1K03A

Crystal structure of old yellow enzyme mutant gln114asn complexed with para-hydroxy benzaldehyde
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
399
structure length
399
Chain Sequence
SFVKDFKPQALGDTNLFKPIKIGNNELLHRAVIPPLTRMRALHPGNIPNRDWAVEYYTQRAQRPGTMIITEGAFISPQAGGYDNAPGVWSEEQMVEWTKIFNAIHEKKSFVWVNLWVLGWAAFPDNLARDGLRYDSASDNVFMDAEQEAKAKKANNPQHSLTKDEIKQYIKEYVQAAKNSIAAGADGVEIHSANGYLLNQFLDPHSNTRTDEYGGSIENRARFTLEVVDALVEAIGHEKVGLRLSPYGVFNSMSGGAETGIVAQYAYVAGELEKRAKAGKRLAFVHLVEPRVTNPFLTEGEGEYEGGSNDFVYSIWKGPVIRAGNFALHPEVVREEVKDKRTLIGYGRFFISNPDLVDRLEKGLPLNKYDRDTFYQMSAHGYIDYPTYEEALKLGWDKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords NADPH DEHYDROGENASE 1
publication title The role of glutamine 114 in old yellow enzyme
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 145
structure length 399
sequence length 399
ec nomenclature ec 1.6.99.1: NADPH dehydrogenase.
pdb deposition date 2001-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1k03A00
1OF8A 3C2OA 3GDRA 3SZ8A 2YDAA 3M7WA 1IXOA 3N2MA 4UTKA 1OFOA 4QITA 2WNQA 3G22A 4FX8A 2ISVA 3LI0A 3TW6A 2NXHA 2D73A 4HSNA 1XDLA 4XQ6A 3W7EA 2TMDA 1ME8A 2VOMA 2ZFAA 5E0KA 3PAJA 4A2RA 5LNUA 3FYOA 1QFEA 2Y7EA 4A21A 3NEVA 2QCEA 5D33A 3NZ1A 5A5WA 3KVKA 4WXYA 3DBPA 4X22A 2VEKA 3A23A 3M6YA 5U7SA 5DXXA 5EPDA 5G4WA 2C3ZA 1CX9A 1L6SA 3LCFA 3RLUA 5D2YA 3CIXA 1OYAA 6TIMA 1SO4A 3MI3A 1V7YA 3LCWA 4JTJA 1TIMA 2RDUA 1QNVA 3S8HA 3PVFA 4M6PA 1JCLA 2E5CA 3S5YA 3QMTA 3W1RA 3W84A 1W5MA 3PUOA 5DXYA 3IIXA 3P5ZA 3GXTA 5AC7A 3LB0A 3FFSA 1SZNA 3M5YA 3Q37A 3G1VA 4ZQNA 1WBJA 3NL2A 2ZZ2A 1FWWA 4UTTA 3NQAA 2A0NA 3W76A 1W0MA 2WV8A 4UTJA 3M47A 2I14A 5C54A 3S1UA 4UIOA 3WJWA 1VYRA 1B9BA 2JK2A 5KMYA 3LRLA 4QAIA 3H54A 4JGDA 3QSTA 1H7WA 3LHTA 3O15A 1KLYA 2ZTKA 1TRIA 1HTIA 3W23A 4PCFA 4NU7A 1W5PA 2VENA 3TJXA 1XDMA 3R89A 3W1XA 1UJPA 4I7WA 3NQ6A 3M43A 4YXGA 3G1AA 4TU1A 2E09A 1Z44A 2E6DA 3PF3A 3TSDA 1EIXA 1J4EA 3FKKA 3NO5A 2NX9A 3TMQA 3C2FA 4JTGA 1WBHA 3NQDA 3N34A 3EWXA 3B0UX 3BW3A 3L67A 1LYXA 1JCYA 5F2LA 3NPUA 3LRKA 3E49A 4XBKA 1S5VA 2ZZ7A 1P0NA 2DZSA 1FCQA 3MO7A 3E02A 3W1UA 4JS3A 5BW6A 3UWZA 3G1HA 4FNQA 4FNRA 3WJYA 2AQWA 4MKNA 3B0VC 1JCXA 3EWUA 5F2IA 3B04A 3QFEA 3W3OA 4O0KA 4PTNA 3VKJA 1WV2A 3O16A 2FB2A 1UBSA 1OX4A 1RVGA 3LI1A 2YR1A 3MHUA 1G69A 3O07A 4Z1AA 5FEPA 1K02A 2JGYA 4LVDA 1FX6A 1VYSX 4UTTC 2DJXA 4O1BA 4HNTA 5FESA 4U28A 3DU0A 4OE7A 3T40A 1LCOA 5LNVA 1LLWA 2I9EA 5F1VA 5D32A 3I65A 4O19A 4HNNA 4RZ5A 3EX4A 2E77A 1SFLA 3LHVA 4ZQMA 3INPA 1PCWA 1KFBA 3KVMA 2NUWA 4FNTA 3TE9A 3MYOA 1VHNA 1OYBA 3PBUA 1I4NA 4LC6A 3QEZA 4AHPA 4WUIA 3W7HA 3PS7A 3W7OA 1DJNA 5G1YA 2QR6A 4LV4A 3LTSA 5AHNA 3P82A 4JX4A 3BGJA 1K8ZA 3PSVA 2J9ZA 1VZWA 2E6YA 3EEGA 4UMAA 3BLFA 3L66A 4FXRA 4S2CA 3CTLA 1ME7A 4IX0A 2FJKA 1SSGA 8TIMA 1YPIA 2EPHA 3PUDA 3K30A 4JTKA 2WQPA 1QCWA 4M6VA 3G0XA 2DZUA 3FS2A 4XTDA 4UTMA 3NDOA 3NL5A 3GAYA 5AHMA 3QMSA 3TIMA 2GQ9A 5E1QA 1VYPX 1J5TA 3AJXA 4IXXA 3MUXA 3DHDA 4UTWA 2C14A 1MEWA 2QKFA 1MZHA 2G96A 3W88A 3NQVA 4Z1CA 4DEFA 1WA3A 1W3TA 4RR4A 2E6FA 3S1WA 4HN4A 1GOXA 2WSRA 3TV8A 2LLEA 1W8SA 3V75A 3W7KA 2VKZG 4QSHA 3RMJA 2A6LA 5LKYA 2O7QA 3TAKA 3CIWA 2V82A 3W2LA 4AAJA 3JRKA 2FIQA 5K9DA 3FJLA 1WOAA 4E0CA 4Q33A 3P84A 4XUGA 2B7PA 1TCDA 1KM5A 3P62A 3W7MA 1Z41A 4BR1A 4CCEA 5D2WA 4CCDA 2VC6A 3W87A 1VHCA 2RDTA 1FBAA 3LDVA 4N2YA 3E9AA 3UZJA 4GXMA 5AB3A 1ZFJA 3BG9A 3IV3A 2DZVA 3W2NA 1JQXA 4YCOA 3UWQA 4HKPA 2A4AA 4XWUA 3TW7A 4HPXA 3UD6A 4N9BA 3BK0A 5EKYA 3EWYA 5C2XA 2JGQA 4GNJA 1KLZA 1LOQA 1KM0A 1I2NA 6ALDA 4JTUA 4LW7A 3STGA 4LC8A 2C16A 4MZ8A 3DI1A 1DORA 1GQNA 2PRLA 5F2GA 4I7UA 4JNMA 3P67A 5HR7A 4ADSA 1D3GA 5EBUA 3NPVA 4UTWC 1A5SA 1H50A 4LVBA 2A1YA 4L4MA 1EP2A 2VFEA 4UUIA 4BI5A 2Y63A 1MSSA 1RR2A 2TPSA 5DLCA 3PG8A 2B7NA 3GAKA 4RCXA 5J5DA 1P0KA 2Z6JA 4MPQA 2QJHA 3VI2A 3E96A 4YWIA 4NUWA 1X6UA 3SFKA 3M16A 1XI3A 3A22A 3MHFA 4R7JA 2PC4A 1R2RA 1W3NA 2F84A 1NEYA 4WOZA 3G3MA 3THAA 1SU5A 2DP3A 3RF9A 4MYXA 3S1XA 2Y88A 5LNSA 4GC4A 1F7BA 2DJLA 1TQJA 2A6NA 4OQVA 1XL9A 2G95A 4GUGA 3L2IA 1GG1A 5K4ZA 1OYCA 2GQ8A 2WSQA 4O4VA 1BWKA 5TIMA 2Y7GA 4JTFA 2JKAA 4U4MA 2CZFA 1ZALA 1XBYA 2FFCA 3TR2A 3TQKA 3SW6A 4J9JA 4EIVA 1NSJA 2KZHA 3T7VA 1KA9F 1JCJA 1QPNA 1GVFA 1R46A 3HGOA 5K9XA 5CZTA 1DVJA 3B0PA 3GK0A 4B5NA 3NG3A 1TJPA 3LXAA 1IF2A 4QQ3A 2Y62A 1G7UA 1DBTA 2QJIA 1U5JA 3TFXA 1A53A 3UWWA 2YPIA 1H63A 4HT3A 1TPDA 3QF0A 1KTNA 3PG9A 2CLKA 3SECA 2V5BA 3G24A 3NQ8A 2ZBTA 1SR9A 3TKFA 1TTPA 5U4NA 4Z1DA 1SO5A 2NWSA 4GRSA 1LRQA 5I3JA 1RD5A 3WK1A 3NZRA 2V8ZA 3S6DA 1W31A 1FUYA 2XN2A 2X16A 3FA5A 2QCFA 1H7RA 4MVAA 1TYGA 3TH6A 3N73A 5L9FA 2YW4A 1DQWA 3LCIA 4HNUA 2CLLA 1OF6A 1S5WA 1H1YA 4N4PA 4O53A 1EWEA 1GVQA 4LOCA 3BPWA 2FLIA 2H90A 3IIPA 3STEA 2Q3RA 3B03A 3USBA 1X7FA 1MEIA 1FWRA 5BOOA 1LBFA 1QPQA 5LGZA 1F2JA 4JY9A 4N4QA 3Q94A 4JDBA 3W71A 4BF9A 7TIMA 2QCDB 4Z0SA 4E38A 3W74A 4BI7A 3F03K 1LOLA 2OT0A 3LX9A 5HJLA 3B8DA 3PSWA 1K7EA 2QUVA 4ADUA 4AWTA 3GXNA 1WYIA 2OJPA 3G8RA 4UR8A 2R91A 2ZRWA 2IQTA 1XBZA 3C0JA 3A24A 3LTPA 2GJNA 3IIZA 4H4IA 4O14A 3S0CA 3GKAA 4KFOA 3A5VA 3LV6A 1Q3NA 4E2BA 2H3BA 3RNDA 3HMJG 4NNBA 1YTEA 1VH7A 3ELFA 4Y6GA 2TSYA 4O10A 4RX0A 3HG2A 2R14A 4LRSA 5AC6A 5CPLA 4OHQA 1N7KA 4O0ZA 3GDTA 1KV5A 4UCGA 1WQ5A 3CEUA 2VEMA 1JR1A 4FNUA 4RLIA 1W5QA 1R30A 2EGZA 3EWZA 5E93A 2ISSA 3EX6A 5AHIA 2C13A 4AF0B 2FDSA 4LS1A 5LZLA 3EX1A 5TQLA 1GYNA 5DBTA 2XN0A 3CEPA 5LGXA 1F5ZA 5CPNA 2XFWA 5HWJA 3HPXA 2CLHA 1GJPA 3PUEA 3ATYA 3W72A 5HWMA 3P61A 2DZWA 3P81A 4LWWA 3QH2A 1KFLA 3OVQA 1I2RA 3KVJA 1EP1A 1DL3A 4OWGA 4JTSA 1L2UA 5D30A 3P7YA 4DQWA 3HG5A 1GTHA 3TJLA 4GUIA 4M19A 1K03A 3NQCA 1TTIA 2J9XA 4O1DA 1H7XA 1M7PA 2V0TA 4RXFA 1XUZA 1AL8A 1VR6A 3U2OA 3PBYA 2H8XA 1L6WA 2C18A 3C4UA 4MFDA 5FEXA 1DHPA 3M9YA 2Q8ZA 1X8FA 3KFTA 4O17A 1EWDA 4AB4A 2OT1A 1EPXA 4YL2A 4AEOA 3QM3A 4EOUA 2QUUA 2Y70A 5FF3A 3LM7A 3R5EA 3WK3A 5DN1A 3GR8A 4XKYA 4UMBA 1FCVA 4CLMA 3O63A 4JYDA 4POCA 3B4UA 1LLZA 3PBWA 4O8RA 2E5DA 5G4EA 3TU9A 2FPVA 3QMRA 3W70A 5F4WA 1RPXA 3QW4B 3D0CA 3W9ZA 4DBEA 1HUVA 2Q8LA 3W85A 4ORIA 3W7RA 2YYTA 4BI6A 1KM4A 4S1FA 4JYFA 1VJIA 4TR9A 4O4WA 4JTEA 5HULA 3VCRA 2J9YA 4NXSA 5BMWA 3W1AA 3CT7A 2G5WA 2C6QA 2CLIA 3I68A 2HS8A 3IGXA 3SI9A 1ZHAA 1AW5A 1VLIA 3TA6A 2VFFA 1T0OA 2V30A 3LTYA 1FY6A 2ATSA 3EXRA 1WDWA 4FIQA 3IGUA 2E6AA 2PRHA 3I6RA 2YXGA 4P2VA 1G4TA 1VC4A 3TUUA 4IUOA 3NAVA 4CQAA 1H7OA 4QISA 3CQ0A 5C6MA 3GX9A 1DJQA 1EEPA 5G5IA 4FIRA 3SJ3A 4YCPA 1FXQA 1NFBA 5D2TA 1KFKA 3GB6A 3GXPA 4Q4KA 1AW1A 3OHIA 2WO5A 1QMLA 5EA9A 3L5AA 5D2VA 4PEKA 4MUZA 1TSIA 5AN7A 4IWWA 4IXHA 3TMLA 2ZDRA 3CU2A 1YYAA 3MMTA 1YLVA 2CZEA 1F74A 3THQA 1Q6LA 2QCLA 2ZA2A 1KTCA 1F6KA 1UB3A 2GPTA 3G18A 1G4EA 1JCMP 2H8ZA 3BGGA 3HG4A 2ZRYA 4ML9A 1TPH1 1BKSA 3WFAA 4FNSA 3LV5A 1TV8A 1AK5A 1RV8A 1U83A 1MO0A 2A7RA 1KM1A 1X1ZA 3L0GA 2ZQ0A 4FX7A 1H1ZA 3HGRA 4WJEA 1FWNA 1O4UA 1Q6RA 4M7SA 4OU1A 4JICA 3NQEA 5D38A 2B7QA 1JCNA 2OZ0A 3S5ZA 3LERA 2E5BA 1SPQA 4HIBA 4C1LA 5LHFA 3DENA 1TJRA 1XC4A 1OFRA 3S9YA 5L6UA 1EX5A 4MLRA 3QPYA 4GUHA 4LY8A 4CQ8A 1T96A 3DAQA 4Y96A 3R8RA 5G2HA 1QO5A 2H3DA 1TTQA 4M5PA 5GVJA 1P4CA 1IGSA 4UFLA 4ICNA 4O12A 4WQ6A 1SZGA 1UCWA 1JJKA 3G1YA 2DZXA 2WSYA 3M5XA 4QNWA 2ZA1A 1K3UA 1FCUA 1GZGA 3M0ZA 2GJLA 4XZ9A 4JTIA 3EB2A 4JD4A 1WXJA 1ZENA 3EX2A 3IVTA 3HGSA 2RKXA 4DPQA 1NF0A 5KITA 3HGJA 3NQGA 2VFHA 1LP6A 2VFIA 1ICSA 3LHYA 4NJKA 4NX5A 4ZQRA 3TC6A 4H3DA 5FEWA 3BG5A 1I8JA 4RXGA 5K3VA 1OJXA 2X1RA 1SZEA 1G4SA 1VCGA 1TV7A 3LBCA 1N8FA 2NWRA 5CG7A 2X1SA 1JQVA 3VFLA 4N6FA 3HIJA 1TREA 3N3MA 2CZDA 3M41A 1Z48A 5HUOA 2YSWA 4MY9A 1KBJA 1PIIA 1HO4A 1KTBA 2V5LA 4M7TA 4OV9A 4QNEA 3GLCA 5CKSA 2C0AA 1DV7A 4N6EA 1PHWA 1YTKA 1G67A 4GUFA 1JVNA 2CLEA 3TK7A 4WY0A 3VE7A 1SO6A 3UWUA 3C2VA 3QSRA 2F7FA 1GT8A 5DCEA 4LTSA 3DFSA 1AG1O 4UFHA 1SZFA 3TDFA 1FDZA 1LOSA 1M7OA 1ZCOA 4H6KA 4UNLA 4G1KA 2QJGA 3LBMA 1QDSA 3RLVA 5C5YA 1QAPA 1W3IA 5SWUA 3W7NA 2ZRVA 3W7CA 1DQXA 4RK8A 1K7XA 5I3HA 3N2XA 1SW7A 3QZEA 2DZTA 4WD0A 3W7JA 2W79A 4IGHA 4D2JA 5F4SA 4LVFA 1C8VA 4A29A 2Z6IA 1TPB1 5D02A 4IMCA 4O28A 1LZOA 1OABA 1L9WA 2Y6ZA 4PL1A 5D09A 5CPMA 3P8JA 3HF3A 3NL6A 1ZAIA 3IGSA 3WK0A 4PH6A 4R53A 1BEUA 2CLOA 4MY8A 2X1UA 2ZZ4A 3A21A 3W22A 3QRHA 3B05A 1QOQA 4FEZA 3M44A 3N9RA 3NR0A 3W1MA 4ADTA 4C1KA 4FNPA 2JKEA 3TSMA 4JTLA 2BTMA 1W54A 5F1UA 3FJ6A 1KW1A 3NQFA 4A3UA 1OX4B 1RQEA 4UFMA 2YZRA 3F4WA 3WJZA 1JULA 3L21A 1P5BA 3BVJA 2WKJA 3ABQA 1ZY9A 1QWGA 2GVGA 1WX0A 4O11A 4UR7A 4GBUA 5I3GA 2P10A 1TPC1 4K38A 5CSSA 1YDNA 1G7VA 2PURA 3UYCA 4JIQA 1O94A 4XTIA 3W7DA 2QCGA 1OX6A 4R33A 1SUXA 4HPJA 2E1DA 3UXDA 3NM1A 1OVDA 3FEMA 3SGZA 1W37A 3LGEA 2HTMA 1XFBA 3RK8A 5BNKA 4AHQA 3OVRA 1ICQA 3DFPA 3F1QA 1JUBA 3TC7A 2RH9A 3UZ5A 2I1OA 3KRZA 5KINA 1AL7A 3PBVA 5CZJA 1DKWA 3HJZA 2Z0IA 3RU6A 1B4EA 1GVOA 2OCZA 4AVFA 2NV2A 1XBXA 2EAWA 4M6QA 3PY2A 1SSDA 3IEBA 1GWJA 1A5AA 1LBLA 1ICPA 3KHJA 3KX6A 1KV8A 1O60A 3GZ3A 4DO5A 4RZ4A 3G1FA 3W7QA 4CNOA 3SSJA 1Q6OA 3M1ZA 4JIPA 1VRDA 5D05A 3OIXA 3ZR4A 2DORA 1IXQA 3C6CA 4NJGA 5HUPA 5D03A 1FQ0A 5LHEA 3CWNA 1F76A 4AMAA 2JBMA 3G8EA 1EB3A 2B0MA 2H6RA 4LS0A 4Y8FA 1YTDA 2QCNA 5D37A 3T55A 3I7SA 2X30A 3G3DA 4BWLA 1ZAHA 2AAMA 3W07A 1SQ7A 3WJSA 2DU2A 4W9TA 4PFMA 4WX2A 1OG0A 1OK6A 1XUUA 4IMGA 3VNDA 3LHWA 5BRBA 3PWAA 1KM2A 1EP3A 5J5RA 1H5YA 1NVMA 2B7OA 5AHEA 1XBVA 1PCKA 4MFEA 3YPIA 3PR2A 4WZHA 4OT7A 2VFGA 2QAPA 2B4GA 4K39A 5F2MA 3A9IA 3C8FA 4JY8A 1A5CA 1FDYA 3NNTA 3BG3A 1OK4A 4ZQOA 3BLEA 3L0NA 3O1NA 4LUIA 4LT9A 5A8GA 1C9DA 1RZMA 4LU0A 3S1VA 4ALDA 4RV8A 1P1XA 5KZDA 3STCA 3BW4A 1IXPA 3TXZA 2EHHA 3GNDA 1DOSA 4QM1A 3P5YA 2VFDA 3QQ1A 4IQLA 3FLUA 3ZFHA 3G0UA 3P74A 4TO8A 4AXKA 4FX6M 4K36A 2CLMA 3L65A 2NZLA 4UTIA 4RJEA 1TRDA 4Y90A 4E2DA 4TMBA 4JTTA 2NV1A 1H60A 4ZVJA 3MWAA 3WK2A 3ZS4A 5FF7A 3OEXA 1VGAA 2ZZ5A 3MI2A 2ZTJA 3NPXA 4CNPA 2GUUA 5CGQA 2GQAA 4O57A 1H62A 1HFBA 1LORA 2J6XA 5CPOA 1E51A 2WJZA 4BWLC 3N19B 4GUJA 3HG3A 4DBDA 1KBIA 4ZQPA 4ZZ9A 1NF7A 3SY5A 3W7IA 3PB0A 2YFNA 4FHAA 3W7LA 2BXVA 4N9EA 2GVJA 3QPZA 1D3HA 5FF0A 1TPVA 1B3OA 4Z08A 4ZMGA 1EUNA 3MP4A 3Q58A 1XM3A 4K37A 5EL1A 1SO3A 3DZ1A 1S5TA 4LV9A 4O52A 3G1XA 3NXFA 5EYWA 4IMEA 3GVGA 1WOBA 3DXIA 4A22A 1HL2A 1YPFA 3GDKA 3ANYA 4L4LA 2FQIA 3Q2DA 3O6CA 5LNWA 5EMUA 4KFNA 3MHGA 3EXSA 4NNAA 4LNYA 4Z1BA 2BLEA 2NUYA 1T8XA 3KAOA 5DCBA 3MBDA 3RFAA 3L5MA 3R12A 4K7VA 2HS6A 3W83A 4JN6A 2O7SA 5DY3A 3MYPA 2ATMA 4DPPA 4ZQCA 1ADOA 4DF1A 1PE1A 3DGRA 2CU0A 4NX0A 3GNNA 4NQ1A 4O18A 1GG0A 2ZZ1A 4X3ZA 4JR5A 2TYSA 1I2PA 1QR7A 1OFDA 4K8EA 1L6YA 4IPJA 1GVSA 2QDGA 3DI0A 1V5XA 2NLIA 3EWBX 1GPWA 4BK9A 2FTPA 3H55A 4S2BA 3SIZA 3TSBA 3HOJA 2WNNA 1CW2A 4CNNA 1VS1A 2Y85A 2WOQA 2BSLA 2W6RA 2GVLA 3DFNA 1FWSA 1OFBA 2CW6A 5FI8A 5D04C 2EKCA 3R2GA 1O95A 1YDVA 1Z42A 3UWYA 4O50A 1VLWA 1TQXA 3SR7A 3PM6A 3E0IA 1SW0A 4RKAA 3ZWTA 5AOUA 1BWLA 2E68A 2C1HA 3KXQA 1LRTA 3EX3A 2BZNA 5G2WA 5AC8A 1PV8A 3M5VA 1H7PA 1TPUA 4UFKA 4N9CA 1K8YA 1B57A 3IVSA 3CB8A 3IRDA 3MP5A 4UFIA 2YX0A 1LM1A 1K7FA 4PC8A 4AH7A 3UPBA 1I2OA 1PHQA 2V81A 4WY0F 3HPSA 2UV8G 1W1ZA 5G1TA 2CLFA 1XKYA 1JRBA 1QPRA 5AFDA 2V2DA 4JX6A 3CPRA 5I3IA 2YYUA 3AO0A 3UY7A 3W73A 5AYYA 1LDCA 4R34A 3EKLA 3LLFA 2A85A 3NM3A 3E12A 1A5BA 1TPFA 4RZ6A 3TAOA 3TQ0A 2QAFA 4LRTA 5H91A 3NYZA 1FCBA 1MXSA 4UTHA 5T26A 3GR7A 5DBUA 4BFAA 3FYPA 5LNRA 3NQMA 2QEZA 3HQ1A 2HSAA 2AGKA 3C52A 2NXIA 4MZ1A 3MI6A 3OA3A 5H2ZA 3G1SA 1S3HA 3W86A 4LS2A 3N14A 5TBOA 3HO8A 2GOUA 1ME9A 5FF4A 5DELA 1X1OA 2RFGA 3CLMA 1M5WA 4ONVA 1YXDA 5K2ZA 1FDJA 3TNOA 4GE8A 3NQ2A 4I7VA 1KM6A 4GFSA 4TMCA 3GKFA 5K9CA 1HG3A 3LRMA 5C55A 2R8WA 3M5ZA 1VPXA 2FPTA 4K7YA 3DKJA 3G0SA 2V9DA 3MBFA 5AHFA 2OMAA 3R13A 3S5NA 4NNCA 3MP3A 4PA8A 4XBSA 1OFQA 4QJ1A 4OV4A 1THFD 5F4XA 4QIUA 2BWGA 2FB3A 3C2EA 2A7NA 3UXAA 2ISWA 5HINA 4O54A 4NVTA 3DKLA 3W2MA 4JTHA 5DCDA 4FXSA 4UFJA 1ONRA 2NUXA 4LUJA 3TCEA 3MW7A 2YGYA 3BO9A 3W1QA 1AMKA 3BV4A 1EA0A 4MOZA 4PL2A 2VXNA 2HMCA 1K8XA 1WAUA 4HHPA 4HSOA 4UNKA 3O6YX 5AYXA 4DF0A 2A7PA 1T99A 3TXVA 1CI1A 2J27A 4YMZA 3CC1A 3GDLA 2ZRUA 3LXCA 1GYLA 3JS3A 3UPWA 1G4PA 3W2UA 3EKZA 4EWND 4EF8A 4ZL1A 3W2KA 3KRUA 5MHBA 3L9CA 4WOQA 1GVRA 1R47A 2WPBA 4Q32A 4NT0A 5KSWA 1A50A 5CZSA 3NA8A 2QCHA 1PS9A 2Q3OA 3TX9A 3C3NA 3O05A 1N55A 1ZJIA 5HWNA 2VELA 2YW3A 2QCDA 5ABTA 3G1DA 1Q6QA 3CM4A 1OHLA 4O13A 4XKYB 3EXTA 1RQHA 3O06A 3PC0A 4UTLA 4DO4A 4N9DA 4IMDA 2J88A 1TMHA 3LHUA 1SFJA 4MLJA 3NGJA 3OG3A 5FEZA 2ZYFA 3HB9A 2NX1A 1J2WA 1BTMA 3LLDA 4Y9AA 1F05A 3LXBA 2JKPA 3QC3A 2NX3A 4PODA 1H7NA 2CWNA 2C15A 5AYZA 1D9EA 3U8GA 4JYEA 5IM51 3ABOA 3S5OA 4DF2A 3BARA 5I3KA 1GTEA 1RQBA 2PRMA 3GYEA 2VEIA 1KFCA 3F4NA 5EY5A 1JRCA 4EVZA 5KTLA 2BX7A 4UTUA 3P60A 1HO1A 2ABAA 2ZRXA 4O15A 4TX9A 2Z2UA 4LVAA 3HBLA 1W5NA 3QW3A 2YFOA 2DZPA 4KWVA 4EF9A 2X1TA 2CFFA 2VEPA 4WXZA 3TFCA 4AF0A 2RHGA 3C61A 3W7PA 3OVPA 3L68A 4JDYA 3VE9A 3C2RA 2ZCGA 1KFJA 5D2XA 2YCEA 3BLIA 2FPYA 1ZNNA 1PVNA 3WJXA 1EUAA 3I7QA 3TROA 3DFQA 3L0KA 1LROA 1IIHA 1Y0EA 4UXDA 3FIGA 1JUKA 4GWEA 5KZMA 3DH7A 2A21A 5HQEA 4MJZA 1Q45A 3UY8A 1MEHA 3PULA 2ALDA 4NJJA 2X2GA 5FF2A 2V2CA 3LCXA 1OFPA 1YDOA 3O6DA 4DO6A 3S42A 2Y89A 1PL9A 2ZZ3A 1UUOA 1M6JA 3PB2A 3CWOX 4MZYA 3B06A 1QPOA 4X2RA 1TPWA 3C56A 4MY1A 4FF7A 4AHOA 2XN1A 3LCHA 4K8HA 4OBTA 4FO4A 3QJAA 4NZJA 3P80A 3W1LA 1YADA 5CZ0A 3LCGA 1QO2A 2WNZA 1TV5A 4LVGA 3W6YA 4JXCA 1VCFA 4DELA 3LHZA 1OFAA 4DXVA 3MJYA 2ZZ6A 4UC5A 1KM3A 3UWVA 3NVTA 3U6WA 2QCCA 1FXPA 1LRNA 2TRSA 1H51A 3FOKA 1IXNA 1XXXA 2Z1BA 3NOEA 1TB3A 4IOTA 2ABBA 1UASA 2A2IA 1I2QA 4K6AA 5CSRA 4I9AA 3W75A 1UUMA 2NXGA 3W1TA 1JUEA 3NQ7A 4NZFA 4UMCA 4IX2A 5KZEA 1VCVA 1SW3A 1OFEA 3KRSA 3O8AA 2R94A 4NXKA 3A5FA 5I3FA 2QDHA 2W0UA 4IJBA 3T44A 3ZWSA 1H61A 3P8IA 4MIMA 1R2SA 4GJ1A 1NAL1 3ATZA 3L5LA 4NJHA 5LSMA 1QOPA 4MYAA 3N9SA 1AW2A 1VQTA 3EWWA 3LCLA 5AHLA 4TIMA 4IPIA 2QCMA 1O5KA 3JR2A 4O16A 3IIVA 3ABRA 2J24A 3GDMA 3KOFA 5DY2A 2Y7DA 2ZRZA 4JX5A 3DFTA 3NL3A 1B4KA 4AWUA 4OGZA 2V2HA 1ML1A 2Y7FA 3W7GA 3T4CA 4KWWA 4P61A 1TO3A 4JEQA 2G97A 5IBXA 4HNVA 4KKXA 1TTJA 4A2SA 3UNDA 2QF7A 1R2TA 5BMXA 1OX5A 4MJMA 1O5XA 3UQNA 3NPWA 2PE4A 1C29A 1ALDA 1F6PA 3DHFA 1KFEA 3BW2A 3GIYA 3TQVA 4IMFA 2CZ5A 4WY0B 1FWTA 1IIGA 3I7RA 3W1NA 1LTDA 2RDWA 3HPZA 4CCCA 4ORMA 5HNRA 1F73A 3IVUA 2ZA3A 1ZAJA 3OBKA 4AWSA 2QUTA 3T78A 4X9SA 2P1FA 4CQ9A 2A5HA 3W1PA 1I45A 2EF9A 1TPEA 4NJIA 4N02A 1XCFA 1YXCA 1G6CA 4O1AA 1W5OA 3STFA 3KVLA 1YXYA 1LBMA 2P0OA 4FB7A 2C19A 5HR6A 3QQ0A 3IIOA 3V1PA 1W56A 5K4XA 3W2JA 3ABSA 4KFPA 3FKRA 3QYQA 2PCQA 1GEQA 3SGUA 3LOTA 3CHVA 5HMSA 5G2IA 2Y61A 3H53A 4Z0JA 5IBXC 5K7JA 4YLWA 3DFOA 4O1CA 2OX1A
chains in the Genus database with same CATH superfamily
2BS9A 3CPGA 2CXGA 3GDRA 3SZ8A 2IKHA 3M7WA 1IXOA 3ITOA 3DG7A 3N2MA 4GZJA 2OGJA 4FX8A 3TYDA 4HSNA 2WMGA 2UZ9A 1DYSA 3I6EA 4Z42C 2TMDA 3L4YA 1FFRA 2VTFA 1SFTA 4HPHA 2X0HA 2DT2A 5HMDA 3MUZ1 4XAFA 4C6NA 3T6CA 2QUNA 2I9UA 3AHXA 3NZ1A 3JU2A 4WXYA 1L8NA 5GNZA 2FVLA 3M6YA 5FJJA 4E8CA 2I17A 5EPDA 2C3ZA 1L6SA 4M6UA 3WQ6A 3CIXA 1OYAA 4GIEA 6TIMA 4PRRA 4XZLX 2RDUA 1FP8A 1QNVA 1W5MA 4CU8A 3WL0A 3GXTA 5AC7A 3LB0A 4GC3A 3G1VA 3RUBL 2ZZ2A 1HVXA 5DMLA 4UTTA 3NQAA 1ZBCA 2A0NA 8RUCA 1NQ6A 5M1TA 1OC7A 3C0QA 1QK0A 1VYRA 1JNEA 2X41A 4E3TA 2CXEA 3LHTA 1G01A 4B9YA 7ODCA 5KZ6A 3H7VA 2C0HA 3RCYA 4PCFA 1W5PA 3LM3A 1MUWA 3FSUA 4I7WA 3NQ6A 2R9RA 4YXGA 1RBAA 3UU0A 2V69A 3G1AA 1Z44A 2E6DA 3LQLA 3FKKA 1GHRA 3TMQA 1WBHA 2J13A 2INEA 3N34A 4DN1A 3B0UX 3LPOA 1LYXA 2OEKA 4XBKA 3E49A 2BHUA 1GK8A 4CD5A 1P0NA 3U48A 1CXHA 4JS3A 3G1HA 4FNRA 3COTA 5F2IA 3VGDA 3AMKA 3KRBA 2VJXA 2WJDA 3W3OA 2EBNA 1R86A 3O16A 2FB2A 4QEEA 1OX4A 1RVGA 2YR1A 3MHUA 3KBMA 1C7TA 1ZZMA 4Y7EA 4Z1AA 1K02A 2J6VA 3RO6A 2AL2A 3DU0A 3BMWA 5AKQA 4UQBA 3RJXA 1AFSA 5T8GA 3I65A 1JCTA 4HNNA 3LHVA 4S3KA 4YTSA 1BVNP 1V03A 1QUMA 3MYOA 2I5IA 2WKGA 5CAHA 3QEZA 4WUIA 4GIYA 1V7AA 3W7OA 4CQDA 3WQFA 2QR6A 6A3HA 3KUMA 3BGJA 3PSVA 1CGTA 2J9ZA 3NO1A 2CITA 2OWXA 4UMAA 3BLFA 4FXRA 2PGRA 3CTLA 2IMRA 1QI5A 1TWDA 3G77A 2WVTA 3K30A 1EJVC 4R9OA 1JDDA 4AD3A 3NL5A 3QMSA 2ONEA 1VYPX 4IXXA 3MCOA 1MEWA 3PPHA 1D3CA 4NAEA 4DEFA 1WA3A 3S1WA 1C93A 4E5TA 3V75A 3WQ4A 4YVPA 3W7KA 2VKZG 2A6LA 1OEPA 5LKYA 2V82A 3W2LA 5K9DA 3JRKA 2FIQA 3VGFA 5BXSA 2GK1A 2OSXA 4XUGA 2B7PA 3VCCA 4CCEA 1ZP3A 3TTYA 1HP4A 4Q8OA 2WLZA 2RDTA 1FBAA 3LDVA 3WLSA 3AWNA 3UZJA 1NP2A 5AB3A 4A3QA 3BG9A 3IV3A 4TX8A 1JQXA 3JUGA 4YCOA 3ZT5A 4D6CA 4JFSA 4N9BA 3BK0A 3VZZA 5AC5A 5C2XA 1MYRA 2WMIA 1KLZA 1I2NA 4LC8A 3NUKA 2C16A 3DI1A 2QJNA 1GQNA 2BXZA 1GQIA 4JNMA 4ZO8A 3FY1A 9RUBA 4UTWC 2CKRA 1JZ2A 1B30A 1PTAA 5I00A 4L4MA 2QIWA 2Y63A 4BQ3A 3A4XA 4A05A 3ZVHA 4RNJA 4B5SA 3VDHA 2B7NA 5J5DA 1E3ZA 2QJHA 1VFHA 3E2VA 1VPQA 1XIIA 2YLAA 1UQYA 3S46A 1QI2A 3A22A 3M07A 1R2RA 2QLYA 1S1RA 1S2AA 5H8UA 3THAA 2WANA 3OODA 1SU5A 2DP3A 2Y88A 2XGBA 2DIJA 1CGVA 1PYMA 2ZE0A 1TV4A 4GUGA 7ENLA 3L2IA 4X9YA 2BVWA 1GG1A 5CJMA 5K4ZA 1XLIA 3TTQA 2GQ8A 4NZ4A 5TIMA 1GOWA 4JTFA 3SIMA 1HF6A 5E09A 2FMNA 3TQKA 3WLRA 4C5YA 1XG4A 2FKPA 5K9XA 1DVJA 4IM4A 4Z2HA 3L12A 1RH9A 4JCMA 3OZPA 3H70A 1CB7B 1WO2A 4DUWA 1DBTA 2O4QA 1OGGA 1R9ZA 2PP0A 2YPIA 2UY4A 1ESWA 2VZUA 3SECA 3NQ8A 1SR9A 3KDNA 1UHVA 3TKFA 4GRSA 3HQOA 3O6AA 2DEPA 4IG2A 5I3JA 3A3XA 2V8ZA 2WSKA 3IGHX 3RYSA 2REQB 4AIEA 5CH9A 3IJ6A 2GVYA 2X16A 2QCFA 1TYGA 1ZBKA 1DQWA 4IIBA 3LCIA 3K13A 3T07A 3MPGA 2HBVA 1UD6A 1HQTA 1S5WA 4WRHA 3QV8A 2YCLB 4ZOAA 1HKVA 3BPWA 4LJ3A 1UMYA 1XH2A 3RMEA 3BSMA 1MEIA 2BDQA 4JY9A 3R1ZA 4JDBA 3O9NA 3JZEA 1E73M 1UD5A 2GGGA 2QMKA 3W74A 4AXNA 4RE3A 5HJLA 4OKDA 3VKCA 2PTXA 2D2GA 3O0KA 4ZE5A 3RDKA 2IKIA 3DDMA 2R91A 3GH5A 3UXKA 1XBZA 2E67A 4Q8MA 2GJNA 2WM1A 3IIZA 1RXOB 2QGHA 1K1DA 3NSMA 1C91A 3CO4A 5LIYX 3SAZA 1Q3NA 3HMJG 3SO7A 1JYXA 4ZO7A 2PGFA 1VH7A 4RE2A 2E3ZA 1QNRA 2NSOA 2R14A 2UY2A 3P6LA 5FJUA 5CPLA 1N7KA 1DWFM 3QFWA 2MUCA 2WKLA 3GDTA 3II1A 1WQ5A 1REQA 4DBSA 3TA9A 1W5QA 2EGZA 1EZWA 1FWCC 3TEVA 2GGEA 3EX6A 2VZVA 3BOLA 4AF0B 4LS1A 1JPDX 4J28A 1JFHA 1T41A 5LGXA 1KKRA 3HPXA 3BJFA 4JIHA 3U7BA 6REQA 3ATYA 3W72A 5HWMA 1E3XA 3H26A 1E9LA 3P81A 4LWWA 4DYEA 1KFLA 1HNYA 1I2RA 1EP1A 4JTSA 5IOBA 1IZKA 3ZJKA 5D30A 1VKFA 3ICJA 3SY1A 3KL5A 3HG5A 1UZHA 1MXGA 2EO7A 3T0DA 4GZIA 4IH3A 3TJLA 2WMHA 4M19A 1K03A 4GY7A 1XLKA 2J9XA 1M7PA 2V0TA 4DJFC 3SCRA 1XUZA 4MMWA 3OQEA 3U2OA 2Y5EA 2BGNE 3FAXA 4Q8NA 1H5VA 2HPIA 1L6WA 1GHSA 3SURA 1Z7AA 3EDKA 2Q8ZA 3WDRA 1JZ6A 5E0FA 4PUUA 4AB4A 2OT1A 1BYAA 2HV5A 1B1YA 1CTNA 4REQB 2Y70A 3WK3A 4HNCA 3LS9A 4CLMA 4JYDA 4O8RA 2G3IA 4BA0A 3QMRA 5EU9A 5F4WA 3QW4B 4QS6A 1HUVA 1W32A 3R11A 2G50A 4UQEA 4BI6A 4GFIA 4S1FA 2R1LA 1VJIA 2XTKA 5CBBA 4JTEA 8CGTA 5CJ5A 4AZCB 2J9YA 4NXSA 1XYFA 3KLKA 4EWJA 3ZR5A 1FKXA 2BVYA 4PMUA 2C6QA 2CLIA 5LXEA 3V5FA 3PBGA 1BGGA 4YTUA 1SM9A 2GJPA 2HS8A 3SI9A 1FWGC 1ZHAA 1VLIA 3LTYA 3VKKA 3EXRA 3E1F1 4WSHA 3IGUA 2E6AA 2PRHA 4RE4A 2CESA 5EB8A 4DJEC 4DUOA 5GNYA 4U10A 1Z89A 1QW7A 4MSSA 4QISA 4XO7A 3GX9A 3GNRA 2YL5A 1DWGM 3O3RA 3SJ3A 1FXQA 1IEWA 1NFBA 4KQNA 1E4IA 5D2TA 2PEVA 2NVDA 4GY1A 4WSKA 3VD9A 3GXPA 2CETA 3OHIA 2J77A 3ARWA 1QMLA 4ASTA 5DEZA 3N2CA 1JI2A 2IXUA 4X61A 4HZ8A 2CZEA 1O1ZA 3EDDA 2QPSA 2G3FA 1KTCA 1F6KA 2V5CA 4ZE4A 5I09A 4EXBA 1JCMP 3HG4A 4ATLA 3M0JA 2XVPA 3EMZA 1RLDA 3GTHA 1TV8A 1UMLA 1AK5A 2QV4A 1U83A 2A7RA 4YU1A 3HGRA 1RJRA 1E6PA 1FWNA 4JTDA 2YL6A 4DNMA 4OU1A 2HCVA 5D38A 1NM9A 3S5ZA 5CCZA 1SPQA 4C1LA 5LHFA 1FWBC 1E9IA 4Q8VA 3DENA 1XC4A 5HNTA 4I90A 1GOIA 1OFRA 3NJ3A 1DIEA 1JPMA 1SFSA 4GUHA 4LY8A 3ZJ8A 4CQ8A 1R3VA 1T96A 1NDYA 3DAQA 2PTYA 3KWSA 3B97A 1N8WA 5G2HA 3SADA 4M5PA 5GVJA 3ZLHA 1E9ZB 3PJWA 1NOFA 1IGSA 1JDCA 1ZPTA 2NQ5A 3H2MA 1GZGA 3M0ZA 2GJLA 3UCCA 4JTIA 4JD4A 2GSHA 2W61A 3IVTA 2RKXA 4DPQA 3F2BA 3QTPA 1J0IA 2VFHA 1HKMA 1OINA 4CCZA 5M2FX 4C6CA 3LHYA 4NJKA 3CNYA 2EJ1A 8A3HA 3H2CA 3BG5A 3WNLA 1OJXA 3OP2A 1WDRA 5I02A 1N8FA 2NWRA 1E15A 5CG7A 3VFLA 1PKYA 3N3MA 2CZDA 3AXHA 1AZ2A 5JIPA 3QV9A 1PIIA 5DRCA 1KTBA 2V5LA 3H7RA 2CBUA 4M7TA 2H9AB 4CEUC 4QNEA 1TWZA 2EPOA 2C0AA 4N6EA 1XQKA 4DRSA 2HEJA 3TJIA 3UXLA 3VE7A 3FEQA 2F7FA 1GT8A 5DCEA 2F38A 4QG6A 1PTDA 2ADAA 1ZBVA 3N4FA 1UBPC 4HBKA 4H6KA 2GJRA 4HZ6A 5C5YA 4EE9A 2WCAA 3CO8A 1DQXA 2Y24A 4RK8A 1K7XA 2WZHA 2CBJA 4B15A 5A8MA 2DZTA 4R85A 3THUA 2GGHA 2W79A 1XLBA 4IGHA 3T9PA 4D2JA 4JTRA 1BXNA 3I3DA 5F4SA 3UJSA 4LVFA 3WQCA 2PDQA 1TPB1 1LZOA 1L9WA 1SZRA 4PL1A 1UIPA 2Y5SA 2DVUA 1FH7A 4FXJA 1R87A 2GDUA 1GPFA 3KEHA 4IGMA 4R53A 1BEUA 4J3XA 4P5UA 4CD7A 3W22A 1QOQA 3PFRA 3NR0A 4FNPA 3TSMA 3GBEA 1X39A 3LYEA 1B90A 3CV6A 1Q63A 5F1UA 2F61A 2PTDA 3Q65A 2BG5A 1E4MM 2VUNA 5A2BA 3QPEA 3MSYA 4QE5A 3WUGA 2A3HA 1FH8A 3WZ0E 1HGYA 5I3GA 3F7JA 4X60A 3BXWA 4W93A 2R1PA 3UYCA 4EPEC 3PZQA 3BZGA 1R3QA 1QASA 1R8LA 4IQJA 1E6XM 1ITCA 3BOXA 4XTIA 2DY3A 4O1EA 2EQDA 3CMJA 1MW3A 3AISA 4XD4A 3MSGA 4HPJA 2YDSA 1VJZA 2YIHA 3UXDA 3NM1A 5JMUA 3SGZA 1W37A 1FKWA 3RK8A 5BNKA 5LIWX 3SFWA 5BOEA 4E3VA 1JUBA 3TC7A 3UZ5A 3A4AA 3PBVA 2O9PA 2ACRA 2Z0IA 3ITYA 1J0YA 1F8IA 4AVFA 1W17A 2NV2A 2EAWA 1EEXA 2DW7A 3KX6A 3KHJA 1O60A 3HJEA 4DAIA 3H6OA 3SSJA 1Q6OA 3FNDA 1VRDA 4KF1A 2J74A 3ZR4A 1IXQA 5HUPA 1YQ2A 1GQJA 1V6UA 5D03A 3GVRA 1XICA 3UR7A 4N7QA 4MDPA 2JBMA 4PB4A 3AALA 4KWUA 2WWDA 2BMBA 3M7SA 4XBJA 4NSBA 4G56A 4GX9A 3WSUA 3WJSA 2NT0A 4W9TA 4PFMA 3S9IA 3VNDA 1HVQA 4B3KA 3LHWA 1EP3A 1H5YA 2DSUA 3OGRA 1UP3A 3VD3A 3PTQA 4MFEA 4F9DA 3S2CA 5AVNA 4K39A 5F2MA 3UGRA 1L8PA 4Y9MA 3VM5A 1A5CA 3NNTA 4ZQOA 2E28A 3WLJA 4ZO6A 1C9DA 5BXPA 3N6QA 5KZDA 3STCA 1RALA 1QW9A 3BW4A 3RRXA 1IXPA 2EHHA 4QM1A 1NY1A 1XYLA 3QQ1A 3SCWA 3ZFHA 2BBFA 5FAJA 3P74A 3FVMA 5MKGB 1UR9A 4K36A 1IEQA 4UTIA 4Y90A 4TMBA 4JTTA 4L6HA 3MSDA 3VOHA 1O7AA 3MI2A 2ZTJA 2GQAA 4O57A 1EXPA 2GZXA 1LORA 3FA4A 5CPOA 2WJZA 4BWLC 1C8XA 3HG3A 1K8CA 4ROQA 3WY1A 1NF7A 4QSFA 4UTFA 1UP0A 4DHGA 3UCDA 2YJQA 3W7LA 5BYWA 1VFSA 4HSHA 1PKNA 2FHCA 1TPVA 1B3OA 4ZMGA 1EXBA 4LV9A 3RIKA 4HOZA 5A6BD 3G1XA 3NXFA 1OD0A 2XDFA 1WOBA 3URQA 4CUCA 4KFNA 4NY2A 2PDBA 1M7JA 3ABXA 1IWPA 3T08A 3E0LA 3RFAA 3L5MA 5CEWA 4K7VA 4P8VA 4S3GA 1R9XA 2PLKA 1PE1A 1GG0A 2HK1A 3WEZA 2E4TA 2TYSA 1OFDA 3C0SA 1LWJA 3AS2A 2XUCA 5AYBA 3GHSA 4BK9A 4S2BA 3HOJA 1P43A 2WNNA 4NRRA 1VS1A 4DWSB 2Y85A 3CS2A 1KQZA 2W6RA 1JYVA 3OG2A 4K68A 3VDBA 2CW6A 2EKCA 3R2GA 4GI6A 3SR7A 3PM6A 1SW0A 1A0EA 1YKWA 4RKAA 3KXQA 3DCPA 2VRKA 1PV8A 3PPFA 3M5VA 3WQEA 3V0UA 1K8YA 4UNIA 1UWTA 3ARSA 5HQLA 3ZLFA 4PTWA 3UG5A 4F48A 4H01A 4M24A 4AC1X 3CV7A 4WY0F 3W37A 2UV8G 3R0KA 1TMQA 1SMAA 4GCAA 1XKYA 1WAWA 1W9UA 3B9DA 1OM0A 1KGUA 2VQTA 3RX3A 4JX6A 2WHKA 2CWXA 1Q2RA 3AO0A 1UWRA 5AYYA 4NHVA 3LLFA 2A85A 3NM3A 3DYOA 3E12A 1A5BA 3SN4A 3MMDA 1EO7A 4LRTA 3WIJA 3NYZA 1MXSA 4R3UA 1CDGA 2XH4A 5FCZA 2XFRA 3UESA 5LNRA 4LB3A 4QFUA 4EK7A 2AGKA 1XLJA 4MZ1A 1YRRA 3MI6A 3MU7A 4JFWA 5H2ZA 3FN9A 2PDFA 1S3HA 2QDEA 3W86A 4LS2A 4L1WA 3CLMA 4GE8A 3HTWA 1KM6A 4LH8A 1EYWA 1HG3A 5C55A 2YA2A 2R8WA 3CHCA 4K7YA 2NQ9A 4OV4A 5F4XA 2BWGA 3SM0A 1UKSA 4MWAC 5DO8A 3GY1A 4LBSA 1CT5A 3O0FA 1WUFA 4URIA 4FXSA 4DWDA 2NSXA 1ONRA 3TCEA 3C2YA 3MW7A 4A8RA 1CGXA 4NL1A 3U4FA 1FWHC 2ZUWA 3W1QA 4CEXC 1R0MA 4MOZA 5HATA 3S2JA 1QNOA 3ABZA 1H0IA 2VXNA 2HMCA 4HSOA 4UNKA 4LGXA 4HU4A 3CC1A 5CC6A 4JTQA 1ZRQA 2VZOA 2OELA 2QIIA 3LXCA 1UWIA 4QDMA 4IIEA 4N42A 2ZDSA 5DRIA 3K4WA 1FHUA 4EWND 4YN5A 2YCLA 5MHBA 1DE5A 1GVRA 3KL0A 2Z2AA 4NT0A 2WWCA 2DT1A 2QCHA 2C1IA 2Q3OA 3TX9A 4C60A 4OFCA 2Z1KA 3N11A 1E0WA 2PDLA 5D9MA 4DWSD 1AQ0A 4TVDA 1LQAA 2P8BA 3O06A 1EDGA 1E6RA 1VBGA 3CPUA 1LUCB 4NKCA 3W00A 4QEHA 4INFA 4S39A 1TMHA 3LHUA 1X6NA 1SFJA 1RBOB 2DT3A 2B31A 2OKOA 5FEZA 5D9PA 4S3JA 3HB9A 1A47A 2VDIA 3QC3A 4L64A 3FJNA 1KBLA 2O0TA 3VYLA 1U5HA 4S3AA 2C15A 1DHKA 4AZBA 3MUY1 5REQB 1B5TA 3BAXA 4DF2A 3GYCA 4DY1A 5I6SA 4V1YA 2XWDA 1GTEA 3GYEA 1EH9A 4PTDA 1KFCA 4GA8A 1W2PA 3AU2A 3P60A 1W2VA 2ABAA 2ZRXA 3WQVA 3TTOA 3QW3A 4HA3A 3BH4A 3ECQA 4X63A 1C8QA 2DZPA 4EF9A 2DSZA 2VEPA 4AF0A 4NASA 3C61A 4E2VA 4LQ1A 4C6JA 4JDYA 3VE9A 1KCKA 3XIMA 5D2XA 1LF1A 3IACA 4I3GA 1XLFA 3POCA 3I7QA 3TROA 1WZAA 2P3ZA 3WYZA 3T09A 4UXDA 4CNTA 5LXXA 4RNIA 4DLFA 3OLGA 4MJZA 3UY8A 4A3RA 1NDZA 4JQ3A 3H2NA 4DJFD 2VCCA 9XIAA 2ALDA 2X2GA 4WGHA 1DXFA 1OY0A 1I60A 1LT8A 3PZGA 3RG6A 2Y89A 1PL9A 1GOKA 3EDEA 1WNOA 4MZYA 1V0NA 1TPWA 3KBSA 2O55A 4AHOA 4IGSA 4HTYA 1F3WA 4OBTA 2QJMA 4FO4A 4ZB2A 2NVCA 3Q4DA 3P80A 3ZOAA 1YADA 4LVGA 1FFQA 4PUJA 4DELA 3HA1A 1OFAA 2D22A 4GG9A 1PX4A 1YNPA 4REQA 1OB0A 4LUTB 3MJYA 2CHNA 3UWVA 1KKOA 3GNOA 1E40A 1H51A 3FOKA 3JW7A 1IXNA 3NOEA 3SN0A 4GVHA 5AYIA 2A2IA 1E5NA 4LX4A 1K77A 3HQNA 1UUMA 1L6GA 1D2KA 3KS5A 4FOUA 4NZFA 4P8UA 4F79A 3ARXA 1VCVA 3APGA 2INFA 2HVMA 3PZNA 3VA8A 4CQCA 1UW9A 1CCWB 2QDHA 4AZCA 3ARPA 3HFYA 5HMFA 3URAA 4MIMA 1NAL1 3AXMA 3L5LA 4NJHA 5LSMA 1VQTA 4DJED 3EWWA 3LCLA 4IPIA 2QCMA 2OO6A 1UD3A 4D8AA 1CLVA 1C7SA 4L7ZA 3B9EA 3NL3A 5H8MA 2V2HA 3T4CA 4KWWA 4H6QA 5LA1A 4TVCA 3N12A 1J0HA 4DJDC 2G97A 5IBXA 4HNVA 3G5EA 5BMXA 1OX5A 4MJMA 3GG0A 1ZJHA 1T6MA 4QLKA 3VIIA 1KBBA 1F6PA 3DHFA 3EA3A 3M64A 4KS0A 3OO2A 2PA6A 1QNQA 4V33A 1IIGA 1MNSA 1E43A 1CGWA 3CV1A 1WZKA 4ATDA 3VMNA 3IVUA 1W1VA 2ZA3A 4P7OA 3OPSA 3RX4A 4AWSA 3WLMA 4LF1A 2P1FA 3MA8A 3VC5A 1J0KA 7TAAA 4FP1A 2YDRA 1K9TA 4F0RA 2BOFX 4DI9A 2EG6A 3BUVA 2ASHA 3KS6A 1UC5A 3BL3A 4N02A 3RPDA 5CZKA 1KGXA 1DP0A 3ZJ6A 4DI8A 1YXYA 3AIEA 3IIOA 1JZ8A 4UR9A 1M04A 2EJAA 1SVDA 3ZM8A 3BAKA 5PTDA 3CHVA 3QHOA 5A6TC 1OGBA 5G2IA 2NQHA 3SCTA 4YLWA 1O12A 1P6BA 3C2OA 1XIFA 1PX8A 1UKQA 1TIWA 1UQZA 3ARQA 3SCSA 4J3VA 3C3UA 2OLAA 3WL1A 1OFOA 4GD0A 4QITA 4UTKA 3LI0A 2W4XA 3SDOA 3WFLA 1IT8A 1XDLA 1W3JA 1ME8A 2VOMA 3HURA 2ZFAA 5HQMA 5LNUA 2V68A 3FYOA 3IAPA 3H2AA 2QCEA 5D33A 4HMDA 3GNPA 1RK5A 1VFUA 2VEKA 3A23A 5U7SA 5DXXA 3RRAA 3VZYA 3EOLA 2WCSA 3WQ5A 3L4XA 2H9AA 4LXFA 3T8LA 1V7YA 4LYPA 2OOFA 3VNJA 3R43A 3PVFA 3AS1A 3MTWA 4B2DD 4M6PA 3S5YA 3W1RA 3W84A 4CD6A 4Q3MA 3QGAC 2CNCA 1SZNA 3DECA 3Q37A 4DM1A 1WBJA 1FWWA 2ZX8A 6XIMA 3P3BA 1W0MA 3WO8A 3M47A 1DWHM 3T0CA 3KBWA 2BOEX 4DYKA 1CECA 1O6IA 2BY1A 3H54A 1UKOA 4JGDA 1H7WA 2G37A 4AY1A 2ZTKA 1TRIA 1HTIA 3PZMA 1J12A 3TJXA 3FHAA 3CMGA 4V28A 3UP8A 3M43A 4XZNX 4CD4A 2E09A 3QHMA 3TSDA 3TVAA 1ISZA 3NO5A 3ERPA 2INZA 3AIRA 3K2GA 1B54A 3WH7A 3F2DA 3W38A 3BW3A 3NCOA 1XG3A 3NPUA 1PZ0A 3LRKA 4GQRA 1S5VA 2ZZ7A 1CLKA 2ZC8A 4XISA 5FKYA 1JCXA 2IXVA 3ISIX 4HHMA 7REQB 4PTNA 5TF0A 3PWGA 1RJQA 5A6BA 5J04A 2PSNA 3LI1A 5I78A 2P53A 1S2VA 2UY5A 4LSBA 2FHBA 4LNCA 2VL4A 4KBXA 4X0NA 2JGYA 2JIWA 1V3HA 1ODUA 3RX2A 1UWSA 3PBMA 1AH0A 1JGIA 3QGVA 5FESA 1DJIA 1WDQA 3L4WA 2XH7A 5D32A 4RZ5A 3WMLA 4ZQMA 2OQYA 1A4MA 2FGZA 3INPA 1PCWA 1KFBA 2G3JA 1OYBA 3NZQA 3PBUA 3HMCA 3KBNA 4LC6A 4BZYA 1QHOA 4LCRA 3W7HA 3PS7A 3SRHA 2G4JA 3AUOA 3EAUA 1F07A 3LTSA 3P82A 3CUGA 1E4LA 2GQ3A 1VZWA 2E6YA 3EEGA 1BYDA 1V4YA 2VUYA 3AS0A 1VBJA 1X96A 1ME7A 4M82A 1HN1A 5T9CE 4DLMA 1DE6A 1XLDA 2X8RA 4AZIA 3NDOA 2ODOA 3FW6A 5AHMA 2GQ9A 1KGWA 4UTWA 1TR9A 2G96A 1OWQA 3U3HA 4RR4A 1JDEA 3BSHA 1DJHA 2WSRA 3BZJA 3TV8A 3UT0A 1W8SA 1K4HA 1KWGA 5D8WA 3UERA 1E1EA 4L56A 1QU4A 3FJLA 1WOAA 2XVGA 3T4WA 5BCAA 4Q33A 1K6AA 3BQ5A 5FJRA 1V93A 2VZTA 4P7LA 4XB3A 1SGJA 1KM5A 3W7MA 4BR1A 4MB3A 4Q22A 3WH6A 3IV8A 4WCJA 2VC6A 4L9YA 2E25A 3AHTA 1EOMA 1Q6CA 3E9AA 2Y2WA 5M03A 1XR2A 4M3PA 2XJ7A 4HD5A 1JG9A 2DZVA 3W2NA 4KRUA 2JIEA 3BDKA 1BFNA 4DZHA 3M0YA 3UD6A 5GQBA 4GNJA 1KM0A 4OBSA 2C8NA 1EC8A 2BY0A 5IFPA 4YWSA 1KCXA 4F9JA 5MKGA 3LEPA 2PRLA 5F2GA 4UOQA 1TV2A 2G3MA 4ZGYA 2GDVA 3IUDA 3UR2A 4JQ1A 2VNCA 2R1KA 3NPVA 1H50A 4LVBA 5JVLA 5I07A 4BI5A 1D8CA 3DUGA 4MWAB 3W27A 3PG8A 3GAKA 1P0KA 2XVNA 3E96A 3V0SA 2CHRA 4YWIA 4WDTA 1POKA 2QV5A 5EMMA 4G1NA 1XI3A 3MHFA 1V0LA 1OQFA 4V27A 3K46A 3G3MA 4PMZA 1MWOA 2J8GA 3GFZA 3BLLA 3KTSA 5LNSA 2DJLA 4HNLA 1TQJA 2ZUVA 4B3LA 3NVDA 3I4KA 2WSQA 1EDTA 2Y7GA 4F0LA 1ZALA 1BSLA 4RL3A 4YHGA 1UA7A 2FFCA 4EIVA 2KZHA 3NO3A 3QLDA 1R46A 3NFUA 4NZ5A 3HQPA 3B0PA 1S5NA 1AQHA 2AL2B 2Y5JA 1UH3A 4ZOBA 5E0CA 5C9XA 4JKKA 4C6MA 3DESA 4QQ3A 1V77A 3BJTA 1U5JA 4R88A 3OHMB 3TFXA 4O1FA 3OBEA 3QKZA 4GXPA 3OW1A 4HT3A 1VBUA 1ECEA 4DWSA 3QF0A 2CLKA 3N4AA 2WSPA 3IUHA 2V5BA 4AU0A 2ZBTA 4NZCA 3N6JA 1TTPA 4FPSA 4Z1DA 1SO5A 2NWSA 2EPKX 1D8WA 3L2MA 3AC0A 3WK1A 3S6DA 1NP0A 1W31A 3KP0A 3WD1A 4BKNA 2XVKA 2OSWA 4Z2IA 1I0BA 3W0KA 2QW5A 4MVAA 1TVLA 5L9FA 4HNUA 2CLLA 3ME3A 1OF6A 1CXKA 3BMXA 1H1YA 4N4PA 4O53A 4X2PA 4NRSA 3AQUA 1E0VA 4H9UA 4HNOA 1W3KA 3ARTA 2XH2A 3IIPA 3CYJA 1IEXA 3B03A 5DF0A 1FWRA 3L7RA 4AEEA 3M0IA 1QPQA 5LGZA 3W71A 4BF9A 4E8GA 2QCDB 4Z0SA 5HJXA 3F03K 3VMOA 5FSDC 3LX9A 3B8DA 2QUVA 3VIGA 2HJPA 1W6TA 4QLJA 5JU6A 2VCBA 3G8RA 3SUVA 4AUBA 1DWIM 3B8WA 2JFEX 2IQTA 2MANA 3C0JA 1ZL1A 3H23A 2X09A 4ZB5A 3UZXA 3GKAA 4KFOA 3A5VA 4GOAA 2HZGA 1RK6A 2QXWA 3RNDA 4DJFA 4A35A 4NNBA 1YNQA 4B91A 3H22A 1MVYA 3ELFA 4Y6GA 3VD7A 1V6WA 4W4QA 3AICA 4LAMA 5AC6A 3MMUA 4H9ZA 4MB4A 3W81A 4H8UA 4OHQA 3CUZA 4QAWA 1KV5A 4MWAD 3WLNA 3CEUA 1EJRC 1JR1A 4FNUA 1R30A 4M1RA 5E93A 1CZ1A 1W9BM 5LZLA 2PAJA 2XZ7A 3EX1A 5DBTA 3DBNA 1HW6A 3QZ6A 3WH9A 1MZRA 3GG7A 3CWHA 4BF5A 1F5ZA 3KWXA 4DXXA 5D4YA 2CLHA 2J47A 3N9KA 2VGIA 1SYTA 3TN4A 2DZWA 1R5YA 3QH2A 3QR1A 4D8LA 3GTFA 1RUSA 1DL3A 4OWGA 1EF3A 5CJNA 3WDJA 1FOBA 1S2WA 3GSMA 3PZUA 4WLCA 4UQAA 4GUIA 1TTIA 4O1DA 1WZLA 4PTVA 3A3WA 3PZOA 2GWNA 2OZTA 1JFXA 2ZX6A 4DJEA 3NURA 3PBYA 1W9XA 1VJSA 1DHPA 4HOXA 1X8FA 4HZMA 2XIMA 1M1BA 3FYYA 4YL2A 2R6OA 2VURA 1QI4A 4EXAA 2QUUA 5FF3A 5DN1A 3LM7A 3R5EA 1XIMA 1DJWA 1LUCA 4M56A 1AH4A 1XP3A 3SGGA 3TU9A 5A1AA 2IPJA 3W70A 1W1TA 1ONEA 3VU2A 4HCDA 4DBEA 2Q8LA 3LA4A 3SUUA 1QOXA 2Q01A 4LB4A 3R8HA 1KM4A 4C6PA 3U9IA 4ZTXA 2NVAA 1PKMA 4PTXA 3D6NA 5REQA 2AKZA 4TOQA 2VGGA 1WE5A 3FSTA 4RV3A 1CXIA 1DXIA 4LAOA 1EJSC 4WKAA 5JH1A 2WC3A 4A6GA 3OYZA 2XFFA 1XLLA 3T0AA 2BVDA 3SUTA 4B3ZA 5HPCA 4IUOA 1V02E 1H7OA 1OCBA 4IIGA 2RAGA 3V18A 2ZX9A 3SUSA 4FIRA 4YCPA 3GTNA 4HTBA 2D20A 1S39A 3A4WA 3GB6A 4G5DA 4LYQA 5CGTA 5EA9A 1UKTA 5D2VA 2OLSA 3EB4A 5EGRA 5AN7A 4ZFMA 1LL6A 4HYRA 3CU2A 2J66A 1YYAA 4NP7A 3SQLA 4IF2A 3THQA 3U5UA 4YYFA 3MKKA 1ADSA 3EOOA 1JD7A 4Q7BA 1G4EA 1T40A 3T2QA 2ZRYA 4OZOA 1TPH1 2VVNA 1BKSA 3HPFA 3TTEA 5FL0A 3WFAA 2AL1A 3WMCA 2ZOXA 1XLHA 3UGVA 4CU6A 4M7SA 3B8VA 1X1NA 2OZ0A 1UROA 3LERA 4D8ZA 3QN3A 1AJ2A 2E5BA 4HIBA 4C7GA 3R79A 4LEFA 2GDQA 3UYIA 5L6UA 3QPYA 4DYJA 1Y8BA 6TAAA 1Z3NA 1UR0A 3W26A 3VFCA 3C8NA 5BU9A 4Y96A 2PBOA 3EKGA 3RR4A 2VO5A 4B2DA 4JQAA 1ITQA 4WQ6A 4YS1A 3SQSA 1UCWA 3G1YA 4OTKA 2WSYA 1YBQB 3KP1A 1LL4A 2ZA1A 1K3UA 4Q6JA 1V6XA 2WLYA 1X6LA 3BLPX 4CD8A 4DJDD 2D24A 4HA4A 4ZQRA 3TC6A 3V1HA 4TTUA 2P50A 2J7DA 1XIEA 3LNPA 4LCQA 4RXGA 3RM9A 5K3VA 4KGLA 3BURA 3HIJA 1TREA 2V3GA 1L6FA 3U0HA 4JEJA 1KBJA 2QMJA 3GLCA 3ZXWA 3AI0A 3EPNA 1DV7A 3M0XA 4QCFA 3EPMA 1G67A 4GUFA 2CLEA 3TK7A 1EOKA 1HL8A 1P0EA 3L4TA 2ZIDA 3UWUA 1KRBC 4LTSA 1A5MC 3A12A 1SZFA 2FGBA 1M7OA 2PB1A 3H4WA 3WX7A 4UNLA 4XAYA 2OR2A 1E72M 4IL2A 1QDSA 3RLVA 1QAPA 2XSXA 1ZS2A 1W3IA 2BODX 4E8DA 5IHRA 3UA4A 4U2YA 5A6MA 2OOGA 1GW1A 3W7JA 4IGNA 1P6WA 1EBHA 4EACA 3UEQA 3ITXA 4A29A 3T8QA 4PTMA 1OABA 5D09A 5CPMA 1ZAIA 4PH6A 4L65A 1HJUA 1MFVA 3WNKA 3M44A 2ZICA 3W1MA 4MDOA 2JKEA 3WBEA 1ISYA 1ITXA 4ZSUA 3CTTA 3UZZA 3FJ6A 1KW1A 4GVIA 1G1YA 3F4WA 3L21A 4CU7A 2QNEA 2HE5A 2WKJA 4ZOEA 1QWGA 2GVGA 4IP4A 3FA3A 4O11A 3CZGA 3W7DA 1OX6A 4R33A 4J1OA 2E1DA 1OVDA 3LGEA 2HTMA 1XFBA 3JVAA 1W1A1 1TA3B 4HU3A 3TTSA 3GU9A 1QVBA 1E5JA 1AL7A 4AX7A 1HJSA 3CL8A 3K8LA 5CZJA 1DKWA 3HJZA 3CLWA 2OCZA 4M6QA 3E3HA 3PY2A 3WEMA 2C1GA 4GJIA 4HA1A 2X2YA 2YLLA 1ICPA 1O68A 3VOIA 1FVPA 3GZ3A 4RZ4A 3W7QA 3UFYA 2F2HA 3R0UA 3ZQ9A 4NI3A 1RSCA 5JBEA 1FWFC 3QHNA 4L9XA 3THCA 4Q6XA 1GNXA 1WXZA 2V5KA 4AMAA 5E70A 3CQKA 1EB3A 1A4LA 2ANUA 2H6RA 1XYZA 4Y8FA 3CZEA 1S46A 2PUZA 3U57A 5D37A 1GQKA 4BWLA 3VNMA 3K4DA 4WX2A 2O4MA 4IMGA 4WGXA 4MG4A 3LPGA 1RCOB 2B7OA 1S2UA 1VENA 2R82A 4JHZA 4XZIA 3VIJA 4MKSA 3PR2A 2QAPA 1MXDA 1PSCA 1Z69A 3C8FA 3N15A 4MPKA 3GXIA 5I77A 1OK4A 3EDFA 3M0VA 4J3ZA 3L0NA 3O1NA 5MF5A 1AQFA 1RZMA 7REQA 3CAKA 2CPUA 4LEQA 1P1XA 4S38A 4PYSA 1X7IA 1CB2A 1E55A 3VNYA 3GNDA 1VFOA 1DOSA 3E5PA 4KEZA 3G0UA 1EJ7L 3CH9A 4AXKA 2XINA 4EAYA 4RJEA 3T2PA 4PMOA 4E2DA 4GNVA 4ML4A 1MNZA 4QROA 2ZZ5A 4C6KA 3NPXA 4C6EA 3AYRA 1W8GA 1HFBA 2J6XA 3P14A 1E51A 2PWGA 1FA2A 3N19B 3GW3A 2J8TA 1L2QA 4IIHA 4IPNB 3W7IA 3HFTA 1HJXA 2BXVA 4N9EA 4AC7C 4FLRA 5FF0A 4Z08A 1EUNA 3MP4A 3Q58A 3WLIA 3DZ1A 4BCEA 5LA0A 4O52A 2Z29A 4HHLA 1XD0A 3TYUA 3LGDA 2D1ZA 1YPFA 1NIUA 3THDA 5DMMA 2V6AA 3O6CA 4PULA 4W7VA 4L4PA 4LNYA 3QXBA 4B90A 2OG9A 2NUYA 3KAOA 5DCBA 3MBDA 3UG8A 5HK4A 3W83A 1JD9A 4IP5A 5B80A 3BANA 4GINA 3DGRA 4NX0A 2PLJA 4X3ZA 1PBGA 4ZB0A 3PK7A 3R10A 3CL6A 3DFHA 4K8EA 6ENLA 1L6YA 5LIUX 1R7AA 2NLIA 1GW9A 1GPWA 2FTPA 3SIZA 3CMFA 4EANA 3VGHA 3OLEA 3BAJA 2G0WA 1J6PA 3PFMA 5GJNA 3DFNA 1XV8A 1GZJA 1XYCA 3URBA 1O95A 4LAUA 4HJWA 4O50A 2C71A 1KXTA 3ZWTA 1GEHA 5AOUA 3SCOA 4D1IA 1CPUA 1XRVA 2E68A 4OUIA 3EX3A 2BZNA 5JIWA 1VFLA 1J10A 1HX0A 1I0DA 2XSAA 4X0VA 3LENA 5BROA 2L5HA 4UFKA 3WNNA 3CB8A 2IKJA 4IP7A 1S2TA 5JXQA 4TV5A 2Z00A 2D2OA 2YX0A 1K7FA 4KWOA 4PC8A 4QJ3B 4QDPA 1I2OA 1ECQA 4PN2A 1Q7MA 2RJGA 2W66A 4MWAA 2CLFA 2CIPA 5T91A 1JRBA 2OKTA 5AFDA 2V2DA 3QR0A 3CPRA 1E56A 1IWAA 3HV8A 3LGGA 1LDCA 1TELA 3WBXA 1Q6FA 4ZSTA 3EMQA 4J5NA 2PU0A 2QAFA 5H91A 2V38A 1FCBA 3FK4A 3M46A 4Q4SA 3GR7A 1F3EA 1EGMA 2ZXDA 1EQPA 2D3NA 1D7KA 1P48A 2QEZA 4FSAA 3HQ1A 2ZWZA 2HSAA 1Q5MA 3U2EA 3C52A 1W3LA 5J8LA 3XISA 1O5RA 1TE6A 3EOUA 4D1JA 1NDVA 3LSBA 3S47A 1OBAA 3AOFA 1PO9A 4I6KA 2FMOA 1TJ1A 4ONVA 5K2ZA 3BE7A 4AY7A 1VEMA 4I7VA 1YE4A 1V08A 4ERGA 2GLKA 1HP5A 3M5ZA 1TV3A 2J62A 3DG6A 3G0SA 2V9DA 1YIXA 3MBFA 2Z1WA 3UA3A 4UQ9A 1THFD 3UG3A 4QIUA 2FH8A 2FB3A 3K4AA 4J2PA 1BRLB 3LPPA 2VMFA 4WSJA 5HINA 4O54A 1ZBWA 2E9MA 4NVTA 3DKLA 3W2MA 4UFJA 3WKZA 1GORA 2YA1A 4D72A 1XGZA 4GCXA 5I23A 1CWYA 3BV4A 2OPJA 4W87A 1K8XA 4PMVA 2OEMA 4HHPA 4DB7A 5A95A 5AYXA 2YB4A 3VKAA 2A7PA 3ZSTA 4DF0A 2J27A 3JS3A 1LJYA 5C9RA 2W62A 3AYTA 3LBOA 2WPBA 3IS4A 3NA8A 2W67A 3N04A 3O05A 1A5NC 1K70A 1BVWA 1M01A 4W8AA 1N55A 1ZJIA 2WB5A 2VELA 2QCDA 4IFRA 3WBYA 3CM4A 4B4FA 1EIBA 3RN6A 3HU7A 1RPKA 1HJQA 4WDWA 3EXTA 4GVFA 1F9CA 5G1MA 5IDIA 2PWEA 4IMDA 1JPHA 2PDUA 4JHMA 1E70M 3W53A 3UPMA 4JNZA 4MLJA 3NGJA 3REQB 2RJHA 5ECVA 1OG6A 3TQPA 1EQCA 3LXBA 2JKPA 1EF2A 3VXGA 4PODA 1EHAA 2YOCA 4FXFA 4L80A 5AYZA 4JFUA 4GBDA 4JYEA 3TYAA 2YCKX 1J0JA 3BARA 2WZMA 1RQBA 2PWVA 4OECA 1AJZA 3W82A 2VEIA 2DSVA 3WUFA 3F4NA 3W02A 2FZ8A 1CENA 5KTLA 3PJUA 2VRQA 3WD0A 4O15A 2VZSA 1XYAA 5C2CA 4LVAA 4KWVA 2Y8VA 2E8ZA 4L4OA 4PUMA 4H9YA 1JDFA 2ZX5A 1XRFA 2RHGA 3ALFA 3OVPA 3SRFA 5CG0A 1GOOA 4WDXA 1KFJA 3BLIA 1EUAA 4ICCX 3VOCA 1LROA 3ZO9A 2R1NA 4GWEA 3S2MA 5H1WA 3DH7A 4EP8C 1Q45A 1QTWA 3T0TA 1MEHA 3PULA 5GNXA 1S2CA 1TWWA 4HB7A 1QW8A 3S42A 1SJBA 1UUOA 1M6JA 3G2GA 3B06A 2OYKA 4CKQA 3PZIA 2ZXBA 4MY1A 4NF7A 1T5AA 4K8HA 1ZP4A 3FHQA 1V6YA 2WXDM 1UH2A 4G2DA 2A3BA 1QO2A 2PDKA 1FWJC 3CHDA 2YBVA 4DJDA 4YTRA 4JTAA 4DXVA 4UC5A 4BF7A 1KM3A 1EPVA 2RGLA 3NVTA 4IL0A 3TWBA 1CXLA 1GKRA 1XXXA 1Q6EA 4IOTA 2ABBA 4K6AA 4Y9OA 3VX0A 2YA0A 4LBRA 1JUEA 3NQ7A 2FZMA 1XRTA 4IX2A 5CPQA 5KZEA 1SW3A 4MAVA 3GZAA 3O8AA 2R94A 3OGSA 4LFYA 2W0UA 4IJBA 2FVMA 2WZTA 5CLWA 3STPA 1S5MA 3ZWSA 1H61A 1O5QA 3O2LA 3K1GA 3NOYA 4FMVA 3GD6A 7A3HA 3F2CA 3U4AA 4I9JA 4AYSA 4DUXA 2E0PA 4F0KA 3CAWA 3JR2A 1QI3A 4O16A 2Q6ZA 3NYDA 3GDMA 3KOFA 4C6BA 2DZBA 4YYCA 1X8CA 1XYBA 2ZRZA 3DFTA 3S6TA 1J96A 2EEXA 1B4KA 2PLCA 4Q8UA 3ITGA 2AMXA 3RPMA 4OGZA 3QYSA 4FOJA 1XCWA 4GQQA 2EG7A 4RE0A 1EA9C 3V5OA 1IWBA 1XLCA 1S38A 1HKKA 4JN8A 1G0CA 5DMYA 4JEQA 4PCNA 5A6AA 4KERA 1TTJA 2E40A 3UNDA 2QF7A 3PNUA 1C29A 4GJJA 1ALDA 2AAAA 1TUFA 1KFEA 3QV7A 1H4PA 3GIYA 4DWSC 3TQVA 4WY0B 2A3LA 4MJ2A 4ZXLA 4OOUA 1FWTA 3HPZA 4ORMA 4B5TA 1P1MA 1F73A 4QJ5B 3B9NA 1XLAA 5HJYA 3SCUA 1ZAJA 4IIFA 2BV9A 4D6FA 4F8XA 3T78A 4X9SA 4XSLA 3PWIA 1Q7QA 2PDNA 1XGEA 3W1PA 3OJGA 3DC0A 2EF9A 2DQWA 4C6FA 4WVXA 1XCFA 1YXCA 3PNZA 1G6CA 4P7RA 2HQAA 3KVLA 2P0OA 4FB7A 2C19A 5HR6A 1J01A 3QQ0A 1W56A 2VVSA 1R6WA 1XCXA 3ABSA 4KFPA 3B0XA 1GEQA 5HMSA 4F0SA 2Y61A 3BOFA 3H53A 3BCDA 3WF3A 3DFOA 3UBPC 4MAZA 5IXEA 1OF8A 1KFWA 4PEEA 4C7DA 2KAUC 4OUEA 2YDAA 1M3UA 4GKLA 4LAKA 4ZCWA 2VX6A 4EXQA 1YBQA 4L61A 1ELSA 3GC2A 3TWAA 2WNQA 5DQPA 1YX1A 2D0GA 4AMCA 4S3FA 3DC8A 3TW6A 3GVVA 2NXHA 4DO7A 4XQ6A 3WBAA 1IV8A 4H6RA 2YZ5A 4B16A 3IJIA 1NJJA 3WLLA 3PAJA 4A2RA 4AD5A 1GKQA 1QFEA 1EL3A 2Y7EA 4F66A 4A21A 1KWKA 4FAMA 2CEQA 3CB3A 1UYQA 3LD5A 4ERAA 5A5WA 4X22A 5JBFA 2CBVA 1GVYA 1JEZA 3RXZA 5G4WA 1XYMA 3CGTA 3PZ9A 4KIRA 5D2YA 2XGIA 1SO4A 1TG7A 3W4RA 1UOKA 3E0WA 2A79A 3LCWA 1PX3A 2POZA 3S8HA 4GO9A 4ZOCA 2HRWA 3LZ3A 1WDSA 3PUOA 5DXYA 3IIXA 1FWDC 3P5ZA 2Z7GA 3WMBA 4A3YA 3MVIA 4IHCA 3M5YA 4PMRA 4ZQNA 3TYCA 2WV8A 4UTJA 5H6HA 3RAOA 3AWOA 4CN1A 5I06A 3UCQA 2I14A 2OWCA 4UIOA 4FOKA 3AHZA 3VNKA 3WJWA 2JK2A 2BB0A 4QAIA 1CYGA 3O15A 1KLYA 3W23A 1RAKA 1LWHA 4NU7A 2VENA 1XDMA 1W1PA 2XM2A 4TU1A 3VIMA 2P76A 1YPXA 1J4EA 2TODA 2NX9A 3T0BA 3C2FA 3NQDA 1JCYA 5F2LA 3WLQA 3S9ZA 3MZ2A 3MO7A 4QBXA 4ZR8A 3E02A 3W1UA 5BWFA 2IS7A 3WJYA 2AQWA 4MKNA 3B0VC 3EWUA 1MQQA 4U33A 3S6OA 3AUJA 3QFEA 4O0KA 2DUAA 3VKJA 3R7MA 1VAHA 1DJYA 1FTXA 4FR1A 4I9MA 4GQGA 4C6OA 4F4RA 4FR6A 1G69A 5FEPA 3MC5A 1WB0A 4LVDA 1VYSX 2DJXA 4P8XA 4KEVA 4KT2A 3SY8A 4HNTA 5I7GA 4OE7A 3T40A 1LCOA 1XPGA 1XH1A 3BAIA 2D23A 1KCZA 3FXYA 5F1VA 3S2NA 3GS6A 4PBFA 4O19A 2E77A 1SFLA 3VX1A 3W28A 4KEMA 3S5SA 5ABHA 1JZ3A 3KVMA 2NUWA 1B31A 3UR8A 3CUJA 3TE9A 1FWIC 4WHBA 1VEOA 1I4NA 1TA3A 3BTNA 2WQDA 2WPGA 5G1YA 1HXJA 4LV4A 4JIRA 3VABA 1PUDA 1W1IE 4ZFCA 3KOZA 4UZSA 3L66A 1ADDA 2YL9A 4IX0A 4PRTA 5C9WA 2XWEA 8TIMA 1YPIA 2Z27A 4J35A 4JTKA 1QCWA 4M6VA 2VDHA 2P3EA 3TN3A 2HK0A 3FS2A 4XTDA 4NILA 2W91A 2J7EA 3TIMA 2O56A 1CLXA 3AJXA 4K2SA 2C14A 4K1WA 3BICA 2QKFA 1MZHA 3W88A 2ZC1A 3WD4A 3NQVA 4Z1CA 4H00A 2E6FA 3LNMA 4Y8EA 1GOXA 3R94A 3PTKA 2O7QA 3TAKA 3CIWA 5FAGA 4AAJA 4RNHA 4DZIA 3KCJA 1J93A 3EDJA 3ARZA 5BZAA 3CHEA 3P84A 1VPYA 4OVXA 1JNDA 1VB9A 4G9PA 3VAVA 4CCDA 3SEPA 3MB9A 4B5VA 4RUBA 1M7XA 1CGUA 4EPBC 4LANA 2XM1A 4HMCA 3T42A 1ZFJA 3MDUA 2V3EA 3TW7A 4BJHA 2VCAA 4FF5A 5EKYA 1RA0A 1LOQA 2JF6A 4HZ7A 2W27A 4H2HA 3FAWA 4IPLA 3WH5A 2IPFA 4PSPA 5XIMA 4I7UA 3MJMA 3D46A 3P67A 1GQLA 5HR7A 4TV6A 4ADSA 1YEYA 1UOZA 1A5SA 2J4GA 3MANA 5LIXX 2PU1A 1EP2A 2VFEA 2WZEA 1BG4A 3V0TA 1MSSA 1RR2A 2TPSA 5DLCA 3DEQA 4RCXA 3UJEA 4IZGA 1X6UA 4IISA 3SFKA 3M16A 4JN7A 4FLSA 3CXOA 1W3NA 2F84A 3OOQA 3RF9A 1GKPA 3S1XA 3KLLA 2QJJA 4HU8A 3FDKA 1F7BA 3E2RA 4H7CA 1TVPA 2A6NA 4JL2A 4OQVA 3NZGA 2G95A 5XINA 1AH3A 1JPIA 1OCNA 1DIOA 4S23A 1OYCA 2W5FA 1BWKA 3F4DA 2JKAA 4U4MA 3WD2A 1XBYA 3VNLA 1Z9AA 3ENLA 1PJ9A 1H3GA 1ZSXA 3SW6A 1GUVA 4RW3A 4EPDC 3GU1A 1JCJA 1GVFA 1EO5A 2OYMA 2PFHA 3VDCA 5CZTA 1EDQA 4NIRA 4KETA 3ANVA 3MO4A 4XD5A 1JYNA 4B5NA 2TAAA 3LXAA 1IF2A 2Y62A 3AZTA 2AQVA 5A8QA 2QJIA 2OSYA 2QULA 2XZ9A 3UG4A 1A53A 3UWWA 1H63A 3RM8A 1BKHA 1D7FA 1Q6GA 3PG9A 1JXKA 4XO6A 3G24A 1KXQA 4MM1A 2EG8A 5U4NA 3EEZA 1KO0A 1W1YA 1FUYA 5EMJA 1TMLA 2XN2A 4C90A 2XHYA 3R8GA 1H7RA 3TH6A 5AVHA 2BY3A 4ECLA 1EWEA 4LOCA 3M6DA 1AA1B 4GXWA 4AIOA 3VILA 2H90A 2I5GA 2Q3RA 4HHHA 1X7FA 5BOOA 3EMCA 1LBFA 4W85A 1F2JA 4AD1A 1G9HA 4TVUA 3Q94A 3MZNA 2DZAA 2WHLA 7TIMA 1C92A 4E38A 4BI7A 1LOLA 5CPTA 4ADUA 4IPPA 3I3EA 4MNJA 1US2A 5HMEA 5IFTA 1NELA 4Q7NA 1WYIA 2OJPA 1R9YA 4UR8A 3E38A 2ZRWA 3A6OA 3A24A 1E9YB 2VX7A 1UD4A 1P6CA 1N82A 2HNHA 1V3IA 3ORWA 4PCSA 3IJLA 4XAPA 3CQHA 1QJWA 3H24A 3ID7A 1YTEA 4C5ZA 2HE8A 2TSYA 4UBPC 3HG2A 4IJCA 4LRSA 2CBIA 3O7UA 3VK5A 4PB5A 4UCGA 2PWDA 2F6UA 3W6MA 1AVAA 4GLEA 4KH2A 4NG3A 3EWZA 2ZADA 3OQ8A 1AUSL 2ZUUA 2ISSA 5AHIA 3UJFA 2C13A 2ZWYA 1BRLA 4LUSB 5FA5A 2PDCA 2XN0A 5BRQA 2IQDA 5CPNA 1IZCA 3OBAA 4XD6A 3B40A 4KCWA 1CNVA 3CHFA 3OVQA 1XKJA 5GJMA 1LWIA 1GTHA 3VCNA 5CAKA 1EJTC 3R6IA 3QC0A 3TP4A 4AX6A 5E6ZA 4RXFA 1RCXB 1AL8A 1QBAA 3I3BA 1P0BA 2H8XA 2G8ZA 3H12A 2UBPC 3M9YA 1R3RA 3MMWA 5GPRA 4O17A 3KCOA 3FGCB 1EPXA 4E4FA 4QTGA 3QM3A 4EOUA 5EBAA 5C0QA 3ARUA 3FCPA 3B4UA 1LLZA 3PBWA 1XLEA 1DQUA 3D3AA 1JI1A 2FPVA 3WN6A 2YDQA 1RPXA 3QY6A 3D0CA 3REQA 3W9ZA 4GYFA 4S3EA 4ORIA 1I75A 3W7RA 2YYTA 3BJSA 3LLXA 3H4GA 4C1NB 4K1GA 1H0GA 2PDIA 2IPWA 3VCRA 1TKKA 2J7GA 2JF7A 5CQ1A 3BWWA 3A3HA 1H41A 1JPKA 4JFTA 3MUCA 3CUFA 2OO0A 4HGXA 1MW0A 1A0DA 4LYKA 1AW5A 3TA6A 2IPGA 3E74A 3GH4A 2ATSA 5ABFB 1F8MA 4HU0A 3EA2A 4GH1A 2FZNA 3I6RA 4UOZA 2YXGA 4P2VA 3TUUA 2J7FA 3ZR6A 1XLGA 3N13A 3CQ0A 5C6MA 1DJQA 1EEPA 5G5IA 3L2LA 3DIPA 1EC9A 3ZZ1A 3T1GA 4I8DA 4PBEA 3L5AA 3MQTA 3WELA 4PEKA 3IK2A 3H7UA 4G7EB 2GSJA 2D69A 4IWWA 4IXHA 1B3XA 1X38A 3TMLA 3WBWA 1HT6A 2ZDRA 4GI8A 3B9OA 4JIEA 1EGZA 1F74A 1JAEA 4RDYA 2QCLA 2XYLA 4Q8WA 1UB3A 3G18A 2XIQA 4ML9A 1ONWA 1Q13A 1CEOA 2FHFA 3GHRA 4TTGA 1TX0A 1MO0A 1KM1A 3L0GA 2ZQ0A 3N2OA 1M03A 1Q6RA 5TNVA 1NU5A 4JICA 1BD0A 3BC9A 1UD2A 4U2ZA 3CYVA 2OX4A 2PWFA 3OGVA 1PB0A 3P93A 3ITLA 1XC6A 2Z25A 1A5KC 2PD5A 1TJRA 3NZPA 2J7BA 3S9YA 2VR5A 1EX5A 4GYPA 4PMXA 4XSMA 3SCNA 4E6MA 3WENA 2DFAA 3R8RA 4JIIX 1TTQA 2V5DA 1E71M 2PDWA 3EYPA 4RDVA 4ICNA 4B92A 3OZMA 2NLYA 1R7OA 2XU2A 2RUSA 3LQGA 1T7LA 4QG9A 3VPLA 1PXGA 4QNWA 1FCUA 1MRQA 1WXJA 1ZENA 3RPTA 3N6HA 4IJRA 5B7ZA 1F3TA 3HGJA 4AIBA 3NQGA 1LP6A 1ICSA 5KETA 4H3DA 4LY4A 1QT1A 1G4SA 1TV7A 3LBCA 3ZYZA 3WLHA 4N6FA 3ES7A 2ISDA 4PSRA 2YSWA 4MGGA 4MY9A 4MTVA 5A8NA 2Y0FA 2YXXA 4CGTA 3CJPA 1Q66A 2WMKA 5CKSA 4H8NA 1MRAA 1YTKA 2BXYA 3HPAA 4WY0A 2PF0A 3ZIZA 3C2VA 1B3WA 1JF5A 3QSRA 3DFSA 1AG1O 1V79A 4UFHA 4MF4A 4HPGA 5BXRA 2OGYA 1ZCOA 4ZODA 3RLGA 3CUHA 4QCEA 4UQCA 2X1IA 3VNIA 4G1KA 2QJGA 1UR1A 4U3CA 1A3WA 3W7NA 3W7CA 5I3HA 2P8CA 3N2XA 4RPQA