1K03A

Crystal structure of old yellow enzyme mutant gln114asn complexed with para-hydroxy benzaldehyde
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
399
structure length
399
Chain Sequence
SFVKDFKPQALGDTNLFKPIKIGNNELLHRAVIPPLTRMRALHPGNIPNRDWAVEYYTQRAQRPGTMIITEGAFISPQAGGYDNAPGVWSEEQMVEWTKIFNAIHEKKSFVWVNLWVLGWAAFPDNLARDGLRYDSASDNVFMDAEQEAKAKKANNPQHSLTKDEIKQYIKEYVQAAKNSIAAGADGVEIHSANGYLLNQFLDPHSNTRTDEYGGSIENRARFTLEVVDALVEAIGHEKVGLRLSPYGVFNSMSGGAETGIVAQYAYVAGELEKRAKAGKRLAFVHLVEPRVTNPFLTEGEGEYEGGSNDFVYSIWKGPVIRAGNFALHPEVVREEVKDKRTLIGYGRFFISNPDLVDRLEKGLPLNKYDRDTFYQMSAHGYIDYPTYEEALKLGWDKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role of glutamine 114 in old yellow enzyme
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
molecule keywords NADPH DEHYDROGENASE 1
total genus 145
structure length 399
sequence length 399
ec nomenclature ec 1.6.99.1: NADPH dehydrogenase.
pdb deposition date 2001-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1k03A00
3DFQA 4JTTA 1YTDA 5AC7A 3CEUA 3L68A 2NWSA 4DXVA 2RDTA 2YZRA 3HGRA 3O07A 1N7KA 5FEPA 4H4IA 1FCQA 3NOEA 4ML9A 1FWWA 1W54A 1KBJA 3U8GA 3B05A 1PCKA 3GDKA 5EA9A 3MI2A 3NG3A 2CLKA 5LGXA 3HG3A 3SJ3A 4DO5A 2EAWA 3E9AA 3V1PA 1YXDA 3LBMA 3MI3A 4O17A 4Q32A 4QQ3A 3TU9A 1W5QA 4IPJA 1QMLA 1I2PA 3PSWA 3UNDA 3NQ6A 5KZDA 1LBMA 1ML1A 4UFLA 2NV2A 1TMHA 2RKXA 1OFOA 4RXFA 1VGAA 2Z1BA 3GAKA 1QWGA 1TV7A 2QCLA 1VYRA 1WBJA 4NJGA 1U5JA 3S1UA 1D3HA 1KM2A 2QAFA 1AL7A 3WJWA 3B03A 3VE7A 2CFFA 3L2IA 3W07A 5LSMA 1QAPA 4R7JA 1UUMA 5C55A 1D3GA 3EWXA 4Y8FA 3S8HA 3GLCA 5E93A 4WX2A 1Q45A 4O12A 3GNDA 4U28A 1HUVA 4LVFA 4YCOA 1RQHA 2J9YA 3LTPA 1V7YA 2A0NA 3HIJA 3IIXA 3M5ZA 4M6VA 3LXAA 4UR8A 2YXGA 3M9YA 2VOMA 3SGZA 3KRUA 4UFMA 4PC8A 3QSTA 4PEKA 3T4CA 3TC7A 4JNMA 3GKFA 4PA8A 4LRSA 5EYWA 4ZQOA 1SUXA 1OFAA 3ABQA 4LVBA 1IIGA 2J9XA 4XTIA 4N9CA 4OQVA 2GQ8A 5AC6A 1P4CA 3DZ1A 5HINA 3A24A 3TQKA 3EX1A 4RK8A 4MVAA 1GVOA 3GDRA 1PE1A 3BG3A 3UXAA 4FEZA 5HWJA 2Z2UA 4GJ1A 4WUIA 3TW7A 1YTKA 1GT8A 3TMLA 3N19B 3CIWA 4O13A 3R13A 4M7TA 1MXSA 1G67A 3BLEA 2YSWA 4W9TA 5AYXA 4HPXA 1PCWA 2BTMA 1DBTA 3RF9A 3FIGA 4GNJA 2C6QA 1YADA 3NQVA 3M0ZA 1GJPA 3QM3A 4UR7A 3UYCA 2Y7GA 3F1QA 4YL2A 1F5ZA 3W85A 4A2RA 5J5DA 3BW4A 5D04C 1FDYA 4LVAA 3BO9A 5DCBA 4WY0A 1GVSA 4CLMA 1KM0A 4MOZA 1TPVA 3W88A 1JUEA 2J9ZA 3S1VA 4BWLC 4O18A 3LHZA 1WA3A 4LS2A 1H7RA 1MO0A 4GRSA 4IWWA 1H5YA 3A22A 3W1UA 3O6CA 2XN2A 3L0GA 4WY0B 4LTSA 2CW6A 4IMCA 1YDNA 4UTWC 2V81A 4YXGA 1W31A 4JX6A 4HPJA 3HF3A 4YWIA 4QM1A 3QQ1A 1OYAA 2PRHA 1DV7A 4DELA 3QMSA 3P67A 1KFKA 3LRMA 5EPDA 1W56A 3UXDA 3U2OA 5BMXA 2ISSA 3BV4A 4FO4A 3N34A 1GVRA 2Y7DA 4ZL1A 1A5BA 5D2TA 1W5MA 2Y6ZA 1JCXA 1BEUA 1Q6QA 4TMCA 3G1AA 2YFOA 2C13A 1X8FA 1W0MA 4I7WA 4PH6A 4IMGA 2ISVA 3NVTA 1X6UA 4FXSA 4K6AA 4LW7A 3BLFA 1JCYA 2YPIA 1WOAA 1RD5A 2FJKA 1WQ5A 3TE9A 4HIBA 3PUOA 2QUUA 1TQXA 3K30A 5LHFA 5LNRA 3DU0A 1VR6A 3MBDA 3QH2A 1WYIA 1OK4A 4UC5A 1P0KA 2GOUA 2QCFA 4ADSA 1PIIA 2GQ9A 1TQJA 5CZSA 5LKYA 2CLEA 1ME9A 1KBIA 1FWNA 1KLYA 2GPTA 4AHOA 4O0ZA 5HR6A 4M7SA 1KV8A 3QJAA 3NM1A 4HHPA 4JX4A 3F4NA 5U4NA 5LZLA 2H8XA 3FYOA 3PB2A 3SECA 1IGSA 3B4UA 3M16A 3HB9A 1R2RA 2QCMA 4OV9A 1H62A 1JVNA 5HQEA 3YPIA 3PM6A 1OHLA 5E1QA 2E5CA 3A21A 5KZEA 4IX0A 4ZQRA 4ONVA 3M5XA 3GYEA 1VCFA 3UWQA 5DCEA 4PTNA 2WPBA 5BNKA 3SFKA 3EWYA 3CM4A 3IVSA 3WJZA 3WFAA 3A5FA 4CQAA 1W37A 3WK1A 2GUUA 4UTKA 1MSSA 5F2MA 2FFCA 1TCDA 1SW3A 1XI3A 3G8RA 4B5NA 1JCJA 5HJLA 1W1ZA 4Q4KA 3N2MA 3UPWA 3C3NA 5IBXA 3WJXA 2BXVA 2V0TA 2FPYA 3JR2A 3IGUA 1JUBA 4ZZ9A 3F4WA 1DHPA 1DJNA 2FIQA 1S5WA 1HL2A 2FLIA 4MKNA 4XKYA 5AHLA 4NZJA 1MEIA 2VC6A 4JYEA 4X9SA 3GDLA 1EX5A 1NVMA 3LCIA 3UWUA 3W2NA 3UQNA 4K37A 1R2SA 1VQTA 2YW4A 3AO0A 3UPBA 5K2ZA 4GWEA 1YPIA 2Y61A 3G1YA 4EF9A 1TJPA 1OX4A 5FF3A 3S1WA 1TPH1 5FEZA 3PBYA 4NZFA 2X1UA 1I2QA 3P62A 2C18A 4O0KA 1CX9A 1KV5A 1WXJA 3SIZA 4ZQNA 2G5WA 2VENA 3N14A 3ZWSA 2ZZ2A 4CCDA 4LV4A 1AL8A 3CC1A 3H55A 4LVGA 3W3OA 3O8AA 4I7VA 3GAYA 1SSDA 2QDGA 5HUPA 4ZMGA 1ZJIA 2DZPA 2E68A 4OV4A 2ATSA 3HGOA 3EX3A 1FCVA 5KSWA 4HNUA 4O50A 3DI1A 1G4PA 4JTIA 5CZJA 3FEMA 3W1PA 3LCGA 2AQWA 5D05A 1H7WA 1LOLA 1K8ZA 4MJZA 3C2OA 3QMTA 5DXXA 4LC8A 2DJLA 1DL3A 2E6FA 3TC6A 2FQIA 1Q6RA 4WXZA 1AK5A 2VFIA 5AB3A 8TIMA 2ZRXA 3VCRA 3G0UA 1PHQA 5KMYA 4IMEA 3DHFA 3O15A 1TV5A 3R12A 3P5ZA 4PODA 5AHNA 1OFBA 4QNWA 3W7EA 3ZS4A 4HSNA 1QCWA 3ATYA 5D30A 3STEA 1QPRA 4JIQA 5SWUA 1FX6A 4X3ZA 4MFEA 1XDMA 2CLFA 3L65A 3OBKA 3TCEA 3LDVA 3VNDA 1JCLA 1VZWA 4MFDA 1X1ZA 4QITA 2A6NA 3C2RA 4XTDA 3CTLA 1KFCA 3HPSA 4MLRA 3TMQA 3NEVA 2VEMA 3B8DA 1T8XA 1A50A 3QW4B 3M43A 3PBWA 3QMRA 2Y63A 1XC4A 1GOXA 3W75A 5ABTA 1VPXA 1NFBA 4O53A 4MIMA 4CQ9A 2V2HA 3EWBX 2R94A 3I65A 3FJLA 3GNNA 3MUXA 1IXQA 3BARA 1GZGA 3UWYA 5LNVA 1K02A 3W2MA 1FQ0A 5H2ZA 4TU1A 3T78A 2ZDRA 3LGEA 4PFMA 3Q37A 4A21A 2R8WA 4R34A 1I2OA 2ABBA 4AB4A 2TPSA 4S1FA 1Z42A 2ZRWA 4OGZA 5CZTA 2X1TA 4WQ6A 1TREA 1S3HA 2YYTA 3CQ0A 3KRSA 3TSMA 3TSDA 2B7PA 5I3HA 4OHQA 5IBXC 4LOCA 2DZSA 2R91A 3WK0A 4K36A 1T99A 3R89A 1ZAHA 1EUAA 4NU7A 2E6AA 3IIVA 2WJZA 5BW6A 2TYSA 2J6XA 4ZQCA 4CQ8A 3G0XA 2EF9A 1LP6A 3G18A 3PY2A 2YGYA 1OX4B 1YXCA 3BW3A 3KVKA 3IV3A 5A5WA 3CT7A 3G24A 3E12A 1OYCA 4IJBA 2B0MA 2VFEA 3O16A 1G4EA 2NXIA 2GVGA 1DORA 4K7VA 5HULA 1GG0A 1KW1A 2I14A 2Q8LA 4GUGA 3HG5A 4FF7A 3NQ2A 3LX9A 3GB6A 2EPHA 4JICA 3O06A 4Z1CA 1TIMA 2QCEA 2VXNA 3CLMA 2W0UA 2A7PA 4GUJA 5F1VA 2E6YA 3LXBA 4O8RA 5J5RA 4ALDA 3W84A 1GPWA 4C1KA 1H60A 2H3BA 1GQNA 4JTFA 1VHNA 5L6UA 3C2FA 1LRTA 1Q6LA 5EL1A 2DZVA 3GR8A 1DKWA 2CLOA 2J88A 3NNTA 2CZFA 2PRLA 3PB0A 1QR7A 4JDYA 1WX0A 4RLIA 2E6DA 1E51A 1JQXA 3S9YA 3STGA 3W7HA 1OF6A 1XBYA 3U6WA 3I7QA 3DHDA 3UY7A 5G4WA 4XBKA 4RX0A 3IRDA 5T26A 1JCNA 1SPQA 5DBTA 4C1LA 1B3OA 1G7VA 1SO5A 3A5VA 5AHMA 3SY5A 2HSAA 3W71A 5HNRA 4QIUA 1YDOA 3DFOA 1C8VA 1DQXA 3E02A 2E5BA 4E0CA 4N02A 5D2XA 5A8GA 4UXDA 3DKJA 1EP1A 2DZTA 2O7QA 4NXSA 1NF7A 2FB3A 2Q3RA 4AF0A 4H3DA 5F4WA 1R30A 1LRQA 3O1NA 1B4EA 1F6KA 3QZEA 3V75A 1OFRA 3NL2A 4H6KA 4NXKA 3E0IA 3G3DA 2V9DA 3OG3A 5KINA 3L5MA 1H1ZA 2NUYA 5L9FA 3PF3A 1NEYA 5DELA 3LRLA 4Y9AA 1I8JA 4ZQPA 4UTJA 4UIOA 3GIYA 3W7OA 5HWMA 3MP3A 2OJPA 3NQ7A 1EWDA 4FIQA 3ABSA 4DF1A 3P80A 2A5HA 1OFPA 3L67A 3PSVA 4JS3A 3MW7A 2VFFA 2WSRA 3TXVA 1GWJA 5CPMA 3TAKA 4Z1AA 1H7OA 1Z44A 4FB7A 1ICQA 3W86A 2BZNA 1XBZA 2ZCGA 3DH7A 4QJ1A 3A23A 3LERA 4JXCA 3UWVA 2GJLA 2NX3A 2JK2A 3TKFA 3H53A 3LCWA 3NPXA 1FUYA 3ELFA 1VYPX 1F74A 3W73A 1L6WA 2ZRVA 3GDMA 3C52A 4XKYB 1Q6OA 2GQAA 4UFKA 3DI0A 1LBFA 3QPYA 4IX2A 5IM51 2IQTA 2YW3A 2PRMA 1H7XA 2Y7FA 5CSSA 5FEXA 4O10A 4X2RA 3M1ZA 3VI2A 4K7YA 2VEPA 1XM3A 3HGSA 3W23A 3S6DA 1L9WA 1SZFA 3DXIA 4GBUA 3W74A 3W7JA 4DF2A 1FXPA 4WZHA 1H51A 4MZ8A 1K7EA 4GFSA 5AHEA 4Z08A 3HGJA 2O7SA 2TSYA 3P8JA 3QSRA 1F73A 1TJRA 1OABA 4MY9A 2CLLA 5FESA 5I3IA 1GTEA 1UCWA 1GYNA 3UZ5A 3W7NA 3D0CA 3W1NA 3G1DA 2FDSA 1O94A 1FCUA 1X1OA 5G2IA 3M5YA 1TTPA 1ME8A 1KTBA 4JIPA 4LV9A 2JKEA 5CPOA 3R5EA 2H90A 4QAIA 4IPIA 4O19A 1ZHAA 1QO5A 4HN4A 3NXFA 4LT9A 3B0UX 3STCA 1L6SA 1SO3A 3GXPA 4LC6A 4ORMA 3DENA 5D02A 1FWTA 4M5PA 4Z1DA 1AW2A 2OX1A 5F1UA 1SSGA 1L6YA 2F84A 2A6LA 1F2JA 4JTJA 2YR1A 2E77A 1PV8A 3ZWTA 3TK7A 4TO8A 2OT0A 3RLUA 2LLEA 5DY3A 2ZZ3A 1TPDA 4LS0A 1GTHA 3W7DA 1W5OA 3MMTA 3UWZA 1G4TA 3HMJG 4CNPA 4FNQA 3EKZA 2C16A 1SQ7A 3A9IA 1RR2A 3UZJA 2DJXA 2NLIA 3OA3A 3B04A 2ISWA 5AOUA 5DY2A 2P1FA 3LV5A 3TW6A 3W1RA 3LM7A 3Q94A 1SU5A 1W5PA 5G1TA 5EKYA 3NPUA 4EVZA 4NT0A 4O28A 1XDLA 2ZRYA 3FKRA 2CLHA 3BW2A 3O6DA 2A21A 3C2EA 3N73A 1KM5A 3KVJA 4KWVA 4N2YA 4FNUA 3M6YA 3KFTA 2YX0A 4MY8A 1A5AA 4LWWA 5AFDA 3AJXA 1EB3A 2GJNA 3LI1A 1TYGA 2OMAA 2H6RA 3WK2A 1TTJA 3G3MA 3MHFA 2YDAA 2P0OA 1QOQA 5D38A 3W1LA 5KTLA 3W7KA 4X22A 1F76A 4BI7A 3W72A 2WNQA 2PURA 2CWNA 3NM3A 6TIMA 4Z0SA 3NQCA 3C61A 1SFJA 1HO4A 5CPNA 3W22A 3JS3A 4JYDA 4JYFA 3W87A 4UTHA 3INPA 1OG0A 3FJ6A 1RQEA 4P61A 2VFGA 3G1FA 4OT7A 4HNTA 7TIMA 3DFNA 2FPVA 3NL5A 5DN1A 5GVJA 4RXGA 3PAJA 3C0JA 2VKZG 1XCFA 2I9EA 3W7GA 2WSQA 4OWGA 4K39A 1Y0EA 1J5TA 3BK0A 3Q58A 3EX4A 5AYZA 3T55A 3BGGA 4BWLA 1W8SA 4AH7A 3IIZA 2X1RA 5CKSA 3M44A 1LROA 4JY9A 1KFBA 3SI9A 4QNEA 3L0NA 2H3DA 3TSBA 3TDFA 4DPPA 3EWZA 5HWNA 3FA5A 3QW3A 1LOSA 3RK8A 4NVTA 4UTMA 3LCHA 1U83A 2VELA 1HTIA 1OF8A 2TRSA 4JTSA 3SSJA 2ZRZA 3MP5A 3P81A 4EIVA 3WK3A 3KVLA 1I4NA 3NQEA 3SZ8A 4JTGA 5K9XA 3IIPA 2G96A 3LHUA 2RDUA 4NX5A 1FDZA 3USBA 2KZHA 4IXHA 3S0CA 1G4SA 1TRIA 3LLDA 2AAMA 4KWWA 3NQMA 3MWAA 3CWNA 4UMCA 4LVDA 5U7SA 3LXCA 3I7RA 3P5YA 4KFNA 3W76A 4O52A 1T96A 2Z6JA 3NPVA 4XQ6A 4FNTA 3QYQA 2CZ5A 4N9DA 2NXHA 3TNOA 2ZRUA 5C5YA 2WKJA 4G1KA 2CLIA 1YXYA 2BX7A 3HJZA 3T44A 4WOQA 3RFAA 1WBHA 4N4QA 2QJGA 5G1YA 3DFSA 3KOFA 4XWUA 3ABRA 3ZFHA 2DP3A 4PCFA 1K8YA 5F4SA 1QFEA 5KITA 1KM4A 3TJLA 4WOZA 3TV8A 3B0VC 1TTQA 2QF7A 1G6CA 5G2WA 4N6FA 2X2GA 2B4GA 2W6RA 3GKAA 2QCGA 3W2JA 3CEPA 1EP2A 1PL9A 2NUXA 3LHTA 1YLVA 4QSHA 3STFA 1ZCOA 3PBVA 4MUZA 3EKLA 1F05A 3P84A 4BFAA 2XFWA 3DAQA 3O63A 2WQPA 4L4MA 1EWEA 3IVUA 3NQ8A 1DOSA 5D33A 2XN1A 1Z48A 1JRBA 3P61A 1UASA 2NX9A 3LRKA 2BWGA 3R2GA 3WJYA 4A29A 2QUVA 4RZ4A 3TH6A 1IXOA 2G95A 5CG7A 2G97A 3GZ3A 4OBTA 3F03K 3IVTA 4DPQA 3P60A 1H63A 5E0KA 2Q3OA 2DZUA 1UB3A 1VC4A 3M5VA 4NJKA 1B4KA 5EBUA 3ATZA 1J2WA 2VEKA 4OU1A 3PS7A 3B06A 3NGJA 3HPZA 5D2VA 3LHWA 1VS1A 3G8EA 1XKYA 3B0PA 4R53A 4IMDA 1SW0A 3OVRA 1TPB1 3LCLA 3I6RA 1BTMA 1SZEA 3DKLA 1V5XA 3W7CA 1XBVA 5I3JA 2C0AA 2F7FA 2ZZ5A 3PC0A 3W1MA 3EX6A 4CNOA 2VEIA 4TX9A 3T40A 4JD4A 4TIMA 5BOOA 1UJPA 3N3MA 5G2HA 4RJEA 2VFHA 2QCHA 4P2VA 4XZ9A 2OCZA 4M19A 2BSLA 3HO8A 4IUOA 1KLZA 3G1VA 4Y96A 1OYBA 5D2WA 2RDWA 4GC4A 1RZMA 3PUEA 1VCGA 1YDVA 4AHQA 1K3UA 2Y85A 3GR7A 4JTHA 3CHVA 4JEQA 1LDCA 3NQDA 4HKPA 4JDBA 3BVJA 2TMDA 1HO1A 3MYPA 2QKFA 1MEHA 3W1XA 3NL6A 4PL1A 3P82A 1LCOA 5TQLA 4DF0A 1H61A 1C9DA 2GVJA 1MZHA 4Z1BA 1WOBA 3RNDA 1ZNNA 3PG9A 4FX7A 1EP3A 2JBMA 4NNAA 1EUNA 4E2BA 3CIXA 3TQ0A 3HQ1A 1TV8A 5LNUA 2ZQ0A 1ZAJA 1LLWA 2ZTKA 2QAPA 4BI6A 1G7UA 4N6EA 2EKCA 2CZEA 4O16A 5D37A 1FWSA 3HG4A 3W7PA 5D09A 1KFJA 4A22A 4BR1A 4A3UA 1ALDA 5FF2A 1KA9F 4UNKA 3QC3A 1THFD 3EWUA 3HG2A 5LHEA 5BMWA 1TSIA 1K7XA 3LCXA 1IIHA 2A7NA 1LTDA 1ADOA 1KFLA 5F2GA 1R47A 3O05A 5FF0A 3BG5A 2Z0IA 1SO6A 4HNNA 1N55A 1W3NA 3NA8A 3N9SA 4CCCA 4JTEA 1LRNA 1WDWA 4U4MA 1UBSA 1K7FA 4EWND 1P1XA 2HMCA 2WV8A 3C56A 5H91A 3NDOA 1AMKA 1I2RA 5DXYA 1Z41A 1EPXA 3GXTA 1XBXA 5TBOA 1KTNA 4Z0JA 5D03A 1ME7A 4NNCA 4K8EA 3E49A 5C2XA 5HMSA 2X16A 3TXZA 1PVNA 3LTYA 4BK9A 1A53A 1DJQA 4LU0A 3IIOA 3C2VA 1ICSA 5FF4A 5C6MA 3TROA 3FS2A 1OK6A 1H1YA 3PBUA 2WNZA 1H7NA 1VH7A 2Y70A 4IGHA 4UTWA 2I1OA 1X7FA 1I45A 3IEBA 3LB0A 4GUFA 1NSJA 1G69A 4RZ6A 3OVQA 3THAA 4GXMA 3W1QA 4UTTA 1OJXA 1ZENA 2ATMA 4O14A 3PWAA 5FF7A 4AWTA 4AVFA 1H7PA 1OX5A 2ZZ6A 5HUOA 1C29A 3S5OA 5FI8A 4FNPA 1QPQA 4MLJA 3I68A 1SR9A 5LGZA 1O5KA 3P74A 2DU2A 1IXNA 3TJXA 4FIRA 1LYXA 3LV6A 3W9ZA 1QNVA 2V5LA 3IGXA 3KAOA 1IF2A 3QQ0A 4ORIA 3EX2A 2WNNA 3FOKA 2Y62A 1JJKA 2FTPA 3GXNA 4O1DA 4ZVJA 4S2BA 4WD0A 1VYSX 4BF9A 4EF8A 1HFBA 2C14A 1SZNA 5TIMA 2RFGA 3UWWA 4AWUA 3LTSA 2YFNA 3RMJA 4MYXA 5DLCA 3QRHA 3W1TA 4XUGA 3TAOA 2AGKA 3TUUA 1TRDA 1FWRA 4ADUA 3W7LA 5DBUA 3P7YA 3L5LA 2X30A 1AG1O 3QEZA 4RV8A 4LS1A 3QFEA 4QISA 5EMUA 2ZA1A 1DVJA 2C3ZA 5CSRA 4N9EA 5D2YA 3L66A 3N2XA 3H54A 1L2UA 2P10A 1LBLA 2EGZA 2QEZA 3W70A 4DEFA 2WO5A 2YYUA 4KFPA 1F7BA 3MI6A 4L4LA 1VHCA 3MP4A 1S5TA 2ZZ7A 1EEPA 6ALDA 3TIMA 4UFHA 4NX0A 3TA6A 4WJEA 3DGRA 4IXXA 1D9EA 3LI0A 4Q33A 2J24A 3EXSA 1B57A 2PCQA 1IXPA 3GDTA 2QCDB 1N8FA 3OHIA 4HNVA 1P5BA 5MHBA 2Z6IA 1GVQA 1NF0A 3EXTA 1W3IA 1YTEA 3PULA 1R2TA 1VLIA 1OFDA 4POCA 2A1YA 3VFLA 5C54A 3Q2DA 2V2DA 2BLEA 1WV2A 1XUZA 3NO5A 4DBDA 2QCNA 2PC4A 2E5DA 2HS6A 3C4UA 1JCMP 1UUOA 3W7RA 1TO3A 3M7WA 4A2SA 3NR0A 3SGUA 4AWSA 1KTCA 2CLMA 3EWWA 1JQVA 1WAUA 2QJIA 1ZFJA 3W83A 1PHWA 3N9RA 1GVFA 2J27A 2ZZ1A 4JN6A 4BI5A 4I9AA 3I7SA 2GVLA 4UMAA 4UNLA 2C19A 2E1DA 2FPTA 4GUIA 5CGQA 5I3FA 1MEWA 2OZ0A 3NZRA 2WOQA 2B7OA 1FDJA 5D32A 3BLIA 1XFBA 3MO7A 4MPQA 1TTIA 2DORA 3UD6A 1LZOA 2Y88A 2RHGA 2WSYA 1GEQA 4DQWA 3NZ1A 4ICNA 1DQWA 4JTUA 3L9CA 2UV8G 4UFIA 1VLWA 4DO4A 4GE8A 1ZALA 3MBFA 4KFOA 1R46A 1SO4A 2NXGA 1EA0A 4K38A 1QO2A 3FKKA 3M47A 4O57A 2A2IA 2ZA3A 3MJYA 4IOTA 2HTMA 2E09A 2ZYFA 4GUHA 4UCGA 4AEOA 1SW7A 1RPXA 3BPWA 1KM1A 4FNRA 4EOUA 2ABAA 3GVGA 2DZWA 4FNSA 4K8HA 4O1AA 4RZ5A 3THQA 3HOJA 3OEXA 4LUIA 2NX1A 4UUIA 1QPNA 3HPXA 3O6YX 1AW1A 3EXRA 2YCEA 3LHYA 3WJSA 2ZA2A 1KFEA 1FY6A 3TQVA 3L0KA 4MZ1A 3T7VA 1XXXA 4UMBA 2HS8A 3W7IA 1OFQA 4JY8A 3PR2A 5K4ZA 1SFLA 2OT1A 4MZYA 1ICPA 3W7MA 1W5NA 4NUWA 3BG9A 1TPEA 4UFJA 1M7PA 4FHAA 3TR2A 3NQAA 3DBPA 4Y6GA 3L5AA 4D2JA 1OVDA 2ALDA 4N9BA 1JUKA 1LLZA 3TFXA 5K3VA 4MYAA 1QOPA 2W79A 1VRDA 4UTLA 4OE7A 3S5NA 1K8XA 3LHVA 4O4WA 3EEGA 5F2LA 4YMZA 4MY1A 1P0NA 2C15A 1JULA 5KZMA 3LBCA 3KHJA 4UTUA 1SZGA 3G1HA 5CPLA 1M5WA 1O5XA 3S42A 1FXQA 5K4XA 3G1SA 1O60A 4O1BA 4AMAA 1LORA 3CB8A 1BKSA 5K9DA 3P8IA 2FB2A 4NQ1A 4M6PA 2ZFAA 5CZ0A 4AF0B 1VJIA 5LNWA 3VE9A 3DFTA 1K03A 2R14A 3W2KA 2QJHA 1GYLA 3FLUA 3RLVA 2V2CA 2Y7EA 5AYYA 4LUJA 4ZQMA 3L21A 4LNYA 4RCXA 3MHUA 1LOQA 3FFSA 3KX6A 1O4UA 1EIXA 3ABOA 4NNBA 3NYZA 4PL2A 2V5BA 4WY0F 2QUTA 2V30A 3CPRA 3R8RA 2XN0A 2QDHA 2A85A 3MHGA 4CNNA 3TFCA 1YPFA 3GK0A 5BRBA 4O11A 1HG3A 1BWKA 5AHFA 3FYPA 3W1AA 4AXKA 3LOTA 2A7RA 5EY5A 3G22A 4NJJA 1RQBA 4YLWA 3S5YA 4JGDA 4LRTA 4AAJA 1PS9A 1RV8A 1F6PA 3C6CA 3HBLA 2V8ZA 4TR9A 4LY8A 4ADTA 1H50A 1RVGA 3CU2A 5G5IA 3W6YA 5I3GA 4IQLA 4YCPA 3OVPA 5G4EA 1A5SA 1M6JA 3NQGA 3GX9A 2ZBTA 4I7UA 1W3TA 3KVMA 4NJHA 4E2DA 2X1SA 3KXQA 1QDSA 3LCFA 3BGJA 1JR1A 2NWRA 2ZTJA 3IGSA 1QPOA 3VKJA 4R33A 1O95A 3C8FA 4FX8A 4JR5A 1TPWA 1JRCA 2JKAA 2NUWA 3PUDA 4AHPA 2JGYA 2QCCA 5FEWA 4DO6A 1XL9A 1ZY9A 2H8ZA 1J4EA 1TPFA 2Q8ZA 2CU0A 3DFPA 5AHIA 2V82A 5F2IA 2QR6A 2CZDA 5K7JA 4DBEA 3SR7A 4Y90A 4FX6M 2QCDA 3NL3A 5K9CA 1B9BA 1BWLA 5LNSA 5AN7A 1XUUA 1Q3NA 5DCDA 2DZXA 4S2CA 4KKXA 1FCBA 4J9JA 1NAL1 3KRZA 4NJIA 3JRKA 4FXRA 4MJMA 3RU6A 4RR4A 3MYOA 3M41A 1KM6A 2RH9A 3QPZA 2VFDA 1OX6A 1FBAA 4CCEA 1ZAIA 3S1XA 3NAVA 1TB3A 3UY8A 1CW2A 2A4AA 5AC8A 4N4PA 1S5VA 4O54A 2D73A 1T0OA 2Y89A 1KM3A 4HSOA 4JX5A 1LM1A 1I2NA 1GG1A 3LLFA 4HT3A 4JTLA 1YYAA 2C1HA 1A5CA 3PG8A 4O4VA 5I3KA 3CWOX 4IMFA 4RKAA 4TMBA 4E38A 1AW5A 3W2LA 4UTIA 3S5ZA 1TPUA 3ANYA 2PE4A 1CI1A 1TPC1 4WXYA 2EHHA 1ONRA 2B7QA 3NPWA 3E96A 1M7OA 3TX9A 4O15A 4UTTC 2B7NA 4JTKA 4O1CA 3PVFA 4XBSA 2JKPA 3SW6A 3EB2A 1VCVA 2JGQA 5HR7A 4M6QA 3ZR4A 3OIXA 5F4XA 2NZLA 3W2UA 2NV1A 3G0SA 3QF0A 3NQFA 2ZZ4A 3G1XA 3W7QA 1OFEA
chains in the Genus database with same CATH superfamily
4IP4A 5AC7A 3O3RA 1C9WA 3H2MA 2OODA 3CEUA 2V38A 2NWSA 4DXVA 3QLLA 1J93A 5EA9A 4IT1A 2CLPA 1T6MA 2OEKA 1K70A 5AZ0A 3MI3A 4W84A 2PTWA 2DIJA 3BOFA 1J01A 3PSWA 2VRJA 1LBMA 2QUNA 7ENLA 2NV2A 4PRRA 2OXNA 1CCWB 4A8IA 1OFOA 5HANA 2Z1BA 1S1RA 3GAKA 3AUJA 1QWGA 4KS0A 5JIWA 4C5ZA 1VYRA 3DEQA 4ROPA 3S1UA 1DXIA 4C6NA 2QAFA 3HTWA 3WNNA 1CLVA 2WVTA 1I75A 4DUVA 2HXUA 3UPMA 4NL1A 1QHZA 3GVWA 3L2IA 3SFWA 1KXHA 3BJSA 5C9RA 4R7JA 4F66A 2GUYA 4JQ2A 3BLOA 3EWXA 3S8HA 3CMGA 3IJ8A 4ZXOA 1XX1A 3C8NA 1HUVA 4LVFA 4YCOA 2J9YA 1UZ4A 3UXLA 3M5ZA 4PCNA 3OGVA 2YXGA 2VOMA 3MUZ1 4UFMA 4PC8A 2WMKA 3QSTA 1H49A 3VGEA 3I4KA 4JNMA 2PU1A 3GKFA 4AD4A 5EYWA 1SUXA 1OFAA 4LVBA 1UWSA 2CXGA 4WRHA 4Z2HA 3VFCA 4N9CA 2GQ8A 3QY8A 1KNWA 2YCLB 1S5MA 3WQDA 1P4CA 6REQB 5BXSA 4PTDA 1TA3A 1E4NA 3U0HA 4C6QA 3CTTA 1GVOA 4MVAA 3VOJA 2PDXA 4WUIA 3TW7A 1YTKA 2VOTA 2RJGA 1ZJHA 3I3DA 4LYRA 2PBGA 1V6XA 3R13A 1M03A 4W9TA 6XIMA 2G3MA 3P3BA 2BTMA 4GNJA 3NQVA 3A4WA 4UR7A 1DTNA 3UYCA 3F1QA 4ERIA 1F5ZA 3W85A 3JUGA 1B9ZA 5EMJA 1PXGA 3URAA 4QGCA 5D04C 1N82A 4LVAA 3BO9A 1GVSA 5C2CA 1Y7VA 4OOZA 4BF7A 5IRPA 3R0DA 3S1VA 4BWLC 1OC5A 3B40A 1MO0A 2OQLA 4IWWA 4MJ4A 1H5YA 4C6MA 3W1UA 2DSUA 3DX5A 4WY0B 1YDNA 3AMKA 1E6QM 1GUVA 2NQHA 3WQ6A 2NQJA 1WZKA 1KQYA 3QMSA 1Y5XA 3LRMA 1NQ6A 1W56A 3UCDA 2OX4A 4GKTA 5BMXA 4Q7BA 3BV4A 3N34A 3L2LA 4GIRA 3ZJKA 1NWTA 2HEJA 4EAYA 1R0MA 3RITA 4KCWA 3GNOA 2NVDA 1BEUA 1QI2A 4TMCA 3S2MA 4A8LA 3G1AA 1W0MA 3AHYA 3NVTA 4FXSA 1MDRA 4R3UA 3IJ6A 4TUFA 3AMLA 4HIBA 2PF0A 1UWTA 3HN3A 2YB1A 1M04A 4LBUA 3PZ9A 5LNRA 3DU0A 4Q8QA 3NSXA 5A6BD 4GH3A 3WNOA 3GXFA 2Z1WA 1PIIA 3IJIA 2ZXAA 1TQJA 4M3PA 1CEOA 3IPWA 2BY1A 2GPTA 1X39A 5CPTA 1CIUA 4AHOA 1H09A 3QJAA 4QE5A 3NM1A 4BY3A 3SRFA 2H8XA 3PB2A 1A5NC 3E38A 1IGSA 3M16A 5A6SA 4MNMA 3DIPA 1H62A 1JVNA 5HQEA 3WN6A 3YPIA 1OHLA 3OZOA 2E5CA 2PSNA 2DT2A 5I23A 4IX0A 2WMHA 3EOLA 3V36A 3R79A 2VVSA 3A64A 2YL6A 1RH9A 1WZMA 3CM4A 3WFAA 3A5FA 3ZR5A 1E3XA 2C7FA 1TCDA 4X60A 3W38A 1SW3A 1JCJA 3RRAA 1W1ZA 2VCCA 3MS8A 5IBXA 4Z17A 3SCRA 3UG8A 3JR2A 4QG6A 4CNUA 4ZZ9A 1CXEA 1UD2A 1S5WA 2PCEA 4IG2A 3GTXA 1A3WA 3D46A 3LCIA 1UROA 1UBPC 3CUIA 1EXBA 3BH4A 1GNXA 1QW9A 4B9ZA 3AO0A 1YPIA 2Y61A 5GJNA 3G1YA 4I9JA 4HA1A 1OX4A 1ZBKA 1V77A 3MQTA 2VC5A 4GXWA 2MNRA 1FWFC 3PBYA 2CBIA 1TZZA 5HK4A 1BG9A 2GWNA 4Q8OA 2XTKA 4YHGA 1OIFA 1Q66A 2VENA 2FZ8A 2GZXA 2P88A 3H55A 4LVGA 3UJFA 1REQB 2QGHA 3O8AA 3GAYA 2QDGA 1EPVA 3RPTA 1XGZA 2MANA 1PO9A 5EMLA 4LX4A 4OV4A 3HGOA 3BMXA 5XIMA 2QULA 5KSWA 3PTMA 3S9IA 1JG9A 3RJYA 1UH3A 3FEMA 3ZT6A 5D9MA 3LCGA 4NP7A 2FFIA 3ENLA 5DT5A 2Z2AA 1XQLA 3TC6A 1VFUA 4GKLA 4KRZA 1UKOA 1CLXA 8TIMA 2E8YA 3G0UA 1MNSA 4F2TA 3GYCA 4C7FA 3VVGA 4LXFA 2WKLA 5AHNA 4QNWA 2I57A 3BGAA 4HSNA 4AD0A 3GG8A 2D69A 1B30A 1GCYA 1K4HA 3WLKX 2WM0A 3LN3A 3LDVA 1RCOB 2VWSA 4AXNA 3T1GA 3VNDA 1JCLA 1VZWA 2VP8A 1WCGA 3NEVA 2QZRA 5TF0A 2O56A 2PTZA 1T8XA 1A50A 3QW4B 3RAOA 4JTCA 3SGGA 4HNLA 2FJUB 1VPXA 2VNCA 5A6KA 2NSXA 3OZYA 3EWBX 2R94A 4YIWA 4QCFA 4JFTA 1R7OA 3GNNA 1IXQA 4AIBA 1UG6A 3VGHA 3QZ6A 2HVOA 5LNVA 4TXEA 1KRCC 2VDGA 3T78A 4PFMA 3Q37A 3OLGA 1DIKA 1I2OA 1RCXB 4AB4A 2X1TA 2YYTA 2INZA 1AODA 2XIJA 4F9JA 1D2KA 2DZSA 1XLHA 1UIOA 3LS9A 4XB3A 3F5JA 4ZQCA 4IGSA 1S3TC 2EF9A 4G1NA 1B5TA 3SUTA 1PZ1A 3VPLA 1JL8A 2B81A 2B0MA 2VFEA 3O16A 5BXPA 2ON3A 2DIKA 3BLPX 5HULA 4GUGA 2OQHA 5IHSA 2HE5A 3LX9A 1MRAA 4Z1CA 2J7EA 2VXNA 1HX0A 2F9RA 3WLHA 1XLGA 4O8RA 5J5RA 4D8ZA 4MDPA 4C1KA 4GVHA 2H3BA 1GQNA 2R1LA 4DYJA 5L6UA 5BOEA 2DZVA 3S47A 2PDJA 3WD1A 1EH9A 4HYWA 3AIRA 4OOUA 4L64A 4J27A 3ZZ1A 3NNTA 5HMEA 2PRLA 1QR7A 4JDYA 3BAXA 3S9YA 4DUXA 1B2YA 1MUWA 3U6WA 2PLCA 3UY7A 5G4WA 5T26A 2AL2A 1A3XA 3H2EA 3SEPA 1G7VA 1QUMA 2F8QA 5AHMA 5LIYX 1C8VA 3E02A 3FYYA 4E0CA 2PA6A 4D6DA 5D2XA 4GVGA 1A80A 2VD9A 4FPSA 2YA1A 3DKJA 5BZAA 1UKPA 5IOBA 4AF0A 1BQCA 1LRQA 3O1NA 1YMYA 3EA2A 4FLSA 3B9EA 3QZEA 3NL2A 2HZGA 4Q4MA 2BASA 3L5MA 4HYVA 1XS2A 1H0IA 1I8JA 3EOUA 4MM1A 4UIOA 2FTWA 2VEFA 3OODA 3SAZA 1S2UA 1JDDA 3BSGA 4K2SA 5JUVA 4LB4A 4JS3A 5DFAA 3ABXA 2ZXDA 5JBEA 4JFUA 2J77A 2WC7A 3TAKA 5CBIA 1W2VA 1XBZA 3WQPA 4JL2A 3OTRA 3KCOA 2J62A 1UHVA 1CGYA 4CVWA 2PDBA 1U30A 3P2VA 2QIIA 4IPLA 1KCLA 3NPXA 1FUYA 1B3ZA 1SFSA 3CQIA 3W73A 1L6WA 1ZBWA 3C52A 2GQAA 3VCCA 3QPYA 1H7XA 2Y7FA 4ZFMA 3ZJ6A 4X2RA 3N6JA 3VKKA 1P0EA 4K7YA 3HGSA 3S6DA 6A3HA 1XLDA 5AVHA 1PYMA 3M0YA 4D6CA 2O7SA 1RP9A 4FLRA 4R88A 2BVDA 1F73A 1OABA 3WLTA 2QVHA 1PTDA 4RNJA 1L6GA 3AIUA 4RNFA 2POZA 2VUNA 2EG8A 4IISA 2YB4A 2R9RA 3M5YA 4JIPA 3AZSA 4HZMA 2H90A 3TLQA 1R9ZA 2POTA 1QO5A 4HN4A 4XX6A 3CXOA 1KBBA 1SO3A 3POHA 4W8AA 2HJPA 3DENA 4Z1DA 3EBVA 1AW2A 3DECA 2J66A 2OX1A 5F1UA 1S2VA 2E77A 1KCZA 4JIEA 1UA3A 4IQDA 3T6CA 5LXXA 3XIMA 3MMTA 4UOJA 3NSNA 4JKLA 2WQDA 3T0TA 1T8QA 1R3RA 1E1CB 1LG2A 3OA3A 3NFUA 3B04A 5JQ9A 1RK6A 1SU5A 5G1TA 3NPUA 3TN4A 3CYJA 3DCPA 4O28A 2WMJA 4H1ZA 1WZAA 2CLHA 4CQCA 2DY3A 1KM5A 3LNPA 1OINA 4FNUA 1V8EA 2YX0A 2GJNA 3LI1A 1KGXA 1TYGA 3L2MA 2H6RA 2GGJA 4B4HA 1KBLA 1WDQA 5I02A 3MHFA 2YDAA 1P48A 2GJPA 1QOQA 4IJCA 5I79A 1XGDA 3S2CA 2L5HA 1S38A 3W72A 3EWDA 3QTGA 2JIEA 1HO4A 2G41A 3JS3A 4JYDA 3AYSA 4J7RA 3PHAA 3INPA 2A3AA 3FJ6A 2BBFA 3G1FA 4L6OA 3W00A 7TIMA 5CCZA 2FPVA 3NL5A 3RO6A 4RXGA 4AIUA 4CD7A 4PCSA 1R3QA 1D8CA 1XV8A 4K39A 3N25A 3GBDA 1MYRA 4JTQA 4P8VA 1W6TA 2VTFA 1KFBA 3B9AA 3WQEA 1H11A 3TDFA 1UP3A 4DPPA 1MQPA 5I78A 3TJIA 2C0HA 1SFTA 1I0DA 1QNSA 3LCHA 3VNJA 3A12A 5LA1A 1HTIA 1OF8A 3EPMA 4ZXLA 2SFPA 1I4NA 3LPPA 2GDUA 3TEVA 2TAAA 4NX5A 4Z1YA 4LYKA 4IXHA 3MVIA 1GOKA 1TRIA 3UJ2A 2HBVA 3MKKA 4LVDA 1J6PA 1T5AA 5FIPA 3I7RA 4KFNA 3QOMA 1VBRA 1UR2A 1T96A 4XQ6A 4UQAA 5BU6A 4N9DA 2DT1A 3TNOA 2ZRUA 2DSWA 4JHOA 3NWRA 4G1KA 2CLIA 4XK2A 4PSRA 1G94A 2ZUVA 3RFAA 4QJ5B 1CNVA 3H26A 3NQBA 3SCSA 4Z42C 3ZFHA 3VOHA 3KZPA 5KITA 2G3IA 4V2XA 3B0VC 1MW2A 4HA3A 2W6RA 3W2JA 5A95A 3CEPA 3STFA 3D5HA 2CERA 3CAVA 3ZQ9A 1ISYA 3RILA 3EKLA 2AOSA 2OB3A 4BFAA 1BXCA 4G7FA 3DAQA 1WKFA 3IVUA 4DN1A 1LG1A 1Z32X 2XN1A 1Z48A 1UASA 2XIIA 2NX9A 4FP1A 4RDWA 3VU2A 5A2CA 2QUVA 4RZ4A 3IK4A 1AH3A 1IXOA 2GSHA 2IPGA 4OBTA 3F03K 3IVTA 1DTUA 5E0FA 4DPQA 1W1A1 2E9LA 2XH4A 2JE8A 2VEKA 4XKMA 3PS7A 3RGTA 2O9PA 3CUZA 1XDJA 1XH0A 4B5WA 1XKYA 3DC8A 1NELA 3H23A 4NSBA 4ZSUA 4Z2GA 4ZFCA 3K8KA 4QG8A 3S2NA 3DKLA 4US6A 3AS1A 4AZGA 2PDMA 1BG4A 3EX6A 1QOXA 1C7TA 3XINA 2ZWYA 4TX9A 2F6KA 3VXGA 1DYSA 2OZ8A 1K6WA 3N3MA 2BHUA 4DJFD 1P0BA 1TJ1A 3HO8A 1KLZA 4Y96A 3AYTA 1TCMA 4WKAA 1VCGA 1TUXA 3GR7A 3JZEA 3UYIA 3NQDA 4HKPA 3LA4A 3WUFA 2TMDA 4W88A 2UY4A 1A49A 5CXPA 1H61A 4L1XA 4E8DA 1G01A 1MZHA 3FJ4A 1WZLA 3I6EA 3QXBA 2WMIA 4B3KA 2ZQ0A 1ZAJA 4L4PA 1LLWA 3GU1A 5ABFB 4CD6A 3T08A 4N6EA 3MDUA 3U4AA 5D09A 1VP5A 2YL8A 3LLXA 1V6UA 4BR1A 3H7RA 1ALDA 3OB8A 1JXJA 4UNKA 4L56A 4UQDA 2XVLA 2A3EA 4S39A 3DESA 3O05A 1XWYA 2F6XA 1SO6A 5HJXA 4HNNA 2ZUNA 3EDFA 2Y8UA 3T2OA 3R58A 2DW7A 1MZRA 4EWND 5HNTA 2HMCA 2WV8A 5FD0A 3NDOA 1B3YA 3PWIA 4F0LA 5DXYA 2R1PA 5TBOA 4H04A 5CJNA 4Z0JA 4J2MA 4LUTA 1NOFA 4K8EA 4C6EA 3VCNA 5C2XA 3CV2A 3TXZA 1EQPA 2X8RA 1DJQA 1M68A 1GORA 2Z26A 5EMMA 3FJNA 3TROA 3FS2A 1AZ2A 1UQYA 1H1YA 2O0TA 3UG5A 3GG0A 2XG9A 3EMQA 1GKQA 2ESCA 1QBBA 3EDJA 1EF3A 4DUWA 1NSJA 3OBAA 3WF3A 3U48A 1RBLA 4RZ6A 1DIDA 5JIPA 2A79A 4TVDA 1V0KA 2OG9A 1F07A 1OJXA 1JD9A 4O14A 4PTMA 1M3UA 3PPGA 3S5OA 2OYKA 2Z28A 1QPQA 2PWEA 1W8GA 3WQ8A 5H8PA 1IXNA 4FIRA 3WF0A 3LV6A 4XZHA 2E8ZA 1RPKA 1V6TA 4ORIA 3EX2A 4F0MA 2Y62A 1JJKA 1D7FA 5F7UA 1V02A 4BF9A 1VYSX 4ZA0A 3LUTA 5M2FX 1LL6A 2RFGA 5TIMA 3UWWA 2JF6A 4IP5A 1UD3A 3RMJA 4PE8A 4EXBA 4MYXA 4G8TA 4U10A 1RAKA 2I5QA 4GY7A 4D8LA 1GVEA 5E9AA 5DBUA 5LA0A 5AKQA 4RV8A 5EMUA 1DVJA 5D2YA 3L66A 3CAQA 4D6GA 2XYLA 2EGZA 2WO5A 2YYUA 1UZDA 4KFPA 3BURA 4JN7A 4L4LA 3FVMA 3UG3A 4ZO8A 3QY7A 3RJXA 4DWSB 4W4QA 4NX0A 3TA6A 1TR1A 1FWIC 4WJEA 3ISIX 4IXXA 4Q33A 3B9NA 4AUBA 2CKRA 3RLHA 8RUCA 1IXPA 3GDTA 2QCDB 1N8FA 3W6LA 2WKGA 3VD4A 5MHBA 1B3WA 3EXTA 4FA3A 1Q6DA 3PULA 1R2TA 2Y5SA 2A1YA 3VFLA 5J8LA 1X7IA 5HATA 1ONXA 1TWZA 2V2DA 1X8CA 4EK7A 3KOWA 1GKPA 2PC4A 2E5DA 2HQAA 1JCMP 4QROA 2IKHA 4Q8WA 4AWSA 1E55A 1K8CA 1Q6FA 2DFAA 2Z7KA 4K68A 3R11A 1XYLA 4IHCA 2UWFA 3WLMA 4UNLA 3F5LA 4PFHA 2C19A 3DERA 4GUIA 2D2JA 2XGBA 1BSIA 2WOQA 5D32A 4HMCA 3BLIA 1VFTA 2J47A 3EGJA 1TZ7A 3UD6A 1WP6A 1LZOA 3AROA 3R0KA 1GEQA 1Z3NA 3EYPA 4A3YA 3NZ1A 3APGA 3L9CA 4U2YA 2RAGA 4C6FA 4DO4A 4GE8A 3SCTA 4KFOA 3QTPA 2NVAA 2YCKX 3KBWA 1EA0A 2Z27A 3FKKA 3G1RA 5CAKA 3OGSA 4O57A 2JEQA 4DBWA 1R3WA 4W87A 3UGVA 2E09A 2ZYFA 4Q7IA 3H2FA 4MG4A 4AEOA 1SW7A 3BPWA 1KM1A 4FNRA 4EOUA 2ABAA 4S38A 3FDGA 2FHBA 3THQA 1F61A 4L7ZA 4Z2LA 3OEXA 3WEMA 1JZ2A 1QPNA 1MQRA 5CQ1A 1DPMA 4HK5A 3O6YX 4C7GA 1GJUA 3LHYA 4PMOA 2ZA2A 1KFEA 1BYBA 3TQVA 3L0KA 1VJZA 4GI8A 1QK0A 1V03A 1HJWA 2XH2A 3T0AA 1SFLA 1OCQA 4KF1A 1W5NA 1TPEA 3B8IA 2E9MA 3DBPA 1MDLA 3C5QA 3QKEA 4Y6GA 2C8NA 1GGOA 3ZJ7A 3SRHA 4D2JA 4D6HA 1E0WA 3U3HA 5GQBA 4JKMA 1VFFA 5I3DA 4MYAA 4QJ3B 5B7ZA 1VRDA 1ODZA 2VDIA 1SZRA 1TX0A 3CQJA 3S5NA 1Q85A 4PUEA 5FCZA 2IKGA 1AH4A 1K8XA 4YS1A 3SCOA 1CXHA 4U5KA 3KHJA 4GYKA 5BRQA 1IT0A 2D1ZA 5K4XA 3G1SA 1O60A 3CB8A 3MTWA 1J0IA 5K9DA 1LUCB 1MMFA 3V7PA 3H22A 4PB4A 3EAUA 1PUDA 3XISA 2R14A 2PGWA 2V2CA 3O0FA 4ZQMA 3QPEA 1JZ5A 2VMFA 4KIRA 4GI4A 3ABOA 3ERPA 1EDTA 3N2TA 3PNUA 3KBVA 4MWAB 3R8RA 3GXDA 2QDHA 3VX0A 3BMVA 4F3HA 3O0KA 3WKZA 2V5DA 4ZEPA 3AU2A 3VC5A 4B5TA 3M07A 3MUY1 2A7RA 4C6LA 2PP0A 4MB4A 4Q8UA 1RQBA 4YLWA 3S5YA 3D6NA 1WXZA 5ECVA 3VMPA 2X1IA 1F6PA 4L1GA 3ABZA 2V8ZA 1ITQA 3CU2A 4XVDA 5I3GA 4YCPA 1XRSA 3VKAA 2VRKA 3TWAA 3KVMA 4NJHA 4PMQA 1G9HA 4WDTA 4X0NA 1Q2RA 5LIKX 3WSUA 3BGJA 3E3HA 4IL2A 2Z4GA 3VKJA 4LJ3A 1TPWA 3TYAA 3O9NA 4M81A 3WQWA 3D47A 2XGZA 2QCCA 4JKKA 2XVPA 3QV8A 4H6EA 1QK2A 2H8ZA 4YVPA 1TPFA 1PB0A 2CU0A 3ZXWA 3O2LA 2TODA 3WLSA 2O9TA 2P3EA 2IS7A 1TVNA 2QHAA 2W3ZA 3HJEA 2BS9A 1BWLA 4M6UA 1Q3NA 5DCDA 3WQGA 3B8TA 2J6VA 3O6AA 4HHLA 1NAL1 3FGCA 3BCJA 8XIAA 2X7WA 4ACYA 2ACUA 4LEQA 5JXQA 2KX9A 2VFDA 2D0FA 1KWGA 3C86A 3NO1A 3CAKA 3JU2A 3UY8A 2A4AA 1WO2A 3IACA 1JGMA 2D73A 3ES7A 3K2GA 2PGEA 3VIHA 3GC5A 5LXEA 1ISXA 3DG3A 1LM1A 4A3HA 1GG1A 1E0XA 3WMCA 4KMQA 4AY1A 5B80A 3VDBA 2PDLA 2PS2A 4RKAA 4E38A 3V5FA 3W2LA 2J8FA 2PE4A 1W3KA 1TMQA 3WNLA 4RDVA 3W28A 4UTTC 4O1CA 3SW6A 1VCVA 5HR7A 4M6QA 1A0DA 2ZX8A 3ZR4A 4MWAC 3NQFA 3VM5A 3NZQA 3KWXA 5FJIA 2XVGA 4J5NA 2GGEA 5A3HA 3W26A 1N7KA 3UZXA 4H4IA 1W54A 3U8GA 1VPQA 3B05A 3NOYA 4XAPA 4QRNA 2W62A 2OGJA 2VR2A 3ZLGA 3SJ3A 4DO5A 2EAWA 1HGYA 3LBMA 4O17A 4Q32A 4QQ3A 4KERA 4PBGA 1PWLA 2P53A 3PZIA 3UNDA 4AYSA 1TMHA 4G9PA 1U33A 2RKXA 1E15A 4Q4RA 2CBVA 1ADDA 3FNDA 4WIWA 1WBJA 4NJGA 1U5JA 1CGVA 1W17A 1KM2A 2R24A 1BHGA 4DJED 4EPEC 3OA5A 3WJWA 3KLKA 4DUOA 3B03A 2PD9A 4CVUA 5D8WA 4JBRA 2F6UA 1W9DM 2F2KA 5LSMA 3EB3A 5H1WA 4DBSA 1QAPA 2VGIA 3GVRA 1KR0A 4Y8FA 3GLCA 5TD4A 1E6XM 3QV9A 1J0YA 4U28A 4YPJA 3CL8A 1S5NA 2A0NA 3HIJA 3UR7A 3M0LA 2IPJA 4UR8A 2X41A 3SGZA 3F2DA 3JZUA 2QDEA 3WF4A 5CGTA 3T4WA 4PEKA 3TC7A 3VDCA 4OQVA 3PZUA 3TQKA 3RCMA 3EX1A 4HYRA 4RK8A 4FEZA 5HWJA 1J5SA 2OEJA 1GOMA 1HGWA 1CGTA 1EHAA 2I5IA 4F9DA 1TX2A 3ONCA 2G0WA 3PZVA 2ADAA 3WMSA 4HPXA 1PCWA 3MCOA 4P8UA 3R43A 1BGGA 2C6QA 2Y7GA 1XCXA 3CL7A 4YL2A 1UQZA 4A2RA 1RP8A 3UEQA 4ZB5A 1DWIM 4HPGA 1CGUA 3BW4A 4US5A 3GFYA 3CV6A 1QWKA 1JDCA 1W1IE 5CJ5A 4CLMA 4JIHA 4EKJA 2WC4A 4N7QA 4QTGA 4Z2KA 2V3FA 4MOZA 3W24A 3W88A 4XG1A 1V3HA 1WDRA 2J9ZA 4GRSA 2EXOA 4HMEA 3A22A 1EL3A 2XGIA 4BA0A 3L0GA 2QDDA 4NKCA 4UTWC 5C8BB 3A4JA 4YWIA 3OO2A 5C2GA 1OYAA 2PRHA 3ZR6A 3P67A 4FI4A 4PSPA 3UXDA 4UWMA 1PX8A 2ISSA 3THUA 4FO4A 3HQOA 3WQ5A 4IQEA 4CNSA 1A5BA 1JCXA 5BWAA 1XH2A 3SUVA 3VUSA 2C13A 1HNYA 1X8FA 2BDQA 5AZ1A 1O5QA 2DZAA 2QPUA 5ABHA 4K6AA 2O9RA 3RU8X 1RD5A 3TE9A 3PUOA 1A47A 1QW7A 1BQGA 1TQXA 2I17A 3QYSA 6CGTA 5BXRA 3QH2A 4S3FA 2GOUA 2VT0A 2VX4A 4AWEA 3UU0A 2CLEA 4XZLX 4O0ZA 4LAUA 1YQ2A 2WJDA 1CZ1A 4JX4A 3F4NA 5U4NA 5A8NA 2WWDA 3SECA 1LQ0A 2DQWA 4U31A 3HB9A 5M17A 1O5RA 4RW5A 3PM6A 2DDXA 1AUSL 1KGWA 3D3FA 4ZQRA 2W5FA 4ONVA 2VM8A 1VCFA 3UWQA 2QNEA 2WPBA 1ADSA 3EWYA 4GC3A 3WJZA 4IFKB 4MGGA 1W37A 2VI0A 3WK1A 3WG6A 3MCMA 3A47A 4UTKA 2Y5JA 1IT8A 2FFCA 4TOQA 2GVYA 2GGGA 4Q8TA 3WQFA 3UPWA 3C3NA 3WJXA 2BXVA 3P6LA 2FPYA 1UR4A 1JUBA 1YEYA 3F4WA 3TONA 4DY1A 1IHIA 4R9OA 1P1MA 2WVVB 1HL2A 3M0HA 2FTYA 1JDFA 4NAFB 1R5YA 3SIMA 4NZJA 1MEIA 1PKLA 2XZ7A 4X9SA 4JYEA 1EX5A 3UWUA 1DWJM 1HN1A 2G50A 2XH0A 3CZ8A 4KEZA 1VQTA 3NTYA 4N0RA 3OLDA 3I3BA 4M56A 4P5UA 4LQ1A 1UW9A 1KXVA 3C0SA 4ECLA 3AI0A 1TELA 4PEEA 3BL3A 1TPH1 1HJVA 2X1UA 1I2QA 4NZ4A 4O0KA 2YL9A 3CHFA 1DJWA 2G5WA 2VR5A 3W3OA 4I7VA 4HU3A 4M24A 1V6WA 4ACZA 4ZMGA 2Y4SA 4QLLA 2V5CA 1XICA 3Q45A 2DUZA 2OPJA 4ZE4A 2HVNA 2ATSA 7PTDA 1FCVA 3WF2A 1TWDA 1M9HA 3DI1A 1G4PA 1UWUA 1VBUA 1D7KA 5M1TA 3W1PA 2AQWA 1ITUA 4K3ZA 4I90A 1LOLA 3BZJA 1K8ZA 4HJFA 1GYMA 1WKDA 3AHVA 4J3ZA 4WXZA 1AK5A 2PAJA 3QV6A 1BVWA 5KMYA 4IMEA 2BY2A 3QHMA 5CEWA 3QR0A 4J3UA 3MC5A 3R12A 3P5ZA 1FFQA 2INFA 3GHRA 4PMDA 3W7EA 3ZS4A 1QCWA 1US0A 3FHQA 4QEEA 1QPRA 4JIQA 1XPYA 2PMQA 1BVZA 2OO0A 4X3ZA 1PEZA 3BAKA 4MFEA 2CLFA 2ACSA 3OBKA 4B15A 3FN9A 3WL1A 2YBTA 4GZIA 2D0HA 4GACA 1JF5A 4XTDA 4IG2B 4C65A 4NI8A 2GYIA 3B0YA 2VEGA 5T8GA 1BGAA 1NFBA 3JW7A 1JAKA 3FJLA 1P7TA 2WW5A 4W7VA 3SN0A 3S3GA 3W2MA 2BOEX 2UY3A 5H2ZA 3KLLA 1JYWA 6TAAA 3LGEA 4H83A 5IDIA 2BY3A 4S1FA 1Z42A 4OGZA 4WQ6A 1REQA 3QC0A 7REQB 3QR3A 4BF5A 4B4FA 4OHQA 4LOCA 3VNMA 3KOXA 2R91A 3AFBA 4HQVA 3WK0A 4KWUA 3VZYA 3GH5A 1ZAHA 3WLLA 5BW6A 2TYSA 2PDCA 3TCSA 3K1DA 3TYUA 1LP6A 1ONEA 5KZ6A 4GABA 3PY2A 2YGYA 3BW3A 1YXCA 1TV2A 3IV3A 5A5WA 3CT7A 3E12A 3C0QA 4HK6A 4LAOA 2NXIA 2WC3A 4EX4A 4GGBA 1HJSA 1KW1A 2Q8LA 1QTWA 3HG5A 3QBUA 4FF7A 2GLKA 3WEZA 2VGFA 3WBYA 3AMGA 3MVTA 3CIVA 4FZIA 4EACA 3H12A 3EDEA 2OLHA 4YU1A 3CMFA 6ENLA 4DJEC 3W84A 3MSDA 3N6QA 3IJQA 4QBXA 1VHNA 3C2FA 1MW1A 1DKWA 1AH0A 4IUGA 1WXYA 3S1GA 1IR1A 3U2CA 3STGA 3W7HA 4S23A 1EDGA 4KCUA 1XBYA 1I1WA 1V3KA 4RX0A 4YNGA 3QZAA 1B3OA 5AECA 4Z2JA 4J35A 3VUPA 3SY5A 4HMNA 1O68A 2HSAA 3DFOA 3UXIA 1BXNA 3KBSA 4DHGA 2PDNA 2BODX 3BLKA 4BJHA 2CHOA 4YJ5A 1WDDA 3KDNA 4UXDA 1EP1A 5EMYA 2FB3A 5F4WA 1R30A 3T9PA 4RUBA 3GHSA 3WUEA 1B4EA 3OPSA 1EZ2A 3VIMA 4A8RA 3SCQA 3E0IA 3G3DA 1LWHA 5KINA 3OG3A 3DGBA 1U2YA 1X96A 2NUYA 3VNYA 2E3ZA 5DMMA 3IUDA 3B97A 3LRLA 1LLOA 3VINA 2ZX6A 2PU0A 2YA0A 2J7CA 3MP3A 3NQ7A 1UOKA 3CS2A 4TTGA 5E6ZA 1EWDA 3MMDA 1OFPA 1HL8A 3L67A 4CN6A 1JIBA 5A8PA 3RDKA 4TQTA 1OZMA 1GWJA 3CJPA 4HU0A 5CPMA 1H7OA 4GX8A 4FB7A 1C93A 3W86A 2XDFA 2ZCGA 5J04A 2PODA 3NXLA 3TC3A 2EO7A 3LERA 4ZGYA 3UWVA 3ANVA 4XD5A 2E4TA 5E09A 1Q5MA 4IH3A 2CESA 1KKRA 4XBJA 3KP1A 3GDMA 4XKYB 4M29A 5EMKA 1LBFA 4IX2A 1POJA 2WHMA 3DG6A 3M0MA 1TUFA 3CUHA 3CWHA 2OEMA 4KH2A 4B2DD 3R6IA 1VD6A 1L9WA 3AWNA 4ERAA 1XINA 1FXPA 4WZHA 1J18A 3NZGA 1H51A 1K7EA 3FK4A 3MDWA 1H4PA 3HGJA 3N12A 2TSYA 1CXFA 2OSXA 3N04A 1TJRA 4RDZA 1UR0A 1DJXA 3B3DA 3IARA 1XLMA 4C6KA 3T8LA 3RPDA 3WDJA 3W7NA 1QNOA 3D0CA 2QGYA 3W1NA 3G1DA 3VIOA 1RY8A 2AKMA 4ICCX 3SJNA 4JQ3A 3QFWA 1ME8A 3M46A 3PPFA 5CPOA 4QAIA 1MW3A 5CPQA 3K1GA 9CGTA 2X7VA 1BLIA 2NLYA 3GUWA 3VC6A 1FWTA 4O8AA 1O6IA 4C6OA 4JTJA 3BAIA 1PV8A 3BE7A 3TK7A 3TJ4A 3RLUA 5DY3A 1OIMA 3M0XA 4N42A 2ZZ3A 1M7XA 5CBJA 3MO4A 3SQMA 1FWEC 4LS0A 2G4FA 2HPMA 1HJQA 4CNPA 3ZT5A 3EOOA 3UZJA 2NLIA 3CV1A 4J3SA 3RIKA 4A6GA 5DY2A 3LV5A 3TW6A 3LM7A 1W5PA 4NT0A 1H5VA 1XDLA 2ZE0A 1FHUA 2ZRYA 1RSCA 3FKRA 3BW2A 3C2EA 1UUQA 5CZKA 1BYAA 5I7GA 3KFTA 3LD5A 1OCNA 1XD0A 2WANA 3FGCB 2PWFA 3WK2A 1I0BA 3CH9A 3VOGA 1DEDA 2QJJA 1E6SM 3WLJA 4C6PA 1W91A 3PUGA 2BGNE 1MQQA 1OGGA 5KTLA 3BLLA 3KE0A 3W7KA 1OCJA 4X22A 1EYEA 4BI7A 2WNQA 1Q6GA 5C9ZA 4WGXA 6TIMA 4Z0SA 1CB2A 5FOOA 3WENA 4FLOA 5CPNA 3W22A 3MA8A 2P8CA 3W87A 1UPPA 1HP5A 3S5SA 3FEQA 1P7TB 3AISA 1EA9C 5GNZA 1RQEA 4INFA 2VFGA 4OT7A 1EJVC 2OOFA 3SUSA 3WFLA 1R3TA 2DGAA 3N15A 1XCFA 2HE8A 2WSQA 6REQA 1Y0EA 4E6MA 3BK0A 3E0VA 2AGTA 3LEPA 2HWGA 4BWLA 3EPOA 4AH7A 2Y5EA 4ZOAA 4JY9A 5XIAA 1FHVA 2H3DA 3TSBA 1EJUC 4FR1A 5HWNA 3FA5A 1R7AA 4UTMA 2GSEA 1FWCC 4DNMA 1BAGA 3SSJA 4PMYA 4YTQA 3MP5A 4O0QA 3P81A 3WK3A 2NSOA 2YBUA 3NQEA 1X38A 1CXIA 4JTGA 5K9XA 1C90A 1ZTVA 2RDUA 3AXKA 1A5KC 4H8HA 2KZHA 3QKZA 1G4SA 1Q7QA 2AAMA 3CZEA 4KWWA 5HQMA 4UMCA 3W76A 2Z6JA 2HDJA 3NPVA 3DYOA 4FNTA 3G77A 3IUHA 3AS2A 4IF2A 2WKJA 4C91A 3KZSA 1R9YA 2BX7A 2IW0A 3W4RA 2W27A 1WBHA 3T09A 2QJGA 3TZFA 4DWSC 1XLJA 3PFMA 3KOFA 4XWUA 3V35A 4UQ9A 3VD7A 2DP3A 4PCFA 2XWDA 1ZRQA 1PKNA 3TZNA 2FGLA 2QF7A 5G2WA 2CHRA 1IEVA 2XU2A 3GKAA 1XYZA 2NUXA 2CIPA 1FA2A 5IHRA 1XKJA 1Z7AA 5D9PA 3WH9A 4LCSA 3PBVA 2AL2B 1OGSA 1YX1A 2WHKA 4QEHA 4YTSA 1VENA 4Y9PA 2WQPA 4L4MA 3NQ8A 4A3RA 1JRBA 1NWUA 1JYNA 2BWGA 3WJYA 4A29A 1BYCA 4CQBA 2EG6A 2G95A 1T7LA 2V5JA 4QDPA 5E0KA 5GJMA 3ITOA 2ZUTA 3DFHA 3QHNA 4NJKA 1B1YA 1B4KA 1SJAA 1W3LA 3PZOA 3B06A 4Y2WA 3UZYA 3NGJA 2D24A 4C5YA 5LIXX 1JD7A 4WDUA 2FZDA 3B0PA 1UYQA 3V0UA 4TVUA 3U57A 3U4FA 1XBVA 3F4DA 1B31A 2C0AA 1HVQA 3W1MA 3UETA 3OBEA 3N29A 3T40A 3VOIA 4JD4A 2QT3A 4TIMA 1UJPA 4B2DA 4RJEA 1Q2SA 2ASHA 3AWOA 1FH9A 4IFRA 3ARPA 4RL3A 1CYGA 2BSLA 2YCIX 3G1VA 1GONA 4XV0A 4A05A 3PUEA 1IYXA 4AHQA 1K3UA 3OYZA 4CN4A 4IIDA 4XAGA 3L7RA 1LDCA 4JDBA 2F61A 1XPGA 3VNKA 3MYPA 3PBMA 5I07A 1GQIA 1VKFA 3M0JA 1RUSA 2QKFA 1EO7A 2EPMX 1NDZA 3UW6A 3NL6A 4DF0A 5TQLA 2NQ9A 1NIUA 1V6VA 1WOBA 3TVAA 1L0PA 2PTYA 4FX7A 3CZGA 4X9YA 3CIXA 3TQ0A 5LNUA 5CC7A 1AQFA 3UVIA 2QAPA 4BI6A 1V7AA 3RN6A 2JF7A 5D37A 4JFVA 2I56A 1IWPA 3W7PA 1KFJA 1UC4A 4A3UA 2GJXA 5FF2A 4FF5A 3OOQA 2H9AA 3E2SA 1XYAA 3KS6A 5BMWA 3LCXA 5LHEA 2A7NA 3WBAA 1LTDA 5F2GA 3AS0A 3FSTA 5FF0A 1QI3A 2DIEA 1W3NA 4KWOA 4U4MA 3VA8A 4ZODA 3RCNA 3T2PA 5GNYA 1VAHA 3C56A 3M4HA 2UY2A 1I2RA 2QF8A 4S3GA 1Z41A 1XBXA 2WMGA 3M0IA 5I5RA 1MWOA 1NFPA 3L4YA 3ZSSA 4BK9A 1O7AA 5E5CA 3E5BA 3HURA 3IIOA 1UJQA 1IGWA 5C6MA 4F0KA 3AIQA 4AFYA 2NQ5A 3SN4A 1Y65A 3PBUA 1VH7A 2Y70A 3MWCA 4IGHA 4DNHA 5CGMA 4UQEA 2FZ9A 3LB0A 4GUFA 1G69A 4BQ3A 3ES8A 5CLTA 1CPUA 4LCRA 2ATMA 4AWTA 1A5UA 1P6WA 5FF7A 5HXMA 1H7PA 1OX5A 4XAFA 3GC4A 4PTWA 1B3VA 3OLIA 3MZ2A 5HUOA 1ECQA 5FI8A 2YKKA 4AEEA 1DWGM 5LGZA 1O5KA 3BSMA 3TJXA 3CAWA 1WPCA 3QQ0A 1A5OC 4LYPA 3RR4A 1MW0A 3E0WA 4ICMA 3UF9A 3M7SA 3G6LA 4WD0A 3LNMA 1SZNA 1JAEA 1A0EA 4QS6A 4F2UA 5DLCA 2OLSA 3EPNA 3QRHA 5DMYA 1EQCA 3TAOA 2ZUWA 1FWRA 3GTIA 4ADUA 2OWCA 2YCLA 3L5LA 2X30A 4MF4A 3QEZA 3CHEA 1F3WA 3GU2A 4A8NA 3N2BA 3N13A 8XIMA 3QFEA 4LAKA 4L9YA 2PDWA 1UWRA 2VO5A 2C3ZA 1CXLA 1KKOA 3H54A 3SRKA 1F7BA 2VX7A 1VHCA 3FSUA 1S5TA 2ZZ7A 1EC9A 1NM9A 1EEPA 3TIMA 2CETA 4WK9A 4RE4A 3H7VA 1BPLB 3GE7A 4RDYA 1XSJA 3FCPA 2FGZA 1B57A 2PCQA 4NHVA 3OHIA 4OKDA 4WDWA 4HNVA 4RNIA 1AJ2A 2PP1A 4NYYA 4GHRA 1W3IA 1YTEA 3GRIA 1K9EA 4PRWA 4DJFA 4W86A 2Z7GA 4DWDA 3C4UA 1UD8A 1JZ6A 1BVNP 4TX8A 3NYDA 1TO3A 2XSBA 1RJPA 1KTCA 4HZ7A 3U9IA 1JQVA 1TG7A 1DWAM 4AW7A 1PHWA 3VTRA 3I7SA 4REQB 2FPTA 3H2CA 3LMZA 4WJXA 1E70M 1L2QA 3NZRA 2XH7A 2B7OA 1FDJA 3EEZA 1XFBA 1U1UA 5TAOA 1TTIA 2VX5A 3IS4A 4UZUA 4ICNA 2BB0A 1ZALA 3AALA 4OBSA 1SO4A 1SMDA 4K38A 1QO2A 2V3GA 3M47A 1UH4A 3WDIA 1ISVA 3MJYA 4NASA 1H2JA 4XD3A 2HTMA 3EA1A 2XSXA 1XIHA 3TYBA 4H9UA 1CGXA 3BAYA 2FZMA 2EJ1A 2YDQA 3DDMA 3FXGA 1HKMA 4NZ3A 1OWQA 4O1AA 4IFOA 1EBGA 3MSGA 3OZMA 3EDKA 4I6KA 4J3WA 3ZLFA 1U5HA 3WBXA 1GW9A 2CEQA 5HQLA 1AW1A 2YCEA 1IEXA 3WJSA 5HDRA 1AFSA 3UT0A 3T7VA 1XXXA 1XLCA 5K4ZA 2OT1A 4MZYA 3W7MA 3BG9A 1M7PA 3TR2A 3MT1A 4ZBCA 1J2BA 2Z25A 1JYVA 3L5AA 4U3CA 4R9XA 4LUTB 3ZMRA 1JUKA 4GIYA 5CJMA 3I3EA 1JF6A 4OE7A 2D22A 4Q22A 1ZQ5A 2ODOA 3EEGA 4D6JA 4YMZA 1P0NA 2C15A 4ZCWA 5MKGA 4MJ2A 1XIDA 5KZMA 2QW5A 1SZGA 4KCVA 1HZYA 2PDIA 1J0KA 1LL7A 1FXQA 2DQXA 2DVXA 4AMAA 1LORA 2NW0A 4US5D 3WYZA 2ZFAA 4U3AA 4OFCA 4FR6A 1VJIA 5A6JA 3DFTA 1K03A 2PWUA 3FLUA 5IDZA 4JFWA 4BKNA 1XSKA 4S3JA 3MHUA 1LOQA 3W01A 1O4UA 4JPGA 1EIXA 1E40A 4NNBA 2GL5A 3NYZA 1NH6A 4PL2A 4EWJA 2V5BA 4XD6A 2XN0A 1GZ1A 3H24A 2A85A 1WNOA 1YPFA 2IQDA 4AG0A 3H21A 1BFNA 3FYPA 2Y24A 3LOTA 1V08A 5EBAA 5EY5A 2DSZA 1MUMA 3LQLA 4NJJA 2PDYA 4LRTA 4KIEA 1RV8A 1W3HA 3W6YA 4U2ZA 1W1VA 4IQLA 5G4EA 1ZLPA 3IANA 1UH2A 3NQGA 4ZOCA 3GX9A 2ZBTA 3EWCA 4Y8EA 4WF7A 4DYEA 1M65A 1XIJA 4E2DA 3Q67A 4H6QA 3SUUA 1K4GA 1QDSA 4CQDA 4FOKA 3VIKA 3ZIZA 1UZHA 3CHDA 4M1BA 1PYFA 1O95A 3FHAA 2R1MA 4I5RA 2JKAA 3PUDA 1TJ2A 2JGYA 5REQB 1X6NA 4KEMA 4DO6A 1XL9A 1ZY9A 4H7VA 3TTEA 2Q8ZA 1YBQA 2WCGA 2WAGA 2XIBA 2V82A 2QR6A 5K7JA 3SR7A 3UJRA 5BWFA 1I1XA 1FWGC 2QCDA 3WUBA 1JPDX 3LZ5A 5A6LA 5I03A 1MI3A 4PULA 4I8YA 3KP0A 2HPIA 3VNIA 4KKXA 1FCBA 3L4WA 4KBXA 2WVVA 1EJXC 1OT1A 3KRZA 4X61A 2BG5A 4NJIA 1TV4A 3RU6A 3MYOA 1CBGA 3M41A 1A3HA 1KM6A 3GTNA 1JZ3A 3QPZA 4CCEA 4GJJA 1ZAIA 4Y7EA 4RE0A 3S1XA 1TB3A 3KUMA 1CW2A 5I77A 5AC8A 3GVQA 1CDGA 3ZT7A 1C8QA 1WUFA 4EXAA 1I2NA 3MY9A 5BU9A 1OD8A 1B3XA 4GG9A 3C2YA 2A3HA 1N8WA 2XHYA 3CPUA 5I09A 3S2LA 1V0MA 4OTKA 5I3KA 2GFTA 4IMFA 2O9OA 1AW5A 3DOPA 1CXKA 1UWIA 3ANYA 3IJDA 1J0ZA 1HKIA 1BWVA 2D3NA 2GSJA 3S6OA 3VAVA 3TX9A 1XLBA 4AU0A 3ICJA 2Y1HA 2JKPA 4J40A 3ZYZA 5I0DA 4L9XA 3TLLA 1UD6A 3AMDA 3QGKC 4B5VA 1N8IA 3RYSA 1XIIA 2ZZ4A 2E0PA 3W7QA 1CECA 4QFUA 4IL0A 4JTTA 4JCLA 4YVVA 2A3CA 4NRRA 3CBWA 3VK5A 1NQKA 3Q65A 3T0CA 3QHOA 1C3FA 3OYXA 2E25A 3HGRA 4DO7A 1FCQA 4ML9A 1KBJA 1RJQA 4H01A 5A1AA 3MI2A 3NG3A 5LGXA 2JQXA 2J13A 3E9AA 4W7WA 4IPJA 3LZ3A 3FA4A 2GK1B 3W81A 2HNHA 1ML1A 4LANA 1XSIA 4QHRA 2WSPA 1VGAA 2PWVA 1YNYA 3PJXA 4H7CA 1TV7A 2QCLA 1C8YA 1E0UA 1FVPA 3FX4A 3T2QA 4LAZA 1AL7A 2REQB 1HKKA 4ZO6A 4HBKA 4X63A 3VE7A 3S46A 2CFFA 3L4TA 4GQRA 5A2AA 2QPSA 4C1NB 2HBXA 4HZ6A 3IV8A 4JCMA 1S2WA 2NT1A 2BGQA 1D3GA 3CNYA 4WX2A 3GZAA 4O12A 1XLEA 4IPNB 1RQHA 1PTAA 3LTPA 1V7YA 3UG4A 4M6VA 1ZU8A 5DEZA 3M9YA 4HP5A 4K1WA 5A69A 4PMXA 2ZX7A 3LSCA 2V63A 2YCJA 3T4CA 7REQA 3BUVA 4F0RA 4PA8A 4LRSA 4ZQOA 1O12A 1M01A 2J9XA 3AXIA 1XH1A 4CD8A 1JGIA 3GDBA 4X0VA 2EPNA 5AC6A 4R27A 4B16A 3DZ1A 5HINA 4RW3A 3CL6A 3BG3A 4HNCA 4QLJA 2ZUMA 3NDZA 2D3LA 1GT8A 3TMLA 3N19B 3NO3A 4O13A 3GXIA 4M7TA 1MXSA 1G67A 2VZVA 2YSWA 3VO0A 5AYXA 1Y8BA 4W8BA 4JIIX 3WBEA 7XIMA 5BRPA 3MZNA 3RF9A 3QM3A 3SM0A 3KL0A 3MKVA 5JBFA 1C92A 5J5DA 4QQUA 4J3VA 1FDYA 5M5DA 3WD2A 1JI1A 3REQB 3KBNA 1KM0A 4OIFA 4GA8A 1BXBA 3VGBA 1WA3A 3IAPA 3MUIA 3N18A 4IQJA 3B9DA 3CPGA 1H7RA 2GUBA 4DJEA 3QN3A 1YRRA 4B5SA 4E2OA 3O6CA 3MJMA 4O1FA 2FYMA 3WNPA 2CW6A 1LT8A 4IMCA 1J0HA 4YXGA 2AL1A 1W31A 1Q65A 4HPJA 2WLYA 4QM1A 4XO7A 3SN1A 3QQ1A 1DV7A 4DELA 4DVOA 5D4YA 5FSEC 1KFKA 5EPDA 5FJRA 4BCEA 1OZQA 1FFRA 3U2OA 1GVRA 2Y7DA 4GYPA 2Y6ZA 1V0LA 5E0CA 2BHZA 1DQUA 4ZB0A 4JTDA 4PH6A 4IMGA 2ISVA 5A94A 5E6YA 4DX3A 4LW7A 3M0KA 1JCYA 1WOAA 2FJKA 2IPWA 3FY1A 2QUUA 4H9TA 1ZP4A 1PTGA 3K30A 3OIHA 5LHFA 3ORWA 3HPAA 2CWXA 3IAQA 4MUPA 1OK4A 4UC5A 2QCFA 3PPCA 4ADSA 5LKYA 2Q6ZA 1ME9A 4FLQA 1KBIA 3TTOA 1K9DA 1YE4A 1PZ3A 4F0HA 3GU9A 2XIQA 4PUNA 4RNHA 2PDPA 5FJOA 4HHPA 2Q01A 5LZLA 3WH6A 4BEUA 3B4UA 5CSYA 4UQBA 1UR1A 4QE1A 4OV9A 5FA5A 4AY8A 1E6PA 4QCEA 5E1QA 1UC5A 3A21A 4DZIA 4ZENA 1AJ0A 3CUXA 1TV3A 2OLAA 4H9MA 1LJYA 4PTNA 5DCEA 1J11A 5BNKA 1POKA 3IVSA 4CQAA 1PZ0A 4Q8NA 1GPFA 1KO0A 2XZ9A 4LPCA 1MSSA 2PC8A 4K8GA 4Z2IA 3WQ4A 1E1CA 3GR4A 4FK9A 3G8RA 5T9BG 1XIGA 1XIBA 1H41A 5HJLA 4QE4A 3N2MA 3IGUA 1DHPA 1Q4NX 1DJNA 4UOQA 4IIBA 4MKNA 4XKYA 5AHLA 2ISDA 1W1PA 2GJRA 3MSRA 3T0BA 2VZTA 4NZCA 1HQTA 4H9YA 1NVMA 2DPEA 1Z9AA 3UQNA 4K37A 1R2SA 1Y5WA 7A3HA 5K2ZA 2QS8A 4GWEA 4JFSA 4EF9A 5DRIA 5FF3A 3S1WA 3UBPC 2PGRA 3SQLA 1I6NA 3TOYA 1KRAC 3H2AA 3UR5A 1CX9A 1KV5A 1EHNA 1TMLA 2J78A 4ZQNA 4ZO9A 4DJDC 3GW0A 2BVWA 1LT7A 4CCDA 4LV4A 3MSYA 4AD5A 1AL8A 1VPYA 2MUCA 3TR9A 1MFUA 5HUPA 1ZJIA 2DZPA 4AZCB 4DRSA 2J7HA 4WKFA 5M3WA 3EX3A 3GQYA 3MKCA 5CG0A 1H3GA 4O50A 1ENUA 4PMRA 1HKVA 1R85A 5E9XA 2QJNA 4JTIA 2PLJA 5CZJA 3UVAA 5A8OA 5D05A 3C3UA 4B91A 5DXXA 3RX3A 4LC8A 2DJLA 1PZ2A 2FQIA 5HPOA 3WDPP 2G8ZA 3ZLHA 1E72M 1KR1A 3UERA 4Q6JA 1YE6A 3DHFA 3O15A 2YL5A 4PODA 5KEZA 1RALA 2BV9A 3STEA 2EPLX 1FX6A 1XDMA 1IR2A 2UY5A 4DYKA 3L65A 3UP8A 2PGFA 2OR2A 3TCEA 3LM3A 4G7EA 1E6NA 4MFDA 4UQCA 1X1ZA 4QITA 2A6NA 3U7VA 2XISA 4PR4A 3TMQA 4HA4A 1OGBA 2VEMA 3CK5A 4P8WA 3M43A 4Q8VA 1NDVA 2Y63A 1XC4A 3RLGA 1GOXA 3EDDA 1K9TA 4O53A 4I9TA 3I65A 3R10A 1PKYA 3MUXA 1AQHA 3BARA 1EDQA 3AXXA 1R6WA 3WDQA 1K02A 2IXUA 1FQ0A 1Q7ZA 3THCA 2ZDRA 3TYZA 4A21A 4R34A 2PPGA 3HA1A 3I10A 1XRFA 5CZTA 3CO8A 3QR1A 1S3HA 1UZ1A 3CQ0A 3KRSA 3TSMA 3WD4A 2OVLA 2XPKA 2B7PA 2WMFA 2NVCA 4K36A 4AVOA 4R7OA 1T99A 3R89A 1ECEA 2BOFX 1EUAA 4NU7A 2E6AA 2HISA 4CQ8A 3G0XA 1RHCA 1W1B1 3WZ0E 1OYCA 4IJBA 3HV9A 2GVGA 2PLMA 1GG0A 4KCTA 1L6FA 2YXXA 4ROQA 4LNCA 1FKWA 1F3TA 2EPHA 3N4EA 1PPIA 2RJHA 1E0VA 1TIMA 1X1NA 2G4JA 2QCEA 1XHGA 3IGHX 3R25A 3CLMA 4HHHA 1KXTA 5I6SA 2A7PA 4GUJA 2E6YA 3LXBA 1JDEA 4QDWA 4ALDA 1GPWA 1H60A 3G6MA 4L80A 2QXWA 4JIRA 1Q63A 3GR8A 1E56A 1EZWA 1SVDA 4HNOA 2CLOA 3MMUA 5ABGA 3E5PA 4JNYA 3PB0A 5JBDA 5DO8A 2Y8VA 2V68A 3ARXA 1WX0A 3A13A 4MPKA 4RLIA 3UNTA 1OF6A 3RX2A 1V0NA 2O55A 4XZWA 5C9UA 2F38A 4Q7NA 4XBKA 4C90A 1J12A 1OM0A 1TE6A 4C1LA 5DBTA 1EJWC 1SO5A 4AIOA 3A5VA 4HZ8A 3VKBA 1AA1B 3W71A 5HNRA 4QIUA 3APTA 3WLQA 4E2VA 4QXIA 4JN8A 5A8GA 2EKGA 2VR4A 4URIA 2DZTA 3R0UA 4NXSA 4HCLA 3EOEA 1NF7A 2Q3RA 4H3DA 1LL4A 5D9OA 1PBGA 2YIHA 3E2VA 4HVXA 3W37A 1E9ZB 3V16A 3V75A 1RLDA 1OFRA 1JNEA 1DJGA 2ICSA 3URBA 2V9DA 3FA3A 1H1ZA 5L9FA 3LYEA 1NEYA 3NGFA 4Y9AA 3OW1A 4MNJA 2IMRA 3GIYA 3W7OA 1EXPA 5AY7A 3RX4A 4C6DA 3ABSA 2A5HA 3OP2A 3MW7A 4MB3A 3W02A 2VFFA 4HTYA 2G3FA 3TXVA 1YHTA 1VFOA 3GIPA 4L5ZA 3OQ8A 3DH7A 4QJ1A 3A23A 4C6CA 5I2UA 1RA5A 3CV7A 2GJLA 2NX3A 2JK2A 3LCWA 1TWWA 3ELFA 3V0TA 3HM7A 4JTAA 3D3AA 3VIFA 2ZRVA 3BV7A 4MAZA 4IM4A 2IQTA 1F4AA 4Y9OA 2QV5A 1JZ7A 4O10A 4V28A 4GO8A 1S2CA 1KWKA 2WCSA 4MB5A 3HFTA 4NILA 2BVTA 1XM3A 3W23A 1US2A 2HCVA 3SCNA 1SZFA 3UXKA 2D23A 4CU6A 3OLEA 3W7JA 2UZ9A 4S3DA 4YYCA 1QATA 2QQ6A 4MZ8A 4GFSA 5AHEA 2WZIA 3PJUA 3P8JA 3QSRA 3T07A 3NVDA 4MY9A 1VIWA 1Z8AA 4E5TA 4TV5A 1GYNA 2XINA 4P7RA 2A3BA 2FDSA 1O94A 3WQOA 1QI5A 1TTPA 1FH8A 2W9MA 1KTBA 3F2BA 4HTBA 3R5EA 5AYIA 4IPIA 4O19A 1ZHAA 4R5EA 3KTSA 3B0UX 1A0CA 2R1NA 3GXPA 4ORMA 4P7OA 5D02A 4M5PA 4L61A 4GGHA 2F84A 1OY0A 2A6LA 2YR1A 4G2DA 4IICA 3TTSA 2ZVIA 2OT0A 5HBFA 3MANA 4QG9A 2LLEA 2VURA 4L6DA 1ZGDA 4YWSA 1TPDA 1KB3A 5FAJA 3HFYA 3W7DA 2CBJA 3UWZA 2J79A 4CEXC 3HMJG 3VD9A 4FNQA 2FVMA 1SQ7A 1RR2A 1OQFA 4IGNA 2ANUA 2C79A 3ALFA 4ZR8A 2ISWA 2J7GA 5AOUA 2P1FA 3W1RA 1P0DA 3AXMA 1SJBA 3R8HA 5EKYA 4EVZA 1ZJAA 2NQLA 3WNKA 2V67A 1S46A 3T8QA 2PD5A 2A21A 5C70A 3N73A 2ZX5A 3QQWA 1K1DA 4S3KA 4N2YA 5FAGA 1EYWA 4MY8A 1A5AA 4LWWA 3CQKA 4LCQA 4CU8A 1JFXA 2QMKA 4P8XA 3KW3A 3G3MA 3ONBA 4F40A 4ZB2A 2P0OA 3KBMA 5I24A 5D38A 2BNJA 1XQKA 4BZYA 1F76A 2CWNA 1CENA 2RDXA 3NM3A 3TP4A 2AKZA 4PMNA 4XUYA 2DEPA 3C61A 4CD5A 2HK1A 1YDYA 1UKTA 5JVLA 5H8UA 3UR8A 5B7YA 4JYFA 3WF1A 1UIPA 1NOWA 5FJTA 1M41A 4UTHA 2X2YA 1OG0A 5T9CE 4KEUA 2WJEA 1NDYA 4F0SA 4HNTA 3DFNA 4B92A 3UZWA 3ARZA 3KL5A 2D2GA