA 4OU1A 4IOTA 2PRHA 3EXTA 1EEPA 3CT7A 4AXKA 1PHQA 5LGZA 2B4GA 4ONVA 7TIMA 4NT0A 2RDWA 3GR7A 2YR1A 4A2SA 3EX3A 2A1YA 3G1AA 2Y89A 3NQ6A 1GQNA 4IXXA 4UTTA 4LY8A 1RVGA 2V2DA 2CLMA 2H3DA 2NUWA 3LHZA 2V30A 1BTMA 3PR2A 3W7QA 3W7MA 4AB4A 2HS6A 3GYEA 4NX5A 4JN6A 2XN0A 4DXVA 3G24A 1HFBA 1D3GA 3LCXA 3DFPA 4O0ZA 3OVRA 3NR0A 3JRKA 2V9DA 3KXQA 1OVDA 3TFCA 2FDSA 2C0AA 4BFAA 3KVMA 1KFEA 4CNNA 1HO4A 3EWBX 3P84A 1R47A 1YPIA 3LHWA 2DU2A 3OHIA 3NG3A 3B04A 3PS7A 2Z6JA 3W7RA 1P4CA 1NF0A 3IIPA 2TRSA 4OBTA 3W7EA 4UR7A 4S1FA 1FDZA 4PH6A 4GWEA 1GVOA 4UFMA 3WK0A 1GVSA 1G4SA 2E6DA 3R2GA 5DXYA 4O53A 3THQA 1YDNA 5E93A 4QQ3A 1JR1A 3LLFA 3ABRA 3O1NA 4E2DA 3KRZA 1M7OA 2Z6IA 4UMBA 2KZHA 4JGDA 3TDFA 4HN4A 2Y70A 3TU9A 2ZTJA 3NL2A 1TPB1 2BX7A 3TC7A 1MEWA 1NEYA 1EIXA 1KFKA 1OX6A 4KWWA 1SSDA 3TSMA 3W85A 3V75A 1F2JA 3LCWA 3MW7A 4OV9A 5F1UA 4P2VA 3W7HA 5LZLA 3IIXA 4UMCA 4FNQA 3NQ8A 2WO5A 3HG2A 4RXGA 2BTMA 1PS9A 1ZHAA 3IEBA 3ZWSA 1RPXA 3HG4A 1A5AA 2VFHA 2C13A 1PL9A 3A23A 1TQJA 2NLIA 1W3TA 4O50A 3LBCA 4LVFA 2DORA 3W87A 4CQAA 1T99A 4CCEA 1AL7A 2VFIA 3NM3A 1G6CA 5GVJA 1KFCA 1H63A 3DFQA 4RV8A 5G4EA 4KFOA 4PCFA 1QMLA 3RNDA 2E5CA 5HULA 2J9ZA 4LV9A 3DKJA 4L4MA 4CCCA 3DFTA 2NWRA 4QISA 3UWQA 4AHPA 4RCXA 2ZZ3A 2D73A 1IIHA 1IGSA 5C2XA 1XBXA 2DJLA 3GVGA 3STFA 1EP2A 1R2TA 5LNUA 1K03A 5AYZA 2JBMA 3GZ3A 1SZNA 5I3GA 2H8ZA 3QZEA 5EKYA 5TBOA 2NUYA 4R34A 3QSRA 3NQEA 4ICNA 1X1OA 3M6YA 3PF3A 3BARA 5HWMA 2ZRXA 4XBSA 3LHYA 3FFSA 1SO6A 3RMJA 3HG3A 3S1WA 1W0MA 1VS1A 3G0SA 2NXHA 4Z0JA 1PHWA 1MSSA 1I4NA 4UFLA 4Z08A 4LS1A 2Y62A 3MUXA 2CWNA 1K7FA 4AVFA 3NQDA 3A24A 2ZBTA 3QPZA 3WJZA 4XZ9A 2HSAA 3UPBA 1W5PA 3O07A 4KFNA 4PC8A 3W1RA 1SO5A 4O14A 2TMDA 2QDGA 4N9BA 4CNPA 3BLEA 2CW6A 5A5WA 3E96A 1A53A 4WZHA 4TIMA 3W7IA 3FJLA 1VZWA 1CW2A 1TPH1 3QQ1A 5CPMA 4JNMA 1H62A 4PA8A 1XCFA 3W73A 1DL3A 1BKSA 5E1QA 4WD0A 4RZ5A 1R2RA 5F4XA 4O1AA 5EMUA 3KVJA 1KBJA 2V5BA 1WOAA 1SFLA 1W3IA 4MZ8A 1SO4A 2VFGA 3STEA 1C29A 3AO0A 2OT1A 3UWWA 5LHFA 5AHLA 4RZ6A 3DFNA 2Y7EA 2NZLA 3NL5A 2R91A 3IGXA 2VKZG 1JJKA 3B0PA 1WBJA 5AHIA 3PBUA 2Y61A 2ZZ7A 3L5LA 1XBZA 3HB9A 3MHFA 5CZ0A 3CWOX 1Y0EA 4FNUA 1OYCA 4UR8A 4QNEA 3VNDA 1H1YA 2B7OA 4LRTA 2I1OA 1PCWA 3H53A 3ZWTA 3A5FA 1OF6A 4I7WA 3CEUA 4LOCA 1J5TA 3VI2A 2QF7A 2RKXA 1UASA 1TQXA 3UWUA 4AF0B 1H7WA 3Q2DA 3GLCA 3PUDA 1LTDA 3BW4A 4O15A 3NPVA 2RDUA 3EWZA 2I9EA 2ZRZA 1XUUA 3ZR4A 1VHCA 2A85A 1FCVA 2HTMA 1U83A 4PL2A 3NQVA 3GX9A 1KM4A 3QMRA 1VCGA 4E0CA 4OE7A 1F74A 1LCOA 4HSOA 1ICQA 4UTTC 1IXPA 1QO5A 3HMJG 1P5BA 3BLFA 2YYTA 4K37A 5H91A 2QUUA 2C19A 4N9EA 3LLDA 1FCBA 5HWNA 2H6RA 1LBLA 2QDHA 1LLWA 4J9JA 4JTHA 5U7SA 4UC5A 3MP4A 2CZFA 4A3UA 5BRBA 1SW0A 5LNVA 2AAMA 2Z2UA 3W9ZA 1P0KA 1QAPA 1LYXA 2QR6A 4K38A 4FX7A 4DBDA 3P74A 3L5AA 5DCBA 3S5ZA 4EWND 1OX5A 1KM6A 3VE7A 4UFKA 3VKJA 3UPWA 4N6EA 2PE4A 3DHDA 4CLMA 4ZQCA 4N4QA 3IV3A 1YTKA 2GPTA 3ATZA 4DQWA 1E51A 3E12A 4LW7A 1OG0A 4YMZA 1GTEA 3SFKA 3FA5A 4CQ8A 3PG8A 2E09A 4HNUA 5KZDA 3PBYA 4JR5A 2BWGA 1G4EA 3O6YX 4Z1BA 2NXIA 3GB6A 3SGUA 4OGZA 1TPC1 2FJKA 2UV8G 4BR1A 4WY0F 2JKAA 3SY5A 1OFRA 2QJGA 3W7OA 3B0VC 3MJYA 5FEZA 1QFEA 2CLEA 4MKNA 3L5MA 1OK4A 4U28A 4MYAA 3P81A 1SSGA 2Y7FA 3M7WA 4UMAA 1SZFA 3PSVA 1H7PA 1ZAHA 4H6KA 1DKWA 4MZYA 3QH2A 3BW3A 1HG3A 3SI9A 5D30A 3W75A 3NGJA 4LVDA 1SQ7A 3NM1A 4U4MA 3C61A 4QAIA 4UTLA 5I3KA 4NNAA 2A4AA 5D04C 1DBTA 2C3ZA 1GVRA 5DCDA 3RLUA 3MP3A 4MY1A 4EF8A 1TPEA 3IGSA 3G0XA 1C9DA 5CPLA 1HL2A 4QNWA 3TXVA 2FIQA 3TFXA 1TPUA 4IPIA 4WOZA 5LKYA 5AHMA 2QCCA 3S6DA 1RQHA 3NEVA 5CG7A 1FXPA 1FWNA 3W88A 3ATYA 2E68A 1LOSA 2C18A 3A21A 2ZA3A 2OCZA 1M5WA 3SGZA 4UTJA 3W76A 1TO3A 1IIGA 1Q45A 1R30A 1UJPA 4FNSA 3BGJA 3C56A 1VPXA 5K9DA 1ME7A 5LNSA 1K8YA 2Y7DA 3U8GA 3TQ0A 5FEWA 1XXXA 4JYFA 3W2JA 3S1VA 1AW1A 4AF0A 1WV2A 2GQAA 2R8WA 3MI3A 5HNRA 3GNNA 2YFOA 1KV8A 5D2WA 1D3HA 3MI6A 1FWRA 3JS3A 3LTYA 3S5YA 4MUZA 3W2KA 1FY6A 4W9TA 4N02A 3PG9A 3TV8A 1JCYA 2ZZ1A 1IF2A 3P5ZA 3OVQA 3NL6A 1AMKA 1H51A 3NQAA 3RK8A 3Q94A 4N2YA 3C0JA 2V81A 5F4WA 1ZJIA 3NAVA 3LV6A 1CX9A 4M19A 5D33A 1B57A 4PODA 2W79A 4O11A 4Y8FA 5EBUA 3WJXA 4M6QA 4RX0A 1EWDA 5CZTA 4LUJA 3KVKA 3N34A 4UTIA 2ZZ6A 1I2NA 3TNOA 1VJIA 1FCQA 1TRDA 2A0NA 1AK5A 5FI8A 1U5JA 1JCXA 1P1XA 1YDVA 2YZRA 3UYCA 3SR7A 4O18A 1JRCA 2AQWA 2WSQA 3LDVA 1W3NA 1W5QA 1GZGA 2EF9A 1DQXA 3OIXA 3TX9A 3C2RA 3QPYA 5G2WA 3W7JA 1WA3A 2Q3OA 3QQ0A 1Q6OA 1TTPA 1KLZA 4JIQA 5AYYA 1SU5A 5HMSA 3GKFA 4LU0A 3A22A 1SUXA 1F73A 4JX5A 1JQVA 2C14A 3NZRA 1LOLA 3E49A 1YXDA 5MHBA 2E6AA 1WAUA 4IQLA 2DP3A 3W1LA 3W7PA 2F84A 3TQKA 3NOEA 4JY9A 5I3FA 2ZRWA 2X1RA 2W0UA 1LM1A 2R94A 2ZTKA 3K30A 3C8FA 4ZZ9A 3FOKA 1F6KA 3LB0A 2VEIA 3OA3A 3PSWA 3LXBA 4AHQA 1QCWA 1TJPA 4Y96A 1EB3A 5HINA 3B05A 3PBWA 1VLIA 2C16A 4BI5A 4LVAA 1ICPA 2ZYFA 2ISSA 4UFHA 2CFFA 4MZ1A 2ZRVA 4WX2A 1TRIA 4BK9A 3DBPA 4HHPA 2JK2A 2P0OA 3LHUA 1LZOA 2QUVA 3L2IA 1VQTA 1H7OA 1S5WA 2E77A 1L9WA 3ELFA 5EYWA 3TA6A 3SZ8A 2X2GA 4A2RA 3EB2A 1OFPA 1GVFA 2B7QA 1UCWA 2H8XA 1W5MA 4BF9A 5HQEA 2YGYA 2G5WA 1H1ZA 3QW4B 3I65A 3HIJA 4TX9A 1TPFA 1KTCA 4MJMA 3S0CA 3EKZA 1QOPA 3CPRA 4R7JA 4ZQMA 3P67A 3BPWA 3VFLA 4OWGA 1N55A 1TTIA 3QM3A 5BNKA 3BK0A 1H50A 4GUFA 5C6MA 2WKJA 3BV4A 1W8SA 1ME9A 1KLYA 5CZSA 2G97A 4AMAA 3BGGA 3W07A 3TH6A 3M43A 3DI0A 4GJ1A 3I6RA 2XFWA 1KBIA 3NQ7A 3P61A 1G69A 1THFD 4Z0SA 3LRMA 2QCFA 3L65A 1G7VA 3R8RA 5KTLA 3I7QA 2WQPA 3P82A 2WNQA 2CZEA 2CLIA 4UFIA 1K02A 3QEZA 3TXZA 2WV8A 2ZQ0A 2DJXA 1KFBA 3HPSA 4X9SA 3LERA 3M41A 2BSLA 4YWIA 4UTWC 2Y88A 1GT8A 5AB3A 3LCIA 5AHFA 1GG1A 1ZENA 1I2OA 3M0ZA 3LXCA 4JTIA 4UXDA 4I9AA 2JKPA 2X1UA 1S3HA 1XL9A 1DJQA 2QCDA 4MOZA 2ATSA 3QJAA 4PL1A 3C52A 3KFTA 4GC4A 1FCUA 1GJPA 1N8FA 1DHPA 3VCRA 5K9CA 4FNRA 3DGRA 1KV5A 3LI1A 3W1UA 1TSIA 4HKPA 3O16A 3SIZA 4N9DA 3W70A 3L0KA 5SWUA 2DZVA 5DELA 2J27A 4NX0A 2DZSA 1OYBA 4NXSA 4DF1A 2VFFA 3I68A 3JR2A 3DH7A 1B9BA 1NSJA 3N14A 4ZMGA 3SW6A 3L67A 3TK7A 2A7PA 3CHVA 2HS8A 2R14A 3NQ2A 3RU6A 3FKRA 5AHNA 2YXGA 4JYEA 3E9AA 3MWAA 4NJGA 5L9FA 3LRKA 2Y63A 4AAJA 1Q6QA 2WSYA 4LRSA 3FYOA 4FNPA 4PEKA 3WFAA 2YDAA 3PVFA 4IMCA 3LOTA 4HSNA 4MFEA 3KRUA 3FEMA 3CLMA 2CU0A 4MJZA 4N9CA 1O94A 4DO6A 3QMTA 5HWJA 3GXTA 4MLRA 3SSJA 2NX3A 4NVTA 2B7PA 4IJBA 3O6CA 3SJ3A 1OFBA 4GUJA 1KM0A 2ZRUA 3TMQA 3LCLA 2QKFA 3VE9A 4HNTA 5HUOA 3EWXA 2X1SA 4HPXA 3W1XA 2YSWA 4ZVJA 1VYRA 3M44A 1L6SA 4FB7A 1J4EA 4UFJA 1W56A 3CB8A 4IWWA 4JX6A 1LBMA 4JTKA 1Z44A 3N2XA 4FEZA 5D02A 3GR8A 4AH7A 4GNJA 1AW2A 3CU2A 5AC8A 3UY7A 4LWWA 2Q8LA 1JQXA 2WNNA 1WYIA 2PCQA 4AWSA 1XI3A 2CLOA 3O63A 2OMAA 2ISWA 1XDLA 5DCEA 1BWKA 1GTHA 2GJLA 1HO1A 3P8IA 2JGQA 4LNYA 4Z1DA 3E0IA 4DPQA 2Y6ZA 4FIQA 3P8JA 3M5XA 4MY8A 1TCDA 1VRDA 3G1XA 3H55A 4WY0B 3FJ6A 3HGJA 4YL2A 2YW4A 1SZGA 4DPPA 3LHVA 1EWEA 4EOUA 2GVLA 4O17A 4ZL1A 1O5KA 2WJZA 2G95A 5IBXA 1UBSA 3R13A 2AGKA 1EA0A 1LBFA 3GIYA 3B0UX 3G1YA 1FX6A 4FXSA 3PULA 3IIZA 3MHGA 4XTDA 4AWUA 5D38A 3MBFA 2ZCGA 3PB2A 4LT9A 4RZ4A 1YTDA 1S5VA 3W74A 5F1VA 3UZJA 4UTKA 3LBMA 4RKAA 4TMBA 6TIMA 1K8XA 5KZMA 1QDSA 3B06A 3CM4A 4NZFA 3LCFA 3WJYA 2VOMA 3UWVA 4YXGA 1QPQA 2FTPA 2FPVA 1S5TA 2J24A 4ZQRA 4TO8A 1F05A 5K7JA 4AHOA 3HO8A 2V82A 4LVBA 3M1ZA 1ZAIA 3NXFA 2O7QA 3C2VA 3O06A 5T26A 3CTLA 3UWZA 2NX9A 2VC6A 2QCMA 3P7YA 4JTLA 4O1BA 3S1XA 4M6VA 2Q8ZA 3T44A 3B4UA 3UXAA 3WK3A 1VC4A 3EWUA 1YXYA 3S42A 5LSMA 2PC4A 5L6UA 3GXPA 1TTQA 2DZTA 4XQ6A 3HJZA 1LORA 2C1HA 1I2RA 3QW3A 5D05A 4S2BA 1VR6A 4IX0A 3G1SA 1SR9A 2RDTA 3LCHA 1DQWA 1TYGA 3MMTA 4E2BA 2BXVA 4IGHA 1FDYA 4Z1AA 3W23A 1OFQA 2YW3A 1K7XA 3G3DA 4NNCA 3N3MA 1UUOA 4K6AA 1NVMA 4FIRA 1B4KA 3NQGA 4UTHA 1XFBA 3O05A 3MYOA 2Z1BA 4TU1A 4JD4A 2J6XA 1KM5A 3STCA 1H7RA 1FBAA 4K8EA 3F4WA 2X30A 1K3UA 1PCKA 3KHJA 3TQVA 3PB0A 1LRTA 5TIMA 3UD6A 5K4XA 3FIGA 3EWWA 1I8JA 5DBTA 4YCPA 1TTJA 3W1TA 4O19A 2WPBA 4NJJA 4H3DA 3BW2A 3EX2A 2A6LA 3EKLA 5TQLA 1H7XA 2GOUA 3STGA 3DXIA 1SO3A 4HT3A 4AWTA 1KFLA 1HUVA 2ATMA 4TMCA 3B03A 1TB3A 1OFDA 4XBKA 3R5EA 5FF4A 3TAOA 3QFEA 1VYSX 2OZ0A 3TW7A 2Z0IA 3FYPA 5F4SA 1SPQA 3W7LA 5KMYA 1A5CA 1EPXA 2H3BA 2A5HA 5C54A 2YCEA 3C2OA 1ZY9A 2FB2A 2OJPA 3M16A 4KKXA 5FF0A 4FO4A 4C1LA 5FESA 3M5YA 4ORMA 1G4TA 3OEXA 3G1FA 1ZCOA 4BI7A 3A5VA 3GDRA 3OBKA 4DO5A 3TCEA 1DJNA 4X2RA 4NJKA 3W2NA 3M9YA 3W7KA 3RFAA 1ADOA 1X1ZA 5C5YA 4GFSA 3IVSA 1TREA 3WK1A 5J5DA 3S5NA 3ABSA 3TJXA 3D0CA 3EXRA 2PRLA 4C1KA 3QRHA 4I7UA
chains in the Genus database with same CATH superfamily
1OB0A 3W86A 2VDHA 2WVVA 3N9RA 1J12A 5CCZA 2EPHA 2W62A 4FLRA 4FSAA 3PC0A 4M7TA 3OVGA 4QHRA 3UG4A 4WY0A 2I5QA 5A3HA 3VCNA 2HV5A 2QCHA 1B54A 1AJZA 5D8WA 2PF8A 1EJ7L 3AQUA 1HJVA 3DAQA 3E0FA 4ZEPA 4D8AA 1YMYA 4O54A 3SY8A 1WKFA 1W37A 1UWAA 1VFLA 1JDDA 4GO9A 2OQLA 3G3MA 3W1AA 1CYGA 1M41A 4GUGA 3TE9A 5BOOA 2EKCA 1G7UA 5G1YA 4LV4A 1BVWA 2I5GA 4C6CA 3LENA 3R89A 2J7GA 3TLLA 1EX5A 2WHKA 4JICA 3OGSA 1UR3M 4GYJA 3RITA 4ZO6A 4D8LA 1L2UA 5G2IA 2OPJA 4XIMA 4PMDA 2A2IA 3OZOA 3BAKA 4B9YA 4EIVA 2BNJA 3TIMA 3WLLA 3ZJKA 3A4XA 3BQ5A 1WX0A 2NUXA 4LTSA 4ORIA 1O1ZA 1LOQA 3P14A 4B91A 4P7QA 3DI1A 3IJQA 3VD3A 1HTIA 3FS2A 2JGYA 2VX4A 5IOBA 3VOGA 2CLHA 3HGSA 3ZJ7A 3W1PA 1VKFA 3AAMA 1XH0A 4NF7A 1TUXA 3W7CA 1I45A 4NZCA 2EHHA 1O5QA 4GGBA 2RHGA 1E0UA 4FX8A 3M5VA 3P0XA 2QULA 3VM7A 5C55A 3TSDA 4CU7A 3H2AA 1XLJA 4GIEA 4GUIA 2WC7A 4KPLA 5A8PA 1GCYA 3OG2A 3GNDA 1XG4A 4DI9A 1BSIA 1KTBA 4KBXA 3TAKA 4GYKA 2EBNA 3AZRA 2GSEA 4BQ5A 1Q3NA 3OU8A 3KBVA 2LLEA 3NWRA 4Q33A 3XISA 2CLKA 4GIYA 3EDKA 4PRRA 2AKMA 1VRXA 3OZYA 1GYLA 4PMNA 1E4IA 4L4LA 1FP8A 5DMLA 1OK6A 3W2UA 1W54A 1TPVA 1U30A 3TJLA 1AQHA 3B4YA 2B7NA 5KITA 1JGMA 5M1TA 1MO0A 3GHSA 3E1F1 2B0MA 2WKGA 1TR9A 4A22A 3LXAA 1EHAA 5G2HA 3KBJA 2VUYA 2HMCA 1F5ZA 1BVNP 3UG8A 3OGVA 1W9XA 3VNJA 1XC4A 1M9HA 4GINA 1AW5A 3KZSA 4WCJA 3LCGA 1CWYA 1C8YA 4S3GA 2ABAA 4RZBA 4Q8OA 1SFTA 3VA8A 4G2DA 5F2GA 1FXQA 2WOQA 3V18A 1Y5XA 3EX4A 4JFWA 1YYAA 3G1VA 3QHMA 4EACA 3VU2A 1FUYA 4GY7A 5JIPA 2WHJA 5I3IA 3ID7A 4HHMA 4ZB5A 2GQ9A 1XKYA 4J40A 1EZ2A 2BZNA 2V3FA 2QV4A 1FH8A 3GW3A 1UQYA 5I03A 1V6UA 5I6SA 3CV2A 4PSRA 1FDJA 2ZZ2A 3UYIA 4WOQA 1GG0A 2IQTA 2GGIA 1CENA 4ZCWA 1TE1A 3THAA 1Q5MA 1MMFA 1GKRA 2DZAA 3WQPA 3FLUA 3T2QA 4MNMA 2PS2A 1ITQA 3SUWA 5FEXA 3VM5A 4NYUA 4LFYA 1H41A 3P60A 4IFKA 2IPWA 1VPQA 4NY2A 5BMXA 3SO7A 3BG5A 3L66A 2G96A 3LMYA 3QYQA 5E0KA 5DX7A 2QV5A 1WP6A 5T8GA 3OYZA 4LAZA 4CCDA 1S2AA 4H6QA 2PDYA 1WBHA 3W6LA 3KCJA 3HZ3A 3SCOA 1W3LA 1FWGC 4JKKA 3EWYA 3AALA 4KWVA 2EG6A 3OLEA 1SMAA 3F1QA 1YADA 2WNZA 2DVTA 4Y9NA 2X40A 3DKLA 3HPXA 1QNVA 3OZPA 2HPMA 5LGXA 1IT0A 4M6PA 1O5XA 4S3BA 1UWQA 4I90A 4XKYB 1KC7A 4H7VA 4DI8A 1WE5A 5F2LA 2GJRA 4GUHA 3CO4A 1LL4A 5KZ6A 4XKMA 1GONA 1GW9A 1YKWA 4A35A 4PTNA 3ZLHA 4OKDA 1AUSL 4MPQA 2Z28A 3M0HA 3S4TA 4ZQOA 1W32A 3GH7A 4WKFA 3IK4A 1K9TA 4J3TA 1E0TA 1I0BA 4P8VA 3TTSA 3RU8X 1XBYA 2GJNA 2D2GA 4P8UA 3PHAA 3THCA 4QSHA 4FPSA 4N42A 3A4JA 3REQA 1R3TA 4UWMA 3WLOA 1VFHA 4JQAA 4C6BA 1IWPA 2P10A 2DT1A 4YWSA 1C9WA 2E5DA 4B5NA 1E55A 1UH3A 4MY9A 1V3MA 3ERPA 1OGBA 2PC8A 2IKGA 3HGOA 5AC6A 1HKIA 5A6LA 4AQLA 4GLEA 3KDOA 3WFLA 4JL1A 1LUCB 5AC7A 2YDRA 3KOWA 4DWDA 3ITYA 3UG3A 4IIHA 3ZFHA 1VP5A 3FXGA 2CBJA 4N6FA 1I2QA 3OTRA 4H41A 4L6OA 2XH7A 2GSJA 3GWQA 5EL1A 1ZUAX 3EZ4A 2BVWA 3MB9A 3DHFA 3G1HA 4XAGA 4CCZA 1MW1A 4GIRA 4C6LA 2E5BA 3XIMA 3AYTA 4ZXOA 4GE8A 4YS1A 1DTNA 4LUSA 5BW6A 4C7GA 1EJSC 2QJMA 2ZE3A 3B0XA 1RK5A 2W3ZA 4RR4A 1LRQA 4NNBA 5BRPA 1M7PA 1UD3A 1EJUC 1UPMB 2IXVA 4HMEA 1OJXA 2ON3A 4A8IA 3VIGA 3T7VA 3T78A 1ECQA 3P5YA 3VOHA 3WN6A 2P50A 3APTA 4I8YA 4H4IA 1DXEA 1V03A 4UTWA 1D9EA 4TR9A 3P0WA 4LC6A 5B7ZA 3MY9A 2NWSA 3RUBL 1UR0A 3ARWA 2D24A 4C6DA 1OY0A 2EPKX 2QDEA 3N19B 4A3RA 1JF5A 3QF0A 3UZZA 5HOSA 3QV9A 3SECA 3W00A 3RRAA 1VYPX 2ANUA 1FWSA 1HF6A 3BLDA 4JDBA 3QSTA 1RP9A 2C8NA 1WDPA 1CBGA 4AD3A 2PU0A 2D69A 4DYEA 3GXNA 1V0LA 2ZUMA 2WSRA 1EBGA 1XLKA 3M5ZA 1IHIA 4NJHA 5DLCA 1FWEC 3FX4A 5LA0A 5BYWA 2QQ6A 4IGMA 2OLAA 5A69A 1A47A 2OQYA 5I5RA 2D22A 4NJIA 1PZ2A 5HJLA 1DOSA 2BVDA 4GVIA 3QYSA 1UB3A 5H8PA 3BVJA 3IVUA 4KEVA 4AD0A 3N2TA 4DJFA 4JDYA 2A6NA 5CC6A 3DCPA 3LRLA 1X38A 4JTSA 2P88A 1V6WA 3AICA 4A21A 3LV5A 4HSHA 4IIDA 2NV2A 2GJXA 4J3ZA 1DIOA 1WZMA 1ONRA 4M1BA 5IM51 4EXQA 2FVKA 4JTCA 5KZEA 4OJYA 3CK5A 3N18A 4U5KA 3BL3A 1W1TA 1S2VA 1R7AA 5HNUA 2YZ5A 1X96A 5HAOA 3G22A 5D2VA 1TV7A 4DF2A 4A29A 2DT3A 4JTJA 2NV1A 1BGAA 3DBNA 3U2OA 5FJPA 2VC7A 5KSWA 3N73A 3LX9A 4JBRA 4PMXA 3KL0A 1Y5WA 4IGNA 4JTFA 3LHTA 1PYMA 3AYSA 4BWLC 3BAYA 3NZ1A 3WEZA 3EXTA 4WJ8A 1BSLA 1QASA 1IV8A 4OZOA 1NDYA 4AXKA 2BDQA 1YBQB 2OQHA 4NT0A 2RDWA 1GNXA 3GR7A 2ACUA 2YR1A 2G4JA 3PTKA 2X7WA 3NQ6A 3WQCA 1GQNA 2OKTA 3T2PA 4IG2A 5I23A 4J7RA 4DAIA 1KO0A 2DUXA 1IR2A 4UTTA 4LY8A 4D6GA 2XUCA 2CLMA 4ZOAA 2H3DA 2NUWA 3LHZA 3GQYA 1BTMA 1UQZA 2HS6A 2WMFA 4R7OA 2V6AA 1MW2A 4S3JA 4MMWA 1RXOB 3EMCA 3R10A 3U7VA 2V9DA 3KXQA 1UJQA 5FCZA 2WZHA 4Q8QA 4D6EA 1KFEA 3QY6A 1Q8JA 3WNKA 3ARUA 3MDUA 4E4PA 1R47A 4Q8MA 3CGTA 2CBIA 1D7KA 1NF0A 5HNTA 2X1IA 2R1NA 3GU1A 4HHHA 2E6DA 4O53A 3VABA 4DYJA 3PANA 3ABRA 3CIVA 2VCAA 2WK2A 3O1NA 3WY1A 1M7OA 3L12A 1PEZA 4GYFA 4JGDA 4UQ9A 5E6YA 2ZTJA 2QZRA 3NL2A 4AISA 3RJXA 1EIXA 1C8XA 1SSDA 1UG6A 4LPCA 3W85A 5F1UA 3W7HA 3H2CA 2WB5A 5LZLA 3OIHA 4UMCA 3U5UA 2J78A 3VIOA 3L2LA 4IP4A 5I78A 3E2SA 1QRQA 4RXGA 4UBPC 1ZHAA 4JL2A 2VR5A 3IEBA 3ZWSA 4EK7A 5C9WA 1NP2A 1G01A 3JVAA 3MCMA 1YNYA 1PL9A 3A23A 4NI8A 1R3YA 3VIHA 4LVFA 4DBSA 5T9BG 9RUBA 1AL7A 4AZ6A 4TV6A 1G6CA 2CKRA 5G4EA 4ZR8A 3BOXA 3RNDA 6CGTA 3F5JA 4L4MA 1XSJA 2NWRA 3UWQA 1YW1A 3U48A 1IIHA 1CT5A 2NVDA 3MUIA 2DJLA 5JH1A 1R2TA 5LNUA 5AYZA 4HU8A 3MZNA 3GZ3A 4GX8A 4PBFA 3I6EA 3QZEA 5FAJA 3CT2A 1QBBA 4R34A 4WDWA 4U3AA 3TEVA 3BARA 1Q8AA 3T07A 4HYRA 5HWMA 4QDPA 4XBSA 5B80A 3FAWA 3LHYA 3RR1A 3HG3A 1W0MA 3G0SA 4S3CA 2NXHA 1E6SM 3SRFA 3U0HA 3CMGA 2RJGA 4G7EB 1IZJA 1PHWA 1MSSA 1KXQA 3OZMA 1IR1A 2Y62A 2WC4A 3I6TA 1QNRA 4JQ1A 3NQDA 1XLHA 3QPZA 2YIHA 3QZAA 5EMKA 3UPBA 1W5PA 2XVKA 3O07A 2AL1A 1WXYA 2B81A 3QGVA 4PC8A 1YIXA 2QDGA 3SCVA 4Z17A 4CNPA 1OZMA 1A53A 1XISA 4WZHA 4TIMA 4AVNA 2XVNA 1UP0A 4BQ2A 5CPMA 4JNMA 1UUQA 1DE6A 1CGUA 3UNTA 2JALA 2GQ3A 5E1QA 5TNVA 1PZ3A 1SYTA 2QIWA 5EMUA 3FVMA 4MZ8A 1C29A 4GVFA 3KEHA 4RZ6A 3SJNA 2J13A 1ISXA 2R91A 1JJKA 3B0PA 1WBJA 3V5FA 3EGJA 3PBUA 5HNNA 4M1RA 2Y61A 5GJMA 1ZBKA 3HB9A 3MHFA 4C6NA 2Q6ZA 3ZJ8A 3NFUA 4UR8A 5F7UA 3CPGA 3TZNA 4LRTA 3H53A 2PU1A 1GK8A 2VR4A 2QLYA 3C0SA 3IJ9A 3CUXA 1IWAA 1HZYA 4AF0B 3KL3A 4B5SA 1KKRA 1KQYA 2PP0A 4JCMA 4O15A 2OWWA 1P48A 4H7ZA 2C0HA 4PRTA 2I9EA 2ZRZA 1XUUA 2A85A 1R5YA 4PL2A 5FKYA 3M0XA 4IPLA 4O1EA 2Z7KA 4C6EA 3KLKA 2YYTA 4K37A 3NXLA 1D8CA 1FCBA 1XX1A 3VDCA 2G3MA 1AFSA 3WNNA 4J9JA 1UA3A 5U7SA 3HA1A 4WGXA 3R4IA 2XFYA 1V3LA 2CZFA 5BOFA 2ZC1A 5BRBA 4JN7A 1UA7A 2AAMA 3AS3A 1P0KA 4LAMA 1L6FA 3MUZ1 1LYXA 4CQCA 2QR6A 1KFWA 4N0RA 3S5ZA 1OX5A 4L65A 4UFKA 1E15A 1E0WA 2PE4A 4N6EA 4H9XA 3DHDA 4UQBA 3H2MA 3CAKA 3TYZA 1YTKA 2GPTA 1CECA 3FSTA 3CO8A 4V1YA 2L5HA 3EPNA 3SFKA 3SUVA 5G1MA 4CQ8A 1MW3A 1E6XM 3LN3A 4ZSTA 3ARVA 2BWGA 4Z1BA 3O6YX 3CHCA 2ZXBA 3SGUA 4OGZA 2FJKA 1DWGM 4BR1A 3M0KA 3WF0A 1WAWA 1OFRA 4W87A 4B5WA 2ZE0A 3U2EA 2BGSA 2CLEA 4Z42C 5IFPA 1HJXA 4Q4SA 1SGJA 4U10A 1IE7C 3UETA 1UP3A 4PFHA 3VIFA 3PSVA 2PBOA 1YE4A 1DKWA 3NSMA 3BOLA 3UR2A 4KCWA 2FHFA 1W8GA 4U4MA 4GI4A 2J77A 4FP1A 2YOCA 5I3KA 4NZ5A 5FJUA 2A4AA 1FWIC 2ZVIA 3F4DA 3UZYA 3DUGA 3K5XA 3IANA 4WGHA 3G0XA 5CPLA 1QT1A 3RXZA 1JFHA 5HQMA 3TXVA 3GBDA 1JI2A 1WDSA 3CUHA 2QCCA 4KQNA 2OKOA 3AROA 3RDKA 4R7WA 3NEVA 4P7LA 1LOSA 3A21A 3W6MA 3BZGA 1TMLA 2POTA 1M5WA 2OB3A 2VD9A 3SGZA 5I3DA 1TO3A 1Q45A 3WL0A 1UJPA 2BASA 4FNSA 3C56A 5K9DA 5LNSA 4AD5A 2R1PA 2Y7DA 3VOCA 3TQ0A 1XXXA 3AWOA 1JXKA 4JYFA 2GWNA 4J28A 4FMVA 1AW1A 1EO7A 1WV2A 2OWCA 4H01A 1FFRA 4PCPA 1K6AA 2ZC8A 1FWRA 2KX9A 2WW5A 3LTYA 2NSXA 3TV8A 3SCUA 1TVLA 2FZ9A 1V6YA 4HOWA 3OVQA 3NQAA 5XIMA 4PULA 3KHDA 1KGWA 4Q6XA 3S1GA 1XIFA 1KRMA 1ZJIA 1LQ2A 7REQA 1UKOA 1KCLA 4G7FA 1B57A 2W79A 3ABZA 4YTSA 1S2WA 3WJXA 4M6QA 3BMWA 4DN1A 4L80A 1I2NA 4ERGA 2A0NA 3VNYA 1JPDX 2Q01A 3VGDA 4RNHA 2YZRA 3UYCA 1I0DA 1ZL1A 3POHA 4O18A 2RAGA 1JRCA 2AQWA 1XYMA 4DJDC 3QLLA 3LDVA 1GZGA 2EF9A 3OIXA 3WD4A 3TX9A 1WA3A 4TTUA 5I09A 1Q6OA 3VPLA 5AYYA 1SU5A 5HMSA 1RA0A 2QW5A 2OSWA 1SUXA 3E49A 1WAUA 4E5TA 2PZ0A 3W7PA 4C6KA 5C2GA 4X0VA 4JY9A 1I75A 3M07A 3GXMA 5CBBA 4K68A 1LM1A 5E9XA 4Q8VA 2P53A 4DJED 2DT2A 3FOKA 3LB0A 4TOQA 2DSZA 2Y1HA 1N8IA 3B8VA 3TTYA 4AHQA 4W89A 5CZKA 2WWDA 4GKTA 4KRTA 1C7TA 2WJFA 3PBWA 2ACRA 3TN5A 1ICPA 1H5VA 1RD6A 4UFHA 4MZ1A 4QEHA 4WX2A 1QVBA 5A6TC 4BK9A 4PUMA 1JCTA 5LXEA 3MUAA 2JK2A 3WNPA 3L2IA 1CXIA 3TA6A 4F0MA 3H4GA 4HCDA 1UKSA 4YYFA 2H8XA 1W5MA 4BF9A 3R0DA 1KTCA 3GYCA 2CPUA 3EKZA 3O6AA 4F48A 3BCFA 2W4XA 3KW3A 3SRKA 1ZTVA 4ZGYA 3WNLA 3CLWA 5BNKA 2VRJA 2OR2A 4GUFA 1PZ0A 3LBOA 5C6MA 1ZP4A 3NZQA 2VC9A 4AMAA 3W07A 2HRWA 5EMMA 3I6RA 2XFWA 1KBIA 3EAUA 1THFD 1A5UA 1KXVA 1VFMA 3LRMA 4HU3A 3PNZA 1CXHA 4HOZA 1AQ0A 3VZXA 2WQPA 3P82A 4S38A 5A6MA 1FWAC 1EQPA 1K02A 1I6NA 3QEZA 3UJFA 4IISA 4IFRA 3A3HA 2V3DA 3LGDA 4X9SA 2BSLA 4MJ2A 2ZVRA 4UTWC 1B3VA 3QFWA 3LXCA 4DBUA 2ATSA 3QJAA 1CDGA 1Y5VA 3C52A 3CZLA 2PCEA 4HZ8A 1FCUA 5IDZA 3B9AA 1N8FA 1DHPA 4FNRA 4Q8UA 3N15A 1LG1A 2ZX7A 1EDQA 2HXUA 2J8FA 1DJIA 1XP3A 3KLLA 3Q67A 4AU0A 4H8NA 2DZSA 3VDBA 5I06A 3AU2A 2V5KA 4QXIA 3I68A 3VUSA 4GBDA 3DH7A 1DWFM 1H49A 3GFZA 3SEPA 1JPKA 1ZJHA 3DYOA 4ZMGA 3L67A 3AWNA 3TK7A 1NH6A 4TVCA 3CHVA 2HS8A 2R14A 3WQOA 2YXGA 3MWAA 1FWCC 4JOMA 4OFCA 4XD6A 1Q6QA 3FAXA 2WSYA 4FNPA 4E8GA 4PEKA 1QNPA 3WFAA 4DJFC 3A9BA 5IDIA 1XYZA 3AMDA 3FHAA 4HSNA 2PDNA 3KRUA 5DFAA 3FEMA 2CU0A 5I00A 2ZUUA 1O94A 5HWJA 2QVNA 2WJDA 1PZ1A 4H8UA 4IJBA 2VHLA 1KM0A 2PWFA 1Z89A 2G4FA 3EWXA 3ECQA 1VYRA 3M44A 1L6SA 4IIGA 4FB7A 1RJQA 1KRCC 3RIKA 4JX6A 3WF1A 5A95A 4R88A 4JTKA 1Z44A 3N2XA 2FTWA 1XJBA 4FEZA 3AC0A 4GNJA 1NM9A 1UD4A 1UROA 5FD0A 4URIA 1W1VA 2Q8LA 2RGLA 1VPYA 1XI3A 1UZDA 1WKYA 3WBXA 1XH2A 3GH5A 1UZHA 5C9XA 2OMAA 4XO7A 4H83A 1PJ9A 1XLIA 1W91A 1XKJA 1XDLA 2BVYA 4GNKB 4Z1DA 2Y6ZA 4F9JA 1UMLA 4R85A 3P8JA 4IL2A 1PDYA 3BAIA 1VRDA 4DWSC 1C93A 1S1PA 1JZ4A 3G1XA 4WY0B 3UPMA 3WH7A 5EMJA 3GO2A 3LHVA 1EWEA 2GVLA 1DHKA 2WJZA 2G95A 4ATDA 1EA0A 1FX6A 4KF1A 2PSNA 1KKOA 1I60A 3MHGA 4H6RA 4WR3A 1OC7A 3ITCA 1QW7A 1WZLA 1IEVA 4M81A 1R3VA 4RKAA 1GEHA 3ZR6A 1K8XA 1B31A 3H70A 3N2CA 2VOMA 1PX8A 1PAMA 2P76A 4B4FA 1F05A 1EKOA 4Z2IA 4RDVA 3M1ZA 1ZAIA 2QHAA 3NXFA 1Q63A 1S1RA 1MWOA 2CETA 4RDZA 2R82A 3KTXA 2VQUA 3C3UA 2P3EA 5AVHA 5CJNA 3T44A 3AXKA 1VC4A 4V28A 5I07A 3S42A 2C1IA 2PC4A 4RV3A 1TTQA 3AHXA 1AA1B 1LORA 1QK0A 2C1HA 3QW3A 4B2DA 3G1SA 3CAVA 2EPMX 3HV8A 1SR9A 2CHOA 1X6NA 4HA0A 4E2BA 3XINA 4IGHA 3WLHA 1TELA 4Z1AA 3W23A 1UUOA 3MDWA 3ARRA 1DIKA 3NQGA 2ACSA 3CBWA 1OIMA 1TFVA 1Z6KA 3MKCA 2Z1BA 4TU1A 4RUBA 2E4TA 3K4DA 2J6XA 2ZUSA 4GGHA 4KEZA 3STCA 3AI0A 5I24A 1H7RA 3D47A 1V3JA 2ADAA 2X30A 3ES7A 3KHJA 5CAHA 1CGXA 3CL8A 2CZVA 4XBJA 1TTJA 4J35A 2WPBA 4HZ7A 5GNXA 4GC3A 3EX2A 3QN3A 4HPGA 1Z3NA 3DFYA 1WDQA 1HJQA 4NILA 1A5LC 5LIYX 2H9AA 4XBKA 3UXLA 3R5EA 1VYSX 3QV7A 5KMYA 2C79A 4A3YA 2YCEA 5A8QA 4DYKA 5FF0A 4XZLX 4XZWA 1G4TA 2OEJA 2IKIA 3G1FA 1ZCOA 4WKAA 4R9OA 3QV6A 3WENA 3GDRA 4G5DA 4GFSA 2ZXAA 3HN3A 3WK1A 2OVLA 2PRLA 3ENLA 3EXRA 4C1KA 1P6CA 5A6SA 3KAOA 1H4PA 3USBA 4KIEA 5DN1A 2ZRYA 3O8AA 3PAOA 4WRHA 2OT0A 2JIEA 4JFTA 5D8ZA 2NQLA 4EANA 3T09A 2UWFA 1W9VA 4IPJA 3VTRA 4EVZA 2OX1A 3NQMA 4EP8C 1ICSA 4X3ZA 1XBVA 4DBEA 3WEOA 2CLLA 3FXYA 3CZEA 3CIXA 2PWVA 3WK2A 4AZBA 1JPIA 4MJ4A 3PZTA 1EFZA 2QCEA 1HKWA 1X39A 3E02A 4R27A 3U57A 4ML9A 1XRFA 3MP5A 1I2PA 4JIPA 4KWOA 2TPSA 3O0KA 3U7BA 2VR2A 5ABHA 3H7VA 4KIRA 5GNYA 4GO8A 3W1QA 3M47A 4JKLA 1GHRA 5MKGA 4D71A 2QUTA 1X6LA 5BXRA 2ZA1A 2E1DA 4ZQNA 1QOQA 4R33A 1W1A1 3QHOA 3S5OA 4WUIA 3URBA 3MSDA 1VHNA 1JCJA 2X8RA 1QW9A 1XM3A 4RPQA 3IGHX 3NNTA 4YJ5A 1ONWA 2PZNA 2ISVA 3LNPA 1MXSA 1NP0A 4GCAA 4QROA 1PWMA 3PY2A 2JF6A 3MWCA 4PB4A 1OIFA 4MIMA 1LJYA 1EUNA 4QIUA 1MEHA 4CU8A 3PJXA 1HL9A 4YPJA 3R7MA 4IFKB 5A6BA 4X2PA 2EAWA 2GVGA 1HP5A 2XGIA 1JUKA 3M0MA 2D0HA 3DGBA 2VFDA 1R46A 1OT1A 4JYDA 1WUFA 2PUZA 2ONEA 1UKQA 1XIIA 1AMYA 3CV7A 2W6RA 3I7SA 3W6YA 1B0IA 5G1TA 4QLJA 3UA4A 1DJZA 2Z1XA 3NQFA 2CZDA 1ZU8A 4WXZA 4HA1A 1R86A 1E1CA 2P8BA 1UH4A 3LTSA 1LRNA 2TYSA 4H6EA 1KD0A 2XN1A 1X6UA 1EXBA 7XIMA 5ABFB 3FA3A 3UT0A 1T96A 2ISDA 3ZT6A 1TMHA 1LG2A 3OW1A 1J18A 3A4AA 4XZMX 3MYPA 2Y7GA 1L6WA 1PTAA 1QJWA 1TV8A 1CLVA 5EU9A 3AIWA 2VX5A 4UNLA 3DESA 4D2JA 1SFJA 2PRMA 2ALRA 4FF7A 1H1NA 5IXEA 3NDOA 2YJQA 3RILA 2O7SA 5EFDA 3B9EA 3O2LA 1CEOA 1I1XA 1ZS2A 3T42A 1R38A 2EQDA 3VNIA 3TW6A 1JZ2A 4Z1CA 1Y8BA 4LAOA 2GUYA 3MI2A 2YCIX 2HK0A 1EJRC 4U3CA 4WXYA 3TP4A 2VEKA 3SCSA 3MHUA 3AMGA 3DENA 3QMSA 3BE7A 4I6VA 1ISYA 3REQB 5CZJA 1NAL1 2CLFA 3F2CA 3PAJA 2INEA 1HKJA 7CGTA 2RGMA 4OV4A 4Q32A 2X1TA 2ZX5A 1Q65A 5T9CE 1B3OA 3VNZA 4GBUA 3AJ7A 5AHEA 1RQBA 2XHYA 1XV8A 1JNEA 2PURA 2ACQA 3QY8A 5CPQA 5CPOA 3KL5A 1NDZA 1OF8A 3G18A 4Q8NA 2F38A 2F2KA 2BODX 3I4EA 1A5BA 4PTWA 1GKPA 2PDJA 5JVLA 3WELA 3OO2A 4HP5A 1VCVA 3L4TA 4MNKA 4PMJA 2BGNE 5G5IA 3WD3A 3DIPA 3IK2A 2C71A 4FNTA 4RXFA 4JTUA 3VC6A 2BS9A 4DXXA 1O95A 1UZ1A 2PMQA 1BQCA 1MDLA 2RH9A 1XD1A 3IAQA 1SW3A 3VKAA 4LUSB 1TJ0A 1UD5A 1EL3A 4AZCA 3WDPP 3CQHA 1ONXA 4QE4A 2P5NA 4M8UA 1F7BA 5G4WA 1Z42A 1FFQA 1JYVA 3WLTA 2PDWA 4CD7A 4A6GA 1WDDA 3IRDA 3VOFA 3WDIA 4KCUA 5LYRA 3ZOAA 3T2OA 2OZ3A 2CBUA 4GIAA 3SSZA 2PAJA 1Z41A 1LT8A 4HNNA 4GX9A 1PIIA 3V0SA 4UUIA 1TA3A 5J04A 4FLQA 1JCMP 3WJWA 5K2ZA 4CD8A 1XLMA 4XX6A 3P80A 4Q4MA 4D6JA 4XD4A 4FR6A 4GA8A 5D2TA 2CXEA 1AL8A 5EY5A 4H9MA 2VGIA 4B16A 4NXKA 2OYLA 3AS2A 1N8WA 1F76A 4GACA 2CLPA 3URAA 2BMBA 1GVEA 2H90A 2WBKA 3SUUA 1KFJA 5AOUA 3UXKA 1PPIA 2QMKA 4JNYA 1C8VA 4B15A 1NWUA 1PYFA 1QOXA 3CXOA 3FJ4A 2J6VA 4MPKA 1QR7A 2VEFA 4NL1A 1RCQA 5RUBA 3PWAA 4Z2HA 5AFDA 2OGJA 4DHGA 1BWLA 3G1DA 4IP5A 1XYAA 1RR2A 4MB4A 1ZFJA 4L9ZA 3H2FA 1YXCA 1A3WA 1WOBA 2VX7A 3LI0A 1GOXA 3WF2A 2FGLA 5LIXX 3DERA 3ZLFA 4Y9AA 3URNA 1JNDA 2E0PA 3INPA 2VGGA 3TWBA 2DUAA 3AHVA 3LG3A 1AJ0A 2GJXB 4PUNA 3HFYA 3TKFA 4CNTA 1JRBA 2QGHA 9XIAA 3PZNA 3M46A 2QJHA 1RCOB 2W5FA 3S8HA 4H9VA 1R0MA 4K39A 4GFIA 4BEQA 5DT5A 2VMFA 5I3JA 1E0XA 4DNMA 2GVYA 3EXSA 5HDRA 2FZMA 3HG5A 4IMDA 3C0LA 3RN6A 3DHUA 3VX1A 1Y65A 1R85A 3EOEA 1ALDA 1Q4NX 3UNDA 2E8YA 3GFYA 4HPJA 3W83A 4XVEA 1DJXA 1F4HA 2W27A 4D1JA 2J9YA 1GWJA 2YA2A 4B5VA 3CEPA 4NG3A 1Z69A 5LHEA 1CLKA 1SJDA 1R3QA 3ANYA 3GTFA 2O0TA 1MEIA 1J01A 4UZUA 3CZKA 3V5OA 4IMFA 1POKA 4H2HA 4B5UA 4DJFD 4IG2B 1YPXA 3R0KA 1VBRA 2XFRA 3NOYA 1ZJBA 2V5LA 4DO4A 3NPXA 3NVDA 2FB3A 3ITVA 3SIMA 2QCNA 3S1UA 1HGYA 3W7NA 3BXWA 5TD4A 3CIWA 1GVQA 2PGFA 5E5CA 1A5SA 1OBAA 1T5AA 4J3XA 1W5NA 3UCDA 4IX2A 1WZAA 4PUDA 1RZMA 1J8VA 5D03A 1O66A 3H2EA 4K7VA 3GXIA 4TX6A 4NAFB 3WUEA 2VEPA 4REQB 3GKAA 2V0TA 3FN9A 4XTIA 4ZO8A 3DZ1A 2Y0FA 2WQDA 4O13A 1PIFA 4DO7A 2G50A 1UWIA 4JIHA 1PV8A 3EDDA 1X97A 1VEPA 4HZMA 3E2VA 1YLVA 1GOQA 1FWWA 3AYRA 3V1HA 1RP8A 2AOSA 1DP0A 1PIGA 2I17A 4EAYA 3GHUA 2PLMA 3QTGA 2VO5A 4S3DA 2WMIA 2ZXQA 3TUUA 2EJ1A 4GISA 4IPNB 5D37A 4D6HA 4K36A 1M01A 8TIMA 4NHVA 4ILSA 1R7OA 4F2UA 5CC7A 2DIKA 4RNJA 3GAKA 1PB0A 3W38A 3BANA 5BU6A 2C15A 4WDTA 4WJEA 2Y5SA 4YNGA 1OT2A 1TIMA 3G77A 3WQWA 3D6NA 1J11A 4ADTA 1R9YA 2AL2B 1RK6A 5BMWA 3DX5A 4N4PA 5CJMA 3OG3A 1EGMA 2DT0A 5KINA 3I7RA 1ITXA 3WO8A 1IXQA 3ME3A 4NZJA 4ZOCA 1JAKA 1XICA 1M03A 4FLSA 1EZWA 1U1UA 2ZA2A 1NFBA 1KA9F 3WMSA 1PVNA 1UYQA 2VEMA 3P62A 3A13A 1K6WA 3S46A 4CGTA 1S5MA 4JIIX 3EOLA 4A8LA 5KETA 3LGEA 1F4AA 4HN8A 3DOPA 1QHZA 1OFAA 3N6QA 1XCWA 3HQNA 1SW7A 1W1ZA 4EF9A 1HJUA 1XDJA 4QJ4B 1HIZA 1UWRA 3GUGA 2Q71A 3JW7A 2P8CA 1V08A 4LUIA 1QI2A 2O4QA 4TVDA 2XH4A 1HKVA 5JBEA 3UR8A 5HMDA 1L0PA 2MUCA 1QPNA 4RNFA 3F5LA 2DZPA 3BLPX 4ZFMA 1WXJA 3BUVA 4OU1A 6ENLA 4AZ7A 3MANA 2FHCA 3CT7A 1ODZA 4ONVA 7TIMA 5CPSA 3SN4A 1XIMA 3HV9A 3G1AA 4LBRA 3RX2A 4IXXA 1U2YA 3LPPA 3R1ZA 3W7QA 3VINA 3W7MA 4AB4A 3M64A 1D3GA 3LCXA 2PI6A 5IHRA 4QJ3B 1OVDA 3WEMA 3KVMA 4I9TA 4AY8A 4PCNA 3NURA 1EYWA 1YPIA 3LHWA 2DU2A 1DYSA 4NYYA 3W7RA 1P4CA 3RX4A 4CD6A 2FVMA 4K2SA 2PDXA 1GVOA 4H8VA 4UFMA 1NJJA 1GVSA 1G4SA 3R2GA 1WKDA 5DXYA 1Q6DA 3THQA 3WUFA 4QQ3A 1C90A 2J74A 2OZTA 3LLFA 5CC5A 4YTQA 4R3UA 2G8ZA 4E2DA 1OCBA 4LNCA 1A4MA 1VAHA 2WHLA 3T8LA 2J75A 4ZTYA 3TONA 3GTXA 4D8ZA 1UWSA 1TPB1 1GJUA 2BX7A 3TC7A 3UU0A 1V0KA 3DEQA 2GGJA 4MUPA 4C6QA 2UBPC 1F2JA 3LCWA 6PTDA 2YXXA 3IIXA 4FNQA 2WO5A 3VKKA 3HG2A 4Q4OA 3U2ZA 3KCLA 2UY3A 4MB5A 4P8WA 4C5ZA 3OODA 2DPEA 3H23A 3WMCA 3U2CA 2C13A 4PUUA 1LT7A 4BHYA 1TV4A 4O50A 4HK6A 3LGGA 2DORA 2OYKA 2VFIA 5JBDA 3MCNA 3NM3A 4IQDA 3A47A 4RV8A 4YIWA 3PNUA 4LV9A 3ONBA 2GL5A 4CCCA 3DFTA 4QISA 4AHPA 1E3XA 1XBXA 3K8MA 3GTHA 1K03A 1B30A 2GDVA 2R1KA 1W6TA 3ZR5A 4NZ1A 4HD5A 1KCZA 3QSRA 2D1ZA 2DSKA 4ICNA 1X1OA 1CTNA 3K8LA 4E8DA 2ZRXA 5FACA 1B3ZA 3FFSA 4MSSA 1VS1A 2XZ9A 3GIPA 2PWDA 4QX4A 1B3XA 4Z08A 4L7ZA 3OLIA 3BQ6A 4AVFA 3GH4A 1W9UA 3A24A 2ZBTA 4AW7A 3KZPA 2HSAA 3KUMA 4BJHA 4GH3A 2PLKA 3PZGA 3UP8A 2FYMA 1Z7AA 4KFNA 1JD7A 4LYRA 2CW6A 1VF8A 3UR5A 1U1JA 4MHBA 2OWXA 3G1RA 4Q6JA 1EGVA 3W7IA 1JZ5A 1ZZMA 3V36A 1TPH1 4PA8A 2DUZA 5A8OA 3W73A 4WF7A 3RGTA 2O56A 3DC0A 1BKSA 1PTGA 3UERA 2XJ7A 4W5UA 1JEZA 4L6DA 3LU2A 3TYEA 1KWGA 4O1AA 1WOAA 1HKMA 2D2JA 1SFLA 3CZJA 1SO4A 2VFGA 3STEA 5AHLA 3DFNA 2NZLA 1EC7A 4Q4PA 2OOGA 4Q4RA 4J3WA 2ZZ7A 4ICMA 5CZ0A 3CWOX 1Y0EA 4FNUA 1FVPA 2IMRA 1XQLA 1H2JA 5C9ZA 2B7OA 4CEUC 3ZWTA 2VP8A 4I7WA 1XIGA 4LOCA 1J5TA 5EFFA 2QF7A 2RKXA 1HKKA 3UWUA 3MUCA 3GLCA 4AUBA 2DDXA 1OD0A 1CXKA 4WK9A 2POZA 2RDUA 3S5SA 4B4HA 4HTYA 5BWAA 5I79A 3FYYA 3ZR4A 1VHCA 1FCVA 1U83A 2PDCA 1NOFA 2C91A 5A1AA 3QTPA 1GZ1A 1KM4A 4E0CA 4OE7A 1F74A 4HSOA 3BURA 1P5BA 3BLFA 5LIKX 4FF5A 2Z27A 4N9EA 3LLDA 2PF0A 3NDYA 4F4RA 2X2YA 3N6JA 1V4YA 7REQB 2FMOA 2QDHA 3EA2A 3SCNA 1P7TA 1LLWA 1XYBA 4JTHA 4UC5A 4GZ7A 1E70M 3MP4A 3R11A 4A3UA 1KCXA 1SW0A 4S3KA 3W9ZA 2WCGA 4XV0A 3JU2A 3GU9A 4HGXA 4C91A 4NKCA 4FX7A 4DBDA 1F3EA 4EWND 1KM6A 4FALA 3PZOA 3ZO9A 3RYSA 2HBXA 3BMVA 3E12A 1OG0A 1ZSXA 3F7JA 3FA5A 1L2QA 3PG8A 3WQ8A 2E09A 4HNUA 5KZDA 3TYUA 3PBYA 1A0CA 4LGXA 3DFHA 1TPC1 2J25A 3MJYA 4MKNA 3WBWA 1SZRA 4GZJA 2A3BA 1P0DA 2XSAA 1A5OC 1JDFA 1F61A 3T9PA 3QH2A 1J5SA 3BW3A 1HG3A 3SI9A 3RR4A 3N12A 3W75A 5C8BB 3NGJA 4L1XA 3AHYA 1J9YA 1QI5A 5FSEC 2ODOA 3LUTA 5JXQA 1B5TA 3E38A 1GVRA 1BYDA 2OSXA 5DCDA 2DH2A 2VVSA 3MP3A 4MY1A 4QNWA 1GQKA 1U22A 3O0FA 4GYPC 1HJWA 4IPIA 4WOZA 1P0EA 4I8DA 4IL0A 2C1GA 3UG5A 1RLDA 4DZAA 4I9JA 1BTCA 2Z26A 3WBAA 3II1A 3LMZA 5BRQA 5M2FX 1RQHA 5M17A 2NSOA 3NIYA 1A5MC 4HYWA 4AYSA 1NFPA 2C18A 2GK1A 2PLCA 4UTJA 4ZOBA 5C7HA 4AG0A 1R30A 4AYGA 1Q6FA 4AIUA 1ME7A 5I0DA 1SJAA 3IJIA 3U8GA 3GUWA 2WC3A 4HYVA 4QBXA 3W2JA 3E0VA 2R8WA 2NV9A 4A05A 1JGIA 4L56A 5D2WA 1D3HA 3MI6A 3H2NA 4IJCA 5CAKA 3QPEA 3PZQA 4MWAA 3VXGA 4JQ3A 3IV8A 1S2TA 1FY6A 3W2KA 2AQOA 2NVCA 3PG9A 2BG5A 3L4XA 4PTXA 3H8AA 3MPGA 1AMKA 2Y5JA 4FAMA 5E70A 5A2BA 2FTYA 3H21A 1VFUA 4ZENA 3W26A 5LA2A 4CN1A 4PMRA 4PODA 1K8CA 1ZRQA 4TV5A 5EBUA 1JL8A 2PBGA 4RX0A 5CZTA 4LUJA 2G41A 3PBGA 1LUCA 1MXGA 3TNOA 1JZ3A 1U5JA 1WCGA 1P1XA 4L1GA 4NSBA 3SAZA 1J96A 3PTQA 1W3NA 1W5QA 3QPYA 5G2WA 3RLHA 3QQ0A 1ZCCA 1KLZA 3T81A 4JIQA 1RA5A 2Z2AA 2VCCA 1XFCA 3WFZA 1F73A 1JQVA 1VBJA 4F0HA 1LOLA 2DIEA 5MHBA 2E6AA 3B8IA 3NSXA 3W1LA 2F84A 3ITTA 1E5NA 5DF0A 1O1HA 5I3FA 1R6WA 2W0UA 5HJYA 3RCMA 4U33A 3VGBA 1FOBA 3T05A 5DQPA 1IEIA 2VEIA 3OA3A 1G9HA 3E2RA 3UXIA 4ENLA 4Y96A 5HINA 1TIWA 5B7YA 2WZEA 3CZ8A 1VLIA 4BI5A 3MMDA 1DQUA 4LJ3A 2CFFA 2Z25A 1TRIA 1PDZA 3MTWA 3DBPA 1KQZA 1LZOA 2A3HA 2E77A 1L9WA 1DXIA 3SZ8A 3KOZA 1F07A 1OFPA 1E9ZB 2BOFX 2G5WA 2PD5A 2PDBA 3QW4B 3KE0A 4MJMA 1XWYA 4ATWA 3W37A 1ZPTA 4R7JA 4ZQMA 4LYQA 2O92A 2F9RA 4OWGA 2QJNA 1JF6A 2G0WA 2IQ0A 2W67A 1N55A 1TTIA 4PUKA 4Y9OA 4PE8A 4M24A 1E0VA 2VYOA 1ME9A 1KLYA 3PFRA 2Q09A 2CCRA 3M43A 4GJ1A 3IJDA 1TVNA 4U5IA 2PDIA 1XPYA 3SUSA 2PDPA 4EPKA 1G7VA 5KTLA 3EYPA 3I7QA 3QLDA 1BXBA 3WBYA 2DIJA 1GOIA 1RALA 4UFIA 1Q7ZA 4BA0A 2IPGA 3T0DA 1C91A 2PP3A 3RM9A 1GPFA 1F3TA 5CGMA 1J79A 3E6EA 4Y9PA 2FZ8A 1GT8A 2QT3A 4JEJA 4LXFA 5AHFA 1ZENA 3ARTA 5AB3A 1I2OA 3M0ZA 6REQB 2J8GA 3MS8A 2ASHA 3BTNA 4PL1A 3KFTA 1GJPA 2R24A 2F61A 5K9CA 3DGRA 1AD1A 2EXOA 5E09A 4MG4A 3A3WA 4M29A 1TSIA 4HKPA 3O16A 3SIZA 4N9DA 3W70A 4F0KA 4BKNA 4Q7BA 3AU6A 3WL1A 5DELA 4NXSA 4C6PA 5C2CA 1VFTA 2Z24A 3GNOA 1TJ1A 1VD6A 3N14A 2G3FA 1H11A 1R8LA 2YA1A 3SW6A 1XLAA 1MZRA 1J0YA 4QEEA 3NQ2A 4O8AA 1K77A 5AHNA 1VJZA 4JYEA 4PUJA 1E9YB 1YBQA 4AAJA 1V93A 4LRSA 4YVPA 4YHGA 3OHMB 3LA4A 2YDAA 1V51A 3TN6A 3WBEA 4MJZA 3MJMA 4N9CA 4M56A 2QDDA 4NVTA 2H9AB 3PUGA 2FKPA 1OFBA 1KBLA 4LAKA 4LCSA 2YA0A 3LCLA 3VE9A 1Q66A 4GQRA 3H4XA 4HPXA 4A8RA 3NQBA 1J4EA 1RH9A 1W56A 3CB8A 1LBMA 4B2DD 1IZCA 1KR0A 5D02A 4X63A 1QK2A 3CU2A 4RDYA 5AC8A 4QP0A 1A80A 1M3UA 3VGHA 3G2GA 3AZSA 1ZBCA 4CVUA 1BWKA 1GTHA 3CB3A 5LXXA 3H7UA 3RAOA 4TX8A 4ZO9A 4MY8A 1TCDA 3H55A 2JF7A 3HGJA 3BAXA 1ITCA 2I7GA 3AXIA 4EOUA 2GLKA 2AGKA 3BC9A 3B0UX 4M51A 4J5NA 3ORWA 3IACA 4XTDA 4AWUA 4LT9A 1OC6A 4S3AA 5BOEA 1FH9A 1S5VA 3W74A 3QR3A 1E5JA 4UTKA 4C1NB 3NCOA 6TIMA 4W8LA 3B06A 4NZFA 3LCFA 2FTPA 2FPVA 4BS0A 1S5TA 2J24A 3R58A 4PBGA 4GQGA 4HPHA 1J10A 4AHOA 5MKGB 3TNBA 3C2VA 3CL7A 5T26A 1J0JA 3EMZA 3CTLA 3ALFA 1LL7A 3UWZA 3N4FA 5C70A 2VC6A 2J7FA 3W25A 4O1BA 4E2OA 2ZX9A 1XPGA 2J7DA 1YXYA 3A3XA 5LSMA 5L6UA 1EX1A 3MU7A 3GXPA 3MQTA 4ICCX 4XQ6A 1I2RA 5D05A 3UA3A 1VR6A 3CMFA 4IX0A 4JTRA 3WDHA 3QR0A 5EMYA 1UIPA 2E3ZA 1REQB 1DQWA 1TYGA 3MMTA 4LEQA 3B9DA 2VGFA 3G5EA 2CESA 5M5DA 2WSPA 1GQIA 4KMQA 1D7FA 3TLQA 3N3MA 2V3EA 4K6AA 1NVMA 3K4AA 1WB0A 1XFBA 2E1WA 5CBJA 2EPOA 3L4VA 4KGJA 3MYOA 4B3KA 1OZQA 4JD4A 3SCRA 2ZUWA 2V38A 1ZGDA 4QE1A 3T6CA 4ZB2A 3F4WA 2XTKA 1V3IA 2OG9A 1MUCA 4LUTA 3WQVA 1LQ0A 4BEUA 3FIGA 3EWWA 5IHSA 1I8JA 3HPAA 5DBTA 1QWKA 2BVTA 2W92A 2BOGX 5IFTA 1E1CB 4QS6A 4J3UA 4A3HA 2Q8XA 1MRAA 5TQLA 4L6HA 2V67A 4TQTA 4AWTA 2X7VA 4DJEC 4KCTA 1HUVA 1U5VA 4TMCA 3GD6A 2E28A 4KS0A 3TW7A 4AY1A 3ARXA 4PR4A 1SPQA 3W7LA 5TF0A 2A5HA 5C54A 3GVRA 3V7PA 1ZY9A 4C5YA 2OJPA 4C1LA 3E2QA 3M5YA 1Q4WA 5LIUX 2HDJA 4ORMA 1KRAC 4JFVA 3OBKA 2Z2BA 4NJKA 3W7KA 3RFAA 1X1ZA 5H6HA 3PPFA 3IVSA 3FDKA 1TREA 5J5DA 3ABSA 3TJXA 3QRHA 4I7UA 5A6BD 2UZ9A 2OLHA 1UW9A 5I3HA 1QNSA 3TJ4A 4RPPA 2WNWA 2CC0A 1W17A 3CQ0A 2QS8A 2GVJA 3AXMA 3RHGA 4W7VA 3N9SA 3ISIX 4POCA 4E38A 1OEPA 3GTNA 2EPLX 1HGWA 2DV0A 2CZ5A 3UW6A 2GJPA 3IIVA 4JTTA 5AZ1A 2WAGA 2I14A 2EPNA 5CQ1A 1SM9A 1E6NA 5GJNA 1S3TC 1C3FA 2VM8A 1JULA 3PPCA 1PUDA 1NIUA 2VQTA 1EP1A 1W1YA 4M80A 1GZJA 2ZFAA 2Z7GA 4NP7A 2HNHA 4Y90A 3VIMA 3C3NA 3EA1A 1P1MA 1WXZA 4XAZA 1UP2A 2QUNA 4MM1A 2JE8A 3HF3A 4WSJA 1QBAA 2WYSA 4UTMA 4C65A 3N2MA 2ZOXA 3URQA 3NL3A 2CHNA 2WLZA 1R2SA 3E74A 4B5XA 3MBDA 4HMCA 4LS0A 1DE5A 2XGZA 2E67A 3VNLA 4OUEA 1V6VA 4W84A 3H4WA 2DQWA 2INZA 4AZCB 1UR2A 2FFCA 4DEFA 2UY2A 1YDYA 5XINA 3OYXA 2HK1A 4UQCA 1ZNNA 2FPTA 3NO5A 2IPJA 1Q2SA 1O7AA 4F2TA 2YCJA 4R53A 2XIBA 1EOMA 1OINA 2O9TA 5IBXC 5D2YA 3HQOA 1XH1A 3EDEA 3KX6A 2TSYA 2PDMA 4XWUA 1ESWA 3KBSA 3AYVA 1H09A 2ZZ4A 2J8TA 5CGQA 4K1GA 3ONCA 4NI3A 1KW1A 3FKKA 5GPRA 3AJXA 6XIMA 1KBKA 2YKKA 3W84A 1FRBA 1FTXA 2MNRA 3VIKA 1BAGA 2F6UA 3VDHA 4JXCA 2QCLA 3BGAA 4XUGA 1TV2A 3MT1A 4GRSA 4FX6M 1M65A 2HE8A 4O4WA 2VZTA 4QE5A 5FOOA 3PUOA 2YPIA 4ALDA 1S39A 3BJFA 1LLZA 4CNOA 4ZSUA 2PD9A 3NUKA 2GDUA 1TWWA 3WQGA 1ISZA 5HK4A 3NPUA 3GG0A 1GPWA 3PBMA 3NYZA 3H2OA 3PZ9A 3T55A 3SCTA 4MDOA 3W71A 1HJSA 1IT7A 4O12A 4H8HA 4UTUA 3AHZA 4FK9A 4MVAA 4J27A 4RLIA 1WDRA 3L21A 2GUUA 3VOIA 5LNWA 3MO7A 3DU0A 4H1ZA 3VYLA 4QQUA 2E25A 4XAYA 5HMFA 4LCRA 1MZHA 4I3GA 5D9PA 1CZ1A 2ZDRA 5FJTA 1XYLA 3ALGA 5CKSA 3GK0A 2BLEA 2XIJA 3EWCA 4IP7A 3RO8A 4GXWA 5FF2A 3U3HA 4QCFA 1TWSA 4AVOA 4XB3A 3HQ1A 2QGYA 4CQ9A 1EPVA 3MO4A 5BU9A 4L4OA 9CGTA 2E40A 4RE3A 1FHLA 2NX1A 5EPDA 3TTOA 4LC8A 1UWUA 3UFYA 1VLWA 2BBFA 2HXTA 4JZ5A 4P7OA 1LWJA 5KEZA 2F7FA 4E8CA 1FWDC 4M6UA 4G9PA 3ABOA 1H61A 1PWLA 3NGFA 2W63A 1VBUA 4L9XA 3AMLA 1ISWA 3CPUA 4D6CA 4H9UA 4O1FA 1JCLA 3W7DA 4K7YA 4NUWA 2GZXA 4A3QA 1EH9A 1ONEA 2Q02A 1B9ZA 2IQDA 4O16A 1YDOA 1UD8A 2C6QA 1K4GA 2GFTA 2OTDA 1BG9A 1VGAA 1OHLA 4HOXA 1QO2A 3UJEA 3DFSA 1AG1O 1AODA 3S9YA 4DELA 1CI1A 4MYXA 8A3HA 1W3HA 3TN3A 3KTCA 3SURA 1QWGA 1PKNA 5LA1A 4GZIA 5DY2A 2HJPA 2O9RA 4U2ZA 4DVOA 1JCNA 4E4UA 4O1CA 1HVXA 4KRZA 2FQIA 1V02A 3CMJA 2GWGA 2HWGA 3BG3A 3UJRA 4AD2A 2NW0A 3BDKA 3WNOA 3TSBA 2CITA 1R9ZA 1IXOA 3K13A 2WMIB 3C2EA 3FCPA 1JYNA 3W2LA 3PBVA 1F8IA 4C6OA 5AKQA 4WKHA 3GRIA 1IEWA 1T0OA 4NAEB 1PE1A 3B8UA 4AXNA 4OIFA 4W88A 3C6CA 4BWLA 5AVNA 2YBUA 1BYCA 1BYBA 3WH5A 4OT7A 4V15A 7TAAA 2D0FA 1CGVA 3DC8A 3WJSA 3O7UA 4Q8PA 3VKDA 3CTTA 4ASTA 1X8CA 3C2FA 4IJRA 3ITLA 5FF3A 4J2MA 1HX0A 4RJEA 3TR9A 1XHGA 1F6PA 3RCNA 4M82A 2ZXDA 3B8TA 1OC5A 2WVSA 2YX0A 4JHMA 1KGUA 3WLJA 2EKGA 3SM0A 3LTPA 3EB3A 8XIMA 1QPKA 1YQ2A 1S46A 4RDWA 4ATLA 2NLYA 1RV8A 2XPKA 3Q37A 2DH3A 3B9OA 1P0NA 1X1NA 4CD5A 4Q4KA 5DEZA 3MVTA 2OEKA 1KM1A 3OVPA 2VFEA 5FF7A 4QITA 1RPKA 1N82A 4OQVA 2DZUA 2VC5A 5DBUA 1V6TA 1L6YA 2BY0A 3TQPA 1DWIM 5DO8A 2AMXA 2BHYA 1O4UA 1W1IE 2WMHA 3K46A 2J9XA 3KVLA 3W22A 3WYZA 3VMOA 1OM0A 3MZ2A 1A50A 1TZ9A 2DY3A 3BWWA 3BLIA 2IKJA 1C8QA 1ZAJA 1WDWA 3S83A 1DORA 1VFSA 1YTEA 3TJIA 2A3CA 4XAFA 2VNCA 4MFDA 4CQBA 4F0RA 5EB8A 3TC6A 2CEQA 2YL9A 4C90A 3A9IA 5AYXA 2AAAA 2QEZA 5E0CA 4GVGA 1UD2A 3W24A 4AIEA 2V8ZA 4JEQA 1EUAA 1BHGA 3WLKX 3S6TA 4O1DA 1T6MA 1XG3A 1TV5A 1OFEA 4TTGA 3EX6A 1TJRA 2ZUTA 3V16A 4G8TA 2B31A 1W1B1 2NXGA 3G8RA 3W72A 5AN7A 5CSSA 3D5HA 2ZZ5A 1ECEA 2CBVA 3UJ2A 1HL8A 4QM1A 3VIJA 5AC4A 2X0HA 1HVQA 4XSMA 1TE6A 3ES8A 1BVZA 4J1OA 3QQWA 3FDGA 3AXHA 1K7EA 1K70A 3NPWA 4FR1A 3ZVHA 5FJJA 2XVGA 4DUWA 3F2BA 1G67A 3KP0A 3GAYA 4UCGA 3UGRA 3RPDA 3L0NA 3HQPA 4CVWA 5CSRA 3WLMA 1MVYA 1WQ5A 4G1NA 4F0LA 3EDJA 3UWYA 1A0EA 5ABTA 3LNMA 3N6HA 2WVTA 3GSMA 4O0KA 1DWHM 2GGHA 3GHTA 3KS5A 5HUPA 5H2ZA 1OX4A 1W31A 3DYPA 1XIHA 3GDLA 1DVJA 5D32A 1BF6A 3BG9A 3PM6A 1J0KA 1JG9A 1UC5A 3ABXA 2FZBA 4O4VA 4OBSA 2VCBA 3W3OA 3BZJA 1YNQA 4K8HA 3SN1A 1H60A 4TXEA 1TPWA 5A6JA 5HJXA 3UVIA 4D6FA 4IXHA 3KRBA 4JS3A 2DW6A 2CIPA 1NOWA 3IIOA 3YPIA 3HBLA 4MKSA 3T4WA 3IJLA 2XDFA 4GQQA 4US6A 1M7XA 3WQ4A 3R8HA 2QCDB 3G8EA 4D6IA 1TWIA 4ZQPA 5EA9A 1HP4A 1TPDA 5FEPA 3TR2A 3WLPA 3ZSSA 3GDTA 1LQAA 3B40A 3T1GA 3VZYA 1W3JA 3GVWA 4MNLA 1G4PA 4GY1A 2NVAA 5IRPA 3UY8A 2V2HA 4PFMA 3TMLA 2AMGA 4B5TA 4B9ZA 2X42A 2E7FA 1BEUA 3K1GA 4LYPA 1DV7A 3T40A 4IOTA 5C9RA 1MI3A 3AOFA 3L23A 4UB9A 2GVEA 4HK7A 5LGZA 1PHQA 2B4GA 4X9YA 3MKVA 3GE7A 2VZUA 4A2SA 3H12A 3HPFA 2WPGA 2A1YA 2Y89A 1LWHA 2A79A 4ACZA 1U5HA 1RVGA 4JTAA 2V2DA 3EPOA 2CERA 4EXBA 2V30A 4IT1A 4YTRA 3VKCA 4NX5A 2XN0A 1OQFA 2XSBA 2BXZA 1XS2A 1AZ1A 1HFBA 3AFBA 3W4RA 4O0ZA 1YEYA 4OBRA 1QHOA 3NR0A 1AZ2A 3JRKA 3W0KA 1LF1A 3TFCA 2FDSA 2C0AA 4W7UA 4BFAA 4AY7A 1H3GA 4CNNA 1OCQA 1HO4A 3SADA 3EKGA 2E9BA 4PTDA 3USZA 4F0SA 3RRXA 3NG3A 3POCA 5AYBA 3OOQA 1GOWA 2TRSA 3IIPA 4OBTA 3W7EA 2V5CA 3H24A 4GWEA 4HB7A 4KEMA 1XGZA 3WF4A 4IUGA 4TUFA 4X0NA 2C7FA 1XIJA 2ZDSA 1R3WA 4DIAA 1W2VA 2Z6IA 3EWDA 1R3RA 3TDFA 2Y4SA 2XWDA 4HN4A 3TU9A 1MEWA 3IUIA 1NEYA 1PKLA 3QOKA 4KCVA 1KFKA 1T40A 1OX6A 5FJIA 3TSMA 3NO3A 3V75A 8CGTA 1CPUA 4JHOA 5A8NA 2WANA 2OELA 4Q8WA 4MB1A 4LALA 1FA2A 2GYIA 2PTXA 3M0VA 1V79A 1P7TB 3HG4A 5HPCA 1A5AA 4Y8EA 1V3KA 4OVXA 2NLIA 4AWEA 1W3TA 3LBCA