1K03A

Crystal structure of old yellow enzyme mutant gln114asn complexed with para-hydroxy benzaldehyde
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
399
structure length
399
Chain Sequence
b'SFVKDFKPQALGDTNLFKPIKIGNNELLHRAVIPPLTRMRALHPGNIPNRDWAVEYYTQRAQRPGTMIITEGAFISPQAGGYDNAPGVWSEEQMVEWTKIFNAIHEKKSFVWVNLWVLGWAAFPDNLARDGLRYDSASDNVFMDAEQEAKAKKANNPQHSLTKDEIKQYIKEYVQAAKNSIAAGADGVEIHSANGYLLNQFLDPHSNTRTDEYGGSIENRARFTLEVVDALVEAIGHEKVGLRLSPYGVFNSMSGGAETGIVAQYAYVAGELEKRAKAGKRLAFVHLVEPRVTNPFLTEGEGEYEGGSNDFVYSIWKGPVIRAGNFALHPEVVREEVKDKRTLIGYGRFFISNPDLVDRLEKGLPLNKYDRDTFYQMSAHGYIDYPTYEEALKLGWDKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADPH DEHYDROGENASE 1
molecule tags Oxidoreductase
source organism Saccharomyces cerevisiae
publication title The role of glutamine 114 in old yellow enzyme
pubmed doi rcsb
total genus 145
structure length 399
sequence length 399
ec nomenclature ec 1.6.99.1: NADPH dehydrogenase.
pdb deposition date 2001-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1k03A00
1G7UA 2RFGA 4HN4A 2ABAA 5D37A 4Q32A 1DJQA 2Z0IA 2YZRA 4JIQA 5TQLA 1B4EA 5LHEA 2CLIA 1SFJA 2YYUA 3HG4A 4UFIA 3DHDA 3IIZA 2QCHA 4LW7A 1LLWA 3TAOA 4LVAA 4JX4A 2V5BA 3FKRA 4KWWA 3A5FA 3LI0A 2V5LA 2H90A 3LERA 3LRMA 4W9TA 1VHCA 1MEIA 3EEGA 4FIQA 5AHLA 2VFIA 2WQPA 3EX2A 4NX0A 3IGUA 2PRLA 5FEPA 4YL2A 2NWSA 2C0AA 1B3OA 4IMDA 4XUGA 1D3GA 5CG7A 4M7TA 3SW6A 3N9RA 1C29A 2QCMA 4DO4A 3LCIA 5K7JA 3CEPA 1LBFA 2NUWA 3B0UX 3GAYA 2QAPA 4BWLA 3DFOA 3W2LA 3EWYA 1ML1A 5CKSA 5EA9A 1JUBA 2CLFA 3KXQA 4UIOA 1AL8A 2AQWA 1RQBA 1KM1A 1PHQA 1OK4A 5D03A 3UY7A 5BW6A 5HQEA 2HS8A 1XUUA 4RKAA 2V8ZA 3MP5A 3BW3A 1UASA 1W3IA 1AW2A 1I2RA 3N9SA 1X1OA 1SO4A 1ME8A 5HR7A 1QFEA 1ONRA 2D73A 3TFXA 4ZQNA 4O0ZA 3NQVA 2NX3A 4N9CA 4C1LA 5I3HA 1MO0A 1TPEA 3W1MA 2Z6JA 4NZJA 5G4EA 2ZBTA 1GG0A 4CQ9A 4DF1A 1OFAA 2H3DA 3P60A 3W88A 1T8XA 3GXPA 5DBTA 5KITA 2XN2A 1ALDA 3H53A 2A2IA 3NL6A 4XQ6A 1TB3A 5LHFA 2I9EA 2ZZ7A 1M5WA 3ZWSA 4PFMA 4BFAA 2Y7DA 3KVMA 4UMCA 4K36A 4XBSA 4N6EA 3B03A 1RR2A 5CPLA 3O6CA 4Z0SA 4B5NA 5LGXA 5HUOA 4GRSA 1IIHA 1MEWA 3BLFA 3A9IA 1OJXA 4MVAA 2NV1A 1MSSA 1LDCA 1R2SA 3PUDA 3SECA 5LNRA 3DFQA 3NZRA 4BF9A 5G1YA 3KOFA 1H51A 2ISSA 1GG1A 1X8FA 1E51A 3W23A 2P10A 4N6FA 2A5HA 3TMQA 4WXYA 3S8HA 1HL2A 2YGYA 5D38A 2HTMA 3TXZA 1G4EA 3LCWA 3HB9A 3THAA 3W7LA 1L6SA 1TTQA 2NXIA 5C2XA 5K4ZA 3LCGA 1B57A 2FB2A 5E0KA 4JYFA 2QCDA 3KRUA 3N14A 4CQ8A 1YTDA 1F5ZA 2NXHA 4UFKA 3E12A 3TQ0A 3S1VA 5FF0A 3RU6A 2X1SA 1HUVA 3I7SA 4IJBA 1VCGA 5D2TA 1B4KA 5F2LA 3NYZA 2Y7EA 2CZEA 3EWUA 2CZDA 4JYEA 2ZZ4A 1PCKA 3M1ZA 2FPVA 1H7XA 3KAOA 1GVRA 3I7QA 4DXVA 1AL7A 4O14A 1OF8A 4MKNA 3KFTA 1EEPA 4UTMA 4GNJA 3HGJA 3CB8A 2GVJA 1VYPX 3RLVA 1LOSA 3DAQA 3EWXA 4OV4A 4ZL1A 4TIMA 2Q3RA 3QRHA 4M19A 3EWZA 5D33A 1PCWA 4I9AA 2OMAA 1O94A 2GQ9A 4MY8A 4E38A 4BK9A 4GFSA 2OX1A 3TC6A 4UXDA 1SW7A 1SR9A 1RV8A 1AW1A 1W5NA 1K7FA 2VFGA 4RR4A 1KM4A 1OX4B 2DZXA 1XC4A 3NQCA 1VJIA 1DJNA 2LLEA 3WJWA 1ME7A 1UBSA 4PTNA 4K8EA 3MYPA 3W1QA 1IXNA 3T78A 1K03A 2Q3OA 4WJEA 3M9YA 3DI0A 4Z1CA 4S1FA 4HHPA 3TROA 3HPZA 4AH7A 3LHVA 3PVFA 1LOLA 1TPWA 1D3HA 1YPIA 1W0MA 4JXCA 2R14A 1XDLA 3LHTA 4LVBA 3M44A 5D30A 4RK8A 4E2BA 5D05A 3LTPA 3W2KA 3QSTA 3SIZA 3LRLA 4ADUA 5HWNA 3QJAA 1KTCA 2VFDA 4WUIA 3GXNA 5KTLA 4KWVA 5BRBA 3AJXA 1OFOA 4RJEA 1ME9A 3TSBA 1Z42A 1K7XA 2NX9A 4GBUA 5A8GA 1YTEA 3WK1A 3UD6A 1YXYA 3QMSA 5CZJA 2HSAA 1W5OA 4JDYA 5LNSA 3E96A 3LV6A 1OYBA 2QR6A 2P1FA 3T4CA 2WJZA 3CC1A 3HG5A 4NQ1A 1OFRA 1TO3A 3C6CA 5J5RA 3QZEA 3C2EA 4DEFA 2E6FA 3IVTA 4NJKA 2E5BA 8TIMA 5I3GA 5AC8A 3I6RA 6ALDA 3O15A 4I7UA 4ZQRA 3FIGA 2PURA 3W74A 1NVMA 1XUZA 3QMRA 2G96A 3HPXA 4WY0A 2NX1A 1JCYA 2EAWA 2DZPA 3LOTA 3W83A 1M7OA 2UV8G 5FEXA 5C5YA 2YPIA 1P0NA 1KM6A 4KFOA 3MO7A 5CSSA 4RV8A 4HNNA 1TMHA 2QKFA 4MYAA 1IGSA 4NXKA 1L6WA 4FNUA 1YYAA 2RDUA 4LS2A 5G2HA 1H60A 3TUUA 3M7WA 3W2UA 1TV5A 2W6RA 1HG3A 1LBLA 3UZJA 5EL1A 2H8ZA 3N2MA 5HWMA 2QEZA 4K8HA 2OZ0A 3W7NA 1YDOA 1KM5A 3P67A 1GVOA 3DKLA 3OVPA 1TPH1 1QMLA 2GJNA 2VC6A 3C2OA 1OVDA 5T26A 1XL9A 2DU2A 3O6YX 5FI8A 3LHUA 3MI6A 4EF8A 2PRHA 3U6WA 3TJLA 1EX5A 3T7VA 1W8SA 2ZZ6A 1SU5A 1T96A 3IGXA 2E1DA 2QUVA 4OGZA 1OYCA 1ZFJA 1L2UA 5G1TA 3W2JA 2VKZG 3W84A 5H2ZA 1J4EA 3NZ1A 3EXTA 4OE7A 5GVJA 1W5PA 3QYQA 5G4WA 4MUZA 4MFEA 2J9XA 3TMLA 3M5ZA 3IVUA 4P61A 4NNBA 1THFD 3BV4A 4QJ1A 2DJLA 4MZYA 5HINA 3ZR4A 2GQ8A 4UTTA 3CIWA 4O1BA 3QPYA 3QPZA 1QO5A 3CEUA 4MJMA 3TAKA 3W85A 4AF0A 1T99A 5AC6A 2GQAA 1O4UA 1GQNA 2Y6ZA 1GWJA 3NQMA 3WK2A 1NFBA 4R53A 4N02A 4JTTA 2B7QA 2P0OA 4O13A 3QM3A 2W79A 4PL2A 4FNPA 3STFA 1VHNA 1H62A 5DLCA 3DHFA 3GZ3A 1F05A 5EY5A 3W7HA 4JIPA 3UWZA 4JNMA 1OABA 1SZEA 3HMJG 5FF3A 4ORMA 2A1YA 1K7EA 1Q6QA 2V30A 1VR6A 1PS9A 1O5XA 2E5CA 4K6AA 2A85A 2CLOA 2NZLA 2CWNA 2H3BA 1JCLA 1TTPA 3GYEA 2VELA 7TIMA 4NZFA 3BK0A 3TE9A 1CX9A 1SSDA 4IMCA 1TSIA 3I65A 4IPJA 2VOMA 4CQAA 4K39A 3PR2A 3SGZA 2A7NA 1XBZA 4CCCA 2CW6A 2YSWA 3WJXA 3B4UA 2JKPA 3TH6A 4EVZA 2J9ZA 2OT1A 1O95A 5MHBA 4M7SA 3M6YA 4MLJA 3NL2A 3GKAA 2FLIA 2ZRVA 5K9XA 4CLMA 4DPQA 2R91A 2VEIA 1ADOA 2VFHA 4JY8A 3LI1A 1FBAA 5DY2A 2GJLA 1A5CA 1EP1A 1FCVA 1XXXA 3NEVA 4LOCA 5LKYA 3P8JA 1OF6A 2X16A 3L65A 3P8IA 4OHQA 3W72A 1QWGA 2GPTA 3ZS4A 1SW3A 1TPDA 2XFWA 2ZQ0A 3V75A 3GKFA 1O60A 3DZ1A 2R94A 1VCVA 3E49A 4QNEA 4GXMA 4AXKA 5IM51 4I7WA 3TA6A 2A7PA 3CU2A 2G95A 1XFBA 5E1QA 3HO8A 1W5QA 1ZHAA 1IXOA 3P7YA 3PSVA 1EB3A 1TPB1 2ZRWA 4TMBA 2ZRZA 4PH6A 3W7GA 5HWJA 3EWBX 2JBMA 4TR9A 3NVTA 3FJ6A 1KFLA 4QISA 3LLDA 3NAVA 1LBMA 4XKYB 3GDMA 3W7OA 3I7RA 4L4LA 3BLEA 5EKYA 1OX6A 3P74A 2CZFA 1ZAIA 4NJGA 2V2CA 3W7DA 4Y9AA 2I14A 4HNUA 2WSRA 2QDGA 4UTWC 1UUMA 4O12A 1H7OA 4UFHA 1Z48A 3LM7A 4JTKA 3TDFA 3BVJA 1K8YA 4UFLA 1VGAA 2E68A 1XKYA 1XM3A 3LXCA 3NPXA 1U83A 1SZFA 3G1XA 4LUJA 4NNCA 3DXIA 1RVGA 4YCPA 1WA3A 3B0PA 1W31A 3R89A 1EA0A 3UY8A 2YX0A 3LLFA 3LBMA 3IIXA 5L6UA 4XZ9A 4AWSA 4JDBA 1QAPA 2OJPA 1G69A 1GYLA 3IIPA 4S2BA 4LNYA 4LRTA 4AHPA 3TU9A 4ML9A 3UNDA 3NR0A 2XN1A 2IQTA 1RD5A 3GDLA 1YDVA 3KRZA 1FDYA 4OBTA 3RLUA 1H1ZA 1NSJA 1QCWA 3C2RA 3SI9A 5AC7A 3MBDA 5CGQA 3PC0A 4CCDA 3C4UA 2C3ZA 4O19A 4HNVA 3NNTA 4MFDA 3Q94A 4UR7A 5AB3A 1S5VA 3UPBA 1C9DA 3DFTA 3G0SA 1WBHA 4O1CA 3TW7A 3THQA 1H7RA 3PBUA 4FEZA 1M7PA 2FPTA 2TRSA 4JTEA 3IRDA 4UNLA 1I45A 3HBLA 3LGEA 3STGA 3TXVA 4X22A 2C16A 3C3NA 3OA3A 3PB0A 4JS3A 3GDKA 3QQ0A 1GJPA 2VENA 1XBYA 5AYYA 5I3FA 1SO6A 1DQWA 5AHMA 3INPA 2EKCA 4DO6A 3LV5A 1FDJA 3HIJA 1PIIA 1PL9A 2A4AA 4ADSA 2WV8A 2TMDA 1N8FA 2VEPA 4ZQPA 4PA8A 5J5DA 1OFBA 3E02A 3DI1A 4JR5A 1Q6LA 5K2ZA 2DZUA 3NQAA 1QPQA 3P5YA 3WJZA 3C52A 1BWLA 4CCEA 1GZGA 4KFPA 3LCFA 1OFPA 5D2WA 4JTFA 1LYXA 4AHQA 2QJIA 5CPMA 4AWTA 2Y88A 1LLZA 4WQ6A 3TSMA 1FWWA 1MEHA 3FS2A 3SZ8A 3G1DA 3F4NA 2RHGA 1FDZA 5TIMA 2ZDRA 3PB2A 3P82A 4E0CA 5HMSA 2FTPA 2QCGA 3TC7A 1FUYA 1KTNA 4MYXA 1M6JA 4R7JA 1FCUA 4NUWA 1YTKA 1LROA 3MHFA 2X1UA 2DP3A 3NM1A 2JGYA 4IMGA 1GYNA 2JKAA 3NQEA 5I3IA 2Z1BA 5LGZA 1JR1A 3F03K 1ZY9A 3UZ5A 4GUFA 3W75A 3TKFA 1YXDA 3U2OA 2C1HA 1WXJA 1KV5A 4EOUA 1GVFA 1GOXA 3Q2DA 5DCEA 4DF0A 4JD4A 3VCRA 1KFCA 3L0NA 3W1AA 3QW4B 2WNQA 1ZENA 1QPRA 3PY2A 5D2YA 5HJLA 3W7JA 2QCDB 3S9YA 4RCXA 1LRQA 3M43A 4EF9A 1G67A 2YFOA 3DU0A 4K7VA 4RZ5A 1MZHA 3MMTA 3VI2A 1F6KA 3BW2A 3C0JA 1Z41A 4M6PA 3P61A 3HGSA 3TIMA 4JTLA 3IIVA 4RZ4A 3NO5A 2B7NA 4IMFA 4PEKA 5CZSA 3PG8A 4AMAA 5D2XA 2KZHA 1AG1O 3NQ2A 3VFLA 1FWNA 4UTKA 1I2QA 2O7SA 4M6QA 2FB3A 4AAJA 1ZNNA 3ABOA 4FNRA 1ZAJA 4DQWA 1C8VA 4K37A 3DENA 5EMUA 1DVJA 4QSHA 1AK5A 1KM0A 2NUXA 3GAKA 1KA9F 1YXCA 2RDTA 2WKJA 2Q8LA 1MXSA 3G8RA 3L66A 1VYSX 3O63A 2VEKA 3HGRA 3W07A 3PG9A 1KFEA 1NF7A 1LZOA 3BARA 4CNOA 1DBTA 1I8JA 3CTLA 1W54A 4IUOA 4O11A 4RZ6A 1GTHA 3NG3A 3O06A 2A7RA 3T44A 4JTIA 1QPNA 1SW0A 2A21A 4O4VA 4LS1A 4JX5A 3SR7A 3O8AA 4BR1A 1FWTA 3EKLA 3YPIA 2F84A 4LS0A 5I3KA 3MI2A 5DCDA 1WOBA 4FHAA 4IGHA 5DXYA 2I1OA 1T0OA 3LBCA 1LP6A 5DN1A 4NXSA 4A3UA 4JTSA 1IIGA 2QUUA 5D32A 2Y63A 5AYZA 3PS7A 3L5AA 3NQDA 3GIYA 3EB2A 3IV3A 4NT0A 4RXFA 3W2MA 2WNZA 1OYAA 1LM1A 3NQGA 5U4NA 2CLHA 1H7PA 3A23A 1EUNA 3C2VA 4LC6A 1JRCA 1H50A 1OFDA 1EWDA 1BTMA 3NA8A 2CLEA 3ANYA 2OT0A 4KFNA 4LC8A 1W37A 1KLZA 3W3OA 2JK2A 2RH9A 3USBA 1EUAA 3WJYA 4YMZA 5AHFA 1VH7A 4LVFA 4Z1DA 4ORIA 4ZMGA 3P5ZA 5E93A 2H8XA 3O1NA 3BPWA 1KBIA 3DFSA 4WD0A 2WSQA 3L67A 2WNNA 4HT3A 1HO1A 1CI1A 1KBJA 1Z44A 3LTSA 5F2MA 4GUIA 3IVSA 4U28A 3NL3A 2Y89A 3BG5A 1R47A 4UTHA 1GVSA 3DBPA 3LCHA 4ZZ9A 1QOPA 1WAUA 2C13A 4NX5A 4R33A 5FF7A 1EIXA 3TQKA 3GK0A 3L21A 2ALDA 3CT7A 1TPFA 4LU0A 4LV4A 3A22A 4O57A 1LOQA 4FNSA 3G1FA 4FB7A 1H61A 2E6YA 3NPVA 4XTIA 3FA5A 4FX7A 4MPQA 3MWAA 1A5AA 1ICPA 3GXTA 4PL1A 5AHNA 5F4SA 1SSGA 6TIMA 3W7CA 1DL3A 3W7RA 1GT8A 1QDSA 4N9EA 2E6AA 4GE8A 2J9YA 2YDAA 1JCNA 3S5ZA 4ZQCA 4POCA 5KINA 5D02A 1A53A 4WZHA 3W2NA 3GNNA 1KW1A 5EPDA 3CQ0A 3WFAA 5DXXA 2BLEA 1F73A 3BO9A 2ZYFA 1Q3NA 4NJHA 2YFNA 3I68A 4Z1BA 1TJRA 1F2JA 3CPRA 4DBEA 4FNQA 3NQ8A 2E5DA 1YPFA 1G6CA 3LB0A 1A5SA 4IXHA 4OT7A 2WSYA 4FNTA 3T40A 1H7NA 5CZ0A 1W3TA 1LTDA 2GVGA 1W5MA 3EX1A 4FXRA 2XN0A 3M0ZA 4MZ8A 4XTDA 3BG9A 3CWNA 2G97A 2ZA1A 1F6PA 4LRSA 1PV8A 2V2DA 2J6XA 2WOQA 1TPVA 1YDNA 3E9AA 2WO5A 4PODA 3S1UA 4BI6A 1TV8A 1I4NA 3TR2A 1I2NA 2HS6A 3CWOX 4X2RA 2FPYA 3S1XA 3V1PA 3LHWA 2B7OA 3PBWA 5AFDA 1SFLA 5F4XA 1S5WA 1WQ5A 1I2PA 1TJPA 3OG3A 3MI3A 1F76A 3FFSA 3P84A 1W56A 4GUJA 4UNKA 3M41A 1R2TA 2PC4A 1X1ZA 3C61A 3JRKA 3NXFA 5A5WA 1DV7A 4QQ3A 1ZAHA 5IBXA 3UWQA 4IPIA 2Y62A 3QC3A 5HR6A 4N2YA 3OVRA 5TBOA 1N7KA 3N19B 4UTIA 1VRDA 4ALDA 3M47A 3ZWTA 4HPJA 3TX9A 1K3UA 3BLIA 3M5VA 3A21A 4MY9A 4LT9A 4ADTA 2ZA3A 4YWIA 3HPSA 1HTIA 3L9CA 1OX4A 5AYXA 3SGUA 4HSOA 1S5TA 2QCLA 5AN7A 4LVGA 3UWWA 4O0KA 3KVJA 3EX4A 4LWWA 4MY1A 1XI3A 4LUIA 4MIMA 4NJJA 4AB4A 4IXXA 2YYTA 3RMJA 3KHJA 3KVKA 5F4WA 4MOZA 1VYRA 2A0NA 1VS1A 4N9BA 2PE4A 3AO0A 4FX6M 3QSRA 5BNKA 1O5KA 5D09A 1RQEA 1GTEA 3VKJA 5ABTA 5F1UA 3QW3A 1H63A 3NOEA 3B05A 3L68A 1XBVA 3TFCA 1UUOA 1ZJIA 4O18A 1IXQA 5CPNA 2JKEA 4ZQOA 3PULA 2QAFA 3WJSA 2E6DA 2F7FA 4AVFA 2HMCA 3W1TA 1X6UA 4WX2A 1FXPA 3W7PA 4JTJA 3P81A 4OQVA 3WK3A 1DKWA 3HG2A 1HFBA 2ZTKA 4M6VA 3L2IA 4O53A 3K30A 2C19A 3GLCA 1S3HA 4J9JA 3N73A 3FOKA 1WV2A 1N55A 5BMWA 3W1RA 1JVNA 2CLMA 4ZQMA 3HF3A 3HOJA 4HPXA 3W7IA 1FCQA 3QH2A 2G5WA 1LORA 3B8DA 1WX0A 2NUYA 3UXDA 5H91A 3T55A 4NU7A 1KFKA 3P62A 3W7KA 3G3MA 3TSDA 3DKJA 1QO2A 5FF2A 1K02A 3EX6A 3NQ7A 2A6NA 1V5XA 2FJKA 2FIQA 4G1KA 4Q4KA 4JN6A 1IXPA 1LRTA 1BEUA 2EPHA 4HSNA 3G0UA 1I2OA 3SSJA 3VE7A 4O15A 1TREA 4FF7A 4WXZA 1JUEA 4AHOA 2RKXA 1CW2A 4HNTA 3S1WA 3KX6A 5FEZA 3STEA 4EIVA 4YXGA 3LCLA 4UMAA 4UC5A 1DQXA 2QDHA 5KZEA 2ZFAA 5F1VA 5I3JA 4IMEA 3N3MA 2Y7GA 4RLIA 3W1XA 2V0TA 4I7VA 3CIXA 2V9DA 1K8XA 1NEYA 1EWEA 3M5XA 4U4MA 4DBDA 3PUEA 1B9BA 4ICNA 1FWSA 2ISVA 1VPXA 5KZDA 1R30A 5KMYA 4A2RA 1K8ZA 2QCCA 1QNVA 1FQ0A 2ZCGA 3R5EA 4DELA 2DZWA 2QCEA 1RQHA 1KV8A 1AW5A 4YLWA 3N2XA 4IWWA 3M5YA 3LTYA 3UYCA 3W9ZA 4NJIA 1VC4A 3ABSA 3KRSA 1SZGA 1H5YA 3HJZA 2CLLA 2CZ5A 1JQVA 3UWYA 2NXGA 3ELFA 3ZFHA 1DHPA 2FFCA 5EBUA 3DFNA 3G1AA 3U8GA 2H6RA 2Y70A 3Q37A 4M5PA 3WK0A 3FLUA 2TYSA 4XBKA 2RDWA 2BZNA 3ATZA 2PRMA 3EWWA 3TJXA 1KFJA 1FY6A 2ZTJA 2NWRA 1KM2A 4N4PA 5HULA 1WOAA 3L0KA 4JYDA 4QIUA 1LRNA 3W7EA 4O17A 2Z2UA 1TRDA 4UTTC 5K3VA 2Y61A 1JCJA 2PCQA 2DZSA 2DZTA 2O7QA 2ABBA 3C56A 3NGJA 3W1NA 3L5LA 3GR7A 3S5NA 4Y90A 4H6KA 3F1QA 1J5TA 2Q8ZA 1UJPA 1OFQA 2VFFA 3IGSA 5LZLA 3E0IA 3ATYA 4RXGA 4UUIA 2TPSA 3BGGA 4YCOA 5F2GA 3GDRA 4Z1AA 3GDTA 4UCGA 1KFBA 5AHEA 1P4CA 1IF2A 3TCEA 3LXAA 4QITA 5AHIA 3LHYA 4JICA 4JTGA 1KLYA 1TYGA 4FIRA 2GOUA 1PE1A 4MZ1A 4O16A 2ATMA 3S6DA 4PC8A 2ZZ3A 3JS3A 3W1PA 3D0CA 4QAIA 1VLWA 1JULA 3JR2A 5HNRA 4DF2A 4O54A 4D2JA 3G1VA 3FYOA 5U7SA 2GVLA 3M16A 4GJ1A 4UFJA 1GPWA 2EGZA 1GVQA 4LTSA 1W1ZA 3LCXA 3G22A 1JCXA 4A22A 3PF3A 1OFEA 4FO4A 1VZWA 3HG3A 2C18A 1TTJA 2B4GA 3CM4A 2ZZ5A 1HO4A 2BX7A 4UTUA 3SFKA 1P0KA 3G1YA 3TNOA 3GB6A 5SWUA 3A5VA 4O10A 3Q58A 1UB3A 1ZALA 5FF4A 1R2RA 2CFFA 3C8FA 3W70A 4BWLC 4UFMA 1VLIA 1EP2A 3HGOA 2CLKA 3B06A 4JTUA 4DO5A 5K4XA 2VXNA 3MYOA 4MJZA 5C54A 5BMXA 5LNWA 5F2IA 4K38A 1TPUA 3DFPA 4O8RA 3EXSA 3NQ6A 3CHVA 3OIXA 4UTLA 3S5YA 5KZMA 2C6QA 2YR1A 3PSWA 5DELA 4OV9A 1OX5A 2EF9A 3C2FA 1JJKA 2FQIA 4FXSA 2J88A 3PUOA 3W1UA 4Y96A 2V2HA 1AMKA 1H1YA 3QEZA 1TQXA 1TIMA 3W73A 3VE9A 3DH7A 3OEXA 3PWAA 3TK7A 3G1SA 3FYPA 2X2GA 3MP3A 1JUKA 3UXAA 1TRIA 2ISWA 1FCBA 2Z6IA 3O05A 4UTJA 2B0MA 1FWRA 3H55A 4AWUA 4LV9A 1NF0A 1OG0A 4UTWA 4Y6GA 3LRKA 1OHLA 5IBXC 3LDVA 2X1TA 3W76A 3EXRA 5DY3A 3S42A 3R2GA 4HKPA 4WOZA 3W87A 4A29A 4R34A 3W7QA 2B7PA 1TPC1 2TSYA 2V81A 3G8EA 2AGKA 1TCDA 1L6YA 4O4WA 4P2VA 3W7MA 5G5IA 4OWGA 4WY0B 4JX6A 5CSRA 3ABQA 1G4PA 3G24A 1SZNA 5AOUA 1ZCOA 4C1KA 4Z0JA 4K7YA 1KM3A 2QCFA 2OCZA 1PVNA 1QR7A 1NAL1 2DJXA 2GUUA 2QUTA 4O52A 1XBXA 3L5MA 1RZMA 5FESA 1QPOA 3NPUA 5DCBA 3PAJA 1KTBA 1FXQA 3G3DA 3QMTA 3PM6A 4IX2A 1V7YA 2Y7FA 4QM1A 1SO5A 3R12A 4JEQA 5L9FA 3B0VC 4ONVA 1YADA 1BKSA 3DGRA 1XCFA 2QCNA 2BSLA 2W0UA 3N34A 1L9WA 2VEMA 2EHHA 1DORA 1Q6OA 3QQ1A 3EX3A 4A2SA 1PHWA 1Q45A 5D2VA 1A5BA 4JY9A 5C55A 3TQVA 1P5BA 1R46A 3STCA 1U5JA 2NLIA 4TMCA 3MW7A 3UWVA 4EWND 4XKYA 3OBKA 4HIBA 4TU1A 5LNVA 3R8RA 2ZZ1A 2Y85A 3EKZA 3F4WA 1D9EA 4IQLA 1G7VA 2DZVA 5G2WA 3TW6A 1JCMP 3NL5A 3GX9A 2AAMA 4GWEA 4FX8A 4S2CA 3FKKA 3BGJA 4CNNA 1YLVA 3O07A 2WPBA 3IIOA 2ZRXA 3OVQA 4O1AA 3W1LA 1WDWA 2YXGA 4MLRA 3LX9A 1TV7A 4QNWA 4Y8FA 4LVDA 5CZTA 2X1RA 3H54A 2E09A 5K9CA 2BXVA 3RFAA 3W6YA 3MUXA 2QJGA 2DORA 1OK6A 3UQNA 4Q33A 5K9DA 4X3ZA 3FJLA 4DPPA 5BOOA 4GUGA 5HUPA 4O1DA 2X30A 3G0XA 1SO3A 2ATSA 3MHUA 3GNDA 3LHZA 3NM3A 1VQTA 2CU0A 1QOQA 3NPWA 1VCFA 4N9DA 3NQFA 3KVLA 1F7BA 4E2DA 3L0GA 3LXBA 3G1HA 3MP4A 1SQ7A 4X9SA 5LSMA 3R13A 5DBUA 4Z08A 3BG3A 5C6MA 1ICSA 1EP3A 2VFEA 4IOTA 1RPXA 2YW3A 2JGQA 5FEWA 2J24A 1W3NA 4O50A 2NV2A 5EYWA 3O6DA 4H3DA 3W71A 1J2WA 2YCEA 3P80A 1A50A 2A6LA 3NDOA 2J27A 1G4TA 3S0CA 4JGDA 3SY5A 3IEBA 4ZVJA 1P1XA 1ICQA 2YW4A 2BTMA 2QJHA 4NNAA 5G2IA 4H4IA 1Q6RA 4A21A 2ZA2A 1JQXA 2QF7A 4UMBA 3S5OA 1UCWA 3G18A 4GUHA 3VNDA 1G4SA 4O28A 1X7FA 2E77A 1DOSA 1TQJA 3B04A 3SJ3A 3UWUA 3RNDA 4AF0B 4PCFA 3MHGA 3BW4A 3HQ1A 1FX6A 5KSWA 3QF0A 2C14A 4N4QA 1SUXA 4TO8A 4L4MA 3PBYA 4NVTA 3RF9A 4WY0F 3W86A 4XWUA 5D04C 3GVGA 2BWGA 4RX0A 3FEMA 3GR8A 4CNPA 3A24A 2FDSA 1WYIA 4BI5A 2R8WA 1Y0EA 1TTIA 5CPOA 1XDMA 3ABRA 2V82A 1LCOA 3QFEA 4WOQA 5LNUA 1GEQA 2ZZ2A 4KKXA 4LY8A 4TX9A 2ZRYA 1BWKA 4UR8A 4BI7A 1F74A 3PBVA 3W22A 3MBFA 4OU1A 3OHIA 3CLMA 4AEOA 2ZRUA 3TV8A 1SPQA 4JTHA 3RK8A 3MJYA 4IX0A 1H7WA 3UPWA 4GC4A 1WBJA 1JRBA 3O16A 1EPXA 2C15A
chains in the Genus database with same CATH superfamily
4Q7BA 3N4FA 2IKGA 1QBAA 1XSIA 1DJQA 2YZRA 1TWDA 2NT1A 4JIQA 3RN6A 2CLIA 1SFJA 2Z00A 1CGUA 3DHDA 4FXJA 3IIZA 4LW7A 2E28A 1IR2A 3LLXA 3TAOA 4L4PA 2BHUA 4JX4A 3AHYA 3FKRA 2I16A 1OIMA 3AUJA 3LERA 1IZKA 3HJEA 3LRMA 4W9TA 3WEOA 5DFAA 1JPHA 3CT2A 3LZ5A 3WSUA 3EPOA 3BAXA 1OADA 4JN7A 4LYKA 4IG2A 1Q7ZA 5IHRA 1QHPA 4AZCB 4ML4A 3IGUA 3G6LA 5FEPA 1BYBA 4D9PA 2XVPA 2C0AA 1B3OA 5HQLA 1D3GA 4HYVA 1VJSA 4M7TA 2QV4A 2YXOA 3LCIA 5FL1A 5K7JA 2FGLA 2NUWA 3GAYA 2BHYA 4BWLA 3M0KA 2WKLA 3S2LA 3EWYA 1JUBA 3AYSA 4UIOA 4J5NA 8XIMA 1KKRA 5D03A 3UY7A 1OBAA 2INEA 3A3WA 4RKAA 3TYBA 3MP5A 1ITUA 1W3IA 1E9ZB 1NOFA 3AS3A 1F8IA 5HR7A 1NDZA 1QFEA 2J75A 3TFXA 2VOTA 3PJWA 1XLGA 4O0ZA 3SN4A 1EJ7L 2F6KA 3HZ3A 4LYQA 1I75A 1XD1A 4N9CA 5I3HA 1MO0A 1JZ3A 4IPNB 3V4BA 1XIHA 2Z6JA 3IUHA 7CGTA 1AH3A 1CPUA 1PTAA 1GQLA 1W1TA 3BSHA 3P60A 2UBPC 4MWAB 3RM4A 4DJFD 2AOSA 4L5ZA 3ONCA 1T8XA 1R3SA 5DBTA 4IFOA 3H53A 2A2IA 1TB3A 3JW7A 1AQMA 5LHFA 1KO0A 2I9EA 1JZ2A 2PWDA 4US5A 2E9LA 1M5WA 3ZWSA 5DT7A 4BFAA 1DJYA 2WC7A 3KZSA 3Q45A 2R1LA 2FDMA 3O6CA 5LGXA 3KBNA 3BLFA 1VKFA 4IL2A 3SM0A 1CXLA 3MSGA 1LDCA 4UOJA 2VGGA 4C6PA 2ZX6A 1WXZA 4F0MA 5G1YA 2ISSA 3U2ZA 1L6GA 3NDYA 3W23A 2P10A 1FKWA 1GZ1A 4N6FA 4WRHA 3S8HA 5D38A 3TXZA 1G4EA 3QV7A 5XIMA 1TTQA 2CHRA 2NXIA 4JKKA 2FB2A 1XLHA 3DG3A 2QCDA 4AY1A 2NXHA 2FZNA 1WZKA 3E12A 1UJQA 1HUVA 7REQB 1B4KA 3NYZA 3ES7A 3EMQA 4IIHA 5FOOA 4JYEA 3TYDA 4DZHA 1UKQA 2ZZ4A 3MMWA 4CUCA 1H7XA 2YOCA 3WF3A 3DERA 4YHGA 1EEPA 4Q4OA 2VRKA 4Q7IA 1W6TA 1O66A 4AD1A 4JIHA 4HTBA 4QEEA 5D33A 3UR7A 4I9AA 3MT1A 1VBUA 1E73M 1QBBA 2GQ9A 3MUAA 3PTDA 1X6LA 3TC6A 1F3EA 1RV8A 5T8GA 1E9YB 4ZO7A 1OX4B 1DJNA 2C91A 1UBSA 4PTNA 2BODX 3MYPA 3W1QA 1K03A 2DH3A 2BOGX 3DI0A 4S1FA 4FR6A 3HPZA 3CZLA 4Q6XA 1V3LA 2OWWA 1D3HA 3CZKA 2GUBA 4YTRA 1XPYA 3OPSA 1W1VA 3LTPA 4DXKA 2PMQA 1UWTA 3QJAA 1KTCA 2WMKA 3BL3A 3QBUA 2GJPA 2BXZA 1VRXA 3AJXA 1OFOA 2PWUA 3TSBA 4HMNA 2NX9A 4WSHA 4HTYA 3QMSA 2HSAA 3PPGA 3LV6A 4L9XA 2PEVA 4NQ1A 3C2EA 4O1EA 4MPKA 3CWHA 4YVPA 2D3LA 1O5RA 3ABXA 3RX2A 2PURA 3W74A 3KEHA 3QMRA 1XUZA 3BUVA 1Q7QA 3HPXA 3KCJA 4NRSA 2NX1A 3W83A 1JD7A 3BMWA 3MKCA 1Z6KA 3U4AA 1KM6A 3MO7A 2QKFA 4MYAA 3B8UA 1EQCA 3CIVA 2RDUA 1QI4A 4LS2A 1PWMA 1UR4A 3U5YA 3H4GA 1HG3A 1LBLA 3T6CA 3MTWA 2D2JA 2OZ0A 3W7NA 2UZ9A 3GHTA 1YDOA 1KM5A 1GVOA 1YMYA 3OVPA 3WDJA 2F6XA 2GJNA 2VC6A 2OEJA 3I3EA 4NAFA 3VD9A 2ZXQA 4MUPA 3WEZA 2CESA 5FI8A 3V5OA 4XZHA 2NSXA 3T7VA 3U2CA 1W8SA 1VB9A 2E1DA 4PCTA 1OYCA 1L2UA 3WUEA 1KBLA 3TOPA 5HJYA 4OE7A 4TVUA 3DEQA 2DVXA 5JQ9A 4MFEA 2J9XA 3M5ZA 4H6QA 4P61A 1DTNA 1THFD 1D8WA 3BV4A 2YA2A 1M7JA 3AHZA 2Z26A 4C6BA 2GJXB 1LUCB 2GQ8A 1AQFA 4F3HA 3FAXA 5A6LA 1XIEA 4WKFA 3QPYA 1QO5A 3QPZA 1T99A 3RPTA 1O4UA 2HRWA 5DX7A 1BTCA 1BVZA 3CMJA 1OCBA 2B7QA 4L56A 5BROA 4O13A 3BSGA 2AL2B 3STFA 4C6EA 1XH0A 1F05A 1HJSA 5G4HC 4JNMA 2HISA 4PN2A 3HMJG 1NQ6A 3TTQA 2A1YA 1MFUA 1Q6QA 2XSAA 1VR6A 2E5CA 3PPCA 1O7AA 2PD5A 3FY1A 2CWNA 3GG7A 2P8CA 2EPLX 2VELA 3F5LA 4Q8TA 3AS0A 3BK0A 4KBXA 4IPJA 1TSIA 3I65A 3WQEA 4K39A 1AZ2A 2PPGA 1QWKA 3PR2A 4JTCA 2A7NA 3F7JA 2CW6A 1R38A 3WG6A 2JFEX 3RITA 1CGVA 4XSLA 3WH8A 1E4MM 4EVZA 2VR2A 4PUKA 1K6AA 5MHBA 4M7SA 5M3WA 3M6YA 2OQHA 3R8GA 3CS2A 3WDHA 5EMMA 2VURA 2UY2A 4LANA 3SCRA 3TJIA 3DDMA 1UIPA 1DEDA 2GJLA 4DLMA 2W61A 3P8IA 1A5KC 1UR1A 2PLJA 4IFKA 2XFWA 3V75A 2EO7A 2QPXA 2R94A 4LH8A 3E49A 3A3XA 2IKHA 4AXKA 3TA6A 2ZUWA 3THDA 3UT0A 4P8UA 4WIWA 4J3SA 3DBNA 3UCCA 3LEPA 3P7YA 3PSVA 3SCSA 3T9PA 5HWJA 2IPGA 4C6OA 3AMDA 3LLDA 3S3GA 3NAVA 4XKYB 3BLEA 4ZFCA 3NYDA 1TVNA 1P7TA 1VBGA 2I14A 4HNUA 2VCAA 1LQ2A 1PIGA 3PZIA 4FLOA 3OJGA 1H7OA 3MSDA 1Z48A 3RXZA 3RPDA 3TDFA 3BVJA 1VGAA 1XM3A 1OC6A 3MDUA 4YN5A 3DXIA 4FALA 1RVGA 3B0PA 3AHTA 1Z69A 1XRFA 2ZDSA 1EA0A 3EB4A 4Z1YA 2QGHA 1MFVA 1GKPA 1WKFA 4TXEA 5XIAA 5L6UA 5AKQA 4F0RA 4MAZA 3AMLA 1XIMA 1GW9A 4S2BA 1GYLA 1RA0A 4LRTA 3EB3A 5HNNA 4BKNA 1RA5A 2DW6A 3S46A 4Z2KA 3TYAA 3UXKA 5CJMA 1VIWA 1YDVA 1FDYA 1P0BA 1EGVA 2CEQA 5I77A 2PU0A 1ZRQA 1B3VA 2XGZA 4IGNA 4CCDA 1LLOA 2C3ZA 2V5CA 4PZVA 4L7ZA 3RLGA 2YKKA 3CYJA 2X0HA 4O1CA 1BQCA 1RBOB 4JHMA 3R94A 4D6IA 3HBLA 2PU1A 1A3XA 5C9UA 3GDKA 3QQWA 1GJPA 4XZNX 5AYYA 4AUBA 3W02A 1B5TA 1JAEA 4GIRA 5AHMA 3OLDA 4PTXA 2EKCA 4DO6A 4E4UA 1FDJA 1PAMA 2CXEA 3ALFA 3L7RA 1N8FA 4ZQPA 2VRJA 3LENA 5J5DA 4F2UA 4IL0A 3GC4A 4OUEA 1OFBA 1TJ1A 5K2ZA 4HZ7A 3UBPC 2PP3A 4C1NA 1KC7A 3C52A 3SCPA 3H4XA 4AMCA 1N8WA 1YHTA 3CASA 3N6HA 8RUCA 1XIFA 5D2WA 3URAA 4UBPC 3AMGA 3S6OA 3IAPA 4GA8A 1W9BM 3NURA 5FSEC 2ZUUA 4AWTA 2Q8XA 2Y88A 4MF4A 3GNPA 4RW3A 2D23A 2WWCA 3EDKA 4BEQA 5TIMA 1BSLA 2Y4SA 1DWFM 2PDCA 1M6JA 3LNMA 5FJIA 2QT3A 4LUSA 3MHFA 3NM1A 2DP3A 2IPWA 2QLYA 4PMQA 2I17A 3SO7A 5I3IA 5CBJA 2BV9A 4LAUA 1JR1A 2RUSA 1XFCA 5LA0A 5H8PA 3WQPA 1XP3A 4YHEA 5PTDA 4DBUA 1YXDA 3ZT5A 2PWEA 3FNDA 4GY7A 1BSIA 3F2CA 3WDPP 1E3ZA 2IQ0A 1KV5A 4EOUA 4C6LA 4DF0A 4L9ZA 3VCRA 4DM1A 1Y5XA 1ZENA 3FXGA 5TF0A 4AFYA 2YFOA 4K7VA 2ANUA 2E25A 3NZQA 1F6KA 4H9XA 4RW5A 3P61A 3KL3A 3HGSA 1WKYA 3IIVA 4GGBA 1VENA 5CZSA 3DOPA 4GHRA 2OZTA 4DB7A 3QYSA 2KZHA 1BG4A 1J0KA 3SCOA 1VD6A 3SSZA 2O7SA 2E9MA 1ZAJA 1C8VA 1IQ8A 4K37A 5EMUA 1DVJA 1UP2A 2YCKX 3GAKA 1KA9F 2OEKA 3BTNA 3KCOA 1VYSX 2XG9A 2A3LA 4B3KA 3PG9A 2WWDA 1XR2A 1NF7A 1LZOA 3WX7A 1DBTA 1I8JA 3ITVA 2VYOA 1NOWA 4WKHA 3CTLA 4O11A 4QJ4B 4IFKB 2A7RA 3OVGA 5C9WA 4JX5A 4J2MA 3PK7A 4GI8A 4MM1A 1W32A 2PF0A 1FWIC 2J7HA 1Y7VA 4PFHA 2J77A 4FHAA 4DY1A 4IGHA 2I57A 1REQB 5AY7A 5DN1A 3GXFA 3QTPA 3ZXWA 3PS7A 3GIYA 1VFMA 4S3BA 4CU6A 3I3DA 3IV3A 4BQ5A 3VINA 2VZTA 5U4NA 1H7PA 5H8UA 4J2PA 3PZQA 1H50A 3GNOA 3NA8A 2VGFA 2G8ZA 4LC8A 1P48A 3WDQA 1HGWA 2O4QA 2GWGA 5AHFA 4OBSA 2FTWA 3O1NA 5CBBA 3II1A 1JIBA 3L67A 3VZZA 4DX3A 1R87A 1Z44A 3LTSA 4GUIA 3IVSA 3NL3A 3BG5A 4DLFA 1R47A 4UTHA 1GVSA 1V6UA 1QOPA 1WAUA 2C13A 4NX5A 2R1MA 4C6MA 2WLYA 2XU2A 3PZMA 1TJ2A 3TQKA 1JGMA 3GK0A 4ZA0A 1DJGA 2ALDA 3CT7A 3QY6A 5E70A 4BY3A 2G0WA 5DMNA 1A5MC 3A22A 4O57A 4B4HA 2BFGA 4UZSA 5ABGA 1ICPA 1W3KA 5KZ6A 4GO9A 4QLJA 1EX1A 1QDSA 4D6HA 2J9YA 2YDAA 1JCNA 2XSBA 1IWPA 5KINA 3W2NA 2WKGA 3WLMA 5DANA 2BLEA 1F73A 3BO9A 1EO7A 3HPFA 4AIOA 1F2JA 4GO8A 4WLCA 2ZXDA 2XM1A 2YDSA 3LB0A 4X0NA 3LZ3A 3T40A 2PBOA 2ADAA 2GVGA 1QVBA 5A6BA 4A6GA 4EPEC 3EX1A 2WPGA 4P8XA 2OO0A 3M0ZA 4QLLA 4CD6A 1BRLA 2ZA1A 5GNZA 4LALA 3QHMA 2OLSA 3E9AA 3WQWA 2PC8A 2WO5A 2QGYA 2J79A 4X2RA 2HS6A 4IG2B 3V1PA 5AFDA 3PBWA 1SFLA 5F4XA 4PTMA 3OG3A 4AD2A 3AS1A 2PDPA 1XLMA 4HPNA 2HXTA 1W56A 4GUJA 3M41A 5GQBA 2WMFA 4B4FA 4IPIA 1XGZA 4GXPA 4IICA 4S3FA 3AXKA 3N19B 1ADDA 3M47A 1C8XA 3QC0A 4HPJA 1K3UA 3BLIA 3BCFA 4MY9A 2B81A 4LT9A 1TMLA 1W9PA 2ZA3A 4KMQA 2PZNA 4MSSA 1BWVA 4JTDA 5EMYA 5AYXA 1OX4A 3QGVA 3B9NA 1S5TA 4GD0A 3UWWA 2QVHA 3ZM8A 2H9AB 1HIZA 3KVJA 4TV5A 4LWWA 2XSXA 1JF6A 2DVTA 3FW6A 4LUIA 4MIMA 4ZBCA 4DJEA 3A47A 4DYKA 2YYTA 2F9RA 1GOIA 2PLKA 3LQLA 5F4WA 5I2UA 2DSZA 1G94A 4RNHA 3MPGA 3W28A 2DVUA 3VKJA 5ABTA 1POJA 5F1UA 1XYLA 3P2VA 4QP0A 4XD3A 3QOKA 3T0DA 3GE7A 3TFCA 3ZR6A 1ZJIA 5J04A 2Y1HA 4W84A 2QAFA 2F7FA 3R8HA 3LPGA 1JPKA 4JTJA 4OQVA 1TUXA 5B80A 1EF3A 4M6VA 1IWAA 1R3TA 3N12A 3BAKA 4J9JA 3GM8A 3UPMA 1QU4A 2QNEA 1ODZA 2QIWA 1N55A 1WPCA 5BMWA 3K8MA 2CLMA 3N04A 3HF3A 4AY8A 3QH2A 1IEXA 3MB9A 3K2GA 4GQBA 5CPTA 4NU7A 4E3TA 1JAKA 1KFKA 4Q8NA 3UGRA 3P62A 1GOKA 2HQAA 3L2MA 1KBKA 3DKJA 3KS5A 1K02A 1UMLA 1ADSA 3GVWA 3EX6A 1V5XA 2FJKA 2FIQA 3OQEA 1BEUA 2EPHA 3SSJA 5B7ZA 1OD8A 4C7FA 3EWCA 2AQOA 2RKXA 1XICA 4KCVA 5FEZA 3STEA 4EIVA 1HKJA 3LCLA 3AYTA 4UC5A 4KWOA 5I3DA 5F1VA 4RLIA 3F4CA 4I7VA 4LFYA 4Q7NA 5IDZA 1K8XA 3UXLA 4XISA 4U4MA 1Q6CA 2INFA 4UQCA 1GHRA 2ZX5A 3E2RA 4ICNA 1FWSA 3C3UA 1VPXA 4Z2IA 1BHGA 3AIBA 2J8GA 2ZCGA 1MMFA 4JL1A 1RQHA 3AQUA 4WEVX 4HQVA 2OKOA 4YIWA 4KRZA 3I6EA 3KRSA 1H5YA 3HJZA 5E6YA 1JQVA 2NXGA 1W8GA 4MB5A 3L4VA 3ZFHA 2PWVA 2FFCA 5A8QA 4V15A 3VNMA 4F79A 4M5PA 1KFWA 4ZB0A 4G5DA 2VWTA 2TYSA 3N13A 4I6VA 1S38A 2RDWA 2Y5SA 3KOWA 3BDKA 1LL7A 3CB3A 3SDOA 5I06A 1RVKA 7ENLA 3VILA 4O17A 2Z2UA 2Y61A 1JCJA 3HQOA 3WD1A 1SGJA 1U1JA 2ABBA 3NGJA 1H11A 1KD0A 2VNCA 3MV11 1XPGA 3GR7A 4FF5A 3F1QA 2Q8ZA 4GBDA 6ENLA 1OFQA 3VX0A 4UUIA 2Q02A 3BGGA 4PBFA 4YCOA 5F2GA 3GDTA 1GVEA 1IF2A 2G4FA 3LXAA 3WEMA 4QE1A 1XX1A 4DJFC 4JTGA 4FIRA 2GOUA 1PE1A 1E6RA 2OSXA 2CETA 1W1YA 1UWIA 1QI3A 1GVYA 1WXYA 3PZVA 4RZBA 3S6DA 1X98A 4QGCA 4QAIA 4G9PA 1R7AA 2INZA 2DPEA 3ZSSA 3B3DA 4DF2A 1R3RA 1PX8A 4LAKA 2BVYA 3ZJ8A 3G1VA 3FYOA 3OBAA 4MADA 5U7SA 4S39A 2GVLA 1H4PA 4CN4A 4AVNA 1GVQA 1RCOB 1GJUA 4H6EA 2FMNA 3KM8A 1JCXA 2VX7A 3RCYA 5HOSA 3PF3A 1P0EA 3BLKA 2EPMX 1KQZA 3DN5A 1PKNA 2WZMA 1SMDA 4ACYA 1VFLA 4OZOA 3KS6A 3WZ0E 1TIWA 3GB6A 4H04A 4E2OA 3GG8A 3UR5A 2VVNA 1XV8A 4QROA 4CN1A 3I10A 4M29A 3V0SA 1VLIA 1EP2A 3IJ9A 7REQA 3MYOA 2R9RA 5BMXA 1HJWA 3S83A 3NQ6A 4W85A 4UTLA 3SN0A 2ONEA 2G3FA 2WMJA 1YRRA 4NI3A 2BG5A 5DELA 1OX5A 2EF9A 2AL2A 1YEYA 2PDMA 4FXSA 2J88A 3CL7A 3ENLA 9XIAA 1EDGA 3R7MA 3DH7A 3RILA 1EYEA 3G1SA 4QQUA 2I5QA 1N2VA 4Z2GA 3VD5A 2ISWA 1FWRA 4AWUA 4I3GA 3H22A 1I1XA 3RO8A 3N6QA 1W2VA 3DYPA 1Z7AA 1R3VA 3S42A 1B9ZA 4A29A 1BKHA 3G8EA 2FHFA 1GGOA 4DO7A 1JCTA 4H2HA 2WANA 4WY0B 2JEPA 1UQZA 1JI1A 3OYZA 5C70A 4XSMA 4K7YA 1B3WA 4YWSA 1CIUA 3EPNA 1OGSA 1PXGA 2GUUA 2PP1A 1R7OA 3NPUA 1BVNP 1KTBA 3PNUA 3PP7A 3VDHA 1V7YA 3QZAA 2PI6A 3CMGA 4M81A 2V6AA 5L9FA 3UCDA 2BGQA 4GOAA 2BSLA 1XKJA 2W0UA 1L9WA 1Q2SA 4A2SA 1PHWA 2XH4A 3TVAA 4JY9A 3BOLA 3TQVA 5C55A 1R46A 1U5JA 3CHDA 4HZ6A 4XKYA 3SY8A 3OBKA 2J7EA 3VXGA 4QEHA 3CLWA 1G7VA 4KRUA 5G2WA 1H0GA 4HZMA 1KQYA 7TAAA 1JCMP 4S2CA 3FKKA 4GQRA 4CNNA 2JIEA 4GJIA 3QVQA 3O6AA 4XIAA 2XFYA 1G5AA 2GZXA 3RM8A 4BQ2A 3A3HA 1VJZA 4E8DA 2WNWA 4Y8FA 3WQ8A 5CLTA 1OSEA 3CHEA 1J10A 4G8TA 3W6YA 3GHRA 2DORA 2AMGA 1US0A 1OK6A 1F3XA 3OLIA 5AECA 2V5JA 3WNKA 4DPPA 1ITXA 1HL9A 3BWWA 2VDIA 3WCZA 3G0XA 2OVLA 3OZPA 4LAMA 1VQTA 2CU0A 1QOQA 4Q4RA 4Y9NA 4GIEA 4GINA 3ZR5A 1VCFA 3G1HA 3MP4A 1SQ7A 4X9SA 4UOZA 4D6EA 2FTYA 2WAGA 4CEUC 2VFEA 2YW3A 5CC3A 4QJ5B 4C6NA 4H3DA 4MHBA 3KE0A 2A6LA 3NDOA 2DFAA 4ACZB 4AYSA 3LYEA 5CC6A 1TE1A 4PUJA 1P1XA 1QI5A 1C93A 2GWNA 4NNAA 4H4IA 3GTXA 4A21A 2ALRA 4UMBA 3S5OA 1B54A 1UCWA 3UG3A 3VNDA 4O28A 4F0SA 2UY5A 1MXDA 4K1GA 2DSUA 1U30A 5AZ1A 3ITOA 4HCHA 3RNDA 2E0PA 5EMJA 4PB5A 1TX2A 4H19A 2RGLA 3BW4A 4AX7A 2X0SA 3HQ1A 1DIEA 3O0KA 1NU5A 2FZDA 2C14A 4N4QA 1SUXA 4L4MA 3WO8A 1UD8A 4XWUA 2OGJA 3ARXA 2YA0A 3GR8A 4CNPA 3A24A 4BI5A 2R8WA 1Y0EA 4QBXA 1UKSA 3RGTA 5CBIA 3BJSA 3ABRA 3P93A 3S4TA 2XPKA 4MTVA 5CQ1A 3LBOA 1GEQA 1VBJA 2Z27A 4EWJA 5I02A 4BI7A 3W22A 3MBFA 3KDOA 3OHIA 4AEOA 2ZWYA 1JPIA 1SPQA 1EDTA 2W66A 3CZJA 4LAOA 4J1OA 4C5ZA 3MS8A 2YDRA 1IZCA 1WBJA 1EPXA 3WF4A 2RFGA 1ESWA 4Q32A 2Z0IA 2E8ZA 1LG1A 3PZUA 1B4EA 2VQTA 1R8LA 4GYJA 1OGGA 2J8TA 4HCLA 2UWFA 4LVAA 3WYZA 2V5BA 4KWWA 3WUFA 1E1FA 2H90A 2R1KA 2PBGA 3BOXA 5M2FX 1WDQA 3D3FA 1MEIA 2QJMA 2R1NA 3EEGA 5A6SA 1AVAA 5AHLA 2WQPA 3EX2A 4NX0A 4IT1A 2F2KA 5CG7A 4GXWA 2MNRA 4QCEA 3SW6A 4KERA 5M1TA 1M03A 1B1YA 2QCMA 4DO4A 1IEVA 1KGUA 1LBFA 3KTXA 3B0UX 2YLLA 1QJWA 1RY8A 3SUTA 3QY7A 3DFOA 2PDUA 3UVAA 4R88A 4BHYA 3T81A 5CKSA 5EA9A 2O9PA 3AOFA 2AQWA 1UZ4A 2NLYA 3AICA 1QW8A 1RY0A 3VIIA 2VZOA 3VC5A 3RCNA 4L6HA 3BW3A 1UASA 4JBRA 1BXNA 4DXXA 1SJAA 1ME8A 3VZXA 1FKXA 1GOMA 4DUVA 4R9OA 4JQ3A 1HVXA 2NX3A 4GC3A 2OYMA 5CAKA 4C1LA 2X1IA 3NGFA 3W1MA 3EPMA 4U10A 2RDXA 4KF1A 5TD4A 2POTA 1GG0A 3DYMA 4DF1A 2DEPA 5FJOA 2DDXA 2ZUNA 2GDUA 3N2CA 4R7WA 3W88A 4U5IA 4XZBA 1ZBKA 3FCPA 4Z2JA 2XN2A 1NIUA 3D46A 3NL6A 1ELSA 4H41A 1CB2A 4PCPA 3BJTA 4PFMA 4UMCA 3LMYA 1CBGA 3SY1A 1Q7MA 1E1EA 1E9IA 4BA0A 3M0YA 1V6WA 3A9IA 3URBA 1OJXA 4MVAA 1ZBWA 1ZJAA 1UZ1A 3GVVA 3DFQA 4NIRA 1M65A 4HB7A 4HK6A 1X8FA 4HOXA 2CXGA 4A3YA 2VO5A 2ZADA 2HTMA 3LCWA 3THAA 3W24A 5BRQA 4PTVA 1Q6DA 2PDGA 3CH9A 2GK1B 3LCGA 1B57A 1CGXA 4QLKA 4H7CA 1KR1A 3ZVIA 3KRUA 3N14A 4CQ8A 1XLDA 1YTDA 1F5ZA 1H3GA 3URNA 1PIFA 2J8FA 1Z9AA 2GGGA 1UKOA 3MSYA 5F2LA 2CZEA 1T6MA 1RD6A 2Z1XA 1PCKA 2J6VA 4HHHA 3CNYA 2FPVA 3BQ6A 4QSFA 4FLRA 4W8AA 1RP9A 4GI9A 3U4FA 4DXVA 2OPJA 3UZZA 3PPHA 4UTMA 4C6JA 3ZLHA 3H7UA 3GFXA 3CB8A 3OG2A 3AIEA 4MDOA 1HW6A 2J62A 3EWXA 4OV4A 1CDGA 2I56A 4BCEA 3QRHA 4M19A 1MXGA 3CYVA 2DH2A 2OMAA 4E38A 3KL0A 4PRWA 4BK9A 3F4DA 5I24A 1FWJC 3P0XA 4UXDA 1JL8A 1SR9A 4NZ1A 3VTRA 4P8VA 2WVUA 2Y5EA 3PJTA 3XISA 2AKMA 1K7FA 2PGRA 2PTXA 3B8IA 2PDWA 1XHGA 2LLEA 3OZOA 4LBUA 2PGWA 2PDNA 4K8EA 4QX4A 1OCNA 2DIEA 3M9YA 3A4XA 3TROA 1ZBCA 1EEXA 4AH7A 3LHVA 1LOLA 3M44A 4RK8A 1FWGC 3M4HA 3MO4A 3V5CA 3NIYA 4DZ5A 5LIXX 3SIZA 3LRLA 4ADUA 5HWNA 2IXUA 2EBNA 4DHGA 1D2KA 4WUIA 2W91A 3GXNA 2WQDA 5KTLA 4KWVA 1LJYA 2VI0A 1ME9A 3ARWA 3M0HA 4HPGA 1K7XA 1AD4A 3UD6A 1YXYA 4Z42C 2P76A 4C6IA 1UBPC 1W5OA 4JDYA 1CLKA 2VCBA 4GZEA 3TW9A 2XINA 2VX4A 4GVHA 5J5RA 2ACSA 3QZEA 2ON3A 3IVTA 1PBGA 1MQQA 4KESA 1X96A 3TNBA 4ZQRA 3FIGA 2QULA 1NVMA 2CERA 4WY0A 2WLZA 2EAWA 2DZPA 1I0DA 1M7OA 1W1A1 2BY0A 5CSSA 1VAHA 4PMDA 4NXKA 7PTDA 2GLKA 1YYAA 1DPMA 5G2HA 1H60A 3M7WA 3W2UA 3UZJA 3ISIX 5EL1A 4ZOBA 2QEZA 4W7VA 2PDKA 3DKLA 1TPH1 1QMLA 5DEZA 1FWBC 1S1PA 1OVDA 3FV9A 5AYIA 3MZ2A 1S3TC 3Q67A 2H9AA 3MI6A 4EF8A 2PRHA 3TJLA 1Y5WA 4LXFA 1T5AA 2JEQA 1T96A 3IGXA 1W17A 2QUVA 3WMCA 1RJRA 1S2AA 2XDFA 5H2ZA 1J4EA 3NZ1A 5A1AA 4H9TA 4I9JA 3QYQA 3F2BA 3C0QA 3TMLA 4C1NB 2PCEA 7XIMA 3IVUA 2D0GA 5A2BA 1ZQ5A 3CUJA 2Z1SA 2QIIA 1RAKA 4JNYA 3CEUA 4M8UA 4MJMA 4HGXA 1XS2A 4E4FA 1E4NA 3AZRA 3IJQA 1QNPA 4YTSA 1GWJA 1NWTA 1PEZA 2HDJA 4JZ5A 4R53A 4N02A 3MU7A 4GJJA 2P0OA 3BCDA 3QM3A 1EFZA 2W79A 4PL2A 2X2YA 1VHNA 3QTGA 1AMYA 4WCJA 2QMKA 4G7EB 1SZEA 5FF3A 5CGMA 4ORMA 3BAJA 2YCJA 1PS9A 3AU6A 2A85A 2CLOA 2H3BA 1E6QM 1JCLA 2OGYA 4PRRA 1CX9A 3P6LA 2VOMA 2DT3A 1XBZA 4ZO9A 1PX3A 3BURA 2YSWA 1TA3B 2J9ZA 3GFYA 1QW7A 1RJQA 1VPQA 3MV01 1VBRA 3GH7A 1XLEA 2EJAA 3NL2A 2FLIA 3R58A 4S3KA 1G0CA 3NCOA 3W4RA 1EP1A 4PTDA 3GBDA 1OF6A 3L65A 4OHQA 1UOZA 2DUXA 1QWGA 2GPTA 3K4DA 1SW3A 3O3RA 2AL1A 3DZ1A 3ITCA 1VCVA 5FKYA 4QNEA 4OJYA 4GXMA 4Q3MA 5IM51 4L65A 3QLLA 4H00A 2DSWA 5GJMA 2A7PA 5T9CE 2G95A 4YVVA 1XFBA 1D7FA 3HO8A 5AC4A 4AXNA 3SADA 1V0MA 4F40A 4W5UA 4PUMA 3EWBX 4DJED 1CENA 2WHLA 1RLCL 1QASA 4QISA 4RNJA 5C71A 1LBMA 3I7RA 4D6DA 4L4LA 5EKYA 1OX6A 3QPEA 1UMYA 3W7DA 3M0XA 2V2CA 4Y9AA 2WSRA 3EEZA 4MNJA 4O12A 2P3EA 3PZOA 4O8AA 4UFLA 2E68A 1XKYA 1B30A 4I9TA 1U83A 4AZHA 1SZFA 3WLJA 2FZBA 1VFUA 4INFA 4NNCA 4YCPA 2D0FA 3AYRA 2WXDM 1TZZA 5JUVA 1W31A 5BU9A 3U48A 1HKWA 1UWUA 4U31A 1I6NA 1Y65A 5REQB 3VMPA 4F66A 4FP1A 1QAPA 3RX3A 4XKMA 1FH7A 4MJ2A 1ONWA 4LNYA 5J8LA 3UNDA 5FJRA 3WQOA 4DVOA 2E4TA 2XN1A 3DUGA 3H7RA 3ABZA 4DWDA 2IQTA 1RD5A 3V35A 4US5D 3WF0A 4MKSA 4AVOA 4OBTA 3RLUA 2OSWA 3ARUA 3VIFA 3OGVA 2C8NA 1NSJA 5AC7A 1EA9C 4H9UA 1BFNA 3VNLA 4S3EA 3N4AA 4O19A 4C6DA 1TWWA 1S2TA 1DIOA 1S5VA 3UPBA 3DFTA 3CPUA 1FP8A 3VMNA 4TUFA 2OFJA 1WBHA 3OW1A 5JH2A 1JXJA 3THQA 1H7RA 4FEZA 1M7PA 2FPTA 2WZIA 3DC0A 2TRSA 4D8ZA 3RR4A 2VD8A 3LGEA 5FJJA 2D2HA 3UNTA 3TXVA 4X22A 4IQJA 1E0TA 3OA3A 3I6TA 3L4YA 1AZ1A 1QK0A 1GPFA 5HQMA 1FHLA 3QQ0A 2VENA 1T7LA 1XBYA 3W81A 3HA1A 1SO6A 1DQWA 3INPA 2Y2WA 5E6ZA 3VDBA 1PDYA 1V77A 2AQVA 3RDKA 1A4MA 4MNLA 4IP5A 4PA8A 3TR9A 4JKMA 1TR9A 3DI1A 4U2ZA 2DZUA 1PDZA 3N6JA 1QPQA 4NZ5A 6XIMA 4J3TA 4RE3A 4CCEA 3TYCA 1GZGA 2G3MA 3REQA 4PUNA 4UNIA 5I00A 3LGGA 1RJPA 2PDFA 5A6KA 3POCA 2R6OA 2CBUA 3CUFA 1LLZA 1GNXA 2ODOA 1EL3A 3TSMA 1FWWA 1MEHA 3FS2A 1XYBA 3SZ8A 3G1DA 1EJRC 1FRBA 3PB2A 3P82A 4E0CA 4UQAA 1KTNA 4N0RA 1R3YA 2ZIDA 3ZJ7A 1OWQA 1XYMA 2X1UA 1UD2A 2JGYA 2GDQA 3R43A 2JKAA 3NQEA 4IM4A 2EG7A 2OOGA 3W27A 4ZTXA 5LGZA 2WZTA 1XYFA 3F03K 5C7VA 3UZ5A 2Z1WA 2P88A 3W75A 1SFTA 6TAAA 1BD0A 5D4YA 3U2OA 4J3VA 3WQ5A 2Z2AA 3LUTA 5DCEA 3Q2DA 1NP0A 4JD4A 1OGBA 3QW4B 3PY2A 3T08A 5HJLA 5DQPA 4F9DA 3M43A 4TX8A 1G67A 1XH1A 3DU0A 4RZ5A 3SBFA 1ZPTA 4YYFA 4GPNA 4GI6A 3T09A 3MMTA 3BW2A 4W8BA 5CSYA 1Z41A 3WLHA 3H6OA 5ABEA 4DWSB 4JTLA 3NSXA 1EIBA 2VX5A 2B7NA 2QZRA 4IMFA 4PEKA 3L4ZA 2PZ0A 4IQEA 3OP2A 4DWSC 5D2XA 2VR4A 5BRPA 1ITQA 3G6MA 3NQ2A 5MKGA 1FWNA 3APYA 2Y5JA 4FPSA 1JYWA 4AAJA 2OTDA 1ZNNA 4DQWA 4Y9PA 1ZB5A 3U3HA 4IP4A 1KM0A 3QGKC 1X39A 3EZ4A 2WKJA 3MUCA 3G8RA 4F2TA 3O63A 3RRXA 5I79A 1KFEA 4X63A 1W54A 1Y8BA 1HXJA 4N42A 1V03A 4B90A 1NELA 1JZ6A 3OU8A 1QPNA 1SW0A 4JTIA 4CCZA 1K8CA 3S1GA 3C0LA 1TX0A 1H5VA 3O8AA 1FWTA 3VO0A 3WLIA 5T91A 1QNQA 3WF1A 4PYSA 4JQ1A 4MNKA 1LP6A 4NXSA 3B9EA 2QUUA 2CHOA 2Y63A 4LCQA 1B3YA 3L5AA 4NT0A 4BEUA 4EAYA 4H83A 4RXFA 3W2MA 2WNZA 3KHDA 1OYAA 1XF0A 1LM1A 1DYSA 3AU2A 2CLHA 3A23A 2PDLA 4U2YA 2HVNA 1OFDA 3UXIA 2ESCA 1EWDA 1BTMA 2CLEA 3IANA 2OT0A 4L80A 1Q8JA 3GTFA 3QV9A 3USBA 3R4IA 1R6WA 1VBHA 4B9ZA 1VH7A 4LVFA 2WVSA 4ZMGA 4HBKA 1E15A 5FSDC 2H8XA 4I5RA 3BPWA 1KBIA 1BYAA 4EPDC 4DBSA 1YKWA 3DBPA 4FOUA 4ZZ9A 4NZ4A 4RDYA 1Z89A 1PZ0A 3WH5A 3KTSA 3PZTA 3L21A 2DIKA 4LU0A 4ZOCA 3VAVA 1E4LA 4FB7A 1A5AA 1SSGA 6TIMA 3W7CA 2E6AA 2FMOA 1V8EA 3WNPA 1CWYA 1CLVA 2CIPA 1K4HA 5D02A 3LMZA 5FL0A 1WDPA 2OYKA 1KW1A 3CQ0A 3VUPA 2X40A 3WFAA 3CHCA 4UR9A 3I68A 3TTEA 3CPRA 1FWFC 4G56A 4IHCA 3KOYA 3T42A 1YPXA 1UD3A 4G1NA 4MB3A 1JFXA 3ITYA 1U5HA 1HGYA 1OG6A 1ZUAX 3NZGA 2XN0A 3T05A 4MZ8A 2BP1A 3N25A 1PV8A 1R9ZA 4F9JA 2J6XA 2YIHA 1MNSA 1YDNA 4Y8EA 4AZIA 3SEPA 1LUCA 2NQHA 1OEPA 2YZ5A 5AYBA 3LHWA 4REQA 2B7OA 3IRSA 1CXHA 1TJPA 1AJ2A 3FFSA 2ICSA 1SR0A 4IIEA 4RV3A 1V02A 3XIMA 4UNKA 3CL8A 1V02E 2PC4A 1X1ZA 1ZP4A 3C61A 3NXFA 3VA8A 5A5WA 1DV7A 1ZAHA 5IBXA 1SJCA 3QC3A 4CQDA 1N7KA 4Q8QA 2ZXBA 3M5VA 2NQZA 4KEMA 3CV1A 4YWIA 3HPSA 4XVEA 5CZKA 4WVXA 3L9CA 3SGUA 4HSOA 4DYJA 4LVGA 4BQ3A 3PFMA 2BMBA 2YL9A 5I0DA 3V0TA 3OHMB 1XQKA 4NJJA 4AB4A 1GKRA 1VFTA 3RMJA 4PB3A 4PRTA 4IPLA 4MOZA 3K46A 3QV6A 1J93A 4I90A 4LUYA 4REQB 3AIWA 2PE4A 3AO0A 5GPRA 4FX6M 2ZC1A 2J78A 4J40A 1JDCA 5BNKA 1RQEA 3QW3A 4RE2A 1H63A 3NOEA 3B05A 2GGHA 1ZBVA 4ENLA 1UUOA 4O18A 1J11A 1M1BA 4L1WA 3IAQA 1K9FA 6A3HA 1C91A 1FXPA 2G50A 1UH4A 1H09A 4IJCA 3W7PA 3P81A 3WQCA 3FA4A 4XX6A 3L2IA 4MAVA 3ALGA 3K30A 2WBGA 3GLCA 4FOKA 1IEIA 2FGZA 1WV2A 5IHSA 3AZTA 2X41A 4K8GA 1JVNA 4Y7EA 2NSOA 4ZTYA 3CV7A 3OLGA 4F0HA 3HTWA 4NAEA 3W7IA 3HU7A 1ZZMA 5H91A 3VKAA 1HL8A 4E8CA 2G3IA 3W7KA 3SRDA 3UP8A 2F6UA 2IS7A 5FF2A 1J0HA 2Z1VA 2A6NA 4DZIA 5HA7A 1IXPA 4LGXA 1LRTA 2EKGA 1I2OA 1S2WA 3PFRA 4O15A 1TREA 5IFPA 5F7UA 1R0MA 3LPPA 1CW2A 3SQSA 4HNTA 4UMAA 4WF7A 3VM7A 1OCQA 2ZFAA 1A49A 4S3CA 1UD4A 3LS9A 3VKDA 1K9DA 1NQKA 3DHPA 3TYZA 4RPQA 2PGFA 3PUEA 1FWDC 2JQXA 4RDWA 2ISVA 1R30A 3WLLA 1OD0A 3WH7A 2HBVA 1K8ZA 3R5EA 1KRAC 2ZUMA 2GGIA 1AW5A 4RNFA 4QXIA 3O0FA 4XZMX 4AZBA 4IWWA 3UYCA 1DXEA 2WK2A 5FJTA 1UPPA 3PNZA 8XIAA 1SZGA 1WAWA 5EGRA 4XZLX 2CLLA 4PE8A 3UWYA 1D3CA 1HJVA 2QHAA 1W1IE 2ZOXA 3ELFA 3CV6A 2V67A 4GYPC 4WJ8A 3U8GA 3VNJA 4PMJA 1YNYA 3WK0A 2QF8A 3OGSA 1KCZA 4HZ8A 2OYLA 2QJJA 3LSCA 2PRMA 3EWWA 1KFJA 1FY6A 2ZTJA 1KM2A 1MW1A 2DSKA 4JYDA 4QIUA 3A13A 3VUSA 3KP1A 3LY0A 2DZSA 2O7QA 4AWEA 1XSJA 2XVLA 3L5LA 3S5NA 4DN1A 3TYEA 3THUA 5BOFA 1AQHA 1UJPA 3WLPA 2VFFA 3IGSA 2X42A 1FVPA 1NFPA 3ATYA 2TPSA 1UPMB 4CD8A 1C9WA 3GDRA 3HV9A 4XB3A 5AHEA 4OFCA 3MANA 4EX4A 5AHIA 4D8AA 1TYGA 4JNZA 4HA0A 4I5XA 2VZUA 4PC8A 2P50A 3JS3A 2QS8A 4LF1A 1VLWA 3JR2A 1EXBA 3LPOA 4YTTA 1O5QA 2J13A 5HNRA 1J9YA 4O54A 2BS9A 3W01A 4B5UA 1YW1A 4DYEA 2F2HA 3M16A 3H12A 5HXMA 3KLLA 4UFJA 1P6WA 2Z25A 2V69A 5D9PA 4LTSA 3UCQA 1JYVA 1EJVC 4A22A 3TZFA 1NWRA 1IHIA 1J12A 1US3A 2BX7A 5CG0A 3N17A 3DG7A 2YL6A 3SFKA 1P0KA 3E3HA 3G1YA 5SWUA 4JFVA 2KX9A 4O10A 4WGXA 3VKCA 5JU6A 4G7FA 1R2RA 3C8FA 3W70A 4BWLC 4UFMA 1OB0A 4DJDD 3HGOA 3B06A 4B92A 4LJ3A 1LQ0A 4S23A 5CC5A 3S6TA 4O8RA 1V3IA 4Q8OA 2YR1A 2XJ7A 4H9YA 3PWGA 4PCSA 1B0IA 1JJKA 1Q8AA 4AX6A 3W1UA 1QI2A 2V2HA 1J6OA 4DNMA 1AMKA 1EGZA 1LT8A 1K9EA 1G01A 4ZEPA 6XIAA 1TIMA 3OEXA 3TK7A 1A5UA 4NKCA 3GNXA 1KCLA 2X2GA 5DMMA 1BXCA 5BZAA 2HVOA 3WLKX 4JHZA 1FCBA 1X97A 4UTJA 2Z6IA 3O05A 4HOWA 1NF0A 1OG0A 4UTWA 4XVDA 3COTA 1GYMA 4Y6GA 1OHLA 3W76A 2X1TA 1Q5MA 1UA7A 3EXRA 5DY3A 4HKPA 1WKDA 3W7QA 2B7PA 3MUIA 3VKKA 1PWLA 4OBRA 1CGTA 2BVWA 4P2VA 3W7MA 5G5IA 3K1GA 6REQB 4OWGA 4JX6A 1G4PA 1ONXA 3G24A 4P8WA 1ZCOA 1TKKA 2QCFA 1JFHA 3BMVA 3VNKA 2BNJA 1BRLB 3Q4DA 2X0YA 1S2CA 4O52A 1XBXA 1M68A 1RZMA 5FESA 2VTFA 1QPOA 3BANA 3PAJA 3SFWA 1S1RA 3QMTA 4PMZA 5C8BB 3N18A 1MQPA 2OOFA 2Y7FA 4QM1A 1XLJA 1SO5A 3AMKA 4JEQA 4GGHA 4J27A 1MDLA 3M64A 5I23A 3F4VA 4LEQA 5BXSA 1BKSA 1ZJHA 1NY1A 3FX4A 5HNTA 3VGFA 2QCNA 4BF7A 4IIGA 2VEMA 3E0VA 3T8QA 1Q6OA 3QQ1A 4NILA 3WMLA 3EX3A 2PWHA 1Q45A 2J25A 2VMFA 1A5BA 3UZWA 4TMCA 3FGCA 3MW7A 3UWVA 4NASA 4D1IA 3URQA 4TU1A 4KEVA 2PTDA 2C0HA 3R8RA 2Y85A 3WH9A 4YS1A 4IQLA 4CEXC 2V3GA 3UJFA 1V4YA 5A8MA 3C2YA 4FX8A 4TVCA 3O07A 2YXXA 1HN1A 1PB0A 4U3AA 1LL6A 3OVQA 2YXGA 1A3HA 5LYRA 3AXMA 3CMFA 4RL3A 5JIWA 1DE5A 4AEFA 2QUMA 3H54A 2ACUA 4KWUA 5K9CA 3L23A 3LPFA 2BXVA 1RLDA 4DWSD 3MUXA 3R25A 5H1WA 3UQNA 3QOMA 4D8LA 5K9DA 2CBVA 1E72M 3FJLA 1BF2A 2PA6A 1D7KA 4GUGA 2I5GA 4O1DA 3R79A 1SO3A 1KXQA 1T41A 1PUDA 1S5MA 4G7EA 3GNDA 3NM3A 1ECEA 3V5FA 3P0WA 3NPWA 2DQWA 3KWSA 3SCQA 4N9DA 3A6OA 3UR8A 3BLDA 2WVVB 5IXEA 1U5VA 3IPWA 5DBUA 5C6MA 4HA4A 1BXBA 1WO2A 3TWBA 1RPXA 2JGQA 4G2DA 3UJSA 4U3CA 1E55A 1E6PA 3CXOA 5HK4A 2V5DA 5LXXA 2D2OA 3C5QA 4X61A 3KCLA 2FZ9A 2J27A 3TTSA 4DZAA 1HVQA 3RAOA 4X60A 1ICQA 2BGNE 3GH5A 3IV8A 4ZFMA 5FA5A 1Q6RA 4JFWA 3HN3A 1XIGA 2GJRA 4GNVA 2BDQA 3IJLA 2WMIA 2E77A 3APGA 4XAZA 1GQIA 3UWUA 2QYGA 4AF0B 2DT0A 3MHGA 1P7TB 4PUDA 1FX6A 4KCUA 1UZHA 4TO8A 3PBYA 3T0BA 3WQ6A 5D04C 2BWGA 4MGGA 5HBFA 3AISA 1WYIA 3AWOA 3BLPX 4HYWA 1XDMA 4B5TA 4ICCX 3QFEA 5LNUA 3WMBA 5CCZA 2Y0FA 3UWEA 4KKXA 3ECQA 4LY8A 1KRCC 4H9VA 1XIJA 2OSYA 4OU1A 3CLMA 5C9ZA 4V2XA 3ARSA 4JTHA 3MJYA 2WB5A 4IX0A 1HJQA 1JRBA 2YCLA 3SUUA 1DWGM 4JQ2A 4HN4A 5D37A 3FN9A 5LHEA 4DJDC 3WBWA 5CAHA 5FJUA 3HG4A 4UFIA 3HMCA 1JZ8A 4GMEA 2FVKA 1LLWA 3ZJ6A 1MQRA 3A5FA 3LI0A 4CD5A 4CVWA 4ZR8A 4LSBA 2XGBA 4XD5A 1V08A 5AVHA 4UQDA 4LQ1A 1YE6A 4XD4A 2VFIA 3V1HA 2VUNA 1FOBA 2PRLA 5BU6A 3PAOA 2NQJA 4YL2A 2NWSA 3D5HA 4XUGA 4Q8PA 9RUBA 5FCZA 4GVGA 2XIQA 4JFSA 3LD5A 4GNKB 2VC9A 3VOIA 4OUIA 4AU0A 3UJEA 4H6RA 3UU0A 4I6KA 2FZMA 2YB1A 3CEPA 2QAPA 2DW7A 3W2LA 1MUCA 5A6AA 3PBGA 1H0IA 1ML1A 1R5YA 4NL1A 1DWAM 2CLFA 3KXQA 4FOJA 1RQBA 3QZ6A 5LIKX 5TAOA 2YBVA 1EH9A 5HQEA 1XUUA 1GQKA 1KB3A 4NY2A 3N9SA 5MF5A 2L5HA 1ONRA 3M0JA 5JBDA 1CYGA 2XH7A 3H2EA 5GNXA 1ISYA 3WY1A 2ZBTA 4CQ9A 1OFAA 1E6NA 5EFDA 4O1FA 4W93A 5GNYA 1OC5A 3FJ4A 1YX1A 3GXPA 5KITA 1V51A 1ALDA 1IT8A 2OZ8A 2Z7GA 4XQ6A 1UR3M 3EOEA 1Z32X 2BY2A 4M51A 1JNDA 1UC4A 2Y7DA 4K36A 4GQ0A 2GUYA 1RR2A 3K13A 1BF6A 3GTHA 3QV8A 4B5NA 5HUOA 4GRSA 3VIMA 1JPDX 1PSCA 4S3GA 4KCTA 4L1XA 1EC8A 2NVAA 5I09A 2NV1A 1MSSA 3SECA 5LNRA 3T0AA 4A8IA 4XAGA 1GG1A 2VHLA 2PTWA 4R27A 2ZXAA 3SAZA 4KCWA 3TMQA 1POKA 2POZA 4WXYA 1JD9A 3HB9A 4BJHA 3SURA 1Q4WA 3WNOA 3L4TA 5C2XA 5K4ZA 5E0KA 3VVGA 4JYFA 1UR8A 2Z2BA 3WD4A 1F3TA 2V3DA 4CKQA 1HJXA 3GXMA 4IH3A 3PJUA 4D6FA 3N29A 5FF0A 3HFYA 2BBFA 1VCGA 3CAVA 2Y7EA 1OINA 2VCCA 4IISA 3GUWA 3KAOA 1JI2A 2RJGA 2CYGA 3GNRA 3JUGA 1GVRA 4O14A 1OF8A 2OQYA 4MKNA 3KFTA 4TTGA 1V6XA 1VFSA 4FAMA 4EACA 2GVJA 1VYPX 2BHZA 2WW5A 3RLVA 1LOSA 3DAQA 1XQLA 4ZL1A 4ATDA 5HAOA 3W6LA 3IACA 3ZMRA 2ZWZA 3M07A 1W1PA 3FDKA 1O94A 4TV6A 4MY8A 2HJPA 3LNPA 4PR4A 1AW1A 1TZ9A 1W5NA 3H24A 4KEUA 2VFGA 4RR4A 2DZXA 1XC4A 3NQCA 3WJWA 3JU2A 1ME7A 2W3ZA 4WJEA 4Z1CA 4WDWA 1REQA 4MDPA 3PVFA 1W0MA 4GYKA 2WC4A 2R14A 3LHTA 4LVBA 2EPOA 5JH1A 2HXUA 3BAWA 3G5EA 1ZU8A 1FHDA 4D72A 3VDGA 2VFDA 1J01A 1V93A 2Y8KA 3ITXA 2OU4A 5BRBA 1MWOA 5H6HA 1Z42A 4ATWA 3WENA 1XSKA 2FVLA 2CNCA 2G3JA 4ZOEA 1OYBA 3T4CA 2P1FA 1UYQA 3CC1A 3HG5A 3R1ZA 4HA3A 1OFRA 1A47A 3C6CA 1QK2A 2C7FA 4DEFA 1E1CA 4IMAA 2NV9A 4NJKA 4YTUA 2E5BA 3CJPA 5I3GA 3FGCB 3I6RA 1S2VA 3O15A 5EU9A 1T8QA 1NDVA 2G96A 2D3NA 5JVLA 2QJNA 3LOTA 2IMRA 3SCUA 3WNLA 5C5YA 2YPIA 1WB0A 4UTFA 4HNNA 5DMYA 3QY8A 1IGSA 5M03A 1L6WA 4FNUA 1TFVA 4AZ5A 4D6CA 1HJUA 1NTHA 5IDIA 3LU2A 4JFUA 1TV5A 2W6RA 1P43A 3HV8A 2XIMA 4PEEA 2H8ZA 4HVXA 1K6WA 4K8HA 2Q09A 4FZIA 4QS5A 3M0LA 3C2OA 2VM8A 5T26A 1XL9A 4HCDA 2DU2A 5HPCA 3O6YX 3LHUA 2V3EA 2VQUA 2ZVRA 3USZA 3GVQA 2AAAA 3G77A 2CWXA 2ZZ6A 1CECA 1Z8AA 3N1AA 4OGZA 3UGVA 4X2PA 3CZEA 1ZFJA 5G1TA 2TODA 3W84A 3SRFA 3EXTA 5GVJA 4H8UA 1W5PA 1X6NA 3VOCA 5G4WA 4NNBA 1M7XA 5D8WA 1F61A 4L61A 3LG3A 4QJ1A 1ONEA 2DJLA 4MZYA 4Q8WA 4GX9A 3PZGA 4O1BA 1A0EA 4ROPA 3TAKA 3NOYA 3E6EA 4D6GA 2XM2A 1W9VA 5AC6A 1GQNA 2Y6ZA 1IV8A 2P3ZA 2NVCA 3CUXA 2WJEA 1QHOA 1H62A 5EY5A 4JIPA 3UWZA 3AAMA 3E2QA 2V5KA 1A0DA 2W92A 4PUWA 1K7EA 4B5SA 2V30A 2J7BA 4GZIA 3ITGA 2NZLA 4E4PA 5CEWA 3CAQA 5KEZA 1X7IA 4NZFA 3DECA 2A3AA 4IMCA 4CQAA 4ZE4A 1UH2A 2W67A 3UETA 3KZPA 4AC1X 3B4UA 2JKPA 4ASTA 1O95A 4ERIA 3WL1A 3K1DA 3GKAA 1IR1A 2ZRVA 5K9XA 2HBXA 4HMCA 2R91A 2VEIA 1ADOA 2VFHA 4JY8A 5IFTA 2J74A 3GHUA 3WLNA 3T1GA 3RIKA 5DY2A 2JF6A 4V1XA 1TELA 1A5CA 1FCVA 3MJMA 5LKYA 3P8JA 2WMIB 3KP0A 3MQTA 3W72A 3ZS4A 4PGLA 1TPDA 1O60A 3RLHA 5ABFA 3ARRA 4V33A 2C1GA 3U9IA 4B3ZA 1W5QA 1AJ0A 5I5RA 1TPB1 4TMBA 4PH6A 4JTRA 4TR9A 3NVTA 3TCSA 3VM5A 1KFLA 4IIBA 3E0FA 3NJ3A 3GDMA 3M0IA 4W88A 1RP8A 2CZFA 1ZAIA 3WDIA 2QDGA 3VFCA 1UWRA 4IJRA 2D0HA 4UTWC 3ZVHB 2D2GA 1NH6A 3KW3A 4UFHA 3M46A 2PLMA 1UA3A 3LM7A 1P6CA 1K8YA 3N2BA 4R3UA 4K68A 5A2CA 3CUIA 3G2GA 4GVFA 1JZ5A 3VNYA 4IZGA 3GXIA 1AODA 1HKKA 5AZ0A 3R89A 2WMGA 2OKTA 3UY8A 2YX0A 2BGSA 3S2JA 2QPSA 1VFHA 3U2EA 1QUMA 2DY3A 4XZ9A 4AWSA 4JDBA 3MVTA 2OJPA 1G69A 4KETA 1DE6A 3VCCA 4AHPA 1UZDA 1XLLA 3UA3A 2HPIA 3S2NA 1XJBA 2O9TA 4ZSUA 4HD5A 3GDLA 1JXKA 3KRZA 4PULA 1GORA 4V1YA 3C2RA 4B5XA 3GXDA 5CGQA 3C4UA 1W1B1 3SGGA 4U5KA 3NNTA 2E40A 5AB3A 1B3XA 5ECUA 1C9DA 1XYZA 3DFYA 1BGGA 2PODA 2ZICA 3A9BA 4RPPA 1MW3A 3G0SA 2X05A 3TW7A 1HQTA 3PWIA 2PDQA 2WVVA 3PBUA 4QG9A 3E2VA 4PSPA 1I45A 1PYFA 3N11A 3STGA 3TJ4A 2C16A 3C3NA 4JS3A 3EMCA 5I3FA 4P5UA 4TOQA 4WSKA 3LV5A 3E74A 4Q4MA 4ADSA 1RCXB 3NFUA 1GZJA 2VEPA 4W89A 4DAFA 2DUAA 1B3ZA 2WBKA 2YJQA 3NO3A 5M17A 3WELA 3B97A 5CH9A 4JL2A 3EYPA 1NM9A 3GTNA 3W6MA 4Z17A 1EC9A 1ZTVA 2YA1A 1NARA 1V3KA 1IE7C 1X8CA 4JTFA 1LYXA 1A3WA 4AHQA 3BGAA 2QQ6A 4WQ6A 2CLPA 4DJEC 5BXTA 1HX0A 4HU0A 3CK5A 3FEQA 4Q8VA 4WDUA 2ZDRA 2IKIA 5HMSA 1PZ2A 4HMEA 2QCGA 2W63A 1V0LA 3TC7A 1FUYA 1A5OC 3IK2A 4AG0A 4R7JA 4PMNA 1FCUA 4NUWA 2FJUB 1YTKA 2Z1KA 3KBMA 1OIFA 2WZHA 4PSRA 4HP5A 4ZB2A 2VL4A 3C86A 2Z1BA 2OWCA 1W3JA 4DM2A 3LQGA 5E9XA 3BMXA 4GUFA 2FZ8A 4M80A 3UZYA 2HNEA 1B90A 1WZLA 1WXJA 4GH3A 1GVFA 4B15A 4UCFA 4EXBA 3S9ZA 4P7NA 3W1AA 2QVNA 1QNSA 1XIIA 3VPLA 5D2YA 4EE9A 4R5EA 3W7JA 2QCDB 3S9YA 4RCXA 4XZIA 2OX4A 2VP8A 3P3BA 4EF9A 4NI8A 2DZAA 1MZHA 3R6IA 1BAGA 1XCXA 3KBVA 2E7FA 3VI2A 1BQGA 4M6PA 4QS6A 4NRRA 4AY7A 3IWPA 3BAYA 1IWBA 3P14A 4UOQA 2RGMA 1TWZA 4J3UA 1CXIA 2VVSA 4AMAA 5LIUX 1A5LC 1AG1O 4HNOA 3V16A 1S2UA 3VDAA 4M6UA 1AQ0A 2I9UA 4RUBA 3TONA 2CC0A 1CCWB 1EC7A 3KUMA 1OCJA 2O56A 1VEMA 1J79A 2NUXA 4H8HA 2Q8LA 2ZX9A 2VEKA 3HGRA